data_5L9X
# 
_entry.id   5L9X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5L9X         
WWPDB D_1200000389 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5L9X 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Gao, Y.'  1 
'Yang, W.' 2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            352 
_citation.language                  ? 
_citation.page_first                1334 
_citation.page_last                 1337 
_citation.title                     'Capture of a third Mg2+ is essential for catalyzing DNA synthesis.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aad9633 
_citation.pdbx_database_id_PubMed   27284197 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Gao, Y.'  1 
primary 'Yang, W.' 2 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5L9X 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.290 
_cell.length_a_esd                 ? 
_cell.length_b                     98.290 
_cell.length_b_esd                 ? 
_cell.length_c                     82.050 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5L9X 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                 48617.707 1   2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*CP*AP*TP*TP*AP*TP*GP*AP*CP*GP*CP*T)-3')
;
3637.391  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*AP*GP*CP*GP*TP*CP*AP*TP*A)-3')
;
2739.824  1   ?       ? ? ? 
4 non-polymer syn 'MANGANESE (II) ION'                                 54.938    3   ?       ? ? ? 
5 non-polymer syn 'CALCIUM ION'                                        40.078    1   ?       ? ? ? 
6 non-polymer syn GLYCEROL                                             92.094    3   ?       ? ? ? 
7 non-polymer syn 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
491.182   1   ?       ? ? ? 
8 non-polymer syn DIPHOSPHATE                                          173.943   1   ?       ? ? ? 
9 water       nat water                                                18.015    465 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
;GPHMATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLL
AQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTA
EETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTL
VSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPK
TIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSH
DAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
A ? 
2 polydeoxyribonucleotide no no '(DC)(DA)(DT)(DT)(DA)(DT)(DG)(DA)(DC)(DG)(DC)(DT)' CATTATGACGCT T ? 
3 polydeoxyribonucleotide no no '(DA)(DG)(DC)(DG)(DT)(DC)(DA)(DT)(DA)' AGCGTCATA P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   HIS n 
1 4   MET n 
1 5   ALA n 
1 6   THR n 
1 7   GLY n 
1 8   GLN n 
1 9   ASP n 
1 10  ARG n 
1 11  VAL n 
1 12  VAL n 
1 13  ALA n 
1 14  LEU n 
1 15  VAL n 
1 16  ASP n 
1 17  MET n 
1 18  ASP n 
1 19  CYS n 
1 20  PHE n 
1 21  PHE n 
1 22  VAL n 
1 23  GLN n 
1 24  VAL n 
1 25  GLU n 
1 26  GLN n 
1 27  ARG n 
1 28  GLN n 
1 29  ASN n 
1 30  PRO n 
1 31  HIS n 
1 32  LEU n 
1 33  ARG n 
1 34  ASN n 
1 35  LYS n 
1 36  PRO n 
1 37  CYS n 
1 38  ALA n 
1 39  VAL n 
1 40  VAL n 
1 41  GLN n 
1 42  TYR n 
1 43  LYS n 
1 44  SER n 
1 45  TRP n 
1 46  LYS n 
1 47  GLY n 
1 48  GLY n 
1 49  GLY n 
1 50  ILE n 
1 51  ILE n 
1 52  ALA n 
1 53  VAL n 
1 54  SER n 
1 55  TYR n 
1 56  GLU n 
1 57  ALA n 
1 58  ARG n 
1 59  ALA n 
1 60  PHE n 
1 61  GLY n 
1 62  VAL n 
1 63  THR n 
1 64  ARG n 
1 65  SER n 
1 66  MET n 
1 67  TRP n 
1 68  ALA n 
1 69  ASP n 
1 70  ASP n 
1 71  ALA n 
1 72  LYS n 
1 73  LYS n 
1 74  LEU n 
1 75  CYS n 
1 76  PRO n 
1 77  ASP n 
1 78  LEU n 
1 79  LEU n 
1 80  LEU n 
1 81  ALA n 
1 82  GLN n 
1 83  VAL n 
1 84  ARG n 
1 85  GLU n 
1 86  SER n 
1 87  ARG n 
1 88  GLY n 
1 89  LYS n 
1 90  ALA n 
1 91  ASN n 
1 92  LEU n 
1 93  THR n 
1 94  LYS n 
1 95  TYR n 
1 96  ARG n 
1 97  GLU n 
1 98  ALA n 
1 99  SER n 
1 100 VAL n 
1 101 GLU n 
1 102 VAL n 
1 103 MET n 
1 104 GLU n 
1 105 ILE n 
1 106 MET n 
1 107 SER n 
1 108 ARG n 
1 109 PHE n 
1 110 ALA n 
1 111 VAL n 
1 112 ILE n 
1 113 GLU n 
1 114 ARG n 
1 115 ALA n 
1 116 SER n 
1 117 ILE n 
1 118 ASP n 
1 119 GLU n 
1 120 ALA n 
1 121 TYR n 
1 122 VAL n 
1 123 ASP n 
1 124 LEU n 
1 125 THR n 
1 126 SER n 
1 127 ALA n 
1 128 VAL n 
1 129 GLN n 
1 130 GLU n 
1 131 ARG n 
1 132 LEU n 
1 133 GLN n 
1 134 LYS n 
1 135 LEU n 
1 136 GLN n 
1 137 GLY n 
1 138 GLN n 
1 139 PRO n 
1 140 ILE n 
1 141 SER n 
1 142 ALA n 
1 143 ASP n 
1 144 LEU n 
1 145 LEU n 
1 146 PRO n 
1 147 SER n 
1 148 THR n 
1 149 TYR n 
1 150 ILE n 
1 151 GLU n 
1 152 GLY n 
1 153 LEU n 
1 154 PRO n 
1 155 GLN n 
1 156 GLY n 
1 157 PRO n 
1 158 THR n 
1 159 THR n 
1 160 ALA n 
1 161 GLU n 
1 162 GLU n 
1 163 THR n 
1 164 VAL n 
1 165 GLN n 
1 166 LYS n 
1 167 GLU n 
1 168 GLY n 
1 169 MET n 
1 170 ARG n 
1 171 LYS n 
1 172 GLN n 
1 173 GLY n 
1 174 LEU n 
1 175 PHE n 
1 176 GLN n 
1 177 TRP n 
1 178 LEU n 
1 179 ASP n 
1 180 SER n 
1 181 LEU n 
1 182 GLN n 
1 183 ILE n 
1 184 ASP n 
1 185 ASN n 
1 186 LEU n 
1 187 THR n 
1 188 SER n 
1 189 PRO n 
1 190 ASP n 
1 191 LEU n 
1 192 GLN n 
1 193 LEU n 
1 194 THR n 
1 195 VAL n 
1 196 GLY n 
1 197 ALA n 
1 198 VAL n 
1 199 ILE n 
1 200 VAL n 
1 201 GLU n 
1 202 GLU n 
1 203 MET n 
1 204 ARG n 
1 205 ALA n 
1 206 ALA n 
1 207 ILE n 
1 208 GLU n 
1 209 ARG n 
1 210 GLU n 
1 211 THR n 
1 212 GLY n 
1 213 PHE n 
1 214 GLN n 
1 215 CYS n 
1 216 SER n 
1 217 ALA n 
1 218 GLY n 
1 219 ILE n 
1 220 SER n 
1 221 HIS n 
1 222 ASN n 
1 223 LYS n 
1 224 VAL n 
1 225 LEU n 
1 226 ALA n 
1 227 LYS n 
1 228 LEU n 
1 229 ALA n 
1 230 CYS n 
1 231 GLY n 
1 232 LEU n 
1 233 ASN n 
1 234 LYS n 
1 235 PRO n 
1 236 ASN n 
1 237 ARG n 
1 238 GLN n 
1 239 THR n 
1 240 LEU n 
1 241 VAL n 
1 242 SER n 
1 243 HIS n 
1 244 GLY n 
1 245 SER n 
1 246 VAL n 
1 247 PRO n 
1 248 GLN n 
1 249 LEU n 
1 250 PHE n 
1 251 SER n 
1 252 GLN n 
1 253 MET n 
1 254 PRO n 
1 255 ILE n 
1 256 ARG n 
1 257 LYS n 
1 258 ILE n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 GLY n 
1 263 GLY n 
1 264 LYS n 
1 265 LEU n 
1 266 GLY n 
1 267 ALA n 
1 268 SER n 
1 269 VAL n 
1 270 ILE n 
1 271 GLU n 
1 272 ILE n 
1 273 LEU n 
1 274 GLY n 
1 275 ILE n 
1 276 GLU n 
1 277 TYR n 
1 278 MET n 
1 279 GLY n 
1 280 GLU n 
1 281 LEU n 
1 282 THR n 
1 283 GLN n 
1 284 PHE n 
1 285 THR n 
1 286 GLU n 
1 287 SER n 
1 288 GLN n 
1 289 LEU n 
1 290 GLN n 
1 291 SER n 
1 292 HIS n 
1 293 PHE n 
1 294 GLY n 
1 295 GLU n 
1 296 LYS n 
1 297 ASN n 
1 298 GLY n 
1 299 SER n 
1 300 TRP n 
1 301 LEU n 
1 302 TYR n 
1 303 ALA n 
1 304 MET n 
1 305 CYS n 
1 306 ARG n 
1 307 GLY n 
1 308 ILE n 
1 309 GLU n 
1 310 HIS n 
1 311 ASP n 
1 312 PRO n 
1 313 VAL n 
1 314 LYS n 
1 315 PRO n 
1 316 ARG n 
1 317 GLN n 
1 318 LEU n 
1 319 PRO n 
1 320 LYS n 
1 321 THR n 
1 322 ILE n 
1 323 GLY n 
1 324 CYS n 
1 325 SER n 
1 326 LYS n 
1 327 ASN n 
1 328 PHE n 
1 329 PRO n 
1 330 GLY n 
1 331 LYS n 
1 332 THR n 
1 333 ALA n 
1 334 LEU n 
1 335 ALA n 
1 336 THR n 
1 337 ARG n 
1 338 GLU n 
1 339 GLN n 
1 340 VAL n 
1 341 GLN n 
1 342 TRP n 
1 343 TRP n 
1 344 LEU n 
1 345 LEU n 
1 346 GLN n 
1 347 LEU n 
1 348 ALA n 
1 349 GLN n 
1 350 GLU n 
1 351 LEU n 
1 352 GLU n 
1 353 GLU n 
1 354 ARG n 
1 355 LEU n 
1 356 THR n 
1 357 LYS n 
1 358 ASP n 
1 359 ARG n 
1 360 ASN n 
1 361 ASP n 
1 362 ASN n 
1 363 ASP n 
1 364 ARG n 
1 365 VAL n 
1 366 ALA n 
1 367 THR n 
1 368 GLN n 
1 369 LEU n 
1 370 VAL n 
1 371 VAL n 
1 372 SER n 
1 373 ILE n 
1 374 ARG n 
1 375 VAL n 
1 376 GLN n 
1 377 GLY n 
1 378 ASP n 
1 379 LYS n 
1 380 ARG n 
1 381 LEU n 
1 382 SER n 
1 383 SER n 
1 384 LEU n 
1 385 ARG n 
1 386 ARG n 
1 387 CYS n 
1 388 CYS n 
1 389 ALA n 
1 390 LEU n 
1 391 THR n 
1 392 ARG n 
1 393 TYR n 
1 394 ASP n 
1 395 ALA n 
1 396 HIS n 
1 397 LYS n 
1 398 MET n 
1 399 SER n 
1 400 HIS n 
1 401 ASP n 
1 402 ALA n 
1 403 PHE n 
1 404 THR n 
1 405 VAL n 
1 406 ILE n 
1 407 LYS n 
1 408 ASN n 
1 409 CYS n 
1 410 ASN n 
1 411 THR n 
1 412 SER n 
1 413 GLY n 
1 414 ILE n 
1 415 GLN n 
1 416 THR n 
1 417 GLU n 
1 418 TRP n 
1 419 SER n 
1 420 PRO n 
1 421 PRO n 
1 422 LEU n 
1 423 THR n 
1 424 MET n 
1 425 LEU n 
1 426 PHE n 
1 427 LEU n 
1 428 CYS n 
1 429 ALA n 
1 430 THR n 
1 431 LYS n 
1 432 PHE n 
1 433 SER n 
1 434 ALA n 
1 435 SER n 
2 1   DC  n 
2 2   DA  n 
2 3   DT  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DG  n 
2 8   DA  n 
2 9   DC  n 
2 10  DG  n 
2 11  DC  n 
2 12  DT  n 
3 1   DA  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DT  n 
3 6   DC  n 
3 7   DA  n 
3 8   DT  n 
3 9   DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   435 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' Human 9606 ? 
3 1 sample 1 9  'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;MATGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQV
RESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEET
VQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSH
GSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIG
CSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAF
TVIKNCNTSGIQTEWSPPLTMLFLCATKFSAS
;
1 
2 PDB 5L9X       5L9X   ? 2 ? 1 
3 PDB 5L9X       5L9X   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5L9X A 4 ? 435 ? Q9Y253 1 ? 432 ? 1 432 
2 2 5L9X T 1 ? 12  ? 5L9X   1 ? 12  ? 1 12  
3 3 5L9X P 1 ? 9   ? 5L9X   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5L9X GLY A 1 ? UNP Q9Y253 ? ? 'expression tag' -2 1 
1 5L9X PRO A 2 ? UNP Q9Y253 ? ? 'expression tag' -1 2 
1 5L9X HIS A 3 ? UNP Q9Y253 ? ? 'expression tag' 0  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                               'C4 H7 N O4'        133.103 
CA  non-polymer         . 'CALCIUM ION'                        ?                               'Ca 2'              40.078  
CYS 'L-peptide linking' y CYSTEINE                             ?                               'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
DPO non-polymer         . DIPHOSPHATE                          ?                               'O7 P2 -4'          173.943 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                               'C10 H15 N2 O8 P'   322.208 
DTP non-polymer         . 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
?                               'C10 H16 N5 O12 P3' 491.182 
GLN 'L-peptide linking' y GLUTAMINE                            ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                             'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
HIS 'L-peptide linking' y HISTIDINE                            ?                               'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                ?                               'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                               'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ?                               'C5 H11 N O2 S'     149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ?                               'Mn 2'              54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ?                               'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5L9X 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.08 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         40.88 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '17% PEG 2000MME, 0.1 M MES' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      '4*4 mosiac' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 225 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-03 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'double crystal-liquid nitrogen cooled' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-BM' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-BM 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            28.287 
_reflns.entry_id                         5L9X 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.900 
_reflns.d_resolution_low                 20.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       35503 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       -3.000 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.9 
_reflns.pdbx_Rmerge_I_obs                0.081 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            20.900 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.900 1.950 ? 3.080  ? ? ? ? ? 99.800  ? ? ? ? 0.684 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1  1 ? ? 
1.950 2.000 ? 3.850  ? ? ? ? ? 100.000 ? ? ? ? 0.512 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2  1 ? ? 
2.000 2.060 ? 4.520  ? ? ? ? ? 100.000 ? ? ? ? 0.441 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 3  1 ? ? 
2.060 2.120 ? 6.070  ? ? ? ? ? 100.000 ? ? ? ? 0.341 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 4  1 ? ? 
2.120 2.190 ? 7.060  ? ? ? ? ? 100.000 ? ? ? ? 0.276 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 5  1 ? ? 
2.190 2.270 ? 8.210  ? ? ? ? ? 99.700  ? ? ? ? 0.258 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 6  1 ? ? 
2.270 2.360 ? 9.920  ? ? ? ? ? 100.000 ? ? ? ? 0.199 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 7  1 ? ? 
2.360 2.450 ? 11.830 ? ? ? ? ? 100.000 ? ? ? ? 0.167 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 8  1 ? ? 
2.450 2.560 ? 12.660 ? ? ? ? ? 100.000 ? ? ? ? 0.152 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 9  1 ? ? 
2.560 2.690 ? 15.180 ? ? ? ? ? 100.000 ? ? ? ? 0.128 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 10 1 ? ? 
2.690 2.830 ? 19.520 ? ? ? ? ? 100.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 11 1 ? ? 
2.830 3.000 ? 22.960 ? ? ? ? ? 100.000 ? ? ? ? 0.081 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 12 1 ? ? 
3.000 3.210 ? 30.230 ? ? ? ? ? 100.000 ? ? ? ? 0.060 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 13 1 ? ? 
3.210 3.470 ? 42.000 ? ? ? ? ? 100.000 ? ? ? ? 0.043 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 14 1 ? ? 
3.470 3.800 ? 50.330 ? ? ? ? ? 100.000 ? ? ? ? 0.034 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 15 1 ? ? 
3.800 4.250 ? 60.620 ? ? ? ? ? 99.900  ? ? ? ? 0.027 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 16 1 ? ? 
4.250 4.910 ? 69.030 ? ? ? ? ? 99.900  ? ? ? ? 0.022 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 17 1 ? ? 
4.910 6.010 ? 64.970 ? ? ? ? ? 100.000 ? ? ? ? 0.023 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 18 1 ? ? 
6.010 8.500 ? 68.100 ? ? ? ? ? 99.700  ? ? ? ? 0.021 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 19 1 ? ? 
8.500 ?     ? 90.300 ? ? ? ? ? 91.600  ? ? ? ? 0.016 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 20 1 ? ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                110.180 
_refine.B_iso_mean                               26.7949 
_refine.B_iso_min                                6.090 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5L9X 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.9000 
_refine.ls_d_res_low                             19.9420 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     35501 
_refine.ls_number_reflns_R_free                  2709 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.9400 
_refine.ls_percent_reflns_R_free                 7.6300 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1683 
_refine.ls_R_factor_R_free                       0.2143 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1646 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.370 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4ECV 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.5700 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2300 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.9000 
_refine_hist.d_res_low                        19.9420 
_refine_hist.pdbx_number_atoms_ligand         61 
_refine_hist.number_atoms_solvent             465 
_refine_hist.number_atoms_total               4300 
_refine_hist.pdbx_number_residues_total       451 
_refine_hist.pdbx_B_iso_mean_ligand           23.94 
_refine_hist.pdbx_B_iso_mean_solvent          31.77 
_refine_hist.pdbx_number_atoms_protein        3366 
_refine_hist.pdbx_number_atoms_nucleic_acid   408 
# 
_struct.entry_id                     5L9X 
_struct.title                        'Human DNA polymerase eta-DNA ternary complex: reaction with 10 mM Mn2+ for 60s' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5L9X 
_struct_keywords.text            'in crystallo reaction, DNA polymerase, metal ion dependent catalysis, transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 4 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 4 ? 
M N N 9 ? 
N N N 9 ? 
O N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 19  ? ASN A 29  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 30  ? ARG A 33  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 54  ? ALA A 59  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 67  ? CYS A 75  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 92  ? SER A 107 ? LEU A 89  SER A 104 1 ? 16 
HELX_P HELX_P6  AA6 LEU A 124 ? GLN A 136 ? LEU A 121 GLN A 133 1 ? 13 
HELX_P HELX_P7  AA7 SER A 141 ? LEU A 145 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLN A 165 ? LEU A 181 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P9  AA9 SER A 188 ? GLY A 212 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P10 AB1 ASN A 222 ? GLY A 231 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P11 AB2 LEU A 232 ? LYS A 234 ? LEU A 229 LYS A 231 5 ? 3  
HELX_P HELX_P12 AB3 SER A 245 ? GLN A 252 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P13 AB4 MET A 253 ? ILE A 258 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P14 AB5 GLY A 263 ? GLY A 274 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P15 AB6 TYR A 277 ? PHE A 284 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P16 AB7 THR A 285 ? GLY A 294 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P17 AB8 GLY A 294 ? CYS A 305 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P18 AB9 PRO A 329 ? ALA A 333 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P19 AC1 ARG A 337 ? ASP A 363 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P20 AC2 ASP A 394 ? LYS A 407 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P21 AC3 ASN A 408 ? ASN A 410 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            2.327 ? 
metalc2  metalc ? ? A ASP 16  OD1   ? ? ? 1_555 F MN  . MN  B ? A ASP 13  A MN  503 1_555 ? ? ? ? ? ? ?            2.326 ? 
metalc3  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 D MN  . MN  ? ? A ASP 13  A MN  501 1_555 ? ? ? ? ? ? ?            2.169 ? 
metalc4  metalc ? ? A ASP 16  OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 13  A CA  502 1_555 ? ? ? ? ? ? ?            3.199 ? 
metalc5  metalc ? ? A MET 17  O     ? ? ? 1_555 E CA  . CA  A ? A MET 14  A CA  502 1_555 ? ? ? ? ? ? ?            2.417 ? 
metalc6  metalc ? ? A MET 17  O     ? ? ? 1_555 F MN  . MN  B ? A MET 14  A MN  503 1_555 ? ? ? ? ? ? ?            2.420 ? 
metalc7  metalc ? ? A ASP 118 OD1   ? ? ? 1_555 D MN  . MN  ? ? A ASP 115 A MN  501 1_555 ? ? ? ? ? ? ?            2.148 ? 
metalc8  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 E CA  . CA  A ? A ASP 115 A CA  502 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc9  metalc ? ? A ASP 118 OD2   ? ? ? 1_555 F MN  . MN  B ? A ASP 115 A MN  503 1_555 ? ? ? ? ? ? ?            2.341 ? 
metalc10 metalc ? ? A GLU 119 OE2   ? ? ? 1_555 D MN  . MN  ? ? A GLU 116 A MN  501 1_555 ? ? ? ? ? ? ?            2.166 ? 
metalc11 metalc ? ? C DT  8   "O3'" A ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.418 ? 
metalc12 metalc ? ? C DT  8   "O3'" B ? ? 1_555 D MN  . MN  ? ? P DT  8   A MN  501 1_555 ? ? ? ? ? ? ?            2.434 ? 
metalc13 metalc ? ? C DA  9   OP1   B ? ? 1_555 D MN  . MN  ? ? P DA  9   A MN  501 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc14 metalc ? ? C DA  9   OP1   B ? ? 1_555 F MN  . MN  B ? P DA  9   A MN  503 1_555 ? ? ? ? ? ? ?            2.468 ? 
metalc15 metalc ? ? C DA  9   OP2   B ? ? 1_555 L MN  . MN  B ? P DA  9   P MN  101 1_555 ? ? ? ? ? ? ?            2.013 ? 
metalc16 metalc ? ? D MN  .   MN    ? ? ? 1_555 O HOH . O   ? ? A MN  501 P HOH 214 1_555 ? ? ? ? ? ? ?            2.195 ? 
metalc17 metalc ? ? D MN  .   MN    ? ? ? 1_555 J DTP . O1A A ? A MN  501 A DTP 507 1_555 ? ? ? ? ? ? ?            2.299 ? 
metalc18 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1B A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.315 ? 
metalc19 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1A A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.317 ? 
metalc20 metalc ? ? E CA  .   CA    A ? ? 1_555 J DTP . O1G A ? A CA  502 A DTP 507 1_555 ? ? ? ? ? ? ?            2.270 ? 
metalc21 metalc ? ? F MN  .   MN    B ? ? 1_555 K DPO . O1  B ? A MN  503 A DPO 508 1_555 ? ? ? ? ? ? ?            2.378 ? 
metalc22 metalc ? ? F MN  .   MN    B ? ? 1_555 K DPO . O5  B ? A MN  503 A DPO 508 1_555 ? ? ? ? ? ? ?            2.184 ? 
metalc23 metalc ? ? K DPO .   O2    B ? ? 1_555 L MN  . MN  B ? A DPO 508 P MN  101 1_555 ? ? ? ? ? ? ?            2.343 ? 
metalc24 metalc ? ? L MN  .   MN    B ? ? 1_555 M HOH . O   B ? P MN  101 A HOH 606 1_555 ? ? ? ? ? ? ?            2.209 ? 
metalc25 metalc ? ? L MN  .   MN    B ? ? 1_555 M HOH . O   ? ? P MN  101 A HOH 642 1_555 ? ? ? ? ? ? ?            2.797 ? 
hydrog1  hydrog ? ? B DT  4   N3    ? ? ? 1_555 C DA  9 N1  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  4   O4    ? ? ? 1_555 C DA  9 N6  B ? T DT  4   P DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  5   N1    ? ? ? 1_555 C DT  8 N3  B ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  A ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DA  5   N6    ? ? ? 1_555 C DT  8 O4  B ? T DA  5   P DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  7 N1  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  7 N6  ? ? T DT  6   P DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DG  7   N1    ? ? ? 1_555 C DC  6 N3  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DG  7   N2    ? ? ? 1_555 C DC  6 O2  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  7   O6    ? ? ? 1_555 C DC  6 N4  ? ? T DG  7   P DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  5 N3  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  5 O4  ? ? T DA  8   P DT  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  4 N1  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  4 O6  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  4 N2  ? ? T DC  9   P DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  10  N1    ? ? ? 1_555 C DC  3 N3  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DG  10  N2    ? ? ? 1_555 C DC  3 O2  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DG  10  O6    ? ? ? 1_555 C DC  3 N4  ? ? T DG  10  P DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  2 N1  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  2 O6  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  2 N2  ? ? T DC  11  P DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  1 N1  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  1 N6  ? ? T DT  12  P DA  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 153 A . ? LEU 150 A PRO 154 A ? PRO 151 A 1 -0.41  
2 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 4.78   
3 LYS 234 A . ? LYS 231 A PRO 235 A ? PRO 232 A 1 -9.10  
4 SER 419 A . ? SER 416 A PRO 420 A ? PRO 417 A 1 -10.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 112 ? SER A 116 ? ILE A 109 SER A 113 
AA1 2 GLU A 119 ? ASP A 123 ? GLU A 116 ASP A 120 
AA1 3 VAL A 12  ? MET A 17  ? VAL A 9   MET A 14  
AA1 4 CYS A 215 ? SER A 220 ? CYS A 212 SER A 217 
AA1 5 GLN A 238 ? LEU A 240 ? GLN A 235 LEU A 237 
AA1 6 THR A 148 ? ILE A 150 ? THR A 145 ILE A 147 
AA2 1 GLY A 49  ? VAL A 53  ? GLY A 46  VAL A 50  
AA2 2 CYS A 37  ? GLN A 41  ? CYS A 34  GLN A 38  
AA2 3 LEU A 79  ? GLN A 82  ? LEU A 76  GLN A 79  
AA3 1 GLU A 85  ? SER A 86  ? GLU A 82  SER A 83  
AA3 2 LYS A 89  ? ALA A 90  ? LYS A 86  ALA A 87  
AA4 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA4 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA4 3 LEU A 334 ? THR A 336 ? LEU A 331 THR A 333 
AA5 1 ILE A 322 ? ASN A 327 ? ILE A 319 ASN A 324 
AA5 2 GLU A 417 ? ALA A 434 ? GLU A 414 ALA A 431 
AA5 3 ARG A 364 ? VAL A 375 ? ARG A 361 VAL A 372 
AA5 4 LEU A 384 ? ALA A 389 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ALA A 115 ? N ALA A 112 O GLU A 119 ? O GLU A 116 
AA1 2 3 O VAL A 122 ? O VAL A 119 N ALA A 13  ? N ALA A 10  
AA1 3 4 N VAL A 12  ? N VAL A 9   O SER A 220 ? O SER A 217 
AA1 4 5 N ILE A 219 ? N ILE A 216 O THR A 239 ? O THR A 236 
AA1 5 6 O LEU A 240 ? O LEU A 237 N TYR A 149 ? N TYR A 146 
AA2 1 2 O ILE A 51  ? O ILE A 48  N VAL A 39  ? N VAL A 36  
AA2 2 3 N VAL A 40  ? N VAL A 37  O ALA A 81  ? O ALA A 78  
AA3 1 2 N SER A 86  ? N SER A 83  O LYS A 89  ? O LYS A 86  
AA4 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA4 2 3 O TRP A 418 ? O TRP A 415 N ALA A 335 ? N ALA A 332 
AA5 1 2 N CYS A 324 ? N CYS A 321 O LEU A 427 ? O LEU A 424 
AA5 2 3 O CYS A 428 ? O CYS A 425 N VAL A 370 ? N VAL A 367 
AA5 3 4 N VAL A 371 ? N VAL A 368 O ARG A 386 ? O ARG A 383 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN  501 ? 9  'binding site for residue MN A 501'  
AC2 Software A CA  502 ? 7  'binding site for residue CA A 502'  
AC3 Software A MN  503 ? 7  'binding site for residue MN A 503'  
AC4 Software A GOL 504 ? 9  'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 6  'binding site for residue GOL A 505' 
AC6 Software A GOL 506 ? 10 'binding site for residue GOL A 506' 
AC7 Software A DTP 507 ? 33 'binding site for residue DTP A 507' 
AC8 Software A DPO 508 ? 19 'binding site for residue DPO A 508' 
AC9 Software P MN  101 ? 8  'binding site for residue MN P 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 9  ASP A 16  ? ASP A 13  . ? 1_555 ? 
2   AC1 9  ASP A 118 ? ASP A 115 . ? 1_555 ? 
3   AC1 9  GLU A 119 ? GLU A 116 . ? 1_555 ? 
4   AC1 9  CA  E .   ? CA  A 502 . ? 1_555 ? 
5   AC1 9  MN  F .   ? MN  A 503 . ? 1_555 ? 
6   AC1 9  DTP J .   ? DTP A 507 . ? 1_555 ? 
7   AC1 9  DT  C 8   ? DT  P 8   . ? 1_555 ? 
8   AC1 9  DA  C 9   ? DA  P 9   . ? 1_555 ? 
9   AC1 9  HOH O .   ? HOH P 214 . ? 1_555 ? 
10  AC2 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
11  AC2 7  MET A 17  ? MET A 14  . ? 1_555 ? 
12  AC2 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
13  AC2 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
14  AC2 7  DTP J .   ? DTP A 507 . ? 1_555 ? 
15  AC2 7  DPO K .   ? DPO A 508 . ? 1_555 ? 
16  AC2 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
17  AC3 7  ASP A 16  ? ASP A 13  . ? 1_555 ? 
18  AC3 7  MET A 17  ? MET A 14  . ? 1_555 ? 
19  AC3 7  ASP A 118 ? ASP A 115 . ? 1_555 ? 
20  AC3 7  MN  D .   ? MN  A 501 . ? 1_555 ? 
21  AC3 7  DTP J .   ? DTP A 507 . ? 1_555 ? 
22  AC3 7  DPO K .   ? DPO A 508 . ? 1_555 ? 
23  AC3 7  DA  C 9   ? DA  P 9   . ? 1_555 ? 
24  AC4 9  ARG A 27  ? ARG A 24  . ? 6_545 ? 
25  AC4 9  PRO A 247 ? PRO A 244 . ? 1_555 ? 
26  AC4 9  PHE A 250 ? PHE A 247 . ? 1_555 ? 
27  AC4 9  SER A 251 ? SER A 248 . ? 1_555 ? 
28  AC4 9  GLY A 279 ? GLY A 276 . ? 1_555 ? 
29  AC4 9  GLU A 280 ? GLU A 277 . ? 1_555 ? 
30  AC4 9  HOH M .   ? HOH A 654 . ? 1_555 ? 
31  AC4 9  HOH M .   ? HOH A 695 . ? 1_555 ? 
32  AC4 9  HOH M .   ? HOH A 698 . ? 1_555 ? 
33  AC5 6  GLU A 97  ? GLU A 94  . ? 1_555 ? 
34  AC5 6  ALA A 98  ? ALA A 95  . ? 1_555 ? 
35  AC5 6  GLU A 101 ? GLU A 98  . ? 1_555 ? 
36  AC5 6  HOH M .   ? HOH A 656 . ? 1_555 ? 
37  AC5 6  HOH M .   ? HOH A 667 . ? 1_555 ? 
38  AC5 6  HOH M .   ? HOH A 707 . ? 1_555 ? 
39  AC6 10 ASN A 29  ? ASN A 26  . ? 1_555 ? 
40  AC6 10 PRO A 30  ? PRO A 27  . ? 1_555 ? 
41  AC6 10 HIS A 31  ? HIS A 28  . ? 1_555 ? 
42  AC6 10 GLY A 274 ? GLY A 271 . ? 5_664 ? 
43  AC6 10 GLU A 276 ? GLU A 273 . ? 5_664 ? 
44  AC6 10 TYR A 277 ? TYR A 274 . ? 5_664 ? 
45  AC6 10 GLU A 280 ? GLU A 277 . ? 5_664 ? 
46  AC6 10 HOH M .   ? HOH A 603 . ? 5_664 ? 
47  AC6 10 HOH M .   ? HOH A 615 . ? 1_555 ? 
48  AC6 10 HOH M .   ? HOH A 675 . ? 1_555 ? 
49  AC7 33 ASP A 16  ? ASP A 13  . ? 1_555 ? 
50  AC7 33 MET A 17  ? MET A 14  . ? 1_555 ? 
51  AC7 33 ASP A 18  ? ASP A 15  . ? 1_555 ? 
52  AC7 33 CYS A 19  ? CYS A 16  . ? 1_555 ? 
53  AC7 33 PHE A 20  ? PHE A 17  . ? 1_555 ? 
54  AC7 33 PHE A 21  ? PHE A 18  . ? 1_555 ? 
55  AC7 33 ILE A 51  ? ILE A 48  . ? 1_555 ? 
56  AC7 33 ALA A 52  ? ALA A 49  . ? 1_555 ? 
57  AC7 33 TYR A 55  ? TYR A 52  . ? 1_555 ? 
58  AC7 33 ARG A 58  ? ARG A 55  . ? 1_555 ? 
59  AC7 33 ARG A 64  ? ARG A 61  . ? 1_555 ? 
60  AC7 33 ASP A 118 ? ASP A 115 . ? 1_555 ? 
61  AC7 33 LYS A 234 ? LYS A 231 . ? 1_555 ? 
62  AC7 33 MN  D .   ? MN  A 501 . ? 1_555 ? 
63  AC7 33 CA  E .   ? CA  A 502 . ? 1_555 ? 
64  AC7 33 MN  F .   ? MN  A 503 . ? 1_555 ? 
65  AC7 33 DPO K .   ? DPO A 508 . ? 1_555 ? 
66  AC7 33 HOH M .   ? HOH A 606 . ? 1_555 ? 
67  AC7 33 HOH M .   ? HOH A 641 . ? 1_555 ? 
68  AC7 33 HOH M .   ? HOH A 642 . ? 1_555 ? 
69  AC7 33 HOH M .   ? HOH A 701 . ? 1_555 ? 
70  AC7 33 HOH M .   ? HOH A 715 . ? 1_555 ? 
71  AC7 33 DT  C 8   ? DT  P 8   . ? 1_555 ? 
72  AC7 33 DA  C 9   ? DA  P 9   . ? 1_555 ? 
73  AC7 33 MN  L .   ? MN  P 101 . ? 1_555 ? 
74  AC7 33 HOH O .   ? HOH P 204 . ? 1_555 ? 
75  AC7 33 HOH O .   ? HOH P 213 . ? 1_555 ? 
76  AC7 33 HOH O .   ? HOH P 214 . ? 1_555 ? 
77  AC7 33 HOH O .   ? HOH P 217 . ? 1_555 ? 
78  AC7 33 HOH O .   ? HOH P 220 . ? 1_555 ? 
79  AC7 33 DT  B 3   ? DT  T 3   . ? 1_555 ? 
80  AC7 33 DT  B 4   ? DT  T 4   . ? 1_555 ? 
81  AC7 33 DA  B 5   ? DA  T 5   . ? 1_555 ? 
82  AC8 19 ASP A 16  ? ASP A 13  . ? 1_555 ? 
83  AC8 19 MET A 17  ? MET A 14  . ? 1_555 ? 
84  AC8 19 ASP A 18  ? ASP A 15  . ? 1_555 ? 
85  AC8 19 CYS A 19  ? CYS A 16  . ? 1_555 ? 
86  AC8 19 PHE A 20  ? PHE A 17  . ? 1_555 ? 
87  AC8 19 TYR A 55  ? TYR A 52  . ? 1_555 ? 
88  AC8 19 ARG A 58  ? ARG A 55  . ? 1_555 ? 
89  AC8 19 ARG A 64  ? ARG A 61  . ? 1_555 ? 
90  AC8 19 ASP A 118 ? ASP A 115 . ? 1_555 ? 
91  AC8 19 LYS A 234 ? LYS A 231 . ? 1_555 ? 
92  AC8 19 CA  E .   ? CA  A 502 . ? 1_555 ? 
93  AC8 19 MN  F .   ? MN  A 503 . ? 1_555 ? 
94  AC8 19 DTP J .   ? DTP A 507 . ? 1_555 ? 
95  AC8 19 HOH M .   ? HOH A 641 . ? 1_555 ? 
96  AC8 19 HOH M .   ? HOH A 642 . ? 1_555 ? 
97  AC8 19 HOH M .   ? HOH A 701 . ? 1_555 ? 
98  AC8 19 HOH M .   ? HOH A 715 . ? 1_555 ? 
99  AC8 19 DA  C 9   ? DA  P 9   . ? 1_555 ? 
100 AC8 19 MN  L .   ? MN  P 101 . ? 1_555 ? 
101 AC9 8  ARG A 64  ? ARG A 61  . ? 1_555 ? 
102 AC9 8  DTP J .   ? DTP A 507 . ? 1_555 ? 
103 AC9 8  DPO K .   ? DPO A 508 . ? 1_555 ? 
104 AC9 8  HOH M .   ? HOH A 606 . ? 1_555 ? 
105 AC9 8  HOH M .   ? HOH A 642 . ? 1_555 ? 
106 AC9 8  HOH M .   ? HOH A 899 . ? 1_555 ? 
107 AC9 8  DA  C 9   ? DA  P 9   . ? 1_555 ? 
108 AC9 8  HOH O .   ? HOH P 217 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5L9X 
_atom_sites.fract_transf_matrix[1][1]   0.010174 
_atom_sites.fract_transf_matrix[1][2]   0.005874 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011748 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012188 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CA 
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 1   ? 65.721 -34.434 -3.797  1.00 39.26  ? -2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 1   ? 67.040 -33.829 -3.742  1.00 52.17  ? -2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 1   ? 67.350 -32.903 -4.907  1.00 50.72  ? -2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 1   ? 67.083 -31.703 -4.834  1.00 53.42  ? -2   GLY A O     1 
ATOM   5    N  N     . PRO A 1 2   ? 67.923 -33.462 -5.987  1.00 48.78  ? -1   PRO A N     1 
ATOM   6    C  CA    . PRO A 1 2   ? 68.369 -32.748 -7.195  1.00 55.59  ? -1   PRO A CA    1 
ATOM   7    C  C     . PRO A 1 2   ? 67.235 -32.198 -8.073  1.00 56.88  ? -1   PRO A C     1 
ATOM   8    O  O     . PRO A 1 2   ? 67.504 -31.423 -8.997  1.00 58.17  ? -1   PRO A O     1 
ATOM   9    C  CB    . PRO A 1 2   ? 69.162 -33.819 -7.958  1.00 51.25  ? -1   PRO A CB    1 
ATOM   10   C  CG    . PRO A 1 2   ? 68.604 -35.121 -7.481  1.00 48.10  ? -1   PRO A CG    1 
ATOM   11   C  CD    . PRO A 1 2   ? 68.257 -34.896 -6.041  1.00 43.91  ? -1   PRO A CD    1 
ATOM   12   N  N     . HIS A 1 3   ? 65.995 -32.593 -7.791  1.00 56.71  ? 0    HIS A N     1 
ATOM   13   C  CA    . HIS A 1 3   ? 64.847 -32.126 -8.569  1.00 58.26  ? 0    HIS A CA    1 
ATOM   14   C  C     . HIS A 1 3   ? 63.884 -31.300 -7.718  1.00 60.66  ? 0    HIS A C     1 
ATOM   15   O  O     . HIS A 1 3   ? 62.871 -30.809 -8.219  1.00 55.17  ? 0    HIS A O     1 
ATOM   16   C  CB    . HIS A 1 3   ? 64.106 -33.311 -9.195  1.00 47.00  ? 0    HIS A CB    1 
ATOM   17   C  CG    . HIS A 1 3   ? 65.016 -34.331 -9.802  1.00 43.91  ? 0    HIS A CG    1 
ATOM   18   N  ND1   . HIS A 1 3   ? 65.404 -35.469 -9.128  1.00 46.82  ? 0    HIS A ND1   1 
ATOM   19   C  CD2   . HIS A 1 3   ? 65.643 -34.371 -11.002 1.00 40.98  ? 0    HIS A CD2   1 
ATOM   20   C  CE1   . HIS A 1 3   ? 66.218 -36.173 -9.895  1.00 43.03  ? 0    HIS A CE1   1 
ATOM   21   N  NE2   . HIS A 1 3   ? 66.377 -35.531 -11.038 1.00 46.14  ? 0    HIS A NE2   1 
ATOM   22   N  N     . MET A 1 4   ? 64.202 -31.152 -6.433  1.00 63.62  ? 1    MET A N     1 
ATOM   23   C  CA    . MET A 1 4   ? 63.397 -30.331 -5.532  1.00 64.10  ? 1    MET A CA    1 
ATOM   24   C  C     . MET A 1 4   ? 63.585 -28.853 -5.839  1.00 61.39  ? 1    MET A C     1 
ATOM   25   O  O     . MET A 1 4   ? 64.623 -28.275 -5.506  1.00 61.96  ? 1    MET A O     1 
ATOM   26   C  CB    . MET A 1 4   ? 63.765 -30.591 -4.067  1.00 67.79  ? 1    MET A CB    1 
ATOM   27   C  CG    . MET A 1 4   ? 63.667 -32.039 -3.623  1.00 74.43  ? 1    MET A CG    1 
ATOM   28   S  SD    . MET A 1 4   ? 64.120 -32.257 -1.886  1.00 103.55 ? 1    MET A SD    1 
ATOM   29   C  CE    . MET A 1 4   ? 65.568 -31.206 -1.759  1.00 64.03  ? 1    MET A CE    1 
ATOM   30   N  N     . ALA A 1 5   ? 62.586 -28.242 -6.472  1.00 62.61  ? 2    ALA A N     1 
ATOM   31   C  CA    . ALA A 1 5   ? 62.641 -26.811 -6.754  1.00 59.79  ? 2    ALA A CA    1 
ATOM   32   C  C     . ALA A 1 5   ? 62.726 -26.031 -5.447  1.00 53.02  ? 2    ALA A C     1 
ATOM   33   O  O     . ALA A 1 5   ? 62.064 -26.372 -4.463  1.00 51.00  ? 2    ALA A O     1 
ATOM   34   C  CB    . ALA A 1 5   ? 61.439 -26.368 -7.568  1.00 51.43  ? 2    ALA A CB    1 
ATOM   35   N  N     . THR A 1 6   ? 63.560 -24.998 -5.429  1.00 46.19  ? 3    THR A N     1 
ATOM   36   C  CA    . THR A 1 6   ? 63.810 -24.275 -4.191  1.00 44.93  ? 3    THR A CA    1 
ATOM   37   C  C     . THR A 1 6   ? 63.319 -22.827 -4.245  1.00 32.32  ? 3    THR A C     1 
ATOM   38   O  O     . THR A 1 6   ? 63.539 -22.067 -3.302  1.00 34.92  ? 3    THR A O     1 
ATOM   39   C  CB    . THR A 1 6   ? 65.305 -24.290 -3.834  1.00 35.73  ? 3    THR A CB    1 
ATOM   40   O  OG1   . THR A 1 6   ? 66.048 -23.593 -4.842  1.00 37.13  ? 3    THR A OG1   1 
ATOM   41   C  CG2   . THR A 1 6   ? 65.812 -25.728 -3.734  1.00 42.05  ? 3    THR A CG2   1 
ATOM   42   N  N     . GLY A 1 7   ? 62.647 -22.460 -5.337  1.00 34.30  ? 4    GLY A N     1 
ATOM   43   C  CA    . GLY A 1 7   ? 62.062 -21.133 -5.466  1.00 23.63  ? 4    GLY A CA    1 
ATOM   44   C  C     . GLY A 1 7   ? 63.111 -20.048 -5.335  1.00 25.18  ? 4    GLY A C     1 
ATOM   45   O  O     . GLY A 1 7   ? 62.937 -19.083 -4.587  1.00 25.76  ? 4    GLY A O     1 
ATOM   46   N  N     . GLN A 1 8   ? 64.220 -20.228 -6.047  1.00 20.15  ? 5    GLN A N     1 
ATOM   47   C  CA    . GLN A 1 8   ? 65.345 -19.301 -5.980  1.00 17.43  ? 5    GLN A CA    1 
ATOM   48   C  C     . GLN A 1 8   ? 65.700 -18.751 -7.363  1.00 18.83  ? 5    GLN A C     1 
ATOM   49   O  O     . GLN A 1 8   ? 66.782 -18.204 -7.558  1.00 18.36  ? 5    GLN A O     1 
ATOM   50   C  CB    . GLN A 1 8   ? 66.572 -19.989 -5.372  1.00 20.26  ? 5    GLN A CB    1 
ATOM   51   C  CG    . GLN A 1 8   ? 66.476 -20.344 -3.892  1.00 23.94  ? 5    GLN A CG    1 
ATOM   52   C  CD    . GLN A 1 8   ? 67.697 -21.130 -3.408  1.00 23.80  ? 5    GLN A CD    1 
ATOM   53   O  OE1   . GLN A 1 8   ? 67.804 -22.329 -3.649  1.00 28.61  ? 5    GLN A OE1   1 
ATOM   54   N  NE2   . GLN A 1 8   ? 68.622 -20.452 -2.737  1.00 23.14  ? 5    GLN A NE2   1 
ATOM   55   N  N     A ASP A 1 9   ? 64.752 -18.887 -8.288  0.50 19.51  ? 6    ASP A N     1 
ATOM   56   N  N     B ASP A 1 9   ? 64.804 -18.883 -8.334  0.50 19.53  ? 6    ASP A N     1 
ATOM   57   C  CA    A ASP A 1 9   ? 64.935 -18.520 -9.687  0.50 21.43  ? 6    ASP A CA    1 
ATOM   58   C  CA    B ASP A 1 9   ? 65.148 -18.469 -9.694  0.50 21.19  ? 6    ASP A CA    1 
ATOM   59   C  C     A ASP A 1 9   ? 64.936 -17.008 -9.925  0.50 20.66  ? 6    ASP A C     1 
ATOM   60   C  C     B ASP A 1 9   ? 64.937 -16.973 -9.958  0.50 20.64  ? 6    ASP A C     1 
ATOM   61   O  O     A ASP A 1 9   ? 65.546 -16.529 -10.873 0.50 19.94  ? 6    ASP A O     1 
ATOM   62   O  O     B ASP A 1 9   ? 65.388 -16.468 -10.977 0.50 19.82  ? 6    ASP A O     1 
ATOM   63   C  CB    A ASP A 1 9   ? 63.841 -19.181 -10.547 0.50 22.47  ? 6    ASP A CB    1 
ATOM   64   C  CB    B ASP A 1 9   ? 64.355 -19.283 -10.723 0.50 21.96  ? 6    ASP A CB    1 
ATOM   65   C  CG    A ASP A 1 9   ? 62.435 -19.018 -9.961  0.50 24.75  ? 6    ASP A CG    1 
ATOM   66   C  CG    B ASP A 1 9   ? 65.061 -20.571 -11.124 0.50 27.68  ? 6    ASP A CG    1 
ATOM   67   O  OD1   A ASP A 1 9   ? 62.226 -19.307 -8.760  0.50 17.84  ? 6    ASP A OD1   1 
ATOM   68   O  OD1   B ASP A 1 9   ? 66.252 -20.751 -10.771 0.50 20.86  ? 6    ASP A OD1   1 
ATOM   69   O  OD2   A ASP A 1 9   ? 61.523 -18.609 -10.712 0.50 29.22  ? 6    ASP A OD2   1 
ATOM   70   O  OD2   B ASP A 1 9   ? 64.427 -21.402 -11.810 0.50 28.93  ? 6    ASP A OD2   1 
ATOM   71   N  N     . ARG A 1 10  ? 64.260 -16.266 -9.056  1.00 18.24  ? 7    ARG A N     1 
ATOM   72   C  CA    . ARG A 1 10  ? 64.058 -14.824 -9.239  1.00 18.41  ? 7    ARG A CA    1 
ATOM   73   C  C     . ARG A 1 10  ? 64.672 -13.966 -8.137  1.00 15.42  ? 7    ARG A C     1 
ATOM   74   O  O     . ARG A 1 10  ? 64.873 -14.430 -7.015  1.00 13.29  ? 7    ARG A O     1 
ATOM   75   C  CB    . ARG A 1 10  ? 62.566 -14.490 -9.291  1.00 19.58  ? 7    ARG A CB    1 
ATOM   76   C  CG    . ARG A 1 10  ? 61.762 -15.150 -10.396 1.00 16.49  ? 7    ARG A CG    1 
ATOM   77   C  CD    . ARG A 1 10  ? 60.293 -14.753 -10.259 1.00 14.02  ? 7    ARG A CD    1 
ATOM   78   N  NE    . ARG A 1 10  ? 59.651 -15.374 -9.095  1.00 12.28  ? 7    ARG A NE    1 
ATOM   79   C  CZ    . ARG A 1 10  ? 58.585 -14.877 -8.466  1.00 19.02  ? 7    ARG A CZ    1 
ATOM   80   N  NH1   . ARG A 1 10  ? 58.060 -15.514 -7.426  1.00 13.62  ? 7    ARG A NH1   1 
ATOM   81   N  NH2   . ARG A 1 10  ? 58.038 -13.740 -8.878  1.00 17.41  ? 7    ARG A NH2   1 
ATOM   82   N  N     . VAL A 1 11  ? 64.935 -12.700 -8.450  1.00 15.00  ? 8    VAL A N     1 
ATOM   83   C  CA    . VAL A 1 11  ? 65.241 -11.729 -7.413  1.00 11.26  ? 8    VAL A CA    1 
ATOM   84   C  C     . VAL A 1 11  ? 64.116 -10.690 -7.432  1.00 16.81  ? 8    VAL A C     1 
ATOM   85   O  O     . VAL A 1 11  ? 63.868 -10.061 -8.455  1.00 14.95  ? 8    VAL A O     1 
ATOM   86   C  CB    . VAL A 1 11  ? 66.621 -11.051 -7.614  1.00 14.21  ? 8    VAL A CB    1 
ATOM   87   C  CG1   . VAL A 1 11  ? 66.872 -9.986  -6.536  1.00 11.76  ? 8    VAL A CG1   1 
ATOM   88   C  CG2   . VAL A 1 11  ? 67.748 -12.081 -7.606  1.00 11.62  ? 8    VAL A CG2   1 
ATOM   89   N  N     . VAL A 1 12  ? 63.428 -10.530 -6.306  1.00 14.44  ? 9    VAL A N     1 
ATOM   90   C  CA    . VAL A 1 12  ? 62.257 -9.666  -6.246  1.00 11.56  ? 9    VAL A CA    1 
ATOM   91   C  C     . VAL A 1 12  ? 62.429 -8.694  -5.097  1.00 14.18  ? 9    VAL A C     1 
ATOM   92   O  O     . VAL A 1 12  ? 62.876 -9.078  -4.024  1.00 11.31  ? 9    VAL A O     1 
ATOM   93   C  CB    . VAL A 1 12  ? 60.959 -10.483 -6.075  1.00 7.89   ? 9    VAL A CB    1 
ATOM   94   C  CG1   . VAL A 1 12  ? 59.751 -9.564  -5.839  1.00 11.48  ? 9    VAL A CG1   1 
ATOM   95   C  CG2   . VAL A 1 12  ? 60.723 -11.360 -7.307  1.00 15.79  ? 9    VAL A CG2   1 
ATOM   96   N  N     . ALA A 1 13  ? 62.129 -7.420  -5.323  1.00 14.09  ? 10   ALA A N     1 
ATOM   97   C  CA    . ALA A 1 13  ? 62.194 -6.474  -4.220  1.00 10.95  ? 10   ALA A CA    1 
ATOM   98   C  C     . ALA A 1 13  ? 60.830 -5.871  -3.975  1.00 11.82  ? 10   ALA A C     1 
ATOM   99   O  O     . ALA A 1 13  ? 59.992 -5.833  -4.875  1.00 13.53  ? 10   ALA A O     1 
ATOM   100  C  CB    . ALA A 1 13  ? 63.238 -5.380  -4.491  1.00 12.83  ? 10   ALA A CB    1 
ATOM   101  N  N     . LEU A 1 14  ? 60.601 -5.434  -2.740  1.00 7.39   ? 11   LEU A N     1 
ATOM   102  C  CA    . LEU A 1 14  ? 59.427 -4.627  -2.440  1.00 10.47  ? 11   LEU A CA    1 
ATOM   103  C  C     . LEU A 1 14  ? 59.906 -3.333  -1.826  1.00 17.83  ? 11   LEU A C     1 
ATOM   104  O  O     . LEU A 1 14  ? 60.583 -3.347  -0.792  1.00 14.39  ? 11   LEU A O     1 
ATOM   105  C  CB    . LEU A 1 14  ? 58.468 -5.357  -1.501  1.00 8.83   ? 11   LEU A CB    1 
ATOM   106  C  CG    . LEU A 1 14  ? 57.115 -4.753  -1.084  1.00 22.89  ? 11   LEU A CG    1 
ATOM   107  C  CD1   . LEU A 1 14  ? 57.242 -3.876  0.156   1.00 17.00  ? 11   LEU A CD1   1 
ATOM   108  C  CD2   . LEU A 1 14  ? 56.416 -3.993  -2.244  1.00 13.13  ? 11   LEU A CD2   1 
ATOM   109  N  N     . VAL A 1 15  ? 59.577 -2.217  -2.471  1.00 11.41  ? 12   VAL A N     1 
ATOM   110  C  CA    . VAL A 1 15  ? 59.958 -0.912  -1.935  1.00 10.56  ? 12   VAL A CA    1 
ATOM   111  C  C     . VAL A 1 15  ? 58.743 -0.203  -1.387  1.00 14.52  ? 12   VAL A C     1 
ATOM   112  O  O     . VAL A 1 15  ? 57.747 -0.044  -2.077  1.00 10.80  ? 12   VAL A O     1 
ATOM   113  C  CB    . VAL A 1 15  ? 60.630 -0.033  -2.996  1.00 13.60  ? 12   VAL A CB    1 
ATOM   114  C  CG1   . VAL A 1 15  ? 61.082 1.305   -2.372  1.00 11.54  ? 12   VAL A CG1   1 
ATOM   115  C  CG2   . VAL A 1 15  ? 61.812 -0.792  -3.612  1.00 17.66  ? 12   VAL A CG2   1 
ATOM   116  N  N     . ASP A 1 16  ? 58.831 0.249   -0.150  1.00 10.50  ? 13   ASP A N     1 
ATOM   117  C  CA    . ASP A 1 16  ? 57.707 0.820   0.547   1.00 15.10  ? 13   ASP A CA    1 
ATOM   118  C  C     . ASP A 1 16  ? 58.090 2.132   1.274   1.00 9.80   ? 13   ASP A C     1 
ATOM   119  O  O     . ASP A 1 16  ? 59.027 2.156   2.006   1.00 11.59  ? 13   ASP A O     1 
ATOM   120  C  CB    . ASP A 1 16  ? 57.150 -0.186  1.528   1.00 13.41  ? 13   ASP A CB    1 
ATOM   121  C  CG    . ASP A 1 16  ? 55.967 0.353   2.283   1.00 17.02  ? 13   ASP A CG    1 
ATOM   122  O  OD1   . ASP A 1 16  ? 56.163 0.857   3.321   1.00 13.51  ? 13   ASP A OD1   1 
ATOM   123  O  OD2   . ASP A 1 16  ? 54.898 0.266   1.791   1.00 17.83  ? 13   ASP A OD2   1 
ATOM   124  N  N     . MET A 1 17  ? 57.406 3.214   0.984   1.00 11.54  ? 14   MET A N     1 
ATOM   125  C  CA    . MET A 1 17  ? 57.764 4.540   1.518   1.00 14.38  ? 14   MET A CA    1 
ATOM   126  C  C     . MET A 1 17  ? 57.563 4.565   3.051   1.00 13.30  ? 14   MET A C     1 
ATOM   127  O  O     . MET A 1 17  ? 56.630 4.067   3.483   1.00 12.13  ? 14   MET A O     1 
ATOM   128  C  CB    . MET A 1 17  ? 56.881 5.588   0.878   1.00 11.96  ? 14   MET A CB    1 
ATOM   129  C  CG    . MET A 1 17  ? 56.895 5.569   -0.640  1.00 8.89   ? 14   MET A CG    1 
ATOM   130  S  SD    . MET A 1 17  ? 58.537 5.506   -1.286  1.00 16.60  ? 14   MET A SD    1 
ATOM   131  C  CE    . MET A 1 17  ? 59.103 7.085   -0.966  1.00 14.20  ? 14   MET A CE    1 
ATOM   132  N  N     . ASP A 1 18  ? 58.466 5.146   3.813   1.00 10.63  ? 15   ASP A N     1 
ATOM   133  C  CA    . ASP A 1 18  ? 58.286 5.266   5.253   1.00 12.30  ? 15   ASP A CA    1 
ATOM   134  C  C     . ASP A 1 18  ? 57.176 6.318   5.544   1.00 16.35  ? 15   ASP A C     1 
ATOM   135  O  O     . ASP A 1 18  ? 57.197 7.318   4.962   1.00 9.18   ? 15   ASP A O     1 
ATOM   136  C  CB    . ASP A 1 18  ? 59.556 5.717   5.902   1.00 12.69  ? 15   ASP A CB    1 
ATOM   137  C  CG    . ASP A 1 18  ? 60.687 4.730   5.747   1.00 14.52  ? 15   ASP A CG    1 
ATOM   138  O  OD1   . ASP A 1 18  ? 60.467 3.550   5.640   1.00 12.44  ? 15   ASP A OD1   1 
ATOM   139  O  OD2   . ASP A 1 18  ? 61.785 5.206   5.699   1.00 16.30  ? 15   ASP A OD2   1 
ATOM   140  N  N     . CYS A 1 19  ? 56.209 5.972   6.392   1.00 12.43  ? 16   CYS A N     1 
ATOM   141  C  CA    . CYS A 1 19  ? 55.178 6.884   6.868   1.00 15.83  ? 16   CYS A CA    1 
ATOM   142  C  C     . CYS A 1 19  ? 54.693 7.828   5.767   1.00 12.99  ? 16   CYS A C     1 
ATOM   143  O  O     . CYS A 1 19  ? 54.875 8.965   5.882   1.00 11.55  ? 16   CYS A O     1 
ATOM   144  C  CB    . CYS A 1 19  ? 55.510 7.619   8.193   1.00 9.55   ? 16   CYS A CB    1 
ATOM   145  S  SG    . CYS A 1 19  ? 57.007 8.539   8.260   1.00 15.96  ? 16   CYS A SG    1 
ATOM   146  N  N     . PHE A 1 20  ? 54.216 7.299   4.667   1.00 9.36   ? 17   PHE A N     1 
ATOM   147  C  CA    . PHE A 1 20  ? 54.235 8.040   3.429   1.00 9.90   ? 17   PHE A CA    1 
ATOM   148  C  C     . PHE A 1 20  ? 53.477 9.376   3.401   1.00 12.25  ? 17   PHE A C     1 
ATOM   149  O  O     . PHE A 1 20  ? 54.054 10.340  3.108   1.00 8.74   ? 17   PHE A O     1 
ATOM   150  C  CB    . PHE A 1 20  ? 53.665 7.166   2.322   1.00 9.70   ? 17   PHE A CB    1 
ATOM   151  C  CG    . PHE A 1 20  ? 53.719 7.789   0.964   1.00 12.01  ? 17   PHE A CG    1 
ATOM   152  C  CD1   . PHE A 1 20  ? 54.843 8.464   0.526   1.00 13.54  ? 17   PHE A CD1   1 
ATOM   153  C  CD2   . PHE A 1 20  ? 52.633 7.724   0.126   1.00 14.74  ? 17   PHE A CD2   1 
ATOM   154  C  CE1   . PHE A 1 20  ? 54.862 9.054   -0.717  1.00 13.88  ? 17   PHE A CE1   1 
ATOM   155  C  CE2   . PHE A 1 20  ? 52.673 8.299   -1.095  1.00 15.54  ? 17   PHE A CE2   1 
ATOM   156  C  CZ    . PHE A 1 20  ? 53.788 8.959   -1.520  1.00 13.65  ? 17   PHE A CZ    1 
ATOM   157  N  N     . PHE A 1 21  ? 52.235 9.425   3.820   1.00 8.78   ? 18   PHE A N     1 
ATOM   158  C  CA    . PHE A 1 21  ? 51.503 10.691  3.756   1.00 10.48  ? 18   PHE A CA    1 
ATOM   159  C  C     . PHE A 1 21  ? 52.169 11.730  4.658   1.00 10.61  ? 18   PHE A C     1 
ATOM   160  O  O     . PHE A 1 21  ? 52.177 12.915  4.346   1.00 12.34  ? 18   PHE A O     1 
ATOM   161  C  CB    . PHE A 1 21  ? 50.029 10.531  4.161   1.00 7.15   ? 18   PHE A CB    1 
ATOM   162  C  CG    . PHE A 1 21  ? 49.182 9.810   3.162   1.00 12.83  ? 18   PHE A CG    1 
ATOM   163  C  CD1   . PHE A 1 21  ? 49.739 9.108   2.108   1.00 9.85   ? 18   PHE A CD1   1 
ATOM   164  C  CD2   . PHE A 1 21  ? 47.801 9.842   3.282   1.00 15.53  ? 18   PHE A CD2   1 
ATOM   165  C  CE1   . PHE A 1 21  ? 48.927 8.446   1.199   1.00 13.79  ? 18   PHE A CE1   1 
ATOM   166  C  CE2   . PHE A 1 21  ? 46.982 9.178   2.379   1.00 16.19  ? 18   PHE A CE2   1 
ATOM   167  C  CZ    . PHE A 1 21  ? 47.543 8.488   1.333   1.00 11.84  ? 18   PHE A CZ    1 
ATOM   168  N  N     . VAL A 1 22  ? 52.741 11.277  5.774   1.00 11.47  ? 19   VAL A N     1 
ATOM   169  C  CA    . VAL A 1 22  ? 53.487 12.170  6.657   1.00 10.13  ? 19   VAL A CA    1 
ATOM   170  C  C     . VAL A 1 22  ? 54.690 12.778  5.939   1.00 14.56  ? 19   VAL A C     1 
ATOM   171  O  O     . VAL A 1 22  ? 54.913 13.989  6.021   1.00 7.51   ? 19   VAL A O     1 
ATOM   172  C  CB    . VAL A 1 22  ? 53.966 11.439  7.939   1.00 11.17  ? 19   VAL A CB    1 
ATOM   173  C  CG1   . VAL A 1 22  ? 55.053 12.233  8.641   1.00 12.48  ? 19   VAL A CG1   1 
ATOM   174  C  CG2   . VAL A 1 22  ? 52.782 11.159  8.881   1.00 12.33  ? 19   VAL A CG2   1 
ATOM   175  N  N     . GLN A 1 23  ? 55.472 11.950  5.240   1.00 9.40   ? 20   GLN A N     1 
ATOM   176  C  CA    . GLN A 1 23  ? 56.621 12.504  4.519   1.00 10.16  ? 20   GLN A CA    1 
ATOM   177  C  C     . GLN A 1 23  ? 56.180 13.508  3.469   1.00 9.07   ? 20   GLN A C     1 
ATOM   178  O  O     . GLN A 1 23  ? 56.875 14.501  3.233   1.00 13.51  ? 20   GLN A O     1 
ATOM   179  C  CB    . GLN A 1 23  ? 57.440 11.424  3.839   1.00 11.92  ? 20   GLN A CB    1 
ATOM   180  C  CG    . GLN A 1 23  ? 58.324 10.595  4.763   1.00 11.35  ? 20   GLN A CG    1 
ATOM   181  C  CD    . GLN A 1 23  ? 59.425 9.903   3.978   1.00 15.33  ? 20   GLN A CD    1 
ATOM   182  O  OE1   . GLN A 1 23  ? 60.494 10.467  3.787   1.00 14.18  ? 20   GLN A OE1   1 
ATOM   183  N  NE2   . GLN A 1 23  ? 59.158 8.679   3.498   1.00 15.84  ? 20   GLN A NE2   1 
ATOM   184  N  N     . VAL A 1 24  ? 55.058 13.228  2.811   1.00 9.00   ? 21   VAL A N     1 
ATOM   185  C  CA    . VAL A 1 24  ? 54.555 14.149  1.784   1.00 7.66   ? 21   VAL A CA    1 
ATOM   186  C  C     . VAL A 1 24  ? 54.263 15.516  2.405   1.00 12.06  ? 21   VAL A C     1 
ATOM   187  O  O     . VAL A 1 24  ? 54.652 16.552  1.850   1.00 10.33  ? 21   VAL A O     1 
ATOM   188  C  CB    . VAL A 1 24  ? 53.287 13.600  1.070   1.00 12.79  ? 21   VAL A CB    1 
ATOM   189  C  CG1   . VAL A 1 24  ? 52.667 14.661  0.142   1.00 9.09   ? 21   VAL A CG1   1 
ATOM   190  C  CG2   . VAL A 1 24  ? 53.631 12.339  0.277   1.00 9.85   ? 21   VAL A CG2   1 
ATOM   191  N  N     . GLU A 1 25  ? 53.599 15.516  3.562   1.00 10.80  ? 22   GLU A N     1 
ATOM   192  C  CA    . GLU A 1 25  ? 53.303 16.765  4.275   1.00 10.78  ? 22   GLU A CA    1 
ATOM   193  C  C     . GLU A 1 25  ? 54.571 17.421  4.849   1.00 10.45  ? 22   GLU A C     1 
ATOM   194  O  O     . GLU A 1 25  ? 54.683 18.649  4.874   1.00 11.18  ? 22   GLU A O     1 
ATOM   195  C  CB    . GLU A 1 25  ? 52.284 16.513  5.401   1.00 6.09   ? 22   GLU A CB    1 
ATOM   196  C  CG    . GLU A 1 25  ? 50.946 16.047  4.897   1.00 7.94   ? 22   GLU A CG    1 
ATOM   197  C  CD    . GLU A 1 25  ? 50.238 17.095  4.026   1.00 16.18  ? 22   GLU A CD    1 
ATOM   198  O  OE1   . GLU A 1 25  ? 50.509 18.305  4.199   1.00 16.06  ? 22   GLU A OE1   1 
ATOM   199  O  OE2   . GLU A 1 25  ? 49.392 16.706  3.196   1.00 11.84  ? 22   GLU A OE2   1 
ATOM   200  N  N     . GLN A 1 26  ? 55.524 16.611  5.302   1.00 10.45  ? 23   GLN A N     1 
ATOM   201  C  CA    . GLN A 1 26  ? 56.773 17.157  5.858   1.00 11.58  ? 23   GLN A CA    1 
ATOM   202  C  C     . GLN A 1 26  ? 57.664 17.787  4.782   1.00 12.79  ? 23   GLN A C     1 
ATOM   203  O  O     . GLN A 1 26  ? 58.364 18.774  5.035   1.00 9.16   ? 23   GLN A O     1 
ATOM   204  C  CB    . GLN A 1 26  ? 57.570 16.070  6.593   1.00 11.96  ? 23   GLN A CB    1 
ATOM   205  C  CG    . GLN A 1 26  ? 56.967 15.623  7.916   1.00 11.46  ? 23   GLN A CG    1 
ATOM   206  C  CD    . GLN A 1 26  ? 57.738 14.465  8.537   1.00 11.33  ? 23   GLN A CD    1 
ATOM   207  O  OE1   . GLN A 1 26  ? 58.157 13.539  7.840   1.00 14.48  ? 23   GLN A OE1   1 
ATOM   208  N  NE2   . GLN A 1 26  ? 57.969 14.539  9.841   1.00 14.57  ? 23   GLN A NE2   1 
ATOM   209  N  N     . ARG A 1 27  ? 57.679 17.193  3.593   1.00 10.11  ? 24   ARG A N     1 
ATOM   210  C  CA    . ARG A 1 27  ? 58.388 17.834  2.491   1.00 9.78   ? 24   ARG A CA    1 
ATOM   211  C  C     . ARG A 1 27  ? 57.806 19.233  2.237   1.00 12.95  ? 24   ARG A C     1 
ATOM   212  O  O     . ARG A 1 27  ? 58.548 20.196  2.066   1.00 13.34  ? 24   ARG A O     1 
ATOM   213  C  CB    . ARG A 1 27  ? 58.319 16.999  1.218   1.00 11.40  ? 24   ARG A CB    1 
ATOM   214  C  CG    . ARG A 1 27  ? 59.141 17.602  0.068   1.00 14.11  ? 24   ARG A CG    1 
ATOM   215  C  CD    . ARG A 1 27  ? 59.130 16.712  -1.155  1.00 10.80  ? 24   ARG A CD    1 
ATOM   216  N  NE    . ARG A 1 27  ? 57.824 16.700  -1.808  1.00 12.77  ? 24   ARG A NE    1 
ATOM   217  C  CZ    . ARG A 1 27  ? 57.592 16.109  -2.974  1.00 10.84  ? 24   ARG A CZ    1 
ATOM   218  N  NH1   . ARG A 1 27  ? 58.578 15.470  -3.610  1.00 10.22  ? 24   ARG A NH1   1 
ATOM   219  N  NH2   . ARG A 1 27  ? 56.381 16.152  -3.504  1.00 10.93  ? 24   ARG A NH2   1 
ATOM   220  N  N     . GLN A 1 28  ? 56.479 19.332  2.237   1.00 10.31  ? 25   GLN A N     1 
ATOM   221  C  CA    . GLN A 1 28  ? 55.782 20.580  1.926   1.00 13.32  ? 25   GLN A CA    1 
ATOM   222  C  C     . GLN A 1 28  ? 55.920 21.632  3.025   1.00 17.44  ? 25   GLN A C     1 
ATOM   223  O  O     . GLN A 1 28  ? 55.983 22.849  2.760   1.00 14.37  ? 25   GLN A O     1 
ATOM   224  C  CB    . GLN A 1 28  ? 54.289 20.304  1.695   1.00 12.22  ? 25   GLN A CB    1 
ATOM   225  C  CG    . GLN A 1 28  ? 53.487 21.528  1.257   1.00 12.93  ? 25   GLN A CG    1 
ATOM   226  C  CD    . GLN A 1 28  ? 51.996 21.217  1.068   1.00 19.62  ? 25   GLN A CD    1 
ATOM   227  O  OE1   . GLN A 1 28  ? 51.625 20.136  0.626   1.00 19.70  ? 25   GLN A OE1   1 
ATOM   228  N  NE2   . GLN A 1 28  ? 51.147 22.167  1.422   1.00 19.84  ? 25   GLN A NE2   1 
ATOM   229  N  N     . ASN A 1 29  ? 55.920 21.158  4.263   1.00 12.13  ? 26   ASN A N     1 
ATOM   230  C  CA    . ASN A 1 29  ? 55.983 22.029  5.422   1.00 14.60  ? 26   ASN A CA    1 
ATOM   231  C  C     . ASN A 1 29  ? 57.140 21.625  6.337   1.00 15.41  ? 26   ASN A C     1 
ATOM   232  O  O     . ASN A 1 29  ? 56.991 20.753  7.197   1.00 11.98  ? 26   ASN A O     1 
ATOM   233  C  CB    . ASN A 1 29  ? 54.648 22.010  6.187   1.00 16.14  ? 26   ASN A CB    1 
ATOM   234  C  CG    . ASN A 1 29  ? 54.646 22.946  7.415   1.00 19.22  ? 26   ASN A CG    1 
ATOM   235  O  OD1   . ASN A 1 29  ? 55.627 23.627  7.705   1.00 19.49  ? 26   ASN A OD1   1 
ATOM   236  N  ND2   . ASN A 1 29  ? 53.525 22.978  8.127   1.00 17.67  ? 26   ASN A ND2   1 
ATOM   237  N  N     . PRO A 1 30  ? 58.298 22.272  6.148   1.00 14.44  ? 27   PRO A N     1 
ATOM   238  C  CA    . PRO A 1 30  ? 59.541 21.997  6.885   1.00 15.59  ? 27   PRO A CA    1 
ATOM   239  C  C     . PRO A 1 30  ? 59.361 22.025  8.413   1.00 17.98  ? 27   PRO A C     1 
ATOM   240  O  O     . PRO A 1 30  ? 60.081 21.332  9.125   1.00 17.82  ? 27   PRO A O     1 
ATOM   241  C  CB    . PRO A 1 30  ? 60.471 23.123  6.423   1.00 19.93  ? 27   PRO A CB    1 
ATOM   242  C  CG    . PRO A 1 30  ? 59.986 23.472  5.046   1.00 15.87  ? 27   PRO A CG    1 
ATOM   243  C  CD    . PRO A 1 30  ? 58.491 23.273  5.083   1.00 13.92  ? 27   PRO A CD    1 
ATOM   244  N  N     . HIS A 1 31  ? 58.396 22.798  8.900   1.00 17.14  ? 28   HIS A N     1 
ATOM   245  C  CA    . HIS A 1 31  ? 58.084 22.844  10.334  1.00 23.61  ? 28   HIS A CA    1 
ATOM   246  C  C     . HIS A 1 31  ? 57.675 21.493  10.927  1.00 20.11  ? 28   HIS A C     1 
ATOM   247  O  O     . HIS A 1 31  ? 57.740 21.295  12.138  1.00 22.84  ? 28   HIS A O     1 
ATOM   248  C  CB    . HIS A 1 31  ? 56.956 23.841  10.597  1.00 28.26  ? 28   HIS A CB    1 
ATOM   249  C  CG    . HIS A 1 31  ? 57.392 25.270  10.598  1.00 24.45  ? 28   HIS A CG    1 
ATOM   250  N  ND1   . HIS A 1 31  ? 56.655 26.269  9.998   1.00 35.90  ? 28   HIS A ND1   1 
ATOM   251  C  CD2   . HIS A 1 31  ? 58.474 25.874  11.145  1.00 32.50  ? 28   HIS A CD2   1 
ATOM   252  C  CE1   . HIS A 1 31  ? 57.270 27.427  10.168  1.00 33.03  ? 28   HIS A CE1   1 
ATOM   253  N  NE2   . HIS A 1 31  ? 58.376 27.214  10.858  1.00 36.28  ? 28   HIS A NE2   1 
ATOM   254  N  N     . LEU A 1 32  ? 57.241 20.567  10.081  1.00 20.30  ? 29   LEU A N     1 
ATOM   255  C  CA    . LEU A 1 32  ? 56.789 19.265  10.566  1.00 15.22  ? 29   LEU A CA    1 
ATOM   256  C  C     . LEU A 1 32  ? 57.916 18.233  10.550  1.00 20.43  ? 29   LEU A C     1 
ATOM   257  O  O     . LEU A 1 32  ? 57.771 17.145  11.099  1.00 14.61  ? 29   LEU A O     1 
ATOM   258  C  CB    . LEU A 1 32  ? 55.620 18.747  9.723   1.00 14.38  ? 29   LEU A CB    1 
ATOM   259  C  CG    . LEU A 1 32  ? 54.425 19.670  9.475   1.00 13.92  ? 29   LEU A CG    1 
ATOM   260  C  CD1   . LEU A 1 32  ? 53.422 19.011  8.542   1.00 15.52  ? 29   LEU A CD1   1 
ATOM   261  C  CD2   . LEU A 1 32  ? 53.757 20.066  10.784  1.00 20.50  ? 29   LEU A CD2   1 
ATOM   262  N  N     . ARG A 1 33  ? 59.041 18.569  9.924   1.00 13.60  ? 30   ARG A N     1 
ATOM   263  C  CA    . ARG A 1 33  ? 60.131 17.599  9.791   1.00 12.51  ? 30   ARG A CA    1 
ATOM   264  C  C     . ARG A 1 33  ? 60.730 17.288  11.156  1.00 18.46  ? 30   ARG A C     1 
ATOM   265  O  O     . ARG A 1 33  ? 60.834 18.167  12.000  1.00 14.79  ? 30   ARG A O     1 
ATOM   266  C  CB    . ARG A 1 33  ? 61.216 18.110  8.843   1.00 16.23  ? 30   ARG A CB    1 
ATOM   267  C  CG    . ARG A 1 33  ? 60.679 18.480  7.465   1.00 15.46  ? 30   ARG A CG    1 
ATOM   268  C  CD    . ARG A 1 33  ? 61.759 19.041  6.544   1.00 17.29  ? 30   ARG A CD    1 
ATOM   269  N  NE    . ARG A 1 33  ? 61.209 19.300  5.205   1.00 17.16  ? 30   ARG A NE    1 
ATOM   270  C  CZ    . ARG A 1 33  ? 61.889 19.876  4.222   1.00 21.36  ? 30   ARG A CZ    1 
ATOM   271  N  NH1   . ARG A 1 33  ? 63.141 20.260  4.419   1.00 20.60  ? 30   ARG A NH1   1 
ATOM   272  N  NH2   . ARG A 1 33  ? 61.317 20.070  3.050   1.00 15.83  ? 30   ARG A NH2   1 
ATOM   273  N  N     . ASN A 1 34  ? 61.091 16.018  11.356  1.00 18.16  ? 31   ASN A N     1 
ATOM   274  C  CA    . ASN A 1 34  ? 61.711 15.538  12.603  1.00 26.08  ? 31   ASN A CA    1 
ATOM   275  C  C     . ASN A 1 34  ? 60.900 15.852  13.855  1.00 23.63  ? 31   ASN A C     1 
ATOM   276  O  O     . ASN A 1 34  ? 61.446 16.220  14.895  1.00 21.54  ? 31   ASN A O     1 
ATOM   277  C  CB    . ASN A 1 34  ? 63.126 16.113  12.741  1.00 20.80  ? 31   ASN A CB    1 
ATOM   278  C  CG    . ASN A 1 34  ? 63.994 15.806  11.526  1.00 26.72  ? 31   ASN A CG    1 
ATOM   279  O  OD1   . ASN A 1 34  ? 64.291 14.642  11.239  1.00 37.04  ? 31   ASN A OD1   1 
ATOM   280  N  ND2   . ASN A 1 34  ? 64.377 16.847  10.793  1.00 29.96  ? 31   ASN A ND2   1 
ATOM   281  N  N     . LYS A 1 35  ? 59.587 15.713  13.740  1.00 16.75  ? 32   LYS A N     1 
ATOM   282  C  CA    . LYS A 1 35  ? 58.681 15.948  14.855  1.00 15.75  ? 32   LYS A CA    1 
ATOM   283  C  C     . LYS A 1 35  ? 57.683 14.809  14.954  1.00 17.77  ? 32   LYS A C     1 
ATOM   284  O  O     . LYS A 1 35  ? 57.407 14.157  13.958  1.00 16.95  ? 32   LYS A O     1 
ATOM   285  C  CB    . LYS A 1 35  ? 57.927 17.273  14.681  1.00 18.50  ? 32   LYS A CB    1 
ATOM   286  C  CG    . LYS A 1 35  ? 58.821 18.513  14.721  1.00 22.68  ? 32   LYS A CG    1 
ATOM   287  C  CD    . LYS A 1 35  ? 58.662 19.283  16.019  1.00 36.22  ? 32   LYS A CD    1 
ATOM   288  C  CE    . LYS A 1 35  ? 59.733 20.367  16.150  1.00 43.84  ? 32   LYS A CE    1 
ATOM   289  N  NZ    . LYS A 1 35  ? 60.072 20.972  14.825  1.00 39.18  ? 32   LYS A NZ    1 
ATOM   290  N  N     . PRO A 1 36  ? 57.132 14.580  16.158  1.00 16.34  ? 33   PRO A N     1 
ATOM   291  C  CA    . PRO A 1 36  ? 55.954 13.718  16.249  1.00 14.03  ? 33   PRO A CA    1 
ATOM   292  C  C     . PRO A 1 36  ? 54.812 14.386  15.471  1.00 19.47  ? 33   PRO A C     1 
ATOM   293  O  O     . PRO A 1 36  ? 54.325 15.463  15.839  1.00 13.60  ? 33   PRO A O     1 
ATOM   294  C  CB    . PRO A 1 36  ? 55.672 13.652  17.751  1.00 15.67  ? 33   PRO A CB    1 
ATOM   295  C  CG    . PRO A 1 36  ? 56.304 14.901  18.321  1.00 21.48  ? 33   PRO A CG    1 
ATOM   296  C  CD    . PRO A 1 36  ? 57.484 15.203  17.446  1.00 19.22  ? 33   PRO A CD    1 
ATOM   297  N  N     A CYS A 1 37  ? 54.412 13.767  14.373  0.61 14.67  ? 34   CYS A N     1 
ATOM   298  N  N     B CYS A 1 37  ? 54.393 13.732  14.393  0.39 14.67  ? 34   CYS A N     1 
ATOM   299  C  CA    A CYS A 1 37  ? 53.310 14.314  13.615  0.61 14.03  ? 34   CYS A CA    1 
ATOM   300  C  CA    B CYS A 1 37  ? 53.460 14.306  13.432  0.39 14.39  ? 34   CYS A CA    1 
ATOM   301  C  C     . CYS A 1 37  ? 52.521 13.209  12.958  1.00 10.76  ? 34   CYS A C     1 
ATOM   302  O  O     . CYS A 1 37  ? 52.937 12.060  12.906  1.00 16.27  ? 34   CYS A O     1 
ATOM   303  C  CB    A CYS A 1 37  ? 53.802 15.317  12.576  0.61 18.63  ? 34   CYS A CB    1 
ATOM   304  C  CB    B CYS A 1 37  ? 54.241 14.919  12.251  0.39 16.07  ? 34   CYS A CB    1 
ATOM   305  S  SG    A CYS A 1 37  ? 54.919 14.600  11.396  0.61 15.11  ? 34   CYS A SG    1 
ATOM   306  S  SG    B CYS A 1 37  ? 53.290 15.699  10.909  0.39 11.72  ? 34   CYS A SG    1 
ATOM   307  N  N     . ALA A 1 38  ? 51.309 13.565  12.562  1.00 7.78   ? 35   ALA A N     1 
ATOM   308  C  CA    . ALA A 1 38  ? 50.384 12.607  11.985  1.00 10.43  ? 35   ALA A CA    1 
ATOM   309  C  C     . ALA A 1 38  ? 49.562 13.292  10.920  1.00 12.86  ? 35   ALA A C     1 
ATOM   310  O  O     . ALA A 1 38  ? 49.429 14.526  10.920  1.00 12.19  ? 35   ALA A O     1 
ATOM   311  C  CB    . ALA A 1 38  ? 49.472 11.988  13.064  1.00 12.91  ? 35   ALA A CB    1 
ATOM   312  N  N     . VAL A 1 39  ? 49.018 12.494  10.003  1.00 12.48  ? 36   VAL A N     1 
ATOM   313  C  CA    . VAL A 1 39  ? 48.099 13.005  9.001   1.00 9.16   ? 36   VAL A CA    1 
ATOM   314  C  C     . VAL A 1 39  ? 46.692 12.558  9.359   1.00 15.18  ? 36   VAL A C     1 
ATOM   315  O  O     . VAL A 1 39  ? 46.462 11.394  9.705   1.00 14.57  ? 36   VAL A O     1 
ATOM   316  C  CB    . VAL A 1 39  ? 48.470 12.523  7.581   1.00 11.03  ? 36   VAL A CB    1 
ATOM   317  C  CG1   . VAL A 1 39  ? 47.371 12.878  6.580   1.00 11.53  ? 36   VAL A CG1   1 
ATOM   318  C  CG2   . VAL A 1 39  ? 49.824 13.120  7.170   1.00 11.13  ? 36   VAL A CG2   1 
ATOM   319  N  N     . VAL A 1 40  ? 45.762 13.503  9.286   1.00 14.70  ? 37   VAL A N     1 
ATOM   320  C  CA    . VAL A 1 40  ? 44.410 13.329  9.790   1.00 13.48  ? 37   VAL A CA    1 
ATOM   321  C  C     . VAL A 1 40  ? 43.411 13.686  8.694   1.00 17.31  ? 37   VAL A C     1 
ATOM   322  O  O     . VAL A 1 40  ? 43.673 14.592  7.883   1.00 17.56  ? 37   VAL A O     1 
ATOM   323  C  CB    . VAL A 1 40  ? 44.161 14.225  11.065  1.00 19.63  ? 37   VAL A CB    1 
ATOM   324  C  CG1   A VAL A 1 40  ? 45.006 13.751  12.231  0.38 16.79  ? 37   VAL A CG1   1 
