data_5LAH
# 
_entry.id   5LAH 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.308 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LAH         
WWPDB D_1200000427 
BMRB  34008        
# 
_pdbx_database_related.db_name        BMRB 
_pdbx_database_related.details        . 
_pdbx_database_related.db_id          34008 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  REL 
_pdbx_database_status.entry_id                        5LAH 
_pdbx_database_status.recvd_initial_deposition_date   2016-06-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  REL 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Mineev, K.S.'    1 ? 
'Arseniev, A.S.'  2 ? 
'Andreev, Y.A.'   3 ? 
'Kozlov, S.A.'    4 ? 
'Logashina, Y.A.' 5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   CH 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Toxins 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2072-6651 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            9 
_citation.language                  ? 
_citation.page_first                154 
_citation.page_last                 ? 
_citation.title                     
'New Disulfide-Stabilized Fold Provides Sea Anemone Peptide to Exhibit Both Antimicrobial and TRPA1 Potentiating Properties' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.3390/toxins9050154 
_citation.pdbx_database_id_PubMed   28468269 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Logashina, Y.A.' 1  ? 
primary 'Solstad, R.G.'   2  ? 
primary 'Mineev, K.S.'    3  ? 
primary 'Korolkova, Y.V.' 4  ? 
primary 'Mosharova, I.V.' 5  ? 
primary 'Dyachenko, I.A.' 6  ? 
primary 'Palikov, V.A.'   7  ? 
primary 'Palikova, Y.A.'  8  ? 
primary 'Murashev, A.N.'  9  ? 
primary 'Arseniev, A.S.'  10 ? 
primary 'Kozlov, S.A.'    11 ? 
primary 'Stensvag, K.'    12 ? 
primary 'Haug, T.'        13 ? 
primary 'Andreev, Y.A.'   14 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LAH 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.000 
_cell.length_a_esd                 ? 
_cell.length_b                     1.000 
_cell.length_b_esd                 ? 
_cell.length_c                     1.000 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LAH 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
_entity.id                         1 
_entity.type                       polymer 
_entity.src_method                 nat 
_entity.pdbx_description           'tau-AnmTx Ueq 12-1' 
_entity.formula_weight             4808.258 
_entity.pdbx_number_of_molecules   1 
_entity.pdbx_ec                    ? 
_entity.pdbx_mutation              ? 
_entity.pdbx_fragment              ? 
_entity.details                    ? 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       CYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA 
_entity_poly.pdbx_seq_one_letter_code_can   CYPGQPGCGHCSRPNYCEGARCESGFHDCGSDHWCDASGDRCCCA 
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  CYS n 
1 2  TYR n 
1 3  PRO n 
1 4  GLY n 
1 5  GLN n 
1 6  PRO n 
1 7  GLY n 
1 8  CYS n 
1 9  GLY n 
1 10 HIS n 
1 11 CYS n 
1 12 SER n 
1 13 ARG n 
1 14 PRO n 
1 15 ASN n 
1 16 TYR n 
1 17 CYS n 
1 18 GLU n 
1 19 GLY n 
1 20 ALA n 
1 21 ARG n 
1 22 CYS n 
1 23 GLU n 
1 24 SER n 
1 25 GLY n 
1 26 PHE n 
1 27 HIS n 
1 28 ASP n 
1 29 CYS n 
1 30 GLY n 
1 31 SER n 
1 32 ASP n 
1 33 HIS n 
1 34 TRP n 
1 35 CYS n 
1 36 ASP n 
1 37 ALA n 
1 38 SER n 
1 39 GLY n 
1 40 ASP n 
1 41 ARG n 
1 42 CYS n 
1 43 CYS n 
1 44 CYS n 
1 45 ALA n 
# 
_entity_src_nat.entity_id                  1 
_entity_src_nat.pdbx_src_id                1 
_entity_src_nat.pdbx_alt_source_flag       sample 
_entity_src_nat.pdbx_beg_seq_num           1 
_entity_src_nat.pdbx_end_seq_num           45 
_entity_src_nat.common_name                ? 
_entity_src_nat.pdbx_organism_scientific   'Urticina eques' 
_entity_src_nat.pdbx_ncbi_taxonomy_id      417072 
_entity_src_nat.genus                      ? 
_entity_src_nat.species                    ? 
_entity_src_nat.strain                     ? 
_entity_src_nat.tissue                     ? 
_entity_src_nat.tissue_fraction            ? 
_entity_src_nat.pdbx_secretion             ? 
_entity_src_nat.pdbx_fragment              ? 
_entity_src_nat.pdbx_variant               ? 
_entity_src_nat.pdbx_cell_line             ? 
_entity_src_nat.pdbx_atcc                  ? 
_entity_src_nat.pdbx_cellular_location     ? 
_entity_src_nat.pdbx_organ                 ? 
_entity_src_nat.pdbx_organelle             ? 
_entity_src_nat.pdbx_cell                  ? 
_entity_src_nat.pdbx_plasmid_name          ? 
_entity_src_nat.pdbx_plasmid_details       ? 
_entity_src_nat.details                    ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    PDB 
_struct_ref.db_code                    5LAH 
_struct_ref.pdbx_db_accession          5LAH 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   ? 
_struct_ref.pdbx_align_begin           1 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              5LAH 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 45 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             5LAH 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  45 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       45 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
# 
loop_
_pdbx_nmr_exptl.experiment_id 
_pdbx_nmr_exptl.conditions_id 
_pdbx_nmr_exptl.solution_id 
_pdbx_nmr_exptl.type 
_pdbx_nmr_exptl.spectrometer_id 
_pdbx_nmr_exptl.sample_state 
1 1 1 NOESY            1 isotropic 
2 1 1 '2D 1H-1H TOCSY' 1 isotropic 
3 1 1 '2D 1H-15N HSQC' 1 isotropic 
4 1 2 '2D 1H-13C HSQC' 1 isotropic 
5 1 2 '2D 1H-1H NOESY' 1 isotropic 
6 1 2 '2D 1H-1H TOCSY' 1 isotropic 
7 1 2 '2D DQF-COSY'    1 isotropic 
# 
_pdbx_nmr_exptl_sample_conditions.conditions_id          1 
_pdbx_nmr_exptl_sample_conditions.temperature            303 
_pdbx_nmr_exptl_sample_conditions.pressure_units         atm 
_pdbx_nmr_exptl_sample_conditions.pressure               AMBIENT 
_pdbx_nmr_exptl_sample_conditions.pH                     3.2 
_pdbx_nmr_exptl_sample_conditions.ionic_strength         10 
_pdbx_nmr_exptl_sample_conditions.details                ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_err     ? 
_pdbx_nmr_exptl_sample_conditions.ionic_strength_units   mM 
_pdbx_nmr_exptl_sample_conditions.label                  conditions_1 
_pdbx_nmr_exptl_sample_conditions.pH_err                 0.1 
_pdbx_nmr_exptl_sample_conditions.pH_units               pH 
_pdbx_nmr_exptl_sample_conditions.pressure_err           ? 
_pdbx_nmr_exptl_sample_conditions.temperature_err        0.05 
_pdbx_nmr_exptl_sample_conditions.temperature_units      K 
# 
loop_
_pdbx_nmr_sample_details.solution_id 
_pdbx_nmr_sample_details.contents 
_pdbx_nmr_sample_details.solvent_system 
_pdbx_nmr_sample_details.label 
_pdbx_nmr_sample_details.type 
_pdbx_nmr_sample_details.details 
1 '0.5 mM tau-AnmTx Ueq 12-1, 1 mM sodium azide, 95% H2O/5% D2O' '95% H2O/5% D2O' 'water sample' solution ? 
2 '0.5 mM tau-AnmTx Ueq 12-1, 1 mM sodium azide, 100% D2O'       '100% D2O'       D2O_sample     solution ? 
# 
_pdbx_nmr_spectrometer.spectrometer_id   1 
_pdbx_nmr_spectrometer.model             Avance 
_pdbx_nmr_spectrometer.type              ? 
_pdbx_nmr_spectrometer.manufacturer      Bruker 
_pdbx_nmr_spectrometer.field_strength    700 
_pdbx_nmr_spectrometer.details           ? 
# 
_pdbx_nmr_refine.entry_id           5LAH 
_pdbx_nmr_refine.method             'torsion angle dynamics' 
_pdbx_nmr_refine.details            ? 
_pdbx_nmr_refine.software_ordinal   1 
# 
_pdbx_nmr_ensemble.entry_id                                      5LAH 
_pdbx_nmr_ensemble.conformers_calculated_total_number            100 
_pdbx_nmr_ensemble.conformers_submitted_total_number             10 
_pdbx_nmr_ensemble.conformer_selection_criteria                  'structures with the least restraint violations' 
_pdbx_nmr_ensemble.representative_conformer                      ? 
_pdbx_nmr_ensemble.average_constraints_per_residue               ? 
_pdbx_nmr_ensemble.average_constraint_violations_per_residue     ? 
_pdbx_nmr_ensemble.maximum_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.average_distance_constraint_violation         ? 
_pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation   ? 
_pdbx_nmr_ensemble.distance_constraint_violation_method          ? 
_pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.average_torsion_angle_constraint_violation    ? 
_pdbx_nmr_ensemble.torsion_angle_constraint_violation_method     ? 
# 
_pdbx_nmr_representative.entry_id             5LAH 
_pdbx_nmr_representative.conformer_id         1 
_pdbx_nmr_representative.selection_criteria   'fewest violations' 
# 
loop_
_pdbx_nmr_software.ordinal 
_pdbx_nmr_software.classification 
_pdbx_nmr_software.name 
_pdbx_nmr_software.version 
_pdbx_nmr_software.authors 
1 'structure calculation'     CYANA   3.0   'Guntert, Mumenthaler and Wuthrich' 
2 'chemical shift assignment' CARA    1.9.4 'Keller and Wuthrich'               
3 processing                  TopSpin ?     'Bruker Biospin'                    
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LAH 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'SOLUTION NMR' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5LAH 
_struct.title                        'NMR structure of the sea anemone peptide tau-AnmTx Ueq 12-1 with an uncommon fold' 
_struct.pdbx_descriptor              'tau-AnmTx Ueq 12-1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LAH 
_struct_keywords.text            'PROTEIN, sea anemone, antimicrobial peptide, TRPA1 potentiator, membrane protein, toxin' 
_struct_keywords.pdbx_keywords   TOXIN 
# 
_struct_asym.id                            A 
_struct_asym.pdbx_blank_PDB_chainid_flag   N 
_struct_asym.pdbx_modified                 N 
_struct_asym.entity_id                     1 
_struct_asym.details                       ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
TURN_P TURN_P1 T01 CYS A 1 ? GLN A 5  ? CYS A 1 GLN A 5  5 ? ? 
TURN_P TURN_P2 T02 CYS A 1 ? CYS A 8  ? CYS A 1 CYS A 8  5 ? ? 
TURN_P TURN_P3 T03 CYS A 1 ? ASN A 15 ? CYS A 1 ASN A 15 5 ? ? 
TURN_P TURN_P4 T04 CYS A 1 ? PHE A 26 ? CYS A 1 PHE A 26 5 ? ? 
TURN_P TURN_P5 T05 CYS A 1 ? ASP A 40 ? CYS A 1 ASP A 40 5 ? ? 
# 
_struct_conf_type.id          TURN_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 1  SG ? ? ? 1_555 A CYS 8  SG ? ? A CYS 1  A CYS 8  1_555 ? ? ? ? ? ? ? 1.968 ? 
disulf2 disulf ? ? A CYS 11 SG ? ? ? 1_555 A CYS 42 SG ? ? A CYS 11 A CYS 42 1_555 ? ? ? ? ? ? ? 2.122 ? 
disulf3 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 35 SG ? ? A CYS 17 A CYS 35 1_555 ? ? ? ? ? ? ? 2.118 ? 
disulf4 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 22 A CYS 43 1_555 ? ? ? ? ? ? ? 1.996 ? 
disulf5 disulf ? ? A CYS 29 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 29 A CYS 44 1_555 ? ? ? ? ? ? ? 1.997 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 1  -0.01 
2  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 2  -0.06 
3  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 3  0.00  
4  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 4  0.05  
5  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 5  -0.03 
6  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 6  -0.03 
7  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 7  0.08  
8  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 8  0.03  
9  ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 9  0.03  
10 ARG 13 A . ? ARG 13 A PRO 14 A ? PRO 14 A 10 -0.03 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 9  ? HIS A 10 ? GLY A 9  HIS A 10 
AA1 2 HIS A 33 ? TRP A 34 ? HIS A 33 TRP A 34 
AA2 1 TYR A 16 ? GLU A 18 ? TYR A 16 GLU A 18 
AA2 2 ARG A 41 ? CYS A 44 ? ARG A 41 CYS A 44 
AA2 3 HIS A 27 ? ASP A 28 ? HIS A 27 ASP A 28 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLY A 9  ? N GLY A 9  O TRP A 34 ? O TRP A 34 
AA2 1 2 N TYR A 16 ? N TYR A 16 O CYS A 43 ? O CYS A 43 
AA2 2 3 O CYS A 44 ? O CYS A 44 N HIS A 27 ? N HIS A 27 
# 
_database_PDB_matrix.entry_id          5LAH 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    5LAH 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    N N    . CYS A 1 1  ? 1.329   0.000   0.000  1.00 0.00 ? 1  CYS A N    1  
ATOM 2    C CA   . CYS A 1 1  ? 2.094   0.000   -1.241 1.00 0.00 ? 1  CYS A CA   1  
ATOM 3    C C    . CYS A 1 1  ? 2.737   -1.363  -1.483 1.00 0.00 ? 1  CYS A C    1  
ATOM 4    O O    . CYS A 1 1  ? 2.914   -2.152  -0.554 1.00 0.00 ? 1  CYS A O    1  
ATOM 5    C CB   . CYS A 1 1  ? 3.172   1.085   -1.200 1.00 0.00 ? 1  CYS A CB   1  
ATOM 6    S SG   . CYS A 1 1  ? 3.963   1.286   0.428  1.00 0.00 ? 1  CYS A SG   1  
ATOM 7    H H    . CYS A 1 1  ? 1.807   0.001   0.856  1.00 0.00 ? 1  CYS A H    1  
ATOM 8    H HA   . CYS A 1 1  ? 1.413   0.211   -2.051 1.00 0.00 ? 1  CYS A HA   1  
ATOM 9    H HB2  . CYS A 1 1  ? 3.946   0.839   -1.913 1.00 0.00 ? 1  CYS A HB2  1  
ATOM 10   H HB3  . CYS A 1 1  ? 2.728   2.032   -1.470 1.00 0.00 ? 1  CYS A HB3  1  
ATOM 11   N N    . TYR A 1 2  ? 3.086   -1.632  -2.736 1.00 0.00 ? 2  TYR A N    1  
ATOM 12   C CA   . TYR A 1 2  ? 3.708   -2.899  -3.101 1.00 0.00 ? 2  TYR A CA   1  
ATOM 13   C C    . TYR A 1 2  ? 5.216   -2.850  -2.878 1.00 0.00 ? 2  TYR A C    1  
ATOM 14   O O    . TYR A 1 2  ? 5.837   -1.787  -2.886 1.00 0.00 ? 2  TYR A O    1  
ATOM 15   C CB   . TYR A 1 2  ? 3.408   -3.236  -4.563 1.00 0.00 ? 2  TYR A CB   1  
ATOM 16   C CG   . TYR A 1 2  ? 2.702   -4.560  -4.746 1.00 0.00 ? 2  TYR A CG   1  
ATOM 17   C CD1  . TYR A 1 2  ? 1.678   -4.948  -3.891 1.00 0.00 ? 2  TYR A CD1  1  
ATOM 18   C CD2  . TYR A 1 2  ? 3.059   -5.424  -5.774 1.00 0.00 ? 2  TYR A CD2  1  
ATOM 19   C CE1  . TYR A 1 2  ? 1.030   -6.157  -4.054 1.00 0.00 ? 2  TYR A CE1  1  
ATOM 20   C CE2  . TYR A 1 2  ? 2.416   -6.634  -5.946 1.00 0.00 ? 2  TYR A CE2  1  
ATOM 21   C CZ   . TYR A 1 2  ? 1.402   -6.997  -5.083 1.00 0.00 ? 2  TYR A CZ   1  
ATOM 22   O OH   . TYR A 1 2  ? 0.760   -8.202  -5.250 1.00 0.00 ? 2  TYR A OH   1  
ATOM 23   H H    . TYR A 1 2  ? 2.920   -0.963  -3.433 1.00 0.00 ? 2  TYR A H    1  
ATOM 24   H HA   . TYR A 1 2  ? 3.287   -3.669  -2.471 1.00 0.00 ? 2  TYR A HA   1  
ATOM 25   H HB2  . TYR A 1 2  ? 2.779   -2.465  -4.981 1.00 0.00 ? 2  TYR A HB2  1  
ATOM 26   H HB3  . TYR A 1 2  ? 4.336   -3.275  -5.114 1.00 0.00 ? 2  TYR A HB3  1  
ATOM 27   H HD1  . TYR A 1 2  ? 1.388   -4.288  -3.086 1.00 0.00 ? 2  TYR A HD1  1  
ATOM 28   H HD2  . TYR A 1 2  ? 3.854   -5.137  -6.448 1.00 0.00 ? 2  TYR A HD2  1  
ATOM 29   H HE1  . TYR A 1 2  ? 0.236   -6.441  -3.379 1.00 0.00 ? 2  TYR A HE1  1  
ATOM 30   H HE2  . TYR A 1 2  ? 2.708   -7.292  -6.751 1.00 0.00 ? 2  TYR A HE2  1  
ATOM 31   H HH   . TYR A 1 2  ? 0.074   -8.294  -4.585 1.00 0.00 ? 2  TYR A HH   1  
ATOM 32   N N    . PRO A 1 3  ? 5.822   -4.029  -2.675 1.00 0.00 ? 3  PRO A N    1  
ATOM 33   C CA   . PRO A 1 3  ? 7.265   -4.149  -2.447 1.00 0.00 ? 3  PRO A CA   1  
ATOM 34   C C    . PRO A 1 3  ? 8.078   -3.837  -3.699 1.00 0.00 ? 3  PRO A C    1  
ATOM 35   O O    . PRO A 1 3  ? 8.475   -4.739  -4.434 1.00 0.00 ? 3  PRO A O    1  
ATOM 36   C CB   . PRO A 1 3  ? 7.440   -5.617  -2.048 1.00 0.00 ? 3  PRO A CB   1  
ATOM 37   C CG   . PRO A 1 3  ? 6.283   -6.319  -2.670 1.00 0.00 ? 3  PRO A CG   1  
ATOM 38   C CD   . PRO A 1 3  ? 5.144   -5.337  -2.653 1.00 0.00 ? 3  PRO A CD   1  
ATOM 39   H HA   . PRO A 1 3  ? 7.593   -3.513  -1.638 1.00 0.00 ? 3  PRO A HA   1  
ATOM 40   H HB2  . PRO A 1 3  ? 8.381   -5.987  -2.432 1.00 0.00 ? 3  PRO A HB2  1  
ATOM 41   H HB3  . PRO A 1 3  ? 7.424   -5.706  -0.972 1.00 0.00 ? 3  PRO A HB3  1  
ATOM 42   H HG2  . PRO A 1 3  ? 6.524   -6.596  -3.685 1.00 0.00 ? 3  PRO A HG2  1  
ATOM 43   H HG3  . PRO A 1 3  ? 6.030   -7.195  -2.090 1.00 0.00 ? 3  PRO A HG3  1  
ATOM 44   H HD2  . PRO A 1 3  ? 4.523   -5.464  -3.527 1.00 0.00 ? 3  PRO A HD2  1  
ATOM 45   H HD3  . PRO A 1 3  ? 4.560   -5.452  -1.752 1.00 0.00 ? 3  PRO A HD3  1  
ATOM 46   N N    . GLY A 1 4  ? 8.322   -2.551  -3.934 1.00 0.00 ? 4  GLY A N    1  
ATOM 47   C CA   . GLY A 1 4  ? 9.087   -2.143  -5.098 1.00 0.00 ? 4  GLY A CA   1  
ATOM 48   C C    . GLY A 1 4  ? 8.368   -1.096  -5.926 1.00 0.00 ? 4  GLY A C    1  
ATOM 49   O O    . GLY A 1 4  ? 8.748   -0.830  -7.066 1.00 0.00 ? 4  GLY A O    1  
ATOM 50   H H    . GLY A 1 4  ? 7.980   -1.875  -3.313 1.00 0.00 ? 4  GLY A H    1  
ATOM 51   H HA2  . GLY A 1 4  ? 10.033  -1.739  -4.770 1.00 0.00 ? 4  GLY A HA2  1  
ATOM 52   H HA3  . GLY A 1 4  ? 9.271   -3.009  -5.716 1.00 0.00 ? 4  GLY A HA3  1  
ATOM 53   N N    . GLN A 1 5  ? 7.325   -0.504  -5.353 1.00 0.00 ? 5  GLN A N    1  
ATOM 54   C CA   . GLN A 1 5  ? 6.550   0.517   -6.048 1.00 0.00 ? 5  GLN A CA   1  
ATOM 55   C C    . GLN A 1 5  ? 7.305   1.842   -6.086 1.00 0.00 ? 5  GLN A C    1  
ATOM 56   O O    . GLN A 1 5  ? 8.172   2.114   -5.255 1.00 0.00 ? 5  GLN A O    1  
ATOM 57   C CB   . GLN A 1 5  ? 5.194   0.709   -5.367 1.00 0.00 ? 5  GLN A CB   1  
ATOM 58   C CG   . GLN A 1 5  ? 4.303   -0.521  -5.427 1.00 0.00 ? 5  GLN A CG   1  
ATOM 59   C CD   . GLN A 1 5  ? 2.832   -0.172  -5.536 1.00 0.00 ? 5  GLN A CD   1  
ATOM 60   O OE1  . GLN A 1 5  ? 2.230   0.333   -4.588 1.00 0.00 ? 5  GLN A OE1  1  
ATOM 61   N NE2  . GLN A 1 5  ? 2.244   -0.440  -6.697 1.00 0.00 ? 5  GLN A NE2  1  
ATOM 62   H H    . GLN A 1 5  ? 7.071   -0.760  -4.442 1.00 0.00 ? 5  GLN A H    1  
ATOM 63   H HA   . GLN A 1 5  ? 6.390   0.179   -7.060 1.00 0.00 ? 5  GLN A HA   1  
ATOM 64   H HB2  . GLN A 1 5  ? 5.357   0.958   -4.329 1.00 0.00 ? 5  GLN A HB2  1  
ATOM 65   H HB3  . GLN A 1 5  ? 4.675   1.525   -5.848 1.00 0.00 ? 5  GLN A HB3  1  
ATOM 66   H HG2  . GLN A 1 5  ? 4.582   -1.110  -6.289 1.00 0.00 ? 5  GLN A HG2  1  
ATOM 67   H HG3  . GLN A 1 5  ? 4.455   -1.104  -4.531 1.00 0.00 ? 5  GLN A HG3  1  
ATOM 68   H HE21 . GLN A 1 5  ? 2.786   -0.844  -7.407 1.00 0.00 ? 5  GLN A HE21 1  
ATOM 69   H HE22 . GLN A 1 5  ? 1.294   -0.225  -6.794 1.00 0.00 ? 5  GLN A HE22 1  
ATOM 70   N N    . PRO A 1 6  ? 6.970   2.686   -7.073 1.00 0.00 ? 6  PRO A N    1  
ATOM 71   C CA   . PRO A 1 6  ? 7.605   3.996   -7.243 1.00 0.00 ? 6  PRO A CA   1  
ATOM 72   C C    . PRO A 1 6  ? 7.217   4.976   -6.141 1.00 0.00 ? 6  PRO A C    1  
ATOM 73   O O    . PRO A 1 6  ? 6.217   5.684   -6.250 1.00 0.00 ? 6  PRO A O    1  
ATOM 74   C CB   . PRO A 1 6  ? 7.073   4.475   -8.596 1.00 0.00 ? 6  PRO A CB   1  
ATOM 75   C CG   . PRO A 1 6  ? 5.775   3.763   -8.766 1.00 0.00 ? 6  PRO A CG   1  
ATOM 76   C CD   . PRO A 1 6  ? 5.946   2.427   -8.099 1.00 0.00 ? 6  PRO A CD   1  
ATOM 77   H HA   . PRO A 1 6  ? 8.681   3.913   -7.287 1.00 0.00 ? 6  PRO A HA   1  
ATOM 78   H HB2  . PRO A 1 6  ? 6.936   5.547   -8.573 1.00 0.00 ? 6  PRO A HB2  1  
ATOM 79   H HB3  . PRO A 1 6  ? 7.772   4.213   -9.376 1.00 0.00 ? 6  PRO A HB3  1  
ATOM 80   H HG2  . PRO A 1 6  ? 4.984   4.322   -8.290 1.00 0.00 ? 6  PRO A HG2  1  
ATOM 81   H HG3  . PRO A 1 6  ? 5.564   3.632   -9.817 1.00 0.00 ? 6  PRO A HG3  1  
ATOM 82   H HD2  . PRO A 1 6  ? 5.018   2.110   -7.646 1.00 0.00 ? 6  PRO A HD2  1  
ATOM 83   H HD3  . PRO A 1 6  ? 6.291   1.691   -8.810 1.00 0.00 ? 6  PRO A HD3  1  
ATOM 84   N N    . GLY A 1 7  ? 8.016   5.012   -5.079 1.00 0.00 ? 7  GLY A N    1  
ATOM 85   C CA   . GLY A 1 7  ? 7.739   5.909   -3.972 1.00 0.00 ? 7  GLY A CA   1  
ATOM 86   C C    . GLY A 1 7  ? 7.788   5.206   -2.630 1.00 0.00 ? 7  GLY A C    1  
ATOM 87   O O    . GLY A 1 7  ? 8.088   5.823   -1.608 1.00 0.00 ? 7  GLY A O    1  
ATOM 88   H H    . GLY A 1 7  ? 8.800   4.424   -5.047 1.00 0.00 ? 7  GLY A H    1  
ATOM 89   H HA2  . GLY A 1 7  ? 8.469   6.705   -3.977 1.00 0.00 ? 7  GLY A HA2  1  
ATOM 90   H HA3  . GLY A 1 7  ? 6.756   6.335   -4.106 1.00 0.00 ? 7  GLY A HA3  1  
ATOM 91   N N    . CYS A 1 8  ? 7.491   3.910   -2.631 1.00 0.00 ? 8  CYS A N    1  
ATOM 92   C CA   . CYS A 1 8  ? 7.499   3.122   -1.405 1.00 0.00 ? 8  CYS A CA   1  
ATOM 93   C C    . CYS A 1 8  ? 8.829   2.392   -1.237 1.00 0.00 ? 8  CYS A C    1  
ATOM 94   O O    . CYS A 1 8  ? 9.641   2.339   -2.159 1.00 0.00 ? 8  CYS A O    1  
ATOM 95   C CB   . CYS A 1 8  ? 6.349   2.114   -1.414 1.00 0.00 ? 8  CYS A CB   1  
ATOM 96   S SG   . CYS A 1 8  ? 5.913   1.468   0.233  1.00 0.00 ? 8  CYS A SG   1  
ATOM 97   H H    . CYS A 1 8  ? 7.259   3.473   -3.478 1.00 0.00 ? 8  CYS A H    1  
ATOM 98   H HA   . CYS A 1 8  ? 7.367   3.799   -0.574 1.00 0.00 ? 8  CYS A HA   1  
ATOM 99   H HB2  . CYS A 1 8  ? 5.469   2.587   -1.823 1.00 0.00 ? 8  CYS A HB2  1  
ATOM 100  H HB3  . CYS A 1 8  ? 6.622   1.274   -2.035 1.00 0.00 ? 8  CYS A HB3  1  
ATOM 101  N N    . GLY A 1 9  ? 9.044   1.831   -0.051 1.00 0.00 ? 9  GLY A N    1  
ATOM 102  C CA   . GLY A 1 9  ? 10.275  1.112   0.217  1.00 0.00 ? 9  GLY A CA   1  
ATOM 103  C C    . GLY A 1 9  ? 10.334  0.569   1.632  1.00 0.00 ? 9  GLY A C    1  
ATOM 104  O O    . GLY A 1 9  ? 9.393   0.737   2.408  1.00 0.00 ? 9  GLY A O    1  
ATOM 105  H H    . GLY A 1 9  ? 8.360   1.906   0.648  1.00 0.00 ? 9  GLY A H    1  
ATOM 106  H HA2  . GLY A 1 9  ? 10.357  0.289   -0.477 1.00 0.00 ? 9  GLY A HA2  1  
ATOM 107  H HA3  . GLY A 1 9  ? 11.110  1.781   0.067  1.00 0.00 ? 9  GLY A HA3  1  
ATOM 108  N N    . HIS A 1 10 ? 11.441  -0.086  1.967  1.00 0.00 ? 10 HIS A N    1  
ATOM 109  C CA   . HIS A 1 10 ? 11.618  -0.656  3.298  1.00 0.00 ? 10 HIS A CA   1  
ATOM 110  C C    . HIS A 1 10 ? 11.772  0.443   4.345  1.00 0.00 ? 10 HIS A C    1  
ATOM 111  O O    . HIS A 1 10 ? 12.692  1.258   4.274  1.00 0.00 ? 10 HIS A O    1  
ATOM 112  C CB   . HIS A 1 10 ? 12.840  -1.575  3.324  1.00 0.00 ? 10 HIS A CB   1  
ATOM 113  C CG   . HIS A 1 10 ? 12.686  -2.751  4.239  1.00 0.00 ? 10 HIS A CG   1  
ATOM 114  N ND1  . HIS A 1 10 ? 13.674  -3.695  4.423  1.00 0.00 ? 10 HIS A ND1  1  
ATOM 115  C CD2  . HIS A 1 10 ? 11.653  -3.131  5.025  1.00 0.00 ? 10 HIS A CD2  1  
ATOM 116  C CE1  . HIS A 1 10 ? 13.254  -4.607  5.282  1.00 0.00 ? 10 HIS A CE1  1  
ATOM 117  N NE2  . HIS A 1 10 ? 12.030  -4.287  5.663  1.00 0.00 ? 10 HIS A NE2  1  
ATOM 118  H H    . HIS A 1 10 ? 12.156  -0.187  1.305  1.00 0.00 ? 10 HIS A H    1  
ATOM 119  H HA   . HIS A 1 10 ? 10.738  -1.236  3.530  1.00 0.00 ? 10 HIS A HA   1  
ATOM 120  H HB2  . HIS A 1 10 ? 13.020  -1.952  2.327  1.00 0.00 ? 10 HIS A HB2  1  
ATOM 121  H HB3  . HIS A 1 10 ? 13.701  -1.009  3.650  1.00 0.00 ? 10 HIS A HB3  1  
ATOM 122  H HD1  . HIS A 1 10 ? 14.552  -3.698  3.987  1.00 0.00 ? 10 HIS A HD1  1  
ATOM 123  H HD2  . HIS A 1 10 ? 10.706  -2.621  5.132  1.00 0.00 ? 10 HIS A HD2  1  
ATOM 124  H HE1  . HIS A 1 10 ? 13.815  -5.466  5.616  1.00 0.00 ? 10 HIS A HE1  1  
ATOM 125  N N    . CYS A 1 11 ? 10.864  0.461   5.315  1.00 0.00 ? 11 CYS A N    1  
ATOM 126  C CA   . CYS A 1 11 ? 10.897  1.460   6.376  1.00 0.00 ? 11 CYS A CA   1  
ATOM 127  C C    . CYS A 1 11 ? 12.153  1.307   7.229  1.00 0.00 ? 11 CYS A C    1  
ATOM 128  O O    . CYS A 1 11 ? 12.864  0.307   7.131  1.00 0.00 ? 11 CYS A O    1  
ATOM 129  C CB   . CYS A 1 11 ? 9.651   1.342   7.256  1.00 0.00 ? 11 CYS A CB   1  
ATOM 130  S SG   . CYS A 1 11 ? 9.589   -0.181  8.254  1.00 0.00 ? 11 CYS A SG   1  
ATOM 131  H H    . CYS A 1 11 ? 10.154  -0.216  5.318  1.00 0.00 ? 11 CYS A H    1  
ATOM 132  H HA   . CYS A 1 11 ? 10.909  2.435   5.913  1.00 0.00 ? 11 CYS A HA   1  
ATOM 133  H HB2  . CYS A 1 11 ? 9.619   2.181   7.935  1.00 0.00 ? 11 CYS A HB2  1  
ATOM 134  H HB3  . CYS A 1 11 ? 8.773   1.360   6.628  1.00 0.00 ? 11 CYS A HB3  1  
ATOM 135  N N    . SER A 1 12 ? 12.418  2.304   8.066  1.00 0.00 ? 12 SER A N    1  
ATOM 136  C CA   . SER A 1 12 ? 13.589  2.282   8.935  1.00 0.00 ? 12 SER A CA   1  
ATOM 137  C C    . SER A 1 12 ? 13.370  3.158   10.165 1.00 0.00 ? 12 SER A C    1  
ATOM 138  O O    . SER A 1 12 ? 12.630  4.141   10.116 1.00 0.00 ? 12 SER A O    1  
ATOM 139  C CB   . SER A 1 12 ? 14.827  2.757   8.170  1.00 0.00 ? 12 SER A CB   1  
ATOM 140  O OG   . SER A 1 12 ? 14.645  4.071   7.672  1.00 0.00 ? 12 SER A OG   1  
ATOM 141  H H    . SER A 1 12 ? 11.813  3.075   8.099  1.00 0.00 ? 12 SER A H    1  
ATOM 142  H HA   . SER A 1 12 ? 13.744  1.263   9.256  1.00 0.00 ? 12 SER A HA   1  
ATOM 143  H HB2  . SER A 1 12 ? 15.680  2.750   8.831  1.00 0.00 ? 12 SER A HB2  1  
ATOM 144  H HB3  . SER A 1 12 ? 15.010  2.091   7.339  1.00 0.00 ? 12 SER A HB3  1  
ATOM 145  H HG   . SER A 1 12 ? 15.130  4.171   6.850  1.00 0.00 ? 12 SER A HG   1  
ATOM 146  N N    . ARG A 1 13 ? 14.020  2.795   11.266 1.00 0.00 ? 13 ARG A N    1  
ATOM 147  C CA   . ARG A 1 13 ? 13.896  3.546   12.509 1.00 0.00 ? 13 ARG A CA   1  
ATOM 148  C C    . ARG A 1 13 ? 13.916  5.048   12.241 1.00 0.00 ? 13 ARG A C    1  
ATOM 149  O O    . ARG A 1 13 ? 14.585  5.532   11.328 1.00 0.00 ? 13 ARG A O    1  
ATOM 150  C CB   . ARG A 1 13 ? 15.027  3.173   13.469 1.00 0.00 ? 13 ARG A CB   1  
ATOM 151  C CG   . ARG A 1 13 ? 14.750  1.916   14.277 1.00 0.00 ? 13 ARG A CG   1  
ATOM 152  C CD   . ARG A 1 13 ? 14.863  2.178   15.771 1.00 0.00 ? 13 ARG A CD   1  
ATOM 153  N NE   . ARG A 1 13 ? 13.896  1.396   16.538 1.00 0.00 ? 13 ARG A NE   1  
ATOM 154  C CZ   . ARG A 1 13 ? 14.087  0.128   16.885 1.00 0.00 ? 13 ARG A CZ   1  
ATOM 155  N NH1  . ARG A 1 13 ? 15.202  -0.498  16.536 1.00 0.00 ? 13 ARG A NH1  1  
ATOM 156  N NH2  . ARG A 1 13 ? 13.160  -0.516  17.583 1.00 0.00 ? 13 ARG A NH2  1  
ATOM 157  H H    . ARG A 1 13 ? 14.596  2.002   11.242 1.00 0.00 ? 13 ARG A H    1  
ATOM 158  H HA   . ARG A 1 13 ? 12.951  3.285   12.961 1.00 0.00 ? 13 ARG A HA   1  
ATOM 159  H HB2  . ARG A 1 13 ? 15.931  3.017   12.900 1.00 0.00 ? 13 ARG A HB2  1  
ATOM 160  H HB3  . ARG A 1 13 ? 15.182  3.990   14.158 1.00 0.00 ? 13 ARG A HB3  1  
ATOM 161  H HG2  . ARG A 1 13 ? 13.751  1.571   14.058 1.00 0.00 ? 13 ARG A HG2  1  
ATOM 162  H HG3  . ARG A 1 13 ? 15.465  1.156   13.999 1.00 0.00 ? 13 ARG A HG3  1  
ATOM 163  H HD2  . ARG A 1 13 ? 15.859  1.917   16.095 1.00 0.00 ? 13 ARG A HD2  1  
ATOM 164  H HD3  . ARG A 1 13 ? 14.688  3.228   15.953 1.00 0.00 ? 13 ARG A HD3  1  
ATOM 165  H HE   . ARG A 1 13 ? 13.065  1.839   16.806 1.00 0.00 ? 13 ARG A HE   1  
ATOM 166  H HH11 . ARG A 1 13 ? 15.902  -0.015  16.011 1.00 0.00 ? 13 ARG A HH11 1  
ATOM 167  H HH12 . ARG A 1 13 ? 15.344  -1.452  16.800 1.00 0.00 ? 13 ARG A HH12 1  
ATOM 168  H HH21 . ARG A 1 13 ? 12.318  -0.047  17.848 1.00 0.00 ? 13 ARG A HH21 1  
ATOM 169  H HH22 . ARG A 1 13 ? 13.304  -1.470  17.844 1.00 0.00 ? 13 ARG A HH22 1  
ATOM 170  N N    . PRO A 1 14 ? 13.165  5.805   13.055 1.00 0.00 ? 14 PRO A N    1  
ATOM 171  C CA   . PRO A 1 14 ? 12.364  5.240   14.145 1.00 0.00 ? 14 PRO A CA   1  
ATOM 172  C C    . PRO A 1 14 ? 11.174  4.436   13.633 1.00 0.00 ? 14 PRO A C    1  
ATOM 173  O O    . PRO A 1 14 ? 10.263  4.107   14.392 1.00 0.00 ? 14 PRO A O    1  
ATOM 174  C CB   . PRO A 1 14 ? 11.885  6.476   14.910 1.00 0.00 ? 14 PRO A CB   1  
ATOM 175  C CG   . PRO A 1 14 ? 11.897  7.574   13.903 1.00 0.00 ? 14 PRO A CG   1  
ATOM 176  C CD   . PRO A 1 14 ? 13.040  7.269   12.973 1.00 0.00 ? 14 PRO A CD   1  
ATOM 177  H HA   . PRO A 1 14 ? 12.962  4.620   14.797 1.00 0.00 ? 14 PRO A HA   1  
ATOM 178  H HB2  . PRO A 1 14 ? 10.890  6.302   15.294 1.00 0.00 ? 14 PRO A HB2  1  
ATOM 179  H HB3  . PRO A 1 14 ? 12.560  6.683   15.727 1.00 0.00 ? 14 PRO A HB3  1  
ATOM 180  H HG2  . PRO A 1 14 ? 10.965  7.584   13.360 1.00 0.00 ? 14 PRO A HG2  1  
ATOM 181  H HG3  . PRO A 1 14 ? 12.058  8.521   14.395 1.00 0.00 ? 14 PRO A HG3  1  
ATOM 182  H HD2  . PRO A 1 14 ? 12.800  7.581   11.967 1.00 0.00 ? 14 PRO A HD2  1  
ATOM 183  H HD3  . PRO A 1 14 ? 13.943  7.753   13.315 1.00 0.00 ? 14 PRO A HD3  1  
ATOM 184  N N    . ASN A 1 15 ? 11.189  4.121   12.342 1.00 0.00 ? 15 ASN A N    1  
ATOM 185  C CA   . ASN A 1 15 ? 10.110  3.355   11.730 1.00 0.00 ? 15 ASN A CA   1  
ATOM 186  C C    . ASN A 1 15 ? 10.319  1.858   11.940 1.00 0.00 ? 15 ASN A C    1  
ATOM 187  O O    . ASN A 1 15 ? 11.451  1.373   11.943 1.00 0.00 ? 15 ASN A O    1  
ATOM 188  C CB   . ASN A 1 15 ? 10.023  3.664   10.234 1.00 0.00 ? 15 ASN A CB   1  
ATOM 189  C CG   . ASN A 1 15 ? 10.284  5.126   9.929  1.00 0.00 ? 15 ASN A CG   1  
ATOM 190  O OD1  . ASN A 1 15 ? 10.022  6.000   10.756 1.00 0.00 ? 15 ASN A OD1  1  
ATOM 191  N ND2  . ASN A 1 15 ? 10.803  5.399   8.738  1.00 0.00 ? 15 ASN A ND2  1  
ATOM 192  H H    . ASN A 1 15 ? 11.943  4.411   11.788 1.00 0.00 ? 15 ASN A H    1  
ATOM 193  H HA   . ASN A 1 15 ? 9.185   3.647   12.203 1.00 0.00 ? 15 ASN A HA   1  
ATOM 194  H HB2  . ASN A 1 15 ? 10.755  3.070   9.706  1.00 0.00 ? 15 ASN A HB2  1  
ATOM 195  H HB3  . ASN A 1 15 ? 9.036   3.411   9.877  1.00 0.00 ? 15 ASN A HB3  1  
ATOM 196  H HD21 . ASN A 1 15 ? 10.986  4.652   8.130  1.00 0.00 ? 15 ASN A HD21 1  
ATOM 197  H HD22 . ASN A 1 15 ? 10.983  6.336   8.515  1.00 0.00 ? 15 ASN A HD22 1  
ATOM 198  N N    . TYR A 1 16 ? 9.220   1.132   12.114 1.00 0.00 ? 16 TYR A N    1  
ATOM 199  C CA   . TYR A 1 16 ? 9.282   -0.309  12.326 1.00 0.00 ? 16 TYR A CA   1  
ATOM 200  C C    . TYR A 1 16 ? 8.125   -1.014  11.626 1.00 0.00 ? 16 TYR A C    1  
ATOM 201  O O    . TYR A 1 16 ? 7.311   -0.379  10.954 1.00 0.00 ? 16 TYR A O    1  
ATOM 202  C CB   . TYR A 1 16 ? 9.257   -0.627  13.822 1.00 0.00 ? 16 TYR A CB   1  
ATOM 203  C CG   . TYR A 1 16 ? 7.917   -0.368  14.474 1.00 0.00 ? 16 TYR A CG   1  
ATOM 204  C CD1  . TYR A 1 16 ? 7.516   0.924   14.793 1.00 0.00 ? 16 TYR A CD1  1  
ATOM 205  C CD2  . TYR A 1 16 ? 7.053   -1.414  14.771 1.00 0.00 ? 16 TYR A CD2  1  
ATOM 206  C CE1  . TYR A 1 16 ? 6.293   1.166   15.388 1.00 0.00 ? 16 TYR A CE1  1  
ATOM 207  C CE2  . TYR A 1 16 ? 5.827   -1.181  15.365 1.00 0.00 ? 16 TYR A CE2  1  
ATOM 208  C CZ   . TYR A 1 16 ? 5.452   0.110   15.672 1.00 0.00 ? 16 TYR A CZ   1  
ATOM 209  O OH   . TYR A 1 16 ? 4.233   0.346   16.265 1.00 0.00 ? 16 TYR A OH   1  
ATOM 210  H H    . TYR A 1 16 ? 8.347   1.575   12.101 1.00 0.00 ? 16 TYR A H    1  
ATOM 211  H HA   . TYR A 1 16 ? 10.212  -0.666  11.908 1.00 0.00 ? 16 TYR A HA   1  
ATOM 212  H HB2  . TYR A 1 16 ? 9.499   -1.669  13.967 1.00 0.00 ? 16 TYR A HB2  1  
ATOM 213  H HB3  . TYR A 1 16 ? 9.994   -0.018  14.325 1.00 0.00 ? 16 TYR A HB3  1  
ATOM 214  H HD1  . TYR A 1 16 ? 8.177   1.749   14.569 1.00 0.00 ? 16 TYR A HD1  1  
ATOM 215  H HD2  . TYR A 1 16 ? 7.350   -2.424  14.529 1.00 0.00 ? 16 TYR A HD2  1  
ATOM 216  H HE1  . TYR A 1 16 ? 5.999   2.177   15.629 1.00 0.00 ? 16 TYR A HE1  1  
ATOM 217  H HE2  . TYR A 1 16 ? 5.169   -2.008  15.588 1.00 0.00 ? 16 TYR A HE2  1  
ATOM 218  H HH   . TYR A 1 16 ? 4.168   -0.165  17.075 1.00 0.00 ? 16 TYR A HH   1  
ATOM 219  N N    . CYS A 1 17 ? 8.057   -2.331  11.788 1.00 0.00 ? 17 CYS A N    1  
ATOM 220  C CA   . CYS A 1 17 ? 7.000   -3.124  11.172 1.00 0.00 ? 17 CYS A CA   1  
ATOM 221  C C    . CYS A 1 17 ? 5.768   -3.181  12.072 1.00 0.00 ? 17 CYS A C    1  
ATOM 222  O O    . CYS A 1 17 ? 5.881   -3.357  13.284 1.00 0.00 ? 17 CYS A O    1  
ATOM 223  C CB   . CYS A 1 17 ? 7.500   -4.541  10.884 1.00 0.00 ? 17 CYS A CB   1  
ATOM 224  S SG   . CYS A 1 17 ? 8.137   -4.774  9.193  1.00 0.00 ? 17 CYS A SG   1  
ATOM 225  H H    . CYS A 1 17 ? 8.735   -2.781  12.336 1.00 0.00 ? 17 CYS A H    1  
ATOM 226  H HA   . CYS A 1 17 ? 6.729   -2.651  10.241 1.00 0.00 ? 17 CYS A HA   1  
ATOM 227  H HB2  . CYS A 1 17 ? 8.298   -4.780  11.571 1.00 0.00 ? 17 CYS A HB2  1  
ATOM 228  H HB3  . CYS A 1 17 ? 6.687   -5.237  11.028 1.00 0.00 ? 17 CYS A HB3  1  
ATOM 229  N N    . GLU A 1 18 ? 4.594   -3.030  11.467 1.00 0.00 ? 18 GLU A N    1  
ATOM 230  C CA   . GLU A 1 18 ? 3.342   -3.063  12.214 1.00 0.00 ? 18 GLU A CA   1  
ATOM 231  C C    . GLU A 1 18 ? 2.227   -3.687  11.379 1.00 0.00 ? 18 GLU A C    1  
ATOM 232  O O    . GLU A 1 18 ? 1.646   -3.034  10.513 1.00 0.00 ? 18 GLU A O    1  
ATOM 233  C CB   . GLU A 1 18 ? 2.941   -1.651  12.645 1.00 0.00 ? 18 GLU A CB   1  
ATOM 234  C CG   . GLU A 1 18 ? 1.936   -1.625  13.785 1.00 0.00 ? 18 GLU A CG   1  
ATOM 235  C CD   . GLU A 1 18 ? 2.058   -2.829  14.698 1.00 0.00 ? 18 GLU A CD   1  
ATOM 236  O OE1  . GLU A 1 18 ? 1.402   -3.854  14.417 1.00 0.00 ? 18 GLU A OE1  1  
ATOM 237  O OE2  . GLU A 1 18 ? 2.807   -2.747  15.693 1.00 0.00 ? 18 GLU A OE2  1  
ATOM 238  H H    . GLU A 1 18 ? 4.569   -2.893  10.497 1.00 0.00 ? 18 GLU A H    1  
ATOM 239  H HA   . GLU A 1 18 ? 3.496   -3.668  13.094 1.00 0.00 ? 18 GLU A HA   1  
ATOM 240  H HB2  . GLU A 1 18 ? 3.827   -1.120  12.961 1.00 0.00 ? 18 GLU A HB2  1  
ATOM 241  H HB3  . GLU A 1 18 ? 2.508   -1.139  11.799 1.00 0.00 ? 18 GLU A HB3  1  
ATOM 242  H HG2  . GLU A 1 18 ? 2.097   -0.731  14.369 1.00 0.00 ? 18 GLU A HG2  1  
ATOM 243  H HG3  . GLU A 1 18 ? 0.940   -1.606  13.368 1.00 0.00 ? 18 GLU A HG3  1  
ATOM 244  N N    . GLY A 1 19 ? 1.934   -4.956  11.646 1.00 0.00 ? 19 GLY A N    1  
ATOM 245  C CA   . GLY A 1 19 ? 0.891   -5.647  10.911 1.00 0.00 ? 19 GLY A CA   1  
ATOM 246  C C    . GLY A 1 19 ? -0.485  -5.420  11.506 1.00 0.00 ? 19 GLY A C    1  
ATOM 247  O O    . GLY A 1 19 ? -1.478  -5.950  11.009 1.00 0.00 ? 19 GLY A O    1  
ATOM 248  H H    . GLY A 1 19 ? 2.431   -5.427  12.348 1.00 0.00 ? 19 GLY A H    1  
ATOM 249  H HA2  . GLY A 1 19 ? 0.893   -5.297  9.890  1.00 0.00 ? 19 GLY A HA2  1  
ATOM 250  H HA3  . GLY A 1 19 ? 1.103   -6.707  10.919 1.00 0.00 ? 19 GLY A HA3  1  
ATOM 251  N N    . ALA A 1 20 ? -0.544  -4.631  12.574 1.00 0.00 ? 20 ALA A N    1  
ATOM 252  C CA   . ALA A 1 20 ? -1.808  -4.335  13.236 1.00 0.00 ? 20 ALA A CA   1  
ATOM 253  C C    . ALA A 1 20 ? -2.011  -2.831  13.383 1.00 0.00 ? 20 ALA A C    1  
ATOM 254  O O    . ALA A 1 20 ? -2.719  -2.210  12.589 1.00 0.00 ? 20 ALA A O    1  
ATOM 255  C CB   . ALA A 1 20 ? -1.862  -5.013  14.597 1.00 0.00 ? 20 ALA A CB   1  
ATOM 256  H H    . ALA A 1 20 ? 0.283   -4.238  12.923 1.00 0.00 ? 20 ALA A H    1  
ATOM 257  H HA   . ALA A 1 20 ? -2.605  -4.739  12.629 1.00 0.00 ? 20 ALA A HA   1  
ATOM 258  H HB1  . ALA A 1 20 ? -0.892  -5.430  14.829 1.00 0.00 ? 20 ALA A HB1  1  
ATOM 259  H HB2  . ALA A 1 20 ? -2.131  -4.287  15.350 1.00 0.00 ? 20 ALA A HB2  1  
ATOM 260  H HB3  . ALA A 1 20 ? -2.598  -5.802  14.578 1.00 0.00 ? 20 ALA A HB3  1  
ATOM 261  N N    . ARG A 1 21 ? -1.388  -2.251  14.404 1.00 0.00 ? 21 ARG A N    1  
ATOM 262  C CA   . ARG A 1 21 ? -1.503  -0.820  14.655 1.00 0.00 ? 21 ARG A CA   1  
ATOM 263  C C    . ARG A 1 21 ? -0.295  -0.306  15.435 1.00 0.00 ? 21 ARG A C    1  
ATOM 264  O O    . ARG A 1 21 ? 0.223   -0.989  16.319 1.00 0.00 ? 21 ARG A O    1  
ATOM 265  C CB   . ARG A 1 21 ? -2.788  -0.518  15.428 1.00 0.00 ? 21 ARG A CB   1  
ATOM 266  C CG   . ARG A 1 21 ? -3.736  0.415   14.693 1.00 0.00 ? 21 ARG A CG   1  
ATOM 267  C CD   . ARG A 1 21 ? -5.154  -0.133  14.674 1.00 0.00 ? 21 ARG A CD   1  
ATOM 268  N NE   . ARG A 1 21 ? -5.678  -0.341  16.021 1.00 0.00 ? 21 ARG A NE   1  
ATOM 269  C CZ   . ARG A 1 21 ? -5.980  0.649   16.854 1.00 0.00 ? 21 ARG A CZ   1  
ATOM 270  N NH1  . ARG A 1 21 ? -5.811  1.909   16.479 1.00 0.00 ? 21 ARG A NH1  1  
ATOM 271  N NH2  . ARG A 1 21 ? -6.453  0.378   18.064 1.00 0.00 ? 21 ARG A NH2  1  
ATOM 272  H H    . ARG A 1 21 ? -0.838  -2.799  15.002 1.00 0.00 ? 21 ARG A H    1  
ATOM 273  H HA   . ARG A 1 21 ? -1.541  -0.317  13.701 1.00 0.00 ? 21 ARG A HA   1  
ATOM 274  H HB2  . ARG A 1 21 ? -3.307  -1.446  15.617 1.00 0.00 ? 21 ARG A HB2  1  
ATOM 275  H HB3  . ARG A 1 21 ? -2.528  -0.062  16.371 1.00 0.00 ? 21 ARG A HB3  1  
ATOM 276  H HG2  . ARG A 1 21 ? -3.739  1.375   15.189 1.00 0.00 ? 21 ARG A HG2  1  
ATOM 277  H HG3  . ARG A 1 21 ? -3.391  0.535   13.676 1.00 0.00 ? 21 ARG A HG3  1  
ATOM 278  H HD2  . ARG A 1 21 ? -5.790  0.569   14.155 1.00 0.00 ? 21 ARG A HD2  1  
ATOM 279  H HD3  . ARG A 1 21 ? -5.154  -1.075  14.147 1.00 0.00 ? 21 ARG A HD3  1  
ATOM 280  H HE   . ARG A 1 21 ? -5.811  -1.265  16.318 1.00 0.00 ? 21 ARG A HE   1  
ATOM 281  H HH11 . ARG A 1 21 ? -5.456  2.116   15.568 1.00 0.00 ? 21 ARG A HH11 1  
ATOM 282  H HH12 . ARG A 1 21 ? -6.040  2.653   17.108 1.00 0.00 ? 21 ARG A HH12 1  
ATOM 283  H HH21 . ARG A 1 21 ? -6.582  -0.571  18.349 1.00 0.00 ? 21 ARG A HH21 1  
ATOM 284  H HH22 . ARG A 1 21 ? -6.680  1.124   18.690 1.00 0.00 ? 21 ARG A HH22 1  
ATOM 285  N N    . CYS A 1 22 ? 0.148   0.901   15.100 1.00 0.00 ? 22 CYS A N    1  
ATOM 286  C CA   . CYS A 1 22 ? 1.294   1.506   15.767 1.00 0.00 ? 22 CYS A CA   1  
ATOM 287  C C    . CYS A 1 22 ? 0.984   1.788   17.234 1.00 0.00 ? 22 CYS A C    1  
ATOM 288  O O    . CYS A 1 22 ? -0.151  2.102   17.589 1.00 0.00 ? 22 CYS A O    1  
ATOM 289  C CB   . CYS A 1 22 ? 1.695   2.804   15.061 1.00 0.00 ? 22 CYS A CB   1  