ATOM   325  C  CG1   B VAL A 1 40  ? 44.166 15.700  10.700  0.62 16.61  ? 37   VAL A CG1   1 
ATOM   326  C  CG2   A VAL A 1 40  ? 44.419 15.693  10.759  0.38 16.92  ? 37   VAL A CG2   1 
ATOM   327  C  CG2   B VAL A 1 40  ? 42.877 13.876  11.745  0.62 14.76  ? 37   VAL A CG2   1 
ATOM   328  N  N     . GLN A 1 41  ? 42.275 12.993  8.638   1.00 17.03  ? 38   GLN A N     1 
ATOM   329  C  CA    . GLN A 1 41  ? 41.228 13.463  7.730   1.00 17.54  ? 38   GLN A CA    1 
ATOM   330  C  C     . GLN A 1 41  ? 39.977 13.823  8.514   1.00 16.99  ? 38   GLN A C     1 
ATOM   331  O  O     . GLN A 1 41  ? 39.584 13.121  9.451   1.00 16.05  ? 38   GLN A O     1 
ATOM   332  C  CB    . GLN A 1 41  ? 40.919 12.452  6.607   1.00 21.99  ? 38   GLN A CB    1 
ATOM   333  C  CG    . GLN A 1 41  ? 40.758 11.024  6.992   1.00 30.19  ? 38   GLN A CG    1 
ATOM   334  C  CD    . GLN A 1 41  ? 40.626 10.090  5.778   1.00 23.39  ? 38   GLN A CD    1 
ATOM   335  O  OE1   . GLN A 1 41  ? 40.928 10.451  4.627   1.00 23.55  ? 38   GLN A OE1   1 
ATOM   336  N  NE2   . GLN A 1 41  ? 40.176 8.881   6.043   1.00 21.96  ? 38   GLN A NE2   1 
ATOM   337  N  N     . TYR A 1 42  ? 39.389 14.949  8.114   1.00 18.24  ? 39   TYR A N     1 
ATOM   338  C  CA    . TYR A 1 42  ? 38.283 15.601  8.798   1.00 17.21  ? 39   TYR A CA    1 
ATOM   339  C  C     . TYR A 1 42  ? 38.787 16.077  10.173  1.00 24.79  ? 39   TYR A C     1 
ATOM   340  O  O     . TYR A 1 42  ? 39.979 15.952  10.473  1.00 29.13  ? 39   TYR A O     1 
ATOM   341  C  CB    . TYR A 1 42  ? 37.071 14.677  8.879   1.00 14.33  ? 39   TYR A CB    1 
ATOM   342  C  CG    . TYR A 1 42  ? 36.669 14.136  7.509   1.00 18.70  ? 39   TYR A CG    1 
ATOM   343  C  CD1   . TYR A 1 42  ? 36.355 15.005  6.468   1.00 15.90  ? 39   TYR A CD1   1 
ATOM   344  C  CD2   . TYR A 1 42  ? 36.628 12.763  7.251   1.00 20.30  ? 39   TYR A CD2   1 
ATOM   345  C  CE1   . TYR A 1 42  ? 35.986 14.528  5.210   1.00 19.52  ? 39   TYR A CE1   1 
ATOM   346  C  CE2   . TYR A 1 42  ? 36.254 12.270  5.980   1.00 16.98  ? 39   TYR A CE2   1 
ATOM   347  C  CZ    . TYR A 1 42  ? 35.937 13.169  4.973   1.00 16.26  ? 39   TYR A CZ    1 
ATOM   348  O  OH    . TYR A 1 42  ? 35.567 12.719  3.725   1.00 16.88  ? 39   TYR A OH    1 
ATOM   349  N  N     . LYS A 1 43  ? 37.915 16.660  10.983  1.00 25.41  ? 40   LYS A N     1 
ATOM   350  C  CA    . LYS A 1 43  ? 38.360 17.293  12.229  1.00 24.62  ? 40   LYS A CA    1 
ATOM   351  C  C     . LYS A 1 43  ? 37.251 17.363  13.266  1.00 31.32  ? 40   LYS A C     1 
ATOM   352  O  O     . LYS A 1 43  ? 37.494 17.213  14.462  1.00 30.74  ? 40   LYS A O     1 
ATOM   353  C  CB    . LYS A 1 43  ? 38.892 18.702  11.950  1.00 29.41  ? 40   LYS A CB    1 
ATOM   354  C  CG    . LYS A 1 43  ? 40.417 18.845  12.040  1.00 51.92  ? 40   LYS A CG    1 
ATOM   355  C  CD    . LYS A 1 43  ? 40.880 19.186  13.459  1.00 43.83  ? 40   LYS A CD    1 
ATOM   356  C  CE    . LYS A 1 43  ? 42.379 18.929  13.649  1.00 41.16  ? 40   LYS A CE    1 
ATOM   357  N  NZ    . LYS A 1 43  ? 43.218 19.573  12.584  1.00 32.96  ? 40   LYS A NZ    1 
ATOM   358  N  N     . SER A 1 44  ? 36.031 17.591  12.798  1.00 27.59  ? 41   SER A N     1 
ATOM   359  C  CA    . SER A 1 44  ? 34.893 17.792  13.680  1.00 31.78  ? 41   SER A CA    1 
ATOM   360  C  C     . SER A 1 44  ? 34.664 16.620  14.623  1.00 33.98  ? 41   SER A C     1 
ATOM   361  O  O     . SER A 1 44  ? 34.450 16.812  15.820  1.00 32.42  ? 41   SER A O     1 
ATOM   362  C  CB    . SER A 1 44  ? 33.632 18.044  12.853  1.00 32.80  ? 41   SER A CB    1 
ATOM   363  O  OG    . SER A 1 44  ? 33.844 19.133  11.974  1.00 43.01  ? 41   SER A OG    1 
ATOM   364  N  N     . TRP A 1 45  ? 34.705 15.403  14.092  1.00 26.87  ? 42   TRP A N     1 
ATOM   365  C  CA    . TRP A 1 45  ? 34.474 14.237  14.938  1.00 26.26  ? 42   TRP A CA    1 
ATOM   366  C  C     . TRP A 1 45  ? 35.777 13.835  15.617  1.00 26.55  ? 42   TRP A C     1 
ATOM   367  O  O     . TRP A 1 45  ? 36.678 13.296  14.978  1.00 24.46  ? 42   TRP A O     1 
ATOM   368  C  CB    . TRP A 1 45  ? 33.901 13.068  14.134  1.00 29.32  ? 42   TRP A CB    1 
ATOM   369  C  CG    . TRP A 1 45  ? 33.449 11.914  14.987  1.00 31.10  ? 42   TRP A CG    1 
ATOM   370  C  CD1   . TRP A 1 45  ? 34.159 10.784  15.280  1.00 34.53  ? 42   TRP A CD1   1 
ATOM   371  C  CD2   . TRP A 1 45  ? 32.188 11.780  15.656  1.00 39.33  ? 42   TRP A CD2   1 
ATOM   372  N  NE1   . TRP A 1 45  ? 33.418 9.953   16.088  1.00 38.33  ? 42   TRP A NE1   1 
ATOM   373  C  CE2   . TRP A 1 45  ? 32.205 10.541  16.333  1.00 41.23  ? 42   TRP A CE2   1 
ATOM   374  C  CE3   . TRP A 1 45  ? 31.048 12.584  15.747  1.00 46.16  ? 42   TRP A CE3   1 
ATOM   375  C  CZ2   . TRP A 1 45  ? 31.124 10.090  17.093  1.00 43.95  ? 42   TRP A CZ2   1 
ATOM   376  C  CZ3   . TRP A 1 45  ? 29.972 12.133  16.502  1.00 45.45  ? 42   TRP A CZ3   1 
ATOM   377  C  CH2   . TRP A 1 45  ? 30.018 10.896  17.162  1.00 39.89  ? 42   TRP A CH2   1 
ATOM   378  N  N     . LYS A 1 46  ? 35.862 14.141  16.909  1.00 28.02  ? 43   LYS A N     1 
ATOM   379  C  CA    . LYS A 1 46  ? 36.969 13.754  17.781  1.00 22.61  ? 43   LYS A CA    1 
ATOM   380  C  C     . LYS A 1 46  ? 38.347 14.145  17.256  1.00 23.17  ? 43   LYS A C     1 
ATOM   381  O  O     . LYS A 1 46  ? 39.330 13.432  17.475  1.00 22.19  ? 43   LYS A O     1 
ATOM   382  C  CB    . LYS A 1 46  ? 36.931 12.249  18.031  1.00 24.38  ? 43   LYS A CB    1 
ATOM   383  C  CG    . LYS A 1 46  ? 35.623 11.739  18.626  1.00 33.59  ? 43   LYS A CG    1 
ATOM   384  C  CD    . LYS A 1 46  ? 35.676 10.234  18.807  1.00 33.52  ? 43   LYS A CD    1 
ATOM   385  C  CE    . LYS A 1 46  ? 34.478 9.714   19.581  1.00 42.56  ? 43   LYS A CE    1 
ATOM   386  N  NZ    . LYS A 1 46  ? 34.616 8.256   19.848  1.00 55.80  ? 43   LYS A NZ    1 
ATOM   387  N  N     . GLY A 1 47  ? 38.407 15.271  16.556  1.00 19.80  ? 44   GLY A N     1 
ATOM   388  C  CA    . GLY A 1 47  ? 39.661 15.840  16.109  1.00 19.10  ? 44   GLY A CA    1 
ATOM   389  C  C     . GLY A 1 47  ? 40.118 15.313  14.767  1.00 14.81  ? 44   GLY A C     1 
ATOM   390  O  O     . GLY A 1 47  ? 41.141 15.755  14.255  1.00 17.37  ? 44   GLY A O     1 
ATOM   391  N  N     . GLY A 1 48  ? 39.360 14.363  14.214  1.00 19.39  ? 45   GLY A N     1 
ATOM   392  C  CA    . GLY A 1 48  ? 39.683 13.747  12.941  1.00 20.25  ? 45   GLY A CA    1 
ATOM   393  C  C     . GLY A 1 48  ? 40.308 12.374  13.095  1.00 18.38  ? 45   GLY A C     1 
ATOM   394  O  O     . GLY A 1 48  ? 40.857 12.058  14.144  1.00 16.81  ? 45   GLY A O     1 
ATOM   395  N  N     . GLY A 1 49  ? 40.248 11.565  12.038  1.00 14.85  ? 46   GLY A N     1 
ATOM   396  C  CA    . GLY A 1 49  ? 40.811 10.224  12.065  1.00 11.19  ? 46   GLY A CA    1 
ATOM   397  C  C     . GLY A 1 49  ? 42.240 10.223  11.553  1.00 20.61  ? 46   GLY A C     1 
ATOM   398  O  O     . GLY A 1 49  ? 42.510 10.756  10.482  1.00 15.45  ? 46   GLY A O     1 
ATOM   399  N  N     . ILE A 1 50  ? 43.155 9.635   12.313  1.00 12.83  ? 47   ILE A N     1 
ATOM   400  C  CA    . ILE A 1 50  ? 44.558 9.572   11.898  1.00 15.67  ? 47   ILE A CA    1 
ATOM   401  C  C     . ILE A 1 50  ? 44.780 8.481   10.846  1.00 14.03  ? 47   ILE A C     1 
ATOM   402  O  O     . ILE A 1 50  ? 44.327 7.349   11.012  1.00 14.49  ? 47   ILE A O     1 
ATOM   403  C  CB    . ILE A 1 50  ? 45.480 9.318   13.106  1.00 14.41  ? 47   ILE A CB    1 
ATOM   404  C  CG1   . ILE A 1 50  ? 45.488 10.547  14.019  1.00 24.03  ? 47   ILE A CG1   1 
ATOM   405  C  CG2   . ILE A 1 50  ? 46.917 8.961   12.651  1.00 16.27  ? 47   ILE A CG2   1 
ATOM   406  C  CD1   . ILE A 1 50  ? 46.515 10.456  15.110  1.00 32.51  ? 47   ILE A CD1   1 
ATOM   407  N  N     . ILE A 1 51  ? 45.463 8.810   9.753   1.00 10.34  ? 48   ILE A N     1 
ATOM   408  C  CA    . ILE A 1 51  ? 45.731 7.777   8.764   1.00 14.75  ? 48   ILE A CA    1 
ATOM   409  C  C     . ILE A 1 51  ? 47.219 7.532   8.512   1.00 15.87  ? 48   ILE A C     1 
ATOM   410  O  O     . ILE A 1 51  ? 47.570 6.526   7.895   1.00 13.42  ? 48   ILE A O     1 
ATOM   411  C  CB    . ILE A 1 51  ? 45.023 8.070   7.430   1.00 18.45  ? 48   ILE A CB    1 
ATOM   412  C  CG1   . ILE A 1 51  ? 45.418 9.430   6.854   1.00 13.41  ? 48   ILE A CG1   1 
ATOM   413  C  CG2   . ILE A 1 51  ? 43.493 7.986   7.610   1.00 22.56  ? 48   ILE A CG2   1 
ATOM   414  C  CD1   . ILE A 1 51  ? 44.857 9.625   5.436   1.00 13.87  ? 48   ILE A CD1   1 
ATOM   415  N  N     . ALA A 1 52  ? 48.084 8.413   9.015   1.00 13.70  ? 49   ALA A N     1 
ATOM   416  C  CA    . ALA A 1 52  ? 49.538 8.169   8.947   1.00 12.37  ? 49   ALA A CA    1 
ATOM   417  C  C     . ALA A 1 52  ? 50.263 8.828   10.117  1.00 10.87  ? 49   ALA A C     1 
ATOM   418  O  O     . ALA A 1 52  ? 49.827 9.855   10.623  1.00 12.84  ? 49   ALA A O     1 
ATOM   419  C  CB    . ALA A 1 52  ? 50.107 8.660   7.615   1.00 9.66   ? 49   ALA A CB    1 
ATOM   420  N  N     . VAL A 1 53  ? 51.365 8.220   10.553  1.00 7.75   ? 50   VAL A N     1 
ATOM   421  C  CA    . VAL A 1 53  ? 52.014 8.590   11.814  1.00 8.49   ? 50   VAL A CA    1 
ATOM   422  C  C     . VAL A 1 53  ? 53.530 8.565   11.659  1.00 7.98   ? 50   VAL A C     1 
ATOM   423  O  O     . VAL A 1 53  ? 54.090 7.547   11.220  1.00 12.92  ? 50   VAL A O     1 
ATOM   424  C  CB    . VAL A 1 53  ? 51.619 7.604   12.968  1.00 10.68  ? 50   VAL A CB    1 
ATOM   425  C  CG1   . VAL A 1 53  ? 52.174 8.072   14.299  1.00 14.16  ? 50   VAL A CG1   1 
ATOM   426  C  CG2   . VAL A 1 53  ? 50.114 7.449   13.054  1.00 15.10  ? 50   VAL A CG2   1 
ATOM   427  N  N     . SER A 1 54  ? 54.197 9.647   12.032  1.00 9.78   ? 51   SER A N     1 
ATOM   428  C  CA    . SER A 1 54  ? 55.657 9.700   11.960  1.00 12.04  ? 51   SER A CA    1 
ATOM   429  C  C     . SER A 1 54  ? 56.260 8.798   13.025  1.00 14.48  ? 51   SER A C     1 
ATOM   430  O  O     . SER A 1 54  ? 55.622 8.511   14.039  1.00 12.64  ? 51   SER A O     1 
ATOM   431  C  CB    . SER A 1 54  ? 56.176 11.127  12.137  1.00 12.17  ? 51   SER A CB    1 
ATOM   432  O  OG    . SER A 1 54  ? 56.271 11.478  13.507  1.00 16.63  ? 51   SER A OG    1 
ATOM   433  N  N     . TYR A 1 55  ? 57.495 8.363   12.803  1.00 12.11  ? 52   TYR A N     1 
ATOM   434  C  CA    . TYR A 1 55  ? 58.128 7.440   13.727  1.00 15.58  ? 52   TYR A CA    1 
ATOM   435  C  C     . TYR A 1 55  ? 58.361 8.086   15.091  1.00 19.51  ? 52   TYR A C     1 
ATOM   436  O  O     . TYR A 1 55  ? 58.259 7.414   16.106  1.00 16.02  ? 52   TYR A O     1 
ATOM   437  C  CB    . TYR A 1 55  ? 59.421 6.901   13.121  1.00 15.31  ? 52   TYR A CB    1 
ATOM   438  C  CG    . TYR A 1 55  ? 59.076 5.818   12.140  1.00 15.41  ? 52   TYR A CG    1 
ATOM   439  C  CD1   . TYR A 1 55  ? 58.673 6.128   10.848  1.00 13.42  ? 52   TYR A CD1   1 
ATOM   440  C  CD2   . TYR A 1 55  ? 59.063 4.491   12.533  1.00 17.79  ? 52   TYR A CD2   1 
ATOM   441  C  CE1   . TYR A 1 55  ? 58.304 5.136   9.956   1.00 16.13  ? 52   TYR A CE1   1 
ATOM   442  C  CE2   . TYR A 1 55  ? 58.697 3.490   11.653  1.00 17.27  ? 52   TYR A CE2   1 
ATOM   443  C  CZ    . TYR A 1 55  ? 58.321 3.814   10.372  1.00 17.83  ? 52   TYR A CZ    1 
ATOM   444  O  OH    . TYR A 1 55  ? 57.963 2.804   9.507   1.00 17.98  ? 52   TYR A OH    1 
ATOM   445  N  N     . GLU A 1 56  ? 58.617 9.391   15.114  1.00 16.30  ? 53   GLU A N     1 
ATOM   446  C  CA    . GLU A 1 56  ? 58.701 10.113  16.383  1.00 17.34  ? 53   GLU A CA    1 
ATOM   447  C  C     . GLU A 1 56  ? 57.399 10.011  17.174  1.00 16.91  ? 53   GLU A C     1 
ATOM   448  O  O     . GLU A 1 56  ? 57.417 9.859   18.386  1.00 16.89  ? 53   GLU A O     1 
ATOM   449  C  CB    . GLU A 1 56  ? 59.047 11.585  16.155  1.00 16.24  ? 53   GLU A CB    1 
ATOM   450  C  CG    . GLU A 1 56  ? 60.448 11.815  15.578  1.00 22.36  ? 53   GLU A CG    1 
ATOM   451  C  CD    . GLU A 1 56  ? 60.520 11.680  14.053  1.00 32.06  ? 53   GLU A CD    1 
ATOM   452  O  OE1   . GLU A 1 56  ? 59.554 11.195  13.420  1.00 25.21  ? 53   GLU A OE1   1 
ATOM   453  O  OE2   . GLU A 1 56  ? 61.565 12.056  13.487  1.00 29.27  ? 53   GLU A OE2   1 
ATOM   454  N  N     . ALA A 1 57  ? 56.264 10.099  16.492  1.00 14.78  ? 54   ALA A N     1 
ATOM   455  C  CA    . ALA A 1 57  ? 54.975 10.020  17.183  1.00 12.71  ? 54   ALA A CA    1 
ATOM   456  C  C     . ALA A 1 57  ? 54.625 8.581   17.597  1.00 12.40  ? 54   ALA A C     1 
ATOM   457  O  O     . ALA A 1 57  ? 53.982 8.371   18.625  1.00 10.61  ? 54   ALA A O     1 
ATOM   458  C  CB    . ALA A 1 57  ? 53.863 10.612  16.314  1.00 15.46  ? 54   ALA A CB    1 
ATOM   459  N  N     . ARG A 1 58  ? 55.041 7.592   16.799  1.00 12.18  ? 55   ARG A N     1 
ATOM   460  C  CA    . ARG A 1 58  ? 54.801 6.189   17.152  1.00 15.06  ? 55   ARG A CA    1 
ATOM   461  C  C     . ARG A 1 58  ? 55.441 5.836   18.486  1.00 14.89  ? 55   ARG A C     1 
ATOM   462  O  O     . ARG A 1 58  ? 54.932 4.999   19.228  1.00 17.47  ? 55   ARG A O     1 
ATOM   463  C  CB    . ARG A 1 58  ? 55.337 5.244   16.078  1.00 14.37  ? 55   ARG A CB    1 
ATOM   464  C  CG    . ARG A 1 58  ? 54.751 5.496   14.740  1.00 12.16  ? 55   ARG A CG    1 
ATOM   465  C  CD    . ARG A 1 58  ? 55.255 4.525   13.718  1.00 17.12  ? 55   ARG A CD    1 
ATOM   466  N  NE    . ARG A 1 58  ? 54.782 4.936   12.406  1.00 12.40  ? 55   ARG A NE    1 
ATOM   467  C  CZ    . ARG A 1 58  ? 54.828 4.191   11.313  1.00 16.23  ? 55   ARG A CZ    1 
ATOM   468  N  NH1   . ARG A 1 58  ? 55.330 2.969   11.370  1.00 13.80  ? 55   ARG A NH1   1 
ATOM   469  N  NH2   . ARG A 1 58  ? 54.356 4.681   10.164  1.00 17.94  ? 55   ARG A NH2   1 
ATOM   470  N  N     . ALA A 1 59  ? 56.556 6.488   18.781  1.00 14.66  ? 56   ALA A N     1 
ATOM   471  C  CA    . ALA A 1 59  ? 57.236 6.302   20.055  1.00 21.30  ? 56   ALA A CA    1 
ATOM   472  C  C     . ALA A 1 59  ? 56.317 6.642   21.240  1.00 21.67  ? 56   ALA A C     1 
ATOM   473  O  O     . ALA A 1 59  ? 56.492 6.101   22.331  1.00 23.03  ? 56   ALA A O     1 
ATOM   474  C  CB    . ALA A 1 59  ? 58.506 7.142   20.106  1.00 18.64  ? 56   ALA A CB    1 
ATOM   475  N  N     . PHE A 1 60  ? 55.333 7.521   21.032  1.00 14.35  ? 57   PHE A N     1 
ATOM   476  C  CA    . PHE A 1 60  ? 54.390 7.867   22.106  1.00 17.13  ? 57   PHE A CA    1 
ATOM   477  C  C     . PHE A 1 60  ? 53.185 6.925   22.151  1.00 17.77  ? 57   PHE A C     1 
ATOM   478  O  O     . PHE A 1 60  ? 52.351 7.030   23.050  1.00 19.48  ? 57   PHE A O     1 
ATOM   479  C  CB    . PHE A 1 60  ? 53.883 9.309   21.960  1.00 15.85  ? 57   PHE A CB    1 
ATOM   480  C  CG    . PHE A 1 60  ? 54.910 10.364  22.272  1.00 16.27  ? 57   PHE A CG    1 
ATOM   481  C  CD1   . PHE A 1 60  ? 54.909 11.014  23.501  1.00 27.63  ? 57   PHE A CD1   1 
ATOM   482  C  CD2   . PHE A 1 60  ? 55.857 10.727  21.330  1.00 13.75  ? 57   PHE A CD2   1 
ATOM   483  C  CE1   . PHE A 1 60  ? 55.840 12.000  23.794  1.00 24.79  ? 57   PHE A CE1   1 
ATOM   484  C  CE2   . PHE A 1 60  ? 56.794 11.711  21.606  1.00 19.61  ? 57   PHE A CE2   1 
ATOM   485  C  CZ    . PHE A 1 60  ? 56.786 12.352  22.844  1.00 26.80  ? 57   PHE A CZ    1 
ATOM   486  N  N     . GLY A 1 61  ? 53.082 6.031   21.169  1.00 16.19  ? 58   GLY A N     1 
ATOM   487  C  CA    . GLY A 1 61  ? 51.978 5.084   21.080  1.00 14.40  ? 58   GLY A CA    1 
ATOM   488  C  C     . GLY A 1 61  ? 50.873 5.527   20.133  1.00 19.57  ? 58   GLY A C     1 
ATOM   489  O  O     . GLY A 1 61  ? 49.791 4.941   20.095  1.00 13.68  ? 58   GLY A O     1 
ATOM   490  N  N     . VAL A 1 62  ? 51.133 6.584   19.369  1.00 15.46  ? 59   VAL A N     1 
ATOM   491  C  CA    . VAL A 1 62  ? 50.157 7.072   18.403  1.00 15.34  ? 59   VAL A CA    1 
ATOM   492  C  C     . VAL A 1 62  ? 50.063 6.066   17.263  1.00 15.84  ? 59   VAL A C     1 
ATOM   493  O  O     . VAL A 1 62  ? 51.080 5.598   16.771  1.00 14.64  ? 59   VAL A O     1 
ATOM   494  C  CB    . VAL A 1 62  ? 50.542 8.477   17.855  1.00 14.88  ? 59   VAL A CB    1 
ATOM   495  C  CG1   . VAL A 1 62  ? 49.547 8.930   16.773  1.00 18.53  ? 59   VAL A CG1   1 
ATOM   496  C  CG2   . VAL A 1 62  ? 50.561 9.497   18.995  1.00 15.02  ? 59   VAL A CG2   1 
ATOM   497  N  N     . THR A 1 63  ? 48.847 5.723   16.845  1.00 17.35  ? 60   THR A N     1 
ATOM   498  C  CA    . THR A 1 63  ? 48.701 4.832   15.707  1.00 21.90  ? 60   THR A CA    1 
ATOM   499  C  C     . THR A 1 63  ? 47.679 5.299   14.694  1.00 22.22  ? 60   THR A C     1 
ATOM   500  O  O     . THR A 1 63  ? 46.866 6.185   14.949  1.00 22.49  ? 60   THR A O     1 
ATOM   501  C  CB    . THR A 1 63  ? 48.285 3.402   16.145  1.00 20.18  ? 60   THR A CB    1 
ATOM   502  O  OG1   . THR A 1 63  ? 46.996 3.447   16.774  1.00 22.02  ? 60   THR A OG1   1 
ATOM   503  C  CG2   . THR A 1 63  ? 49.315 2.809   17.096  1.00 19.04  ? 60   THR A CG2   1 
ATOM   504  N  N     . ARG A 1 64  ? 47.750 4.694   13.520  1.00 18.87  ? 61   ARG A N     1 
ATOM   505  C  CA    A ARG A 1 64  ? 46.690 4.787   12.532  0.80 22.25  ? 61   ARG A CA    1 
ATOM   506  C  CA    B ARG A 1 64  ? 46.683 4.810   12.537  0.20 22.36  ? 61   ARG A CA    1 
ATOM   507  C  C     . ARG A 1 64  ? 45.374 4.286   13.143  1.00 26.53  ? 61   ARG A C     1 
ATOM   508  O  O     . ARG A 1 64  ? 45.396 3.433   14.032  1.00 23.32  ? 61   ARG A O     1 
ATOM   509  C  CB    A ARG A 1 64  ? 47.092 3.979   11.299  0.80 25.90  ? 61   ARG A CB    1 
ATOM   510  C  CB    B ARG A 1 64  ? 47.062 4.051   11.260  0.20 25.86  ? 61   ARG A CB    1 
ATOM   511  C  CG    A ARG A 1 64  ? 46.003 3.678   10.322  0.80 30.68  ? 61   ARG A CG    1 
ATOM   512  C  CG    B ARG A 1 64  ? 45.903 3.583   10.403  0.20 30.09  ? 61   ARG A CG    1 
ATOM   513  C  CD    A ARG A 1 64  ? 46.578 2.966   9.111   0.80 26.27  ? 61   ARG A CD    1 
ATOM   514  C  CD    B ARG A 1 64  ? 46.398 2.890   9.142   0.20 26.25  ? 61   ARG A CD    1 
ATOM   515  N  NE    A ARG A 1 64  ? 47.578 3.803   8.465   0.80 28.24  ? 61   ARG A NE    1 
ATOM   516  N  NE    B ARG A 1 64  ? 47.596 2.087   9.380   0.20 25.53  ? 61   ARG A NE    1 
ATOM   517  C  CZ    A ARG A 1 64  ? 48.755 3.379   8.007   0.80 28.46  ? 61   ARG A CZ    1 
ATOM   518  C  CZ    B ARG A 1 64  ? 47.598 0.889   9.956   0.20 25.30  ? 61   ARG A CZ    1 
ATOM   519  N  NH1   A ARG A 1 64  ? 49.111 2.096   8.105   0.80 23.80  ? 61   ARG A NH1   1 
ATOM   520  N  NH1   B ARG A 1 64  ? 46.462 0.347   10.374  0.20 26.63  ? 61   ARG A NH1   1 
ATOM   521  N  NH2   A ARG A 1 64  ? 49.577 4.253   7.438   0.80 20.24  ? 61   ARG A NH2   1 
ATOM   522  N  NH2   B ARG A 1 64  ? 48.738 0.235   10.124  0.20 27.68  ? 61   ARG A NH2   1 
ATOM   523  N  N     . SER A 1 65  ? 44.246 4.836   12.680  1.00 23.68  ? 62   SER A N     1 
ATOM   524  C  CA    . SER A 1 65  ? 42.872 4.504   13.116  1.00 29.23  ? 62   SER A CA    1 
ATOM   525  C  C     . SER A 1 65  ? 42.470 5.221   14.398  1.00 33.19  ? 62   SER A C     1 
ATOM   526  O  O     . SER A 1 65  ? 41.311 5.215   14.791  1.00 37.03  ? 62   SER A O     1 
ATOM   527  C  CB    . SER A 1 65  ? 42.678 3.007   13.324  1.00 37.32  ? 62   SER A CB    1 
ATOM   528  O  OG    . SER A 1 65  ? 42.938 2.676   14.675  1.00 46.45  ? 62   SER A OG    1 
ATOM   529  N  N     . MET A 1 66  ? 43.445 5.824   15.054  1.00 28.19  ? 63   MET A N     1 
ATOM   530  C  CA    . MET A 1 66  ? 43.215 6.563   16.284  1.00 25.35  ? 63   MET A CA    1 
ATOM   531  C  C     . MET A 1 66  ? 42.530 7.892   15.968  1.00 22.70  ? 63   MET A C     1 
ATOM   532  O  O     . MET A 1 66  ? 42.830 8.507   14.951  1.00 20.39  ? 63   MET A O     1 
ATOM   533  C  CB    . MET A 1 66  ? 44.558 6.780   16.967  1.00 23.91  ? 63   MET A CB    1 
ATOM   534  C  CG    . MET A 1 66  ? 44.569 7.250   18.382  1.00 25.88  ? 63   MET A CG    1 
ATOM   535  S  SD    . MET A 1 66  ? 46.239 6.945   19.022  1.00 22.99  ? 63   MET A SD    1 
ATOM   536  C  CE    . MET A 1 66  ? 46.129 5.261   19.567  1.00 21.65  ? 63   MET A CE    1 
ATOM   537  N  N     . TRP A 1 67  ? 41.605 8.333   16.819  1.00 18.49  ? 64   TRP A N     1 
ATOM   538  C  CA    . TRP A 1 67  ? 41.090 9.706   16.715  1.00 16.96  ? 64   TRP A CA    1 
ATOM   539  C  C     . TRP A 1 67  ? 42.183 10.665  17.178  1.00 14.76  ? 64   TRP A C     1 
ATOM   540  O  O     . TRP A 1 67  ? 42.901 10.355  18.120  1.00 18.58  ? 64   TRP A O     1 
ATOM   541  C  CB    . TRP A 1 67  ? 39.818 9.907   17.557  1.00 18.31  ? 64   TRP A CB    1 
ATOM   542  C  CG    . TRP A 1 67  ? 38.686 9.055   17.124  1.00 23.01  ? 64   TRP A CG    1 
ATOM   543  C  CD1   . TRP A 1 67  ? 38.113 8.033   17.822  1.00 25.25  ? 64   TRP A CD1   1 
ATOM   544  C  CD2   . TRP A 1 67  ? 38.008 9.116   15.865  1.00 26.20  ? 64   TRP A CD2   1 
ATOM   545  N  NE1   . TRP A 1 67  ? 37.108 7.463   17.078  1.00 34.73  ? 64   TRP A NE1   1 
ATOM   546  C  CE2   . TRP A 1 67  ? 37.026 8.110   15.873  1.00 35.94  ? 64   TRP A CE2   1 
ATOM   547  C  CE3   . TRP A 1 67  ? 38.134 9.933   14.734  1.00 21.96  ? 64   TRP A CE3   1 
ATOM   548  C  CZ2   . TRP A 1 67  ? 36.171 7.896   14.793  1.00 39.28  ? 64   TRP A CZ2   1 
ATOM   549  C  CZ3   . TRP A 1 67  ? 37.286 9.722   13.665  1.00 23.62  ? 64   TRP A CZ3   1 
ATOM   550  C  CH2   . TRP A 1 67  ? 36.320 8.707   13.700  1.00 29.37  ? 64   TRP A CH2   1 
ATOM   551  N  N     . ALA A 1 68  ? 42.311 11.821  16.528  1.00 16.03  ? 65   ALA A N     1 
ATOM   552  C  CA    . ALA A 1 68  ? 43.359 12.776  16.894  1.00 18.62  ? 65   ALA A CA    1 
ATOM   553  C  C     . ALA A 1 68  ? 43.218 13.289  18.332  1.00 16.46  ? 65   ALA A C     1 
ATOM   554  O  O     . ALA A 1 68  ? 44.222 13.576  18.980  1.00 16.64  ? 65   ALA A O     1 
ATOM   555  C  CB    . ALA A 1 68  ? 43.378 13.945  15.929  1.00 16.43  ? 65   ALA A CB    1 
ATOM   556  N  N     . ASP A 1 69  ? 41.991 13.422  18.835  1.00 21.24  ? 66   ASP A N     1 
ATOM   557  C  CA    . ASP A 1 69  ? 41.841 13.838  20.235  1.00 19.47  ? 66   ASP A CA    1 
ATOM   558  C  C     . ASP A 1 69  ? 42.467 12.815  21.183  1.00 16.00  ? 66   ASP A C     1 
ATOM   559  O  O     . ASP A 1 69  ? 43.004 13.169  22.234  1.00 14.87  ? 66   ASP A O     1 
ATOM   560  C  CB    . ASP A 1 69  ? 40.378 14.041  20.604  1.00 18.33  ? 66   ASP A CB    1 
ATOM   561  C  CG    . ASP A 1 69  ? 39.782 15.287  19.975  1.00 23.24  ? 66   ASP A CG    1 
ATOM   562  O  OD1   . ASP A 1 69  ? 40.543 16.161  19.496  1.00 25.78  ? 66   ASP A OD1   1 
ATOM   563  O  OD2   . ASP A 1 69  ? 38.546 15.394  19.980  1.00 25.65  ? 66   ASP A OD2   1 
ATOM   564  N  N     . ASP A 1 70  ? 42.387 11.544  20.813  1.00 14.17  ? 67   ASP A N     1 
ATOM   565  C  CA    . ASP A 1 70  ? 42.916 10.489  21.665  1.00 17.41  ? 67   ASP A CA    1 
ATOM   566  C  C     . ASP A 1 70  ? 44.424 10.414  21.526  1.00 16.41  ? 67   ASP A C     1 
ATOM   567  O  O     . ASP A 1 70  ? 45.151 10.206  22.501  1.00 15.25  ? 67   ASP A O     1 
ATOM   568  C  CB    . ASP A 1 70  ? 42.264 9.152   21.310  1.00 17.51  ? 67   ASP A CB    1 
ATOM   569  C  CG    . ASP A 1 70  ? 40.771 9.148   21.591  1.00 29.58  ? 67   ASP A CG    1 
ATOM   570  O  OD1   . ASP A 1 70  ? 40.333 9.902   22.494  1.00 22.53  ? 67   ASP A OD1   1 
ATOM   571  O  OD2   . ASP A 1 70  ? 40.035 8.399   20.911  1.00 24.14  ? 67   ASP A OD2   1 
ATOM   572  N  N     . ALA A 1 71  ? 44.893 10.587  20.294  1.00 14.46  ? 68   ALA A N     1 
ATOM   573  C  CA    . ALA A 1 71  ? 46.323 10.659  20.038  1.00 17.12  ? 68   ALA A CA    1 
ATOM   574  C  C     . ALA A 1 71  ? 46.981 11.792  20.833  1.00 15.32  ? 68   ALA A C     1 
ATOM   575  O  O     . ALA A 1 71  ? 48.098 11.642  21.328  1.00 15.79  ? 68   ALA A O     1 
ATOM   576  C  CB    . ALA A 1 71  ? 46.581 10.846  18.548  1.00 13.40  ? 68   ALA A CB    1 
ATOM   577  N  N     . LYS A 1 72  ? 46.287 12.924  20.927  1.00 12.47  ? 69   LYS A N     1 
ATOM   578  C  CA    . LYS A 1 72  ? 46.777 14.084  21.690  1.00 13.80  ? 69   LYS A CA    1 
ATOM   579  C  C     . LYS A 1 72  ? 46.901 13.772  23.177  1.00 15.77  ? 69   LYS A C     1 
ATOM   580  O  O     . LYS A 1 72  ? 47.697 14.382  23.892  1.00 13.41  ? 69   LYS A O     1 
ATOM   581  C  CB    . LYS A 1 72  ? 45.846 15.288  21.494  1.00 19.26  ? 69   LYS A CB    1 
ATOM   582  C  CG    . LYS A 1 72  ? 46.154 16.122  20.253  1.00 22.51  ? 69   LYS A CG    1 
ATOM   583  C  CD    . LYS A 1 72  ? 47.426 16.923  20.459  1.00 20.79  ? 69   LYS A CD    1 
ATOM   584  C  CE    . LYS A 1 72  ? 47.629 17.965  19.368  1.00 24.02  ? 69   LYS A CE    1 
ATOM   585  N  NZ    . LYS A 1 72  ? 48.857 18.783  19.652  1.00 21.37  ? 69   LYS A NZ    1 
ATOM   586  N  N     . LYS A 1 73  ? 46.102 12.822  23.648  1.00 16.09  ? 70   LYS A N     1 
ATOM   587  C  CA    . LYS A 1 73  ? 46.209 12.395  25.032  1.00 16.49  ? 70   LYS A CA    1 
ATOM   588  C  C     . LYS A 1 73  ? 47.537 11.664  25.261  1.00 17.83  ? 70   LYS A C     1 
ATOM   589  O  O     . LYS A 1 73  ? 48.131 11.773  26.327  1.00 18.65  ? 70   LYS A O     1 
ATOM   590  C  CB    . LYS A 1 73  ? 45.024 11.506  25.411  1.00 14.41  ? 70   LYS A CB    1 
ATOM   591  C  CG    . LYS A 1 73  ? 43.675 12.141  25.167  1.00 14.66  ? 70   LYS A CG    1 
ATOM   592  C  CD    . LYS A 1 73  ? 42.536 11.155  25.469  1.00 14.75  ? 70   LYS A CD    1 
ATOM   593  C  CE    . LYS A 1 73  ? 41.179 11.800  25.200  1.00 19.96  ? 70   LYS A CE    1 
ATOM   594  N  NZ    . LYS A 1 73  ? 40.078 10.798  25.169  1.00 23.53  ? 70   LYS A NZ    1 
ATOM   595  N  N     . LEU A 1 74  ? 48.012 10.938  24.251  1.00 15.52  ? 71   LEU A N     1 
ATOM   596  C  CA    . LEU A 1 74  ? 49.281 10.220  24.382  1.00 20.66  ? 71   LEU A CA    1 
ATOM   597  C  C     . LEU A 1 74  ? 50.457 11.131  24.075  1.00 22.17  ? 71   LEU A C     1 
ATOM   598  O  O     . LEU A 1 74  ? 51.556 10.963  24.619  1.00 17.90  ? 71   LEU A O     1 
ATOM   599  C  CB    . LEU A 1 74  ? 49.341 9.009   23.447  1.00 13.30  ? 71   LEU A CB    1 
ATOM   600  C  CG    . LEU A 1 74  ? 48.311 7.891   23.578  1.00 19.30  ? 71   LEU A CG    1 
ATOM   601  C  CD1   . LEU A 1 74  ? 48.570 6.859   22.476  1.00 20.26  ? 71   LEU A CD1   1 
ATOM   602  C  CD2   . LEU A 1 74  ? 48.374 7.236   24.950  1.00 14.37  ? 71   LEU A CD2   1 
ATOM   603  N  N     . CYS A 1 75  ? 50.220 12.087  23.188  1.00 16.88  ? 72   CYS A N     1 
ATOM   604  C  CA    . CYS A 1 75  ? 51.295 12.920  22.665  1.00 12.81  ? 72   CYS A CA    1 
ATOM   605  C  C     . CYS A 1 75  ? 50.809 14.358  22.512  1.00 21.93  ? 72   CYS A C     1 
ATOM   606  O  O     . CYS A 1 75  ? 50.324 14.756  21.443  1.00 19.25  ? 72   CYS A O     1 
ATOM   607  C  CB    . CYS A 1 75  ? 51.779 12.348  21.335  1.00 17.83  ? 72   CYS A CB    1 
ATOM   608  S  SG    . CYS A 1 75  ? 53.112 13.284  20.562  1.00 19.89  ? 72   CYS A SG    1 
ATOM   609  N  N     . PRO A 1 76  ? 50.900 15.140  23.601  1.00 17.06  ? 73   PRO A N     1 
ATOM   610  C  CA    . PRO A 1 76  ? 50.304 16.484  23.605  1.00 17.43  ? 73   PRO A CA    1 
ATOM   611  C  C     . PRO A 1 76  ? 50.916 17.417  22.559  1.00 12.95  ? 73   PRO A C     1 
ATOM   612  O  O     . PRO A 1 76  ? 50.236 18.325  22.067  1.00 19.68  ? 73   PRO A O     1 
ATOM   613  C  CB    . PRO A 1 76  ? 50.587 16.987  25.028  1.00 19.74  ? 73   PRO A CB    1 
ATOM   614  C  CG    . PRO A 1 76  ? 50.654 15.715  25.864  1.00 22.78  ? 73   PRO A CG    1 
ATOM   615  C  CD    . PRO A 1 76  ? 51.312 14.700  24.949  1.00 21.26  ? 73   PRO A CD    1 
ATOM   616  N  N     . ASP A 1 77  ? 52.175 17.197  22.209  1.00 17.41  ? 74   ASP A N     1 
ATOM   617  C  CA    . ASP A 1 77  ? 52.818 18.092  21.251  1.00 21.29  ? 74   ASP A CA    1 
ATOM   618  C  C     . ASP A 1 77  ? 52.719 17.577  19.814  1.00 24.20  ? 74   ASP A C     1 
ATOM   619  O  O     . ASP A 1 77  ? 53.383 18.109  18.920  1.00 15.39  ? 74   ASP A O     1 
ATOM   620  C  CB    . ASP A 1 77  ? 54.283 18.307  21.629  1.00 25.56  ? 74   ASP A CB    1 
ATOM   621  C  CG    . ASP A 1 77  ? 54.435 18.998  22.971  1.00 32.26  ? 74   ASP A CG    1 
ATOM   622  O  OD1   . ASP A 1 77  ? 55.343 18.614  23.737  1.00 34.48  ? 74   ASP A OD1   1 
ATOM   623  O  OD2   . ASP A 1 77  ? 53.634 19.913  23.264  1.00 34.71  ? 74   ASP A OD2   1 
ATOM   624  N  N     . LEU A 1 78  ? 51.893 16.550  19.606  1.00 14.14  ? 75   LEU A N     1 
ATOM   625  C  CA    . LEU A 1 78  ? 51.701 15.948  18.272  1.00 15.46  ? 75   LEU A CA    1 
ATOM   626  C  C     . LEU A 1 78  ? 51.305 17.000  17.261  1.00 15.83  ? 75   LEU A C     1 
ATOM   627  O  O     . LEU A 1 78  ? 50.357 17.740  17.483  1.00 15.00  ? 75   LEU A O     1 
ATOM   628  C  CB    . LEU A 1 78  ? 50.621 14.861  18.305  1.00 12.44  ? 75   LEU A CB    1 
ATOM   629  C  CG    . LEU A 1 78  ? 50.262 14.175  16.980  1.00 12.61  ? 75   LEU A CG    1 
ATOM   630  C  CD1   . LEU A 1 78  ? 51.401 13.253  16.567  1.00 11.84  ? 75   LEU A CD1   1 
ATOM   631  C  CD2   . LEU A 1 78  ? 48.977 13.387  17.153  1.00 14.40  ? 75   LEU A CD2   1 
ATOM   632  N  N     . LEU A 1 79  ? 52.027 17.071  16.151  1.00 14.59  ? 76   LEU A N     1 
ATOM   633  C  CA    . LEU A 1 79  ? 51.660 18.010  15.100  1.00 12.54  ? 76   LEU A CA    1 
ATOM   634  C  C     . LEU A 1 79  ? 50.756 17.297  14.094  1.00 17.52  ? 76   LEU A C     1 
ATOM   635  O  O     . LEU A 1 79  ? 50.877 16.097  13.892  1.00 14.65  ? 76   LEU A O     1 
ATOM   636  C  CB    . LEU A 1 79  ? 52.910 18.580  14.432  1.00 10.47  ? 76   LEU A CB    1 
ATOM   637  C  CG    . LEU A 1 79  ? 53.817 19.409  15.355  1.00 11.81  ? 76   LEU A CG    1 
ATOM   638  C  CD1   . LEU A 1 79  ? 55.012 19.983  14.600  1.00 14.50  ? 76   LEU A CD1   1 
ATOM   639  C  CD2   . LEU A 1 79  ? 53.042 20.529  16.044  1.00 11.77  ? 76   LEU A CD2   1 
ATOM   640  N  N     . LEU A 1 80  ? 49.831 18.032  13.482  1.00 16.16  ? 77   LEU A N     1 
ATOM   641  C  CA    . LEU A 1 80  ? 48.886 17.418  12.555  1.00 14.82  ? 77   LEU A CA    1 
ATOM   642  C  C     . LEU A 1 80  ? 48.853 18.133  11.212  1.00 16.88  ? 77   LEU A C     1 
ATOM   643  O  O     . LEU A 1 80  ? 48.895 19.363  11.140  1.00 20.81  ? 77   LEU A O     1 
ATOM   644  C  CB    . LEU A 1 80  ? 47.482 17.400  13.160  1.00 11.01  ? 77   LEU A CB    1 
ATOM   645  C  CG    . LEU A 1 80  ? 47.319 16.640  14.473  1.00 16.96  ? 77   LEU A CG    1 
ATOM   646  C  CD1   . LEU A 1 80  ? 45.897 16.773  15.006  1.00 20.64  ? 77   LEU A CD1   1 
ATOM   647  C  CD2   . LEU A 1 80  ? 47.694 15.174  14.284  1.00 18.51  ? 77   LEU A CD2   1 
ATOM   648  N  N     . ALA A 1 81  ? 48.796 17.354  10.142  1.00 14.38  ? 78   ALA A N     1 
ATOM   649  C  CA    . ALA A 1 81  ? 48.492 17.900  8.824   1.00 15.17  ? 78   ALA A CA    1 
ATOM   650  C  C     . ALA A 1 81  ? 47.175 17.293  8.359   1.00 16.63  ? 78   ALA A C     1 
ATOM   651  O  O     . ALA A 1 81  ? 46.940 16.098  8.548   1.00 13.98  ? 78   ALA A O     1 
ATOM   652  C  CB    . ALA A 1 81  ? 49.621 17.613  7.836   1.00 14.29  ? 78   ALA A CB    1 
ATOM   653  N  N     . GLN A 1 82  ? 46.313 18.116  7.768   1.00 14.59  ? 79   GLN A N     1 
ATOM   654  C  CA    . GLN A 1 82  ? 44.973 17.679  7.354   1.00 14.42  ? 79   GLN A CA    1 
ATOM   655  C  C     . GLN A 1 82  ? 44.933 17.326  5.885   1.00 13.40  ? 79   GLN A C     1 
ATOM   656  O  O     . GLN A 1 82  ? 45.481 18.059  5.064   1.00 16.72  ? 79   GLN A O     1 
ATOM   657  C  CB    . GLN A 1 82  ? 43.935 18.771  7.605   1.00 16.72  ? 79   GLN A CB    1 
ATOM   658  C  CG    . GLN A 1 82  ? 43.605 19.032  9.045   1.00 29.13  ? 79   GLN A CG    1 
ATOM   659  C  CD    . GLN A 1 82  ? 42.459 19.998  9.159   1.00 35.56  ? 79   GLN A CD    1 
ATOM   660  O  OE1   . GLN A 1 82  ? 42.644 21.151  9.536   1.00 32.61  ? 79   GLN A OE1   1 
ATOM   661  N  NE2   . GLN A 1 82  ? 41.264 19.543  8.792   1.00 29.65  ? 79   GLN A NE2   1 
ATOM   662  N  N     . VAL A 1 83  ? 44.281 16.214  5.555   1.00 16.25  ? 80   VAL A N     1 
ATOM   663  C  CA    . VAL A 1 83  ? 44.009 15.875  4.162   1.00 17.51  ? 80   VAL A CA    1 
ATOM   664  C  C     . VAL A 1 83  ? 43.120 16.955  3.563   1.00 15.74  ? 80   VAL A C     1 
ATOM   665  O  O     . VAL A 1 83  ? 42.212 17.461  4.216   1.00 12.50  ? 80   VAL A O     1 
ATOM   666  C  CB    . VAL A 1 83  ? 43.324 14.498  4.026   1.00 13.02  ? 80   VAL A CB    1 
ATOM   667  C  CG1   . VAL A 1 83  ? 42.919 14.219  2.589   1.00 12.61  ? 80   VAL A CG1   1 
ATOM   668  C  CG2   . VAL A 1 83  ? 44.248 13.389  4.551   1.00 16.19  ? 80   VAL A CG2   1 
ATOM   669  N  N     . ARG A 1 84  ? 43.404 17.319  2.324   1.00 14.48  ? 81   ARG A N     1 
ATOM   670  C  CA    . ARG A 1 84  ? 42.635 18.345  1.640   1.00 16.99  ? 81   ARG A CA    1 
ATOM   671  C  C     . ARG A 1 84  ? 41.166 17.952  1.558   1.00 18.81  ? 81   ARG A C     1 
ATOM   672  O  O     . ARG A 1 84  ? 40.825 16.773  1.450   1.00 13.20  ? 81   ARG A O     1 
ATOM   673  C  CB    . ARG A 1 84  ? 43.213 18.577  0.249   1.00 21.32  ? 81   ARG A CB    1 
ATOM   674  C  CG    . ARG A 1 84  ? 42.353 19.433  -0.674  1.00 29.94  ? 81   ARG A CG    1 
ATOM   675  C  CD    . ARG A 1 84  ? 43.107 19.684  -1.969  1.00 43.95  ? 81   ARG A CD    1 
ATOM   676  N  NE    . ARG A 1 84  ? 42.301 20.327  -2.999  1.00 60.79  ? 81   ARG A NE    1 
ATOM   677  C  CZ    . ARG A 1 84  ? 42.715 20.518  -4.249  1.00 68.40  ? 81   ARG A CZ    1 
ATOM   678  N  NH1   . ARG A 1 84  ? 43.924 20.110  -4.616  1.00 56.37  ? 81   ARG A NH1   1 
ATOM   679  N  NH2   . ARG A 1 84  ? 41.923 21.112  -5.134  1.00 68.54  ? 81   ARG A NH2   1 
ATOM   680  N  N     . GLU A 1 85  ? 40.283 18.933  1.639   1.00 14.14  ? 82   GLU A N     1 
ATOM   681  C  CA    . GLU A 1 85  ? 38.887 18.650  1.374   1.00 20.20  ? 82   GLU A CA    1 
ATOM   682  C  C     . GLU A 1 85  ? 38.431 19.453  0.167   1.00 21.72  ? 82   GLU A C     1 
ATOM   683  O  O     . GLU A 1 85  ? 38.709 20.648  0.061   1.00 16.78  ? 82   GLU A O     1 
ATOM   684  C  CB    . GLU A 1 85  ? 38.031 18.944  2.602   1.00 23.11  ? 82   GLU A CB    1 
ATOM   685  C  CG    . GLU A 1 85  ? 38.178 17.871  3.676   1.00 23.75  ? 82   GLU A CG    1 
ATOM   686  C  CD    . GLU A 1 85  ? 37.495 18.247  4.986   1.00 35.51  ? 82   GLU A CD    1 
ATOM   687  O  OE1   . GLU A 1 85  ? 36.323 18.708  4.955   1.00 32.66  ? 82   GLU A OE1   1 
ATOM   688  O  OE2   . GLU A 1 85  ? 38.145 18.085  6.045   1.00 33.81  ? 82   GLU A OE2   1 
ATOM   689  N  N     . SER A 1 86  ? 37.765 18.763  -0.754  1.00 16.70  ? 83   SER A N     1 
ATOM   690  C  CA    . SER A 1 86  ? 37.200 19.373  -1.943  1.00 16.44  ? 83   SER A CA    1 
ATOM   691  C  C     . SER A 1 86  ? 35.842 18.748  -2.195  1.00 21.56  ? 83   SER A C     1 
ATOM   692  O  O     . SER A 1 86  ? 35.657 17.541  -1.997  1.00 20.45  ? 83   SER A O     1 
ATOM   693  C  CB    . SER A 1 86  ? 38.111 19.178  -3.155  1.00 19.73  ? 83   SER A CB    1 
ATOM   694  O  OG    . SER A 1 86  ? 39.403 19.690  -2.894  1.00 39.43  ? 83   SER A OG    1 
ATOM   695  N  N     . ARG A 1 87  ? 34.891 19.580  -2.612  1.00 20.67  ? 84   ARG A N     1 
ATOM   696  C  CA    . ARG A 1 87  ? 33.531 19.131  -2.883  1.00 23.24  ? 84   ARG A CA    1 
ATOM   697  C  C     . ARG A 1 87  ? 32.953 18.361  -1.715  1.00 19.77  ? 84   ARG A C     1 
ATOM   698  O  O     . ARG A 1 87  ? 32.211 17.393  -1.900  1.00 21.87  ? 84   ARG A O     1 
ATOM   699  C  CB    . ARG A 1 87  ? 33.492 18.280  -4.156  1.00 23.51  ? 84   ARG A CB    1 
ATOM   700  C  CG    . ARG A 1 87  ? 33.992 19.025  -5.376  1.00 24.19  ? 84   ARG A CG    1 
ATOM   701  C  CD    . ARG A 1 87  ? 33.795 18.218  -6.648  1.00 28.83  ? 84   ARG A CD    1 
ATOM   702  N  NE    . ARG A 1 87  ? 35.040 18.152  -7.407  1.00 33.19  ? 84   ARG A NE    1 
ATOM   703  C  CZ    . ARG A 1 87  ? 35.349 18.967  -8.411  1.00 46.55  ? 84   ARG A CZ    1 
ATOM   704  N  NH1   . ARG A 1 87  ? 34.490 19.906  -8.800  1.00 46.67  ? 84   ARG A NH1   1 
ATOM   705  N  NH2   . ARG A 1 87  ? 36.517 18.835  -9.030  1.00 38.29  ? 84   ARG A NH2   1 
ATOM   706  N  N     . GLY A 1 88  ? 33.302 18.790  -0.508  1.00 19.33  ? 85   GLY A N     1 
ATOM   707  C  CA    . GLY A 1 88  ? 32.734 18.233  0.702   1.00 18.79  ? 85   GLY A CA    1 
ATOM   708  C  C     . GLY A 1 88  ? 33.337 16.923  1.180   1.00 25.35  ? 85   GLY A C     1 
ATOM   709  O  O     . GLY A 1 88  ? 32.791 16.290  2.089   1.00 20.91  ? 85   GLY A O     1 
ATOM   710  N  N     . LYS A 1 89  ? 34.453 16.506  0.585   1.00 13.59  ? 86   LYS A N     1 
ATOM   711  C  CA    . LYS A 1 89  ? 35.050 15.212  0.926   1.00 15.45  ? 86   LYS A CA    1 
ATOM   712  C  C     . LYS A 1 89  ? 36.574 15.232  0.949   1.00 16.11  ? 86   LYS A C     1 
ATOM   713  O  O     . LYS A 1 89  ? 37.210 16.125  0.379   1.00 16.43  ? 86   LYS A O     1 
ATOM   714  C  CB    . LYS A 1 89  ? 34.590 14.135  -0.057  1.00 18.36  ? 86   LYS A CB    1 
ATOM   715  C  CG    . LYS A 1 89  ? 35.135 14.308  -1.466  1.00 17.89  ? 86   LYS A CG    1 
ATOM   716  C  CD    . LYS A 1 89  ? 34.647 13.196  -2.399  1.00 24.79  ? 86   LYS A CD    1 
ATOM   717  C  CE    . LYS A 1 89  ? 35.255 11.850  -2.025  1.00 14.02  ? 86   LYS A CE    1 
ATOM   718  N  NZ    . LYS A 1 89  ? 36.738 11.789  -2.280  1.00 16.56  ? 86   LYS A NZ    1 
ATOM   719  N  N     . ALA A 1 90  ? 37.153 14.242  1.621   1.00 16.43  ? 87   ALA A N     1 
ATOM   720  C  CA    . ALA A 1 90  ? 38.600 14.083  1.608   1.00 18.17  ? 87   ALA A CA    1 
ATOM   721  C  C     . ALA A 1 90  ? 39.024 13.875  0.173   1.00 15.11  ? 87   ALA A C     1 
ATOM   722  O  O     . ALA A 1 90  ? 38.345 13.192  -0.600  1.00 17.15  ? 87   ALA A O     1 
ATOM   723  C  CB    . ALA A 1 90  ? 39.046 12.928  2.481   1.00 18.04  ? 87   ALA A CB    1 
ATOM   724  N  N     . ASN A 1 91  ? 40.124 14.513  -0.193  1.00 13.34  ? 88   ASN A N     1 
ATOM   725  C  CA    . ASN A 1 91  ? 40.659 14.402  -1.542  1.00 17.37  ? 88   ASN A CA    1 
ATOM   726  C  C     . ASN A 1 91  ? 42.128 14.018  -1.468  1.00 13.74  ? 88   ASN A C     1 
ATOM   727  O  O     . ASN A 1 91  ? 42.936 14.739  -0.877  1.00 17.33  ? 88   ASN A O     1 
ATOM   728  C  CB    . ASN A 1 91  ? 40.474 15.719  -2.300  1.00 18.32  ? 88   ASN A CB    1 
ATOM   729  C  CG    . ASN A 1 91  ? 40.872 15.611  -3.769  1.00 24.92  ? 88   ASN A CG    1 
ATOM   730  O  OD1   . ASN A 1 91  ? 42.027 15.394  -4.083  1.00 17.39  ? 88   ASN A OD1   1 
ATOM   731  N  ND2   . ASN A 1 91  ? 39.907 15.777  -4.667  1.00 23.61  ? 88   ASN A ND2   1 
ATOM   732  N  N     . LEU A 1 92  ? 42.478 12.879  -2.053  1.00 9.56   ? 89   LEU A N     1 
ATOM   733  C  CA    . LEU A 1 92  ? 43.813 12.315  -1.845  1.00 12.80  ? 89   LEU A CA    1 
ATOM   734  C  C     . LEU A 1 92  ? 44.777 12.606  -2.984  1.00 13.62  ? 89   LEU A C     1 
ATOM   735  O  O     . LEU A 1 92  ? 45.798 11.938  -3.111  1.00 12.92  ? 89   LEU A O     1 
ATOM   736  C  CB    . LEU A 1 92  ? 43.716 10.796  -1.638  1.00 15.60  ? 89   LEU A CB    1 
ATOM   737  C  CG    . LEU A 1 92  ? 42.749 10.358  -0.540  1.00 14.38  ? 89   LEU A CG    1 
ATOM   738  C  CD1   . LEU A 1 92  ? 42.655 8.851   -0.534  1.00 21.60  ? 89   LEU A CD1   1 
ATOM   739  C  CD2   . LEU A 1 92  ? 43.208 10.892  0.814   1.00 14.58  ? 89   LEU A CD2   1 
ATOM   740  N  N     . THR A 1 93  ? 44.460 13.606  -3.800  1.00 14.21  ? 90   THR A N     1 
ATOM   741  C  CA    . THR A 1 93  ? 45.252 13.899  -4.999  1.00 15.76  ? 90   THR A CA    1 
ATOM   742  C  C     . THR A 1 93  ? 46.744 14.144  -4.747  1.00 16.60  ? 90   THR A C     1 
ATOM   743  O  O     . THR A 1 93  ? 47.599 13.641  -5.493  1.00 12.23  ? 90   THR A O     1 
ATOM   744  C  CB    . THR A 1 93  ? 44.653 15.113  -5.742  1.00 19.22  ? 90   THR A CB    1 
ATOM   745  O  OG1   . THR A 1 93  ? 43.317 14.782  -6.139  1.00 17.52  ? 90   THR A OG1   1 
ATOM   746  C  CG2   . THR A 1 93  ? 45.459 15.445  -6.987  1.00 13.40  ? 90   THR A CG2   1 
ATOM   747  N  N     . LYS A 1 94  ? 47.066 14.894  -3.697  1.00 14.89  ? 91   LYS A N     1 
ATOM   748  C  CA    . LYS A 1 94  ? 48.459 15.201  -3.380  1.00 14.89  ? 91   LYS A CA    1 
ATOM   749  C  C     . LYS A 1 94  ? 49.301 13.943  -3.182  1.00 14.18  ? 91   LYS A C     1 
ATOM   750  O  O     . LYS A 1 94  ? 50.466 13.891  -3.587  1.00 14.35  ? 91   LYS A O     1 
ATOM   751  C  CB    . LYS A 1 94  ? 48.547 16.061  -2.115  1.00 14.64  ? 91   LYS A CB    1 
ATOM   752  C  CG    . LYS A 1 94  ? 49.956 16.579  -1.813  1.00 17.60  ? 91   LYS A CG    1 
ATOM   753  C  CD    . LYS A 1 94  ? 50.069 17.132  -0.382  1.00 18.03  ? 91   LYS A CD    1 
ATOM   754  C  CE    . LYS A 1 94  ? 49.112 18.279  -0.131  1.00 21.96  ? 91   LYS A CE    1 
ATOM   755  N  NZ    . LYS A 1 94  ? 49.285 18.848  1.244   1.00 12.52  ? 91   LYS A NZ    1 
ATOM   756  N  N     . TYR A 1 95  ? 48.700 12.938  -2.562  1.00 12.00  ? 92   TYR A N     1 
ATOM   757  C  CA    . TYR A 1 95  ? 49.402 11.713  -2.233  1.00 11.57  ? 92   TYR A CA    1 
ATOM   758  C  C     . TYR A 1 95  ? 49.519 10.851  -3.476  1.00 11.89  ? 92   TYR A C     1 
ATOM   759  O  O     . TYR A 1 95  ? 50.558 10.229  -3.697  1.00 13.19  ? 92   TYR A O     1 
ATOM   760  C  CB    . TYR A 1 95  ? 48.688 10.982  -1.083  1.00 10.63  ? 92   TYR A CB    1 
ATOM   761  C  CG    . TYR A 1 95  ? 48.399 11.953  0.035   1.00 9.94   ? 92   TYR A CG    1 
ATOM   762  C  CD1   . TYR A 1 95  ? 47.103 12.361  0.299   1.00 14.94  ? 92   TYR A CD1   1 
ATOM   763  C  CD2   . TYR A 1 95  ? 49.436 12.530  0.771   1.00 10.65  ? 92   TYR A CD2   1 
ATOM   764  C  CE1   . TYR A 1 95  ? 46.838 13.280  1.278   1.00 14.02  ? 92   TYR A CE1   1 
ATOM   765  C  CE2   . TYR A 1 95  ? 49.182 13.443  1.753   1.00 10.10  ? 92   TYR A CE2   1 
ATOM   766  C  CZ    . TYR A 1 95  ? 47.867 13.825  1.998   1.00 14.02  ? 92   TYR A CZ    1 
ATOM   767  O  OH    . TYR A 1 95  ? 47.568 14.753  2.959   1.00 16.94  ? 92   TYR A OH    1 
ATOM   768  N  N     . ARG A 1 96  ? 48.470 10.833  -4.299  1.00 12.96  ? 93   ARG A N     1 
ATOM   769  C  CA    . ARG A 1 96  ? 48.510 10.087  -5.567  1.00 15.79  ? 93   ARG A CA    1 
ATOM   770  C  C     . ARG A 1 96  ? 49.593 10.644  -6.488  1.00 18.45  ? 93   ARG A C     1 
ATOM   771  O  O     . ARG A 1 96  ? 50.320 9.895   -7.156  1.00 13.86  ? 93   ARG A O     1 
ATOM   772  C  CB    . ARG A 1 96  ? 47.151 10.116  -6.288  1.00 13.07  ? 93   ARG A CB    1 
ATOM   773  C  CG    . ARG A 1 96  ? 46.063 9.290   -5.602  1.00 13.42  ? 93   ARG A CG    1 
ATOM   774  C  CD    . ARG A 1 96  ? 44.864 9.001   -6.495  1.00 14.62  ? 93   ARG A CD    1 
ATOM   775  N  NE    . ARG A 1 96  ? 43.841 8.307   -5.717  1.00 16.67  ? 93   ARG A NE    1 
ATOM   776  C  CZ    . ARG A 1 96  ? 42.821 8.905   -5.108  1.00 21.28  ? 93   ARG A CZ    1 
ATOM   777  N  NH1   . ARG A 1 96  ? 41.970 8.181   -4.389  1.00 12.97  ? 93   ARG A NH1   1 
ATOM   778  N  NH2   . ARG A 1 96  ? 42.659 10.225  -5.207  1.00 17.81  ? 93   ARG A NH2   1 
ATOM   779  N  N     . GLU A 1 97  ? 49.716 11.964  -6.512  1.00 14.51  ? 94   GLU A N     1 
ATOM   780  C  CA    . GLU A 1 97  ? 50.703 12.584  -7.376  1.00 13.48  ? 94   GLU A CA    1 
ATOM   781  C  C     . GLU A 1 97  ? 52.113 12.351  -6.827  1.00 14.42  ? 94   GLU A C     1 
ATOM   782  O  O     . GLU A 1 97  ? 53.052 12.136  -7.589  1.00 10.89  ? 94   GLU A O     1 
ATOM   783  C  CB    . GLU A 1 97  ? 50.405 14.074  -7.551  1.00 16.67  ? 94   GLU A CB    1 
ATOM   784  C  CG    . GLU A 1 97  ? 49.121 14.316  -8.350  1.00 20.34  ? 94   GLU A CG    1 
ATOM   785  C  CD    . GLU A 1 97  ? 48.786 15.783  -8.564  1.00 28.04  ? 94   GLU A CD    1 
ATOM   786  O  OE1   . GLU A 1 97  ? 49.372 16.652  -7.889  1.00 32.01  ? 94   GLU A OE1   1 
ATOM   787  O  OE2   . GLU A 1 97  ? 47.910 16.065  -9.413  1.00 27.83  ? 94   GLU A OE2   1 
ATOM   788  N  N     . ALA A 1 98  ? 52.265 12.379  -5.509  1.00 11.85  ? 95   ALA A N     1 
ATOM   789  C  CA    . ALA A 1 98  ? 53.567 12.049  -4.924  1.00 12.05  ? 95   ALA A CA    1 
ATOM   790  C  C     . ALA A 1 98  ? 53.953 10.588  -5.198  1.00 11.02  ? 95   ALA A C     1 
ATOM   791  O  O     . ALA A 1 98  ? 55.119 10.269  -5.418  1.00 15.17  ? 95   ALA A O     1 
ATOM   792  C  CB    . ALA A 1 98  ? 53.556 12.316  -3.443  1.00 10.89  ? 95   ALA A CB    1 
ATOM   793  N  N     . SER A 1 99  ? 52.967 9.703   -5.165  1.00 11.62  ? 96   SER A N     1 
ATOM   794  C  CA    . SER A 1 99  ? 53.175 8.302   -5.509  1.00 15.60  ? 96   SER A CA    1 
ATOM   795  C  C     . SER A 1 99  ? 53.729 8.145   -6.928  1.00 15.43  ? 96   SER A C     1 
ATOM   796  O  O     . SER A 1 99  ? 54.674 7.385   -7.174  1.00 14.56  ? 96   SER A O     1 
ATOM   797  C  CB    . SER A 1 99  ? 51.857 7.539   -5.373  1.00 15.71  ? 96   SER A CB    1 
ATOM   798  O  OG    . SER A 1 99  ? 52.011 6.193   -5.762  1.00 16.01  ? 96   SER A OG    1 
ATOM   799  N  N     . VAL A 1 100 ? 53.141 8.875   -7.864  1.00 14.90  ? 97   VAL A N     1 
ATOM   800  C  CA    . VAL A 1 100 ? 53.598 8.835   -9.249  1.00 13.16  ? 97   VAL A CA    1 
ATOM   801  C  C     . VAL A 1 100 ? 55.065 9.237   -9.350  1.00 11.39  ? 97   VAL A C     1 
ATOM   802  O  O     . VAL A 1 100 ? 55.830 8.619   -10.099 1.00 15.54  ? 97   VAL A O     1 
ATOM   803  C  CB    . VAL A 1 100 ? 52.750 9.751   -10.137 1.00 15.69  ? 97   VAL A CB    1 
ATOM   804  C  CG1   . VAL A 1 100 ? 53.375 9.902   -11.532 1.00 13.58  ? 97   VAL A CG1   1 
ATOM   805  C  CG2   . VAL A 1 100 ? 51.331 9.202   -10.225 1.00 17.92  ? 97   VAL A CG2   1 
ATOM   806  N  N     . GLU A 1 101 ? 55.463 10.253  -8.583  1.00 11.92  ? 98   GLU A N     1 
ATOM   807  C  CA    . GLU A 1 101 ? 56.870 10.676  -8.547  1.00 12.10  ? 98   GLU A CA    1 
ATOM   808  C  C     . GLU A 1 101 ? 57.792 9.496   -8.277  1.00 14.25  ? 98   GLU A C     1 
ATOM   809  O  O     . GLU A 1 101 ? 58.811 9.305   -8.957  1.00 13.70  ? 98   GLU A O     1 
ATOM   810  C  CB    . GLU A 1 101 ? 57.117 11.731  -7.456  1.00 13.38  ? 98   GLU A CB    1 
ATOM   811  C  CG    . GLU A 1 101 ? 56.622 13.136  -7.737  1.00 15.03  ? 98   GLU A CG    1 
ATOM   812  C  CD    . GLU A 1 101 ? 56.975 14.103  -6.603  1.00 15.99  ? 98   GLU A CD    1 
ATOM   813  O  OE1   . GLU A 1 101 ? 58.168 14.460  -6.466  1.00 17.20  ? 98   GLU A OE1   1 
ATOM   814  O  OE2   . GLU A 1 101 ? 56.057 14.509  -5.844  1.00 18.07  ? 98   GLU A OE2   1 
ATOM   815  N  N     . VAL A 1 102 ? 57.441 8.724   -7.250  1.00 10.73  ? 99   VAL A N     1 
ATOM   816  C  CA    . VAL A 1 102 ? 58.265 7.603   -6.825  1.00 12.39  ? 99   VAL A CA    1 
ATOM   817  C  C     . VAL A 1 102 ? 58.211 6.449   -7.809  1.00 14.56  ? 99   VAL A C     1 
ATOM   818  O  O     . VAL A 1 102 ? 59.250 5.857   -8.133  1.00 15.58  ? 99   VAL A O     1 
ATOM   819  C  CB    . VAL A 1 102 ? 57.839 7.085   -5.429  1.00 13.12  ? 99   VAL A CB    1 
ATOM   820  C  CG1   . VAL A 1 102 ? 58.663 5.852   -5.058  1.00 14.44  ? 99   VAL A CG1   1 
ATOM   821  C  CG2   . VAL A 1 102 ? 58.024 8.193   -4.390  1.00 14.87  ? 99   VAL A CG2   1 
ATOM   822  N  N     . MET A 1 103 ? 57.011 6.132   -8.295  1.00 11.31  ? 100  MET A N     1 
ATOM   823  C  CA    . MET A 1 103 ? 56.836 5.029   -9.237  1.00 16.16  ? 100  MET A CA    1 
ATOM   824  C  C     . MET A 1 103 ? 57.605 5.275   -10.533 1.00 19.39  ? 100  MET A C     1 
ATOM   825  O  O     . MET A 1 103 ? 58.125 4.340   -11.126 1.00 13.00  ? 100  MET A O     1 
ATOM   826  C  CB    . MET A 1 103 ? 55.355 4.800   -9.554  1.00 17.93  ? 100  MET A CB    1 
ATOM   827  C  CG    A MET A 1 103 ? 54.457 4.597   -8.335  0.44 19.40  ? 100  MET A CG    1 
ATOM   828  C  CG    B MET A 1 103 ? 54.523 4.413   -8.351  0.56 19.45  ? 100  MET A CG    1 
ATOM   829  S  SD    A MET A 1 103 ? 54.283 2.897   -7.766  0.44 13.41  ? 100  MET A SD    1 
ATOM   830  S  SD    B MET A 1 103 ? 55.310 3.095   -7.418  0.56 17.43  ? 100  MET A SD    1 
ATOM   831  C  CE    A MET A 1 103 ? 53.502 3.146   -6.171  0.44 13.90  ? 100  MET A CE    1 
ATOM   832  C  CE    B MET A 1 103 ? 54.397 3.186   -5.867  0.56 12.09  ? 100  MET A CE    1 
ATOM   833  N  N     . GLU A 1 104 ? 57.682 6.530   -10.980 1.00 14.46  ? 101  GLU A N     1 
ATOM   834  C  CA    . GLU A 1 104 ? 58.382 6.816   -12.229 1.00 18.27  ? 101  GLU A CA    1 
ATOM   835  C  C     . GLU A 1 104 ? 59.896 6.633   -12.064 1.00 18.47  ? 101  GLU A C     1 
ATOM   836  O  O     . GLU A 1 104 ? 60.576 6.151   -12.974 1.00 15.16  ? 101  GLU A O     1 
ATOM   837  C  CB    . GLU A 1 104 ? 58.022 8.232   -12.732 1.00 16.85  ? 101  GLU A CB    1 
ATOM   838  C  CG    . GLU A 1 104 ? 56.576 8.283   -13.250 1.00 14.54  ? 101  GLU A CG    1 
ATOM   839  C  CD    . GLU A 1 104 ? 56.186 9.617   -13.894 1.00 37.48  ? 101  GLU A CD    1 
ATOM   840  O  OE1   . GLU A 1 104 ? 56.981 10.580  -13.845 1.00 40.42  ? 101  GLU A OE1   1 
ATOM   841  O  OE2   . GLU A 1 104 ? 55.072 9.689   -14.450 1.00 32.84  ? 101  GLU A OE2   1 
ATOM   842  N  N     . ILE A 1 105 ? 60.416 6.981   -10.893 1.00 13.26  ? 102  ILE A N     1 
ATOM   843  C  CA    . ILE A 1 105 ? 61.832 6.751   -10.602 1.00 14.43  ? 102  ILE A CA    1 
ATOM   844  C  C     . ILE A 1 105 ? 62.136 5.255   -10.577 1.00 12.66  ? 102  ILE A C     1 
ATOM   845  O  O     . ILE A 1 105 ? 63.062 4.789   -11.251 1.00 16.87  ? 102  ILE A O     1 
ATOM   846  C  CB    . ILE A 1 105 ? 62.248 7.389   -9.279  1.00 11.99  ? 102  ILE A CB    1 
ATOM   847  C  CG1   . ILE A 1 105 ? 62.171 8.908   -9.391  1.00 18.69  ? 102  ILE A CG1   1 
ATOM   848  C  CG2   . ILE A 1 105 ? 63.682 6.973   -8.883  1.00 16.01  ? 102  ILE A CG2   1 
ATOM   849  C  CD1   . ILE A 1 105 ? 62.227 9.599   -8.036  1.00 19.88  ? 102  ILE A CD1   1 
ATOM   850  N  N     . MET A 1 106 ? 61.336 4.496   -9.838  1.00 13.95  ? 103  MET A N     1 
ATOM   851  C  CA    . MET A 1 106 ? 61.543 3.048   -9.764  1.00 13.52  ? 103  MET A CA    1 
ATOM   852  C  C     . MET A 1 106 ? 61.517 2.398   -11.136 1.00 13.16  ? 103  MET A C     1 
ATOM   853  O  O     . MET A 1 106 ? 62.299 1.494   -11.414 1.00 16.73  ? 103  MET A O     1 
ATOM   854  C  CB    . MET A 1 106 ? 60.490 2.400   -8.858  1.00 13.18  ? 103  MET A CB    1 
ATOM   855  C  CG    A MET A 1 106 ? 60.775 2.661   -7.376  0.44 15.42  ? 103  MET A CG    1 
ATOM   856  C  CG    B MET A 1 106 ? 60.613 2.760   -7.386  0.56 15.51  ? 103  MET A CG    1 
ATOM   857  S  SD    A MET A 1 106 ? 59.704 1.777   -6.220  0.44 20.88  ? 103  MET A SD    1 
ATOM   858  S  SD    B MET A 1 106 ? 59.350 1.927   -6.390  0.56 19.87  ? 103  MET A SD    1 
ATOM   859  C  CE    A MET A 1 106 ? 58.126 2.528   -6.606  0.44 17.53  ? 103  MET A CE    1 
ATOM   860  C  CE    B MET A 1 106 ? 59.698 0.214   -6.767  0.56 15.21  ? 103  MET A CE    1 
ATOM   861  N  N     . SER A 1 107 ? 60.622 2.868   -11.998 1.00 12.99  ? 104  SER A N     1 
ATOM   862  C  CA    . SER A 1 107 ? 60.467 2.290   -13.327 1.00 16.42  ? 104  SER A CA    1 
ATOM   863  C  C     . SER A 1 107 ? 61.700 2.444   -14.216 1.00 18.58  ? 104  SER A C     1 
ATOM   864  O  O     . SER A 1 107 ? 61.770 1.803   -15.265 1.00 18.77  ? 104  SER A O     1 
ATOM   865  C  CB    . SER A 1 107 ? 59.259 2.912   -14.033 1.00 21.48  ? 104  SER A CB    1 
ATOM   866  O  OG    . SER A 1 107 ? 58.067 2.613   -13.334 1.00 30.41  ? 104  SER A OG    1 
ATOM   867  N  N     . ARG A 1 108 ? 62.650 3.296   -13.823 1.00 18.10  ? 105  ARG A N     1 
ATOM   868  C  CA    . ARG A 1 108 ? 63.895 3.441   -14.586 1.00 22.02  ? 105  ARG A CA    1 
ATOM   869  C  C     . ARG A 1 108 ? 64.819 2.251   -14.359 1.00 26.38  ? 105  ARG A C     1 
ATOM   870  O  O     . ARG A 1 108 ? 65.710 1.984   -15.164 1.00 20.35  ? 105  ARG A O     1 
ATOM   871  C  CB    . ARG A 1 108 ? 64.662 4.720   -14.212 1.00 21.73  ? 105  ARG A CB    1 
ATOM   872  C  CG    . ARG A 1 108 ? 63.863 6.000   -14.226 1.00 21.61  ? 105  ARG A CG    1 
ATOM   873  C  CD    . ARG A 1 108 ? 64.766 7.209   -14.438 1.00 20.68  ? 105  ARG A CD    1 
ATOM   874  N  NE    . ARG A 1 108 ? 65.808 7.352   -13.430 1.00 24.64  ? 105  ARG A NE    1 
ATOM   875  C  CZ    . ARG A 1 108 ? 65.783 8.255   -12.448 1.00 19.05  ? 105  ARG A CZ    1 
ATOM   876  N  NH1   . ARG A 1 108 ? 66.779 8.317   -11.576 1.00 23.83  ? 105  ARG A NH1   1 
ATOM   877  N  NH2   . ARG A 1 108 ? 64.759 9.086   -12.332 1.00 23.05  ? 105  ARG A NH2   1 
ATOM   878  N  N     . PHE A 1 109 ? 64.619 1.548   -13.250 1.00 19.40  ? 106  PHE A N     1 
ATOM   879  C  CA    . PHE A 1 109 ? 65.504 0.442   -12.901 1.00 25.29  ? 106  PHE A CA    1 
ATOM   880  C  C     . PHE A 1 109 ? 64.950 -0.876  -13.408 1.00 27.46  ? 106  PHE A C     1 
ATOM   881  O  O     . PHE A 1 109 ? 65.703 -1.749  -13.849 1.00 33.45  ? 106  PHE A O     1 
ATOM   882  C  CB    . PHE A 1 109 ? 65.728 0.400   -11.385 1.00 14.93  ? 106  PHE A CB    1 
ATOM   883  C  CG    . PHE A 1 109 ? 66.449 1.614   -10.850 1.00 26.93  ? 106  PHE A CG    1 
ATOM   884  C  CD1   . PHE A 1 109 ? 65.764 2.805   -10.629 1.00 18.49  ? 106  PHE A CD1   1 
ATOM   885  C  CD2   . PHE A 1 109 ? 67.809 1.565   -10.575 1.00 18.49  ? 106  PHE A CD2   1 
ATOM   886  C  CE1   . PHE A 1 109 ? 66.420 3.929   -10.143 1.00 16.43  ? 106  PHE A CE1   1 
ATOM   887  C  CE2   . PHE A 1 109 ? 68.471 2.670   -10.090 1.00 19.16  ? 106  PHE A CE2   1 
ATOM   888  C  CZ    . PHE A 1 109 ? 67.776 3.865   -9.873  1.00 18.67  ? 106  PHE A CZ    1 
ATOM   889  N  N     . ALA A 1 110 ? 63.629 -1.010  -13.376 1.00 23.45  ? 107  ALA A N     1 
ATOM   890  C  CA    . ALA A 1 110 ? 62.980 -2.249  -13.770 1.00 18.40  ? 107  ALA A CA    1 
ATOM   891  C  C     . ALA A 1 110 ? 61.478 -2.102  -13.901 1.00 28.66  ? 107  ALA A C     1 
ATOM   892  O  O     . ALA A 1 110 ? 60.893 -1.102  -13.479 1.00 31.69  ? 107  ALA A O     1 
ATOM   893  C  CB    . ALA A 1 110 ? 63.287 -3.354  -12.774 1.00 27.00  ? 107  ALA A CB    1 
ATOM   894  N  N     . VAL A 1 111 ? 60.866 -3.124  -14.485 1.00 31.93  ? 108  VAL A N     1 
ATOM   895  C  CA    . VAL A 1 111 ? 59.420 -3.264  -14.505 1.00 34.46  ? 108  VAL A CA    1 
ATOM   896  C  C     . VAL A 1 111 ? 58.889 -3.332  -13.070 1.00 24.66  ? 108  VAL A C     1 
ATOM   897  O  O     . VAL A 1 111 ? 59.475 -4.008  -12.214 1.00 24.00  ? 108  VAL A O     1 
ATOM   898  C  CB    . VAL A 1 111 ? 59.009 -4.516  -15.290 1.00 41.78  ? 108  VAL A CB    1 
ATOM   899  C  CG1   . VAL A 1 111 ? 57.569 -4.903  -14.990 1.00 39.79  ? 108  VAL A CG1   1 
ATOM   900  C  CG2   . VAL A 1 111 ? 59.221 -4.284  -16.782 1.00 53.84  ? 108  VAL A CG2   1 
ATOM   901  N  N     . ILE A 1 112 ? 57.822 -2.588  -12.788 1.00 24.57  ? 109  ILE A N     1 
ATOM   902  C  CA    . ILE A 1 112 ? 57.283 -2.580  -11.430 1.00 21.99  ? 109  ILE A CA    1 
ATOM   903  C  C     . ILE A 1 112 ? 55.806 -2.933  -11.414 1.00 14.97  ? 109  ILE A C     1 
ATOM   904  O  O     . ILE A 1 112 ? 55.104 -2.755  -12.403 1.00 16.69  ? 109  ILE A O     1 
ATOM   905  C  CB    . ILE A 1 112 ? 57.509 -1.205  -10.733 1.00 18.88  ? 109  ILE A CB    1 
ATOM   906  C  CG1   . ILE A 1 112 ? 56.580 -0.131  -11.296 1.00 20.54  ? 109  ILE A CG1   1 
ATOM   907  C  CG2   . ILE A 1 112 ? 58.971 -0.789  -10.854 1.00 21.99  ? 109  ILE A CG2   1 
ATOM   908  C  CD1   . ILE A 1 112 ? 56.561 1.166   -10.477 1.00 20.89  ? 109  ILE A CD1   1 
ATOM   909  N  N     . GLU A 1 113 ? 55.355 -3.491  -10.294 1.00 14.02  ? 110  GLU A N     1 
ATOM   910  C  CA    . GLU A 1 113 ? 53.942 -3.708  -10.031 1.00 16.77  ? 110  GLU A CA    1 
ATOM   911  C  C     . GLU A 1 113 ? 53.541 -2.753  -8.921  1.00 16.24  ? 110  GLU A C     1 
ATOM   912  O  O     . GLU A 1 113 ? 53.995 -2.887  -7.789  1.00 12.99  ? 110  GLU A O     1 
ATOM   913  C  CB    . GLU A 1 113 ? 53.655 -5.165  -9.616  1.00 12.45  ? 110  GLU A CB    1 
ATOM   914  C  CG    . GLU A 1 113 ? 52.194 -5.432  -9.269  1.00 15.18  ? 110  GLU A CG    1 
ATOM   915  C  CD    . GLU A 1 113 ? 51.940 -6.861  -8.805  1.00 26.77  ? 110  GLU A CD    1 
ATOM   916  O  OE1   . GLU A 1 113 ? 50.852 -7.122  -8.249  1.00 24.41  ? 110  GLU A OE1   1 
ATOM   917  O  OE2   . GLU A 1 113 ? 52.819 -7.726  -9.006  1.00 18.50  ? 110  GLU A OE2   1 
ATOM   918  N  N     . ARG A 1 114 ? 52.718 -1.769  -9.253  1.00 13.65  ? 111  ARG A N     1 
ATOM   919  C  CA    . ARG A 1 114 ? 52.168 -0.884  -8.235  1.00 17.01  ? 111  ARG A CA    1 
ATOM   920  C  C     . ARG A 1 114 ? 51.263 -1.686  -7.317  1.00 20.21  ? 111  ARG A C     1 
ATOM   921  O  O     . ARG A 1 114 ? 50.255 -2.222  -7.757  1.00 20.65  ? 111  ARG A O     1 
ATOM   922  C  CB    . ARG A 1 114 ? 51.398 0.269   -8.884  1.00 13.16  ? 111  ARG A CB    1 
ATOM   923  C  CG    . ARG A 1 114 ? 50.888 1.311   -7.915  1.00 17.53  ? 111  ARG A CG    1 
ATOM   924  C  CD    . ARG A 1 114 ? 49.642 1.976   -8.466  1.00 21.86  ? 111  ARG A CD    1 
ATOM   925  N  NE    . ARG A 1 114 ? 49.315 3.229   -7.792  1.00 21.96  ? 111  ARG A NE    1 
ATOM   926  C  CZ    . ARG A 1 114 ? 48.389 3.355   -6.848  1.00 21.75  ? 111  ARG A CZ    1 
ATOM   927  N  NH1   . ARG A 1 114 ? 47.694 2.299   -6.442  1.00 22.65  ? 111  ARG A NH1   1 
ATOM   928  N  NH2   . ARG A 1 114 ? 48.173 4.540   -6.297  1.00 20.81  ? 111  ARG A NH2   1 
ATOM   929  N  N     . ALA A 1 115 ? 51.621 -1.780  -6.042  1.00 16.59  ? 112  ALA A N     1 
ATOM   930  C  CA    . ALA A 1 115 ? 50.889 -2.651  -5.132  1.00 13.68  ? 112  ALA A CA    1 
ATOM   931  C  C     . ALA A 1 115 ? 49.989 -1.859  -4.195  1.00 20.70  ? 112  ALA A C     1 
ATOM   932  O  O     . ALA A 1 115 ? 49.053 -2.403  -3.630  1.00 16.09  ? 112  ALA A O     1 
ATOM   933  C  CB    . ALA A 1 115 ? 51.856 -3.525  -4.328  1.00 15.67  ? 112  ALA A CB    1 
ATOM   934  N  N     . SER A 1 116 ? 50.295 -0.577  -4.032  1.00 15.77  ? 113  SER A N     1 
ATOM   935  C  CA    . SER A 1 116 ? 49.470 0.354   -3.263  1.00 16.11  ? 113  SER A CA    1 
ATOM   936  C  C     . SER A 1 116 ? 49.928 1.759   -3.614  1.00 13.09  ? 113  SER A C     1 
ATOM   937  O  O     . SER A 1 116 ? 50.847 1.925   -4.409  1.00 13.68  ? 113  SER A O     1 
ATOM   938  C  CB    . SER A 1 116 ? 49.589 0.122   -1.750  1.00 16.93  ? 113  SER A CB    1 
ATOM   939  O  OG    . SER A 1 116 ? 50.827 0.621   -1.242  1.00 18.00  ? 113  SER A OG    1 
ATOM   940  N  N     . ILE A 1 117 ? 49.315 2.766   -3.001  1.00 11.35  ? 114  ILE A N     1 
ATOM   941  C  CA    . ILE A 1 117 ? 49.736 4.145   -3.223  1.00 13.44  ? 114  ILE A CA    1 
ATOM   942  C  C     . ILE A 1 117 ? 51.212 4.369   -2.842  1.00 14.39  ? 114  ILE A C     1 
ATOM   943  O  O     . ILE A 1 117 ? 51.851 5.268   -3.385  1.00 12.12  ? 114  ILE A O     1 
ATOM   944  C  CB    . ILE A 1 117 ? 48.825 5.127   -2.429  1.00 12.35  ? 114  ILE A CB    1 
ATOM   945  C  CG1   . ILE A 1 117 ? 48.947 6.563   -2.939  1.00 12.92  ? 114  ILE A CG1   1 
ATOM   946  C  CG2   . ILE A 1 117 ? 49.109 5.045   -0.940  1.00 12.53  ? 114  ILE A CG2   1 
ATOM   947  C  CD1   . ILE A 1 117 ? 47.761 7.453   -2.459  1.00 13.18  ? 114  ILE A CD1   1 
ATOM   948  N  N     . ASP A 1 118 ? 51.782 3.549   -1.950  1.00 11.42  ? 115  ASP A N     1 
ATOM   949  C  CA    . ASP A 1 118 ? 53.145 3.844   -1.508  1.00 12.93  ? 115  ASP A CA    1 
ATOM   950  C  C     . ASP A 1 118 ? 54.146 2.693   -1.643  1.00 16.20  ? 115  ASP A C     1 
ATOM   951  O  O     . ASP A 1 118 ? 55.226 2.731   -1.033  1.00 13.35  ? 115  ASP A O     1 
ATOM   952  C  CB    . ASP A 1 118 ? 53.125 4.331   -0.057  1.00 11.15  ? 115  ASP A CB    1 
ATOM   953  C  CG    . ASP A 1 118 ? 53.317 3.207   0.943   1.00 13.78  ? 115  ASP A CG    1 
ATOM   954  O  OD1   . ASP A 1 118 ? 52.701 2.115   0.782   1.00 10.47  ? 115  ASP A OD1   1 
ATOM   955  O  OD2   . ASP A 1 118 ? 54.104 3.430   1.883   1.00 13.55  ? 115  ASP A OD2   1 
ATOM   956  N  N     . GLU A 1 119 ? 53.827 1.689   -2.452  1.00 10.19  ? 116  GLU A N     1 
ATOM   957  C  CA    . GLU A 1 119 ? 54.783 0.591   -2.624  1.00 12.09  ? 116  GLU A CA    1 
ATOM   958  C  C     . GLU A 1 119 ? 54.642 -0.137  -3.955  1.00 15.76  ? 116  GLU A C     1 
ATOM   959  O  O     . GLU A 1 119 ? 53.560 -0.200  -4.543  1.00 12.99  ? 116  GLU A O     1 
ATOM   960  C  CB    . GLU A 1 119 ? 54.657 -0.408  -1.471  1.00 15.54  ? 116  GLU A CB    1 
ATOM   961  C  CG    . GLU A 1 119 ? 53.465 -1.359  -1.568  1.00 17.64  ? 116  GLU A CG    1 
ATOM   962  C  CD    . GLU A 1 119 ? 52.976 -1.796  -0.200  1.00 18.36  ? 116  GLU A CD    1 
ATOM   963  O  OE1   . GLU A 1 119 ? 53.281 -2.936  0.222   1.00 18.73  ? 116  GLU A OE1   1 
ATOM   964  O  OE2   . GLU A 1 119 ? 52.301 -0.984  0.461   1.00 14.96  ? 116  GLU A OE2   1 
ATOM   965  N  N     . ALA A 1 120 ? 55.760 -0.678  -4.428  1.00 10.89  ? 117  ALA A N     1 
ATOM   966  C  CA    . ALA A 1 120 ? 55.774 -1.438  -5.652  1.00 12.68  ? 117  ALA A CA    1 
ATOM   967  C  C     . ALA A 1 120 ? 56.724 -2.619  -5.539  1.00 16.11  ? 117  ALA A C     1 
ATOM   968  O  O     . ALA A 1 120 ? 57.770 -2.524  -4.886  1.00 15.43  ? 117  ALA A O     1 
ATOM   969  C  CB    . ALA A 1 120 ? 56.180 -0.552  -6.824  1.00 10.08  ? 117  ALA A CB    1 
ATOM   970  N  N     . TYR A 1 121 ? 56.373 -3.717  -6.199  1.00 13.90  ? 118  TYR A N     1 
ATOM   971  C  CA    . TYR A 1 121 ? 57.325 -4.804  -6.362  1.00 14.00  ? 118  TYR A CA    1 
ATOM   972  C  C     . TYR A 1 121 ? 58.160 -4.591  -7.612  1.00 15.58  ? 118  TYR A C     1 
ATOM   973  O  O     . TYR A 1 121 ? 57.701 -3.994  -8.580  1.00 14.85  ? 118  TYR A O     1 
ATOM   974  C  CB    . TYR A 1 121 ? 56.614 -6.149  -6.430  1.00 11.24  ? 118  TYR A CB    1 
ATOM   975  C  CG    . TYR A 1 121 ? 55.898 -6.513  -5.151  1.00 14.48  ? 118  TYR A CG    1 
ATOM   976  C  CD1   . TYR A 1 121 ? 54.563 -6.173  -4.954  1.00 16.23  ? 118  TYR A CD1   1 
ATOM   977  C  CD2   . TYR A 1 121 ? 56.559 -7.199  -4.139  1.00 15.65  ? 118  TYR A CD2   1 
ATOM   978  C  CE1   . TYR A 1 121 ? 53.898 -6.518  -3.779  1.00 18.71  ? 118  TYR A CE1   1 
ATOM   979  C  CE2   . TYR A 1 121 ? 55.901 -7.548  -2.959  1.00 15.54  ? 118  TYR A CE2   1 
ATOM   980  C  CZ    . TYR A 1 121 ? 54.584 -7.200  -2.788  1.00 17.36  ? 118  TYR A CZ    1 
ATOM   981  O  OH    . TYR A 1 121 ? 53.945 -7.549  -1.627  1.00 19.79  ? 118  TYR A OH    1 
ATOM   982  N  N     . VAL A 1 122 ? 59.386 -5.102  -7.564  1.00 12.40  ? 119  VAL A N     1 
ATOM   983  C  CA    . VAL A 1 122 ? 60.374 -4.974  -8.622  1.00 15.65  ? 119  VAL A CA    1 
ATOM   984  C  C     . VAL A 1 122 ? 60.893 -6.358  -8.954  1.00 18.13  ? 119  VAL A C     1 
ATOM   985  O  O     . VAL A 1 122 ? 61.346 -7.047  -8.053  1.00 13.80  ? 119  VAL A O     1 
ATOM   986  C  CB    . VAL A 1 122 ? 61.591 -4.109  -8.166  1.00 17.94  ? 119  VAL A CB    1 
ATOM   987  C  CG1   . VAL A 1 122 ? 62.331 -3.555  -9.361  1.00 28.76  ? 119  VAL A CG1   1 
ATOM   988  C  CG2   . VAL A 1 122 ? 61.158 -2.998  -7.223  1.00 27.25  ? 119  VAL A CG2   1 
ATOM   989  N  N     . ASP A 1 123 ? 60.841 -6.782  -10.213 1.00 14.97  ? 120  ASP A N     1 
ATOM   990  C  CA    . ASP A 1 123 ? 61.525 -8.021  -10.592 1.00 21.28  ? 120  ASP A CA    1 
ATOM   991  C  C     . ASP A 1 123 ? 62.918 -7.662  -11.090 1.00 25.56  ? 120  ASP A C     1 
ATOM   992  O  O     . ASP A 1 123 ? 63.078 -7.171  -12.204 1.00 23.89  ? 120  ASP A O     1 
ATOM   993  C  CB    . ASP A 1 123 ? 60.743 -8.802  -11.656 1.00 21.68  ? 120  ASP A CB    1 
ATOM   994  C  CG    . ASP A 1 123 ? 61.312 -10.196 -11.897 1.00 25.25  ? 120  ASP A CG    1 
ATOM   995  O  OD1   . ASP A 1 123 ? 62.547 -10.327 -12.057 1.00 17.40  ? 120  ASP A OD1   1 
ATOM   996  O  OD2   . ASP A 1 123 ? 60.529 -11.175 -11.908 1.00 38.32  ? 120  ASP A OD2   1 
ATOM   997  N  N     . LEU A 1 124 ? 63.927 -7.911  -10.263 1.00 16.48  ? 121  LEU A N     1 
ATOM   998  C  CA    . LEU A 1 124 ? 65.298 -7.501  -10.574 1.00 17.06  ? 121  LEU A CA    1 
ATOM   999  C  C     . LEU A 1 124 ? 66.160 -8.589  -11.205 1.00 12.54  ? 121  LEU A C     1 
ATOM   1000 O  O     . LEU A 1 124 ? 67.373 -8.413  -11.340 1.00 15.55  ? 121  LEU A O     1 
ATOM   1001 C  CB    . LEU A 1 124 ? 65.992 -7.013  -9.306  1.00 11.71  ? 121  LEU A CB    1 
ATOM   1002 C  CG    . LEU A 1 124 ? 65.424 -5.759  -8.653  1.00 18.66  ? 121  LEU A CG    1 
ATOM   1003 C  CD1   . LEU A 1 124 ? 65.992 -5.597  -7.255  1.00 16.38  ? 121  LEU A CD1   1 
ATOM   1004 C  CD2   . LEU A 1 124 ? 65.743 -4.546  -9.527  1.00 25.89  ? 121  LEU A CD2   1 
ATOM   1005 N  N     . THR A 1 125 ? 65.542 -9.708  -11.558 1.00 16.61  ? 122  THR A N     1 
ATOM   1006 C  CA    . THR A 1 125 ? 66.287 -10.857 -12.056 1.00 19.92  ? 122  THR A CA    1 
ATOM   1007 C  C     . THR A 1 125 ? 67.204 -10.489 -13.233 1.00 21.66  ? 122  THR A C     1 
ATOM   1008 O  O     . THR A 1 125 ? 68.400 -10.798 -13.209 1.00 17.53  ? 122  THR A O     1 
ATOM   1009 C  CB    . THR A 1 125 ? 65.340 -11.978 -12.472 1.00 22.08  ? 122  THR A CB    1 
ATOM   1010 O  OG1   . THR A 1 125 ? 64.472 -12.292 -11.378 1.00 20.01  ? 122  THR A OG1   1 
ATOM   1011 C  CG2   . THR A 1 125 ? 66.129 -13.219 -12.877 1.00 20.39  ? 122  THR A CG2   1 
ATOM   1012 N  N     . SER A 1 126 ? 66.652 -9.814  -14.241 1.00 18.62  ? 123  SER A N     1 
ATOM   1013 C  CA    . SER A 1 126 ? 67.432 -9.436  -15.421 1.00 20.25  ? 123  SER A CA    1 
ATOM   1014 C  C     A SER A 1 126 ? 68.526 -8.434  -15.075 0.46 25.62  ? 123  SER A C     1 
ATOM   1015 C  C     B SER A 1 126 ? 68.526 -8.435  -15.075 0.54 25.64  ? 123  SER A C     1 
ATOM   1016 O  O     . SER A 1 126 ? 69.686 -8.615  -15.452 1.00 24.87  ? 123  SER A O     1 
ATOM   1017 C  CB    . SER A 1 126 ? 66.525 -8.859  -16.509 1.00 28.18  ? 123  SER A CB    1 
ATOM   1018 O  OG    A SER A 1 126 ? 65.763 -9.866  -17.142 0.46 26.35  ? 123  SER A OG    1 
ATOM   1019 O  OG    B SER A 1 126 ? 65.808 -7.736  -16.039 0.54 25.82  ? 123  SER A OG    1 
ATOM   1020 N  N     . ALA A 1 127 ? 68.149 -7.375  -14.363 1.00 18.71  ? 124  ALA A N     1 
ATOM   1021 C  CA    . ALA A 1 127 ? 69.095 -6.351  -13.940 1.00 20.67  ? 124  ALA A CA    1 
ATOM   1022 C  C     . ALA A 1 127 ? 70.275 -6.942  -13.167 1.00 22.50  ? 124  ALA A C     1 
ATOM   1023 O  O     . ALA A 1 127 ? 71.414 -6.525  -13.353 1.00 18.83  ? 124  ALA A O     1 
ATOM   1024 C  CB    . ALA A 1 127 ? 68.379 -5.289  -13.091 1.00 15.68  ? 124  ALA A CB    1 
ATOM   1025 N  N     . VAL A 1 128 ? 69.997 -7.913  -12.298 1.00 16.21  ? 125  VAL A N     1 
ATOM   1026 C  CA    . VAL A 1 128 ? 71.048 -8.602  -11.559 1.00 18.96  ? 125  VAL A CA    1 
ATOM   1027 C  C     . VAL A 1 128 ? 72.029 -9.315  -12.493 1.00 18.98  ? 125  VAL A C     1 
ATOM   1028 O  O     . VAL A 1 128 ? 73.243 -9.213  -12.307 1.00 23.06  ? 125  VAL A O     1 
ATOM   1029 C  CB    . VAL A 1 128 ? 70.445 -9.618  -10.552 1.00 16.71  ? 125  VAL A CB    1 
ATOM   1030 C  CG1   . VAL A 1 128 ? 71.480 -10.641 -10.114 1.00 20.81  ? 125  VAL A CG1   1 
ATOM   1031 C  CG2   . VAL A 1 128 ? 69.904 -8.866  -9.335  1.00 14.12  ? 125  VAL A CG2   1 
ATOM   1032 N  N     . GLN A 1 129 ? 71.505 -10.023 -13.492 1.00 18.04  ? 126  GLN A N     1 
ATOM   1033 C  CA    . GLN A 1 129 ? 72.362 -10.714 -14.452 1.00 30.92  ? 126  GLN A CA    1 
ATOM   1034 C  C     . GLN A 1 129 ? 73.269 -9.723  -15.163 1.00 27.63  ? 126  GLN A C     1 
ATOM   1035 O  O     . GLN A 1 129 ? 74.443 -9.995  -15.398 1.00 28.85  ? 126  GLN A O     1 
ATOM   1036 C  CB    . GLN A 1 129 ? 71.534 -11.489 -15.473 1.00 27.37  ? 126  GLN A CB    1 
ATOM   1037 C  CG    . GLN A 1 129 ? 70.762 -12.666 -14.890 1.00 40.89  ? 126  GLN A CG    1 
ATOM   1038 C  CD    . GLN A 1 129 ? 71.646 -13.613 -14.087 1.00 47.74  ? 126  GLN A CD    1 
ATOM   1039 O  OE1   . GLN A 1 129 ? 71.441 -13.804 -12.888 1.00 46.46  ? 126  GLN A OE1   1 
ATOM   1040 N  NE2   . GLN A 1 129 ? 72.634 -14.210 -14.748 1.00 54.03  ? 126  GLN A NE2   1 
ATOM   1041 N  N     . GLU A 1 130 ? 72.713 -8.567  -15.501 1.00 29.58  ? 127  GLU A N     1 
ATOM   1042 C  CA    . GLU A 1 130 ? 73.484 -7.512  -16.139 1.00 32.46  ? 127  GLU A CA    1 
ATOM   1043 C  C     . GLU A 1 130 ? 74.601 -7.017  -15.236 1.00 37.09  ? 127  GLU A C     1 
ATOM   1044 O  O     . GLU A 1 130 ? 75.755 -6.941  -15.654 1.00 36.24  ? 127  GLU A O     1 
ATOM   1045 C  CB    . GLU A 1 130 ? 72.581 -6.339  -16.517 1.00 33.59  ? 127  GLU A CB    1 
ATOM   1046 C  CG    . GLU A 1 130 ? 71.688 -6.587  -17.709 1.00 45.20  ? 127  GLU A CG    1 
ATOM   1047 C  CD    . GLU A 1 130 ? 71.044 -5.301  -18.201 1.00 70.82  ? 127  GLU A CD    1 
ATOM   1048 O  OE1   . GLU A 1 130 ? 71.791 -4.339  -18.492 1.00 58.57  ? 127  GLU A OE1   1 
ATOM   1049 O  OE2   . GLU A 1 130 ? 69.797 -5.247  -18.280 1.00 69.56  ? 127  GLU A OE2   1 
ATOM   1050 N  N     . ARG A 1 131 ? 74.256 -6.670  -13.999 1.00 24.09  ? 128  ARG A N     1 
ATOM   1051 C  CA    . ARG A 1 131 ? 75.231 -6.086  -13.088 1.00 24.65  ? 128  ARG A CA    1 
ATOM   1052 C  C     . ARG A 1 131 ? 76.340 -7.093  -12.781 1.00 29.60  ? 128  ARG A C     1 
ATOM   1053 O  O     . ARG A 1 131 ? 77.505 -6.717  -12.655 1.00 29.19  ? 128  ARG A O     1 
ATOM   1054 C  CB    . ARG A 1 131 ? 74.551 -5.618  -11.798 1.00 21.63  ? 128  ARG A CB    1 
ATOM   1055 C  CG    A ARG A 1 131 ? 75.458 -4.886  -10.823 0.50 26.57  ? 128  ARG A CG    1 
ATOM   1056 C  CG    B ARG A 1 131 ? 75.516 -5.013  -10.785 0.50 26.52  ? 128  ARG A CG    1 
ATOM   1057 C  CD    A ARG A 1 131 ? 75.970 -3.573  -11.408 0.50 23.97  ? 128  ARG A CD    1 
ATOM   1058 C  CD    B ARG A 1 131 ? 76.152 -3.741  -11.340 0.50 24.37  ? 128  ARG A CD    1 
ATOM   1059 N  NE    A ARG A 1 131 ? 76.648 -2.778  -10.391 0.50 26.03  ? 128  ARG A NE    1 
ATOM   1060 N  NE    B ARG A 1 131 ? 75.119 -2.792  -11.723 0.50 20.10  ? 128  ARG A NE    1 
ATOM   1061 C  CZ    A ARG A 1 131 ? 76.029 -1.907  -9.599  0.50 18.62  ? 128  ARG A CZ    1 
ATOM   1062 C  CZ    B ARG A 1 131 ? 74.524 -1.966  -10.870 0.50 23.05  ? 128  ARG A CZ    1 
ATOM   1063 N  NH1   A ARG A 1 131 ? 76.713 -1.224  -8.692  0.50 22.04  ? 128  ARG A NH1   1 
ATOM   1064 N  NH1   B ARG A 1 131 ? 73.576 -1.140  -11.290 0.50 24.40  ? 128  ARG A NH1   1 
ATOM   1065 N  NH2   A ARG A 1 131 ? 74.723 -1.725  -9.717  0.50 25.56  ? 128  ARG A NH2   1 
ATOM   1066 N  NH2   B ARG A 1 131 ? 74.888 -1.961  -9.596  0.50 24.86  ? 128  ARG A NH2   1 
ATOM   1067 N  N     . LEU A 1 132 ? 75.977 -8.370  -12.695 1.00 26.58  ? 129  LEU A N     1 
ATOM   1068 C  CA    . LEU A 1 132 ? 76.943 -9.445  -12.428 1.00 28.62  ? 129  LEU A CA    1 
ATOM   1069 C  C     . LEU A 1 132 ? 78.019 -9.570  -13.513 1.00 41.21  ? 129  LEU A C     1 
ATOM   1070 O  O     . LEU A 1 132 ? 79.196 -9.737  -13.203 1.00 40.96  ? 129  LEU A O     1 
ATOM   1071 C  CB    . LEU A 1 132 ? 76.220 -10.786 -12.272 1.00 26.05  ? 129  LEU A CB    1 
ATOM   1072 C  CG    . LEU A 1 132 ? 75.770 -11.167 -10.851 1.00 26.32  ? 129  LEU A CG    1 
ATOM   1073 C  CD1   . LEU A 1 132 ? 74.763 -12.307 -10.878 1.00 27.61  ? 129  LEU A CD1   1 
ATOM   1074 C  CD2   . LEU A 1 132 ? 76.976 -11.544 -9.993  1.00 26.98  ? 129  LEU A CD2   1 
ATOM   1075 N  N     . GLN A 1 133 ? 77.616 -9.505  -14.779 1.00 38.89  ? 130  GLN A N     1 
ATOM   1076 C  CA    . GLN A 1 133 ? 78.581 -9.579  -15.871 1.00 43.17  ? 130  GLN A CA    1 
ATOM   1077 C  C     . GLN A 1 133 ? 79.391 -8.288  -15.970 1.00 45.03  ? 130  GLN A C     1 
ATOM   1078 O  O     . GLN A 1 133 ? 80.516 -8.292  -16.461 1.00 57.62  ? 130  GLN A O     1 
ATOM   1079 C  CB    . GLN A 1 133 ? 77.880 -9.877  -17.196 1.00 50.12  ? 130  GLN A CB    1 
ATOM   1080 C  CG    . GLN A 1 133 ? 77.157 -8.694  -17.809 1.00 58.58  ? 130  GLN A CG    1 
ATOM   1081 C  CD    . GLN A 1 133 ? 76.240 -9.100  -18.948 1.00 63.04  ? 130  GLN A CD    1 
ATOM   1082 O  OE1   . GLN A 1 133 ? 76.137 -10.281 -19.287 1.00 66.36  ? 130  GLN A OE1   1 
ATOM   1083 N  NE2   . GLN A 1 133 ? 75.562 -8.121  -19.543 1.00 49.60  ? 130  GLN A NE2   1 
ATOM   1084 N  N     . LYS A 1 134 ? 78.823 -7.185  -15.492 1.00 41.85  ? 131  LYS A N     1 
ATOM   1085 C  CA    . LYS A 1 134 ? 79.556 -5.922  -15.419 1.00 52.89  ? 131  LYS A CA    1 
ATOM   1086 C  C     . LYS A 1 134 ? 80.655 -6.009  -14.362 1.00 57.57  ? 131  LYS A C     1 
ATOM   1087 O  O     . LYS A 1 134 ? 81.762 -5.501  -14.553 1.00 50.52  ? 131  LYS A O     1 
ATOM   1088 C  CB    . LYS A 1 134 ? 78.611 -4.758  -15.100 1.00 47.66  ? 131  LYS A CB    1 
ATOM   1089 C  CG    . LYS A 1 134 ? 79.309 -3.432  -14.822 1.00 50.75  ? 131  LYS A CG    1 
ATOM   1090 C  CD    . LYS A 1 134 ? 78.375 -2.423  -14.155 1.00 53.20  ? 131  LYS A CD    1 
ATOM   1091 C  CE    . LYS A 1 134 ? 77.166 -2.107  -15.029 1.00 40.36  ? 131  LYS A CE    1 
ATOM   1092 N  NZ    . LYS A 1 134 ? 76.213 -1.167  -14.360 1.00 41.91  ? 131  LYS A NZ    1 
ATOM   1093 N  N     . LEU A 1 135 ? 80.341 -6.669  -13.251 1.00 51.74  ? 132  LEU A N     1 
ATOM   1094 C  CA    . LEU A 1 135 ? 81.257 -6.764  -12.121 1.00 56.69  ? 132  LEU A CA    1 
ATOM   1095 C  C     . LEU A 1 135 ? 82.517 -7.551  -12.458 1.00 62.03  ? 132  LEU A C     1 
ATOM   1096 O  O     . LEU A 1 135 ? 83.577 -7.297  -11.880 1.00 63.95  ? 132  LEU A O     1 
ATOM   1097 C  CB    . LEU A 1 135 ? 80.553 -7.397  -10.917 1.00 54.16  ? 132  LEU A CB    1 
ATOM   1098 C  CG    . LEU A 1 135 ? 79.588 -6.471  -10.171 1.00 46.45  ? 132  LEU A CG    1 
ATOM   1099 C  CD1   . LEU A 1 135 ? 79.066 -7.139  -8.910  1.00 46.65  ? 132  LEU A CD1   1 
ATOM   1100 C  CD2   . LEU A 1 135 ? 80.261 -5.144  -9.848  1.00 44.48  ? 132  LEU A CD2   1 
ATOM   1101 N  N     . GLN A 1 136 ? 82.392 -8.500  -13.386 1.00 60.23  ? 133  GLN A N     1 
ATOM   1102 C  CA    . GLN A 1 136 ? 83.518 -9.329  -13.820 1.00 66.48  ? 133  GLN A CA    1 
ATOM   1103 C  C     . GLN A 1 136 ? 84.094 -10.161 -12.676 1.00 64.46  ? 133  GLN A C     1 
ATOM   1104 O  O     . GLN A 1 136 ? 85.313 -10.235 -12.509 1.00 62.84  ? 133  GLN A O     1 
ATOM   1105 C  CB    . GLN A 1 136 ? 84.625 -8.461  -14.436 1.00 66.67  ? 133  GLN A CB    1 
ATOM   1106 C  CG    . GLN A 1 136 ? 84.212 -7.687  -15.680 1.00 68.18  ? 133  GLN A CG    1 
ATOM   1107 C  CD    . GLN A 1 136 ? 84.689 -8.344  -16.961 1.00 70.00  ? 133  GLN A CD    1 
ATOM   1108 O  OE1   . GLN A 1 136 ? 85.516 -9.259  -16.935 1.00 76.21  ? 133  GLN A OE1   1 
ATOM   1109 N  NE2   . GLN A 1 136 ? 84.169 -7.881  -18.092 1.00 64.83  ? 133  GLN A NE2   1 
ATOM   1110 N  N     . GLY A 1 137 ? 83.216 -10.779 -11.890 1.00 59.89  ? 134  GLY A N     1 
ATOM   1111 C  CA    . GLY A 1 137 ? 83.633 -11.645 -10.797 1.00 51.91  ? 134  GLY A CA    1 
ATOM   1112 C  C     . GLY A 1 137 ? 84.280 -10.915 -9.631  1.00 58.49  ? 134  GLY A C     1 
ATOM   1113 O  O     . GLY A 1 137 ? 84.918 -11.530 -8.779  1.00 51.43  ? 134  GLY A O     1 
ATOM   1114 N  N     . GLN A 1 138 ? 84.115 -9.598  -9.596  1.00 54.94  ? 135  GLN A N     1 
ATOM   1115 C  CA    . GLN A 1 138 ? 84.645 -8.774  -8.517  1.00 56.04  ? 135  GLN A CA    1 
ATOM   1116 C  C     . GLN A 1 138 ? 83.786 -8.899  -7.260  1.00 56.15  ? 135  GLN A C     1 
ATOM   1117 O  O     . GLN A 1 138 ? 82.560 -8.877  -7.344  1.00 46.29  ? 135  GLN A O     1 
ATOM   1118 C  CB    . GLN A 1 138 ? 84.726 -7.313  -8.970  1.00 54.08  ? 135  GLN A CB    1 
ATOM   1119 C  CG    . GLN A 1 138 ? 85.109 -6.322  -7.884  1.00 60.24  ? 135  GLN A CG    1 
ATOM   1120 C  CD    . GLN A 1 138 ? 85.128 -4.896  -8.392  1.00 68.54  ? 135  GLN A CD    1 
ATOM   1121 O  OE1   . GLN A 1 138 ? 84.881 -4.643  -9.573  1.00 73.19  ? 135  GLN A OE1   1 
ATOM   1122 N  NE2   . GLN A 1 138 ? 85.421 -3.954  -7.504  1.00 63.41  ? 135  GLN A NE2   1 
ATOM   1123 N  N     . PRO A 1 139 ? 84.429 -9.029  -6.086  1.00 50.02  ? 136  PRO A N     1 
ATOM   1124 C  CA    . PRO A 1 139 ? 83.704 -9.139  -4.815  1.00 45.92  ? 136  PRO A CA    1 
ATOM   1125 C  C     . PRO A 1 139 ? 82.831 -7.921  -4.531  1.00 44.10  ? 136  PRO A C     1 
ATOM   1126 O  O     . PRO A 1 139 ? 83.076 -6.843  -5.071  1.00 40.33  ? 136  PRO A O     1 
ATOM   1127 C  CB    . PRO A 1 139 ? 84.828 -9.245  -3.777  1.00 50.41  ? 136  PRO A CB    1 
ATOM   1128 C  CG    . PRO A 1 139 ? 86.011 -8.631  -4.442  1.00 47.95  ? 136  PRO A CG    1 
ATOM   1129 C  CD    . PRO A 1 139 ? 85.885 -9.034  -5.875  1.00 51.42  ? 136  PRO A CD    1 
ATOM   1130 N  N     . ILE A 1 140 ? 81.813 -8.096  -3.699  1.00 39.82  ? 137  ILE A N     1 
ATOM   1131 C  CA    . ILE A 1 140 ? 80.949 -6.985  -3.335  1.00 26.97  ? 137  ILE A CA    1 
ATOM   1132 C  C     . ILE A 1 140 ? 81.361 -6.388  -2.002  1.00 26.78  ? 137  ILE A C     1 
ATOM   1133 O  O     . ILE A 1 140 ? 81.389 -7.071  -0.981  1.00 28.21  ? 137  ILE A O     1 
ATOM   1134 C  CB    . ILE A 1 140 ? 79.487 -7.420  -3.280  1.00 31.28  ? 137  ILE A CB    1 
ATOM   1135 C  CG1   . ILE A 1 140 ? 79.056 -7.898  -4.670  1.00 39.42  ? 137  ILE A CG1   1 
ATOM   1136 C  CG2   . ILE A 1 140 ? 78.614 -6.271  -2.809  1.00 22.19  ? 137  ILE A CG2   1 
ATOM   1137 C  CD1   . ILE A 1 140 ? 77.677 -8.465  -4.721  1.00 38.86  ? 137  ILE A CD1   1 
ATOM   1138 N  N     . SER A 1 141 ? 81.678 -5.101  -2.031  1.00 26.15  ? 138  SER A N     1 
ATOM   1139 C  CA    . SER A 1 141 ? 82.128 -4.373  -0.851  1.00 26.49  ? 138  SER A CA    1 
ATOM   1140 C  C     . SER A 1 141 ? 80.962 -4.009  0.067   1.00 25.19  ? 138  SER A C     1 
ATOM   1141 O  O     . SER A 1 141 ? 79.870 -3.688  -0.405  1.00 23.82  ? 138  SER A O     1 
ATOM   1142 C  CB    . SER A 1 141 ? 82.886 -3.112  -1.286  1.00 23.64  ? 138  SER A CB    1 
ATOM   1143 O  OG    . SER A 1 141 ? 82.930 -2.130  -0.263  1.00 33.88  ? 138  SER A OG    1 
ATOM   1144 N  N     . ALA A 1 142 ? 81.199 -4.055  1.376   1.00 18.66  ? 139  ALA A N     1 
ATOM   1145 C  CA    . ALA A 1 142 ? 80.199 -3.618  2.347   1.00 22.69  ? 139  ALA A CA    1 
ATOM   1146 C  C     . ALA A 1 142 ? 79.735 -2.180  2.096   1.00 27.95  ? 139  ALA A C     1 
ATOM   1147 O  O     . ALA A 1 142 ? 78.618 -1.809  2.461   1.00 19.90  ? 139  ALA A O     1 
ATOM   1148 C  CB    . ALA A 1 142 ? 80.741 -3.750  3.760   1.00 27.45  ? 139  ALA A CB    1 
ATOM   1149 N  N     . ASP A 1 143 ? 80.608 -1.382  1.485   1.00 31.56  ? 140  ASP A N     1 
ATOM   1150 C  CA    . ASP A 1 143 ? 80.318 0.012   1.171   1.00 33.88  ? 140  ASP A CA    1 
ATOM   1151 C  C     . ASP A 1 143 ? 79.176 0.152   0.182   1.00 27.22  ? 140  ASP A C     1 
ATOM   1152 O  O     . ASP A 1 143 ? 78.501 1.179   0.148   1.00 26.60  ? 140  ASP A O     1 
ATOM   1153 C  CB    . ASP A 1 143 ? 81.557 0.701   0.606   1.00 28.62  ? 140  ASP A CB    1 
ATOM   1154 C  CG    . ASP A 1 143 ? 82.700 0.747   1.595   1.00 49.91  ? 140  ASP A CG    1 
ATOM   1155 O  OD1   . ASP A 1 143 ? 82.437 0.693   2.817   1.00 43.99  ? 140  ASP A OD1   1 
ATOM   1156 O  OD2   . ASP A 1 143 ? 83.865 0.842   1.147   1.00 64.96  ? 140  ASP A OD2   1 
ATOM   1157 N  N     . LEU A 1 144 ? 78.965 -0.876  -0.630  1.00 20.11  ? 141  LEU A N     1 
ATOM   1158 C  CA    . LEU A 1 144 ? 77.867 -0.852  -1.585  1.00 22.44  ? 141  LEU A CA    1 
ATOM   1159 C  C     . LEU A 1 144 ? 76.518 -1.184  -0.936  1.00 20.41  ? 141  LEU A C     1 
ATOM   1160 O  O     . LEU A 1 144 ? 75.483 -1.084  -1.586  1.00 20.09  ? 141  LEU A O     1 
ATOM   1161 C  CB    . LEU A 1 144 ? 78.142 -1.815  -2.727  1.00 25.27  ? 141  LEU A CB    1 
ATOM   1162 C  CG    . LEU A 1 144 ? 79.400 -1.525  -3.543  1.00 31.03  ? 141  LEU A CG    1 
ATOM   1163 C  CD1   . LEU A 1 144 ? 79.555 -2.554  -4.641  1.00 33.22  ? 141  LEU A CD1   1 
ATOM   1164 C  CD2   . LEU A 1 144 ? 79.317 -0.129  -4.127  1.00 34.64  ? 141  LEU A CD2   1 
ATOM   1165 N  N     . LEU A 1 145 ? 76.536 -1.571  0.339   1.00 17.63  ? 142  LEU A N     1 
ATOM   1166 C  CA    . LEU A 1 145 ? 75.307 -1.959  1.044   1.00 17.34  ? 142  LEU A CA    1 
ATOM   1167 C  C     . LEU A 1 145 ? 75.167 -1.221  2.372   1.00 18.81  ? 142  LEU A C     1 
ATOM   1168 O  O     . LEU A 1 145 ? 75.062 -1.846  3.429   1.00 15.45  ? 142  LEU A O     1 
ATOM   1169 C  CB    . LEU A 1 145 ? 75.296 -3.481  1.269   1.00 15.84  ? 142  LEU A CB    1 
ATOM   1170 C  CG    . LEU A 1 145 ? 75.215 -4.329  0.001   1.00 18.83  ? 142  LEU A CG    1 
ATOM   1171 C  CD1   . LEU A 1 145 ? 75.709 -5.768  0.213   1.00 15.42  ? 142  LEU A CD1   1 
ATOM   1172 C  CD2   . LEU A 1 145 ? 73.791 -4.345  -0.493  1.00 18.42  ? 142  LEU A CD2   1 
ATOM   1173 N  N     . PRO A 1 146 ? 75.161 0.124   2.331   1.00 25.89  ? 143  PRO A N     1 
ATOM   1174 C  CA    . PRO A 1 146 ? 75.305 0.885   3.576   1.00 22.62  ? 143  PRO A CA    1 
ATOM   1175 C  C     . PRO A 1 146 ? 74.066 0.908   4.452   1.00 19.62  ? 143  PRO A C     1 
ATOM   1176 O  O     . PRO A 1 146 ? 74.142 1.393   5.572   1.00 17.99  ? 143  PRO A O     1 
ATOM   1177 C  CB    . PRO A 1 146 ? 75.632 2.300   3.075   1.00 22.95  ? 143  PRO A CB    1 
ATOM   1178 C  CG    . PRO A 1 146 ? 74.974 2.375   1.746   1.00 25.99  ? 143  PRO A CG    1 
ATOM   1179 C  CD    . PRO A 1 146 ? 75.138 1.007   1.149   1.00 16.32  ? 143  PRO A CD    1 
ATOM   1180 N  N     . SER A 1 147 ? 72.938 0.410   3.959   1.00 17.77  ? 144  SER A N     1 
ATOM   1181 C  CA    . SER A 1 147 ? 71.720 0.426   4.768   1.00 17.23  ? 144  SER A CA    1 
ATOM   1182 C  C     . SER A 1 147 ? 71.037 -0.941  4.804   1.00 12.81  ? 144  SER A C     1 
ATOM   1183 O  O     . SER A 1 147 ? 69.870 -1.041  5.174   1.00 12.47  ? 144  SER A O     1 
ATOM   1184 C  CB    . SER A 1 147 ? 70.737 1.481   4.239   1.00 14.86  ? 144  SER A CB    1 
ATOM   1185 O  OG    . SER A 1 147 ? 70.384 1.222   2.884   1.00 20.75  ? 144  SER A OG    1 
ATOM   1186 N  N     . THR A 1 148 ? 71.781 -1.977  4.429   1.00 16.02  ? 145  THR A N     1 
ATOM   1187 C  CA    . THR A 1 148 ? 71.239 -3.328  4.274   1.00 18.11  ? 145  THR A CA    1 
ATOM   1188 C  C     . THR A 1 148 ? 71.450 -4.181  5.527   1.00 13.56  ? 145  THR A C     1 
ATOM   1189 O  O     . THR A 1 148 ? 72.546 -4.202  6.091   1.00 15.97  ? 145  THR A O     1 
ATOM   1190 C  CB    . THR A 1 148 ? 71.891 -4.042  3.063   1.00 12.83  ? 145  THR A CB    1 
ATOM   1191 O  OG1   . THR A 1 148 ? 71.514 -3.367  1.856   1.00 14.26  ? 145  THR A OG1   1 
ATOM   1192 C  CG2   . THR A 1 148 ? 71.456 -5.528  2.973   1.00 12.74  ? 145  THR A CG2   1 
ATOM   1193 N  N     . TYR A 1 149 ? 70.383 -4.856  5.952   1.00 13.63  ? 146  TYR A N     1 
ATOM   1194 C  CA    . TYR A 1 149 ? 70.422 -5.895  6.978   1.00 18.46  ? 146  TYR A CA    1 
ATOM   1195 C  C     . TYR A 1 149 ? 70.348 -7.246  6.323   1.00 17.40  ? 146  TYR A C     1 
ATOM   1196 O  O     . TYR A 1 149 ? 69.588 -7.422  5.374   1.00 16.57  ? 146  TYR A O     1 
ATOM   1197 C  CB    . TYR A 1 149 ? 69.249 -5.777  7.942   1.00 14.11  ? 146  TYR A CB    1 
ATOM   1198 C  CG    . TYR A 1 149 ? 69.425 -4.721  8.983   1.00 14.15  ? 146  TYR A CG    1 
ATOM   1199 C  CD1   . TYR A 1 149 ? 69.843 -5.055  10.263  1.00 16.20  ? 146  TYR A CD1   1 
ATOM   1200 C  CD2   . TYR A 1 149 ? 69.174 -3.384  8.689   1.00 15.31  ? 146  TYR A CD2   1 
ATOM   1201 C  CE1   . TYR A 1 149 ? 70.008 -4.086  11.226  1.00 17.52  ? 146  TYR A CE1   1 
ATOM   1202 C  CE2   . TYR A 1 149 ? 69.342 -2.408  9.640   1.00 17.45  ? 146  TYR A CE2   1 
ATOM   1203 C  CZ    . TYR A 1 149 ? 69.762 -2.761  10.906  1.00 19.24  ? 146  TYR A CZ    1 
ATOM   1204 O  OH    . TYR A 1 149 ? 69.924 -1.786  11.861  1.00 26.94  ? 146  TYR A OH    1 
ATOM   1205 N  N     . ILE A 1 150 ? 71.101 -8.207  6.848   1.00 11.31  ? 147  ILE A N     1 
ATOM   1206 C  CA    . ILE A 1 150 ? 70.979 -9.588  6.388   1.00 11.77  ? 147  ILE A CA    1 
ATOM   1207 C  C     . ILE A 1 150 ? 70.233 -10.358 7.466   1.00 15.12  ? 147  ILE A C     1 
ATOM   1208 O  O     . ILE A 1 150 ? 70.749 -10.533 8.570   1.00 15.49  ? 147  ILE A O     1 
ATOM   1209 C  CB    . ILE A 1 150 ? 72.347 -10.244 6.123   1.00 11.72  ? 147  ILE A CB    1 
ATOM   1210 C  CG1   . ILE A 1 150 ? 73.202 -9.355  5.213   1.00 14.78  ? 147  ILE A CG1   1 
ATOM   1211 C  CG2   . ILE A 1 150 ? 72.145 -11.669 5.529   1.00 12.90  ? 147  ILE A CG2   1 
ATOM   1212 C  CD1   . ILE A 1 150 ? 72.619 -9.155  3.812   1.00 16.06  ? 147  ILE A CD1   1 
ATOM   1213 N  N     . GLU A 1 151 ? 69.006 -10.781 7.173   1.00 11.03  ? 148  GLU A N     1 
ATOM   1214 C  CA    . GLU A 1 151 ? 68.165 -11.362 8.213   1.00 10.72  ? 148  GLU A CA    1 
ATOM   1215 C  C     . GLU A 1 151 ? 68.760 -12.679 8.720   1.00 14.82  ? 148  GLU A C     1 
ATOM   1216 O  O     . GLU A 1 151 ? 69.133 -13.533 7.927   1.00 13.14  ? 148  GLU A O     1 
ATOM   1217 C  CB    . GLU A 1 151 ? 66.743 -11.587 7.697   1.00 15.41  ? 148  GLU A CB    1 
ATOM   1218 C  CG    . GLU A 1 151 ? 65.865 -12.451 8.634   1.00 16.00  ? 148  GLU A CG    1 
ATOM   1219 C  CD    . GLU A 1 151 ? 65.637 -11.816 9.989   1.00 19.26  ? 148  GLU A CD    1 
ATOM   1220 O  OE1   . GLU A 1 151 ? 65.363 -12.551 10.960  1.00 20.64  ? 148  GLU A OE1   1 
ATOM   1221 O  OE2   . GLU A 1 151 ? 65.711 -10.580 10.077  1.00 23.06  ? 148  GLU A OE2   1 
ATOM   1222 N  N     . GLY A 1 152 ? 68.851 -12.823 10.040  1.00 15.36  ? 149  GLY A N     1 
ATOM   1223 C  CA    . GLY A 1 152 ? 69.386 -14.029 10.648  1.00 17.16  ? 149  GLY A CA    1 
ATOM   1224 C  C     . GLY A 1 152 ? 70.843 -13.897 11.059  1.00 22.32  ? 149  GLY A C     1 
ATOM   1225 O  O     . GLY A 1 152 ? 71.377 -14.747 11.779  1.00 21.45  ? 149  GLY A O     1 
ATOM   1226 N  N     . LEU A 1 153 ? 71.496 -12.835 10.596  1.00 17.62  ? 150  LEU A N     1 
ATOM   1227 C  CA    . LEU A 1 153 ? 72.892 -12.582 10.940  1.00 12.88  ? 150  LEU A CA    1 
ATOM   1228 C  C     . LEU A 1 153 ? 72.998 -11.292 11.750  1.00 22.33  ? 150  LEU A C     1 
ATOM   1229 O  O     . LEU A 1 153 ? 72.141 -10.417 11.621  1.00 17.46  ? 150  LEU A O     1 
ATOM   1230 C  CB    . LEU A 1 153 ? 73.752 -12.507 9.674   1.00 13.79  ? 150  LEU A CB    1 
ATOM   1231 C  CG    . LEU A 1 153 ? 73.799 -13.768 8.811   1.00 14.85  ? 150  LEU A CG    1 
ATOM   1232 C  CD1   . LEU A 1 153 ? 74.683 -13.576 7.593   1.00 14.09  ? 150  LEU A CD1   1 
ATOM   1233 C  CD2   . LEU A 1 153 ? 74.242 -14.990 9.627   1.00 20.76  ? 150  LEU A CD2   1 
ATOM   1234 N  N     . PRO A 1 154 ? 74.032 -11.175 12.613  1.00 22.56  ? 151  PRO A N     1 
ATOM   1235 C  CA    . PRO A 1 154 ? 75.089 -12.164 12.881  1.00 19.00  ? 151  PRO A CA    1 
ATOM   1236 C  C     . PRO A 1 154 ? 74.628 -13.326 13.739  1.00 16.88  ? 151  PRO A C     1 
ATOM   1237 O  O     . PRO A 1 154 ? 73.634 -13.240 14.449  1.00 23.33  ? 151  PRO A O     1 
ATOM   1238 C  CB    . PRO A 1 154 ? 76.155 -11.351 13.629  1.00 22.36  ? 151  PRO A CB    1 
ATOM   1239 C  CG    . PRO A 1 154 ? 75.382 -10.273 14.316  1.00 28.98  ? 151  PRO A CG    1 
ATOM   1240 C  CD    . PRO A 1 154 ? 74.237 -9.931  13.376  1.00 20.93  ? 151  PRO A CD    1 
ATOM   1241 N  N     . GLN A 1 155 ? 75.374 -14.416 13.675  1.00 26.58  ? 152  GLN A N     1 
ATOM   1242 C  CA    . GLN A 1 155 ? 75.073 -15.590 14.473  1.00 34.47  ? 152  GLN A CA    1 
ATOM   1243 C  C     . GLN A 1 155 ? 76.380 -16.222 14.922  1.00 42.46  ? 152  GLN A C     1 
ATOM   1244 O  O     . GLN A 1 155 ? 77.388 -16.089 14.234  1.00 33.59  ? 152  GLN A O     1 
ATOM   1245 C  CB    . GLN A 1 155 ? 74.250 -16.593 13.671  1.00 31.67  ? 152  GLN A CB    1 
ATOM   1246 C  CG    . GLN A 1 155 ? 74.799 -18.005 13.757  1.00 42.43  ? 152  GLN A CG    1 
ATOM   1247 C  CD    . GLN A 1 155 ? 74.538 -18.802 12.519  1.00 46.04  ? 152  GLN A CD    1 
ATOM   1248 O  OE1   . GLN A 1 155 ? 73.382 -19.043 12.171  1.00 40.45  ? 152  GLN A OE1   1 
ATOM   1249 N  NE2   . GLN A 1 155 ? 75.611 -19.219 11.833  1.00 29.39  ? 152  GLN A NE2   1 
ATOM   1250 N  N     . GLY A 1 156 ? 76.372 -16.884 16.076  1.00 47.80  ? 153  GLY A N     1 
ATOM   1251 C  CA    . GLY A 1 156 ? 77.473 -17.759 16.449  1.00 52.73  ? 153  GLY A CA    1 
ATOM   1252 C  C     . GLY A 1 156 ? 78.582 -17.153 17.288  1.00 52.25  ? 153  GLY A C     1 
ATOM   1253 O  O     . GLY A 1 156 ? 78.433 -16.064 17.842  1.00 65.94  ? 153  GLY A O     1 
ATOM   1254 N  N     . PRO A 1 157 ? 79.711 -17.875 17.390  1.00 63.59  ? 154  PRO A N     1 
ATOM   1255 C  CA    . PRO A 1 157 ? 80.862 -17.510 18.225  1.00 57.63  ? 154  PRO A CA    1 
ATOM   1256 C  C     . PRO A 1 157 ? 81.765 -16.447 17.597  1.00 47.21  ? 154  PRO A C     1 
ATOM   1257 O  O     . PRO A 1 157 ? 81.912 -16.398 16.375  1.00 62.34  ? 154  PRO A O     1 
ATOM   1258 C  CB    . PRO A 1 157 ? 81.607 -18.839 18.381  1.00 47.24  ? 154  PRO A CB    1 
ATOM   1259 C  CG    . PRO A 1 157 ? 81.269 -19.605 17.140  1.00 37.46  ? 154  PRO A CG    1 
ATOM   1260 C  CD    . PRO A 1 157 ? 79.875 -19.201 16.761  1.00 53.78  ? 154  PRO A CD    1 
ATOM   1261 N  N     . THR A 1 163 ? 79.794 -5.998  20.682  1.00 72.47  ? 160  THR A N     1 
ATOM   1262 C  CA    . THR A 1 163 ? 79.077 -4.790  20.283  1.00 70.90  ? 160  THR A CA    1 
ATOM   1263 C  C     . THR A 1 163 ? 77.631 -4.814  20.774  1.00 61.98  ? 160  THR A C     1 
ATOM   1264 O  O     . THR A 1 163 ? 76.977 -5.860  20.782  1.00 67.73  ? 160  THR A O     1 
ATOM   1265 C  CB    . THR A 1 163 ? 79.095 -4.597  18.745  1.00 71.59  ? 160  THR A CB    1 
ATOM   1266 O  OG1   . THR A 1 163 ? 78.278 -3.472  18.394  1.00 63.00  ? 160  THR A OG1   1 
ATOM   1267 C  CG2   . THR A 1 163 ? 78.576 -5.843  18.027  1.00 69.52  ? 160  THR A CG2   1 
ATOM   1268 N  N     . VAL A 1 164 ? 77.139 -3.651  21.186  1.00 54.89  ? 161  VAL A N     1 
ATOM   1269 C  CA    . VAL A 1 164 ? 75.804 -3.538  21.761  1.00 59.32  ? 161  VAL A CA    1 
ATOM   1270 C  C     . VAL A 1 164 ? 74.984 -2.439  21.074  1.00 57.17  ? 161  VAL A C     1 
ATOM   1271 O  O     . VAL A 1 164 ? 73.959 -1.996  21.595  1.00 51.45  ? 161  VAL A O     1 
ATOM   1272 C  CB    . VAL A 1 164 ? 75.878 -3.250  23.282  1.00 57.34  ? 161  VAL A CB    1 
ATOM   1273 C  CG1   . VAL A 1 164 ? 76.651 -4.355  24.002  1.00 40.50  ? 161  VAL A CG1   1 
ATOM   1274 C  CG2   . VAL A 1 164 ? 76.519 -1.888  23.541  1.00 51.16  ? 161  VAL A CG2   1 
ATOM   1275 N  N     . GLN A 1 165 ? 75.446 -2.011  19.901  1.00 39.89  ? 162  GLN A N     1 
ATOM   1276 C  CA    . GLN A 1 165 ? 74.813 -0.936  19.138  1.00 45.53  ? 162  GLN A CA    1 
ATOM   1277 C  C     . GLN A 1 165 ? 74.117 -1.505  17.906  1.00 42.36  ? 162  GLN A C     1 
ATOM   1278 O  O     . GLN A 1 165 ? 74.537 -2.528  17.374  1.00 37.35  ? 162  GLN A O     1 
ATOM   1279 C  CB    . GLN A 1 165 ? 75.852 0.101   18.719  1.00 50.25  ? 162  GLN A CB    1 
ATOM   1280 C  CG    . GLN A 1 165 ? 77.025 -0.524  17.976  1.00 58.74  ? 162  GLN A CG    1 
ATOM   1281 C  CD    . GLN A 1 165 ? 78.142 0.454   17.683  1.00 67.86  ? 162  GLN A CD    1 
ATOM   1282 O  OE1   . GLN A 1 165 ? 79.092 0.572   18.456  1.00 74.65  ? 162  GLN A OE1   1 
ATOM   1283 N  NE2   . GLN A 1 165 ? 78.042 1.150   16.555  1.00 65.20  ? 162  GLN A NE2   1 
ATOM   1284 N  N     . LYS A 1 166 ? 73.063 -0.841  17.448  1.00 36.24  ? 163  LYS A N     1 
ATOM   1285 C  CA    . LYS A 1 166 ? 72.270 -1.367  16.340  1.00 35.11  ? 163  LYS A CA    1 
ATOM   1286 C  C     . LYS A 1 166 ? 73.037 -1.377  15.010  1.00 26.11  ? 163  LYS A C     1 
ATOM   1287 O  O     . LYS A 1 166 ? 73.032 -2.376  14.294  1.00 27.64  ? 163  LYS A O     1 
ATOM   1288 C  CB    . LYS A 1 166 ? 70.977 -0.564  16.203  1.00 42.62  ? 163  LYS A CB    1 
ATOM   1289 C  CG    . LYS A 1 166 ? 70.067 -1.016  15.078  1.00 38.54  ? 163  LYS A CG    1 
ATOM   1290 C  CD    . LYS A 1 166 ? 69.337 0.179   14.499  1.00 53.36  ? 163  LYS A CD    1 
ATOM   1291 C  CE    . LYS A 1 166 ? 70.303 1.344   14.285  1.00 46.86  ? 163  LYS A CE    1 
ATOM   1292 N  NZ    . LYS A 1 166 ? 69.719 2.449   13.482  1.00 52.12  ? 163  LYS A NZ    1 
ATOM   1293 N  N     . GLU A 1 167 ? 73.693 -0.271  14.676  1.00 32.79  ? 164  GLU A N     1 
ATOM   1294 C  CA    . GLU A 1 167 ? 74.461 -0.194  13.436  1.00 33.30  ? 164  GLU A CA    1 
ATOM   1295 C  C     . GLU A 1 167 ? 75.650 -1.157  13.458  1.00 31.63  ? 164  GLU A C     1 
ATOM   1296 O  O     . GLU A 1 167 ? 76.096 -1.646  12.417  1.00 27.27  ? 164  GLU A O     1 
ATOM   1297 C  CB    . GLU A 1 167 ? 74.927 1.249   13.191  1.00 38.20  ? 164  GLU A CB    1 
ATOM   1298 C  CG    . GLU A 1 167 ? 75.945 1.438   12.060  1.00 29.37  ? 164  GLU A CG    1 
ATOM   1299 C  CD    . GLU A 1 167 ? 75.414 1.050   10.684  1.00 36.68  ? 164  GLU A CD    1 
ATOM   1300 O  OE1   . GLU A 1 167 ? 76.245 0.877   9.762   1.00 34.67  ? 164  GLU A OE1   1 
ATOM   1301 O  OE2   . GLU A 1 167 ? 74.177 0.925   10.517  1.00 35.55  ? 164  GLU A OE2   1 
ATOM   1302 N  N     . GLY A 1 168 ? 76.159 -1.428  14.653  1.00 35.95  ? 165  GLY A N     1 
ATOM   1303 C  CA    . GLY A 1 168 ? 77.273 -2.338  14.809  1.00 39.01  ? 165  GLY A CA    1 
ATOM   1304 C  C     . GLY A 1 168 ? 76.841 -3.761  14.541  1.00 31.28  ? 165  GLY A C     1 
ATOM   1305 O  O     . GLY A 1 168 ? 77.560 -4.523  13.894  1.00 32.82  ? 165  GLY A O     1 
ATOM   1306 N  N     . MET A 1 169 ? 75.667 -4.117  15.056  1.00 33.74  ? 166  MET A N     1 
ATOM   1307 C  CA    . MET A 1 169 ? 75.053 -5.408  14.762  1.00 25.34  ? 166  MET A CA    1 
ATOM   1308 C  C     . MET A 1 169 ? 74.793 -5.542  13.263  1.00 23.33  ? 166  MET A C     1 
ATOM   1309 O  O     . MET A 1 169 ? 75.046 -6.596  12.676  1.00 24.92  ? 166  MET A O     1 
ATOM   1310 C  CB    . MET A 1 169 ? 73.746 -5.583  15.546  1.00 33.13  ? 166  MET A CB    1 
ATOM   1311 C  CG    . MET A 1 169 ? 73.923 -5.671  17.062  1.00 52.01  ? 166  MET A CG    1 
ATOM   1312 S  SD    . MET A 1 169 ? 74.678 -7.222  17.605  1.00 69.58  ? 166  MET A SD    1 
ATOM   1313 C  CE    . MET A 1 169 ? 73.430 -8.404  17.075  1.00 39.64  ? 166  MET A CE    1 
ATOM   1314 N  N     . ARG A 1 170 ? 74.314 -4.469  12.636  1.00 22.22  ? 167  ARG A N     1 
ATOM   1315 C  CA    . ARG A 1 170 ? 74.017 -4.516  11.208  1.00 17.85  ? 167  ARG A CA    1 
ATOM   1316 C  C     . ARG A 1 170 ? 75.261 -4.847  10.423  1.00 26.30  ? 167  ARG A C     1 
ATOM   1317 O  O     . ARG A 1 170 ? 75.221 -5.712  9.556   1.00 18.79  ? 167  ARG A O     1 
ATOM   1318 C  CB    . ARG A 1 170 ? 73.441 -3.189  10.689  1.00 20.37  ? 167  ARG A CB    1 
ATOM   1319 C  CG    . ARG A 1 170 ? 73.093 -3.226  9.187   1.00 15.62  ? 167  ARG A CG    1 
ATOM   1320 C  CD    . ARG A 1 170 ? 72.937 -1.814  8.587   1.00 21.84  ? 167  ARG A CD    1 
ATOM   1321 N  NE    . ARG A 1 170 ? 74.219 -1.166  8.318   1.00 20.52  ? 167  ARG A NE    1 
ATOM   1322 C  CZ    . ARG A 1 170 ? 74.943 -1.366  7.223   1.00 20.21  ? 167  ARG A CZ    1 
ATOM   1323 N  NH1   . ARG A 1 170 ? 74.524 -2.208  6.292   1.00 21.30  ? 167  ARG A NH1   1 
ATOM   1324 N  NH2   . ARG A 1 170 ? 76.094 -0.729  7.057   1.00 20.74  ? 167  ARG A NH2   1 
ATOM   1325 N  N     . LYS A 1 171 ? 76.357 -4.144  10.721  1.00 21.34  ? 168  LYS A N     1 
ATOM   1326 C  CA    . LYS A 1 171 ? 77.615 -4.332  10.002  1.00 18.43  ? 168  LYS A CA    1 
ATOM   1327 C  C     . LYS A 1 171 ? 78.180 -5.727  10.244  1.00 22.70  ? 168  LYS A C     1 
ATOM   1328 O  O     . LYS A 1 171 ? 78.694 -6.358  9.327   1.00 22.28  ? 168  LYS A O     1 
ATOM   1329 C  CB    . LYS A 1 171 ? 78.653 -3.281  10.410  1.00 35.99  ? 168  LYS A CB    1 
ATOM   1330 C  CG    . LYS A 1 171 ? 78.527 -1.935  9.706   1.00 41.10  ? 168  LYS A CG    1 
ATOM   1331 C  CD    . LYS A 1 171 ? 79.768 -1.073  9.968   1.00 43.20  ? 168  LYS A CD    1 
ATOM   1332 C  CE    . LYS A 1 171 ? 79.721 0.266   9.239   1.00 43.59  ? 168  LYS A CE    1 
ATOM   1333 N  NZ    . LYS A 1 171 ? 78.745 1.219   9.856   1.00 54.02  ? 168  LYS A NZ    1 
ATOM   1334 N  N     . GLN A 1 172 ? 78.076 -6.199  11.482  1.00 20.41  ? 169  GLN A N     1 
ATOM   1335 C  CA    . GLN A 1 172 ? 78.550 -7.530  11.835  1.00 24.39  ? 169  GLN A CA    1 
ATOM   1336 C  C     . GLN A 1 172 ? 77.888 -8.600  10.975  1.00 21.80  ? 169  GLN A C     1 
ATOM   1337 O  O     . GLN A 1 172 ? 78.570 -9.439  10.412  1.00 16.81  ? 169  GLN A O     1 
ATOM   1338 C  CB    . GLN A 1 172 ? 78.291 -7.838  13.310  1.00 28.54  ? 169  GLN A CB    1 
ATOM   1339 C  CG    . GLN A 1 172 ? 79.468 -7.578  14.218  1.00 51.73  ? 169  GLN A CG    1 
ATOM   1340 C  CD    . GLN A 1 172 ? 79.529 -8.566  15.366  1.00 74.74  ? 169  GLN A CD    1 
ATOM   1341 O  OE1   . GLN A 1 172 ? 78.510 -8.881  15.986  1.00 75.35  ? 169  GLN A OE1   1 
ATOM   1342 N  NE2   . GLN A 1 172 ? 80.726 -9.075  15.646  1.00 74.05  ? 169  GLN A NE2   1 
ATOM   1343 N  N     . GLY A 1 173 ? 76.563 -8.561  10.870  1.00 19.22  ? 170  GLY A N     1 
ATOM   1344 C  CA    . GLY A 1 173 ? 75.856 -9.533  10.052  1.00 14.93  ? 170  GLY A CA    1 
ATOM   1345 C  C     . GLY A 1 173 ? 76.242 -9.435  8.590   1.00 14.29  ? 170  GLY A C     1 
ATOM   1346 O  O     . GLY A 1 173 ? 76.445 -10.449 7.914   1.00 16.99  ? 170  GLY A O     1 
ATOM   1347 N  N     . LEU A 1 174 ? 76.352 -8.202  8.101   1.00 20.12  ? 171  LEU A N     1 
ATOM   1348 C  CA    . LEU A 1 174 ? 76.725 -7.954  6.716   1.00 21.21  ? 171  LEU A CA    1 
ATOM   1349 C  C     . LEU A 1 174 ? 78.119 -8.487  6.414   1.00 24.34  ? 171  LEU A C     1 
ATOM   1350 O  O     . LEU A 1 174 ? 78.358 -9.070  5.356   1.00 21.39  ? 171  LEU A O     1 
ATOM   1351 C  CB    . LEU A 1 174 ? 76.665 -6.453  6.409   1.00 18.85  ? 171  LEU A CB    1 
ATOM   1352 C  CG    . LEU A 1 174 ? 77.022 -6.060  4.979   1.00 16.26  ? 171  LEU A CG    1 
ATOM   1353 C  CD1   . LEU A 1 174 ? 76.114 -6.780  3.999   1.00 18.28  ? 171  LEU A CD1   1 
ATOM   1354 C  CD2   . LEU A 1 174 ? 76.931 -4.548  4.798   1.00 18.85  ? 171  LEU A CD2   1 
ATOM   1355 N  N     . PHE A 1 175 ? 79.044 -8.279  7.343   1.00 20.32  ? 172  PHE A N     1 
ATOM   1356 C  CA    . PHE A 1 175 ? 80.389 -8.821  7.171   1.00 24.14  ? 172  PHE A CA    1 
ATOM   1357 C  C     . PHE A 1 175 ? 80.348 -10.352 7.055   1.00 20.88  ? 172  PHE A C     1 
ATOM   1358 O  O     . PHE A 1 175 ? 80.958 -10.929 6.144   1.00 22.87  ? 172  PHE A O     1 
ATOM   1359 C  CB    . PHE A 1 175 ? 81.290 -8.404  8.326   1.00 21.68  ? 172  PHE A CB    1 
ATOM   1360 C  CG    . PHE A 1 175 ? 81.665 -6.947  8.312   1.00 41.49  ? 172  PHE A CG    1 
ATOM   1361 C  CD1   . PHE A 1 175 ? 81.751 -6.250  7.118   1.00 45.80  ? 172  PHE A CD1   1 
ATOM   1362 C  CD2   . PHE A 1 175 ? 81.931 -6.275  9.497   1.00 40.78  ? 172  PHE A CD2   1 
ATOM   1363 C  CE1   . PHE A 1 175 ? 82.096 -4.907  7.105   1.00 56.28  ? 172  PHE A CE1   1 
ATOM   1364 C  CE2   . PHE A 1 175 ? 82.281 -4.934  9.493   1.00 53.61  ? 172  PHE A CE2   1 
ATOM   1365 C  CZ    . PHE A 1 175 ? 82.360 -4.248  8.295   1.00 56.68  ? 172  PHE A CZ    1 
ATOM   1366 N  N     . GLN A 1 176 ? 79.613 -11.005 7.958   1.00 21.34  ? 173  GLN A N     1 
ATOM   1367 C  CA    . GLN A 1 176 ? 79.527 -12.471 7.945   1.00 20.03  ? 173  GLN A CA    1 
ATOM   1368 C  C     . GLN A 1 176 ? 78.968 -12.961 6.618   1.00 22.79  ? 173  GLN A C     1 
ATOM   1369 O  O     . GLN A 1 176 ? 79.433 -13.954 6.057   1.00 21.25  ? 173  GLN A O     1 
ATOM   1370 C  CB    . GLN A 1 176 ? 78.662 -12.997 9.105   1.00 20.26  ? 173  GLN A CB    1 
ATOM   1371 C  CG    . GLN A 1 176 ? 79.273 -12.803 10.493  1.00 26.05  ? 173  GLN A CG    1 
ATOM   1372 C  CD    . GLN A 1 176 ? 78.473 -13.471 11.603  1.00 28.20  ? 173  GLN A CD    1 
ATOM   1373 O  OE1   . GLN A 1 176 ? 77.433 -14.089 11.360  1.00 25.92  ? 173  GLN A OE1   1 
ATOM   1374 N  NE2   . GLN A 1 176 ? 78.967 -13.357 12.835  1.00 33.19  ? 173  GLN A NE2   1 
ATOM   1375 N  N     . TRP A 1 177 ? 77.971 -12.241 6.118   1.00 17.27  ? 174  TRP A N     1 
ATOM   1376 C  CA    . TRP A 1 177 ? 77.308 -12.590 4.871   1.00 17.08  ? 174  TRP A CA    1 
ATOM   1377 C  C     . TRP A 1 177 ? 78.275 -12.486 3.694   1.00 20.06  ? 174  TRP A C     1 
ATOM   1378 O  O     . TRP A 1 177 ? 78.454 -13.442 2.919   1.00 19.18  ? 174  TRP A O     1 
ATOM   1379 C  CB    . TRP A 1 177 ? 76.089 -11.672 4.659   1.00 12.10  ? 174  TRP A CB    1 
ATOM   1380 C  CG    . TRP A 1 177 ? 75.400 -11.848 3.339   1.00 15.25  ? 174  TRP A CG    1 
ATOM   1381 C  CD1   . TRP A 1 177 ? 75.472 -11.014 2.263   1.00 16.58  ? 174  TRP A CD1   1 
ATOM   1382 C  CD2   . TRP A 1 177 ? 74.525 -12.924 2.955   1.00 15.47  ? 174  TRP A CD2   1 
ATOM   1383 N  NE1   . TRP A 1 177 ? 74.705 -11.497 1.236   1.00 18.04  ? 174  TRP A NE1   1 
ATOM   1384 C  CE2   . TRP A 1 177 ? 74.107 -12.665 1.632   1.00 21.26  ? 174  TRP A CE2   1 
ATOM   1385 C  CE3   . TRP A 1 177 ? 74.062 -14.077 3.600   1.00 13.99  ? 174  TRP A CE3   1 
ATOM   1386 C  CZ2   . TRP A 1 177 ? 73.247 -13.517 0.938   1.00 14.88  ? 174  TRP A CZ2   1 
ATOM   1387 C  CZ3   . TRP A 1 177 ? 73.199 -14.922 2.918   1.00 18.51  ? 174  TRP A CZ3   1 
ATOM   1388 C  CH2   . TRP A 1 177 ? 72.798 -14.636 1.595   1.00 21.17  ? 174  TRP A CH2   1 
ATOM   1389 N  N     . LEU A 1 178 ? 78.905 -11.323 3.568   1.00 18.87  ? 175  LEU A N     1 
ATOM   1390 C  CA    . LEU A 1 178 ? 79.811 -11.072 2.448   1.00 21.97  ? 175  LEU A CA    1 
ATOM   1391 C  C     . LEU A 1 178 ? 81.034 -11.974 2.540   1.00 29.08  ? 175  LEU A C     1 
ATOM   1392 O  O     . LEU A 1 178 ? 81.590 -12.381 1.520   1.00 29.32  ? 175  LEU A O     1 
ATOM   1393 C  CB    . LEU A 1 178 ? 80.242 -9.604  2.413   1.00 19.06  ? 175  LEU A CB    1 
ATOM   1394 C  CG    . LEU A 1 178 ? 79.126 -8.588  2.134   1.00 20.16  ? 175  LEU A CG    1 
ATOM   1395 C  CD1   . LEU A 1 178 ? 79.664 -7.162  2.220   1.00 18.92  ? 175  LEU A CD1   1 
ATOM   1396 C  CD2   . LEU A 1 178 ? 78.468 -8.854  0.774   1.00 16.78  ? 175  LEU A CD2   1 
ATOM   1397 N  N     . ASP A 1 179 ? 81.436 -12.288 3.768   1.00 25.06  ? 176  ASP A N     1 
ATOM   1398 C  CA    . ASP A 1 179 ? 82.579 -13.177 4.001   1.00 30.54  ? 176  ASP A CA    1 
ATOM   1399 C  C     . ASP A 1 179 ? 82.310 -14.558 3.453   1.00 34.26  ? 176  ASP A C     1 
ATOM   1400 O  O     . ASP A 1 179 ? 83.227 -15.250 3.016   1.00 38.53  ? 176  ASP A O     1 
ATOM   1401 C  CB    . ASP A 1 179 ? 82.909 -13.281 5.494   1.00 27.00  ? 176  ASP A CB    1 
ATOM   1402 C  CG    . ASP A 1 179 ? 83.811 -12.168 5.966   1.00 45.33  ? 176  ASP A CG    1 
ATOM   1403 O  OD1   . ASP A 1 179 ? 84.559 -11.620 5.128   1.00 52.19  ? 176  ASP A OD1   1 
ATOM   1404 O  OD2   . ASP A 1 179 ? 83.777 -11.841 7.175   1.00 54.61  ? 176  ASP A OD2   1 
ATOM   1405 N  N     . SER A 1 180 ? 81.040 -14.949 3.470   1.00 31.10  ? 177  SER A N     1 
ATOM   1406 C  CA    . SER A 1 180 ? 80.645 -16.281 3.047   1.00 29.58  ? 177  SER A CA    1 
ATOM   1407 C  C     . SER A 1 180 ? 80.344 -16.415 1.557   1.00 32.34  ? 177  SER A C     1 
ATOM   1408 O  O     . SER A 1 180 ? 80.243 -17.531 1.051   1.00 36.21  ? 177  SER A O     1 
ATOM   1409 C  CB    . SER A 1 180 ? 79.417 -16.732 3.840   1.00 30.78  ? 177  SER A CB    1 
ATOM   1410 O  OG    . SER A 1 180 ? 79.720 -16.836 5.216   1.00 40.62  ? 177  SER A OG    1 
ATOM   1411 N  N     . LEU A 1 181 ? 80.189 -15.296 0.856   1.00 22.27  ? 178  LEU A N     1 
ATOM   1412 C  CA    . LEU A 1 181 ? 79.695 -15.337 -0.527  1.00 24.61  ? 178  LEU A CA    1 
ATOM   1413 C  C     . LEU A 1 181 ? 80.632 -16.023 -1.521  1.00 34.29  ? 178  LEU A C     1 
ATOM   1414 O  O     . LEU A 1 181 ? 81.838 -15.811 -1.481  1.00 37.99  ? 178  LEU A O     1 
ATOM   1415 C  CB    . LEU A 1 181 ? 79.422 -13.919 -1.031  1.00 34.94  ? 178  LEU A CB    1 
ATOM   1416 C  CG    . LEU A 1 181 ? 78.021 -13.333 -0.885  1.00 32.74  ? 178  LEU A CG    1 
ATOM   1417 C  CD1   . LEU A 1 181 ? 77.937 -11.978 -1.610  1.00 19.14  ? 178  LEU A CD1   1 
ATOM   1418 C  CD2   . LEU A 1 181 ? 76.971 -14.307 -1.411  1.00 33.14  ? 178  LEU A CD2   1 
ATOM   1419 N  N     . GLN A 1 182 ? 80.066 -16.826 -2.424  1.00 36.33  ? 179  GLN A N     1 
ATOM   1420 C  CA    . GLN A 1 182 ? 80.826 -17.320 -3.576  1.00 57.92  ? 179  GLN A CA    1 
ATOM   1421 C  C     . GLN A 1 182 ? 80.608 -16.425 -4.812  1.00 57.14  ? 179  GLN A C     1 
ATOM   1422 O  O     . GLN A 1 182 ? 79.727 -16.679 -5.643  1.00 53.90  ? 179  GLN A O     1 
ATOM   1423 C  CB    . GLN A 1 182 ? 80.466 -18.779 -3.893  1.00 54.65  ? 179  GLN A CB    1 
ATOM   1424 C  CG    . GLN A 1 182 ? 78.978 -19.105 -3.927  1.00 65.95  ? 179  GLN A CG    1 
ATOM   1425 C  CD    . GLN A 1 182 ? 78.705 -20.491 -4.507  1.00 73.55  ? 179  GLN A CD    1 
ATOM   1426 O  OE1   . GLN A 1 182 ? 79.523 -21.036 -5.253  1.00 75.38  ? 179  GLN A OE1   1 
ATOM   1427 N  NE2   . GLN A 1 182 ? 77.556 -21.065 -4.162  1.00 68.89  ? 179  GLN A NE2   1 
ATOM   1428 N  N     . ILE A 1 183 ? 81.439 -15.392 -4.932  1.00 45.82  ? 180  ILE A N     1 
ATOM   1429 C  CA    . ILE A 1 183 ? 81.251 -14.354 -5.946  1.00 56.98  ? 180  ILE A CA    1 
ATOM   1430 C  C     . ILE A 1 183 ? 81.733 -14.769 -7.341  1.00 60.90  ? 180  ILE A C     1 
ATOM   1431 O  O     . ILE A 1 183 ? 81.650 -13.992 -8.296  1.00 58.90  ? 180  ILE A O     1 
ATOM   1432 C  CB    . ILE A 1 183 ? 81.960 -13.044 -5.526  1.00 46.47  ? 180  ILE A CB    1 
ATOM   1433 C  CG1   . ILE A 1 183 ? 83.350 -13.332 -4.954  1.00 53.83  ? 180  ILE A CG1   1 
ATOM   1434 C  CG2   . ILE A 1 183 ? 81.135 -12.301 -4.486  1.00 50.33  ? 180  ILE A CG2   1 
ATOM   1435 C  CD1   . ILE A 1 183 ? 84.454 -13.362 -5.984  1.00 57.22  ? 180  ILE A CD1   1 
ATOM   1436 N  N     . ASP A 1 184 ? 82.225 -15.998 -7.451  1.00 58.38  ? 181  ASP A N     1 
ATOM   1437 C  CA    . ASP A 1 184 ? 82.698 -16.535 -8.720  1.00 56.73  ? 181  ASP A CA    1 
ATOM   1438 C  C     . ASP A 1 184 ? 81.642 -17.426 -9.371  1.00 67.85  ? 181  ASP A C     1 
ATOM   1439 O  O     . ASP A 1 184 ? 81.858 -17.975 -10.452 1.00 71.51  ? 181  ASP A O     1 
ATOM   1440 C  CB    . ASP A 1 184 ? 83.995 -17.317 -8.510  1.00 64.56  ? 181  ASP A CB    1 
ATOM   1441 C  CG    . ASP A 1 184 ? 83.917 -18.269 -7.326  1.00 76.20  ? 181  ASP A CG    1 
ATOM   1442 O  OD1   . ASP A 1 184 ? 84.134 -17.814 -6.181  1.00 75.24  ? 181  ASP A OD1   1 
ATOM   1443 O  OD2   . ASP A 1 184 ? 83.636 -19.470 -7.538  1.00 81.96  ? 181  ASP A OD2   1 
ATOM   1444 N  N     . ASN A 1 185 ? 80.501 -17.569 -8.704  1.00 61.77  ? 182  ASN A N     1 
ATOM   1445 C  CA    . ASN A 1 185 ? 79.390 -18.343 -9.245  1.00 62.98  ? 182  ASN A CA    1 
ATOM   1446 C  C     . ASN A 1 185 ? 78.237 -17.423 -9.636  1.00 54.26  ? 182  ASN A C     1 
ATOM   1447 O  O     . ASN A 1 185 ? 77.472 -16.985 -8.781  1.00 51.83  ? 182  ASN A O     1 
ATOM   1448 C  CB    . ASN A 1 185 ? 78.924 -19.393 -8.228  1.00 50.43  ? 182  ASN A CB    1 
ATOM   1449 C  CG    . ASN A 1 185 ? 77.819 -20.292 -8.767  1.00 51.59  ? 182  ASN A CG    1 
ATOM   1450 O  OD1   . ASN A 1 185 ? 77.459 -20.227 -9.946  1.00 47.69  ? 182  ASN A OD1   1 
ATOM   1451 N  ND2   . ASN A 1 185 ? 77.282 -21.148 -7.900  1.00 55.47  ? 182  ASN A ND2   1 
ATOM   1452 N  N     . LEU A 1 186 ? 78.109 -17.143 -10.931 1.00 52.27  ? 183  LEU A N     1 
ATOM   1453 C  CA    . LEU A 1 186 ? 77.096 -16.203 -11.413 1.00 52.71  ? 183  LEU A CA    1 
ATOM   1454 C  C     . LEU A 1 186 ? 75.661 -16.731 -11.293 1.00 43.46  ? 183  LEU A C     1 
ATOM   1455 O  O     . LEU A 1 186 ? 74.703 -16.014 -11.596 1.00 41.66  ? 183  LEU A O     1 
ATOM   1456 C  CB    . LEU A 1 186 ? 77.380 -15.817 -12.871 1.00 50.23  ? 183  LEU A CB    1 
ATOM   1457 C  CG    . LEU A 1 186 ? 78.620 -14.954 -13.135 1.00 60.93  ? 183  LEU A CG    1 
ATOM   1458 C  CD1   . LEU A 1 186 ? 79.789 -15.805 -13.623 1.00 66.09  ? 183  LEU A CD1   1 
ATOM   1459 C  CD2   . LEU A 1 186 ? 78.315 -13.824 -14.119 1.00 48.36  ? 183  LEU A CD2   1 
ATOM   1460 N  N     . THR A 1 187 ? 75.509 -17.975 -10.848 1.00 42.24  ? 184  THR A N     1 
ATOM   1461 C  CA    . THR A 1 187 ? 74.174 -18.553 -10.696 1.00 46.60  ? 184  THR A CA    1 
ATOM   1462 C  C     . THR A 1 187 ? 73.799 -18.833 -9.234  1.00 39.59  ? 184  THR A C     1 
ATOM   1463 O  O     . THR A 1 187 ? 72.706 -19.335 -8.973  1.00 40.28  ? 184  THR A O     1 
ATOM   1464 C  CB    . THR A 1 187 ? 74.027 -19.870 -11.508 1.00 53.32  ? 184  THR A CB    1 
ATOM   1465 O  OG1   . THR A 1 187 ? 74.911 -20.873 -10.985 1.00 52.92  ? 184  THR A OG1   1 
ATOM   1466 C  CG2   . THR A 1 187 ? 74.338 -19.632 -12.988 1.00 53.33  ? 184  THR A CG2   1 
ATOM   1467 N  N     . SER A 1 188 ? 74.692 -18.524 -8.290  1.00 31.05  ? 185  SER A N     1 
ATOM   1468 C  CA    . SER A 1 188 ? 74.352 -18.645 -6.864  1.00 30.85  ? 185  SER A CA    1 
ATOM   1469 C  C     . SER A 1 188 ? 73.229 -17.691 -6.489  1.00 17.21  ? 185  SER A C     1 
ATOM   1470 O  O     . SER A 1 188 ? 73.356 -16.481 -6.671  1.00 17.67  ? 185  SER A O     1 
ATOM   1471 C  CB    . SER A 1 188 ? 75.551 -18.363 -5.960  1.00 32.56  ? 185  SER A CB    1 
ATOM   1472 O  OG    . SER A 1 188 ? 75.140 -18.277 -4.596  1.00 29.07  ? 185  SER A OG    1 
ATOM   1473 N  N     . PRO A 1 189 ? 72.130 -18.241 -5.965  1.00 19.53  ? 186  PRO A N     1 
ATOM   1474 C  CA    . PRO A 1 189 ? 70.989 -17.439 -5.510  1.00 17.34  ? 186  PRO A CA    1 
ATOM   1475 C  C     . PRO A 1 189 ? 71.389 -16.397 -4.481  1.00 16.41  ? 186  PRO A C     1 
ATOM   1476 O  O     . PRO A 1 189 ? 70.843 -15.301 -4.532  1.00 16.19  ? 186  PRO A O     1 
ATOM   1477 C  CB    . PRO A 1 189 ? 70.060 -18.477 -4.891  1.00 18.40  ? 186  PRO A CB    1 
ATOM   1478 C  CG    . PRO A 1 189 ? 70.388 -19.746 -5.625  1.00 20.54  ? 186  PRO A CG    1 
ATOM   1479 C  CD    . PRO A 1 189 ? 71.864 -19.683 -5.875  1.00 19.79  ? 186  PRO A CD    1 
ATOM   1480 N  N     . ASP A 1 190 ? 72.302 -16.725 -3.563  1.00 15.81  ? 187  ASP A N     1 
ATOM   1481 C  CA    . ASP A 1 190 ? 72.690 -15.771 -2.530  1.00 15.86  ? 187  ASP A CA    1 
ATOM   1482 C  C     . ASP A 1 190 ? 73.455 -14.598 -3.124  1.00 14.29  ? 187  ASP A C     1 
ATOM   1483 O  O     . ASP A 1 190 ? 73.297 -13.467 -2.688  1.00 14.32  ? 187  ASP A O     1 
ATOM   1484 C  CB    . ASP A 1 190 ? 73.550 -16.422 -1.443  1.00 15.90  ? 187  ASP A CB    1 
ATOM   1485 C  CG    . ASP A 1 190 ? 72.768 -17.399 -0.576  1.00 20.07  ? 187  ASP A CG    1 
ATOM   1486 O  OD1   . ASP A 1 190 ? 71.522 -17.339 -0.554  1.00 16.46  ? 187  ASP A OD1   1 
ATOM   1487 O  OD2   . ASP A 1 190 ? 73.413 -18.228 0.088   1.00 20.90  ? 187  ASP A OD2   1 
ATOM   1488 N  N     . LEU A 1 191 ? 74.324 -14.877 -4.091  1.00 13.14  ? 188  LEU A N     1 
ATOM   1489 C  CA    . LEU A 1 191 ? 75.035 -13.794 -4.757  1.00 19.69  ? 188  LEU A CA    1 
ATOM   1490 C  C     . LEU A 1 191 ? 74.045 -12.914 -5.514  1.00 12.14  ? 188  LEU A C     1 
ATOM   1491 O  O     . LEU A 1 191 ? 74.143 -11.692 -5.474  1.00 12.80  ? 188  LEU A O     1 
ATOM   1492 C  CB    . LEU A 1 191 ? 76.100 -14.345 -5.709  1.00 16.60  ? 188  LEU A CB    1 
ATOM   1493 C  CG    . LEU A 1 191 ? 76.833 -13.310 -6.575  1.00 17.41  ? 188  LEU A CG    1 
ATOM   1494 C  CD1   . LEU A 1 191 ? 77.514 -12.252 -5.743  1.00 16.06  ? 188  LEU A CD1   1 
ATOM   1495 C  CD2   . LEU A 1 191 ? 77.852 -13.991 -7.481  1.00 25.00  ? 188  LEU A CD2   1 
ATOM   1496 N  N     . GLN A 1 192 ? 73.094 -13.544 -6.197  1.00 11.86  ? 189  GLN A N     1 
ATOM   1497 C  CA    . GLN A 1 192 ? 72.077 -12.818 -6.956  1.00 17.02  ? 189  GLN A CA    1 
ATOM   1498 C  C     . GLN A 1 192 ? 71.249 -11.878 -6.065  1.00 17.26  ? 189  GLN A C     1 
ATOM   1499 O  O     . GLN A 1 192 ? 71.025 -10.725 -6.419  1.00 13.21  ? 189  GLN A O     1 
ATOM   1500 C  CB    . GLN A 1 192 ? 71.167 -13.804 -7.696  1.00 14.48  ? 189  GLN A CB    1 
ATOM   1501 C  CG    . GLN A 1 192 ? 71.905 -14.586 -8.796  1.00 18.75  ? 189  GLN A CG    1 
ATOM   1502 C  CD    . GLN A 1 192 ? 71.058 -15.681 -9.421  1.00 29.85  ? 189  GLN A CD    1 
ATOM   1503 O  OE1   . GLN A 1 192 ? 70.018 -16.066 -8.884  1.00 34.42  ? 189  GLN A OE1   1 
ATOM   1504 N  NE2   . GLN A 1 192 ? 71.501 -16.188 -10.568 1.00 44.31  ? 189  GLN A NE2   1 
ATOM   1505 N  N     . LEU A 1 193 ? 70.809 -12.372 -4.908  1.00 16.37  ? 190  LEU A N     1 
ATOM   1506 C  CA    . LEU A 1 193 ? 70.126 -11.527 -3.926  1.00 9.91   ? 190  LEU A CA    1 
ATOM   1507 C  C     . LEU A 1 193 ? 70.993 -10.357 -3.498  1.00 14.85  ? 190  LEU A C     1 
ATOM   1508 O  O     . LEU A 1 193 ? 70.505 -9.250  -3.299  1.00 13.39  ? 190  LEU A O     1 
ATOM   1509 C  CB    . LEU A 1 193 ? 69.747 -12.326 -2.681  1.00 13.30  ? 190  LEU A CB    1 
ATOM   1510 C  CG    . LEU A 1 193 ? 68.658 -13.380 -2.823  1.00 13.60  ? 190  LEU A CG    1 
ATOM   1511 C  CD1   . LEU A 1 193 ? 68.368 -13.954 -1.441  1.00 13.84  ? 190  LEU A CD1   1 
ATOM   1512 C  CD2   . LEU A 1 193 ? 67.413 -12.749 -3.442  1.00 12.36  ? 190  LEU A CD2   1 
ATOM   1513 N  N     . THR A 1 194 ? 72.279 -10.620 -3.314  1.00 11.74  ? 191  THR A N     1 
ATOM   1514 C  CA    . THR A 1 194 ? 73.186 -9.602  -2.813  1.00 12.35  ? 191  THR A CA    1 
ATOM   1515 C  C     . THR A 1 194 ? 73.304 -8.452  -3.811  1.00 15.80  ? 191  THR A C     1 
ATOM   1516 O  O     . THR A 1 194 ? 73.258 -7.284  -3.436  1.00 14.11  ? 191  THR A O     1 
ATOM   1517 C  CB    . THR A 1 194 ? 74.577 -10.177 -2.544  1.00 13.78  ? 191  THR A CB    1 
ATOM   1518 O  OG1   . THR A 1 194 ? 74.478 -11.246 -1.596  1.00 16.88  ? 191  THR A OG1   1 
ATOM   1519 C  CG2   . THR A 1 194 ? 75.490 -9.102  -1.994  1.00 12.98  ? 191  THR A CG2   1 
ATOM   1520 N  N     . VAL A 1 195 ? 73.459 -8.810  -5.080  1.00 14.57  ? 192  VAL A N     1 
ATOM   1521 C  CA    . VAL A 1 195 ? 73.534 -7.835  -6.159  1.00 18.61  ? 192  VAL A CA    1 
ATOM   1522 C  C     . VAL A 1 195 ? 72.194 -7.121  -6.274  1.00 18.03  ? 192  VAL A C     1 
ATOM   1523 O  O     . VAL A 1 195 ? 72.145 -5.907  -6.509  1.00 15.21  ? 192  VAL A O     1 
ATOM   1524 C  CB    . VAL A 1 195 ? 73.927 -8.517  -7.491  1.00 13.98  ? 192  VAL A CB    1 
ATOM   1525 C  CG1   . VAL A 1 195 ? 73.741 -7.579  -8.691  1.00 16.37  ? 192  VAL A CG1   1 
ATOM   1526 C  CG2   . VAL A 1 195 ? 75.370 -9.001  -7.423  1.00 16.99  ? 192  VAL A CG2   1 
ATOM   1527 N  N     . GLY A 1 196 ? 71.107 -7.865  -6.091  1.00 13.39  ? 193  GLY A N     1 
ATOM   1528 C  CA    . GLY A 1 196 ? 69.784 -7.256  -6.028  1.00 12.01  ? 193  GLY A CA    1 
ATOM   1529 C  C     . GLY A 1 196 ? 69.765 -6.152  -4.977  1.00 12.44  ? 193  GLY A C     1 
ATOM   1530 O  O     . GLY A 1 196 ? 69.268 -5.061  -5.221  1.00 18.14  ? 193  GLY A O     1 
ATOM   1531 N  N     . ALA A 1 197 ? 70.329 -6.430  -3.805  1.00 12.39  ? 194  ALA A N     1 
ATOM   1532 C  CA    . ALA A 1 197 ? 70.376 -5.446  -2.728  1.00 12.20  ? 194  ALA A CA    1 
ATOM   1533 C  C     . ALA A 1 197 ? 71.244 -4.212  -3.075  1.00 17.63  ? 194  ALA A C     1 
ATOM   1534 O  O     . ALA A 1 197 ? 70.920 -3.082  -2.677  1.00 14.38  ? 194  ALA A O     1 
ATOM   1535 C  CB    . ALA A 1 197 ? 70.863 -6.112  -1.441  1.00 13.07  ? 194  ALA A CB    1 
ATOM   1536 N  N     . VAL A 1 198 ? 72.330 -4.417  -3.815  1.00 16.27  ? 195  VAL A N     1 
ATOM   1537 C  CA    . VAL A 1 198 ? 73.137 -3.283  -4.309  1.00 9.74   ? 195  VAL A CA    1 
ATOM   1538 C  C     . VAL A 1 198 ? 72.280 -2.371  -5.199  1.00 16.27  ? 195  VAL A C     1 
ATOM   1539 O  O     . VAL A 1 198 ? 72.295 -1.145  -5.061  1.00 17.28  ? 195  VAL A O     1 
ATOM   1540 C  CB    . VAL A 1 198 ? 74.381 -3.775  -5.094  1.00 16.83  ? 195  VAL A CB    1 
ATOM   1541 C  CG1   . VAL A 1 198 ? 75.168 -2.587  -5.678  1.00 17.47  ? 195  VAL A CG1   1 
ATOM   1542 C  CG2   . VAL A 1 198 ? 75.277 -4.627  -4.191  1.00 14.11  ? 195  VAL A CG2   1 
ATOM   1543 N  N     . ILE A 1 199 ? 71.492 -2.973  -6.079  1.00 12.49  ? 196  ILE A N     1 
ATOM   1544 C  CA    . ILE A 1 199 ? 70.631 -2.200  -6.959  1.00 18.48  ? 196  ILE A CA    1 
ATOM   1545 C  C     . ILE A 1 199 ? 69.535 -1.466  -6.171  1.00 16.42  ? 196  ILE A C     1 
ATOM   1546 O  O     . ILE A 1 199 ? 69.220 -0.325  -6.476  1.00 14.86  ? 196  ILE A O     1 
ATOM   1547 C  CB    . ILE A 1 199 ? 70.016 -3.094  -8.037  1.00 13.62  ? 196  ILE A CB    1 
ATOM   1548 C  CG1   . ILE A 1 199 ? 71.113 -3.509  -9.017  1.00 13.89  ? 196  ILE A CG1   1 
ATOM   1549 C  CG2   . ILE A 1 199 ? 68.890 -2.374  -8.773  1.00 14.13  ? 196  ILE A CG2   1 
ATOM   1550 C  CD1   . ILE A 1 199 ? 70.743 -4.645  -9.962  1.00 14.49  ? 196  ILE A CD1   1 
ATOM   1551 N  N     . VAL A 1 200 ? 68.986 -2.099  -5.138  1.00 14.67  ? 197  VAL A N     1 
ATOM   1552 C  CA    . VAL A 1 200 ? 67.941 -1.468  -4.355  1.00 10.26  ? 197  VAL A CA    1 
ATOM   1553 C  C     . VAL A 1 200 ? 68.491 -0.309  -3.508  1.00 14.24  ? 197  VAL A C     1 
ATOM   1554 O  O     . VAL A 1 200 ? 67.802 0.707   -3.346  1.00 12.83  ? 197  VAL A O     1 
ATOM   1555 C  CB    . VAL A 1 200 ? 67.199 -2.504  -3.479  1.00 9.78   ? 197  VAL A CB    1 
ATOM   1556 C  CG1   . VAL A 1 200 ? 66.126 -1.808  -2.656  1.00 14.32  ? 197  VAL A CG1   1 
ATOM   1557 C  CG2   . VAL A 1 200 ? 66.550 -3.546  -4.383  1.00 12.19  ? 197  VAL A CG2   1 
ATOM   1558 N  N     . GLU A 1 201 ? 69.728 -0.418  -3.014  1.00 14.18  ? 198  GLU A N     1 
ATOM   1559 C  CA    . GLU A 1 201 ? 70.383 0.739   -2.398  1.00 16.14  ? 198  GLU A CA    1 
ATOM   1560 C  C     . GLU A 1 201 ? 70.400 1.921   -3.381  1.00 17.33  ? 198  GLU A C     1 
ATOM   1561 O  O     . GLU A 1 201 ? 70.139 3.074   -3.008  1.00 16.31  ? 198  GLU A O     1 
ATOM   1562 C  CB    . GLU A 1 201 ? 71.829 0.416   -1.954  1.00 17.32  ? 198  GLU A CB    1 
ATOM   1563 C  CG    . GLU A 1 201 ? 71.994 -0.607  -0.820  1.00 15.93  ? 198  GLU A CG    1 
ATOM   1564 C  CD    . GLU A 1 201 ? 71.888 -0.013  0.584   1.00 18.10  ? 198  GLU A CD    1 
ATOM   1565 O  OE1   . GLU A 1 201 ? 71.474 1.161   0.730   1.00 18.96  ? 198  GLU A OE1   1 
ATOM   1566 O  OE2   . GLU A 1 201 ? 72.204 -0.733  1.559   1.00 17.69  ? 198  GLU A OE2   1 
ATOM   1567 N  N     . GLU A 1 202 ? 70.735 1.625   -4.634  1.00 15.29  ? 199  GLU A N     1 
ATOM   1568 C  CA    . GLU A 1 202 ? 70.830 2.649   -5.669  1.00 18.15  ? 199  GLU A CA    1 
ATOM   1569 C  C     . GLU A 1 202 ? 69.444 3.212   -5.987  1.00 20.86  ? 199  GLU A C     1 
ATOM   1570 O  O     . GLU A 1 202 ? 69.277 4.426   -6.116  1.00 14.01  ? 199  GLU A O     1 
ATOM   1571 C  CB    . GLU A 1 202 ? 71.490 2.071   -6.933  1.00 18.54  ? 199  GLU A CB    1 
ATOM   1572 C  CG    . GLU A 1 202 ? 72.938 1.641   -6.713  1.00 21.54  ? 199  GLU A CG    1 
ATOM   1573 C  CD    . GLU A 1 202 ? 73.525 0.819   -7.862  1.00 23.91  ? 199  GLU A CD    1 
ATOM   1574 O  OE1   . GLU A 1 202 ? 74.733 0.495   -7.800  1.00 32.49  ? 199  GLU A OE1   1 
ATOM   1575 O  OE2   . GLU A 1 202 ? 72.786 0.493   -8.813  1.00 31.33  ? 199  GLU A OE2   1 
ATOM   1576 N  N     . MET A 1 203 ? 68.454 2.327   -6.106  1.00 15.54  ? 200  MET A N     1 
ATOM   1577 C  CA    . MET A 1 203 ? 67.065 2.751   -6.308  1.00 15.31  ? 200  MET A CA    1 
ATOM   1578 C  C     . MET A 1 203 ? 66.598 3.638   -5.181  1.00 13.65  ? 200  MET A C     1 
ATOM   1579 O  O     . MET A 1 203 ? 66.001 4.686   -5.423  1.00 12.95  ? 200  MET A O     1 
ATOM   1580 C  CB    . MET A 1 203 ? 66.119 1.548   -6.416  1.00 10.26  ? 200  MET A CB    1 
ATOM   1581 C  CG    A MET A 1 203 ? 64.680 1.915   -6.754  0.40 15.37  ? 200  MET A CG    1 
ATOM   1582 C  CG    B MET A 1 203 ? 66.380 0.608   -7.560  0.60 15.82  ? 200  MET A CG    1 
ATOM   1583 S  SD    A MET A 1 203 ? 63.579 0.483   -6.816  0.40 19.49  ? 200  MET A SD    1 
ATOM   1584 S  SD    B MET A 1 203 ? 65.148 -0.709  -7.553  0.60 17.49  ? 200  MET A SD    1 
ATOM   1585 C  CE    A MET A 1 203 ? 64.121 -0.342  -8.308  0.40 16.56  ? 200  MET A CE    1 
ATOM   1586 C  CE    B MET A 1 203 ? 63.646 0.229   -7.826  0.60 13.90  ? 200  MET A CE    1 
ATOM   1587 N  N     . ARG A 1 204 ? 66.853 3.213   -3.941  1.00 12.92  ? 201  ARG A N     1 
ATOM   1588 C  CA    . ARG A 1 204 ? 66.412 3.983   -2.784  1.00 15.77  ? 201  ARG A CA    1 
ATOM   1589 C  C     . ARG A 1 204 ? 67.173 5.313   -2.668  1.00 18.12  ? 201  ARG A C     1 
ATOM   1590 O  O     . ARG A 1 204 ? 66.603 6.315   -2.240  1.00 12.76  ? 201  ARG A O     1 
ATOM   1591 C  CB    . ARG A 1 204 ? 66.541 3.159   -1.495  1.00 15.90  ? 201  ARG A CB    1 
ATOM   1592 C  CG    . ARG A 1 204 ? 65.557 1.966   -1.456  1.00 17.17  ? 201  ARG A CG    1 
ATOM   1593 C  CD    . ARG A 1 204 ? 65.691 1.113   -0.211  1.00 15.57  ? 201  ARG A CD    1 
ATOM   1594 N  NE    . ARG A 1 204 ? 65.732 1.952   0.974   1.00 13.47  ? 201  ARG A NE    1 
ATOM   1595 C  CZ    . ARG A 1 204 ? 66.808 2.103   1.742   1.00 17.05  ? 201  ARG A CZ    1 
ATOM   1596 N  NH1   . ARG A 1 204 ? 66.766 2.921   2.782   1.00 13.03  ? 201  ARG A NH1   1 
ATOM   1597 N  NH2   . ARG A 1 204 ? 67.928 1.443   1.464   1.00 18.65  ? 201  ARG A NH2   1 
ATOM   1598 N  N     . ALA A 1 205 ? 68.445 5.338   -3.062  1.00 13.46  ? 202  ALA A N     1 
ATOM   1599 C  CA    . ALA A 1 205 ? 69.187 6.600   -3.046  1.00 17.40  ? 202  ALA A CA    1 
ATOM   1600 C  C     . ALA A 1 205 ? 68.602 7.577   -4.083  1.00 14.00  ? 202  ALA A C     1 
ATOM   1601 O  O     . ALA A 1 205 ? 68.448 8.768   -3.806  1.00 15.05  ? 202  ALA A O     1 
ATOM   1602 C  CB    . ALA A 1 205 ? 70.683 6.359   -3.296  1.00 15.17  ? 202  ALA A CB    1 
ATOM   1603 N  N     . ALA A 1 206 ? 68.250 7.070   -5.261  1.00 14.31  ? 203  ALA A N     1 
ATOM   1604 C  CA    . ALA A 1 206 ? 67.664 7.913   -6.293  1.00 14.15  ? 203  ALA A CA    1 
ATOM   1605 C  C     . ALA A 1 206 ? 66.302 8.468   -5.848  1.00 13.14  ? 203  ALA A C     1 
ATOM   1606 O  O     . ALA A 1 206 ? 65.974 9.637   -6.103  1.00 14.70  ? 203  ALA A O     1 
ATOM   1607 C  CB    . ALA A 1 206 ? 67.530 7.147   -7.583  1.00 14.52  ? 203  ALA A CB    1 
ATOM   1608 N  N     . ILE A 1 207 ? 65.511 7.641   -5.173  1.00 9.30   ? 204  ILE A N     1 
ATOM   1609 C  CA    . ILE A 1 207 ? 64.205 8.093   -4.722  1.00 15.21  ? 204  ILE A CA    1 
ATOM   1610 C  C     . ILE A 1 207 ? 64.385 9.233   -3.745  1.00 16.74  ? 204  ILE A C     1 
ATOM   1611 O  O     . ILE A 1 207 ? 63.728 10.266  -3.859  1.00 12.49  ? 204  ILE A O     1 
ATOM   1612 C  CB    . ILE A 1 207 ? 63.391 6.971   -4.060  1.00 13.45  ? 204  ILE A CB    1 
ATOM   1613 C  CG1   . ILE A 1 207 ? 62.978 5.947   -5.114  1.00 12.61  ? 204  ILE A CG1   1 
ATOM   1614 C  CG2   . ILE A 1 207 ? 62.138 7.542   -3.386  1.00 11.46  ? 204  ILE A CG2   1 
ATOM   1615 C  CD1   . ILE A 1 207 ? 62.243 4.701   -4.541  1.00 14.56  ? 204  ILE A CD1   1 
ATOM   1616 N  N     . GLU A 1 208 ? 65.275 9.051   -2.779  1.00 15.82  ? 205  GLU A N     1 
ATOM   1617 C  CA    . GLU A 1 208 ? 65.485 10.099  -1.786  1.00 16.49  ? 205  GLU A CA    1 
ATOM   1618 C  C     . GLU A 1 208 ? 66.096 11.360  -2.398  1.00 16.80  ? 205  GLU A C     1 
ATOM   1619 O  O     . GLU A 1 208 ? 65.669 12.474  -2.087  1.00 14.61  ? 205  GLU A O     1 
ATOM   1620 C  CB    . GLU A 1 208 ? 66.377 9.612   -0.651  1.00 14.16  ? 205  GLU A CB    1 
ATOM   1621 C  CG    . GLU A 1 208 ? 66.536 10.689  0.436   1.00 19.48  ? 205  GLU A CG    1 
ATOM   1622 C  CD    . GLU A 1 208 ? 67.227 10.177  1.671   1.00 20.99  ? 205  GLU A CD    1 
ATOM   1623 O  OE1   . GLU A 1 208 ? 67.149 10.851  2.715   1.00 25.58  ? 205  GLU A OE1   1 
ATOM   1624 O  OE2   . GLU A 1 208 ? 67.843 9.096   1.596   1.00 18.98  ? 205  GLU A OE2   1 
ATOM   1625 N  N     . ARG A 1 209 ? 67.071 11.190  -3.285  1.00 16.21  ? 206  ARG A N     1 
ATOM   1626 C  CA    . ARG A 1 209 ? 67.693 12.353  -3.942  1.00 17.12  ? 206  ARG A CA    1 
ATOM   1627 C  C     . ARG A 1 209 ? 66.684 13.190  -4.725  1.00 16.66  ? 206  ARG A C     1 
ATOM   1628 O  O     . ARG A 1 209 ? 66.700 14.423  -4.666  1.00 14.25  ? 206  ARG A O     1 
ATOM   1629 C  CB    . ARG A 1 209 ? 68.826 11.920  -4.884  1.00 16.86  ? 206  ARG A CB    1 
ATOM   1630 C  CG    . ARG A 1 209 ? 69.597 13.128  -5.449  1.00 21.88  ? 206  ARG A CG    1 
ATOM   1631 C  CD    . ARG A 1 209 ? 70.663 12.775  -6.491  1.00 20.76  ? 206  ARG A CD    1 
ATOM   1632 N  NE    . ARG A 1 209 ? 70.119 12.442  -7.813  1.00 22.99  ? 206  ARG A NE    1 
ATOM   1633 C  CZ    . ARG A 1 209 ? 69.702 13.340  -8.707  1.00 28.02  ? 206  ARG A CZ    1 
ATOM   1634 N  NH1   . ARG A 1 209 ? 69.243 12.937  -9.886  1.00 23.87  ? 206  ARG A NH1   1 
ATOM   1635 N  NH2   . ARG A 1 209 ? 69.728 14.640  -8.417  1.00 20.13  ? 206  ARG A NH2   1 
ATOM   1636 N  N     . GLU A 1 210 ? 65.794 12.508  -5.436  1.00 15.21  ? 207  GLU A N     1 
ATOM   1637 C  CA    . GLU A 1 210 ? 64.953 13.158  -6.426  1.00 12.50  ? 207  GLU A CA    1 
ATOM   1638 C  C     . GLU A 1 210 ? 63.576 13.527  -5.896  1.00 10.57  ? 207  GLU A C     1 
ATOM   1639 O  O     . GLU A 1 210 ? 62.847 14.285  -6.550  1.00 10.05  ? 207  GLU A O     1 