ATOM 290  S SG   . CYS A 1 22 ? 1.582   2.727   13.244 1.00 0.00 ? 22 CYS A SG   1  
ATOM 291  H H    . CYS A 1 22 ? -0.307  1.397   14.387 1.00 0.00 ? 22 CYS A H    1  
ATOM 292  H HA   . CYS A 1 22 ? 2.117   0.809   15.713 1.00 0.00 ? 22 CYS A HA   1  
ATOM 293  H HB2  . CYS A 1 22 ? 1.047   3.601   15.396 1.00 0.00 ? 22 CYS A HB2  1  
ATOM 294  H HB3  . CYS A 1 22 ? 2.716   3.044   15.318 1.00 0.00 ? 22 CYS A HB3  1  
ATOM 295  N N    . GLU A 1 23 ? 2.003   1.672   18.081 1.00 0.00 ? 23 GLU A N    1  
ATOM 296  C CA   . GLU A 1 23 ? 1.838   1.913   19.510 1.00 0.00 ? 23 GLU A CA   1  
ATOM 297  C C    . GLU A 1 23 ? 1.466   3.369   19.776 1.00 0.00 ? 23 GLU A C    1  
ATOM 298  O O    . GLU A 1 23 ? 1.497   4.204   18.873 1.00 0.00 ? 23 GLU A O    1  
ATOM 299  C CB   . GLU A 1 23 ? 3.123   1.558   20.261 1.00 0.00 ? 23 GLU A CB   1  
ATOM 300  C CG   . GLU A 1 23 ? 4.377   2.139   19.630 1.00 0.00 ? 23 GLU A CG   1  
ATOM 301  C CD   . GLU A 1 23 ? 5.502   1.127   19.530 1.00 0.00 ? 23 GLU A CD   1  
ATOM 302  O OE1  . GLU A 1 23 ? 5.712   0.581   18.426 1.00 0.00 ? 23 GLU A OE1  1  
ATOM 303  O OE2  . GLU A 1 23 ? 6.172   0.881   20.554 1.00 0.00 ? 23 GLU A OE2  1  
ATOM 304  H H    . GLU A 1 23 ? 2.884   1.418   17.738 1.00 0.00 ? 23 GLU A H    1  
ATOM 305  H HA   . GLU A 1 23 ? 1.039   1.280   19.863 1.00 0.00 ? 23 GLU A HA   1  
ATOM 306  H HB2  . GLU A 1 23 ? 3.049   1.929   21.273 1.00 0.00 ? 23 GLU A HB2  1  
ATOM 307  H HB3  . GLU A 1 23 ? 3.224   0.483   20.288 1.00 0.00 ? 23 GLU A HB3  1  
ATOM 308  H HG2  . GLU A 1 23 ? 4.137   2.487   18.636 1.00 0.00 ? 23 GLU A HG2  1  
ATOM 309  H HG3  . GLU A 1 23 ? 4.714   2.972   20.229 1.00 0.00 ? 23 GLU A HG3  1  
ATOM 310  N N    . SER A 1 24 ? 1.113   3.665   21.023 1.00 0.00 ? 24 SER A N    1  
ATOM 311  C CA   . SER A 1 24 ? 0.730   5.018   21.409 1.00 0.00 ? 24 SER A CA   1  
ATOM 312  C C    . SER A 1 24 ? 1.943   5.944   21.419 1.00 0.00 ? 24 SER A C    1  
ATOM 313  O O    . SER A 1 24 ? 2.049   6.837   22.258 1.00 0.00 ? 24 SER A O    1  
ATOM 314  C CB   . SER A 1 24 ? 0.069   5.010   22.789 1.00 0.00 ? 24 SER A CB   1  
ATOM 315  O OG   . SER A 1 24 ? -1.279  5.439   22.711 1.00 0.00 ? 24 SER A OG   1  
ATOM 316  H H    . SER A 1 24 ? 1.108   2.955   21.699 1.00 0.00 ? 24 SER A H    1  
ATOM 317  H HA   . SER A 1 24 ? 0.020   5.382   20.681 1.00 0.00 ? 24 SER A HA   1  
ATOM 318  H HB2  . SER A 1 24 ? 0.093   4.009   23.191 1.00 0.00 ? 24 SER A HB2  1  
ATOM 319  H HB3  . SER A 1 24 ? 0.609   5.675   23.447 1.00 0.00 ? 24 SER A HB3  1  
ATOM 320  H HG   . SER A 1 24 ? -1.451  6.082   23.403 1.00 0.00 ? 24 SER A HG   1  
ATOM 321  N N    . GLY A 1 25 ? 2.856   5.722   20.478 1.00 0.00 ? 25 GLY A N    1  
ATOM 322  C CA   . GLY A 1 25 ? 4.049   6.544   20.395 1.00 0.00 ? 25 GLY A CA   1  
ATOM 323  C C    . GLY A 1 25 ? 4.554   6.692   18.973 1.00 0.00 ? 25 GLY A C    1  
ATOM 324  O O    . GLY A 1 25 ? 5.487   7.452   18.714 1.00 0.00 ? 25 GLY A O    1  
ATOM 325  H H    . GLY A 1 25 ? 2.718   4.995   19.835 1.00 0.00 ? 25 GLY A H    1  
ATOM 326  H HA2  . GLY A 1 25 ? 3.827   7.523   20.791 1.00 0.00 ? 25 GLY A HA2  1  
ATOM 327  H HA3  . GLY A 1 25 ? 4.826   6.091   20.994 1.00 0.00 ? 25 GLY A HA3  1  
ATOM 328  N N    . PHE A 1 26 ? 3.936   5.963   18.049 1.00 0.00 ? 26 PHE A N    1  
ATOM 329  C CA   . PHE A 1 26 ? 4.329   6.015   16.646 1.00 0.00 ? 26 PHE A CA   1  
ATOM 330  C C    . PHE A 1 26 ? 3.148   6.408   15.764 1.00 0.00 ? 26 PHE A C    1  
ATOM 331  O O    . PHE A 1 26 ? 2.038   6.621   16.252 1.00 0.00 ? 26 PHE A O    1  
ATOM 332  C CB   . PHE A 1 26 ? 4.886   4.661   16.200 1.00 0.00 ? 26 PHE A CB   1  
ATOM 333  C CG   . PHE A 1 26 ? 6.149   4.269   16.910 1.00 0.00 ? 26 PHE A CG   1  
ATOM 334  C CD1  . PHE A 1 26 ? 6.175   4.146   18.290 1.00 0.00 ? 26 PHE A CD1  1  
ATOM 335  C CD2  . PHE A 1 26 ? 7.313   4.024   16.198 1.00 0.00 ? 26 PHE A CD2  1  
ATOM 336  C CE1  . PHE A 1 26 ? 7.336   3.785   18.947 1.00 0.00 ? 26 PHE A CE1  1  
ATOM 337  C CE2  . PHE A 1 26 ? 8.477   3.662   16.849 1.00 0.00 ? 26 PHE A CE2  1  
ATOM 338  C CZ   . PHE A 1 26 ? 8.489   3.544   18.226 1.00 0.00 ? 26 PHE A CZ   1  
ATOM 339  H H    . PHE A 1 26 ? 3.198   5.376   18.318 1.00 0.00 ? 26 PHE A H    1  
ATOM 340  H HA   . PHE A 1 26 ? 5.101   6.762   16.546 1.00 0.00 ? 26 PHE A HA   1  
ATOM 341  H HB2  . PHE A 1 26 ? 4.148   3.897   16.390 1.00 0.00 ? 26 PHE A HB2  1  
ATOM 342  H HB3  . PHE A 1 26 ? 5.096   4.698   15.142 1.00 0.00 ? 26 PHE A HB3  1  
ATOM 343  H HD1  . PHE A 1 26 ? 5.273   4.335   18.856 1.00 0.00 ? 26 PHE A HD1  1  
ATOM 344  H HD2  . PHE A 1 26 ? 7.305   4.117   15.122 1.00 0.00 ? 26 PHE A HD2  1  
ATOM 345  H HE1  . PHE A 1 26 ? 7.342   3.693   20.023 1.00 0.00 ? 26 PHE A HE1  1  
ATOM 346  H HE2  . PHE A 1 26 ? 9.377   3.474   16.283 1.00 0.00 ? 26 PHE A HE2  1  
ATOM 347  H HZ   . PHE A 1 26 ? 9.397   3.261   18.737 1.00 0.00 ? 26 PHE A HZ   1  
ATOM 348  N N    . HIS A 1 27 ? 3.395   6.502   14.461 1.00 0.00 ? 27 HIS A N    1  
ATOM 349  C CA   . HIS A 1 27 ? 2.352   6.869   13.509 1.00 0.00 ? 27 HIS A CA   1  
ATOM 350  C C    . HIS A 1 27 ? 2.395   5.965   12.281 1.00 0.00 ? 27 HIS A C    1  
ATOM 351  O O    . HIS A 1 27 ? 3.462   5.711   11.722 1.00 0.00 ? 27 HIS A O    1  
ATOM 352  C CB   . HIS A 1 27 ? 2.508   8.330   13.088 1.00 0.00 ? 27 HIS A CB   1  
ATOM 353  C CG   . HIS A 1 27 ? 3.933   8.746   12.886 1.00 0.00 ? 27 HIS A CG   1  
ATOM 354  N ND1  . HIS A 1 27 ? 4.651   9.453   13.828 1.00 0.00 ? 27 HIS A ND1  1  
ATOM 355  C CD2  . HIS A 1 27 ? 4.774   8.550   11.844 1.00 0.00 ? 27 HIS A CD2  1  
ATOM 356  C CE1  . HIS A 1 27 ? 5.871   9.674   13.373 1.00 0.00 ? 27 HIS A CE1  1  
ATOM 357  N NE2  . HIS A 1 27 ? 5.972   9.137   12.170 1.00 0.00 ? 27 HIS A NE2  1  
ATOM 358  H H    . HIS A 1 27 ? 4.300   6.320   14.132 1.00 0.00 ? 27 HIS A H    1  
ATOM 359  H HA   . HIS A 1 27 ? 1.398   6.745   13.999 1.00 0.00 ? 27 HIS A HA   1  
ATOM 360  H HB2  . HIS A 1 27 ? 1.983   8.488   12.157 1.00 0.00 ? 27 HIS A HB2  1  
ATOM 361  H HB3  . HIS A 1 27 ? 2.081   8.966   13.850 1.00 0.00 ? 27 HIS A HB3  1  
ATOM 362  H HD1  . HIS A 1 27 ? 4.316   9.749   14.700 1.00 0.00 ? 27 HIS A HD1  1  
ATOM 363  H HD2  . HIS A 1 27 ? 4.545   8.030   10.924 1.00 0.00 ? 27 HIS A HD2  1  
ATOM 364  H HE1  . HIS A 1 27 ? 6.654   10.205  13.894 1.00 0.00 ? 27 HIS A HE1  1  
ATOM 365  N N    . ASP A 1 28 ? 1.229   5.483   11.867 1.00 0.00 ? 28 ASP A N    1  
ATOM 366  C CA   . ASP A 1 28 ? 1.133   4.607   10.704 1.00 0.00 ? 28 ASP A CA   1  
ATOM 367  C C    . ASP A 1 28 ? 1.639   5.312   9.450  1.00 0.00 ? 28 ASP A C    1  
ATOM 368  O O    . ASP A 1 28 ? 1.059   6.303   9.004  1.00 0.00 ? 28 ASP A O    1  
ATOM 369  C CB   . ASP A 1 28 ? -0.313  4.152   10.500 1.00 0.00 ? 28 ASP A CB   1  
ATOM 370  C CG   . ASP A 1 28 ? -0.553  3.595   9.111  1.00 0.00 ? 28 ASP A CG   1  
ATOM 371  O OD1  . ASP A 1 28 ? 0.384   2.997   8.540  1.00 0.00 ? 28 ASP A OD1  1  
ATOM 372  O OD2  . ASP A 1 28 ? -1.678  3.756   8.594  1.00 0.00 ? 28 ASP A OD2  1  
ATOM 373  H H    . ASP A 1 28 ? 0.412   5.722   12.354 1.00 0.00 ? 28 ASP A H    1  
ATOM 374  H HA   . ASP A 1 28 ? 1.751   3.742   10.889 1.00 0.00 ? 28 ASP A HA   1  
ATOM 375  H HB2  . ASP A 1 28 ? -0.546  3.382   11.221 1.00 0.00 ? 28 ASP A HB2  1  
ATOM 376  H HB3  . ASP A 1 28 ? -0.973  4.993   10.650 1.00 0.00 ? 28 ASP A HB3  1  
ATOM 377  N N    . CYS A 1 29 ? 2.726   4.796   8.885  1.00 0.00 ? 29 CYS A N    1  
ATOM 378  C CA   . CYS A 1 29 ? 3.312   5.376   7.683  1.00 0.00 ? 29 CYS A CA   1  
ATOM 379  C C    . CYS A 1 29 ? 3.416   4.336   6.571  1.00 0.00 ? 29 CYS A C    1  
ATOM 380  O O    . CYS A 1 29 ? 4.246   4.454   5.671  1.00 0.00 ? 29 CYS A O    1  
ATOM 381  C CB   . CYS A 1 29 ? 4.697   5.949   7.991  1.00 0.00 ? 29 CYS A CB   1  
ATOM 382  S SG   . CYS A 1 29 ? 5.782   4.815   8.914  1.00 0.00 ? 29 CYS A SG   1  
ATOM 383  H H    . CYS A 1 29 ? 3.144   4.005   9.286  1.00 0.00 ? 29 CYS A H    1  
ATOM 384  H HA   . CYS A 1 29 ? 2.667   6.176   7.351  1.00 0.00 ? 29 CYS A HA   1  
ATOM 385  H HB2  . CYS A 1 29 ? 5.192   6.194   7.062  1.00 0.00 ? 29 CYS A HB2  1  
ATOM 386  H HB3  . CYS A 1 29 ? 4.583   6.848   8.579  1.00 0.00 ? 29 CYS A HB3  1  
ATOM 387  N N    . GLY A 1 30 ? 2.567   3.315   6.642  1.00 0.00 ? 30 GLY A N    1  
ATOM 388  C CA   . GLY A 1 30 ? 2.579   2.268   5.637  1.00 0.00 ? 30 GLY A CA   1  
ATOM 389  C C    . GLY A 1 30 ? 2.348   2.805   4.238  1.00 0.00 ? 30 GLY A C    1  
ATOM 390  O O    . GLY A 1 30 ? 2.492   2.078   3.256  1.00 0.00 ? 30 GLY A O    1  
ATOM 391  H H    . GLY A 1 30 ? 1.927   3.272   7.383  1.00 0.00 ? 30 GLY A H    1  
ATOM 392  H HA2  . GLY A 1 30 ? 3.536   1.768   5.666  1.00 0.00 ? 30 GLY A HA2  1  
ATOM 393  H HA3  . GLY A 1 30 ? 1.803   1.554   5.869  1.00 0.00 ? 30 GLY A HA3  1  
ATOM 394  N N    . SER A 1 31 ? 1.988   4.081   4.148  1.00 0.00 ? 31 SER A N    1  
ATOM 395  C CA   . SER A 1 31 ? 1.731   4.713   2.859  1.00 0.00 ? 31 SER A CA   1  
ATOM 396  C C    . SER A 1 31 ? 2.835   4.381   1.861  1.00 0.00 ? 31 SER A C    1  
ATOM 397  O O    . SER A 1 31 ? 2.618   3.639   0.902  1.00 0.00 ? 31 SER A O    1  
ATOM 398  C CB   . SER A 1 31 ? 1.617   6.230   3.025  1.00 0.00 ? 31 SER A CB   1  
ATOM 399  O OG   . SER A 1 31 ? 2.119   6.644   4.284  1.00 0.00 ? 31 SER A OG   1  
ATOM 400  H H    . SER A 1 31 ? 1.890   4.609   4.968  1.00 0.00 ? 31 SER A H    1  
ATOM 401  H HA   . SER A 1 31 ? 0.794   4.330   2.483  1.00 0.00 ? 31 SER A HA   1  
ATOM 402  H HB2  . SER A 1 31 ? 2.185   6.718   2.247  1.00 0.00 ? 31 SER A HB2  1  
ATOM 403  H HB3  . SER A 1 31 ? 0.580   6.521   2.950  1.00 0.00 ? 31 SER A HB3  1  
ATOM 404  H HG   . SER A 1 31 ? 1.573   7.355   4.628  1.00 0.00 ? 31 SER A HG   1  
ATOM 405  N N    . ASP A 1 32 ? 4.020   4.934   2.093  1.00 0.00 ? 32 ASP A N    1  
ATOM 406  C CA   . ASP A 1 32 ? 5.161   4.697   1.216  1.00 0.00 ? 32 ASP A CA   1  
ATOM 407  C C    . ASP A 1 32 ? 6.181   3.782   1.886  1.00 0.00 ? 32 ASP A C    1  
ATOM 408  O O    . ASP A 1 32 ? 7.379   3.866   1.614  1.00 0.00 ? 32 ASP A O    1  
ATOM 409  C CB   . ASP A 1 32 ? 5.820   6.022   0.831  1.00 0.00 ? 32 ASP A CB   1  
ATOM 410  C CG   . ASP A 1 32 ? 6.001   6.945   2.020  1.00 0.00 ? 32 ASP A CG   1  
ATOM 411  O OD1  . ASP A 1 32 ? 4.983   7.325   2.637  1.00 0.00 ? 32 ASP A OD1  1  
ATOM 412  O OD2  . ASP A 1 32 ? 7.160   7.288   2.334  1.00 0.00 ? 32 ASP A OD2  1  
ATOM 413  H H    . ASP A 1 32 ? 4.131   5.517   2.874  1.00 0.00 ? 32 ASP A H    1  
ATOM 414  H HA   . ASP A 1 32 ? 4.796   4.214   0.322  1.00 0.00 ? 32 ASP A HA   1  
ATOM 415  H HB2  . ASP A 1 32 ? 6.792   5.822   0.403  1.00 0.00 ? 32 ASP A HB2  1  
ATOM 416  H HB3  . ASP A 1 32 ? 5.205   6.523   0.098  1.00 0.00 ? 32 ASP A HB3  1  
ATOM 417  N N    . HIS A 1 33 ? 5.699   2.910   2.766  1.00 0.00 ? 33 HIS A N    1  
ATOM 418  C CA   . HIS A 1 33 ? 6.569   1.979   3.476  1.00 0.00 ? 33 HIS A CA   1  
ATOM 419  C C    . HIS A 1 33 ? 5.843   0.669   3.764  1.00 0.00 ? 33 HIS A C    1  
ATOM 420  O O    . HIS A 1 33 ? 4.783   0.660   4.390  1.00 0.00 ? 33 HIS A O    1  
ATOM 421  C CB   . HIS A 1 33 ? 7.058   2.603   4.783  1.00 0.00 ? 33 HIS A CB   1  
ATOM 422  C CG   . HIS A 1 33 ? 7.656   3.965   4.610  1.00 0.00 ? 33 HIS A CG   1  
ATOM 423  N ND1  . HIS A 1 33 ? 7.161   5.090   5.235  1.00 0.00 ? 33 HIS A ND1  1  
ATOM 424  C CD2  . HIS A 1 33 ? 8.717   4.380   3.879  1.00 0.00 ? 33 HIS A CD2  1  
ATOM 425  C CE1  . HIS A 1 33 ? 7.889   6.138   4.894  1.00 0.00 ? 33 HIS A CE1  1  
ATOM 426  N NE2  . HIS A 1 33 ? 8.841   5.734   4.072  1.00 0.00 ? 33 HIS A NE2  1  
ATOM 427  H H    . HIS A 1 33 ? 4.735   2.891   2.940  1.00 0.00 ? 33 HIS A H    1  
ATOM 428  H HA   . HIS A 1 33 ? 7.420   1.774   2.845  1.00 0.00 ? 33 HIS A HA   1  
ATOM 429  H HB2  . HIS A 1 33 ? 6.226   2.691   5.466  1.00 0.00 ? 33 HIS A HB2  1  
ATOM 430  H HB3  . HIS A 1 33 ? 7.810   1.962   5.221  1.00 0.00 ? 33 HIS A HB3  1  
ATOM 431  H HD1  . HIS A 1 33 ? 6.388   5.116   5.837  1.00 0.00 ? 33 HIS A HD1  1  
ATOM 432  H HD2  . HIS A 1 33 ? 9.350   3.761   3.258  1.00 0.00 ? 33 HIS A HD2  1  
ATOM 433  H HE1  . HIS A 1 33 ? 7.734   7.152   5.230  1.00 0.00 ? 33 HIS A HE1  1  
ATOM 434  N N    . TRP A 1 34 ? 6.420   -0.435  3.303  1.00 0.00 ? 34 TRP A N    1  
ATOM 435  C CA   . TRP A 1 34 ? 5.827   -1.751  3.510  1.00 0.00 ? 34 TRP A CA   1  
ATOM 436  C C    . TRP A 1 34 ? 6.770   -2.655  4.297  1.00 0.00 ? 34 TRP A C    1  
ATOM 437  O O    . TRP A 1 34 ? 7.940   -2.325  4.496  1.00 0.00 ? 34 TRP A O    1  
ATOM 438  C CB   . TRP A 1 34 ? 5.485   -2.397  2.167  1.00 0.00 ? 34 TRP A CB   1  
ATOM 439  C CG   . TRP A 1 34 ? 6.415   -1.996  1.061  1.00 0.00 ? 34 TRP A CG   1  
ATOM 440  C CD1  . TRP A 1 34 ? 6.092   -1.303  -0.070 1.00 0.00 ? 34 TRP A CD1  1  
ATOM 441  C CD2  . TRP A 1 34 ? 7.819   -2.267  0.982  1.00 0.00 ? 34 TRP A CD2  1  
ATOM 442  N NE1  . TRP A 1 34 ? 7.211   -1.126  -0.848 1.00 0.00 ? 34 TRP A NE1  1  
ATOM 443  C CE2  . TRP A 1 34 ? 8.283   -1.708  -0.225 1.00 0.00 ? 34 TRP A CE2  1  
ATOM 444  C CE3  . TRP A 1 34 ? 8.729   -2.926  1.813  1.00 0.00 ? 34 TRP A CE3  1  
ATOM 445  C CZ2  . TRP A 1 34 ? 9.616   -1.790  -0.618 1.00 0.00 ? 34 TRP A CZ2  1  
ATOM 446  C CZ3  . TRP A 1 34 ? 10.051  -3.007  1.421  1.00 0.00 ? 34 TRP A CZ3  1  
ATOM 447  C CH2  . TRP A 1 34 ? 10.485  -2.440  0.215  1.00 0.00 ? 34 TRP A CH2  1  
ATOM 448  H H    . TRP A 1 34 ? 7.265   -0.363  2.811  1.00 0.00 ? 34 TRP A H    1  
ATOM 449  H HA   . TRP A 1 34 ? 4.918   -1.618  4.078  1.00 0.00 ? 34 TRP A HA   1  
ATOM 450  H HB2  . TRP A 1 34 ? 5.531   -3.471  2.268  1.00 0.00 ? 34 TRP A HB2  1  
ATOM 451  H HB3  . TRP A 1 34 ? 4.484   -2.108  1.882  1.00 0.00 ? 34 TRP A HB3  1  
ATOM 452  H HD1  . TRP A 1 34 ? 5.099   -0.953  -0.306 1.00 0.00 ? 34 TRP A HD1  1  
ATOM 453  H HE1  . TRP A 1 34 ? 7.237   -0.658  -1.709 1.00 0.00 ? 34 TRP A HE1  1  
ATOM 454  H HE3  . TRP A 1 34 ? 8.413   -3.369  2.746  1.00 0.00 ? 34 TRP A HE3  1  
ATOM 455  H HZ2  . TRP A 1 34 ? 9.966   -1.358  -1.544 1.00 0.00 ? 34 TRP A HZ2  1  
ATOM 456  H HZ3  . TRP A 1 34 ? 10.769  -3.512  2.050  1.00 0.00 ? 34 TRP A HZ3  1  
ATOM 457  H HH2  . TRP A 1 34 ? 11.527  -2.528  -0.051 1.00 0.00 ? 34 TRP A HH2  1  
ATOM 458  N N    . CYS A 1 35 ? 6.255   -3.796  4.742  1.00 0.00 ? 35 CYS A N    1  
ATOM 459  C CA   . CYS A 1 35 ? 7.051   -4.748  5.508  1.00 0.00 ? 35 CYS A CA   1  
ATOM 460  C C    . CYS A 1 35 ? 7.442   -5.946  4.647  1.00 0.00 ? 35 CYS A C    1  
ATOM 461  O O    . CYS A 1 35 ? 6.947   -6.111  3.532  1.00 0.00 ? 35 CYS A O    1  
ATOM 462  C CB   . CYS A 1 35 ? 6.274   -5.222  6.737  1.00 0.00 ? 35 CYS A CB   1  
ATOM 463  S SG   . CYS A 1 35 ? 6.404   -4.108  8.173  1.00 0.00 ? 35 CYS A SG   1  
ATOM 464  H H    . CYS A 1 35 ? 5.316   -4.004  4.551  1.00 0.00 ? 35 CYS A H    1  
ATOM 465  H HA   . CYS A 1 35 ? 7.949   -4.245  5.832  1.00 0.00 ? 35 CYS A HA   1  
ATOM 466  H HB2  . CYS A 1 35 ? 5.228   -5.307  6.482  1.00 0.00 ? 35 CYS A HB2  1  
ATOM 467  H HB3  . CYS A 1 35 ? 6.646   -6.190  7.037  1.00 0.00 ? 35 CYS A HB3  1  
ATOM 468  N N    . ASP A 1 36 ? 8.333   -6.779  5.173  1.00 0.00 ? 36 ASP A N    1  
ATOM 469  C CA   . ASP A 1 36 ? 8.790   -7.963  4.455  1.00 0.00 ? 36 ASP A CA   1  
ATOM 470  C C    . ASP A 1 36 ? 7.611   -8.730  3.865  1.00 0.00 ? 36 ASP A C    1  
ATOM 471  O O    . ASP A 1 36 ? 7.687   -9.242  2.748  1.00 0.00 ? 36 ASP A O    1  
ATOM 472  C CB   . ASP A 1 36 ? 9.592   -8.873  5.386  1.00 0.00 ? 36 ASP A CB   1  
ATOM 473  C CG   . ASP A 1 36 ? 11.065  -8.515  5.420  1.00 0.00 ? 36 ASP A CG   1  
ATOM 474  O OD1  . ASP A 1 36 ? 11.544  -7.883  4.456  1.00 0.00 ? 36 ASP A OD1  1  
ATOM 475  O OD2  . ASP A 1 36 ? 11.737  -8.866  6.411  1.00 0.00 ? 36 ASP A OD2  1  
ATOM 476  H H    . ASP A 1 36 ? 8.692   -6.594  6.066  1.00 0.00 ? 36 ASP A H    1  
ATOM 477  H HA   . ASP A 1 36 ? 9.430   -7.636  3.649  1.00 0.00 ? 36 ASP A HA   1  
ATOM 478  H HB2  . ASP A 1 36 ? 9.197   -8.789  6.388  1.00 0.00 ? 36 ASP A HB2  1  
ATOM 479  H HB3  . ASP A 1 36 ? 9.496   -9.895  5.051  1.00 0.00 ? 36 ASP A HB3  1  
ATOM 480  N N    . ALA A 1 37 ? 6.522   -8.805  4.623  1.00 0.00 ? 37 ALA A N    1  
ATOM 481  C CA   . ALA A 1 37 ? 5.326   -9.508  4.174  1.00 0.00 ? 37 ALA A CA   1  
ATOM 482  C C    . ALA A 1 37 ? 4.346   -8.552  3.504  1.00 0.00 ? 37 ALA A C    1  
ATOM 483  O O    . ALA A 1 37 ? 3.913   -7.569  4.106  1.00 0.00 ? 37 ALA A O    1  
ATOM 484  C CB   . ALA A 1 37 ? 4.660   -10.215 5.345  1.00 0.00 ? 37 ALA A CB   1  
ATOM 485  H H    . ALA A 1 37 ? 6.522   -8.376  5.503  1.00 0.00 ? 37 ALA A H    1  
ATOM 486  H HA   . ALA A 1 37 ? 5.629   -10.258 3.458  1.00 0.00 ? 37 ALA A HA   1  
ATOM 487  H HB1  . ALA A 1 37 ? 4.352   -11.204 5.039  1.00 0.00 ? 37 ALA A HB1  1  
ATOM 488  H HB2  . ALA A 1 37 ? 5.359   -10.293 6.164  1.00 0.00 ? 37 ALA A HB2  1  
ATOM 489  H HB3  . ALA A 1 37 ? 3.796   -9.651  5.662  1.00 0.00 ? 37 ALA A HB3  1  
ATOM 490  N N    . SER A 1 38 ? 4.000   -8.845  2.255  1.00 0.00 ? 38 SER A N    1  
ATOM 491  C CA   . SER A 1 38 ? 3.074   -8.009  1.501  1.00 0.00 ? 38 SER A CA   1  
ATOM 492  C C    . SER A 1 38 ? 1.729   -7.909  2.214  1.00 0.00 ? 38 SER A C    1  
ATOM 493  O O    . SER A 1 38 ? 0.766   -8.579  1.843  1.00 0.00 ? 38 SER A O    1  
ATOM 494  C CB   . SER A 1 38 ? 2.877   -8.571  0.092  1.00 0.00 ? 38 SER A CB   1  
ATOM 495  O OG   . SER A 1 38 ? 2.303   -9.865  0.135  1.00 0.00 ? 38 SER A OG   1  
ATOM 496  H H    . SER A 1 38 ? 4.379   -9.643  1.829  1.00 0.00 ? 38 SER A H    1  
ATOM 497  H HA   . SER A 1 38 ? 3.504   -7.021  1.428  1.00 0.00 ? 38 SER A HA   1  
ATOM 498  H HB2  . SER A 1 38 ? 2.222   -7.918  -0.465 1.00 0.00 ? 38 SER A HB2  1  
ATOM 499  H HB3  . SER A 1 38 ? 3.834   -8.630  -0.406 1.00 0.00 ? 38 SER A HB3  1  
ATOM 500  H HG   . SER A 1 38 ? 1.518   -9.886  -0.417 1.00 0.00 ? 38 SER A HG   1  
ATOM 501  N N    . GLY A 1 39 ? 1.671   -7.065  3.240  1.00 0.00 ? 39 GLY A N    1  
ATOM 502  C CA   . GLY A 1 39 ? 0.440   -6.892  3.989  1.00 0.00 ? 39 GLY A CA   1  
ATOM 503  C C    . GLY A 1 39 ? 0.645   -6.100  5.265  1.00 0.00 ? 39 GLY A C    1  
ATOM 504  O O    . GLY A 1 39 ? -0.299  -5.516  5.800  1.00 0.00 ? 39 GLY A O    1  
ATOM 505  H H    . GLY A 1 39 ? 2.470   -6.557  3.490  1.00 0.00 ? 39 GLY A H    1  
ATOM 506  H HA2  . GLY A 1 39 ? -0.277  -6.377  3.369  1.00 0.00 ? 39 GLY A HA2  1  
ATOM 507  H HA3  . GLY A 1 39 ? 0.047   -7.866  4.244  1.00 0.00 ? 39 GLY A HA3  1  
ATOM 508  N N    . ASP A 1 40 ? 1.879   -6.080  5.756  1.00 0.00 ? 40 ASP A N    1  
ATOM 509  C CA   . ASP A 1 40 ? 2.205   -5.354  6.978  1.00 0.00 ? 40 ASP A CA   1  
ATOM 510  C C    . ASP A 1 40 ? 2.605   -3.915  6.664  1.00 0.00 ? 40 ASP A C    1  
ATOM 511  O O    . ASP A 1 40 ? 3.411   -3.666  5.768  1.00 0.00 ? 40 ASP A O    1  
ATOM 512  C CB   . ASP A 1 40 ? 3.334   -6.059  7.730  1.00 0.00 ? 40 ASP A CB   1  
ATOM 513  C CG   . ASP A 1 40 ? 2.818   -7.058  8.746  1.00 0.00 ? 40 ASP A CG   1  
ATOM 514  O OD1  . ASP A 1 40 ? 3.362   -7.096  9.870  1.00 0.00 ? 40 ASP A OD1  1  
ATOM 515  O OD2  . ASP A 1 40 ? 1.869   -7.801  8.419  1.00 0.00 ? 40 ASP A OD2  1  
ATOM 516  H H    . ASP A 1 40 ? 2.589   -6.565  5.284  1.00 0.00 ? 40 ASP A H    1  
ATOM 517  H HA   . ASP A 1 40 ? 1.323   -5.341  7.601  1.00 0.00 ? 40 ASP A HA   1  
ATOM 518  H HB2  . ASP A 1 40 ? 3.957   -6.584  7.021  1.00 0.00 ? 40 ASP A HB2  1  
ATOM 519  H HB3  . ASP A 1 40 ? 3.929   -5.320  8.247  1.00 0.00 ? 40 ASP A HB3  1  
ATOM 520  N N    . ARG A 1 41 ? 2.037   -2.973  7.409  1.00 0.00 ? 41 ARG A N    1  
ATOM 521  C CA   . ARG A 1 41 ? 2.333   -1.559  7.209  1.00 0.00 ? 41 ARG A CA   1  
ATOM 522  C C    . ARG A 1 41 ? 3.441   -1.097  8.150  1.00 0.00 ? 41 ARG A C    1  
ATOM 523  O O    . ARG A 1 41 ? 3.407   -1.374  9.350  1.00 0.00 ? 41 ARG A O    1  
ATOM 524  C CB   . ARG A 1 41 ? 1.076   -0.716  7.432  1.00 0.00 ? 41 ARG A CB   1  
ATOM 525  C CG   . ARG A 1 41 ? -0.006  -1.433  8.223  1.00 0.00 ? 41 ARG A CG   1  
ATOM 526  C CD   . ARG A 1 41 ? -1.147  -0.495  8.583  1.00 0.00 ? 41 ARG A CD   1  
ATOM 527  N NE   . ARG A 1 41 ? -2.138  -0.404  7.515  1.00 0.00 ? 41 ARG A NE   1  
ATOM 528  C CZ   . ARG A 1 41 ? -2.024  0.414   6.474  1.00 0.00 ? 41 ARG A CZ   1  
ATOM 529  N NH1  . ARG A 1 41 ? -0.967  1.207   6.363  1.00 0.00 ? 41 ARG A NH1  1  
ATOM 530  N NH2  . ARG A 1 41 ? -2.968  0.440   5.542  1.00 0.00 ? 41 ARG A NH2  1  
ATOM 531  H H    . ARG A 1 41 ? 1.402   -3.233  8.109  1.00 0.00 ? 41 ARG A H    1  
ATOM 532  H HA   . ARG A 1 41 ? 2.665   -1.431  6.190  1.00 0.00 ? 41 ARG A HA   1  
ATOM 533  H HB2  . ARG A 1 41 ? 1.348   0.181   7.968  1.00 0.00 ? 41 ARG A HB2  1  
ATOM 534  H HB3  . ARG A 1 41 ? 0.666   -0.442  6.471  1.00 0.00 ? 41 ARG A HB3  1  
ATOM 535  H HG2  . ARG A 1 41 ? -0.396  -2.245  7.628  1.00 0.00 ? 41 ARG A HG2  1  
ATOM 536  H HG3  . ARG A 1 41 ? 0.427   -1.826  9.132  1.00 0.00 ? 41 ARG A HG3  1  
ATOM 537  H HD2  . ARG A 1 41 ? -1.629  -0.862  9.477  1.00 0.00 ? 41 ARG A HD2  1  
ATOM 538  H HD3  . ARG A 1 41 ? -0.742  0.488   8.771  1.00 0.00 ? 41 ARG A HD3  1  
ATOM 539  H HE   . ARG A 1 41 ? -2.928  -0.980  7.577  1.00 0.00 ? 41 ARG A HE   1  
ATOM 540  H HH11 . ARG A 1 41 ? -0.253  1.188   7.063  1.00 0.00 ? 41 ARG A HH11 1  
ATOM 541  H HH12 . ARG A 1 41 ? -0.882  1.821   5.578  1.00 0.00 ? 41 ARG A HH12 1  
ATOM 542  H HH21 . ARG A 1 41 ? -3.766  -0.156  5.623  1.00 0.00 ? 41 ARG A HH21 1  
ATOM 543  H HH22 . ARG A 1 41 ? -2.881  1.056   4.760  1.00 0.00 ? 41 ARG A HH22 1  
ATOM 544  N N    . CYS A 1 42 ? 4.423   -0.392  7.599  1.00 0.00 ? 42 CYS A N    1  
ATOM 545  C CA   . CYS A 1 42 ? 5.543   0.107   8.387  1.00 0.00 ? 42 CYS A CA   1  
ATOM 546  C C    . CYS A 1 42 ? 5.157   1.381   9.133  1.00 0.00 ? 42 CYS A C    1  
ATOM 547  O O    . CYS A 1 42 ? 4.635   2.327   8.541  1.00 0.00 ? 42 CYS A O    1  
ATOM 548  C CB   . CYS A 1 42 ? 6.749   0.377   7.485  1.00 0.00 ? 42 CYS A CB   1  
ATOM 549  S SG   . CYS A 1 42 ? 7.886   -1.037  7.321  1.00 0.00 ? 42 CYS A SG   1  
ATOM 550  H H    . CYS A 1 42 ? 4.395   -0.204  6.636  1.00 0.00 ? 42 CYS A H    1  
ATOM 551  H HA   . CYS A 1 42 ? 5.806   -0.651  9.108  1.00 0.00 ? 42 CYS A HA   1  
ATOM 552  H HB2  . CYS A 1 42 ? 6.399   0.632   6.496  1.00 0.00 ? 42 CYS A HB2  1  
ATOM 553  H HB3  . CYS A 1 42 ? 7.311   1.206   7.888  1.00 0.00 ? 42 CYS A HB3  1  
ATOM 554  N N    . CYS A 1 43 ? 5.417   1.399   10.436 1.00 0.00 ? 43 CYS A N    1  
ATOM 555  C CA   . CYS A 1 43 ? 5.098   2.556   11.264 1.00 0.00 ? 43 CYS A CA   1  
ATOM 556  C C    . CYS A 1 43 ? 6.324   3.444   11.454 1.00 0.00 ? 43 CYS A C    1  
ATOM 557  O O    . CYS A 1 43 ? 7.459   3.002   11.273 1.00 0.00 ? 43 CYS A O    1  
ATOM 558  C CB   . CYS A 1 43 ? 4.567   2.103   12.626 1.00 0.00 ? 43 CYS A CB   1  
ATOM 559  S SG   . CYS A 1 43 ? 2.894   1.382   12.570 1.00 0.00 ? 43 CYS A SG   1  
ATOM 560  H H    . CYS A 1 43 ? 5.834   0.615   10.852 1.00 0.00 ? 43 CYS A H    1  
ATOM 561  H HA   . CYS A 1 43 ? 4.331   3.124   10.760 1.00 0.00 ? 43 CYS A HA   1  
ATOM 562  H HB2  . CYS A 1 43 ? 5.232   1.355   13.033 1.00 0.00 ? 43 CYS A HB2  1  
ATOM 563  H HB3  . CYS A 1 43 ? 4.537   2.952   13.293 1.00 0.00 ? 43 CYS A HB3  1  
ATOM 564  N N    . CYS A 1 44 ? 6.087   4.700   11.820 1.00 0.00 ? 44 CYS A N    1  
ATOM 565  C CA   . CYS A 1 44 ? 7.170   5.652   12.034 1.00 0.00 ? 44 CYS A CA   1  
ATOM 566  C C    . CYS A 1 44 ? 6.942   6.456   13.311 1.00 0.00 ? 44 CYS A C    1  
ATOM 567  O O    . CYS A 1 44 ? 5.856   6.990   13.535 1.00 0.00 ? 44 CYS A O    1  
ATOM 568  C CB   . CYS A 1 44 ? 7.290   6.597   10.837 1.00 0.00 ? 44 CYS A CB   1  
ATOM 569  S SG   . CYS A 1 44 ? 7.516   5.750   9.241  1.00 0.00 ? 44 CYS A SG   1  
ATOM 570  H H    . CYS A 1 44 ? 5.160   4.994   11.949 1.00 0.00 ? 44 CYS A H    1  
ATOM 571  H HA   . CYS A 1 44 ? 8.088   5.093   12.134 1.00 0.00 ? 44 CYS A HA   1  
ATOM 572  H HB2  . CYS A 1 44 ? 6.392   7.193   10.768 1.00 0.00 ? 44 CYS A HB2  1  
ATOM 573  H HB3  . CYS A 1 44 ? 8.138   7.249   10.987 1.00 0.00 ? 44 CYS A HB3  1  
ATOM 574  N N    . ALA A 1 45 ? 7.974   6.537   14.144 1.00 0.00 ? 45 ALA A N    1  
ATOM 575  C CA   . ALA A 1 45 ? 7.888   7.278   15.397 1.00 0.00 ? 45 ALA A CA   1  
ATOM 576  C C    . ALA A 1 45 ? 8.040   8.777   15.160 1.00 0.00 ? 45 ALA A C    1  
ATOM 577  O O    . ALA A 1 45 ? 8.185   9.553   16.105 1.00 0.00 ? 45 ALA A O    1  
ATOM 578  C CB   . ALA A 1 45 ? 8.945   6.786   16.374 1.00 0.00 ? 45 ALA A CB   1  
ATOM 579  H H    . ALA A 1 45 ? 8.814   6.090   13.910 1.00 0.00 ? 45 ALA A H    1  
ATOM 580  H HA   . ALA A 1 45 ? 6.917   7.089   15.830 1.00 0.00 ? 45 ALA A HA   1  
ATOM 581  H HB1  . ALA A 1 45 ? 9.820   7.417   16.304 1.00 0.00 ? 45 ALA A HB1  1  
ATOM 582  H HB2  . ALA A 1 45 ? 8.553   6.826   17.379 1.00 0.00 ? 45 ALA A HB2  1  
ATOM 583  H HB3  . ALA A 1 45 ? 9.214   5.769   16.132 1.00 0.00 ? 45 ALA A HB3  1  
ATOM 584  N N    . CYS A 1 1  ? 0.574   0.784   -1.559 1.00 0.00 ? 1  CYS A N    2  
ATOM 585  C CA   . CYS A 1 1  ? 1.748   0.717   -2.421 1.00 0.00 ? 1  CYS A CA   2  
ATOM 586  C C    . CYS A 1 1  ? 2.185   -0.730  -2.632 1.00 0.00 ? 1  CYS A C    2  
ATOM 587  O O    . CYS A 1 1  ? 1.630   -1.651  -2.033 1.00 0.00 ? 1  CYS A O    2  
ATOM 588  C CB   . CYS A 1 1  ? 2.897   1.526   -1.817 1.00 0.00 ? 1  CYS A CB   2  
ATOM 589  S SG   . CYS A 1 1  ? 3.589   0.809   -0.292 1.00 0.00 ? 1  CYS A SG   2  
ATOM 590  H H    . CYS A 1 1  ? 0.613   1.323   -0.741 1.00 0.00 ? 1  CYS A H    2  
ATOM 591  H HA   . CYS A 1 1  ? 1.483   1.143   -3.377 1.00 0.00 ? 1  CYS A HA   2  
ATOM 592  H HB2  . CYS A 1 1  ? 3.698   1.594   -2.539 1.00 0.00 ? 1  CYS A HB2  2  
ATOM 593  H HB3  . CYS A 1 1  ? 2.544   2.519   -1.583 1.00 0.00 ? 1  CYS A HB3  2  
ATOM 594  N N    . TYR A 1 2  ? 3.183   -0.921  -3.488 1.00 0.00 ? 2  TYR A N    2  
ATOM 595  C CA   . TYR A 1 2  ? 3.694   -2.255  -3.780 1.00 0.00 ? 2  TYR A CA   2  
ATOM 596  C C    . TYR A 1 2  ? 5.195   -2.334  -3.514 1.00 0.00 ? 2  TYR A C    2  
ATOM 597  O O    . TYR A 1 2  ? 5.903   -1.327  -3.500 1.00 0.00 ? 2  TYR A O    2  
ATOM 598  C CB   . TYR A 1 2  ? 3.402   -2.629  -5.234 1.00 0.00 ? 2  TYR A CB   2  
ATOM 599  C CG   . TYR A 1 2  ? 2.560   -3.875  -5.382 1.00 0.00 ? 2  TYR A CG   2  
ATOM 600  C CD1  . TYR A 1 2  ? 1.473   -4.105  -4.548 1.00 0.00 ? 2  TYR A CD1  2  
ATOM 601  C CD2  . TYR A 1 2  ? 2.851   -4.824  -6.354 1.00 0.00 ? 2  TYR A CD2  2  
ATOM 602  C CE1  . TYR A 1 2  ? 0.700   -5.243  -4.678 1.00 0.00 ? 2  TYR A CE1  2  
ATOM 603  C CE2  . TYR A 1 2  ? 2.083   -5.964  -6.493 1.00 0.00 ? 2  TYR A CE2  2  
ATOM 604  C CZ   . TYR A 1 2  ? 1.009   -6.169  -5.652 1.00 0.00 ? 2  TYR A CZ   2  
ATOM 605  O OH   . TYR A 1 2  ? 0.243   -7.304  -5.786 1.00 0.00 ? 2  TYR A OH   2  
ATOM 606  H H    . TYR A 1 2  ? 3.585   -0.147  -3.935 1.00 0.00 ? 2  TYR A H    2  
ATOM 607  H HA   . TYR A 1 2  ? 3.188   -2.954  -3.131 1.00 0.00 ? 2  TYR A HA   2  
ATOM 608  H HB2  . TYR A 1 2  ? 2.876   -1.815  -5.709 1.00 0.00 ? 2  TYR A HB2  2  
ATOM 609  H HB3  . TYR A 1 2  ? 4.337   -2.796  -5.750 1.00 0.00 ? 2  TYR A HB3  2  
ATOM 610  H HD1  . TYR A 1 2  ? 1.233   -3.378  -3.785 1.00 0.00 ? 2  TYR A HD1  2  
ATOM 611  H HD2  . TYR A 1 2  ? 3.694   -4.660  -7.011 1.00 0.00 ? 2  TYR A HD2  2  
ATOM 612  H HE1  . TYR A 1 2  ? -0.141  -5.404  -4.020 1.00 0.00 ? 2  TYR A HE1  2  
ATOM 613  H HE2  . TYR A 1 2  ? 2.326   -6.689  -7.256 1.00 0.00 ? 2  TYR A HE2  2  
ATOM 614  H HH   . TYR A 1 2  ? -0.392  -7.180  -6.496 1.00 0.00 ? 2  TYR A HH   2  
ATOM 615  N N    . PRO A 1 3  ? 5.692   -3.561  -3.299 1.00 0.00 ? 3  PRO A N    2  
ATOM 616  C CA   . PRO A 1 3  ? 7.113   -3.803  -3.030 1.00 0.00 ? 3  PRO A CA   2  
ATOM 617  C C    . PRO A 1 3  ? 7.985   -3.558  -4.257 1.00 0.00 ? 3  PRO A C    2  
ATOM 618  O O    . PRO A 1 3  ? 8.384   -4.497  -4.945 1.00 0.00 ? 3  PRO A O    2  
ATOM 619  C CB   . PRO A 1 3  ? 7.152   -5.280  -2.633 1.00 0.00 ? 3  PRO A CB   2  
ATOM 620  C CG   . PRO A 1 3  ? 5.958   -5.881  -3.290 1.00 0.00 ? 3  PRO A CG   2  
ATOM 621  C CD   . PRO A 1 3  ? 4.907   -4.806  -3.301 1.00 0.00 ? 3  PRO A CD   2  
ATOM 622  H HA   . PRO A 1 3  ? 7.471   -3.198  -2.210 1.00 0.00 ? 3  PRO A HA   2  
ATOM 623  H HB2  . PRO A 1 3  ? 8.069   -5.728  -2.991 1.00 0.00 ? 3  PRO A HB2  2  
ATOM 624  H HB3  . PRO A 1 3  ? 7.098   -5.369  -1.558 1.00 0.00 ? 3  PRO A HB3  2  
ATOM 625  H HG2  . PRO A 1 3  ? 6.203   -6.176  -4.298 1.00 0.00 ? 3  PRO A HG2  2  
ATOM 626  H HG3  . PRO A 1 3  ? 5.616   -6.733  -2.720 1.00 0.00 ? 3  PRO A HG3  2  
ATOM 627  H HD2  . PRO A 1 3  ? 4.302   -4.879  -4.192 1.00 0.00 ? 3  PRO A HD2  2  
ATOM 628  H HD3  . PRO A 1 3  ? 4.289   -4.873  -2.417 1.00 0.00 ? 3  PRO A HD3  2  
ATOM 629  N N    . GLY A 1 4  ? 8.277   -2.289  -4.527 1.00 0.00 ? 4  GLY A N    2  
ATOM 630  C CA   . GLY A 1 4  ? 9.100   -1.944  -5.672 1.00 0.00 ? 4  GLY A CA   2  
ATOM 631  C C    . GLY A 1 4  ? 8.579   -0.731  -6.415 1.00 0.00 ? 4  GLY A C    2  
ATOM 632  O O    . GLY A 1 4  ? 9.138   -0.335  -7.438 1.00 0.00 ? 4  GLY A O    2  
ATOM 633  H H    . GLY A 1 4  ? 7.931   -1.581  -3.944 1.00 0.00 ? 4  GLY A H    2  
ATOM 634  H HA2  . GLY A 1 4  ? 10.104  -1.741  -5.331 1.00 0.00 ? 4  GLY A HA2  2  
ATOM 635  H HA3  . GLY A 1 4  ? 9.123   -2.785  -6.350 1.00 0.00 ? 4  GLY A HA3  2  
ATOM 636  N N    . GLN A 1 5  ? 7.504   -0.140  -5.903 1.00 0.00 ? 5  GLN A N    2  
ATOM 637  C CA   . GLN A 1 5  ? 6.907   1.034   -6.527 1.00 0.00 ? 5  GLN A CA   2  
ATOM 638  C C    . GLN A 1 5  ? 7.747   2.279   -6.263 1.00 0.00 ? 5  GLN A C    2  
ATOM 639  O O    . GLN A 1 5  ? 8.492   2.358   -5.285 1.00 0.00 ? 5  GLN A O    2  
ATOM 640  C CB   . GLN A 1 5  ? 5.483   1.246   -6.008 1.00 0.00 ? 5  GLN A CB   2  
ATOM 641  C CG   . GLN A 1 5  ? 4.551   0.080   -6.297 1.00 0.00 ? 5  GLN A CG   2  
ATOM 642  C CD   . GLN A 1 5  ? 3.088   0.463   -6.192 1.00 0.00 ? 5  GLN A CD   2  
ATOM 643  O OE1  . GLN A 1 5  ? 2.666   1.088   -5.218 1.00 0.00 ? 5  GLN A OE1  2  
ATOM 644  N NE2  . GLN A 1 5  ? 2.304   0.090   -7.197 1.00 0.00 ? 5  GLN A NE2  2  
ATOM 645  H H    . GLN A 1 5  ? 7.103   -0.503  -5.086 1.00 0.00 ? 5  GLN A H    2  
ATOM 646  H HA   . GLN A 1 5  ? 6.869   0.860   -7.592 1.00 0.00 ? 5  GLN A HA   2  
ATOM 647  H HB2  . GLN A 1 5  ? 5.521   1.393   -4.939 1.00 0.00 ? 5  GLN A HB2  2  
ATOM 648  H HB3  . GLN A 1 5  ? 5.072   2.130   -6.471 1.00 0.00 ? 5  GLN A HB3  2  
ATOM 649  H HG2  . GLN A 1 5  ? 4.742   -0.278  -7.298 1.00 0.00 ? 5  GLN A HG2  2  
ATOM 650  H HG3  . GLN A 1 5  ? 4.753   -0.710  -5.589 1.00 0.00 ? 5  GLN A HG3  2  
ATOM 651  H HE21 . GLN A 1 5  ? 2.709   -0.406  -7.939 1.00 0.00 ? 5  GLN A HE21 2  
ATOM 652  H HE22 . GLN A 1 5  ? 1.355   0.324   -7.154 1.00 0.00 ? 5  GLN A HE22 2  
ATOM 653  N N    . PRO A 1 6  ? 7.628   3.275   -7.153 1.00 0.00 ? 6  PRO A N    2  
ATOM 654  C CA   . PRO A 1 6  ? 8.369   4.534   -7.037 1.00 0.00 ? 6  PRO A CA   2  
ATOM 655  C C    . PRO A 1 6  ? 7.884   5.387   -5.870 1.00 0.00 ? 6  PRO A C    2  
ATOM 656  O O    . PRO A 1 6  ? 7.094   6.312   -6.052 1.00 0.00 ? 6  PRO A O    2  
ATOM 657  C CB   . PRO A 1 6  ? 8.087   5.236   -8.367 1.00 0.00 ? 6  PRO A CB   2  
ATOM 658  C CG   . PRO A 1 6  ? 6.786   4.672   -8.824 1.00 0.00 ? 6  PRO A CG   2  
ATOM 659  C CD   . PRO A 1 6  ? 6.759   3.248   -8.342 1.00 0.00 ? 6  PRO A CD   2  
ATOM 660  H HA   . PRO A 1 6  ? 9.431   4.361   -6.937 1.00 0.00 ? 6  PRO A HA   2  
ATOM 661  H HB2  . PRO A 1 6  ? 8.021   6.303   -8.207 1.00 0.00 ? 6  PRO A HB2  2  
ATOM 662  H HB3  . PRO A 1 6  ? 8.879   5.020   -9.068 1.00 0.00 ? 6  PRO A HB3  2  
ATOM 663  H HG2  . PRO A 1 6  ? 5.971   5.231   -8.389 1.00 0.00 ? 6  PRO A HG2  2  
ATOM 664  H HG3  . PRO A 1 6  ? 6.731   4.704   -9.902 1.00 0.00 ? 6  PRO A HG3  2  
ATOM 665  H HD2  . PRO A 1 6  ? 5.753   2.958   -8.078 1.00 0.00 ? 6  PRO A HD2  2  
ATOM 666  H HD3  . PRO A 1 6  ? 7.159   2.587   -9.096 1.00 0.00 ? 6  PRO A HD3  2  
ATOM 667  N N    . GLY A 1 7  ? 8.362   5.069   -4.670 1.00 0.00 ? 7  GLY A N    2  
ATOM 668  C CA   . GLY A 1 7  ? 7.965   5.817   -3.492 1.00 0.00 ? 7  GLY A CA   2  
ATOM 669  C C    . GLY A 1 7  ? 7.879   4.945   -2.254 1.00 0.00 ? 7  GLY A C    2  
ATOM 670  O O    . GLY A 1 7  ? 8.092   5.418   -1.137 1.00 0.00 ? 7  GLY A O    2  
ATOM 671  H H    . GLY A 1 7  ? 8.989   4.321   -4.585 1.00 0.00 ? 7  GLY A H    2  
ATOM 672  H HA2  . GLY A 1 7  ? 8.685   6.602   -3.317 1.00 0.00 ? 7  GLY A HA2  2  
ATOM 673  H HA3  . GLY A 1 7  ? 6.998   6.263   -3.671 1.00 0.00 ? 7  GLY A HA3  2  
ATOM 674  N N    . CYS A 1 8  ? 7.563   3.670   -2.452 1.00 0.00 ? 8  CYS A N    2  
ATOM 675  C CA   . CYS A 1 8  ? 7.447   2.730   -1.343 1.00 0.00 ? 8  CYS A CA   2  
ATOM 676  C C    . CYS A 1 8  ? 8.743   1.948   -1.155 1.00 0.00 ? 8  CYS A C    2  
ATOM 677  O O    . CYS A 1 8  ? 9.543   1.819   -2.081 1.00 0.00 ? 8  CYS A O    2  
ATOM 678  C CB   . CYS A 1 8  ? 6.286   1.764   -1.586 1.00 0.00 ? 8  CYS A CB   2  
ATOM 679  S SG   . CYS A 1 8  ? 5.485   1.165   -0.063 1.00 0.00 ? 8  CYS A SG   2  
ATOM 680  H H    . CYS A 1 8  ? 7.404   3.352   -3.366 1.00 0.00 ? 8  CYS A H    2  
ATOM 681  H HA   . CYS A 1 8  ? 7.250   3.297   -0.446 1.00 0.00 ? 8  CYS A HA   2  
ATOM 682  H HB2  . CYS A 1 8  ? 5.531   2.261   -2.179 1.00 0.00 ? 8  CYS A HB2  2  
ATOM 683  H HB3  . CYS A 1 8  ? 6.651   0.903   -2.127 1.00 0.00 ? 8  CYS A HB3  2  
ATOM 684  N N    . GLY A 1 9  ? 8.944   1.426   0.052  1.00 0.00 ? 9  GLY A N    2  
ATOM 685  C CA   . GLY A 1 9  ? 10.144  0.663   0.340  1.00 0.00 ? 9  GLY A CA   2  
ATOM 686  C C    . GLY A 1 9  ? 10.178  0.154   1.768  1.00 0.00 ? 9  GLY A C    2  
ATOM 687  O O    . GLY A 1 9  ? 9.223   0.338   2.524  1.00 0.00 ? 9  GLY A O    2  
ATOM 688  H H    . GLY A 1 9  ? 8.271   1.562   0.752  1.00 0.00 ? 9  GLY A H    2  
ATOM 689  H HA2  . GLY A 1 9  ? 10.191  -0.180  -0.333 1.00 0.00 ? 9  GLY A HA2  2  
ATOM 690  H HA3  . GLY A 1 9  ? 11.005  1.293   0.174  1.00 0.00 ? 9  GLY A HA3  2  
ATOM 691  N N    . HIS A 1 10 ? 11.280  -0.490  2.138  1.00 0.00 ? 10 HIS A N    2  
ATOM 692  C CA   . HIS A 1 10 ? 11.435  -1.028  3.485  1.00 0.00 ? 10 HIS A CA   2  
ATOM 693  C C    . HIS A 1 10 ? 11.559  0.096   4.509  1.00 0.00 ? 10 HIS A C    2  
ATOM 694  O O    . HIS A 1 10 ? 12.435  0.955   4.401  1.00 0.00 ? 10 HIS A O    2  
ATOM 695  C CB   . HIS A 1 10 ? 12.663  -1.936  3.556  1.00 0.00 ? 10 HIS A CB   2  
ATOM 696  C CG   . HIS A 1 10 ? 13.877  -1.354  2.900  1.00 0.00 ? 10 HIS A CG   2  
ATOM 697  N ND1  . HIS A 1 10 ? 14.256  -1.663  1.610  1.00 0.00 ? 10 HIS A ND1  2  
ATOM 698  C CD2  . HIS A 1 10 ? 14.798  -0.477  3.361  1.00 0.00 ? 10 HIS A CD2  2  
ATOM 699  C CE1  . HIS A 1 10 ? 15.359  -1.001  1.308  1.00 0.00 ? 10 HIS A CE1  2  
ATOM 700  N NE2  . HIS A 1 10 ? 15.708  -0.274  2.353  1.00 0.00 ? 10 HIS A NE2  2  
ATOM 701  H H    . HIS A 1 10 ? 12.007  -0.605  1.491  1.00 0.00 ? 10 HIS A H    2  
ATOM 702  H HA   . HIS A 1 10 ? 10.554  -1.610  3.713  1.00 0.00 ? 10 HIS A HA   2  
ATOM 703  H HB2  . HIS A 1 10 ? 12.904  -2.123  4.592  1.00 0.00 ? 10 HIS A HB2  2  
ATOM 704  H HB3  . HIS A 1 10 ? 12.438  -2.874  3.069  1.00 0.00 ? 10 HIS A HB3  2  
ATOM 705  H HD1  . HIS A 1 10 ? 13.787  -2.276  1.008  1.00 0.00 ? 10 HIS A HD1  2  
ATOM 706  H HD2  . HIS A 1 10 ? 14.815  -0.020  4.341  1.00 0.00 ? 10 HIS A HD2  2  
ATOM 707  H HE1  . HIS A 1 10 ? 15.885  -1.047  0.366  1.00 0.00 ? 10 HIS A HE1  2  
ATOM 708  N N    . CYS A 1 11 ? 10.676  0.086   5.502  1.00 0.00 ? 11 CYS A N    2  
ATOM 709  C CA   . CYS A 1 11 ? 10.685  1.104   6.545  1.00 0.00 ? 11 CYS A CA   2  
ATOM 710  C C    . CYS A 1 11 ? 11.969  1.031   7.366  1.00 0.00 ? 11 CYS A C    2  
ATOM 711  O O    . CYS A 1 11 ? 12.685  0.031   7.329  1.00 0.00 ? 11 CYS A O    2  
ATOM 712  C CB   . CYS A 1 11 ? 9.471   0.937   7.461  1.00 0.00 ? 11 CYS A CB   2  
ATOM 713  S SG   . CYS A 1 11 ? 9.531   -0.551  8.510  1.00 0.00 ? 11 CYS A SG   2  
ATOM 714  H H    . CYS A 1 11 ? 10.001  -0.625  5.534  1.00 0.00 ? 11 CYS A H    2  
ATOM 715  H HA   . CYS A 1 11 ? 10.633  2.070   6.066  1.00 0.00 ? 11 CYS A HA   2  
ATOM 716  H HB2  . CYS A 1 11 ? 9.400   1.795   8.113  1.00 0.00 ? 11 CYS A HB2  2  
ATOM 717  H HB3  . CYS A 1 11 ? 8.578   0.877   6.856  1.00 0.00 ? 11 CYS A HB3  2  
ATOM 718  N N    . SER A 1 12 ? 12.253  2.098   8.106  1.00 0.00 ? 12 SER A N    2  
ATOM 719  C CA   . SER A 1 12 ? 13.452  2.157   8.933  1.00 0.00 ? 12 SER A CA   2  
ATOM 720  C C    . SER A 1 12 ? 13.245  3.087   10.125 1.00 0.00 ? 12 SER A C    2  
ATOM 721  O O    . SER A 1 12 ? 12.495  4.060   10.044 1.00 0.00 ? 12 SER A O    2  