ATOM   1640 C  CB    . GLU A 1 210 ? 64.830 12.266  -7.663  1.00 14.52  ? 207  GLU A CB    1 
ATOM   1641 C  CG    . GLU A 1 210 ? 66.170 11.995  -8.290  1.00 15.36  ? 207  GLU A CG    1 
ATOM   1642 C  CD    . GLU A 1 210 ? 66.101 11.135  -9.533  1.00 26.30  ? 207  GLU A CD    1 
ATOM   1643 O  OE1   . GLU A 1 210 ? 65.067 11.151  -10.235 1.00 22.09  ? 207  GLU A OE1   1 
ATOM   1644 O  OE2   . GLU A 1 210 ? 67.099 10.436  -9.804  1.00 23.15  ? 207  GLU A OE2   1 
ATOM   1645 N  N     . THR A 1 211 ? 63.214 13.017  -4.715  1.00 13.11  ? 208  THR A N     1 
ATOM   1646 C  CA    . THR A 1 211 ? 61.915 13.360  -4.140  1.00 10.87  ? 208  THR A CA    1 
ATOM   1647 C  C     . THR A 1 211 ? 62.018 13.895  -2.728  1.00 12.39  ? 208  THR A C     1 
ATOM   1648 O  O     . THR A 1 211 ? 61.112 14.560  -2.266  1.00 15.93  ? 208  THR A O     1 
ATOM   1649 C  CB    . THR A 1 211 ? 60.946 12.160  -4.084  1.00 10.80  ? 208  THR A CB    1 
ATOM   1650 O  OG1   . THR A 1 211 ? 61.440 11.199  -3.144  1.00 10.83  ? 208  THR A OG1   1 
ATOM   1651 C  CG2   . THR A 1 211 ? 60.767 11.524  -5.464  1.00 11.84  ? 208  THR A CG2   1 
ATOM   1652 N  N     . GLY A 1 212 ? 63.101 13.587  -2.032  1.00 15.16  ? 209  GLY A N     1 
ATOM   1653 C  CA    . GLY A 1 212 ? 63.168 13.891  -0.614  1.00 12.11  ? 209  GLY A CA    1 
ATOM   1654 C  C     . GLY A 1 212 ? 62.592 12.799  0.284   1.00 15.09  ? 209  GLY A C     1 
ATOM   1655 O  O     . GLY A 1 212 ? 62.723 12.874  1.495   1.00 16.61  ? 209  GLY A O     1 
ATOM   1656 N  N     . PHE A 1 213 ? 61.967 11.780  -0.303  1.00 13.92  ? 210  PHE A N     1 
ATOM   1657 C  CA    . PHE A 1 213 ? 61.287 10.746  0.481   1.00 12.81  ? 210  PHE A CA    1 
ATOM   1658 C  C     . PHE A 1 213 ? 62.203 9.563   0.788   1.00 14.28  ? 210  PHE A C     1 
ATOM   1659 O  O     . PHE A 1 213 ? 62.931 9.090   -0.074  1.00 12.39  ? 210  PHE A O     1 
ATOM   1660 C  CB    . PHE A 1 213 ? 60.040 10.223  -0.245  1.00 11.73  ? 210  PHE A CB    1 
ATOM   1661 C  CG    . PHE A 1 213 ? 59.035 11.287  -0.611  1.00 10.24  ? 210  PHE A CG    1 
ATOM   1662 C  CD1   . PHE A 1 213 ? 58.311 11.188  -1.794  1.00 11.49  ? 210  PHE A CD1   1 
ATOM   1663 C  CD2   . PHE A 1 213 ? 58.781 12.348  0.241   1.00 14.26  ? 210  PHE A CD2   1 
ATOM   1664 C  CE1   . PHE A 1 213 ? 57.378 12.159  -2.138  1.00 13.21  ? 210  PHE A CE1   1 
ATOM   1665 C  CE2   . PHE A 1 213 ? 57.842 13.313  -0.092  1.00 14.47  ? 210  PHE A CE2   1 
ATOM   1666 C  CZ    . PHE A 1 213 ? 57.137 13.213  -1.288  1.00 11.72  ? 210  PHE A CZ    1 
ATOM   1667 N  N     . GLN A 1 214 ? 62.144 9.091   2.026   1.00 11.70  ? 211  GLN A N     1 
ATOM   1668 C  CA    . GLN A 1 214 ? 62.850 7.884   2.429   1.00 13.59  ? 211  GLN A CA    1 
ATOM   1669 C  C     . GLN A 1 214 ? 61.926 6.675   2.383   1.00 11.72  ? 211  GLN A C     1 
ATOM   1670 O  O     . GLN A 1 214 ? 60.712 6.800   2.534   1.00 11.62  ? 211  GLN A O     1 
ATOM   1671 C  CB    . GLN A 1 214 ? 63.434 8.061   3.832   1.00 14.07  ? 211  GLN A CB    1 
ATOM   1672 C  CG    . GLN A 1 214 ? 64.598 9.052   3.843   1.00 18.72  ? 211  GLN A CG    1 
ATOM   1673 C  CD    . GLN A 1 214 ? 65.173 9.261   5.222   1.00 20.82  ? 211  GLN A CD    1 
ATOM   1674 O  OE1   . GLN A 1 214 ? 64.648 8.747   6.206   1.00 18.61  ? 211  GLN A OE1   1 
ATOM   1675 N  NE2   . GLN A 1 214 ? 66.266 10.018  5.299   1.00 20.00  ? 211  GLN A NE2   1 
ATOM   1676 N  N     . CYS A 1 215 ? 62.509 5.502   2.189   1.00 12.96  ? 212  CYS A N     1 
ATOM   1677 C  CA    . CYS A 1 215 ? 61.728 4.292   2.076   1.00 10.94  ? 212  CYS A CA    1 
ATOM   1678 C  C     . CYS A 1 215 ? 62.504 3.121   2.627   1.00 13.88  ? 212  CYS A C     1 
ATOM   1679 O  O     . CYS A 1 215 ? 63.726 3.189   2.819   1.00 12.79  ? 212  CYS A O     1 
ATOM   1680 C  CB    . CYS A 1 215 ? 61.364 4.021   0.613   1.00 10.86  ? 212  CYS A CB    1 
ATOM   1681 S  SG    . CYS A 1 215 ? 62.829 3.919   -0.443  1.00 20.11  ? 212  CYS A SG    1 
ATOM   1682 N  N     . SER A 1 216 ? 61.788 2.034   2.860   1.00 11.15  ? 213  SER A N     1 
ATOM   1683 C  CA    . SER A 1 216 ? 62.427 0.794   3.244   1.00 11.75  ? 213  SER A CA    1 
ATOM   1684 C  C     . SER A 1 216 ? 62.273 -0.185  2.090   1.00 13.59  ? 213  SER A C     1 
ATOM   1685 O  O     . SER A 1 216 ? 61.535 0.094   1.135   1.00 11.07  ? 213  SER A O     1 
ATOM   1686 C  CB    . SER A 1 216 ? 61.816 0.270   4.539   1.00 12.27  ? 213  SER A CB    1 
ATOM   1687 O  OG    . SER A 1 216 ? 62.063 1.208   5.583   1.00 15.92  ? 213  SER A OG    1 
ATOM   1688 N  N     . ALA A 1 217 ? 62.986 -1.308  2.145   1.00 10.58  ? 214  ALA A N     1 
ATOM   1689 C  CA    . ALA A 1 217 ? 62.827 -2.320  1.103   1.00 8.38   ? 214  ALA A CA    1 
ATOM   1690 C  C     . ALA A 1 217 ? 63.140 -3.713  1.590   1.00 8.72   ? 214  ALA A C     1 
ATOM   1691 O  O     . ALA A 1 217 ? 63.889 -3.891  2.545   1.00 10.01  ? 214  ALA A O     1 
ATOM   1692 C  CB    . ALA A 1 217 ? 63.691 -1.996  -0.100  1.00 9.63   ? 214  ALA A CB    1 
ATOM   1693 N  N     . GLY A 1 218 ? 62.548 -4.701  0.929   1.00 11.37  ? 215  GLY A N     1 
ATOM   1694 C  CA    . GLY A 1 218 ? 62.881 -6.089  1.194   1.00 9.82   ? 215  GLY A CA    1 
ATOM   1695 C  C     . GLY A 1 218 ? 63.413 -6.682  -0.091  1.00 10.72  ? 215  GLY A C     1 
ATOM   1696 O  O     . GLY A 1 218 ? 62.927 -6.347  -1.163  1.00 9.61   ? 215  GLY A O     1 
ATOM   1697 N  N     . ILE A 1 219 ? 64.426 -7.532  0.009   1.00 9.27   ? 216  ILE A N     1 
ATOM   1698 C  CA    . ILE A 1 219 ? 64.967 -8.212  -1.163  1.00 8.38   ? 216  ILE A CA    1 
ATOM   1699 C  C     . ILE A 1 219 ? 64.980 -9.712  -0.901  1.00 12.62  ? 216  ILE A C     1 
ATOM   1700 O  O     . ILE A 1 219 ? 65.618 -10.171 0.054   1.00 11.60  ? 216  ILE A O     1 
ATOM   1701 C  CB    . ILE A 1 219 ? 66.394 -7.715  -1.493  1.00 12.36  ? 216  ILE A CB    1 
ATOM   1702 C  CG1   . ILE A 1 219 ? 66.424 -6.179  -1.644  1.00 17.28  ? 216  ILE A CG1   1 
ATOM   1703 C  CG2   . ILE A 1 219 ? 66.951 -8.406  -2.751  1.00 10.50  ? 216  ILE A CG2   1 
ATOM   1704 C  CD1   . ILE A 1 219 ? 66.983 -5.448  -0.437  1.00 14.46  ? 216  ILE A CD1   1 
ATOM   1705 N  N     . SER A 1 220 ? 64.255 -10.470 -1.722  1.00 10.08  ? 217  SER A N     1 
ATOM   1706 C  CA    . SER A 1 220 ? 64.236 -11.918 -1.593  1.00 11.00  ? 217  SER A CA    1 
ATOM   1707 C  C     . SER A 1 220 ? 63.982 -12.568 -2.940  1.00 13.61  ? 217  SER A C     1 
ATOM   1708 O  O     . SER A 1 220 ? 64.241 -11.957 -3.974  1.00 11.02  ? 217  SER A O     1 
ATOM   1709 C  CB    . SER A 1 220 ? 63.177 -12.343 -0.576  1.00 13.57  ? 217  SER A CB    1 
ATOM   1710 O  OG    . SER A 1 220 ? 63.408 -13.678 -0.173  1.00 12.57  ? 217  SER A OG    1 
ATOM   1711 N  N     . HIS A 1 221 ? 63.468 -13.797 -2.928  1.00 11.13  ? 218  HIS A N     1 
ATOM   1712 C  CA    . HIS A 1 221 ? 63.243 -14.555 -4.153  1.00 15.69  ? 218  HIS A CA    1 
ATOM   1713 C  C     . HIS A 1 221 ? 61.808 -14.497 -4.652  1.00 9.63   ? 218  HIS A C     1 
ATOM   1714 O  O     . HIS A 1 221 ? 61.505 -14.984 -5.728  1.00 13.59  ? 218  HIS A O     1 
ATOM   1715 C  CB    . HIS A 1 221 ? 63.635 -16.025 -3.945  1.00 10.47  ? 218  HIS A CB    1 
ATOM   1716 C  CG    . HIS A 1 221 ? 65.107 -16.229 -3.811  1.00 18.59  ? 218  HIS A CG    1 
ATOM   1717 N  ND1   . HIS A 1 221 ? 65.990 -15.903 -4.817  1.00 13.52  ? 218  HIS A ND1   1 
ATOM   1718 C  CD2   . HIS A 1 221 ? 65.855 -16.709 -2.788  1.00 13.04  ? 218  HIS A CD2   1 
ATOM   1719 C  CE1   . HIS A 1 221 ? 67.220 -16.178 -4.422  1.00 18.63  ? 218  HIS A CE1   1 
ATOM   1720 N  NE2   . HIS A 1 221 ? 67.164 -16.666 -3.195  1.00 13.58  ? 218  HIS A NE2   1 
ATOM   1721 N  N     . ASN A 1 222 ? 60.920 -13.911 -3.865  1.00 10.78  ? 219  ASN A N     1 
ATOM   1722 C  CA    . ASN A 1 222 ? 59.534 -13.757 -4.277  1.00 8.35   ? 219  ASN A CA    1 
ATOM   1723 C  C     . ASN A 1 222 ? 58.885 -12.588 -3.539  1.00 10.89  ? 219  ASN A C     1 
ATOM   1724 O  O     . ASN A 1 222 ? 59.497 -11.979 -2.659  1.00 14.20  ? 219  ASN A O     1 
ATOM   1725 C  CB    . ASN A 1 222 ? 58.751 -15.059 -4.022  1.00 7.08   ? 219  ASN A CB    1 
ATOM   1726 C  CG    . ASN A 1 222 ? 58.879 -15.539 -2.588  1.00 15.39  ? 219  ASN A CG    1 
ATOM   1727 O  OD1   . ASN A 1 222 ? 58.392 -14.886 -1.660  1.00 12.63  ? 219  ASN A OD1   1 
ATOM   1728 N  ND2   . ASN A 1 222 ? 59.527 -16.691 -2.397  1.00 12.44  ? 219  ASN A ND2   1 
ATOM   1729 N  N     . LYS A 1 223 ? 57.648 -12.276 -3.904  1.00 12.27  ? 220  LYS A N     1 
ATOM   1730 C  CA    . LYS A 1 223 ? 56.951 -11.107 -3.365  1.00 13.70  ? 220  LYS A CA    1 
ATOM   1731 C  C     . LYS A 1 223 ? 56.596 -11.234 -1.885  1.00 11.83  ? 220  LYS A C     1 
ATOM   1732 O  O     . LYS A 1 223 ? 56.699 -10.266 -1.118  1.00 11.69  ? 220  LYS A O     1 
ATOM   1733 C  CB    . LYS A 1 223 ? 55.685 -10.852 -4.188  1.00 14.55  ? 220  LYS A CB    1 
ATOM   1734 C  CG    . LYS A 1 223 ? 55.995 -10.414 -5.621  1.00 12.78  ? 220  LYS A CG    1 
ATOM   1735 C  CD    . LYS A 1 223 ? 54.790 -10.594 -6.558  1.00 23.26  ? 220  LYS A CD    1 
ATOM   1736 C  CE    . LYS A 1 223 ? 53.634 -9.724  -6.182  1.00 24.15  ? 220  LYS A CE    1 
ATOM   1737 N  NZ    . LYS A 1 223 ? 52.530 -9.779  -7.216  1.00 22.85  ? 220  LYS A NZ    1 
ATOM   1738 N  N     . VAL A 1 224 ? 56.165 -12.417 -1.468  1.00 10.54  ? 221  VAL A N     1 
ATOM   1739 C  CA    . VAL A 1 224 ? 55.751 -12.565 -0.075  1.00 10.13  ? 221  VAL A CA    1 
ATOM   1740 C  C     . VAL A 1 224 ? 56.950 -12.385 0.861   1.00 9.40   ? 221  VAL A C     1 
ATOM   1741 O  O     . VAL A 1 224 ? 56.860 -11.641 1.849   1.00 12.67  ? 221  VAL A O     1 
ATOM   1742 C  CB    . VAL A 1 224 ? 55.055 -13.924 0.187   1.00 11.78  ? 221  VAL A CB    1 
ATOM   1743 C  CG1   . VAL A 1 224 ? 55.068 -14.266 1.679   1.00 14.56  ? 221  VAL A CG1   1 
ATOM   1744 C  CG2   . VAL A 1 224 ? 53.613 -13.863 -0.314  1.00 16.19  ? 221  VAL A CG2   1 
ATOM   1745 N  N     . LEU A 1 225 ? 58.083 -12.999 0.529   1.00 9.68   ? 222  LEU A N     1 
ATOM   1746 C  CA    . LEU A 1 225 ? 59.287 -12.829 1.346   1.00 12.27  ? 222  LEU A CA    1 
ATOM   1747 C  C     . LEU A 1 225 ? 59.829 -11.396 1.251   1.00 13.70  ? 222  LEU A C     1 
ATOM   1748 O  O     . LEU A 1 225 ? 60.341 -10.867 2.224   1.00 11.84  ? 222  LEU A O     1 
ATOM   1749 C  CB    . LEU A 1 225 ? 60.397 -13.828 0.945   1.00 11.66  ? 222  LEU A CB    1 
ATOM   1750 C  CG    . LEU A 1 225 ? 60.194 -15.319 1.275   1.00 12.42  ? 222  LEU A CG    1 
ATOM   1751 C  CD1   . LEU A 1 225 ? 61.413 -16.201 0.873   1.00 12.33  ? 222  LEU A CD1   1 
ATOM   1752 C  CD2   . LEU A 1 225 ? 59.835 -15.527 2.747   1.00 14.05  ? 222  LEU A CD2   1 
ATOM   1753 N  N     . ALA A 1 226 ? 59.730 -10.777 0.075   1.00 11.20  ? 223  ALA A N     1 
ATOM   1754 C  CA    . ALA A 1 226 ? 60.215 -9.414  -0.087  1.00 14.14  ? 223  ALA A CA    1 
ATOM   1755 C  C     . ALA A 1 226 ? 59.412 -8.443  0.771   1.00 10.75  ? 223  ALA A C     1 
ATOM   1756 O  O     . ALA A 1 226 ? 59.974 -7.551  1.401   1.00 10.18  ? 223  ALA A O     1 
ATOM   1757 C  CB    . ALA A 1 226 ? 60.170 -8.991  -1.563  1.00 14.28  ? 223  ALA A CB    1 
ATOM   1758 N  N     . LYS A 1 227 ? 58.099 -8.629  0.791   1.00 12.01  ? 224  LYS A N     1 
ATOM   1759 C  CA    . LYS A 1 227 ? 57.205 -7.816  1.613   1.00 12.55  ? 224  LYS A CA    1 
ATOM   1760 C  C     . LYS A 1 227 ? 57.503 -8.003  3.110   1.00 15.32  ? 224  LYS A C     1 
ATOM   1761 O  O     . LYS A 1 227 ? 57.623 -7.035  3.859   1.00 12.18  ? 224  LYS A O     1 
ATOM   1762 C  CB    . LYS A 1 227 ? 55.742 -8.167  1.317   1.00 12.14  ? 224  LYS A CB    1 
ATOM   1763 C  CG    A LYS A 1 227 ? 54.732 -7.558  2.286   0.45 18.79  ? 224  LYS A CG    1 
ATOM   1764 C  CG    B LYS A 1 227 ? 54.723 -7.393  2.167   0.55 18.81  ? 224  LYS A CG    1 
ATOM   1765 C  CD    A LYS A 1 227 ? 54.610 -6.054  2.099   0.45 21.74  ? 224  LYS A CD    1 
ATOM   1766 C  CD    B LYS A 1 227 ? 54.911 -5.884  2.023   0.55 20.94  ? 224  LYS A CD    1 
ATOM   1767 C  CE    A LYS A 1 227 ? 53.567 -5.462  3.046   0.45 26.97  ? 224  LYS A CE    1 
ATOM   1768 C  CE    B LYS A 1 227 ? 53.814 -5.100  2.750   0.55 25.84  ? 224  LYS A CE    1 
ATOM   1769 N  NZ    A LYS A 1 227 ? 52.264 -6.179  2.977   0.45 17.79  ? 224  LYS A NZ    1 
ATOM   1770 N  NZ    B LYS A 1 227 ? 54.029 -3.629  2.677   0.55 14.56  ? 224  LYS A NZ    1 
ATOM   1771 N  N     . LEU A 1 228 ? 57.636 -9.256  3.531   1.00 9.86   ? 225  LEU A N     1 
ATOM   1772 C  CA    . LEU A 1 228 ? 57.978 -9.569  4.912   1.00 13.22  ? 225  LEU A CA    1 
ATOM   1773 C  C     . LEU A 1 228 ? 59.317 -8.932  5.332   1.00 15.31  ? 225  LEU A C     1 
ATOM   1774 O  O     . LEU A 1 228 ? 59.396 -8.252  6.358   1.00 14.52  ? 225  LEU A O     1 
ATOM   1775 C  CB    . LEU A 1 228 ? 58.018 -11.092 5.103   1.00 12.70  ? 225  LEU A CB    1 
ATOM   1776 C  CG    . LEU A 1 228 ? 58.231 -11.577 6.541   1.00 19.17  ? 225  LEU A CG    1 
ATOM   1777 C  CD1   . LEU A 1 228 ? 57.084 -11.093 7.445   1.00 18.05  ? 225  LEU A CD1   1 
ATOM   1778 C  CD2   . LEU A 1 228 ? 58.351 -13.088 6.571   1.00 13.80  ? 225  LEU A CD2   1 
ATOM   1779 N  N     . ALA A 1 229 ? 60.348 -9.143  4.517   1.00 10.78  ? 226  ALA A N     1 
ATOM   1780 C  CA    . ALA A 1 229 ? 61.671 -8.548  4.711   1.00 12.39  ? 226  ALA A CA    1 
ATOM   1781 C  C     . ALA A 1 229 ? 61.628 -7.028  4.870   1.00 14.34  ? 226  ALA A C     1 
ATOM   1782 O  O     . ALA A 1 229 ? 62.304 -6.474  5.734   1.00 14.18  ? 226  ALA A O     1 
ATOM   1783 C  CB    . ALA A 1 229 ? 62.595 -8.918  3.531   1.00 8.94   ? 226  ALA A CB    1 
ATOM   1784 N  N     . CYS A 1 230 ? 60.849 -6.358  4.025   1.00 10.06  ? 227  CYS A N     1 
ATOM   1785 C  CA    . CYS A 1 230 ? 60.789 -4.899  4.052   1.00 12.13  ? 227  CYS A CA    1 
ATOM   1786 C  C     . CYS A 1 230 ? 60.460 -4.366  5.453   1.00 8.82   ? 227  CYS A C     1 
ATOM   1787 O  O     . CYS A 1 230 ? 61.086 -3.408  5.935   1.00 14.76  ? 227  CYS A O     1 
ATOM   1788 C  CB    . CYS A 1 230 ? 59.755 -4.408  3.033   1.00 11.52  ? 227  CYS A CB    1 
ATOM   1789 S  SG    . CYS A 1 230 ? 59.676 -2.635  2.858   1.00 12.97  ? 227  CYS A SG    1 
ATOM   1790 N  N     . GLY A 1 231 ? 59.515 -5.020  6.122   1.00 12.54  ? 228  GLY A N     1 
ATOM   1791 C  CA    . GLY A 1 231 ? 59.052 -4.569  7.422   1.00 13.15  ? 228  GLY A CA    1 
ATOM   1792 C  C     . GLY A 1 231 ? 59.980 -4.894  8.584   1.00 18.30  ? 228  GLY A C     1 
ATOM   1793 O  O     . GLY A 1 231 ? 59.762 -4.431  9.698   1.00 17.25  ? 228  GLY A O     1 
ATOM   1794 N  N     . LEU A 1 232 ? 61.022 -5.680  8.338   1.00 13.30  ? 229  LEU A N     1 
ATOM   1795 C  CA    . LEU A 1 232 ? 61.832 -6.199  9.442   1.00 16.52  ? 229  LEU A CA    1 
ATOM   1796 C  C     . LEU A 1 232 ? 62.729 -5.140  10.047  1.00 17.14  ? 229  LEU A C     1 
ATOM   1797 O  O     . LEU A 1 232 ? 63.105 -5.248  11.219  1.00 16.38  ? 229  LEU A O     1 
ATOM   1798 C  CB    . LEU A 1 232 ? 62.693 -7.384  8.985   1.00 15.34  ? 229  LEU A CB    1 
ATOM   1799 C  CG    . LEU A 1 232 ? 61.935 -8.673  8.662   1.00 15.84  ? 229  LEU A CG    1 
ATOM   1800 C  CD1   . LEU A 1 232 ? 62.915 -9.772  8.247   1.00 12.76  ? 229  LEU A CD1   1 
ATOM   1801 C  CD2   . LEU A 1 232 ? 61.091 -9.111  9.871   1.00 20.00  ? 229  LEU A CD2   1 
ATOM   1802 N  N     . ASN A 1 233 ? 63.094 -4.129  9.257   1.00 13.47  ? 230  ASN A N     1 
ATOM   1803 C  CA    . ASN A 1 233 ? 64.010 -3.101  9.744   1.00 12.86  ? 230  ASN A CA    1 
ATOM   1804 C  C     . ASN A 1 233 ? 63.674 -1.675  9.305   1.00 16.34  ? 230  ASN A C     1 
ATOM   1805 O  O     . ASN A 1 233 ? 64.543 -0.933  8.883   1.00 29.27  ? 230  ASN A O     1 
ATOM   1806 C  CB    . ASN A 1 233 ? 65.444 -3.419  9.311   1.00 13.26  ? 230  ASN A CB    1 
ATOM   1807 C  CG    . ASN A 1 233 ? 66.019 -4.593  10.055  1.00 18.70  ? 230  ASN A CG    1 
ATOM   1808 O  OD1   . ASN A 1 233 ? 66.391 -4.465  11.214  1.00 15.82  ? 230  ASN A OD1   1 
ATOM   1809 N  ND2   . ASN A 1 233 ? 66.116 -5.742  9.385   1.00 11.95  ? 230  ASN A ND2   1 
ATOM   1810 N  N     A LYS A 1 234 ? 62.406 -1.294  9.389   0.50 22.07  ? 231  LYS A N     1 
ATOM   1811 N  N     B LYS A 1 234 ? 62.412 -1.301  9.467   0.50 22.07  ? 231  LYS A N     1 
ATOM   1812 C  CA    A LYS A 1 234 ? 61.997 0.057   9.016   0.50 18.19  ? 231  LYS A CA    1 
ATOM   1813 C  CA    B LYS A 1 234 ? 61.953 0.048   9.183   0.50 18.19  ? 231  LYS A CA    1 
ATOM   1814 C  C     A LYS A 1 234 ? 62.188 1.007   10.207  0.50 18.58  ? 231  LYS A C     1 
ATOM   1815 C  C     B LYS A 1 234 ? 62.314 1.024   10.287  0.50 18.75  ? 231  LYS A C     1 
ATOM   1816 O  O     A LYS A 1 234 ? 62.139 0.565   11.352  0.50 20.01  ? 231  LYS A O     1 
ATOM   1817 O  O     B LYS A 1 234 ? 62.522 0.627   11.433  0.50 20.41  ? 231  LYS A O     1 
ATOM   1818 C  CB    A LYS A 1 234 ? 60.542 0.048   8.525   0.50 18.18  ? 231  LYS A CB    1 
ATOM   1819 C  CB    B LYS A 1 234 ? 60.443 0.059   8.990   0.50 19.10  ? 231  LYS A CB    1 
ATOM   1820 C  CG    A LYS A 1 234 ? 59.541 -0.540  9.505   0.50 17.67  ? 231  LYS A CG    1 
ATOM   1821 C  CG    B LYS A 1 234 ? 59.972 -0.620  7.748   0.50 16.21  ? 231  LYS A CG    1 
ATOM   1822 C  CD    A LYS A 1 234 ? 58.160 -0.665  8.874   0.50 16.57  ? 231  LYS A CD    1 
ATOM   1823 C  CD    B LYS A 1 234 ? 58.654 -0.004  7.363   0.50 22.76  ? 231  LYS A CD    1 
ATOM   1824 C  CE    A LYS A 1 234 ? 57.068 -0.775  9.930   0.50 17.60  ? 231  LYS A CE    1 
ATOM   1825 C  CE    B LYS A 1 234 ? 58.848 1.460   6.968   0.50 12.41  ? 231  LYS A CE    1 
ATOM   1826 N  NZ    A LYS A 1 234 ? 55.715 -0.611  9.317   0.50 13.03  ? 231  LYS A NZ    1 
ATOM   1827 N  NZ    B LYS A 1 234 ? 58.384 1.771   5.577   0.50 16.48  ? 231  LYS A NZ    1 
ATOM   1828 N  N     . PRO A 1 235 ? 62.405 2.318   9.952   1.00 14.89  ? 232  PRO A N     1 
ATOM   1829 C  CA    . PRO A 1 235 ? 62.386 2.980   8.636   1.00 16.56  ? 232  PRO A CA    1 
ATOM   1830 C  C     . PRO A 1 235 ? 63.752 3.172   8.012   1.00 16.89  ? 232  PRO A C     1 
ATOM   1831 O  O     . PRO A 1 235 ? 64.779 2.975   8.665   1.00 16.84  ? 232  PRO A O     1 
ATOM   1832 C  CB    . PRO A 1 235 ? 61.786 4.356   8.960   1.00 14.77  ? 232  PRO A CB    1 
ATOM   1833 C  CG    . PRO A 1 235 ? 62.390 4.657   10.320  1.00 15.57  ? 232  PRO A CG    1 
ATOM   1834 C  CD    . PRO A 1 235 ? 62.491 3.316   11.037  1.00 21.28  ? 232  PRO A CD    1 
ATOM   1835 N  N     . ASN A 1 236 ? 63.750 3.587   6.750   1.00 14.93  ? 233  ASN A N     1 
ATOM   1836 C  CA    . ASN A 1 236 ? 64.975 3.995   6.064   1.00 13.25  ? 233  ASN A CA    1 
ATOM   1837 C  C     . ASN A 1 236 ? 66.062 2.910   6.009   1.00 10.53  ? 233  ASN A C     1 
ATOM   1838 O  O     . ASN A 1 236 ? 67.246 3.221   6.039   1.00 12.81  ? 233  ASN A O     1 
ATOM   1839 C  CB    . ASN A 1 236 ? 65.530 5.260   6.733   1.00 19.14  ? 233  ASN A CB    1 
ATOM   1840 C  CG    . ASN A 1 236 ? 66.506 6.015   5.843   1.00 20.09  ? 233  ASN A CG    1 
ATOM   1841 O  OD1   . ASN A 1 236 ? 66.391 5.986   4.623   1.00 17.29  ? 233  ASN A OD1   1 
ATOM   1842 N  ND2   . ASN A 1 236 ? 67.465 6.694   6.458   1.00 20.81  ? 233  ASN A ND2   1 
ATOM   1843 N  N     . ARG A 1 237 ? 65.665 1.636   5.947   1.00 11.10  ? 234  ARG A N     1 
ATOM   1844 C  CA    . ARG A 1 237 ? 66.636 0.543   5.841   1.00 16.47  ? 234  ARG A CA    1 
ATOM   1845 C  C     . ARG A 1 237 ? 66.100 -0.524  4.896   1.00 16.64  ? 234  ARG A C     1 
ATOM   1846 O  O     . ARG A 1 237 ? 64.909 -0.551  4.608   1.00 13.47  ? 234  ARG A O     1 
ATOM   1847 C  CB    . ARG A 1 237 ? 66.937 -0.086  7.215   1.00 15.14  ? 234  ARG A CB    1 
ATOM   1848 C  CG    . ARG A 1 237 ? 67.555 0.858   8.258   1.00 16.25  ? 234  ARG A CG    1 
ATOM   1849 C  CD    . ARG A 1 237 ? 69.028 1.132   7.938   1.00 24.00  ? 234  ARG A CD    1 
ATOM   1850 N  NE    . ARG A 1 237 ? 69.712 1.943   8.950   1.00 24.29  ? 234  ARG A NE    1 
ATOM   1851 C  CZ    . ARG A 1 237 ? 69.752 3.275   8.946   1.00 32.61  ? 234  ARG A CZ    1 
ATOM   1852 N  NH1   . ARG A 1 237 ? 69.137 3.963   7.993   1.00 19.62  ? 234  ARG A NH1   1 
ATOM   1853 N  NH2   . ARG A 1 237 ? 70.408 3.923   9.900   1.00 34.47  ? 234  ARG A NH2   1 
ATOM   1854 N  N     . GLN A 1 238 ? 66.970 -1.406  4.410   1.00 12.63  ? 235  GLN A N     1 
ATOM   1855 C  CA    . GLN A 1 238 ? 66.494 -2.506  3.585   1.00 12.64  ? 235  GLN A CA    1 
ATOM   1856 C  C     . GLN A 1 238 ? 67.012 -3.835  4.115   1.00 16.10  ? 235  GLN A C     1 
ATOM   1857 O  O     . GLN A 1 238 ? 68.077 -3.901  4.729   1.00 14.14  ? 235  GLN A O     1 
ATOM   1858 C  CB    . GLN A 1 238 ? 66.902 -2.317  2.123   1.00 11.42  ? 235  GLN A CB    1 
ATOM   1859 C  CG    . GLN A 1 238 ? 68.406 -2.202  1.923   1.00 11.28  ? 235  GLN A CG    1 
ATOM   1860 C  CD    . GLN A 1 238 ? 68.778 -1.962  0.472   1.00 12.47  ? 235  GLN A CD    1 
ATOM   1861 O  OE1   . GLN A 1 238 ? 68.365 -0.969  -0.125  1.00 16.98  ? 235  GLN A OE1   1 
ATOM   1862 N  NE2   . GLN A 1 238 ? 69.553 -2.871  -0.102  1.00 11.11  ? 235  GLN A NE2   1 
ATOM   1863 N  N     . THR A 1 239 ? 66.242 -4.894  3.881   1.00 12.36  ? 236  THR A N     1 
ATOM   1864 C  CA    . THR A 1 239 ? 66.555 -6.192  4.458   1.00 11.64  ? 236  THR A CA    1 
ATOM   1865 C  C     . THR A 1 239 ? 66.567 -7.280  3.392   1.00 13.13  ? 236  THR A C     1 
ATOM   1866 O  O     . THR A 1 239 ? 65.644 -7.382  2.568   1.00 11.71  ? 236  THR A O     1 
ATOM   1867 C  CB    . THR A 1 239 ? 65.541 -6.559  5.566   1.00 12.45  ? 236  THR A CB    1 
ATOM   1868 O  OG1   . THR A 1 239 ? 65.439 -5.482  6.499   1.00 14.28  ? 236  THR A OG1   1 
ATOM   1869 C  CG2   . THR A 1 239 ? 65.950 -7.831  6.321   1.00 13.99  ? 236  THR A CG2   1 
ATOM   1870 N  N     . LEU A 1 240 ? 67.626 -8.085  3.417   1.00 11.45  ? 237  LEU A N     1 
ATOM   1871 C  CA    . LEU A 1 240 ? 67.764 -9.239  2.548   1.00 11.56  ? 237  LEU A CA    1 
ATOM   1872 C  C     . LEU A 1 240 ? 67.336 -10.508 3.300   1.00 15.75  ? 237  LEU A C     1 
ATOM   1873 O  O     . LEU A 1 240 ? 67.886 -10.840 4.362   1.00 13.16  ? 237  LEU A O     1 
ATOM   1874 C  CB    . LEU A 1 240 ? 69.214 -9.344  2.041   1.00 14.19  ? 237  LEU A CB    1 
ATOM   1875 C  CG    . LEU A 1 240 ? 69.530 -10.325 0.909   1.00 13.96  ? 237  LEU A CG    1 
ATOM   1876 C  CD1   . LEU A 1 240 ? 70.797 -9.884  0.197   1.00 14.54  ? 237  LEU A CD1   1 
ATOM   1877 C  CD2   . LEU A 1 240 ? 69.646 -11.794 1.395   1.00 11.59  ? 237  LEU A CD2   1 
ATOM   1878 N  N     . VAL A 1 241 ? 66.335 -11.203 2.759   1.00 14.23  ? 238  VAL A N     1 
ATOM   1879 C  CA    . VAL A 1 241 ? 65.901 -12.478 3.323   1.00 14.21  ? 238  VAL A CA    1 
ATOM   1880 C  C     . VAL A 1 241 ? 66.296 -13.552 2.335   1.00 14.52  ? 238  VAL A C     1 
ATOM   1881 O  O     . VAL A 1 241 ? 65.735 -13.639 1.244   1.00 13.27  ? 238  VAL A O     1 
ATOM   1882 C  CB    . VAL A 1 241 ? 64.383 -12.490 3.630   1.00 12.91  ? 238  VAL A CB    1 
ATOM   1883 C  CG1   . VAL A 1 241 ? 63.824 -13.916 3.783   1.00 10.74  ? 238  VAL A CG1   1 
ATOM   1884 C  CG2   . VAL A 1 241 ? 64.107 -11.661 4.888   1.00 11.40  ? 238  VAL A CG2   1 
ATOM   1885 N  N     . SER A 1 242 ? 67.314 -14.334 2.688   1.00 9.96   ? 239  SER A N     1 
ATOM   1886 C  CA    . SER A 1 242 ? 67.776 -15.396 1.797   1.00 13.26  ? 239  SER A CA    1 
ATOM   1887 C  C     . SER A 1 242 ? 66.911 -16.655 1.908   1.00 10.90  ? 239  SER A C     1 
ATOM   1888 O  O     . SER A 1 242 ? 66.155 -16.824 2.872   1.00 9.90   ? 239  SER A O     1 
ATOM   1889 C  CB    . SER A 1 242 ? 69.235 -15.743 2.100   1.00 17.33  ? 239  SER A CB    1 
ATOM   1890 O  OG    . SER A 1 242 ? 69.342 -16.280 3.408   1.00 16.58  ? 239  SER A OG    1 
ATOM   1891 N  N     . HIS A 1 243 ? 67.034 -17.556 0.931   1.00 10.08  ? 240  HIS A N     1 
ATOM   1892 C  CA    . HIS A 1 243 ? 66.298 -18.817 1.007   1.00 7.27   ? 240  HIS A CA    1 
ATOM   1893 C  C     . HIS A 1 243 ? 66.664 -19.559 2.296   1.00 13.52  ? 240  HIS A C     1 
ATOM   1894 O  O     . HIS A 1 243 ? 65.800 -20.153 2.960   1.00 11.05  ? 240  HIS A O     1 
ATOM   1895 C  CB    . HIS A 1 243 ? 66.581 -19.714 -0.198  1.00 12.83  ? 240  HIS A CB    1 
ATOM   1896 C  CG    . HIS A 1 243 ? 65.778 -20.981 -0.195  1.00 12.89  ? 240  HIS A CG    1 
ATOM   1897 N  ND1   . HIS A 1 243 ? 64.425 -20.996 -0.449  1.00 15.58  ? 240  HIS A ND1   1 
ATOM   1898 C  CD2   . HIS A 1 243 ? 66.128 -22.267 0.051   1.00 14.93  ? 240  HIS A CD2   1 
ATOM   1899 C  CE1   . HIS A 1 243 ? 63.976 -22.237 -0.375  1.00 22.92  ? 240  HIS A CE1   1 
ATOM   1900 N  NE2   . HIS A 1 243 ? 64.988 -23.030 -0.075  1.00 14.50  ? 240  HIS A NE2   1 
ATOM   1901 N  N     . GLY A 1 244 ? 67.944 -19.490 2.649   1.00 12.35  ? 241  GLY A N     1 
ATOM   1902 C  CA    . GLY A 1 244 ? 68.480 -20.197 3.799   1.00 13.66  ? 241  GLY A CA    1 
ATOM   1903 C  C     . GLY A 1 244 ? 67.981 -19.670 5.132   1.00 12.79  ? 241  GLY A C     1 
ATOM   1904 O  O     . GLY A 1 244 ? 67.859 -20.420 6.102   1.00 12.27  ? 241  GLY A O     1 
ATOM   1905 N  N     . SER A 1 245 ? 67.679 -18.375 5.184   1.00 11.99  ? 242  SER A N     1 
ATOM   1906 C  CA    . SER A 1 245 ? 67.185 -17.773 6.408   1.00 11.02  ? 242  SER A CA    1 
ATOM   1907 C  C     . SER A 1 245 ? 65.754 -18.202 6.750   1.00 10.52  ? 242  SER A C     1 
ATOM   1908 O  O     . SER A 1 245 ? 65.285 -17.959 7.860   1.00 12.00  ? 242  SER A O     1 
ATOM   1909 C  CB    . SER A 1 245 ? 67.247 -16.240 6.305   1.00 15.22  ? 242  SER A CB    1 
ATOM   1910 O  OG    . SER A 1 245 ? 66.197 -15.741 5.477   1.00 12.24  ? 242  SER A OG    1 
ATOM   1911 N  N     . VAL A 1 246 ? 65.052 -18.834 5.813   1.00 10.06  ? 243  VAL A N     1 
ATOM   1912 C  CA    . VAL A 1 246 ? 63.613 -19.036 6.005   1.00 11.08  ? 243  VAL A CA    1 
ATOM   1913 C  C     . VAL A 1 246 ? 63.237 -19.968 7.181   1.00 11.75  ? 243  VAL A C     1 
ATOM   1914 O  O     . VAL A 1 246 ? 62.363 -19.614 7.975   1.00 10.52  ? 243  VAL A O     1 
ATOM   1915 C  CB    . VAL A 1 246 ? 62.939 -19.547 4.703   1.00 13.34  ? 243  VAL A CB    1 
ATOM   1916 C  CG1   . VAL A 1 246 ? 61.473 -19.991 4.967   1.00 7.99   ? 243  VAL A CG1   1 
ATOM   1917 C  CG2   . VAL A 1 246 ? 62.986 -18.446 3.625   1.00 12.80  ? 243  VAL A CG2   1 
ATOM   1918 N  N     . PRO A 1 247 ? 63.893 -21.142 7.316   1.00 13.32  ? 244  PRO A N     1 
ATOM   1919 C  CA    . PRO A 1 247 ? 63.505 -22.009 8.446   1.00 14.13  ? 244  PRO A CA    1 
ATOM   1920 C  C     . PRO A 1 247 ? 63.529 -21.306 9.821   1.00 9.52   ? 244  PRO A C     1 
ATOM   1921 O  O     . PRO A 1 247 ? 62.536 -21.376 10.554  1.00 13.35  ? 244  PRO A O     1 
ATOM   1922 C  CB    . PRO A 1 247 ? 64.553 -23.142 8.396   1.00 10.30  ? 244  PRO A CB    1 
ATOM   1923 C  CG    . PRO A 1 247 ? 64.933 -23.216 6.923   1.00 18.28  ? 244  PRO A CG    1 
ATOM   1924 C  CD    . PRO A 1 247 ? 64.942 -21.768 6.474   1.00 11.53  ? 244  PRO A CD    1 
ATOM   1925 N  N     A GLN A 1 248 ? 64.631 -20.635 10.150  0.50 11.64  ? 245  GLN A N     1 
ATOM   1926 N  N     B GLN A 1 248 ? 64.624 -20.633 10.164  0.50 11.65  ? 245  GLN A N     1 
ATOM   1927 C  CA    A GLN A 1 248 ? 64.727 -19.947 11.433  0.50 11.48  ? 245  GLN A CA    1 
ATOM   1928 C  CA    B GLN A 1 248 ? 64.664 -19.959 11.456  0.50 11.47  ? 245  GLN A CA    1 
ATOM   1929 C  C     A GLN A 1 248 ? 63.714 -18.792 11.525  0.50 11.47  ? 245  GLN A C     1 
ATOM   1930 C  C     B GLN A 1 248 ? 63.655 -18.811 11.514  0.50 11.46  ? 245  GLN A C     1 
ATOM   1931 O  O     A GLN A 1 248 ? 63.029 -18.641 12.544  0.50 11.67  ? 245  GLN A O     1 
ATOM   1932 O  O     B GLN A 1 248 ? 62.927 -18.671 12.505  0.50 11.63  ? 245  GLN A O     1 
ATOM   1933 C  CB    A GLN A 1 248 ? 66.159 -19.437 11.670  0.50 12.58  ? 245  GLN A CB    1 
ATOM   1934 C  CB    B GLN A 1 248 ? 66.065 -19.436 11.768  0.50 12.68  ? 245  GLN A CB    1 
ATOM   1935 C  CG    A GLN A 1 248 ? 67.195 -20.537 11.929  0.50 12.58  ? 245  GLN A CG    1 
ATOM   1936 C  CG    B GLN A 1 248 ? 66.131 -18.707 13.110  0.50 16.68  ? 245  GLN A CG    1 
ATOM   1937 C  CD    A GLN A 1 248 ? 68.374 -20.066 12.788  0.50 18.75  ? 245  GLN A CD    1 
ATOM   1938 C  CD    B GLN A 1 248 ? 66.140 -19.660 14.306  0.50 23.47  ? 245  GLN A CD    1 
ATOM   1939 O  OE1   A GLN A 1 248 ? 69.522 -19.981 12.326  0.50 11.87  ? 245  GLN A OE1   1 
ATOM   1940 O  OE1   B GLN A 1 248 ? 66.993 -20.545 14.396  0.50 24.51  ? 245  GLN A OE1   1 
ATOM   1941 N  NE2   A GLN A 1 248 ? 68.093 -19.773 14.048  0.50 16.34  ? 245  GLN A NE2   1 
ATOM   1942 N  NE2   B GLN A 1 248 ? 65.194 -19.474 15.232  0.50 20.89  ? 245  GLN A NE2   1 
ATOM   1943 N  N     . LEU A 1 249 ? 63.615 -17.995 10.460  1.00 10.55  ? 246  LEU A N     1 
ATOM   1944 C  CA    . LEU A 1 249 ? 62.672 -16.856 10.409  1.00 10.07  ? 246  LEU A CA    1 
ATOM   1945 C  C     . LEU A 1 249 ? 61.237 -17.326 10.616  1.00 8.99   ? 246  LEU A C     1 
ATOM   1946 O  O     . LEU A 1 249 ? 60.489 -16.764 11.418  1.00 10.57  ? 246  LEU A O     1 
ATOM   1947 C  CB    . LEU A 1 249 ? 62.782 -16.106 9.068   1.00 10.26  ? 246  LEU A CB    1 
ATOM   1948 C  CG    . LEU A 1 249 ? 61.844 -14.905 8.850   1.00 16.88  ? 246  LEU A CG    1 
ATOM   1949 C  CD1   . LEU A 1 249 ? 62.140 -13.785 9.836   1.00 16.08  ? 246  LEU A CD1   1 
ATOM   1950 C  CD2   . LEU A 1 249 ? 61.895 -14.374 7.398   1.00 20.06  ? 246  LEU A CD2   1 
ATOM   1951 N  N     . PHE A 1 250 ? 60.856 -18.389 9.916   1.00 9.18   ? 247  PHE A N     1 
ATOM   1952 C  CA    . PHE A 1 250 ? 59.486 -18.875 10.002  1.00 11.76  ? 247  PHE A CA    1 
ATOM   1953 C  C     . PHE A 1 250 ? 59.186 -19.658 11.283  1.00 12.14  ? 247  PHE A C     1 
ATOM   1954 O  O     . PHE A 1 250 ? 58.024 -19.867 11.605  1.00 10.71  ? 247  PHE A O     1 
ATOM   1955 C  CB    . PHE A 1 250 ? 59.160 -19.740 8.779   1.00 11.56  ? 247  PHE A CB    1 
ATOM   1956 C  CG    . PHE A 1 250 ? 58.740 -18.942 7.568   1.00 14.53  ? 247  PHE A CG    1 
ATOM   1957 C  CD1   . PHE A 1 250 ? 58.232 -19.582 6.444   1.00 12.06  ? 247  PHE A CD1   1 
ATOM   1958 C  CD2   . PHE A 1 250 ? 58.856 -17.552 7.557   1.00 13.58  ? 247  PHE A CD2   1 
ATOM   1959 C  CE1   . PHE A 1 250 ? 57.843 -18.858 5.329   1.00 16.19  ? 247  PHE A CE1   1 
ATOM   1960 C  CE2   . PHE A 1 250 ? 58.471 -16.810 6.440   1.00 14.08  ? 247  PHE A CE2   1 
ATOM   1961 C  CZ    . PHE A 1 250 ? 57.957 -17.469 5.324   1.00 13.46  ? 247  PHE A CZ    1 
ATOM   1962 N  N     . SER A 1 251 ? 60.216 -20.089 12.015  1.00 11.59  ? 248  SER A N     1 
ATOM   1963 C  CA    . SER A 1 251 ? 59.984 -20.961 13.176  1.00 11.21  ? 248  SER A CA    1 
ATOM   1964 C  C     . SER A 1 251 ? 59.227 -20.238 14.299  1.00 13.37  ? 248  SER A C     1 
ATOM   1965 O  O     . SER A 1 251 ? 58.547 -20.869 15.106  1.00 8.94   ? 248  SER A O     1 
ATOM   1966 C  CB    . SER A 1 251 ? 61.307 -21.527 13.720  1.00 10.64  ? 248  SER A CB    1 
ATOM   1967 O  OG    . SER A 1 251 ? 62.103 -20.523 14.343  1.00 12.99  ? 248  SER A OG    1 
ATOM   1968 N  N     . GLN A 1 252 ? 59.339 -18.917 14.348  1.00 12.55  ? 249  GLN A N     1 
ATOM   1969 C  CA    . GLN A 1 252 ? 58.620 -18.156 15.361  1.00 12.60  ? 249  GLN A CA    1 
ATOM   1970 C  C     . GLN A 1 252 ? 57.752 -17.057 14.757  1.00 15.16  ? 249  GLN A C     1 
ATOM   1971 O  O     . GLN A 1 252 ? 57.378 -16.122 15.450  1.00 17.16  ? 249  GLN A O     1 
ATOM   1972 C  CB    . GLN A 1 252 ? 59.596 -17.523 16.344  1.00 17.05  ? 249  GLN A CB    1 
ATOM   1973 C  CG    . GLN A 1 252 ? 60.462 -18.493 17.105  1.00 17.03  ? 249  GLN A CG    1 
ATOM   1974 C  CD    . GLN A 1 252 ? 61.230 -17.782 18.180  1.00 27.28  ? 249  GLN A CD    1 
ATOM   1975 O  OE1   . GLN A 1 252 ? 60.711 -17.554 19.273  1.00 22.86  ? 249  GLN A OE1   1 
ATOM   1976 N  NE2   . GLN A 1 252 ? 62.458 -17.387 17.867  1.00 25.42  ? 249  GLN A NE2   1 
ATOM   1977 N  N     . MET A 1 253 ? 57.454 -17.168 13.469  1.00 11.53  ? 250  MET A N     1 
ATOM   1978 C  CA    . MET A 1 253 ? 56.723 -16.128 12.741  1.00 13.56  ? 250  MET A CA    1 
ATOM   1979 C  C     . MET A 1 253 ? 55.231 -16.422 12.791  1.00 13.39  ? 250  MET A C     1 
ATOM   1980 O  O     . MET A 1 253 ? 54.772 -17.414 12.218  1.00 12.09  ? 250  MET A O     1 
ATOM   1981 C  CB    . MET A 1 253 ? 57.220 -16.052 11.281  1.00 13.32  ? 250  MET A CB    1 
ATOM   1982 C  CG    . MET A 1 253 ? 56.547 -14.997 10.394  1.00 22.65  ? 250  MET A CG    1 
ATOM   1983 S  SD    . MET A 1 253 ? 56.842 -13.296 10.916  1.00 21.07  ? 250  MET A SD    1 
ATOM   1984 C  CE    . MET A 1 253 ? 58.631 -13.121 10.776  1.00 14.09  ? 250  MET A CE    1 
ATOM   1985 N  N     . PRO A 1 254 ? 54.455 -15.567 13.479  1.00 12.42  ? 251  PRO A N     1 
ATOM   1986 C  CA    . PRO A 1 254 ? 53.003 -15.810 13.508  1.00 16.11  ? 251  PRO A CA    1 
ATOM   1987 C  C     . PRO A 1 254 ? 52.409 -15.862 12.095  1.00 12.55  ? 251  PRO A C     1 
ATOM   1988 O  O     . PRO A 1 254 ? 52.812 -15.106 11.220  1.00 12.11  ? 251  PRO A O     1 
ATOM   1989 C  CB    . PRO A 1 254 ? 52.455 -14.616 14.302  1.00 11.79  ? 251  PRO A CB    1 
ATOM   1990 C  CG    . PRO A 1 254 ? 53.631 -14.162 15.136  1.00 19.46  ? 251  PRO A CG    1 
ATOM   1991 C  CD    . PRO A 1 254 ? 54.823 -14.351 14.220  1.00 17.81  ? 251  PRO A CD    1 
ATOM   1992 N  N     . ILE A 1 255 ? 51.481 -16.782 11.881  1.00 12.41  ? 252  ILE A N     1 
ATOM   1993 C  CA    . ILE A 1 255 ? 50.931 -17.006 10.553  1.00 11.71  ? 252  ILE A CA    1 
ATOM   1994 C  C     . ILE A 1 255 ? 50.327 -15.715 9.977   1.00 15.21  ? 252  ILE A C     1 
ATOM   1995 O  O     . ILE A 1 255 ? 50.471 -15.441 8.784   1.00 11.97  ? 252  ILE A O     1 
ATOM   1996 C  CB    . ILE A 1 255 ? 49.913 -18.153 10.604  1.00 13.94  ? 252  ILE A CB    1 
ATOM   1997 C  CG1   . ILE A 1 255 ? 50.694 -19.474 10.707  1.00 17.82  ? 252  ILE A CG1   1 
ATOM   1998 C  CG2   . ILE A 1 255 ? 49.001 -18.164 9.383   1.00 15.09  ? 252  ILE A CG2   1 
ATOM   1999 C  CD1   . ILE A 1 255 ? 49.883 -20.647 11.159  1.00 16.02  ? 252  ILE A CD1   1 
ATOM   2000 N  N     . ARG A 1 256 ? 49.731 -14.891 10.841  1.00 12.72  ? 253  ARG A N     1 
ATOM   2001 C  CA    . ARG A 1 256 ? 49.012 -13.703 10.380  1.00 12.73  ? 253  ARG A CA    1 
ATOM   2002 C  C     . ARG A 1 256 ? 49.950 -12.656 9.778   1.00 16.08  ? 253  ARG A C     1 
ATOM   2003 O  O     . ARG A 1 256 ? 49.495 -11.706 9.148   1.00 13.99  ? 253  ARG A O     1 
ATOM   2004 C  CB    . ARG A 1 256 ? 48.202 -13.076 11.525  1.00 12.65  ? 253  ARG A CB    1 
ATOM   2005 C  CG    . ARG A 1 256 ? 49.071 -12.478 12.621  1.00 17.47  ? 253  ARG A CG    1 
ATOM   2006 C  CD    . ARG A 1 256 ? 48.247 -11.800 13.720  1.00 24.07  ? 253  ARG A CD    1 
ATOM   2007 N  NE    . ARG A 1 256 ? 49.134 -11.337 14.788  1.00 22.73  ? 253  ARG A NE    1 
ATOM   2008 C  CZ    . ARG A 1 256 ? 49.623 -12.130 15.737  1.00 34.07  ? 253  ARG A CZ    1 
ATOM   2009 N  NH1   . ARG A 1 256 ? 49.290 -13.415 15.753  1.00 25.73  ? 253  ARG A NH1   1 
ATOM   2010 N  NH2   . ARG A 1 256 ? 50.446 -11.646 16.666  1.00 28.54  ? 253  ARG A NH2   1 
ATOM   2011 N  N     . LYS A 1 257 ? 51.256 -12.823 9.965   1.00 15.42  ? 254  LYS A N     1 
ATOM   2012 C  CA    . LYS A 1 257 ? 52.204 -11.838 9.461   1.00 12.89  ? 254  LYS A CA    1 
ATOM   2013 C  C     . LYS A 1 257 ? 52.459 -11.975 7.975   1.00 16.07  ? 254  LYS A C     1 
ATOM   2014 O  O     . LYS A 1 257 ? 52.962 -11.042 7.347   1.00 16.91  ? 254  LYS A O     1 
ATOM   2015 C  CB    . LYS A 1 257 ? 53.532 -11.925 10.201  1.00 15.34  ? 254  LYS A CB    1 
ATOM   2016 C  CG    . LYS A 1 257 ? 53.413 -11.673 11.683  1.00 20.81  ? 254  LYS A CG    1 
ATOM   2017 C  CD    . LYS A 1 257 ? 52.770 -10.339 11.980  1.00 22.04  ? 254  LYS A CD    1 
ATOM   2018 C  CE    . LYS A 1 257 ? 52.746 -10.077 13.490  1.00 41.74  ? 254  LYS A CE    1 
ATOM   2019 N  NZ    . LYS A 1 257 ? 52.274 -8.705  13.849  1.00 33.40  ? 254  LYS A NZ    1 
ATOM   2020 N  N     . ILE A 1 258 ? 52.126 -13.131 7.410   1.00 12.78  ? 255  ILE A N     1 
ATOM   2021 C  CA    . ILE A 1 258 ? 52.388 -13.364 5.994   1.00 12.54  ? 255  ILE A CA    1 
ATOM   2022 C  C     . ILE A 1 258 ? 51.237 -12.812 5.156   1.00 17.27  ? 255  ILE A C     1 
ATOM   2023 O  O     . ILE A 1 258 ? 50.068 -12.985 5.505   1.00 14.38  ? 255  ILE A O     1 
ATOM   2024 C  CB    . ILE A 1 258 ? 52.607 -14.869 5.696   1.00 16.30  ? 255  ILE A CB    1 
ATOM   2025 C  CG1   . ILE A 1 258 ? 54.065 -15.266 5.954   1.00 25.76  ? 255  ILE A CG1   1 
ATOM   2026 C  CG2   . ILE A 1 258 ? 52.296 -15.183 4.247   1.00 16.55  ? 255  ILE A CG2   1 
ATOM   2027 C  CD1   . ILE A 1 258 ? 54.533 -15.088 7.355   1.00 27.65  ? 255  ILE A CD1   1 
ATOM   2028 N  N     . ARG A 1 259 ? 51.575 -12.164 4.063   1.00 13.69  ? 256  ARG A N     1 
ATOM   2029 C  CA    . ARG A 1 259 ? 50.625 -11.506 3.213   1.00 14.49  ? 256  ARG A CA    1 
ATOM   2030 C  C     . ARG A 1 259 ? 49.543 -12.474 2.687   1.00 17.33  ? 256  ARG A C     1 
ATOM   2031 O  O     . ARG A 1 259 ? 49.875 -13.432 2.122   1.00 14.99  ? 256  ARG A O     1 
ATOM   2032 C  CB    . ARG A 1 259 ? 51.354 -10.873 2.048   1.00 17.94  ? 256  ARG A CB    1 
ATOM   2033 C  CG    . ARG A 1 259 ? 50.548 -9.872  1.283   1.00 22.52  ? 256  ARG A CG    1 
ATOM   2034 C  CD    . ARG A 1 259 ? 50.986 -9.807  -0.159  1.00 27.31  ? 256  ARG A CD    1 
ATOM   2035 N  NE    . ARG A 1 259 ? 49.854 -9.689  -1.043  1.00 61.01  ? 256  ARG A NE    1 
ATOM   2036 C  CZ    . ARG A 1 259 ? 49.158 -8.565  -1.166  1.00 58.10  ? 256  ARG A CZ    1 
ATOM   2037 N  NH1   . ARG A 1 259 ? 48.121 -8.474  -1.958  1.00 51.16  ? 256  ARG A NH1   1 
ATOM   2038 N  NH2   . ARG A 1 259 ? 49.526 -7.523  -0.470  1.00 50.63  ? 256  ARG A NH2   1 
ATOM   2039 N  N     . SER A 1 260 ? 48.285 -12.127 2.908   1.00 17.03  ? 257  SER A N     1 
ATOM   2040 C  CA    . SER A 1 260 ? 47.063 -12.887 2.570   1.00 19.15  ? 257  SER A CA    1 
ATOM   2041 C  C     . SER A 1 260 ? 46.591 -13.773 3.726   1.00 21.18  ? 257  SER A C     1 
ATOM   2042 O  O     . SER A 1 260 ? 45.484 -14.306 3.680   1.00 19.12  ? 257  SER A O     1 
ATOM   2043 C  CB    . SER A 1 260 ? 47.224 -13.742 1.297   1.00 19.49  ? 257  SER A CB    1 
ATOM   2044 O  OG    . SER A 1 260 ? 47.821 -15.011 1.569   1.00 19.58  ? 257  SER A OG    1 
ATOM   2045 N  N     . LEU A 1 261 ? 47.411 -13.921 4.765   1.00 14.35  ? 258  LEU A N     1 
ATOM   2046 C  CA    . LEU A 1 261 ? 47.018 -14.730 5.920   1.00 13.89  ? 258  LEU A CA    1 
ATOM   2047 C  C     . LEU A 1 261 ? 46.612 -13.891 7.145   1.00 15.29  ? 258  LEU A C     1 
ATOM   2048 O  O     . LEU A 1 261 ? 46.419 -14.424 8.236   1.00 13.87  ? 258  LEU A O     1 
ATOM   2049 C  CB    . LEU A 1 261 ? 48.156 -15.692 6.295   1.00 15.24  ? 258  LEU A CB    1 
ATOM   2050 C  CG    . LEU A 1 261 ? 48.551 -16.683 5.186   1.00 16.42  ? 258  LEU A CG    1 
ATOM   2051 C  CD1   . LEU A 1 261 ? 49.568 -17.716 5.683   1.00 13.58  ? 258  LEU A CD1   1 
ATOM   2052 C  CD2   . LEU A 1 261 ? 47.323 -17.402 4.614   1.00 16.25  ? 258  LEU A CD2   1 
ATOM   2053 N  N     . GLY A 1 262 ? 46.468 -12.578 6.975   1.00 15.96  ? 259  GLY A N     1 
ATOM   2054 C  CA    . GLY A 1 262 ? 46.131 -11.722 8.101   1.00 16.06  ? 259  GLY A CA    1 
ATOM   2055 C  C     . GLY A 1 262 ? 44.661 -11.726 8.502   1.00 22.05  ? 259  GLY A C     1 
ATOM   2056 O  O     . GLY A 1 262 ? 44.275 -11.097 9.484   1.00 21.01  ? 259  GLY A O     1 
ATOM   2057 N  N     . GLY A 1 263 ? 43.838 -12.451 7.751   1.00 19.15  ? 260  GLY A N     1 
ATOM   2058 C  CA    . GLY A 1 263 ? 42.399 -12.404 7.938   1.00 16.60  ? 260  GLY A CA    1 
ATOM   2059 C  C     . GLY A 1 263 ? 41.779 -13.731 8.319   1.00 23.66  ? 260  GLY A C     1 
ATOM   2060 O  O     . GLY A 1 263 ? 42.325 -14.465 9.145   1.00 17.61  ? 260  GLY A O     1 
ATOM   2061 N  N     . LYS A 1 264 ? 40.637 -14.047 7.714   1.00 16.45  ? 261  LYS A N     1 
ATOM   2062 C  CA    . LYS A 1 264 ? 39.883 -15.246 8.078   1.00 20.54  ? 261  LYS A CA    1 
ATOM   2063 C  C     . LYS A 1 264 ? 40.605 -16.557 7.748   1.00 14.73  ? 261  LYS A C     1 
ATOM   2064 O  O     . LYS A 1 264 ? 40.569 -17.489 8.549   1.00 18.28  ? 261  LYS A O     1 
ATOM   2065 C  CB    . LYS A 1 264 ? 38.507 -15.229 7.400   1.00 22.63  ? 261  LYS A CB    1 
ATOM   2066 C  CG    . LYS A 1 264 ? 37.526 -14.264 8.058   1.00 29.57  ? 261  LYS A CG    1 
ATOM   2067 C  CD    . LYS A 1 264 ? 36.178 -14.239 7.331   1.00 26.13  ? 261  LYS A CD    1 
ATOM   2068 C  CE    . LYS A 1 264 ? 35.220 -13.203 7.916   1.00 41.51  ? 261  LYS A CE    1 
ATOM   2069 N  NZ    . LYS A 1 264 ? 33.878 -13.264 7.251   1.00 37.34  ? 261  LYS A NZ    1 
ATOM   2070 N  N     . LEU A 1 265 ? 41.251 -16.633 6.584   1.00 12.22  ? 262  LEU A N     1 
ATOM   2071 C  CA    . LEU A 1 265 ? 41.976 -17.846 6.202   1.00 16.70  ? 262  LEU A CA    1 
ATOM   2072 C  C     . LEU A 1 265 ? 43.101 -18.149 7.190   1.00 14.50  ? 262  LEU A C     1 
ATOM   2073 O  O     . LEU A 1 265 ? 43.256 -19.282 7.643   1.00 18.69  ? 262  LEU A O     1 
ATOM   2074 C  CB    . LEU A 1 265 ? 42.546 -17.720 4.791   1.00 12.35  ? 262  LEU A CB    1 
ATOM   2075 C  CG    . LEU A 1 265 ? 43.440 -18.843 4.264   1.00 16.86  ? 262  LEU A CG    1 
ATOM   2076 C  CD1   . LEU A 1 265 ? 42.656 -20.155 4.158   1.00 18.94  ? 262  LEU A CD1   1 
ATOM   2077 C  CD2   . LEU A 1 265 ? 44.050 -18.462 2.904   1.00 15.42  ? 262  LEU A CD2   1 
ATOM   2078 N  N     . GLY A 1 266 ? 43.881 -17.127 7.528   1.00 15.17  ? 263  GLY A N     1 
ATOM   2079 C  CA    . GLY A 1 266 ? 44.959 -17.296 8.479   1.00 16.12  ? 263  GLY A CA    1 
ATOM   2080 C  C     . GLY A 1 266 ? 44.427 -17.764 9.816   1.00 19.92  ? 263  GLY A C     1 
ATOM   2081 O  O     . GLY A 1 266 ? 45.022 -18.627 10.467  1.00 16.04  ? 263  GLY A O     1 
ATOM   2082 N  N     . ALA A 1 267 ? 43.295 -17.201 10.226  1.00 16.79  ? 264  ALA A N     1 
ATOM   2083 C  CA    . ALA A 1 267 ? 42.671 -17.616 11.472  1.00 17.92  ? 264  ALA A CA    1 
ATOM   2084 C  C     . ALA A 1 267 ? 42.247 -19.070 11.381  1.00 15.49  ? 264  ALA A C     1 
ATOM   2085 O  O     . ALA A 1 267 ? 42.358 -19.812 12.345  1.00 17.49  ? 264  ALA A O     1 
ATOM   2086 C  CB    . ALA A 1 267 ? 41.465 -16.722 11.809  1.00 19.90  ? 264  ALA A CB    1 
ATOM   2087 N  N     . SER A 1 268 ? 41.768 -19.487 10.215  1.00 16.52  ? 265  SER A N     1 
ATOM   2088 C  CA    . SER A 1 268 ? 41.320 -20.863 10.081  1.00 15.13  ? 265  SER A CA    1 
ATOM   2089 C  C     . SER A 1 268 ? 42.513 -21.833 10.036  1.00 15.92  ? 265  SER A C     1 
ATOM   2090 O  O     . SER A 1 268 ? 42.416 -22.954 10.543  1.00 17.84  ? 265  SER A O     1 
ATOM   2091 C  CB    . SER A 1 268 ? 40.433 -21.032 8.840   1.00 21.73  ? 265  SER A CB    1 
ATOM   2092 O  OG    . SER A 1 268 ? 41.173 -20.886 7.650   1.00 29.04  ? 265  SER A OG    1 
ATOM   2093 N  N     . VAL A 1 269 ? 43.632 -21.412 9.447   1.00 16.99  ? 266  VAL A N     1 
ATOM   2094 C  CA    . VAL A 1 269 ? 44.827 -22.266 9.436   1.00 15.75  ? 266  VAL A CA    1 
ATOM   2095 C  C     . VAL A 1 269 ? 45.232 -22.585 10.882  1.00 18.05  ? 266  VAL A C     1 
ATOM   2096 O  O     . VAL A 1 269 ? 45.485 -23.739 11.239  1.00 17.45  ? 266  VAL A O     1 
ATOM   2097 C  CB    . VAL A 1 269 ? 46.019 -21.621 8.691   1.00 17.47  ? 266  VAL A CB    1 
ATOM   2098 C  CG1   . VAL A 1 269 ? 47.287 -22.468 8.888   1.00 18.33  ? 266  VAL A CG1   1 
ATOM   2099 C  CG2   . VAL A 1 269 ? 45.708 -21.467 7.191   1.00 15.33  ? 266  VAL A CG2   1 
ATOM   2100 N  N     . ILE A 1 270 ? 45.238 -21.552 11.710  1.00 15.64  ? 267  ILE A N     1 
ATOM   2101 C  CA    . ILE A 1 270 ? 45.607 -21.651 13.117  1.00 15.46  ? 267  ILE A CA    1 
ATOM   2102 C  C     . ILE A 1 270 ? 44.639 -22.557 13.872  1.00 14.78  ? 267  ILE A C     1 
ATOM   2103 O  O     . ILE A 1 270 ? 45.060 -23.490 14.569  1.00 21.45  ? 267  ILE A O     1 
ATOM   2104 C  CB    . ILE A 1 270 ? 45.626 -20.244 13.765  1.00 14.59  ? 267  ILE A CB    1 
ATOM   2105 C  CG1   . ILE A 1 270 ? 46.850 -19.456 13.293  1.00 16.00  ? 267  ILE A CG1   1 
ATOM   2106 C  CG2   . ILE A 1 270 ? 45.579 -20.325 15.286  1.00 25.32  ? 267  ILE A CG2   1 
ATOM   2107 C  CD1   . ILE A 1 270 ? 46.733 -17.955 13.542  1.00 21.40  ? 267  ILE A CD1   1 
ATOM   2108 N  N     . GLU A 1 271 ? 43.343 -22.289 13.713  1.00 15.71  ? 268  GLU A N     1 
ATOM   2109 C  CA    . GLU A 1 271 ? 42.310 -23.050 14.408  1.00 22.37  ? 268  GLU A CA    1 
ATOM   2110 C  C     . GLU A 1 271 ? 42.239 -24.505 13.976  1.00 27.56  ? 268  GLU A C     1 
ATOM   2111 O  O     . GLU A 1 271 ? 42.264 -25.404 14.818  1.00 20.21  ? 268  GLU A O     1 
ATOM   2112 C  CB    . GLU A 1 271 ? 40.943 -22.401 14.205  1.00 28.36  ? 268  GLU A CB    1 
ATOM   2113 C  CG    . GLU A 1 271 ? 39.786 -23.286 14.637  1.00 45.21  ? 268  GLU A CG    1 
ATOM   2114 C  CD    . GLU A 1 271 ? 38.790 -22.551 15.507  1.00 51.39  ? 268  GLU A CD    1 
ATOM   2115 O  OE1   . GLU A 1 271 ? 37.584 -22.572 15.174  1.00 50.76  ? 268  GLU A OE1   1 
ATOM   2116 O  OE2   . GLU A 1 271 ? 39.216 -21.954 16.523  1.00 52.90  ? 268  GLU A OE2   1 
ATOM   2117 N  N     . ILE A 1 272 ? 42.135 -24.740 12.670  1.00 20.85  ? 269  ILE A N     1 
ATOM   2118 C  CA    . ILE A 1 272 ? 41.965 -26.097 12.169  1.00 18.21  ? 269  ILE A CA    1 
ATOM   2119 C  C     . ILE A 1 272 ? 43.199 -26.970 12.413  1.00 20.34  ? 269  ILE A C     1 
ATOM   2120 O  O     . ILE A 1 272 ? 43.085 -28.158 12.723  1.00 21.40  ? 269  ILE A O     1 
ATOM   2121 C  CB    . ILE A 1 272 ? 41.634 -26.096 10.652  1.00 19.40  ? 269  ILE A CB    1 
ATOM   2122 C  CG1   . ILE A 1 272 ? 40.229 -25.540 10.419  1.00 18.49  ? 269  ILE A CG1   1 
ATOM   2123 C  CG2   . ILE A 1 272 ? 41.736 -27.500 10.066  1.00 20.21  ? 269  ILE A CG2   1 
ATOM   2124 C  CD1   . ILE A 1 272 ? 39.824 -25.507 8.958   1.00 30.46  ? 269  ILE A CD1   1 
ATOM   2125 N  N     . LEU A 1 273 ? 44.383 -26.390 12.282  1.00 21.17  ? 270  LEU A N     1 
ATOM   2126 C  CA    . LEU A 1 273 ? 45.600 -27.193 12.372  1.00 17.82  ? 270  LEU A CA    1 
ATOM   2127 C  C     . LEU A 1 273 ? 46.209 -27.166 13.766  1.00 18.00  ? 270  LEU A C     1 
ATOM   2128 O  O     . LEU A 1 273 ? 47.099 -27.965 14.085  1.00 18.48  ? 270  LEU A O     1 
ATOM   2129 C  CB    . LEU A 1 273 ? 46.621 -26.722 11.336  1.00 19.06  ? 270  LEU A CB    1 
ATOM   2130 C  CG    . LEU A 1 273 ? 46.216 -26.927 9.872   1.00 18.01  ? 270  LEU A CG    1 
ATOM   2131 C  CD1   . LEU A 1 273 ? 47.321 -26.432 8.928   1.00 12.78  ? 270  LEU A CD1   1 
ATOM   2132 C  CD2   . LEU A 1 273 ? 45.887 -28.396 9.597   1.00 18.36  ? 270  LEU A CD2   1 
ATOM   2133 N  N     . GLY A 1 274 ? 45.748 -26.240 14.598  1.00 16.83  ? 271  GLY A N     1 
ATOM   2134 C  CA    . GLY A 1 274 ? 46.242 -26.157 15.961  1.00 15.80  ? 271  GLY A CA    1 
ATOM   2135 C  C     . GLY A 1 274 ? 47.685 -25.701 16.031  1.00 22.33  ? 271  GLY A C     1 
ATOM   2136 O  O     . GLY A 1 274 ? 48.444 -26.151 16.893  1.00 22.59  ? 271  GLY A O     1 
ATOM   2137 N  N     . ILE A 1 275 ? 48.066 -24.796 15.128  1.00 17.96  ? 272  ILE A N     1 
ATOM   2138 C  CA    . ILE A 1 275 ? 49.435 -24.277 15.091  1.00 15.81  ? 272  ILE A CA    1 
ATOM   2139 C  C     . ILE A 1 275 ? 49.463 -22.754 15.249  1.00 18.37  ? 272  ILE A C     1 
ATOM   2140 O  O     . ILE A 1 275 ? 48.419 -22.109 15.207  1.00 21.97  ? 272  ILE A O     1 
ATOM   2141 C  CB    . ILE A 1 275 ? 50.144 -24.667 13.763  1.00 16.53  ? 272  ILE A CB    1 
ATOM   2142 C  CG1   . ILE A 1 275 ? 49.433 -24.033 12.559  1.00 16.63  ? 272  ILE A CG1   1 
ATOM   2143 C  CG2   . ILE A 1 275 ? 50.228 -26.199 13.619  1.00 11.53  ? 272  ILE A CG2   1 
ATOM   2144 C  CD1   . ILE A 1 275 ? 50.158 -24.253 11.205  1.00 18.35  ? 272  ILE A CD1   1 
ATOM   2145 N  N     . GLU A 1 276 ? 50.658 -22.185 15.425  1.00 14.15  ? 273  GLU A N     1 
ATOM   2146 C  CA    . GLU A 1 276 ? 50.808 -20.726 15.604  1.00 14.42  ? 273  GLU A CA    1 
ATOM   2147 C  C     . GLU A 1 276 ? 51.754 -20.081 14.583  1.00 19.58  ? 273  GLU A C     1 
ATOM   2148 O  O     . GLU A 1 276 ? 51.585 -18.915 14.219  1.00 16.28  ? 273  GLU A O     1 
ATOM   2149 C  CB    . GLU A 1 276 ? 51.334 -20.393 16.999  1.00 19.17  ? 273  GLU A CB    1 
ATOM   2150 C  CG    . GLU A 1 276 ? 50.446 -20.794 18.161  1.00 32.50  ? 273  GLU A CG    1 
ATOM   2151 C  CD    . GLU A 1 276 ? 51.113 -20.540 19.511  1.00 44.41  ? 273  GLU A CD    1 
ATOM   2152 O  OE1   . GLU A 1 276 ? 51.163 -21.472 20.341  1.00 54.59  ? 273  GLU A OE1   1 
ATOM   2153 O  OE2   . GLU A 1 276 ? 51.588 -19.407 19.744  1.00 44.14  ? 273  GLU A OE2   1 
ATOM   2154 N  N     . TYR A 1 277 ? 52.758 -20.832 14.141  1.00 14.21  ? 274  TYR A N     1 
ATOM   2155 C  CA    . TYR A 1 277 ? 53.856 -20.251 13.369  1.00 14.75  ? 274  TYR A CA    1 
ATOM   2156 C  C     . TYR A 1 277 ? 53.915 -20.816 11.971  1.00 13.67  ? 274  TYR A C     1 
ATOM   2157 O  O     . TYR A 1 277 ? 53.545 -21.974 11.732  1.00 13.95  ? 274  TYR A O     1 
ATOM   2158 C  CB    . TYR A 1 277 ? 55.206 -20.476 14.075  1.00 12.69  ? 274  TYR A CB    1 
ATOM   2159 C  CG    . TYR A 1 277 ? 55.222 -19.955 15.491  1.00 16.61  ? 274  TYR A CG    1 
ATOM   2160 C  CD1   . TYR A 1 277 ? 55.456 -20.807 16.566  1.00 17.85  ? 274  TYR A CD1   1 
ATOM   2161 C  CD2   . TYR A 1 277 ? 54.957 -18.622 15.758  1.00 14.62  ? 274  TYR A CD2   1 
ATOM   2162 C  CE1   . TYR A 1 277 ? 55.454 -20.336 17.867  1.00 17.84  ? 274  TYR A CE1   1 
ATOM   2163 C  CE2   . TYR A 1 277 ? 54.947 -18.137 17.054  1.00 17.76  ? 274  TYR A CE2   1 
ATOM   2164 C  CZ    . TYR A 1 277 ? 55.190 -19.005 18.109  1.00 28.87  ? 274  TYR A CZ    1 
ATOM   2165 O  OH    . TYR A 1 277 ? 55.178 -18.546 19.408  1.00 23.08  ? 274  TYR A OH    1 
ATOM   2166 N  N     . MET A 1 278 ? 54.393 -19.987 11.049  1.00 10.60  ? 275  MET A N     1 
ATOM   2167 C  CA    . MET A 1 278 ? 54.494 -20.359 9.641   1.00 14.86  ? 275  MET A CA    1 
ATOM   2168 C  C     . MET A 1 278 ? 55.280 -21.670 9.438   1.00 17.89  ? 275  MET A C     1 
ATOM   2169 O  O     . MET A 1 278 ? 54.894 -22.531 8.635   1.00 12.72  ? 275  MET A O     1 
ATOM   2170 C  CB    . MET A 1 278 ? 55.150 -19.213 8.864   1.00 14.77  ? 275  MET A CB    1 
ATOM   2171 C  CG    . MET A 1 278 ? 54.791 -19.163 7.394   1.00 20.88  ? 275  MET A CG    1 
ATOM   2172 S  SD    . MET A 1 278 ? 53.018 -19.000 7.066   1.00 19.87  ? 275  MET A SD    1 
ATOM   2173 C  CE    . MET A 1 278 ? 53.089 -19.374 5.316   1.00 24.09  ? 275  MET A CE    1 
ATOM   2174 N  N     . GLY A 1 279 ? 56.368 -21.826 10.184  1.00 13.42  ? 276  GLY A N     1 
ATOM   2175 C  CA    . GLY A 1 279 ? 57.214 -23.006 10.049  1.00 14.26  ? 276  GLY A CA    1 
ATOM   2176 C  C     . GLY A 1 279 ? 56.484 -24.299 10.358  1.00 17.97  ? 276  GLY A C     1 
ATOM   2177 O  O     . GLY A 1 279 ? 56.797 -25.355 9.792   1.00 17.45  ? 276  GLY A O     1 
ATOM   2178 N  N     . GLU A 1 280 ? 55.496 -24.230 11.247  1.00 11.38  ? 277  GLU A N     1 
ATOM   2179 C  CA    . GLU A 1 280 ? 54.795 -25.434 11.653  1.00 10.69  ? 277  GLU A CA    1 
ATOM   2180 C  C     . GLU A 1 280 ? 53.991 -26.034 10.494  1.00 10.87  ? 277  GLU A C     1 
ATOM   2181 O  O     . GLU A 1 280 ? 53.575 -27.187 10.566  1.00 14.78  ? 277  GLU A O     1 
ATOM   2182 C  CB    . GLU A 1 280 ? 53.855 -25.150 12.834  1.00 10.13  ? 277  GLU A CB    1 
ATOM   2183 C  CG    . GLU A 1 280 ? 54.543 -24.772 14.127  1.00 15.48  ? 277  GLU A CG    1 
ATOM   2184 C  CD    . GLU A 1 280 ? 53.544 -24.520 15.240  1.00 18.60  ? 277  GLU A CD    1 
ATOM   2185 O  OE1   . GLU A 1 280 ? 53.219 -23.352 15.479  1.00 16.34  ? 277  GLU A OE1   1 
ATOM   2186 O  OE2   . GLU A 1 280 ? 53.068 -25.490 15.861  1.00 18.42  ? 277  GLU A OE2   1 
ATOM   2187 N  N     . LEU A 1 281 ? 53.773 -25.260 9.434   1.00 12.28  ? 278  LEU A N     1 
ATOM   2188 C  CA    . LEU A 1 281 ? 53.046 -25.759 8.266   1.00 14.83  ? 278  LEU A CA    1 
ATOM   2189 C  C     . LEU A 1 281 ? 53.793 -26.854 7.497   1.00 13.53  ? 278  LEU A C     1 
ATOM   2190 O  O     . LEU A 1 281 ? 53.179 -27.597 6.740   1.00 12.72  ? 278  LEU A O     1 
ATOM   2191 C  CB    . LEU A 1 281 ? 52.723 -24.606 7.310   1.00 8.81   ? 278  LEU A CB    1 
ATOM   2192 C  CG    . LEU A 1 281 ? 51.523 -23.751 7.726   1.00 17.19  ? 278  LEU A CG    1 
ATOM   2193 C  CD1   . LEU A 1 281 ? 51.512 -22.436 6.953   1.00 19.49  ? 278  LEU A CD1   1 
ATOM   2194 C  CD2   . LEU A 1 281 ? 50.231 -24.546 7.494   1.00 17.55  ? 278  LEU A CD2   1 
ATOM   2195 N  N     . THR A 1 282 ? 55.113 -26.948 7.666   1.00 15.48  ? 279  THR A N     1 
ATOM   2196 C  CA    . THR A 1 282 ? 55.895 -27.896 6.863   1.00 17.44  ? 279  THR A CA    1 
ATOM   2197 C  C     . THR A 1 282 ? 55.525 -29.350 7.175   1.00 17.40  ? 279  THR A C     1 
ATOM   2198 O  O     . THR A 1 282 ? 55.787 -30.245 6.385   1.00 16.93  ? 279  THR A O     1 
ATOM   2199 C  CB    . THR A 1 282 ? 57.421 -27.717 7.070   1.00 17.35  ? 279  THR A CB    1 
ATOM   2200 O  OG1   . THR A 1 282 ? 57.755 -27.962 8.441   1.00 17.26  ? 279  THR A OG1   1 
ATOM   2201 C  CG2   . THR A 1 282 ? 57.881 -26.303 6.671   1.00 13.28  ? 279  THR A CG2   1 
ATOM   2202 N  N     . GLN A 1 283 ? 54.904 -29.589 8.324   1.00 13.25  ? 280  GLN A N     1 
ATOM   2203 C  CA    . GLN A 1 283 ? 54.631 -30.962 8.726   1.00 17.01  ? 280  GLN A CA    1 
ATOM   2204 C  C     . GLN A 1 283 ? 53.351 -31.534 8.117   1.00 18.95  ? 280  GLN A C     1 
ATOM   2205 O  O     . GLN A 1 283 ? 52.950 -32.641 8.442   1.00 25.75  ? 280  GLN A O     1 
ATOM   2206 C  CB    . GLN A 1 283 ? 54.563 -31.037 10.250  1.00 22.75  ? 280  GLN A CB    1 
ATOM   2207 C  CG    A GLN A 1 283 ? 55.915 -30.773 10.873  0.57 17.68  ? 280  GLN A CG    1 
ATOM   2208 C  CG    B GLN A 1 283 ? 53.399 -30.273 10.833  0.43 14.53  ? 280  GLN A CG    1 
ATOM   2209 C  CD    A GLN A 1 283 ? 57.007 -31.538 10.148  0.57 20.95  ? 280  GLN A CD    1 
ATOM   2210 C  CD    B GLN A 1 283 ? 53.643 -29.839 12.263  0.43 23.35  ? 280  GLN A CD    1 
ATOM   2211 O  OE1   A GLN A 1 283 ? 57.027 -32.769 10.166  0.57 19.11  ? 280  GLN A OE1   1 
ATOM   2212 O  OE1   B GLN A 1 283 ? 54.490 -30.399 12.958  0.43 30.24  ? 280  GLN A OE1   1 
ATOM   2213 N  NE2   A GLN A 1 283 ? 57.904 -30.814 9.484   0.57 20.83  ? 280  GLN A NE2   1 
ATOM   2214 N  NE2   B GLN A 1 283 ? 52.899 -28.832 12.711  0.43 9.82   ? 280  GLN A NE2   1 
ATOM   2215 N  N     . PHE A 1 284 ? 52.706 -30.779 7.238   1.00 14.81  ? 281  PHE A N     1 
ATOM   2216 C  CA    . PHE A 1 284 ? 51.504 -31.263 6.594   1.00 13.88  ? 281  PHE A CA    1 
ATOM   2217 C  C     . PHE A 1 284 ? 51.785 -31.571 5.126   1.00 18.97  ? 281  PHE A C     1 
ATOM   2218 O  O     . PHE A 1 284 ? 52.632 -30.932 4.511   1.00 20.15  ? 281  PHE A O     1 
ATOM   2219 C  CB    . PHE A 1 284 ? 50.385 -30.238 6.744   1.00 14.59  ? 281  PHE A CB    1 
ATOM   2220 C  CG    . PHE A 1 284 ? 50.016 -29.973 8.181   1.00 16.90  ? 281  PHE A CG    1 
ATOM   2221 C  CD1   . PHE A 1 284 ? 49.129 -30.809 8.844   1.00 16.55  ? 281  PHE A CD1   1 
ATOM   2222 C  CD2   . PHE A 1 284 ? 50.592 -28.922 8.878   1.00 14.98  ? 281  PHE A CD2   1 
ATOM   2223 C  CE1   . PHE A 1 284 ? 48.796 -30.582 10.177  1.00 23.28  ? 281  PHE A CE1   1 
ATOM   2224 C  CE2   . PHE A 1 284 ? 50.268 -28.687 10.208  1.00 18.21  ? 281  PHE A CE2   1 
ATOM   2225 C  CZ    . PHE A 1 284 ? 49.370 -29.522 10.863  1.00 17.90  ? 281  PHE A CZ    1 
ATOM   2226 N  N     . THR A 1 285 ? 51.099 -32.563 4.567   1.00 18.66  ? 282  THR A N     1 
ATOM   2227 C  CA    . THR A 1 285 ? 51.296 -32.855 3.156   1.00 20.33  ? 282  THR A CA    1 
ATOM   2228 C  C     . THR A 1 285 ? 50.549 -31.813 2.353   1.00 13.00  ? 282  THR A C     1 
ATOM   2229 O  O     . THR A 1 285 ? 49.699 -31.112 2.882   1.00 14.50  ? 282  THR A O     1 
ATOM   2230 C  CB    . THR A 1 285 ? 50.800 -34.254 2.754   1.00 14.96  ? 282  THR A CB    1 
ATOM   2231 O  OG1   . THR A 1 285 ? 49.387 -34.310 2.931   1.00 12.80  ? 282  THR A OG1   1 
ATOM   2232 C  CG2   . THR A 1 285 ? 51.473 -35.324 3.602   1.00 18.42  ? 282  THR A CG2   1 
ATOM   2233 N  N     . GLU A 1 286 ? 50.870 -31.715 1.072   1.00 15.95  ? 283  GLU A N     1 
ATOM   2234 C  CA    . GLU A 1 286 ? 50.181 -30.771 0.219   1.00 20.06  ? 283  GLU A CA    1 
ATOM   2235 C  C     . GLU A 1 286 ? 48.706 -31.159 0.149   1.00 19.22  ? 283  GLU A C     1 
ATOM   2236 O  O     . GLU A 1 286 ? 47.834 -30.294 0.221   1.00 15.94  ? 283  GLU A O     1 
ATOM   2237 C  CB    . GLU A 1 286 ? 50.822 -30.716 -1.177  1.00 16.89  ? 283  GLU A CB    1 
ATOM   2238 C  CG    . GLU A 1 286 ? 50.182 -29.662 -2.074  1.00 16.39  ? 283  GLU A CG    1 
ATOM   2239 C  CD    . GLU A 1 286 ? 50.871 -29.533 -3.414  1.00 27.96  ? 283  GLU A CD    1 
ATOM   2240 O  OE1   . GLU A 1 286 ? 51.764 -30.347 -3.703  1.00 21.71  ? 283  GLU A OE1   1 
ATOM   2241 O  OE2   . GLU A 1 286 ? 50.519 -28.610 -4.176  1.00 22.06  ? 283  GLU A OE2   1 
ATOM   2242 N  N     A SER A 1 287 ? 48.425 -32.459 0.045   0.72 17.18  ? 284  SER A N     1 
ATOM   2243 N  N     B SER A 1 287 ? 48.425 -32.457 0.038   0.28 17.20  ? 284  SER A N     1 
ATOM   2244 C  CA    . SER A 1 287 ? 47.044 -32.922 -0.011  1.00 15.51  ? 284  SER A CA    1 
ATOM   2245 C  C     . SER A 1 287 ? 46.306 -32.573 1.271   1.00 18.64  ? 284  SER A C     1 
ATOM   2246 O  O     . SER A 1 287 ? 45.136 -32.187 1.229   1.00 17.27  ? 284  SER A O     1 
ATOM   2247 C  CB    . SER A 1 287 ? 46.980 -34.440 -0.263  1.00 17.23  ? 284  SER A CB    1 
ATOM   2248 O  OG    A SER A 1 287 ? 47.428 -34.752 -1.565  0.72 17.38  ? 284  SER A OG    1 
ATOM   2249 O  OG    B SER A 1 287 ? 47.584 -35.168 0.793   0.28 17.30  ? 284  SER A OG    1 
ATOM   2250 N  N     . GLN A 1 288 ? 46.996 -32.672 2.408   1.00 16.75  ? 285  GLN A N     1 
ATOM   2251 C  CA    . GLN A 1 288 ? 46.371 -32.326 3.675   1.00 14.49  ? 285  GLN A CA    1 
ATOM   2252 C  C     . GLN A 1 288 ? 45.945 -30.866 3.683   1.00 18.70  ? 285  GLN A C     1 
ATOM   2253 O  O     . GLN A 1 288 ? 44.811 -30.538 4.042   1.00 17.28  ? 285  GLN A O     1 
ATOM   2254 C  CB    . GLN A 1 288 ? 47.311 -32.593 4.844   1.00 11.08  ? 285  GLN A CB    1 
ATOM   2255 C  CG    . GLN A 1 288 ? 47.292 -34.012 5.352   1.00 23.67  ? 285  GLN A CG    1 
ATOM   2256 C  CD    . GLN A 1 288 ? 48.224 -34.189 6.532   1.00 22.00  ? 285  GLN A CD    1 
ATOM   2257 O  OE1   . GLN A 1 288 ? 49.382 -33.787 6.481   1.00 18.68  ? 285  GLN A OE1   1 
ATOM   2258 N  NE2   . GLN A 1 288 ? 47.719 -34.785 7.605   1.00 35.97  ? 285  GLN A NE2   1 
ATOM   2259 N  N     . LEU A 1 289 ? 46.852 -29.991 3.273   1.00 14.53  ? 286  LEU A N     1 
ATOM   2260 C  CA    . LEU A 1 289 ? 46.546 -28.566 3.245   1.00 13.03  ? 286  LEU A CA    1 
ATOM   2261 C  C     . LEU A 1 289 ? 45.444 -28.238 2.237   1.00 17.99  ? 286  LEU A C     1 
ATOM   2262 O  O     . LEU A 1 289 ? 44.572 -27.406 2.498   1.00 17.56  ? 286  LEU A O     1 
ATOM   2263 C  CB    . LEU A 1 289 ? 47.807 -27.762 2.928   1.00 14.89  ? 286  LEU A CB    1 
ATOM   2264 C  CG    . LEU A 1 289 ? 48.907 -27.861 3.986   1.00 14.88  ? 286  LEU A CG    1 
ATOM   2265 C  CD1   . LEU A 1 289 ? 50.162 -27.084 3.542   1.00 15.62  ? 286  LEU A CD1   1 
ATOM   2266 C  CD2   . LEU A 1 289 ? 48.400 -27.369 5.338   1.00 13.85  ? 286  LEU A CD2   1 
ATOM   2267 N  N     . GLN A 1 290 ? 45.495 -28.881 1.076   1.00 16.42  ? 287  GLN A N     1 
ATOM   2268 C  CA    . GLN A 1 290 ? 44.443 -28.713 0.071   1.00 17.08  ? 287  GLN A CA    1 
ATOM   2269 C  C     . GLN A 1 290 ? 43.070 -29.179 0.582   1.00 17.51  ? 287  GLN A C     1 
ATOM   2270 O  O     . GLN A 1 290 ? 42.039 -28.627 0.207   1.00 18.37  ? 287  GLN A O     1 
ATOM   2271 C  CB    . GLN A 1 290 ? 44.804 -29.477 -1.202  1.00 20.19  ? 287  GLN A CB    1 
ATOM   2272 C  CG    . GLN A 1 290 ? 45.922 -28.850 -2.041  1.00 19.06  ? 287  GLN A CG    1 
ATOM   2273 C  CD    . GLN A 1 290 ? 46.294 -29.733 -3.211  1.00 22.74  ? 287  GLN A CD    1 
ATOM   2274 O  OE1   . GLN A 1 290 ? 46.248 -30.960 -3.108  1.00 18.78  ? 287  GLN A OE1   1 
ATOM   2275 N  NE2   . GLN A 1 290 ? 46.661 -29.117 -4.333  1.00 20.93  ? 287  GLN A NE2   1 
ATOM   2276 N  N     . SER A 1 291 ? 43.055 -30.193 1.438   1.00 17.33  ? 288  SER A N     1 
ATOM   2277 C  CA    . SER A 1 291 ? 41.786 -30.695 1.983   1.00 13.49  ? 288  SER A CA    1 
ATOM   2278 C  C     . SER A 1 291 ? 41.100 -29.647 2.855   1.00 21.99  ? 288  SER A C     1 
ATOM   2279 O  O     . SER A 1 291 ? 39.876 -29.482 2.813   1.00 27.39  ? 288  SER A O     1 
ATOM   2280 C  CB    . SER A 1 291 ? 42.012 -31.978 2.791   1.00 15.53  ? 288  SER A CB    1 
ATOM   2281 O  OG    A SER A 1 291 ? 42.611 -31.697 4.052   0.58 17.58  ? 288  SER A OG    1 
ATOM   2282 O  OG    B SER A 1 291 ? 40.811 -32.712 2.900   0.42 19.49  ? 288  SER A OG    1 
ATOM   2283 N  N     . HIS A 1 292 ? 41.885 -28.929 3.641   1.00 19.93  ? 289  HIS A N     1 
ATOM   2284 C  CA    . HIS A 1 292 ? 41.310 -27.934 4.543   1.00 17.17  ? 289  HIS A CA    1 
ATOM   2285 C  C     . HIS A 1 292 ? 41.048 -26.590 3.866   1.00 22.05  ? 289  HIS A C     1 
ATOM   2286 O  O     . HIS A 1 292 ? 40.063 -25.921 4.175   1.00 30.68  ? 289  HIS A O     1 
ATOM   2287 C  CB    . HIS A 1 292 ? 42.224 -27.703 5.744   1.00 21.59  ? 289  HIS A CB    1 
ATOM   2288 C  CG    . HIS A 1 292 ? 42.428 -28.904 6.611   1.00 20.65  ? 289  HIS A CG    1 
ATOM   2289 N  ND1   . HIS A 1 292 ? 41.421 -29.454 7.377   1.00 28.54  ? 289  HIS A ND1   1 
ATOM   2290 C  CD2   . HIS A 1 292 ? 43.539 -29.631 6.879   1.00 23.85  ? 289  HIS A CD2   1 
ATOM   2291 C  CE1   . HIS A 1 292 ? 41.897 -30.477 8.060   1.00 20.21  ? 289  HIS A CE1   1 
ATOM   2292 N  NE2   . HIS A 1 292 ? 43.184 -30.605 7.780   1.00 27.80  ? 289  HIS A NE2   1 
ATOM   2293 N  N     . PHE A 1 293 ? 41.939 -26.177 2.965   1.00 17.30  ? 290  PHE A N     1 
ATOM   2294 C  CA    . PHE A 1 293 ? 41.934 -24.776 2.528   1.00 22.65  ? 290  PHE A CA    1 
ATOM   2295 C  C     . PHE A 1 293 ? 41.677 -24.588 1.028   1.00 27.27  ? 290  PHE A C     1 
ATOM   2296 O  O     . PHE A 1 293 ? 41.718 -23.466 0.499   1.00 17.14  ? 290  PHE A O     1 
ATOM   2297 C  CB    . PHE A 1 293 ? 43.259 -24.121 2.952   1.00 15.10  ? 290  PHE A CB    1 
ATOM   2298 C  CG    . PHE A 1 293 ? 43.592 -24.360 4.402   1.00 17.22  ? 290  PHE A CG    1 
ATOM   2299 C  CD1   . PHE A 1 293 ? 42.780 -23.848 5.402   1.00 17.06  ? 290  PHE A CD1   1 
ATOM   2300 C  CD2   . PHE A 1 293 ? 44.687 -25.126 4.764   1.00 16.53  ? 290  PHE A CD2   1 
ATOM   2301 C  CE1   . PHE A 1 293 ? 43.058 -24.081 6.738   1.00 17.21  ? 290  PHE A CE1   1 
ATOM   2302 C  CE2   . PHE A 1 293 ? 44.978 -25.371 6.097   1.00 17.48  ? 290  PHE A CE2   1 
ATOM   2303 C  CZ    . PHE A 1 293 ? 44.165 -24.849 7.088   1.00 19.00  ? 290  PHE A CZ    1 
ATOM   2304 N  N     . GLY A 1 294 ? 41.381 -25.686 0.345   1.00 21.28  ? 291  GLY A N     1 
ATOM   2305 C  CA    . GLY A 1 294 ? 41.123 -25.619 -1.077  1.00 21.37  ? 291  GLY A CA    1 
ATOM   2306 C  C     . GLY A 1 294 ? 42.380 -25.928 -1.850  1.00 22.33  ? 291  GLY A C     1 
ATOM   2307 O  O     . GLY A 1 294 ? 43.488 -25.854 -1.316  1.00 17.53  ? 291  GLY A O     1 
ATOM   2308 N  N     . GLU A 1 295 ? 42.200 -26.265 -3.120  1.00 20.13  ? 292  GLU A N     1 
ATOM   2309 C  CA    . GLU A 1 295 ? 43.291 -26.675 -3.983  1.00 19.83  ? 292  GLU A CA    1 
ATOM   2310 C  C     . GLU A 1 295 ? 44.361 -25.597 -4.133  1.00 20.11  ? 292  GLU A C     1 
ATOM   2311 O  O     . GLU A 1 295 ? 45.547 -25.866 -3.992  1.00 15.58  ? 292  GLU A O     1 
ATOM   2312 C  CB    . GLU A 1 295 ? 42.742 -27.057 -5.355  1.00 23.08  ? 292  GLU A CB    1 
ATOM   2313 C  CG    . GLU A 1 295 ? 43.780 -27.551 -6.333  1.00 26.64  ? 292  GLU A CG    1 
ATOM   2314 C  CD    . GLU A 1 295 ? 43.164 -27.976 -7.654  1.00 53.09  ? 292  GLU A CD    1 
ATOM   2315 O  OE1   . GLU A 1 295 ? 43.805 -27.762 -8.705  1.00 50.91  ? 292  GLU A OE1   1 
ATOM   2316 O  OE2   . GLU A 1 295 ? 42.034 -28.517 -7.640  1.00 39.95  ? 292  GLU A OE2   1 
ATOM   2317 N  N     . LYS A 1 296 ? 43.930 -24.375 -4.411  1.00 16.19  ? 293  LYS A N     1 
ATOM   2318 C  CA    . LYS A 1 296 ? 44.848 -23.275 -4.677  1.00 20.00  ? 293  LYS A CA    1 
ATOM   2319 C  C     . LYS A 1 296 ? 45.582 -22.857 -3.396  1.00 16.27  ? 293  LYS A C     1 
ATOM   2320 O  O     . LYS A 1 296 ? 46.817 -22.797 -3.370  1.00 17.26  ? 293  LYS A O     1 
ATOM   2321 C  CB    . LYS A 1 296 ? 44.081 -22.085 -5.291  1.00 16.38  ? 293  LYS A CB    1 
ATOM   2322 C  CG    . LYS A 1 296 ? 44.948 -20.952 -5.785  1.00 28.30  ? 293  LYS A CG    1 
ATOM   2323 C  CD    . LYS A 1 296 ? 44.109 -19.849 -6.450  1.00 42.31  ? 293  LYS A CD    1 
ATOM   2324 C  CE    . LYS A 1 296 ? 44.939 -18.582 -6.688  1.00 42.05  ? 293  LYS A CE    1 
ATOM   2325 N  NZ    . LYS A 1 296 ? 44.252 -17.595 -7.568  1.00 47.30  ? 293  LYS A NZ    1 
ATOM   2326 N  N     . ASN A 1 297 ? 44.828 -22.583 -2.336  1.00 17.61  ? 294  ASN A N     1 
ATOM   2327 C  CA    . ASN A 1 297 ? 45.446 -22.175 -1.081  1.00 17.86  ? 294  ASN A CA    1 
ATOM   2328 C  C     . ASN A 1 297 ? 46.346 -23.265 -0.506  1.00 14.69  ? 294  ASN A C     1 
ATOM   2329 O  O     . ASN A 1 297 ? 47.414 -22.966 0.014   1.00 18.49  ? 294  ASN A O     1 
ATOM   2330 C  CB    . ASN A 1 297 ? 44.398 -21.812 -0.036  1.00 19.64  ? 294  ASN A CB    1 
ATOM   2331 C  CG    . ASN A 1 297 ? 43.681 -20.526 -0.345  1.00 24.19  ? 294  ASN A CG    1 
ATOM   2332 O  OD1   . ASN A 1 297 ? 44.222 -19.629 -0.999  1.00 27.09  ? 294  ASN A OD1   1 
ATOM   2333 N  ND2   . ASN A 1 297 ? 42.453 -20.418 0.142   1.00 22.56  ? 294  ASN A ND2   1 
ATOM   2334 N  N     . GLY A 1 298 ? 45.902 -24.517 -0.584  1.00 18.40  ? 295  GLY A N     1 
ATOM   2335 C  CA    . GLY A 1 298 ? 46.693 -25.639 -0.096  1.00 13.66  ? 295  GLY A CA    1 
ATOM   2336 C  C     . GLY A 1 298 ? 48.069 -25.711 -0.748  1.00 14.92  ? 295  GLY A C     1 
ATOM   2337 O  O     . GLY A 1 298 ? 49.089 -25.860 -0.060  1.00 16.60  ? 295  GLY A O     1 
ATOM   2338 N  N     . SER A 1 299 ? 48.105 -25.606 -2.076  1.00 10.85  ? 296  SER A N     1 
ATOM   2339 C  CA    . SER A 1 299 ? 49.365 -25.659 -2.818  1.00 13.76  ? 296  SER A CA    1 
ATOM   2340 C  C     . SER A 1 299 ? 50.225 -24.452 -2.480  1.00 13.56  ? 296  SER A C     1 
ATOM   2341 O  O     . SER A 1 299 ? 51.439 -24.567 -2.340  1.00 11.57  ? 296  SER A O     1 
ATOM   2342 C  CB    . SER A 1 299 ? 49.114 -25.714 -4.333  1.00 17.97  ? 296  SER A CB    1 
ATOM   2343 O  OG    . SER A 1 299 ? 48.767 -27.025 -4.740  1.00 20.58  ? 296  SER A OG    1 
ATOM   2344 N  N     . TRP A 1 300 ? 49.577 -23.303 -2.338  1.00 15.88  ? 297  TRP A N     1 
ATOM   2345 C  CA    . TRP A 1 300 ? 50.280 -22.064 -2.044  1.00 16.35  ? 297  TRP A CA    1 
ATOM   2346 C  C     . TRP A 1 300 ? 50.907 -22.150 -0.657  1.00 17.40  ? 297  TRP A C     1 
ATOM   2347 O  O     . TRP A 1 300 ? 52.080 -21.829 -0.490  1.00 15.79  ? 297  TRP A O     1 
ATOM   2348 C  CB    . TRP A 1 300 ? 49.328 -20.866 -2.144  1.00 14.75  ? 297  TRP A CB    1 
ATOM   2349 C  CG    . TRP A 1 300 ? 49.991 -19.535 -1.844  1.00 13.61  ? 297  TRP A CG    1 
ATOM   2350 C  CD1   . TRP A 1 300 ? 50.658 -18.730 -2.727  1.00 23.69  ? 297  TRP A CD1   1 
ATOM   2351 C  CD2   . TRP A 1 300 ? 50.027 -18.861 -0.578  1.00 15.41  ? 297  TRP A CD2   1 
ATOM   2352 N  NE1   . TRP A 1 300 ? 51.118 -17.601 -2.081  1.00 19.97  ? 297  TRP A NE1   1 
ATOM   2353 C  CE2   . TRP A 1 300 ? 50.743 -17.662 -0.763  1.00 16.26  ? 297  TRP A CE2   1 
ATOM   2354 C  CE3   . TRP A 1 300 ? 49.530 -19.159 0.693   1.00 21.73  ? 297  TRP A CE3   1 
ATOM   2355 C  CZ2   . TRP A 1 300 ? 50.954 -16.762 0.272   1.00 13.45  ? 297  TRP A CZ2   1 
ATOM   2356 C  CZ3   . TRP A 1 300 ? 49.755 -18.266 1.717   1.00 18.93  ? 297  TRP A CZ3   1 
ATOM   2357 C  CH2   . TRP A 1 300 ? 50.460 -17.086 1.503   1.00 13.58  ? 297  TRP A CH2   1 
ATOM   2358 N  N     . LEU A 1 301 ? 50.133 -22.625 0.323   1.00 12.06  ? 298  LEU A N     1 
ATOM   2359 C  CA    . LEU A 1 301 ? 50.646 -22.804 1.688   1.00 15.96  ? 298  LEU A CA    1 
ATOM   2360 C  C     . LEU A 1 301 ? 51.790 -23.816 1.759   1.00 14.39  ? 298  LEU A C     1 
ATOM   2361 O  O     . LEU A 1 301 ? 52.780 -23.614 2.476   1.00 16.30  ? 298  LEU A O     1 
ATOM   2362 C  CB    . LEU A 1 301 ? 49.524 -23.247 2.625   1.00 10.18  ? 298  LEU A CB    1 
ATOM   2363 C  CG    . LEU A 1 301 ? 48.477 -22.169 2.965   1.00 13.15  ? 298  LEU A CG    1 
ATOM   2364 C  CD1   . LEU A 1 301 ? 47.261 -22.800 3.627   1.00 12.76  ? 298  LEU A CD1   1 
ATOM   2365 C  CD2   . LEU A 1 301 ? 49.095 -21.119 3.890   1.00 14.72  ? 298  LEU A CD2   1 
ATOM   2366 N  N     . TYR A 1 302 ? 51.657 -24.899 1.007   1.00 10.57  ? 299  TYR A N     1 
ATOM   2367 C  CA    . TYR A 1 302 ? 52.665 -25.964 1.050   1.00 13.86  ? 299  TYR A CA    1 
ATOM   2368 C  C     . TYR A 1 302 ? 54.024 -25.422 0.600   1.00 18.15  ? 299  TYR A C     1 
ATOM   2369 O  O     . TYR A 1 302 ? 55.055 -25.692 1.224   1.00 10.94  ? 299  TYR A O     1 
ATOM   2370 C  CB    . TYR A 1 302 ? 52.241 -27.157 0.183   1.00 14.91  ? 299  TYR A CB    1 
ATOM   2371 C  CG    . TYR A 1 302 ? 53.271 -28.277 0.185   1.00 15.47  ? 299  TYR A CG    1 
ATOM   2372 C  CD1   . TYR A 1 302 ? 53.248 -29.267 1.168   1.00 15.14  ? 299  TYR A CD1   1 
ATOM   2373 C  CD2   . TYR A 1 302 ? 54.280 -28.327 -0.768  1.00 20.21  ? 299  TYR A CD2   1 
ATOM   2374 C  CE1   . TYR A 1 302 ? 54.179 -30.278 1.182   1.00 17.02  ? 299  TYR A CE1   1 
ATOM   2375 C  CE2   . TYR A 1 302 ? 55.232 -29.328 -0.744  1.00 22.49  ? 299  TYR A CE2   1 
ATOM   2376 C  CZ    . TYR A 1 302 ? 55.172 -30.303 0.234   1.00 23.30  ? 299  TYR A CZ    1 
ATOM   2377 O  OH    . TYR A 1 302 ? 56.108 -31.310 0.261   1.00 28.85  ? 299  TYR A OH    1 
ATOM   2378 N  N     . ALA A 1 303 ? 54.018 -24.636 -0.471  1.00 12.58  ? 300  ALA A N     1 
ATOM   2379 C  CA    . ALA A 1 303 ? 55.227 -24.008 -0.962  1.00 13.26  ? 300  ALA A CA    1 
ATOM   2380 C  C     . ALA A 1 303 ? 55.639 -22.804 -0.099  1.00 11.70  ? 300  ALA A C     1 
ATOM   2381 O  O     . ALA A 1 303 ? 56.829 -22.619 0.170   1.00 13.56  ? 300  ALA A O     1 
ATOM   2382 C  CB    . ALA A 1 303 ? 55.047 -23.570 -2.435  1.00 13.45  ? 300  ALA A CB    1 
ATOM   2383 N  N     . MET A 1 304 ? 54.673 -22.007 0.357   1.00 12.06  ? 301  MET A N     1 
ATOM   2384 C  CA    . MET A 1 304 ? 55.041 -20.756 1.046   1.00 11.95  ? 301  MET A CA    1 
ATOM   2385 C  C     . MET A 1 304 ? 55.781 -21.003 2.352   1.00 11.67  ? 301  MET A C     1 
ATOM   2386 O  O     . MET A 1 304 ? 56.723 -20.276 2.683   1.00 11.76  ? 301  MET A O     1 
ATOM   2387 C  CB    . MET A 1 304 ? 53.823 -19.888 1.328   1.00 14.50  ? 301  MET A CB    1 
ATOM   2388 C  CG    . MET A 1 304 ? 54.203 -18.441 1.696   1.00 15.66  ? 301  MET A CG    1 
ATOM   2389 S  SD    . MET A 1 304 ? 54.988 -17.591 0.307   1.00 17.09  ? 301  MET A SD    1 
ATOM   2390 C  CE    . MET A 1 304 ? 56.691 -17.471 0.864   1.00 16.43  ? 301  MET A CE    1 
ATOM   2391 N  N     . CYS A 1 305 ? 55.365 -22.023 3.095   1.00 13.00  ? 302  CYS A N     1 
ATOM   2392 C  CA    . CYS A 1 305 ? 56.014 -22.315 4.382   1.00 16.09  ? 302  CYS A CA    1 
ATOM   2393 C  C     . CYS A 1 305 ? 57.450 -22.830 4.213   1.00 12.79  ? 302  CYS A C     1 
ATOM   2394 O  O     . CYS A 1 305 ? 58.201 -22.890 5.190   1.00 12.73  ? 302  CYS A O     1 
ATOM   2395 C  CB    . CYS A 1 305 ? 55.193 -23.317 5.208   1.00 12.28  ? 302  CYS A CB    1 
ATOM   2396 S  SG    . CYS A 1 305 ? 55.135 -25.025 4.609   1.00 12.16  ? 302  CYS A SG    1 
ATOM   2397 N  N     . ARG A 1 306 ? 57.815 -23.201 2.983   1.00 7.87   ? 303  ARG A N     1 
ATOM   2398 C  CA    . ARG A 1 306 ? 59.177 -23.565 2.617   1.00 11.46  ? 303  ARG A CA    1 
ATOM   2399 C  C     . ARG A 1 306 ? 59.905 -22.390 1.938   1.00 13.28  ? 303  ARG A C     1 
ATOM   2400 O  O     . ARG A 1 306 ? 61.029 -22.539 1.454   1.00 14.43  ? 303  ARG A O     1 
ATOM   2401 C  CB    . ARG A 1 306 ? 59.170 -24.799 1.699   1.00 14.47  ? 303  ARG A CB    1 
ATOM   2402 C  CG    . ARG A 1 306 ? 58.611 -26.046 2.398   1.00 17.11  ? 303  ARG A CG    1 
ATOM   2403 C  CD    . ARG A 1 306 ? 58.307 -27.215 1.443   1.00 21.38  ? 303  ARG A CD    1 
ATOM   2404 N  NE    . ARG A 1 306 ? 58.124 -28.435 2.224   1.00 17.90  ? 303  ARG A NE    1 
ATOM   2405 C  CZ    . ARG A 1 306 ? 57.041 -28.695 2.946   1.00 18.00  ? 303  ARG A CZ    1 
ATOM   2406 N  NH1   . ARG A 1 306 ? 56.952 -29.827 3.643   1.00 18.07  ? 303  ARG A NH1   1 
ATOM   2407 N  NH2   . ARG A 1 306 ? 56.032 -27.831 2.947   1.00 15.22  ? 303  ARG A NH2   1 
ATOM   2408 N  N     . GLY A 1 307 ? 59.255 -21.229 1.920   1.00 12.38  ? 304  GLY A N     1 
ATOM   2409 C  CA    . GLY A 1 307 ? 59.830 -20.011 1.368   1.00 16.20  ? 304  GLY A CA    1 
ATOM   2410 C  C     . GLY A 1 307 ? 59.671 -19.864 -0.139  1.00 13.70  ? 304  GLY A C     1 
ATOM   2411 O  O     . GLY A 1 307 ? 60.368 -19.071 -0.772  1.00 11.99  ? 304  GLY A O     1 
ATOM   2412 N  N     . ILE A 1 308 ? 58.754 -20.627 -0.719  1.00 16.95  ? 305  ILE A N     1 
ATOM   2413 C  CA    . ILE A 1 308 ? 58.627 -20.704 -2.174  1.00 15.42  ? 305  ILE A CA    1 
ATOM   2414 C  C     . ILE A 1 308 ? 57.280 -20.173 -2.611  1.00 17.74  ? 305  ILE A C     1 
ATOM   2415 O  O     . ILE A 1 308 ? 56.256 -20.561 -2.059  1.00 12.41  ? 305  ILE A O     1 
ATOM   2416 C  CB    . ILE A 1 308 ? 58.794 -22.153 -2.660  1.00 18.53  ? 305  ILE A CB    1 
ATOM   2417 C  CG1   . ILE A 1 308 ? 60.183 -22.670 -2.276  1.00 17.80  ? 305  ILE A CG1   1 
ATOM   2418 C  CG2   . ILE A 1 308 ? 58.555 -22.266 -4.164  1.00 13.59  ? 305  ILE A CG2   1 
ATOM   2419 C  CD1   . ILE A 1 308 ? 60.410 -24.144 -2.594  1.00 24.51  ? 305  ILE A CD1   1 
ATOM   2420 N  N     . GLU A 1 309 ? 57.284 -19.272 -3.589  1.00 13.91  ? 306  GLU A N     1 
ATOM   2421 C  CA    . GLU A 1 309 ? 56.042 -18.723 -4.149  1.00 18.21  ? 306  GLU A CA    1 
ATOM   2422 C  C     . GLU A 1 309 ? 56.311 -18.256 -5.576  1.00 21.30  ? 306  GLU A C     1 
ATOM   2423 O  O     . GLU A 1 309 ? 57.401 -17.764 -5.868  1.00 20.79  ? 306  GLU A O     1 
ATOM   2424 C  CB    . GLU A 1 309 ? 55.503 -17.560 -3.316  1.00 18.55  ? 306  GLU A CB    1 
ATOM   2425 C  CG    . GLU A 1 309 ? 54.273 -16.963 -3.950  1.00 35.41  ? 306  GLU A CG    1 
ATOM   2426 C  CD    . GLU A 1 309 ? 53.975 -15.553 -3.514  1.00 22.80  ? 306  GLU A CD    1 
ATOM   2427 O  OE1   . GLU A 1 309 ? 54.872 -14.672 -3.583  1.00 20.71  ? 306  GLU A OE1   1 
ATOM   2428 O  OE2   . GLU A 1 309 ? 52.817 -15.331 -3.124  1.00 31.44  ? 306  GLU A OE2   1 
ATOM   2429 N  N     . HIS A 1 310 ? 55.342 -18.395 -6.474  1.00 19.93  ? 307  HIS A N     1 
ATOM   2430 C  CA    . HIS A 1 310 ? 55.645 -18.092 -7.869  1.00 21.09  ? 307  HIS A CA    1 
ATOM   2431 C  C     . HIS A 1 310 ? 54.878 -16.912 -8.452  1.00 21.85  ? 307  HIS A C     1 
ATOM   2432 O  O     . HIS A 1 310 ? 55.047 -16.615 -9.630  1.00 22.45  ? 307  HIS A O     1 
ATOM   2433 C  CB    . HIS A 1 310 ? 55.415 -19.339 -8.720  1.00 31.16  ? 307  HIS A CB    1 
ATOM   2434 C  CG    . HIS A 1 310 ? 56.311 -20.483 -8.352  1.00 38.09  ? 307  HIS A CG    1 
ATOM   2435 N  ND1   . HIS A 1 310 ? 57.683 -20.369 -8.302  1.00 43.28  ? 307  HIS A ND1   1 
ATOM   2436 C  CD2   . HIS A 1 310 ? 56.024 -21.760 -7.998  1.00 39.11  ? 307  HIS A CD2   1 
ATOM   2437 C  CE1   . HIS A 1 310 ? 58.207 -21.529 -7.945  1.00 40.23  ? 307  HIS A CE1   1 
ATOM   2438 N  NE2   . HIS A 1 310 ? 57.222 -22.388 -7.755  1.00 39.11  ? 307  HIS A NE2   1 
ATOM   2439 N  N     . ASP A 1 311 ? 54.065 -16.243 -7.634  1.00 18.13  ? 308  ASP A N     1 
ATOM   2440 C  CA    . ASP A 1 311 ? 53.288 -15.075 -8.073  1.00 21.28  ? 308  ASP A CA    1 
ATOM   2441 C  C     . ASP A 1 311 ? 54.176 -14.049 -8.770  1.00 18.95  ? 308  ASP A C     1 
ATOM   2442 O  O     . ASP A 1 311 ? 55.112 -13.536 -8.174  1.00 13.96  ? 308  ASP A O     1 
ATOM   2443 C  CB    . ASP A 1 311 ? 52.583 -14.418 -6.890  1.00 18.35  ? 308  ASP A CB    1 
ATOM   2444 C  CG    . ASP A 1 311 ? 51.679 -13.270 -7.317  1.00 23.79  ? 308  ASP A CG    1 
ATOM   2445 O  OD1   . ASP A 1 311 ? 51.610 -12.262 -6.600  1.00 28.90  ? 308  ASP A OD1   1 
ATOM   2446 O  OD2   . ASP A 1 311 ? 51.029 -13.375 -8.375  1.00 32.76  ? 308  ASP A OD2   1 
ATOM   2447 N  N     . PRO A 1 312 ? 53.895 -13.757 -10.050 1.00 16.13  ? 309  PRO A N     1 
ATOM   2448 C  CA    . PRO A 1 312 ? 54.807 -12.856 -10.749 1.00 13.98  ? 309  PRO A CA    1 
ATOM   2449 C  C     . PRO A 1 312 ? 54.620 -11.388 -10.369 1.00 11.91  ? 309  PRO A C     1 
ATOM   2450 O  O     . PRO A 1 312 ? 53.543 -10.970 -9.948  1.00 15.85  ? 309  PRO A O     1 
ATOM   2451 C  CB    . PRO A 1 312 ? 54.458 -13.075 -12.225 1.00 21.48  ? 309  PRO A CB    1 
ATOM   2452 C  CG    . PRO A 1 312 ? 53.053 -13.520 -12.218 1.00 18.69  ? 309  PRO A CG    1 
ATOM   2453 C  CD    . PRO A 1 312 ? 52.855 -14.303 -10.942 1.00 21.93  ? 309  PRO A CD    1 
ATOM   2454 N  N     . VAL A 1 313 ? 55.697 -10.632 -10.502 1.00 14.81  ? 310  VAL A N     1 
ATOM   2455 C  CA    . VAL A 1 313 ? 55.633 -9.181  -10.459 1.00 13.57  ? 310  VAL A CA    1 
ATOM   2456 C  C     . VAL A 1 313 ? 54.909 -8.750  -11.733 1.00 19.05  ? 310  VAL A C     1 
ATOM   2457 O  O     . VAL A 1 313 ? 55.456 -8.876  -12.818 1.00 14.96  ? 310  VAL A O     1 
ATOM   2458 C  CB    . VAL A 1 313 ? 57.037 -8.549  -10.389 1.00 17.05  ? 310  VAL A CB    1 
ATOM   2459 C  CG1   . VAL A 1 313 ? 56.953 -7.016  -10.348 1.00 14.62  ? 310  VAL A CG1   1 
ATOM   2460 C  CG2   . VAL A 1 313 ? 57.786 -9.067  -9.165  1.00 14.32  ? 310  VAL A CG2   1 
ATOM   2461 N  N     . LYS A 1 314 ? 53.671 -8.290  -11.617 1.00 17.28  ? 311  LYS A N     1 
ATOM   2462 C  CA    . LYS A 1 314 ? 52.936 -7.898  -12.811 1.00 16.67  ? 311  LYS A CA    1 
ATOM   2463 C  C     . LYS A 1 314 ? 53.470 -6.577  -13.373 1.00 14.66  ? 311  LYS A C     1 
ATOM   2464 O  O     . LYS A 1 314 ? 53.754 -5.640  -12.623 1.00 17.93  ? 311  LYS A O     1 
ATOM   2465 C  CB    . LYS A 1 314 ? 51.443 -7.787  -12.508 1.00 21.31  ? 311  LYS A CB    1 
ATOM   2466 C  CG    . LYS A 1 314 ? 50.782 -9.096  -12.072 1.00 26.29  ? 311  LYS A CG    1 
ATOM   2467 C  CD    . LYS A 1 314 ? 49.329 -8.834  -11.659 1.00 32.87  ? 311  LYS A CD    1 
ATOM   2468 C  CE    . LYS A 1 314 ? 48.566 -10.114 -11.330 1.00 39.14  ? 311  LYS A CE    1 
ATOM   2469 N  NZ    . LYS A 1 314 ? 48.166 -10.890 -12.539 1.00 45.38  ? 311  LYS A NZ    1 
ATOM   2470 N  N     . PRO A 1 315 ? 53.605 -6.493  -14.702 1.00 16.43  ? 312  PRO A N     1 
ATOM   2471 C  CA    . PRO A 1 315 ? 53.944 -5.215  -15.329 1.00 14.89  ? 312  PRO A CA    1 
ATOM   2472 C  C     . PRO A 1 315 ? 52.756 -4.259  -15.310 1.00 22.64  ? 312  PRO A C     1 
ATOM   2473 O  O     . PRO A 1 315 ? 51.991 -4.178  -16.279 1.00 20.10  ? 312  PRO A O     1 
ATOM   2474 C  CB    . PRO A 1 315 ? 54.315 -5.612  -16.763 1.00 18.71  ? 312  PRO A CB    1 
ATOM   2475 C  CG    . PRO A 1 315 ? 53.506 -6.865  -17.005 1.00 21.47  ? 312  PRO A CG    1 
ATOM   2476 C  CD    . PRO A 1 315 ? 53.445 -7.576  -15.693 1.00 18.83  ? 312  PRO A CD    1 
ATOM   2477 N  N     . ARG A 1 316 ? 52.599 -3.544  -14.202 1.00 19.19  ? 313  ARG A N     1 
ATOM   2478 C  CA    . ARG A 1 316 ? 51.478 -2.616  -14.054 1.00 18.46  ? 313  ARG A CA    1 
ATOM   2479 C  C     . ARG A 1 316 ? 51.855 -1.483  -13.103 1.00 18.93  ? 313  ARG A C     1 
ATOM   2480 O  O     . ARG A 1 316 ? 51.920 -1.679  -11.889 1.00 16.95  ? 313  ARG A O     1 
ATOM   2481 C  CB    . ARG A 1 316 ? 50.235 -3.347  -13.540 1.00 19.43  ? 313  ARG A CB    1 
ATOM   2482 C  CG    A ARG A 1 316 ? 48.990 -2.495  -13.400 0.51 24.31  ? 313  ARG A CG    1 
ATOM   2483 C  CG    B ARG A 1 316 ? 49.002 -2.463  -13.514 0.49 24.31  ? 313  ARG A CG    1 
ATOM   2484 C  CD    A ARG A 1 316 ? 47.875 -3.272  -12.698 0.51 24.83  ? 313  ARG A CD    1 
ATOM   2485 C  CD    B ARG A 1 316 ? 47.831 -3.144  -12.832 0.49 24.85  ? 313  ARG A CD    1 
ATOM   2486 N  NE    A ARG A 1 316 ? 48.182 -3.512  -11.287 0.51 26.80  ? 313  ARG A NE    1 
ATOM   2487 N  NE    B ARG A 1 316 ? 48.170 -3.574  -11.478 0.49 26.76  ? 313  ARG A NE    1 
ATOM   2488 C  CZ    A ARG A 1 316 ? 48.358 -4.714  -10.743 0.51 28.22  ? 313  ARG A CZ    1 
ATOM   2489 C  CZ    B ARG A 1 316 ? 48.258 -2.761  -10.428 0.49 25.59  ? 313  ARG A CZ    1 
ATOM   2490 N  NH1   A ARG A 1 316 ? 48.636 -4.824  -9.450  0.51 29.20  ? 313  ARG A NH1   1 
ATOM   2491 N  NH1   B ARG A 1 316 ? 48.573 -3.253  -9.235  0.49 20.64  ? 313  ARG A NH1   1 
ATOM   2492 N  NH2   A ARG A 1 316 ? 48.250 -5.808  -11.483 0.51 29.06  ? 313  ARG A NH2   1 
ATOM   2493 N  NH2   B ARG A 1 316 ? 48.033 -1.459  -10.564 0.49 20.24  ? 313  ARG A NH2   1 
ATOM   2494 N  N     . GLN A 1 317 ? 52.109 -0.305  -13.663 1.00 16.16  ? 314  GLN A N     1 
ATOM   2495 C  CA    . GLN A 1 317 ? 52.511 0.857   -12.878 1.00 23.61  ? 314  GLN A CA    1 
ATOM   2496 C  C     . GLN A 1 317 ? 51.328 1.752   -12.478 1.00 23.89  ? 314  GLN A C     1 
ATOM   2497 O  O     . GLN A 1 317 ? 51.403 2.528   -11.515 1.00 22.64  ? 314  GLN A O     1 
ATOM   2498 C  CB    . GLN A 1 317 ? 53.524 1.671   -13.676 1.00 29.25  ? 314  GLN A CB    1 
ATOM   2499 C  CG    . GLN A 1 317 ? 54.086 2.827   -12.930 1.00 33.57  ? 314  GLN A CG    1 
ATOM   2500 C  CD    . GLN A 1 317 ? 55.058 3.608   -13.761 1.00 30.89  ? 314  GLN A CD    1 
ATOM   2501 O  OE1   . GLN A 1 317 ? 55.343 3.248   -14.905 1.00 43.18  ? 314  GLN A OE1   1 
ATOM   2502 N  NE2   . GLN A 1 317 ? 55.589 4.682   -13.189 1.00 27.88  ? 314  GLN A NE2   1 
ATOM   2503 N  N     . LEU A 1 318 ? 50.241 1.646   -13.233 1.00 18.20  ? 315  LEU A N     1 
ATOM   2504 C  CA    . LEU A 1 318 ? 49.053 2.466   -13.027 1.00 19.35  ? 315  LEU A CA    1 
ATOM   2505 C  C     . LEU A 1 318 ? 47.921 1.660   -12.397 1.00 19.32  ? 315  LEU A C     1 
ATOM   2506 O  O     . LEU A 1 318 ? 47.771 0.479   -12.684 1.00 17.95  ? 315  LEU A O     1 
ATOM   2507 C  CB    . LEU A 1 318 ? 48.570 3.039   -14.360 1.00 22.73  ? 315  LEU A CB    1 
ATOM   2508 C  CG    . LEU A 1 318 ? 49.561 3.749   -15.285 1.00 21.47  ? 315  LEU A CG    1 
ATOM   2509 C  CD1   . LEU A 1 318 ? 48.900 4.000   -16.643 1.00 19.93  ? 315  LEU A CD1   1 
ATOM   2510 C  CD2   . LEU A 1 318 ? 50.062 5.048   -14.665 1.00 22.78  ? 315  LEU A CD2   1 
ATOM   2511 N  N     . PRO A 1 319 ? 47.109 2.300   -11.543 1.00 15.76  ? 316  PRO A N     1 
ATOM   2512 C  CA    . PRO A 1 319 ? 45.927 1.615   -11.002 1.00 23.07  ? 316  PRO A CA    1 
ATOM   2513 C  C     . PRO A 1 319 ? 44.960 1.178   -12.113 1.00 19.57  ? 316  PRO A C     1 
ATOM   2514 O  O     . PRO A 1 319 ? 44.906 1.853   -13.139 1.00 22.52  ? 316  PRO A O     1 
ATOM   2515 C  CB    . PRO A 1 319 ? 45.289 2.666   -10.085 1.00 16.74  ? 316  PRO A CB    1 
ATOM   2516 C  CG    . PRO A 1 319 ? 45.964 3.965   -10.411 1.00 29.86  ? 316  PRO A CG    1 
ATOM   2517 C  CD    . PRO A 1 319 ? 47.296 3.651   -10.983 1.00 18.21  ? 316  PRO A CD    1 
ATOM   2518 N  N     . LYS A 1 320 ? 44.257 0.059   -11.906 1.00 19.85  ? 317  LYS A N     1 
ATOM   2519 C  CA    . LYS A 1 320 ? 43.267 -0.493  -12.842 1.00 24.85  ? 317  LYS A CA    1 
ATOM   2520 C  C     . LYS A 1 320 ? 41.891 0.147   -12.703 1.00 20.63  ? 317  LYS A C     1 
ATOM   2521 O  O     . LYS A 1 320 ? 41.005 -0.069  -13.529 1.00 21.75  ? 317  LYS A O     1 
ATOM   2522 C  CB    . LYS A 1 320 ? 43.073 -2.000  -12.617 1.00 27.10  ? 317  LYS A CB    1 
ATOM   2523 C  CG    . LYS A 1 320 ? 44.252 -2.896  -12.859 1.00 35.38  ? 317  LYS A CG    1 
ATOM   2524 C  CD    . LYS A 1 320 ? 43.787 -4.351  -12.832 1.00 31.26  ? 317  LYS A CD    1 
ATOM   2525 C  CE    . LYS A 1 320 ? 44.917 -5.299  -13.184 1.00 48.70  ? 317  LYS A CE    1 
ATOM   2526 N  NZ    . LYS A 1 320 ? 44.459 -6.702  -13.334 1.00 49.09  ? 317  LYS A NZ    1 
ATOM   2527 N  N     . THR A 1 321 ? 41.689 0.871   -11.611 1.00 20.92  ? 318  THR A N     1 
ATOM   2528 C  CA    . THR A 1 321 ? 40.396 1.486   -11.338 1.00 20.24  ? 318  THR A CA    1 
ATOM   2529 C  C     . THR A 1 321 ? 40.639 2.877   -10.784 1.00 18.84  ? 318  THR A C     1 
ATOM   2530 O  O     . THR A 1 321 ? 41.714 3.151   -10.232 1.00 23.66  ? 318  THR A O     1 
ATOM   2531 C  CB    . THR A 1 321 ? 39.550 0.667   -10.324 1.00 27.26  ? 318  THR A CB    1 
ATOM   2532 O  OG1   . THR A 1 321 ? 40.239 0.603   -9.067  1.00 21.06  ? 318  THR A OG1   1 
ATOM   2533 C  CG2   . THR A 1 321 ? 39.265 -0.752  -10.833 1.00 19.85  ? 318  THR A CG2   1 
ATOM   2534 N  N     . ILE A 1 322 ? 39.661 3.759   -10.958 1.00 15.98  ? 319  ILE A N     1 
ATOM   2535 C  CA    . ILE A 1 322 ? 39.709 5.099   -10.379 1.00 19.48  ? 319  ILE A CA    1 
ATOM   2536 C  C     . ILE A 1 322 ? 38.380 5.332   -9.666  1.00 20.99  ? 319  ILE A C     1 
ATOM   2537 O  O     . ILE A 1 322 ? 37.331 5.375   -10.311 1.00 20.69  ? 319  ILE A O     1 
ATOM   2538 C  CB    . ILE A 1 322 ? 39.955 6.189   -11.454 1.00 21.71  ? 319  ILE A CB    1 
ATOM   2539 C  CG1   . ILE A 1 322 ? 41.322 5.988   -12.122 1.00 24.34  ? 319  ILE A CG1   1 
ATOM   2540 C  CG2   . ILE A 1 322 ? 39.839 7.596   -10.851 1.00 19.91  ? 319  ILE A CG2   1 
ATOM   2541 C  CD1   . ILE A 1 322 ? 41.752 7.156   -13.039 1.00 21.08  ? 319  ILE A CD1   1 
ATOM   2542 N  N     . GLY A 1 323 ? 38.420 5.444   -8.341  1.00 18.94  ? 320  GLY A N     1 
ATOM   2543 C  CA    . GLY A 1 323 ? 37.198 5.503   -7.552  1.00 19.10  ? 320  GLY A CA    1 
ATOM   2544 C  C     . GLY A 1 323 ? 37.116 6.658   -6.570  1.00 18.90  ? 320  GLY A C     1 
ATOM   2545 O  O     . GLY A 1 323 ? 38.133 7.246   -6.197  1.00 18.85  ? 320  GLY A O     1 
ATOM   2546 N  N     . CYS A 1 324 ? 35.884 6.949   -6.151  1.00 18.41  ? 321  CYS A N     1 
ATOM   2547 C  CA    . CYS A 1 324 ? 35.518 8.062   -5.277  1.00 22.35  ? 321  CYS A CA    1 
ATOM   2548 C  C     . CYS A 1 324 ? 34.502 7.510   -4.297  1.00 18.33  ? 321  CYS A C     1 
ATOM   2549 O  O     . CYS A 1 324 ? 33.502 6.943   -4.724  1.00 19.86  ? 321  CYS A O     1 
ATOM   2550 C  CB    . CYS A 1 324 ? 34.915 9.246   -6.072  1.00 15.53  ? 321  CYS A CB    1 
ATOM   2551 S  SG    A CYS A 1 324 ? 35.277 10.878  -5.438  0.32 27.27  ? 321  CYS A SG    1 
ATOM   2552 S  SG    B CYS A 1 324 ? 36.046 10.057  -7.198  0.68 29.62  ? 321  CYS A SG    1 
ATOM   2553 N  N     . SER A 1 325 ? 34.737 7.647   -2.997  1.00 16.06  ? 322  SER A N     1 
ATOM   2554 C  CA    A SER A 1 325 ? 33.765 7.153   -2.031  0.60 18.77  ? 322  SER A CA    1 
ATOM   2555 C  CA    B SER A 1 325 ? 33.830 7.105   -1.996  0.40 18.80  ? 322  SER A CA    1 
ATOM   2556 C  C     . SER A 1 325 ? 33.663 8.056   -0.811  1.00 22.67  ? 322  SER A C     1 
ATOM   2557 O  O     . SER A 1 325 ? 34.587 8.806   -0.479  1.00 21.28  ? 322  SER A O     1 
ATOM   2558 C  CB    A SER A 1 325 ? 34.097 5.722   -1.585  0.60 20.15  ? 322  SER A CB    1 
ATOM   2559 C  CB    B SER A 1 325 ? 34.341 5.745   -1.512  0.40 20.40  ? 322  SER A CB    1 
ATOM   2560 O  OG    A SER A 1 325 ? 35.227 5.689   -0.736  0.60 16.10  ? 322  SER A OG    1 
ATOM   2561 O  OG    B SER A 1 325 ? 33.701 5.345   -0.317  0.40 19.57  ? 322  SER A OG    1 
ATOM   2562 N  N     . LYS A 1 326 ? 32.508 7.999   -0.161  1.00 15.93  ? 323  LYS A N     1 
ATOM   2563 C  CA    . LYS A 1 326 ? 32.304 8.765   1.064   1.00 16.90  ? 323  LYS A CA    1 
ATOM   2564 C  C     . LYS A 1 326 ? 31.348 8.043   1.984   1.00 22.31  ? 323  LYS A C     1 
ATOM   2565 O  O     . LYS A 1 326 ? 30.288 7.591   1.550   1.00 17.67  ? 323  LYS A O     1 
ATOM   2566 C  CB    . LYS A 1 326 ? 31.786 10.169  0.754   1.00 19.47  ? 323  LYS A CB    1 
ATOM   2567 C  CG    . LYS A 1 326 ? 31.542 10.976  2.019   1.00 23.03  ? 323  LYS A CG    1 
ATOM   2568 C  CD    . LYS A 1 326 ? 31.649 12.464  1.799   1.00 29.34  ? 323  LYS A CD    1 
ATOM   2569 C  CE    . LYS A 1 326 ? 31.422 13.178  3.121   1.00 26.80  ? 323  LYS A CE    1 
ATOM   2570 N  NZ    . LYS A 1 326 ? 32.307 12.577  4.144   1.00 30.97  ? 323  LYS A NZ    1 
ATOM   2571 N  N     . ASN A 1 327 ? 31.741 7.910   3.247   1.00 20.03  ? 324  ASN A N     1 
ATOM   2572 C  CA    . ASN A 1 327 ? 30.840 7.427   4.283   1.00 24.08  ? 324  ASN A CA    1 
ATOM   2573 C  C     . ASN A 1 327 ? 29.972 8.550   4.822   1.00 23.80  ? 324  ASN A C     1 
ATOM   2574 O  O     . ASN A 1 327 ? 30.393 9.699   4.881   1.00 16.82  ? 324  ASN A O     1 
ATOM   2575 C  CB    . ASN A 1 327 ? 31.607 6.804   5.447   1.00 24.87  ? 324  ASN A CB    1 
ATOM   2576 C  CG    . ASN A 1 327 ? 32.238 5.486   5.094   1.00 29.01  ? 324  ASN A CG    1 
ATOM   2577 O  OD1   . ASN A 1 327 ? 31.939 4.884   4.061   1.00 30.55  ? 324  ASN A OD1   1 
ATOM   2578 N  ND2   . ASN A 1 327 ? 33.122 5.019   5.963   1.00 32.36  ? 324  ASN A ND2   1 
ATOM   2579 N  N     . PHE A 1 328 ? 28.755 8.207   5.224   1.00 25.85  ? 325  PHE A N     1 
ATOM   2580 C  CA    . PHE A 1 328 ? 27.872 9.154   5.886   1.00 27.05  ? 325  PHE A CA    1 
ATOM   2581 C  C     . PHE A 1 328 ? 27.400 8.498   7.169   1.00 32.33  ? 325  PHE A C     1 
ATOM   2582 O  O     . PHE A 1 328 ? 26.309 7.931   7.225   1.00 31.39  ? 325  PHE A O     1 
ATOM   2583 C  CB    . PHE A 1 328 ? 26.714 9.543   4.974   1.00 34.29  ? 325  PHE A CB    1 
ATOM   2584 C  CG    . PHE A 1 328 ? 27.162 10.088  3.653   1.00 23.19  ? 325  PHE A CG    1 
ATOM   2585 C  CD1   . PHE A 1 328 ? 27.271 9.253   2.550   1.00 26.72  ? 325  PHE A CD1   1 
ATOM   2586 C  CD2   . PHE A 1 328 ? 27.519 11.420  3.519   1.00 19.24  ? 325  PHE A CD2   1 
ATOM   2587 C  CE1   . PHE A 1 328 ? 27.701 9.744   1.338   1.00 15.90  ? 325  PHE A CE1   1 
ATOM   2588 C  CE2   . PHE A 1 328 ? 27.945 11.922  2.305   1.00 23.24  ? 325  PHE A CE2   1 
ATOM   2589 C  CZ    . PHE A 1 328 ? 28.044 11.083  1.211   1.00 21.83  ? 325  PHE A CZ    1 
ATOM   2590 N  N     . PRO A 1 329 ? 28.257 8.545   8.198   1.00 29.30  ? 326  PRO A N     1 
ATOM   2591 C  CA    . PRO A 1 329 ? 28.097 7.801   9.450   1.00 34.02  ? 326  PRO A CA    1 
ATOM   2592 C  C     . PRO A 1 329 ? 27.057 8.391   10.390  1.00 46.87  ? 326  PRO A C     1 
ATOM   2593 O  O     . PRO A 1 329 ? 26.649 9.543   10.224  1.00 32.41  ? 326  PRO A O     1 
ATOM   2594 C  CB    . PRO A 1 329 ? 29.488 7.882   10.077  1.00 47.78  ? 326  PRO A CB    1 
ATOM   2595 C  CG    . PRO A 1 329 ? 30.036 9.167   9.572   1.00 43.16  ? 326  PRO A CG    1 
ATOM   2596 C  CD    . PRO A 1 329 ? 29.524 9.296   8.166   1.00 34.31  ? 326  PRO A CD    1 
ATOM   2597 N  N     . GLY A 1 330 ? 26.649 7.582   11.366  1.00 54.30  ? 327  GLY A N     1 
ATOM   2598 C  CA    . GLY A 1 330 ? 25.710 7.981   12.398  1.00 52.75  ? 327  GLY A CA    1 
ATOM   2599 C  C     . GLY A 1 330 ? 24.487 8.699   11.872  1.00 49.28  ? 327  GLY A C     1 
ATOM   2600 O  O     . GLY A 1 330 ? 23.690 8.137   11.118  1.00 49.70  ? 327  GLY A O     1 
ATOM   2601 N  N     . LYS A 1 331 ? 24.359 9.964   12.258  1.00 45.76  ? 328  LYS A N     1 
ATOM   2602 C  CA    . LYS A 1 331 ? 23.178 10.743  11.926  1.00 44.05  ? 328  LYS A CA    1 
ATOM   2603 C  C     . LYS A 1 331 ? 23.288 11.479  10.595  1.00 41.39  ? 328  LYS A C     1 
ATOM   2604 O  O     . LYS A 1 331 ? 22.306 12.057  10.133  1.00 44.68  ? 328  LYS A O     1 
ATOM   2605 C  CB    . LYS A 1 331 ? 22.881 11.742  13.046  1.00 51.53  ? 328  LYS A CB    1 
ATOM   2606 C  CG    . LYS A 1 331 ? 22.227 11.116  14.275  1.00 53.32  ? 328  LYS A CG    1 
ATOM   2607 C  CD    . LYS A 1 331 ? 21.720 12.185  15.234  1.00 67.75  ? 328  LYS A CD    1 
ATOM   2608 C  CE    . LYS A 1 331 ? 20.791 13.164  14.526  1.00 67.37  ? 328  LYS A CE    1 
ATOM   2609 N  NZ    . LYS A 1 331 ? 20.358 14.285  15.410  1.00 66.33  ? 328  LYS A NZ    1 
ATOM   2610 N  N     . THR A 1 332 ? 24.464 11.463  9.970   1.00 44.22  ? 329  THR A N     1 
ATOM   2611 C  CA    . THR A 1 332 ? 24.638 12.173  8.698   1.00 40.98  ? 329  THR A CA    1 
ATOM   2612 C  C     . THR A 1 332 ? 24.159 11.347  7.503   1.00 32.80  ? 329  THR A C     1 
ATOM   2613 O  O     . THR A 1 332 ? 24.186 11.824  6.373   1.00 36.78  ? 329  THR A O     1 
ATOM   2614 C  CB    . THR A 1 332 ? 26.109 12.584  8.452   1.00 35.90  ? 329  THR A CB    1 
ATOM   2615 O  OG1   . THR A 1 332 ? 26.901 11.420  8.174   1.00 36.87  ? 329  THR A OG1   1 
ATOM   2616 C  CG2   . THR A 1 332 ? 26.679 13.317  9.659   1.00 30.99  ? 329  THR A CG2   1 
ATOM   2617 N  N     . ALA A 1 333 ? 23.733 10.112  7.763   1.00 32.04  ? 330  ALA A N     1 
ATOM   2618 C  CA    . ALA A 1 333 ? 23.183 9.237   6.728   1.00 37.79  ? 330  ALA A CA    1 
ATOM   2619 C  C     . ALA A 1 333 ? 22.158 9.964   5.858   1.00 37.61  ? 330  ALA A C     1 
ATOM   2620 O  O     . ALA A 1 333 ? 21.330 10.722  6.359   1.00 42.13  ? 330  ALA A O     1 
ATOM   2621 C  CB    . ALA A 1 333 ? 22.564 8.006   7.361   1.00 33.54  ? 330  ALA A CB    1 
ATOM   2622 N  N     . LEU A 1 334 ? 22.229 9.738   4.552   1.00 35.94  ? 331  LEU A N     1 
ATOM   2623 C  CA    . LEU A 1 334 ? 21.424 10.492  3.594   1.00 35.74  ? 331  LEU A CA    1 
ATOM   2624 C  C     . LEU A 1 334 ? 19.973 10.000  3.557   1.00 40.75  ? 331  LEU A C     1 
ATOM   2625 O  O     . LEU A 1 334 ? 19.712 8.843   3.233   1.00 35.07  ? 331  LEU A O     1 
ATOM   2626 C  CB    . LEU A 1 334 ? 22.045 10.400  2.201   1.00 33.66  ? 331  LEU A CB    1 
ATOM   2627 C  CG    . LEU A 1 334 ? 23.550 10.650  2.100   1.00 30.38  ? 331  LEU A CG    1 
ATOM   2628 C  CD1   . LEU A 1 334 ? 23.976 10.613  0.639   1.00 21.41  ? 331  LEU A CD1   1 
ATOM   2629 C  CD2   . LEU A 1 334 ? 23.924 11.981  2.753   1.00 25.68  ? 331  LEU A CD2   1 
ATOM   2630 N  N     . ALA A 1 335 ? 19.031 10.887  3.866   1.00 50.05  ? 332  ALA A N     1 
ATOM   2631 C  CA    . ALA A 1 335 ? 17.640 10.475  4.065   1.00 37.65  ? 332  ALA A CA    1 
ATOM   2632 C  C     . ALA A 1 335 ? 16.675 11.111  3.065   1.00 45.59  ? 332  ALA A C     1 
ATOM   2633 O  O     . ALA A 1 335 ? 15.473 10.844  3.097   1.00 47.30  ? 332  ALA A O     1 
ATOM   2634 C  CB    . ALA A 1 335 ? 17.207 10.796  5.489   1.00 42.92  ? 332  ALA A CB    1 
ATOM   2635 N  N     . THR A 1 336 ? 17.199 11.956  2.186   1.00 35.33  ? 333  THR A N     1 
ATOM   2636 C  CA    . THR A 1 336 ? 16.382 12.597  1.168   1.00 44.43  ? 333  THR A CA    1 
ATOM   2637 C  C     . THR A 1 336 ? 16.990 12.399  -0.210  1.00 48.13  ? 333  THR A C     1 
ATOM   2638 O  O     . THR A 1 336 ? 18.209 12.349  -0.356  1.00 43.38  ? 333  THR A O     1 
ATOM   2639 C  CB    . THR A 1 336 ? 16.218 14.106  1.428   1.00 43.56  ? 333  THR A CB    1 
ATOM   2640 O  OG1   . THR A 1 336 ? 17.385 14.809  0.984   1.00 40.54  ? 333  THR A OG1   1 
ATOM   2641 C  CG2   . THR A 1 336 ? 15.988 14.382  2.907   1.00 45.77  ? 333  THR A CG2   1 
ATOM   2642 N  N     . ARG A 1 337 ? 16.134 12.297  -1.219  1.00 49.58  ? 334  ARG A N     1 
ATOM   2643 C  CA    . ARG A 1 337 ? 16.578 12.124  -2.595  1.00 46.48  ? 334  ARG A CA    1 
ATOM   2644 C  C     . ARG A 1 337 ? 17.521 13.245  -3.037  1.00 46.06  ? 334  ARG A C     1 
ATOM   2645 O  O     . ARG A 1 337 ? 18.548 12.985  -3.666  1.00 46.10  ? 334  ARG A O     1 
ATOM   2646 C  CB    . ARG A 1 337 ? 15.370 12.048  -3.533  1.00 56.59  ? 334  ARG A CB    1 
ATOM   2647 C  CG    . ARG A 1 337 ? 15.731 11.941  -5.003  1.00 59.30  ? 334  ARG A CG    1 
ATOM   2648 C  CD    . ARG A 1 337 ? 14.492 11.809  -5.883  1.00 61.99  ? 334  ARG A CD    1 
ATOM   2649 N  NE    . ARG A 1 337 ? 13.475 12.811  -5.571  1.00 76.03  ? 334  ARG A NE    1 
ATOM   2650 C  CZ    . ARG A 1 337 ? 13.571 14.103  -5.876  1.00 74.83  ? 334  ARG A CZ    1 
ATOM   2651 N  NH1   . ARG A 1 337 ? 14.648 14.568  -6.497  1.00 73.29  ? 334  ARG A NH1   1 
ATOM   2652 N  NH2   . ARG A 1 337 ? 12.589 14.935  -5.552  1.00 75.66  ? 334  ARG A NH2   1 
ATOM   2653 N  N     . GLU A 1 338 ? 17.171 14.485  -2.704  1.00 46.70  ? 335  GLU A N     1 
ATOM   2654 C  CA    . GLU A 1 338 ? 18.004 15.648  -3.022  1.00 43.22  ? 335  GLU A CA    1 
ATOM   2655 C  C     . GLU A 1 338 ? 19.394 15.540  -2.401  1.00 38.89  ? 335  GLU A C     1 
ATOM   2656 O  O     . GLU A 1 338 ? 20.380 16.021  -2.957  1.00 31.37  ? 335  GLU A O     1 
ATOM   2657 C  CB    . GLU A 1 338 ? 17.339 16.937  -2.539  1.00 43.18  ? 335  GLU A CB    1 
ATOM   2658 C  CG    . GLU A 1 338 ? 16.025 17.273  -3.224  1.00 62.82  ? 335  GLU A CG    1 
ATOM   2659 C  CD    . GLU A 1 338 ? 16.221 17.906  -4.588  1.00 68.15  ? 335  GLU A CD    1 
ATOM   2660 O  OE1   . GLU A 1 338 ? 17.383 18.159  -4.968  1.00 70.06  ? 335  GLU A OE1   1 
ATOM   2661 O  OE2   . GLU A 1 338 ? 15.212 18.155  -5.282  1.00 68.33  ? 335  GLU A OE2   1 
ATOM   2662 N  N     . GLN A 1 339 ? 19.460 14.919  -1.231  1.00 42.34  ? 336  GLN A N     1 
ATOM   2663 C  CA    . GLN A 1 339 ? 20.727 14.732  -0.551  1.00 39.11  ? 336  GLN A CA    1 
ATOM   2664 C  C     . GLN A 1 339 ? 21.564 13.695  -1.294  1.00 43.59  ? 336  GLN A C     1 
ATOM   2665 O  O     . GLN A 1 339 ? 22.732 13.931  -1.600  1.00 29.60  ? 336  GLN A O     1 
ATOM   2666 C  CB    . GLN A 1 339 ? 20.503 14.298  0.896   1.00 42.30  ? 336  GLN A CB    1 
ATOM   2667 C  CG    . GLN A 1 339 ? 21.205 15.169  1.917   1.00 38.63  ? 336  GLN A CG    1 
ATOM   2668 C  CD    . GLN A 1 339 ? 21.169 14.565  3.303   1.00 39.85  ? 336  GLN A CD    1 
ATOM   2669 O  OE1   . GLN A 1 339 ? 20.236 13.840  3.654   1.00 46.90  ? 336  GLN A OE1   1 
ATOM   2670 N  NE2   . GLN A 1 339 ? 22.190 14.852  4.098   1.00 43.04  ? 336  GLN A NE2   1 
ATOM   2671 N  N     . VAL A 1 340 ? 20.955 12.549  -1.586  1.00 35.24  ? 337  VAL A N     1 
ATOM   2672 C  CA    . VAL A 1 340 ? 21.631 11.486  -2.314  1.00 32.13  ? 337  VAL A CA    1 
ATOM   2673 C  C     . VAL A 1 340 ? 22.150 11.999  -3.656  1.00 28.66  ? 337  VAL A C     1 
ATOM   2674 O  O     . VAL A 1 340 ? 23.272 11.694  -4.050  1.00 33.01  ? 337  VAL A O     1 
ATOM   2675 C  CB    . VAL A 1 340 ? 20.699 10.273  -2.532  1.00 36.60  ? 337  VAL A CB    1 
ATOM   2676 C  CG1   . VAL A 1 340 ? 21.322 9.268   -3.488  1.00 29.62  ? 337  VAL A CG1   1 
ATOM   2677 C  CG2   . VAL A 1 340 ? 20.393 9.611   -1.210  1.00 33.26  ? 337  VAL A CG2   1 
ATOM   2678 N  N     . GLN A 1 341 ? 21.347 12.807  -4.338  1.00 26.05  ? 338  GLN A N     1 
ATOM   2679 C  CA    . GLN A 1 341 ? 21.706 13.295  -5.663  1.00 36.32  ? 338  GLN A CA    1 
ATOM   2680 C  C     . GLN A 1 341 ? 22.833 14.317  -5.616  1.00 35.96  ? 338  GLN A C     1 
ATOM   2681 O  O     . GLN A 1 341 ? 23.670 14.367  -6.516  1.00 32.61  ? 338  GLN A O     1 
ATOM   2682 C  CB    . GLN A 1 341 ? 20.483 13.894  -6.365  1.00 39.47  ? 338  GLN A CB    1 
ATOM   2683 C  CG    . GLN A 1 341 ? 19.509 12.840  -6.887  1.00 35.09  ? 338  GLN A CG    1 
ATOM   2684 C  CD    . GLN A 1 341 ? 18.287 13.441  -7.564  1.00 54.63  ? 338  GLN A CD    1 
ATOM   2685 O  OE1   . GLN A 1 341 ? 18.024 14.639  -7.454  1.00 46.19  ? 338  GLN A OE1   1 
ATOM   2686 N  NE2   . GLN A 1 341 ? 17.538 12.606  -8.276  1.00 43.68  ? 338  GLN A NE2   1 
ATOM   2687 N  N     . TRP A 1 342 ? 22.857 15.128  -4.567  1.00 33.40  ? 339  TRP A N     1 
ATOM   2688 C  CA    . TRP A 1 342 ? 23.885 16.148  -4.436  1.00 34.52  ? 339  TRP A CA    1 
ATOM   2689 C  C     . TRP A 1 342 ? 25.268 15.525  -4.196  1.00 23.63  ? 339  TRP A C     1 
ATOM   2690 O  O     . TRP A 1 342 ? 26.267 15.985  -4.738  1.00 26.24  ? 339  TRP A O     1 
ATOM   2691 C  CB    . TRP A 1 342 ? 23.537 17.116  -3.304  1.00 25.39  ? 339  TRP A CB    1 
ATOM   2692 C  CG    . TRP A 1 342 ? 24.500 18.258  -3.198  1.00 29.21  ? 339  TRP A CG    1 
ATOM   2693 C  CD1   . TRP A 1 342 ? 24.466 19.425  -3.902  1.00 30.06  ? 339  TRP A CD1   1 
ATOM   2694 C  CD2   . TRP A 1 342 ? 25.641 18.338  -2.344  1.00 28.97  ? 339  TRP A CD2   1 
ATOM   2695 N  NE1   . TRP A 1 342 ? 25.512 20.229  -3.537  1.00 32.59  ? 339  TRP A NE1   1 
ATOM   2696 C  CE2   . TRP A 1 342 ? 26.250 19.587  -2.579  1.00 31.10  ? 339  TRP A CE2   1 
ATOM   2697 C  CE3   . TRP A 1 342 ? 26.205 17.478  -1.398  1.00 25.95  ? 339  TRP A CE3   1 
ATOM   2698 C  CZ2   . TRP A 1 342 ? 27.401 19.997  -1.908  1.00 32.82  ? 339  TRP A CZ2   1 
ATOM   2699 C  CZ3   . TRP A 1 342 ? 27.343 17.889  -0.727  1.00 30.90  ? 339  TRP A CZ3   1 
ATOM   2700 C  CH2   . TRP A 1 342 ? 27.932 19.137  -0.989  1.00 27.06  ? 339  TRP A CH2   1 
ATOM   2701 N  N     . TRP A 1 343 ? 25.311 14.482  -3.377  1.00 22.25  ? 340  TRP A N     1 
ATOM   2702 C  CA    . TRP A 1 343 ? 26.567 13.802  -3.083  1.00 27.71  ? 340  TRP A CA    1 
ATOM   2703 C  C     . TRP A 1 343 ? 27.014 12.927  -4.246  1.00 25.92  ? 340  TRP A C     1 
ATOM   2704 O  O     . TRP A 1 343 ? 28.209 12.786  -4.490  1.00 20.17  ? 340  TRP A O     1 
ATOM   2705 C  CB    . TRP A 1 343 ? 26.441 12.969  -1.805  1.00 21.27  ? 340  TRP A CB    1 
ATOM   2706 C  CG    . TRP A 1 343 ? 26.600 13.804  -0.560  1.00 26.80  ? 340  TRP A CG    1 
ATOM   2707 C  CD1   . TRP A 1 343 ? 25.627 14.143  0.336   1.00 30.89  ? 340  TRP A CD1   1 
ATOM   2708 C  CD2   . TRP A 1 343 ? 27.808 14.427  -0.096  1.00 23.72  ? 340  TRP A CD2   1 
ATOM   2709 N  NE1   . TRP A 1 343 ? 26.157 14.929  1.336   1.00 33.29  ? 340  TRP A NE1   1 
ATOM   2710 C  CE2   . TRP A 1 343 ? 27.495 15.115  1.095   1.00 21.56  ? 340  TRP A CE2   1 
ATOM   2711 C  CE3   . TRP A 1 343 ? 29.126 14.457  -0.568  1.00 22.31  ? 340  TRP A CE3   1 
ATOM   2712 C  CZ2   . TRP A 1 343 ? 28.450 15.830  1.821   1.00 23.01  ? 340  TRP A CZ2   1 
ATOM   2713 C  CZ3   . TRP A 1 343 ? 30.075 15.172  0.154   1.00 22.63  ? 340  TRP A CZ3   1 
ATOM   2714 C  CH2   . TRP A 1 343 ? 29.732 15.846  1.336   1.00 28.12  ? 340  TRP A CH2   1 
ATOM   2715 N  N     . LEU A 1 344 ? 26.061 12.341  -4.970  1.00 21.51  ? 341  LEU A N     1 
ATOM   2716 C  CA    . LEU A 1 344 ? 26.416 11.599  -6.177  1.00 29.42  ? 341  LEU A CA    1 
ATOM   2717 C  C     . LEU A 1 344 ? 27.093 12.549  -7.142  1.00 24.78  ? 341  LEU A C     1 
ATOM   2718 O  O     . LEU A 1 344 ? 28.066 12.189  -7.809  1.00 22.67  ? 341  LEU A O     1 
ATOM   2719 C  CB    . LEU A 1 344 ? 25.194 10.954  -6.834  1.00 26.99  ? 341  LEU A CB    1 
ATOM   2720 C  CG    . LEU A 1 344 ? 24.586 9.713   -6.173  1.00 32.40  ? 341  LEU A CG    1 
ATOM   2721 C  CD1   . LEU A 1 344 ? 23.300 9.330   -6.886  1.00 36.66  ? 341  LEU A CD1   1 
ATOM   2722 C  CD2   . LEU A 1 344 ? 25.566 8.541   -6.161  1.00 21.82  ? 341  LEU A CD2   1 
ATOM   2723 N  N     . LEU A 1 345 ? 26.603 13.784  -7.187  1.00 19.16  ? 342  LEU A N     1 
ATOM   2724 C  CA    . LEU A 1 345 ? 27.207 14.797  -8.042  1.00 26.77  ? 342  LEU A CA    1 
ATOM   2725 C  C     . LEU A 1 345 ? 28.611 15.208  -7.580  1.00 17.92  ? 342  LEU A C     1 
ATOM   2726 O  O     . LEU A 1 345 ? 29.501 15.436  -8.406  1.00 21.82  ? 342  LEU A O     1 
ATOM   2727 C  CB    . LEU A 1 345 ? 26.306 16.032  -8.118  1.00 27.62  ? 342  LEU A CB    1 
ATOM   2728 C  CG    . LEU A 1 345 ? 26.850 17.167  -8.988  1.00 25.39  ? 342  LEU A CG    1 
ATOM   2729 C  CD1   . LEU A 1 345 ? 27.215 16.650  -10.389 1.00 32.72  ? 342  LEU A CD1   1 
ATOM   2730 C  CD2   . LEU A 1 345 ? 25.846 18.308  -9.082  1.00 31.06  ? 342  LEU A CD2   1 
ATOM   2731 N  N     . GLN A 1 346 ? 28.803 15.325  -6.270  1.00 17.87  ? 343  GLN A N     1 
ATOM   2732 C  CA    . GLN A 1 346 ? 30.121 15.681  -5.736  1.00 21.27  ? 343  GLN A CA    1 
ATOM   2733 C  C     . GLN A 1 346 ? 31.134 14.598  -6.106  1.00 16.13  ? 343  GLN A C     1 
ATOM   2734 O  O     . GLN A 1 346 ? 32.211 14.890  -6.638  1.00 14.63  ? 343  GLN A O     1 
ATOM   2735 C  CB    . GLN A 1 346 ? 30.077 15.866  -4.214  1.00 24.52  ? 343  GLN A CB    1 
ATOM   2736 C  CG    . GLN A 1 346 ? 29.118 16.961  -3.720  1.00 22.91  ? 343  GLN A CG    1 
ATOM   2737 C  CD    . GLN A 1 346 ? 29.111 18.202  -4.603  1.00 27.80  ? 343  GLN A CD    1 
ATOM   2738 O  OE1   . GLN A 1 346 ? 30.102 18.937  -4.687  1.00 26.41  ? 343  GLN A OE1   1 
ATOM   2739 N  NE2   . GLN A 1 346 ? 27.978 18.445  -5.265  1.00 29.37  ? 343  GLN A NE2   1 
ATOM   2740 N  N     . LEU A 1 347 ? 30.766 13.351  -5.835  1.00 22.25  ? 344  LEU A N     1 
ATOM   2741 C  CA    . LEU A 1 347 ? 31.615 12.209  -6.163  1.00 22.45  ? 344  LEU A CA    1 
ATOM   2742 C  C     . LEU A 1 347 ? 31.920 12.165  -7.655  1.00 21.69  ? 344  LEU A C     1 
ATOM   2743 O  O     . LEU A 1 347 ? 33.059 11.914  -8.061  1.00 19.79  ? 344  LEU A O     1 
ATOM   2744 C  CB    . LEU A 1 347 ? 30.956 10.896  -5.742  1.00 17.63  ? 344  LEU A CB    1 
ATOM   2745 C  CG    . LEU A 1 347 ? 30.961 10.548  -4.257  1.00 20.52  ? 344  LEU A CG    1 
ATOM   2746 C  CD1   . LEU A 1 347 ? 30.460 9.125   -3.998  1.00 28.43  ? 344  LEU A CD1   1 
ATOM   2747 C  CD2   . LEU A 1 347 ? 32.335 10.719  -3.688  1.00 27.78  ? 344  LEU A CD2   1 
ATOM   2748 N  N     . ALA A 1 348 ? 30.886 12.404  -8.460  1.00 19.43  ? 345  ALA A N     1 
ATOM   2749 C  CA    . ALA A 1 348 ? 30.996 12.319  -9.909  1.00 17.17  ? 345  ALA A CA    1 
ATOM   2750 C  C     . ALA A 1 348 ? 31.878 13.424  -10.460 1.00 18.87  ? 345  ALA A C     1 
ATOM   2751 O  O     . ALA A 1 348 ? 32.557 13.234  -11.467 1.00 17.42  ? 345  ALA A O     1 
ATOM   2752 C  CB    . ALA A 1 348 ? 29.605 12.377  -10.561 1.00 15.27  ? 345  ALA A CB    1 
ATOM   2753 N  N     . GLN A 1 349 ? 31.861 14.583  -9.807  1.00 15.00  ? 346  GLN A N     1 
ATOM   2754 C  CA    . GLN A 1 349 ? 32.693 15.692  -10.244 1.00 15.63  ? 346  GLN A CA    1 
ATOM   2755 C  C     . GLN A 1 349 ? 34.177 15.420  -9.972  1.00 19.59  ? 346  GLN A C     1 
ATOM   2756 O  O     . GLN A 1 349 ? 35.027 15.741  -10.799 1.00 16.64  ? 346  GLN A O     1 
ATOM   2757 C  CB    . GLN A 1 349 ? 32.240 16.998  -9.586  1.00 23.04  ? 346  GLN A CB    1 
ATOM   2758 C  CG    . GLN A 1 349 ? 30.995 17.594  -10.264 1.00 24.04  ? 346  GLN A CG    1 
ATOM   2759 C  CD    . GLN A 1 349 ? 30.442 18.826  -9.552  1.00 36.56  ? 346  GLN A CD    1 
ATOM   2760 O  OE1   . GLN A 1 349 ? 30.926 19.223  -8.490  1.00 33.37  ? 346  GLN A OE1   1 
ATOM   2761 N  NE2   . GLN A 1 349 ? 29.416 19.431  -10.139 1.00 37.15  ? 346  GLN A NE2   1 
ATOM   2762 N  N     . GLU A 1 350 ? 34.489 14.825  -8.825  1.00 17.44  ? 347  GLU A N     1 
ATOM   2763 C  CA    . GLU A 1 350 ? 35.879 14.472  -8.546  1.00 20.05  ? 347  GLU A CA    1 
ATOM   2764 C  C     . GLU A 1 350 ? 36.306 13.362  -9.498  1.00 13.41  ? 347  GLU A C     1 
ATOM   2765 O  O     . GLU A 1 350 ? 37.434 13.365  -9.992  1.00 21.87  ? 347  GLU A O     1 
ATOM   2766 C  CB    . GLU A 1 350 ? 36.086 14.036  -7.095  1.00 14.38  ? 347  GLU A CB    1 
ATOM   2767 C  CG    . GLU A 1 350 ? 37.537 13.571  -6.832  1.00 22.06  ? 347  GLU A CG    1 
ATOM   2768 C  CD    . GLU A 1 350 ? 37.769 12.999  -5.443  1.00 29.54  ? 347  GLU A CD    1 
ATOM   2769 O  OE1   . GLU A 1 350 ? 37.100 13.429  -4.478  1.00 23.98  ? 347  GLU A OE1   1 
ATOM   2770 O  OE2   . GLU A 1 350 ? 38.626 12.105  -5.319  1.00 17.89  ? 347  GLU A OE2   1 
ATOM   2771 N  N     . LEU A 1 351 ? 35.395 12.432  -9.766  1.00 17.38  ? 348  LEU A N     1 
ATOM   2772 C  CA    . LEU A 1 351 ? 35.695 11.315  -10.647 1.00 16.08  ? 348  LEU A CA    1 
ATOM   2773 C  C     . LEU A 1 351 ? 36.011 11.832  -12.046 1.00 19.10  ? 348  LEU A C     1 
ATOM   2774 O  O     . LEU A 1 351 ? 37.010 11.434  -12.644 1.00 17.02  ? 348  LEU A O     1 
ATOM   2775 C  CB    . LEU A 1 351 ? 34.538 10.310  -10.689 1.00 21.04  ? 348  LEU A CB    1 
ATOM   2776 C  CG    . LEU A 1 351 ? 34.905 8.935   -11.277 1.00 25.65  ? 348  LEU A CG    1 
ATOM   2777 C  CD1   . LEU A 1 351 ? 36.037 8.280   -10.479 1.00 26.07  ? 348  LEU A CD1   1 
ATOM   2778 C  CD2   . LEU A 1 351 ? 33.706 7.982   -11.364 1.00 26.87  ? 348  LEU A CD2   1 
ATOM   2779 N  N     . GLU A 1 352 ? 35.178 12.734  -12.564 1.00 18.45  ? 349  GLU A N     1 
ATOM   2780 C  CA    . GLU A 1 352 ? 35.427 13.320  -13.884 1.00 13.96  ? 349  GLU A CA    1 
ATOM   2781 C  C     . GLU A 1 352 ? 36.782 14.009  -13.969 1.00 17.20  ? 349  GLU A C     1 
ATOM   2782 O  O     . GLU A 1 352 ? 37.497 13.900  -14.974 1.00 19.41  ? 349  GLU A O     1 
ATOM   2783 C  CB    . GLU A 1 352 ? 34.341 14.336  -14.256 1.00 15.11  ? 349  GLU A CB    1 
ATOM   2784 C  CG    . GLU A 1 352 ? 34.614 14.980  -15.610 1.00 24.28  ? 349  GLU A CG    1 
ATOM   2785 C  CD    . GLU A 1 352 ? 33.661 16.110  -15.951 1.00 47.41  ? 349  GLU A CD    1 
ATOM   2786 O  OE1   . GLU A 1 352 ? 34.048 16.960  -16.780 1.00 45.55  ? 349  GLU A OE1   1 
ATOM   2787 O  OE2   . GLU A 1 352 ? 32.530 16.143  -15.409 1.00 43.41  ? 349  GLU A OE2   1 
ATOM   2788 N  N     . GLU A 1 353 ? 37.128 14.738  -12.917 1.00 19.47  ? 350  GLU A N     1 
ATOM   2789 C  CA    . GLU A 1 353 ? 38.399 15.446  -12.877 1.00 19.79  ? 350  GLU A CA    1 
ATOM   2790 C  C     . GLU A 1 353 ? 39.578 14.459  -12.930 1.00 17.68  ? 350  GLU A C     1 
ATOM   2791 O  O     . GLU A 1 353 ? 40.536 14.638  -13.688 1.00 19.57  ? 350  GLU A O     1 
ATOM   2792 C  CB    . GLU A 1 353 ? 38.469 16.313  -11.615 1.00 21.48  ? 350  GLU A CB    1 
ATOM   2793 C  CG    . GLU A 1 353 ? 39.753 17.110  -11.470 1.00 33.78  ? 350  GLU A CG    1 
ATOM   2794 C  CD    . GLU A 1 353 ? 39.694 18.106  -10.320 1.00 44.76  ? 350  GLU A CD    1 
ATOM   2795 O  OE1   . GLU A 1 353 ? 38.667 18.136  -9.607  1.00 47.08  ? 350  GLU A OE1   1 
ATOM   2796 O  OE2   . GLU A 1 353 ? 40.673 18.860  -10.134 1.00 63.51  ? 350  GLU A OE2   1 
ATOM   2797 N  N     . ARG A 1 354 ? 39.489 13.406  -12.130 1.00 17.63  ? 351  ARG A N     1 
ATOM   2798 C  CA    . ARG A 1 354 ? 40.564 12.433  -12.083 1.00 23.07  ? 351  ARG A CA    1 
ATOM   2799 C  C     . ARG A 1 354 ? 40.614 11.642  -13.392 1.00 19.17  ? 351  ARG A C     1 
ATOM   2800 O  O     . ARG A 1 354 ? 41.697 11.377  -13.903 1.00 17.42  ? 351  ARG A O     1 
ATOM   2801 C  CB    . ARG A 1 354 ? 40.395 11.513  -10.869 1.00 21.91  ? 351  ARG A CB    1 
ATOM   2802 C  CG    A ARG A 1 354 ? 40.765 12.236  -9.558  0.85 19.55  ? 351  ARG A CG    1 
ATOM   2803 C  CG    B ARG A 1 354 ? 40.670 12.157  -9.517  0.15 19.64  ? 351  ARG A CG    1 
ATOM   2804 C  CD    A ARG A 1 354 ? 40.252 11.502  -8.331  0.85 23.37  ? 351  ARG A CD    1 
ATOM   2805 C  CD    B ARG A 1 354 ? 40.521 11.125  -8.403  0.15 21.23  ? 351  ARG A CD    1 
ATOM   2806 N  NE    A ARG A 1 354 ? 40.784 10.152  -8.255  0.85 14.77  ? 351  ARG A NE    1 
ATOM   2807 N  NE    B ARG A 1 354 ? 41.394 9.973   -8.616  0.15 18.21  ? 351  ARG A NE    1 
ATOM   2808 C  CZ    A ARG A 1 354 ? 40.328 9.221   -7.430  0.85 19.05  ? 351  ARG A CZ    1 
ATOM   2809 C  CZ    B ARG A 1 354 ? 41.240 8.793   -8.023  0.15 17.29  ? 351  ARG A CZ    1 
ATOM   2810 N  NH1   A ARG A 1 354 ? 39.327 9.505   -6.589  0.85 13.42  ? 351  ARG A NH1   1 
ATOM   2811 N  NH1   B ARG A 1 354 ? 40.238 8.596   -7.180  0.15 18.72  ? 351  ARG A NH1   1 
ATOM   2812 N  NH2   A ARG A 1 354 ? 40.876 8.009   -7.446  0.85 13.78  ? 351  ARG A NH2   1 
ATOM   2813 N  NH2   B ARG A 1 354 ? 42.085 7.804   -8.283  0.15 17.81  ? 351  ARG A NH2   1 
ATOM   2814 N  N     . LEU A 1 355 ? 39.447 11.302  -13.944 1.00 17.82  ? 352  LEU A N     1 
ATOM   2815 C  CA    . LEU A 1 355 ? 39.374 10.549  -15.199 1.00 19.09  ? 352  LEU A CA    1 
ATOM   2816 C  C     . LEU A 1 355 ? 39.915 11.336  -16.385 1.00 22.22  ? 352  LEU A C     1 
ATOM   2817 O  O     . LEU A 1 355 ? 40.563 10.776  -17.275 1.00 19.44  ? 352  LEU A O     1 
ATOM   2818 C  CB    . LEU A 1 355 ? 37.933 10.125  -15.499 1.00 15.28  ? 352  LEU A CB    1 
ATOM   2819 C  CG    . LEU A 1 355 ? 37.369 8.941   -14.729 1.00 21.85  ? 352  LEU A CG    1 
ATOM   2820 C  CD1   . LEU A 1 355 ? 35.905 8.745   -15.079 1.00 17.54  ? 352  LEU A CD1   1 
ATOM   2821 C  CD2   . LEU A 1 355 ? 38.173 7.684   -15.049 1.00 22.71  ? 352  LEU A CD2   1 
ATOM   2822 N  N     . THR A 1 356 ? 39.619 12.630  -16.424 1.00 21.14  ? 353  THR A N     1 
ATOM   2823 C  CA    . THR A 1 356 ? 40.068 13.438  -17.545 1.00 22.75  ? 353  THR A CA    1 
ATOM   2824 C  C     . THR A 1 356 ? 41.588 13.564  -17.528 1.00 18.68  ? 353  THR A C     1 
ATOM   2825 O  O     . THR A 1 356 ? 42.239 13.433  -18.567 1.00 21.19  ? 353  THR A O     1 
ATOM   2826 C  CB    . THR A 1 356 ? 39.408 14.831  -17.544 1.00 25.62  ? 353  THR A CB    1 
ATOM   2827 O  OG1   . THR A 1 356 ? 38.002 14.672  -17.758 1.00 21.14  ? 353  THR A OG1   1 
ATOM   2828 C  CG2   . THR A 1 356 ? 39.967 15.677  -18.659 1.00 23.16  ? 353  THR A CG2   1 
ATOM   2829 N  N     . LYS A 1 357 ? 42.148 13.793  -16.344 1.00 15.98  ? 354  LYS A N     1 
ATOM   2830 C  CA    . LYS A 1 357 ? 43.590 13.839  -16.171 1.00 17.98  ? 354  LYS A CA    1 
ATOM   2831 C  C     . LYS A 1 357 ? 44.206 12.499  -16.550 1.00 18.16  ? 354  LYS A C     1 
ATOM   2832 O  O     . LYS A 1 357 ? 45.250 12.438  -17.205 1.00 23.17  ? 354  LYS A O     1 
ATOM   2833 C  CB    . LYS A 1 357 ? 43.944 14.198  -14.726 1.00 22.70  ? 354  LYS A CB    1 
ATOM   2834 C  CG    . LYS A 1 357 ? 45.425 14.208  -14.414 1.00 33.50  ? 354  LYS A CG    1 
ATOM   2835 C  CD    . LYS A 1 357 ? 46.142 15.361  -15.103 1.00 38.83  ? 354  LYS A CD    1 
ATOM   2836 C  CE    . LYS A 1 357 ? 47.340 15.828  -14.285 1.00 44.80  ? 354  LYS A CE    1 
ATOM   2837 N  NZ    . LYS A 1 357 ? 48.229 14.695  -13.908 1.00 41.16  ? 354  LYS A NZ    1 
ATOM   2838 N  N     . ASP A 1 358 ? 43.550 11.422  -16.133 1.00 19.80  ? 355  ASP A N     1 
ATOM   2839 C  CA    . ASP A 1 358 ? 44.025 10.080  -16.451 1.00 25.64  ? 355  ASP A CA    1 
ATOM   2840 C  C     . ASP A 1 358 ? 44.063 9.848   -17.957 1.00 22.48  ? 355  ASP A C     1 
ATOM   2841 O  O     . ASP A 1 358 ? 45.018 9.278   -18.469 1.00 23.45  ? 355  ASP A O     1 
ATOM   2842 C  CB    . ASP A 1 358 ? 43.151 9.016   -15.793 1.00 20.40  ? 355  ASP A CB    1 
ATOM   2843 C  CG    . ASP A 1 358 ? 43.698 7.616   -16.003 1.00 26.34  ? 355  ASP A CG    1 
ATOM   2844 O  OD1   . ASP A 1 358 ? 44.671 7.249   -15.306 1.00 23.23  ? 355  ASP A OD1   1 
ATOM   2845 O  OD2   . ASP A 1 358 ? 43.169 6.893   -16.875 1.00 24.21  ? 355  ASP A OD2   1 
ATOM   2846 N  N     . ARG A 1 359 ? 43.029 10.298  -18.661 1.00 18.58  ? 356  ARG A N     1 
ATOM   2847 C  CA    . ARG A 1 359 ? 42.948 10.069  -20.100 1.00 23.57  ? 356  ARG A CA    1 
ATOM   2848 C  C     . ARG A 1 359 ? 44.078 10.799  -20.827 1.00 24.35  ? 356  ARG A C     1 
ATOM   2849 O  O     . ARG A 1 359 ? 44.664 10.266  -21.761 1.00 19.88  ? 356  ARG A O     1 
ATOM   2850 C  CB    . ARG A 1 359 ? 41.584 10.510  -20.648 1.00 30.27  ? 356  ARG A CB    1 
ATOM   2851 C  CG    . ARG A 1 359 ? 41.399 10.248  -22.147 1.00 32.34  ? 356  ARG A CG    1 
ATOM   2852 C  CD    . ARG A 1 359 ? 40.010 10.672  -22.632 1.00 27.45  ? 356  ARG A CD    1 
ATOM   2853 N  NE    . ARG A 1 359 ? 39.769 12.101  -22.432 1.00 32.42  ? 356  ARG A NE    1 
ATOM   2854 C  CZ    . ARG A 1 359 ? 38.567 12.650  -22.260 1.00 35.56  ? 356  ARG A CZ    1 
ATOM   2855 N  NH1   . ARG A 1 359 ? 37.471 11.893  -22.256 1.00 36.53  ? 356  ARG A NH1   1 
ATOM   2856 N  NH2   . ARG A 1 359 ? 38.463 13.963  -22.086 1.00 33.49  ? 356  ARG A NH2   1 
ATOM   2857 N  N     . ASN A 1 360 ? 44.391 12.008  -20.371 1.00 21.58  ? 357  ASN A N     1 
ATOM   2858 C  CA    . ASN A 1 360 ? 45.472 12.802  -20.958 1.00 19.57  ? 357  ASN A CA    1 
ATOM   2859 C  C     . ASN A 1 360 ? 46.871 12.269  -20.653 1.00 26.75  ? 357  ASN A C     1 
ATOM   2860 O  O     . ASN A 1 360 ? 47.744 12.303  -21.513 1.00 27.27  ? 357  ASN A O     1 
ATOM   2861 C  CB    . ASN A 1 360 ? 45.383 14.252  -20.484 1.00 23.82  ? 357  ASN A CB    1 
ATOM   2862 C  CG    . ASN A 1 360 ? 44.247 15.007  -21.139 1.00 29.57  ? 357  ASN A CG    1 
ATOM   2863 O  OD1   . ASN A 1 360 ? 43.911 14.763  -22.296 1.00 31.83  ? 357  ASN A OD1   1 
ATOM   2864 N  ND2   . ASN A 1 360 ? 43.651 15.931  -20.402 1.00 27.43  ? 357  ASN A ND2   1 
ATOM   2865 N  N     . ASP A 1 361 ? 47.075 11.798  -19.423 1.00 22.15  ? 358  ASP A N     1 
ATOM   2866 C  CA    . ASP A 1 361 ? 48.385 11.317  -18.993 1.00 30.03  ? 358  ASP A CA    1 
ATOM   2867 C  C     . ASP A 1 361 ? 48.710 9.935   -19.538 1.00 23.16  ? 358  ASP A C     1 
ATOM   2868 O  O     . ASP A 1 361 ? 49.865 9.635   -19.819 1.00 20.34  ? 358  ASP A O     1 
ATOM   2869 C  CB    . ASP A 1 361 ? 48.479 11.270  -17.454 1.00 30.03  ? 358  ASP A CB    1 
ATOM   2870 C  CG    . ASP A 1 361 ? 48.617 12.652  -16.823 1.00 41.98  ? 358  ASP A CG    1 
ATOM   2871 O  OD1   . ASP A 1 361 ? 48.776 13.641  -17.573 1.00 29.14  ? 358  ASP A OD1   1 
ATOM   2872 O  OD2   . ASP A 1 361 ? 48.575 12.740  -15.571 1.00 32.30  ? 358  ASP A OD2   1 
ATOM   2873 N  N     . ASN A 1 362 ? 47.691 9.095   -19.680 1.00 19.28  ? 359  ASN A N     1 
ATOM   2874 C  CA    . ASN A 1 362 ? 47.924 7.661   -19.801 1.00 23.48  ? 359  ASN A CA    1 
ATOM   2875 C  C     . ASN A 1 362 ? 47.287 6.998   -21.028 1.00 25.69  ? 359  ASN A C     1 
ATOM   2876 O  O     . ASN A 1 362 ? 47.387 5.784   -21.187 1.00 18.42  ? 359  ASN A O     1 
ATOM   2877 C  CB    . ASN A 1 362 ? 47.442 6.960   -18.516 1.00 18.20  ? 359  ASN A CB    1 
ATOM   2878 C  CG    . ASN A 1 362 ? 48.217 7.421   -17.269 1.00 23.44  ? 359  ASN A CG    1 
ATOM   2879 O  OD1   . ASN A 1 362 ? 49.441 7.553   -17.295 1.00 21.53  ? 359  ASN A OD1   1 
ATOM   2880 N  ND2   . ASN A 1 362 ? 47.502 7.654   -16.178 1.00 20.56  ? 359  ASN A ND2   1 
ATOM   2881 N  N     . ASP A 1 363 ? 46.648 7.781   -21.895 1.00 21.62  ? 360  ASP A N     1 
ATOM   2882 C  CA    . ASP A 1 363 ? 46.114 7.244   -23.155 1.00 21.23  ? 360  ASP A CA    1 
ATOM   2883 C  C     . ASP A 1 363 ? 45.164 6.092   -22.947 1.00 24.05  ? 360  ASP A C     1 
ATOM   2884 O  O     . ASP A 1 363 ? 45.323 5.030   -23.554 1.00 25.22  ? 360  ASP A O     1 
ATOM   2885 C  CB    . ASP A 1 363 ? 47.239 6.763   -24.073 1.00 28.99  ? 360  ASP A CB    1 
ATOM   2886 C  CG    . ASP A 1 363 ? 48.213 7.855   -24.420 1.00 37.19  ? 360  ASP A CG    1 
ATOM   2887 O  OD1   . ASP A 1 363 ? 47.772 8.990   -24.711 1.00 36.06  ? 360  ASP A OD1   1 
ATOM   2888 O  OD2   . ASP A 1 363 ? 49.425 7.567   -24.399 1.00 39.20  ? 360  ASP A OD2   1 
ATOM   2889 N  N     . ARG A 1 364 ? 44.180 6.283   -22.082 1.00 23.72  ? 361  ARG A N     1 
ATOM   2890 C  CA    . ARG A 1 364 ? 43.183 5.243   -21.875 1.00 22.67  ? 361  ARG A CA    1 
ATOM   2891 C  C     . ARG A 1 364 ? 41.870 5.869   -21.462 1.00 24.34  ? 361  ARG A C     1 
ATOM   2892 O  O     . ARG A 1 364 ? 41.835 7.002   -20.975 1.00 23.85  ? 361  ARG A O     1 
ATOM   2893 C  CB    . ARG A 1 364 ? 43.657 4.244   -20.817 1.00 23.56  ? 361  ARG A CB    1 
ATOM   2894 C  CG    . ARG A 1 364 ? 44.021 4.894   -19.487 1.00 24.56  ? 361  ARG A CG    1 
ATOM   2895 C  CD    . ARG A 1 364 ? 44.566 3.874   -18.494 1.00 19.83  ? 361  ARG A CD    1 
ATOM   2896 N  NE    . ARG A 1 364 ? 44.577 4.409   -17.136 1.00 19.45  ? 361  ARG A NE    1 
ATOM   2897 C  CZ    . ARG A 1 364 ? 44.788 3.674   -16.049 1.00 23.81  ? 361  ARG A CZ    1 
ATOM   2898 N  NH1   . ARG A 1 364 ? 44.785 4.242   -14.844 1.00 19.31  ? 361  ARG A NH1   1 
ATOM   2899 N  NH2   . ARG A 1 364 ? 44.996 2.376   -16.167 1.00 17.76  ? 361  ARG A NH2   1 
ATOM   2900 N  N     . VAL A 1 365 ? 40.791 5.125   -21.661 1.00 22.57  ? 362  VAL A N     1 
ATOM   2901 C  CA    . VAL A 1 365 ? 39.466 5.565   -21.256 1.00 25.98  ? 362  VAL A CA    1 
ATOM   2902 C  C     . VAL A 1 365 ? 38.741 4.464   -20.491 1.00 27.39  ? 362  VAL A C     1 
ATOM   2903 O  O     . VAL A 1 365 ? 38.718 3.309   -20.918 1.00 27.68  ? 362  VAL A O     1 
ATOM   2904 C  CB    . VAL A 1 365 ? 38.623 5.984   -22.477 1.00 27.70  ? 362  VAL A CB    1 
ATOM   2905 C  CG1   . VAL A 1 365 ? 39.127 7.305   -23.034 1.00 33.02  ? 362  VAL A CG1   1 
ATOM   2906 C  CG2   . VAL A 1 365 ? 38.680 4.911   -23.554 1.00 37.96  ? 362  VAL A CG2   1 
ATOM   2907 N  N     . ALA A 1 366 ? 38.147 4.817   -19.357 1.00 19.65  ? 363  ALA A N     1 
ATOM   2908 C  CA    . ALA A 1 366 ? 37.282 3.885   -18.643 1.00 18.15  ? 363  ALA A CA    1 
ATOM   2909 C  C     . ALA A 1 366 ? 36.005 3.647   -19.454 1.00 25.07  ? 363  ALA A C     1 
ATOM   2910 O  O     . ALA A 1 366 ? 35.553 4.535   -20.183 1.00 28.26  ? 363  ALA A O     1 
ATOM   2911 C  CB    . ALA A 1 366 ? 36.953 4.419   -17.257 1.00 15.96  ? 363  ALA A CB    1 
ATOM   2912 N  N     . THR A 1 367 ? 35.427 2.454   -19.338 1.00 22.59  ? 364  THR A N     1 
ATOM   2913 C  CA    . THR A 1 367 ? 34.226 2.127   -20.100 1.00 26.19  ? 364  THR A CA    1 
ATOM   2914 C  C     . THR A 1 367 ? 33.084 1.620   -19.223 1.00 25.20  ? 364  THR A C     1 
ATOM   2915 O  O     . THR A 1 367 ? 31.966 1.385   -19.702 1.00 23.80  ? 364  THR A O     1 
ATOM   2916 C  CB    . THR A 1 367 ? 34.527 1.070   -21.180 1.00 21.67  ? 364  THR A CB    1 
ATOM   2917 O  OG1   . THR A 1 367 ? 34.733 -0.207  -20.563 1.00 24.29  ? 364  THR A OG1   1 
ATOM   2918 C  CG2   . THR A 1 367 ? 35.769 1.453   -21.974 1.00 25.16  ? 364  THR A CG2   1 
ATOM   2919 N  N     . GLN A 1 368 ? 33.363 1.429   -17.939 1.00 20.24  ? 365  GLN A N     1 
ATOM   2920 C  CA    . GLN A 1 368 ? 32.332 0.949   -17.026 1.00 25.65  ? 365  GLN A CA    1 
ATOM   2921 C  C     . GLN A 1 368 ? 32.331 1.783   -15.751 1.00 27.72  ? 365  GLN A C     1 
ATOM   2922 O  O     . GLN A 1 368 ? 33.384 2.109   -15.208 1.00 25.04  ? 365  GLN A O     1 
ATOM   2923 C  CB    . GLN A 1 368 ? 32.529 -0.531  -16.689 1.00 30.72  ? 365  GLN A CB    1 
ATOM   2924 C  CG    . GLN A 1 368 ? 31.350 -1.139  -15.930 1.00 29.05  ? 365  GLN A CG    1 
ATOM   2925 C  CD    . GLN A 1 368 ? 31.465 -2.644  -15.735 1.00 33.58  ? 365  GLN A CD    1 
ATOM   2926 O  OE1   . GLN A 1 368 ? 32.312 -3.121  -14.983 1.00 52.31  ? 365  GLN A OE1   1 
ATOM   2927 N  NE2   . GLN A 1 368 ? 30.600 -3.397  -16.404 1.00 44.24  ? 365  GLN A NE2   1 
ATOM   2928 N  N     . LEU A 1 369 ? 31.132 2.131   -15.303 1.00 22.98  ? 366  LEU A N     1 
ATOM   2929 C  CA    . LEU A 1 369 ? 30.925 2.840   -14.047 1.00 25.04  ? 366  LEU A CA    1 
ATOM   2930 C  C     . LEU A 1 369 ? 30.267 1.898   -13.045 1.00 24.04  ? 366  LEU A C     1 
ATOM   2931 O  O     . LEU A 1 369 ? 29.177 1.367   -13.286 1.00 29.90  ? 366  LEU A O     1 
ATOM   2932 C  CB    . LEU A 1 369 ? 30.055 4.081   -14.255 1.00 21.20  ? 366  LEU A CB    1 
ATOM   2933 C  CG    . LEU A 1 369 ? 29.797 4.949   -13.023 1.00 24.76  ? 366  LEU A CG    1 
ATOM   2934 C  CD1   . LEU A 1 369 ? 31.073 5.696   -12.621 1.00 20.40  ? 366  LEU A CD1   1 
ATOM   2935 C  CD2   . LEU A 1 369 ? 28.636 5.922   -13.284 1.00 32.86  ? 366  LEU A CD2   1 
ATOM   2936 N  N     . VAL A 1 370 ? 30.944 1.674   -11.931 1.00 17.31  ? 367  VAL A N     1 
ATOM   2937 C  CA    . VAL A 1 370 ? 30.404 0.847   -10.869 1.00 21.49  ? 367  VAL A CA    1 
ATOM   2938 C  C     . VAL A 1 370 ? 29.863 1.732   -9.751  1.00 26.00  ? 367  VAL A C     1 
ATOM   2939 O  O     . VAL A 1 370 ? 30.551 2.639   -9.286  1.00 24.22  ? 367  VAL A O     1 
ATOM   2940 C  CB    . VAL A 1 370 ? 31.477 -0.102  -10.319 1.00 24.90  ? 367  VAL A CB    1 
ATOM   2941 C  CG1   . VAL A 1 370 ? 30.965 -0.822  -9.085  1.00 24.88  ? 367  VAL A CG1   1 
ATOM   2942 C  CG2   . VAL A 1 370 ? 31.914 -1.095  -11.408 1.00 24.47  ? 367  VAL A CG2   1 
ATOM   2943 N  N     . VAL A 1 371 ? 28.629 1.473   -9.326  1.00 22.04  ? 368  VAL A N     1 
ATOM   2944 C  CA    . VAL A 1 371 ? 28.008 2.257   -8.263  1.00 20.98  ? 368  VAL A CA    1 
ATOM   2945 C  C     . VAL A 1 371 ? 27.741 1.362   -7.070  1.00 25.94  ? 368  VAL A C     1 
ATOM   2946 O  O     . VAL A 1 371 ? 27.170 0.282   -7.211  1.00 26.94  ? 368  VAL A O     1 
ATOM   2947 C  CB    . VAL A 1 371 ? 26.697 2.912   -8.735  1.00 29.61  ? 368  VAL A CB    1 
ATOM   2948 C  CG1   . VAL A 1 371 ? 26.153 3.862   -7.660  1.00 26.89  ? 368  VAL A CG1   1 
ATOM   2949 C  CG2   . VAL A 1 371 ? 26.931 3.653   -10.040 1.00 23.22  ? 368  VAL A CG2   1 
ATOM   2950 N  N     . SER A 1 372 ? 28.184 1.796   -5.897  1.00 23.29  ? 369  SER A N     1 
ATOM   2951 C  CA    . SER A 1 372 ? 28.051 0.990   -4.696  1.00 25.11  ? 369  SER A CA    1 
ATOM   2952 C  C     . SER A 1 372 ? 27.509 1.823   -3.541  1.00 21.28  ? 369  SER A C     1 
ATOM   2953 O  O     . SER A 1 372 ? 27.902 2.970   -3.362  1.00 24.40  ? 369  SER A O     1 