ATOM 722  C CB   . SER A 1 12 ? 14.647  2.632   8.104  1.00 0.00 ? 12 SER A CB   2  
ATOM 723  O OG   . SER A 1 12 ? 15.796  2.803   8.916  1.00 0.00 ? 12 SER A OG   2  
ATOM 724  H H    . SER A 1 12 ? 11.642  2.865   8.093  1.00 0.00 ? 12 SER A H    2  
ATOM 725  H HA   . SER A 1 12 ? 13.652  1.161   9.299  1.00 0.00 ? 12 SER A HA   2  
ATOM 726  H HB2  . SER A 1 12 ? 14.866  1.900   7.341  1.00 0.00 ? 12 SER A HB2  2  
ATOM 727  H HB3  . SER A 1 12 ? 14.406  3.576   7.638  1.00 0.00 ? 12 SER A HB3  2  
ATOM 728  H HG   . SER A 1 12 ? 15.961  1.997   9.411  1.00 0.00 ? 12 SER A HG   2  
ATOM 729  N N    . ARG A 1 13 ? 13.915  2.780   11.231 1.00 0.00 ? 13 ARG A N    2  
ATOM 730  C CA   . ARG A 1 13 ? 13.804  3.586   12.440 1.00 0.00 ? 13 ARG A CA   2  
ATOM 731  C C    . ARG A 1 13 ? 13.793  5.074   12.103 1.00 0.00 ? 13 ARG A C    2  
ATOM 732  O O    . ARG A 1 13 ? 14.443  5.526   11.160 1.00 0.00 ? 13 ARG A O    2  
ATOM 733  C CB   . ARG A 1 13 ? 14.960  3.276   13.393 1.00 0.00 ? 13 ARG A CB   2  
ATOM 734  C CG   . ARG A 1 13 ? 14.719  2.055   14.266 1.00 0.00 ? 13 ARG A CG   2  
ATOM 735  C CD   . ARG A 1 13 ? 13.639  2.317   15.304 1.00 0.00 ? 13 ARG A CD   2  
ATOM 736  N NE   . ARG A 1 13 ? 13.415  1.158   16.164 1.00 0.00 ? 13 ARG A NE   2  
ATOM 737  C CZ   . ARG A 1 13 ? 12.693  1.199   17.279 1.00 0.00 ? 13 ARG A CZ   2  
ATOM 738  N NH1  . ARG A 1 13 ? 12.127  2.334   17.665 1.00 0.00 ? 13 ARG A NH1  2  
ATOM 739  N NH2  . ARG A 1 13 ? 12.535  0.102   18.008 1.00 0.00 ? 13 ARG A NH2  2  
ATOM 740  H H    . ARG A 1 13 ? 14.497  1.991   11.234 1.00 0.00 ? 13 ARG A H    2  
ATOM 741  H HA   . ARG A 1 13 ? 12.872  3.332   12.924 1.00 0.00 ? 13 ARG A HA   2  
ATOM 742  H HB2  . ARG A 1 13 ? 15.854  3.105   12.812 1.00 0.00 ? 13 ARG A HB2  2  
ATOM 743  H HB3  . ARG A 1 13 ? 15.116  4.128   14.038 1.00 0.00 ? 13 ARG A HB3  2  
ATOM 744  H HG2  . ARG A 1 13 ? 14.409  1.232   13.640 1.00 0.00 ? 13 ARG A HG2  2  
ATOM 745  H HG3  . ARG A 1 13 ? 15.638  1.800   14.772 1.00 0.00 ? 13 ARG A HG3  2  
ATOM 746  H HD2  . ARG A 1 13 ? 13.941  3.154   15.916 1.00 0.00 ? 13 ARG A HD2  2  
ATOM 747  H HD3  . ARG A 1 13 ? 12.719  2.558   14.793 1.00 0.00 ? 13 ARG A HD3  2  
ATOM 748  H HE   . ARG A 1 13 ? 13.824  0.309   15.897 1.00 0.00 ? 13 ARG A HE   2  
ATOM 749  H HH11 . ARG A 1 13 ? 12.244  3.162   17.117 1.00 0.00 ? 13 ARG A HH11 2  
ATOM 750  H HH12 . ARG A 1 13 ? 11.583  2.361   18.504 1.00 0.00 ? 13 ARG A HH12 2  
ATOM 751  H HH21 . ARG A 1 13 ? 12.959  -0.756  17.720 1.00 0.00 ? 13 ARG A HH21 2  
ATOM 752  H HH22 . ARG A 1 13 ? 11.991  0.133   18.847 1.00 0.00 ? 13 ARG A HH22 2  
ATOM 753  N N    . PRO A 1 14 ? 13.038  5.854   12.890 1.00 0.00 ? 14 PRO A N    2  
ATOM 754  C CA   . PRO A 1 14 ? 12.259  5.327   14.014 1.00 0.00 ? 14 PRO A CA   2  
ATOM 755  C C    . PRO A 1 14 ? 11.078  4.479   13.555 1.00 0.00 ? 14 PRO A C    2  
ATOM 756  O O    . PRO A 1 14 ? 10.190  4.156   14.343 1.00 0.00 ? 14 PRO A O    2  
ATOM 757  C CB   . PRO A 1 14 ? 11.766  6.589   14.727 1.00 0.00 ? 14 PRO A CB   2  
ATOM 758  C CG   . PRO A 1 14 ? 11.747  7.638   13.670 1.00 0.00 ? 14 PRO A CG   2  
ATOM 759  C CD   . PRO A 1 14 ? 12.884  7.311   12.742 1.00 0.00 ? 14 PRO A CD   2  
ATOM 760  H HA   . PRO A 1 14 ? 12.876  4.749   14.687 1.00 0.00 ? 14 PRO A HA   2  
ATOM 761  H HB2  . PRO A 1 14 ? 10.778  6.415   15.130 1.00 0.00 ? 14 PRO A HB2  2  
ATOM 762  H HB3  . PRO A 1 14 ? 12.447  6.845   15.525 1.00 0.00 ? 14 PRO A HB3  2  
ATOM 763  H HG2  . PRO A 1 14 ? 10.809  7.607   13.138 1.00 0.00 ? 14 PRO A HG2  2  
ATOM 764  H HG3  . PRO A 1 14 ? 11.896  8.611   14.116 1.00 0.00 ? 14 PRO A HG3  2  
ATOM 765  H HD2  . PRO A 1 14 ? 12.628  7.571   11.725 1.00 0.00 ? 14 PRO A HD2  2  
ATOM 766  H HD3  . PRO A 1 14 ? 13.783  7.826   13.050 1.00 0.00 ? 14 PRO A HD3  2  
ATOM 767  N N    . ASN A 1 15 ? 11.075  4.121   12.275 1.00 0.00 ? 15 ASN A N    2  
ATOM 768  C CA   . ASN A 1 15 ? 10.002  3.309   11.711 1.00 0.00 ? 15 ASN A CA   2  
ATOM 769  C C    . ASN A 1 15 ? 10.266  1.824   11.940 1.00 0.00 ? 15 ASN A C    2  
ATOM 770  O O    . ASN A 1 15 ? 11.412  1.376   11.920 1.00 0.00 ? 15 ASN A O    2  
ATOM 771  C CB   . ASN A 1 15 ? 9.858   3.588   10.213 1.00 0.00 ? 15 ASN A CB   2  
ATOM 772  C CG   . ASN A 1 15 ? 10.173  5.028   9.860  1.00 0.00 ? 15 ASN A CG   2  
ATOM 773  O OD1  . ASN A 1 15 ? 9.966   5.936   10.665 1.00 0.00 ? 15 ASN A OD1  2  
ATOM 774  N ND2  . ASN A 1 15 ? 10.677  5.244   8.650  1.00 0.00 ? 15 ASN A ND2  2  
ATOM 775  H H    . ASN A 1 15 ? 11.811  4.409   11.696 1.00 0.00 ? 15 ASN A H    2  
ATOM 776  H HA   . ASN A 1 15 ? 9.084   3.582   12.209 1.00 0.00 ? 15 ASN A HA   2  
ATOM 777  H HB2  . ASN A 1 15 ? 10.535  2.947   9.667  1.00 0.00 ? 15 ASN A HB2  2  
ATOM 778  H HB3  . ASN A 1 15 ? 8.844   3.375   9.910  1.00 0.00 ? 15 ASN A HB3  2  
ATOM 779  H HD21 . ASN A 1 15 ? 10.815  4.473   8.062  1.00 0.00 ? 15 ASN A HD21 2  
ATOM 780  H HD22 . ASN A 1 15 ? 10.890  6.166   8.396  1.00 0.00 ? 15 ASN A HD22 2  
ATOM 781  N N    . TYR A 1 16 ? 9.197   1.066   12.158 1.00 0.00 ? 16 TYR A N    2  
ATOM 782  C CA   . TYR A 1 16 ? 9.311   -0.368  12.393 1.00 0.00 ? 16 TYR A CA   2  
ATOM 783  C C    . TYR A 1 16 ? 8.149   -1.120  11.752 1.00 0.00 ? 16 TYR A C    2  
ATOM 784  O O    . TYR A 1 16 ? 7.290   -0.522  11.103 1.00 0.00 ? 16 TYR A O    2  
ATOM 785  C CB   . TYR A 1 16 ? 9.354   -0.658  13.895 1.00 0.00 ? 16 TYR A CB   2  
ATOM 786  C CG   . TYR A 1 16 ? 8.046   -0.385  14.602 1.00 0.00 ? 16 TYR A CG   2  
ATOM 787  C CD1  . TYR A 1 16 ? 7.193   -1.425  14.952 1.00 0.00 ? 16 TYR A CD1  2  
ATOM 788  C CD2  . TYR A 1 16 ? 7.662   0.912   14.919 1.00 0.00 ? 16 TYR A CD2  2  
ATOM 789  C CE1  . TYR A 1 16 ? 5.996   -1.181  15.597 1.00 0.00 ? 16 TYR A CE1  2  
ATOM 790  C CE2  . TYR A 1 16 ? 6.467   1.165   15.565 1.00 0.00 ? 16 TYR A CE2  2  
ATOM 791  C CZ   . TYR A 1 16 ? 5.638   0.115   15.902 1.00 0.00 ? 16 TYR A CZ   2  
ATOM 792  O OH   . TYR A 1 16 ? 4.447   0.364   16.545 1.00 0.00 ? 16 TYR A OH   2  
ATOM 793  H H    . TYR A 1 16 ? 8.309   1.482   12.163 1.00 0.00 ? 16 TYR A H    2  
ATOM 794  H HA   . TYR A 1 16 ? 10.235  -0.705  11.945 1.00 0.00 ? 16 TYR A HA   2  
ATOM 795  H HB2  . TYR A 1 16 ? 9.602   -1.697  14.047 1.00 0.00 ? 16 TYR A HB2  2  
ATOM 796  H HB3  . TYR A 1 16 ? 10.114  -0.041  14.352 1.00 0.00 ? 16 TYR A HB3  2  
ATOM 797  H HD1  . TYR A 1 16 ? 7.476   -2.440  14.711 1.00 0.00 ? 16 TYR A HD1  2  
ATOM 798  H HD2  . TYR A 1 16 ? 8.313   1.731   14.653 1.00 0.00 ? 16 TYR A HD2  2  
ATOM 799  H HE1  . TYR A 1 16 ? 5.347   -2.003  15.861 1.00 0.00 ? 16 TYR A HE1  2  
ATOM 800  H HE2  . TYR A 1 16 ? 6.187   2.180   15.804 1.00 0.00 ? 16 TYR A HE2  2  
ATOM 801  H HH   . TYR A 1 16 ? 4.065   1.178   16.208 1.00 0.00 ? 16 TYR A HH   2  
ATOM 802  N N    . CYS A 1 17 ? 8.130   -2.435  11.938 1.00 0.00 ? 17 CYS A N    2  
ATOM 803  C CA   . CYS A 1 17 ? 7.075   -3.272  11.379 1.00 0.00 ? 17 CYS A CA   2  
ATOM 804  C C    . CYS A 1 17 ? 5.859   -3.302  12.300 1.00 0.00 ? 17 CYS A C    2  
ATOM 805  O O    . CYS A 1 17 ? 5.992   -3.438  13.516 1.00 0.00 ? 17 CYS A O    2  
ATOM 806  C CB   . CYS A 1 17 ? 7.590   -4.694  11.149 1.00 0.00 ? 17 CYS A CB   2  
ATOM 807  S SG   . CYS A 1 17 ? 8.195   -5.002  9.459  1.00 0.00 ? 17 CYS A SG   2  
ATOM 808  H H    . CYS A 1 17 ? 8.843   -2.855  12.465 1.00 0.00 ? 17 CYS A H    2  
ATOM 809  H HA   . CYS A 1 17 ? 6.782   -2.847  10.431 1.00 0.00 ? 17 CYS A HA   2  
ATOM 810  H HB2  . CYS A 1 17 ? 8.407   -4.887  11.830 1.00 0.00 ? 17 CYS A HB2  2  
ATOM 811  H HB3  . CYS A 1 17 ? 6.792   -5.394  11.346 1.00 0.00 ? 17 CYS A HB3  2  
ATOM 812  N N    . GLU A 1 18 ? 4.674   -3.175  11.711 1.00 0.00 ? 18 GLU A N    2  
ATOM 813  C CA   . GLU A 1 18 ? 3.434   -3.187  12.479 1.00 0.00 ? 18 GLU A CA   2  
ATOM 814  C C    . GLU A 1 18 ? 2.306   -3.833  11.681 1.00 0.00 ? 18 GLU A C    2  
ATOM 815  O O    . GLU A 1 18 ? 1.739   -3.219  10.778 1.00 0.00 ? 18 GLU A O    2  
ATOM 816  C CB   . GLU A 1 18 ? 3.041   -1.763  12.878 1.00 0.00 ? 18 GLU A CB   2  
ATOM 817  C CG   . GLU A 1 18 ? 2.008   -1.706  13.991 1.00 0.00 ? 18 GLU A CG   2  
ATOM 818  C CD   . GLU A 1 18 ? 1.978   -2.973  14.824 1.00 0.00 ? 18 GLU A CD   2  
ATOM 819  O OE1  . GLU A 1 18 ? 3.011   -3.298  15.447 1.00 0.00 ? 18 GLU A OE1  2  
ATOM 820  O OE2  . GLU A 1 18 ? 0.922   -3.639  14.854 1.00 0.00 ? 18 GLU A OE2  2  
ATOM 821  H H    . GLU A 1 18 ? 4.632   -3.069  10.738 1.00 0.00 ? 18 GLU A H    2  
ATOM 822  H HA   . GLU A 1 18 ? 3.604   -3.768  13.374 1.00 0.00 ? 18 GLU A HA   2  
ATOM 823  H HB2  . GLU A 1 18 ? 3.925   -1.238  13.208 1.00 0.00 ? 18 GLU A HB2  2  
ATOM 824  H HB3  . GLU A 1 18 ? 2.635   -1.260  12.013 1.00 0.00 ? 18 GLU A HB3  2  
ATOM 825  H HG2  . GLU A 1 18 ? 2.241   -0.874  14.639 1.00 0.00 ? 18 GLU A HG2  2  
ATOM 826  H HG3  . GLU A 1 18 ? 1.033   -1.558  13.553 1.00 0.00 ? 18 GLU A HG3  2  
ATOM 827  N N    . GLY A 1 19 ? 1.986   -5.078  12.021 1.00 0.00 ? 19 GLY A N    2  
ATOM 828  C CA   . GLY A 1 19 ? 0.927   -5.788  11.326 1.00 0.00 ? 19 GLY A CA   2  
ATOM 829  C C    . GLY A 1 19 ? -0.410  -5.667  12.030 1.00 0.00 ? 19 GLY A C    2  
ATOM 830  O O    . GLY A 1 19 ? -1.339  -6.422  11.744 1.00 0.00 ? 19 GLY A O    2  
ATOM 831  H H    . GLY A 1 19 ? 2.472   -5.519  12.749 1.00 0.00 ? 19 GLY A H    2  
ATOM 832  H HA2  . GLY A 1 19 ? 0.835   -5.387  10.328 1.00 0.00 ? 19 GLY A HA2  2  
ATOM 833  H HA3  . GLY A 1 19 ? 1.193   -6.833  11.261 1.00 0.00 ? 19 GLY A HA3  2  
ATOM 834  N N    . ALA A 1 20 ? -0.508  -4.716  12.952 1.00 0.00 ? 20 ALA A N    2  
ATOM 835  C CA   . ALA A 1 20 ? -1.741  -4.498  13.698 1.00 0.00 ? 20 ALA A CA   2  
ATOM 836  C C    . ALA A 1 20 ? -2.011  -3.010  13.891 1.00 0.00 ? 20 ALA A C    2  
ATOM 837  O O    . ALA A 1 20 ? -2.847  -2.427  13.201 1.00 0.00 ? 20 ALA A O    2  
ATOM 838  C CB   . ALA A 1 20 ? -1.675  -5.204  15.045 1.00 0.00 ? 20 ALA A CB   2  
ATOM 839  H H    . ALA A 1 20 ? 0.268   -4.145  13.135 1.00 0.00 ? 20 ALA A H    2  
ATOM 840  H HA   . ALA A 1 20 ? -2.554  -4.931  13.132 1.00 0.00 ? 20 ALA A HA   2  
ATOM 841  H HB1  . ALA A 1 20 ? -2.304  -6.082  15.021 1.00 0.00 ? 20 ALA A HB1  2  
ATOM 842  H HB2  . ALA A 1 20 ? -0.656  -5.496  15.248 1.00 0.00 ? 20 ALA A HB2  2  
ATOM 843  H HB3  . ALA A 1 20 ? -2.019  -4.534  15.819 1.00 0.00 ? 20 ALA A HB3  2  
ATOM 844  N N    . ARG A 1 21 ? -1.299  -2.402  14.834 1.00 0.00 ? 21 ARG A N    2  
ATOM 845  C CA   . ARG A 1 21 ? -1.464  -0.981  15.119 1.00 0.00 ? 21 ARG A CA   2  
ATOM 846  C C    . ARG A 1 21 ? -0.210  -0.409  15.775 1.00 0.00 ? 21 ARG A C    2  
ATOM 847  O O    . ARG A 1 21 ? 0.436   -1.073  16.586 1.00 0.00 ? 21 ARG A O    2  
ATOM 848  C CB   . ARG A 1 21 ? -2.675  -0.759  16.027 1.00 0.00 ? 21 ARG A CB   2  
ATOM 849  C CG   . ARG A 1 21 ? -3.759  0.099   15.396 1.00 0.00 ? 21 ARG A CG   2  
ATOM 850  C CD   . ARG A 1 21 ? -4.309  1.116   16.384 1.00 0.00 ? 21 ARG A CD   2  
ATOM 851  N NE   . ARG A 1 21 ? -3.789  2.458   16.135 1.00 0.00 ? 21 ARG A NE   2  
ATOM 852  C CZ   . ARG A 1 21 ? -4.206  3.235   15.141 1.00 0.00 ? 21 ARG A CZ   2  
ATOM 853  N NH1  . ARG A 1 21 ? -5.144  2.806   14.309 1.00 0.00 ? 21 ARG A NH1  2  
ATOM 854  N NH2  . ARG A 1 21 ? -3.684  4.444   14.980 1.00 0.00 ? 21 ARG A NH2  2  
ATOM 855  H H    . ARG A 1 21 ? -0.648  -2.920  15.351 1.00 0.00 ? 21 ARG A H    2  
ATOM 856  H HA   . ARG A 1 21 ? -1.630  -0.472  14.181 1.00 0.00 ? 21 ARG A HA   2  
ATOM 857  H HB2  . ARG A 1 21 ? -3.105  -1.718  16.276 1.00 0.00 ? 21 ARG A HB2  2  
ATOM 858  H HB3  . ARG A 1 21 ? -2.345  -0.275  16.934 1.00 0.00 ? 21 ARG A HB3  2  
ATOM 859  H HG2  . ARG A 1 21 ? -3.343  0.625   14.550 1.00 0.00 ? 21 ARG A HG2  2  
ATOM 860  H HG3  . ARG A 1 21 ? -4.564  -0.540  15.065 1.00 0.00 ? 21 ARG A HG3  2  
ATOM 861  H HD2  . ARG A 1 21 ? -5.386  1.136   16.298 1.00 0.00 ? 21 ARG A HD2  2  
ATOM 862  H HD3  . ARG A 1 21 ? -4.034  0.813   17.383 1.00 0.00 ? 21 ARG A HD3  2  
ATOM 863  H HE   . ARG A 1 21 ? -3.095  2.795   16.738 1.00 0.00 ? 21 ARG A HE   2  
ATOM 864  H HH11 . ARG A 1 21 ? -5.540  1.896   14.429 1.00 0.00 ? 21 ARG A HH11 2  
ATOM 865  H HH12 . ARG A 1 21 ? -5.457  3.394   13.562 1.00 0.00 ? 21 ARG A HH12 2  
ATOM 866  H HH21 . ARG A 1 21 ? -2.976  4.771   15.606 1.00 0.00 ? 21 ARG A HH21 2  
ATOM 867  H HH22 . ARG A 1 21 ? -3.998  5.028   14.232 1.00 0.00 ? 21 ARG A HH22 2  
ATOM 868  N N    . CYS A 1 22 ? 0.127   0.825   15.418 1.00 0.00 ? 22 CYS A N    2  
ATOM 869  C CA   . CYS A 1 22 ? 1.303   1.487   15.970 1.00 0.00 ? 22 CYS A CA   2  
ATOM 870  C C    . CYS A 1 22 ? 1.159   1.683   17.476 1.00 0.00 ? 22 CYS A C    2  
ATOM 871  O O    . CYS A 1 22 ? 0.053   1.651   18.013 1.00 0.00 ? 22 CYS A O    2  
ATOM 872  C CB   . CYS A 1 22 ? 1.521   2.838   15.287 1.00 0.00 ? 22 CYS A CB   2  
ATOM 873  S SG   . CYS A 1 22 ? 1.533   2.758   13.467 1.00 0.00 ? 22 CYS A SG   2  
ATOM 874  H H    . CYS A 1 22 ? -0.428  1.304   14.766 1.00 0.00 ? 22 CYS A H    2  
ATOM 875  H HA   . CYS A 1 22 ? 2.158   0.856   15.781 1.00 0.00 ? 22 CYS A HA   2  
ATOM 876  H HB2  . CYS A 1 22 ? 0.730   3.513   15.580 1.00 0.00 ? 22 CYS A HB2  2  
ATOM 877  H HB3  . CYS A 1 22 ? 2.470   3.245   15.605 1.00 0.00 ? 22 CYS A HB3  2  
ATOM 878  N N    . GLU A 1 23 ? 2.286   1.888   18.151 1.00 0.00 ? 23 GLU A N    2  
ATOM 879  C CA   . GLU A 1 23 ? 2.286   2.089   19.595 1.00 0.00 ? 23 GLU A CA   2  
ATOM 880  C C    . GLU A 1 23 ? 1.799   3.491   19.949 1.00 0.00 ? 23 GLU A C    2  
ATOM 881  O O    . GLU A 1 23 ? 1.620   4.337   19.073 1.00 0.00 ? 23 GLU A O    2  
ATOM 882  C CB   . GLU A 1 23 ? 3.688   1.865   20.164 1.00 0.00 ? 23 GLU A CB   2  
ATOM 883  C CG   . GLU A 1 23 ? 4.245   0.479   19.885 1.00 0.00 ? 23 GLU A CG   2  
ATOM 884  C CD   . GLU A 1 23 ? 5.044   -0.074  21.049 1.00 0.00 ? 23 GLU A CD   2  
ATOM 885  O OE1  . GLU A 1 23 ? 5.135   -1.313  21.169 1.00 0.00 ? 23 GLU A OE1  2  
ATOM 886  O OE2  . GLU A 1 23 ? 5.579   0.732   21.839 1.00 0.00 ? 23 GLU A OE2  2  
ATOM 887  H H    . GLU A 1 23 ? 3.138   1.903   17.666 1.00 0.00 ? 23 GLU A H    2  
ATOM 888  H HA   . GLU A 1 23 ? 1.612   1.366   20.030 1.00 0.00 ? 23 GLU A HA   2  
ATOM 889  H HB2  . GLU A 1 23 ? 4.359   2.594   19.734 1.00 0.00 ? 23 GLU A HB2  2  
ATOM 890  H HB3  . GLU A 1 23 ? 3.656   2.008   21.234 1.00 0.00 ? 23 GLU A HB3  2  
ATOM 891  H HG2  . GLU A 1 23 ? 3.423   -0.191  19.682 1.00 0.00 ? 23 GLU A HG2  2  
ATOM 892  H HG3  . GLU A 1 23 ? 4.888   0.532   19.018 1.00 0.00 ? 23 GLU A HG3  2  
ATOM 893  N N    . SER A 1 24 ? 1.585   3.729   21.239 1.00 0.00 ? 24 SER A N    2  
ATOM 894  C CA   . SER A 1 24 ? 1.114   5.026   21.710 1.00 0.00 ? 24 SER A CA   2  
ATOM 895  C C    . SER A 1 24 ? 2.212   6.079   21.589 1.00 0.00 ? 24 SER A C    2  
ATOM 896  O O    . SER A 1 24 ? 2.359   6.941   22.455 1.00 0.00 ? 24 SER A O    2  
ATOM 897  C CB   . SER A 1 24 ? 0.645   4.926   23.162 1.00 0.00 ? 24 SER A CB   2  
ATOM 898  O OG   . SER A 1 24 ? -0.724  5.273   23.281 1.00 0.00 ? 24 SER A OG   2  
ATOM 899  H H    . SER A 1 24 ? 1.745   3.013   21.890 1.00 0.00 ? 24 SER A H    2  
ATOM 900  H HA   . SER A 1 24 ? 0.280   5.321   21.090 1.00 0.00 ? 24 SER A HA   2  
ATOM 901  H HB2  . SER A 1 24 ? 0.779   3.914   23.512 1.00 0.00 ? 24 SER A HB2  2  
ATOM 902  H HB3  . SER A 1 24 ? 1.229   5.599   23.773 1.00 0.00 ? 24 SER A HB3  2  
ATOM 903  H HG   . SER A 1 24 ? -0.849  6.184   23.005 1.00 0.00 ? 24 SER A HG   2  
ATOM 904  N N    . GLY A 1 25 ? 2.982   6.001   20.508 1.00 0.00 ? 25 GLY A N    2  
ATOM 905  C CA   . GLY A 1 25 ? 4.057   6.952   20.293 1.00 0.00 ? 25 GLY A CA   2  
ATOM 906  C C    . GLY A 1 25 ? 4.571   6.932   18.867 1.00 0.00 ? 25 GLY A C    2  
ATOM 907  O O    . GLY A 1 25 ? 5.637   7.476   18.576 1.00 0.00 ? 25 GLY A O    2  
ATOM 908  H H    . GLY A 1 25 ? 2.818   5.292   19.851 1.00 0.00 ? 25 GLY A H    2  
ATOM 909  H HA2  . GLY A 1 25 ? 3.697   7.944   20.521 1.00 0.00 ? 25 GLY A HA2  2  
ATOM 910  H HA3  . GLY A 1 25 ? 4.872   6.713   20.960 1.00 0.00 ? 25 GLY A HA3  2  
ATOM 911  N N    . PHE A 1 26 ? 3.814   6.303   17.975 1.00 0.00 ? 26 PHE A N    2  
ATOM 912  C CA   . PHE A 1 26 ? 4.201   6.212   16.572 1.00 0.00 ? 26 PHE A CA   2  
ATOM 913  C C    . PHE A 1 26 ? 3.017   6.523   15.660 1.00 0.00 ? 26 PHE A C    2  
ATOM 914  O O    . PHE A 1 26 ? 1.906   6.772   16.129 1.00 0.00 ? 26 PHE A O    2  
ATOM 915  C CB   . PHE A 1 26 ? 4.746   4.817   16.260 1.00 0.00 ? 26 PHE A CB   2  
ATOM 916  C CG   . PHE A 1 26 ? 6.009   4.487   17.004 1.00 0.00 ? 26 PHE A CG   2  
ATOM 917  C CD1  . PHE A 1 26 ? 7.185   4.230   16.319 1.00 0.00 ? 26 PHE A CD1  2  
ATOM 918  C CD2  . PHE A 1 26 ? 6.019   4.434   18.388 1.00 0.00 ? 26 PHE A CD2  2  
ATOM 919  C CE1  . PHE A 1 26 ? 8.349   3.927   17.000 1.00 0.00 ? 26 PHE A CE1  2  
ATOM 920  C CE2  . PHE A 1 26 ? 7.179   4.131   19.075 1.00 0.00 ? 26 PHE A CE2  2  
ATOM 921  C CZ   . PHE A 1 26 ? 8.345   3.876   18.380 1.00 0.00 ? 26 PHE A CZ   2  
ATOM 922  H H    . PHE A 1 26 ? 2.975   5.889   18.267 1.00 0.00 ? 26 PHE A H    2  
ATOM 923  H HA   . PHE A 1 26 ? 4.977   6.941   16.395 1.00 0.00 ? 26 PHE A HA   2  
ATOM 924  H HB2  . PHE A 1 26 ? 4.003   4.080   16.526 1.00 0.00 ? 26 PHE A HB2  2  
ATOM 925  H HB3  . PHE A 1 26 ? 4.954   4.748   15.203 1.00 0.00 ? 26 PHE A HB3  2  
ATOM 926  H HD1  . PHE A 1 26 ? 7.189   4.269   15.238 1.00 0.00 ? 26 PHE A HD1  2  
ATOM 927  H HD2  . PHE A 1 26 ? 5.107   4.632   18.933 1.00 0.00 ? 26 PHE A HD2  2  
ATOM 928  H HE1  . PHE A 1 26 ? 9.259   3.728   16.453 1.00 0.00 ? 26 PHE A HE1  2  
ATOM 929  H HE2  . PHE A 1 26 ? 7.174   4.092   20.154 1.00 0.00 ? 26 PHE A HE2  2  
ATOM 930  H HZ   . PHE A 1 26 ? 9.253   3.640   18.914 1.00 0.00 ? 26 PHE A HZ   2  
ATOM 931  N N    . HIS A 1 27 ? 3.264   6.507   14.354 1.00 0.00 ? 27 HIS A N    2  
ATOM 932  C CA   . HIS A 1 27 ? 2.219   6.788   13.375 1.00 0.00 ? 27 HIS A CA   2  
ATOM 933  C C    . HIS A 1 27 ? 2.299   5.816   12.202 1.00 0.00 ? 27 HIS A C    2  
ATOM 934  O O    . HIS A 1 27 ? 3.363   5.623   11.614 1.00 0.00 ? 27 HIS A O    2  
ATOM 935  C CB   . HIS A 1 27 ? 2.336   8.226   12.870 1.00 0.00 ? 27 HIS A CB   2  
ATOM 936  C CG   . HIS A 1 27 ? 3.749   8.716   12.782 1.00 0.00 ? 27 HIS A CG   2  
ATOM 937  N ND1  . HIS A 1 27 ? 4.360   9.435   13.787 1.00 0.00 ? 27 HIS A ND1  2  
ATOM 938  C CD2  . HIS A 1 27 ? 4.672   8.586   11.800 1.00 0.00 ? 27 HIS A CD2  2  
ATOM 939  C CE1  . HIS A 1 27 ? 5.597   9.727   13.427 1.00 0.00 ? 27 HIS A CE1  2  
ATOM 940  N NE2  . HIS A 1 27 ? 5.811   9.223   12.225 1.00 0.00 ? 27 HIS A NE2  2  
ATOM 941  H H    . HIS A 1 27 ? 4.169   6.302   14.041 1.00 0.00 ? 27 HIS A H    2  
ATOM 942  H HA   . HIS A 1 27 ? 1.265   6.664   13.864 1.00 0.00 ? 27 HIS A HA   2  
ATOM 943  H HB2  . HIS A 1 27 ? 1.901   8.291   11.884 1.00 0.00 ? 27 HIS A HB2  2  
ATOM 944  H HB3  . HIS A 1 27 ? 1.798   8.881   13.540 1.00 0.00 ? 27 HIS A HB3  2  
ATOM 945  H HD1  . HIS A 1 27 ? 3.948   9.694   14.637 1.00 0.00 ? 27 HIS A HD1  2  
ATOM 946  H HD2  . HIS A 1 27 ? 4.537   8.076   10.857 1.00 0.00 ? 27 HIS A HD2  2  
ATOM 947  H HE1  . HIS A 1 27 ? 6.312   10.283  14.015 1.00 0.00 ? 27 HIS A HE1  2  
ATOM 948  N N    . ASP A 1 28 ? 1.167   5.206   11.867 1.00 0.00 ? 28 ASP A N    2  
ATOM 949  C CA   . ASP A 1 28 ? 1.109   4.254   10.764 1.00 0.00 ? 28 ASP A CA   2  
ATOM 950  C C    . ASP A 1 28 ? 1.544   4.909   9.457  1.00 0.00 ? 28 ASP A C    2  
ATOM 951  O O    . ASP A 1 28 ? 0.888   5.825   8.960  1.00 0.00 ? 28 ASP A O    2  
ATOM 952  C CB   . ASP A 1 28 ? -0.307  3.693   10.621 1.00 0.00 ? 28 ASP A CB   2  
ATOM 953  C CG   . ASP A 1 28 ? -0.533  3.028   9.277  1.00 0.00 ? 28 ASP A CG   2  
ATOM 954  O OD1  . ASP A 1 28 ? 0.063   1.957   9.037  1.00 0.00 ? 28 ASP A OD1  2  
ATOM 955  O OD2  . ASP A 1 28 ? -1.306  3.579   8.466  1.00 0.00 ? 28 ASP A OD2  2  
ATOM 956  H H    . ASP A 1 28 ? 0.351   5.401   12.374 1.00 0.00 ? 28 ASP A H    2  
ATOM 957  H HA   . ASP A 1 28 ? 1.786   3.444   10.989 1.00 0.00 ? 28 ASP A HA   2  
ATOM 958  H HB2  . ASP A 1 28 ? -0.477  2.960   11.397 1.00 0.00 ? 28 ASP A HB2  2  
ATOM 959  H HB3  . ASP A 1 28 ? -1.019  4.498   10.729 1.00 0.00 ? 28 ASP A HB3  2  
ATOM 960  N N    . CYS A 1 29 ? 2.657   4.435   8.906  1.00 0.00 ? 29 CYS A N    2  
ATOM 961  C CA   . CYS A 1 29 ? 3.182   4.976   7.658  1.00 0.00 ? 29 CYS A CA   2  
ATOM 962  C C    . CYS A 1 29 ? 3.223   3.901   6.575  1.00 0.00 ? 29 CYS A C    2  
ATOM 963  O O    . CYS A 1 29 ? 4.015   3.981   5.637  1.00 0.00 ? 29 CYS A O    2  
ATOM 964  C CB   . CYS A 1 29 ? 4.583   5.549   7.876  1.00 0.00 ? 29 CYS A CB   2  
ATOM 965  S SG   . CYS A 1 29 ? 5.705   4.444   8.792  1.00 0.00 ? 29 CYS A SG   2  
ATOM 966  H H    . CYS A 1 29 ? 3.137   3.704   9.349  1.00 0.00 ? 29 CYS A H    2  
ATOM 967  H HA   . CYS A 1 29 ? 2.524   5.768   7.336  1.00 0.00 ? 29 CYS A HA   2  
ATOM 968  H HB2  . CYS A 1 29 ? 5.035   5.752   6.915  1.00 0.00 ? 29 CYS A HB2  2  
ATOM 969  H HB3  . CYS A 1 29 ? 4.504   6.472   8.432  1.00 0.00 ? 29 CYS A HB3  2  
ATOM 970  N N    . GLY A 1 30 ? 2.363   2.896   6.712  1.00 0.00 ? 30 GLY A N    2  
ATOM 971  C CA   . GLY A 1 30 ? 2.317   1.821   5.739  1.00 0.00 ? 30 GLY A CA   2  
ATOM 972  C C    . GLY A 1 30 ? 2.147   2.328   4.321  1.00 0.00 ? 30 GLY A C    2  
ATOM 973  O O    . GLY A 1 30 ? 2.338   1.583   3.361  1.00 0.00 ? 30 GLY A O    2  
ATOM 974  H H    . GLY A 1 30 ? 1.755   2.886   7.481  1.00 0.00 ? 30 GLY A H    2  
ATOM 975  H HA2  . GLY A 1 30 ? 3.235   1.255   5.801  1.00 0.00 ? 30 GLY A HA2  2  
ATOM 976  H HA3  . GLY A 1 30 ? 1.489   1.170   5.978  1.00 0.00 ? 30 GLY A HA3  2  
ATOM 977  N N    . SER A 1 31 ? 1.786   3.601   4.189  1.00 0.00 ? 31 SER A N    2  
ATOM 978  C CA   . SER A 1 31 ? 1.584   4.206   2.878  1.00 0.00 ? 31 SER A CA   2  
ATOM 979  C C    . SER A 1 31 ? 2.697   3.801   1.916  1.00 0.00 ? 31 SER A C    2  
ATOM 980  O O    . SER A 1 31 ? 2.493   2.978   1.024  1.00 0.00 ? 31 SER A O    2  
ATOM 981  C CB   . SER A 1 31 ? 1.529   5.730   2.999  1.00 0.00 ? 31 SER A CB   2  
ATOM 982  O OG   . SER A 1 31 ? 2.655   6.227   3.701  1.00 0.00 ? 31 SER A OG   2  
ATOM 983  H H    . SER A 1 31 ? 1.649   4.144   4.993  1.00 0.00 ? 31 SER A H    2  
ATOM 984  H HA   . SER A 1 31 ? 0.642   3.850   2.490  1.00 0.00 ? 31 SER A HA   2  
ATOM 985  H HB2  . SER A 1 31 ? 1.513   6.167   2.013  1.00 0.00 ? 31 SER A HB2  2  
ATOM 986  H HB3  . SER A 1 31 ? 0.633   6.013   3.533  1.00 0.00 ? 31 SER A HB3  2  
ATOM 987  H HG   . SER A 1 31 ? 2.476   6.217   4.644  1.00 0.00 ? 31 SER A HG   2  
ATOM 988  N N    . ASP A 1 32 ? 3.875   4.387   2.104  1.00 0.00 ? 32 ASP A N    2  
ATOM 989  C CA   . ASP A 1 32 ? 5.022   4.088   1.255  1.00 0.00 ? 32 ASP A CA   2  
ATOM 990  C C    . ASP A 1 32 ? 6.044   3.237   2.002  1.00 0.00 ? 32 ASP A C    2  
ATOM 991  O O    . ASP A 1 32 ? 7.247   3.333   1.755  1.00 0.00 ? 32 ASP A O    2  
ATOM 992  C CB   . ASP A 1 32 ? 5.675   5.382   0.769  1.00 0.00 ? 32 ASP A CB   2  
ATOM 993  C CG   . ASP A 1 32 ? 5.599   6.492   1.799  1.00 0.00 ? 32 ASP A CG   2  
ATOM 994  O OD1  . ASP A 1 32 ? 4.578   7.211   1.823  1.00 0.00 ? 32 ASP A OD1  2  
ATOM 995  O OD2  . ASP A 1 32 ? 6.559   6.640   2.583  1.00 0.00 ? 32 ASP A OD2  2  
ATOM 996  H H    . ASP A 1 32 ? 3.975   5.035   2.833  1.00 0.00 ? 32 ASP A H    2  
ATOM 997  H HA   . ASP A 1 32 ? 4.666   3.532   0.401  1.00 0.00 ? 32 ASP A HA   2  
ATOM 998  H HB2  . ASP A 1 32 ? 6.716   5.192   0.548  1.00 0.00 ? 32 ASP A HB2  2  
ATOM 999  H HB3  . ASP A 1 32 ? 5.176   5.714   -0.129 1.00 0.00 ? 32 ASP A HB3  2  
ATOM 1000 N N    . HIS A 1 33 ? 5.558   2.406   2.919  1.00 0.00 ? 33 HIS A N    2  
ATOM 1001 C CA   . HIS A 1 33 ? 6.430   1.538   3.703  1.00 0.00 ? 33 HIS A CA   2  
ATOM 1002 C C    . HIS A 1 33 ? 5.741   0.213   4.014  1.00 0.00 ? 33 HIS A C    2  
ATOM 1003 O O    . HIS A 1 33 ? 4.722   0.179   4.705  1.00 0.00 ? 33 HIS A O    2  
ATOM 1004 C CB   . HIS A 1 33 ? 6.838   2.231   5.003  1.00 0.00 ? 33 HIS A CB   2  
ATOM 1005 C CG   . HIS A 1 33 ? 7.513   3.552   4.792  1.00 0.00 ? 33 HIS A CG   2  
ATOM 1006 N ND1  . HIS A 1 33 ? 7.139   4.702   5.454  1.00 0.00 ? 33 HIS A ND1  2  
ATOM 1007 C CD2  . HIS A 1 33 ? 8.545   3.900   3.988  1.00 0.00 ? 33 HIS A CD2  2  
ATOM 1008 C CE1  . HIS A 1 33 ? 7.911   5.702   5.064  1.00 0.00 ? 33 HIS A CE1  2  
ATOM 1009 N NE2  . HIS A 1 33 ? 8.772   5.241   4.176  1.00 0.00 ? 33 HIS A NE2  2  
ATOM 1010 H H    . HIS A 1 33 ? 4.591   2.375   3.071  1.00 0.00 ? 33 HIS A H    2  
ATOM 1011 H HA   . HIS A 1 33 ? 7.315   1.341   3.118  1.00 0.00 ? 33 HIS A HA   2  
ATOM 1012 H HB2  . HIS A 1 33 ? 5.958   2.402   5.605  1.00 0.00 ? 33 HIS A HB2  2  
ATOM 1013 H HB3  . HIS A 1 33 ? 7.520   1.592   5.546  1.00 0.00 ? 33 HIS A HB3  2  
ATOM 1014 H HD1  . HIS A 1 33 ? 6.415   4.776   6.109  1.00 0.00 ? 33 HIS A HD1  2  
ATOM 1015 H HD2  . HIS A 1 33 ? 9.089   3.245   3.322  1.00 0.00 ? 33 HIS A HD2  2  
ATOM 1016 H HE1  . HIS A 1 33 ? 7.848   6.722   5.413  1.00 0.00 ? 33 HIS A HE1  2  
ATOM 1017 N N    . TRP A 1 34 ? 6.302   -0.875  3.499  1.00 0.00 ? 34 TRP A N    2  
ATOM 1018 C CA   . TRP A 1 34 ? 5.741   -2.202  3.721  1.00 0.00 ? 34 TRP A CA   2  
ATOM 1019 C C    . TRP A 1 34 ? 6.716   -3.083  4.494  1.00 0.00 ? 34 TRP A C    2  
ATOM 1020 O O    . TRP A 1 34 ? 7.900   -2.766  4.607  1.00 0.00 ? 34 TRP A O    2  
ATOM 1021 C CB   . TRP A 1 34 ? 5.389   -2.860  2.386  1.00 0.00 ? 34 TRP A CB   2  
ATOM 1022 C CG   . TRP A 1 34 ? 6.290   -2.444  1.263  1.00 0.00 ? 34 TRP A CG   2  
ATOM 1023 C CD1  . TRP A 1 34 ? 5.943   -1.716  0.161  1.00 0.00 ? 34 TRP A CD1  2  
ATOM 1024 C CD2  . TRP A 1 34 ? 7.686   -2.732  1.133  1.00 0.00 ? 34 TRP A CD2  2  
ATOM 1025 N NE1  . TRP A 1 34 ? 7.040   -1.535  -0.647 1.00 0.00 ? 34 TRP A NE1  2  
ATOM 1026 C CE2  . TRP A 1 34 ? 8.122   -2.148  -0.072 1.00 0.00 ? 34 TRP A CE2  2  
ATOM 1027 C CE3  . TRP A 1 34 ? 8.611   -3.425  1.919  1.00 0.00 ? 34 TRP A CE3  2  
ATOM 1028 C CZ2  . TRP A 1 34 ? 9.441   -2.239  -0.509 1.00 0.00 ? 34 TRP A CZ2  2  
ATOM 1029 C CZ3  . TRP A 1 34 ? 9.920   -3.514  1.484  1.00 0.00 ? 34 TRP A CZ3  2  
ATOM 1030 C CH2  . TRP A 1 34 ? 10.325  -2.923  0.280  1.00 0.00 ? 34 TRP A CH2  2  
ATOM 1031 H H    . TRP A 1 34 ? 7.114   -0.784  2.957  1.00 0.00 ? 34 TRP A H    2  
ATOM 1032 H HA   . TRP A 1 34 ? 4.839   -2.086  4.304  1.00 0.00 ? 34 TRP A HA   2  
ATOM 1033 H HB2  . TRP A 1 34 ? 5.459   -3.932  2.490  1.00 0.00 ? 34 TRP A HB2  2  
ATOM 1034 H HB3  . TRP A 1 34 ? 4.376   -2.593  2.118  1.00 0.00 ? 34 TRP A HB3  2  
ATOM 1035 H HD1  . TRP A 1 34 ? 4.949   -1.346  -0.036 1.00 0.00 ? 34 TRP A HD1  2  
ATOM 1036 H HE1  . TRP A 1 34 ? 7.047   -1.045  -1.496 1.00 0.00 ? 34 TRP A HE1  2  
ATOM 1037 H HE3  . TRP A 1 34 ? 8.318   -3.888  2.850  1.00 0.00 ? 34 TRP A HE3  2  
ATOM 1038 H HZ2  . TRP A 1 34 ? 9.769   -1.788  -1.434 1.00 0.00 ? 34 TRP A HZ2  2  
ATOM 1039 H HZ3  . TRP A 1 34 ? 10.649  -4.046  2.078  1.00 0.00 ? 34 TRP A HZ3  2  
ATOM 1040 H HH2  . TRP A 1 34 ? 11.357  -3.018  -0.020 1.00 0.00 ? 34 TRP A HH2  2  
ATOM 1041 N N    . CYS A 1 35 ? 6.211   -4.192  5.026  1.00 0.00 ? 35 CYS A N    2  
ATOM 1042 C CA   . CYS A 1 35 ? 7.038   -5.119  5.789  1.00 0.00 ? 35 CYS A CA   2  
ATOM 1043 C C    . CYS A 1 35 ? 7.418   -6.331  4.944  1.00 0.00 ? 35 CYS A C    2  
ATOM 1044 O O    . CYS A 1 35 ? 6.940   -6.492  3.821  1.00 0.00 ? 35 CYS A O    2  
ATOM 1045 C CB   . CYS A 1 35 ? 6.299   -5.574  7.050  1.00 0.00 ? 35 CYS A CB   2  
ATOM 1046 S SG   . CYS A 1 35 ? 6.433   -4.415  8.449  1.00 0.00 ? 35 CYS A SG   2  
ATOM 1047 H H    . CYS A 1 35 ? 5.259   -4.391  4.903  1.00 0.00 ? 35 CYS A H    2  
ATOM 1048 H HA   . CYS A 1 35 ? 7.939   -4.600  6.078  1.00 0.00 ? 35 CYS A HA   2  
ATOM 1049 H HB2  . CYS A 1 35 ? 5.250   -5.691  6.821  1.00 0.00 ? 35 CYS A HB2  2  
ATOM 1050 H HB3  . CYS A 1 35 ? 6.701   -6.524  7.370  1.00 0.00 ? 35 CYS A HB3  2  
ATOM 1051 N N    . ASP A 1 36 ? 8.279   -7.181  5.492  1.00 0.00 ? 36 ASP A N    2  
ATOM 1052 C CA   . ASP A 1 36 ? 8.723   -8.380  4.789  1.00 0.00 ? 36 ASP A CA   2  
ATOM 1053 C C    . ASP A 1 36 ? 7.533   -9.152  4.227  1.00 0.00 ? 36 ASP A C    2  
ATOM 1054 O O    . ASP A 1 36 ? 7.595   -9.687  3.121  1.00 0.00 ? 36 ASP A O    2  
ATOM 1055 C CB   . ASP A 1 36 ? 9.532   -9.277  5.728  1.00 0.00 ? 36 ASP A CB   2  
ATOM 1056 C CG   . ASP A 1 36 ? 11.002  -8.907  5.757  1.00 0.00 ? 36 ASP A CG   2  
ATOM 1057 O OD1  . ASP A 1 36 ? 11.791  -9.555  5.038  1.00 0.00 ? 36 ASP A OD1  2  
ATOM 1058 O OD2  . ASP A 1 36 ? 11.363  -7.970  6.499  1.00 0.00 ? 36 ASP A OD2  2  
ATOM 1059 H H    . ASP A 1 36 ? 8.625   -6.998  6.391  1.00 0.00 ? 36 ASP A H    2  
ATOM 1060 H HA   . ASP A 1 36 ? 9.354   -8.070  3.970  1.00 0.00 ? 36 ASP A HA   2  
ATOM 1061 H HB2  . ASP A 1 36 ? 9.137   -9.187  6.730  1.00 0.00 ? 36 ASP A HB2  2  
ATOM 1062 H HB3  . ASP A 1 36 ? 9.443   -10.302 5.400  1.00 0.00 ? 36 ASP A HB3  2  
ATOM 1063 N N    . ALA A 1 37 ? 6.452   -9.206  4.998  1.00 0.00 ? 37 ALA A N    2  
ATOM 1064 C CA   . ALA A 1 37 ? 5.248   -9.911  4.577  1.00 0.00 ? 37 ALA A CA   2  
ATOM 1065 C C    . ALA A 1 37 ? 4.268   -8.964  3.893  1.00 0.00 ? 37 ALA A C    2  
ATOM 1066 O O    . ALA A 1 37 ? 3.821   -7.983  4.486  1.00 0.00 ? 37 ALA A O    2  
ATOM 1067 C CB   . ALA A 1 37 ? 4.587   -10.586 5.770  1.00 0.00 ? 37 ALA A CB   2  
ATOM 1068 H H    . ALA A 1 37 ? 6.464   -8.759  5.870  1.00 0.00 ? 37 ALA A H    2  
ATOM 1069 H HA   . ALA A 1 37 ? 5.540   -10.680 3.876  1.00 0.00 ? 37 ALA A HA   2  
ATOM 1070 H HB1  . ALA A 1 37 ? 5.271   -10.587 6.606  1.00 0.00 ? 37 ALA A HB1  2  
ATOM 1071 H HB2  . ALA A 1 37 ? 3.691   -10.047 6.038  1.00 0.00 ? 37 ALA A HB2  2  
ATOM 1072 H HB3  . ALA A 1 37 ? 4.332   -11.603 5.512  1.00 0.00 ? 37 ALA A HB3  2  
ATOM 1073 N N    . SER A 1 38 ? 3.938   -9.265  2.641  1.00 0.00 ? 38 SER A N    2  
ATOM 1074 C CA   . SER A 1 38 ? 3.014   -8.437  1.874  1.00 0.00 ? 38 SER A CA   2  
ATOM 1075 C C    . SER A 1 38 ? 1.672   -8.317  2.589  1.00 0.00 ? 38 SER A C    2  
ATOM 1076 O O    . SER A 1 38 ? 0.706   -8.992  2.237  1.00 0.00 ? 38 SER A O    2  
ATOM 1077 C CB   . SER A 1 38 ? 2.809   -9.025  0.476  1.00 0.00 ? 38 SER A CB   2  
ATOM 1078 O OG   . SER A 1 38 ? 3.619   -8.362  -0.479 1.00 0.00 ? 38 SER A OG   2  
ATOM 1079 H H    . SER A 1 38 ? 4.328   -10.061 2.222  1.00 0.00 ? 38 SER A H    2  
ATOM 1080 H HA   . SER A 1 38 ? 3.449   -7.453  1.781  1.00 0.00 ? 38 SER A HA   2  
ATOM 1081 H HB2  . SER A 1 38 ? 3.071   -10.072 0.487  1.00 0.00 ? 38 SER A HB2  2  
ATOM 1082 H HB3  . SER A 1 38 ? 1.773   -8.915  0.191  1.00 0.00 ? 38 SER A HB3  2  
ATOM 1083 H HG   . SER A 1 38 ? 3.447   -7.418  -0.446 1.00 0.00 ? 38 SER A HG   2  
ATOM 1084 N N    . GLY A 1 39 ? 1.620   -7.450  3.596  1.00 0.00 ? 39 GLY A N    2  
ATOM 1085 C CA   . GLY A 1 39 ? 0.393   -7.256  4.345  1.00 0.00 ? 39 GLY A CA   2  
ATOM 1086 C C    . GLY A 1 39 ? 0.609   -6.457  5.615  1.00 0.00 ? 39 GLY A C    2  
ATOM 1087 O O    . GLY A 1 39 ? -0.323  -5.849  6.141  1.00 0.00 ? 39 GLY A O    2  
ATOM 1088 H H    . GLY A 1 39 ? 2.422   -6.938  3.832  1.00 0.00 ? 39 GLY A H    2  
ATOM 1089 H HA2  . GLY A 1 39 ? -0.318  -6.734  3.722  1.00 0.00 ? 39 GLY A HA2  2  
ATOM 1090 H HA3  . GLY A 1 39 ? -0.013  -8.222  4.606  1.00 0.00 ? 39 GLY A HA3  2  
ATOM 1091 N N    . ASP A 1 40 ? 1.842   -6.460  6.111  1.00 0.00 ? 40 ASP A N    2  
ATOM 1092 C CA   . ASP A 1 40 ? 2.178   -5.731  7.329  1.00 0.00 ? 40 ASP A CA   2  
ATOM 1093 C C    . ASP A 1 40 ? 2.549   -4.286  7.012  1.00 0.00 ? 40 ASP A C    2  
ATOM 1094 O O    . ASP A 1 40 ? 3.359   -4.023  6.123  1.00 0.00 ? 40 ASP A O    2  
ATOM 1095 C CB   . ASP A 1 40 ? 3.333   -6.419  8.058  1.00 0.00 ? 40 ASP A CB   2  
ATOM 1096 C CG   . ASP A 1 40 ? 2.853   -7.431  9.079  1.00 0.00 ? 40 ASP A CG   2  
ATOM 1097 O OD1  . ASP A 1 40 ? 3.623   -7.748  10.009 1.00 0.00 ? 40 ASP A OD1  2  
ATOM 1098 O OD2  . ASP A 1 40 ? 1.705   -7.907  8.947  1.00 0.00 ? 40 ASP A OD2  2  
ATOM 1099 H H    . ASP A 1 40 ? 2.543   -6.964  5.646  1.00 0.00 ? 40 ASP A H    2  
ATOM 1100 H HA   . ASP A 1 40 ? 1.308   -5.734  7.968  1.00 0.00 ? 40 ASP A HA   2  
ATOM 1101 H HB2  . ASP A 1 40 ? 3.953   -6.930  7.335  1.00 0.00 ? 40 ASP A HB2  2  
ATOM 1102 H HB3  . ASP A 1 40 ? 3.924   -5.672  8.568  1.00 0.00 ? 40 ASP A HB3  2  
ATOM 1103 N N    . ARG A 1 41 ? 1.950   -3.352  7.744  1.00 0.00 ? 41 ARG A N    2  
ATOM 1104 C CA   . ARG A 1 41 ? 2.215   -1.934  7.539  1.00 0.00 ? 41 ARG A CA   2  
ATOM 1105 C C    . ARG A 1 41 ? 3.300   -1.440  8.492  1.00 0.00 ? 41 ARG A C    2  
ATOM 1106 O O    . ARG A 1 41 ? 3.224   -1.656  9.702  1.00 0.00 ? 41 ARG A O    2  
ATOM 1107 C CB   . ARG A 1 41 ? 0.935   -1.119  7.741  1.00 0.00 ? 41 ARG A CB   2  
ATOM 1108 C CG   . ARG A 1 41 ? -0.169  -1.886  8.451  1.00 0.00 ? 41 ARG A CG   2  
ATOM 1109 C CD   . ARG A 1 41 ? -1.331  -0.976  8.816  1.00 0.00 ? 41 ARG A CD   2  
ATOM 1110 N NE   . ARG A 1 41 ? -2.339  -0.925  7.760  1.00 0.00 ? 41 ARG A NE   2  
ATOM 1111 C CZ   . ARG A 1 41 ? -2.254  -0.125  6.703  1.00 0.00 ? 41 ARG A CZ   2  
ATOM 1112 N NH1  . ARG A 1 41 ? -1.213  0.684   6.561  1.00 0.00 ? 41 ARG A NH1  2  
ATOM 1113 N NH2  . ARG A 1 41 ? -3.211  -0.135  5.784  1.00 0.00 ? 41 ARG A NH2  2  
ATOM 1114 H H    . ARG A 1 41 ? 1.313   -3.624  8.438  1.00 0.00 ? 41 ARG A H    2  
ATOM 1115 H HA   . ARG A 1 41 ? 2.558   -1.803  6.524  1.00 0.00 ? 41 ARG A HA   2  
ATOM 1116 H HB2  . ARG A 1 41 ? 1.169   -0.243  8.326  1.00 0.00 ? 41 ARG A HB2  2  
ATOM 1117 H HB3  . ARG A 1 41 ? 0.565   -0.809  6.775  1.00 0.00 ? 41 ARG A HB3  2  
ATOM 1118 H HG2  . ARG A 1 41 ? -0.529  -2.667  7.798  1.00 0.00 ? 41 ARG A HG2  2  
ATOM 1119 H HG3  . ARG A 1 41 ? 0.233   -2.323  9.353  1.00 0.00 ? 41 ARG A HG3  2  
ATOM 1120 H HD2  . ARG A 1 41 ? -1.791  -1.348  9.721  1.00 0.00 ? 41 ARG A HD2  2  
ATOM 1121 H HD3  . ARG A 1 41 ? -0.952  0.019   8.989  1.00 0.00 ? 41 ARG A HD3  2  
ATOM 1122 H HE   . ARG A 1 41 ? -3.116  -1.514  7.845  1.00 0.00 ? 41 ARG A HE   2  
ATOM 1123 H HH11 . ARG A 1 41 ? -0.490  0.693   7.251  1.00 0.00 ? 41 ARG A HH11 2  
ATOM 1124 H HH12 . ARG A 1 41 ? -1.151  1.284   5.763  1.00 0.00 ? 41 ARG A HH12 2  
ATOM 1125 H HH21 . ARG A 1 41 ? -3.997  -0.744  5.887  1.00 0.00 ? 41 ARG A HH21 2  
ATOM 1126 H HH22 . ARG A 1 41 ? -3.146  0.466   4.988  1.00 0.00 ? 41 ARG A HH22 2  
ATOM 1127 N N    . CYS A 1 42 ? 4.309   -0.777  7.938  1.00 0.00 ? 42 CYS A N    2  
ATOM 1128 C CA   . CYS A 1 42 ? 5.411   -0.253  8.737  1.00 0.00 ? 42 CYS A CA   2  
ATOM 1129 C C    . CYS A 1 42 ? 5.020   1.061   9.406  1.00 0.00 ? 42 CYS A C    2  
ATOM 1130 O O    . CYS A 1 42 ? 4.475   1.960   8.765  1.00 0.00 ? 42 CYS A O    2  
ATOM 1131 C CB   . CYS A 1 42 ? 6.649   -0.045  7.862  1.00 0.00 ? 42 CYS A CB   2  
ATOM 1132 S SG   . CYS A 1 42 ? 7.771   -1.479  7.809  1.00 0.00 ? 42 CYS A SG   2  
ATOM 1133 H H    . CYS A 1 42 ? 4.314   -0.636  6.967  1.00 0.00 ? 42 CYS A H    2  
ATOM 1134 H HA   . CYS A 1 42 ? 5.640   -0.979  9.503  1.00 0.00 ? 42 CYS A HA   2  
ATOM 1135 H HB2  . CYS A 1 42 ? 6.334   0.162   6.850  1.00 0.00 ? 42 CYS A HB2  2  
ATOM 1136 H HB3  . CYS A 1 42 ? 7.209   0.798   8.240  1.00 0.00 ? 42 CYS A HB3  2  
ATOM 1137 N N    . CYS A 1 43 ? 5.303   1.167   10.700 1.00 0.00 ? 43 CYS A N    2  
ATOM 1138 C CA   . CYS A 1 43 ? 4.982   2.370   11.458 1.00 0.00 ? 43 CYS A CA   2  
ATOM 1139 C C    . CYS A 1 43 ? 6.198   3.286   11.564 1.00 0.00 ? 43 CYS A C    2  
ATOM 1140 O O    . CYS A 1 43 ? 7.335   2.853   11.373 1.00 0.00 ? 43 CYS A O    2  
ATOM 1141 C CB   . CYS A 1 43 ? 4.486   2.000   12.857 1.00 0.00 ? 43 CYS A CB   2  
ATOM 1142 S SG   . CYS A 1 43 ? 2.795   1.322   12.891 1.00 0.00 ? 43 CYS A SG   2  
ATOM 1143 H H    . CYS A 1 43 ? 5.739   0.416   11.158 1.00 0.00 ? 43 CYS A H    2  
ATOM 1144 H HA   . CYS A 1 43 ? 4.197   2.893   10.934 1.00 0.00 ? 43 CYS A HA   2  
ATOM 1145 H HB2  . CYS A 1 43 ? 5.146   1.256   13.280 1.00 0.00 ? 43 CYS A HB2  2  
ATOM 1146 H HB3  . CYS A 1 43 ? 4.500   2.881   13.481 1.00 0.00 ? 43 CYS A HB3  2  
ATOM 1147 N N    . CYS A 1 44 ? 5.950   4.556   11.869 1.00 0.00 ? 44 CYS A N    2  
ATOM 1148 C CA   . CYS A 1 44 ? 7.022   5.535   12.001 1.00 0.00 ? 44 CYS A CA   2  
ATOM 1149 C C    . CYS A 1 44 ? 6.811   6.411   13.231 1.00 0.00 ? 44 CYS A C    2  
ATOM 1150 O O    . CYS A 1 44 ? 5.726   6.952   13.442 1.00 0.00 ? 44 CYS A O    2  
ATOM 1151 C CB   . CYS A 1 44 ? 7.101   6.407   10.746 1.00 0.00 ? 44 CYS A CB   2  
ATOM 1152 S SG   . CYS A 1 44 ? 7.362   5.472   9.205  1.00 0.00 ? 44 CYS A SG   2  
ATOM 1153 H H    . CYS A 1 44 ? 5.022   4.842   12.009 1.00 0.00 ? 44 CYS A H    2  