ATOM   2954 C  CB    . SER A 1 372 ? 29.401 0.378   -4.320  1.00 27.47  ? 369  SER A CB    1 
ATOM   2955 O  OG    . SER A 1 372 ? 29.276 -0.455  -3.185  1.00 37.47  ? 369  SER A OG    1 
ATOM   2956 N  N     . ILE A 1 373 ? 26.587 1.259   -2.773  1.00 25.05  ? 370  ILE A N     1 
ATOM   2957 C  CA    . ILE A 1 373 ? 26.064 1.963   -1.608  1.00 24.32  ? 370  ILE A CA    1 
ATOM   2958 C  C     . ILE A 1 373 ? 26.057 1.049   -0.387  1.00 31.87  ? 370  ILE A C     1 
ATOM   2959 O  O     . ILE A 1 373 ? 26.202 -0.171  -0.500  1.00 29.96  ? 370  ILE A O     1 
ATOM   2960 C  CB    . ILE A 1 373 ? 24.626 2.515   -1.838  1.00 31.67  ? 370  ILE A CB    1 
ATOM   2961 C  CG1   . ILE A 1 373 ? 23.625 1.375   -2.020  1.00 36.64  ? 370  ILE A CG1   1 
ATOM   2962 C  CG2   . ILE A 1 373 ? 24.583 3.527   -3.002  1.00 19.90  ? 370  ILE A CG2   1 
ATOM   2963 C  CD1   . ILE A 1 373 ? 22.211 1.862   -2.257  1.00 38.99  ? 370  ILE A CD1   1 
ATOM   2964 N  N     . ARG A 1 374 ? 25.914 1.660   0.783   1.00 29.06  ? 371  ARG A N     1 
ATOM   2965 C  CA    . ARG A 1 374 ? 25.682 0.921   2.007   1.00 35.31  ? 371  ARG A CA    1 
ATOM   2966 C  C     . ARG A 1 374 ? 24.407 1.499   2.596   1.00 41.83  ? 371  ARG A C     1 
ATOM   2967 O  O     . ARG A 1 374 ? 24.140 2.695   2.443   1.00 30.58  ? 371  ARG A O     1 
ATOM   2968 C  CB    . ARG A 1 374 ? 26.860 1.042   2.973   1.00 40.34  ? 371  ARG A CB    1 
ATOM   2969 C  CG    . ARG A 1 374 ? 26.806 0.110   4.175   1.00 39.38  ? 371  ARG A CG    1 
ATOM   2970 C  CD    . ARG A 1 374 ? 27.982 0.371   5.111   1.00 49.09  ? 371  ARG A CD    1 
ATOM   2971 N  NE    . ARG A 1 374 ? 28.017 -0.553  6.243   1.00 61.93  ? 371  ARG A NE    1 
ATOM   2972 C  CZ    . ARG A 1 374 ? 28.819 -0.418  7.297   1.00 67.74  ? 371  ARG A CZ    1 
ATOM   2973 N  NH1   . ARG A 1 374 ? 29.656 0.610   7.375   1.00 56.49  ? 371  ARG A NH1   1 
ATOM   2974 N  NH2   . ARG A 1 374 ? 28.782 -1.308  8.281   1.00 69.31  ? 371  ARG A NH2   1 
ATOM   2975 N  N     . VAL A 1 375 ? 23.605 0.647   3.224   1.00 40.03  ? 372  VAL A N     1 
ATOM   2976 C  CA    . VAL A 1 375 ? 22.365 1.093   3.842   1.00 47.60  ? 372  VAL A CA    1 
ATOM   2977 C  C     . VAL A 1 375 ? 22.481 0.981   5.354   1.00 38.91  ? 372  VAL A C     1 
ATOM   2978 O  O     . VAL A 1 375 ? 23.171 0.098   5.866   1.00 38.55  ? 372  VAL A O     1 
ATOM   2979 C  CB    . VAL A 1 375 ? 21.160 0.279   3.347   1.00 53.84  ? 372  VAL A CB    1 
ATOM   2980 C  CG1   . VAL A 1 375 ? 20.805 0.676   1.921   1.00 44.99  ? 372  VAL A CG1   1 
ATOM   2981 C  CG2   . VAL A 1 375 ? 21.460 -1.213  3.442   1.00 52.47  ? 372  VAL A CG2   1 
ATOM   2982 N  N     . GLN A 1 376 ? 21.816 1.887   6.061   1.00 46.87  ? 373  GLN A N     1 
ATOM   2983 C  CA    . GLN A 1 376 ? 21.917 1.947   7.515   1.00 48.65  ? 373  GLN A CA    1 
ATOM   2984 C  C     . GLN A 1 376 ? 21.525 0.620   8.152   1.00 47.46  ? 373  GLN A C     1 
ATOM   2985 O  O     . GLN A 1 376 ? 20.457 0.082   7.877   1.00 49.53  ? 373  GLN A O     1 
ATOM   2986 C  CB    . GLN A 1 376 ? 21.040 3.071   8.063   1.00 43.80  ? 373  GLN A CB    1 
ATOM   2987 C  CG    . GLN A 1 376 ? 21.340 3.435   9.507   1.00 56.75  ? 373  GLN A CG    1 
ATOM   2988 C  CD    . GLN A 1 376 ? 21.136 4.910   9.785   1.00 55.62  ? 373  GLN A CD    1 
ATOM   2989 O  OE1   . GLN A 1 376 ? 20.014 5.411   9.729   1.00 64.59  ? 373  GLN A OE1   1 
ATOM   2990 N  NE2   . GLN A 1 376 ? 22.231 5.622   10.069  1.00 52.88  ? 373  GLN A NE2   1 
ATOM   2991 N  N     . GLY A 1 377 ? 22.406 0.079   8.984   1.00 51.85  ? 374  GLY A N     1 
ATOM   2992 C  CA    . GLY A 1 377 ? 22.115 -1.166  9.669   1.00 58.77  ? 374  GLY A CA    1 
ATOM   2993 C  C     . GLY A 1 377 ? 22.833 -2.380  9.105   1.00 71.79  ? 374  GLY A C     1 
ATOM   2994 O  O     . GLY A 1 377 ? 23.085 -3.347  9.830   1.00 68.19  ? 374  GLY A O     1 
ATOM   2995 N  N     . ASP A 1 378 ? 23.162 -2.340  7.816   1.00 58.91  ? 375  ASP A N     1 
ATOM   2996 C  CA    . ASP A 1 378 ? 23.838 -3.462  7.180   1.00 52.21  ? 375  ASP A CA    1 
ATOM   2997 C  C     . ASP A 1 378 ? 25.219 -3.671  7.789   1.00 63.01  ? 375  ASP A C     1 
ATOM   2998 O  O     . ASP A 1 378 ? 26.017 -2.738  7.891   1.00 61.07  ? 375  ASP A O     1 
ATOM   2999 C  CB    . ASP A 1 378 ? 23.952 -3.251  5.666   1.00 53.68  ? 375  ASP A CB    1 
ATOM   3000 C  CG    . ASP A 1 378 ? 24.370 -4.519  4.925   1.00 58.19  ? 375  ASP A CG    1 
ATOM   3001 O  OD1   . ASP A 1 378 ? 25.187 -5.310  5.456   1.00 49.19  ? 375  ASP A OD1   1 
ATOM   3002 O  OD2   . ASP A 1 378 ? 23.872 -4.727  3.801   1.00 57.07  ? 375  ASP A OD2   1 
ATOM   3003 N  N     . LYS A 1 379 ? 25.486 -4.908  8.191   1.00 67.31  ? 376  LYS A N     1 
ATOM   3004 C  CA    . LYS A 1 379 ? 26.759 -5.267  8.795   1.00 77.30  ? 376  LYS A CA    1 
ATOM   3005 C  C     . LYS A 1 379 ? 27.916 -5.033  7.833   1.00 74.90  ? 376  LYS A C     1 
ATOM   3006 O  O     . LYS A 1 379 ? 29.003 -4.608  8.235   1.00 76.64  ? 376  LYS A O     1 
ATOM   3007 C  CB    . LYS A 1 379 ? 26.739 -6.733  9.238   1.00 84.42  ? 376  LYS A CB    1 
ATOM   3008 C  CG    . LYS A 1 379 ? 28.009 -7.188  9.942   1.00 87.18  ? 376  LYS A CG    1 
ATOM   3009 C  CD    . LYS A 1 379 ? 28.208 -6.427  11.245  1.00 90.40  ? 376  LYS A CD    1 
ATOM   3010 C  CE    . LYS A 1 379 ? 29.421 -6.930  12.014  1.00 90.16  ? 376  LYS A CE    1 
ATOM   3011 N  NZ    . LYS A 1 379 ? 29.566 -6.224  13.321  1.00 78.87  ? 376  LYS A NZ    1 
ATOM   3012 N  N     . ARG A 1 380 ? 27.664 -5.304  6.557   1.00 57.94  ? 377  ARG A N     1 
ATOM   3013 C  CA    . ARG A 1 380 ? 28.712 -5.320  5.542   1.00 66.25  ? 377  ARG A CA    1 
ATOM   3014 C  C     . ARG A 1 380 ? 29.189 -3.930  5.140   1.00 67.96  ? 377  ARG A C     1 
ATOM   3015 O  O     . ARG A 1 380 ? 28.493 -2.933  5.349   1.00 67.38  ? 377  ARG A O     1 
ATOM   3016 C  CB    . ARG A 1 380 ? 28.216 -6.071  4.307   1.00 60.92  ? 377  ARG A CB    1 
ATOM   3017 C  CG    . ARG A 1 380 ? 27.646 -7.437  4.624   1.00 62.63  ? 377  ARG A CG    1 
ATOM   3018 C  CD    . ARG A 1 380 ? 26.947 -8.023  3.422   1.00 61.27  ? 377  ARG A CD    1 
ATOM   3019 N  NE    . ARG A 1 380 ? 25.727 -7.298  3.082   1.00 42.65  ? 377  ARG A NE    1 
ATOM   3020 C  CZ    . ARG A 1 380 ? 24.965 -7.603  2.038   1.00 48.29  ? 377  ARG A CZ    1 
ATOM   3021 N  NH1   . ARG A 1 380 ? 25.311 -8.612  1.252   1.00 50.60  ? 377  ARG A NH1   1 
ATOM   3022 N  NH2   . ARG A 1 380 ? 23.864 -6.909  1.782   1.00 46.55  ? 377  ARG A NH2   1 
ATOM   3023 N  N     . LEU A 1 381 ? 30.382 -3.872  4.557   1.00 63.45  ? 378  LEU A N     1 
ATOM   3024 C  CA    . LEU A 1 381 ? 30.929 -2.613  4.077   1.00 59.15  ? 378  LEU A CA    1 
ATOM   3025 C  C     . LEU A 1 381 ? 30.186 -2.140  2.827   1.00 58.90  ? 378  LEU A C     1 
ATOM   3026 O  O     . LEU A 1 381 ? 29.935 -0.946  2.660   1.00 56.79  ? 378  LEU A O     1 
ATOM   3027 C  CB    . LEU A 1 381 ? 32.429 -2.751  3.802   1.00 62.10  ? 378  LEU A CB    1 
ATOM   3028 C  CG    . LEU A 1 381 ? 33.343 -2.322  4.960   1.00 71.37  ? 378  LEU A CG    1 
ATOM   3029 C  CD1   . LEU A 1 381 ? 33.030 -3.091  6.241   1.00 68.82  ? 378  LEU A CD1   1 
ATOM   3030 C  CD2   . LEU A 1 381 ? 34.816 -2.463  4.593   1.00 68.50  ? 378  LEU A CD2   1 
ATOM   3031 N  N     . SER A 1 382 ? 29.832 -3.078  1.955   1.00 57.49  ? 379  SER A N     1 
ATOM   3032 C  CA    . SER A 1 382 ? 29.001 -2.766  0.797   1.00 47.01  ? 379  SER A CA    1 
ATOM   3033 C  C     . SER A 1 382 ? 27.705 -3.545  0.848   1.00 47.91  ? 379  SER A C     1 
ATOM   3034 O  O     . SER A 1 382 ? 27.711 -4.755  1.072   1.00 50.30  ? 379  SER A O     1 
ATOM   3035 C  CB    . SER A 1 382 ? 29.727 -3.072  -0.514  1.00 40.91  ? 379  SER A CB    1 
ATOM   3036 O  OG    . SER A 1 382 ? 28.812 -3.046  -1.601  1.00 41.14  ? 379  SER A OG    1 
ATOM   3037 N  N     . SER A 1 383 ? 26.594 -2.852  0.629   1.00 49.85  ? 380  SER A N     1 
ATOM   3038 C  CA    . SER A 1 383 ? 25.288 -3.493  0.639   1.00 40.07  ? 380  SER A CA    1 
ATOM   3039 C  C     . SER A 1 383 ? 24.864 -3.886  -0.764  1.00 54.83  ? 380  SER A C     1 
ATOM   3040 O  O     . SER A 1 383 ? 24.168 -4.886  -0.954  1.00 42.07  ? 380  SER A O     1 
ATOM   3041 C  CB    . SER A 1 383 ? 24.233 -2.569  1.257   1.00 50.49  ? 380  SER A CB    1 
ATOM   3042 O  OG    . SER A 1 383 ? 24.533 -2.274  2.611   1.00 50.79  ? 380  SER A OG    1 
ATOM   3043 N  N     . LEU A 1 384 ? 25.290 -3.095  -1.744  1.00 51.19  ? 381  LEU A N     1 
ATOM   3044 C  CA    . LEU A 1 384 ? 24.832 -3.263  -3.118  1.00 40.91  ? 381  LEU A CA    1 
ATOM   3045 C  C     . LEU A 1 384 ? 25.808 -2.666  -4.126  1.00 46.03  ? 381  LEU A C     1 
ATOM   3046 O  O     . LEU A 1 384 ? 26.344 -1.579  -3.921  1.00 29.21  ? 381  LEU A O     1 
ATOM   3047 C  CB    . LEU A 1 384 ? 23.452 -2.627  -3.290  1.00 41.79  ? 381  LEU A CB    1 
ATOM   3048 C  CG    . LEU A 1 384 ? 22.841 -2.622  -4.692  1.00 35.45  ? 381  LEU A CG    1 
ATOM   3049 C  CD1   . LEU A 1 384 ? 21.442 -3.210  -4.658  1.00 48.80  ? 381  LEU A CD1   1 
ATOM   3050 C  CD2   . LEU A 1 384 ? 22.810 -1.217  -5.258  1.00 42.12  ? 381  LEU A CD2   1 
ATOM   3051 N  N     . ARG A 1 385 ? 26.019 -3.384  -5.223  1.00 31.63  ? 382  ARG A N     1 
ATOM   3052 C  CA    . ARG A 1 385 ? 26.959 -2.967  -6.249  1.00 31.36  ? 382  ARG A CA    1 
ATOM   3053 C  C     . ARG A 1 385 ? 26.360 -3.204  -7.631  1.00 37.52  ? 382  ARG A C     1 
ATOM   3054 O  O     . ARG A 1 385 ? 26.114 -4.345  -8.024  1.00 40.93  ? 382  ARG A O     1 
ATOM   3055 C  CB    . ARG A 1 385 ? 28.276 -3.728  -6.102  1.00 38.00  ? 382  ARG A CB    1 
ATOM   3056 C  CG    . ARG A 1 385 ? 29.500 -2.950  -6.542  1.00 35.58  ? 382  ARG A CG    1 
ATOM   3057 C  CD    . ARG A 1 385 ? 30.489 -3.847  -7.269  1.00 54.81  ? 382  ARG A CD    1 
ATOM   3058 N  NE    . ARG A 1 385 ? 29.930 -4.339  -8.527  1.00 50.30  ? 382  ARG A NE    1 
ATOM   3059 C  CZ    . ARG A 1 385 ? 30.633 -4.962  -9.469  1.00 50.95  ? 382  ARG A CZ    1 
ATOM   3060 N  NH1   . ARG A 1 385 ? 30.031 -5.371  -10.580 1.00 55.59  ? 382  ARG A NH1   1 
ATOM   3061 N  NH2   . ARG A 1 385 ? 31.934 -5.170  -9.306  1.00 50.72  ? 382  ARG A NH2   1 
ATOM   3062 N  N     . ARG A 1 386 ? 26.109 -2.123  -8.358  1.00 28.04  ? 383  ARG A N     1 
ATOM   3063 C  CA    . ARG A 1 386 ? 25.518 -2.215  -9.687  1.00 31.41  ? 383  ARG A CA    1 
ATOM   3064 C  C     . ARG A 1 386 ? 26.372 -1.446  -10.690 1.00 30.52  ? 383  ARG A C     1 
ATOM   3065 O  O     . ARG A 1 386 ? 26.978 -0.427  -10.350 1.00 26.36  ? 383  ARG A O     1 
ATOM   3066 C  CB    . ARG A 1 386 ? 24.090 -1.675  -9.676  1.00 32.74  ? 383  ARG A CB    1 
ATOM   3067 C  CG    . ARG A 1 386 ? 23.141 -2.424  -8.757  1.00 32.86  ? 383  ARG A CG    1 
ATOM   3068 C  CD    . ARG A 1 386 ? 22.680 -3.727  -9.384  1.00 30.48  ? 383  ARG A CD    1 
ATOM   3069 N  NE    . ARG A 1 386 ? 21.444 -4.220  -8.781  1.00 31.71  ? 383  ARG A NE    1 
ATOM   3070 C  CZ    . ARG A 1 386 ? 21.393 -5.104  -7.790  1.00 46.28  ? 383  ARG A CZ    1 
ATOM   3071 N  NH1   . ARG A 1 386 ? 22.518 -5.599  -7.277  1.00 40.34  ? 383  ARG A NH1   1 
ATOM   3072 N  NH2   . ARG A 1 386 ? 20.215 -5.496  -7.314  1.00 49.26  ? 383  ARG A NH2   1 
ATOM   3073 N  N     A CYS A 1 387 ? 26.425 -1.939  -11.922 0.68 35.23  ? 384  CYS A N     1 
ATOM   3074 N  N     B CYS A 1 387 ? 26.426 -1.939  -11.922 0.32 35.21  ? 384  CYS A N     1 
ATOM   3075 C  CA    . CYS A 1 387 ? 27.244 -1.308  -12.953 1.00 34.88  ? 384  CYS A CA    1 
ATOM   3076 C  C     . CYS A 1 387 ? 26.390 -0.715  -14.062 1.00 34.87  ? 384  CYS A C     1 
ATOM   3077 O  O     . CYS A 1 387 ? 25.258 -1.131  -14.280 1.00 34.17  ? 384  CYS A O     1 
ATOM   3078 C  CB    . CYS A 1 387 ? 28.241 -2.319  -13.549 1.00 40.11  ? 384  CYS A CB    1 
ATOM   3079 S  SG    A CYS A 1 387 ? 27.512 -3.679  -14.513 0.68 41.43  ? 384  CYS A SG    1 
ATOM   3080 S  SG    B CYS A 1 387 ? 29.167 -3.258  -12.324 0.32 39.75  ? 384  CYS A SG    1 
ATOM   3081 N  N     . CYS A 1 388 ? 26.942 0.262   -14.764 1.00 35.80  ? 385  CYS A N     1 
ATOM   3082 C  CA    . CYS A 1 388 ? 26.315 0.760   -15.977 1.00 44.29  ? 385  CYS A CA    1 
ATOM   3083 C  C     . CYS A 1 388 ? 27.409 1.248   -16.906 1.00 36.40  ? 385  CYS A C     1 
ATOM   3084 O  O     . CYS A 1 388 ? 28.566 1.342   -16.503 1.00 32.14  ? 385  CYS A O     1 
ATOM   3085 C  CB    . CYS A 1 388 ? 25.312 1.875   -15.671 1.00 36.24  ? 385  CYS A CB    1 
ATOM   3086 S  SG    . CYS A 1 388 ? 26.061 3.375   -15.025 1.00 35.08  ? 385  CYS A SG    1 
ATOM   3087 N  N     . ALA A 1 389 ? 27.045 1.551   -18.146 1.00 33.18  ? 386  ALA A N     1 
ATOM   3088 C  CA    . ALA A 1 389 ? 28.013 2.024   -19.129 1.00 31.48  ? 386  ALA A CA    1 
ATOM   3089 C  C     . ALA A 1 389 ? 28.584 3.371   -18.732 1.00 30.71  ? 386  ALA A C     1 
ATOM   3090 O  O     . ALA A 1 389 ? 27.878 4.220   -18.188 1.00 33.45  ? 386  ALA A O     1 
ATOM   3091 C  CB    . ALA A 1 389 ? 27.372 2.117   -20.509 1.00 29.38  ? 386  ALA A CB    1 
ATOM   3092 N  N     . LEU A 1 390 ? 29.867 3.560   -19.008 1.00 25.21  ? 387  LEU A N     1 
ATOM   3093 C  CA    . LEU A 1 390 ? 30.507 4.862   -18.874 1.00 23.63  ? 387  LEU A CA    1 
ATOM   3094 C  C     . LEU A 1 390 ? 30.963 5.301   -20.262 1.00 26.73  ? 387  LEU A C     1 
ATOM   3095 O  O     . LEU A 1 390 ? 32.020 4.891   -20.737 1.00 31.70  ? 387  LEU A O     1 
ATOM   3096 C  CB    . LEU A 1 390 ? 31.692 4.792   -17.904 1.00 30.11  ? 387  LEU A CB    1 
ATOM   3097 C  CG    . LEU A 1 390 ? 32.121 6.016   -17.087 1.00 28.91  ? 387  LEU A CG    1 
ATOM   3098 C  CD1   . LEU A 1 390 ? 33.356 5.661   -16.258 1.00 23.42  ? 387  LEU A CD1   1 
ATOM   3099 C  CD2   . LEU A 1 390 ? 32.398 7.241   -17.939 1.00 27.02  ? 387  LEU A CD2   1 
ATOM   3100 N  N     . THR A 1 391 ? 30.161 6.129   -20.918 1.00 27.74  ? 388  THR A N     1 
ATOM   3101 C  CA    . THR A 1 391 ? 30.406 6.470   -22.317 1.00 32.97  ? 388  THR A CA    1 
ATOM   3102 C  C     . THR A 1 391 ? 30.969 7.870   -22.501 1.00 33.04  ? 388  THR A C     1 
ATOM   3103 O  O     . THR A 1 391 ? 31.551 8.178   -23.539 1.00 30.60  ? 388  THR A O     1 
ATOM   3104 C  CB    . THR A 1 391 ? 29.115 6.361   -23.141 1.00 43.75  ? 388  THR A CB    1 
ATOM   3105 O  OG1   . THR A 1 391 ? 28.181 7.347   -22.682 1.00 38.82  ? 388  THR A OG1   1 
ATOM   3106 C  CG2   . THR A 1 391 ? 28.502 4.974   -22.991 1.00 33.80  ? 388  THR A CG2   1 
ATOM   3107 N  N     . ARG A 1 392 ? 30.774 8.725   -21.502 1.00 31.04  ? 389  ARG A N     1 
ATOM   3108 C  CA    . ARG A 1 392 ? 31.312 10.079  -21.543 1.00 28.26  ? 389  ARG A CA    1 
ATOM   3109 C  C     . ARG A 1 392 ? 31.813 10.518  -20.177 1.00 25.47  ? 389  ARG A C     1 
ATOM   3110 O  O     . ARG A 1 392 ? 31.187 10.244  -19.148 1.00 28.90  ? 389  ARG A O     1 
ATOM   3111 C  CB    . ARG A 1 392 ? 30.261 11.077  -22.045 1.00 36.76  ? 389  ARG A CB    1 
ATOM   3112 C  CG    . ARG A 1 392 ? 29.878 10.908  -23.507 1.00 46.30  ? 389  ARG A CG    1 
ATOM   3113 C  CD    . ARG A 1 392 ? 29.150 12.128  -24.046 1.00 54.96  ? 389  ARG A CD    1 
ATOM   3114 N  NE    . ARG A 1 392 ? 28.336 12.786  -23.028 1.00 69.50  ? 389  ARG A NE    1 
ATOM   3115 C  CZ    . ARG A 1 392 ? 28.548 14.023  -22.588 1.00 68.75  ? 389  ARG A CZ    1 
ATOM   3116 N  NH1   . ARG A 1 392 ? 27.757 14.543  -21.657 1.00 67.57  ? 389  ARG A NH1   1 
ATOM   3117 N  NH2   . ARG A 1 392 ? 29.546 14.742  -23.083 1.00 64.13  ? 389  ARG A NH2   1 
ATOM   3118 N  N     . TYR A 1 393 ? 32.941 11.212  -20.186 1.00 27.01  ? 390  TYR A N     1 
ATOM   3119 C  CA    . TYR A 1 393 ? 33.501 11.806  -18.982 1.00 22.73  ? 390  TYR A CA    1 
ATOM   3120 C  C     . TYR A 1 393 ? 32.725 13.069  -18.639 1.00 30.83  ? 390  TYR A C     1 
ATOM   3121 O  O     . TYR A 1 393 ? 33.194 14.182  -18.869 1.00 28.55  ? 390  TYR A O     1 
ATOM   3122 C  CB    . TYR A 1 393 ? 34.986 12.113  -19.176 1.00 23.26  ? 390  TYR A CB    1 
ATOM   3123 C  CG    . TYR A 1 393 ? 35.875 10.882  -19.123 1.00 22.53  ? 390  TYR A CG    1 
ATOM   3124 C  CD1   . TYR A 1 393 ? 37.258 10.999  -19.130 1.00 20.29  ? 390  TYR A CD1   1 
ATOM   3125 C  CD2   . TYR A 1 393 ? 35.327 9.610   -19.052 1.00 28.04  ? 390  TYR A CD2   1 
ATOM   3126 C  CE1   . TYR A 1 393 ? 38.066 9.878   -19.074 1.00 21.18  ? 390  TYR A CE1   1 
ATOM   3127 C  CE2   . TYR A 1 393 ? 36.126 8.489   -18.992 1.00 26.95  ? 390  TYR A CE2   1 
ATOM   3128 C  CZ    . TYR A 1 393 ? 37.490 8.624   -19.004 1.00 26.42  ? 390  TYR A CZ    1 
ATOM   3129 O  OH    . TYR A 1 393 ? 38.271 7.491   -18.943 1.00 24.80  ? 390  TYR A OH    1 
ATOM   3130 N  N     . ASP A 1 394 ? 31.522 12.883  -18.110 1.00 28.06  ? 391  ASP A N     1 
ATOM   3131 C  CA    . ASP A 1 394 ? 30.676 14.004  -17.740 1.00 29.75  ? 391  ASP A CA    1 
ATOM   3132 C  C     . ASP A 1 394 ? 30.046 13.742  -16.393 1.00 22.00  ? 391  ASP A C     1 
ATOM   3133 O  O     . ASP A 1 394 ? 29.273 12.788  -16.239 1.00 26.00  ? 391  ASP A O     1 
ATOM   3134 C  CB    . ASP A 1 394 ? 29.597 14.247  -18.794 1.00 37.94  ? 391  ASP A CB    1 
ATOM   3135 C  CG    . ASP A 1 394 ? 28.760 15.469  -18.483 1.00 36.95  ? 391  ASP A CG    1 
ATOM   3136 O  OD1   . ASP A 1 394 ? 27.790 15.334  -17.711 1.00 30.84  ? 391  ASP A OD1   1 
ATOM   3137 O  OD2   . ASP A 1 394 ? 29.093 16.565  -18.986 1.00 56.49  ? 391  ASP A OD2   1 
ATOM   3138 N  N     . ALA A 1 395 ? 30.382 14.578  -15.415 1.00 22.88  ? 392  ALA A N     1 
ATOM   3139 C  CA    . ALA A 1 395 ? 29.953 14.342  -14.035 1.00 23.66  ? 392  ALA A CA    1 
ATOM   3140 C  C     . ALA A 1 395 ? 28.434 14.315  -13.873 1.00 25.41  ? 392  ALA A C     1 
ATOM   3141 O  O     . ALA A 1 395 ? 27.899 13.487  -13.131 1.00 24.22  ? 392  ALA A O     1 
ATOM   3142 C  CB    . ALA A 1 395 ? 30.559 15.388  -13.110 1.00 20.06  ? 392  ALA A CB    1 
ATOM   3143 N  N     . HIS A 1 396 ? 27.736 15.217  -14.556 1.00 32.86  ? 393  HIS A N     1 
ATOM   3144 C  CA    . HIS A 1 396 ? 26.280 15.271  -14.427 1.00 34.27  ? 393  HIS A CA    1 
ATOM   3145 C  C     . HIS A 1 396 ? 25.629 14.013  -14.971 1.00 24.57  ? 393  HIS A C     1 
ATOM   3146 O  O     . HIS A 1 396 ? 24.729 13.453  -14.337 1.00 25.10  ? 393  HIS A O     1 
ATOM   3147 C  CB    . HIS A 1 396 ? 25.713 16.510  -15.124 1.00 28.82  ? 393  HIS A CB    1 
ATOM   3148 C  CG    . HIS A 1 396 ? 25.867 17.767  -14.322 1.00 37.48  ? 393  HIS A CG    1 
ATOM   3149 N  ND1   . HIS A 1 396 ? 26.846 18.703  -14.579 1.00 40.67  ? 393  HIS A ND1   1 
ATOM   3150 C  CD2   . HIS A 1 396 ? 25.182 18.227  -13.247 1.00 45.53  ? 393  HIS A CD2   1 
ATOM   3151 C  CE1   . HIS A 1 396 ? 26.750 19.693  -13.709 1.00 35.42  ? 393  HIS A CE1   1 
ATOM   3152 N  NE2   . HIS A 1 396 ? 25.748 19.428  -12.889 1.00 56.10  ? 393  HIS A NE2   1 
ATOM   3153 N  N     . LYS A 1 397 ? 26.088 13.563  -16.137 1.00 24.61  ? 394  LYS A N     1 
ATOM   3154 C  CA    . LYS A 1 397 ? 25.635 12.280  -16.683 1.00 30.43  ? 394  LYS A CA    1 
ATOM   3155 C  C     . LYS A 1 397 ? 25.992 11.088  -15.795 1.00 30.19  ? 394  LYS A C     1 
ATOM   3156 O  O     . LYS A 1 397 ? 25.186 10.168  -15.625 1.00 28.81  ? 394  LYS A O     1 
ATOM   3157 C  CB    . LYS A 1 397 ? 26.213 12.042  -18.078 1.00 26.11  ? 394  LYS A CB    1 
ATOM   3158 C  CG    . LYS A 1 397 ? 25.886 10.643  -18.619 1.00 36.43  ? 394  LYS A CG    1 
ATOM   3159 C  CD    . LYS A 1 397 ? 26.245 10.477  -20.090 1.00 39.95  ? 394  LYS A CD    1 
ATOM   3160 C  CE    . LYS A 1 397 ? 25.980 9.047   -20.570 1.00 41.43  ? 394  LYS A CE    1 
ATOM   3161 N  NZ    . LYS A 1 397 ? 24.595 8.549   -20.274 1.00 47.18  ? 394  LYS A NZ    1 
ATOM   3162 N  N     . MET A 1 398 ? 27.202 11.087  -15.240 1.00 24.40  ? 395  MET A N     1 
ATOM   3163 C  CA    . MET A 1 398 ? 27.616 9.952   -14.428 1.00 25.14  ? 395  MET A CA    1 
ATOM   3164 C  C     . MET A 1 398 ? 26.776 9.864   -13.146 1.00 23.87  ? 395  MET A C     1 
ATOM   3165 O  O     . MET A 1 398 ? 26.372 8.774   -12.738 1.00 25.97  ? 395  MET A O     1 
ATOM   3166 C  CB    . MET A 1 398 ? 29.117 10.028  -14.109 1.00 22.31  ? 395  MET A CB    1 
ATOM   3167 C  CG    . MET A 1 398 ? 30.005 9.600   -15.281 1.00 21.76  ? 395  MET A CG    1 
ATOM   3168 S  SD    . MET A 1 398 ? 31.730 9.342   -14.817 1.00 31.17  ? 395  MET A SD    1 
ATOM   3169 C  CE    . MET A 1 398 ? 32.278 11.020  -14.567 1.00 23.70  ? 395  MET A CE    1 
ATOM   3170 N  N     . SER A 1 399 ? 26.496 11.006  -12.524 1.00 27.70  ? 396  SER A N     1 
ATOM   3171 C  CA    . SER A 1 399 ? 25.691 11.016  -11.304 1.00 24.50  ? 396  SER A CA    1 
ATOM   3172 C  C     . SER A 1 399 ? 24.227 10.675  -11.598 1.00 28.64  ? 396  SER A C     1 
ATOM   3173 O  O     . SER A 1 399 ? 23.575 9.971   -10.824 1.00 24.62  ? 396  SER A O     1 
ATOM   3174 C  CB    . SER A 1 399 ? 25.785 12.373  -10.601 1.00 28.26  ? 396  SER A CB    1 
ATOM   3175 O  OG    . SER A 1 399 ? 25.471 13.433  -11.487 1.00 32.43  ? 396  SER A OG    1 
ATOM   3176 N  N     . HIS A 1 400 ? 23.712 11.166  -12.718 1.00 29.09  ? 397  HIS A N     1 
ATOM   3177 C  CA    . HIS A 1 400 ? 22.347 10.806  -13.107 1.00 35.80  ? 397  HIS A CA    1 
ATOM   3178 C  C     . HIS A 1 400 ? 22.230 9.287   -13.324 1.00 30.70  ? 397  HIS A C     1 
ATOM   3179 O  O     . HIS A 1 400 ? 21.307 8.646   -12.809 1.00 25.37  ? 397  HIS A O     1 
ATOM   3180 C  CB    . HIS A 1 400 ? 21.923 11.573  -14.363 1.00 35.03  ? 397  HIS A CB    1 
ATOM   3181 C  CG    . HIS A 1 400 ? 20.486 11.372  -14.730 1.00 52.66  ? 397  HIS A CG    1 
ATOM   3182 N  ND1   . HIS A 1 400 ? 20.082 10.478  -15.699 1.00 52.97  ? 397  HIS A ND1   1 
ATOM   3183 C  CD2   . HIS A 1 400 ? 19.354 11.938  -14.246 1.00 44.91  ? 397  HIS A CD2   1 
ATOM   3184 C  CE1   . HIS A 1 400 ? 18.765 10.507  -15.801 1.00 45.61  ? 397  HIS A CE1   1 
ATOM   3185 N  NE2   . HIS A 1 400 ? 18.300 11.383  -14.929 1.00 55.89  ? 397  HIS A NE2   1 
ATOM   3186 N  N     . ASP A 1 401 ? 23.187 8.712   -14.052 1.00 33.56  ? 398  ASP A N     1 
ATOM   3187 C  CA    . ASP A 1 401 ? 23.207 7.268   -14.297 1.00 24.98  ? 398  ASP A CA    1 
ATOM   3188 C  C     . ASP A 1 401 ? 23.323 6.466   -13.015 1.00 34.49  ? 398  ASP A C     1 
ATOM   3189 O  O     . ASP A 1 401 ? 22.676 5.427   -12.869 1.00 28.63  ? 398  ASP A O     1 
ATOM   3190 C  CB    . ASP A 1 401 ? 24.356 6.885   -15.228 1.00 26.03  ? 398  ASP A CB    1 
ATOM   3191 C  CG    . ASP A 1 401 ? 24.167 7.417   -16.633 1.00 42.32  ? 398  ASP A CG    1 
ATOM   3192 O  OD1   . ASP A 1 401 ? 23.011 7.728   -16.994 1.00 36.47  ? 398  ASP A OD1   1 
ATOM   3193 O  OD2   . ASP A 1 401 ? 25.166 7.520   -17.376 1.00 39.44  ? 398  ASP A OD2   1 
ATOM   3194 N  N     . ALA A 1 402 ? 24.156 6.940   -12.091 1.00 29.50  ? 399  ALA A N     1 
ATOM   3195 C  CA    . ALA A 1 402 ? 24.344 6.251   -10.823 1.00 25.80  ? 399  ALA A CA    1 
ATOM   3196 C  C     . ALA A 1 402 ? 23.049 6.247   -10.033 1.00 23.46  ? 399  ALA A C     1 
ATOM   3197 O  O     . ALA A 1 402 ? 22.717 5.271   -9.361  1.00 29.05  ? 399  ALA A O     1 
ATOM   3198 C  CB    . ALA A 1 402 ? 25.458 6.909   -10.014 1.00 26.84  ? 399  ALA A CB    1 
ATOM   3199 N  N     . PHE A 1 403 ? 22.321 7.353   -10.107 1.00 26.05  ? 400  PHE A N     1 
ATOM   3200 C  CA    . PHE A 1 403 ? 21.053 7.449   -9.397  1.00 32.54  ? 400  PHE A CA    1 
ATOM   3201 C  C     . PHE A 1 403 ? 20.057 6.450   -9.969  1.00 31.39  ? 400  PHE A C     1 
ATOM   3202 O  O     . PHE A 1 403 ? 19.365 5.750   -9.231  1.00 37.43  ? 400  PHE A O     1 
ATOM   3203 C  CB    . PHE A 1 403 ? 20.485 8.864   -9.475  1.00 35.55  ? 400  PHE A CB    1 
ATOM   3204 C  CG    . PHE A 1 403 ? 19.202 9.037   -8.716  1.00 44.62  ? 400  PHE A CG    1 
ATOM   3205 C  CD1   . PHE A 1 403 ? 17.999 9.213   -9.386  1.00 45.29  ? 400  PHE A CD1   1 
ATOM   3206 C  CD2   . PHE A 1 403 ? 19.194 8.997   -7.330  1.00 37.72  ? 400  PHE A CD2   1 
ATOM   3207 C  CE1   . PHE A 1 403 ? 16.811 9.361   -8.685  1.00 52.54  ? 400  PHE A CE1   1 
ATOM   3208 C  CE2   . PHE A 1 403 ? 18.014 9.145   -6.622  1.00 51.02  ? 400  PHE A CE2   1 
ATOM   3209 C  CZ    . PHE A 1 403 ? 16.820 9.326   -7.300  1.00 54.55  ? 400  PHE A CZ    1 
ATOM   3210 N  N     . THR A 1 404 ? 20.003 6.383   -11.291 1.00 33.51  ? 401  THR A N     1 
ATOM   3211 C  CA    . THR A 1 404 ? 19.120 5.442   -11.962 1.00 38.65  ? 401  THR A CA    1 
ATOM   3212 C  C     . THR A 1 404 ? 19.346 4.000   -11.495 1.00 31.72  ? 401  THR A C     1 
ATOM   3213 O  O     . THR A 1 404 ? 18.389 3.276   -11.219 1.00 36.31  ? 401  THR A O     1 
ATOM   3214 C  CB    . THR A 1 404 ? 19.291 5.522   -13.492 1.00 30.44  ? 401  THR A CB    1 
ATOM   3215 O  OG1   . THR A 1 404 ? 19.022 6.859   -13.928 1.00 31.54  ? 401  THR A OG1   1 
ATOM   3216 C  CG2   . THR A 1 404 ? 18.336 4.563   -14.189 1.00 42.33  ? 401  THR A CG2   1 
ATOM   3217 N  N     . VAL A 1 405 ? 20.600 3.577   -11.370 1.00 30.92  ? 402  VAL A N     1 
ATOM   3218 C  CA    . VAL A 1 405 ? 20.845 2.174   -11.072 1.00 26.57  ? 402  VAL A CA    1 
ATOM   3219 C  C     . VAL A 1 405 ? 20.603 1.844   -9.599  1.00 35.89  ? 402  VAL A C     1 
ATOM   3220 O  O     . VAL A 1 405 ? 20.473 0.672   -9.246  1.00 35.07  ? 402  VAL A O     1 
ATOM   3221 C  CB    . VAL A 1 405 ? 22.273 1.745   -11.467 1.00 42.81  ? 402  VAL A CB    1 
ATOM   3222 C  CG1   . VAL A 1 405 ? 22.583 2.211   -12.875 1.00 41.63  ? 402  VAL A CG1   1 
ATOM   3223 C  CG2   . VAL A 1 405 ? 23.289 2.286   -10.494 1.00 40.80  ? 402  VAL A CG2   1 
ATOM   3224 N  N     . ILE A 1 406 ? 20.520 2.865   -8.745  1.00 29.75  ? 403  ILE A N     1 
ATOM   3225 C  CA    . ILE A 1 406 ? 20.295 2.635   -7.316  1.00 40.18  ? 403  ILE A CA    1 
ATOM   3226 C  C     . ILE A 1 406 ? 18.926 3.095   -6.800  1.00 39.54  ? 403  ILE A C     1 
ATOM   3227 O  O     . ILE A 1 406 ? 18.530 2.730   -5.692  1.00 38.00  ? 403  ILE A O     1 
ATOM   3228 C  CB    . ILE A 1 406 ? 21.358 3.347   -6.445  1.00 39.51  ? 403  ILE A CB    1 
ATOM   3229 C  CG1   . ILE A 1 406 ? 21.175 4.867   -6.517  1.00 37.95  ? 403  ILE A CG1   1 
ATOM   3230 C  CG2   . ILE A 1 406 ? 22.753 2.923   -6.847  1.00 36.84  ? 403  ILE A CG2   1 
ATOM   3231 C  CD1   . ILE A 1 406 ? 21.750 5.614   -5.329  1.00 35.73  ? 403  ILE A CD1   1 
ATOM   3232 N  N     . LYS A 1 407 ? 18.211 3.890   -7.590  1.00 39.23  ? 404  LYS A N     1 
ATOM   3233 C  CA    . LYS A 1 407 ? 17.020 4.585   -7.092  1.00 46.62  ? 404  LYS A CA    1 
ATOM   3234 C  C     . LYS A 1 407 ? 15.919 3.637   -6.615  1.00 51.61  ? 404  LYS A C     1 
ATOM   3235 O  O     . LYS A 1 407 ? 15.109 3.996   -5.754  1.00 48.08  ? 404  LYS A O     1 
ATOM   3236 C  CB    . LYS A 1 407 ? 16.464 5.529   -8.162  1.00 39.83  ? 404  LYS A CB    1 
ATOM   3237 C  CG    . LYS A 1 407 ? 15.989 4.844   -9.431  1.00 41.94  ? 404  LYS A CG    1 
ATOM   3238 C  CD    . LYS A 1 407 ? 15.529 5.872   -10.458 1.00 50.25  ? 404  LYS A CD    1 
ATOM   3239 C  CE    . LYS A 1 407 ? 14.848 5.208   -11.642 1.00 46.50  ? 404  LYS A CE    1 
ATOM   3240 N  NZ    . LYS A 1 407 ? 15.683 4.107   -12.207 1.00 57.27  ? 404  LYS A NZ    1 
ATOM   3241 N  N     . ASN A 1 408 ? 15.902 2.424   -7.151  1.00 48.82  ? 405  ASN A N     1 
ATOM   3242 C  CA    . ASN A 1 408 ? 14.918 1.440   -6.724  1.00 52.33  ? 405  ASN A CA    1 
ATOM   3243 C  C     . ASN A 1 408 ? 15.284 0.798   -5.389  1.00 56.61  ? 405  ASN A C     1 
ATOM   3244 O  O     . ASN A 1 408 ? 14.554 -0.052  -4.887  1.00 43.15  ? 405  ASN A O     1 
ATOM   3245 C  CB    . ASN A 1 408 ? 14.748 0.355   -7.788  1.00 50.55  ? 405  ASN A CB    1 
ATOM   3246 C  CG    . ASN A 1 408 ? 16.034 -0.406  -8.049  1.00 64.79  ? 405  ASN A CG    1 
ATOM   3247 O  OD1   . ASN A 1 408 ? 17.100 0.190   -8.226  1.00 50.95  ? 405  ASN A OD1   1 
ATOM   3248 N  ND2   . ASN A 1 408 ? 15.945 -1.730  -8.055  1.00 67.16  ? 405  ASN A ND2   1 
ATOM   3249 N  N     . CYS A 1 409 ? 16.416 1.194   -4.814  1.00 51.48  ? 406  CYS A N     1 
ATOM   3250 C  CA    . CYS A 1 409 ? 16.819 0.646   -3.523  1.00 48.91  ? 406  CYS A CA    1 
ATOM   3251 C  C     . CYS A 1 409 ? 16.030 1.303   -2.409  1.00 47.71  ? 406  CYS A C     1 
ATOM   3252 O  O     . CYS A 1 409 ? 15.981 0.801   -1.287  1.00 55.63  ? 406  CYS A O     1 
ATOM   3253 C  CB    . CYS A 1 409 ? 18.317 0.835   -3.281  1.00 52.91  ? 406  CYS A CB    1 
ATOM   3254 S  SG    . CYS A 1 409 ? 19.361 -0.207  -4.301  1.00 71.17  ? 406  CYS A SG    1 
ATOM   3255 N  N     . ASN A 1 410 ? 15.411 2.432   -2.736  1.00 39.84  ? 407  ASN A N     1 
ATOM   3256 C  CA    . ASN A 1 410 ? 14.649 3.209   -1.774  1.00 51.07  ? 407  ASN A CA    1 
ATOM   3257 C  C     . ASN A 1 410 ? 13.368 2.500   -1.301  1.00 55.23  ? 407  ASN A C     1 
ATOM   3258 O  O     . ASN A 1 410 ? 12.423 2.327   -2.068  1.00 50.21  ? 407  ASN A O     1 
ATOM   3259 C  CB    . ASN A 1 410 ? 14.312 4.569   -2.385  1.00 42.82  ? 407  ASN A CB    1 
ATOM   3260 C  CG    . ASN A 1 410 ? 13.790 5.540   -1.371  1.00 42.62  ? 407  ASN A CG    1 
ATOM   3261 O  OD1   . ASN A 1 410 ? 13.745 5.236   -0.178  1.00 50.35  ? 407  ASN A OD1   1 
ATOM   3262 N  ND2   . ASN A 1 410 ? 13.396 6.728   -1.829  1.00 48.77  ? 407  ASN A ND2   1 
ATOM   3263 N  N     . THR A 1 411 ? 13.355 2.097   -0.031  1.00 60.91  ? 408  THR A N     1 
ATOM   3264 C  CA    . THR A 1 411 ? 12.209 1.422   0.579   1.00 59.36  ? 408  THR A CA    1 
ATOM   3265 C  C     . THR A 1 411 ? 11.006 2.359   0.648   1.00 57.02  ? 408  THR A C     1 
ATOM   3266 O  O     . THR A 1 411 ? 9.858  1.921   0.590   1.00 64.80  ? 408  THR A O     1 
ATOM   3267 C  CB    . THR A 1 411 ? 12.557 0.903   2.008   1.00 56.46  ? 408  THR A CB    1 
ATOM   3268 O  OG1   . THR A 1 411 ? 13.499 -0.172  1.915   1.00 69.36  ? 408  THR A OG1   1 
ATOM   3269 C  CG2   . THR A 1 411 ? 11.321 0.410   2.750   1.00 74.22  ? 408  THR A CG2   1 
ATOM   3270 N  N     . SER A 1 412 ? 11.287 3.655   0.737   1.00 58.56  ? 409  SER A N     1 
ATOM   3271 C  CA    . SER A 1 412 ? 10.258 4.665   0.974   1.00 63.93  ? 409  SER A CA    1 
ATOM   3272 C  C     . SER A 1 412 ? 9.208  4.779   -0.125  1.00 69.20  ? 409  SER A C     1 
ATOM   3273 O  O     . SER A 1 412 ? 9.534  4.965   -1.300  1.00 69.30  ? 409  SER A O     1 
ATOM   3274 C  CB    . SER A 1 412 ? 10.908 6.032   1.173   1.00 59.13  ? 409  SER A CB    1 
ATOM   3275 O  OG    . SER A 1 412 ? 9.931  7.034   1.379   1.00 70.29  ? 409  SER A OG    1 
ATOM   3276 N  N     . GLY A 1 413 ? 7.944  4.678   0.277   1.00 72.60  ? 410  GLY A N     1 
ATOM   3277 C  CA    . GLY A 1 413 ? 6.832  4.989   -0.602  1.00 75.80  ? 410  GLY A CA    1 
ATOM   3278 C  C     . GLY A 1 413 ? 6.830  6.475   -0.902  1.00 75.39  ? 410  GLY A C     1 
ATOM   3279 O  O     . GLY A 1 413 ? 6.458  6.902   -1.994  1.00 66.75  ? 410  GLY A O     1 
ATOM   3280 N  N     . ILE A 1 414 ? 7.244  7.266   0.084   1.00 77.76  ? 411  ILE A N     1 
ATOM   3281 C  CA    . ILE A 1 414 ? 7.511  8.680   -0.140  1.00 78.22  ? 411  ILE A CA    1 
ATOM   3282 C  C     . ILE A 1 414 ? 8.813  8.799   -0.923  1.00 81.96  ? 411  ILE A C     1 
ATOM   3283 O  O     . ILE A 1 414 ? 9.896  8.587   -0.374  1.00 71.21  ? 411  ILE A O     1 
ATOM   3284 C  CB    . ILE A 1 414 ? 7.628  9.477   1.177   1.00 72.43  ? 411  ILE A CB    1 
ATOM   3285 C  CG1   . ILE A 1 414 ? 6.420  9.221   2.081   1.00 68.38  ? 411  ILE A CG1   1 
ATOM   3286 C  CG2   . ILE A 1 414 ? 7.787  10.965  0.885   1.00 60.16  ? 411  ILE A CG2   1 
ATOM   3287 C  CD1   . ILE A 1 414 ? 6.449  10.015  3.373   1.00 65.22  ? 411  ILE A CD1   1 
ATOM   3288 N  N     . GLN A 1 415 ? 8.700  9.130   -2.206  1.00 82.78  ? 412  GLN A N     1 
ATOM   3289 C  CA    . GLN A 1 415 ? 9.852  9.204   -3.102  1.00 76.70  ? 412  GLN A CA    1 
ATOM   3290 C  C     . GLN A 1 415 ? 10.904 10.226  -2.665  1.00 78.45  ? 412  GLN A C     1 
ATOM   3291 O  O     . GLN A 1 415 ? 12.105 9.994   -2.826  1.00 76.60  ? 412  GLN A O     1 
ATOM   3292 C  CB    . GLN A 1 415 ? 9.383  9.534   -4.517  1.00 76.17  ? 412  GLN A CB    1 
ATOM   3293 C  CG    . GLN A 1 415 ? 8.484  10.756  -4.578  1.00 81.62  ? 412  GLN A CG    1 
ATOM   3294 C  CD    . GLN A 1 415 ? 8.507  11.428  -5.931  1.00 96.25  ? 412  GLN A CD    1 
ATOM   3295 O  OE1   . GLN A 1 415 ? 8.353  10.776  -6.966  1.00 110.18 ? 412  GLN A OE1   1 
ATOM   3296 N  NE2   . GLN A 1 415 ? 8.710  12.743  -5.934  1.00 88.75  ? 412  GLN A NE2   1 
ATOM   3297 N  N     . THR A 1 416 ? 10.446 11.355  -2.127  1.00 71.19  ? 413  THR A N     1 
ATOM   3298 C  CA    . THR A 1 416 ? 11.333 12.432  -1.693  1.00 66.12  ? 413  THR A CA    1 
ATOM   3299 C  C     . THR A 1 416 ? 12.231 11.973  -0.547  1.00 62.08  ? 413  THR A C     1 
ATOM   3300 O  O     . THR A 1 416 ? 13.387 12.384  -0.442  1.00 60.95  ? 413  THR A O     1 
ATOM   3301 C  CB    . THR A 1 416 ? 10.525 13.673  -1.256  1.00 64.82  ? 413  THR A CB    1 
ATOM   3302 O  OG1   . THR A 1 416 ? 9.802  14.186  -2.380  1.00 74.73  ? 413  THR A OG1   1 
ATOM   3303 C  CG2   . THR A 1 416 ? 11.439 14.765  -0.724  1.00 67.55  ? 413  THR A CG2   1 
ATOM   3304 N  N     . GLU A 1 417 ? 11.693 11.109  0.304   1.00 61.63  ? 414  GLU A N     1 
ATOM   3305 C  CA    . GLU A 1 417 ? 12.472 10.541  1.391   1.00 61.02  ? 414  GLU A CA    1 
ATOM   3306 C  C     . GLU A 1 417 ? 13.266 9.340   0.904   1.00 61.28  ? 414  GLU A C     1 
ATOM   3307 O  O     . GLU A 1 417 ? 12.838 8.621   -0.000  1.00 59.01  ? 414  GLU A O     1 
ATOM   3308 C  CB    . GLU A 1 417 ? 11.564 10.140  2.556   1.00 56.03  ? 414  GLU A CB    1 
ATOM   3309 C  CG    . GLU A 1 417 ? 10.702 11.272  3.065   1.00 56.52  ? 414  GLU A CG    1 
ATOM   3310 C  CD    . GLU A 1 417 ? 11.454 12.585  3.132   1.00 59.36  ? 414  GLU A CD    1 
ATOM   3311 O  OE1   . GLU A 1 417 ? 12.264 12.766  4.067   1.00 64.12  ? 414  GLU A OE1   1 
ATOM   3312 O  OE2   . GLU A 1 417 ? 11.239 13.435  2.241   1.00 64.83  ? 414  GLU A OE2   1 
ATOM   3313 N  N     . TRP A 1 418 ? 14.432 9.131   1.504   1.00 45.87  ? 415  TRP A N     1 
ATOM   3314 C  CA    . TRP A 1 418 ? 15.219 7.952   1.205   1.00 46.18  ? 415  TRP A CA    1 
ATOM   3315 C  C     . TRP A 1 418 ? 15.315 7.043   2.421   1.00 45.11  ? 415  TRP A C     1 
ATOM   3316 O  O     . TRP A 1 418 ? 15.862 7.427   3.453   1.00 40.63  ? 415  TRP A O     1 
ATOM   3317 C  CB    . TRP A 1 418 ? 16.623 8.327   0.728   1.00 46.35  ? 415  TRP A CB    1 
ATOM   3318 C  CG    . TRP A 1 418 ? 17.281 7.175   0.062   1.00 30.33  ? 415  TRP A CG    1 
ATOM   3319 C  CD1   . TRP A 1 418 ? 17.779 6.057   0.661   1.00 33.46  ? 415  TRP A CD1   1 
ATOM   3320 C  CD2   . TRP A 1 418 ? 17.472 7.003   -1.342  1.00 35.55  ? 415  TRP A CD2   1 
ATOM   3321 N  NE1   . TRP A 1 418 ? 18.281 5.201   -0.287  1.00 42.58  ? 415  TRP A NE1   1 
ATOM   3322 C  CE2   . TRP A 1 418 ? 18.107 5.759   -1.524  1.00 34.90  ? 415  TRP A CE2   1 
ATOM   3323 C  CE3   . TRP A 1 418 ? 17.176 7.783   -2.460  1.00 28.58  ? 415  TRP A CE3   1 
ATOM   3324 C  CZ2   . TRP A 1 418 ? 18.453 5.279   -2.785  1.00 36.51  ? 415  TRP A CZ2   1 
ATOM   3325 C  CZ3   . TRP A 1 418 ? 17.524 7.304   -3.711  1.00 39.97  ? 415  TRP A CZ3   1 
ATOM   3326 C  CH2   . TRP A 1 418 ? 18.155 6.067   -3.863  1.00 31.18  ? 415  TRP A CH2   1 
ATOM   3327 N  N     . SER A 1 419 ? 14.788 5.830   2.290   1.00 51.52  ? 416  SER A N     1 
ATOM   3328 C  CA    . SER A 1 419 ? 14.889 4.843   3.357   1.00 43.93  ? 416  SER A CA    1 
ATOM   3329 C  C     . SER A 1 419 ? 15.220 3.468   2.780   1.00 49.57  ? 416  SER A C     1 
ATOM   3330 O  O     . SER A 1 419 ? 14.800 3.152   1.668   1.00 47.39  ? 416  SER A O     1 
ATOM   3331 C  CB    . SER A 1 419 ? 13.594 4.785   4.170   1.00 61.76  ? 416  SER A CB    1 
ATOM   3332 O  OG    . SER A 1 419 ? 12.493 4.439   3.347   1.00 68.70  ? 416  SER A OG    1 
ATOM   3333 N  N     . PRO A 1 420 ? 16.028 2.671   3.506   1.00 50.02  ? 417  PRO A N     1 
ATOM   3334 C  CA    . PRO A 1 420 ? 16.779 3.130   4.680   1.00 51.86  ? 417  PRO A CA    1 
ATOM   3335 C  C     . PRO A 1 420 ? 17.844 4.129   4.255   1.00 44.09  ? 417  PRO A C     1 
ATOM   3336 O  O     . PRO A 1 420 ? 18.304 4.053   3.113   1.00 44.97  ? 417  PRO A O     1 
ATOM   3337 C  CB    . PRO A 1 420 ? 17.407 1.845   5.230   1.00 52.50  ? 417  PRO A CB    1 
ATOM   3338 C  CG    . PRO A 1 420 ? 17.460 0.920   4.057   1.00 52.96  ? 417  PRO A CG    1 
ATOM   3339 C  CD    . PRO A 1 420 ? 16.238 1.235   3.249   1.00 47.13  ? 417  PRO A CD    1 
ATOM   3340 N  N     . PRO A 1 421 ? 18.192 5.077   5.139   1.00 48.04  ? 418  PRO A N     1 
ATOM   3341 C  CA    . PRO A 1 421 ? 19.198 6.095   4.822   1.00 42.12  ? 418  PRO A CA    1 
ATOM   3342 C  C     . PRO A 1 421 ? 20.508 5.459   4.368   1.00 33.47  ? 418  PRO A C     1 
ATOM   3343 O  O     . PRO A 1 421 ? 20.841 4.355   4.811   1.00 33.81  ? 418  PRO A O     1 
ATOM   3344 C  CB    . PRO A 1 421 ? 19.378 6.839   6.147   1.00 41.93  ? 418  PRO A CB    1 
ATOM   3345 C  CG    . PRO A 1 421 ? 18.118 6.592   6.897   1.00 49.78  ? 418  PRO A CG    1 
ATOM   3346 C  CD    . PRO A 1 421 ? 17.680 5.215   6.513   1.00 50.08  ? 418  PRO A CD    1 
ATOM   3347 N  N     . LEU A 1 422 ? 21.225 6.148   3.486   1.00 34.46  ? 419  LEU A N     1 
ATOM   3348 C  CA    . LEU A 1 422 ? 22.473 5.637   2.924   1.00 32.75  ? 419  LEU A CA    1 
ATOM   3349 C  C     . LEU A 1 422 ? 23.655 6.041   3.795   1.00 30.24  ? 419  LEU A C     1 
ATOM   3350 O  O     . LEU A 1 422 ? 23.808 7.213   4.140   1.00 32.56  ? 419  LEU A O     1 
ATOM   3351 C  CB    . LEU A 1 422 ? 22.660 6.148   1.482   1.00 22.04  ? 419  LEU A CB    1 
ATOM   3352 C  CG    . LEU A 1 422 ? 21.565 5.737   0.483   1.00 29.23  ? 419  LEU A CG    1 
ATOM   3353 C  CD1   . LEU A 1 422 ? 21.903 6.138   -0.962  1.00 28.75  ? 419  LEU A CD1   1 
ATOM   3354 C  CD2   . LEU A 1 422 ? 21.291 4.247   0.583   1.00 29.77  ? 419  LEU A CD2   1 
ATOM   3355 N  N     . THR A 1 423 ? 24.489 5.069   4.153   1.00 32.14  ? 420  THR A N     1 
ATOM   3356 C  CA    . THR A 1 423 ? 25.657 5.348   4.977   1.00 35.73  ? 420  THR A CA    1 
ATOM   3357 C  C     . THR A 1 423 ? 26.946 5.364   4.158   1.00 30.00  ? 420  THR A C     1 
ATOM   3358 O  O     . THR A 1 423 ? 28.027 5.590   4.698   1.00 29.45  ? 420  THR A O     1 
ATOM   3359 C  CB    . THR A 1 423 ? 25.795 4.322   6.106   1.00 33.26  ? 420  THR A CB    1 
ATOM   3360 O  OG1   . THR A 1 423 ? 25.769 2.999   5.554   1.00 37.91  ? 420  THR A OG1   1 
ATOM   3361 C  CG2   . THR A 1 423 ? 24.649 4.476   7.103   1.00 35.89  ? 420  THR A CG2   1 
ATOM   3362 N  N     . MET A 1 424 ? 26.831 5.121   2.858   1.00 22.43  ? 421  MET A N     1 
ATOM   3363 C  CA    . MET A 1 424 ? 28.004 5.136   1.985   1.00 20.91  ? 421  MET A CA    1 
ATOM   3364 C  C     . MET A 1 424 ? 27.612 5.250   0.520   1.00 28.32  ? 421  MET A C     1 
ATOM   3365 O  O     . MET A 1 424 ? 26.661 4.610   0.075   1.00 26.54  ? 421  MET A O     1 
ATOM   3366 C  CB    . MET A 1 424 ? 28.850 3.875   2.209   1.00 22.75  ? 421  MET A CB    1 
ATOM   3367 C  CG    . MET A 1 424 ? 30.161 3.822   1.417   1.00 27.18  ? 421  MET A CG    1 
ATOM   3368 S  SD    . MET A 1 424 ? 29.962 3.111   -0.231  1.00 28.66  ? 421  MET A SD    1 
ATOM   3369 C  CE    . MET A 1 424 ? 29.414 1.453   0.181   1.00 27.10  ? 421  MET A CE    1 
ATOM   3370 N  N     . LEU A 1 425 ? 28.352 6.077   -0.216  1.00 17.73  ? 422  LEU A N     1 
ATOM   3371 C  CA    . LEU A 1 425 ? 28.270 6.139   -1.671  1.00 20.97  ? 422  LEU A CA    1 
ATOM   3372 C  C     . LEU A 1 425 ? 29.663 5.902   -2.251  1.00 21.07  ? 422  LEU A C     1 
ATOM   3373 O  O     . LEU A 1 425 ? 30.653 6.311   -1.655  1.00 22.93  ? 422  LEU A O     1 
ATOM   3374 C  CB    . LEU A 1 425 ? 27.743 7.491   -2.147  1.00 17.72  ? 422  LEU A CB    1 
ATOM   3375 C  CG    . LEU A 1 425 ? 26.354 7.970   -1.743  1.00 27.07  ? 422  LEU A CG    1 
ATOM   3376 C  CD1   . LEU A 1 425 ? 26.132 9.371   -2.309  1.00 27.12  ? 422  LEU A CD1   1 
ATOM   3377 C  CD2   . LEU A 1 425 ? 25.263 7.002   -2.213  1.00 24.16  ? 422  LEU A CD2   1 
ATOM   3378 N  N     . PHE A 1 426 ? 29.725 5.266   -3.416  1.00 18.31  ? 423  PHE A N     1 
ATOM   3379 C  CA    . PHE A 1 426 ? 30.979 4.845   -4.039  1.00 18.11  ? 423  PHE A CA    1 
ATOM   3380 C  C     . PHE A 1 426 ? 30.817 4.832   -5.556  1.00 19.91  ? 423  PHE A C     1 
ATOM   3381 O  O     . PHE A 1 426 ? 29.934 4.143   -6.087  1.00 28.82  ? 423  PHE A O     1 
ATOM   3382 C  CB    . PHE A 1 426 ? 31.376 3.449   -3.534  1.00 23.10  ? 423  PHE A CB    1 
ATOM   3383 C  CG    . PHE A 1 426 ? 32.728 2.967   -4.009  1.00 33.03  ? 423  PHE A CG    1 
ATOM   3384 C  CD1   . PHE A 1 426 ? 33.038 1.617   -3.964  1.00 49.99  ? 423  PHE A CD1   1 
ATOM   3385 C  CD2   . PHE A 1 426 ? 33.691 3.850   -4.474  1.00 32.44  ? 423  PHE A CD2   1 
ATOM   3386 C  CE1   . PHE A 1 426 ? 34.268 1.157   -4.391  1.00 44.14  ? 423  PHE A CE1   1 
ATOM   3387 C  CE2   . PHE A 1 426 ? 34.932 3.394   -4.898  1.00 29.57  ? 423  PHE A CE2   1 
ATOM   3388 C  CZ    . PHE A 1 426 ? 35.217 2.051   -4.856  1.00 41.87  ? 423  PHE A CZ    1 
ATOM   3389 N  N     . LEU A 1 427 ? 31.646 5.601   -6.250  1.00 17.73  ? 424  LEU A N     1 
ATOM   3390 C  CA    . LEU A 1 427 ? 31.670 5.588   -7.708  1.00 17.78  ? 424  LEU A CA    1 
ATOM   3391 C  C     . LEU A 1 427 ? 33.030 5.130   -8.175  1.00 21.15  ? 424  LEU A C     1 
ATOM   3392 O  O     . LEU A 1 427 ? 34.033 5.717   -7.795  1.00 21.91  ? 424  LEU A O     1 
ATOM   3393 C  CB    . LEU A 1 427 ? 31.375 6.969   -8.288  1.00 18.27  ? 424  LEU A CB    1 
ATOM   3394 C  CG    . LEU A 1 427 ? 30.001 7.577   -8.038  1.00 23.67  ? 424  LEU A CG    1 
ATOM   3395 C  CD1   . LEU A 1 427 ? 29.938 8.970   -8.673  1.00 19.87  ? 424  LEU A CD1   1 
ATOM   3396 C  CD2   . LEU A 1 427 ? 28.906 6.658   -8.592  1.00 20.33  ? 424  LEU A CD2   1 
ATOM   3397 N  N     . CYS A 1 428 ? 33.067 4.094   -9.012  1.00 17.91  ? 425  CYS A N     1 
ATOM   3398 C  CA    . CYS A 1 428 ? 34.339 3.564   -9.489  1.00 20.00  ? 425  CYS A CA    1 
ATOM   3399 C  C     . CYS A 1 428 ? 34.327 3.361   -11.006 1.00 22.53  ? 425  CYS A C     1 
ATOM   3400 O  O     . CYS A 1 428 ? 33.450 2.681   -11.542 1.00 19.67  ? 425  CYS A O     1 
ATOM   3401 C  CB    . CYS A 1 428 ? 34.675 2.241   -8.786  1.00 25.32  ? 425  CYS A CB    1 
ATOM   3402 S  SG    . CYS A 1 428 ? 36.343 1.603   -9.162  1.00 29.28  ? 425  CYS A SG    1 
ATOM   3403 N  N     . ALA A 1 429 ? 35.296 3.981   -11.674 1.00 18.90  ? 426  ALA A N     1 
ATOM   3404 C  CA    . ALA A 1 429 ? 35.506 3.822   -13.104 1.00 20.09  ? 426  ALA A CA    1 
ATOM   3405 C  C     . ALA A 1 429 ? 36.442 2.637   -13.340 1.00 23.60  ? 426  ALA A C     1 
ATOM   3406 O  O     . ALA A 1 429 ? 37.490 2.527   -12.685 1.00 19.36  ? 426  ALA A O     1 
ATOM   3407 C  CB    . ALA A 1 429 ? 36.086 5.088   -13.700 1.00 20.64  ? 426  ALA A CB    1 
ATOM   3408 N  N     . THR A 1 430 ? 36.054 1.752   -14.262 1.00 23.97  ? 427  THR A N     1 
ATOM   3409 C  CA    . THR A 1 430 ? 36.755 0.486   -14.484 1.00 24.83  ? 427  THR A CA    1 
ATOM   3410 C  C     . THR A 1 430 ? 36.762 0.105   -15.970 1.00 23.09  ? 427  THR A C     1 
ATOM   3411 O  O     . THR A 1 430 ? 36.222 0.828   -16.807 1.00 20.25  ? 427  THR A O     1 
ATOM   3412 C  CB    . THR A 1 430 ? 36.095 -0.680  -13.695 1.00 22.78  ? 427  THR A CB    1 
ATOM   3413 O  OG1   . THR A 1 430 ? 34.806 -0.960  -14.257 1.00 28.20  ? 427  THR A OG1   1 
ATOM   3414 C  CG2   . THR A 1 430 ? 35.928 -0.345  -12.206 1.00 22.89  ? 427  THR A CG2   1 
ATOM   3415 N  N     . LYS A 1 431 ? 37.359 -1.047  -16.280 1.00 26.85  ? 428  LYS A N     1 
ATOM   3416 C  CA    . LYS A 1 431 ? 37.430 -1.565  -17.651 1.00 28.32  ? 428  LYS A CA    1 
ATOM   3417 C  C     . LYS A 1 431 ? 38.011 -0.553  -18.641 1.00 21.55  ? 428  LYS A C     1 
ATOM   3418 O  O     . LYS A 1 431 ? 37.313 -0.080  -19.546 1.00 19.93  ? 428  LYS A O     1 
ATOM   3419 C  CB    . LYS A 1 431 ? 36.046 -2.016  -18.127 1.00 24.00  ? 428  LYS A CB    1 
ATOM   3420 C  CG    . LYS A 1 431 ? 35.473 -3.178  -17.339 1.00 40.40  ? 428  LYS A CG    1 
ATOM   3421 C  CD    . LYS A 1 431 ? 34.315 -3.841  -18.080 1.00 46.13  ? 428  LYS A CD    1 
ATOM   3422 C  CE    . LYS A 1 431 ? 33.620 -4.887  -17.214 1.00 50.61  ? 428  LYS A CE    1 
ATOM   3423 N  NZ    . LYS A 1 431 ? 34.580 -5.721  -16.436 1.00 45.47  ? 428  LYS A NZ    1 
ATOM   3424 N  N     . PHE A 1 432 ? 39.285 -0.220  -18.462 1.00 20.47  ? 429  PHE A N     1 
ATOM   3425 C  CA    . PHE A 1 432 ? 39.955 0.725   -19.347 1.00 23.15  ? 429  PHE A CA    1 
ATOM   3426 C  C     . PHE A 1 432 ? 40.269 0.107   -20.696 1.00 33.85  ? 429  PHE A C     1 
ATOM   3427 O  O     . PHE A 1 432 ? 40.542 -1.094  -20.795 1.00 29.10  ? 429  PHE A O     1 
ATOM   3428 C  CB    . PHE A 1 432 ? 41.250 1.241   -18.714 1.00 18.97  ? 429  PHE A CB    1 
ATOM   3429 C  CG    . PHE A 1 432 ? 41.030 2.243   -17.623 1.00 19.96  ? 429  PHE A CG    1 
ATOM   3430 C  CD1   . PHE A 1 432 ? 40.962 3.590   -17.910 1.00 22.27  ? 429  PHE A CD1   1 
ATOM   3431 C  CD2   . PHE A 1 432 ? 40.898 1.835   -16.305 1.00 30.04  ? 429  PHE A CD2   1 
ATOM   3432 C  CE1   . PHE A 1 432 ? 40.750 4.523   -16.906 1.00 18.48  ? 429  PHE A CE1   1 
ATOM   3433 C  CE2   . PHE A 1 432 ? 40.700 2.756   -15.295 1.00 31.41  ? 429  PHE A CE2   1 
ATOM   3434 C  CZ    . PHE A 1 432 ? 40.625 4.107   -15.594 1.00 25.14  ? 429  PHE A CZ    1 
ATOM   3435 N  N     . SER A 1 433 ? 40.216 0.944   -21.729 1.00 27.32  ? 430  SER A N     1 
ATOM   3436 C  CA    . SER A 1 433 ? 40.696 0.589   -23.061 1.00 26.63  ? 430  SER A CA    1 
ATOM   3437 C  C     . SER A 1 433 ? 41.657 1.670   -23.518 1.00 27.93  ? 430  SER A C     1 
ATOM   3438 O  O     . SER A 1 433 ? 41.513 2.841   -23.141 1.00 20.80  ? 430  SER A O     1 
ATOM   3439 C  CB    . SER A 1 433 ? 39.539 0.440   -24.058 1.00 29.99  ? 430  SER A CB    1 
ATOM   3440 O  OG    . SER A 1 433 ? 38.602 -0.527  -23.616 1.00 40.55  ? 430  SER A OG    1 
ATOM   3441 N  N     . ALA A 1 434 ? 42.650 1.283   -24.310 1.00 24.16  ? 431  ALA A N     1 
ATOM   3442 C  CA    . ALA A 1 434 ? 43.626 2.249   -24.782 1.00 31.20  ? 431  ALA A CA    1 
ATOM   3443 C  C     . ALA A 1 434 ? 42.899 3.264   -25.652 1.00 29.96  ? 431  ALA A C     1 
ATOM   3444 O  O     . ALA A 1 434 ? 41.912 2.937   -26.315 1.00 38.25  ? 431  ALA A O     1 
ATOM   3445 C  CB    . ALA A 1 434 ? 44.757 1.565   -25.544 1.00 26.75  ? 431  ALA A CB    1 
ATOM   3446 N  N     . SER A 1 435 ? 43.359 4.507   -25.618 1.00 30.78  ? 432  SER A N     1 
ATOM   3447 C  CA    . SER A 1 435 ? 42.720 5.561   -26.392 1.00 31.60  ? 432  SER A CA    1 
ATOM   3448 C  C     . SER A 1 435 ? 43.779 6.489   -26.957 1.00 38.52  ? 432  SER A C     1 
ATOM   3449 O  O     . SER A 1 435 ? 43.553 7.683   -27.111 1.00 41.86  ? 432  SER A O     1 
ATOM   3450 C  CB    . SER A 1 435 ? 41.727 6.341   -25.533 1.00 38.13  ? 432  SER A CB    1 
ATOM   3451 O  OG    . SER A 1 435 ? 42.403 7.150   -24.585 1.00 51.43  ? 432  SER A OG    1 
ATOM   3452 O  OXT   . SER A 1 435 ? 44.890 6.056   -27.256 1.00 43.38  ? 432  SER A OXT   1 
ATOM   3453 O  "O3'" . DC  B 2 1   ? 27.756 4.636   11.593  1.00 75.05  ? 1    DC  T "O3'" 1 
ATOM   3454 P  P     . DA  B 2 2   ? 28.118 4.255   13.171  1.00 108.14 ? 2    DA  T P     1 
ATOM   3455 O  OP1   . DA  B 2 2   ? 28.113 2.774   13.271  1.00 98.77  ? 2    DA  T OP1   1 
ATOM   3456 O  OP2   . DA  B 2 2   ? 27.223 5.067   14.027  1.00 88.16  ? 2    DA  T OP2   1 
ATOM   3457 O  "O5'" . DA  B 2 2   ? 29.600 4.783   13.439  1.00 82.77  ? 2    DA  T "O5'" 1 
ATOM   3458 C  "C5'" . DA  B 2 2   ? 30.647 4.496   12.520  1.00 68.46  ? 2    DA  T "C5'" 1 
ATOM   3459 C  "C4'" . DA  B 2 2   ? 31.923 5.205   12.938  1.00 63.55  ? 2    DA  T "C4'" 1 
ATOM   3460 O  "O4'" . DA  B 2 2   ? 31.826 6.617   12.617  1.00 63.13  ? 2    DA  T "O4'" 1 
ATOM   3461 C  "C3'" . DA  B 2 2   ? 32.233 5.145   14.431  1.00 68.63  ? 2    DA  T "C3'" 1 
ATOM   3462 O  "O3'" . DA  B 2 2   ? 33.623 5.143   14.621  1.00 63.64  ? 2    DA  T "O3'" 1 
ATOM   3463 C  "C2'" . DA  B 2 2   ? 31.617 6.434   14.952  1.00 61.49  ? 2    DA  T "C2'" 1 
ATOM   3464 C  "C1'" . DA  B 2 2   ? 31.923 7.382   13.806  1.00 57.99  ? 2    DA  T "C1'" 1 
ATOM   3465 N  N9    . DA  B 2 2   ? 30.988 8.491   13.719  1.00 46.96  ? 2    DA  T N9    1 
ATOM   3466 C  C8    . DA  B 2 2   ? 29.746 8.572   14.289  1.00 49.06  ? 2    DA  T C8    1 
ATOM   3467 N  N7    . DA  B 2 2   ? 29.126 9.700   14.040  1.00 55.75  ? 2    DA  T N7    1 
ATOM   3468 C  C5    . DA  B 2 2   ? 30.027 10.404  13.256  1.00 48.90  ? 2    DA  T C5    1 
ATOM   3469 C  C6    . DA  B 2 2   ? 29.975 11.678  12.661  1.00 42.20  ? 2    DA  T C6    1 
ATOM   3470 N  N6    . DA  B 2 2   ? 28.927 12.501  12.771  1.00 52.90  ? 2    DA  T N6    1 
ATOM   3471 N  N1    . DA  B 2 2   ? 31.045 12.073  11.941  1.00 47.99  ? 2    DA  T N1    1 
ATOM   3472 C  C2    . DA  B 2 2   ? 32.092 11.247  11.828  1.00 36.57  ? 2    DA  T C2    1 
ATOM   3473 N  N3    . DA  B 2 2   ? 32.257 10.032  12.342  1.00 38.08  ? 2    DA  T N3    1 
ATOM   3474 C  C4    . DA  B 2 2   ? 31.178 9.669   13.053  1.00 42.05  ? 2    DA  T C4    1 
ATOM   3475 P  P     A DT  B 2 3   ? 34.386 3.785   15.012  0.50 66.22  ? 3    DT  T P     1 
ATOM   3476 P  P     B DT  B 2 3   ? 34.359 3.766   14.984  0.50 66.21  ? 3    DT  T P     1 
ATOM   3477 O  OP1   A DT  B 2 3   ? 33.363 2.720   15.140  0.50 62.57  ? 3    DT  T OP1   1 
ATOM   3478 O  OP1   B DT  B 2 3   ? 33.333 2.695   15.011  0.50 62.51  ? 3    DT  T OP1   1 
ATOM   3479 O  OP2   A DT  B 2 3   ? 35.280 4.108   16.149  0.50 62.49  ? 3    DT  T OP2   1 
ATOM   3480 O  OP2   B DT  B 2 3   ? 35.209 4.027   16.168  0.50 62.54  ? 3    DT  T OP2   1 
ATOM   3481 O  "O5'" A DT  B 2 3   ? 35.309 3.472   13.738  0.50 60.26  ? 3    DT  T "O5'" 1 
ATOM   3482 O  "O5'" B DT  B 2 3   ? 35.328 3.518   13.741  0.50 60.25  ? 3    DT  T "O5'" 1 
ATOM   3483 C  "C5'" A DT  B 2 3   ? 36.715 3.762   13.773  0.50 52.90  ? 3    DT  T "C5'" 1 
ATOM   3484 C  "C5'" B DT  B 2 3   ? 36.695 3.854   13.850  0.50 52.94  ? 3    DT  T "C5'" 1 
ATOM   3485 C  "C4'" A DT  B 2 3   ? 37.070 4.846   12.766  0.50 50.43  ? 3    DT  T "C4'" 1 
ATOM   3486 C  "C4'" B DT  B 2 3   ? 37.099 4.865   12.794  0.50 50.45  ? 3    DT  T "C4'" 1 
ATOM   3487 O  "O4'" A DT  B 2 3   ? 38.498 4.849   12.545  0.50 51.33  ? 3    DT  T "O4'" 1 
ATOM   3488 O  "O4'" B DT  B 2 3   ? 38.535 4.782   12.622  0.50 51.29  ? 3    DT  T "O4'" 1 
ATOM   3489 C  "C3'" A DT  B 2 3   ? 36.436 4.660   11.387  0.50 52.12  ? 3    DT  T "C3'" 1 
ATOM   3490 C  "C3'" B DT  B 2 3   ? 36.470 4.646   11.410  0.50 52.13  ? 3    DT  T "C3'" 1 
ATOM   3491 O  "O3'" A DT  B 2 3   ? 35.444 5.630   11.163  0.50 48.28  ? 3    DT  T "O3'" 1 
ATOM   3492 O  "O3'" B DT  B 2 3   ? 35.464 5.631   11.160  0.50 48.28  ? 3    DT  T "O3'" 1 
ATOM   3493 C  "C2'" A DT  B 2 3   ? 37.585 4.826   10.388  0.50 45.46  ? 3    DT  T "C2'" 1 
ATOM   3494 C  "C2'" B DT  B 2 3   ? 37.640 4.790   10.433  0.50 45.47  ? 3    DT  T "C2'" 1 
ATOM   3495 C  "C1'" A DT  B 2 3   ? 38.758 5.292   11.232  0.50 46.75  ? 3    DT  T "C1'" 1 
ATOM   3496 C  "C1'" B DT  B 2 3   ? 38.855 4.447   11.288  0.50 48.04  ? 3    DT  T "C1'" 1 
ATOM   3497 N  N1    A DT  B 2 3   ? 40.018 4.684   10.768  0.50 43.00  ? 3    DT  T N1    1 
ATOM   3498 N  N1    B DT  B 2 3   ? 39.293 2.990   11.212  0.50 43.77  ? 3    DT  T N1    1 
ATOM   3499 C  C2    A DT  B 2 3   ? 41.019 5.482   10.261  0.50 37.26  ? 3    DT  T C2    1 
ATOM   3500 C  C2    B DT  B 2 3   ? 40.540 2.699   10.709  0.50 43.88  ? 3    DT  T C2    1 
ATOM   3501 O  O2    A DT  B 2 3   ? 40.945 6.701   10.212  0.50 30.89  ? 3    DT  T O2    1 
ATOM   3502 O  O2    B DT  B 2 3   ? 41.323 3.555   10.324  0.50 42.30  ? 3    DT  T O2    1 
ATOM   3503 N  N3    A DT  B 2 3   ? 42.130 4.796   9.836   0.50 29.45  ? 3    DT  T N3    1 
ATOM   3504 N  N3    B DT  B 2 3   ? 40.846 1.363   10.675  0.50 45.10  ? 3    DT  T N3    1 
ATOM   3505 C  C4    A DT  B 2 3   ? 42.317 3.422   9.856   0.50 37.38  ? 3    DT  T C4    1 
ATOM   3506 C  C4    B DT  B 2 3   ? 40.045 0.309   11.079  0.50 48.62  ? 3    DT  T C4    1 
ATOM   3507 O  O4    A DT  B 2 3   ? 43.340 2.892   9.452   0.50 39.21  ? 3    DT  T O4    1 
ATOM   3508 O  O4    B DT  B 2 3   ? 40.413 -0.861  11.004  0.50 47.28  ? 3    DT  T O4    1 
ATOM   3509 C  C5    A DT  B 2 3   ? 41.216 2.653   10.382  0.50 42.71  ? 3    DT  T C5    1 
ATOM   3510 C  C5    B DT  B 2 3   ? 38.749 0.681   11.592  0.50 46.61  ? 3    DT  T C5    1 
ATOM   3511 C  C7    A DT  B 2 3   ? 41.308 1.157   10.454  0.50 45.03  ? 3    DT  T C7    1 
ATOM   3512 C  C7    B DT  B 2 3   ? 37.794 -0.376  12.059  0.50 45.82  ? 3    DT  T C7    1 
ATOM   3513 C  C6    A DT  B 2 3   ? 40.134 3.313   10.800  0.50 43.56  ? 3    DT  T C6    1 
ATOM   3514 C  C6    B DT  B 2 3   ? 38.439 1.984   11.633  0.50 45.93  ? 3    DT  T C6    1 
ATOM   3515 P  P     . DT  B 2 4   ? 34.604 5.581   9.802   1.00 51.51  ? 4    DT  T P     1 
ATOM   3516 O  OP1   . DT  B 2 4   ? 33.386 6.409   9.987   1.00 54.74  ? 4    DT  T OP1   1 
ATOM   3517 O  OP2   . DT  B 2 4   ? 34.548 4.169   9.371   1.00 44.78  ? 4    DT  T OP2   1 
ATOM   3518 O  "O5'" . DT  B 2 4   ? 35.543 6.275   8.710   1.00 36.34  ? 4    DT  T "O5'" 1 
ATOM   3519 C  "C5'" . DT  B 2 4   ? 35.895 7.643   8.799   1.00 22.52  ? 4    DT  T "C5'" 1 
ATOM   3520 C  "C4'" . DT  B 2 4   ? 36.588 8.075   7.518   1.00 23.50  ? 4    DT  T "C4'" 1 
ATOM   3521 O  "O4'" . DT  B 2 4   ? 37.842 7.364   7.380   1.00 19.92  ? 4    DT  T "O4'" 1 
ATOM   3522 C  "C3'" . DT  B 2 4   ? 35.814 7.786   6.234   1.00 22.63  ? 4    DT  T "C3'" 1 
ATOM   3523 O  "O3'" . DT  B 2 4   ? 36.058 8.828   5.319   1.00 22.54  ? 4    DT  T "O3'" 1 
ATOM   3524 C  "C2'" . DT  B 2 4   ? 36.414 6.456   5.761   1.00 25.02  ? 4    DT  T "C2'" 1 
ATOM   3525 C  "C1'" . DT  B 2 4   ? 37.864 6.645   6.164   1.00 23.96  ? 4    DT  T "C1'" 1 
ATOM   3526 N  N1    . DT  B 2 4   ? 38.628 5.388   6.397   1.00 23.55  ? 4    DT  T N1    1 
ATOM   3527 C  C2    . DT  B 2 4   ? 39.927 5.334   5.969   1.00 20.78  ? 4    DT  T C2    1 
ATOM   3528 O  O2    . DT  B 2 4   ? 40.471 6.252   5.381   1.00 16.98  ? 4    DT  T O2    1 
ATOM   3529 N  N3    . DT  B 2 4   ? 40.571 4.168   6.244   1.00 23.57  ? 4    DT  T N3    1 
ATOM   3530 C  C4    . DT  B 2 4   ? 40.073 3.067   6.893   1.00 24.04  ? 4    DT  T C4    1 
ATOM   3531 O  O4    . DT  B 2 4   ? 40.753 2.066   7.087   1.00 25.00  ? 4    DT  T O4    1 
ATOM   3532 C  C5    . DT  B 2 4   ? 38.701 3.182   7.340   1.00 33.81  ? 4    DT  T C5    1 
ATOM   3533 C  C7    . DT  B 2 4   ? 38.044 2.039   8.063   1.00 27.41  ? 4    DT  T C7    1 
ATOM   3534 C  C6    . DT  B 2 4   ? 38.049 4.329   7.074   1.00 23.48  ? 4    DT  T C6    1 
ATOM   3535 P  P     . DA  B 2 5   ? 35.391 8.825   3.863   1.00 22.05  ? 5    DA  T P     1 
ATOM   3536 O  OP1   . DA  B 2 5   ? 35.031 10.226  3.574   1.00 24.18  ? 5    DA  T OP1   1 
ATOM   3537 O  OP2   . DA  B 2 5   ? 34.358 7.762   3.817   1.00 18.94  ? 5    DA  T OP2   1 
ATOM   3538 O  "O5'" . DA  B 2 5   ? 36.597 8.376   2.899   1.00 21.06  ? 5    DA  T "O5'" 1 
ATOM   3539 C  "C5'" . DA  B 2 5   ? 37.757 9.213   2.727   1.00 17.35  ? 5    DA  T "C5'" 1 
ATOM   3540 C  "C4'" . DA  B 2 5   ? 38.731 8.598   1.731   1.00 16.96  ? 5    DA  T "C4'" 1 
ATOM   3541 O  "O4'" . DA  B 2 5   ? 39.337 7.389   2.298   1.00 17.68  ? 5    DA  T "O4'" 1 
ATOM   3542 C  "C3'" . DA  B 2 5   ? 38.103 8.161   0.407   1.00 17.91  ? 5    DA  T "C3'" 1 
ATOM   3543 O  "O3'" . DA  B 2 5   ? 39.004 8.427   -0.653  1.00 17.05  ? 5    DA  T "O3'" 1 
ATOM   3544 C  "C2'" . DA  B 2 5   ? 37.917 6.654   0.608   1.00 20.61  ? 5    DA  T "C2'" 1 
ATOM   3545 C  "C1'" . DA  B 2 5   ? 39.183 6.324   1.385   1.00 22.84  ? 5    DA  T "C1'" 1 
ATOM   3546 N  N9    . DA  B 2 5   ? 39.111 5.072   2.134   1.00 17.87  ? 5    DA  T N9    1 
ATOM   3547 C  C8    . DA  B 2 5   ? 38.027 4.567   2.792   1.00 17.76  ? 5    DA  T C8    1 
ATOM   3548 N  N7    . DA  B 2 5   ? 38.261 3.420   3.395   1.00 24.58  ? 5    DA  T N7    1 
ATOM   3549 C  C5    . DA  B 2 5   ? 39.593 3.159   3.110   1.00 20.69  ? 5    DA  T C5    1 
ATOM   3550 C  C6    . DA  B 2 5   ? 40.436 2.094   3.455   1.00 26.94  ? 5    DA  T C6    1 
ATOM   3551 N  N6    . DA  B 2 5   ? 40.033 1.062   4.198   1.00 26.50  ? 5    DA  T N6    1 
ATOM   3552 N  N1    . DA  B 2 5   ? 41.716 2.131   3.012   1.00 25.91  ? 5    DA  T N1    1 
ATOM   3553 C  C2    . DA  B 2 5   ? 42.105 3.174   2.266   1.00 27.70  ? 5    DA  T C2    1 
ATOM   3554 N  N3    . DA  B 2 5   ? 41.390 4.238   1.872   1.00 20.15  ? 5    DA  T N3    1 
ATOM   3555 C  C4    . DA  B 2 5   ? 40.133 4.164   2.336   1.00 20.68  ? 5    DA  T C4    1 
ATOM   3556 P  P     . DT  B 2 6   ? 38.504 8.403   -2.182  1.00 18.74  ? 6    DT  T P     1 
ATOM   3557 O  OP1   . DT  B 2 6   ? 39.679 8.809   -2.982  1.00 20.01  ? 6    DT  T OP1   1 
ATOM   3558 O  OP2   . DT  B 2 6   ? 37.213 9.107   -2.308  1.00 16.74  ? 6    DT  T OP2   1 
ATOM   3559 O  "O5'" . DT  B 2 6   ? 38.146 6.860   -2.430  1.00 22.67  ? 6    DT  T "O5'" 1 
ATOM   3560 C  "C5'" . DT  B 2 6   ? 38.852 6.100   -3.367  1.00 23.57  ? 6    DT  T "C5'" 1 
ATOM   3561 C  "C4'" . DT  B 2 6   ? 40.079 5.436   -2.755  1.00 19.76  ? 6    DT  T "C4'" 1 
ATOM   3562 O  "O4'" . DT  B 2 6   ? 39.718 4.720   -1.553  1.00 21.69  ? 6    DT  T "O4'" 1 
ATOM   3563 C  "C3'" . DT  B 2 6   ? 40.692 4.392   -3.664  1.00 22.83  ? 6    DT  T "C3'" 1 
ATOM   3564 O  "O3'" . DT  B 2 6   ? 41.729 4.980   -4.409  1.00 24.55  ? 6    DT  T "O3'" 1 
ATOM   3565 C  "C2'" . DT  B 2 6   ? 41.207 3.285   -2.722  1.00 25.67  ? 6    DT  T "C2'" 1 
ATOM   3566 C  "C1'" . DT  B 2 6   ? 40.636 3.664   -1.356  1.00 23.62  ? 6    DT  T "C1'" 1 
ATOM   3567 N  N1    . DT  B 2 6   ? 39.934 2.539   -0.629  1.00 22.54  ? 6    DT  T N1    1 
ATOM   3568 C  C2    . DT  B 2 6   ? 40.655 1.437   -0.213  1.00 26.85  ? 6    DT  T C2    1 
ATOM   3569 O  O2    . DT  B 2 6   ? 41.849 1.288   -0.429  1.00 25.06  ? 6    DT  T O2    1 
ATOM   3570 N  N3    . DT  B 2 6   ? 39.925 0.500   0.470   1.00 22.29  ? 6    DT  T N3    1 
ATOM   3571 C  C4    . DT  B 2 6   ? 38.587 0.554   0.787   1.00 25.24  ? 6    DT  T C4    1 
ATOM   3572 O  O4    . DT  B 2 6   ? 38.025 -0.336  1.408   1.00 29.07  ? 6    DT  T O4    1 
ATOM   3573 C  C5    . DT  B 2 6   ? 37.892 1.734   0.339   1.00 26.63  ? 6    DT  T C5    1 
ATOM   3574 C  C7    . DT  B 2 6   ? 36.424 1.891   0.627   1.00 30.92  ? 6    DT  T C7    1 
ATOM   3575 C  C6    . DT  B 2 6   ? 38.590 2.664   -0.334  1.00 18.52  ? 6    DT  T C6    1 
ATOM   3576 P  P     . DG  B 2 7   ? 41.897 4.607   -5.957  1.00 22.17  ? 7    DG  T P     1 
ATOM   3577 O  OP1   . DG  B 2 7   ? 43.059 5.374   -6.455  1.00 21.45  ? 7    DG  T OP1   1 
ATOM   3578 O  OP2   . DG  B 2 7   ? 40.607 4.671   -6.660  1.00 16.72  ? 7    DG  T OP2   1 
ATOM   3579 O  "O5'" . DG  B 2 7   ? 42.247 3.033   -5.922  1.00 23.14  ? 7    DG  T "O5'" 1 
ATOM   3580 C  "C5'" . DG  B 2 7   ? 43.571 2.603   -5.690  1.00 29.87  ? 7    DG  T "C5'" 1 
ATOM   3581 C  "C4'" . DG  B 2 7   ? 43.634 1.084   -5.597  1.00 19.97  ? 7    DG  T "C4'" 1 
ATOM   3582 O  "O4'" . DG  B 2 7   ? 42.928 0.640   -4.425  1.00 24.53  ? 7    DG  T "O4'" 1 
ATOM   3583 C  "C3'" . DG  B 2 7   ? 43.001 0.337   -6.775  1.00 32.07  ? 7    DG  T "C3'" 1 
ATOM   3584 O  "O3'" . DG  B 2 7   ? 44.019 -0.279  -7.543  1.00 27.76  ? 7    DG  T "O3'" 1 
ATOM   3585 C  "C2'" . DG  B 2 7   ? 42.070 -0.699  -6.119  1.00 33.71  ? 7    DG  T "C2'" 1 
ATOM   3586 C  "C1'" . DG  B 2 7   ? 42.492 -0.664  -4.656  1.00 25.88  ? 7    DG  T "C1'" 1 
ATOM   3587 N  N9    . DG  B 2 7   ? 41.404 -0.978  -3.731  1.00 29.34  ? 7    DG  T N9    1 
ATOM   3588 C  C8    . DG  B 2 7   ? 40.212 -0.301  -3.572  1.00 25.51  ? 7    DG  T C8    1 
ATOM   3589 N  N7    . DG  B 2 7   ? 39.430 -0.833  -2.669  1.00 27.98  ? 7    DG  T N7    1 
ATOM   3590 C  C5    . DG  B 2 7   ? 40.144 -1.943  -2.217  1.00 25.19  ? 7    DG  T C5    1 
ATOM   3591 C  C6    . DG  B 2 7   ? 39.805 -2.911  -1.243  1.00 32.88  ? 7    DG  T C6    1 
ATOM   3592 O  O6    . DG  B 2 7   ? 38.771 -2.980  -0.567  1.00 25.03  ? 7    DG  T O6    1 
ATOM   3593 N  N1    . DG  B 2 7   ? 40.816 -3.872  -1.086  1.00 26.56  ? 7    DG  T N1    1 
ATOM   3594 C  C2    . DG  B 2 7   ? 42.001 -3.885  -1.790  1.00 36.77  ? 7    DG  T C2    1 
ATOM   3595 N  N2    . DG  B 2 7   ? 42.856 -4.890  -1.507  1.00 27.90  ? 7    DG  T N2    1 
ATOM   3596 N  N3    . DG  B 2 7   ? 42.329 -2.976  -2.710  1.00 22.40  ? 7    DG  T N3    1 
ATOM   3597 C  C4    . DG  B 2 7   ? 41.356 -2.044  -2.867  1.00 24.58  ? 7    DG  T C4    1 
ATOM   3598 P  P     . DA  B 2 8   ? 43.654 -1.288  -8.742  1.00 27.50  ? 8    DA  T P     1 
ATOM   3599 O  OP1   . DA  B 2 8   ? 44.664 -1.085  -9.770  1.00 21.99  ? 8    DA  T OP1   1 
ATOM   3600 O  OP2   . DA  B 2 8   ? 42.206 -1.244  -9.106  1.00 27.97  ? 8    DA  T OP2   1 
ATOM   3601 O  "O5'" . DA  B 2 8   ? 43.901 -2.728  -8.106  1.00 32.48  ? 8    DA  T "O5'" 1 
ATOM   3602 C  "C5'" . DA  B 2 8   ? 45.174 -3.072  -7.569  1.00 21.06  ? 8    DA  T "C5'" 1 
ATOM   3603 C  "C4'" . DA  B 2 8   ? 45.163 -4.520  -7.143  1.00 23.51  ? 8    DA  T "C4'" 1 
ATOM   3604 O  "O4'" . DA  B 2 8   ? 44.237 -4.662  -6.032  1.00 24.95  ? 8    DA  T "O4'" 1 
ATOM   3605 C  "C3'" . DA  B 2 8   ? 44.676 -5.482  -8.235  1.00 29.97  ? 8    DA  T "C3'" 1 
ATOM   3606 O  "O3'" . DA  B 2 8   ? 45.505 -6.638  -8.293  1.00 24.64  ? 8    DA  T "O3'" 1 
ATOM   3607 C  "C2'" . DA  B 2 8   ? 43.249 -5.821  -7.812  1.00 30.76  ? 8    DA  T "C2'" 1 
ATOM   3608 C  "C1'" . DA  B 2 8   ? 43.322 -5.695  -6.300  1.00 29.82  ? 8    DA  T "C1'" 1 
ATOM   3609 N  N9    . DA  B 2 8   ? 42.040 -5.348  -5.697  1.00 28.29  ? 8    DA  T N9    1 
ATOM   3610 C  C8    . DA  B 2 8   ? 41.229 -4.301  -6.038  1.00 30.45  ? 8    DA  T C8    1 