ATOM 1154 H HA   . CYS A 1 44 ? 7.951   4.996   12.113 1.00 0.00 ? 44 CYS A HA   2  
ATOM 1155 H HB2  . CYS A 1 44 ? 6.178   6.959   10.643 1.00 0.00 ? 44 CYS A HB2  2  
ATOM 1156 H HB3  . CYS A 1 44 ? 7.920   7.103   10.852 1.00 0.00 ? 44 CYS A HB3  2  
ATOM 1157 N N    . ALA A 1 45 ? 7.856   6.547   14.041 1.00 0.00 ? 45 ALA A N    2  
ATOM 1158 C CA   . ALA A 1 45 ? 7.786   7.359   15.249 1.00 0.00 ? 45 ALA A CA   2  
ATOM 1159 C C    . ALA A 1 45 ? 7.932   8.842   14.923 1.00 0.00 ? 45 ALA A C    2  
ATOM 1160 O O    . ALA A 1 45 ? 7.801   9.696   15.801 1.00 0.00 ? 45 ALA A O    2  
ATOM 1161 C CB   . ALA A 1 45 ? 8.857   6.927   16.239 1.00 0.00 ? 45 ALA A CB   2  
ATOM 1162 H H    . ALA A 1 45 ? 8.694   6.091   13.820 1.00 0.00 ? 45 ALA A H    2  
ATOM 1163 H HA   . ALA A 1 45 ? 6.820   7.195   15.707 1.00 0.00 ? 45 ALA A HA   2  
ATOM 1164 H HB1  . ALA A 1 45 ? 8.469   7.004   17.245 1.00 0.00 ? 45 ALA A HB1  2  
ATOM 1165 H HB2  . ALA A 1 45 ? 9.139   5.904   16.040 1.00 0.00 ? 45 ALA A HB2  2  
ATOM 1166 H HB3  . ALA A 1 45 ? 9.721   7.566   16.136 1.00 0.00 ? 45 ALA A HB3  2  
ATOM 1167 N N    . CYS A 1 1  ? 1.305   -0.092  -0.165 1.00 0.00 ? 1  CYS A N    3  
ATOM 1168 C CA   . CYS A 1 1  ? 2.130   -0.073  -1.367 1.00 0.00 ? 1  CYS A CA   3  
ATOM 1169 C C    . CYS A 1 1  ? 2.801   -1.426  -1.587 1.00 0.00 ? 1  CYS A C    3  
ATOM 1170 O O    . CYS A 1 1  ? 2.981   -2.202  -0.648 1.00 0.00 ? 1  CYS A O    3  
ATOM 1171 C CB   . CYS A 1 1  ? 3.191   1.024   -1.265 1.00 0.00 ? 1  CYS A CB   3  
ATOM 1172 S SG   . CYS A 1 1  ? 3.938   1.184   0.388  1.00 0.00 ? 1  CYS A SG   3  
ATOM 1173 H H    . CYS A 1 1  ? 1.717   -0.321  0.694  1.00 0.00 ? 1  CYS A H    3  
ATOM 1174 H HA   . CYS A 1 1  ? 1.487   0.137   -2.208 1.00 0.00 ? 1  CYS A HA   3  
ATOM 1175 H HB2  . CYS A 1 1  ? 3.987   0.811   -1.965 1.00 0.00 ? 1  CYS A HB2  3  
ATOM 1176 H HB3  . CYS A 1 1  ? 2.742   1.973   -1.517 1.00 0.00 ? 1  CYS A HB3  3  
ATOM 1177 N N    . TYR A 1 2  ? 3.168   -1.702  -2.833 1.00 0.00 ? 2  TYR A N    3  
ATOM 1178 C CA   . TYR A 1 2  ? 3.817   -2.962  -3.177 1.00 0.00 ? 2  TYR A CA   3  
ATOM 1179 C C    . TYR A 1 2  ? 5.321   -2.884  -2.936 1.00 0.00 ? 2  TYR A C    3  
ATOM 1180 O O    . TYR A 1 2  ? 5.921   -1.809  -2.936 1.00 0.00 ? 2  TYR A O    3  
ATOM 1181 C CB   . TYR A 1 2  ? 3.542   -3.318  -4.639 1.00 0.00 ? 2  TYR A CB   3  
ATOM 1182 C CG   . TYR A 1 2  ? 2.848   -4.650  -4.818 1.00 0.00 ? 2  TYR A CG   3  
ATOM 1183 C CD1  . TYR A 1 2  ? 1.832   -5.046  -3.957 1.00 0.00 ? 2  TYR A CD1  3  
ATOM 1184 C CD2  . TYR A 1 2  ? 3.209   -5.512  -5.846 1.00 0.00 ? 2  TYR A CD2  3  
ATOM 1185 C CE1  . TYR A 1 2  ? 1.195   -6.262  -4.115 1.00 0.00 ? 2  TYR A CE1  3  
ATOM 1186 C CE2  . TYR A 1 2  ? 2.577   -6.729  -6.013 1.00 0.00 ? 2  TYR A CE2  3  
ATOM 1187 C CZ   . TYR A 1 2  ? 1.571   -7.099  -5.145 1.00 0.00 ? 2  TYR A CZ   3  
ATOM 1188 O OH   . TYR A 1 2  ? 0.940   -8.311  -5.307 1.00 0.00 ? 2  TYR A OH   3  
ATOM 1189 H H    . TYR A 1 2  ? 2.998   -1.044  -3.539 1.00 0.00 ? 2  TYR A H    3  
ATOM 1190 H HA   . TYR A 1 2  ? 3.402   -3.733  -2.545 1.00 0.00 ? 2  TYR A HA   3  
ATOM 1191 H HB2  . TYR A 1 2  ? 2.915   -2.557  -5.077 1.00 0.00 ? 2  TYR A HB2  3  
ATOM 1192 H HB3  . TYR A 1 2  ? 4.479   -3.358  -5.175 1.00 0.00 ? 2  TYR A HB3  3  
ATOM 1193 H HD1  . TYR A 1 2  ? 1.540   -4.388  -3.151 1.00 0.00 ? 2  TYR A HD1  3  
ATOM 1194 H HD2  . TYR A 1 2  ? 3.998   -5.218  -6.523 1.00 0.00 ? 2  TYR A HD2  3  
ATOM 1195 H HE1  . TYR A 1 2  ? 0.407   -6.553  -3.436 1.00 0.00 ? 2  TYR A HE1  3  
ATOM 1196 H HE2  . TYR A 1 2  ? 2.871   -7.385  -6.818 1.00 0.00 ? 2  TYR A HE2  3  
ATOM 1197 H HH   . TYR A 1 2  ? 1.141   -8.879  -4.559 1.00 0.00 ? 2  TYR A HH   3  
ATOM 1198 N N    . PRO A 1 3  ? 5.947   -4.051  -2.725 1.00 0.00 ? 3  PRO A N    3  
ATOM 1199 C CA   . PRO A 1 3  ? 7.389   -4.144  -2.479 1.00 0.00 ? 3  PRO A CA   3  
ATOM 1200 C C    . PRO A 1 3  ? 8.211   -3.815  -3.720 1.00 0.00 ? 3  PRO A C    3  
ATOM 1201 O O    . PRO A 1 3  ? 8.644   -4.710  -4.445 1.00 0.00 ? 3  PRO A O    3  
ATOM 1202 C CB   . PRO A 1 3  ? 7.588   -5.607  -2.078 1.00 0.00 ? 3  PRO A CB   3  
ATOM 1203 C CG   . PRO A 1 3  ? 6.452   -6.332  -2.714 1.00 0.00 ? 3  PRO A CG   3  
ATOM 1204 C CD   . PRO A 1 3  ? 5.295   -5.372  -2.711 1.00 0.00 ? 3  PRO A CD   3  
ATOM 1205 H HA   . PRO A 1 3  ? 7.695   -3.501  -1.666 1.00 0.00 ? 3  PRO A HA   3  
ATOM 1206 H HB2  . PRO A 1 3  ? 8.540   -5.959  -2.450 1.00 0.00 ? 3  PRO A HB2  3  
ATOM 1207 H HB3  . PRO A 1 3  ? 7.560   -5.697  -1.002 1.00 0.00 ? 3  PRO A HB3  3  
ATOM 1208 H HG2  . PRO A 1 3  ? 6.711   -6.604  -3.725 1.00 0.00 ? 3  PRO A HG2  3  
ATOM 1209 H HG3  . PRO A 1 3  ? 6.209   -7.212  -2.137 1.00 0.00 ? 3  PRO A HG3  3  
ATOM 1210 H HD2  . PRO A 1 3  ? 4.687   -5.511  -3.592 1.00 0.00 ? 3  PRO A HD2  3  
ATOM 1211 H HD3  . PRO A 1 3  ? 4.701   -5.498  -1.817 1.00 0.00 ? 3  PRO A HD3  3  
ATOM 1212 N N    . GLY A 1 4  ? 8.424   -2.525  -3.960 1.00 0.00 ? 4  GLY A N    3  
ATOM 1213 C CA   . GLY A 1 4  ? 9.194   -2.101  -5.114 1.00 0.00 ? 4  GLY A CA   3  
ATOM 1214 C C    . GLY A 1 4  ? 8.471   -1.058  -5.943 1.00 0.00 ? 4  GLY A C    3  
ATOM 1215 O O    . GLY A 1 4  ? 8.868   -0.768  -7.071 1.00 0.00 ? 4  GLY A O    3  
ATOM 1216 H H    . GLY A 1 4  ? 8.054   -1.854  -3.347 1.00 0.00 ? 4  GLY A H    3  
ATOM 1217 H HA2  . GLY A 1 4  ? 10.133  -1.690  -4.776 1.00 0.00 ? 4  GLY A HA2  3  
ATOM 1218 H HA3  . GLY A 1 4  ? 9.393   -2.963  -5.735 1.00 0.00 ? 4  GLY A HA3  3  
ATOM 1219 N N    . GLN A 1 5  ? 7.407   -0.493  -5.382 1.00 0.00 ? 5  GLN A N    3  
ATOM 1220 C CA   . GLN A 1 5  ? 6.626   0.523   -6.078 1.00 0.00 ? 5  GLN A CA   3  
ATOM 1221 C C    . GLN A 1 5  ? 7.355   1.862   -6.081 1.00 0.00 ? 5  GLN A C    3  
ATOM 1222 O O    . GLN A 1 5  ? 8.197   2.140   -5.228 1.00 0.00 ? 5  GLN A O    3  
ATOM 1223 C CB   . GLN A 1 5  ? 5.252   0.677   -5.424 1.00 0.00 ? 5  GLN A CB   3  
ATOM 1224 C CG   . GLN A 1 5  ? 4.389   -0.571  -5.517 1.00 0.00 ? 5  GLN A CG   3  
ATOM 1225 C CD   . GLN A 1 5  ? 2.913   -0.252  -5.641 1.00 0.00 ? 5  GLN A CD   3  
ATOM 1226 O OE1  . GLN A 1 5  ? 2.322   0.362   -4.752 1.00 0.00 ? 5  GLN A OE1  3  
ATOM 1227 N NE2  . GLN A 1 5  ? 2.307   -0.668  -6.747 1.00 0.00 ? 5  GLN A NE2  3  
ATOM 1228 H H    . GLN A 1 5  ? 7.140   -0.766  -4.480 1.00 0.00 ? 5  GLN A H    3  
ATOM 1229 H HA   . GLN A 1 5  ? 6.493   0.197   -7.099 1.00 0.00 ? 5  GLN A HA   3  
ATOM 1230 H HB2  . GLN A 1 5  ? 5.389   0.918   -4.380 1.00 0.00 ? 5  GLN A HB2  3  
ATOM 1231 H HB3  . GLN A 1 5  ? 4.726   1.489   -5.906 1.00 0.00 ? 5  GLN A HB3  3  
ATOM 1232 H HG2  . GLN A 1 5  ? 4.693   -1.139  -6.384 1.00 0.00 ? 5  GLN A HG2  3  
ATOM 1233 H HG3  . GLN A 1 5  ? 4.542   -1.165  -4.628 1.00 0.00 ? 5  GLN A HG3  3  
ATOM 1234 H HE21 . GLN A 1 5  ? 2.841   -1.152  -7.412 1.00 0.00 ? 5  GLN A HE21 3  
ATOM 1235 H HE22 . GLN A 1 5  ? 1.353   -0.476  -6.853 1.00 0.00 ? 5  GLN A HE22 3  
ATOM 1236 N N    . PRO A 1 6  ? 7.025   2.714   -7.064 1.00 0.00 ? 6  PRO A N    3  
ATOM 1237 C CA   . PRO A 1 6  ? 7.636   4.039   -7.202 1.00 0.00 ? 6  PRO A CA   3  
ATOM 1238 C C    . PRO A 1 6  ? 7.204   4.995   -6.095 1.00 0.00 ? 6  PRO A C    3  
ATOM 1239 O O    . PRO A 1 6  ? 6.197   5.690   -6.220 1.00 0.00 ? 6  PRO A O    3  
ATOM 1240 C CB   . PRO A 1 6  ? 7.124   4.526   -8.560 1.00 0.00 ? 6  PRO A CB   3  
ATOM 1241 C CG   . PRO A 1 6  ? 5.846   3.791   -8.769 1.00 0.00 ? 6  PRO A CG   3  
ATOM 1242 C CD   . PRO A 1 6  ? 6.029   2.449   -8.116 1.00 0.00 ? 6  PRO A CD   3  
ATOM 1243 H HA   . PRO A 1 6  ? 8.715   3.978   -7.222 1.00 0.00 ? 6  PRO A HA   3  
ATOM 1244 H HB2  . PRO A 1 6  ? 6.965   5.595   -8.525 1.00 0.00 ? 6  PRO A HB2  3  
ATOM 1245 H HB3  . PRO A 1 6  ? 7.846   4.289   -9.327 1.00 0.00 ? 6  PRO A HB3  3  
ATOM 1246 H HG2  . PRO A 1 6  ? 5.033   4.327   -8.303 1.00 0.00 ? 6  PRO A HG2  3  
ATOM 1247 H HG3  . PRO A 1 6  ? 5.661   3.671   -9.826 1.00 0.00 ? 6  PRO A HG3  3  
ATOM 1248 H HD2  . PRO A 1 6  ? 5.098   2.107   -7.688 1.00 0.00 ? 6  PRO A HD2  3  
ATOM 1249 H HD3  . PRO A 1 6  ? 6.405   1.730   -8.829 1.00 0.00 ? 6  PRO A HD3  3  
ATOM 1250 N N    . GLY A 1 7  ? 7.973   5.025   -5.011 1.00 0.00 ? 7  GLY A N    3  
ATOM 1251 C CA   . GLY A 1 7  ? 7.653   5.899   -3.898 1.00 0.00 ? 7  GLY A CA   3  
ATOM 1252 C C    . GLY A 1 7  ? 7.717   5.185   -2.563 1.00 0.00 ? 7  GLY A C    3  
ATOM 1253 O O    . GLY A 1 7  ? 7.992   5.802   -1.533 1.00 0.00 ? 7  GLY A O    3  
ATOM 1254 H H    . GLY A 1 7  ? 8.765   4.448   -4.967 1.00 0.00 ? 7  GLY A H    3  
ATOM 1255 H HA2  . GLY A 1 7  ? 8.352   6.722   -3.888 1.00 0.00 ? 7  GLY A HA2  3  
ATOM 1256 H HA3  . GLY A 1 7  ? 6.655   6.289   -4.037 1.00 0.00 ? 7  GLY A HA3  3  
ATOM 1257 N N    . CYS A 1 8  ? 7.461   3.881   -2.578 1.00 0.00 ? 8  CYS A N    3  
ATOM 1258 C CA   . CYS A 1 8  ? 7.488   3.082   -1.359 1.00 0.00 ? 8  CYS A CA   3  
ATOM 1259 C C    . CYS A 1 8  ? 8.839   2.393   -1.190 1.00 0.00 ? 8  CYS A C    3  
ATOM 1260 O O    . CYS A 1 8  ? 9.668   2.397   -2.099 1.00 0.00 ? 8  CYS A O    3  
ATOM 1261 C CB   . CYS A 1 8  ? 6.370   2.038   -1.383 1.00 0.00 ? 8  CYS A CB   3  
ATOM 1262 S SG   . CYS A 1 8  ? 5.883   1.431   0.264  1.00 0.00 ? 8  CYS A SG   3  
ATOM 1263 H H    . CYS A 1 8  ? 7.248   3.445   -3.430 1.00 0.00 ? 8  CYS A H    3  
ATOM 1264 H HA   . CYS A 1 8  ? 7.330   3.746   -0.523 1.00 0.00 ? 8  CYS A HA   3  
ATOM 1265 H HB2  . CYS A 1 8  ? 5.494   2.471   -1.845 1.00 0.00 ? 8  CYS A HB2  3  
ATOM 1266 H HB3  . CYS A 1 8  ? 6.694   1.188   -1.965 1.00 0.00 ? 8  CYS A HB3  3  
ATOM 1267 N N    . GLY A 1 9  ? 9.053   1.800   -0.019 1.00 0.00 ? 9  GLY A N    3  
ATOM 1268 C CA   . GLY A 1 9  ? 10.304  1.114   0.247  1.00 0.00 ? 9  GLY A CA   3  
ATOM 1269 C C    . GLY A 1 9  ? 10.376  0.568   1.659  1.00 0.00 ? 9  GLY A C    3  
ATOM 1270 O O    . GLY A 1 9  ? 9.434   0.716   2.439  1.00 0.00 ? 9  GLY A O    3  
ATOM 1271 H H    . GLY A 1 9  ? 8.355   1.828   0.669  1.00 0.00 ? 9  GLY A H    3  
ATOM 1272 H HA2  . GLY A 1 9  ? 10.410  0.297   -0.450 1.00 0.00 ? 9  GLY A HA2  3  
ATOM 1273 H HA3  . GLY A 1 9  ? 11.119  1.807   0.100  1.00 0.00 ? 9  GLY A HA3  3  
ATOM 1274 N N    . HIS A 1 10 ? 11.495  -0.068  1.990  1.00 0.00 ? 10 HIS A N    3  
ATOM 1275 C CA   . HIS A 1 10 ? 11.686  -0.641  3.318  1.00 0.00 ? 10 HIS A CA   3  
ATOM 1276 C C    . HIS A 1 10 ? 11.806  0.457   4.370  1.00 0.00 ? 10 HIS A C    3  
ATOM 1277 O O    . HIS A 1 10 ? 12.700  1.302   4.302  1.00 0.00 ? 10 HIS A O    3  
ATOM 1278 C CB   . HIS A 1 10 ? 12.933  -1.525  3.341  1.00 0.00 ? 10 HIS A CB   3  
ATOM 1279 C CG   . HIS A 1 10 ? 12.741  -2.812  4.083  1.00 0.00 ? 10 HIS A CG   3  
ATOM 1280 N ND1  . HIS A 1 10 ? 13.268  -4.012  3.655  1.00 0.00 ? 10 HIS A ND1  3  
ATOM 1281 C CD2  . HIS A 1 10 ? 12.078  -3.081  5.231  1.00 0.00 ? 10 HIS A CD2  3  
ATOM 1282 C CE1  . HIS A 1 10 ? 12.935  -4.965  4.507  1.00 0.00 ? 10 HIS A CE1  3  
ATOM 1283 N NE2  . HIS A 1 10 ? 12.213  -4.426  5.473  1.00 0.00 ? 10 HIS A NE2  3  
ATOM 1284 H H    . HIS A 1 10 ? 12.210  -0.155  1.325  1.00 0.00 ? 10 HIS A H    3  
ATOM 1285 H HA   . HIS A 1 10 ? 10.822  -1.246  3.545  1.00 0.00 ? 10 HIS A HA   3  
ATOM 1286 H HB2  . HIS A 1 10 ? 13.214  -1.766  2.327  1.00 0.00 ? 10 HIS A HB2  3  
ATOM 1287 H HB3  . HIS A 1 10 ? 13.740  -0.985  3.815  1.00 0.00 ? 10 HIS A HB3  3  
ATOM 1288 H HD1  . HIS A 1 10 ? 13.804  -4.146  2.846  1.00 0.00 ? 10 HIS A HD1  3  
ATOM 1289 H HD2  . HIS A 1 10 ? 11.541  -2.371  5.844  1.00 0.00 ? 10 HIS A HD2  3  
ATOM 1290 H HE1  . HIS A 1 10 ? 13.206  -6.007  4.428  1.00 0.00 ? 10 HIS A HE1  3  
ATOM 1291 N N    . CYS A 1 11 ? 10.901  0.440   5.343  1.00 0.00 ? 11 CYS A N    3  
ATOM 1292 C CA   . CYS A 1 11 ? 10.904  1.434   6.409  1.00 0.00 ? 11 CYS A CA   3  
ATOM 1293 C C    . CYS A 1 11 ? 12.171  1.322   7.253  1.00 0.00 ? 11 CYS A C    3  
ATOM 1294 O O    . CYS A 1 11 ? 12.904  0.338   7.163  1.00 0.00 ? 11 CYS A O    3  
ATOM 1295 C CB   . CYS A 1 11 ? 9.670   1.264   7.297  1.00 0.00 ? 11 CYS A CB   3  
ATOM 1296 S SG   . CYS A 1 11 ? 9.686   -0.250  8.311  1.00 0.00 ? 11 CYS A SG   3  
ATOM 1297 H H    . CYS A 1 11 ? 10.213  -0.259  5.343  1.00 0.00 ? 11 CYS A H    3  
ATOM 1298 H HA   . CYS A 1 11 ? 10.876  2.411   5.952  1.00 0.00 ? 11 CYS A HA   3  
ATOM 1299 H HB2  . CYS A 1 11 ? 9.600   2.107   7.969  1.00 0.00 ? 11 CYS A HB2  3  
ATOM 1300 H HB3  . CYS A 1 11 ? 8.789   1.233   6.674  1.00 0.00 ? 11 CYS A HB3  3  
ATOM 1301 N N    . SER A 1 12 ? 12.421  2.339   8.072  1.00 0.00 ? 12 SER A N    3  
ATOM 1302 C CA   . SER A 1 12 ? 13.600  2.357   8.930  1.00 0.00 ? 12 SER A CA   3  
ATOM 1303 C C    . SER A 1 12 ? 13.368  3.239   10.153 1.00 0.00 ? 12 SER A C    3  
ATOM 1304 O O    . SER A 1 12 ? 12.620  4.215   10.096 1.00 0.00 ? 12 SER A O    3  
ATOM 1305 C CB   . SER A 1 12 ? 14.817  2.858   8.149  1.00 0.00 ? 12 SER A CB   3  
ATOM 1306 O OG   . SER A 1 12 ? 14.661  2.627   6.760  1.00 0.00 ? 12 SER A OG   3  
ATOM 1307 H H    . SER A 1 12 ? 11.798  3.095   8.099  1.00 0.00 ? 12 SER A H    3  
ATOM 1308 H HA   . SER A 1 12 ? 13.786  1.346   9.260  1.00 0.00 ? 12 SER A HA   3  
ATOM 1309 H HB2  . SER A 1 12 ? 14.936  3.918   8.315  1.00 0.00 ? 12 SER A HB2  3  
ATOM 1310 H HB3  . SER A 1 12 ? 15.700  2.338   8.492  1.00 0.00 ? 12 SER A HB3  3  
ATOM 1311 H HG   . SER A 1 12 ? 15.461  2.890   6.300  1.00 0.00 ? 12 SER A HG   3  
ATOM 1312 N N    . ARG A 1 13 ? 14.016  2.887   11.259 1.00 0.00 ? 13 ARG A N    3  
ATOM 1313 C CA   . ARG A 1 13 ? 13.880  3.645   12.498 1.00 0.00 ? 13 ARG A CA   3  
ATOM 1314 C C    . ARG A 1 13 ? 13.885  5.145   12.220 1.00 0.00 ? 13 ARG A C    3  
ATOM 1315 O O    . ARG A 1 13 ? 14.553  5.630   11.306 1.00 0.00 ? 13 ARG A O    3  
ATOM 1316 C CB   . ARG A 1 13 ? 15.012  3.290   13.464 1.00 0.00 ? 13 ARG A CB   3  
ATOM 1317 C CG   . ARG A 1 13 ? 14.730  2.056   14.306 1.00 0.00 ? 13 ARG A CG   3  
ATOM 1318 C CD   . ARG A 1 13 ? 14.556  2.412   15.774 1.00 0.00 ? 13 ARG A CD   3  
ATOM 1319 N NE   . ARG A 1 13 ? 13.546  1.580   16.422 1.00 0.00 ? 13 ARG A NE   3  
ATOM 1320 C CZ   . ARG A 1 13 ? 12.889  1.942   17.519 1.00 0.00 ? 13 ARG A CZ   3  
ATOM 1321 N NH1  . ARG A 1 13 ? 13.135  3.114   18.086 1.00 0.00 ? 13 ARG A NH1  3  
ATOM 1322 N NH2  . ARG A 1 13 ? 11.984  1.130   18.050 1.00 0.00 ? 13 ARG A NH2  3  
ATOM 1323 H H    . ARG A 1 13 ? 14.598  2.099   11.243 1.00 0.00 ? 13 ARG A H    3  
ATOM 1324 H HA   . ARG A 1 13 ? 12.937  3.377   12.949 1.00 0.00 ? 13 ARG A HA   3  
ATOM 1325 H HB2  . ARG A 1 13 ? 15.913  3.112   12.895 1.00 0.00 ? 13 ARG A HB2  3  
ATOM 1326 H HB3  . ARG A 1 13 ? 15.175  4.124   14.130 1.00 0.00 ? 13 ARG A HB3  3  
ATOM 1327 H HG2  . ARG A 1 13 ? 13.824  1.589   13.950 1.00 0.00 ? 13 ARG A HG2  3  
ATOM 1328 H HG3  . ARG A 1 13 ? 15.556  1.368   14.206 1.00 0.00 ? 13 ARG A HG3  3  
ATOM 1329 H HD2  . ARG A 1 13 ? 15.500  2.274   16.279 1.00 0.00 ? 13 ARG A HD2  3  
ATOM 1330 H HD3  . ARG A 1 13 ? 14.257  3.447   15.847 1.00 0.00 ? 13 ARG A HD3  3  
ATOM 1331 H HE   . ARG A 1 13 ? 13.348  0.709   16.019 1.00 0.00 ? 13 ARG A HE   3  
ATOM 1332 H HH11 . ARG A 1 13 ? 13.816  3.729   17.688 1.00 0.00 ? 13 ARG A HH11 3  
ATOM 1333 H HH12 . ARG A 1 13 ? 12.638  3.385   18.911 1.00 0.00 ? 13 ARG A HH12 3  
ATOM 1334 H HH21 . ARG A 1 13 ? 11.796  0.245   17.625 1.00 0.00 ? 13 ARG A HH21 3  
ATOM 1335 H HH22 . ARG A 1 13 ? 11.491  1.403   18.875 1.00 0.00 ? 13 ARG A HH22 3  
ATOM 1336 N N    . PRO A 1 14 ? 13.123  5.899   13.026 1.00 0.00 ? 14 PRO A N    3  
ATOM 1337 C CA   . PRO A 1 14 ? 12.324  5.332   14.117 1.00 0.00 ? 14 PRO A CA   3  
ATOM 1338 C C    . PRO A 1 14 ? 11.144  4.512   13.606 1.00 0.00 ? 14 PRO A C    3  
ATOM 1339 O O    . PRO A 1 14 ? 10.235  4.176   14.364 1.00 0.00 ? 14 PRO A O    3  
ATOM 1340 C CB   . PRO A 1 14 ? 11.828  6.568   14.872 1.00 0.00 ? 14 PRO A CB   3  
ATOM 1341 C CG   . PRO A 1 14 ? 11.833  7.659   13.858 1.00 0.00 ? 14 PRO A CG   3  
ATOM 1342 C CD   . PRO A 1 14 ? 12.982  7.362   12.935 1.00 0.00 ? 14 PRO A CD   3  
ATOM 1343 H HA   . PRO A 1 14 ? 12.926  4.723   14.775 1.00 0.00 ? 14 PRO A HA   3  
ATOM 1344 H HB2  . PRO A 1 14 ? 10.833  6.385   15.253 1.00 0.00 ? 14 PRO A HB2  3  
ATOM 1345 H HB3  . PRO A 1 14 ? 12.498  6.787   15.690 1.00 0.00 ? 14 PRO A HB3  3  
ATOM 1346 H HG2  . PRO A 1 14 ? 10.902  7.656   13.312 1.00 0.00 ? 14 PRO A HG2  3  
ATOM 1347 H HG3  . PRO A 1 14 ? 11.981  8.612   14.345 1.00 0.00 ? 14 PRO A HG3  3  
ATOM 1348 H HD2  . PRO A 1 14 ? 12.743  7.664   11.926 1.00 0.00 ? 14 PRO A HD2  3  
ATOM 1349 H HD3  . PRO A 1 14 ? 13.879  7.857   13.277 1.00 0.00 ? 14 PRO A HD3  3  
ATOM 1350 N N    . ASN A 1 15 ? 11.166  4.193   12.316 1.00 0.00 ? 15 ASN A N    3  
ATOM 1351 C CA   . ASN A 1 15 ? 10.098  3.411   11.704 1.00 0.00 ? 15 ASN A CA   3  
ATOM 1352 C C    . ASN A 1 15 ? 10.327  1.918   11.915 1.00 0.00 ? 15 ASN A C    3  
ATOM 1353 O O    . ASN A 1 15 ? 11.465  1.450   11.930 1.00 0.00 ? 15 ASN A O    3  
ATOM 1354 C CB   . ASN A 1 15 ? 10.006  3.718   10.208 1.00 0.00 ? 15 ASN A CB   3  
ATOM 1355 C CG   . ASN A 1 15 ? 10.278  5.178   9.899  1.00 0.00 ? 15 ASN A CG   3  
ATOM 1356 O OD1  . ASN A 1 15 ? 10.008  6.057   10.717 1.00 0.00 ? 15 ASN A OD1  3  
ATOM 1357 N ND2  . ASN A 1 15 ? 10.814  5.442   8.713  1.00 0.00 ? 15 ASN A ND2  3  
ATOM 1358 H H    . ASN A 1 15 ? 11.918  4.490   11.762 1.00 0.00 ? 15 ASN A H    3  
ATOM 1359 H HA   . ASN A 1 15 ? 9.169   3.692   12.177 1.00 0.00 ? 15 ASN A HA   3  
ATOM 1360 H HB2  . ASN A 1 15 ? 10.732  3.117   9.678  1.00 0.00 ? 15 ASN A HB2  3  
ATOM 1361 H HB3  . ASN A 1 15 ? 9.016   3.472   9.855  1.00 0.00 ? 15 ASN A HB3  3  
ATOM 1362 H HD21 . ASN A 1 15 ? 11.001  4.691   8.112  1.00 0.00 ? 15 ASN A HD21 3  
ATOM 1363 H HD22 . ASN A 1 15 ? 11.000  6.377   8.488  1.00 0.00 ? 15 ASN A HD22 3  
ATOM 1364 N N    . TYR A 1 16 ? 9.237   1.175   12.077 1.00 0.00 ? 16 TYR A N    3  
ATOM 1365 C CA   . TYR A 1 16 ? 9.319   -0.265  12.289 1.00 0.00 ? 16 TYR A CA   3  
ATOM 1366 C C    . TYR A 1 16 ? 8.170   -0.985  11.589 1.00 0.00 ? 16 TYR A C    3  
ATOM 1367 O O    . TYR A 1 16 ? 7.355   -0.362  10.907 1.00 0.00 ? 16 TYR A O    3  
ATOM 1368 C CB   . TYR A 1 16 ? 9.299   -0.583  13.785 1.00 0.00 ? 16 TYR A CB   3  
ATOM 1369 C CG   . TYR A 1 16 ? 7.956   -0.342  14.438 1.00 0.00 ? 16 TYR A CG   3  
ATOM 1370 C CD1  . TYR A 1 16 ? 7.111   -1.400  14.744 1.00 0.00 ? 16 TYR A CD1  3  
ATOM 1371 C CD2  . TYR A 1 16 ? 7.534   0.945   14.746 1.00 0.00 ? 16 TYR A CD2  3  
ATOM 1372 C CE1  . TYR A 1 16 ? 5.883   -1.184  15.340 1.00 0.00 ? 16 TYR A CE1  3  
ATOM 1373 C CE2  . TYR A 1 16 ? 6.308   1.171   15.343 1.00 0.00 ? 16 TYR A CE2  3  
ATOM 1374 C CZ   . TYR A 1 16 ? 5.487   0.103   15.638 1.00 0.00 ? 16 TYR A CZ   3  
ATOM 1375 O OH   . TYR A 1 16 ? 4.265   0.323   16.231 1.00 0.00 ? 16 TYR A OH   3  
ATOM 1376 H H    . TYR A 1 16 ? 8.357   1.605   12.055 1.00 0.00 ? 16 TYR A H    3  
ATOM 1377 H HA   . TYR A 1 16 ? 10.253  -0.610  11.870 1.00 0.00 ? 16 TYR A HA   3  
ATOM 1378 H HB2  . TYR A 1 16 ? 9.554   -1.622  13.929 1.00 0.00 ? 16 TYR A HB2  3  
ATOM 1379 H HB3  . TYR A 1 16 ? 10.028  0.035   14.287 1.00 0.00 ? 16 TYR A HB3  3  
ATOM 1380 H HD1  . TYR A 1 16 ? 7.424   -2.408  14.510 1.00 0.00 ? 16 TYR A HD1  3  
ATOM 1381 H HD2  . TYR A 1 16 ? 8.180   1.780   14.514 1.00 0.00 ? 16 TYR A HD2  3  
ATOM 1382 H HE1  . TYR A 1 16 ? 5.239   -2.020  15.571 1.00 0.00 ? 16 TYR A HE1  3  
ATOM 1383 H HE2  . TYR A 1 16 ? 5.998   2.178   15.576 1.00 0.00 ? 16 TYR A HE2  3  
ATOM 1384 H HH   . TYR A 1 16 ? 3.951   -0.492  16.630 1.00 0.00 ? 16 TYR A HH   3  
ATOM 1385 N N    . CYS A 1 17 ? 8.111   -2.301  11.764 1.00 0.00 ? 17 CYS A N    3  
ATOM 1386 C CA   . CYS A 1 17 ? 7.064   -3.108  11.150 1.00 0.00 ? 17 CYS A CA   3  
ATOM 1387 C C    . CYS A 1 17 ? 5.830   -3.171  12.047 1.00 0.00 ? 17 CYS A C    3  
ATOM 1388 O O    . CYS A 1 17 ? 5.941   -3.360  13.257 1.00 0.00 ? 17 CYS A O    3  
ATOM 1389 C CB   . CYS A 1 17 ? 7.577   -4.522  10.871 1.00 0.00 ? 17 CYS A CB   3  
ATOM 1390 S SG   . CYS A 1 17 ? 8.208   -4.763  9.179  1.00 0.00 ? 17 CYS A SG   3  
ATOM 1391 H H    . CYS A 1 17 ? 8.790   -2.741  12.319 1.00 0.00 ? 17 CYS A H    3  
ATOM 1392 H HA   . CYS A 1 17 ? 6.790   -2.643  10.215 1.00 0.00 ? 17 CYS A HA   3  
ATOM 1393 H HB2  . CYS A 1 17 ? 8.383   -4.745  11.556 1.00 0.00 ? 17 CYS A HB2  3  
ATOM 1394 H HB3  . CYS A 1 17 ? 6.774   -5.226  11.026 1.00 0.00 ? 17 CYS A HB3  3  
ATOM 1395 N N    . GLU A 1 18 ? 4.657   -3.012  11.442 1.00 0.00 ? 18 GLU A N    3  
ATOM 1396 C CA   . GLU A 1 18 ? 3.404   -3.050  12.186 1.00 0.00 ? 18 GLU A CA   3  
ATOM 1397 C C    . GLU A 1 18 ? 2.289   -3.664  11.343 1.00 0.00 ? 18 GLU A C    3  
ATOM 1398 O O    . GLU A 1 18 ? 1.726   -3.010  10.467 1.00 0.00 ? 18 GLU A O    3  
ATOM 1399 C CB   . GLU A 1 18 ? 3.005   -1.641  12.630 1.00 0.00 ? 18 GLU A CB   3  
ATOM 1400 C CG   . GLU A 1 18 ? 1.997   -1.623  13.766 1.00 0.00 ? 18 GLU A CG   3  
ATOM 1401 C CD   . GLU A 1 18 ? 2.111   -2.839  14.666 1.00 0.00 ? 18 GLU A CD   3  
ATOM 1402 O OE1  . GLU A 1 18 ? 2.870   -2.774  15.656 1.00 0.00 ? 18 GLU A OE1  3  
ATOM 1403 O OE2  . GLU A 1 18 ? 1.442   -3.854  14.381 1.00 0.00 ? 18 GLU A OE2  3  
ATOM 1404 H H    . GLU A 1 18 ? 4.634   -2.864  10.474 1.00 0.00 ? 18 GLU A H    3  
ATOM 1405 H HA   . GLU A 1 18 ? 3.556   -3.663  13.061 1.00 0.00 ? 18 GLU A HA   3  
ATOM 1406 H HB2  . GLU A 1 18 ? 3.890   -1.114  12.953 1.00 0.00 ? 18 GLU A HB2  3  
ATOM 1407 H HB3  . GLU A 1 18 ? 2.574   -1.120  11.787 1.00 0.00 ? 18 GLU A HB3  3  
ATOM 1408 H HG2  . GLU A 1 18 ? 2.160   -0.738  14.362 1.00 0.00 ? 18 GLU A HG2  3  
ATOM 1409 H HG3  . GLU A 1 18 ? 1.001   -1.596  13.348 1.00 0.00 ? 18 GLU A HG3  3  
ATOM 1410 N N    . GLY A 1 19 ? 1.977   -4.928  11.616 1.00 0.00 ? 19 GLY A N    3  
ATOM 1411 C CA   . GLY A 1 19 ? 0.933   -5.610  10.875 1.00 0.00 ? 19 GLY A CA   3  
ATOM 1412 C C    . GLY A 1 19 ? -0.428  -5.468  11.527 1.00 0.00 ? 19 GLY A C    3  
ATOM 1413 O O    . GLY A 1 19 ? -1.387  -6.127  11.127 1.00 0.00 ? 19 GLY A O    3  
ATOM 1414 H H    . GLY A 1 19 ? 2.461   -5.400  12.326 1.00 0.00 ? 19 GLY A H    3  
ATOM 1415 H HA2  . GLY A 1 19 ? 0.887   -5.200  9.877  1.00 0.00 ? 19 GLY A HA2  3  
ATOM 1416 H HA3  . GLY A 1 19 ? 1.180   -6.660  10.810 1.00 0.00 ? 19 GLY A HA3  3  
ATOM 1417 N N    . ALA A 1 20 ? -0.512  -4.607  12.535 1.00 0.00 ? 20 ALA A N    3  
ATOM 1418 C CA   . ALA A 1 20 ? -1.766  -4.380  13.243 1.00 0.00 ? 20 ALA A CA   3  
ATOM 1419 C C    . ALA A 1 20 ? -2.018  -2.890  13.451 1.00 0.00 ? 20 ALA A C    3  
ATOM 1420 O O    . ALA A 1 20 ? -2.860  -2.294  12.779 1.00 0.00 ? 20 ALA A O    3  
ATOM 1421 C CB   . ALA A 1 20 ? -1.755  -5.106  14.580 1.00 0.00 ? 20 ALA A CB   3  
ATOM 1422 H H    . ALA A 1 20 ? 0.287   -4.111  12.808 1.00 0.00 ? 20 ALA A H    3  
ATOM 1423 H HA   . ALA A 1 20 ? -2.566  -4.790  12.645 1.00 0.00 ? 20 ALA A HA   3  
ATOM 1424 H HB1  . ALA A 1 20 ? -0.960  -4.712  15.197 1.00 0.00 ? 20 ALA A HB1  3  
ATOM 1425 H HB2  . ALA A 1 20 ? -2.703  -4.960  15.077 1.00 0.00 ? 20 ALA A HB2  3  
ATOM 1426 H HB3  . ALA A 1 20 ? -1.594  -6.161  14.415 1.00 0.00 ? 20 ALA A HB3  3  
ATOM 1427 N N    . ARG A 1 21 ? -1.283  -2.295  14.384 1.00 0.00 ? 21 ARG A N    3  
ATOM 1428 C CA   . ARG A 1 21 ? -1.429  -0.875  14.681 1.00 0.00 ? 21 ARG A CA   3  
ATOM 1429 C C    . ARG A 1 21 ? -0.201  -0.344  15.414 1.00 0.00 ? 21 ARG A C    3  
ATOM 1430 O O    . ARG A 1 21 ? 0.381   -1.033  16.253 1.00 0.00 ? 21 ARG A O    3  
ATOM 1431 C CB   . ARG A 1 21 ? -2.683  -0.634  15.523 1.00 0.00 ? 21 ARG A CB   3  
ATOM 1432 C CG   . ARG A 1 21 ? -3.701  0.275   14.853 1.00 0.00 ? 21 ARG A CG   3  
ATOM 1433 C CD   . ARG A 1 21 ? -3.850  1.591   15.601 1.00 0.00 ? 21 ARG A CD   3  
ATOM 1434 N NE   . ARG A 1 21 ? -4.890  1.524   16.624 1.00 0.00 ? 21 ARG A NE   3  
ATOM 1435 C CZ   . ARG A 1 21 ? -4.999  2.397   17.619 1.00 0.00 ? 21 ARG A CZ   3  
ATOM 1436 N NH1  . ARG A 1 21 ? -4.136  3.398   17.724 1.00 0.00 ? 21 ARG A NH1  3  
ATOM 1437 N NH2  . ARG A 1 21 ? -5.973  2.270   18.511 1.00 0.00 ? 21 ARG A NH2  3  
ATOM 1438 H H    . ARG A 1 21 ? -0.628  -2.823  14.886 1.00 0.00 ? 21 ARG A H    3  
ATOM 1439 H HA   . ARG A 1 21 ? -1.529  -0.349  13.743 1.00 0.00 ? 21 ARG A HA   3  
ATOM 1440 H HB2  . ARG A 1 21 ? -3.157  -1.584  15.721 1.00 0.00 ? 21 ARG A HB2  3  
ATOM 1441 H HB3  . ARG A 1 21 ? -2.392  -0.183  16.459 1.00 0.00 ? 21 ARG A HB3  3  
ATOM 1442 H HG2  . ARG A 1 21 ? -3.376  0.482   13.844 1.00 0.00 ? 21 ARG A HG2  3  
ATOM 1443 H HG3  . ARG A 1 21 ? -4.657  -0.227  14.830 1.00 0.00 ? 21 ARG A HG3  3  
ATOM 1444 H HD2  . ARG A 1 21 ? -2.909  1.830   16.073 1.00 0.00 ? 21 ARG A HD2  3  
ATOM 1445 H HD3  . ARG A 1 21 ? -4.104  2.365   14.892 1.00 0.00 ? 21 ARG A HD3  3  
ATOM 1446 H HE   . ARG A 1 21 ? -5.538  0.792   16.565 1.00 0.00 ? 21 ARG A HE   3  
ATOM 1447 H HH11 . ARG A 1 21 ? -3.402  3.497   17.053 1.00 0.00 ? 21 ARG A HH11 3  
ATOM 1448 H HH12 . ARG A 1 21 ? -4.221  4.055   18.474 1.00 0.00 ? 21 ARG A HH12 3  
ATOM 1449 H HH21 . ARG A 1 21 ? -6.625  1.516   18.435 1.00 0.00 ? 21 ARG A HH21 3  
ATOM 1450 H HH22 . ARG A 1 21 ? -6.054  2.927   19.260 1.00 0.00 ? 21 ARG A HH22 3  
ATOM 1451 N N    . CYS A 1 22 ? 0.189   0.885   15.093 1.00 0.00 ? 22 CYS A N    3  
ATOM 1452 C CA   . CYS A 1 22 ? 1.348   1.509   15.720 1.00 0.00 ? 22 CYS A CA   3  
ATOM 1453 C C    . CYS A 1 22 ? 1.148   1.635   17.227 1.00 0.00 ? 22 CYS A C    3  
ATOM 1454 O O    . CYS A 1 22 ? 0.038   1.879   17.698 1.00 0.00 ? 22 CYS A O    3  
ATOM 1455 C CB   . CYS A 1 22 ? 1.602   2.890   15.111 1.00 0.00 ? 22 CYS A CB   3  
ATOM 1456 S SG   . CYS A 1 22 ? 1.631   2.905   13.289 1.00 0.00 ? 22 CYS A SG   3  
ATOM 1457 H H    . CYS A 1 22 ? -0.315  1.385   14.416 1.00 0.00 ? 22 CYS A H    3  
ATOM 1458 H HA   . CYS A 1 22 ? 2.205   0.880   15.534 1.00 0.00 ? 22 CYS A HA   3  
ATOM 1459 H HB2  . CYS A 1 22 ? 0.822   3.565   15.431 1.00 0.00 ? 22 CYS A HB2  3  
ATOM 1460 H HB3  . CYS A 1 22 ? 2.555   3.258   15.458 1.00 0.00 ? 22 CYS A HB3  3  
ATOM 1461 N N    . GLU A 1 23 ? 2.233   1.468   17.978 1.00 0.00 ? 23 GLU A N    3  
ATOM 1462 C CA   . GLU A 1 23 ? 2.176   1.562   19.432 1.00 0.00 ? 23 GLU A CA   3  
ATOM 1463 C C    . GLU A 1 23 ? 1.947   3.005   19.875 1.00 0.00 ? 23 GLU A C    3  
ATOM 1464 O O    . GLU A 1 23 ? 2.114   3.940   19.092 1.00 0.00 ? 23 GLU A O    3  
ATOM 1465 C CB   . GLU A 1 23 ? 3.469   1.027   20.051 1.00 0.00 ? 23 GLU A CB   3  
ATOM 1466 C CG   . GLU A 1 23 ? 3.859   -0.353  19.548 1.00 0.00 ? 23 GLU A CG   3  
ATOM 1467 C CD   . GLU A 1 23 ? 4.012   -1.361  20.670 1.00 0.00 ? 23 GLU A CD   3  
ATOM 1468 O OE1  . GLU A 1 23 ? 3.276   -2.371  20.663 1.00 0.00 ? 23 GLU A OE1  3  
ATOM 1469 O OE2  . GLU A 1 23 ? 4.865   -1.141  21.554 1.00 0.00 ? 23 GLU A OE2  3  
ATOM 1470 H H    . GLU A 1 23 ? 3.090   1.276   17.544 1.00 0.00 ? 23 GLU A H    3  
ATOM 1471 H HA   . GLU A 1 23 ? 1.349   0.958   19.772 1.00 0.00 ? 23 GLU A HA   3  
ATOM 1472 H HB2  . GLU A 1 23 ? 4.273   1.711   19.824 1.00 0.00 ? 23 GLU A HB2  3  
ATOM 1473 H HB3  . GLU A 1 23 ? 3.346   0.974   21.123 1.00 0.00 ? 23 GLU A HB3  3  
ATOM 1474 H HG2  . GLU A 1 23 ? 3.095   -0.704  18.871 1.00 0.00 ? 23 GLU A HG2  3  
ATOM 1475 H HG3  . GLU A 1 23 ? 4.798   -0.278  19.021 1.00 0.00 ? 23 GLU A HG3  3  
ATOM 1476 N N    . SER A 1 24 ? 1.562   3.176   21.136 1.00 0.00 ? 24 SER A N    3  
ATOM 1477 C CA   . SER A 1 24 ? 1.305   4.503   21.682 1.00 0.00 ? 24 SER A CA   3  
ATOM 1478 C C    . SER A 1 24 ? 2.537   5.393   21.551 1.00 0.00 ? 24 SER A C    3  
ATOM 1479 O O    . SER A 1 24 ? 3.371   5.455   22.454 1.00 0.00 ? 24 SER A O    3  
ATOM 1480 C CB   . SER A 1 24 ? 0.889   4.401   23.151 1.00 0.00 ? 24 SER A CB   3  
ATOM 1481 O OG   . SER A 1 24 ? -0.500  4.635   23.306 1.00 0.00 ? 24 SER A OG   3  
ATOM 1482 H H    . SER A 1 24 ? 1.445   2.391   21.711 1.00 0.00 ? 24 SER A H    3  
ATOM 1483 H HA   . SER A 1 24 ? 0.496   4.943   21.118 1.00 0.00 ? 24 SER A HA   3  
ATOM 1484 H HB2  . SER A 1 24 ? 1.119   3.413   23.520 1.00 0.00 ? 24 SER A HB2  3  
ATOM 1485 H HB3  . SER A 1 24 ? 1.433   5.136   23.728 1.00 0.00 ? 24 SER A HB3  3  
ATOM 1486 H HG   . SER A 1 24 ? -0.728  5.480   22.911 1.00 0.00 ? 24 SER A HG   3  
ATOM 1487 N N    . GLY A 1 25 ? 2.645   6.081   20.419 1.00 0.00 ? 25 GLY A N    3  
ATOM 1488 C CA   . GLY A 1 25 ? 3.777   6.959   20.189 1.00 0.00 ? 25 GLY A CA   3  
ATOM 1489 C C    . GLY A 1 25 ? 4.182   7.012   18.729 1.00 0.00 ? 25 GLY A C    3  
ATOM 1490 O O    . GLY A 1 25 ? 4.693   8.027   18.256 1.00 0.00 ? 25 GLY A O    3  
ATOM 1491 H H    . GLY A 1 25 ? 1.949   5.993   19.734 1.00 0.00 ? 25 GLY A H    3  
ATOM 1492 H HA2  . GLY A 1 25 ? 3.520   7.955   20.517 1.00 0.00 ? 25 GLY A HA2  3  
ATOM 1493 H HA3  . GLY A 1 25 ? 4.616   6.605   20.770 1.00 0.00 ? 25 GLY A HA3  3  
ATOM 1494 N N    . PHE A 1 26 ? 3.956   5.916   18.013 1.00 0.00 ? 26 PHE A N    3  
ATOM 1495 C CA   . PHE A 1 26 ? 4.303   5.841   16.599 1.00 0.00 ? 26 PHE A CA   3  
ATOM 1496 C C    . PHE A 1 26 ? 3.094   6.161   15.724 1.00 0.00 ? 26 PHE A C    3  
ATOM 1497 O O    . PHE A 1 26 ? 1.964   6.230   16.209 1.00 0.00 ? 26 PHE A O    3  
ATOM 1498 C CB   . PHE A 1 26 ? 4.840   4.449   16.257 1.00 0.00 ? 26 PHE A CB   3  
ATOM 1499 C CG   . PHE A 1 26 ? 6.126   4.114   16.957 1.00 0.00 ? 26 PHE A CG   3  
ATOM 1500 C CD1  . PHE A 1 26 ? 6.147   3.878   18.322 1.00 0.00 ? 26 PHE A CD1  3  
ATOM 1501 C CD2  . PHE A 1 26 ? 7.315   4.037   16.249 1.00 0.00 ? 26 PHE A CD2  3  
ATOM 1502 C CE1  . PHE A 1 26 ? 7.329   3.569   18.969 1.00 0.00 ? 26 PHE A CE1  3  
ATOM 1503 C CE2  . PHE A 1 26 ? 8.500   3.728   16.891 1.00 0.00 ? 26 PHE A CE2  3  
ATOM 1504 C CZ   . PHE A 1 26 ? 8.507   3.496   18.252 1.00 0.00 ? 26 PHE A CZ   3  
ATOM 1505 H H    . PHE A 1 26 ? 3.545   5.138   18.447 1.00 0.00 ? 26 PHE A H    3  
ATOM 1506 H HA   . PHE A 1 26 ? 5.074   6.571   16.409 1.00 0.00 ? 26 PHE A HA   3  
ATOM 1507 H HB2  . PHE A 1 26 ? 4.107   3.709   16.540 1.00 0.00 ? 26 PHE A HB2  3  
ATOM 1508 H HB3  . PHE A 1 26 ? 5.014   4.390   15.193 1.00 0.00 ? 26 PHE A HB3  3  
ATOM 1509 H HD1  . PHE A 1 26 ? 5.225   3.936   18.884 1.00 0.00 ? 26 PHE A HD1  3  
ATOM 1510 H HD2  . PHE A 1 26 ? 7.312   4.220   15.185 1.00 0.00 ? 26 PHE A HD2  3  
ATOM 1511 H HE1  . PHE A 1 26 ? 7.330   3.388   20.033 1.00 0.00 ? 26 PHE A HE1  3  
ATOM 1512 H HE2  . PHE A 1 26 ? 9.420   3.671   16.328 1.00 0.00 ? 26 PHE A HE2  3  
ATOM 1513 H HZ   . PHE A 1 26 ? 9.431   3.254   18.755 1.00 0.00 ? 26 PHE A HZ   3  
ATOM 1514 N N    . HIS A 1 27 ? 3.341   6.355   14.433 1.00 0.00 ? 27 HIS A N    3  
ATOM 1515 C CA   . HIS A 1 27 ? 2.274   6.668   13.489 1.00 0.00 ? 27 HIS A CA   3  
ATOM 1516 C C    . HIS A 1 27 ? 2.343   5.756   12.268 1.00 0.00 ? 27 HIS A C    3  
ATOM 1517 O O    . HIS A 1 27 ? 3.425   5.466   11.759 1.00 0.00 ? 27 HIS A O    3  
ATOM 1518 C CB   . HIS A 1 27 ? 2.362   8.131   13.053 1.00 0.00 ? 27 HIS A CB   3  
ATOM 1519 C CG   . HIS A 1 27 ? 3.766   8.609   12.842 1.00 0.00 ? 27 HIS A CG   3  
ATOM 1520 N ND1  . HIS A 1 27 ? 4.476   9.304   13.797 1.00 0.00 ? 27 HIS A ND1  3  
ATOM 1521 C CD2  . HIS A 1 27 ? 4.592   8.486   11.776 1.00 0.00 ? 27 HIS A CD2  3  
ATOM 1522 C CE1  . HIS A 1 27 ? 5.678   9.590   13.328 1.00 0.00 ? 27 HIS A CE1  3  
ATOM 1523 N NE2  . HIS A 1 27 ? 5.774   9.104   12.104 1.00 0.00 ? 27 HIS A NE2  3  
ATOM 1524 H H    . HIS A 1 27 ? 4.262   6.286   14.107 1.00 0.00 ? 27 HIS A H    3  
ATOM 1525 H HA   . HIS A 1 27 ? 1.331   6.508   13.990 1.00 0.00 ? 27 HIS A HA   3  
ATOM 1526 H HB2  . HIS A 1 27 ? 1.827   8.256   12.124 1.00 0.00 ? 27 HIS A HB2  3  
ATOM 1527 H HB3  . HIS A 1 27 ? 1.909   8.754   13.811 1.00 0.00 ? 27 HIS A HB3  3  
ATOM 1528 H HD1  . HIS A 1 27 ? 4.148   9.552   14.686 1.00 0.00 ? 27 HIS A HD1  3  
ATOM 1529 H HD2  . HIS A 1 27 ? 4.364   7.994   10.841 1.00 0.00 ? 27 HIS A HD2  3  
ATOM 1530 H HE1  . HIS A 1 27 ? 6.451   10.129  13.856 1.00 0.00 ? 27 HIS A HE1  3  
ATOM 1531 N N    . ASP A 1 28 ? 1.182   5.307   11.805 1.00 0.00 ? 28 ASP A N    3  
ATOM 1532 C CA   . ASP A 1 28 ? 1.110   4.427   10.644 1.00 0.00 ? 28 ASP A CA   3  
ATOM 1533 C C    . ASP A 1 28 ? 1.588   5.147   9.387  1.00 0.00 ? 28 ASP A C    3  
ATOM 1534 O O    . ASP A 1 28 ? 0.952   6.093   8.921  1.00 0.00 ? 28 ASP A O    3  
ATOM 1535 C CB   . ASP A 1 28 ? -0.320  3.923   10.446 1.00 0.00 ? 28 ASP A CB   3  
ATOM 1536 C CG   . ASP A 1 28 ? -0.553  3.374   9.053  1.00 0.00 ? 28 ASP A CG   3  
ATOM 1537 O OD1  . ASP A 1 28 ? -1.588  3.718   8.444  1.00 0.00 ? 28 ASP A OD1  3  
ATOM 1538 O OD2  . ASP A 1 28 ? 0.300   2.601   8.570  1.00 0.00 ? 28 ASP A OD2  3  
ATOM 1539 H H    . ASP A 1 28 ? 0.352   5.573   12.255 1.00 0.00 ? 28 ASP A H    3  
ATOM 1540 H HA   . ASP A 1 28 ? 1.757   3.582   10.828 1.00 0.00 ? 28 ASP A HA   3  
ATOM 1541 H HB2  . ASP A 1 28 ? -0.521  3.138   11.161 1.00 0.00 ? 28 ASP A HB2  3  
ATOM 1542 H HB3  . ASP A 1 28 ? -1.008  4.739   10.612 1.00 0.00 ? 28 ASP A HB3  3  
ATOM 1543 N N    . CYS A 1 29 ? 2.712   4.693   8.843  1.00 0.00 ? 29 CYS A N    3  
ATOM 1544 C CA   . CYS A 1 29 ? 3.277   5.294   7.641  1.00 0.00 ? 29 CYS A CA   3  
ATOM 1545 C C    . CYS A 1 29 ? 3.376   4.269   6.515  1.00 0.00 ? 29 CYS A C    3  
ATOM 1546 O O    . CYS A 1 29 ? 4.220   4.384   5.628  1.00 0.00 ? 29 CYS A O    3  
ATOM 1547 C CB   . CYS A 1 29 ? 4.660   5.876   7.938  1.00 0.00 ? 29 CYS A CB   3  
ATOM 1548 S SG   . CYS A 1 29 ? 5.734   4.778   8.917  1.00 0.00 ? 29 CYS A SG   3  
ATOM 1549 H H    . CYS A 1 29 ? 3.174   3.935   9.260  1.00 0.00 ? 29 CYS A H    3  
ATOM 1550 H HA   . CYS A 1 29 ? 2.620   6.092   7.328  1.00 0.00 ? 29 CYS A HA   3  
ATOM 1551 H HB2  . CYS A 1 29 ? 5.165   6.080   7.004  1.00 0.00 ? 29 CYS A HB2  3  
ATOM 1552 H HB3  . CYS A 1 29 ? 4.544   6.799   8.487  1.00 0.00 ? 29 CYS A HB3  3  
ATOM 1553 N N    . GLY A 1 30 ? 2.505   3.265   6.558  1.00 0.00 ? 30 GLY A N    3  
ATOM 1554 C CA   . GLY A 1 30 ? 2.510   2.234   5.537  1.00 0.00 ? 30 GLY A CA   3  
ATOM 1555 C C    . GLY A 1 30 ? 2.362   2.801   4.139  1.00 0.00 ? 30 GLY A C    3  
ATOM 1556 O O    . GLY A 1 30 ? 2.543   2.090   3.151  1.00 0.00 ? 30 GLY A O    3  
ATOM 1557 H H    . GLY A 1 30 ? 1.854   3.224   7.290  1.00 0.00 ? 30 GLY A H    3  
ATOM 1558 H HA2  . GLY A 1 30 ? 3.440   1.688   5.596  1.00 0.00 ? 30 GLY A HA2  3  
ATOM 1559 H HA3  . GLY A 1 30 ? 1.693   1.553   5.725  1.00 0.00 ? 30 GLY A HA3  3  
ATOM 1560 N N    . SER A 1 31 ? 2.031   4.086   4.056  1.00 0.00 ? 31 SER A N    3  
ATOM 1561 C CA   . SER A 1 31 ? 1.854   4.747   2.768  1.00 0.00 ? 31 SER A CA   3  
ATOM 1562 C C    . SER A 1 31 ? 2.967   4.359   1.800  1.00 0.00 ? 31 SER A C    3  
ATOM 1563 O O    . SER A 1 31 ? 2.750   3.590   0.863  1.00 0.00 ? 31 SER A O    3  
ATOM 1564 C CB   . SER A 1 31 ? 1.827   6.266   2.951  1.00 0.00 ? 31 SER A CB   3  
ATOM 1565 O OG   . SER A 1 31 ? 0.507   6.769   2.844  1.00 0.00 ? 31 SER A OG   3  
ATOM 1566 H H    . SER A 1 31 ? 1.901   4.600   4.880  1.00 0.00 ? 31 SER A H    3  
ATOM 1567 H HA   . SER A 1 31 ? 0.908   4.426   2.358  1.00 0.00 ? 31 SER A HA   3  
ATOM 1568 H HB2  . SER A 1 31 ? 2.217   6.516   3.926  1.00 0.00 ? 31 SER A HB2  3  
ATOM 1569 H HB3  . SER A 1 31 ? 2.439   6.728   2.189  1.00 0.00 ? 31 SER A HB3  3  
ATOM 1570 H HG   . SER A 1 31 ? 0.486   7.480   2.199  1.00 0.00 ? 31 SER A HG   3  
ATOM 1571 N N    . ASP A 1 32 ? 4.159   4.897   2.033  1.00 0.00 ? 32 ASP A N    3  
ATOM 1572 C CA   . ASP A 1 32 ? 5.308   4.607   1.183  1.00 0.00 ? 32 ASP A CA   3  
ATOM 1573 C C    . ASP A 1 32 ? 6.307   3.711   1.907  1.00 0.00 ? 32 ASP A C    3  
ATOM 1574 O O    . ASP A 1 32 ? 7.515   3.802   1.682  1.00 0.00 ? 32 ASP A O    3  
ATOM 1575 C CB   . ASP A 1 32 ? 5.989   5.907   0.750  1.00 0.00 ? 32 ASP A CB   3  
ATOM 1576 C CG   . ASP A 1 32 ? 5.927   6.978   1.821  1.00 0.00 ? 32 ASP A CG   3  
ATOM 1577 O OD1  . ASP A 1 32 ? 6.076   6.635   3.013  1.00 0.00 ? 32 ASP A OD1  3  
ATOM 1578 O OD2  . ASP A 1 32 ? 5.730   8.159   1.468  1.00 0.00 ? 32 ASP A OD2  3  
ATOM 1579 H H    . ASP A 1 32 ? 4.269   5.503   2.796  1.00 0.00 ? 32 ASP A H    3  
ATOM 1580 H HA   . ASP A 1 32 ? 4.949   4.090   0.306  1.00 0.00 ? 32 ASP A HA   3  
ATOM 1581 H HB2  . ASP A 1 32 ? 7.027   5.705   0.529  1.00 0.00 ? 32 ASP A HB2  3  
ATOM 1582 H HB3  . ASP A 1 32 ? 5.503   6.282   -0.138 1.00 0.00 ? 32 ASP A HB3  3  
ATOM 1583 N N    . HIS A 1 33 ? 5.796   2.846   2.777  1.00 0.00 ? 33 HIS A N    3  
ATOM 1584 C CA   . HIS A 1 33 ? 6.645   1.932   3.535  1.00 0.00 ? 33 HIS A CA   3  
ATOM 1585 C C    . HIS A 1 33 ? 5.916   0.622   3.817  1.00 0.00 ? 33 HIS A C    3  
ATOM 1586 O O    . HIS A 1 33 ? 4.865   0.611   4.457  1.00 0.00 ? 33 HIS A O    3  
ATOM 1587 C CB   . HIS A 1 33 ? 7.081   2.580   4.849  1.00 0.00 ? 33 HIS A CB   3  
ATOM 1588 C CG   . HIS A 1 33 ? 7.678   3.943   4.677  1.00 0.00 ? 33 HIS A CG   3  
ATOM 1589 N ND1  . HIS A 1 33 ? 7.197   5.063   5.321  1.00 0.00 ? 33 HIS A ND1  3  
ATOM 1590 C CD2  . HIS A 1 33 ? 8.725   4.362   3.927  1.00 0.00 ? 33 HIS A CD2  3  
ATOM 1591 C CE1  . HIS A 1 33 ? 7.921   6.112   4.975  1.00 0.00 ? 33 HIS A CE1  3  
ATOM 1592 N NE2  . HIS A 1 33 ? 8.855   5.714   4.130  1.00 0.00 ? 33 HIS A NE2  3  
ATOM 1593 H H    . HIS A 1 33 ? 4.826   2.821   2.912  1.00 0.00 ? 33 HIS A H    3  
ATOM 1594 H HA   . HIS A 1 33 ? 7.520   1.722   2.940  1.00 0.00 ? 33 HIS A HA   3  
ATOM 1595 H HB2  . HIS A 1 33 ? 6.223   2.675   5.498  1.00 0.00 ? 33 HIS A HB2  3  
ATOM 1596 H HB3  . HIS A 1 33 ? 7.819   1.951   5.326  1.00 0.00 ? 33 HIS A HB3  3  
ATOM 1597 H HD1  . HIS A 1 33 ? 6.438   5.085   5.939  1.00 0.00 ? 33 HIS A HD1  3  
ATOM 1598 H HD2  . HIS A 1 33 ? 9.344   3.747   3.288  1.00 0.00 ? 33 HIS A HD2  3  
ATOM 1599 H HE1  . HIS A 1 33 ? 7.775   7.124   5.323  1.00 0.00 ? 33 HIS A HE1  3  
ATOM 1600 N N    . TRP A 1 34 ? 6.481   -0.479  3.335  1.00 0.00 ? 34 TRP A N    3  
ATOM 1601 C CA   . TRP A 1 34 ? 5.884   -1.795  3.535  1.00 0.00 ? 34 TRP A CA   3  
ATOM 1602 C C    . TRP A 1 34 ? 6.820   -2.703  4.324  1.00 0.00 ? 34 TRP A C    3  
ATOM 1603 O O    . TRP A 1 34 ? 7.985   -2.370  4.544  1.00 0.00 ? 34 TRP A O    3  
ATOM 1604 C CB   . TRP A 1 34 ? 5.549   -2.435  2.187  1.00 0.00 ? 34 TRP A CB   3  
ATOM 1605 C CG   . TRP A 1 34 ? 6.484   -2.030  1.087  1.00 0.00 ? 34 TRP A CG   3  
ATOM 1606 C CD1  . TRP A 1 34 ? 6.164   -1.345  -0.050 1.00 0.00 ? 34 TRP A CD1  3  
ATOM 1607 C CD2  . TRP A 1 34 ? 7.891   -2.287  1.021  1.00 0.00 ? 34 TRP A CD2  3  
ATOM 1608 N NE1  . TRP A 1 34 ? 7.287   -1.161  -0.819 1.00 0.00 ? 34 TRP A NE1  3  
ATOM 1609 C CE2  . TRP A 1 34 ? 8.360   -1.728  -0.184 1.00 0.00 ? 34 TRP A CE2  3  
ATOM 1610 C CE3  . TRP A 1 34 ? 8.800   -2.932  1.863  1.00 0.00 ? 34 TRP A CE3  3  
ATOM 1611 C CZ2  . TRP A 1 34 ? 9.697   -1.798  -0.566 1.00 0.00 ? 34 TRP A CZ2  3  
ATOM 1612 C CZ3  . TRP A 1 34 ? 10.127  -3.001  1.483  1.00 0.00 ? 34 TRP A CZ3  3  
ATOM 1613 C CH2  . TRP A 1 34 ? 10.565  -2.436  0.278  1.00 0.00 ? 34 TRP A CH2  3  
ATOM 1614 H H    . TRP A 1 34 ? 7.320   -0.406  2.832  1.00 0.00 ? 34 TRP A H    3  
ATOM 1615 H HA   . TRP A 1 34 ? 4.971   -1.662  4.097  1.00 0.00 ? 34 TRP A HA   3  
ATOM 1616 H HB2  . TRP A 1 34 ? 5.594   -3.509  2.284  1.00 0.00 ? 34 TRP A HB2  3  
ATOM 1617 H HB3  . TRP A 1 34 ? 4.549   -2.146  1.898  1.00 0.00 ? 34 TRP A HB3  3  
ATOM 1618 H HD1  . TRP A 1 34 ? 5.169   -1.006  -0.296 1.00 0.00 ? 34 TRP A HD1  3  
ATOM 1619 H HE1  . TRP A 1 34 ? 7.315   -0.696  -1.682 1.00 0.00 ? 34 TRP A HE1  3  
ATOM 1620 H HE3  . TRP A 1 34 ? 8.481   -3.374  2.796  1.00 0.00 ? 34 TRP A HE3  3  
ATOM 1621 H HZ2  . TRP A 1 34 ? 10.051  -1.367  -1.491 1.00 0.00 ? 34 TRP A HZ2  3  
ATOM 1622 H HZ3  . TRP A 1 34 ? 10.844  -3.496  2.121  1.00 0.00 ? 34 TRP A HZ3  3  
ATOM 1623 H HH2  . TRP A 1 34 ? 11.611  -2.514  0.021  1.00 0.00 ? 34 TRP A HH2  3  
ATOM 1624 N N    . CYS A 1 35 ? 6.305   -3.852  4.748  1.00 0.00 ? 35 CYS A N    3  
ATOM 1625 C CA   . CYS A 1 35 ? 7.094   -4.809  5.514  1.00 0.00 ? 35 CYS A CA   3  
ATOM 1626 C C    . CYS A 1 35 ? 7.462   -6.018  4.659  1.00 0.00 ? 35 CYS A C    3  
ATOM 1627 O O    . CYS A 1 35 ? 7.127   -6.080  3.476  1.00 0.00 ? 35 CYS A O    3  
ATOM 1628 C CB   . CYS A 1 35 ? 6.322   -5.263  6.754  1.00 0.00 ? 35 CYS A CB   3  
ATOM 1629 S SG   . CYS A 1 35 ? 6.459   -4.128  8.172  1.00 0.00 ? 35 CYS A SG   3  
ATOM 1630 H H    . CYS A 1 35 ? 5.369   -4.062  4.541  1.00 0.00 ? 35 CYS A H    3  
ATOM 1631 H HA   . CYS A 1 35 ? 8.002   -4.315  5.826  1.00 0.00 ? 35 CYS A HA   3  
ATOM 1632 H HB2  . CYS A 1 35 ? 5.275   -5.350  6.504  1.00 0.00 ? 35 CYS A HB2  3  
ATOM 1633 H HB3  . CYS A 1 35 ? 6.694   -6.227  7.067  1.00 0.00 ? 35 CYS A HB3  3  
ATOM 1634 N N    . ASP A 1 36 ? 8.152   -6.977  5.266  1.00 0.00 ? 36 ASP A N    3  
ATOM 1635 C CA   . ASP A 1 36 ? 8.565   -8.185  4.562  1.00 0.00 ? 36 ASP A CA   3  
ATOM 1636 C C    . ASP A 1 36 ? 7.420   -8.742  3.721  1.00 0.00 ? 36 ASP A C    3  
ATOM 1637 O O    . ASP A 1 36 ? 7.614   -9.131  2.570  1.00 0.00 ? 36 ASP A O    3  
ATOM 1638 C CB   . ASP A 1 36 ? 9.044   -9.243  5.557  1.00 0.00 ? 36 ASP A CB   3  
ATOM 1639 C CG   . ASP A 1 36 ? 10.531  -9.146  5.834  1.00 0.00 ? 36 ASP A CG   3  
ATOM 1640 O OD1  . ASP A 1 36 ? 10.902  -8.697  6.939  1.00 0.00 ? 36 ASP A OD1  3  
ATOM 1641 O OD2  . ASP A 1 36 ? 11.325  -9.519  4.945  1.00 0.00 ? 36 ASP A OD2  3  
ATOM 1642 H H    . ASP A 1 36 ? 8.390   -6.869  6.211  1.00 0.00 ? 36 ASP A H    3  
ATOM 1643 H HA   . ASP A 1 36 ? 9.382   -7.925  3.906  1.00 0.00 ? 36 ASP A HA   3  
ATOM 1644 H HB2  . ASP A 1 36 ? 8.515   -9.116  6.491  1.00 0.00 ? 36 ASP A HB2  3  
ATOM 1645 H HB3  . ASP A 1 36 ? 8.833   -10.224 5.159  1.00 0.00 ? 36 ASP A HB3  3  
ATOM 1646 N N    . ALA A 1 37 ? 6.227   -8.777  4.306  1.00 0.00 ? 37 ALA A N    3  
ATOM 1647 C CA   . ALA A 1 37 ? 5.051   -9.285  3.610  1.00 0.00 ? 37 ALA A CA   3  
ATOM 1648 C C    . ALA A 1 37 ? 4.216   -8.145  3.037  1.00 0.00 ? 37 ALA A C    3  
ATOM 1649 O O    . ALA A 1 37 ? 4.105   -7.079  3.643  1.00 0.00 ? 37 ALA A O    3  
ATOM 1650 C CB   . ALA A 1 37 ? 4.209   -10.137 4.549  1.00 0.00 ? 37 ALA A CB   3  
ATOM 1651 H H    . ALA A 1 37 ? 6.135   -8.453  5.225  1.00 0.00 ? 37 ALA A H    3  
ATOM 1652 H HA   . ALA A 1 37 ? 5.388   -9.914  2.799  1.00 0.00 ? 37 ALA A HA   3  
ATOM 1653 H HB1  . ALA A 1 37 ? 3.842   -9.523  5.359  1.00 0.00 ? 37 ALA A HB1  3  
ATOM 1654 H HB2  . ALA A 1 37 ? 3.374   -10.554 4.006  1.00 0.00 ? 37 ALA A HB2  3  
ATOM 1655 H HB3  . ALA A 1 37 ? 4.814   -10.936 4.950  1.00 0.00 ? 37 ALA A HB3  3  
ATOM 1656 N N    . SER A 1 38 ? 3.633   -8.375  1.865  1.00 0.00 ? 38 SER A N    3  
ATOM 1657 C CA   . SER A 1 38 ? 2.812   -7.365  1.208  1.00 0.00 ? 38 SER A CA   3  
ATOM 1658 C C    . SER A 1 38 ? 1.486   -7.182  1.940  1.00 0.00 ? 38 SER A C    3  
ATOM 1659 O O    . SER A 1 38 ? 0.426   -7.114  1.319  1.00 0.00 ? 38 SER A O    3  
ATOM 1660 C CB   . SER A 1 38 ? 2.554   -7.756  -0.249 1.00 0.00 ? 38 SER A CB   3  
ATOM 1661 O OG   . SER A 1 38 ? 1.607   -8.806  -0.335 1.00 0.00 ? 38 SER A OG   3  
ATOM 1662 H H    . SER A 1 38 ? 3.760   -9.245  1.431  1.00 0.00 ? 38 SER A H    3  
ATOM 1663 H HA   . SER A 1 38 ? 3.355   -6.432  1.230  1.00 0.00 ? 38 SER A HA   3  
ATOM 1664 H HB2  . SER A 1 38 ? 2.175   -6.900  -0.786 1.00 0.00 ? 38 SER A HB2  3  
ATOM 1665 H HB3  . SER A 1 38 ? 3.480   -8.083  -0.700 1.00 0.00 ? 38 SER A HB3  3  
ATOM 1666 H HG   . SER A 1 38 ? 1.884   -9.433  -1.006 1.00 0.00 ? 38 SER A HG   3  
ATOM 1667 N N    . GLY A 1 39 ? 1.555   -7.102  3.265  1.00 0.00 ? 39 GLY A N    3  
ATOM 1668 C CA   . GLY A 1 39 ? 0.354   -6.927  4.061  1.00 0.00 ? 39 GLY A CA   3  
ATOM 1669 C C    . GLY A 1 39 ? 0.614   -6.159  5.341  1.00 0.00 ? 39 GLY A C    3  
ATOM 1670 O O    . GLY A 1 39 ? -0.309  -5.603  5.938  1.00 0.00 ? 39 GLY A O    3  
ATOM 1671 H H    . GLY A 1 39 ? 2.428   -7.162  3.706  1.00 0.00 ? 39 GLY A H    3  
ATOM 1672 H HA2  . GLY A 1 39 ? -0.379  -6.394  3.475  1.00 0.00 ? 39 GLY A HA2  3  
ATOM 1673 H HA3  . GLY A 1 39 ? -0.041  -7.901  4.314  1.00 0.00 ? 39 GLY A HA3  3  
ATOM 1674 N N    . ASP A 1 40 ? 1.872   -6.127  5.766  1.00 0.00 ? 40 ASP A N    3  
ATOM 1675 C CA   . ASP A 1 40 ? 2.251   -5.421  6.984  1.00 0.00 ? 40 ASP A CA   3  
ATOM 1676 C C    . ASP A 1 40 ? 2.669   -3.987  6.674  1.00 0.00 ? 40 ASP A C    3  
ATOM 1677 O O    . ASP A 1 40 ? 3.498   -3.748  5.796  1.00 0.00 ? 40 ASP A O    3  
ATOM 1678 C CB   . ASP A 1 40 ? 3.390   -6.156  7.692  1.00 0.00 ? 40 ASP A CB   3  
ATOM 1679 C CG   . ASP A 1 40 ? 2.888   -7.169  8.701  1.00 0.00 ? 40 ASP A CG   3  
ATOM 1680 O OD1  . ASP A 1 40 ? 3.383   -7.161  9.847  1.00 0.00 ? 40 ASP A OD1  3  
ATOM 1681 O OD2  . ASP A 1 40 ? 1.998   -7.969  8.345  1.00 0.00 ? 40 ASP A OD2  3  
ATOM 1682 H H    . ASP A 1 40 ? 2.564   -6.589  5.246  1.00 0.00 ? 40 ASP A H    3  
ATOM 1683 H HA   . ASP A 1 40 ? 1.390   -5.398  7.635  1.00 0.00 ? 40 ASP A HA   3  
ATOM 1684 H HB2  . ASP A 1 40 ? 3.987   -6.674  6.956  1.00 0.00 ? 40 ASP A HB2  3  
ATOM 1685 H HB3  . ASP A 1 40 ? 4.008   -5.436  8.208  1.00 0.00 ? 40 ASP A HB3  3  
ATOM 1686 N N    . ARG A 1 41 ? 2.089   -3.037  7.399  1.00 0.00 ? 41 ARG A N    3  
ATOM 1687 C CA   . ARG A 1 41 ? 2.399   -1.626  7.200  1.00 0.00 ? 41 ARG A CA   3  
ATOM 1688 C C    . ARG A 1 41 ? 3.479   -1.164  8.174  1.00 0.00 ? 41 ARG A C    3  
ATOM 1689 O O    . ARG A 1 41 ? 3.400   -1.425  9.375  1.00 0.00 ? 41 ARG A O    3  
ATOM 1690 C CB   . ARG A 1 41 ? 1.140   -0.775  7.376  1.00 0.00 ? 41 ARG A CB   3  
ATOM 1691 C CG   . ARG A 1 41 ? 0.023   -1.487  8.121  1.00 0.00 ? 41 ARG A CG   3  
ATOM 1692 C CD   . ARG A 1 41 ? -1.068  -0.517  8.549  1.00 0.00 ? 41 ARG A CD   3  
ATOM 1693 N NE   . ARG A 1 41 ? -2.289  -0.688  7.767  1.00 0.00 ? 41 ARG A NE   3  
ATOM 1694 C CZ   . ARG A 1 41 ? -2.486  -0.127  6.580  1.00 0.00 ? 41 ARG A CZ   3  
ATOM 1695 N NH1  . ARG A 1 41 ? -1.546  0.637   6.040  1.00 0.00 ? 41 ARG A NH1  3  
ATOM 1696 N NH2  . ARG A 1 41 ? -3.624  -0.329  5.929  1.00 0.00 ? 41 ARG A NH2  3  
ATOM 1697 H H    . ARG A 1 41 ? 1.435   -3.290  8.085  1.00 0.00 ? 41 ARG A H    3  
ATOM 1698 H HA   . ARG A 1 41 ? 2.765   -1.506  6.191  1.00 0.00 ? 41 ARG A HA   3  
ATOM 1699 H HB2  . ARG A 1 41 ? 1.397   0.118   7.926  1.00 0.00 ? 41 ARG A HB2  3  
ATOM 1700 H HB3  . ARG A 1 41 ? 0.771   -0.494  6.401  1.00 0.00 ? 41 ARG A HB3  3  
ATOM 1701 H HG2  . ARG A 1 41 ? -0.410  -2.235  7.473  1.00 0.00 ? 41 ARG A HG2  3  
ATOM 1702 H HG3  . ARG A 1 41 ? 0.435   -1.963  8.999  1.00 0.00 ? 41 ARG A HG3  3  
ATOM 1703 H HD2  . ARG A 1 41 ? -1.292  -0.687  9.592  1.00 0.00 ? 41 ARG A HD2  3  
ATOM 1704 H HD3  . ARG A 1 41 ? -0.705  0.491   8.419  1.00 0.00 ? 41 ARG A HD3  3  
ATOM 1705 H HE   . ARG A 1 41 ? -2.997  -1.248  8.148  1.00 0.00 ? 41 ARG A HE   3  
ATOM 1706 H HH11 . ARG A 1 41 ? -0.686  0.790   6.527  1.00 0.00 ? 41 ARG A HH11 3  
ATOM 1707 H HH12 . ARG A 1 41 ? -1.696  1.057   5.144  1.00 0.00 ? 41 ARG A HH12 3  
ATOM 1708 H HH21 . ARG A 1 41 ? -4.335  -0.904  6.333  1.00 0.00 ? 41 ARG A HH21 3  
ATOM 1709 H HH22 . ARG A 1 41 ? -3.771  0.094   5.035  1.00 0.00 ? 41 ARG A HH22 3  
ATOM 1710 N N    . CYS A 1 42 ? 4.487   -0.477  7.648  1.00 0.00 ? 42 CYS A N    3  
ATOM 1711 C CA   . CYS A 1 42 ? 5.584   0.021   8.469  1.00 0.00 ? 42 CYS A CA   3  
ATOM 1712 C C    . CYS A 1 42 ? 5.185   1.307   9.188  1.00 0.00 ? 42 CYS A C    3  
ATOM 1713 O O    . CYS A 1 42 ? 4.678   2.245   8.571  1.00 0.00 ? 42 CYS A O    3  
ATOM 1714 C CB   . CYS A 1 42 ? 6.823   0.270   7.607  1.00 0.00 ? 42 CYS A CB   3  
ATOM 1715 S SG   . CYS A 1 42 ? 7.952   -1.156  7.499  1.00 0.00 ? 42 CYS A SG   3  
ATOM 1716 H H    . CYS A 1 42 ? 4.495   -0.300  6.683  1.00 0.00 ? 42 CYS A H    3  
ATOM 1717 H HA   . CYS A 1 42 ? 5.815   -0.732  9.207  1.00 0.00 ? 42 CYS A HA   3  
ATOM 1718 H HB2  . CYS A 1 42 ? 6.509   0.516   6.602  1.00 0.00 ? 42 CYS A HB2  3  
ATOM 1719 H HB3  . CYS A 1 42 ? 7.378   1.100   8.018  1.00 0.00 ? 42 CYS A HB3  3  
ATOM 1720 N N    . CYS A 1 43 ? 5.418   1.344   10.496 1.00 0.00 ? 43 CYS A N    3  
ATOM 1721 C CA   . CYS A 1 43 ? 5.084   2.513   11.300 1.00 0.00 ? 43 CYS A CA   3  
ATOM 1722 C C    . CYS A 1 43 ? 6.298   3.422   11.469 1.00 0.00 ? 43 CYS A C    3  
ATOM 1723 O O    . CYS A 1 43 ? 7.438   2.996   11.281 1.00 0.00 ? 43 CYS A O    3  
ATOM 1724 C CB   . CYS A 1 43 ? 4.560   2.082   12.671 1.00 0.00 ? 43 CYS A CB   3  
ATOM 1725 S SG   . CYS A 1 43 ? 2.848   1.461   12.652 1.00 0.00 ? 43 CYS A SG   3  
ATOM 1726 H H    . CYS A 1 43 ? 5.825   0.565   10.931 1.00 0.00 ? 43 CYS A H    3  
ATOM 1727 H HA   . CYS A 1 43 ? 4.309   3.060   10.784 1.00 0.00 ? 43 CYS A HA   3  
ATOM 1728 H HB2  . CYS A 1 43 ? 5.190   1.294   13.057 1.00 0.00 ? 43 CYS A HB2  3  
ATOM 1729 H HB3  . CYS A 1 43 ? 4.597   2.927   13.344 1.00 0.00 ? 43 CYS A HB3  3  
ATOM 1730 N N    . CYS A 1 44 ? 6.045   4.677   11.826 1.00 0.00 ? 44 CYS A N    3  
ATOM 1731 C CA   . CYS A 1 44 ? 7.116   5.647   12.021 1.00 0.00 ? 44 CYS A CA   3  
ATOM 1732 C C    . CYS A 1 44 ? 6.882   6.468   13.286 1.00 0.00 ? 44 CYS A C    3  
ATOM 1733 O O    . CYS A 1 44 ? 5.791   6.995   13.504 1.00 0.00 ? 44 CYS A O    3  
ATOM 1734 C CB   . CYS A 1 44 ? 7.218   6.576   10.809 1.00 0.00 ? 44 CYS A CB   3  
ATOM 1735 S SG   . CYS A 1 44 ? 7.474   5.708   9.228  1.00 0.00 ? 44 CYS A SG   3  
ATOM 1736 H H    . CYS A 1 44 ? 5.115   4.958   11.961 1.00 0.00 ? 44 CYS A H    3  
ATOM 1737 H HA   . CYS A 1 44 ? 8.042   5.103   12.126 1.00 0.00 ? 44 CYS A HA   3  
ATOM 1738 H HB2  . CYS A 1 44 ? 6.305   7.147   10.725 1.00 0.00 ? 44 CYS A HB2  3  
ATOM 1739 H HB3  . CYS A 1 44 ? 8.048   7.251   10.952 1.00 0.00 ? 44 CYS A HB3  3  
ATOM 1740 N N    . ALA A 1 45 ? 7.914   6.573   14.116 1.00 0.00 ? 45 ALA A N    3  
ATOM 1741 C CA   . ALA A 1 45 ? 7.822   7.331   15.358 1.00 0.00 ? 45 ALA A CA   3  
ATOM 1742 C C    . ALA A 1 45 ? 7.969   8.827   15.100 1.00 0.00 ? 45 ALA A C    3  
ATOM 1743 O O    . ALA A 1 45 ? 7.471   9.651   15.867 1.00 0.00 ? 45 ALA A O    3  
ATOM 1744 C CB   . ALA A 1 45 ? 8.879   6.857   16.345 1.00 0.00 ? 45 ALA A CB   3  
ATOM 1745 H H    . ALA A 1 45 ? 8.758   6.130   13.888 1.00 0.00 ? 45 ALA A H    3  
ATOM 1746 H HA   . ALA A 1 45 ? 6.850   7.145   15.791 1.00 0.00 ? 45 ALA A HA   3  
ATOM 1747 H HB1  . ALA A 1 45 ? 8.480   6.904   17.348 1.00 0.00 ? 45 ALA A HB1  3  
ATOM 1748 H HB2  . ALA A 1 45 ? 9.156   5.840   16.114 1.00 0.00 ? 45 ALA A HB2  3  
ATOM 1749 H HB3  . ALA A 1 45 ? 9.749   7.493   16.273 1.00 0.00 ? 45 ALA A HB3  3  
ATOM 1750 N N    . CYS A 1 1  ? 1.094   -0.052  -0.141 1.00 0.00 ? 1  CYS A N    4  
ATOM 1751 C CA   . CYS A 1 1  ? 1.975   -0.148  -1.299 1.00 0.00 ? 1  CYS A CA   4  
ATOM 1752 C C    . CYS A 1 1  ? 2.693   -1.494  -1.326 1.00 0.00 ? 1  CYS A C    4  
ATOM 1753 O O    . CYS A 1 1  ? 2.940   -2.099  -0.282 1.00 0.00 ? 1  CYS A O    4  
ATOM 1754 C CB   . CYS A 1 1  ? 3.000   0.989   -1.281 1.00 0.00 ? 1  CYS A CB   4  
ATOM 1755 S SG   . CYS A 1 1  ? 3.638   1.389   0.377  1.00 0.00 ? 1  CYS A SG   4  
ATOM 1756 H H    . CYS A 1 1  ? 1.436   -0.307  0.742  1.00 0.00 ? 1  CYS A H    4  
ATOM 1757 H HA   . CYS A 1 1  ? 1.368   -0.059  -2.187 1.00 0.00 ? 1  CYS A HA   4  
ATOM 1758 H HB2  . CYS A 1 1  ? 3.842   0.713   -1.898 1.00 0.00 ? 1  CYS A HB2  4  
ATOM 1759 H HB3  . CYS A 1 1  ? 2.543   1.881   -1.683 1.00 0.00 ? 1  CYS A HB3  4  
ATOM 1760 N N    . TYR A 1 2  ? 3.024   -1.957  -2.526 1.00 0.00 ? 2  TYR A N    4  
ATOM 1761 C CA   . TYR A 1 2  ? 3.712   -3.232  -2.690 1.00 0.00 ? 2  TYR A CA   4  
ATOM 1762 C C    . TYR A 1 2  ? 5.220   -3.062  -2.537 1.00 0.00 ? 2  TYR A C    4  
ATOM 1763 O O    . TYR A 1 2  ? 5.765   -1.968  -2.680 1.00 0.00 ? 2  TYR A O    4  
ATOM 1764 C CB   . TYR A 1 2  ? 3.392   -3.835  -4.059 1.00 0.00 ? 2  TYR A CB   4  
ATOM 1765 C CG   . TYR A 1 2  ? 2.691   -5.173  -3.983 1.00 0.00 ? 2  TYR A CG   4  
ATOM 1766 C CD1  . TYR A 1 2  ? 3.109   -6.244  -4.763 1.00 0.00 ? 2  TYR A CD1  4  
ATOM 1767 C CD2  . TYR A 1 2  ? 1.610   -5.366  -3.131 1.00 0.00 ? 2  TYR A CD2  4  
ATOM 1768 C CE1  . TYR A 1 2  ? 2.472   -7.468  -4.697 1.00 0.00 ? 2  TYR A CE1  4  
ATOM 1769 C CE2  . TYR A 1 2  ? 0.967   -6.586  -3.058 1.00 0.00 ? 2  TYR A CE2  4  
ATOM 1770 C CZ   . TYR A 1 2  ? 1.402   -7.634  -3.843 1.00 0.00 ? 2  TYR A CZ   4  
ATOM 1771 O OH   . TYR A 1 2  ? 0.763   -8.851  -3.774 1.00 0.00 ? 2  TYR A OH   4  
ATOM 1772 H H    . TYR A 1 2  ? 2.800   -1.430  -3.321 1.00 0.00 ? 2  TYR A H    4  
ATOM 1773 H HA   . TYR A 1 2  ? 3.356   -3.902  -1.921 1.00 0.00 ? 2  TYR A HA   4  
ATOM 1774 H HB2  . TYR A 1 2  ? 2.753   -3.158  -4.603 1.00 0.00 ? 2  TYR A HB2  4  
ATOM 1775 H HB3  . TYR A 1 2  ? 4.312   -3.974  -4.608 1.00 0.00 ? 2  TYR A HB3  4  
ATOM 1776 H HD1  . TYR A 1 2  ? 3.948   -6.111  -5.431 1.00 0.00 ? 2  TYR A HD1  4  
ATOM 1777 H HD2  . TYR A 1 2  ? 1.272   -4.543  -2.518 1.00 0.00 ? 2  TYR A HD2  4  
ATOM 1778 H HE1  . TYR A 1 2  ? 2.811   -8.289  -5.312 1.00 0.00 ? 2  TYR A HE1  4  
ATOM 1779 H HE2  . TYR A 1 2  ? 0.129   -6.717  -2.389 1.00 0.00 ? 2  TYR A HE2  4  
ATOM 1780 H HH   . TYR A 1 2  ? 1.005   -9.293  -2.957 1.00 0.00 ? 2  TYR A HH   4  
ATOM 1781 N N    . PRO A 1 3  ? 5.912   -4.172  -2.238 1.00 0.00 ? 3  PRO A N    4  
ATOM 1782 C CA   . PRO A 1 3  ? 7.367   -4.173  -2.059 1.00 0.00 ? 3  PRO A CA   4  
ATOM 1783 C C    . PRO A 1 3  ? 8.112   -3.943  -3.369 1.00 0.00 ? 3  PRO A C    4  
ATOM 1784 O O    . PRO A 1 3  ? 8.604   -4.886  -3.988 1.00 0.00 ? 3  PRO A O    4  
ATOM 1785 C CB   . PRO A 1 3  ? 7.656   -5.575  -1.518 1.00 0.00 ? 3  PRO A CB   4  
ATOM 1786 C CG   . PRO A 1 3  ? 6.529   -6.413  -2.015 1.00 0.00 ? 3  PRO A CG   4  
ATOM 1787 C CD   . PRO A 1 3  ? 5.327   -5.510  -2.052 1.00 0.00 ? 3  PRO A CD   4  
ATOM 1788 H HA   . PRO A 1 3  ? 7.678   -3.435  -1.335 1.00 0.00 ? 3  PRO A HA   4  
ATOM 1789 H HB2  . PRO A 1 3  ? 8.606   -5.922  -1.900 1.00 0.00 ? 3  PRO A HB2  4  
ATOM 1790 H HB3  . PRO A 1 3  ? 7.684   -5.550  -0.439 1.00 0.00 ? 3  PRO A HB3  4  
ATOM 1791 H HG2  . PRO A 1 3  ? 6.753   -6.781  -3.004 1.00 0.00 ? 3  PRO A HG2  4  
ATOM 1792 H HG3  . PRO A 1 3  ? 6.358   -7.237  -1.337 1.00 0.00 ? 3  PRO A HG3  4  
ATOM 1793 H HD2  . PRO A 1 3  ? 4.686   -5.770  -2.881 1.00 0.00 ? 3  PRO A HD2  4  
ATOM 1794 H HD3  . PRO A 1 3  ? 4.784   -5.567  -1.120 1.00 0.00 ? 3  PRO A HD3  4  
ATOM 1795 N N    . GLY A 1 4  ? 8.192   -2.683  -3.786 1.00 0.00 ? 4  GLY A N    4  
ATOM 1796 C CA   . GLY A 1 4  ? 8.880   -2.352  -5.021 1.00 0.00 ? 4  GLY A CA   4  
ATOM 1797 C C    . GLY A 1 4  ? 8.134   -1.319  -5.841 1.00 0.00 ? 4  GLY A C    4  
ATOM 1798 O O    . GLY A 1 4  ? 8.577   -0.942  -6.925 1.00 0.00 ? 4  GLY A O    4  
ATOM 1799 H H    . GLY A 1 4  ? 7.781   -1.972  -3.251 1.00 0.00 ? 4  GLY A H    4  
ATOM 1800 H HA2  . GLY A 1 4  ? 9.860   -1.968  -4.782 1.00 0.00 ? 4  GLY A HA2  4  
ATOM 1801 H HA3  . GLY A 1 4  ? 8.990   -3.251  -5.609 1.00 0.00 ? 4  GLY A HA3  4  
ATOM 1802 N N    . GLN A 1 5  ? 6.998   -0.863  -5.324 1.00 0.00 ? 5  GLN A N    4  
ATOM 1803 C CA   . GLN A 1 5  ? 6.188   0.131   -6.018 1.00 0.00 ? 5  GLN A CA   4  
ATOM 1804 C C    . GLN A 1 5  ? 6.815   1.517   -5.908 1.00 0.00 ? 5  GLN A C    4  
ATOM 1805 O O    . GLN A 1 5  ? 7.568   1.813   -4.981 1.00 0.00 ? 5  GLN A O    4  
ATOM 1806 C CB   . GLN A 1 5  ? 4.769   0.153   -5.446 1.00 0.00 ? 5  GLN A CB   4  
ATOM 1807 C CG   . GLN A 1 5  ? 4.032   -1.168  -5.595 1.00 0.00 ? 5  GLN A CG   4  
ATOM 1808 C CD   . GLN A 1 5  ? 2.527   -1.010  -5.508 1.00 0.00 ? 5  GLN A CD   4  
ATOM 1809 O OE1  . GLN A 1 5  ? 2.015   -0.296  -4.645 1.00 0.00 ? 5  GLN A OE1  4  
ATOM 1810 N NE2  . GLN A 1 5  ? 1.809   -1.677  -6.403 1.00 0.00 ? 5  GLN A NE2  4  
ATOM 1811 H H    . GLN A 1 5  ? 6.697   -1.203  -4.456 1.00 0.00 ? 5  GLN A H    4  
ATOM 1812 H HA   . GLN A 1 5  ? 6.142   -0.148  -7.060 1.00 0.00 ? 5  GLN A HA   4  
ATOM 1813 H HB2  . GLN A 1 5  ? 4.821   0.395   -4.395 1.00 0.00 ? 5  GLN A HB2  4  
ATOM 1814 H HB3  . GLN A 1 5  ? 4.200   0.917   -5.956 1.00 0.00 ? 5  GLN A HB3  4  
ATOM 1815 H HG2  . GLN A 1 5  ? 4.278   -1.596  -6.555 1.00 0.00 ? 5  GLN A HG2  4  
ATOM 1816 H HG3  . GLN A 1 5  ? 4.356   -1.836  -4.811 1.00 0.00 ? 5  GLN A HG3  4  
ATOM 1817 H HE21 . GLN A 1 5  ? 2.284   -2.228  -7.060 1.00 0.00 ? 5  GLN A HE21 4  
ATOM 1818 H HE22 . GLN A 1 5  ? 0.834   -1.594  -6.370 1.00 0.00 ? 5  GLN A HE22 4  
ATOM 1819 N N    . PRO A 1 6  ? 6.498   2.389   -6.877 1.00 0.00 ? 6  PRO A N    4  
ATOM 1820 C CA   . PRO A 1 6  ? 7.019   3.758   -6.912 1.00 0.00 ? 6  PRO A CA   4  
ATOM 1821 C C    . PRO A 1 6  ? 6.437   4.628   -5.804 1.00 0.00 ? 6  PRO A C    4  
ATOM 1822 O O    . PRO A 1 6  ? 5.228   4.852   -5.747 1.00 0.00 ? 6  PRO A O    4  
ATOM 1823 C CB   . PRO A 1 6  ? 6.576   4.272   -8.284 1.00 0.00 ? 6  PRO A CB   4  
ATOM 1824 C CG   . PRO A 1 6  ? 5.374   3.460   -8.623 1.00 0.00 ? 6  PRO A CG   4  
ATOM 1825 C CD   . PRO A 1 6  ? 5.605   2.104   -8.014 1.00 0.00 ? 6  PRO A CD   4  
ATOM 1826 H HA   . PRO A 1 6  ? 8.098   3.774   -6.851 1.00 0.00 ? 6  PRO A HA   4  
ATOM 1827 H HB2  . PRO A 1 6  ? 6.337   5.324   -8.217 1.00 0.00 ? 6  PRO A HB2  4  
ATOM 1828 H HB3  . PRO A 1 6  ? 7.369   4.122   -9.002 1.00 0.00 ? 6  PRO A HB3  4  
ATOM 1829 H HG2  . PRO A 1 6  ? 4.492   3.915   -8.200 1.00 0.00 ? 6  PRO A HG2  4  
ATOM 1830 H HG3  . PRO A 1 6  ? 5.278   3.377   -9.695 1.00 0.00 ? 6  PRO A HG3  4  
ATOM 1831 H HD2  . PRO A 1 6  ? 4.672   1.679   -7.675 1.00 0.00 ? 6  PRO A HD2  4  
ATOM 1832 H HD3  . PRO A 1 6  ? 6.085   1.448   -8.725 1.00 0.00 ? 6  PRO A HD3  4  
ATOM 1833 N N    . GLY A 1 7  ? 7.305   5.117   -4.923 1.00 0.00 ? 7  GLY A N    4  
ATOM 1834 C CA   . GLY A 1 7  ? 6.857   5.958   -3.828 1.00 0.00 ? 7  GLY A CA   4  
ATOM 1835 C C    . GLY A 1 7  ? 6.842   5.224   -2.502 1.00 0.00 ? 7  GLY A C    4  
ATOM 1836 O O    . GLY A 1 7  ? 6.438   5.780   -1.480 1.00 0.00 ? 7  GLY A O    4  
ATOM 1837 H H    . GLY A 1 7  ? 8.257   4.905   -5.018 1.00 0.00 ? 7  GLY A H    4  
ATOM 1838 H HA2  . GLY A 1 7  ? 7.517   6.809   -3.749 1.00 0.00 ? 7  GLY A HA2  4  
ATOM 1839 H HA3  . GLY A 1 7  ? 5.858   6.308   -4.044 1.00 0.00 ? 7  GLY A HA3  4  
ATOM 1840 N N    . CYS A 1 8  ? 7.281   3.970   -2.517 1.00 0.00 ? 8  CYS A N    4  
ATOM 1841 C CA   . CYS A 1 8  ? 7.314   3.156   -1.307 1.00 0.00 ? 8  CYS A CA   4  
ATOM 1842 C C    . CYS A 1 8  ? 8.643   2.415   -1.188 1.00 0.00 ? 8  CYS A C    4  
ATOM 1843 O O    . CYS A 1 8  ? 9.311   2.152   -2.186 1.00 0.00 ? 8  CYS A O    4  
ATOM 1844 C CB   . CYS A 1 8  ? 6.157   2.155   -1.308 1.00 0.00 ? 8  CYS A CB   4  
ATOM 1845 S SG   . CYS A 1 8  ? 5.576   1.689   0.354  1.00 0.00 ? 8  CYS A SG   4  
ATOM 1846 H H    . CYS A 1 8  ? 7.590   3.581   -3.363 1.00 0.00 ? 8  CYS A H    4  
ATOM 1847 H HA   . CYS A 1 8  ? 7.207   3.816   -0.460 1.00 0.00 ? 8  CYS A HA   4  
ATOM 1848 H HB2  . CYS A 1 8  ? 5.320   2.585   -1.839 1.00 0.00 ? 8  CYS A HB2  4  
ATOM 1849 H HB3  . CYS A 1 8  ? 6.472   1.254   -1.812 1.00 0.00 ? 8  CYS A HB3  4  
ATOM 1850 N N    . GLY A 1 9  ? 9.018   2.080   0.043  1.00 0.00 ? 9  GLY A N    4  
ATOM 1851 C CA   . GLY A 1 9  ? 10.264  1.372   0.272  1.00 0.00 ? 9  GLY A CA   4  
ATOM 1852 C C    . GLY A 1 9  ? 10.352  0.789   1.668  1.00 0.00 ? 9  GLY A C    4  
ATOM 1853 O O    . GLY A 1 9  ? 9.419   0.914   2.461  1.00 0.00 ? 9  GLY A O    4  
ATOM 1854 H H    . GLY A 1 9  ? 8.445   2.316   0.802  1.00 0.00 ? 9  GLY A H    4  
ATOM 1855 H HA2  . GLY A 1 9  ? 10.348  0.571   -0.448 1.00 0.00 ? 9  GLY A HA2  4  
ATOM 1856 H HA3  . GLY A 1 9  ? 11.086  2.058   0.129  1.00 0.00 ? 9  GLY A HA3  4  
ATOM 1857 N N    . HIS A 1 10 ? 11.476  0.147   1.970  1.00 0.00 ? 10 HIS A N    4  
ATOM 1858 C CA   . HIS A 1 10 ? 11.682  -0.460  3.281  1.00 0.00 ? 10 HIS A CA   4  
ATOM 1859 C C    . HIS A 1 10 ? 11.820  0.610   4.359  1.00 0.00 ? 10 HIS A C    4  
ATOM 1860 O O    . HIS A 1 10 ? 12.723  1.446   4.307  1.00 0.00 ? 10 HIS A O    4  
ATOM 1861 C CB   . HIS A 1 10 ? 12.926  -1.349  3.265  1.00 0.00 ? 10 HIS A CB   4  
ATOM 1862 C CG   . HIS A 1 10 ? 13.541  -1.542  4.617  1.00 0.00 ? 10 HIS A CG   4  
ATOM 1863 N ND1  . HIS A 1 10 ? 14.755  -0.995  4.976  1.00 0.00 ? 10 HIS A ND1  4  
ATOM 1864 C CD2  . HIS A 1 10 ? 13.103  -2.225  5.700  1.00 0.00 ? 10 HIS A CD2  4  
ATOM 1865 C CE1  . HIS A 1 10 ? 15.037  -1.334  6.221  1.00 0.00 ? 10 HIS A CE1  4  
ATOM 1866 N NE2  . HIS A 1 10 ? 14.050  -2.081  6.683  1.00 0.00 ? 10 HIS A NE2  4  
ATOM 1867 H H    . HIS A 1 10 ? 12.184  0.080   1.296  1.00 0.00 ? 10 HIS A H    4  
ATOM 1868 H HA   . HIS A 1 10 ? 10.818  -1.068  3.504  1.00 0.00 ? 10 HIS A HA   4  
ATOM 1869 H HB2  . HIS A 1 10 ? 12.660  -2.322  2.880  1.00 0.00 ? 10 HIS A HB2  4  
ATOM 1870 H HB3  . HIS A 1 10 ? 13.671  -0.904  2.621  1.00 0.00 ? 10 HIS A HB3  4  
ATOM 1871 H HD1  . HIS A 1 10 ? 15.325  -0.441  4.404  1.00 0.00 ? 10 HIS A HD1  4  
ATOM 1872 H HD2  . HIS A 1 10 ? 12.179  -2.781  5.777  1.00 0.00 ? 10 HIS A HD2  4  
ATOM 1873 H HE1  . HIS A 1 10 ? 15.923  -1.050  6.769  1.00 0.00 ? 10 HIS A HE1  4  
ATOM 1874 N N    . CYS A 1 11 ? 10.920  0.580   5.335  1.00 0.00 ? 11 CYS A N    4  
ATOM 1875 C CA   . CYS A 1 11 ? 10.940  1.547   6.426  1.00 0.00 ? 11 CYS A CA   4  
ATOM 1876 C C    . CYS A 1 11 ? 12.208  1.398   7.262  1.00 0.00 ? 11 CYS A C    4  
ATOM 1877 O O    . CYS A 1 11 ? 12.936  0.413   7.134  1.00 0.00 ? 11 CYS A O    4  
ATOM 1878 C CB   . CYS A 1 11 ? 9.706   1.371   7.314  1.00 0.00 ? 11 CYS A CB   4  
ATOM 1879 S SG   . CYS A 1 11 ? 9.723   -0.149  8.317  1.00 0.00 ? 11 CYS A SG   4  
ATOM 1880 H H    . CYS A 1 11 ? 10.223  -0.111  5.322  1.00 0.00 ? 11 CYS A H    4  
ATOM 1881 H HA   . CYS A 1 11 ? 10.923  2.536   5.993  1.00 0.00 ? 11 CYS A HA   4  
ATOM 1882 H HB2  . CYS A 1 11 ? 9.638   2.210   7.992  1.00 0.00 ? 11 CYS A HB2  4  
ATOM 1883 H HB3  . CYS A 1 11 ? 8.825   1.346   6.691  1.00 0.00 ? 11 CYS A HB3  4  
ATOM 1884 N N    . SER A 1 12 ? 12.465  2.382   8.117  1.00 0.00 ? 12 SER A N    4  
ATOM 1885 C CA   . SER A 1 12 ? 13.646  2.363   8.972  1.00 0.00 ? 12 SER A CA   4  
ATOM 1886 C C    . SER A 1 12 ? 13.423  3.203   10.226 1.00 0.00 ? 12 SER A C    4  
ATOM 1887 O O    . SER A 1 12 ? 12.676  4.181   10.206 1.00 0.00 ? 12 SER A O    4  
ATOM 1888 C CB   . SER A 1 12 ? 14.864  2.883   8.206  1.00 0.00 ? 12 SER A CB   4  
ATOM 1889 O OG   . SER A 1 12 ? 15.837  1.865   8.044  1.00 0.00 ? 12 SER A OG   4  
ATOM 1890 H H    . SER A 1 12 ? 11.846  3.141   8.173  1.00 0.00 ? 12 SER A H    4  
ATOM 1891 H HA   . SER A 1 12 ? 13.826  1.339   9.266  1.00 0.00 ? 12 SER A HA   4  
ATOM 1892 H HB2  . SER A 1 12 ? 14.554  3.226   7.231  1.00 0.00 ? 12 SER A HB2  4  
ATOM 1893 H HB3  . SER A 1 12 ? 15.306  3.703   8.753  1.00 0.00 ? 12 SER A HB3  4  
ATOM 1894 H HG   . SER A 1 12 ? 16.080  1.514   8.904  1.00 0.00 ? 12 SER A HG   4  
ATOM 1895 N N    . ARG A 1 13 ? 14.076  2.813   11.316 1.00 0.00 ? 13 ARG A N    4  
ATOM 1896 C CA   . ARG A 1 13 ? 13.949  3.528   12.580 1.00 0.00 ? 13 ARG A CA   4  
ATOM 1897 C C    . ARG A 1 13 ? 13.954  5.037   12.354 1.00 0.00 ? 13 ARG A C    4  
ATOM 1898 O O    . ARG A 1 13 ? 14.616  5.552   11.453 1.00 0.00 ? 13 ARG A O    4  
ATOM 1899 C CB   . ARG A 1 13 ? 15.086  3.140   13.526 1.00 0.00 ? 13 ARG A CB   4  
ATOM 1900 C CG   . ARG A 1 13 ? 15.095  1.665   13.896 1.00 0.00 ? 13 ARG A CG   4  
ATOM 1901 C CD   . ARG A 1 13 ? 16.145  1.363   14.954 1.00 0.00 ? 13 ARG A CD   4  
ATOM 1902 N NE   . ARG A 1 13 ? 16.397  -0.070  15.080 1.00 0.00 ? 13 ARG A NE   4  
ATOM 1903 C CZ   . ARG A 1 13 ? 17.065  -0.781  14.178 1.00 0.00 ? 13 ARG A CZ   4  
ATOM 1904 N NH1  . ARG A 1 13 ? 17.546  -0.194  13.091 1.00 0.00 ? 13 ARG A NH1  4  
ATOM 1905 N NH2  . ARG A 1 13 ? 17.255  -2.081  14.364 1.00 0.00 ? 13 ARG A NH2  4  
ATOM 1906 H H    . ARG A 1 13 ? 14.657  2.025   11.269 1.00 0.00 ? 13 ARG A H    4  
ATOM 1907 H HA   . ARG A 1 13 ? 13.008  3.246   13.028 1.00 0.00 ? 13 ARG A HA   4  
ATOM 1908 H HB2  . ARG A 1 13 ? 16.029  3.376   13.054 1.00 0.00 ? 13 ARG A HB2  4  
ATOM 1909 H HB3  . ARG A 1 13 ? 14.994  3.716   14.435 1.00 0.00 ? 13 ARG A HB3  4  
ATOM 1910 H HG2  . ARG A 1 13 ? 14.123  1.394   14.281 1.00 0.00 ? 13 ARG A HG2  4  
ATOM 1911 H HG3  . ARG A 1 13 ? 15.310  1.084   13.011 1.00 0.00 ? 13 ARG A HG3  4  
ATOM 1912 H HD2  . ARG A 1 13 ? 17.065  1.858   14.682 1.00 0.00 ? 13 ARG A HD2  4  
ATOM 1913 H HD3  . ARG A 1 13 ? 15.799  1.743   15.903 1.00 0.00 ? 13 ARG A HD3  4  
ATOM 1914 H HE   . ARG A 1 13 ? 16.051  -0.524  15.876 1.00 0.00 ? 13 ARG A HE   4  
ATOM 1915 H HH11 . ARG A 1 13 ? 17.406  0.786   12.949 1.00 0.00 ? 13 ARG A HH11 4  
ATOM 1916 H HH12 . ARG A 1 13 ? 18.050  -0.731  12.414 1.00 0.00 ? 13 ARG A HH12 4  
ATOM 1917 H HH21 . ARG A 1 13 ? 16.894  -2.527  15.182 1.00 0.00 ? 13 ARG A HH21 4  
ATOM 1918 H HH22 . ARG A 1 13 ? 17.757  -2.615  13.685 1.00 0.00 ? 13 ARG A HH22 4  
ATOM 1919 N N    . PRO A 1 14 ? 13.197  5.763   13.189 1.00 0.00 ? 14 PRO A N    4  
ATOM 1920 C CA   . PRO A 1 14 ? 12.403  5.161   14.265 1.00 0.00 ? 14 PRO A CA   4  
ATOM 1921 C C    . PRO A 1 14 ? 11.220  4.359   13.733 1.00 0.00 ? 14 PRO A C    4  
ATOM 1922 O O    . PRO A 1 14 ? 10.317  3.996   14.485 1.00 0.00 ? 14 PRO A O    4  
ATOM 1923 C CB   . PRO A 1 14 ? 11.914  6.370   15.065 1.00 0.00 ? 14 PRO A CB   4  
ATOM 1924 C CG   . PRO A 1 14 ? 11.913  7.495   14.088 1.00 0.00 ? 14 PRO A CG   4  
ATOM 1925 C CD   . PRO A 1 14 ? 13.056  7.228   13.149 1.00 0.00 ? 14 PRO A CD   4  
ATOM 1926 H HA   . PRO A 1 14 ? 13.009  4.529   14.898 1.00 0.00 ? 14 PRO A HA   4  
ATOM 1927 H HB2  . PRO A 1 14 ? 10.921  6.175   15.445 1.00 0.00 ? 14 PRO A HB2  4  
ATOM 1928 H HB3  . PRO A 1 14 ? 12.588  6.561   15.886 1.00 0.00 ? 14 PRO A HB3  4  
ATOM 1929 H HG2  . PRO A 1 14 ? 10.979  7.512   13.547 1.00 0.00 ? 14 PRO A HG2  4  
ATOM 1930 H HG3  . PRO A 1 14 ? 12.065  8.431   14.606 1.00 0.00 ? 14 PRO A HG3  4  
ATOM 1931 H HD2  . PRO A 1 14 ? 12.812  7.565   12.152 1.00 0.00 ? 14 PRO A HD2  4  
ATOM 1932 H HD3  . PRO A 1 14 ? 13.956  7.711   13.502 1.00 0.00 ? 14 PRO A HD3  4  
ATOM 1933 N N    . ASN A 1 15 ? 11.233  4.086   12.432 1.00 0.00 ? 15 ASN A N    4  
ATOM 1934 C CA   . ASN A 1 15 ? 10.160  3.327   11.800 1.00 0.00 ? 15 ASN A CA   4  
ATOM 1935 C C    . ASN A 1 15 ? 10.392  1.827   11.952 1.00 0.00 ? 15 ASN A C    4  
ATOM 1936 O O    . ASN A 1 15 ? 11.530  1.358   11.917 1.00 0.00 ? 15 ASN A O    4  
ATOM 1937 C CB   . ASN A 1 15 ? 10.054  3.691   10.318 1.00 0.00 ? 15 ASN A CB   4  
ATOM 1938 C CG   . ASN A 1 15 ? 10.336  5.159   10.061 1.00 0.00 ? 15 ASN A CG   4  
ATOM 1939 O OD1  . ASN A 1 15 ? 10.082  6.009   10.914 1.00 0.00 ? 15 ASN A OD1  4  
ATOM 1940 N ND2  . ASN A 1 15 ? 10.863  5.462   8.881  1.00 0.00 ? 15 ASN A ND2  4  
ATOM 1941 H H    . ASN A 1 15 ? 11.980  4.404   11.884 1.00 0.00 ? 15 ASN A H    4  
ATOM 1942 H HA   . ASN A 1 15 ? 9.235   3.588   12.292 1.00 0.00 ? 15 ASN A HA   4  
ATOM 1943 H HB2  . ASN A 1 15 ? 10.768  3.104   9.758  1.00 0.00 ? 15 ASN A HB2  4  
ATOM 1944 H HB3  . ASN A 1 15 ? 9.058   3.467   9.968  1.00 0.00 ? 15 ASN A HB3  4  
ATOM 1945 H HD21 . ASN A 1 15 ? 11.038  4.733   8.250  1.00 0.00 ? 15 ASN A HD21 4  
ATOM 1946 H HD22 . ASN A 1 15 ? 11.055  6.404   8.689  1.00 0.00 ? 15 ASN A HD22 4  
ATOM 1947 N N    . TYR A 1 16 ? 9.307   1.080   12.121 1.00 0.00 ? 16 TYR A N    4  
ATOM 1948 C CA   . TYR A 1 16 ? 9.392   -0.367  12.280 1.00 0.00 ? 16 TYR A CA   4  
ATOM 1949 C C    . TYR A 1 16 ? 8.222   -1.061  11.590 1.00 0.00 ? 16 TYR A C    4  
ATOM 1950 O O    . TYR A 1 16 ? 7.389   -0.414  10.954 1.00 0.00 ? 16 TYR A O    4  
ATOM 1951 C CB   . TYR A 1 16 ? 9.416   -0.737  13.764 1.00 0.00 ? 16 TYR A CB   4  
ATOM 1952 C CG   . TYR A 1 16 ? 8.068   -0.622  14.438 1.00 0.00 ? 16 TYR A CG   4  
ATOM 1953 C CD1  . TYR A 1 16 ? 7.566   0.615   14.826 1.00 0.00 ? 16 TYR A CD1  4  
ATOM 1954 C CD2  . TYR A 1 16 ? 7.295   -1.750  14.689 1.00 0.00 ? 16 TYR A CD2  4  
ATOM 1955 C CE1  . TYR A 1 16 ? 6.335   0.725   15.443 1.00 0.00 ? 16 TYR A CE1  4  
ATOM 1956 C CE2  . TYR A 1 16 ? 6.063   -1.649  15.304 1.00 0.00 ? 16 TYR A CE2  4  
ATOM 1957 C CZ   . TYR A 1 16 ? 5.587   -0.410  15.679 1.00 0.00 ? 16 TYR A CZ   4  
ATOM 1958 O OH   . TYR A 1 16 ? 4.360   -0.305  16.293 1.00 0.00 ? 16 TYR A OH   4  
ATOM 1959 H H    . TYR A 1 16 ? 8.428   1.511   12.141 1.00 0.00 ? 16 TYR A H    4  
ATOM 1960 H HA   . TYR A 1 16 ? 10.313  -0.697  11.822 1.00 0.00 ? 16 TYR A HA   4  
ATOM 1961 H HB2  . TYR A 1 16 ? 9.752   -1.757  13.868 1.00 0.00 ? 16 TYR A HB2  4  
ATOM 1962 H HB3  . TYR A 1 16 ? 10.103  -0.083  14.280 1.00 0.00 ? 16 TYR A HB3  4  
ATOM 1963 H HD1  . TYR A 1 16 ? 8.154   1.501   14.639 1.00 0.00 ? 16 TYR A HD1  4  
ATOM 1964 H HD2  . TYR A 1 16 ? 7.671   -2.719  14.394 1.00 0.00 ? 16 TYR A HD2  4  
ATOM 1965 H HE1  . TYR A 1 16 ? 5.962   1.695   15.736 1.00 0.00 ? 16 TYR A HE1  4  
ATOM 1966 H HE2  . TYR A 1 16 ? 5.477   -2.537  15.490 1.00 0.00 ? 16 TYR A HE2  4  
ATOM 1967 H HH   . TYR A 1 16 ? 4.264   0.573   16.668 1.00 0.00 ? 16 TYR A HH   4  
ATOM 1968 N N    . CYS A 1 17 ? 8.166   -2.382  11.720 1.00 0.00 ? 17 CYS A N    4  
ATOM 1969 C CA   . CYS A 1 17 ? 7.100   -3.167  11.110 1.00 0.00 ? 17 CYS A CA   4  
ATOM 1970 C C    . CYS A 1 17 ? 5.890   -3.252  12.036 1.00 0.00 ? 17 CYS A C    4  
ATOM 1971 O O    . CYS A 1 17 ? 6.026   -3.536  13.226 1.00 0.00 ? 17 CYS A O    4  
ATOM 1972 C CB   . CYS A 1 17 ? 7.600   -4.573  10.775 1.00 0.00 ? 17 CYS A CB   4  
ATOM 1973 S SG   . CYS A 1 17 ? 8.217   -4.757  9.071  1.00 0.00 ? 17 CYS A SG   4  
ATOM 1974 H H    . CYS A 1 17 ? 8.860   -2.842  12.239 1.00 0.00 ? 17 CYS A H    4  
ATOM 1975 H HA   . CYS A 1 17 ? 6.804   -2.672  10.197 1.00 0.00 ? 17 CYS A HA   4  
ATOM 1976 H HB2  . CYS A 1 17 ? 8.408   -4.828  11.445 1.00 0.00 ? 17 CYS A HB2  4  
ATOM 1977 H HB3  . CYS A 1 17 ? 6.791   -5.276  10.910 1.00 0.00 ? 17 CYS A HB3  4  
ATOM 1978 N N    . GLU A 1 18 ? 4.707   -3.005  11.480 1.00 0.00 ? 18 GLU A N    4  
ATOM 1979 C CA   . GLU A 1 18 ? 3.474   -3.054  12.257 1.00 0.00 ? 18 GLU A CA   4  
ATOM 1980 C C    . GLU A 1 18 ? 2.306   -3.523  11.394 1.00 0.00 ? 18 GLU A C    4  
ATOM 1981 O O    . GLU A 1 18 ? 1.928   -2.860  10.428 1.00 0.00 ? 18 GLU A O    4  
ATOM 1982 C CB   . GLU A 1 18 ? 3.164   -1.678  12.850 1.00 0.00 ? 18 GLU A CB   4  
ATOM 1983 C CG   . GLU A 1 18 ? 2.295   -1.735  14.096 1.00 0.00 ? 18 GLU A CG   4  
ATOM 1984 C CD   . GLU A 1 18 ? 2.641   -2.905  14.996 1.00 0.00 ? 18 GLU A CD   4  
ATOM 1985 O OE1  . GLU A 1 18 ? 3.357   -2.692  15.997 1.00 0.00 ? 18 GLU A OE1  4  
ATOM 1986 O OE2  . GLU A 1 18 ? 2.196   -4.034  14.699 1.00 0.00 ? 18 GLU A OE2  4  
ATOM 1987 H H    . GLU A 1 18 ? 4.664   -2.785  10.526 1.00 0.00 ? 18 GLU A H    4  
ATOM 1988 H HA   . GLU A 1 18 ? 3.617   -3.759  13.062 1.00 0.00 ? 18 GLU A HA   4  
ATOM 1989 H HB2  . GLU A 1 18 ? 4.094   -1.192  13.106 1.00 0.00 ? 18 GLU A HB2  4  
ATOM 1990 H HB3  . GLU A 1 18 ? 2.652   -1.086  12.106 1.00 0.00 ? 18 GLU A HB3  4  
ATOM 1991 H HG2  . GLU A 1 18 ? 2.429   -0.820  14.654 1.00 0.00 ? 18 GLU A HG2  4  
ATOM 1992 H HG3  . GLU A 1 18 ? 1.262   -1.824  13.794 1.00 0.00 ? 18 GLU A HG3  4  
ATOM 1993 N N    . GLY A 1 19 ? 1.738   -4.671  11.749 1.00 0.00 ? 19 GLY A N    4  
ATOM 1994 C CA   . GLY A 1 19 ? 0.620   -5.210  10.997 1.00 0.00 ? 19 GLY A CA   4  
ATOM 1995 C C    . GLY A 1 19 ? -0.689  -4.523  11.333 1.00 0.00 ? 19 GLY A C    4  
ATOM 1996 O O    . GLY A 1 19 ? -1.644  -4.580  10.559 1.00 0.00 ? 19 GLY A O    4  
ATOM 1997 H H    . GLY A 1 19 ? 2.082   -5.157  12.528 1.00 0.00 ? 19 GLY A H    4  
ATOM 1998 H HA2  . GLY A 1 19 ? 0.818   -5.090  9.943  1.00 0.00 ? 19 GLY A HA2  4  
ATOM 1999 H HA3  . GLY A 1 19 ? 0.527   -6.264  11.218 1.00 0.00 ? 19 GLY A HA3  4  
ATOM 2000 N N    . ALA A 1 20 ? -0.734  -3.873  12.492 1.00 0.00 ? 20 ALA A N    4  
ATOM 2001 C CA   . ALA A 1 20 ? -1.935  -3.173  12.928 1.00 0.00 ? 20 ALA A CA   4  
ATOM 2002 C C    . ALA A 1 20 ? -1.618  -1.737  13.331 1.00 0.00 ? 20 ALA A C    4  
ATOM 2003 O O    . ALA A 1 20 ? -0.601  -1.178  12.920 1.00 0.00 ? 20 ALA A O    4  
ATOM 2004 C CB   . ALA A 1 20 ? -2.588  -3.915  14.085 1.00 0.00 ? 20 ALA A CB   4  
ATOM 2005 H H    . ALA A 1 20 ? 0.060   -3.864  13.066 1.00 0.00 ? 20 ALA A H    4  
ATOM 2006 H HA   . ALA A 1 20 ? -2.632  -3.159  12.102 1.00 0.00 ? 20 ALA A HA   4  
ATOM 2007 H HB1  . ALA A 1 20 ? -2.501  -3.325  14.985 1.00 0.00 ? 20 ALA A HB1  4  
ATOM 2008 H HB2  . ALA A 1 20 ? -3.632  -4.081  13.862 1.00 0.00 ? 20 ALA A HB2  4  
ATOM 2009 H HB3  . ALA A 1 20 ? -2.094  -4.865  14.227 1.00 0.00 ? 20 ALA A HB3  4  
ATOM 2010 N N    . ARG A 1 21 ? -2.494  -1.145  14.136 1.00 0.00 ? 21 ARG A N    4  
ATOM 2011 C CA   . ARG A 1 21 ? -2.308  0.227   14.592 1.00 0.00 ? 21 ARG A CA   4  
ATOM 2012 C C    . ARG A 1 21 ? -1.054  0.347   15.453 1.00 0.00 ? 21 ARG A C    4  
ATOM 2013 O O    . ARG A 1 21 ? -0.859  -0.421  16.396 1.00 0.00 ? 21 ARG A O    4  
ATOM 2014 C CB   . ARG A 1 21 ? -3.530  0.694   15.384 1.00 0.00 ? 21 ARG A CB   4  
ATOM 2015 C CG   . ARG A 1 21 ? -4.852  0.235   14.791 1.00 0.00 ? 21 ARG A CG   4  
ATOM 2016 C CD   . ARG A 1 21 ? -5.728  1.415   14.402 1.00 0.00 ? 21 ARG A CD   4  
ATOM 2017 N NE   . ARG A 1 21 ? -6.795  1.025   13.484 1.00 0.00 ? 21 ARG A NE   4  