ATOM   3611 N  N7    . DA  B 2 8   ? 40.130 -4.232  -5.330  1.00 24.99  ? 8    DA  T N7    1 
ATOM   3612 C  C5    . DA  B 2 8   ? 40.221 -5.311  -4.468  1.00 25.10  ? 8    DA  T C5    1 
ATOM   3613 C  C6    . DA  B 2 8   ? 39.362 -5.794  -3.467  1.00 27.31  ? 8    DA  T C6    1 
ATOM   3614 N  N6    . DA  B 2 8   ? 38.195 -5.214  -3.160  1.00 21.88  ? 8    DA  T N6    1 
ATOM   3615 N  N1    . DA  B 2 8   ? 39.751 -6.907  -2.787  1.00 25.44  ? 8    DA  T N1    1 
ATOM   3616 C  C2    . DA  B 2 8   ? 40.921 -7.480  -3.102  1.00 21.66  ? 8    DA  T C2    1 
ATOM   3617 N  N3    . DA  B 2 8   ? 41.809 -7.116  -4.030  1.00 22.87  ? 8    DA  T N3    1 
ATOM   3618 C  C4    . DA  B 2 8   ? 41.394 -6.012  -4.683  1.00 28.98  ? 8    DA  T C4    1 
ATOM   3619 P  P     . DC  B 2 9   ? 45.321 -7.714  -9.475  1.00 28.25  ? 9    DC  T P     1 
ATOM   3620 O  OP1   . DC  B 2 9   ? 46.686 -8.155  -9.820  1.00 27.20  ? 9    DC  T OP1   1 
ATOM   3621 O  OP2   . DC  B 2 9   ? 44.426 -7.194  -10.528 1.00 40.29  ? 9    DC  T OP2   1 
ATOM   3622 O  "O5'" . DC  B 2 9   ? 44.559 -8.914  -8.758  1.00 25.03  ? 9    DC  T "O5'" 1 
ATOM   3623 C  "C5'" . DC  B 2 9   ? 45.100 -9.450  -7.569  1.00 29.01  ? 9    DC  T "C5'" 1 
ATOM   3624 C  "C4'" . DC  B 2 9   ? 44.110 -10.364 -6.920  1.00 26.91  ? 9    DC  T "C4'" 1 
ATOM   3625 O  "O4'" . DC  B 2 9   ? 43.005 -9.591  -6.385  1.00 36.61  ? 9    DC  T "O4'" 1 
ATOM   3626 C  "C3'" . DC  B 2 9   ? 43.497 -11.383 -7.881  1.00 36.36  ? 9    DC  T "C3'" 1 
ATOM   3627 O  "O3'" . DC  B 2 9   ? 43.607 -12.658 -7.317  1.00 48.46  ? 9    DC  T "O3'" 1 
ATOM   3628 C  "C2'" . DC  B 2 9   ? 42.035 -10.934 -8.008  1.00 33.92  ? 9    DC  T "C2'" 1 
ATOM   3629 C  "C1'" . DC  B 2 9   ? 41.813 -10.289 -6.655  1.00 36.76  ? 9    DC  T "C1'" 1 
ATOM   3630 N  N1    . DC  B 2 9   ? 40.651 -9.343  -6.596  1.00 28.08  ? 9    DC  T N1    1 
ATOM   3631 C  C2    . DC  B 2 9   ? 39.724 -9.485  -5.570  1.00 31.79  ? 9    DC  T C2    1 
ATOM   3632 O  O2    . DC  B 2 9   ? 39.889 -10.392 -4.737  1.00 28.02  ? 9    DC  T O2    1 
ATOM   3633 N  N3    . DC  B 2 9   ? 38.669 -8.637  -5.508  1.00 26.87  ? 9    DC  T N3    1 
ATOM   3634 C  C4    . DC  B 2 9   ? 38.526 -7.676  -6.420  1.00 32.72  ? 9    DC  T C4    1 
ATOM   3635 N  N4    . DC  B 2 9   ? 37.467 -6.864  -6.307  1.00 24.31  ? 9    DC  T N4    1 
ATOM   3636 C  C5    . DC  B 2 9   ? 39.461 -7.511  -7.487  1.00 35.37  ? 9    DC  T C5    1 
ATOM   3637 C  C6    . DC  B 2 9   ? 40.502 -8.363  -7.537  1.00 32.99  ? 9    DC  T C6    1 
ATOM   3638 P  P     . DG  B 2 10  ? 43.410 -13.975 -8.210  1.00 44.12  ? 10   DG  T P     1 
ATOM   3639 O  OP1   . DG  B 2 10  ? 44.727 -14.636 -8.267  1.00 41.11  ? 10   DG  T OP1   1 
ATOM   3640 O  OP2   . DG  B 2 10  ? 42.653 -13.646 -9.444  1.00 31.12  ? 10   DG  T OP2   1 
ATOM   3641 O  "O5'" . DG  B 2 10  ? 42.453 -14.849 -7.305  1.00 32.02  ? 10   DG  T "O5'" 1 
ATOM   3642 C  "C5'" . DG  B 2 10  ? 42.445 -14.651 -5.905  1.00 31.23  ? 10   DG  T "C5'" 1 
ATOM   3643 C  "C4'" . DG  B 2 10  ? 41.229 -15.296 -5.296  1.00 32.08  ? 10   DG  T "C4'" 1 
ATOM   3644 O  "O4'" . DG  B 2 10  ? 40.190 -14.299 -5.131  1.00 37.94  ? 10   DG  T "O4'" 1 
ATOM   3645 C  "C3'" . DG  B 2 10  ? 40.617 -16.410 -6.141  1.00 37.74  ? 10   DG  T "C3'" 1 
ATOM   3646 O  "O3'" . DG  B 2 10  ? 40.108 -17.431 -5.293  1.00 45.25  ? 10   DG  T "O3'" 1 
ATOM   3647 C  "C2'" . DG  B 2 10  ? 39.510 -15.691 -6.905  1.00 43.00  ? 10   DG  T "C2'" 1 
ATOM   3648 C  "C1'" . DG  B 2 10  ? 39.052 -14.658 -5.887  1.00 34.97  ? 10   DG  T "C1'" 1 
ATOM   3649 N  N9    . DG  B 2 10  ? 38.500 -13.453 -6.493  1.00 31.80  ? 10   DG  T N9    1 
ATOM   3650 C  C8    . DG  B 2 10  ? 39.081 -12.667 -7.467  1.00 32.11  ? 10   DG  T C8    1 
ATOM   3651 N  N7    . DG  B 2 10  ? 38.344 -11.644 -7.823  1.00 33.46  ? 10   DG  T N7    1 
ATOM   3652 C  C5    . DG  B 2 10  ? 37.204 -11.758 -7.032  1.00 27.66  ? 10   DG  T C5    1 
ATOM   3653 C  C6    . DG  B 2 10  ? 36.049 -10.943 -6.976  1.00 31.91  ? 10   DG  T C6    1 
ATOM   3654 O  O6    . DG  B 2 10  ? 35.795 -9.920  -7.633  1.00 39.60  ? 10   DG  T O6    1 
ATOM   3655 N  N1    . DG  B 2 10  ? 35.126 -11.418 -6.038  1.00 36.05  ? 10   DG  T N1    1 
ATOM   3656 C  C2    . DG  B 2 10  ? 35.301 -12.547 -5.261  1.00 36.88  ? 10   DG  T C2    1 
ATOM   3657 N  N2    . DG  B 2 10  ? 34.301 -12.850 -4.419  1.00 31.14  ? 10   DG  T N2    1 
ATOM   3658 N  N3    . DG  B 2 10  ? 36.382 -13.324 -5.305  1.00 32.05  ? 10   DG  T N3    1 
ATOM   3659 C  C4    . DG  B 2 10  ? 37.289 -12.870 -6.207  1.00 26.70  ? 10   DG  T C4    1 
ATOM   3660 P  P     . DC  B 2 11  ? 39.438 -18.758 -5.910  1.00 37.15  ? 11   DC  T P     1 
ATOM   3661 O  OP1   . DC  B 2 11  ? 39.909 -19.887 -5.086  1.00 48.18  ? 11   DC  T OP1   1 
ATOM   3662 O  OP2   . DC  B 2 11  ? 39.605 -18.808 -7.379  1.00 36.11  ? 11   DC  T OP2   1 
ATOM   3663 O  "O5'" . DC  B 2 11  ? 37.881 -18.526 -5.642  1.00 30.56  ? 11   DC  T "O5'" 1 
ATOM   3664 C  "C5'" . DC  B 2 11  ? 37.421 -18.222 -4.342  1.00 31.68  ? 11   DC  T "C5'" 1 
ATOM   3665 C  "C4'" . DC  B 2 11  ? 35.905 -18.214 -4.313  1.00 28.75  ? 11   DC  T "C4'" 1 
ATOM   3666 O  "O4'" . DC  B 2 11  ? 35.415 -16.965 -4.861  1.00 26.23  ? 11   DC  T "O4'" 1 
ATOM   3667 C  "C3'" . DC  B 2 11  ? 35.233 -19.332 -5.119  1.00 29.26  ? 11   DC  T "C3'" 1 
ATOM   3668 O  "O3'" . DC  B 2 11  ? 34.139 -19.870 -4.359  1.00 21.94  ? 11   DC  T "O3'" 1 
ATOM   3669 C  "C2'" . DC  B 2 11  ? 34.769 -18.619 -6.397  1.00 28.53  ? 11   DC  T "C2'" 1 
ATOM   3670 C  "C1'" . DC  B 2 11  ? 34.473 -17.216 -5.882  1.00 26.14  ? 11   DC  T "C1'" 1 
ATOM   3671 N  N1    . DC  B 2 11  ? 34.613 -16.108 -6.909  1.00 23.32  ? 11   DC  T N1    1 
ATOM   3672 C  C2    . DC  B 2 11  ? 33.568 -15.186 -7.086  1.00 20.43  ? 11   DC  T C2    1 
ATOM   3673 O  O2    . DC  B 2 11  ? 32.535 -15.308 -6.427  1.00 25.67  ? 11   DC  T O2    1 
ATOM   3674 N  N3    . DC  B 2 11  ? 33.717 -14.177 -7.988  1.00 28.07  ? 11   DC  T N3    1 
ATOM   3675 C  C4    . DC  B 2 11  ? 34.846 -14.071 -8.685  1.00 27.62  ? 11   DC  T C4    1 
ATOM   3676 N  N4    . DC  B 2 11  ? 34.944 -13.057 -9.563  1.00 22.80  ? 11   DC  T N4    1 
ATOM   3677 C  C5    . DC  B 2 11  ? 35.926 -14.991 -8.513  1.00 20.67  ? 11   DC  T C5    1 
ATOM   3678 C  C6    . DC  B 2 11  ? 35.771 -15.979 -7.617  1.00 22.49  ? 11   DC  T C6    1 
ATOM   3679 P  P     . DT  B 2 12  ? 33.425 -21.245 -4.799  1.00 20.74  ? 12   DT  T P     1 
ATOM   3680 O  OP1   . DT  B 2 12  ? 32.912 -21.875 -3.569  1.00 21.36  ? 12   DT  T OP1   1 
ATOM   3681 O  OP2   . DT  B 2 12  ? 34.310 -22.009 -5.700  1.00 18.81  ? 12   DT  T OP2   1 
ATOM   3682 O  "O5'" . DT  B 2 12  ? 32.172 -20.729 -5.630  1.00 22.63  ? 12   DT  T "O5'" 1 
ATOM   3683 C  "C5'" . DT  B 2 12  ? 31.075 -20.150 -4.942  1.00 22.25  ? 12   DT  T "C5'" 1 
ATOM   3684 C  "C4'" . DT  B 2 12  ? 30.049 -19.621 -5.921  1.00 27.33  ? 12   DT  T "C4'" 1 
ATOM   3685 O  "O4'" . DT  B 2 12  ? 30.616 -18.497 -6.644  1.00 28.28  ? 12   DT  T "O4'" 1 
ATOM   3686 C  "C3'" . DT  B 2 12  ? 29.601 -20.623 -6.996  1.00 23.04  ? 12   DT  T "C3'" 1 
ATOM   3687 O  "O3'" . DT  B 2 12  ? 28.183 -20.534 -7.188  1.00 30.50  ? 12   DT  T "O3'" 1 
ATOM   3688 C  "C2'" . DT  B 2 12  ? 30.357 -20.151 -8.239  1.00 21.98  ? 12   DT  T "C2'" 1 
ATOM   3689 C  "C1'" . DT  B 2 12  ? 30.303 -18.656 -8.005  1.00 26.05  ? 12   DT  T "C1'" 1 
ATOM   3690 N  N1    . DT  B 2 12  ? 31.238 -17.845 -8.830  1.00 30.37  ? 12   DT  T N1    1 
ATOM   3691 C  C2    . DT  B 2 12  ? 30.815 -16.615 -9.256  1.00 25.61  ? 12   DT  T C2    1 
ATOM   3692 O  O2    . DT  B 2 12  ? 29.715 -16.166 -8.989  1.00 31.20  ? 12   DT  T O2    1 
ATOM   3693 N  N3    . DT  B 2 12  ? 31.718 -15.925 -10.005 1.00 22.72  ? 12   DT  T N3    1 
ATOM   3694 C  C4    . DT  B 2 12  ? 32.979 -16.336 -10.381 1.00 23.69  ? 12   DT  T C4    1 
ATOM   3695 O  O4    . DT  B 2 12  ? 33.717 -15.637 -11.070 1.00 24.89  ? 12   DT  T O4    1 
ATOM   3696 C  C5    . DT  B 2 12  ? 33.372 -17.637 -9.902  1.00 28.04  ? 12   DT  T C5    1 
ATOM   3697 C  C7    . DT  B 2 12  ? 34.728 -18.185 -10.246 1.00 26.43  ? 12   DT  T C7    1 
ATOM   3698 C  C6    . DT  B 2 12  ? 32.488 -18.329 -9.153  1.00 26.87  ? 12   DT  T C6    1 
ATOM   3699 O  "O5'" . DA  C 3 1   ? 29.113 -7.885  -15.566 1.00 40.57  ? 1    DA  P "O5'" 1 
ATOM   3700 C  "C5'" . DA  C 3 1   ? 27.742 -8.040  -15.889 1.00 38.39  ? 1    DA  P "C5'" 1 
ATOM   3701 C  "C4'" . DA  C 3 1   ? 26.946 -8.520  -14.689 1.00 38.42  ? 1    DA  P "C4'" 1 
ATOM   3702 O  "O4'" . DA  C 3 1   ? 27.399 -9.837  -14.298 1.00 39.78  ? 1    DA  P "O4'" 1 
ATOM   3703 C  "C3'" . DA  C 3 1   ? 27.035 -7.643  -13.440 1.00 37.96  ? 1    DA  P "C3'" 1 
ATOM   3704 O  "O3'" A DA  C 3 1   ? 25.772 -7.600  -12.794 0.56 36.43  ? 1    DA  P "O3'" 1 
ATOM   3705 O  "O3'" B DA  C 3 1   ? 25.773 -7.587  -12.788 0.44 36.47  ? 1    DA  P "O3'" 1 
ATOM   3706 C  "C2'" . DA  C 3 1   ? 28.076 -8.345  -12.574 1.00 35.87  ? 1    DA  P "C2'" 1 
ATOM   3707 C  "C1'" . DA  C 3 1   ? 27.954 -9.809  -12.998 1.00 40.38  ? 1    DA  P "C1'" 1 
ATOM   3708 N  N9    . DA  C 3 1   ? 29.237 -10.483 -13.051 1.00 32.17  ? 1    DA  P N9    1 
ATOM   3709 C  C8    . DA  C 3 1   ? 30.286 -10.185 -13.875 1.00 32.05  ? 1    DA  P C8    1 
ATOM   3710 N  N7    . DA  C 3 1   ? 31.332 -10.961 -13.699 1.00 39.53  ? 1    DA  P N7    1 
ATOM   3711 C  C5    . DA  C 3 1   ? 30.939 -11.826 -12.692 1.00 27.65  ? 1    DA  P C5    1 
ATOM   3712 C  C6    . DA  C 3 1   ? 31.596 -12.889 -12.050 1.00 29.83  ? 1    DA  P C6    1 
ATOM   3713 N  N6    . DA  C 3 1   ? 32.840 -13.273 -12.354 1.00 25.57  ? 1    DA  P N6    1 
ATOM   3714 N  N1    . DA  C 3 1   ? 30.919 -13.554 -11.088 1.00 25.93  ? 1    DA  P N1    1 
ATOM   3715 C  C2    . DA  C 3 1   ? 29.669 -13.174 -10.793 1.00 26.19  ? 1    DA  P C2    1 
ATOM   3716 N  N3    . DA  C 3 1   ? 28.949 -12.191 -11.327 1.00 34.08  ? 1    DA  P N3    1 
ATOM   3717 C  C4    . DA  C 3 1   ? 29.651 -11.547 -12.278 1.00 30.65  ? 1    DA  P C4    1 
ATOM   3718 P  P     A DG  C 3 2   ? 25.448 -6.436  -11.735 0.65 43.47  ? 2    DG  P P     1 
ATOM   3719 P  P     B DG  C 3 2   ? 25.465 -6.410  -11.737 0.35 43.30  ? 2    DG  P P     1 
ATOM   3720 O  OP1   A DG  C 3 2   ? 23.985 -6.223  -11.766 0.65 36.17  ? 2    DG  P OP1   1 
ATOM   3721 O  OP1   B DG  C 3 2   ? 24.012 -6.142  -11.786 0.35 36.32  ? 2    DG  P OP1   1 
ATOM   3722 O  OP2   A DG  C 3 2   ? 26.398 -5.321  -11.959 0.65 42.45  ? 2    DG  P OP2   1 
ATOM   3723 O  OP2   B DG  C 3 2   ? 26.444 -5.324  -11.970 0.35 42.36  ? 2    DG  P OP2   1 
ATOM   3724 O  "O5'" A DG  C 3 2   ? 25.816 -7.085  -10.325 0.65 38.08  ? 2    DG  P "O5'" 1 
ATOM   3725 O  "O5'" B DG  C 3 2   ? 25.810 -7.058  -10.317 0.35 38.07  ? 2    DG  P "O5'" 1 
ATOM   3726 C  "C5'" A DG  C 3 2   ? 24.912 -7.991  -9.723  0.65 38.24  ? 2    DG  P "C5'" 1 
ATOM   3727 C  "C5'" B DG  C 3 2   ? 24.913 -7.987  -9.729  0.35 38.21  ? 2    DG  P "C5'" 1 
ATOM   3728 C  "C4'" . DG  C 3 2   ? 25.545 -8.644  -8.521  1.00 30.91  ? 2    DG  P "C4'" 1 
ATOM   3729 O  "O4'" . DG  C 3 2   ? 26.762 -9.311  -8.923  1.00 29.03  ? 2    DG  P "O4'" 1 
ATOM   3730 C  "C3'" . DG  C 3 2   ? 25.929 -7.681  -7.392  1.00 30.22  ? 2    DG  P "C3'" 1 
ATOM   3731 O  "O3'" . DG  C 3 2   ? 25.341 -8.148  -6.194  1.00 38.02  ? 2    DG  P "O3'" 1 
ATOM   3732 C  "C2'" . DG  C 3 2   ? 27.464 -7.744  -7.353  1.00 27.28  ? 2    DG  P "C2'" 1 
ATOM   3733 C  "C1'" . DG  C 3 2   ? 27.735 -9.121  -7.930  1.00 32.83  ? 2    DG  P "C1'" 1 
ATOM   3734 N  N9    . DG  C 3 2   ? 29.054 -9.272  -8.538  1.00 29.34  ? 2    DG  P N9    1 
ATOM   3735 C  C8    . DG  C 3 2   ? 29.680 -8.407  -9.406  1.00 31.30  ? 2    DG  P C8    1 
ATOM   3736 N  N7    . DG  C 3 2   ? 30.860 -8.817  -9.787  1.00 29.65  ? 2    DG  P N7    1 
ATOM   3737 C  C5    . DG  C 3 2   ? 31.021 -10.042 -9.139  1.00 29.19  ? 2    DG  P C5    1 
ATOM   3738 C  C6    . DG  C 3 2   ? 32.104 -10.953 -9.160  1.00 23.93  ? 2    DG  P C6    1 
ATOM   3739 O  O6    . DG  C 3 2   ? 33.167 -10.869 -9.789  1.00 29.29  ? 2    DG  P O6    1 
ATOM   3740 N  N1    . DG  C 3 2   ? 31.859 -12.070 -8.355  1.00 32.85  ? 2    DG  P N1    1 
ATOM   3741 C  C2    . DG  C 3 2   ? 30.711 -12.272 -7.626  1.00 33.05  ? 2    DG  P C2    1 
ATOM   3742 N  N2    . DG  C 3 2   ? 30.646 -13.410 -6.908  1.00 31.76  ? 2    DG  P N2    1 
ATOM   3743 N  N3    . DG  C 3 2   ? 29.693 -11.422 -7.599  1.00 29.51  ? 2    DG  P N3    1 
ATOM   3744 C  C4    . DG  C 3 2   ? 29.919 -10.333 -8.369  1.00 26.95  ? 2    DG  P C4    1 
ATOM   3745 P  P     . DC  C 3 3   ? 25.570 -7.415  -4.784  1.00 34.61  ? 3    DC  P P     1 
ATOM   3746 O  OP1   . DC  C 3 3   ? 24.252 -7.471  -4.120  1.00 39.71  ? 3    DC  P OP1   1 
ATOM   3747 O  OP2   . DC  C 3 3   ? 26.296 -6.133  -4.925  1.00 35.32  ? 3    DC  P OP2   1 
ATOM   3748 O  "O5'" . DC  C 3 3   ? 26.558 -8.415  -4.016  1.00 43.46  ? 3    DC  P "O5'" 1 
ATOM   3749 C  "C5'" . DC  C 3 3   ? 26.283 -9.807  -4.003  1.00 41.07  ? 3    DC  P "C5'" 1 
ATOM   3750 C  "C4'" . DC  C 3 3   ? 27.435 -10.576 -3.383  1.00 39.94  ? 3    DC  P "C4'" 1 
ATOM   3751 O  "O4'" . DC  C 3 3   ? 28.518 -10.652 -4.336  1.00 38.06  ? 3    DC  P "O4'" 1 
ATOM   3752 C  "C3'" . DC  C 3 3   ? 28.013 -9.950  -2.102  1.00 38.35  ? 3    DC  P "C3'" 1 
ATOM   3753 O  "O3'" . DC  C 3 3   ? 27.928 -10.873 -1.006  1.00 45.51  ? 3    DC  P "O3'" 1 
ATOM   3754 C  "C2'" . DC  C 3 3   ? 29.465 -9.616  -2.459  1.00 35.46  ? 3    DC  P "C2'" 1 
ATOM   3755 C  "C1'" . DC  C 3 3   ? 29.742 -10.503 -3.665  1.00 40.23  ? 3    DC  P "C1'" 1 
ATOM   3756 N  N1    . DC  C 3 3   ? 30.722 -9.899  -4.609  1.00 42.11  ? 3    DC  P N1    1 
ATOM   3757 C  C2    . DC  C 3 3   ? 31.889 -10.600 -4.944  1.00 29.75  ? 3    DC  P C2    1 
ATOM   3758 O  O2    . DC  C 3 3   ? 32.079 -11.721 -4.465  1.00 35.91  ? 3    DC  P O2    1 
ATOM   3759 N  N3    . DC  C 3 3   ? 32.774 -10.029 -5.793  1.00 37.32  ? 3    DC  P N3    1 
ATOM   3760 C  C4    . DC  C 3 3   ? 32.533 -8.820  -6.295  1.00 31.83  ? 3    DC  P C4    1 
ATOM   3761 N  N4    . DC  C 3 3   ? 33.440 -8.303  -7.129  1.00 36.11  ? 3    DC  P N4    1 
ATOM   3762 C  C5    . DC  C 3 3   ? 31.357 -8.088  -5.962  1.00 37.29  ? 3    DC  P C5    1 
ATOM   3763 C  C6    . DC  C 3 3   ? 30.488 -8.659  -5.121  1.00 34.65  ? 3    DC  P C6    1 
ATOM   3764 P  P     . DG  C 3 4   ? 28.428 -10.443 0.464   1.00 44.35  ? 4    DG  P P     1 
ATOM   3765 O  OP1   . DG  C 3 4   ? 27.605 -11.209 1.426   1.00 44.18  ? 4    DG  P OP1   1 
ATOM   3766 O  OP2   . DG  C 3 4   ? 28.512 -8.966  0.541   1.00 41.55  ? 4    DG  P OP2   1 
ATOM   3767 O  "O5'" . DG  C 3 4   ? 29.924 -10.999 0.525   1.00 35.51  ? 4    DG  P "O5'" 1 
ATOM   3768 C  "C5'" . DG  C 3 4   ? 30.178 -12.346 0.148   1.00 35.81  ? 4    DG  P "C5'" 1 
ATOM   3769 C  "C4'" . DG  C 3 4   ? 31.654 -12.657 0.256   1.00 45.98  ? 4    DG  P "C4'" 1 
ATOM   3770 O  "O4'" . DG  C 3 4   ? 32.355 -12.073 -0.869  1.00 42.22  ? 4    DG  P "O4'" 1 
ATOM   3771 C  "C3'" . DG  C 3 4   ? 32.318 -12.111 1.517   1.00 39.51  ? 4    DG  P "C3'" 1 
ATOM   3772 O  "O3'" . DG  C 3 4   ? 33.048 -13.136 2.146   1.00 38.06  ? 4    DG  P "O3'" 1 
ATOM   3773 C  "C2'" . DG  C 3 4   ? 33.217 -10.982 1.011   1.00 30.37  ? 4    DG  P "C2'" 1 
ATOM   3774 C  "C1'" . DG  C 3 4   ? 33.505 -11.401 -0.420  1.00 32.99  ? 4    DG  P "C1'" 1 
ATOM   3775 N  N9    . DG  C 3 4   ? 33.732 -10.268 -1.311  1.00 29.75  ? 4    DG  P N9    1 
ATOM   3776 C  C8    . DG  C 3 4   ? 32.897 -9.197  -1.507  1.00 33.08  ? 4    DG  P C8    1 
ATOM   3777 N  N7    . DG  C 3 4   ? 33.348 -8.339  -2.375  1.00 34.20  ? 4    DG  P N7    1 
ATOM   3778 C  C5    . DG  C 3 4   ? 34.561 -8.878  -2.780  1.00 30.84  ? 4    DG  P C5    1 
ATOM   3779 C  C6    . DG  C 3 4   ? 35.493 -8.390  -3.702  1.00 29.43  ? 4    DG  P C6    1 
ATOM   3780 O  O6    . DG  C 3 4   ? 35.437 -7.343  -4.358  1.00 30.35  ? 4    DG  P O6    1 
ATOM   3781 N  N1    . DG  C 3 4   ? 36.593 -9.239  -3.828  1.00 36.18  ? 4    DG  P N1    1 
ATOM   3782 C  C2    . DG  C 3 4   ? 36.755 -10.417 -3.142  1.00 35.36  ? 4    DG  P C2    1 
ATOM   3783 N  N2    . DG  C 3 4   ? 37.882 -11.106 -3.398  1.00 33.59  ? 4    DG  P N2    1 
ATOM   3784 N  N3    . DG  C 3 4   ? 35.879 -10.891 -2.267  1.00 26.65  ? 4    DG  P N3    1 
ATOM   3785 C  C4    . DG  C 3 4   ? 34.810 -10.068 -2.138  1.00 32.19  ? 4    DG  P C4    1 
ATOM   3786 P  P     . DT  C 3 5   ? 33.780 -12.872 3.550   1.00 41.83  ? 5    DT  P P     1 
ATOM   3787 O  OP1   . DT  C 3 5   ? 33.684 -14.149 4.289   1.00 42.06  ? 5    DT  P OP1   1 
ATOM   3788 O  OP2   . DT  C 3 5   ? 33.320 -11.608 4.155   1.00 26.68  ? 5    DT  P OP2   1 
ATOM   3789 O  "O5'" . DT  C 3 5   ? 35.297 -12.627 3.113   1.00 34.19  ? 5    DT  P "O5'" 1 
ATOM   3790 C  "C5'" . DT  C 3 5   ? 35.907 -13.539 2.242   1.00 28.63  ? 5    DT  P "C5'" 1 
ATOM   3791 C  "C4'" . DT  C 3 5   ? 37.322 -13.111 1.912   1.00 21.29  ? 5    DT  P "C4'" 1 
ATOM   3792 O  "O4'" . DT  C 3 5   ? 37.310 -12.082 0.905   1.00 24.82  ? 5    DT  P "O4'" 1 
ATOM   3793 C  "C3'" . DT  C 3 5   ? 38.137 -12.572 3.090   1.00 24.72  ? 5    DT  P "C3'" 1 
ATOM   3794 O  "O3'" . DT  C 3 5   ? 39.342 -13.331 3.181   1.00 22.78  ? 5    DT  P "O3'" 1 
ATOM   3795 C  "C2'" . DT  C 3 5   ? 38.396 -11.099 2.722   1.00 20.52  ? 5    DT  P "C2'" 1 
ATOM   3796 C  "C1'" . DT  C 3 5   ? 38.299 -11.128 1.202   1.00 20.68  ? 5    DT  P "C1'" 1 
ATOM   3797 N  N1    . DT  C 3 5   ? 37.875 -9.845  0.586   1.00 26.14  ? 5    DT  P N1    1 
ATOM   3798 C  C2    . DT  C 3 5   ? 38.672 -9.267  -0.371  1.00 23.92  ? 5    DT  P C2    1 
ATOM   3799 O  O2    . DT  C 3 5   ? 39.735 -9.730  -0.722  1.00 23.72  ? 5    DT  P O2    1 
ATOM   3800 N  N3    . DT  C 3 5   ? 38.185 -8.102  -0.896  1.00 23.42  ? 5    DT  P N3    1 
ATOM   3801 C  C4    . DT  C 3 5   ? 37.001 -7.477  -0.587  1.00 21.87  ? 5    DT  P C4    1 
ATOM   3802 O  O4    . DT  C 3 5   ? 36.659 -6.424  -1.125  1.00 22.45  ? 5    DT  P O4    1 
ATOM   3803 C  C5    . DT  C 3 5   ? 36.203 -8.129  0.427   1.00 24.55  ? 5    DT  P C5    1 
ATOM   3804 C  C7    . DT  C 3 5   ? 34.898 -7.533  0.859   1.00 28.75  ? 5    DT  P C7    1 
ATOM   3805 C  C6    . DT  C 3 5   ? 36.668 -9.278  0.953   1.00 25.48  ? 5    DT  P C6    1 
ATOM   3806 P  P     . DC  C 3 6   ? 40.348 -13.182 4.425   1.00 19.69  ? 6    DC  P P     1 
ATOM   3807 O  OP1   . DC  C 3 6   ? 41.094 -14.472 4.460   1.00 20.84  ? 6    DC  P OP1   1 
ATOM   3808 O  OP2   . DC  C 3 6   ? 39.633 -12.704 5.625   1.00 20.67  ? 6    DC  P OP2   1 
ATOM   3809 O  "O5'" . DC  C 3 6   ? 41.355 -12.055 3.948   1.00 17.83  ? 6    DC  P "O5'" 1 
ATOM   3810 C  "C5'" . DC  C 3 6   ? 42.231 -12.305 2.874   1.00 13.15  ? 6    DC  P "C5'" 1 
ATOM   3811 C  "C4'" . DC  C 3 6   ? 42.991 -11.045 2.533   1.00 24.45  ? 6    DC  P "C4'" 1 
ATOM   3812 O  "O4'" . DC  C 3 6   ? 42.109 -10.118 1.875   1.00 23.02  ? 6    DC  P "O4'" 1 
ATOM   3813 C  "C3'" . DC  C 3 6   ? 43.565 -10.296 3.742   1.00 19.00  ? 6    DC  P "C3'" 1 
ATOM   3814 O  "O3'" . DC  C 3 6   ? 44.994 -10.402 3.718   1.00 19.71  ? 6    DC  P "O3'" 1 
ATOM   3815 C  "C2'" . DC  C 3 6   ? 43.086 -8.838  3.554   1.00 16.94  ? 6    DC  P "C2'" 1 
ATOM   3816 C  "C1'" . DC  C 3 6   ? 42.571 -8.823  2.116   1.00 17.75  ? 6    DC  P "C1'" 1 
ATOM   3817 N  N1    . DC  C 3 6   ? 41.436 -7.846  1.881   1.00 19.82  ? 6    DC  P N1    1 
ATOM   3818 C  C2    . DC  C 3 6   ? 41.503 -6.939  0.808   1.00 26.96  ? 6    DC  P C2    1 
ATOM   3819 O  O2    . DC  C 3 6   ? 42.482 -6.965  0.053   1.00 18.48  ? 6    DC  P O2    1 
ATOM   3820 N  N3    . DC  C 3 6   ? 40.476 -6.064  0.619   1.00 23.72  ? 6    DC  P N3    1 
ATOM   3821 C  C4    . DC  C 3 6   ? 39.430 -6.072  1.456   1.00 24.62  ? 6    DC  P C4    1 
ATOM   3822 N  N4    . DC  C 3 6   ? 38.446 -5.195  1.238   1.00 29.34  ? 6    DC  P N4    1 
ATOM   3823 C  C5    . DC  C 3 6   ? 39.347 -6.983  2.552   1.00 23.35  ? 6    DC  P C5    1 
ATOM   3824 C  C6    . DC  C 3 6   ? 40.360 -7.844  2.724   1.00 27.92  ? 6    DC  P C6    1 
ATOM   3825 P  P     . DA  C 3 7   ? 45.909 -9.678  4.823   1.00 17.95  ? 7    DA  P P     1 
ATOM   3826 O  OP1   . DA  C 3 7   ? 47.146 -10.487 4.917   1.00 18.45  ? 7    DA  P OP1   1 
ATOM   3827 O  OP2   . DA  C 3 7   ? 45.096 -9.435  6.034   1.00 19.70  ? 7    DA  P OP2   1 
ATOM   3828 O  "O5'" . DA  C 3 7   ? 46.231 -8.248  4.171   1.00 18.91  ? 7    DA  P "O5'" 1 
ATOM   3829 C  "C5'" . DA  C 3 7   ? 46.839 -8.191  2.895   1.00 23.43  ? 7    DA  P "C5'" 1 
ATOM   3830 C  "C4'" . DA  C 3 7   ? 46.708 -6.803  2.283   1.00 25.48  ? 7    DA  P "C4'" 1 
ATOM   3831 O  "O4'" . DA  C 3 7   ? 45.339 -6.533  1.929   1.00 25.04  ? 7    DA  P "O4'" 1 
ATOM   3832 C  "C3'" . DA  C 3 7   ? 47.053 -5.651  3.200   1.00 24.77  ? 7    DA  P "C3'" 1 
ATOM   3833 O  "O3'" . DA  C 3 7   ? 48.465 -5.470  3.272   1.00 39.74  ? 7    DA  P "O3'" 1 
ATOM   3834 C  "C2'" . DA  C 3 7   ? 46.381 -4.477  2.492   1.00 27.40  ? 7    DA  P "C2'" 1 
ATOM   3835 C  "C1'" . DA  C 3 7   ? 45.205 -5.135  1.772   1.00 25.73  ? 7    DA  P "C1'" 1 
ATOM   3836 N  N9    . DA  C 3 7   ? 43.914 -4.701  2.285   1.00 23.31  ? 7    DA  P N9    1 
ATOM   3837 C  C8    . DA  C 3 7   ? 43.155 -5.295  3.259   1.00 24.54  ? 7    DA  P C8    1 
ATOM   3838 N  N7    . DA  C 3 7   ? 42.025 -4.664  3.502   1.00 25.35  ? 7    DA  P N7    1 
ATOM   3839 C  C5    . DA  C 3 7   ? 42.053 -3.582  2.630   1.00 22.26  ? 7    DA  P C5    1 
ATOM   3840 C  C6    . DA  C 3 7   ? 41.152 -2.532  2.399   1.00 24.56  ? 7    DA  P C6    1 
ATOM   3841 N  N6    . DA  C 3 7   ? 39.997 -2.407  3.055   1.00 29.83  ? 7    DA  P N6    1 
ATOM   3842 N  N1    . DA  C 3 7   ? 41.485 -1.610  1.463   1.00 26.08  ? 7    DA  P N1    1 
ATOM   3843 C  C2    . DA  C 3 7   ? 42.647 -1.744  0.816   1.00 30.38  ? 7    DA  P C2    1 
ATOM   3844 N  N3    . DA  C 3 7   ? 43.577 -2.698  0.947   1.00 22.09  ? 7    DA  P N3    1 
ATOM   3845 C  C4    . DA  C 3 7   ? 43.212 -3.589  1.880   1.00 23.36  ? 7    DA  P C4    1 
ATOM   3846 P  P     A DT  C 3 8   ? 49.066 -4.400  4.312   0.80 35.82  ? 8    DT  P P     1 
ATOM   3847 P  P     B DT  C 3 8   ? 49.146 -4.340  4.217   0.20 35.17  ? 8    DT  P P     1 
ATOM   3848 O  OP1   A DT  C 3 8   ? 50.514 -4.658  4.523   0.80 35.74  ? 8    DT  P OP1   1 
ATOM   3849 O  OP1   B DT  C 3 8   ? 50.599 -4.609  4.286   0.20 34.57  ? 8    DT  P OP1   1 
ATOM   3850 O  OP2   A DT  C 3 8   ? 48.126 -4.304  5.455   0.80 30.02  ? 8    DT  P OP2   1 
ATOM   3851 O  OP2   B DT  C 3 8   ? 48.311 -4.416  5.438   0.20 30.21  ? 8    DT  P OP2   1 
ATOM   3852 O  "O5'" A DT  C 3 8   ? 48.917 -3.003  3.561   0.80 31.06  ? 8    DT  P "O5'" 1 
ATOM   3853 O  "O5'" B DT  C 3 8   ? 48.934 -2.886  3.595   0.20 30.47  ? 8    DT  P "O5'" 1 
ATOM   3854 C  "C5'" A DT  C 3 8   ? 49.357 -2.836  2.213   0.80 24.23  ? 8    DT  P "C5'" 1 
ATOM   3855 C  "C5'" B DT  C 3 8   ? 49.419 -2.573  2.292   0.20 24.54  ? 8    DT  P "C5'" 1 
ATOM   3856 C  "C4'" A DT  C 3 8   ? 49.080 -1.406  1.806   0.80 20.08  ? 8    DT  P "C4'" 1 
ATOM   3857 C  "C4'" B DT  C 3 8   ? 49.083 -1.134  1.964   0.20 20.74  ? 8    DT  P "C4'" 1 
ATOM   3858 O  "O4'" A DT  C 3 8   ? 47.635 -1.206  1.749   0.80 19.52  ? 8    DT  P "O4'" 1 
ATOM   3859 O  "O4'" B DT  C 3 8   ? 47.648 -1.020  1.808   0.20 20.53  ? 8    DT  P "O4'" 1 
ATOM   3860 C  "C3'" A DT  C 3 8   ? 49.619 -0.395  2.818   0.80 22.83  ? 8    DT  P "C3'" 1 
ATOM   3861 C  "C3'" B DT  C 3 8   ? 49.422 0.086   2.842   0.20 21.54  ? 8    DT  P "C3'" 1 
ATOM   3862 O  "O3'" A DT  C 3 8   ? 50.347 0.635   2.173   0.80 13.79  ? 8    DT  P "O3'" 1 
ATOM   3863 O  "O3'" B DT  C 3 8   ? 50.432 0.889   2.621   0.20 16.28  ? 8    DT  P "O3'" 1 
ATOM   3864 C  "C2'" A DT  C 3 8   ? 48.368 0.143   3.531   0.80 21.43  ? 8    DT  P "C2'" 1 
ATOM   3865 C  "C2'" B DT  C 3 8   ? 48.453 1.251   2.743   0.20 20.36  ? 8    DT  P "C2'" 1 
ATOM   3866 C  "C1'" A DT  C 3 8   ? 47.270 -0.055  2.497   0.80 23.92  ? 8    DT  P "C1'" 1 
ATOM   3867 C  "C1'" B DT  C 3 8   ? 47.190 0.173   2.399   0.20 22.94  ? 8    DT  P "C1'" 1 
ATOM   3868 N  N1    A DT  C 3 8   ? 45.902 -0.253  3.124   0.80 22.24  ? 8    DT  P N1    1 
ATOM   3869 N  N1    B DT  C 3 8   ? 45.828 -0.060  2.944   0.20 22.69  ? 8    DT  P N1    1 
ATOM   3870 C  C2    A DT  C 3 8   ? 44.875 0.620   2.808   0.80 23.45  ? 8    DT  P C2    1 
ATOM   3871 C  C2    B DT  C 3 8   ? 44.798 0.776   2.576   0.20 23.71  ? 8    DT  P C2    1 
ATOM   3872 O  O2    A DT  C 3 8   ? 44.985 1.536   2.016   0.80 26.18  ? 8    DT  P O2    1 
ATOM   3873 O  O2    B DT  C 3 8   ? 44.930 1.698   1.790   0.20 25.27  ? 8    DT  P O2    1 
ATOM   3874 N  N3    A DT  C 3 8   ? 43.694 0.369   3.441   0.80 27.46  ? 8    DT  P N3    1 
ATOM   3875 N  N3    B DT  C 3 8   ? 43.593 0.482   3.152   0.20 26.56  ? 8    DT  P N3    1 
ATOM   3876 C  C4    A DT  C 3 8   ? 43.427 -0.626  4.345   0.80 24.72  ? 8    DT  P C4    1 
ATOM   3877 C  C4    B DT  C 3 8   ? 43.322 -0.533  4.050   0.20 24.82  ? 8    DT  P C4    1 
ATOM   3878 O  O4    A DT  C 3 8   ? 42.319 -0.763  4.857   0.80 28.13  ? 8    DT  P O4    1 
ATOM   3879 O  O4    B DT  C 3 8   ? 42.202 -0.715  4.516   0.20 26.83  ? 8    DT  P O4    1 
ATOM   3880 C  C5    A DT  C 3 8   ? 44.535 -1.494  4.654   0.80 21.84  ? 8    DT  P C5    1 
ATOM   3881 C  C5    B DT  C 3 8   ? 44.451 -1.362  4.404   0.20 22.70  ? 8    DT  P C5    1 
ATOM   3882 C  C7    A DT  C 3 8   ? 44.352 -2.618  5.635   0.80 25.45  ? 8    DT  P C7    1 
ATOM   3883 C  C7    B DT  C 3 8   ? 44.279 -2.497  5.371   0.20 25.42  ? 8    DT  P C7    1 
ATOM   3884 C  C6    A DT  C 3 8   ? 45.712 -1.264  4.040   0.80 20.77  ? 8    DT  P C6    1 
ATOM   3885 C  C6    B DT  C 3 8   ? 45.634 -1.083  3.844   0.20 21.94  ? 8    DT  P C6    1 
ATOM   3886 P  P     B DA  C 3 9   ? 50.967 1.516   3.918   0.20 18.23  ? 9    DA  P P     1 
ATOM   3887 O  OP1   B DA  C 3 9   ? 52.549 1.536   3.778   0.20 15.29  ? 9    DA  P OP1   1 
ATOM   3888 O  OP2   B DA  C 3 9   ? 50.470 0.805   5.191   0.20 17.29  ? 9    DA  P OP2   1 
ATOM   3889 O  "O5'" B DA  C 3 9   ? 50.335 2.942   3.826   0.20 16.84  ? 9    DA  P "O5'" 1 
ATOM   3890 C  "C5'" B DA  C 3 9   ? 50.875 4.050   3.110   0.20 16.07  ? 9    DA  P "C5'" 1 
ATOM   3891 C  "C4'" B DA  C 3 9   ? 49.937 5.244   3.161   0.20 13.99  ? 9    DA  P "C4'" 1 
ATOM   3892 O  "O4'" B DA  C 3 9   ? 48.604 4.830   2.766   0.20 15.23  ? 9    DA  P "O4'" 1 
ATOM   3893 C  "C3'" B DA  C 3 9   ? 49.764 5.867   4.534   0.20 14.26  ? 9    DA  P "C3'" 1 
ATOM   3894 O  "O3'" B DA  C 3 9   ? 50.790 6.823   4.773   0.20 12.67  ? 9    DA  P "O3'" 1 
ATOM   3895 C  "C2'" B DA  C 3 9   ? 48.394 6.529   4.408   0.20 14.90  ? 9    DA  P "C2'" 1 
ATOM   3896 C  "C1'" B DA  C 3 9   ? 47.636 5.528   3.533   0.20 16.86  ? 9    DA  P "C1'" 1 
ATOM   3897 N  N9    B DA  C 3 9   ? 46.857 4.557   4.300   0.20 16.83  ? 9    DA  P N9    1 
ATOM   3898 C  C8    B DA  C 3 9   ? 47.307 3.385   4.841   0.20 20.03  ? 9    DA  P C8    1 
ATOM   3899 N  N7    B DA  C 3 9   ? 46.382 2.705   5.478   0.20 19.42  ? 9    DA  P N7    1 
ATOM   3900 C  C5    B DA  C 3 9   ? 45.248 3.488   5.347   0.20 20.09  ? 9    DA  P C5    1 
ATOM   3901 C  C6    B DA  C 3 9   ? 43.924 3.325   5.806   0.20 23.57  ? 9    DA  P C6    1 
ATOM   3902 N  N6    B DA  C 3 9   ? 43.518 2.268   6.517   0.20 21.77  ? 9    DA  P N6    1 
ATOM   3903 N  N1    B DA  C 3 9   ? 43.033 4.294   5.505   0.20 21.70  ? 9    DA  P N1    1 
ATOM   3904 C  C2    B DA  C 3 9   ? 43.447 5.350   4.793   0.20 21.22  ? 9    DA  P C2    1 
ATOM   3905 N  N3    B DA  C 3 9   ? 44.660 5.613   4.309   0.20 19.46  ? 9    DA  P N3    1 
ATOM   3906 C  C4    B DA  C 3 9   ? 45.523 4.633   4.624   0.20 19.69  ? 9    DA  P C4    1 
HETATM 3907 MN MN    . MN  D 4 .   ? 52.751 0.396   2.069   0.90 13.91  ? 501  MN  A MN    1 
HETATM 3908 CA CA    A CA  E 5 .   ? 54.769 2.604   3.970   0.65 16.72  ? 502  CA  A CA    1 
HETATM 3909 MN MN    B MN  F 4 .   ? 54.767 2.601   3.970   0.35 16.68  ? 503  MN  A MN    1 
HETATM 3910 C  C1    . GOL G 6 .   ? 60.303 -24.936 12.059  1.00 29.71  ? 504  GOL A C1    1 
HETATM 3911 O  O1    . GOL G 6 .   ? 58.951 -24.625 12.315  1.00 20.48  ? 504  GOL A O1    1 
HETATM 3912 C  C2    . GOL G 6 .   ? 60.815 -24.303 10.754  1.00 26.55  ? 504  GOL A C2    1 
HETATM 3913 O  O2    . GOL G 6 .   ? 60.416 -22.959 10.624  1.00 17.33  ? 504  GOL A O2    1 
HETATM 3914 C  C3    . GOL G 6 .   ? 60.450 -25.131 9.516   1.00 29.47  ? 504  GOL A C3    1 
HETATM 3915 O  O3    . GOL G 6 .   ? 61.332 -24.838 8.447   1.00 19.94  ? 504  GOL A O3    1 
HETATM 3916 C  C1    . GOL H 6 .   ? 53.743 16.518  -7.188  1.00 40.98  ? 505  GOL A C1    1 
HETATM 3917 O  O1    . GOL H 6 .   ? 53.789 15.215  -6.639  1.00 17.50  ? 505  GOL A O1    1 
HETATM 3918 C  C2    . GOL H 6 .   ? 54.407 16.491  -8.561  1.00 42.83  ? 505  GOL A C2    1 
HETATM 3919 O  O2    . GOL H 6 .   ? 53.481 16.040  -9.529  1.00 35.19  ? 505  GOL A O2    1 
HETATM 3920 C  C3    . GOL H 6 .   ? 54.934 17.879  -8.914  1.00 39.37  ? 505  GOL A C3    1 
HETATM 3921 O  O3    . GOL H 6 .   ? 55.679 17.798  -10.110 1.00 50.81  ? 505  GOL A O3    1 
HETATM 3922 C  C1    . GOL I 6 .   ? 54.075 28.200  4.845   1.00 37.08  ? 506  GOL A C1    1 
HETATM 3923 O  O1    . GOL I 6 .   ? 52.768 27.862  4.413   1.00 42.71  ? 506  GOL A O1    1 
HETATM 3924 C  C2    . GOL I 6 .   ? 54.615 27.102  5.758   1.00 51.66  ? 506  GOL A C2    1 
HETATM 3925 O  O2    . GOL I 6 .   ? 54.071 25.846  5.399   1.00 51.83  ? 506  GOL A O2    1 
HETATM 3926 C  C3    . GOL I 6 .   ? 56.137 27.044  5.670   1.00 43.70  ? 506  GOL A C3    1 
HETATM 3927 O  O3    . GOL I 6 .   ? 56.655 26.064  6.555   1.00 33.21  ? 506  GOL A O3    1 
HETATM 3928 P  PG    A DTP J 7 .   ? 55.163 2.736   7.405   0.80 17.97  ? 507  DTP A PG    1 
HETATM 3929 O  O1G   A DTP J 7 .   ? 55.022 1.944   6.127   0.80 14.23  ? 507  DTP A O1G   1 
HETATM 3930 O  O2G   A DTP J 7 .   ? 56.488 3.481   7.483   0.80 12.81  ? 507  DTP A O2G   1 
HETATM 3931 O  O3G   A DTP J 7 .   ? 55.028 1.822   8.616   0.80 16.69  ? 507  DTP A O3G   1 
HETATM 3932 P  PB    A DTP J 7 .   ? 52.988 4.126   6.293   0.80 16.12  ? 507  DTP A PB    1 
HETATM 3933 O  O1B   A DTP J 7 .   ? 53.720 4.398   4.990   0.80 14.11  ? 507  DTP A O1B   1 
HETATM 3934 O  O2B   A DTP J 7 .   ? 52.203 5.351   6.682   0.80 15.50  ? 507  DTP A O2B   1 
HETATM 3935 O  O3B   A DTP J 7 .   ? 53.982 3.802   7.510   0.80 14.55  ? 507  DTP A O3B   1 
HETATM 3936 P  PA    A DTP J 7 .   ? 51.432 2.138   4.923   0.80 15.62  ? 507  DTP A PA    1 
HETATM 3937 O  O1A   A DTP J 7 .   ? 52.654 1.658   3.988   0.80 15.49  ? 507  DTP A O1A   1 
HETATM 3938 O  O2A   A DTP J 7 .   ? 50.515 0.950   5.391   0.80 16.36  ? 507  DTP A O2A   1 
HETATM 3939 O  O3A   A DTP J 7 .   ? 51.998 2.880   6.208   0.80 17.20  ? 507  DTP A O3A   1 
HETATM 3940 O  "O5'" A DTP J 7 .   ? 50.481 3.061   4.062   0.80 16.77  ? 507  DTP A "O5'" 1 
HETATM 3941 C  "C5'" A DTP J 7 .   ? 50.995 4.037   3.195   0.80 16.14  ? 507  DTP A "C5'" 1 
HETATM 3942 C  "C4'" A DTP J 7 .   ? 50.069 5.255   3.183   0.80 13.75  ? 507  DTP A "C4'" 1 
HETATM 3943 O  "O4'" A DTP J 7 .   ? 48.778 4.866   2.753   0.80 14.98  ? 507  DTP A "O4'" 1 
HETATM 3944 C  "C3'" A DTP J 7 .   ? 49.928 5.820   4.510   0.80 13.99  ? 507  DTP A "C3'" 1 
HETATM 3945 O  "O3'" A DTP J 7 .   ? 50.872 6.875   4.724   0.80 12.54  ? 507  DTP A "O3'" 1 
HETATM 3946 C  "C2'" A DTP J 7 .   ? 48.565 6.339   4.612   0.80 14.89  ? 507  DTP A "C2'" 1 
HETATM 3947 C  "C1'" A DTP J 7 .   ? 47.824 5.520   3.620   0.80 17.11  ? 507  DTP A "C1'" 1 
HETATM 3948 N  N9    A DTP J 7 .   ? 47.051 4.549   4.306   0.80 16.38  ? 507  DTP A N9    1 
HETATM 3949 C  C8    A DTP J 7 .   ? 47.497 3.383   4.823   0.80 20.18  ? 507  DTP A C8    1 
HETATM 3950 N  N7    A DTP J 7 .   ? 46.495 2.729   5.402   0.80 19.27  ? 507  DTP A N7    1 
HETATM 3951 C  C5    A DTP J 7 .   ? 45.369 3.445   5.270   0.80 19.75  ? 507  DTP A C5    1 
HETATM 3952 C  C6    A DTP J 7 .   ? 44.042 3.276   5.670   0.80 23.84  ? 507  DTP A C6    1 
HETATM 3953 N  N6    A DTP J 7 .   ? 43.660 2.090   6.384   0.80 20.46  ? 507  DTP A N6    1 
HETATM 3954 N  N1    A DTP J 7 .   ? 43.136 4.211   5.393   0.80 21.66  ? 507  DTP A N1    1 
HETATM 3955 C  C2    A DTP J 7 .   ? 43.462 5.338   4.722   0.80 21.25  ? 507  DTP A C2    1 
HETATM 3956 N  N3    A DTP J 7 .   ? 44.751 5.543   4.325   0.80 19.41  ? 507  DTP A N3    1 
HETATM 3957 C  C4    A DTP J 7 .   ? 45.706 4.623   4.580   0.80 19.44  ? 507  DTP A C4    1 
HETATM 3958 P  P1    B DPO K 8 .   ? 52.926 4.172   6.492   0.20 16.06  ? 508  DPO A P1    1 
HETATM 3959 O  O1    B DPO K 8 .   ? 53.574 4.298   5.132   0.20 14.53  ? 508  DPO A O1    1 
HETATM 3960 O  O2    B DPO K 8 .   ? 51.933 3.037   6.501   0.20 17.12  ? 508  DPO A O2    1 
HETATM 3961 O  O3    B DPO K 8 .   ? 52.208 5.455   6.828   0.20 15.64  ? 508  DPO A O3    1 
HETATM 3962 O  O4    B DPO K 8 .   ? 53.997 3.886   7.585   0.20 14.68  ? 508  DPO A O4    1 
HETATM 3963 P  P2    B DPO K 8 .   ? 55.035 2.734   7.416   0.20 17.76  ? 508  DPO A P2    1 
HETATM 3964 O  O5    B DPO K 8 .   ? 54.862 2.048   6.081   0.20 14.68  ? 508  DPO A O5    1 
HETATM 3965 O  O6    B DPO K 8 .   ? 54.837 1.730   8.526   0.20 16.54  ? 508  DPO A O6    1 
HETATM 3966 O  O7    B DPO K 8 .   ? 56.414 3.340   7.515   0.20 13.22  ? 508  DPO A O7    1 
HETATM 3967 MN MN    B MN  L 4 .   ? 51.146 0.908   7.084   0.20 18.55  ? 101  MN  P MN    1 
HETATM 3968 O  O     . HOH M 9 .   ? 57.603 12.030  -12.336 1.00 40.92  ? 601  HOH A O     1 
HETATM 3969 O  O     . HOH M 9 .   ? 13.765 11.474  5.082   1.00 46.57  ? 602  HOH A O     1 
HETATM 3970 O  O     . HOH M 9 .   ? 49.531 -26.790 18.770  1.00 43.66  ? 603  HOH A O     1 
HETATM 3971 O  O     . HOH M 9 .   ? 65.267 -25.273 -0.212  1.00 21.91  ? 604  HOH A O     1 
HETATM 3972 O  O     . HOH M 9 .   ? 68.088 -15.902 -7.696  1.00 22.16  ? 605  HOH A O     1 
HETATM 3973 O  O     B HOH M 9 .   ? 49.341 1.865   7.923   0.15 22.74  ? 606  HOH A O     1 
HETATM 3974 O  O     . HOH M 9 .   ? 67.894 -4.742  -17.087 1.00 38.58  ? 607  HOH A O     1 
HETATM 3975 O  O     . HOH M 9 .   ? 41.484 -30.270 -6.233  1.00 24.73  ? 608  HOH A O     1 
HETATM 3976 O  O     . HOH M 9 .   ? 43.298 9.694   -9.925  1.00 20.98  ? 609  HOH A O     1 
HETATM 3977 O  O     . HOH M 9 .   ? 50.870 -11.773 -10.062 1.00 33.02  ? 610  HOH A O     1 
HETATM 3978 O  O     . HOH M 9 .   ? 50.334 17.325  -5.846  1.00 34.06  ? 611  HOH A O     1 
HETATM 3979 O  O     . HOH M 9 .   ? 64.032 -24.242 -7.612  1.00 44.27  ? 612  HOH A O     1 
HETATM 3980 O  O     . HOH M 9 .   ? 77.708 -0.909  5.307   1.00 23.56  ? 613  HOH A O     1 
HETATM 3981 O  O     . HOH M 9 .   ? 60.688 -15.541 13.463  1.00 29.01  ? 614  HOH A O     1 
HETATM 3982 O  O     . HOH M 9 .   ? 52.923 24.073  4.264   1.00 31.85  ? 615  HOH A O     1 
HETATM 3983 O  O     . HOH M 9 .   ? 46.992 -0.610  -8.570  1.00 29.99  ? 616  HOH A O     1 
HETATM 3984 O  O     . HOH M 9 .   ? 56.820 -16.434 -11.246 1.00 26.41  ? 617  HOH A O     1 
HETATM 3985 O  O     . HOH M 9 .   ? 66.261 -2.493  12.600  1.00 31.36  ? 618  HOH A O     1 
HETATM 3986 O  O     . HOH M 9 .   ? 24.011 16.220  3.294   1.00 36.92  ? 619  HOH A O     1 
HETATM 3987 O  O     . HOH M 9 .   ? 76.161 1.070   -5.936  1.00 33.31  ? 620  HOH A O     1 
HETATM 3988 O  O     . HOH M 9 .   ? 34.635 5.551   1.921   1.00 23.55  ? 621  HOH A O     1 
HETATM 3989 O  O     . HOH M 9 .   ? 32.951 10.626  5.460   1.00 25.74  ? 622  HOH A O     1 
HETATM 3990 O  O     . HOH M 9 .   ? 51.559 11.391  -19.845 1.00 45.19  ? 623  HOH A O     1 
HETATM 3991 O  O     . HOH M 9 .   ? 69.269 10.027  -8.748  1.00 29.51  ? 624  HOH A O     1 
HETATM 3992 O  O     . HOH M 9 .   ? 81.088 -18.759 5.867   1.00 39.89  ? 625  HOH A O     1 
HETATM 3993 O  O     . HOH M 9 .   ? 68.133 -1.442  -14.025 1.00 33.77  ? 626  HOH A O     1 
HETATM 3994 O  O     . HOH M 9 .   ? 65.354 -6.738  -13.841 1.00 19.40  ? 627  HOH A O     1 
HETATM 3995 O  O     . HOH M 9 .   ? 69.476 -12.988 -11.654 1.00 27.48  ? 628  HOH A O     1 
HETATM 3996 O  O     . HOH M 9 .   ? 56.981 -34.589 8.509   1.00 30.49  ? 629  HOH A O     1 
HETATM 3997 O  O     . HOH M 9 .   ? 60.208 -28.256 8.565   1.00 33.42  ? 630  HOH A O     1 
HETATM 3998 O  O     . HOH M 9 .   ? 37.190 17.380  -6.456  1.00 33.50  ? 631  HOH A O     1 
HETATM 3999 O  O     . HOH M 9 .   ? 48.228 -36.706 2.623   1.00 23.03  ? 632  HOH A O     1 
HETATM 4000 O  O     . HOH M 9 .   ? 73.446 -20.532 1.050   1.00 32.31  ? 633  HOH A O     1 
HETATM 4001 O  O     . HOH M 9 .   ? 53.094 -28.167 15.110  1.00 18.07  ? 634  HOH A O     1 
HETATM 4002 O  O     . HOH M 9 .   ? 27.437 20.514  -6.566  1.00 36.53  ? 635  HOH A O     1 
HETATM 4003 O  O     . HOH M 9 .   ? 55.936 -2.876  4.116   1.00 32.69  ? 636  HOH A O     1 
HETATM 4004 O  O     . HOH M 9 .   ? 67.654 1.660   12.284  1.00 38.84  ? 637  HOH A O     1 
HETATM 4005 O  O     . HOH M 9 .   ? 61.106 -17.711 -13.034 1.00 41.94  ? 638  HOH A O     1 
HETATM 4006 O  O     . HOH M 9 .   ? 53.000 19.419  -1.387  1.00 26.35  ? 639  HOH A O     1 
HETATM 4007 O  O     . HOH M 9 .   ? 44.445 -32.754 -3.173  1.00 30.13  ? 640  HOH A O     1 
HETATM 4008 O  O     . HOH M 9 .   ? 51.701 5.762   9.306   1.00 16.90  ? 641  HOH A O     1 
HETATM 4009 O  O     . HOH M 9 .   ? 52.547 1.167   9.491   1.00 18.02  ? 642  HOH A O     1 
HETATM 4010 O  O     . HOH M 9 .   ? 58.241 -12.137 -11.324 1.00 14.86  ? 643  HOH A O     1 
HETATM 4011 O  O     . HOH M 9 .   ? 49.481 -9.269  -8.364  1.00 24.23  ? 644  HOH A O     1 
HETATM 4012 O  O     . HOH M 9 .   ? 80.596 -15.814 7.386   1.00 35.60  ? 645  HOH A O     1 
HETATM 4013 O  O     . HOH M 9 .   ? 47.952 -33.328 -3.623  1.00 30.19  ? 646  HOH A O     1 
HETATM 4014 O  O     . HOH M 9 .   ? 63.171 -7.335  12.706  1.00 25.98  ? 647  HOH A O     1 
HETATM 4015 O  O     . HOH M 9 .   ? 75.077 0.500   -3.567  1.00 31.47  ? 648  HOH A O     1 
HETATM 4016 O  O     . HOH M 9 .   ? 42.816 -25.202 17.320  1.00 31.86  ? 649  HOH A O     1 
HETATM 4017 O  O     . HOH M 9 .   ? 70.391 0.656   11.182  1.00 42.23  ? 650  HOH A O     1 
HETATM 4018 O  O     . HOH M 9 .   ? 65.555 5.754   2.194   1.00 23.08  ? 651  HOH A O     1 
HETATM 4019 O  O     . HOH M 9 .   ? 56.124 -14.000 -5.737  1.00 11.70  ? 652  HOH A O     1 
HETATM 4020 O  O     . HOH M 9 .   ? 60.822 20.744  12.167  1.00 34.54  ? 653  HOH A O     1 
HETATM 4021 O  O     . HOH M 9 .   ? 57.684 -23.405 14.218  1.00 12.32  ? 654  HOH A O     1 
HETATM 4022 O  O     . HOH M 9 .   ? 46.884 -22.637 17.235  1.00 26.53  ? 655  HOH A O     1 
HETATM 4023 O  O     . HOH M 9 .   ? 51.745 17.960  -9.748  1.00 33.39  ? 656  HOH A O     1 
HETATM 4024 O  O     . HOH M 9 .   ? 55.269 17.324  -0.553  1.00 11.67  ? 657  HOH A O     1 
HETATM 4025 O  O     . HOH M 9 .   ? 59.007 -18.450 -10.082 1.00 42.98  ? 658  HOH A O     1 
HETATM 4026 O  O     . HOH M 9 .   ? 57.588 -7.403  8.025   1.00 23.45  ? 659  HOH A O     1 
HETATM 4027 O  O     . HOH M 9 .   ? 34.163 5.998   -21.828 1.00 30.10  ? 660  HOH A O     1 
HETATM 4028 O  O     . HOH M 9 .   ? 48.663 13.423  28.270  1.00 31.09  ? 661  HOH A O     1 
HETATM 4029 O  O     . HOH M 9 .   ? 27.647 6.801   -16.998 1.00 29.79  ? 662  HOH A O     1 
HETATM 4030 O  O     . HOH M 9 .   ? 72.014 -7.808  11.625  1.00 21.07  ? 663  HOH A O     1 
HETATM 4031 O  O     . HOH M 9 .   ? 52.161 20.177  4.968   1.00 16.53  ? 664  HOH A O     1 
HETATM 4032 O  O     . HOH M 9 .   ? 59.612 14.043  -8.604  1.00 17.71  ? 665  HOH A O     1 
HETATM 4033 O  O     . HOH M 9 .   ? 36.834 16.018  -4.213  1.00 20.79  ? 666  HOH A O     1 
HETATM 4034 O  O     . HOH M 9 .   ? 52.093 15.684  -4.593  1.00 17.28  ? 667  HOH A O     1 
HETATM 4035 O  O     . HOH M 9 .   ? 70.259 -17.045 12.384  1.00 30.31  ? 668  HOH A O     1 
HETATM 4036 O  O     . HOH M 9 .   ? 41.343 16.890  -14.772 1.00 17.74  ? 669  HOH A O     1 
HETATM 4037 O  O     . HOH M 9 .   ? 30.706 1.979   -21.931 1.00 30.79  ? 670  HOH A O     1 
HETATM 4038 O  O     . HOH M 9 .   ? 37.192 13.762  21.539  1.00 31.80  ? 671  HOH A O     1 
HETATM 4039 O  O     . HOH M 9 .   ? 42.362 13.083  -23.608 1.00 40.50  ? 672  HOH A O     1 
HETATM 4040 O  O     . HOH M 9 .   ? 33.707 3.068   3.335   1.00 41.63  ? 673  HOH A O     1 
HETATM 4041 O  O     . HOH M 9 .   ? 63.834 -3.428  6.097   1.00 11.66  ? 674  HOH A O     1 
HETATM 4042 O  O     . HOH M 9 .   ? 58.923 26.888  7.620   1.00 28.46  ? 675  HOH A O     1 
HETATM 4043 O  O     . HOH M 9 .   ? 62.082 11.977  5.256   1.00 27.91  ? 676  HOH A O     1 
HETATM 4044 O  O     . HOH M 9 .   ? 58.181 -18.030 19.853  1.00 23.67  ? 677  HOH A O     1 
HETATM 4045 O  O     . HOH M 9 .   ? 68.597 16.148  -4.040  1.00 14.69  ? 678  HOH A O     1 
HETATM 4046 O  O     . HOH M 9 .   ? 52.707 -19.584 22.131  1.00 32.18  ? 679  HOH A O     1 
HETATM 4047 O  O     . HOH M 9 .   ? 53.957 15.567  23.283  1.00 32.88  ? 680  HOH A O     1 
HETATM 4048 O  O     . HOH M 9 .   ? 36.991 15.278  -20.328 1.00 37.91  ? 681  HOH A O     1 
HETATM 4049 O  O     . HOH M 9 .   ? 47.673 -27.177 -7.144  1.00 26.77  ? 682  HOH A O     1 
HETATM 4050 O  O     . HOH M 9 .   ? 40.431 11.336  -3.544  1.00 16.83  ? 683  HOH A O     1 
HETATM 4051 O  O     . HOH M 9 .   ? 70.852 3.459   -0.427  1.00 15.67  ? 684  HOH A O     1 
HETATM 4052 O  O     . HOH M 9 .   ? 46.522 -0.263  -14.900 1.00 22.46  ? 685  HOH A O     1 
HETATM 4053 O  O     . HOH M 9 .   ? 40.480 16.832  6.186   1.00 27.49  ? 686  HOH A O     1 
HETATM 4054 O  O     . HOH M 9 .   ? 50.820 5.876   -22.903 1.00 37.39  ? 687  HOH A O     1 
HETATM 4055 O  O     . HOH M 9 .   ? 34.529 14.813  11.509  1.00 25.24  ? 688  HOH A O     1 
HETATM 4056 O  O     . HOH M 9 .   ? 78.877 3.220   1.811   1.00 36.12  ? 689  HOH A O     1 
HETATM 4057 O  O     . HOH M 9 .   ? 40.151 8.848   26.982  1.00 28.15  ? 690  HOH A O     1 
HETATM 4058 O  O     . HOH M 9 .   ? 62.483 9.374   -13.688 1.00 42.35  ? 691  HOH A O     1 
HETATM 4059 O  O     . HOH M 9 .   ? 53.897 -9.449  5.424   1.00 20.39  ? 692  HOH A O     1 
HETATM 4060 O  O     . HOH M 9 .   ? 55.891 18.810  18.341  1.00 24.30  ? 693  HOH A O     1 
HETATM 4061 O  O     . HOH M 9 .   ? 48.798 2.739   21.228  1.00 25.67  ? 694  HOH A O     1 
HETATM 4062 O  O     . HOH M 9 .   ? 62.864 -26.513 7.043   1.00 20.34  ? 695  HOH A O     1 
HETATM 4063 O  O     . HOH M 9 .   ? 33.336 7.525   17.194  1.00 41.09  ? 696  HOH A O     1 
HETATM 4064 O  O     . HOH M 9 .   ? 67.134 -8.321  9.943   1.00 25.91  ? 697  HOH A O     1 
HETATM 4065 O  O     . HOH M 9 .   ? 60.613 -23.436 6.283   1.00 18.20  ? 698  HOH A O     1 
HETATM 4066 O  O     . HOH M 9 .   ? 43.142 -33.094 -0.313  1.00 21.46  ? 699  HOH A O     1 
HETATM 4067 O  O     . HOH M 9 .   ? 37.849 7.489   22.169  1.00 39.40  ? 700  HOH A O     1 
HETATM 4068 O  O     B HOH M 9 .   ? 49.382 4.571   7.601   0.15 18.94  ? 701  HOH A O     1 
HETATM 4069 O  O     . HOH M 9 .   ? 62.545 -17.092 -7.162  1.00 22.14  ? 702  HOH A O     1 
HETATM 4070 O  O     . HOH M 9 .   ? 67.322 6.632   0.664   1.00 27.75  ? 703  HOH A O     1 
HETATM 4071 O  O     . HOH M 9 .   ? 40.929 7.661   -18.531 1.00 21.43  ? 704  HOH A O     1 
HETATM 4072 O  O     . HOH M 9 .   ? 53.713 -28.460 4.155   1.00 17.09  ? 705  HOH A O     1 
HETATM 4073 O  O     . HOH M 9 .   ? 41.013 6.664   19.102  1.00 18.07  ? 706  HOH A O     1 
HETATM 4074 O  O     . HOH M 9 .   ? 53.439 13.382  -9.946  1.00 18.20  ? 707  HOH A O     1 
HETATM 4075 O  O     . HOH M 9 .   ? 59.706 11.515  -10.206 1.00 15.26  ? 708  HOH A O     1 
HETATM 4076 O  O     . HOH M 9 .   ? 76.263 2.659   6.643   1.00 22.41  ? 709  HOH A O     1 
HETATM 4077 O  O     . HOH M 9 .   ? 81.096 -11.017 -8.071  1.00 49.01  ? 710  HOH A O     1 
HETATM 4078 O  O     . HOH M 9 .   ? 46.275 -18.738 -2.499  1.00 34.01  ? 711  HOH A O     1 
HETATM 4079 O  O     . HOH M 9 .   ? 34.268 17.521  -12.675 1.00 35.47  ? 712  HOH A O     1 
HETATM 4080 O  O     . HOH M 9 .   ? 50.181 14.275  -19.785 1.00 45.30  ? 713  HOH A O     1 
HETATM 4081 O  O     . HOH M 9 .   ? 63.031 -19.070 -1.725  1.00 26.45  ? 714  HOH A O     1 
HETATM 4082 O  O     . HOH M 9 .   ? 54.079 -0.586  6.077   1.00 23.09  ? 715  HOH A O     1 
HETATM 4083 O  O     . HOH M 9 .   ? 67.417 -6.396  12.802  1.00 24.28  ? 716  HOH A O     1 
HETATM 4084 O  O     . HOH M 9 .   ? 35.749 10.878  0.817   1.00 25.09  ? 717  HOH A O     1 
HETATM 4085 O  O     . HOH M 9 .   ? 68.920 -17.526 -1.274  1.00 11.93  ? 718  HOH A O     1 
HETATM 4086 O  O     . HOH M 9 .   ? 67.167 -20.540 8.717   1.00 14.66  ? 719  HOH A O     1 
HETATM 4087 O  O     . HOH M 9 .   ? 52.527 3.569   17.835  1.00 28.11  ? 720  HOH A O     1 
HETATM 4088 O  O     . HOH M 9 .   ? 42.855 -1.384  -24.747 1.00 27.93  ? 721  HOH A O     1 
HETATM 4089 O  O     . HOH M 9 .   ? 69.806 -18.677 -9.581  1.00 33.54  ? 722  HOH A O     1 
HETATM 4090 O  O     . HOH M 9 .   ? 64.703 -9.358  12.277  1.00 39.40  ? 723  HOH A O     1 
HETATM 4091 O  O     . HOH M 9 .   ? 49.904 -17.190 15.465  1.00 20.00  ? 724  HOH A O     1 
HETATM 4092 O  O     . HOH M 9 .   ? 44.724 -14.269 10.402  1.00 15.99  ? 725  HOH A O     1 
HETATM 4093 O  O     . HOH M 9 .   ? 41.391 15.562  -22.926 1.00 29.20  ? 726  HOH A O     1 
HETATM 4094 O  O     . HOH M 9 .   ? 63.783 -9.430  -14.306 1.00 21.53  ? 727  HOH A O     1 
HETATM 4095 O  O     . HOH M 9 .   ? 53.489 -20.628 -2.483  1.00 18.75  ? 728  HOH A O     1 
HETATM 4096 O  O     . HOH M 9 .   ? 43.862 10.988  -12.300 1.00 22.62  ? 729  HOH A O     1 
HETATM 4097 O  O     . HOH M 9 .   ? 50.145 -14.938 -3.477  1.00 35.58  ? 730  HOH A O     1 
HETATM 4098 O  O     . HOH M 9 .   ? 25.749 11.132  14.290  1.00 52.77  ? 731  HOH A O     1 
HETATM 4099 O  O     . HOH M 9 .   ? 49.636 -3.167  -17.211 1.00 24.71  ? 732  HOH A O     1 
HETATM 4100 O  O     . HOH M 9 .   ? 62.238 14.774  -9.166  1.00 16.01  ? 733  HOH A O     1 
HETATM 4101 O  O     . HOH M 9 .   ? 66.825 -16.591 9.652   1.00 10.87  ? 734  HOH A O     1 
HETATM 4102 O  O     . HOH M 9 .   ? 70.440 -18.997 1.331   1.00 16.78  ? 735  HOH A O     1 
HETATM 4103 O  O     . HOH M 9 .   ? 59.678 10.413  19.834  1.00 20.34  ? 736  HOH A O     1 
HETATM 4104 O  O     . HOH M 9 .   ? 48.169 19.644  4.698   1.00 30.71  ? 737  HOH A O     1 
HETATM 4105 O  O     . HOH M 9 .   ? 59.731 13.047  11.320  1.00 27.48  ? 738  HOH A O     1 
HETATM 4106 O  O     . HOH M 9 .   ? 48.288 -22.200 -5.609  1.00 19.42  ? 739  HOH A O     1 
HETATM 4107 O  O     . HOH M 9 .   ? 55.193 -1.445  -14.815 1.00 27.27  ? 740  HOH A O     1 
HETATM 4108 O  O     . HOH M 9 .   ? 52.725 -26.374 -3.962  1.00 25.35  ? 741  HOH A O     1 
HETATM 4109 O  O     . HOH M 9 .   ? 45.399 15.780  -1.516  1.00 16.28  ? 742  HOH A O     1 
HETATM 4110 O  O     . HOH M 9 .   ? 46.712 16.336  25.562  1.00 24.08  ? 743  HOH A O     1 
HETATM 4111 O  O     . HOH M 9 .   ? 43.364 12.018  -7.178  1.00 16.91  ? 744  HOH A O     1 
HETATM 4112 O  O     . HOH M 9 .   ? 46.586 19.409  1.298   1.00 22.07  ? 745  HOH A O     1 
HETATM 4113 O  O     . HOH M 9 .   ? 59.159 11.084  8.596   1.00 15.49  ? 746  HOH A O     1 
HETATM 4114 O  O     . HOH M 9 .   ? 66.348 3.815   10.774  1.00 29.17  ? 747  HOH A O     1 
HETATM 4115 O  O     . HOH M 9 .   ? 51.271 5.227   -10.921 1.00 21.90  ? 748  HOH A O     1 
HETATM 4116 O  O     . HOH M 9 .   ? 31.859 -1.422  -2.942  1.00 39.08  ? 749  HOH A O     1 
HETATM 4117 O  O     . HOH M 9 .   ? 41.107 21.480  2.349   1.00 28.23  ? 750  HOH A O     1 
HETATM 4118 O  O     . HOH M 9 .   ? 36.960 18.589  16.808  1.00 43.38  ? 751  HOH A O     1 
HETATM 4119 O  O     . HOH M 9 .   ? 51.251 6.251   -18.942 1.00 31.15  ? 752  HOH A O     1 
HETATM 4120 O  O     . HOH M 9 .   ? 45.701 1.858   18.642  1.00 44.03  ? 753  HOH A O     1 
HETATM 4121 O  O     . HOH M 9 .   ? 49.699 -8.797  12.820  1.00 32.02  ? 754  HOH A O     1 
HETATM 4122 O  O     . HOH M 9 .   ? 59.216 4.892   16.758  1.00 20.01  ? 755  HOH A O     1 
HETATM 4123 O  O     . HOH M 9 .   ? 59.882 -18.157 -7.819  1.00 24.98  ? 756  HOH A O     1 
HETATM 4124 O  O     . HOH M 9 .   ? 71.272 5.961   -7.288  1.00 17.91  ? 757  HOH A O     1 
HETATM 4125 O  O     . HOH M 9 .   ? 21.450 13.465  6.779   1.00 45.09  ? 758  HOH A O     1 
HETATM 4126 O  O     . HOH M 9 .   ? 47.356 -16.465 -0.753  1.00 26.14  ? 759  HOH A O     1 
HETATM 4127 O  O     . HOH M 9 .   ? 50.916 -8.628  -5.265  1.00 28.56  ? 760  HOH A O     1 
HETATM 4128 O  O     . HOH M 9 .   ? 51.087 5.434   -8.276  1.00 20.08  ? 761  HOH A O     1 
HETATM 4129 O  O     . HOH M 9 .   ? 42.500 15.444  23.761  1.00 23.15  ? 762  HOH A O     1 
HETATM 4130 O  O     . HOH M 9 .   ? 83.531 -5.201  2.384   1.00 28.66  ? 763  HOH A O     1 
HETATM 4131 O  O     . HOH M 9 .   ? 57.868 -27.416 11.334  1.00 21.79  ? 764  HOH A O     1 
HETATM 4132 O  O     A HOH M 9 .   ? 58.173 -0.379  4.806   0.50 14.28  ? 765  HOH A O     1 
HETATM 4133 O  O     . HOH M 9 .   ? 71.763 -3.790  -13.769 1.00 25.03  ? 766  HOH A O     1 
HETATM 4134 O  O     . HOH M 9 .   ? 62.285 7.584   7.128   1.00 13.77  ? 767  HOH A O     1 
HETATM 4135 O  O     . HOH M 9 .   ? 53.388 6.168   -12.323 1.00 23.09  ? 768  HOH A O     1 
HETATM 4136 O  O     . HOH M 9 .   ? 43.603 -14.488 5.738   1.00 14.62  ? 769  HOH A O     1 
HETATM 4137 O  O     . HOH M 9 .   ? 44.890 16.976  -18.125 1.00 38.01  ? 770  HOH A O     1 
HETATM 4138 O  O     A HOH M 9 .   ? 48.358 -0.000  9.798   0.60 27.57  ? 771  HOH A O     1 
HETATM 4139 O  O     . HOH M 9 .   ? 61.301 -31.591 -10.400 1.00 44.57  ? 772  HOH A O     1 
HETATM 4140 O  O     . HOH M 9 .   ? 45.813 7.293   -12.747 1.00 32.53  ? 773  HOH A O     1 
HETATM 4141 O  O     . HOH M 9 .   ? 71.530 -19.052 14.277  1.00 36.37  ? 774  HOH A O     1 
HETATM 4142 O  O     . HOH M 9 .   ? 49.859 2.999   12.755  1.00 28.34  ? 775  HOH A O     1 
HETATM 4143 O  O     . HOH M 9 .   ? 45.268 17.936  -3.438  1.00 31.50  ? 776  HOH A O     1 
HETATM 4144 O  O     . HOH M 9 .   ? 65.017 12.840  3.127   1.00 35.09  ? 777  HOH A O     1 
HETATM 4145 O  O     . HOH M 9 .   ? 52.278 -5.427  -0.821  1.00 24.76  ? 778  HOH A O     1 
HETATM 4146 O  O     . HOH M 9 .   ? 64.992 19.467  6.388   1.00 38.03  ? 779  HOH A O     1 
HETATM 4147 O  O     . HOH M 9 .   ? 40.292 -28.579 -9.857  1.00 32.39  ? 780  HOH A O     1 
HETATM 4148 O  O     . HOH M 9 .   ? 52.787 -12.665 -4.059  1.00 30.08  ? 781  HOH A O     1 
HETATM 4149 O  O     . HOH M 9 .   ? 70.344 -16.075 7.644   1.00 13.49  ? 782  HOH A O     1 
HETATM 4150 O  O     . HOH M 9 .   ? 65.296 -22.924 3.237   1.00 14.12  ? 783  HOH A O     1 
HETATM 4151 O  O     . HOH M 9 .   ? 45.641 20.422  11.391  1.00 25.43  ? 784  HOH A O     1 
HETATM 4152 O  O     . HOH M 9 .   ? 64.439 6.537   -0.428  1.00 26.45  ? 785  HOH A O     1 
HETATM 4153 O  O     . HOH M 9 .   ? 49.658 -15.809 -8.839  1.00 32.33  ? 786  HOH A O     1 
HETATM 4154 O  O     . HOH M 9 .   ? 39.093 -2.076  -14.110 1.00 28.19  ? 787  HOH A O     1 
HETATM 4155 O  O     . HOH M 9 .   ? 63.285 -17.250 15.160  1.00 31.38  ? 788  HOH A O     1 
HETATM 4156 O  O     . HOH M 9 .   ? 43.792 -15.111 1.552   1.00 19.88  ? 789  HOH A O     1 
HETATM 4157 O  O     . HOH M 9 .   ? 65.581 -15.270 11.736  1.00 20.81  ? 790  HOH A O     1 
HETATM 4158 O  O     . HOH M 9 .   ? 56.288 1.148   13.323  1.00 26.30  ? 791  HOH A O     1 
HETATM 4159 O  O     . HOH M 9 .   ? 53.317 7.469   -14.660 1.00 28.45  ? 792  HOH A O     1 
HETATM 4160 O  O     . HOH M 9 .   ? 51.460 -35.121 7.884   1.00 31.74  ? 793  HOH A O     1 
HETATM 4161 O  O     . HOH M 9 .   ? 52.327 8.464   25.729  1.00 31.77  ? 794  HOH A O     1 
HETATM 4162 O  O     . HOH M 9 .   ? 62.745 12.703  -10.769 1.00 25.95  ? 795  HOH A O     1 
HETATM 4163 O  O     . HOH M 9 .   ? 60.492 14.073  6.306   1.00 28.00  ? 796  HOH A O     1 
HETATM 4164 O  O     . HOH M 9 .   ? 58.795 4.568   22.992  1.00 29.58  ? 797  HOH A O     1 
HETATM 4165 O  O     . HOH M 9 .   ? 44.137 10.275  -24.557 1.00 38.96  ? 798  HOH A O     1 
HETATM 4166 O  O     . HOH M 9 .   ? 60.161 6.239   -15.792 1.00 32.94  ? 799  HOH A O     1 
HETATM 4167 O  O     . HOH M 9 .   ? 52.931 -33.299 -0.103  1.00 22.51  ? 800  HOH A O     1 
HETATM 4168 O  O     . HOH M 9 .   ? 38.054 -25.379 6.132   1.00 38.51  ? 801  HOH A O     1 
HETATM 4169 O  O     . HOH M 9 .   ? 60.146 -18.471 -4.555  1.00 13.61  ? 802  HOH A O     1 
HETATM 4170 O  O     . HOH M 9 .   ? 44.888 0.686   -18.470 1.00 24.10  ? 803  HOH A O     1 
HETATM 4171 O  O     . HOH M 9 .   ? 65.596 8.691   8.903   1.00 25.80  ? 804  HOH A O     1 
HETATM 4172 O  O     . HOH M 9 .   ? 38.302 -17.994 10.217  1.00 24.85  ? 805  HOH A O     1 
HETATM 4173 O  O     . HOH M 9 .   ? 62.922 -23.701 3.257   1.00 23.83  ? 806  HOH A O     1 
HETATM 4174 O  O     . HOH M 9 .   ? 46.114 -9.374  10.846  1.00 30.43  ? 807  HOH A O     1 
HETATM 4175 O  O     . HOH M 9 .   ? 68.297 -21.141 -8.800  1.00 44.66  ? 808  HOH A O     1 
HETATM 4176 O  O     . HOH M 9 .   ? 48.575 -9.425  10.624  1.00 26.90  ? 809  HOH A O     1 
HETATM 4177 O  O     . HOH M 9 .   ? 34.553 19.745  -16.308 1.00 33.12  ? 810  HOH A O     1 
HETATM 4178 O  O     . HOH M 9 .   ? 50.468 -6.396  -5.499  1.00 35.04  ? 811  HOH A O     1 
HETATM 4179 O  O     . HOH M 9 .   ? 72.970 -7.376  8.919   1.00 15.80  ? 812  HOH A O     1 
HETATM 4180 O  O     . HOH M 9 .   ? 40.724 -1.433  -16.292 1.00 31.16  ? 813  HOH A O     1 
HETATM 4181 O  O     . HOH M 9 .   ? 55.675 -32.810 5.087   1.00 32.77  ? 814  HOH A O     1 
HETATM 4182 O  O     . HOH M 9 .   ? 33.980 15.195  18.829  1.00 34.78  ? 815  HOH A O     1 
HETATM 4183 O  O     . HOH M 9 .   ? 51.135 8.727   -15.263 1.00 30.17  ? 816  HOH A O     1 
HETATM 4184 O  O     . HOH M 9 .   ? 68.893 -13.587 5.000   1.00 15.84  ? 817  HOH A O     1 
HETATM 4185 O  O     . HOH M 9 .   ? 21.839 11.890  -9.517  1.00 35.71  ? 818  HOH A O     1 
HETATM 4186 O  O     . HOH M 9 .   ? 55.704 -33.059 2.538   1.00 33.35  ? 819  HOH A O     1 
HETATM 4187 O  O     . HOH M 9 .   ? 65.331 -22.227 -7.840  1.00 30.11  ? 820  HOH A O     1 
HETATM 4188 O  O     . HOH M 9 .   ? 37.738 10.665  21.408  1.00 38.90  ? 821  HOH A O     1 
HETATM 4189 O  O     . HOH M 9 .   ? 54.853 -1.350  12.002  1.00 39.74  ? 822  HOH A O     1 
HETATM 4190 O  O     . HOH M 9 .   ? 67.883 -14.544 -10.163 1.00 23.59  ? 823  HOH A O     1 
HETATM 4191 O  O     . HOH M 9 .   ? 40.183 22.452  -2.364  1.00 52.67  ? 824  HOH A O     1 
HETATM 4192 O  O     . HOH M 9 .   ? 46.046 16.621  1.299   1.00 12.83  ? 825  HOH A O     1 
HETATM 4193 O  O     . HOH M 9 .   ? 41.417 20.217  4.758   1.00 32.07  ? 826  HOH A O     1 
HETATM 4194 O  O     . HOH M 9 .   ? 68.815 -10.639 11.988  1.00 27.12  ? 827  HOH A O     1 
HETATM 4195 O  O     . HOH M 9 .   ? 72.879 2.311   8.049   1.00 40.45  ? 828  HOH A O     1 
HETATM 4196 O  O     . HOH M 9 .   ? 45.559 17.758  -9.847  1.00 43.37  ? 829  HOH A O     1 
HETATM 4197 O  O     . HOH M 9 .   ? 42.243 -18.659 15.036  1.00 24.81  ? 830  HOH A O     1 
HETATM 4198 O  O     . HOH M 9 .   ? 14.556 14.888  -1.417  1.00 54.13  ? 831  HOH A O     1 
HETATM 4199 O  O     . HOH M 9 .   ? 44.313 -16.771 -0.330  1.00 28.13  ? 832  HOH A O     1 
HETATM 4200 O  O     . HOH M 9 .   ? 36.517 12.879  12.075  1.00 26.25  ? 833  HOH A O     1 
HETATM 4201 O  O     . HOH M 9 .   ? 46.625 -8.615  -4.482  1.00 32.69  ? 834  HOH A O     1 
HETATM 4202 O  O     . HOH M 9 .   ? 42.982 -2.581  -20.089 1.00 29.10  ? 835  HOH A O     1 
HETATM 4203 O  O     . HOH M 9 .   ? 48.872 -34.486 10.299  1.00 31.37  ? 836  HOH A O     1 
HETATM 4204 O  O     . HOH M 9 .   ? 23.253 14.363  -9.432  1.00 35.45  ? 837  HOH A O     1 
HETATM 4205 O  O     . HOH M 9 .   ? 54.472 -11.379 3.556   1.00 15.60  ? 838  HOH A O     1 
HETATM 4206 O  O     . HOH M 9 .   ? 41.117 -2.946  -23.015 1.00 25.31  ? 839  HOH A O     1 
HETATM 4207 O  O     . HOH M 9 .   ? 41.069 -23.869 -4.955  1.00 21.57  ? 840  HOH A O     1 
HETATM 4208 O  O     . HOH M 9 .   ? 40.653 -29.813 13.033  1.00 39.19  ? 841  HOH A O     1 
HETATM 4209 O  O     . HOH M 9 .   ? 61.735 -13.266 -13.626 1.00 33.39  ? 842  HOH A O     1 
HETATM 4210 O  O     . HOH M 9 .   ? 82.640 -3.588  -4.392  1.00 36.69  ? 843  HOH A O     1 
HETATM 4211 O  O     . HOH M 9 .   ? 49.865 20.879  8.784   1.00 33.55  ? 844  HOH A O     1 
HETATM 4212 O  O     . HOH M 9 .   ? 41.868 -22.510 -2.489  1.00 18.95  ? 845  HOH A O     1 
HETATM 4213 O  O     . HOH M 9 .   ? 50.301 -34.616 -0.744  1.00 25.68  ? 846  HOH A O     1 
HETATM 4214 O  O     . HOH M 9 .   ? 48.913 -15.583 13.612  1.00 17.68  ? 847  HOH A O     1 
HETATM 4215 O  O     . HOH M 9 .   ? 70.911 -12.060 14.296  1.00 37.46  ? 848  HOH A O     1 
HETATM 4216 O  O     . HOH M 9 .   ? 31.014 19.186  11.069  1.00 41.78  ? 849  HOH A O     1 
HETATM 4217 O  O     . HOH M 9 .   ? 46.627 -14.438 14.914  1.00 34.32  ? 850  HOH A O     1 
HETATM 4218 O  O     . HOH M 9 .   ? 69.077 4.556   3.710   1.00 24.93  ? 851  HOH A O     1 
HETATM 4219 O  O     . HOH M 9 .   ? 59.251 9.605   10.741  1.00 12.24  ? 852  HOH A O     1 
HETATM 4220 O  O     . HOH M 9 .   ? 39.120 18.388  18.115  1.00 32.81  ? 853  HOH A O     1 
HETATM 4221 O  O     . HOH M 9 .   ? 51.073 21.523  7.253   1.00 26.22  ? 854  HOH A O     1 
HETATM 4222 O  O     . HOH M 9 .   ? 55.404 -35.108 11.068  1.00 32.73  ? 855  HOH A O     1 
HETATM 4223 O  O     . HOH M 9 .   ? 53.367 -8.445  8.767   1.00 28.76  ? 856  HOH A O     1 
HETATM 4224 O  O     . HOH M 9 .   ? 32.809 2.500   -0.124  1.00 38.92  ? 857  HOH A O     1 
HETATM 4225 O  O     . HOH M 9 .   ? 69.158 8.285   4.160   1.00 39.80  ? 858  HOH A O     1 
HETATM 4226 O  O     . HOH M 9 .   ? 29.344 3.844   6.746   1.00 44.30  ? 859  HOH A O     1 
HETATM 4227 O  O     . HOH M 9 .   ? 35.260 20.693  0.728   1.00 27.27  ? 860  HOH A O     1 
HETATM 4228 O  O     . HOH M 9 .   ? 57.133 5.511   -15.765 1.00 33.52  ? 861  HOH A O     1 
HETATM 4229 O  O     . HOH M 9 .   ? 65.487 -4.318  -15.414 1.00 28.51  ? 862  HOH A O     1 
HETATM 4230 O  O     . HOH M 9 .   ? 63.232 -11.523 12.832  1.00 44.95  ? 863  HOH A O     1 
HETATM 4231 O  O     . HOH M 9 .   ? 80.479 -3.779  14.098  1.00 39.52  ? 864  HOH A O     1 
HETATM 4232 O  O     . HOH M 9 .   ? 59.893 14.399  3.392   1.00 30.75  ? 865  HOH A O     1 
HETATM 4233 O  O     . HOH M 9 .   ? 55.719 -3.430  8.203   1.00 31.89  ? 866  HOH A O     1 
HETATM 4234 O  O     . HOH M 9 .   ? 69.633 -8.794  10.792  1.00 25.15  ? 867  HOH A O     1 
HETATM 4235 O  O     . HOH M 9 .   ? 47.118 2.339   -0.951  1.00 20.43  ? 868  HOH A O     1 
HETATM 4236 O  O     . HOH M 9 .   ? 53.583 17.245  -3.022  1.00 18.64  ? 869  HOH A O     1 
HETATM 4237 O  O     . HOH M 9 .   ? 57.311 23.531  14.158  1.00 35.53  ? 870  HOH A O     1 
HETATM 4238 O  O     . HOH M 9 .   ? 35.332 22.524  -3.280  1.00 37.24  ? 871  HOH A O     1 
HETATM 4239 O  O     . HOH M 9 .   ? 49.107 -14.804 18.465  1.00 38.81  ? 872  HOH A O     1 
HETATM 4240 O  O     . HOH M 9 .   ? 28.814 8.329   -18.970 1.00 28.54  ? 873  HOH A O     1 
HETATM 4241 O  O     . HOH M 9 .   ? 48.915 7.201   -7.604  1.00 23.66  ? 874  HOH A O     1 
HETATM 4242 O  O     . HOH M 9 .   ? 57.303 -0.192  -14.623 1.00 27.34  ? 875  HOH A O     1 
HETATM 4243 O  O     . HOH M 9 .   ? 42.605 -8.530  9.729   1.00 39.39  ? 876  HOH A O     1 
HETATM 4244 O  O     . HOH M 9 .   ? 53.777 -32.429 -2.659  1.00 43.22  ? 877  HOH A O     1 
HETATM 4245 O  O     . HOH M 9 .   ? 74.929 -22.406 -6.363  1.00 44.72  ? 878  HOH A O     1 
HETATM 4246 O  O     . HOH M 9 .   ? 45.616 5.109   -4.673  1.00 29.44  ? 879  HOH A O     1 
HETATM 4247 O  O     . HOH M 9 .   ? 65.491 3.479   -17.862 1.00 42.06  ? 880  HOH A O     1 
HETATM 4248 O  O     . HOH M 9 .   ? 17.636 -3.120  -5.863  1.00 55.13  ? 881  HOH A O     1 
HETATM 4249 O  O     . HOH M 9 .   ? 61.339 14.535  8.644   1.00 24.99  ? 882  HOH A O     1 
HETATM 4250 O  O     . HOH M 9 .   ? 62.037 -2.287  12.566  1.00 29.86  ? 883  HOH A O     1 
HETATM 4251 O  O     . HOH M 9 .   ? 18.934 14.490  6.400   1.00 45.71  ? 884  HOH A O     1 
HETATM 4252 O  O     . HOH M 9 .   ? 38.009 10.443  9.528   1.00 29.52  ? 885  HOH A O     1 
HETATM 4253 O  O     . HOH M 9 .   ? 50.281 -13.131 -0.957  1.00 29.26  ? 886  HOH A O     1 
HETATM 4254 O  O     . HOH M 9 .   ? 80.809 -4.156  22.988  1.00 52.94  ? 887  HOH A O     1 
HETATM 4255 O  O     . HOH M 9 .   ? 58.269 18.909  -8.768  1.00 30.20  ? 888  HOH A O     1 
HETATM 4256 O  O     . HOH M 9 .   ? 46.850 0.665   14.015  1.00 39.89  ? 889  HOH A O     1 
HETATM 4257 O  O     . HOH M 9 .   ? 43.102 19.910  -11.828 1.00 41.03  ? 890  HOH A O     1 
HETATM 4258 O  O     . HOH M 9 .   ? 40.457 -18.171 1.113   1.00 39.66  ? 891  HOH A O     1 
HETATM 4259 O  O     . HOH M 9 .   ? 61.561 24.062  9.864   1.00 28.35  ? 892  HOH A O     1 
HETATM 4260 O  O     . HOH M 9 .   ? 61.158 16.156  4.613   1.00 36.07  ? 893  HOH A O     1 
HETATM 4261 O  O     . HOH M 9 .   ? 30.709 21.774  -3.299  1.00 29.44  ? 894  HOH A O     1 
HETATM 4262 O  O     . HOH M 9 .   ? 83.689 -7.815  1.150   1.00 43.86  ? 895  HOH A O     1 
HETATM 4263 O  O     . HOH M 9 .   ? 49.218 8.398   -13.539 1.00 27.51  ? 896  HOH A O     1 
HETATM 4264 O  O     . HOH M 9 .   ? 51.005 4.744   24.915  1.00 40.02  ? 897  HOH A O     1 
HETATM 4265 O  O     . HOH M 9 .   ? 43.176 17.497  18.147  1.00 36.62  ? 898  HOH A O     1 
HETATM 4266 O  O     . HOH M 9 .   ? 52.709 -1.407  8.351   1.00 34.56  ? 899  HOH A O     1 
HETATM 4267 O  O     . HOH M 9 .   ? 47.259 21.785  9.672   1.00 35.26  ? 900  HOH A O     1 