ATOM 2018 C CZ   . ARG A 1 21 ? -7.791  1.830   13.130 1.00 0.00 ? 21 ARG A CZ   4  
ATOM 2019 N NH1  . ARG A 1 21 ? -7.855  3.063   13.613 1.00 0.00 ? 21 ARG A NH1  4  
ATOM 2020 N NH2  . ARG A 1 21 ? -8.725  1.403   12.289 1.00 0.00 ? 21 ARG A NH2  4  
ATOM 2021 H H    . ARG A 1 21 ? -3.286  -1.643  14.429 1.00 0.00 ? 21 ARG A H    4  
ATOM 2022 H HA   . ARG A 1 21 ? -2.193  0.854   13.721 1.00 0.00 ? 21 ARG A HA   4  
ATOM 2023 H HB2  . ARG A 1 21 ? -3.460  0.311   16.391 1.00 0.00 ? 21 ARG A HB2  4  
ATOM 2024 H HB3  . ARG A 1 21 ? -3.531  1.773   15.417 1.00 0.00 ? 21 ARG A HB3  4  
ATOM 2025 H HG2  . ARG A 1 21 ? -4.654  -0.358  13.910 1.00 0.00 ? 21 ARG A HG2  4  
ATOM 2026 H HG3  . ARG A 1 21 ? -5.374  -0.365  15.521 1.00 0.00 ? 21 ARG A HG3  4  
ATOM 2027 H HD2  . ARG A 1 21 ? -6.170  1.829   15.296 1.00 0.00 ? 21 ARG A HD2  4  
ATOM 2028 H HD3  . ARG A 1 21 ? -5.111  2.162   13.925 1.00 0.00 ? 21 ARG A HD3  4  
ATOM 2029 H HE   . ARG A 1 21 ? -6.767  0.118   13.114 1.00 0.00 ? 21 ARG A HE   4  
ATOM 2030 H HH11 . ARG A 1 21 ? -7.152  3.388   14.246 1.00 0.00 ? 21 ARG A HH11 4  
ATOM 2031 H HH12 . ARG A 1 21 ? -8.605  3.668   13.344 1.00 0.00 ? 21 ARG A HH12 4  
ATOM 2032 H HH21 . ARG A 1 21 ? -8.679  0.474   11.922 1.00 0.00 ? 21 ARG A HH21 4  
ATOM 2033 H HH22 . ARG A 1 21 ? -9.473  2.009   12.023 1.00 0.00 ? 21 ARG A HH22 4  
ATOM 2034 N N    . CYS A 1 22 ? -0.206  1.316   15.123 1.00 0.00 ? 22 CYS A N    4  
ATOM 2035 C CA   . CYS A 1 22 ? 1.029   1.537   15.865 1.00 0.00 ? 22 CYS A CA   4  
ATOM 2036 C C    . CYS A 1 22 ? 0.747   1.705   17.355 1.00 0.00 ? 22 CYS A C    4  
ATOM 2037 O O    . CYS A 1 22 ? -0.382  1.988   17.754 1.00 0.00 ? 22 CYS A O    4  
ATOM 2038 C CB   . CYS A 1 22 ? 1.755   2.773   15.330 1.00 0.00 ? 22 CYS A CB   4  
ATOM 2039 S SG   . CYS A 1 22 ? 1.749   2.911   13.513 1.00 0.00 ? 22 CYS A SG   4  
ATOM 2040 H H    . CYS A 1 22 ? -0.416  1.896   14.361 1.00 0.00 ? 22 CYS A H    4  
ATOM 2041 H HA   . CYS A 1 22 ? 1.660   0.672   15.726 1.00 0.00 ? 22 CYS A HA   4  
ATOM 2042 H HB2  . CYS A 1 22 ? 1.282   3.659   15.727 1.00 0.00 ? 22 CYS A HB2  4  
ATOM 2043 H HB3  . CYS A 1 22 ? 2.785   2.745   15.654 1.00 0.00 ? 22 CYS A HB3  4  
ATOM 2044 N N    . GLU A 1 23 ? 1.781   1.529   18.171 1.00 0.00 ? 23 GLU A N    4  
ATOM 2045 C CA   . GLU A 1 23 ? 1.643   1.660   19.617 1.00 0.00 ? 23 GLU A CA   4  
ATOM 2046 C C    . GLU A 1 23 ? 1.502   3.125   20.019 1.00 0.00 ? 23 GLU A C    4  
ATOM 2047 O O    . GLU A 1 23 ? 1.858   4.026   19.259 1.00 0.00 ? 23 GLU A O    4  
ATOM 2048 C CB   . GLU A 1 23 ? 2.849   1.039   20.325 1.00 0.00 ? 23 GLU A CB   4  
ATOM 2049 C CG   . GLU A 1 23 ? 3.587   0.012   19.483 1.00 0.00 ? 23 GLU A CG   4  
ATOM 2050 C CD   . GLU A 1 23 ? 4.553   -0.825  20.298 1.00 0.00 ? 23 GLU A CD   4  
ATOM 2051 O OE1  . GLU A 1 23 ? 5.187   -0.270  21.220 1.00 0.00 ? 23 GLU A OE1  4  
ATOM 2052 O OE2  . GLU A 1 23 ? 4.676   -2.035  20.015 1.00 0.00 ? 23 GLU A OE2  4  
ATOM 2053 H H    . GLU A 1 23 ? 2.656   1.304   17.793 1.00 0.00 ? 23 GLU A H    4  
ATOM 2054 H HA   . GLU A 1 23 ? 0.751   1.130   19.915 1.00 0.00 ? 23 GLU A HA   4  
ATOM 2055 H HB2  . GLU A 1 23 ? 3.542   1.825   20.587 1.00 0.00 ? 23 GLU A HB2  4  
ATOM 2056 H HB3  . GLU A 1 23 ? 2.510   0.555   21.229 1.00 0.00 ? 23 GLU A HB3  4  
ATOM 2057 H HG2  . GLU A 1 23 ? 2.864   -0.645  19.024 1.00 0.00 ? 23 GLU A HG2  4  
ATOM 2058 H HG3  . GLU A 1 23 ? 4.142   0.528   18.713 1.00 0.00 ? 23 GLU A HG3  4  
ATOM 2059 N N    . SER A 1 24 ? 0.981   3.356   21.220 1.00 0.00 ? 24 SER A N    4  
ATOM 2060 C CA   . SER A 1 24 ? 0.788   4.711   21.722 1.00 0.00 ? 24 SER A CA   4  
ATOM 2061 C C    . SER A 1 24 ? 2.105   5.482   21.725 1.00 0.00 ? 24 SER A C    4  
ATOM 2062 O O    . SER A 1 24 ? 2.774   5.585   22.752 1.00 0.00 ? 24 SER A O    4  
ATOM 2063 C CB   . SER A 1 24 ? 0.201   4.676   23.135 1.00 0.00 ? 24 SER A CB   4  
ATOM 2064 O OG   . SER A 1 24 ? -1.215  4.690   23.099 1.00 0.00 ? 24 SER A OG   4  
ATOM 2065 H H    . SER A 1 24 ? 0.717   2.596   21.780 1.00 0.00 ? 24 SER A H    4  
ATOM 2066 H HA   . SER A 1 24 ? 0.093   5.213   21.065 1.00 0.00 ? 24 SER A HA   4  
ATOM 2067 H HB2  . SER A 1 24 ? 0.528   3.777   23.635 1.00 0.00 ? 24 SER A HB2  4  
ATOM 2068 H HB3  . SER A 1 24 ? 0.545   5.539   23.686 1.00 0.00 ? 24 SER A HB3  4  
ATOM 2069 H HG   . SER A 1 24 ? -1.551  5.120   23.889 1.00 0.00 ? 24 SER A HG   4  
ATOM 2070 N N    . GLY A 1 25 ? 2.471   6.021   20.566 1.00 0.00 ? 25 GLY A N    4  
ATOM 2071 C CA   . GLY A 1 25 ? 3.706   6.775   20.456 1.00 0.00 ? 25 GLY A CA   4  
ATOM 2072 C C    . GLY A 1 25 ? 4.159   6.938   19.019 1.00 0.00 ? 25 GLY A C    4  
ATOM 2073 O O    . GLY A 1 25 ? 4.679   7.987   18.639 1.00 0.00 ? 25 GLY A O    4  
ATOM 2074 H H    . GLY A 1 25 ? 1.898   5.906   19.780 1.00 0.00 ? 25 GLY A H    4  
ATOM 2075 H HA2  . GLY A 1 25 ? 3.558   7.753   20.889 1.00 0.00 ? 25 GLY A HA2  4  
ATOM 2076 H HA3  . GLY A 1 25 ? 4.479   6.261   21.009 1.00 0.00 ? 25 GLY A HA3  4  
ATOM 2077 N N    . PHE A 1 26 ? 3.964   5.896   18.217 1.00 0.00 ? 26 PHE A N    4  
ATOM 2078 C CA   . PHE A 1 26 ? 4.359   5.927   16.813 1.00 0.00 ? 26 PHE A CA   4  
ATOM 2079 C C    . PHE A 1 26 ? 3.179   6.307   15.924 1.00 0.00 ? 26 PHE A C    4  
ATOM 2080 O O    . PHE A 1 26 ? 2.069   6.531   16.408 1.00 0.00 ? 26 PHE A O    4  
ATOM 2081 C CB   . PHE A 1 26 ? 4.916   4.567   16.388 1.00 0.00 ? 26 PHE A CB   4  
ATOM 2082 C CG   . PHE A 1 26 ? 6.166   4.175   17.123 1.00 0.00 ? 26 PHE A CG   4  
ATOM 2083 C CD1  . PHE A 1 26 ? 6.169   4.068   18.505 1.00 0.00 ? 26 PHE A CD1  4  
ATOM 2084 C CD2  . PHE A 1 26 ? 7.338   3.913   16.433 1.00 0.00 ? 26 PHE A CD2  4  
ATOM 2085 C CE1  . PHE A 1 26 ? 7.317   3.707   19.184 1.00 0.00 ? 26 PHE A CE1  4  
ATOM 2086 C CE2  . PHE A 1 26 ? 8.489   3.551   17.107 1.00 0.00 ? 26 PHE A CE2  4  
ATOM 2087 C CZ   . PHE A 1 26 ? 8.479   3.449   18.484 1.00 0.00 ? 26 PHE A CZ   4  
ATOM 2088 H H    . PHE A 1 26 ? 3.545   5.087   18.578 1.00 0.00 ? 26 PHE A H    4  
ATOM 2089 H HA   . PHE A 1 26 ? 5.131   6.673   16.704 1.00 0.00 ? 26 PHE A HA   4  
ATOM 2090 H HB2  . PHE A 1 26 ? 4.172   3.808   16.572 1.00 0.00 ? 26 PHE A HB2  4  
ATOM 2091 H HB3  . PHE A 1 26 ? 5.145   4.594   15.333 1.00 0.00 ? 26 PHE A HB3  4  
ATOM 2092 H HD1  . PHE A 1 26 ? 5.259   4.270   19.053 1.00 0.00 ? 26 PHE A HD1  4  
ATOM 2093 H HD2  . PHE A 1 26 ? 7.349   3.993   15.356 1.00 0.00 ? 26 PHE A HD2  4  
ATOM 2094 H HE1  . PHE A 1 26 ? 7.305   3.629   20.261 1.00 0.00 ? 26 PHE A HE1  4  
ATOM 2095 H HE2  . PHE A 1 26 ? 9.397   3.350   16.557 1.00 0.00 ? 26 PHE A HE2  4  
ATOM 2096 H HZ   . PHE A 1 26 ? 9.377   3.166   19.013 1.00 0.00 ? 26 PHE A HZ   4  
ATOM 2097 N N    . HIS A 1 27 ? 3.426   6.376   14.620 1.00 0.00 ? 27 HIS A N    4  
ATOM 2098 C CA   . HIS A 1 27 ? 2.385   6.728   13.662 1.00 0.00 ? 27 HIS A CA   4  
ATOM 2099 C C    . HIS A 1 27 ? 2.462   5.840   12.424 1.00 0.00 ? 27 HIS A C    4  
ATOM 2100 O O    . HIS A 1 27 ? 3.533   5.655   11.846 1.00 0.00 ? 27 HIS A O    4  
ATOM 2101 C CB   . HIS A 1 27 ? 2.510   8.198   13.257 1.00 0.00 ? 27 HIS A CB   4  
ATOM 2102 C CG   . HIS A 1 27 ? 3.926   8.678   13.177 1.00 0.00 ? 27 HIS A CG   4  
ATOM 2103 N ND1  . HIS A 1 27 ? 4.562   9.322   14.218 1.00 0.00 ? 27 HIS A ND1  4  
ATOM 2104 C CD2  . HIS A 1 27 ? 4.831   8.604   12.173 1.00 0.00 ? 27 HIS A CD2  4  
ATOM 2105 C CE1  . HIS A 1 27 ? 5.796   9.625   13.856 1.00 0.00 ? 27 HIS A CE1  4  
ATOM 2106 N NE2  . HIS A 1 27 ? 5.985   9.200   12.620 1.00 0.00 ? 27 HIS A NE2  4  
ATOM 2107 H H    . HIS A 1 27 ? 4.331   6.186   14.294 1.00 0.00 ? 27 HIS A H    4  
ATOM 2108 H HA   . HIS A 1 27 ? 1.429   6.576   14.140 1.00 0.00 ? 27 HIS A HA   4  
ATOM 2109 H HB2  . HIS A 1 27 ? 2.058   8.337   12.286 1.00 0.00 ? 27 HIS A HB2  4  
ATOM 2110 H HB3  . HIS A 1 27 ? 1.991   8.809   13.981 1.00 0.00 ? 27 HIS A HB3  4  
ATOM 2111 H HD1  . HIS A 1 27 ? 4.167   9.528   15.090 1.00 0.00 ? 27 HIS A HD1  4  
ATOM 2112 H HD2  . HIS A 1 27 ? 4.675   8.160   11.200 1.00 0.00 ? 27 HIS A HD2  4  
ATOM 2113 H HE1  . HIS A 1 27 ? 6.527   10.133  14.467 1.00 0.00 ? 27 HIS A HE1  4  
ATOM 2114 N N    . ASP A 1 28 ? 1.320   5.291   12.023 1.00 0.00 ? 28 ASP A N    4  
ATOM 2115 C CA   . ASP A 1 28 ? 1.258   4.422   10.854 1.00 0.00 ? 28 ASP A CA   4  
ATOM 2116 C C    . ASP A 1 28 ? 1.705   5.166   9.600  1.00 0.00 ? 28 ASP A C    4  
ATOM 2117 O O    . ASP A 1 28 ? 1.049   6.110   9.158  1.00 0.00 ? 28 ASP A O    4  
ATOM 2118 C CB   . ASP A 1 28 ? -0.162  3.886   10.666 1.00 0.00 ? 28 ASP A CB   4  
ATOM 2119 C CG   . ASP A 1 28 ? -0.365  3.250   9.304  1.00 0.00 ? 28 ASP A CG   4  
ATOM 2120 O OD1  . ASP A 1 28 ? -1.529  3.155   8.861  1.00 0.00 ? 28 ASP A OD1  4  
ATOM 2121 O OD2  . ASP A 1 28 ? 0.640   2.849   8.682  1.00 0.00 ? 28 ASP A OD2  4  
ATOM 2122 H H    . ASP A 1 28 ? 0.499   5.477   12.526 1.00 0.00 ? 28 ASP A H    4  
ATOM 2123 H HA   . ASP A 1 28 ? 1.927   3.592   11.023 1.00 0.00 ? 28 ASP A HA   4  
ATOM 2124 H HB2  . ASP A 1 28 ? -0.362  3.141   11.423 1.00 0.00 ? 28 ASP A HB2  4  
ATOM 2125 H HB3  . ASP A 1 28 ? -0.864  4.699   10.772 1.00 0.00 ? 28 ASP A HB3  4  
ATOM 2126 N N    . CYS A 1 29 ? 2.825   4.735   9.030  1.00 0.00 ? 29 CYS A N    4  
ATOM 2127 C CA   . CYS A 1 29 ? 3.362   5.360   7.827  1.00 0.00 ? 29 CYS A CA   4  
ATOM 2128 C C    . CYS A 1 29 ? 3.425   4.360   6.676  1.00 0.00 ? 29 CYS A C    4  
ATOM 2129 O O    . CYS A 1 29 ? 4.225   4.509   5.754  1.00 0.00 ? 29 CYS A O    4  
ATOM 2130 C CB   . CYS A 1 29 ? 4.756   5.928   8.101  1.00 0.00 ? 29 CYS A CB   4  
ATOM 2131 S SG   . CYS A 1 29 ? 5.837   4.816   9.056  1.00 0.00 ? 29 CYS A SG   4  
ATOM 2132 H H    . CYS A 1 29 ? 3.304   3.977   9.429  1.00 0.00 ? 29 CYS A H    4  
ATOM 2133 H HA   . CYS A 1 29 ? 2.702   6.168   7.550  1.00 0.00 ? 29 CYS A HA   4  
ATOM 2134 H HB2  . CYS A 1 29 ? 5.245   6.131   7.159  1.00 0.00 ? 29 CYS A HB2  4  
ATOM 2135 H HB3  . CYS A 1 29 ? 4.658   6.849   8.656  1.00 0.00 ? 29 CYS A HB3  4  
ATOM 2136 N N    . GLY A 1 30 ? 2.575   3.340   6.738  1.00 0.00 ? 30 GLY A N    4  
ATOM 2137 C CA   . GLY A 1 30 ? 2.550   2.330   5.696  1.00 0.00 ? 30 GLY A CA   4  
ATOM 2138 C C    . GLY A 1 30 ? 2.348   2.926   4.317  1.00 0.00 ? 30 GLY A C    4  
ATOM 2139 O O    . GLY A 1 30 ? 2.510   2.240   3.308  1.00 0.00 ? 30 GLY A O    4  
ATOM 2140 H H    . GLY A 1 30 ? 1.959   3.272   7.498  1.00 0.00 ? 30 GLY A H    4  
ATOM 2141 H HA2  . GLY A 1 30 ? 3.485   1.790   5.711  1.00 0.00 ? 30 GLY A HA2  4  
ATOM 2142 H HA3  . GLY A 1 30 ? 1.744   1.640   5.899  1.00 0.00 ? 30 GLY A HA3  4  
ATOM 2143 N N    . SER A 1 31 ? 1.991   4.205   4.273  1.00 0.00 ? 31 SER A N    4  
ATOM 2144 C CA   . SER A 1 31 ? 1.761   4.892   3.007  1.00 0.00 ? 31 SER A CA   4  
ATOM 2145 C C    . SER A 1 31 ? 2.865   4.567   2.005  1.00 0.00 ? 31 SER A C    4  
ATOM 2146 O O    . SER A 1 31 ? 2.643   3.846   1.032  1.00 0.00 ? 31 SER A O    4  
ATOM 2147 C CB   . SER A 1 31 ? 1.687   6.404   3.228  1.00 0.00 ? 31 SER A CB   4  
ATOM 2148 O OG   . SER A 1 31 ? 1.465   7.088   2.007  1.00 0.00 ? 31 SER A OG   4  
ATOM 2149 H H    . SER A 1 31 ? 1.878   4.699   5.112  1.00 0.00 ? 31 SER A H    4  
ATOM 2150 H HA   . SER A 1 31 ? 0.818   4.548   2.610  1.00 0.00 ? 31 SER A HA   4  
ATOM 2151 H HB2  . SER A 1 31 ? 0.875   6.626   3.904  1.00 0.00 ? 31 SER A HB2  4  
ATOM 2152 H HB3  . SER A 1 31 ? 2.617   6.748   3.657  1.00 0.00 ? 31 SER A HB3  4  
ATOM 2153 H HG   . SER A 1 31 ? 1.185   7.987   2.190  1.00 0.00 ? 31 SER A HG   4  
ATOM 2154 N N    . ASP A 1 32 ? 4.055   5.105   2.250  1.00 0.00 ? 32 ASP A N    4  
ATOM 2155 C CA   . ASP A 1 32 ? 5.195   4.872   1.371  1.00 0.00 ? 32 ASP A CA   4  
ATOM 2156 C C    . ASP A 1 32 ? 6.216   3.956   2.036  1.00 0.00 ? 32 ASP A C    4  
ATOM 2157 O O    . ASP A 1 32 ? 7.417   4.057   1.780  1.00 0.00 ? 32 ASP A O    4  
ATOM 2158 C CB   . ASP A 1 32 ? 5.853   6.200   0.992  1.00 0.00 ? 32 ASP A CB   4  
ATOM 2159 C CG   . ASP A 1 32 ? 5.891   7.178   2.149  1.00 0.00 ? 32 ASP A CG   4  
ATOM 2160 O OD1  . ASP A 1 32 ? 5.543   8.359   1.941  1.00 0.00 ? 32 ASP A OD1  4  
ATOM 2161 O OD2  . ASP A 1 32 ? 6.269   6.762   3.265  1.00 0.00 ? 32 ASP A OD2  4  
ATOM 2162 H H    . ASP A 1 32 ? 4.169   5.671   3.042  1.00 0.00 ? 32 ASP A H    4  
ATOM 2163 H HA   . ASP A 1 32 ? 4.830   4.393   0.475  1.00 0.00 ? 32 ASP A HA   4  
ATOM 2164 H HB2  . ASP A 1 32 ? 6.867   6.013   0.669  1.00 0.00 ? 32 ASP A HB2  4  
ATOM 2165 H HB3  . ASP A 1 32 ? 5.299   6.650   0.181  1.00 0.00 ? 32 ASP A HB3  4  
ATOM 2166 N N    . HIS A 1 33 ? 5.732   3.061   2.892  1.00 0.00 ? 33 HIS A N    4  
ATOM 2167 C CA   . HIS A 1 33 ? 6.604   2.126   3.595  1.00 0.00 ? 33 HIS A CA   4  
ATOM 2168 C C    . HIS A 1 33 ? 5.887   0.805   3.854  1.00 0.00 ? 33 HIS A C    4  
ATOM 2169 O O    . HIS A 1 33 ? 4.841   0.772   4.504  1.00 0.00 ? 33 HIS A O    4  
ATOM 2170 C CB   . HIS A 1 33 ? 7.075   2.732   4.918  1.00 0.00 ? 33 HIS A CB   4  
ATOM 2171 C CG   . HIS A 1 33 ? 7.691   4.089   4.769  1.00 0.00 ? 33 HIS A CG   4  
ATOM 2172 N ND1  . HIS A 1 33 ? 7.228   5.203   5.436  1.00 0.00 ? 33 HIS A ND1  4  
ATOM 2173 C CD2  . HIS A 1 33 ? 8.742   4.507   4.026  1.00 0.00 ? 33 HIS A CD2  4  
ATOM 2174 C CE1  . HIS A 1 33 ? 7.965   6.249   5.108  1.00 0.00 ? 33 HIS A CE1  4  
ATOM 2175 N NE2  . HIS A 1 33 ? 8.892   5.853   4.254  1.00 0.00 ? 33 HIS A NE2  4  
ATOM 2176 H H    . HIS A 1 33 ? 4.767   3.029   3.054  1.00 0.00 ? 33 HIS A H    4  
ATOM 2177 H HA   . HIS A 1 33 ? 7.463   1.939   2.969  1.00 0.00 ? 33 HIS A HA   4  
ATOM 2178 H HB2  . HIS A 1 33 ? 6.231   2.823   5.585  1.00 0.00 ? 33 HIS A HB2  4  
ATOM 2179 H HB3  . HIS A 1 33 ? 7.812   2.079   5.363  1.00 0.00 ? 33 HIS A HB3  4  
ATOM 2180 H HD1  . HIS A 1 33 ? 6.469   5.224   6.056  1.00 0.00 ? 33 HIS A HD1  4  
ATOM 2181 H HD2  . HIS A 1 33 ? 9.351   3.897   3.374  1.00 0.00 ? 33 HIS A HD2  4  
ATOM 2182 H HE1  . HIS A 1 33 ? 7.834   7.255   5.475  1.00 0.00 ? 33 HIS A HE1  4  
ATOM 2183 N N    . TRP A 1 34 ? 6.454   -0.281  3.342  1.00 0.00 ? 34 TRP A N    4  
ATOM 2184 C CA   . TRP A 1 34 ? 5.868   -1.605  3.517  1.00 0.00 ? 34 TRP A CA   4  
ATOM 2185 C C    . TRP A 1 34 ? 6.812   -2.521  4.288  1.00 0.00 ? 34 TRP A C    4  
ATOM 2186 O O    . TRP A 1 34 ? 7.970   -2.176  4.527  1.00 0.00 ? 34 TRP A O    4  
ATOM 2187 C CB   . TRP A 1 34 ? 5.536   -2.222  2.157  1.00 0.00 ? 34 TRP A CB   4  
ATOM 2188 C CG   . TRP A 1 34 ? 6.471   -1.795  1.067  1.00 0.00 ? 34 TRP A CG   4  
ATOM 2189 C CD1  . TRP A 1 34 ? 6.149   -1.100  -0.064 1.00 0.00 ? 34 TRP A CD1  4  
ATOM 2190 C CD2  . TRP A 1 34 ? 7.881   -2.037  1.003  1.00 0.00 ? 34 TRP A CD2  4  
ATOM 2191 N NE1  . TRP A 1 34 ? 7.273   -0.895  -0.827 1.00 0.00 ? 34 TRP A NE1  4  
ATOM 2192 C CE2  . TRP A 1 34 ? 8.349   -1.459  -0.194 1.00 0.00 ? 34 TRP A CE2  4  
ATOM 2193 C CE3  . TRP A 1 34 ? 8.794   -2.683  1.841  1.00 0.00 ? 34 TRP A CE3  4  
ATOM 2194 C CZ2  . TRP A 1 34 ? 9.688   -1.511  -0.571 1.00 0.00 ? 34 TRP A CZ2  4  
ATOM 2195 C CZ3  . TRP A 1 34 ? 10.123  -2.733  1.465  1.00 0.00 ? 34 TRP A CZ3  4  
ATOM 2196 C CH2  . TRP A 1 34 ? 10.560  -2.150  0.269  1.00 0.00 ? 34 TRP A CH2  4  
ATOM 2197 H H    . TRP A 1 34 ? 7.288   -0.190  2.833  1.00 0.00 ? 34 TRP A H    4  
ATOM 2198 H HA   . TRP A 1 34 ? 4.955   -1.490  4.082  1.00 0.00 ? 34 TRP A HA   4  
ATOM 2199 H HB2  . TRP A 1 34 ? 5.585   -3.298  2.236  1.00 0.00 ? 34 TRP A HB2  4  
ATOM 2200 H HB3  . TRP A 1 34 ? 4.535   -1.931  1.873  1.00 0.00 ? 34 TRP A HB3  4  
ATOM 2201 H HD1  . TRP A 1 34 ? 5.152   -0.768  -0.310 1.00 0.00 ? 34 TRP A HD1  4  
ATOM 2202 H HE1  . TRP A 1 34 ? 7.300   -0.420  -1.684 1.00 0.00 ? 34 TRP A HE1  4  
ATOM 2203 H HE3  . TRP A 1 34 ? 8.476   -3.138  2.767  1.00 0.00 ? 34 TRP A HE3  4  
ATOM 2204 H HZ2  . TRP A 1 34 ? 10.041  -1.066  -1.489 1.00 0.00 ? 34 TRP A HZ2  4  
ATOM 2205 H HZ3  . TRP A 1 34 ? 10.843  -3.229  2.100  1.00 0.00 ? 34 TRP A HZ3  4  
ATOM 2206 H HH2  . TRP A 1 34 ? 11.607  -2.214  0.015  1.00 0.00 ? 34 TRP A HH2  4  
ATOM 2207 N N    . CYS A 1 35 ? 6.312   -3.689  4.675  1.00 0.00 ? 35 CYS A N    4  
ATOM 2208 C CA   . CYS A 1 35 ? 7.110   -4.655  5.420  1.00 0.00 ? 35 CYS A CA   4  
ATOM 2209 C C    . CYS A 1 35 ? 7.513   -5.828  4.531  1.00 0.00 ? 35 CYS A C    4  
ATOM 2210 O O    . CYS A 1 35 ? 7.045   -5.952  3.399  1.00 0.00 ? 35 CYS A O    4  
ATOM 2211 C CB   . CYS A 1 35 ? 6.331   -5.164  6.634  1.00 0.00 ? 35 CYS A CB   4  
ATOM 2212 S SG   . CYS A 1 35 ? 6.450   -4.089  8.099  1.00 0.00 ? 35 CYS A SG   4  
ATOM 2213 H H    . CYS A 1 35 ? 5.381   -3.907  4.455  1.00 0.00 ? 35 CYS A H    4  
ATOM 2214 H HA   . CYS A 1 35 ? 8.004   -4.154  5.761  1.00 0.00 ? 35 CYS A HA   4  
ATOM 2215 H HB2  . CYS A 1 35 ? 5.286   -5.247  6.372  1.00 0.00 ? 35 CYS A HB2  4  
ATOM 2216 H HB3  . CYS A 1 35 ? 6.706   -6.139  6.909  1.00 0.00 ? 35 CYS A HB3  4  
ATOM 2217 N N    . ASP A 1 36 ? 8.384   -6.685  5.052  1.00 0.00 ? 36 ASP A N    4  
ATOM 2218 C CA   . ASP A 1 36 ? 8.849   -7.850  4.308  1.00 0.00 ? 36 ASP A CA   4  
ATOM 2219 C C    . ASP A 1 36 ? 7.676   -8.604  3.689  1.00 0.00 ? 36 ASP A C    4  
ATOM 2220 O O    . ASP A 1 36 ? 7.758   -9.079  2.557  1.00 0.00 ? 36 ASP A O    4  
ATOM 2221 C CB   . ASP A 1 36 ? 9.645   -8.782  5.222  1.00 0.00 ? 36 ASP A CB   4  
ATOM 2222 C CG   . ASP A 1 36 ? 11.117  -8.421  5.277  1.00 0.00 ? 36 ASP A CG   4  
ATOM 2223 O OD1  . ASP A 1 36 ? 11.570  -7.641  4.412  1.00 0.00 ? 36 ASP A OD1  4  
ATOM 2224 O OD2  . ASP A 1 36 ? 11.816  -8.917  6.185  1.00 0.00 ? 36 ASP A OD2  4  
ATOM 2225 H H    . ASP A 1 36 ? 8.721   -6.532  5.960  1.00 0.00 ? 36 ASP A H    4  
ATOM 2226 H HA   . ASP A 1 36 ? 9.494   -7.501  3.515  1.00 0.00 ? 36 ASP A HA   4  
ATOM 2227 H HB2  . ASP A 1 36 ? 9.242   -8.724  6.223  1.00 0.00 ? 36 ASP A HB2  4  
ATOM 2228 H HB3  . ASP A 1 36 ? 9.555   -9.795  4.859  1.00 0.00 ? 36 ASP A HB3  4  
ATOM 2229 N N    . ALA A 1 37 ? 6.585   -8.710  4.441  1.00 0.00 ? 37 ALA A N    4  
ATOM 2230 C CA   . ALA A 1 37 ? 5.395   -9.405  3.967  1.00 0.00 ? 37 ALA A CA   4  
ATOM 2231 C C    . ALA A 1 37 ? 4.408   -8.432  3.330  1.00 0.00 ? 37 ALA A C    4  
ATOM 2232 O O    . ALA A 1 37 ? 3.993   -7.457  3.955  1.00 0.00 ? 37 ALA A O    4  
ATOM 2233 C CB   . ALA A 1 37 ? 4.733   -10.158 5.110  1.00 0.00 ? 37 ALA A CB   4  
ATOM 2234 H H    . ALA A 1 37 ? 6.580   -8.310  5.335  1.00 0.00 ? 37 ALA A H    4  
ATOM 2235 H HA   . ALA A 1 37 ? 5.704   -10.126 3.224  1.00 0.00 ? 37 ALA A HA   4  
ATOM 2236 H HB1  . ALA A 1 37 ? 4.402   -11.125 4.760  1.00 0.00 ? 37 ALA A HB1  4  
ATOM 2237 H HB2  . ALA A 1 37 ? 5.442   -10.290 5.913  1.00 0.00 ? 37 ALA A HB2  4  
ATOM 2238 H HB3  . ALA A 1 37 ? 3.884   -9.595  5.468  1.00 0.00 ? 37 ALA A HB3  4  
ATOM 2239 N N    . SER A 1 38 ? 4.037   -8.704  2.083  1.00 0.00 ? 38 SER A N    4  
ATOM 2240 C CA   . SER A 1 38 ? 3.103   -7.850  1.360  1.00 0.00 ? 38 SER A CA   4  
ATOM 2241 C C    . SER A 1 38 ? 1.766   -7.766  2.091  1.00 0.00 ? 38 SER A C    4  
ATOM 2242 O O    . SER A 1 38 ? 0.801   -8.433  1.721  1.00 0.00 ? 38 SER A O    4  
ATOM 2243 C CB   . SER A 1 38 ? 2.888   -8.379  -0.060 1.00 0.00 ? 38 SER A CB   4  
ATOM 2244 O OG   . SER A 1 38 ? 2.495   -9.740  -0.042 1.00 0.00 ? 38 SER A OG   4  
ATOM 2245 H H    . SER A 1 38 ? 4.403   -9.497  1.638  1.00 0.00 ? 38 SER A H    4  
ATOM 2246 H HA   . SER A 1 38 ? 3.532   -6.861  1.305  1.00 0.00 ? 38 SER A HA   4  
ATOM 2247 H HB2  . SER A 1 38 ? 2.117   -7.800  -0.544 1.00 0.00 ? 38 SER A HB2  4  
ATOM 2248 H HB3  . SER A 1 38 ? 3.809   -8.290  -0.617 1.00 0.00 ? 38 SER A HB3  4  
ATOM 2249 H HG   . SER A 1 38 ? 2.009   -9.923  0.765  1.00 0.00 ? 38 SER A HG   4  
ATOM 2250 N N    . GLY A 1 39 ? 1.719   -6.941  3.132  1.00 0.00 ? 39 GLY A N    4  
ATOM 2251 C CA   . GLY A 1 39 ? 0.497   -6.784  3.900  1.00 0.00 ? 39 GLY A CA   4  
ATOM 2252 C C    . GLY A 1 39 ? 0.719   -6.028  5.195  1.00 0.00 ? 39 GLY A C    4  
ATOM 2253 O O    . GLY A 1 39 ? -0.217  -5.460  5.758  1.00 0.00 ? 39 GLY A O    4  
ATOM 2254 H H    . GLY A 1 39 ? 2.520   -6.434  3.381  1.00 0.00 ? 39 GLY A H    4  
ATOM 2255 H HA2  . GLY A 1 39 ? -0.225  -6.249  3.302  1.00 0.00 ? 39 GLY A HA2  4  
ATOM 2256 H HA3  . GLY A 1 39 ? 0.103   -7.763  4.131  1.00 0.00 ? 39 GLY A HA3  4  
ATOM 2257 N N    . ASP A 1 40 ? 1.960   -6.022  5.669  1.00 0.00 ? 40 ASP A N    4  
ATOM 2258 C CA   . ASP A 1 40 ? 2.302   -5.330  6.907  1.00 0.00 ? 40 ASP A CA   4  
ATOM 2259 C C    . ASP A 1 40 ? 2.708   -3.886  6.628  1.00 0.00 ? 40 ASP A C    4  
ATOM 2260 O O    . ASP A 1 40 ? 3.515   -3.619  5.738  1.00 0.00 ? 40 ASP A O    4  
ATOM 2261 C CB   . ASP A 1 40 ? 3.435   -6.062  7.628  1.00 0.00 ? 40 ASP A CB   4  
ATOM 2262 C CG   . ASP A 1 40 ? 2.923   -7.083  8.624  1.00 0.00 ? 40 ASP A CG   4  
ATOM 2263 O OD1  . ASP A 1 40 ? 2.561   -8.200  8.196  1.00 0.00 ? 40 ASP A OD1  4  
ATOM 2264 O OD2  . ASP A 1 40 ? 2.886   -6.767  9.831  1.00 0.00 ? 40 ASP A OD2  4  
ATOM 2265 H H    . ASP A 1 40 ? 2.663   -6.493  5.174  1.00 0.00 ? 40 ASP A H    4  
ATOM 2266 H HA   . ASP A 1 40 ? 1.427   -5.330  7.539  1.00 0.00 ? 40 ASP A HA   4  
ATOM 2267 H HB2  . ASP A 1 40 ? 4.047   -6.573  6.899  1.00 0.00 ? 40 ASP A HB2  4  
ATOM 2268 H HB3  . ASP A 1 40 ? 4.040   -5.341  8.157  1.00 0.00 ? 40 ASP A HB3  4  
ATOM 2269 N N    . ARG A 1 41 ? 2.141   -2.960  7.394  1.00 0.00 ? 41 ARG A N    4  
ATOM 2270 C CA   . ARG A 1 41 ? 2.442   -1.543  7.228  1.00 0.00 ? 41 ARG A CA   4  
ATOM 2271 C C    . ARG A 1 41 ? 3.537   -1.103  8.196  1.00 0.00 ? 41 ARG A C    4  
ATOM 2272 O O    . ARG A 1 41 ? 3.479   -1.397  9.391  1.00 0.00 ? 41 ARG A O    4  
ATOM 2273 C CB   . ARG A 1 41 ? 1.183   -0.703  7.449  1.00 0.00 ? 41 ARG A CB   4  
ATOM 2274 C CG   . ARG A 1 41 ? 0.068   -1.452  8.161  1.00 0.00 ? 41 ARG A CG   4  
ATOM 2275 C CD   . ARG A 1 41 ? -1.057  -0.516  8.573  1.00 0.00 ? 41 ARG A CD   4  
ATOM 2276 N NE   . ARG A 1 41 ? -2.172  -0.553  7.631  1.00 0.00 ? 41 ARG A NE   4  
ATOM 2277 C CZ   . ARG A 1 41 ? -2.220  0.173   6.520  1.00 0.00 ? 41 ARG A CZ   4  
ATOM 2278 N NH1  . ARG A 1 41 ? -1.221  0.988   6.213  1.00 0.00 ? 41 ARG A NH1  4  
ATOM 2279 N NH2  . ARG A 1 41 ? -3.269  0.084   5.712  1.00 0.00 ? 41 ARG A NH2  4  
ATOM 2280 H H    . ARG A 1 41 ? 1.505   -3.235  8.087  1.00 0.00 ? 41 ARG A H    4  
ATOM 2281 H HA   . ARG A 1 41 ? 2.791   -1.394  6.217  1.00 0.00 ? 41 ARG A HA   4  
ATOM 2282 H HB2  . ARG A 1 41 ? 1.441   0.163   8.042  1.00 0.00 ? 41 ARG A HB2  4  
ATOM 2283 H HB3  . ARG A 1 41 ? 0.811   -0.375  6.490  1.00 0.00 ? 41 ARG A HB3  4  
ATOM 2284 H HG2  . ARG A 1 41 ? -0.329  -2.204  7.496  1.00 0.00 ? 41 ARG A HG2  4  
ATOM 2285 H HG3  . ARG A 1 41 ? 0.472   -1.926  9.044  1.00 0.00 ? 41 ARG A HG3  4  
ATOM 2286 H HD2  . ARG A 1 41 ? -1.413  -0.810  9.549  1.00 0.00 ? 41 ARG A HD2  4  
ATOM 2287 H HD3  . ARG A 1 41 ? -0.671  0.491   8.620  1.00 0.00 ? 41 ARG A HD3  4  
ATOM 2288 H HE   . ARG A 1 41 ? -2.922  -1.149  7.838  1.00 0.00 ? 41 ARG A HE   4  
ATOM 2289 H HH11 . ARG A 1 41 ? -0.428  1.057   6.819  1.00 0.00 ? 41 ARG A HH11 4  
ATOM 2290 H HH12 . ARG A 1 41 ? -1.259  1.533   5.375  1.00 0.00 ? 41 ARG A HH12 4  
ATOM 2291 H HH21 . ARG A 1 41 ? -4.025  -0.530  5.940  1.00 0.00 ? 41 ARG A HH21 4  
ATOM 2292 H HH22 . ARG A 1 41 ? -3.305  0.631   4.877  1.00 0.00 ? 41 ARG A HH22 4  
ATOM 2293 N N    . CYS A 1 42 ? 4.533   -0.396  7.673  1.00 0.00 ? 42 CYS A N    4  
ATOM 2294 C CA   . CYS A 1 42 ? 5.641   0.085   8.489  1.00 0.00 ? 42 CYS A CA   4  
ATOM 2295 C C    . CYS A 1 42 ? 5.250   1.351   9.247  1.00 0.00 ? 42 CYS A C    4  
ATOM 2296 O O    . CYS A 1 42 ? 4.753   2.311   8.658  1.00 0.00 ? 42 CYS A O    4  
ATOM 2297 C CB   . CYS A 1 42 ? 6.865   0.359   7.614  1.00 0.00 ? 42 CYS A CB   4  
ATOM 2298 S SG   . CYS A 1 42 ? 8.002   -1.056  7.461  1.00 0.00 ? 42 CYS A SG   4  
ATOM 2299 H H    . CYS A 1 42 ? 4.523   -0.192  6.714  1.00 0.00 ? 42 CYS A H    4  
ATOM 2300 H HA   . CYS A 1 42 ? 5.886   -0.686  9.204  1.00 0.00 ? 42 CYS A HA   4  
ATOM 2301 H HB2  . CYS A 1 42 ? 6.535   0.623   6.619  1.00 0.00 ? 42 CYS A HB2  4  
ATOM 2302 H HB3  . CYS A 1 42 ? 7.421   1.184   8.034  1.00 0.00 ? 42 CYS A HB3  4  
ATOM 2303 N N    . CYS A 1 43 ? 5.477   1.345   10.556 1.00 0.00 ? 43 CYS A N    4  
ATOM 2304 C CA   . CYS A 1 43 ? 5.150   2.491   11.395 1.00 0.00 ? 43 CYS A CA   4  
ATOM 2305 C C    . CYS A 1 43 ? 6.367   3.391   11.585 1.00 0.00 ? 43 CYS A C    4  
ATOM 2306 O O    . CYS A 1 43 ? 7.504   2.972   11.367 1.00 0.00 ? 43 CYS A O    4  
ATOM 2307 C CB   . CYS A 1 43 ? 4.631   2.021   12.755 1.00 0.00 ? 43 CYS A CB   4  
ATOM 2308 S SG   . CYS A 1 43 ? 2.892   1.477   12.741 1.00 0.00 ? 43 CYS A SG   4  
ATOM 2309 H H    . CYS A 1 43 ? 5.876   0.549   10.968 1.00 0.00 ? 43 CYS A H    4  
ATOM 2310 H HA   . CYS A 1 43 ? 4.374   3.054   10.899 1.00 0.00 ? 43 CYS A HA   4  
ATOM 2311 H HB2  . CYS A 1 43 ? 5.232   1.190   13.094 1.00 0.00 ? 43 CYS A HB2  4  
ATOM 2312 H HB3  . CYS A 1 43 ? 4.716   2.832   13.464 1.00 0.00 ? 43 CYS A HB3  4  
ATOM 2313 N N    . CYS A 1 44 ? 6.120   4.631   11.995 1.00 0.00 ? 44 CYS A N    4  
ATOM 2314 C CA   . CYS A 1 44 ? 7.194   5.592   12.215 1.00 0.00 ? 44 CYS A CA   4  
ATOM 2315 C C    . CYS A 1 44 ? 6.975   6.364   13.513 1.00 0.00 ? 44 CYS A C    4  
ATOM 2316 O O    . CYS A 1 44 ? 5.891   6.894   13.757 1.00 0.00 ? 44 CYS A O    4  
ATOM 2317 C CB   . CYS A 1 44 ? 7.285   6.566   11.039 1.00 0.00 ? 44 CYS A CB   4  
ATOM 2318 S SG   . CYS A 1 44 ? 7.552   5.761   9.427  1.00 0.00 ? 44 CYS A SG   4  
ATOM 2319 H H    . CYS A 1 44 ? 5.192   4.907   12.152 1.00 0.00 ? 44 CYS A H    4  
ATOM 2320 H HA   . CYS A 1 44 ? 8.120   5.043   12.290 1.00 0.00 ? 44 CYS A HA   4  
ATOM 2321 H HB2  . CYS A 1 44 ? 6.365   7.129   10.976 1.00 0.00 ? 44 CYS A HB2  4  
ATOM 2322 H HB3  . CYS A 1 44 ? 8.106   7.247   11.207 1.00 0.00 ? 44 CYS A HB3  4  
ATOM 2323 N N    . ALA A 1 45 ? 8.012   6.423   14.342 1.00 0.00 ? 45 ALA A N    4  
ATOM 2324 C CA   . ALA A 1 45 ? 7.934   7.132   15.614 1.00 0.00 ? 45 ALA A CA   4  
ATOM 2325 C C    . ALA A 1 45 ? 8.089   8.636   15.415 1.00 0.00 ? 45 ALA A C    4  
ATOM 2326 O O    . ALA A 1 45 ? 7.719   9.428   16.282 1.00 0.00 ? 45 ALA A O    4  
ATOM 2327 C CB   . ALA A 1 45 ? 8.995   6.613   16.573 1.00 0.00 ? 45 ALA A CB   4  
ATOM 2328 H H    . ALA A 1 45 ? 8.849   5.981   14.092 1.00 0.00 ? 45 ALA A H    4  
ATOM 2329 H HA   . ALA A 1 45 ? 6.964   6.934   16.047 1.00 0.00 ? 45 ALA A HA   4  
ATOM 2330 H HB1  . ALA A 1 45 ? 9.270   5.606   16.294 1.00 0.00 ? 45 ALA A HB1  4  
ATOM 2331 H HB2  . ALA A 1 45 ? 9.865   7.250   16.526 1.00 0.00 ? 45 ALA A HB2  4  
ATOM 2332 H HB3  . ALA A 1 45 ? 8.602   6.613   17.579 1.00 0.00 ? 45 ALA A HB3  4  
ATOM 2333 N N    . CYS A 1 1  ? 1.059   -0.095  -0.417 1.00 0.00 ? 1  CYS A N    5  
ATOM 2334 C CA   . CYS A 1 1  ? 1.972   -0.096  -1.553 1.00 0.00 ? 1  CYS A CA   5  
ATOM 2335 C C    . CYS A 1 1  ? 2.670   -1.446  -1.690 1.00 0.00 ? 1  CYS A C    5  
ATOM 2336 O O    . CYS A 1 1  ? 2.839   -2.171  -0.709 1.00 0.00 ? 1  CYS A O    5  
ATOM 2337 C CB   . CYS A 1 1  ? 3.012   1.015   -1.399 1.00 0.00 ? 1  CYS A CB   5  
ATOM 2338 S SG   . CYS A 1 1  ? 3.671   1.187   0.291  1.00 0.00 ? 1  CYS A SG   5  
ATOM 2339 H H    . CYS A 1 1  ? 1.397   -0.351  0.468  1.00 0.00 ? 1  CYS A H    5  
ATOM 2340 H HA   . CYS A 1 1  ? 1.392   0.087   -2.445 1.00 0.00 ? 1  CYS A HA   5  
ATOM 2341 H HB2  . CYS A 1 1  ? 3.845   0.811   -2.056 1.00 0.00 ? 1  CYS A HB2  5  
ATOM 2342 H HB3  . CYS A 1 1  ? 2.565   1.958   -1.676 1.00 0.00 ? 1  CYS A HB3  5  
ATOM 2343 N N    . TYR A 1 2  ? 3.072   -1.777  -2.911 1.00 0.00 ? 2  TYR A N    5  
ATOM 2344 C CA   . TYR A 1 2  ? 3.750   -3.041  -3.177 1.00 0.00 ? 2  TYR A CA   5  
ATOM 2345 C C    . TYR A 1 2  ? 5.245   -2.926  -2.900 1.00 0.00 ? 2  TYR A C    5  
ATOM 2346 O O    . TYR A 1 2  ? 5.821   -1.837  -2.900 1.00 0.00 ? 2  TYR A O    5  
ATOM 2347 C CB   . TYR A 1 2  ? 3.520   -3.472  -4.627 1.00 0.00 ? 2  TYR A CB   5  
ATOM 2348 C CG   . TYR A 1 2  ? 2.824   -4.808  -4.758 1.00 0.00 ? 2  TYR A CG   5  
ATOM 2349 C CD1  . TYR A 1 2  ? 1.686   -5.096  -4.015 1.00 0.00 ? 2  TYR A CD1  5  
ATOM 2350 C CD2  . TYR A 1 2  ? 3.305   -5.782  -5.624 1.00 0.00 ? 2  TYR A CD2  5  
ATOM 2351 C CE1  . TYR A 1 2  ? 1.047   -6.316  -4.131 1.00 0.00 ? 2  TYR A CE1  5  
ATOM 2352 C CE2  . TYR A 1 2  ? 2.672   -7.004  -5.747 1.00 0.00 ? 2  TYR A CE2  5  
ATOM 2353 C CZ   . TYR A 1 2  ? 1.544   -7.266  -4.999 1.00 0.00 ? 2  TYR A CZ   5  
ATOM 2354 O OH   . TYR A 1 2  ? 0.911   -8.482  -5.118 1.00 0.00 ? 2  TYR A OH   5  
ATOM 2355 H H    . TYR A 1 2  ? 2.909   -1.158  -3.653 1.00 0.00 ? 2  TYR A H    5  
ATOM 2356 H HA   . TYR A 1 2  ? 3.329   -3.787  -2.519 1.00 0.00 ? 2  TYR A HA   5  
ATOM 2357 H HB2  . TYR A 1 2  ? 2.911   -2.732  -5.123 1.00 0.00 ? 2  TYR A HB2  5  
ATOM 2358 H HB3  . TYR A 1 2  ? 4.473   -3.543  -5.129 1.00 0.00 ? 2  TYR A HB3  5  
ATOM 2359 H HD1  . TYR A 1 2  ? 1.299   -4.350  -3.336 1.00 0.00 ? 2  TYR A HD1  5  
ATOM 2360 H HD2  . TYR A 1 2  ? 4.190   -5.573  -6.208 1.00 0.00 ? 2  TYR A HD2  5  
ATOM 2361 H HE1  . TYR A 1 2  ? 0.163   -6.521  -3.546 1.00 0.00 ? 2  TYR A HE1  5  
ATOM 2362 H HE2  . TYR A 1 2  ? 3.062   -7.748  -6.426 1.00 0.00 ? 2  TYR A HE2  5  
ATOM 2363 H HH   . TYR A 1 2  ? 0.632   -8.784  -4.250 1.00 0.00 ? 2  TYR A HH   5  
ATOM 2364 N N    . PRO A 1 3  ? 5.891   -4.076  -2.659 1.00 0.00 ? 3  PRO A N    5  
ATOM 2365 C CA   . PRO A 1 3  ? 7.329   -4.133  -2.377 1.00 0.00 ? 3  PRO A CA   5  
ATOM 2366 C C    . PRO A 1 3  ? 8.173   -3.802  -3.602 1.00 0.00 ? 3  PRO A C    5  
ATOM 2367 O O    . PRO A 1 3  ? 8.623   -4.696  -4.318 1.00 0.00 ? 3  PRO A O    5  
ATOM 2368 C CB   . PRO A 1 3  ? 7.550   -5.587  -1.952 1.00 0.00 ? 3  PRO A CB   5  
ATOM 2369 C CG   . PRO A 1 3  ? 6.446   -6.344  -2.605 1.00 0.00 ? 3  PRO A CG   5  
ATOM 2370 C CD   . PRO A 1 3  ? 5.268   -5.410  -2.643 1.00 0.00 ? 3  PRO A CD   5  
ATOM 2371 H HA   . PRO A 1 3  ? 7.600   -3.473  -1.565 1.00 0.00 ? 3  PRO A HA   5  
ATOM 2372 H HB2  . PRO A 1 3  ? 8.518   -5.922  -2.296 1.00 0.00 ? 3  PRO A HB2  5  
ATOM 2373 H HB3  . PRO A 1 3  ? 7.498   -5.663  -0.876 1.00 0.00 ? 3  PRO A HB3  5  
ATOM 2374 H HG2  . PRO A 1 3  ? 6.735   -6.624  -3.607 1.00 0.00 ? 3  PRO A HG2  5  
ATOM 2375 H HG3  . PRO A 1 3  ? 6.209   -7.222  -2.023 1.00 0.00 ? 3  PRO A HG3  5  
ATOM 2376 H HD2  . PRO A 1 3  ? 4.685   -5.574  -3.537 1.00 0.00 ? 3  PRO A HD2  5  
ATOM 2377 H HD3  . PRO A 1 3  ? 4.656   -5.539  -1.762 1.00 0.00 ? 3  PRO A HD3  5  
ATOM 2378 N N    . GLY A 1 4  ? 8.386   -2.511  -3.838 1.00 0.00 ? 4  GLY A N    5  
ATOM 2379 C CA   . GLY A 1 4  ? 9.177   -2.085  -4.978 1.00 0.00 ? 4  GLY A CA   5  
ATOM 2380 C C    . GLY A 1 4  ? 8.449   -1.076  -5.844 1.00 0.00 ? 4  GLY A C    5  
ATOM 2381 O O    . GLY A 1 4  ? 8.880   -0.781  -6.958 1.00 0.00 ? 4  GLY A O    5  
ATOM 2382 H H    . GLY A 1 4  ? 8.003   -1.842  -3.233 1.00 0.00 ? 4  GLY A H    5  
ATOM 2383 H HA2  . GLY A 1 4  ? 10.094  -1.642  -4.621 1.00 0.00 ? 4  GLY A HA2  5  
ATOM 2384 H HA3  . GLY A 1 4  ? 9.417   -2.951  -5.578 1.00 0.00 ? 4  GLY A HA3  5  
ATOM 2385 N N    . GLN A 1 5  ? 7.342   -0.549  -5.332 1.00 0.00 ? 5  GLN A N    5  
ATOM 2386 C CA   . GLN A 1 5  ? 6.552   0.431   -6.069 1.00 0.00 ? 5  GLN A CA   5  
ATOM 2387 C C    . GLN A 1 5  ? 7.225   1.799   -6.049 1.00 0.00 ? 5  GLN A C    5  
ATOM 2388 O O    . GLN A 1 5  ? 8.003   2.122   -5.151 1.00 0.00 ? 5  GLN A O    5  
ATOM 2389 C CB   . GLN A 1 5  ? 5.145   0.532   -5.476 1.00 0.00 ? 5  GLN A CB   5  
ATOM 2390 C CG   . GLN A 1 5  ? 4.340   -0.752  -5.597 1.00 0.00 ? 5  GLN A CG   5  
ATOM 2391 C CD   . GLN A 1 5  ? 2.859   -0.496  -5.793 1.00 0.00 ? 5  GLN A CD   5  
ATOM 2392 O OE1  . GLN A 1 5  ? 2.188   0.042   -4.912 1.00 0.00 ? 5  GLN A OE1  5  
ATOM 2393 N NE2  . GLN A 1 5  ? 2.340   -0.880  -6.954 1.00 0.00 ? 5  GLN A NE2  5  
ATOM 2394 H H    . GLN A 1 5  ? 7.049   -0.825  -4.439 1.00 0.00 ? 5  GLN A H    5  
ATOM 2395 H HA   . GLN A 1 5  ? 6.478   0.095   -7.092 1.00 0.00 ? 5  GLN A HA   5  
ATOM 2396 H HB2  . GLN A 1 5  ? 5.225   0.785   -4.430 1.00 0.00 ? 5  GLN A HB2  5  
ATOM 2397 H HB3  . GLN A 1 5  ? 4.608   1.317   -5.988 1.00 0.00 ? 5  GLN A HB3  5  
ATOM 2398 H HG2  . GLN A 1 5  ? 4.707   -1.314  -6.443 1.00 0.00 ? 5  GLN A HG2  5  
ATOM 2399 H HG3  . GLN A 1 5  ? 4.474   -1.331  -4.696 1.00 0.00 ? 5  GLN A HG3  5  
ATOM 2400 H HE21 . GLN A 1 5  ? 2.935   -1.303  -7.609 1.00 0.00 ? 5  GLN A HE21 5  
ATOM 2401 H HE22 . GLN A 1 5  ? 1.385   -0.728  -7.107 1.00 0.00 ? 5  GLN A HE22 5  
ATOM 2402 N N    . PRO A 1 6  ? 6.920   2.624   -7.061 1.00 0.00 ? 6  PRO A N    5  
ATOM 2403 C CA   . PRO A 1 6  ? 7.485   3.972   -7.182 1.00 0.00 ? 6  PRO A CA   5  
ATOM 2404 C C    . PRO A 1 6  ? 6.949   4.923   -6.117 1.00 0.00 ? 6  PRO A C    5  
ATOM 2405 O O    . PRO A 1 6  ? 5.996   5.663   -6.355 1.00 0.00 ? 6  PRO A O    5  
ATOM 2406 C CB   . PRO A 1 6  ? 7.035   4.421   -8.575 1.00 0.00 ? 6  PRO A CB   5  
ATOM 2407 C CG   . PRO A 1 6  ? 5.802   3.631   -8.848 1.00 0.00 ? 6  PRO A CG   5  
ATOM 2408 C CD   . PRO A 1 6  ? 6.000   2.306   -8.166 1.00 0.00 ? 6  PRO A CD   5  
ATOM 2409 H HA   . PRO A 1 6  ? 8.564   3.955   -7.138 1.00 0.00 ? 6  PRO A HA   5  
ATOM 2410 H HB2  . PRO A 1 6  ? 6.831   5.483   -8.565 1.00 0.00 ? 6  PRO A HB2  5  
ATOM 2411 H HB3  . PRO A 1 6  ? 7.810   4.205   -9.294 1.00 0.00 ? 6  PRO A HB3  5  
ATOM 2412 H HG2  . PRO A 1 6  ? 4.942   4.139   -8.439 1.00 0.00 ? 6  PRO A HG2  5  
ATOM 2413 H HG3  . PRO A 1 6  ? 5.685   3.491   -9.913 1.00 0.00 ? 6  PRO A HG3  5  
ATOM 2414 H HD2  . PRO A 1 6  ? 5.060   1.931   -7.789 1.00 0.00 ? 6  PRO A HD2  5  
ATOM 2415 H HD3  . PRO A 1 6  ? 6.446   1.594   -8.845 1.00 0.00 ? 6  PRO A HD3  5  
ATOM 2416 N N    . GLY A 1 7  ? 7.569   4.897   -4.941 1.00 0.00 ? 7  GLY A N    5  
ATOM 2417 C CA   . GLY A 1 7  ? 7.141   5.762   -3.857 1.00 0.00 ? 7  GLY A CA   5  
ATOM 2418 C C    . GLY A 1 7  ? 7.063   5.033   -2.530 1.00 0.00 ? 7  GLY A C    5  
ATOM 2419 O O    . GLY A 1 7  ? 6.660   5.609   -1.519 1.00 0.00 ? 7  GLY A O    5  
ATOM 2420 H H    . GLY A 1 7  ? 8.324   4.286   -4.809 1.00 0.00 ? 7  GLY A H    5  
ATOM 2421 H HA2  . GLY A 1 7  ? 7.839   6.580   -3.766 1.00 0.00 ? 7  GLY A HA2  5  
ATOM 2422 H HA3  . GLY A 1 7  ? 6.165   6.159   -4.094 1.00 0.00 ? 7  GLY A HA3  5  
ATOM 2423 N N    . CYS A 1 8  ? 7.447   3.761   -2.532 1.00 0.00 ? 8  CYS A N    5  
ATOM 2424 C CA   . CYS A 1 8  ? 7.417   2.951   -1.321 1.00 0.00 ? 8  CYS A CA   5  
ATOM 2425 C C    . CYS A 1 8  ? 8.710   2.155   -1.167 1.00 0.00 ? 8  CYS A C    5  
ATOM 2426 O O    . CYS A 1 8  ? 9.369   1.824   -2.151 1.00 0.00 ? 8  CYS A O    5  
ATOM 2427 C CB   . CYS A 1 8  ? 6.220   1.999   -1.348 1.00 0.00 ? 8  CYS A CB   5  
ATOM 2428 S SG   . CYS A 1 8  ? 5.592   1.546   0.301  1.00 0.00 ? 8  CYS A SG   5  
ATOM 2429 H H    . CYS A 1 8  ? 7.758   3.356   -3.370 1.00 0.00 ? 8  CYS A H    5  
ATOM 2430 H HA   . CYS A 1 8  ? 7.317   3.617   -0.478 1.00 0.00 ? 8  CYS A HA   5  
ATOM 2431 H HB2  . CYS A 1 8  ? 5.410   2.466   -1.890 1.00 0.00 ? 8  CYS A HB2  5  
ATOM 2432 H HB3  . CYS A 1 8  ? 6.505   1.088   -1.853 1.00 0.00 ? 8  CYS A HB3  5  
ATOM 2433 N N    . GLY A 1 9  ? 9.067   1.850   0.078  1.00 0.00 ? 9  GLY A N    5  
ATOM 2434 C CA   . GLY A 1 9  ? 10.278  1.096   0.339  1.00 0.00 ? 9  GLY A CA   5  
ATOM 2435 C C    . GLY A 1 9  ? 10.323  0.539   1.748  1.00 0.00 ? 9  GLY A C    5  
ATOM 2436 O O    . GLY A 1 9  ? 9.376   0.703   2.518  1.00 0.00 ? 9  GLY A O    5  
ATOM 2437 H H    . GLY A 1 9  ? 8.502   2.140   0.825  1.00 0.00 ? 9  GLY A H    5  
ATOM 2438 H HA2  . GLY A 1 9  ? 10.338  0.277   -0.363 1.00 0.00 ? 9  GLY A HA2  5  
ATOM 2439 H HA3  . GLY A 1 9  ? 11.130  1.744   0.193  1.00 0.00 ? 9  GLY A HA3  5  
ATOM 2440 N N    . HIS A 1 10 ? 11.425  -0.122  2.087  1.00 0.00 ? 10 HIS A N    5  
ATOM 2441 C CA   . HIS A 1 10 ? 11.588  -0.706  3.414  1.00 0.00 ? 10 HIS A CA   5  
ATOM 2442 C C    . HIS A 1 10 ? 11.717  0.383   4.474  1.00 0.00 ? 10 HIS A C    5  
ATOM 2443 O O    . HIS A 1 10 ? 12.618  1.219   4.415  1.00 0.00 ? 10 HIS A O    5  
ATOM 2444 C CB   . HIS A 1 10 ? 12.818  -1.614  3.446  1.00 0.00 ? 10 HIS A CB   5  
ATOM 2445 C CG   . HIS A 1 10 ? 14.112  -0.876  3.283  1.00 0.00 ? 10 HIS A CG   5  
ATOM 2446 N ND1  . HIS A 1 10 ? 14.959  -0.600  4.335  1.00 0.00 ? 10 HIS A ND1  5  
ATOM 2447 C CD2  . HIS A 1 10 ? 14.702  -0.358  2.180  1.00 0.00 ? 10 HIS A CD2  5  
ATOM 2448 C CE1  . HIS A 1 10 ? 16.013  0.058   3.888  1.00 0.00 ? 10 HIS A CE1  5  
ATOM 2449 N NE2  . HIS A 1 10 ? 15.882  0.217   2.583  1.00 0.00 ? 10 HIS A NE2  5  
ATOM 2450 H H    . HIS A 1 10 ? 12.145  -0.220  1.430  1.00 0.00 ? 10 HIS A H    5  
ATOM 2451 H HA   . HIS A 1 10 ? 10.710  -1.297  3.626  1.00 0.00 ? 10 HIS A HA   5  
ATOM 2452 H HB2  . HIS A 1 10 ? 12.850  -2.132  4.393  1.00 0.00 ? 10 HIS A HB2  5  
ATOM 2453 H HB3  . HIS A 1 10 ? 12.745  -2.338  2.647  1.00 0.00 ? 10 HIS A HB3  5  
ATOM 2454 H HD1  . HIS A 1 10 ? 14.808  -0.847  5.271  1.00 0.00 ? 10 HIS A HD1  5  
ATOM 2455 H HD2  . HIS A 1 10 ? 14.317  -0.390  1.171  1.00 0.00 ? 10 HIS A HD2  5  
ATOM 2456 H HE1  . HIS A 1 10 ? 16.842  0.406   4.486  1.00 0.00 ? 10 HIS A HE1  5  
ATOM 2457 N N    . CYS A 1 11 ? 10.808  0.367   5.444  1.00 0.00 ? 11 CYS A N    5  
ATOM 2458 C CA   . CYS A 1 11 ? 10.818  1.353   6.518  1.00 0.00 ? 11 CYS A CA   5  
ATOM 2459 C C    . CYS A 1 11 ? 12.079  1.219   7.368  1.00 0.00 ? 11 CYS A C    5  
ATOM 2460 O O    . CYS A 1 11 ? 12.751  0.188   7.341  1.00 0.00 ? 11 CYS A O    5  
ATOM 2461 C CB   . CYS A 1 11 ? 9.577   1.192   7.398  1.00 0.00 ? 11 CYS A CB   5  
ATOM 2462 S SG   . CYS A 1 11 ? 9.398   -0.465  8.135  1.00 0.00 ? 11 CYS A SG   5  
ATOM 2463 H H    . CYS A 1 11 ? 10.113  -0.325  5.438  1.00 0.00 ? 11 CYS A H    5  
ATOM 2464 H HA   . CYS A 1 11 ? 10.805  2.334   6.068  1.00 0.00 ? 11 CYS A HA   5  
ATOM 2465 H HB2  . CYS A 1 11 ? 9.624   1.907   8.207  1.00 0.00 ? 11 CYS A HB2  5  
ATOM 2466 H HB3  . CYS A 1 11 ? 8.696   1.385   6.804  1.00 0.00 ? 11 CYS A HB3  5  
ATOM 2467 N N    . SER A 1 12 ? 12.392  2.269   8.121  1.00 0.00 ? 12 SER A N    5  
ATOM 2468 C CA   . SER A 1 12 ? 13.574  2.270   8.976  1.00 0.00 ? 12 SER A CA   5  
ATOM 2469 C C    . SER A 1 12 ? 13.347  3.132   10.214 1.00 0.00 ? 12 SER A C    5  
ATOM 2470 O O    . SER A 1 12 ? 12.628  4.130   10.166 1.00 0.00 ? 12 SER A O    5  
ATOM 2471 C CB   . SER A 1 12 ? 14.790  2.782   8.201  1.00 0.00 ? 12 SER A CB   5  
ATOM 2472 O OG   . SER A 1 12 ? 15.810  1.800   8.147  1.00 0.00 ? 12 SER A OG   5  
ATOM 2473 H H    . SER A 1 12 ? 11.817  3.062   8.098  1.00 0.00 ? 12 SER A H    5  
ATOM 2474 H HA   . SER A 1 12 ? 13.758  1.253   9.288  1.00 0.00 ? 12 SER A HA   5  
ATOM 2475 H HB2  . SER A 1 12 ? 14.493  3.030   7.193  1.00 0.00 ? 12 SER A HB2  5  
ATOM 2476 H HB3  . SER A 1 12 ? 15.180  3.663   8.689  1.00 0.00 ? 12 SER A HB3  5  
ATOM 2477 H HG   . SER A 1 12 ? 16.534  2.120   7.604  1.00 0.00 ? 12 SER A HG   5  
ATOM 2478 N N    . ARG A 1 13 ? 13.965  2.738   11.323 1.00 0.00 ? 13 ARG A N    5  
ATOM 2479 C CA   . ARG A 1 13 ? 13.830  3.473   12.575 1.00 0.00 ? 13 ARG A CA   5  
ATOM 2480 C C    . ARG A 1 13 ? 13.845  4.978   12.326 1.00 0.00 ? 13 ARG A C    5  
ATOM 2481 O O    . ARG A 1 13 ? 14.526  5.478   11.430 1.00 0.00 ? 13 ARG A O    5  
ATOM 2482 C CB   . ARG A 1 13 ? 14.956  3.093   13.538 1.00 0.00 ? 13 ARG A CB   5  
ATOM 2483 C CG   . ARG A 1 13 ? 14.734  1.763   14.240 1.00 0.00 ? 13 ARG A CG   5  
ATOM 2484 C CD   . ARG A 1 13 ? 15.087  1.848   15.717 1.00 0.00 ? 13 ARG A CD   5  
ATOM 2485 N NE   . ARG A 1 13 ? 15.553  0.567   16.243 1.00 0.00 ? 13 ARG A NE   5  
ATOM 2486 C CZ   . ARG A 1 13 ? 15.929  0.383   17.503 1.00 0.00 ? 13 ARG A CZ   5  
ATOM 2487 N NH1  . ARG A 1 13 ? 15.895  1.392   18.362 1.00 0.00 ? 13 ARG A NH1  5  
ATOM 2488 N NH2  . ARG A 1 13 ? 16.341  -0.812  17.906 1.00 0.00 ? 13 ARG A NH2  5  
ATOM 2489 H H    . ARG A 1 13 ? 14.524  1.934   11.299 1.00 0.00 ? 13 ARG A H    5  
ATOM 2490 H HA   . ARG A 1 13 ? 12.883  3.203   13.018 1.00 0.00 ? 13 ARG A HA   5  
ATOM 2491 H HB2  . ARG A 1 13 ? 15.882  3.032   12.985 1.00 0.00 ? 13 ARG A HB2  5  
ATOM 2492 H HB3  . ARG A 1 13 ? 15.045  3.862   14.290 1.00 0.00 ? 13 ARG A HB3  5  
ATOM 2493 H HG2  . ARG A 1 13 ? 13.694  1.486   14.146 1.00 0.00 ? 13 ARG A HG2  5  
ATOM 2494 H HG3  . ARG A 1 13 ? 15.353  1.012   13.773 1.00 0.00 ? 13 ARG A HG3  5  
ATOM 2495 H HD2  . ARG A 1 13 ? 15.867  2.583   15.845 1.00 0.00 ? 13 ARG A HD2  5  
ATOM 2496 H HD3  . ARG A 1 13 ? 14.209  2.155   16.266 1.00 0.00 ? 13 ARG A HD3  5  
ATOM 2497 H HE   . ARG A 1 13 ? 15.586  -0.192  15.624 1.00 0.00 ? 13 ARG A HE   5  
ATOM 2498 H HH11 . ARG A 1 13 ? 15.585  2.294   18.062 1.00 0.00 ? 13 ARG A HH11 5  
ATOM 2499 H HH12 . ARG A 1 13 ? 16.178  1.251   19.311 1.00 0.00 ? 13 ARG A HH12 5  
ATOM 2500 H HH21 . ARG A 1 13 ? 16.367  -1.575  17.261 1.00 0.00 ? 13 ARG A HH21 5  
ATOM 2501 H HH22 . ARG A 1 13 ? 16.624  -0.949  18.855 1.00 0.00 ? 13 ARG A HH22 5  
ATOM 2502 N N    . PRO A 1 14 ? 13.076  5.720   13.137 1.00 0.00 ? 14 PRO A N    5  
ATOM 2503 C CA   . PRO A 1 14 ? 12.260  5.137   14.207 1.00 0.00 ? 14 PRO A CA   5  
ATOM 2504 C C    . PRO A 1 14 ? 11.084  4.332   13.665 1.00 0.00 ? 14 PRO A C    5  
ATOM 2505 O O    . PRO A 1 14 ? 10.163  3.988   14.405 1.00 0.00 ? 14 PRO A O    5  
ATOM 2506 C CB   . PRO A 1 14 ? 11.761  6.360   14.979 1.00 0.00 ? 14 PRO A CB   5  
ATOM 2507 C CG   . PRO A 1 14 ? 11.783  7.470   13.986 1.00 0.00 ? 14 PRO A CG   5  
ATOM 2508 C CD   . PRO A 1 14 ? 12.943  7.185   13.072 1.00 0.00 ? 14 PRO A CD   5  
ATOM 2509 H HA   . PRO A 1 14 ? 12.851  4.512   14.861 1.00 0.00 ? 14 PRO A HA   5  
ATOM 2510 H HB2  . PRO A 1 14 ? 10.760  6.175   15.344 1.00 0.00 ? 14 PRO A HB2  5  
ATOM 2511 H HB3  . PRO A 1 14 ? 12.422  6.560   15.810 1.00 0.00 ? 14 PRO A HB3  5  
ATOM 2512 H HG2  . PRO A 1 14 ? 10.860  7.483   13.428 1.00 0.00 ? 14 PRO A HG2  5  
ATOM 2513 H HG3  . PRO A 1 14 ? 11.930  8.413   14.493 1.00 0.00 ? 14 PRO A HG3  5  
ATOM 2514 H HD2  . PRO A 1 14 ? 12.718  7.508   12.066 1.00 0.00 ? 14 PRO A HD2  5  
ATOM 2515 H HD3  . PRO A 1 14 ? 13.837  7.669   13.435 1.00 0.00 ? 14 PRO A HD3  5  
ATOM 2516 N N    . ASN A 1 15 ? 11.122  4.035   12.370 1.00 0.00 ? 15 ASN A N    5  
ATOM 2517 C CA   . ASN A 1 15 ? 10.057  3.271   11.730 1.00 0.00 ? 15 ASN A CA   5  
ATOM 2518 C C    . ASN A 1 15 ? 10.274  1.773   11.920 1.00 0.00 ? 15 ASN A C    5  
ATOM 2519 O O    . ASN A 1 15 ? 11.408  1.293   11.920 1.00 0.00 ? 15 ASN A O    5  
ATOM 2520 C CB   . ASN A 1 15 ? 9.990   3.602   10.238 1.00 0.00 ? 15 ASN A CB   5  
ATOM 2521 C CG   . ASN A 1 15 ? 10.283  5.063   9.956  1.00 0.00 ? 15 ASN A CG   5  
ATOM 2522 O OD1  . ASN A 1 15 ? 10.058  5.927   10.804 1.00 0.00 ? 15 ASN A OD1  5  
ATOM 2523 N ND2  . ASN A 1 15 ? 10.786  5.346   8.760  1.00 0.00 ? 15 ASN A ND2  5  
ATOM 2524 H H    . ASN A 1 15 ? 11.883  4.338   11.832 1.00 0.00 ? 15 ASN A H    5  
ATOM 2525 H HA   . ASN A 1 15 ? 9.124   3.550   12.194 1.00 0.00 ? 15 ASN A HA   5  
ATOM 2526 H HB2  . ASN A 1 15 ? 10.715  3.001   9.709  1.00 0.00 ? 15 ASN A HB2  5  
ATOM 2527 H HB3  . ASN A 1 15 ? 9.002   3.374   9.868  1.00 0.00 ? 15 ASN A HB3  5  
ATOM 2528 H HD21 . ASN A 1 15 ? 10.938  4.606   8.135  1.00 0.00 ? 15 ASN A HD21 5  
ATOM 2529 H HD22 . ASN A 1 15 ? 10.985  6.282   8.552  1.00 0.00 ? 15 ASN A HD22 5  
ATOM 2530 N N    . TYR A 1 16 ? 9.179   1.038   12.083 1.00 0.00 ? 16 TYR A N    5  
ATOM 2531 C CA   . TYR A 1 16 ? 9.248   -0.405  12.276 1.00 0.00 ? 16 TYR A CA   5  
ATOM 2532 C C    . TYR A 1 16 ? 8.091   -1.105  11.571 1.00 0.00 ? 16 TYR A C    5  
ATOM 2533 O O    . TYR A 1 16 ? 7.332   -0.482  10.828 1.00 0.00 ? 16 TYR A O    5  
ATOM 2534 C CB   . TYR A 1 16 ? 9.230   -0.743  13.768 1.00 0.00 ? 16 TYR A CB   5  
ATOM 2535 C CG   . TYR A 1 16 ? 7.889   -0.508  14.426 1.00 0.00 ? 16 TYR A CG   5  
ATOM 2536 C CD1  . TYR A 1 16 ? 7.463   0.777   14.740 1.00 0.00 ? 16 TYR A CD1  5  
ATOM 2537 C CD2  . TYR A 1 16 ? 7.049   -1.570  14.733 1.00 0.00 ? 16 TYR A CD2  5  
ATOM 2538 C CE1  . TYR A 1 16 ? 6.239   0.996   15.342 1.00 0.00 ? 16 TYR A CE1  5  
ATOM 2539 C CE2  . TYR A 1 16 ? 5.822   -1.360  15.334 1.00 0.00 ? 16 TYR A CE2  5  
ATOM 2540 C CZ   . TYR A 1 16 ? 5.422   -0.075  15.636 1.00 0.00 ? 16 TYR A CZ   5  
ATOM 2541 O OH   . TYR A 1 16 ? 4.202   0.138   16.235 1.00 0.00 ? 16 TYR A OH   5  
ATOM 2542 H H    . TYR A 1 16 ? 8.303   1.477   12.074 1.00 0.00 ? 16 TYR A H    5  
ATOM 2543 H HA   . TYR A 1 16 ? 10.178  -0.753  11.849 1.00 0.00 ? 16 TYR A HA   5  
ATOM 2544 H HB2  . TYR A 1 16 ? 9.485   -1.783  13.898 1.00 0.00 ? 16 TYR A HB2  5  
ATOM 2545 H HB3  . TYR A 1 16 ? 9.961   -0.132  14.277 1.00 0.00 ? 16 TYR A HB3  5  
ATOM 2546 H HD1  . TYR A 1 16 ? 8.105   1.614   14.508 1.00 0.00 ? 16 TYR A HD1  5  
ATOM 2547 H HD2  . TYR A 1 16 ? 7.365   -2.576  14.496 1.00 0.00 ? 16 TYR A HD2  5  
ATOM 2548 H HE1  . TYR A 1 16 ? 5.925   2.002   15.579 1.00 0.00 ? 16 TYR A HE1  5  
ATOM 2549 H HE2  . TYR A 1 16 ? 5.183   -2.199  15.565 1.00 0.00 ? 16 TYR A HE2  5  
ATOM 2550 H HH   . TYR A 1 16 ? 3.836   -0.702  16.524 1.00 0.00 ? 16 TYR A HH   5  
ATOM 2551 N N    . CYS A 1 17 ? 7.961   -2.406  11.809 1.00 0.00 ? 17 CYS A N    5  
ATOM 2552 C CA   . CYS A 1 17 ? 6.897   -3.194  11.199 1.00 0.00 ? 17 CYS A CA   5  
ATOM 2553 C C    . CYS A 1 17 ? 5.672   -3.250  12.107 1.00 0.00 ? 17 CYS A C    5  
ATOM 2554 O O    . CYS A 1 17 ? 5.791   -3.464  13.313 1.00 0.00 ? 17 CYS A O    5  
ATOM 2555 C CB   . CYS A 1 17 ? 7.390   -4.612  10.902 1.00 0.00 ? 17 CYS A CB   5  
ATOM 2556 S SG   . CYS A 1 17 ? 7.991   -4.848  9.198  1.00 0.00 ? 17 CYS A SG   5  
ATOM 2557 H H    . CYS A 1 17 ? 8.597   -2.848  12.411 1.00 0.00 ? 17 CYS A H    5  
ATOM 2558 H HA   . CYS A 1 17 ? 6.621   -2.716  10.271 1.00 0.00 ? 17 CYS A HA   5  
ATOM 2559 H HB2  . CYS A 1 17 ? 8.203   -4.850  11.572 1.00 0.00 ? 17 CYS A HB2  5  
ATOM 2560 H HB3  . CYS A 1 17 ? 6.580   -5.308  11.065 1.00 0.00 ? 17 CYS A HB3  5  
ATOM 2561 N N    . GLU A 1 18 ? 4.496   -3.055  11.518 1.00 0.00 ? 18 GLU A N    5  
ATOM 2562 C CA   . GLU A 1 18 ? 3.250   -3.083  12.274 1.00 0.00 ? 18 GLU A CA   5  
ATOM 2563 C C    . GLU A 1 18 ? 2.113   -3.649  11.428 1.00 0.00 ? 18 GLU A C    5  
ATOM 2564 O O    . GLU A 1 18 ? 1.582   -2.973  10.548 1.00 0.00 ? 18 GLU A O    5  
ATOM 2565 C CB   . GLU A 1 18 ? 2.889   -1.676  12.757 1.00 0.00 ? 18 GLU A CB   5  
ATOM 2566 C CG   . GLU A 1 18 ? 1.894   -1.664  13.905 1.00 0.00 ? 18 GLU A CG   5  
ATOM 2567 C CD   . GLU A 1 18 ? 1.982   -2.908  14.767 1.00 0.00 ? 18 GLU A CD   5  
ATOM 2568 O OE1  . GLU A 1 18 ? 1.300   -3.903  14.442 1.00 0.00 ? 18 GLU A OE1  5  
ATOM 2569 O OE2  . GLU A 1 18 ? 2.731   -2.888  15.765 1.00 0.00 ? 18 GLU A OE2  5  
ATOM 2570 H H    . GLU A 1 18 ? 4.466   -2.888  10.552 1.00 0.00 ? 18 GLU A H    5  
ATOM 2571 H HA   . GLU A 1 18 ? 3.397   -3.721  13.132 1.00 0.00 ? 18 GLU A HA   5  
ATOM 2572 H HB2  . GLU A 1 18 ? 3.790   -1.178  13.082 1.00 0.00 ? 18 GLU A HB2  5  
ATOM 2573 H HB3  . GLU A 1 18 ? 2.462   -1.125  11.932 1.00 0.00 ? 18 GLU A HB3  5  
ATOM 2574 H HG2  . GLU A 1 18 ? 2.090   -0.801  14.525 1.00 0.00 ? 18 GLU A HG2  5  
ATOM 2575 H HG3  . GLU A 1 18 ? 0.896   -1.594  13.499 1.00 0.00 ? 18 GLU A HG3  5  
ATOM 2576 N N    . GLY A 1 19 ? 1.744   -4.897  11.702 1.00 0.00 ? 19 GLY A N    5  
ATOM 2577 C CA   . GLY A 1 19 ? 0.674   -5.535  10.958 1.00 0.00 ? 19 GLY A CA   5  
ATOM 2578 C C    . GLY A 1 19 ? -0.678  -5.355  11.620 1.00 0.00 ? 19 GLY A C    5  
ATOM 2579 O O    . GLY A 1 19 ? -1.676  -5.920  11.172 1.00 0.00 ? 19 GLY A O    5  
ATOM 2580 H H    . GLY A 1 19 ? 2.203   -5.389  12.415 1.00 0.00 ? 19 GLY A H    5  
ATOM 2581 H HA2  . GLY A 1 19 ? 0.637   -5.110  9.966  1.00 0.00 ? 19 GLY A HA2  5  
ATOM 2582 H HA3  . GLY A 1 19 ? 0.885   -6.591  10.879 1.00 0.00 ? 19 GLY A HA3  5  
ATOM 2583 N N    . ALA A 1 20 ? -0.712  -4.568  12.690 1.00 0.00 ? 20 ALA A N    5  
ATOM 2584 C CA   . ALA A 1 20 ? -1.952  -4.315  13.414 1.00 0.00 ? 20 ALA A CA   5  
ATOM 2585 C C    . ALA A 1 20 ? -2.208  -2.819  13.559 1.00 0.00 ? 20 ALA A C    5  
ATOM 2586 O O    . ALA A 1 20 ? -3.087  -2.263  12.901 1.00 0.00 ? 20 ALA A O    5  
ATOM 2587 C CB   . ALA A 1 20 ? -1.909  -4.981  14.781 1.00 0.00 ? 20 ALA A CB   5  
ATOM 2588 H H    . ALA A 1 20 ? 0.116   -4.146  12.999 1.00 0.00 ? 20 ALA A H    5  
ATOM 2589 H HA   . ALA A 1 20 ? -2.763  -4.756  12.851 1.00 0.00 ? 20 ALA A HA   5  
ATOM 2590 H HB1  . ALA A 1 20 ? -2.719  -4.605  15.389 1.00 0.00 ? 20 ALA A HB1  5  
ATOM 2591 H HB2  . ALA A 1 20 ? -2.012  -6.049  14.665 1.00 0.00 ? 20 ALA A HB2  5  
ATOM 2592 H HB3  . ALA A 1 20 ? -0.967  -4.759  15.260 1.00 0.00 ? 20 ALA A HB3  5  
ATOM 2593 N N    . ARG A 1 21 ? -1.435  -2.173  14.426 1.00 0.00 ? 21 ARG A N    5  
ATOM 2594 C CA   . ARG A 1 21 ? -1.580  -0.741  14.658 1.00 0.00 ? 21 ARG A CA   5  
ATOM 2595 C C    . ARG A 1 21 ? -0.348  -0.177  15.361 1.00 0.00 ? 21 ARG A C    5  
ATOM 2596 O O    . ARG A 1 21 ? 0.256   -0.839  16.206 1.00 0.00 ? 21 ARG A O    5  
ATOM 2597 C CB   . ARG A 1 21 ? -2.830  -0.463  15.495 1.00 0.00 ? 21 ARG A CB   5  
ATOM 2598 C CG   . ARG A 1 21 ? -3.826  0.461   14.813 1.00 0.00 ? 21 ARG A CG   5  
ATOM 2599 C CD   . ARG A 1 21 ? -5.119  0.568   15.606 1.00 0.00 ? 21 ARG A CD   5  
ATOM 2600 N NE   . ARG A 1 21 ? -5.275  1.882   16.224 1.00 0.00 ? 21 ARG A NE   5  
ATOM 2601 C CZ   . ARG A 1 21 ? -5.354  3.014   15.534 1.00 0.00 ? 21 ARG A CZ   5  
ATOM 2602 N NH1  . ARG A 1 21 ? -5.293  2.993   14.210 1.00 0.00 ? 21 ARG A NH1  5  
ATOM 2603 N NH2  . ARG A 1 21 ? -5.496  4.171   16.169 1.00 0.00 ? 21 ARG A NH2  5  
ATOM 2604 H H    . ARG A 1 21 ? -0.751  -2.671  14.921 1.00 0.00 ? 21 ARG A H    5  
ATOM 2605 H HA   . ARG A 1 21 ? -1.685  -0.258  13.699 1.00 0.00 ? 21 ARG A HA   5  
ATOM 2606 H HB2  . ARG A 1 21 ? -3.325  -1.399  15.703 1.00 0.00 ? 21 ARG A HB2  5  
ATOM 2607 H HB3  . ARG A 1 21 ? -2.530  -0.008  16.427 1.00 0.00 ? 21 ARG A HB3  5  
ATOM 2608 H HG2  . ARG A 1 21 ? -3.389  1.445   14.725 1.00 0.00 ? 21 ARG A HG2  5  
ATOM 2609 H HG3  . ARG A 1 21 ? -4.047  0.073   13.830 1.00 0.00 ? 21 ARG A HG3  5  
ATOM 2610 H HD2  . ARG A 1 21 ? -5.950  0.394   14.939 1.00 0.00 ? 21 ARG A HD2  5  
ATOM 2611 H HD3  . ARG A 1 21 ? -5.115  -0.186  16.379 1.00 0.00 ? 21 ARG A HD3  5  
ATOM 2612 H HE   . ARG A 1 21 ? -5.322  1.921   17.202 1.00 0.00 ? 21 ARG A HE   5  
ATOM 2613 H HH11 . ARG A 1 21 ? -5.188  2.123   13.729 1.00 0.00 ? 21 ARG A HH11 5  
ATOM 2614 H HH12 . ARG A 1 21 ? -5.355  3.847   13.692 1.00 0.00 ? 21 ARG A HH12 5  
ATOM 2615 H HH21 . ARG A 1 21 ? -5.542  4.191   17.167 1.00 0.00 ? 21 ARG A HH21 5  
ATOM 2616 H HH22 . ARG A 1 21 ? -5.555  5.022   15.649 1.00 0.00 ? 21 ARG A HH22 5  
ATOM 2617 N N    . CYS A 1 22 ? 0.019   1.050   15.006 1.00 0.00 ? 22 CYS A N    5  
ATOM 2618 C CA   . CYS A 1 22 ? 1.179   1.703   15.601 1.00 0.00 ? 22 CYS A CA   5  
ATOM 2619 C C    . CYS A 1 22 ? 1.055   1.752   17.121 1.00 0.00 ? 22 CYS A C    5  
ATOM 2620 O O    . CYS A 1 22 ? -0.034  1.952   17.659 1.00 0.00 ? 22 CYS A O    5  
ATOM 2621 C CB   . CYS A 1 22 ? 1.333   3.120   15.045 1.00 0.00 ? 22 CYS A CB   5  
ATOM 2622 S SG   . CYS A 1 22 ? 1.395   3.203   13.227 1.00 0.00 ? 22 CYS A SG   5  
ATOM 2623 H H    . CYS A 1 22 ? -0.502  1.528   14.327 1.00 0.00 ? 22 CYS A H    5  
ATOM 2624 H HA   . CYS A 1 22 ? 2.054   1.127   15.342 1.00 0.00 ? 22 CYS A HA   5  
ATOM 2625 H HB2  . CYS A 1 22 ? 0.495   3.720   15.372 1.00 0.00 ? 22 CYS A HB2  5  
ATOM 2626 H HB3  . CYS A 1 22 ? 2.247   3.551   15.426 1.00 0.00 ? 22 CYS A HB3  5  
ATOM 2627 N N    . GLU A 1 23 ? 2.179   1.568   17.807 1.00 0.00 ? 23 GLU A N    5  
ATOM 2628 C CA   . GLU A 1 23 ? 2.196   1.591   19.265 1.00 0.00 ? 23 GLU A CA   5  
ATOM 2629 C C    . GLU A 1 23 ? 1.975   3.007   19.790 1.00 0.00 ? 23 GLU A C    5  
ATOM 2630 O O    . GLU A 1 23 ? 2.080   3.980   19.044 1.00 0.00 ? 23 GLU A O    5  
ATOM 2631 C CB   . GLU A 1 23 ? 3.523   1.041   19.791 1.00 0.00 ? 23 GLU A CB   5  
ATOM 2632 C CG   . GLU A 1 23 ? 3.712   -0.444  19.532 1.00 0.00 ? 23 GLU A CG   5  
ATOM 2633 C CD   . GLU A 1 23 ? 4.342   -1.166  20.708 1.00 0.00 ? 23 GLU A CD   5  
ATOM 2634 O OE1  . GLU A 1 23 ? 5.422   -0.731  21.160 1.00 0.00 ? 23 GLU A OE1  5  
ATOM 2635 O OE2  . GLU A 1 23 ? 3.756   -2.164  21.175 1.00 0.00 ? 23 GLU A OE2  5  
ATOM 2636 H H    . GLU A 1 23 ? 3.016   1.413   17.322 1.00 0.00 ? 23 GLU A H    5  
ATOM 2637 H HA   . GLU A 1 23 ? 1.392   0.961   19.616 1.00 0.00 ? 23 GLU A HA   5  
ATOM 2638 H HB2  . GLU A 1 23 ? 4.334   1.575   19.316 1.00 0.00 ? 23 GLU A HB2  5  
ATOM 2639 H HB3  . GLU A 1 23 ? 3.571   1.208   20.857 1.00 0.00 ? 23 GLU A HB3  5  
ATOM 2640 H HG2  . GLU A 1 23 ? 2.748   -0.887  19.332 1.00 0.00 ? 23 GLU A HG2  5  
ATOM 2641 H HG3  . GLU A 1 23 ? 4.350   -0.568  18.669 1.00 0.00 ? 23 GLU A HG3  5  
ATOM 2642 N N    . SER A 1 24 ? 1.669   3.113   21.079 1.00 0.00 ? 24 SER A N    5  
ATOM 2643 C CA   . SER A 1 24 ? 1.429   4.408   21.704 1.00 0.00 ? 24 SER A CA   5  
ATOM 2644 C C    . SER A 1 24 ? 2.630   5.331   21.519 1.00 0.00 ? 24 SER A C    5  
ATOM 2645 O O    . SER A 1 24 ? 3.554   5.337   22.331 1.00 0.00 ? 24 SER A O    5  
ATOM 2646 C CB   . SER A 1 24 ? 1.132   4.232   23.194 1.00 0.00 ? 24 SER A CB   5  
ATOM 2647 O OG   . SER A 1 24 ? -0.262  4.271   23.444 1.00 0.00 ? 24 SER A OG   5  
ATOM 2648 H H    . SER A 1 24 ? 1.600   2.299   21.622 1.00 0.00 ? 24 SER A H    5  
ATOM 2649 H HA   . SER A 1 24 ? 0.570   4.853   21.224 1.00 0.00 ? 24 SER A HA   5  
ATOM 2650 H HB2  . SER A 1 24 ? 1.519   3.281   23.526 1.00 0.00 ? 24 SER A HB2  5  
ATOM 2651 H HB3  . SER A 1 24 ? 1.608   5.028   23.750 1.00 0.00 ? 24 SER A HB3  5  
ATOM 2652 H HG   . SER A 1 24 ? -0.421  4.182   24.387 1.00 0.00 ? 24 SER A HG   5  
ATOM 2653 N N    . GLY A 1 25 ? 2.608   6.111   20.442 1.00 0.00 ? 25 GLY A N    5  
ATOM 2654 C CA   . GLY A 1 25 ? 3.700   7.028   20.168 1.00 0.00 ? 25 GLY A CA   5  
ATOM 2655 C C    . GLY A 1 25 ? 4.100   7.032   18.706 1.00 0.00 ? 25 GLY A C    5  
ATOM 2656 O O    . GLY A 1 25 ? 4.664   8.008   18.212 1.00 0.00 ? 25 GLY A O    5  
ATOM 2657 H H    . GLY A 1 25 ? 1.845   6.064   19.829 1.00 0.00 ? 25 GLY A H    5  
ATOM 2658 H HA2  . GLY A 1 25 ? 3.398   8.025   20.451 1.00 0.00 ? 25 GLY A HA2  5  
ATOM 2659 H HA3  . GLY A 1 25 ? 4.555   6.739   20.762 1.00 0.00 ? 25 GLY A HA3  5  
ATOM 2660 N N    . PHE A 1 26 ? 3.809   5.937   18.011 1.00 0.00 ? 26 PHE A N    5  
ATOM 2661 C CA   . PHE A 1 26 ? 4.145   5.817   16.597 1.00 0.00 ? 26 PHE A CA   5  
ATOM 2662 C C    . PHE A 1 26 ? 2.962   6.219   15.721 1.00 0.00 ? 26 PHE A C    5  
ATOM 2663 O O    . PHE A 1 26 ? 1.827   6.300   16.191 1.00 0.00 ? 26 PHE A O    5  
ATOM 2664 C CB   . PHE A 1 26 ? 4.571   4.384   16.272 1.00 0.00 ? 26 PHE A CB   5  
ATOM 2665 C CG   . PHE A 1 26 ? 5.849   3.971   16.945 1.00 0.00 ? 26 PHE A CG   5  
ATOM 2666 C CD1  . PHE A 1 26 ? 5.858   3.614   18.284 1.00 0.00 ? 26 PHE A CD1  5  
ATOM 2667 C CD2  . PHE A 1 26 ? 7.040   3.939   16.239 1.00 0.00 ? 26 PHE A CD2  5  
ATOM 2668 C CE1  . PHE A 1 26 ? 7.032   3.233   18.906 1.00 0.00 ? 26 PHE A CE1  5  
ATOM 2669 C CE2  . PHE A 1 26 ? 8.217   3.559   16.855 1.00 0.00 ? 26 PHE A CE2  5  
ATOM 2670 C CZ   . PHE A 1 26 ? 8.213   3.207   18.191 1.00 0.00 ? 26 PHE A CZ   5  
ATOM 2671 H H    . PHE A 1 26 ? 3.359   5.191   18.461 1.00 0.00 ? 26 PHE A H    5  
ATOM 2672 H HA   . PHE A 1 26 ? 4.970   6.483   16.396 1.00 0.00 ? 26 PHE A HA   5  
ATOM 2673 H HB2  . PHE A 1 26 ? 3.794   3.704   16.590 1.00 0.00 ? 26 PHE A HB2  5  
ATOM 2674 H HB3  . PHE A 1 26 ? 4.711   4.291   15.206 1.00 0.00 ? 26 PHE A HB3  5  
ATOM 2675 H HD1  . PHE A 1 26 ? 4.934   3.635   18.844 1.00 0.00 ? 26 PHE A HD1  5  
ATOM 2676 H HD2  . PHE A 1 26 ? 7.045   4.216   15.194 1.00 0.00 ? 26 PHE A HD2  5  
ATOM 2677 H HE1  . PHE A 1 26 ? 7.025   2.958   19.950 1.00 0.00 ? 26 PHE A HE1  5  
ATOM 2678 H HE2  . PHE A 1 26 ? 9.139   3.539   16.294 1.00 0.00 ? 26 PHE A HE2  5  
ATOM 2679 H HZ   . PHE A 1 26 ? 9.132   2.909   18.675 1.00 0.00 ? 26 PHE A HZ   5  
ATOM 2680 N N    . HIS A 1 27 ? 3.237   6.472   14.445 1.00 0.00 ? 27 HIS A N    5  
ATOM 2681 C CA   . HIS A 1 27 ? 2.196   6.866   13.503 1.00 0.00 ? 27 HIS A CA   5  
ATOM 2682 C C    . HIS A 1 27 ? 2.219   5.974   12.265 1.00 0.00 ? 27 HIS A C    5  
ATOM 2683 O O    . HIS A 1 27 ? 3.285   5.591   11.783 1.00 0.00 ? 27 HIS A O    5  
ATOM 2684 C CB   . HIS A 1 27 ? 2.375   8.329   13.095 1.00 0.00 ? 27 HIS A CB   5  
ATOM 2685 C CG   . HIS A 1 27 ? 3.808   8.737   12.944 1.00 0.00 ? 27 HIS A CG   5  
ATOM 2686 N ND1  . HIS A 1 27 ? 4.506   9.410   13.925 1.00 0.00 ? 27 HIS A ND1  5  
ATOM 2687 C CD2  . HIS A 1 27 ? 4.675   8.563   11.919 1.00 0.00 ? 27 HIS A CD2  5  
ATOM 2688 C CE1  . HIS A 1 27 ? 5.740   9.634   13.509 1.00 0.00 ? 27 HIS A CE1  5  
ATOM 2689 N NE2  . HIS A 1 27 ? 5.869   9.129   12.295 1.00 0.00 ? 27 HIS A NE2  5  
ATOM 2690 H H    . HIS A 1 27 ? 4.161   6.390   14.131 1.00 0.00 ? 27 HIS A H    5  
ATOM 2691 H HA   . HIS A 1 27 ? 1.243   6.753   13.995 1.00 0.00 ? 27 HIS A HA   5  
ATOM 2692 H HB2  . HIS A 1 27 ? 1.882   8.495   12.149 1.00 0.00 ? 27 HIS A HB2  5  
ATOM 2693 H HB3  . HIS A 1 27 ? 1.926   8.963   13.846 1.00 0.00 ? 27 HIS A HB3  5  
ATOM 2694 H HD1  . HIS A 1 27 ? 4.150   9.684   14.795 1.00 0.00 ? 27 HIS A HD1  5  
ATOM 2695 H HD2  . HIS A 1 27 ? 4.467   8.071   10.979 1.00 0.00 ? 27 HIS A HD2  5  
ATOM 2696 H HE1  . HIS A 1 27 ? 6.513   10.142  14.066 1.00 0.00 ? 27 HIS A HE1  5  
ATOM 2697 N N    . ASP A 1 28 ? 1.036   5.649   11.755 1.00 0.00 ? 28 ASP A N    5  
ATOM 2698 C CA   . ASP A 1 28 ? 0.920   4.802   10.573 1.00 0.00 ? 28 ASP A CA   5  
ATOM 2699 C C    . ASP A 1 28 ? 1.516   5.492   9.350  1.00 0.00 ? 28 ASP A C    5  
ATOM 2700 O O    . ASP A 1 28 ? 1.015   6.523   8.899  1.00 0.00 ? 28 ASP A O    5  
ATOM 2701 C CB   . ASP A 1 28 ? -0.546  4.453   10.312 1.00 0.00 ? 28 ASP A CB   5  
ATOM 2702 C CG   . ASP A 1 28 ? -0.785  3.978   8.892  1.00 0.00 ? 28 ASP A CG   5  
ATOM 2703 O OD1  . ASP A 1 28 ? -0.628  2.766   8.637  1.00 0.00 ? 28 ASP A OD1  5  
ATOM 2704 O OD2  . ASP A 1 28 ? -1.128  4.820   8.036  1.00 0.00 ? 28 ASP A OD2  5  
ATOM 2705 H H    . ASP A 1 28 ? 0.221   5.986   12.184 1.00 0.00 ? 28 ASP A H    5  
ATOM 2706 H HA   . ASP A 1 28 ? 1.469   3.893   10.761 1.00 0.00 ? 28 ASP A HA   5  
ATOM 2707 H HB2  . ASP A 1 28 ? -0.848  3.667   10.989 1.00 0.00 ? 28 ASP A HB2  5  
ATOM 2708 H HB3  . ASP A 1 28 ? -1.155  5.327   10.488 1.00 0.00 ? 28 ASP A HB3  5  
ATOM 2709 N N    . CYS A 1 29 ? 2.590   4.918   8.818  1.00 0.00 ? 29 CYS A N    5  
ATOM 2710 C CA   . CYS A 1 29 ? 3.257   5.478   7.649  1.00 0.00 ? 29 CYS A CA   5  
ATOM 2711 C C    . CYS A 1 29 ? 3.403   4.428   6.552  1.00 0.00 ? 29 CYS A C    5  
ATOM 2712 O O    . CYS A 1 29 ? 4.261   4.543   5.677  1.00 0.00 ? 29 CYS A O    5  
ATOM 2713 C CB   . CYS A 1 29 ? 4.633   6.025   8.034  1.00 0.00 ? 29 CYS A CB   5  
ATOM 2714 S SG   . CYS A 1 29 ? 5.705   4.816   8.874  1.00 0.00 ? 29 CYS A SG   5  
ATOM 2715 H H    . CYS A 1 29 ? 2.944   4.098   9.223  1.00 0.00 ? 29 CYS A H    5  
ATOM 2716 H HA   . CYS A 1 29 ? 2.649   6.288   7.276  1.00 0.00 ? 29 CYS A HA   5  
ATOM 2717 H HB2  . CYS A 1 29 ? 5.145   6.351   7.140  1.00 0.00 ? 29 CYS A HB2  5  
ATOM 2718 H HB3  . CYS A 1 29 ? 4.505   6.868   8.696  1.00 0.00 ? 29 CYS A HB3  5  
ATOM 2719 N N    . GLY A 1 30 ? 2.559   3.402   6.605  1.00 0.00 ? 30 GLY A N    5  
ATOM 2720 C CA   . GLY A 1 30 ? 2.610   2.346   5.611  1.00 0.00 ? 30 GLY A CA   5  
ATOM 2721 C C    . GLY A 1 30 ? 2.426   2.869   4.200  1.00 0.00 ? 30 GLY A C    5  
ATOM 2722 O O    . GLY A 1 30 ? 2.615   2.135   3.230  1.00 0.00 ? 30 GLY A O    5  
ATOM 2723 H H    . GLY A 1 30 ? 1.895   3.362   7.325  1.00 0.00 ? 30 GLY A H    5  
ATOM 2724 H HA2  . GLY A 1 30 ? 3.567   1.850   5.678  1.00 0.00 ? 30 GLY A HA2  5  
ATOM 2725 H HA3  . GLY A 1 30 ? 1.829   1.631   5.822  1.00 0.00 ? 30 GLY A HA3  5  
ATOM 2726 N N    . SER A 1 31 ? 2.055   4.140   4.085  1.00 0.00 ? 31 SER A N    5  
ATOM 2727 C CA   . SER A 1 31 ? 1.840   4.759   2.782  1.00 0.00 ? 31 SER A CA   5  
ATOM 2728 C C    . SER A 1 31 ? 2.982   4.424   1.827  1.00 0.00 ? 31 SER A C    5  
ATOM 2729 O O    . SER A 1 31 ? 2.792   3.715   0.839  1.00 0.00 ? 31 SER A O    5  
ATOM 2730 C CB   . SER A 1 31 ? 1.712   6.276   2.930  1.00 0.00 ? 31 SER A CB   5  
ATOM 2731 O OG   . SER A 1 31 ? 0.352   6.669   2.990  1.00 0.00 ? 31 SER A OG   5  
ATOM 2732 H H    . SER A 1 31 ? 1.921   4.674   4.896  1.00 0.00 ? 31 SER A H    5  
ATOM 2733 H HA   . SER A 1 31 ? 0.920   4.366   2.376  1.00 0.00 ? 31 SER A HA   5  
ATOM 2734 H HB2  . SER A 1 31 ? 2.205   6.590   3.837  1.00 0.00 ? 31 SER A HB2  5  
ATOM 2735 H HB3  . SER A 1 31 ? 2.176   6.758   2.081  1.00 0.00 ? 31 SER A HB3  5  
ATOM 2736 H HG   . SER A 1 31 ? -0.020  6.673   2.105  1.00 0.00 ? 31 SER A HG   5  
ATOM 2737 N N    . ASP A 1 32 ? 4.168   4.940   2.129  1.00 0.00 ? 32 ASP A N    5  
ATOM 2738 C CA   . ASP A 1 32 ? 5.342   4.697   1.299  1.00 0.00 ? 32 ASP A CA   5  
ATOM 2739 C C    . ASP A 1 32 ? 6.321   3.762   2.002  1.00 0.00 ? 32 ASP A C    5  
ATOM 2740 O O    . ASP A 1 32 ? 7.528   3.819   1.768  1.00 0.00 ? 32 ASP A O    5  
ATOM 2741 C CB   . ASP A 1 32 ? 6.035   6.017   0.957  1.00 0.00 ? 32 ASP A CB   5  
ATOM 2742 C CG   . ASP A 1 32 ? 6.090   6.964   2.139  1.00 0.00 ? 32 ASP A CG   5  
ATOM 2743 O OD1  . ASP A 1 32 ? 5.988   8.190   1.923  1.00 0.00 ? 32 ASP A OD1  5  
ATOM 2744 O OD2  . ASP A 1 32 ? 6.233   6.480   3.281  1.00 0.00 ? 32 ASP A OD2  5  
ATOM 2745 H H    . ASP A 1 32 ? 4.257   5.498   2.930  1.00 0.00 ? 32 ASP A H    5  
ATOM 2746 H HA   . ASP A 1 32 ? 5.010   4.228   0.385  1.00 0.00 ? 32 ASP A HA   5  
ATOM 2747 H HB2  . ASP A 1 32 ? 7.046   5.813   0.636  1.00 0.00 ? 32 ASP A HB2  5  
ATOM 2748 H HB3  . ASP A 1 32 ? 5.497   6.501   0.155  1.00 0.00 ? 32 ASP A HB3  5  
ATOM 2749 N N    . HIS A 1 33 ? 5.792   2.901   2.867  1.00 0.00 ? 33 HIS A N    5  
ATOM 2750 C CA   . HIS A 1 33 ? 6.619   1.954   3.606  1.00 0.00 ? 33 HIS A CA   5  
ATOM 2751 C C    . HIS A 1 33 ? 5.857   0.659   3.870  1.00 0.00 ? 33 HIS A C    5  
ATOM 2752 O O    . HIS A 1 33 ? 4.799   0.667   4.498  1.00 0.00 ? 33 HIS A O    5  
ATOM 2753 C CB   . HIS A 1 33 ? 7.078   2.568   4.929  1.00 0.00 ? 33 HIS A CB   5  
ATOM 2754 C CG   . HIS A 1 33 ? 7.706   3.919   4.776  1.00 0.00 ? 33 HIS A CG   5  
ATOM 2755 N ND1  . HIS A 1 33 ? 7.256   5.039   5.443  1.00 0.00 ? 33 HIS A ND1  5  
ATOM 2756 C CD2  . HIS A 1 33 ? 8.758   4.327   4.027  1.00 0.00 ? 33 HIS A CD2  5  
ATOM 2757 C CE1  . HIS A 1 33 ? 8.002   6.077   5.110  1.00 0.00 ? 33 HIS A CE1  5  
ATOM 2758 N NE2  . HIS A 1 33 ? 8.921   5.671   4.253  1.00 0.00 ? 33 HIS A NE2  5  
ATOM 2759 H H    . HIS A 1 33 ? 4.823   2.904   3.011  1.00 0.00 ? 33 HIS A H    5  
ATOM 2760 H HA   . HIS A 1 33 ? 7.486   1.731   3.003  1.00 0.00 ? 33 HIS A HA   5  
ATOM 2761 H HB2  . HIS A 1 33 ? 6.226   2.672   5.584  1.00 0.00 ? 33 HIS A HB2  5  
ATOM 2762 H HB3  . HIS A 1 33 ? 7.803   1.914   5.390  1.00 0.00 ? 33 HIS A HB3  5  
ATOM 2763 H HD1  . HIS A 1 33 ? 6.501   5.068   6.066  1.00 0.00 ? 33 HIS A HD1  5  
ATOM 2764 H HD2  . HIS A 1 33 ? 9.357   3.709   3.373  1.00 0.00 ? 33 HIS A HD2  5  
ATOM 2765 H HE1  . HIS A 1 33 ? 7.882   7.085   5.477  1.00 0.00 ? 33 HIS A HE1  5  
ATOM 2766 N N    . TRP A 1 34 ? 6.403   -0.451  3.386  1.00 0.00 ? 34 TRP A N    5  
ATOM 2767 C CA   . TRP A 1 34 ? 5.774   -1.755  3.569  1.00 0.00 ? 34 TRP A CA   5  
ATOM 2768 C C    . TRP A 1 34 ? 6.681   -2.691  4.359  1.00 0.00 ? 34 TRP A C    5  
ATOM 2769 O O    . TRP A 1 34 ? 7.859   -2.400  4.568  1.00 0.00 ? 34 TRP A O    5  
ATOM 2770 C CB   . TRP A 1 34 ? 5.436   -2.376  2.213  1.00 0.00 ? 34 TRP A CB   5  
ATOM 2771 C CG   . TRP A 1 34 ? 6.385   -1.976  1.123  1.00 0.00 ? 34 TRP A CG   5  
ATOM 2772 C CD1  . TRP A 1 34 ? 6.085   -1.272  -0.007 1.00 0.00 ? 34 TRP A CD1  5  
ATOM 2773 C CD2  . TRP A 1 34 ? 7.787   -2.260  1.062  1.00 0.00 ? 34 TRP A CD2  5  
ATOM 2774 N NE1  . TRP A 1 34 ? 7.217   -1.100  -0.768 1.00 0.00 ? 34 TRP A NE1  5  
ATOM 2775 C CE2  . TRP A 1 34 ? 8.274   -1.697  -0.134 1.00 0.00 ? 34 TRP A CE2  5  
ATOM 2776 C CE3  . TRP A 1 34 ? 8.679   -2.934  1.901  1.00 0.00 ? 34 TRP A CE3  5  
ATOM 2777 C CZ2  . TRP A 1 34 ? 9.612   -1.788  -0.509 1.00 0.00 ? 34 TRP A CZ2  5  
ATOM 2778 C CZ3  . TRP A 1 34 ? 10.006  -3.024  1.527  1.00 0.00 ? 34 TRP A CZ3  5  
ATOM 2779 C CH2  . TRP A 1 34 ? 10.463  -2.453  0.331  1.00 0.00 ? 34 TRP A CH2  5  
ATOM 2780 H H    . TRP A 1 34 ? 7.249   -0.394  2.893  1.00 0.00 ? 34 TRP A H    5  
ATOM 2781 H HA   . TRP A 1 34 ? 4.859   -1.605  4.124  1.00 0.00 ? 34 TRP A HA   5  
ATOM 2782 H HB2  . TRP A 1 34 ? 5.463   -3.452  2.300  1.00 0.00 ? 34 TRP A HB2  5  
ATOM 2783 H HB3  . TRP A 1 34 ? 4.443   -2.067  1.921  1.00 0.00 ? 34 TRP A HB3  5  
ATOM 2784 H HD1  . TRP A 1 34 ? 5.099   -0.911  -0.255 1.00 0.00 ? 34 TRP A HD1  5  
ATOM 2785 H HE1  . TRP A 1 34 ? 7.259   -0.626  -1.625 1.00 0.00 ? 34 TRP A HE1  5  
ATOM 2786 H HE3  . TRP A 1 34 ? 8.346   -3.380  2.826  1.00 0.00 ? 34 TRP A HE3  5  
ATOM 2787 H HZ2  . TRP A 1 34 ? 9.979   -1.353  -1.427 1.00 0.00 ? 34 TRP A HZ2  5  
ATOM 2788 H HZ3  . TRP A 1 34 ? 10.710  -3.541  2.162  1.00 0.00 ? 34 TRP A HZ3  5  
ATOM 2789 H HH2  . TRP A 1 34 ? 11.508  -2.549  0.079  1.00 0.00 ? 34 TRP A HH2  5  
ATOM 2790 N N    . CYS A 1 35 ? 6.126   -3.816  4.796  1.00 0.00 ? 35 CYS A N    5  
ATOM 2791 C CA   . CYS A 1 35 ? 6.886   -4.796  5.564  1.00 0.00 ? 35 CYS A CA   5  
ATOM 2792 C C    . CYS A 1 35 ? 7.258   -5.996  4.698  1.00 0.00 ? 35 CYS A C    5  
ATOM 2793 O O    . CYS A 1 35 ? 6.745   -6.158  3.590  1.00 0.00 ? 35 CYS A O    5  
ATOM 2794 C CB   . CYS A 1 35 ? 6.078   -5.260  6.778  1.00 0.00 ? 35 CYS A CB   5  
ATOM 2795 S SG   . CYS A 1 35 ? 6.225   -4.168  8.229  1.00 0.00 ? 35 CYS A SG   5  
ATOM 2796 H H    . CYS A 1 35 ? 5.182   -3.993  4.598  1.00 0.00 ? 35 CYS A H    5  
ATOM 2797 H HA   . CYS A 1 35 ? 7.792   -4.320  5.906  1.00 0.00 ? 35 CYS A HA   5  
ATOM 2798 H HB2  . CYS A 1 35 ? 5.033   -5.308  6.509  1.00 0.00 ? 35 CYS A HB2  5  
ATOM 2799 H HB3  . CYS A 1 35 ? 6.415   -6.243  7.070  1.00 0.00 ? 35 CYS A HB3  5  
ATOM 2800 N N    . ASP A 1 36 ? 8.152   -6.834  5.211  1.00 0.00 ? 36 ASP A N    5  
ATOM 2801 C CA   . ASP A 1 36 ? 8.592   -8.020  4.486  1.00 0.00 ? 36 ASP A CA   5  
ATOM 2802 C C    . ASP A 1 36 ? 7.401   -8.767  3.893  1.00 0.00 ? 36 ASP A C    5  
ATOM 2803 O O    . ASP A 1 36 ? 7.468   -9.270  2.771  1.00 0.00 ? 36 ASP A O    5  
ATOM 2804 C CB   . ASP A 1 36 ? 9.380   -8.947  5.412  1.00 0.00 ? 36 ASP A CB   5  
ATOM 2805 C CG   . ASP A 1 36 ? 10.859  -8.612  5.444  1.00 0.00 ? 36 ASP A CG   5  
ATOM 2806 O OD1  . ASP A 1 36 ? 11.200  -7.462  5.794  1.00 0.00 ? 36 ASP A OD1  5  
ATOM 2807 O OD2  . ASP A 1 36 ? 11.675  -9.500  5.121  1.00 0.00 ? 36 ASP A OD2  5  
ATOM 2808 H H    . ASP A 1 36 ? 8.524   -6.651  6.099  1.00 0.00 ? 36 ASP A H    5  
ATOM 2809 H HA   . ASP A 1 36 ? 9.235   -7.698  3.682  1.00 0.00 ? 36 ASP A HA   5  
ATOM 2810 H HB2  . ASP A 1 36 ? 8.989   -8.861  6.416  1.00 0.00 ? 36 ASP A HB2  5  
ATOM 2811 H HB3  . ASP A 1 36 ? 9.268   -9.966  5.073  1.00 0.00 ? 36 ASP A HB3  5  
ATOM 2812 N N    . ALA A 1 37 ? 6.314   -8.837  4.653  1.00 0.00 ? 37 ALA A N    5  
ATOM 2813 C CA   . ALA A 1 37 ? 5.108   -9.521  4.202  1.00 0.00 ? 37 ALA A CA   5  
ATOM 2814 C C    . ALA A 1 37 ? 4.136   -8.547  3.546  1.00 0.00 ? 37 ALA A C    5  
ATOM 2815 O O    . ALA A 1 37 ? 3.715   -7.567  4.161  1.00 0.00 ? 37 ALA A O    5  
ATOM 2816 C CB   . ALA A 1 37 ? 4.438   -10.233 5.368  1.00 0.00 ? 37 ALA A CB   5  
ATOM 2817 H H    . ALA A 1 37 ? 6.322   -8.416  5.538  1.00 0.00 ? 37 ALA A H    5  
ATOM 2818 H HA   . ALA A 1 37 ? 5.400   -10.267 3.477  1.00 0.00 ? 37 ALA A HA   5  
ATOM 2819 H HB1  . ALA A 1 37 ? 5.162   -10.394 6.155  1.00 0.00 ? 37 ALA A HB1  5  
ATOM 2820 H HB2  . ALA A 1 37 ? 3.628   -9.626  5.743  1.00 0.00 ? 37 ALA A HB2  5  
ATOM 2821 H HB3  . ALA A 1 37 ? 4.052   -11.185 5.035  1.00 0.00 ? 37 ALA A HB3  5  
ATOM 2822 N N    . SER A 1 38 ? 3.785   -8.822  2.294  1.00 0.00 ? 38 SER A N    5  
ATOM 2823 C CA   . SER A 1 38 ? 2.866   -7.966  1.552  1.00 0.00 ? 38 SER A CA   5  
ATOM 2824 C C    . SER A 1 38 ? 1.526   -7.856  2.272  1.00 0.00 ? 38 SER A C    5  
ATOM 2825 O O    . SER A 1 38 ? 0.553   -8.510  1.899  1.00 0.00 ? 38 SER A O    5  
ATOM 2826 C CB   . SER A 1 38 ? 2.656   -8.512  0.139  1.00 0.00 ? 38 SER A CB   5  
ATOM 2827 O OG   . SER A 1 38 ? 2.328   -9.890  0.168  1.00 0.00 ? 38 SER A OG   5  
ATOM 2828 H H    . SER A 1 38 ? 4.156   -9.618  1.858  1.00 0.00 ? 38 SER A H    5  
ATOM 2829 H HA   . SER A 1 38 ? 3.308   -6.983  1.487  1.00 0.00 ? 38 SER A HA   5  
ATOM 2830 H HB2  . SER A 1 38 ? 1.851   -7.973  -0.337 1.00 0.00 ? 38 SER A HB2  5  
ATOM 2831 H HB3  . SER A 1 38 ? 3.564   -8.382  -0.433 1.00 0.00 ? 38 SER A HB3  5  
ATOM 2832 H HG   . SER A 1 38 ? 1.381   -9.992  0.292  1.00 0.00 ? 38 SER A HG   5  
ATOM 2833 N N    . GLY A 1 39 ? 1.483   -7.024  3.308  1.00 0.00 ? 39 GLY A N    5  
ATOM 2834 C CA   . GLY A 1 39 ? 0.258   -6.843  4.065  1.00 0.00 ? 39 GLY A CA   5  
ATOM 2835 C C    . GLY A 1 39 ? 0.476   -6.051  5.339  1.00 0.00 ? 39 GLY A C    5  
ATOM 2836 O O    . GLY A 1 39 ? -0.459  -5.454  5.874  1.00 0.00 ? 39 GLY A O    5  
ATOM 2837 H H    . GLY A 1 39 ? 2.291   -6.528  3.560  1.00 0.00 ? 39 GLY A H    5  
ATOM 2838 H HA2  . GLY A 1 39 ? -0.459  -6.323  3.448  1.00 0.00 ? 39 GLY A HA2  5  
ATOM 2839 H HA3  . GLY A 1 39 ? -0.139  -7.814  4.322  1.00 0.00 ? 39 GLY A HA3  5  
ATOM 2840 N N    . ASP A 1 40 ? 1.711   -6.047  5.827  1.00 0.00 ? 40 ASP A N    5  
ATOM 2841 C CA   . ASP A 1 40 ? 2.048   -5.323  7.048  1.00 0.00 ? 40 ASP A CA   5  
ATOM 2842 C C    . ASP A 1 40 ? 2.467   -3.891  6.731  1.00 0.00 ? 40 ASP A C    5  
ATOM 2843 O O    . ASP A 1 40 ? 3.284   -3.655  5.841  1.00 0.00 ? 40 ASP A O    5  
ATOM 2844 C CB   . ASP A 1 40 ? 3.170   -6.042  7.799  1.00 0.00 ? 40 ASP A CB   5  
ATOM 2845 C CG   . ASP A 1 40 ? 2.642   -7.021  8.829  1.00 0.00 ? 40 ASP A CG   5  
ATOM 2846 O OD1  . ASP A 1 40 ? 3.384   -7.338  9.782  1.00 0.00 ? 40 ASP A OD1  5  
ATOM 2847 O OD2  . ASP A 1 40 ? 1.486   -7.470  8.682  1.00 0.00 ? 40 ASP A OD2  5  
ATOM 2848 H H    . ASP A 1 40 ? 2.413   -6.542  5.356  1.00 0.00 ? 40 ASP A H    5  
ATOM 2849 H HA   . ASP A 1 40 ? 1.168   -5.297  7.672  1.00 0.00 ? 40 ASP A HA   5  
ATOM 2850 H HB2  . ASP A 1 40 ? 3.778   -6.586  7.091  1.00 0.00 ? 40 ASP A HB2  5  
ATOM 2851 H HB3  . ASP A 1 40 ? 3.782   -5.310  8.305  1.00 0.00 ? 40 ASP A HB3  5  
ATOM 2852 N N    . ARG A 1 41 ? 1.902   -2.938  7.466  1.00 0.00 ? 41 ARG A N    5  
ATOM 2853 C CA   . ARG A 1 41 ? 2.215   -1.529  7.262  1.00 0.00 ? 41 ARG A CA   5  
ATOM 2854 C C    . ARG A 1 41 ? 3.314   -1.073  8.218  1.00 0.00 ? 41 ARG A C    5  
ATOM 2855 O O    . ARG A 1 41 ? 3.282   -1.379  9.410  1.00 0.00 ? 41 ARG A O    5  
ATOM 2856 C CB   . ARG A 1 41 ? 0.964   -0.673  7.461  1.00 0.00 ? 41 ARG A CB   5  
ATOM 2857 C CG   . ARG A 1 41 ? -0.140  -1.377  8.233  1.00 0.00 ? 41 ARG A CG   5  
ATOM 2858 C CD   . ARG A 1 41 ? -1.266  -0.420  8.593  1.00 0.00 ? 41 ARG A CD   5  
ATOM 2859 N NE   . ARG A 1 41 ? -2.422  -0.582  7.716  1.00 0.00 ? 41 ARG A NE   5  
ATOM 2860 C CZ   . ARG A 1 41 ? -2.541  0.020   6.538  1.00 0.00 ? 41 ARG A CZ   5  
ATOM 2861 N NH1  . ARG A 1 41 ? -1.579  0.819   6.098  1.00 0.00 ? 41 ARG A NH1  5  
ATOM 2862 N NH2  . ARG A 1 41 ? -3.624  -0.177  5.797  1.00 0.00 ? 41 ARG A NH2  5  
ATOM 2863 H H    . ARG A 1 41 ? 1.259   -3.189  8.162  1.00 0.00 ? 41 ARG A H    5  
ATOM 2864 H HA   . ARG A 1 41 ? 2.565   -1.410  6.248  1.00 0.00 ? 41 ARG A HA   5  
ATOM 2865 H HB2  . ARG A 1 41 ? 1.236   0.222   8.001  1.00 0.00 ? 41 ARG A HB2  5  
ATOM 2866 H HB3  . ARG A 1 41 ? 0.575   -0.395  6.493  1.00 0.00 ? 41 ARG A HB3  5  
ATOM 2867 H HG2  . ARG A 1 41 ? -0.541  -2.174  7.625  1.00 0.00 ? 41 ARG A HG2  5  
ATOM 2868 H HG3  . ARG A 1 41 ? 0.275   -1.788  9.141  1.00 0.00 ? 41 ARG A HG3  5  
ATOM 2869 H HD2  . ARG A 1 41 ? -1.570  -0.610  9.612  1.00 0.00 ? 41 ARG A HD2  5  
ATOM 2870 H HD3  . ARG A 1 41 ? -0.900  0.592   8.509  1.00 0.00 ? 41 ARG A HD3  5  
ATOM 2871 H HE   . ARG A 1 41 ? -3.146  -1.168  8.022  1.00 0.00 ? 41 ARG A HE   5  
ATOM 2872 H HH11 . ARG A 1 41 ? -0.761  0.968   6.654  1.00 0.00 ? 41 ARG A HH11 5  
ATOM 2873 H HH12 . ARG A 1 41 ? -1.670  1.270   5.210  1.00 0.00 ? 41 ARG A HH12 5  
ATOM 2874 H HH21 . ARG A 1 41 ? -4.352  -0.778  6.125  1.00 0.00 ? 41 ARG A HH21 5  
ATOM 2875 H HH22 . ARG A 1 41 ? -3.712  0.277   4.911  1.00 0.00 ? 41 ARG A HH22 5  
ATOM 2876 N N    . CYS A 1 42 ? 4.286   -0.339  7.686  1.00 0.00 ? 42 CYS A N    5  
ATOM 2877 C CA   . CYS A 1 42 ? 5.396   0.159   8.490  1.00 0.00 ? 42 CYS A CA   5  
ATOM 2878 C C    . CYS A 1 42 ? 4.988   1.410   9.263  1.00 0.00 ? 42 CYS A C    5  
ATOM 2879 O O    . CYS A 1 42 ? 4.463   2.365   8.690  1.00 0.00 ? 42 CYS A O    5  
ATOM 2880 C CB   . CYS A 1 42 ? 6.600   0.468   7.598  1.00 0.00 ? 42 CYS A CB   5  
ATOM 2881 S SG   . CYS A 1 42 ? 7.595   -0.995  7.161  1.00 0.00 ? 42 CYS A SG   5  