HETATM 4268 O  O     . HOH M 9 .   ? 61.477 1.871   14.289  1.00 39.07  ? 901  HOH A O     1 
HETATM 4269 O  O     . HOH M 9 .   ? 51.674 -18.036 -6.256  1.00 32.84  ? 902  HOH A O     1 
HETATM 4270 O  O     . HOH M 9 .   ? 57.185 -19.062 21.980  1.00 30.71  ? 903  HOH A O     1 
HETATM 4271 O  O     . HOH M 9 .   ? 52.923 -20.156 -5.074  1.00 34.66  ? 904  HOH A O     1 
HETATM 4272 O  O     . HOH M 9 .   ? 42.282 -20.825 17.027  1.00 49.45  ? 905  HOH A O     1 
HETATM 4273 O  O     . HOH M 9 .   ? 43.750 -28.880 15.880  1.00 43.16  ? 906  HOH A O     1 
HETATM 4274 O  O     . HOH M 9 .   ? 38.184 13.448  24.585  1.00 40.45  ? 907  HOH A O     1 
HETATM 4275 O  O     . HOH M 9 .   ? 38.621 -3.699  -20.099 1.00 26.90  ? 908  HOH A O     1 
HETATM 4276 O  O     . HOH M 9 .   ? 51.437 -33.754 11.180  1.00 43.11  ? 909  HOH A O     1 
HETATM 4277 O  O     . HOH M 9 .   ? 42.507 10.677  -26.084 1.00 50.61  ? 910  HOH A O     1 
HETATM 4278 O  O     . HOH M 9 .   ? 32.274 3.061   -23.558 1.00 40.78  ? 911  HOH A O     1 
HETATM 4279 O  O     . HOH M 9 .   ? 51.488 -8.748  5.021   1.00 27.96  ? 912  HOH A O     1 
HETATM 4280 O  O     . HOH M 9 .   ? 44.754 7.266   -10.293 1.00 15.93  ? 913  HOH A O     1 
HETATM 4281 O  O     . HOH M 9 .   ? 25.569 14.604  5.019   1.00 33.63  ? 914  HOH A O     1 
HETATM 4282 O  O     . HOH M 9 .   ? 61.445 4.708   -17.004 1.00 39.33  ? 915  HOH A O     1 
HETATM 4283 O  O     . HOH M 9 .   ? 39.767 -22.568 3.146   1.00 36.40  ? 916  HOH A O     1 
HETATM 4284 O  O     . HOH M 9 .   ? 61.850 16.019  2.481   1.00 27.98  ? 917  HOH A O     1 
HETATM 4285 O  O     . HOH M 9 .   ? 48.088 -30.895 -6.875  1.00 43.93  ? 918  HOH A O     1 
HETATM 4286 O  O     . HOH M 9 .   ? 43.772 0.418   -21.185 1.00 34.63  ? 919  HOH A O     1 
HETATM 4287 O  O     . HOH M 9 .   ? 46.966 15.830  -23.462 1.00 25.15  ? 920  HOH A O     1 
HETATM 4288 O  O     . HOH M 9 .   ? 51.187 3.385   10.569  1.00 25.51  ? 921  HOH A O     1 
HETATM 4289 O  O     . HOH M 9 .   ? 50.530 -1.394  12.603  1.00 36.29  ? 922  HOH A O     1 
HETATM 4290 O  O     . HOH M 9 .   ? 61.045 10.070  7.188   1.00 30.64  ? 923  HOH A O     1 
HETATM 4291 O  O     . HOH M 9 .   ? 48.208 21.931  3.284   1.00 38.67  ? 924  HOH A O     1 
HETATM 4292 O  O     . HOH M 9 .   ? 52.416 -18.162 -11.344 1.00 38.59  ? 925  HOH A O     1 
HETATM 4293 O  O     . HOH M 9 .   ? 58.822 -12.954 15.061  1.00 39.49  ? 926  HOH A O     1 
HETATM 4294 O  O     . HOH M 9 .   ? 54.321 -33.892 12.713  1.00 40.82  ? 927  HOH A O     1 
HETATM 4295 O  O     . HOH M 9 .   ? 47.782 10.523  -9.493  1.00 25.68  ? 928  HOH A O     1 
HETATM 4296 O  O     . HOH M 9 .   ? 61.672 8.140   16.482  1.00 32.51  ? 929  HOH A O     1 
HETATM 4297 O  O     . HOH M 9 .   ? 33.853 22.298  -0.646  1.00 42.26  ? 930  HOH A O     1 
HETATM 4298 O  O     . HOH M 9 .   ? 38.311 -27.854 6.950   1.00 35.62  ? 931  HOH A O     1 
HETATM 4299 O  O     . HOH M 9 .   ? 53.226 5.292   -16.848 1.00 42.04  ? 932  HOH A O     1 
HETATM 4300 O  O     . HOH M 9 .   ? 40.129 -18.297 -1.490  1.00 35.76  ? 933  HOH A O     1 
HETATM 4301 O  O     . HOH M 9 .   ? 38.795 -18.923 5.413   1.00 42.22  ? 934  HOH A O     1 
HETATM 4302 O  O     . HOH M 9 .   ? 35.235 -1.695  -23.962 1.00 57.32  ? 935  HOH A O     1 
HETATM 4303 O  O     . HOH M 9 .   ? 48.031 -24.056 19.813  1.00 36.00  ? 936  HOH A O     1 
HETATM 4304 O  O     . HOH M 9 .   ? 39.327 4.452   17.724  1.00 53.44  ? 937  HOH A O     1 
HETATM 4305 O  O     . HOH M 9 .   ? 55.190 -7.329  6.565   1.00 28.85  ? 938  HOH A O     1 
HETATM 4306 O  O     . HOH M 9 .   ? 64.229 -15.457 13.877  1.00 30.06  ? 939  HOH A O     1 
HETATM 4307 O  O     . HOH M 9 .   ? 54.958 -17.395 -13.206 1.00 38.05  ? 940  HOH A O     1 
HETATM 4308 O  O     . HOH M 9 .   ? 42.772 17.370  -16.840 1.00 33.22  ? 941  HOH A O     1 
HETATM 4309 O  O     . HOH M 9 .   ? 44.988 -1.564  -24.353 1.00 42.39  ? 942  HOH A O     1 
HETATM 4310 O  O     . HOH M 9 .   ? 49.338 -0.129  -16.350 1.00 30.38  ? 943  HOH A O     1 
HETATM 4311 O  O     . HOH M 9 .   ? 59.659 -28.943 -8.638  1.00 46.26  ? 944  HOH A O     1 
HETATM 4312 O  O     . HOH M 9 .   ? 39.583 -18.751 14.647  1.00 38.70  ? 945  HOH A O     1 
HETATM 4313 O  O     . HOH M 9 .   ? 67.419 -25.817 -0.634  1.00 47.54  ? 946  HOH A O     1 
HETATM 4314 O  O     . HOH M 9 .   ? 22.856 14.852  -17.523 1.00 46.27  ? 947  HOH A O     1 
HETATM 4315 O  O     . HOH M 9 .   ? 70.174 -21.653 0.545   1.00 24.26  ? 948  HOH A O     1 
HETATM 4316 O  O     . HOH M 9 .   ? 71.165 8.968   -6.728  1.00 44.67  ? 949  HOH A O     1 
HETATM 4317 O  O     . HOH M 9 .   ? 48.846 12.085  -11.247 1.00 34.75  ? 950  HOH A O     1 
HETATM 4318 O  O     . HOH M 9 .   ? 51.139 -18.107 -9.130  1.00 43.34  ? 951  HOH A O     1 
HETATM 4319 O  O     . HOH M 9 .   ? 58.971 30.576  12.531  1.00 48.44  ? 952  HOH A O     1 
HETATM 4320 O  O     . HOH M 9 .   ? 73.237 4.538   -1.360  1.00 33.29  ? 953  HOH A O     1 
HETATM 4321 O  O     . HOH M 9 .   ? 42.753 3.467   18.399  1.00 38.42  ? 954  HOH A O     1 
HETATM 4322 O  O     . HOH M 9 .   ? 55.587 13.324  -11.514 1.00 31.44  ? 955  HOH A O     1 
HETATM 4323 O  O     . HOH M 9 .   ? 38.469 -19.842 12.563  1.00 31.54  ? 956  HOH A O     1 
HETATM 4324 O  O     . HOH M 9 .   ? 22.189 17.958  -7.140  1.00 35.88  ? 957  HOH A O     1 
HETATM 4325 O  O     . HOH M 9 .   ? 58.405 15.058  -10.594 1.00 28.21  ? 958  HOH A O     1 
HETATM 4326 O  O     . HOH M 9 .   ? 51.461 13.332  -11.471 1.00 29.50  ? 959  HOH A O     1 
HETATM 4327 O  O     . HOH M 9 .   ? 62.015 11.989  9.481   1.00 40.18  ? 960  HOH A O     1 
HETATM 4328 O  O     . HOH M 9 .   ? 59.519 -28.092 -2.033  1.00 38.24  ? 961  HOH A O     1 
HETATM 4329 O  O     . HOH M 9 .   ? 49.581 26.057  2.927   1.00 26.10  ? 962  HOH A O     1 
HETATM 4330 O  O     . HOH M 9 .   ? 69.623 1.506   -14.796 1.00 50.61  ? 963  HOH A O     1 
HETATM 4331 O  O     . HOH M 9 .   ? 52.770 -0.010  12.164  1.00 26.92  ? 964  HOH A O     1 
HETATM 4332 O  O     . HOH M 9 .   ? 69.497 5.284   1.030   1.00 32.70  ? 965  HOH A O     1 
HETATM 4333 O  O     . HOH M 9 .   ? 46.329 10.283  -13.257 1.00 43.92  ? 966  HOH A O     1 
HETATM 4334 O  O     . HOH M 9 .   ? 40.584 7.730   -29.827 1.00 43.80  ? 967  HOH A O     1 
HETATM 4335 O  O     . HOH M 9 .   ? 79.004 1.937   4.525   1.00 39.25  ? 968  HOH A O     1 
HETATM 4336 O  O     . HOH M 9 .   ? 54.271 -34.792 1.185   1.00 34.12  ? 969  HOH A O     1 
HETATM 4337 O  O     . HOH M 9 .   ? 47.117 -20.185 18.519  1.00 26.86  ? 970  HOH A O     1 
HETATM 4338 O  O     . HOH M 9 .   ? 42.413 5.085   20.616  1.00 40.88  ? 971  HOH A O     1 
HETATM 4339 O  O     . HOH M 9 .   ? 62.393 -29.284 -12.024 1.00 40.55  ? 972  HOH A O     1 
HETATM 4340 O  O     . HOH M 9 .   ? 57.838 -14.116 -13.161 1.00 26.69  ? 973  HOH A O     1 
HETATM 4341 O  O     . HOH M 9 .   ? 47.565 7.899   -9.633  1.00 24.22  ? 974  HOH A O     1 
HETATM 4342 O  O     . HOH M 9 .   ? 61.501 8.986   18.967  1.00 32.04  ? 975  HOH A O     1 
HETATM 4343 O  O     . HOH M 9 .   ? 38.221 -22.592 10.916  1.00 39.78  ? 976  HOH A O     1 
HETATM 4344 O  O     . HOH M 9 .   ? 64.789 -32.230 -13.266 1.00 53.14  ? 977  HOH A O     1 
HETATM 4345 O  O     . HOH M 9 .   ? 46.738 -37.817 4.706   1.00 29.06  ? 978  HOH A O     1 
HETATM 4346 O  O     . HOH M 9 .   ? 49.409 0.596   20.031  1.00 37.45  ? 979  HOH A O     1 
HETATM 4347 O  O     . HOH M 9 .   ? 47.873 -19.264 -5.721  1.00 32.19  ? 980  HOH A O     1 
HETATM 4348 O  O     . HOH M 9 .   ? 27.528 6.950   -26.999 1.00 34.88  ? 981  HOH A O     1 
HETATM 4349 O  O     . HOH M 9 .   ? 43.898 15.656  26.182  1.00 31.24  ? 982  HOH A O     1 
HETATM 4350 O  O     . HOH M 9 .   ? 61.136 11.578  -12.291 1.00 44.43  ? 983  HOH A O     1 
HETATM 4351 O  O     . HOH M 9 .   ? 45.507 11.497  -9.127  1.00 26.42  ? 984  HOH A O     1 
HETATM 4352 O  O     . HOH M 9 .   ? 55.629 -27.064 -3.899  1.00 41.19  ? 985  HOH A O     1 
HETATM 4353 O  O     . HOH M 9 .   ? 34.649 14.088  21.840  1.00 32.76  ? 986  HOH A O     1 
HETATM 4354 O  O     . HOH M 9 .   ? 39.973 15.304  25.382  1.00 43.08  ? 987  HOH A O     1 
HETATM 4355 O  O     . HOH M 9 .   ? 37.875 -15.812 11.839  1.00 33.47  ? 988  HOH A O     1 
HETATM 4356 O  O     . HOH M 9 .   ? 37.480 -28.760 9.595   1.00 45.85  ? 989  HOH A O     1 
HETATM 4357 O  O     . HOH M 9 .   ? 57.657 -26.491 -3.123  1.00 48.30  ? 990  HOH A O     1 
HETATM 4358 O  O     . HOH M 9 .   ? 48.752 6.657   -11.776 1.00 21.72  ? 991  HOH A O     1 
HETATM 4359 O  O     . HOH M 9 .   ? 44.442 13.087  -10.402 1.00 34.12  ? 992  HOH A O     1 
HETATM 4360 O  O     . HOH M 9 .   ? 48.000 -17.692 17.266  1.00 30.60  ? 993  HOH A O     1 
HETATM 4361 O  O     . HOH M 9 .   ? 58.020 17.860  19.681  1.00 32.09  ? 994  HOH A O     1 
HETATM 4362 O  O     . HOH M 9 .   ? 37.174 -4.704  -21.909 1.00 35.77  ? 995  HOH A O     1 
HETATM 4363 O  O     . HOH M 9 .   ? 33.477 -1.777  -6.372  1.00 51.63  ? 996  HOH A O     1 
HETATM 4364 O  O     . HOH M 9 .   ? 60.052 10.035  22.400  1.00 35.28  ? 997  HOH A O     1 
HETATM 4365 O  O     . HOH M 9 .   ? 47.629 16.666  28.123  1.00 35.48  ? 998  HOH A O     1 
HETATM 4366 O  O     . HOH M 9 .   ? 61.446 8.107   9.969   1.00 27.44  ? 999  HOH A O     1 
HETATM 4367 O  O     . HOH M 9 .   ? 62.926 5.031   13.992  1.00 45.96  ? 1000 HOH A O     1 
HETATM 4368 O  O     . HOH M 9 .   ? 65.116 5.285   13.085  1.00 44.25  ? 1001 HOH A O     1 
HETATM 4369 O  O     . HOH M 9 .   ? 52.299 -21.411 -9.143  1.00 43.22  ? 1002 HOH A O     1 
HETATM 4370 O  O     . HOH N 9 .   ? 42.149 -7.242  -10.464 1.00 43.27  ? 101  HOH T O     1 
HETATM 4371 O  O     . HOH N 9 .   ? 41.394 -19.787 -3.353  1.00 30.36  ? 102  HOH T O     1 
HETATM 4372 O  O     . HOH N 9 .   ? 28.922 4.365   9.605   1.00 63.87  ? 103  HOH T O     1 
HETATM 4373 O  O     . HOH N 9 .   ? 36.272 2.507   4.351   1.00 33.29  ? 104  HOH T O     1 
HETATM 4374 O  O     . HOH N 9 .   ? 34.893 5.675   17.911  1.00 54.29  ? 105  HOH T O     1 
HETATM 4375 O  O     . HOH N 9 .   ? 39.982 8.507   8.883   1.00 40.02  ? 106  HOH T O     1 
HETATM 4376 O  O     . HOH N 9 .   ? 43.125 5.382   -8.946  1.00 22.91  ? 107  HOH T O     1 
HETATM 4377 O  O     . HOH N 9 .   ? 29.080 0.454   13.605  1.00 67.57  ? 108  HOH T O     1 
HETATM 4378 O  O     . HOH N 9 .   ? 38.815 2.825   -6.525  1.00 38.29  ? 109  HOH T O     1 
HETATM 4379 O  O     . HOH N 9 .   ? 39.435 6.970   13.721  1.00 31.11  ? 110  HOH T O     1 
HETATM 4380 O  O     . HOH N 9 .   ? 36.541 -1.747  -1.118  1.00 37.08  ? 111  HOH T O     1 
HETATM 4381 O  O     . HOH N 9 .   ? 30.978 -16.222 -4.500  1.00 30.58  ? 112  HOH T O     1 
HETATM 4382 O  O     . HOH N 9 .   ? 31.749 13.729  9.917   1.00 53.75  ? 113  HOH T O     1 
HETATM 4383 O  O     . HOH N 9 .   ? 36.706 -23.163 -5.153  1.00 27.33  ? 114  HOH T O     1 
HETATM 4384 O  O     . HOH N 9 .   ? 45.051 -4.995  -3.102  1.00 40.46  ? 115  HOH T O     1 
HETATM 4385 O  O     . HOH N 9 .   ? 38.363 -2.516  -6.480  1.00 37.41  ? 116  HOH T O     1 
HETATM 4386 O  O     . HOH N 9 .   ? 44.995 -2.763  -3.230  1.00 41.78  ? 117  HOH T O     1 
HETATM 4387 O  O     . HOH N 9 .   ? 44.099 1.372   -1.979  1.00 30.54  ? 118  HOH T O     1 
HETATM 4388 O  O     . HOH N 9 .   ? 44.232 -8.360  -3.558  1.00 36.42  ? 119  HOH T O     1 
HETATM 4389 O  O     . HOH N 9 .   ? 38.948 -10.137 -10.082 1.00 43.15  ? 120  HOH T O     1 
HETATM 4390 O  O     . HOH N 9 .   ? 40.452 -0.632  7.915   1.00 43.92  ? 121  HOH T O     1 
HETATM 4391 O  O     . HOH N 9 .   ? 25.577 -19.509 -6.720  1.00 37.74  ? 122  HOH T O     1 
HETATM 4392 O  O     . HOH N 9 .   ? 40.813 -3.675  -9.585  1.00 30.13  ? 123  HOH T O     1 
HETATM 4393 O  O     . HOH N 9 .   ? 40.326 -22.200 -6.703  1.00 36.05  ? 124  HOH T O     1 
HETATM 4394 O  O     . HOH N 9 .   ? 43.629 5.469   0.515   1.00 25.90  ? 125  HOH T O     1 
HETATM 4395 O  O     . HOH N 9 .   ? 42.003 7.951   3.290   1.00 22.65  ? 126  HOH T O     1 
HETATM 4396 O  O     . HOH N 9 .   ? 37.346 -12.969 -11.289 1.00 39.63  ? 127  HOH T O     1 
HETATM 4397 O  O     . HOH N 9 .   ? 36.447 -2.940  -4.278  1.00 31.30  ? 128  HOH T O     1 
HETATM 4398 O  O     . HOH N 9 .   ? 37.145 -0.025  4.777   1.00 29.16  ? 129  HOH T O     1 
HETATM 4399 O  O     . HOH N 9 .   ? 37.980 -21.734 -3.305  1.00 32.68  ? 130  HOH T O     1 
HETATM 4400 O  O     . HOH N 9 .   ? 42.449 -11.504 -3.089  1.00 43.21  ? 131  HOH T O     1 
HETATM 4401 O  O     . HOH N 9 .   ? 29.641 15.548  11.157  1.00 37.87  ? 132  HOH T O     1 
HETATM 4402 O  O     . HOH N 9 .   ? 42.905 -15.807 -2.559  1.00 40.22  ? 133  HOH T O     1 
HETATM 4403 O  O     . HOH N 9 .   ? 33.373 10.306  8.101   1.00 49.47  ? 134  HOH T O     1 
HETATM 4404 O  O     . HOH N 9 .   ? 41.072 -10.294 -11.293 1.00 57.20  ? 135  HOH T O     1 
HETATM 4405 O  O     . HOH N 9 .   ? 35.941 10.865  10.244  1.00 29.36  ? 136  HOH T O     1 
HETATM 4406 O  O     . HOH O 9 .   ? 45.937 3.675   1.162   1.00 24.20  ? 201  HOH P O     1 
HETATM 4407 O  O     . HOH O 9 .   ? 38.360 -10.762 6.323   1.00 36.65  ? 202  HOH P O     1 
HETATM 4408 O  O     . HOH O 9 .   ? 41.444 -11.575 -0.772  1.00 25.39  ? 203  HOH P O     1 
HETATM 4409 O  O     . HOH O 9 .   ? 48.866 2.463   1.254   0.70 13.69  ? 204  HOH P O     1 
HETATM 4410 O  O     . HOH O 9 .   ? 32.240 -7.610  -11.583 1.00 45.59  ? 205  HOH P O     1 
HETATM 4411 O  O     . HOH O 9 .   ? 45.899 -8.037  8.064   1.00 42.44  ? 206  HOH P O     1 
HETATM 4412 O  O     . HOH O 9 .   ? 30.618 -6.489  -13.949 1.00 54.62  ? 207  HOH P O     1 
HETATM 4413 O  O     . HOH O 9 .   ? 44.487 -8.286  -1.003  1.00 28.34  ? 208  HOH P O     1 
HETATM 4414 O  O     . HOH O 9 .   ? 40.430 -5.630  5.365   1.00 29.65  ? 209  HOH P O     1 
HETATM 4415 O  O     . HOH O 9 .   ? 42.714 -9.041  7.107   1.00 22.14  ? 210  HOH P O     1 
HETATM 4416 O  O     . HOH O 9 .   ? 36.562 -4.642  3.052   1.00 40.06  ? 211  HOH P O     1 
HETATM 4417 O  O     . HOH O 9 .   ? 49.081 -10.069 6.763   1.00 21.85  ? 212  HOH P O     1 
HETATM 4418 O  O     . HOH O 9 .   ? 44.284 7.287   2.194   1.00 22.23  ? 213  HOH P O     1 
HETATM 4419 O  O     . HOH O 9 .   ? 52.732 -1.182  3.595   1.00 13.31  ? 214  HOH P O     1 
HETATM 4420 O  O     . HOH O 9 .   ? 47.835 -2.057  7.014   1.00 27.86  ? 215  HOH P O     1 
HETATM 4421 O  O     . HOH O 9 .   ? 41.417 -15.594 1.948   1.00 22.72  ? 216  HOH P O     1 
HETATM 4422 O  O     . HOH O 9 .   ? 50.236 -1.696  6.377   0.15 16.02  ? 217  HOH P O     1 
HETATM 4423 O  O     . HOH O 9 .   ? 45.926 -5.059  7.045   1.00 41.31  ? 218  HOH P O     1 
HETATM 4424 O  O     . HOH O 9 .   ? 34.541 -9.105  -11.510 1.00 53.48  ? 219  HOH P O     1 
HETATM 4425 O  O     . HOH O 9 .   ? 46.438 0.426   7.147   1.00 32.06  ? 220  HOH P O     1 
HETATM 4426 O  O     . HOH O 9 .   ? 46.007 -2.539  -0.892  1.00 27.77  ? 221  HOH P O     1 
HETATM 4427 O  O     . HOH O 9 .   ? 38.449 -4.241  4.945   1.00 39.10  ? 222  HOH P O     1 
HETATM 4428 O  O     . HOH O 9 .   ? 43.818 -6.659  6.440   1.00 47.15  ? 223  HOH P O     1 
HETATM 4429 O  O     . HOH O 9 .   ? 40.259 -14.013 -0.033  1.00 36.68  ? 224  HOH P O     1 
HETATM 4430 O  O     . HOH O 9 .   ? 45.654 -10.792 0.006   1.00 25.80  ? 225  HOH P O     1 
HETATM 4431 O  O     . HOH O 9 .   ? 43.917 -12.717 -0.269  1.00 26.29  ? 226  HOH P O     1 
HETATM 4432 O  O     . HOH O 9 .   ? 40.230 -8.932  5.903   1.00 25.00  ? 227  HOH P O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  -2  GLY GLY A . n 
A 1 2   PRO 2   -1  -1  PRO PRO A . n 
A 1 3   HIS 3   0   0   HIS HIS A . n 
A 1 4   MET 4   1   1   MET MET A . n 
A 1 5   ALA 5   2   2   ALA ALA A . n 
A 1 6   THR 6   3   3   THR THR A . n 
A 1 7   GLY 7   4   4   GLY GLY A . n 
A 1 8   GLN 8   5   5   GLN GLN A . n 
A 1 9   ASP 9   6   6   ASP ASP A . n 
A 1 10  ARG 10  7   7   ARG ARG A . n 
A 1 11  VAL 11  8   8   VAL VAL A . n 
A 1 12  VAL 12  9   9   VAL VAL A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  LEU 14  11  11  LEU LEU A . n 
A 1 15  VAL 15  12  12  VAL VAL A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  MET 17  14  14  MET MET A . n 
A 1 18  ASP 18  15  15  ASP ASP A . n 
A 1 19  CYS 19  16  16  CYS CYS A . n 
A 1 20  PHE 20  17  17  PHE PHE A . n 
A 1 21  PHE 21  18  18  PHE PHE A . n 
A 1 22  VAL 22  19  19  VAL VAL A . n 
A 1 23  GLN 23  20  20  GLN GLN A . n 
A 1 24  VAL 24  21  21  VAL VAL A . n 
A 1 25  GLU 25  22  22  GLU GLU A . n 
A 1 26  GLN 26  23  23  GLN GLN A . n 
A 1 27  ARG 27  24  24  ARG ARG A . n 
A 1 28  GLN 28  25  25  GLN GLN A . n 
A 1 29  ASN 29  26  26  ASN ASN A . n 
A 1 30  PRO 30  27  27  PRO PRO A . n 
A 1 31  HIS 31  28  28  HIS HIS A . n 
A 1 32  LEU 32  29  29  LEU LEU A . n 
A 1 33  ARG 33  30  30  ARG ARG A . n 
A 1 34  ASN 34  31  31  ASN ASN A . n 
A 1 35  LYS 35  32  32  LYS LYS A . n 
A 1 36  PRO 36  33  33  PRO PRO A . n 
A 1 37  CYS 37  34  34  CYS CYS A . n 
A 1 38  ALA 38  35  35  ALA ALA A . n 
A 1 39  VAL 39  36  36  VAL VAL A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  GLN 41  38  38  GLN GLN A . n 
A 1 42  TYR 42  39  39  TYR TYR A . n 
A 1 43  LYS 43  40  40  LYS LYS A . n 
A 1 44  SER 44  41  41  SER SER A . n 
A 1 45  TRP 45  42  42  TRP TRP A . n 
A 1 46  LYS 46  43  43  LYS LYS A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  GLY 48  45  45  GLY GLY A . n 
A 1 49  GLY 49  46  46  GLY GLY A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  ALA 52  49  49  ALA ALA A . n 
A 1 53  VAL 53  50  50  VAL VAL A . n 
A 1 54  SER 54  51  51  SER SER A . n 
A 1 55  TYR 55  52  52  TYR TYR A . n 
A 1 56  GLU 56  53  53  GLU GLU A . n 
A 1 57  ALA 57  54  54  ALA ALA A . n 
A 1 58  ARG 58  55  55  ARG ARG A . n 
A 1 59  ALA 59  56  56  ALA ALA A . n 
A 1 60  PHE 60  57  57  PHE PHE A . n 
A 1 61  GLY 61  58  58  GLY GLY A . n 
A 1 62  VAL 62  59  59  VAL VAL A . n 
A 1 63  THR 63  60  60  THR THR A . n 
A 1 64  ARG 64  61  61  ARG ARG A . n 
A 1 65  SER 65  62  62  SER SER A . n 
A 1 66  MET 66  63  63  MET MET A . n 
A 1 67  TRP 67  64  64  TRP TRP A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  ASP 69  66  66  ASP ASP A . n 
A 1 70  ASP 70  67  67  ASP ASP A . n 
A 1 71  ALA 71  68  68  ALA ALA A . n 
A 1 72  LYS 72  69  69  LYS LYS A . n 
A 1 73  LYS 73  70  70  LYS LYS A . n 
A 1 74  LEU 74  71  71  LEU LEU A . n 
A 1 75  CYS 75  72  72  CYS CYS A . n 
A 1 76  PRO 76  73  73  PRO PRO A . n 
A 1 77  ASP 77  74  74  ASP ASP A . n 
A 1 78  LEU 78  75  75  LEU LEU A . n 
A 1 79  LEU 79  76  76  LEU LEU A . n 
A 1 80  LEU 80  77  77  LEU LEU A . n 
A 1 81  ALA 81  78  78  ALA ALA A . n 
A 1 82  GLN 82  79  79  GLN GLN A . n 
A 1 83  VAL 83  80  80  VAL VAL A . n 
A 1 84  ARG 84  81  81  ARG ARG A . n 
A 1 85  GLU 85  82  82  GLU GLU A . n 
A 1 86  SER 86  83  83  SER SER A . n 
A 1 87  ARG 87  84  84  ARG ARG A . n 
A 1 88  GLY 88  85  85  GLY GLY A . n 
A 1 89  LYS 89  86  86  LYS LYS A . n 
A 1 90  ALA 90  87  87  ALA ALA A . n 
A 1 91  ASN 91  88  88  ASN ASN A . n 
A 1 92  LEU 92  89  89  LEU LEU A . n 
A 1 93  THR 93  90  90  THR THR A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  TYR 95  92  92  TYR TYR A . n 
A 1 96  ARG 96  93  93  ARG ARG A . n 
A 1 97  GLU 97  94  94  GLU GLU A . n 
A 1 98  ALA 98  95  95  ALA ALA A . n 
A 1 99  SER 99  96  96  SER SER A . n 
A 1 100 VAL 100 97  97  VAL VAL A . n 
A 1 101 GLU 101 98  98  GLU GLU A . n 
A 1 102 VAL 102 99  99  VAL VAL A . n 
A 1 103 MET 103 100 100 MET MET A . n 
A 1 104 GLU 104 101 101 GLU GLU A . n 
A 1 105 ILE 105 102 102 ILE ILE A . n 
A 1 106 MET 106 103 103 MET MET A . n 
A 1 107 SER 107 104 104 SER SER A . n 
A 1 108 ARG 108 105 105 ARG ARG A . n 
A 1 109 PHE 109 106 106 PHE PHE A . n 
A 1 110 ALA 110 107 107 ALA ALA A . n 
A 1 111 VAL 111 108 108 VAL VAL A . n 
A 1 112 ILE 112 109 109 ILE ILE A . n 
A 1 113 GLU 113 110 110 GLU GLU A . n 
A 1 114 ARG 114 111 111 ARG ARG A . n 
A 1 115 ALA 115 112 112 ALA ALA A . n 
A 1 116 SER 116 113 113 SER SER A . n 
A 1 117 ILE 117 114 114 ILE ILE A . n 
A 1 118 ASP 118 115 115 ASP ASP A . n 
A 1 119 GLU 119 116 116 GLU GLU A . n 
A 1 120 ALA 120 117 117 ALA ALA A . n 
A 1 121 TYR 121 118 118 TYR TYR A . n 
A 1 122 VAL 122 119 119 VAL VAL A . n 
A 1 123 ASP 123 120 120 ASP ASP A . n 
A 1 124 LEU 124 121 121 LEU LEU A . n 
A 1 125 THR 125 122 122 THR THR A . n 
A 1 126 SER 126 123 123 SER SER A . n 
A 1 127 ALA 127 124 124 ALA ALA A . n 
A 1 128 VAL 128 125 125 VAL VAL A . n 
A 1 129 GLN 129 126 126 GLN GLN A . n 
A 1 130 GLU 130 127 127 GLU GLU A . n 
A 1 131 ARG 131 128 128 ARG ARG A . n 
A 1 132 LEU 132 129 129 LEU LEU A . n 
A 1 133 GLN 133 130 130 GLN GLN A . n 
A 1 134 LYS 134 131 131 LYS LYS A . n 
A 1 135 LEU 135 132 132 LEU LEU A . n 
A 1 136 GLN 136 133 133 GLN GLN A . n 
A 1 137 GLY 137 134 134 GLY GLY A . n 
A 1 138 GLN 138 135 135 GLN GLN A . n 
A 1 139 PRO 139 136 136 PRO PRO A . n 
A 1 140 ILE 140 137 137 ILE ILE A . n 
A 1 141 SER 141 138 138 SER SER A . n 
A 1 142 ALA 142 139 139 ALA ALA A . n 
A 1 143 ASP 143 140 140 ASP ASP A . n 
A 1 144 LEU 144 141 141 LEU LEU A . n 
A 1 145 LEU 145 142 142 LEU LEU A . n 
A 1 146 PRO 146 143 143 PRO PRO A . n 
A 1 147 SER 147 144 144 SER SER A . n 
A 1 148 THR 148 145 145 THR THR A . n 
A 1 149 TYR 149 146 146 TYR TYR A . n 
A 1 150 ILE 150 147 147 ILE ILE A . n 
A 1 151 GLU 151 148 148 GLU GLU A . n 
A 1 152 GLY 152 149 149 GLY GLY A . n 
A 1 153 LEU 153 150 150 LEU LEU A . n 
A 1 154 PRO 154 151 151 PRO PRO A . n 
A 1 155 GLN 155 152 152 GLN GLN A . n 
A 1 156 GLY 156 153 153 GLY GLY A . n 
A 1 157 PRO 157 154 154 PRO PRO A . n 
A 1 158 THR 158 155 ?   ?   ?   A . n 
A 1 159 THR 159 156 ?   ?   ?   A . n 
A 1 160 ALA 160 157 ?   ?   ?   A . n 
A 1 161 GLU 161 158 ?   ?   ?   A . n 
A 1 162 GLU 162 159 ?   ?   ?   A . n 
A 1 163 THR 163 160 160 THR THR A . n 
A 1 164 VAL 164 161 161 VAL VAL A . n 
A 1 165 GLN 165 162 162 GLN GLN A . n 
A 1 166 LYS 166 163 163 LYS LYS A . n 
A 1 167 GLU 167 164 164 GLU GLU A . n 
A 1 168 GLY 168 165 165 GLY GLY A . n 
A 1 169 MET 169 166 166 MET MET A . n 
A 1 170 ARG 170 167 167 ARG ARG A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 GLN 172 169 169 GLN GLN A . n 
A 1 173 GLY 173 170 170 GLY GLY A . n 
A 1 174 LEU 174 171 171 LEU LEU A . n 
A 1 175 PHE 175 172 172 PHE PHE A . n 
A 1 176 GLN 176 173 173 GLN GLN A . n 
A 1 177 TRP 177 174 174 TRP TRP A . n 
A 1 178 LEU 178 175 175 LEU LEU A . n 
A 1 179 ASP 179 176 176 ASP ASP A . n 
A 1 180 SER 180 177 177 SER SER A . n 
A 1 181 LEU 181 178 178 LEU LEU A . n 
A 1 182 GLN 182 179 179 GLN GLN A . n 
A 1 183 ILE 183 180 180 ILE ILE A . n 
A 1 184 ASP 184 181 181 ASP ASP A . n 
A 1 185 ASN 185 182 182 ASN ASN A . n 
A 1 186 LEU 186 183 183 LEU LEU A . n 
A 1 187 THR 187 184 184 THR THR A . n 
A 1 188 SER 188 185 185 SER SER A . n 
A 1 189 PRO 189 186 186 PRO PRO A . n 
A 1 190 ASP 190 187 187 ASP ASP A . n 
A 1 191 LEU 191 188 188 LEU LEU A . n 
A 1 192 GLN 192 189 189 GLN GLN A . n 
A 1 193 LEU 193 190 190 LEU LEU A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 VAL 195 192 192 VAL VAL A . n 
A 1 196 GLY 196 193 193 GLY GLY A . n 
A 1 197 ALA 197 194 194 ALA ALA A . n 
A 1 198 VAL 198 195 195 VAL VAL A . n 
A 1 199 ILE 199 196 196 ILE ILE A . n 
A 1 200 VAL 200 197 197 VAL VAL A . n 
A 1 201 GLU 201 198 198 GLU GLU A . n 
A 1 202 GLU 202 199 199 GLU GLU A . n 
A 1 203 MET 203 200 200 MET MET A . n 
A 1 204 ARG 204 201 201 ARG ARG A . n 
A 1 205 ALA 205 202 202 ALA ALA A . n 
A 1 206 ALA 206 203 203 ALA ALA A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 GLU 208 205 205 GLU GLU A . n 
A 1 209 ARG 209 206 206 ARG ARG A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 THR 211 208 208 THR THR A . n 
A 1 212 GLY 212 209 209 GLY GLY A . n 
A 1 213 PHE 213 210 210 PHE PHE A . n 
A 1 214 GLN 214 211 211 GLN GLN A . n 
A 1 215 CYS 215 212 212 CYS CYS A . n 
A 1 216 SER 216 213 213 SER SER A . n 
A 1 217 ALA 217 214 214 ALA ALA A . n 
A 1 218 GLY 218 215 215 GLY GLY A . n 
A 1 219 ILE 219 216 216 ILE ILE A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 HIS 221 218 218 HIS HIS A . n 
A 1 222 ASN 222 219 219 ASN ASN A . n 
A 1 223 LYS 223 220 220 LYS LYS A . n 
A 1 224 VAL 224 221 221 VAL VAL A . n 
A 1 225 LEU 225 222 222 LEU LEU A . n 
A 1 226 ALA 226 223 223 ALA ALA A . n 
A 1 227 LYS 227 224 224 LYS LYS A . n 
A 1 228 LEU 228 225 225 LEU LEU A . n 
A 1 229 ALA 229 226 226 ALA ALA A . n 
A 1 230 CYS 230 227 227 CYS CYS A . n 
A 1 231 GLY 231 228 228 GLY GLY A . n 
A 1 232 LEU 232 229 229 LEU LEU A . n 
A 1 233 ASN 233 230 230 ASN ASN A . n 
A 1 234 LYS 234 231 231 LYS LYS A . n 
A 1 235 PRO 235 232 232 PRO PRO A . n 
A 1 236 ASN 236 233 233 ASN ASN A . n 
A 1 237 ARG 237 234 234 ARG ARG A . n 
A 1 238 GLN 238 235 235 GLN GLN A . n 
A 1 239 THR 239 236 236 THR THR A . n 
A 1 240 LEU 240 237 237 LEU LEU A . n 
A 1 241 VAL 241 238 238 VAL VAL A . n 
A 1 242 SER 242 239 239 SER SER A . n 
A 1 243 HIS 243 240 240 HIS HIS A . n 
A 1 244 GLY 244 241 241 GLY GLY A . n 
A 1 245 SER 245 242 242 SER SER A . n 
A 1 246 VAL 246 243 243 VAL VAL A . n 
A 1 247 PRO 247 244 244 PRO PRO A . n 
A 1 248 GLN 248 245 245 GLN GLN A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PHE 250 247 247 PHE PHE A . n 
A 1 251 SER 251 248 248 SER SER A . n 
A 1 252 GLN 252 249 249 GLN GLN A . n 
A 1 253 MET 253 250 250 MET MET A . n 
A 1 254 PRO 254 251 251 PRO PRO A . n 
A 1 255 ILE 255 252 252 ILE ILE A . n 
A 1 256 ARG 256 253 253 ARG ARG A . n 
A 1 257 LYS 257 254 254 LYS LYS A . n 
A 1 258 ILE 258 255 255 ILE ILE A . n 
A 1 259 ARG 259 256 256 ARG ARG A . n 
A 1 260 SER 260 257 257 SER SER A . n 
A 1 261 LEU 261 258 258 LEU LEU A . n 
A 1 262 GLY 262 259 259 GLY GLY A . n 
A 1 263 GLY 263 260 260 GLY GLY A . n 
A 1 264 LYS 264 261 261 LYS LYS A . n 
A 1 265 LEU 265 262 262 LEU LEU A . n 
A 1 266 GLY 266 263 263 GLY GLY A . n 
A 1 267 ALA 267 264 264 ALA ALA A . n 
A 1 268 SER 268 265 265 SER SER A . n 
A 1 269 VAL 269 266 266 VAL VAL A . n 
A 1 270 ILE 270 267 267 ILE ILE A . n 
A 1 271 GLU 271 268 268 GLU GLU A . n 
A 1 272 ILE 272 269 269 ILE ILE A . n 
A 1 273 LEU 273 270 270 LEU LEU A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 GLU 276 273 273 GLU GLU A . n 
A 1 277 TYR 277 274 274 TYR TYR A . n 
A 1 278 MET 278 275 275 MET MET A . n 
A 1 279 GLY 279 276 276 GLY GLY A . n 
A 1 280 GLU 280 277 277 GLU GLU A . n 
A 1 281 LEU 281 278 278 LEU LEU A . n 
A 1 282 THR 282 279 279 THR THR A . n 
A 1 283 GLN 283 280 280 GLN GLN A . n 
A 1 284 PHE 284 281 281 PHE PHE A . n 
A 1 285 THR 285 282 282 THR THR A . n 
A 1 286 GLU 286 283 283 GLU GLU A . n 
A 1 287 SER 287 284 284 SER SER A . n 
A 1 288 GLN 288 285 285 GLN GLN A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 GLN 290 287 287 GLN GLN A . n 
A 1 291 SER 291 288 288 SER SER A . n 
A 1 292 HIS 292 289 289 HIS HIS A . n 
A 1 293 PHE 293 290 290 PHE PHE A . n 
A 1 294 GLY 294 291 291 GLY GLY A . n 
A 1 295 GLU 295 292 292 GLU GLU A . n 
A 1 296 LYS 296 293 293 LYS LYS A . n 
A 1 297 ASN 297 294 294 ASN ASN A . n 
A 1 298 GLY 298 295 295 GLY GLY A . n 
A 1 299 SER 299 296 296 SER SER A . n 
A 1 300 TRP 300 297 297 TRP TRP A . n 
A 1 301 LEU 301 298 298 LEU LEU A . n 
A 1 302 TYR 302 299 299 TYR TYR A . n 
A 1 303 ALA 303 300 300 ALA ALA A . n 
A 1 304 MET 304 301 301 MET MET A . n 
A 1 305 CYS 305 302 302 CYS CYS A . n 
A 1 306 ARG 306 303 303 ARG ARG A . n 
A 1 307 GLY 307 304 304 GLY GLY A . n 
A 1 308 ILE 308 305 305 ILE ILE A . n 
A 1 309 GLU 309 306 306 GLU GLU A . n 
A 1 310 HIS 310 307 307 HIS HIS A . n 
A 1 311 ASP 311 308 308 ASP ASP A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 VAL 313 310 310 VAL VAL A . n 
A 1 314 LYS 314 311 311 LYS LYS A . n 
A 1 315 PRO 315 312 312 PRO PRO A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 GLN 317 314 314 GLN GLN A . n 
A 1 318 LEU 318 315 315 LEU LEU A . n 
A 1 319 PRO 319 316 316 PRO PRO A . n 
A 1 320 LYS 320 317 317 LYS LYS A . n 
A 1 321 THR 321 318 318 THR THR A . n 
A 1 322 ILE 322 319 319 ILE ILE A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 CYS 324 321 321 CYS CYS A . n 
A 1 325 SER 325 322 322 SER SER A . n 
A 1 326 LYS 326 323 323 LYS LYS A . n 
A 1 327 ASN 327 324 324 ASN ASN A . n 
A 1 328 PHE 328 325 325 PHE PHE A . n 
A 1 329 PRO 329 326 326 PRO PRO A . n 
A 1 330 GLY 330 327 327 GLY GLY A . n 
A 1 331 LYS 331 328 328 LYS LYS A . n 
A 1 332 THR 332 329 329 THR THR A . n 
A 1 333 ALA 333 330 330 ALA ALA A . n 
A 1 334 LEU 334 331 331 LEU LEU A . n 
A 1 335 ALA 335 332 332 ALA ALA A . n 
A 1 336 THR 336 333 333 THR THR A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 GLU 338 335 335 GLU GLU A . n 
A 1 339 GLN 339 336 336 GLN GLN A . n 
A 1 340 VAL 340 337 337 VAL VAL A . n 
A 1 341 GLN 341 338 338 GLN GLN A . n 
A 1 342 TRP 342 339 339 TRP TRP A . n 
A 1 343 TRP 343 340 340 TRP TRP A . n 
A 1 344 LEU 344 341 341 LEU LEU A . n 
A 1 345 LEU 345 342 342 LEU LEU A . n 
A 1 346 GLN 346 343 343 GLN GLN A . n 
A 1 347 LEU 347 344 344 LEU LEU A . n 
A 1 348 ALA 348 345 345 ALA ALA A . n 
A 1 349 GLN 349 346 346 GLN GLN A . n 
A 1 350 GLU 350 347 347 GLU GLU A . n 
A 1 351 LEU 351 348 348 LEU LEU A . n 
A 1 352 GLU 352 349 349 GLU GLU A . n 
A 1 353 GLU 353 350 350 GLU GLU A . n 
A 1 354 ARG 354 351 351 ARG ARG A . n 
A 1 355 LEU 355 352 352 LEU LEU A . n 
A 1 356 THR 356 353 353 THR THR A . n 
A 1 357 LYS 357 354 354 LYS LYS A . n 
A 1 358 ASP 358 355 355 ASP ASP A . n 
A 1 359 ARG 359 356 356 ARG ARG A . n 
A 1 360 ASN 360 357 357 ASN ASN A . n 
A 1 361 ASP 361 358 358 ASP ASP A . n 
A 1 362 ASN 362 359 359 ASN ASN A . n 
A 1 363 ASP 363 360 360 ASP ASP A . n 
A 1 364 ARG 364 361 361 ARG ARG A . n 
A 1 365 VAL 365 362 362 VAL VAL A . n 
A 1 366 ALA 366 363 363 ALA ALA A . n 
A 1 367 THR 367 364 364 THR THR A . n 
A 1 368 GLN 368 365 365 GLN GLN A . n 
A 1 369 LEU 369 366 366 LEU LEU A . n 
A 1 370 VAL 370 367 367 VAL VAL A . n 
A 1 371 VAL 371 368 368 VAL VAL A . n 
A 1 372 SER 372 369 369 SER SER A . n 
A 1 373 ILE 373 370 370 ILE ILE A . n 
A 1 374 ARG 374 371 371 ARG ARG A . n 
A 1 375 VAL 375 372 372 VAL VAL A . n 
A 1 376 GLN 376 373 373 GLN GLN A . n 
A 1 377 GLY 377 374 374 GLY GLY A . n 
A 1 378 ASP 378 375 375 ASP ASP A . n 
A 1 379 LYS 379 376 376 LYS LYS A . n 
A 1 380 ARG 380 377 377 ARG ARG A . n 
A 1 381 LEU 381 378 378 LEU LEU A . n 
A 1 382 SER 382 379 379 SER SER A . n 
A 1 383 SER 383 380 380 SER SER A . n 
A 1 384 LEU 384 381 381 LEU LEU A . n 
A 1 385 ARG 385 382 382 ARG ARG A . n 
A 1 386 ARG 386 383 383 ARG ARG A . n 
A 1 387 CYS 387 384 384 CYS CYS A . n 
A 1 388 CYS 388 385 385 CYS CYS A . n 
A 1 389 ALA 389 386 386 ALA ALA A . n 
A 1 390 LEU 390 387 387 LEU LEU A . n 
A 1 391 THR 391 388 388 THR THR A . n 
A 1 392 ARG 392 389 389 ARG ARG A . n 
A 1 393 TYR 393 390 390 TYR TYR A . n 
A 1 394 ASP 394 391 391 ASP ASP A . n 
A 1 395 ALA 395 392 392 ALA ALA A . n 
A 1 396 HIS 396 393 393 HIS HIS A . n 
A 1 397 LYS 397 394 394 LYS LYS A . n 
A 1 398 MET 398 395 395 MET MET A . n 
A 1 399 SER 399 396 396 SER SER A . n 
A 1 400 HIS 400 397 397 HIS HIS A . n 
A 1 401 ASP 401 398 398 ASP ASP A . n 
A 1 402 ALA 402 399 399 ALA ALA A . n 
A 1 403 PHE 403 400 400 PHE PHE A . n 
A 1 404 THR 404 401 401 THR THR A . n 
A 1 405 VAL 405 402 402 VAL VAL A . n 
A 1 406 ILE 406 403 403 ILE ILE A . n 
A 1 407 LYS 407 404 404 LYS LYS A . n 
A 1 408 ASN 408 405 405 ASN ASN A . n 
A 1 409 CYS 409 406 406 CYS CYS A . n 
A 1 410 ASN 410 407 407 ASN ASN A . n 
A 1 411 THR 411 408 408 THR THR A . n 
A 1 412 SER 412 409 409 SER SER A . n 
A 1 413 GLY 413 410 410 GLY GLY A . n 
A 1 414 ILE 414 411 411 ILE ILE A . n 
A 1 415 GLN 415 412 412 GLN GLN A . n 
A 1 416 THR 416 413 413 THR THR A . n 
A 1 417 GLU 417 414 414 GLU GLU A . n 
A 1 418 TRP 418 415 415 TRP TRP A . n 
A 1 419 SER 419 416 416 SER SER A . n 
A 1 420 PRO 420 417 417 PRO PRO A . n 
A 1 421 PRO 421 418 418 PRO PRO A . n 
A 1 422 LEU 422 419 419 LEU LEU A . n 
A 1 423 THR 423 420 420 THR THR A . n 
A 1 424 MET 424 421 421 MET MET A . n 
A 1 425 LEU 425 422 422 LEU LEU A . n 
A 1 426 PHE 426 423 423 PHE PHE A . n 
A 1 427 LEU 427 424 424 LEU LEU A . n 
A 1 428 CYS 428 425 425 CYS CYS A . n 
A 1 429 ALA 429 426 426 ALA ALA A . n 
A 1 430 THR 430 427 427 THR THR A . n 
A 1 431 LYS 431 428 428 LYS LYS A . n 
A 1 432 PHE 432 429 429 PHE PHE A . n 
A 1 433 SER 433 430 430 SER SER A . n 
A 1 434 ALA 434 431 431 ALA ALA A . n 
A 1 435 SER 435 432 432 SER SER A . n 
B 2 1   DC  1   1   1   DC  DC  T . n 
B 2 2   DA  2   2   2   DA  DA  T . n 
B 2 3   DT  3   3   3   DT  DT  T . n 
B 2 4   DT  4   4   4   DT  DT  T . n 
B 2 5   DA  5   5   5   DA  DA  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DG  7   7   7   DG  DG  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DG  10  10  10  DG  DG  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DA  1   1   1   DA  DA  P . n 
C 3 2   DG  2   2   2   DG  DG  P . n 
C 3 3   DC  3   3   3   DC  DC  P . n 
C 3 4   DG  4   4   4   DG  DG  P . n 
C 3 5   DT  5   5   5   DT  DT  P . n 
C 3 6   DC  6   6   6   DC  DC  P . n 
C 3 7   DA  7   7   7   DA  DA  P . n 
C 3 8   DT  8   8   8   DT  DT  P . n 
C 3 9   DA  9   9   9   DA  DA  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 MN  1   501  501  MN  MN  A . 
E 5 CA  1   502  502  CA  CA  A . 
F 4 MN  1   503  503  MN  MN  A . 
G 6 GOL 1   504  506  GOL GOL A . 
H 6 GOL 1   505  507  GOL GOL A . 
I 6 GOL 1   506  508  GOL GOL A . 
J 7 DTP 1   507  504  DTP DTP A . 
K 8 DPO 1   508  505  DPO DPO A . 
L 4 MN  1   101  506  MN  MN  P . 
M 9 HOH 1   601  797  HOH HOH A . 
M 9 HOH 2   602  995  HOH HOH A . 
M 9 HOH 3   603  865  HOH HOH A . 
M 9 HOH 4   604  840  HOH HOH A . 
M 9 HOH 5   605  644  HOH HOH A . 
M 9 HOH 6   606  602  HOH HOH A . 
M 9 HOH 7   607  981  HOH HOH A . 
M 9 HOH 8   608  714  HOH HOH A . 
M 9 HOH 9   609  977  HOH HOH A . 
M 9 HOH 10  610  735  HOH HOH A . 
M 9 HOH 11  611  783  HOH HOH A . 
M 9 HOH 12  612  975  HOH HOH A . 
M 9 HOH 13  613  660  HOH HOH A . 
M 9 HOH 14  614  778  HOH HOH A . 
M 9 HOH 15  615  803  HOH HOH A . 
M 9 HOH 16  616  105  HOH HOH A . 
M 9 HOH 17  617  722  HOH HOH A . 
M 9 HOH 18  618  998  HOH HOH A . 
M 9 HOH 19  619  209  HOH HOH A . 
M 9 HOH 20  620  759  HOH HOH A . 
M 9 HOH 21  621  640  HOH HOH A . 
M 9 HOH 22  622  646  HOH HOH A . 
M 9 HOH 23  623  827  HOH HOH A . 
M 9 HOH 24  624  776  HOH HOH A . 
M 9 HOH 25  625  919  HOH HOH A . 
M 9 HOH 26  626  863  HOH HOH A . 
M 9 HOH 27  627  657  HOH HOH A . 
M 9 HOH 28  628  742  HOH HOH A . 
M 9 HOH 29  629  724  HOH HOH A . 
M 9 HOH 30  630  824  HOH HOH A . 
M 9 HOH 31  631  999  HOH HOH A . 
M 9 HOH 32  632  658  HOH HOH A . 
M 9 HOH 33  633  852  HOH HOH A . 
M 9 HOH 34  634  667  HOH HOH A . 
M 9 HOH 35  635  935  HOH HOH A . 
M 9 HOH 36  636  886  HOH HOH A . 
M 9 HOH 37  637  843  HOH HOH A . 
M 9 HOH 38  638  884  HOH HOH A . 
M 9 HOH 39  639  769  HOH HOH A . 
M 9 HOH 40  640  838  HOH HOH A . 
M 9 HOH 41  641  611  HOH HOH A . 
M 9 HOH 42  642  653  HOH HOH A . 
M 9 HOH 43  643  617  HOH HOH A . 
M 9 HOH 44  644  704  HOH HOH A . 
M 9 HOH 45  645  831  HOH HOH A . 
M 9 HOH 46  646  842  HOH HOH A . 
M 9 HOH 47  647  877  HOH HOH A . 
M 9 HOH 48  648  707  HOH HOH A . 
M 9 HOH 49  649  990  HOH HOH A . 
M 9 HOH 50  650  725  HOH HOH A . 
M 9 HOH 51  651  692  HOH HOH A . 
M 9 HOH 52  652  605  HOH HOH A . 
M 9 HOH 53  653  834  HOH HOH A . 
M 9 HOH 54  654  609  HOH HOH A . 
M 9 HOH 55  655  896  HOH HOH A . 
M 9 HOH 56  656  972  HOH HOH A . 
M 9 HOH 57  657  625  HOH HOH A . 
M 9 HOH 58  658  773  HOH HOH A . 
M 9 HOH 59  659  689  HOH HOH A . 
M 9 HOH 60  660  819  HOH HOH A . 
M 9 HOH 61  661  730  HOH HOH A . 
M 9 HOH 62  662  890  HOH HOH A . 
M 9 HOH 63  663  752  HOH HOH A . 
M 9 HOH 64  664  645  HOH HOH A . 
M 9 HOH 65  665  678  HOH HOH A . 
M 9 HOH 66  666  686  HOH HOH A . 
M 9 HOH 67  667  647  HOH HOH A . 
M 9 HOH 68  668  808  HOH HOH A . 
M 9 HOH 69  669  670  HOH HOH A . 
M 9 HOH 70  670  899  HOH HOH A . 
M 9 HOH 71  671  855  HOH HOH A . 
M 9 HOH 72  672  846  HOH HOH A . 
M 9 HOH 73  673  917  HOH HOH A . 
M 9 HOH 74  674  606  HOH HOH A . 
M 9 HOH 75  675  771  HOH HOH A . 
M 9 HOH 76  676  740  HOH HOH A . 
M 9 HOH 77  677  701  HOH HOH A . 
M 9 HOH 78  678  616  HOH HOH A . 
M 9 HOH 79  679  763  HOH HOH A . 
M 9 HOH 80  680  744  HOH HOH A . 
M 9 HOH 81  681  875  HOH HOH A . 
M 9 HOH 82  682  679  HOH HOH A . 
M 9 HOH 83  683  622  HOH HOH A . 
M 9 HOH 84  684  638  HOH HOH A . 
M 9 HOH 85  685  682  HOH HOH A . 
M 9 HOH 86  686  661  HOH HOH A . 
M 9 HOH 87  687  870  HOH HOH A . 
M 9 HOH 88  688  810  HOH HOH A . 
M 9 HOH 89  689  772  HOH HOH A . 
M 9 HOH 90  690  668  HOH HOH A . 
M 9 HOH 91  691  760  HOH HOH A . 
M 9 HOH 92  692  623  HOH HOH A . 
M 9 HOH 93  693  736  HOH HOH A . 
M 9 HOH 94  694  685  HOH HOH A . 
M 9 HOH 95  695  688  HOH HOH A . 
M 9 HOH 96  696  848  HOH HOH A . 
M 9 HOH 97  697  687  HOH HOH A . 
M 9 HOH 98  698  627  HOH HOH A . 
M 9 HOH 99  699  639  HOH HOH A . 
M 9 HOH 100 700  1002 HOH HOH A . 
M 9 HOH 101 701  603  HOH HOH A . 
M 9 HOH 102 702  727  HOH HOH A . 
M 9 HOH 103 703  888  HOH HOH A . 
M 9 HOH 104 704  669  HOH HOH A . 
M 9 HOH 105 705  618  HOH HOH A . 
M 9 HOH 106 706  635  HOH HOH A . 
M 9 HOH 107 707  642  HOH HOH A . 
M 9 HOH 108 708  632  HOH HOH A . 
M 9 HOH 109 709  729  HOH HOH A . 
M 9 HOH 110 710  921  HOH HOH A . 
M 9 HOH 111 711  914  HOH HOH A . 
M 9 HOH 112 712  850  HOH HOH A . 
M 9 HOH 113 713  980  HOH HOH A . 
M 9 HOH 114 714  651  HOH HOH A . 
M 9 HOH 115 715  889  HOH HOH A . 
M 9 HOH 116 716  717  HOH HOH A . 
M 9 HOH 117 717  107  HOH HOH A . 
M 9 HOH 118 718  608  HOH HOH A . 
M 9 HOH 119 719  607  HOH HOH A . 
M 9 HOH 120 720  788  HOH HOH A . 
M 9 HOH 121 721  677  HOH HOH A . 
M 9 HOH 122 722  950  HOH HOH A . 
M 9 HOH 123 723  825  HOH HOH A . 
M 9 HOH 124 724  656  HOH HOH A . 
M 9 HOH 125 725  628  HOH HOH A . 
M 9 HOH 126 726  712  HOH HOH A . 
M 9 HOH 127 727  659  HOH HOH A . 
M 9 HOH 128 728  621  HOH HOH A . 
M 9 HOH 129 729  662  HOH HOH A . 
M 9 HOH 130 730  925  HOH HOH A . 
M 9 HOH 131 731  979  HOH HOH A . 
M 9 HOH 132 732  695  HOH HOH A . 
M 9 HOH 133 733  626  HOH HOH A . 
M 9 HOH 134 734  619  HOH HOH A . 
M 9 HOH 135 735  650  HOH HOH A . 
M 9 HOH 136 736  683  HOH HOH A . 
M 9 HOH 137 737  775  HOH HOH A . 
M 9 HOH 138 738  705  HOH HOH A . 
M 9 HOH 139 739  649  HOH HOH A . 
M 9 HOH 140 740  822  HOH HOH A . 
M 9 HOH 141 741  721  HOH HOH A . 
M 9 HOH 142 742  630  HOH HOH A . 
M 9 HOH 143 743  715  HOH HOH A . 
M 9 HOH 144 744  633  HOH HOH A . 
M 9 HOH 145 745  708  HOH HOH A . 
M 9 HOH 146 746  665  HOH HOH A . 
M 9 HOH 147 747  782  HOH HOH A . 
M 9 HOH 148 748  674  HOH HOH A . 
M 9 HOH 149 749  882  HOH HOH A . 
M 9 HOH 150 750  789  HOH HOH A . 
M 9 HOH 151 751  900  HOH HOH A . 
M 9 HOH 152 752  737  HOH HOH A . 
M 9 HOH 153 753  835  HOH HOH A . 
M 9 HOH 154 754  733  HOH HOH A . 
M 9 HOH 155 755  694  HOH HOH A . 
M 9 HOH 156 756  964  HOH HOH A . 
M 9 HOH 157 757  643  HOH HOH A . 
M 9 HOH 158 758  813  HOH HOH A . 
M 9 HOH 159 759  973  HOH HOH A . 
M 9 HOH 160 760  739  HOH HOH A . 
M 9 HOH 161 761  648  HOH HOH A . 
M 9 HOH 162 762  663  HOH HOH A . 
M 9 HOH 163 763  720  HOH HOH A . 
M 9 HOH 164 764  703  HOH HOH A . 
M 9 HOH 165 765  3    HOH HOH A . 
M 9 HOH 166 766  728  HOH HOH A . 
M 9 HOH 167 767  634  HOH HOH A . 
M 9 HOH 168 768  743  HOH HOH A . 
M 9 HOH 169 769  610  HOH HOH A . 
M 9 HOH 170 770  761  HOH HOH A . 
M 9 HOH 171 771  601  HOH HOH A . 
M 9 HOH 172 772  758  HOH HOH A . 
M 9 HOH 173 773  858  HOH HOH A . 
M 9 HOH 174 774  806  HOH HOH A . 
M 9 HOH 175 775  702  HOH HOH A . 
M 9 HOH 176 776  746  HOH HOH A . 
M 9 HOH 177 777  793  HOH HOH A . 
M 9 HOH 178 778  853  HOH HOH A . 
M 9 HOH 179 779  923  HOH HOH A . 
M 9 HOH 180 780  885  HOH HOH A . 
M 9 HOH 181 781  741  HOH HOH A . 
M 9 HOH 182 782  629  HOH HOH A . 
M 9 HOH 183 783  631  HOH HOH A . 
M 9 HOH 184 784  966  HOH HOH A . 
M 9 HOH 185 785  672  HOH HOH A . 
M 9 HOH 186 786  956  HOH HOH A . 
M 9 HOH 187 787  913  HOH HOH A . 
M 9 HOH 188 788  805  HOH HOH A . 
M 9 HOH 189 789  636  HOH HOH A . 
M 9 HOH 190 790  655  HOH HOH A . 
M 9 HOH 191 791  815  HOH HOH A . 
M 9 HOH 192 792  820  HOH HOH A . 
M 9 HOH 193 793  801  HOH HOH A . 
M 9 HOH 194 794  786  HOH HOH A . 
M 9 HOH 195 795  671  HOH HOH A . 
M 9 HOH 196 796  904  HOH HOH A . 
M 9 HOH 197 797  766  HOH HOH A . 
M 9 HOH 198 798  745  HOH HOH A . 
M 9 HOH 199 799  768  HOH HOH A . 
M 9 HOH 200 800  654  HOH HOH A . 
M 9 HOH 201 801  830  HOH HOH A . 
M 9 HOH 202 802  620  HOH HOH A . 
M 9 HOH 203 803  749  HOH HOH A . 
M 9 HOH 204 804  796  HOH HOH A . 
M 9 HOH 205 805  780  HOH HOH A . 
M 9 HOH 206 806  814  HOH HOH A . 
M 9 HOH 207 807  777  HOH HOH A . 
M 9 HOH 208 808  965  HOH HOH A . 
M 9 HOH 209 809  684  HOH HOH A . 
M 9 HOH 210 810  755  HOH HOH A . 
M 9 HOH 211 811  872  HOH HOH A . 
M 9 HOH 212 812  612  HOH HOH A . 
M 9 HOH 213 813  818  HOH HOH A . 
M 9 HOH 214 814  779  HOH HOH A . 
M 9 HOH 215 815  934  HOH HOH A . 
M 9 HOH 216 816  750  HOH HOH A . 
M 9 HOH 217 817  613  HOH HOH A . 
M 9 HOH 218 818  894  HOH HOH A . 
M 9 HOH 219 819  958  HOH HOH A . 
M 9 HOH 220 820  800  HOH HOH A . 
M 9 HOH 221 821  784  HOH HOH A . 
M 9 HOH 222 822  5    HOH HOH A . 
M 9 HOH 223 823  723  HOH HOH A . 
M 9 HOH 224 824  944  HOH HOH A . 
M 9 HOH 225 825  624  HOH HOH A . 
M 9 HOH 226 826  762  HOH HOH A . 
M 9 HOH 227 827  968  HOH HOH A . 
M 9 HOH 228 828  719  HOH HOH A . 
M 9 HOH 229 829  862  HOH HOH A . 
M 9 HOH 230 830  757  HOH HOH A . 
M 9 HOH 231 831  936  HOH HOH A . 
M 9 HOH 232 832  799  HOH HOH A . 
M 9 HOH 233 833  710  HOH HOH A . 
M 9 HOH 234 834  124  HOH HOH A . 
M 9 HOH 235 835  754  HOH HOH A . 
M 9 HOH 236 836  826  HOH HOH A . 
M 9 HOH 237 837  680  HOH HOH A . 
M 9 HOH 238 838  614  HOH HOH A . 
M 9 HOH 239 839  847  HOH HOH A . 
M 9 HOH 240 840  713  HOH HOH A . 
M 9 HOH 241 841  868  HOH HOH A . 
M 9 HOH 242 842  781  HOH HOH A . 
M 9 HOH 243 843  984  HOH HOH A . 
M 9 HOH 244 844  928  HOH HOH A . 
M 9 HOH 245 845  652  HOH HOH A . 
M 9 HOH 246 846  681  HOH HOH A . 
M 9 HOH 247 847  637  HOH HOH A . 
M 9 HOH 248 848  994  HOH HOH A . 
M 9 HOH 249 849  133  HOH HOH A . 
M 9 HOH 250 850  731  HOH HOH A . 
M 9 HOH 251 851  699  HOH HOH A . 
M 9 HOH 252 852  615  HOH HOH A . 
M 9 HOH 253 853  849  HOH HOH A . 
M 9 HOH 254 854  732  HOH HOH A . 
M 9 HOH 255 855  829  HOH HOH A . 
M 9 HOH 256 856  873  HOH HOH A . 
M 9 HOH 257 857  794  HOH HOH A . 
M 9 HOH 258 858  926  HOH HOH A . 
M 9 HOH 259 859  976  HOH HOH A . 
M 9 HOH 260 860  833  HOH HOH A . 
M 9 HOH 261 861  1001 HOH HOH A . 
M 9 HOH 262 862  804  HOH HOH A . 
M 9 HOH 263 863  906  HOH HOH A . 
M 9 HOH 264 864  949  HOH HOH A . 
M 9 HOH 265 865  859  HOH HOH A . 
M 9 HOH 266 866  948  HOH HOH A . 
M 9 HOH 267 867  809  HOH HOH A . 
M 9 HOH 268 868  709  HOH HOH A . 
M 9 HOH 269 869  641  HOH HOH A . 
M 9 HOH 270 870  856  HOH HOH A . 
M 9 HOH 271 871  967  HOH HOH A . 
M 9 HOH 272 872  817  HOH HOH A . 
M 9 HOH 273 873  734  HOH HOH A . 
M 9 HOH 274 874  675  HOH HOH A . 
M 9 HOH 275 875  901  HOH HOH A . 
M 9 HOH 276 876  767  HOH HOH A . 
M 9 HOH 277 877  790  HOH HOH A . 
M 9 HOH 278 878  931  HOH HOH A . 
M 9 HOH 279 879  132  HOH HOH A . 
M 9 HOH 280 880  881  HOH HOH A . 
M 9 HOH 281 881  996  HOH HOH A . 
M 9 HOH 282 882  718  HOH HOH A . 
M 9 HOH 283 883  951  HOH HOH A . 
M 9 HOH 284 884  854  HOH HOH A . 
M 9 HOH 285 885  774  HOH HOH A . 
M 9 HOH 286 886  891  HOH HOH A . 
M 9 HOH 287 887  997  HOH HOH A . 
M 9 HOH 288 888  807  HOH HOH A . 
M 9 HOH 289 889  933  HOH HOH A . 
M 9 HOH 290 890  902  HOH HOH A . 
M 9 HOH 291 891  929  HOH HOH A . 
M 9 HOH 292 892  892  HOH HOH A . 
M 9 HOH 293 893  942  HOH HOH A . 
M 9 HOH 294 894  1000 HOH HOH A . 
M 9 HOH 295 895  938  HOH HOH A . 
M 9 HOH 296 896  711  HOH HOH A . 
M 9 HOH 297 897  910  HOH HOH A . 
M 9 HOH 298 898  912  HOH HOH A . 
M 9 HOH 299 899  4    HOH HOH A . 
M 9 HOH 300 900  811  HOH HOH A . 
M 9 HOH 301 901  861  HOH HOH A . 
M 9 HOH 302 902  915  HOH HOH A . 
M 9 HOH 303 903  785  HOH HOH A . 
M 9 HOH 304 904  716  HOH HOH A . 
M 9 HOH 305 905  989  HOH HOH A . 
M 9 HOH 306 906  816  HOH HOH A . 
M 9 HOH 307 907  802  HOH HOH A . 
M 9 HOH 308 908  787  HOH HOH A . 
M 9 HOH 309 909  946  HOH HOH A . 
M 9 HOH 310 910  908  HOH HOH A . 
M 9 HOH 311 911  992  HOH HOH A . 
M 9 HOH 312 912  698  HOH HOH A . 
M 9 HOH 313 913  666  HOH HOH A . 
M 9 HOH 314 914  216  HOH HOH A . 
M 9 HOH 315 915  988  HOH HOH A . 
M 9 HOH 316 916  970  HOH HOH A . 
M 9 HOH 317 917  756  HOH HOH A . 
M 9 HOH 318 918  963  HOH HOH A . 
M 9 HOH 319 919  866  HOH HOH A . 
M 9 HOH 320 920  836  HOH HOH A . 
M 9 HOH 321 921  706  HOH HOH A . 
M 9 HOH 322 922  6    HOH HOH A . 
M 9 HOH 323 923  857  HOH HOH A . 
M 9 HOH 324 924  941  HOH HOH A . 
M 9 HOH 325 925  764  HOH HOH A . 
M 9 HOH 326 926  969  HOH HOH A . 
M 9 HOH 327 927  960  HOH HOH A . 
M 9 HOH 328 928  690  HOH HOH A . 
M 9 HOH 329 929  770  HOH HOH A . 
M 9 HOH 330 930  993  HOH HOH A . 
M 9 HOH 331 931  907  HOH HOH A . 
M 9 HOH 332 932  978  HOH HOH A . 
M 9 HOH 333 933  798  HOH HOH A . 
M 9 HOH 334 934  971  HOH HOH A . 
M 9 HOH 335 935  957  HOH HOH A . 
M 9 HOH 336 936  916  HOH HOH A . 
M 9 HOH 337 937  874  HOH HOH A . 
M 9 HOH 338 938  765  HOH HOH A . 
M 9 HOH 339 939  909  HOH HOH A . 
M 9 HOH 340 940  924  HOH HOH A . 
M 9 HOH 341 941  812  HOH HOH A . 
M 9 HOH 342 942  898  HOH HOH A . 
M 9 HOH 343 943  897  HOH HOH A . 
M 9 HOH 344 944  920  HOH HOH A . 
M 9 HOH 345 945  927  HOH HOH A . 
M 9 HOH 346 946  869  HOH HOH A . 
M 9 HOH 347 947  937  HOH HOH A . 
M 9 HOH 348 948  860  HOH HOH A . 
M 9 HOH 349 949  903  HOH HOH A . 
M 9 HOH 350 950  792  HOH HOH A . 
M 9 HOH 351 951  983  HOH HOH A . 
M 9 HOH 352 952  945  HOH HOH A . 
M 9 HOH 353 953  893  HOH HOH A . 
M 9 HOH 354 954  1003 HOH HOH A . 
M 9 HOH 355 955  751  HOH HOH A . 
M 9 HOH 356 956  753  HOH HOH A . 
M 9 HOH 357 957  952  HOH HOH A . 
M 9 HOH 358 958  693  HOH HOH A . 
M 9 HOH 359 959  837  HOH HOH A . 
M 9 HOH 360 960  922  HOH HOH A . 
M 9 HOH 361 961  982  HOH HOH A . 
M 9 HOH 362 962  878  HOH HOH A . 
M 9 HOH 363 963  962  HOH HOH A . 
M 9 HOH 364 964  974  HOH HOH A . 
M 9 HOH 365 965  726  HOH HOH A . 
M 9 HOH 366 966  947  HOH HOH A . 
M 9 HOH 367 967  930  HOH HOH A . 
M 9 HOH 368 968  961  HOH HOH A . 
M 9 HOH 369 969  880  HOH HOH A . 
M 9 HOH 370 970  795  HOH HOH A . 
M 9 HOH 371 971  953  HOH HOH A . 
M 9 HOH 372 972  821  HOH HOH A . 
M 9 HOH 373 973  664  HOH HOH A . 
M 9 HOH 374 974  697  HOH HOH A . 
M 9 HOH 375 975  839  HOH HOH A . 
M 9 HOH 376 976  876  HOH HOH A . 
M 9 HOH 377 977  932  HOH HOH A . 
M 9 HOH 378 978  887  HOH HOH A . 
M 9 HOH 379 979  895  HOH HOH A . 
M 9 HOH 380 980  943  HOH HOH A . 
M 9 HOH 381 981  748  HOH HOH A . 
M 9 HOH 382 982  696  HOH HOH A . 
M 9 HOH 383 983  823  HOH HOH A . 
M 9 HOH 384 984  905  HOH HOH A . 
M 9 HOH 385 985  911  HOH HOH A . 
M 9 HOH 386 986  851  HOH HOH A . 
M 9 HOH 387 987  883  HOH HOH A . 
M 9 HOH 388 988  940  HOH HOH A . 
M 9 HOH 389 989  959  HOH HOH A . 
M 9 HOH 390 990  954  HOH HOH A . 
M 9 HOH 391 991  691  HOH HOH A . 
M 9 HOH 392 992  955  HOH HOH A . 
M 9 HOH 393 993  738  HOH HOH A . 
M 9 HOH 394 994  879  HOH HOH A . 
M 9 HOH 395 995  987  HOH HOH A . 
M 9 HOH 396 996  991  HOH HOH A . 
M 9 HOH 397 997  864  HOH HOH A . 
M 9 HOH 398 998  845  HOH HOH A . 
M 9 HOH 399 999  700  HOH HOH A . 
M 9 HOH 400 1000 986  HOH HOH A . 
M 9 HOH 401 1001 985  HOH HOH A . 
M 9 HOH 402 1002 918  HOH HOH A . 
N 9 HOH 1   101  103  HOH HOH T . 
N 9 HOH 2   102  109  HOH HOH T . 
N 9 HOH 3   103  136  HOH HOH T . 
N 9 HOH 4   104  108  HOH HOH T . 
N 9 HOH 5   105  106  HOH HOH T . 
N 9 HOH 6   106  115  HOH HOH T . 
N 9 HOH 7   107  110  HOH HOH T . 
N 9 HOH 8   108  120  HOH HOH T . 
N 9 HOH 9   109  113  HOH HOH T . 
N 9 HOH 10  110  791  HOH HOH T . 
N 9 HOH 11  111  123  HOH HOH T . 
N 9 HOH 12  112  111  HOH HOH T . 
N 9 HOH 13  113  128  HOH HOH T . 
N 9 HOH 14  114  102  HOH HOH T . 
N 9 HOH 15  115  117  HOH HOH T . 
N 9 HOH 16  116  116  HOH HOH T . 
N 9 HOH 17  117  135  HOH HOH T . 
N 9 HOH 18  118  119  HOH HOH T . 
N 9 HOH 19  119  104  HOH HOH T . 
N 9 HOH 20  120  125  HOH HOH T . 
N 9 HOH 21  121  130  HOH HOH T . 
N 9 HOH 22  122  122  HOH HOH T . 
N 9 HOH 23  123  101  HOH HOH T . 
N 9 HOH 24  124  114  HOH HOH T . 
N 9 HOH 25  125  127  HOH HOH T . 
N 9 HOH 26  126  676  HOH HOH T . 
N 9 HOH 27  127  121  HOH HOH T . 
N 9 HOH 28  128  112  HOH HOH T . 
N 9 HOH 29  129  126  HOH HOH T . 
N 9 HOH 30  130  118  HOH HOH T . 
N 9 HOH 31  131  134  HOH HOH T . 
N 9 HOH 32  132  129  HOH HOH T . 
N 9 HOH 33  133  828  HOH HOH T . 
N 9 HOH 34  134  832  HOH HOH T . 
N 9 HOH 35  135  131  HOH HOH T . 
N 9 HOH 36  136  871  HOH HOH T . 
O 9 HOH 1   201  211  HOH HOH P . 
O 9 HOH 2   202  215  HOH HOH P . 
O 9 HOH 3   203  202  HOH HOH P . 
O 9 HOH 4   204  1    HOH HOH P . 
O 9 HOH 5   205  217  HOH HOH P . 
O 9 HOH 6   206  214  HOH HOH P . 
O 9 HOH 7   207  219  HOH HOH P . 
O 9 HOH 8   208  204  HOH HOH P . 
O 9 HOH 9   209  220  HOH HOH P . 
O 9 HOH 10  210  203  HOH HOH P . 
O 9 HOH 11  211  222  HOH HOH P . 
O 9 HOH 12  212  201  HOH HOH P . 
O 9 HOH 13  213  673  HOH HOH P . 
O 9 HOH 14  214  604  HOH HOH P . 
O 9 HOH 15  215  212  HOH HOH P . 
O 9 HOH 16  216  205  HOH HOH P . 
O 9 HOH 17  217  841  HOH HOH P . 
O 9 HOH 18  218  218  HOH HOH P . 
O 9 HOH 19  219  221  HOH HOH P . 
O 9 HOH 20  220  867  HOH HOH P . 
O 9 HOH 21  221  210  HOH HOH P . 
O 9 HOH 22  222  224  HOH HOH P . 
O 9 HOH 23  223  223  HOH HOH P . 
O 9 HOH 24  224  213  HOH HOH P . 
O 9 HOH 25  225  208  HOH HOH P . 
O 9 HOH 26  226  206  HOH HOH P . 
O 9 HOH 27  227  207  HOH HOH P . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6600  ? 
1 MORE         -64   ? 
1 'SSA (A^2)'  21830 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 40.3  ? 
2  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 86.4  ? 
3  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 105.9 ? 
4  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 100.7 ? 
5  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 70.2  ? 
6  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 80.0  ? 
7  OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 167.4 ? 
8  OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 152.2 ? 
9  O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 88.2  ? 
10 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1B   A J DTP .   ? A DTP 507 ? 1_555 89.5  ? 
11 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 104.0 ? 
12 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 75.1  ? 
13 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 162.1 ? 
14 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 83.8  ? 
15 O1B   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 84.2  ? 
16 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 88.9  ? 
17 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 115.5 ? 
18 O     ? A MET 17  ? A MET 14  ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 106.4 ? 
19 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 168.9 ? 
20 O1B   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 81.8  ? 
21 O1A   A J DTP .   ? A DTP 507 ? 1_555 CA A E CA . ? A CA 502 ? 1_555 O1G   A J DTP .   ? A DTP 507 ? 1_555 88.6  ? 
22 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O     ? A MET 17  ? A MET 14  ? 1_555 86.3  ? 
23 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 100.8 ? 
24 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 79.9  ? 
25 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 101.2 ? 
26 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 159.6 ? 
27 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 80.2  ? 
28 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 166.5 ? 
29 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 93.0  ? 
30 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 92.3  ? 
31 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O1    B K DPO .   ? A DPO 508 ? 1_555 84.0  ? 
32 OD1   ? A ASP 16  ? A ASP 13  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 93.1  ? 
33 O     ? A MET 17  ? A MET 14  ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 108.3 ? 
34 OD2   ? A ASP 118 ? A ASP 115 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 164.4 ? 
35 OP1   B C DA  9   ? P DA  9   ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 90.3  ? 
36 O1    B K DPO .   ? A DPO 508 ? 1_555 MN B F MN . ? A MN 503 ? 1_555 O5    B K DPO .   ? A DPO 508 ? 1_555 74.3  ? 
37 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 89.7  ? 
38 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 94.1  ? 
39 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 93.5  ? 
40 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 174.6 ? 
41 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 85.6  ? 
42 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" A C DT  8   ? P DT  8   ? 1_555 83.6  ? 
43 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 169.8 ? 
44 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 87.2  ? 
45 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 95.7  ? 
46 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 "O3'" B C DT  8   ? P DT  8   ? 1_555 12.3  ? 
47 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 103.7 ? 
48 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 93.0  ? 
49 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 161.1 ? 
50 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 79.2  ? 
51 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 OP1   B C DA  9   ? P DA  9   ? 1_555 66.9  ? 
52 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 93.1  ? 
53 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 172.6 ? 
54 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 93.2  ? 
55 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 91.9  ? 
56 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 88.8  ? 
57 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O     ? O HOH .   ? P HOH 214 ? 1_555 79.7  ? 
58 OD2   ? A ASP 16  ? A ASP 13  ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 100.5 ? 
59 OD1   ? A ASP 118 ? A ASP 115 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 93.4  ? 
60 OE2   ? A GLU 119 ? A GLU 116 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 163.9 ? 
61 "O3'" A C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 82.4  ? 
62 "O3'" B C DT  8   ? P DT  8   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 70.1  ? 
63 OP1   B C DA  9   ? P DA  9   ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 3.2   ? 
64 O     ? O HOH .   ? P HOH 214 ? 1_555 MN ? D MN . ? A MN 501 ? 1_555 O1A   A J DTP .   ? A DTP 507 ? 1_555 79.3  ? 
65 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O2    B K DPO .   ? A DPO 508 ? 1_555 85.7  ? 
66 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B M HOH .   ? A HOH 606 ? 1_555 96.0  ? 
67 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     B M HOH .   ? A HOH 606 ? 1_555 88.6  ? 
68 OP2   B C DA  9   ? P DA  9   ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 642 ? 1_555 169.2 ? 
69 O2    B K DPO .   ? A DPO 508 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 642 ? 1_555 87.8  ? 
70 O     B M HOH .   ? A HOH 606 ? 1_555 MN B L MN . ? P MN 101 ? 1_555 O     ? M HOH .   ? A HOH 642 ? 1_555 92.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-06-22 
2 'Structure model' 1 1 2018-01-31 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 2 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support 
2 2 'Structure model' struct_conn        
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    2 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? .    1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XSCALE      ? ? ? .    2 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 3 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS         ? ? ? .    4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .    5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O   A HOH 844 ? ? O A HOH 854 ? ? 2.05 
2 1 O   A HOH 721 ? ? O A HOH 942 ? ? 2.18 
3 1 OE1 A GLU 101 ? ? O A HOH 601 ? ? 2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     776 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    A 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     855 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_664 
_pdbx_validate_symm_contact.dist              2.19 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 "C2'" P DT 8 ? B "C1'" P DT 8 ? B 1.696 1.519 0.177  0.010 N 
2 1 "O3'" P DT 8 ? B "C3'" P DT 8 ? B 1.309 1.419 -0.110 0.006 N 
3 1 P     P DA 9 ? B OP1   P DA 9 ? B 1.588 1.485 0.103  0.017 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 "C5'" P DT 8 ? B "C4'" P DT 8 ? B "C3'" P DT 8 ? B 125.48 115.70 9.78   1.20 N 
2 1 "C2'" P DT 8 ? B "C3'" P DT 8 ? B "O3'" P DT 8 ? B 90.61  109.40 -18.79 2.50 N 
3 1 "C4'" P DT 8 ? B "C3'" P DT 8 ? B "C2'" P DT 8 ? B 115.46 103.10 12.36  0.90 N 
4 1 "C3'" P DT 8 ? B "C2'" P DT 8 ? B "C1'" P DT 8 ? B 90.05  102.40 -12.35 0.80 N 
5 1 "O4'" P DT 8 ? B "C1'" P DT 8 ? B "C2'" P DT 8 ? B 112.43 106.80 5.63   0.50 N 
6 1 N1    P DT 8 ? B "C1'" P DT 8 ? B "C2'" P DT 8 ? B 135.09 114.30 20.79  1.40 N 
7 1 "C3'" P DT 8 ? B "O3'" P DT 8 ? B P     P DA 9 ? B 112.11 119.70 -7.59  1.20 Y 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 38.80   56.92   
2 1 TYR A 39  ? ? 65.03   -177.64 
3 1 LYS A 40  ? ? -155.47 -36.33  
4 1 SER A 62  ? ? 82.01   -11.63  
5 1 SER A 217 ? ? -151.04 -156.52 
6 1 ASN A 230 ? ? -140.44 44.86   
7 1 ASN A 230 ? ? -140.44 48.29   
8 1 SER A 257 ? ? 92.72   -10.41  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 T DC 1 ? "O5'" ? B DC 1 "O5'" 
2  1 Y 1 T DC 1 ? "C5'" ? B DC 1 "C5'" 
3  1 Y 1 T DC 1 ? "C4'" ? B DC 1 "C4'" 
4  1 Y 1 T DC 1 ? "O4'" ? B DC 1 "O4'" 
5  1 Y 1 T DC 1 ? "C3'" ? B DC 1 "C3'" 
6  1 Y 1 T DC 1 ? "C2'" ? B DC 1 "C2'" 
7  1 Y 1 T DC 1 ? "C1'" ? B DC 1 "C1'" 
8  1 Y 1 T DC 1 ? N1    ? B DC 1 N1    
9  1 Y 1 T DC 1 ? C2    ? B DC 1 C2    
10 1 Y 1 T DC 1 ? O2    ? B DC 1 O2    
11 1 Y 1 T DC 1 ? N3    ? B DC 1 N3    
12 1 Y 1 T DC 1 ? C4    ? B DC 1 C4    
13 1 Y 1 T DC 1 ? N4    ? B DC 1 N4    
14 1 Y 1 T DC 1 ? C5    ? B DC 1 C5    
15 1 Y 1 T DC 1 ? C6    ? B DC 1 C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A THR 155 ? A THR 158 
2 1 Y 1 A THR 156 ? A THR 159 
3 1 Y 1 A ALA 157 ? A ALA 160 
4 1 Y 1 A GLU 158 ? A GLU 161 
5 1 Y 1 A GLU 159 ? A GLU 162 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
5L9X 'double helix'        
5L9X 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 4  1_555 C DA 9 1_555 0.101  -0.378 0.218  -4.540 -5.802  3.262  1 T_DT4:DA9_P  T 4  ? P 9 ? 20 1 
1 B DA 5  1_555 C DT 8 1_555 0.136  -0.221 -0.107 -4.865 -6.736  4.184  2 T_DA5:DT8_P  T 5  ? P 8 ? 20 1 
1 B DT 6  1_555 C DA 7 1_555 -0.037 -0.103 0.428  -1.036 -17.065 5.555  3 T_DT6:DA7_P  T 6  ? P 7 ? 20 1 
1 B DG 7  1_555 C DC 6 1_555 0.010  -0.191 -0.495 -8.883 -2.685  1.278  4 T_DG7:DC6_P  T 7  ? P 6 ? 19 1 
1 B DA 8  1_555 C DT 5 1_555 0.072  -0.236 -0.015 3.058  -2.187  -0.924 5 T_DA8:DT5_P  T 8  ? P 5 ? 20 1 
1 B DC 9  1_555 C DG 4 1_555 0.064  -0.248 -0.349 9.628  -8.254  3.029  6 T_DC9:DG4_P  T 9  ? P 4 ? 19 1 
1 B DG 10 1_555 C DC 3 1_555 -0.287 -0.254 -0.193 -4.496 -8.278  4.036  7 T_DG10:DC3_P T 10 ? P 3 ? 19 1 
1 B DC 11 1_555 C DG 2 1_555 -0.203 -0.143 0.224  -6.678 -3.737  -0.438 8 T_DC11:DG2_P T 11 ? P 2 ? 19 1 
1 B DT 12 1_555 C DA 1 1_555 -0.166 -0.212 -0.126 14.792 2.679   -0.441 9 T_DT12:DA1_P T 12 ? P 1 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 4  1_555 C DA 9 1_555 B DA 5  1_555 C DT 8 1_555 0.597  -0.052 3.401 2.312  7.746 38.429 -1.043 -0.602 3.357 11.612 -3.466  
39.238 1 TT_DT4DA5:DT8DA9_PP   T 4  ? P 9 ? T 5  ? P 8 ? 
1 B DA 5  1_555 C DT 8 1_555 B DT 6  1_555 C DA 7 1_555 0.924  -1.122 3.257 -4.278 1.795 24.580 -3.104 -3.354 2.968 4.169  9.935   
25.008 2 TT_DA5DT6:DA7DT8_PP   T 5  ? P 8 ? T 6  ? P 7 ? 
1 B DT 6  1_555 C DA 7 1_555 B DG 7  1_555 C DC 6 1_555 -0.568 -0.990 3.461 7.698  8.664 31.415 -3.156 2.262  2.880 15.361 -13.649 
33.434 3 TT_DT6DG7:DC6DA7_PP   T 6  ? P 7 ? T 7  ? P 6 ? 
1 B DG 7  1_555 C DC 6 1_555 B DA 8  1_555 C DT 5 1_555 -0.639 -0.506 3.094 -3.961 2.545 32.346 -1.319 0.483  3.100 4.538  7.064   
32.678 4 TT_DG7DA8:DT5DC6_PP   T 7  ? P 6 ? T 8  ? P 5 ? 
1 B DA 8  1_555 C DT 5 1_555 B DC 9  1_555 C DG 4 1_555 0.367  -0.732 3.254 3.150  0.231 30.354 -1.437 -0.071 3.269 0.440  -5.996  
30.514 5 TT_DA8DC9:DG4DT5_PP   T 8  ? P 5 ? T 9  ? P 4 ? 
1 B DC 9  1_555 C DG 4 1_555 B DG 10 1_555 C DC 3 1_555 -0.340 -0.322 3.753 -4.156 5.947 35.428 -1.480 -0.125 3.669 9.648  6.742   
36.140 6 TT_DC9DG10:DC3DG4_PP  T 9  ? P 4 ? T 10 ? P 3 ? 
1 B DG 10 1_555 C DC 3 1_555 B DC 11 1_555 C DG 2 1_555 -0.535 -0.651 3.418 -3.865 0.135 35.460 -1.084 0.284  3.453 0.220  6.322   
35.664 7 TT_DG10DC11:DG2DC3_PP T 10 ? P 3 ? T 11 ? P 2 ? 
1 B DC 11 1_555 C DG 2 1_555 B DT 12 1_555 C DA 1 1_555 0.188  0.023  2.942 -0.645 1.877 29.167 -0.320 -0.499 2.933 3.721  1.279   
29.233 8 TT_DC11DT12:DA1DG2_PP T 11 ? P 2 ? T 12 ? P 1 ? 
# 
_pdbx_audit_support.funding_organization   'National Institutes of Health' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           'Intramural DK036146-08' 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MANGANESE (II) ION'                MN  
5 'CALCIUM ION'                       CA  
6 GLYCEROL                            GOL 
7 
;2'-DEOXYADENOSINE 5'-TRIPHOSPHATE
;
DTP 
8 DIPHOSPHATE                         DPO 
9 water                               HOH 
#