ATOM 2882 H H    . CYS A 1 42 ? 4.257   -0.128  6.729  1.00 0.00 ? 42 CYS A H    5  
ATOM 2883 H HA   . CYS A 1 42 ? 5.668   -0.612  9.194  1.00 0.00 ? 42 CYS A HA   5  
ATOM 2884 H HB2  . CYS A 1 42 ? 6.253   0.915   6.678  1.00 0.00 ? 42 CYS A HB2  5  
ATOM 2885 H HB3  . CYS A 1 42 ? 7.248   1.165   8.109  1.00 0.00 ? 42 CYS A HB3  5  
ATOM 2886 N N    . CYS A 1 43 ? 5.234   1.398   10.569 1.00 0.00 ? 43 CYS A N    5  
ATOM 2887 C CA   . CYS A 1 43 ? 4.894   2.529   11.423 1.00 0.00 ? 43 CYS A CA   5  
ATOM 2888 C C    . CYS A 1 43 ? 6.135   3.350   11.759 1.00 0.00 ? 43 CYS A C    5  
ATOM 2889 O O    . CYS A 1 43 ? 7.192   2.799   12.070 1.00 0.00 ? 43 CYS A O    5  
ATOM 2890 C CB   . CYS A 1 43 ? 4.227   2.041   12.710 1.00 0.00 ? 43 CYS A CB   5  
ATOM 2891 S SG   . CYS A 1 43 ? 2.453   1.665   12.533 1.00 0.00 ? 43 CYS A SG   5  
ATOM 2892 H H    . CYS A 1 43 ? 5.655   0.607   10.969 1.00 0.00 ? 43 CYS A H    5  
ATOM 2893 H HA   . CYS A 1 43 ? 4.199   3.155   10.883 1.00 0.00 ? 43 CYS A HA   5  
ATOM 2894 H HB2  . CYS A 1 43 ? 4.721   1.140   13.043 1.00 0.00 ? 43 CYS A HB2  5  
ATOM 2895 H HB3  . CYS A 1 43 ? 4.328   2.802   13.470 1.00 0.00 ? 43 CYS A HB3  5  
ATOM 2896 N N    . CYS A 1 44 ? 6.000   4.670   11.695 1.00 0.00 ? 44 CYS A N    5  
ATOM 2897 C CA   . CYS A 1 44 ? 7.110   5.568   11.992 1.00 0.00 ? 44 CYS A CA   5  
ATOM 2898 C C    . CYS A 1 44 ? 6.852   6.343   13.281 1.00 0.00 ? 44 CYS A C    5  
ATOM 2899 O O    . CYS A 1 44 ? 5.759   6.866   13.495 1.00 0.00 ? 44 CYS A O    5  
ATOM 2900 C CB   . CYS A 1 44 ? 7.329   6.543   10.834 1.00 0.00 ? 44 CYS A CB   5  
ATOM 2901 S SG   . CYS A 1 44 ? 7.487   5.740   9.206  1.00 0.00 ? 44 CYS A SG   5  
ATOM 2902 H H    . CYS A 1 44 ? 5.133   5.051   11.441 1.00 0.00 ? 44 CYS A H    5  
ATOM 2903 H HA   . CYS A 1 44 ? 7.998   4.968   12.119 1.00 0.00 ? 44 CYS A HA   5  
ATOM 2904 H HB2  . CYS A 1 44 ? 6.492   7.224   10.783 1.00 0.00 ? 44 CYS A HB2  5  
ATOM 2905 H HB3  . CYS A 1 44 ? 8.233   7.106   11.013 1.00 0.00 ? 44 CYS A HB3  5  
ATOM 2906 N N    . ALA A 1 45 ? 7.867   6.412   14.137 1.00 0.00 ? 45 ALA A N    5  
ATOM 2907 C CA   . ALA A 1 45 ? 7.752   7.124   15.403 1.00 0.00 ? 45 ALA A CA   5  
ATOM 2908 C C    . ALA A 1 45 ? 7.893   8.629   15.202 1.00 0.00 ? 45 ALA A C    5  
ATOM 2909 O O    . ALA A 1 45 ? 8.854   9.095   14.590 1.00 0.00 ? 45 ALA A O    5  
ATOM 2910 C CB   . ALA A 1 45 ? 8.797   6.621   16.388 1.00 0.00 ? 45 ALA A CB   5  
ATOM 2911 H H    . ALA A 1 45 ? 8.714   5.974   13.910 1.00 0.00 ? 45 ALA A H    5  
ATOM 2912 H HA   . ALA A 1 45 ? 6.775   6.916   15.815 1.00 0.00 ? 45 ALA A HA   5  
ATOM 2913 H HB1  . ALA A 1 45 ? 9.081   5.612   16.127 1.00 0.00 ? 45 ALA A HB1  5  
ATOM 2914 H HB2  . ALA A 1 45 ? 9.665   7.262   16.350 1.00 0.00 ? 45 ALA A HB2  5  
ATOM 2915 H HB3  . ALA A 1 45 ? 8.385   6.632   17.386 1.00 0.00 ? 45 ALA A HB3  5  
ATOM 2916 N N    . CYS A 1 1  ? 1.192   0.095   -0.272 1.00 0.00 ? 1  CYS A N    6  
ATOM 2917 C CA   . CYS A 1 1  ? 2.073   -0.027  -1.427 1.00 0.00 ? 1  CYS A CA   6  
ATOM 2918 C C    . CYS A 1 1  ? 2.731   -1.403  -1.467 1.00 0.00 ? 1  CYS A C    6  
ATOM 2919 O O    . CYS A 1 1  ? 2.927   -2.039  -0.431 1.00 0.00 ? 1  CYS A O    6  
ATOM 2920 C CB   . CYS A 1 1  ? 3.146   1.063   -1.393 1.00 0.00 ? 1  CYS A CB   6  
ATOM 2921 S SG   . CYS A 1 1  ? 3.834   1.378   0.264  1.00 0.00 ? 1  CYS A SG   6  
ATOM 2922 H H    . CYS A 1 1  ? 1.439   0.705   0.455  1.00 0.00 ? 1  CYS A H    6  
ATOM 2923 H HA   . CYS A 1 1  ? 1.474   0.098   -2.317 1.00 0.00 ? 1  CYS A HA   6  
ATOM 2924 H HB2  . CYS A 1 1  ? 3.963   0.773   -2.038 1.00 0.00 ? 1  CYS A HB2  6  
ATOM 2925 H HB3  . CYS A 1 1  ? 2.721   1.988   -1.754 1.00 0.00 ? 1  CYS A HB3  6  
ATOM 2926 N N    . TYR A 1 2  ? 3.070   -1.856  -2.669 1.00 0.00 ? 2  TYR A N    6  
ATOM 2927 C CA   . TYR A 1 2  ? 3.704   -3.157  -2.845 1.00 0.00 ? 2  TYR A CA   6  
ATOM 2928 C C    . TYR A 1 2  ? 5.214   -3.057  -2.656 1.00 0.00 ? 2  TYR A C    6  
ATOM 2929 O O    . TYR A 1 2  ? 5.811   -1.987  -2.776 1.00 0.00 ? 2  TYR A O    6  
ATOM 2930 C CB   . TYR A 1 2  ? 3.388   -3.718  -4.232 1.00 0.00 ? 2  TYR A CB   6  
ATOM 2931 C CG   . TYR A 1 2  ? 2.632   -5.027  -4.198 1.00 0.00 ? 2  TYR A CG   6  
ATOM 2932 C CD1  . TYR A 1 2  ? 1.607   -5.236  -3.283 1.00 0.00 ? 2  TYR A CD1  6  
ATOM 2933 C CD2  . TYR A 1 2  ? 2.943   -6.056  -5.079 1.00 0.00 ? 2  TYR A CD2  6  
ATOM 2934 C CE1  . TYR A 1 2  ? 0.914   -6.431  -3.248 1.00 0.00 ? 2  TYR A CE1  6  
ATOM 2935 C CE2  . TYR A 1 2  ? 2.255   -7.253  -5.052 1.00 0.00 ? 2  TYR A CE2  6  
ATOM 2936 C CZ   . TYR A 1 2  ? 1.241   -7.436  -4.134 1.00 0.00 ? 2  TYR A CZ   6  
ATOM 2937 O OH   . TYR A 1 2  ? 0.554   -8.628  -4.103 1.00 0.00 ? 2  TYR A OH   6  
ATOM 2938 H H    . TYR A 1 2  ? 2.888   -1.303  -3.457 1.00 0.00 ? 2  TYR A H    6  
ATOM 2939 H HA   . TYR A 1 2  ? 3.302   -3.825  -2.097 1.00 0.00 ? 2  TYR A HA   6  
ATOM 2940 H HB2  . TYR A 1 2  ? 2.788   -3.004  -4.774 1.00 0.00 ? 2  TYR A HB2  6  
ATOM 2941 H HB3  . TYR A 1 2  ? 4.313   -3.883  -4.765 1.00 0.00 ? 2  TYR A HB3  6  
ATOM 2942 H HD1  . TYR A 1 2  ? 1.353   -4.448  -2.590 1.00 0.00 ? 2  TYR A HD1  6  
ATOM 2943 H HD2  . TYR A 1 2  ? 3.738   -5.909  -5.796 1.00 0.00 ? 2  TYR A HD2  6  
ATOM 2944 H HE1  . TYR A 1 2  ? 0.120   -6.575  -2.530 1.00 0.00 ? 2  TYR A HE1  6  
ATOM 2945 H HE2  . TYR A 1 2  ? 2.511   -8.040  -5.745 1.00 0.00 ? 2  TYR A HE2  6  
ATOM 2946 H HH   . TYR A 1 2  ? 0.046   -8.683  -3.290 1.00 0.00 ? 2  TYR A HH   6  
ATOM 2947 N N    . PRO A 1 3  ? 5.848   -4.199  -2.352 1.00 0.00 ? 3  PRO A N    6  
ATOM 2948 C CA   . PRO A 1 3  ? 7.297   -4.269  -2.141 1.00 0.00 ? 3  PRO A CA   6  
ATOM 2949 C C    . PRO A 1 3  ? 8.082   -4.061  -3.432 1.00 0.00 ? 3  PRO A C    6  
ATOM 2950 O O    . PRO A 1 3  ? 8.524   -5.021  -4.062 1.00 0.00 ? 3  PRO A O    6  
ATOM 2951 C CB   . PRO A 1 3  ? 7.511   -5.687  -1.608 1.00 0.00 ? 3  PRO A CB   6  
ATOM 2952 C CG   . PRO A 1 3  ? 6.358   -6.469  -2.138 1.00 0.00 ? 3  PRO A CG   6  
ATOM 2953 C CD   . PRO A 1 3  ? 5.200   -5.512  -2.193 1.00 0.00 ? 3  PRO A CD   6  
ATOM 2954 H HA   . PRO A 1 3  ? 7.625   -3.552  -1.403 1.00 0.00 ? 3  PRO A HA   6  
ATOM 2955 H HB2  . PRO A 1 3  ? 8.452   -6.074  -1.972 1.00 0.00 ? 3  PRO A HB2  6  
ATOM 2956 H HB3  . PRO A 1 3  ? 7.515   -5.673  -0.528 1.00 0.00 ? 3  PRO A HB3  6  
ATOM 2957 H HG2  . PRO A 1 3  ? 6.588   -6.837  -3.126 1.00 0.00 ? 3  PRO A HG2  6  
ATOM 2958 H HG3  . PRO A 1 3  ? 6.135   -7.289  -1.472 1.00 0.00 ? 3  PRO A HG3  6  
ATOM 2959 H HD2  . PRO A 1 3  ? 4.566   -5.734  -3.039 1.00 0.00 ? 3  PRO A HD2  6  
ATOM 2960 H HD3  . PRO A 1 3  ? 4.633   -5.552  -1.274 1.00 0.00 ? 3  PRO A HD3  6  
ATOM 2961 N N    . GLY A 1 4  ? 8.252   -2.801  -3.820 1.00 0.00 ? 4  GLY A N    6  
ATOM 2962 C CA   . GLY A 1 4  ? 8.983   -2.491  -5.034 1.00 0.00 ? 4  GLY A CA   6  
ATOM 2963 C C    . GLY A 1 4  ? 8.299   -1.425  -5.868 1.00 0.00 ? 4  GLY A C    6  
ATOM 2964 O O    . GLY A 1 4  ? 8.772   -1.076  -6.949 1.00 0.00 ? 4  GLY A O    6  
ATOM 2965 H H    . GLY A 1 4  ? 7.877   -2.076  -3.278 1.00 0.00 ? 4  GLY A H    6  
ATOM 2966 H HA2  . GLY A 1 4  ? 9.971   -2.145  -4.768 1.00 0.00 ? 4  GLY A HA2  6  
ATOM 2967 H HA3  . GLY A 1 4  ? 9.074   -3.390  -5.626 1.00 0.00 ? 4  GLY A HA3  6  
ATOM 2968 N N    . GLN A 1 5  ? 7.183   -0.909  -5.364 1.00 0.00 ? 5  GLN A N    6  
ATOM 2969 C CA   . GLN A 1 5  ? 6.431   0.121   -6.072 1.00 0.00 ? 5  GLN A CA   6  
ATOM 2970 C C    . GLN A 1 5  ? 7.122   1.476   -5.955 1.00 0.00 ? 5  GLN A C    6  
ATOM 2971 O O    . GLN A 1 5  ? 7.877   1.736   -5.018 1.00 0.00 ? 5  GLN A O    6  
ATOM 2972 C CB   . GLN A 1 5  ? 5.007   0.213   -5.521 1.00 0.00 ? 5  GLN A CB   6  
ATOM 2973 C CG   . GLN A 1 5  ? 4.208   -1.070  -5.683 1.00 0.00 ? 5  GLN A CG   6  
ATOM 2974 C CD   . GLN A 1 5  ? 2.711   -0.834  -5.646 1.00 0.00 ? 5  GLN A CD   6  
ATOM 2975 O OE1  . GLN A 1 5  ? 2.200   -0.156  -4.754 1.00 0.00 ? 5  GLN A OE1  6  
ATOM 2976 N NE2  . GLN A 1 5  ? 1.999   -1.395  -6.616 1.00 0.00 ? 5  GLN A NE2  6  
ATOM 2977 H H    . GLN A 1 5  ? 6.856   -1.229  -4.498 1.00 0.00 ? 5  GLN A H    6  
ATOM 2978 H HA   . GLN A 1 5  ? 6.387   -0.158  -7.114 1.00 0.00 ? 5  GLN A HA   6  
ATOM 2979 H HB2  . GLN A 1 5  ? 5.056   0.451   -4.469 1.00 0.00 ? 5  GLN A HB2  6  
ATOM 2980 H HB3  . GLN A 1 5  ? 4.484   1.004   -6.037 1.00 0.00 ? 5  GLN A HB3  6  
ATOM 2981 H HG2  . GLN A 1 5  ? 4.462   -1.520  -6.631 1.00 0.00 ? 5  GLN A HG2  6  
ATOM 2982 H HG3  . GLN A 1 5  ? 4.472   -1.746  -4.883 1.00 0.00 ? 5  GLN A HG3  6  
ATOM 2983 H HE21 . GLN A 1 5  ? 2.474   -1.923  -7.292 1.00 0.00 ? 5  GLN A HE21 6  
ATOM 2984 H HE22 . GLN A 1 5  ? 1.029   -1.259  -6.616 1.00 0.00 ? 5  GLN A HE22 6  
ATOM 2985 N N    . PRO A 1 6  ? 6.861   2.360   -6.929 1.00 0.00 ? 6  PRO A N    6  
ATOM 2986 C CA   . PRO A 1 6  ? 7.448   3.703   -6.958 1.00 0.00 ? 6  PRO A CA   6  
ATOM 2987 C C    . PRO A 1 6  ? 6.893   4.602   -5.859 1.00 0.00 ? 6  PRO A C    6  
ATOM 2988 O O    . PRO A 1 6  ? 5.694   4.876   -5.814 1.00 0.00 ? 6  PRO A O    6  
ATOM 2989 C CB   . PRO A 1 6  ? 7.048   4.235   -8.337 1.00 0.00 ? 6  PRO A CB   6  
ATOM 2990 C CG   . PRO A 1 6  ? 5.813   3.481   -8.690 1.00 0.00 ? 6  PRO A CG   6  
ATOM 2991 C CD   . PRO A 1 6  ? 5.971   2.117   -8.077 1.00 0.00 ? 6  PRO A CD   6  
ATOM 2992 H HA   . PRO A 1 6  ? 8.525   3.667   -6.883 1.00 0.00 ? 6  PRO A HA   6  
ATOM 2993 H HB2  . PRO A 1 6  ? 6.859   5.298   -8.274 1.00 0.00 ? 6  PRO A HB2  6  
ATOM 2994 H HB3  . PRO A 1 6  ? 7.842   4.046   -9.043 1.00 0.00 ? 6  PRO A HB3  6  
ATOM 2995 H HG2  . PRO A 1 6  ? 4.948   3.979   -8.280 1.00 0.00 ? 6  PRO A HG2  6  
ATOM 2996 H HG3  . PRO A 1 6  ? 5.727   3.401   -9.764 1.00 0.00 ? 6  PRO A HG3  6  
ATOM 2997 H HD2  . PRO A 1 6  ? 5.014   1.737   -7.750 1.00 0.00 ? 6  PRO A HD2  6  
ATOM 2998 H HD3  . PRO A 1 6  ? 6.428   1.437   -8.781 1.00 0.00 ? 6  PRO A HD3  6  
ATOM 2999 N N    . GLY A 1 7  ? 7.773   5.058   -4.973 1.00 0.00 ? 7  GLY A N    6  
ATOM 3000 C CA   . GLY A 1 7  ? 7.352   5.922   -3.885 1.00 0.00 ? 7  GLY A CA   6  
ATOM 3001 C C    . GLY A 1 7  ? 7.253   5.185   -2.564 1.00 0.00 ? 7  GLY A C    6  
ATOM 3002 O O    . GLY A 1 7  ? 6.851   5.760   -1.553 1.00 0.00 ? 7  GLY A O    6  
ATOM 3003 H H    . GLY A 1 7  ? 8.717   4.806   -5.058 1.00 0.00 ? 7  GLY A H    6  
ATOM 3004 H HA2  . GLY A 1 7  ? 8.063   6.727   -3.784 1.00 0.00 ? 7  GLY A HA2  6  
ATOM 3005 H HA3  . GLY A 1 7  ? 6.384   6.337   -4.125 1.00 0.00 ? 7  GLY A HA3  6  
ATOM 3006 N N    . CYS A 1 8  ? 7.619   3.907   -2.573 1.00 0.00 ? 8  CYS A N    6  
ATOM 3007 C CA   . CYS A 1 8  ? 7.567   3.089   -1.367 1.00 0.00 ? 8  CYS A CA   6  
ATOM 3008 C C    . CYS A 1 8  ? 8.851   2.279   -1.205 1.00 0.00 ? 8  CYS A C    6  
ATOM 3009 O O    . CYS A 1 8  ? 9.548   1.999   -2.179 1.00 0.00 ? 8  CYS A O    6  
ATOM 3010 C CB   . CYS A 1 8  ? 6.361   2.149   -1.414 1.00 0.00 ? 8  CYS A CB   6  
ATOM 3011 S SG   . CYS A 1 8  ? 5.780   1.603   0.223  1.00 0.00 ? 8  CYS A SG   6  
ATOM 3012 H H    . CYS A 1 8  ? 7.931   3.504   -3.411 1.00 0.00 ? 8  CYS A H    6  
ATOM 3013 H HA   . CYS A 1 8  ? 7.464   3.750   -0.521 1.00 0.00 ? 8  CYS A HA   6  
ATOM 3014 H HB2  . CYS A 1 8  ? 5.540   2.654   -1.902 1.00 0.00 ? 8  CYS A HB2  6  
ATOM 3015 H HB3  . CYS A 1 8  ? 6.622   1.268   -1.982 1.00 0.00 ? 8  CYS A HB3  6  
ATOM 3016 N N    . GLY A 1 9  ? 9.155   1.905   0.034  1.00 0.00 ? 9  GLY A N    6  
ATOM 3017 C CA   . GLY A 1 9  ? 10.353  1.131   0.302  1.00 0.00 ? 9  GLY A CA   6  
ATOM 3018 C C    . GLY A 1 9  ? 10.376  0.567   1.709  1.00 0.00 ? 9  GLY A C    6  
ATOM 3019 O O    . GLY A 1 9  ? 9.425   0.742   2.472  1.00 0.00 ? 9  GLY A O    6  
ATOM 3020 H H    . GLY A 1 9  ? 8.561   2.157   0.772  1.00 0.00 ? 9  GLY A H    6  
ATOM 3021 H HA2  . GLY A 1 9  ? 10.407  0.315   -0.403 1.00 0.00 ? 9  GLY A HA2  6  
ATOM 3022 H HA3  . GLY A 1 9  ? 11.216  1.767   0.168  1.00 0.00 ? 9  GLY A HA3  6  
ATOM 3023 N N    . HIS A 1 10 ? 11.464  -0.115  2.054  1.00 0.00 ? 10 HIS A N    6  
ATOM 3024 C CA   . HIS A 1 10 ? 11.607  -0.708  3.379  1.00 0.00 ? 10 HIS A CA   6  
ATOM 3025 C C    . HIS A 1 10 ? 11.755  0.373   4.445  1.00 0.00 ? 10 HIS A C    6  
ATOM 3026 O O    . HIS A 1 10 ? 12.675  1.190   4.393  1.00 0.00 ? 10 HIS A O    6  
ATOM 3027 C CB   . HIS A 1 10 ? 12.815  -1.644  3.414  1.00 0.00 ? 10 HIS A CB   6  
ATOM 3028 C CG   . HIS A 1 10 ? 14.029  -1.082  2.741  1.00 0.00 ? 10 HIS A CG   6  
ATOM 3029 N ND1  . HIS A 1 10 ? 14.324  -1.303  1.413  1.00 0.00 ? 10 HIS A ND1  6  
ATOM 3030 C CD2  . HIS A 1 10 ? 15.025  -0.301  3.221  1.00 0.00 ? 10 HIS A CD2  6  
ATOM 3031 C CE1  . HIS A 1 10 ? 15.449  -0.684  1.105  1.00 0.00 ? 10 HIS A CE1  6  
ATOM 3032 N NE2  . HIS A 1 10 ? 15.895  -0.068  2.185  1.00 0.00 ? 10 HIS A NE2  6  
ATOM 3033 H H    . HIS A 1 10 ? 12.188  -0.220  1.402  1.00 0.00 ? 10 HIS A H    6  
ATOM 3034 H HA   . HIS A 1 10 ? 10.714  -1.279  3.584  1.00 0.00 ? 10 HIS A HA   6  
ATOM 3035 H HB2  . HIS A 1 10 ? 13.072  -1.851  4.442  1.00 0.00 ? 10 HIS A HB2  6  
ATOM 3036 H HB3  . HIS A 1 10 ? 12.559  -2.570  2.919  1.00 0.00 ? 10 HIS A HB3  6  
ATOM 3037 H HD1  . HIS A 1 10 ? 13.788  -1.836  0.789  1.00 0.00 ? 10 HIS A HD1  6  
ATOM 3038 H HD2  . HIS A 1 10 ? 15.119  0.071   4.232  1.00 0.00 ? 10 HIS A HD2  6  
ATOM 3039 H HE1  . HIS A 1 10 ? 15.925  -0.681  0.135  1.00 0.00 ? 10 HIS A HE1  6  
ATOM 3040 N N    . CYS A 1 11 ? 10.843  0.372   5.412  1.00 0.00 ? 11 CYS A N    6  
ATOM 3041 C CA   . CYS A 1 11 ? 10.870  1.353   6.490  1.00 0.00 ? 11 CYS A CA   6  
ATOM 3042 C C    . CYS A 1 11 ? 12.127  1.192   7.340  1.00 0.00 ? 11 CYS A C    6  
ATOM 3043 O O    . CYS A 1 11 ? 12.819  0.177   7.258  1.00 0.00 ? 11 CYS A O    6  
ATOM 3044 C CB   . CYS A 1 11 ? 9.626   1.210   7.369  1.00 0.00 ? 11 CYS A CB   6  
ATOM 3045 S SG   . CYS A 1 11 ? 9.609   -0.294  8.396  1.00 0.00 ? 11 CYS A SG   6  
ATOM 3046 H H    . CYS A 1 11 ? 10.133  -0.304  5.399  1.00 0.00 ? 11 CYS A H    6  
ATOM 3047 H HA   . CYS A 1 11 ? 10.875  2.336   6.045  1.00 0.00 ? 11 CYS A HA   6  
ATOM 3048 H HB2  . CYS A 1 11 ? 9.564   2.061   8.032  1.00 0.00 ? 11 CYS A HB2  6  
ATOM 3049 H HB3  . CYS A 1 11 ? 8.749   1.188   6.738  1.00 0.00 ? 11 CYS A HB3  6  
ATOM 3050 N N    . SER A 1 12 ? 12.417  2.200   8.156  1.00 0.00 ? 12 SER A N    6  
ATOM 3051 C CA   . SER A 1 12 ? 13.592  2.173   9.018  1.00 0.00 ? 12 SER A CA   6  
ATOM 3052 C C    . SER A 1 12 ? 13.388  3.059   10.243 1.00 0.00 ? 12 SER A C    6  
ATOM 3053 O O    . SER A 1 12 ? 12.681  4.065   10.184 1.00 0.00 ? 12 SER A O    6  
ATOM 3054 C CB   . SER A 1 12 ? 14.830  2.631   8.244  1.00 0.00 ? 12 SER A CB   6  
ATOM 3055 O OG   . SER A 1 12 ? 15.832  3.111   9.123  1.00 0.00 ? 12 SER A OG   6  
ATOM 3056 H H    . SER A 1 12 ? 11.826  2.983   8.176  1.00 0.00 ? 12 SER A H    6  
ATOM 3057 H HA   . SER A 1 12 ? 13.739  1.155   9.346  1.00 0.00 ? 12 SER A HA   6  
ATOM 3058 H HB2  . SER A 1 12 ? 15.228  1.799   7.683  1.00 0.00 ? 12 SER A HB2  6  
ATOM 3059 H HB3  . SER A 1 12 ? 14.553  3.424   7.565  1.00 0.00 ? 12 SER A HB3  6  
ATOM 3060 H HG   . SER A 1 12 ? 16.015  2.448   9.793  1.00 0.00 ? 12 SER A HG   6  
ATOM 3061 N N    . ARG A 1 13 ? 14.013  2.678   11.353 1.00 0.00 ? 13 ARG A N    6  
ATOM 3062 C CA   . ARG A 1 13 ? 13.899  3.436   12.593 1.00 0.00 ? 13 ARG A CA   6  
ATOM 3063 C C    . ARG A 1 13 ? 13.954  4.936   12.319 1.00 0.00 ? 13 ARG A C    6  
ATOM 3064 O O    . ARG A 1 13 ? 14.645  5.402   11.413 1.00 0.00 ? 13 ARG A O    6  
ATOM 3065 C CB   . ARG A 1 13 ? 15.016  3.042   13.560 1.00 0.00 ? 13 ARG A CB   6  
ATOM 3066 C CG   . ARG A 1 13 ? 14.976  1.580   13.974 1.00 0.00 ? 13 ARG A CG   6  
ATOM 3067 C CD   . ARG A 1 13 ? 15.069  1.425   15.484 1.00 0.00 ? 13 ARG A CD   6  
ATOM 3068 N NE   . ARG A 1 13 ? 14.612  0.112   15.929 1.00 0.00 ? 13 ARG A NE   6  
ATOM 3069 C CZ   . ARG A 1 13 ? 14.973  -0.441  17.082 1.00 0.00 ? 13 ARG A CZ   6  
ATOM 3070 N NH1  . ARG A 1 13 ? 15.792  0.204   17.902 1.00 0.00 ? 13 ARG A NH1  6  
ATOM 3071 N NH2  . ARG A 1 13 ? 14.515  -1.640  17.417 1.00 0.00 ? 13 ARG A NH2  6  
ATOM 3072 H H    . ARG A 1 13 ? 14.562  1.866   11.337 1.00 0.00 ? 13 ARG A H    6  
ATOM 3073 H HA   . ARG A 1 13 ? 12.946  3.198   13.041 1.00 0.00 ? 13 ARG A HA   6  
ATOM 3074 H HB2  . ARG A 1 13 ? 15.969  3.233   13.089 1.00 0.00 ? 13 ARG A HB2  6  
ATOM 3075 H HB3  . ARG A 1 13 ? 14.936  3.648   14.450 1.00 0.00 ? 13 ARG A HB3  6  
ATOM 3076 H HG2  . ARG A 1 13 ? 14.047  1.145   13.636 1.00 0.00 ? 13 ARG A HG2  6  
ATOM 3077 H HG3  . ARG A 1 13 ? 15.806  1.063   13.516 1.00 0.00 ? 13 ARG A HG3  6  
ATOM 3078 H HD2  . ARG A 1 13 ? 16.098  1.558   15.783 1.00 0.00 ? 13 ARG A HD2  6  
ATOM 3079 H HD3  . ARG A 1 13 ? 14.458  2.185   15.948 1.00 0.00 ? 13 ARG A HD3  6  
ATOM 3080 H HE   . ARG A 1 13 ? 14.006  -0.382  15.339 1.00 0.00 ? 13 ARG A HE   6  
ATOM 3081 H HH11 . ARG A 1 13 ? 16.138  1.108   17.652 1.00 0.00 ? 13 ARG A HH11 6  
ATOM 3082 H HH12 . ARG A 1 13 ? 16.061  -0.213  18.770 1.00 0.00 ? 13 ARG A HH12 6  
ATOM 3083 H HH21 . ARG A 1 13 ? 13.897  -2.129  16.802 1.00 0.00 ? 13 ARG A HH21 6  
ATOM 3084 H HH22 . ARG A 1 13 ? 14.787  -2.055  18.284 1.00 0.00 ? 13 ARG A HH22 6  
ATOM 3085 N N    . PRO A 1 14 ? 13.209  5.712   13.121 1.00 0.00 ? 14 PRO A N    6  
ATOM 3086 C CA   . PRO A 1 14 ? 12.383  5.168   14.203 1.00 0.00 ? 14 PRO A CA   6  
ATOM 3087 C C    . PRO A 1 14 ? 11.182  4.387   13.679 1.00 0.00 ? 14 PRO A C    6  
ATOM 3088 O O    . PRO A 1 14 ? 10.259  4.073   14.429 1.00 0.00 ? 14 PRO A O    6  
ATOM 3089 C CB   . PRO A 1 14 ? 11.920  6.417   14.958 1.00 0.00 ? 14 PRO A CB   6  
ATOM 3090 C CG   . PRO A 1 14 ? 11.968  7.510   13.946 1.00 0.00 ? 14 PRO A CG   6  
ATOM 3091 C CD   . PRO A 1 14 ? 13.115  7.179   13.032 1.00 0.00 ? 14 PRO A CD   6  
ATOM 3092 H HA   . PRO A 1 14 ? 12.959  4.539   14.865 1.00 0.00 ? 14 PRO A HA   6  
ATOM 3093 H HB2  . PRO A 1 14 ? 10.916  6.265   15.329 1.00 0.00 ? 14 PRO A HB2  6  
ATOM 3094 H HB3  . PRO A 1 14 ? 12.589  6.613   15.782 1.00 0.00 ? 14 PRO A HB3  6  
ATOM 3095 H HG2  . PRO A 1 14 ? 11.043  7.538   13.392 1.00 0.00 ? 14 PRO A HG2  6  
ATOM 3096 H HG3  . PRO A 1 14 ? 12.142  8.456   14.437 1.00 0.00 ? 14 PRO A HG3  6  
ATOM 3097 H HD2  . PRO A 1 14 ? 12.895  7.491   12.022 1.00 0.00 ? 14 PRO A HD2  6  
ATOM 3098 H HD3  . PRO A 1 14 ? 14.024  7.644   13.384 1.00 0.00 ? 14 PRO A HD3  6  
ATOM 3099 N N    . ASN A 1 15 ? 11.202  4.076   12.387 1.00 0.00 ? 15 ASN A N    6  
ATOM 3100 C CA   . ASN A 1 15 ? 10.115  3.331   11.764 1.00 0.00 ? 15 ASN A CA   6  
ATOM 3101 C C    . ASN A 1 15 ? 10.300  1.830   11.962 1.00 0.00 ? 15 ASN A C    6  
ATOM 3102 O O    . ASN A 1 15 ? 11.425  1.329   11.979 1.00 0.00 ? 15 ASN A O    6  
ATOM 3103 C CB   . ASN A 1 15 ? 10.039  3.654   10.270 1.00 0.00 ? 15 ASN A CB   6  
ATOM 3104 C CG   . ASN A 1 15 ? 10.372  5.104   9.974  1.00 0.00 ? 15 ASN A CG   6  
ATOM 3105 O OD1  . ASN A 1 15 ? 10.142  5.986   10.801 1.00 0.00 ? 15 ASN A OD1  6  
ATOM 3106 N ND2  . ASN A 1 15 ? 10.916  5.355   8.789  1.00 0.00 ? 15 ASN A ND2  6  
ATOM 3107 H H    . ASN A 1 15 ? 11.966  4.354   11.840 1.00 0.00 ? 15 ASN A H    6  
ATOM 3108 H HA   . ASN A 1 15 ? 9.192   3.634   12.236 1.00 0.00 ? 15 ASN A HA   6  
ATOM 3109 H HB2  . ASN A 1 15 ? 10.739  3.028   9.736  1.00 0.00 ? 15 ASN A HB2  6  
ATOM 3110 H HB3  . ASN A 1 15 ? 9.039   3.453   9.914  1.00 0.00 ? 15 ASN A HB3  6  
ATOM 3111 H HD21 . ASN A 1 15 ? 11.070  4.602   8.181  1.00 0.00 ? 15 ASN A HD21 6  
ATOM 3112 H HD22 . ASN A 1 15 ? 11.142  6.284   8.572  1.00 0.00 ? 15 ASN A HD22 6  
ATOM 3113 N N    . TYR A 1 16 ? 9.189   1.117   12.111 1.00 0.00 ? 16 TYR A N    6  
ATOM 3114 C CA   . TYR A 1 16 ? 9.228   -0.327  12.310 1.00 0.00 ? 16 TYR A CA   6  
ATOM 3115 C C    . TYR A 1 16 ? 8.064   -1.007  11.596 1.00 0.00 ? 16 TYR A C    6  
ATOM 3116 O O    . TYR A 1 16 ? 7.273   -0.356  10.913 1.00 0.00 ? 16 TYR A O    6  
ATOM 3117 C CB   . TYR A 1 16 ? 9.189   -0.658  13.803 1.00 0.00 ? 16 TYR A CB   6  
ATOM 3118 C CG   . TYR A 1 16 ? 7.865   -0.338  14.459 1.00 0.00 ? 16 TYR A CG   6  
ATOM 3119 C CD1  . TYR A 1 16 ? 7.525   0.970   14.781 1.00 0.00 ? 16 TYR A CD1  6  
ATOM 3120 C CD2  . TYR A 1 16 ? 6.955   -1.344  14.760 1.00 0.00 ? 16 TYR A CD2  6  
ATOM 3121 C CE1  . TYR A 1 16 ? 6.317   1.267   15.381 1.00 0.00 ? 16 TYR A CE1  6  
ATOM 3122 C CE2  . TYR A 1 16 ? 5.744   -1.056  15.359 1.00 0.00 ? 16 TYR A CE2  6  
ATOM 3123 C CZ   . TYR A 1 16 ? 5.430   0.251   15.668 1.00 0.00 ? 16 TYR A CZ   6  
ATOM 3124 O OH   . TYR A 1 16 ? 4.225   0.541   16.266 1.00 0.00 ? 16 TYR A OH   6  
ATOM 3125 H H    . TYR A 1 16 ? 8.322   1.573   12.088 1.00 0.00 ? 16 TYR A H    6  
ATOM 3126 H HA   . TYR A 1 16 ? 10.155  -0.694  11.894 1.00 0.00 ? 16 TYR A HA   6  
ATOM 3127 H HB2  . TYR A 1 16 ? 9.378   -1.712  13.935 1.00 0.00 ? 16 TYR A HB2  6  
ATOM 3128 H HB3  . TYR A 1 16 ? 9.957   -0.093  14.310 1.00 0.00 ? 16 TYR A HB3  6  
ATOM 3129 H HD1  . TYR A 1 16 ? 8.222   1.764   14.555 1.00 0.00 ? 16 TYR A HD1  6  
ATOM 3130 H HD2  . TYR A 1 16 ? 7.204   -2.367  14.517 1.00 0.00 ? 16 TYR A HD2  6  
ATOM 3131 H HE1  . TYR A 1 16 ? 6.070   2.290   15.623 1.00 0.00 ? 16 TYR A HE1  6  
ATOM 3132 H HE2  . TYR A 1 16 ? 5.049   -1.852  15.584 1.00 0.00 ? 16 TYR A HE2  6  
ATOM 3133 H HH   . TYR A 1 16 ? 3.952   1.428   16.020 1.00 0.00 ? 16 TYR A HH   6  
ATOM 3134 N N    . CYS A 1 17 ? 7.966   -2.322  11.759 1.00 0.00 ? 17 CYS A N    6  
ATOM 3135 C CA   . CYS A 1 17 ? 6.899   -3.093  11.131 1.00 0.00 ? 17 CYS A CA   6  
ATOM 3136 C C    . CYS A 1 17 ? 5.656   -3.121  12.015 1.00 0.00 ? 17 CYS A C    6  
ATOM 3137 O O    . CYS A 1 17 ? 5.748   -3.310  13.227 1.00 0.00 ? 17 CYS A O    6  
ATOM 3138 C CB   . CYS A 1 17 ? 7.371   -4.521  10.851 1.00 0.00 ? 17 CYS A CB   6  
ATOM 3139 S SG   . CYS A 1 17 ? 8.023   -4.773  9.169  1.00 0.00 ? 17 CYS A SG   6  
ATOM 3140 H H    . CYS A 1 17 ? 8.627   -2.786  12.315 1.00 0.00 ? 17 CYS A H    6  
ATOM 3141 H HA   . CYS A 1 17 ? 6.651   -2.616  10.196 1.00 0.00 ? 17 CYS A HA   6  
ATOM 3142 H HB2  . CYS A 1 17 ? 8.157   -4.776  11.548 1.00 0.00 ? 17 CYS A HB2  6  
ATOM 3143 H HB3  . CYS A 1 17 ? 6.542   -5.200  10.988 1.00 0.00 ? 17 CYS A HB3  6  
ATOM 3144 N N    . GLU A 1 18 ? 4.494   -2.932  11.397 1.00 0.00 ? 18 GLU A N    6  
ATOM 3145 C CA   . GLU A 1 18 ? 3.232   -2.934  12.128 1.00 0.00 ? 18 GLU A CA   6  
ATOM 3146 C C    . GLU A 1 18 ? 2.110   -3.520  11.275 1.00 0.00 ? 18 GLU A C    6  
ATOM 3147 O O    . GLU A 1 18 ? 1.580   -2.856  10.386 1.00 0.00 ? 18 GLU A O    6  
ATOM 3148 C CB   . GLU A 1 18 ? 2.866   -1.514  12.565 1.00 0.00 ? 18 GLU A CB   6  
ATOM 3149 C CG   . GLU A 1 18 ? 1.825   -1.466  13.671 1.00 0.00 ? 18 GLU A CG   6  
ATOM 3150 C CD   . GLU A 1 18 ? 1.854   -2.699  14.553 1.00 0.00 ? 18 GLU A CD   6  
ATOM 3151 O OE1  . GLU A 1 18 ? 2.591   -2.689  15.562 1.00 0.00 ? 18 GLU A OE1  6  
ATOM 3152 O OE2  . GLU A 1 18 ? 1.141   -3.674  14.236 1.00 0.00 ? 18 GLU A OE2  6  
ATOM 3153 H H    . GLU A 1 18 ? 4.485   -2.786  10.428 1.00 0.00 ? 18 GLU A H    6  
ATOM 3154 H HA   . GLU A 1 18 ? 3.358   -3.550  13.006 1.00 0.00 ? 18 GLU A HA   6  
ATOM 3155 H HB2  . GLU A 1 18 ? 3.759   -1.018  12.917 1.00 0.00 ? 18 GLU A HB2  6  
ATOM 3156 H HB3  . GLU A 1 18 ? 2.479   -0.977  11.712 1.00 0.00 ? 18 GLU A HB3  6  
ATOM 3157 H HG2  . GLU A 1 18 ? 2.011   -0.598  14.285 1.00 0.00 ? 18 GLU A HG2  6  
ATOM 3158 H HG3  . GLU A 1 18 ? 0.846   -1.385  13.222 1.00 0.00 ? 18 GLU A HG3  6  
ATOM 3159 N N    . GLY A 1 19 ? 1.754   -4.771  11.553 1.00 0.00 ? 19 GLY A N    6  
ATOM 3160 C CA   . GLY A 1 19 ? 0.699   -5.426  10.803 1.00 0.00 ? 19 GLY A CA   6  
ATOM 3161 C C    . GLY A 1 19 ? -0.665  -5.239  11.437 1.00 0.00 ? 19 GLY A C    6  
ATOM 3162 O O    . GLY A 1 19 ? -1.648  -5.834  10.996 1.00 0.00 ? 19 GLY A O    6  
ATOM 3163 H H    . GLY A 1 19 ? 2.213   -5.253  12.274 1.00 0.00 ? 19 GLY A H    6  
ATOM 3164 H HA2  . GLY A 1 19 ? 0.678   -5.020  9.802  1.00 0.00 ? 19 GLY A HA2  6  
ATOM 3165 H HA3  . GLY A 1 19 ? 0.916   -6.483  10.747 1.00 0.00 ? 19 GLY A HA3  6  
ATOM 3166 N N    . ALA A 1 20 ? -0.725  -4.413  12.476 1.00 0.00 ? 20 ALA A N    6  
ATOM 3167 C CA   . ALA A 1 20 ? -1.978  -4.149  13.172 1.00 0.00 ? 20 ALA A CA   6  
ATOM 3168 C C    . ALA A 1 20 ? -2.181  -2.654  13.390 1.00 0.00 ? 20 ALA A C    6  
ATOM 3169 O O    . ALA A 1 20 ? -2.968  -2.016  12.690 1.00 0.00 ? 20 ALA A O    6  
ATOM 3170 C CB   . ALA A 1 20 ? -2.009  -4.888  14.502 1.00 0.00 ? 20 ALA A CB   6  
ATOM 3171 H H    . ALA A 1 20 ? 0.094   -3.968  12.781 1.00 0.00 ? 20 ALA A H    6  
ATOM 3172 H HA   . ALA A 1 20 ? -2.785  -4.526  12.560 1.00 0.00 ? 20 ALA A HA   6  
ATOM 3173 H HB1  . ALA A 1 20 ? -2.903  -4.615  15.043 1.00 0.00 ? 20 ALA A HB1  6  
ATOM 3174 H HB2  . ALA A 1 20 ? -2.007  -5.952  14.322 1.00 0.00 ? 20 ALA A HB2  6  
ATOM 3175 H HB3  . ALA A 1 20 ? -1.140  -4.618  15.083 1.00 0.00 ? 20 ALA A HB3  6  
ATOM 3176 N N    . ARG A 1 21 ? -1.467  -2.100  14.365 1.00 0.00 ? 21 ARG A N    6  
ATOM 3177 C CA   . ARG A 1 21 ? -1.571  -0.680  14.676 1.00 0.00 ? 21 ARG A CA   6  
ATOM 3178 C C    . ARG A 1 21 ? -0.327  -0.193  15.413 1.00 0.00 ? 21 ARG A C    6  
ATOM 3179 O O    . ARG A 1 21 ? 0.256   -0.920  16.217 1.00 0.00 ? 21 ARG A O    6  
ATOM 3180 C CB   . ARG A 1 21 ? -2.817  -0.411  15.522 1.00 0.00 ? 21 ARG A CB   6  
ATOM 3181 C CG   . ARG A 1 21 ? -3.781  0.579   14.890 1.00 0.00 ? 21 ARG A CG   6  
ATOM 3182 C CD   . ARG A 1 21 ? -5.215  0.076   14.950 1.00 0.00 ? 21 ARG A CD   6  
ATOM 3183 N NE   . ARG A 1 21 ? -5.886  0.480   16.182 1.00 0.00 ? 21 ARG A NE   6  
ATOM 3184 C CZ   . ARG A 1 21 ? -7.157  0.204   16.452 1.00 0.00 ? 21 ARG A CZ   6  
ATOM 3185 N NH1  . ARG A 1 21 ? -7.890  -0.474  15.580 1.00 0.00 ? 21 ARG A NH1  6  
ATOM 3186 N NH2  . ARG A 1 21 ? -7.696  0.605   17.596 1.00 0.00 ? 21 ARG A NH2  6  
ATOM 3187 H H    . ARG A 1 21 ? -0.857  -2.661  14.888 1.00 0.00 ? 21 ARG A H    6  
ATOM 3188 H HA   . ARG A 1 21 ? -1.657  -0.141  13.744 1.00 0.00 ? 21 ARG A HA   6  
ATOM 3189 H HB2  . ARG A 1 21 ? -3.342  -1.343  15.676 1.00 0.00 ? 21 ARG A HB2  6  
ATOM 3190 H HB3  . ARG A 1 21 ? -2.509  -0.019  16.480 1.00 0.00 ? 21 ARG A HB3  6  
ATOM 3191 H HG2  . ARG A 1 21 ? -3.718  1.518   15.421 1.00 0.00 ? 21 ARG A HG2  6  
ATOM 3192 H HG3  . ARG A 1 21 ? -3.503  0.728   13.857 1.00 0.00 ? 21 ARG A HG3  6  
ATOM 3193 H HD2  . ARG A 1 21 ? -5.758  0.478   14.107 1.00 0.00 ? 21 ARG A HD2  6  
ATOM 3194 H HD3  . ARG A 1 21 ? -5.207  -1.002  14.891 1.00 0.00 ? 21 ARG A HD3  6  
ATOM 3195 H HE   . ARG A 1 21 ? -5.362  0.982   16.841 1.00 0.00 ? 21 ARG A HE   6  
ATOM 3196 H HH11 . ARG A 1 21 ? -7.486  -0.779  14.718 1.00 0.00 ? 21 ARG A HH11 6  
ATOM 3197 H HH12 . ARG A 1 21 ? -8.847  -0.682  15.786 1.00 0.00 ? 21 ARG A HH12 6  
ATOM 3198 H HH21 . ARG A 1 21 ? -7.146  1.116   18.256 1.00 0.00 ? 21 ARG A HH21 6  
ATOM 3199 H HH22 . ARG A 1 21 ? -8.653  0.397   17.798 1.00 0.00 ? 21 ARG A HH22 6  
ATOM 3200 N N    . CYS A 1 22 ? 0.074   1.043   15.134 1.00 0.00 ? 22 CYS A N    6  
ATOM 3201 C CA   . CYS A 1 22 ? 1.248   1.628   15.769 1.00 0.00 ? 22 CYS A CA   6  
ATOM 3202 C C    . CYS A 1 22 ? 1.029   1.794   17.270 1.00 0.00 ? 22 CYS A C    6  
ATOM 3203 O O    . CYS A 1 22 ? -0.107  1.829   17.741 1.00 0.00 ? 22 CYS A O    6  
ATOM 3204 C CB   . CYS A 1 22 ? 1.573   2.984   15.137 1.00 0.00 ? 22 CYS A CB   6  
ATOM 3205 S SG   . CYS A 1 22 ? 1.619   2.963   13.316 1.00 0.00 ? 22 CYS A SG   6  
ATOM 3206 H H    . CYS A 1 22 ? -0.433  1.575   14.484 1.00 0.00 ? 22 CYS A H    6  
ATOM 3207 H HA   . CYS A 1 22 ? 2.080   0.959   15.610 1.00 0.00 ? 22 CYS A HA   6  
ATOM 3208 H HB2  . CYS A 1 22 ? 0.824   3.701   15.438 1.00 0.00 ? 22 CYS A HB2  6  
ATOM 3209 H HB3  . CYS A 1 22 ? 2.540   3.313   15.488 1.00 0.00 ? 22 CYS A HB3  6  
ATOM 3210 N N    . GLU A 1 23 ? 2.126   1.895   18.015 1.00 0.00 ? 23 GLU A N    6  
ATOM 3211 C CA   . GLU A 1 23 ? 2.054   2.056   19.462 1.00 0.00 ? 23 GLU A CA   6  
ATOM 3212 C C    . GLU A 1 23 ? 1.655   3.482   19.831 1.00 0.00 ? 23 GLU A C    6  
ATOM 3213 O O    . GLU A 1 23 ? 1.587   4.361   18.972 1.00 0.00 ? 23 GLU A O    6  
ATOM 3214 C CB   . GLU A 1 23 ? 3.398   1.708   20.104 1.00 0.00 ? 23 GLU A CB   6  
ATOM 3215 C CG   . GLU A 1 23 ? 4.012   0.424   19.572 1.00 0.00 ? 23 GLU A CG   6  
ATOM 3216 C CD   . GLU A 1 23 ? 4.095   -0.664  20.625 1.00 0.00 ? 23 GLU A CD   6  
ATOM 3217 O OE1  . GLU A 1 23 ? 4.833   -1.647  20.405 1.00 0.00 ? 23 GLU A OE1  6  
ATOM 3218 O OE2  . GLU A 1 23 ? 3.423   -0.532  21.669 1.00 0.00 ? 23 GLU A OE2  6  
ATOM 3219 H H    . GLU A 1 23 ? 3.004   1.860   17.581 1.00 0.00 ? 23 GLU A H    6  
ATOM 3220 H HA   . GLU A 1 23 ? 1.301   1.377   19.834 1.00 0.00 ? 23 GLU A HA   6  
ATOM 3221 H HB2  . GLU A 1 23 ? 4.090   2.517   19.923 1.00 0.00 ? 23 GLU A HB2  6  
ATOM 3222 H HB3  . GLU A 1 23 ? 3.256   1.599   21.169 1.00 0.00 ? 23 GLU A HB3  6  
ATOM 3223 H HG2  . GLU A 1 23 ? 3.409   0.064   18.752 1.00 0.00 ? 23 GLU A HG2  6  
ATOM 3224 H HG3  . GLU A 1 23 ? 5.010   0.638   19.217 1.00 0.00 ? 23 GLU A HG3  6  
ATOM 3225 N N    . SER A 1 24 ? 1.393   3.703   21.116 1.00 0.00 ? 24 SER A N    6  
ATOM 3226 C CA   . SER A 1 24 ? 0.998   5.021   21.599 1.00 0.00 ? 24 SER A CA   6  
ATOM 3227 C C    . SER A 1 24 ? 2.177   5.988   21.567 1.00 0.00 ? 24 SER A C    6  
ATOM 3228 O O    . SER A 1 24 ? 2.348   6.806   22.470 1.00 0.00 ? 24 SER A O    6  
ATOM 3229 C CB   . SER A 1 24 ? 0.445   4.920   23.022 1.00 0.00 ? 24 SER A CB   6  
ATOM 3230 O OG   . SER A 1 24 ? -0.972  4.937   23.021 1.00 0.00 ? 24 SER A OG   6  
ATOM 3231 H H    . SER A 1 24 ? 1.466   2.962   21.753 1.00 0.00 ? 24 SER A H    6  
ATOM 3232 H HA   . SER A 1 24 ? 0.223   5.394   20.946 1.00 0.00 ? 24 SER A HA   6  
ATOM 3233 H HB2  . SER A 1 24 ? 0.781   3.999   23.472 1.00 0.00 ? 24 SER A HB2  6  
ATOM 3234 H HB3  . SER A 1 24 ? 0.802   5.757   23.604 1.00 0.00 ? 24 SER A HB3  6  
ATOM 3235 H HG   . SER A 1 24 ? -1.303  4.051   23.189 1.00 0.00 ? 24 SER A HG   6  
ATOM 3236 N N    . GLY A 1 25 ? 2.989   5.888   20.518 1.00 0.00 ? 25 GLY A N    6  
ATOM 3237 C CA   . GLY A 1 25 ? 4.142   6.759   20.387 1.00 0.00 ? 25 GLY A CA   6  
ATOM 3238 C C    . GLY A 1 25 ? 4.678   6.801   18.970 1.00 0.00 ? 25 GLY A C    6  
ATOM 3239 O O    . GLY A 1 25 ? 5.761   7.331   18.723 1.00 0.00 ? 25 GLY A O    6  
ATOM 3240 H H    . GLY A 1 25 ? 2.803   5.216   19.829 1.00 0.00 ? 25 GLY A H    6  
ATOM 3241 H HA2  . GLY A 1 25 ? 3.860   7.758   20.684 1.00 0.00 ? 25 GLY A HA2  6  
ATOM 3242 H HA3  . GLY A 1 25 ? 4.923   6.405   21.044 1.00 0.00 ? 25 GLY A HA3  6  
ATOM 3243 N N    . PHE A 1 26 ? 3.919   6.239   18.035 1.00 0.00 ? 26 PHE A N    6  
ATOM 3244 C CA   . PHE A 1 26 ? 4.325   6.212   16.634 1.00 0.00 ? 26 PHE A CA   6  
ATOM 3245 C C    . PHE A 1 26 ? 3.166   6.605   15.724 1.00 0.00 ? 26 PHE A C    6  
ATOM 3246 O O    . PHE A 1 26 ? 2.058   6.875   16.191 1.00 0.00 ? 26 PHE A O    6  
ATOM 3247 C CB   . PHE A 1 26 ? 4.835   4.820   16.256 1.00 0.00 ? 26 PHE A CB   6  
ATOM 3248 C CG   . PHE A 1 26 ? 6.069   4.409   17.008 1.00 0.00 ? 26 PHE A CG   6  
ATOM 3249 C CD1  . PHE A 1 26 ? 6.043   4.273   18.387 1.00 0.00 ? 26 PHE A CD1  6  
ATOM 3250 C CD2  . PHE A 1 26 ? 7.255   4.159   16.336 1.00 0.00 ? 26 PHE A CD2  6  
ATOM 3251 C CE1  . PHE A 1 26 ? 7.176   3.895   19.082 1.00 0.00 ? 26 PHE A CE1  6  
ATOM 3252 C CE2  . PHE A 1 26 ? 8.391   3.780   17.026 1.00 0.00 ? 26 PHE A CE2  6  
ATOM 3253 C CZ   . PHE A 1 26 ? 8.352   3.649   18.400 1.00 0.00 ? 26 PHE A CZ   6  
ATOM 3254 H H    . PHE A 1 26 ? 3.065   5.832   18.293 1.00 0.00 ? 26 PHE A H    6  
ATOM 3255 H HA   . PHE A 1 26 ? 5.124   6.925   16.508 1.00 0.00 ? 26 PHE A HA   6  
ATOM 3256 H HB2  . PHE A 1 26 ? 4.064   4.093   16.463 1.00 0.00 ? 26 PHE A HB2  6  
ATOM 3257 H HB3  . PHE A 1 26 ? 5.067   4.803   15.202 1.00 0.00 ? 26 PHE A HB3  6  
ATOM 3258 H HD1  . PHE A 1 26 ? 5.123   4.466   18.921 1.00 0.00 ? 26 PHE A HD1  6  
ATOM 3259 H HD2  . PHE A 1 26 ? 7.287   4.261   15.261 1.00 0.00 ? 26 PHE A HD2  6  
ATOM 3260 H HE1  . PHE A 1 26 ? 7.142   3.794   20.156 1.00 0.00 ? 26 PHE A HE1  6  
ATOM 3261 H HE2  . PHE A 1 26 ? 9.309   3.588   16.491 1.00 0.00 ? 26 PHE A HE2  6  
ATOM 3262 H HZ   . PHE A 1 26 ? 9.238   3.353   18.941 1.00 0.00 ? 26 PHE A HZ   6  
ATOM 3263 N N    . HIS A 1 27 ? 3.428   6.637   14.421 1.00 0.00 ? 27 HIS A N    6  
ATOM 3264 C CA   . HIS A 1 27 ? 2.407   6.998   13.444 1.00 0.00 ? 27 HIS A CA   6  
ATOM 3265 C C    . HIS A 1 27 ? 2.476   6.084   12.224 1.00 0.00 ? 27 HIS A C    6  
ATOM 3266 O O    . HIS A 1 27 ? 3.543   5.894   11.639 1.00 0.00 ? 27 HIS A O    6  
ATOM 3267 C CB   . HIS A 1 27 ? 2.575   8.455   13.014 1.00 0.00 ? 27 HIS A CB   6  
ATOM 3268 C CG   . HIS A 1 27 ? 4.002   8.907   12.971 1.00 0.00 ? 27 HIS A CG   6  
ATOM 3269 N ND1  . HIS A 1 27 ? 4.620   9.551   14.023 1.00 0.00 ? 27 HIS A ND1  6  
ATOM 3270 C CD2  . HIS A 1 27 ? 4.934   8.803   11.995 1.00 0.00 ? 27 HIS A CD2  6  
ATOM 3271 C CE1  . HIS A 1 27 ? 5.870   9.825   13.695 1.00 0.00 ? 27 HIS A CE1  6  
ATOM 3272 N NE2  . HIS A 1 27 ? 6.086   9.381   12.470 1.00 0.00 ? 27 HIS A NE2  6  
ATOM 3273 H H    . HIS A 1 27 ? 4.330   6.412   14.110 1.00 0.00 ? 27 HIS A H    6  
ATOM 3274 H HA   . HIS A 1 27 ? 1.442   6.878   13.913 1.00 0.00 ? 27 HIS A HA   6  
ATOM 3275 H HB2  . HIS A 1 27 ? 2.157   8.583   12.027 1.00 0.00 ? 27 HIS A HB2  6  
ATOM 3276 H HB3  . HIS A 1 27 ? 2.045   9.092   13.709 1.00 0.00 ? 27 HIS A HB3  6  
ATOM 3277 H HD1  . HIS A 1 27 ? 4.203   9.775   14.880 1.00 0.00 ? 27 HIS A HD1  6  
ATOM 3278 H HD2  . HIS A 1 27 ? 4.798   8.350   11.023 1.00 0.00 ? 27 HIS A HD2  6  
ATOM 3279 H HE1  . HIS A 1 27 ? 6.593   10.326  14.321 1.00 0.00 ? 27 HIS A HE1  6  
ATOM 3280 N N    . ASP A 1 28 ? 1.333   5.522   11.846 1.00 0.00 ? 28 ASP A N    6  
ATOM 3281 C CA   . ASP A 1 28 ? 1.264   4.629   10.696 1.00 0.00 ? 28 ASP A CA   6  
ATOM 3282 C C    . ASP A 1 28 ? 1.757   5.330   9.433  1.00 0.00 ? 28 ASP A C    6  
ATOM 3283 O O    . ASP A 1 28 ? 1.148   6.293   8.967  1.00 0.00 ? 28 ASP A O    6  
ATOM 3284 C CB   . ASP A 1 28 ? -0.169  4.134   10.493 1.00 0.00 ? 28 ASP A CB   6  
ATOM 3285 C CG   . ASP A 1 28 ? -0.389  3.549   9.112  1.00 0.00 ? 28 ASP A CG   6  
ATOM 3286 O OD1  . ASP A 1 28 ? -1.498  3.721   8.564  1.00 0.00 ? 28 ASP A OD1  6  
ATOM 3287 O OD2  . ASP A 1 28 ? 0.548   2.918   8.579  1.00 0.00 ? 28 ASP A OD2  6  
ATOM 3288 H H    . ASP A 1 28 ? 0.516   5.713   12.353 1.00 0.00 ? 28 ASP A H    6  
ATOM 3289 H HA   . ASP A 1 28 ? 1.903   3.782   10.894 1.00 0.00 ? 28 ASP A HA   6  
ATOM 3290 H HB2  . ASP A 1 28 ? -0.386  3.370   11.226 1.00 0.00 ? 28 ASP A HB2  6  
ATOM 3291 H HB3  . ASP A 1 28 ? -0.851  4.961   10.627 1.00 0.00 ? 28 ASP A HB3  6  
ATOM 3292 N N    . CYS A 1 29 ? 2.864   4.840   8.885  1.00 0.00 ? 29 CYS A N    6  
ATOM 3293 C CA   . CYS A 1 29 ? 3.440   5.419   7.677  1.00 0.00 ? 29 CYS A CA   6  
ATOM 3294 C C    . CYS A 1 29 ? 3.476   4.395   6.546  1.00 0.00 ? 29 CYS A C    6  
ATOM 3295 O O    . CYS A 1 29 ? 4.274   4.509   5.617  1.00 0.00 ? 29 CYS A O    6  
ATOM 3296 C CB   . CYS A 1 29 ? 4.853   5.935   7.958  1.00 0.00 ? 29 CYS A CB   6  
ATOM 3297 S SG   . CYS A 1 29 ? 5.896   4.772   8.895  1.00 0.00 ? 29 CYS A SG   6  
ATOM 3298 H H    . CYS A 1 29 ? 3.304   4.070   9.302  1.00 0.00 ? 29 CYS A H    6  
ATOM 3299 H HA   . CYS A 1 29 ? 2.817   6.248   7.377  1.00 0.00 ? 29 CYS A HA   6  
ATOM 3300 H HB2  . CYS A 1 29 ? 5.348   6.136   7.019  1.00 0.00 ? 29 CYS A HB2  6  
ATOM 3301 H HB3  . CYS A 1 29 ? 4.787   6.850   8.528  1.00 0.00 ? 29 CYS A HB3  6  
ATOM 3302 N N    . GLY A 1 30 ? 2.605   3.395   6.633  1.00 0.00 ? 30 GLY A N    6  
ATOM 3303 C CA   . GLY A 1 30 ? 2.554   2.365   5.612  1.00 0.00 ? 30 GLY A CA   6  
ATOM 3304 C C    . GLY A 1 30 ? 2.384   2.939   4.219  1.00 0.00 ? 30 GLY A C    6  
ATOM 3305 O O    . GLY A 1 30 ? 2.546   2.231   3.225  1.00 0.00 ? 30 GLY A O    6  
ATOM 3306 H H    . GLY A 1 30 ? 1.993   3.355   7.398  1.00 0.00 ? 30 GLY A H    6  
ATOM 3307 H HA2  . GLY A 1 30 ? 3.469   1.793   5.646  1.00 0.00 ? 30 GLY A HA2  6  
ATOM 3308 H HA3  . GLY A 1 30 ? 1.722   1.708   5.821  1.00 0.00 ? 30 GLY A HA3  6  
ATOM 3309 N N    . SER A 1 31 ? 2.055   4.224   4.146  1.00 0.00 ? 31 SER A N    6  
ATOM 3310 C CA   . SER A 1 31 ? 1.858   4.891   2.864  1.00 0.00 ? 31 SER A CA   6  
ATOM 3311 C C    . SER A 1 31 ? 2.968   4.525   1.885  1.00 0.00 ? 31 SER A C    6  
ATOM 3312 O O    . SER A 1 31 ? 2.742   3.799   0.916  1.00 0.00 ? 31 SER A O    6  
ATOM 3313 C CB   . SER A 1 31 ? 1.812   6.408   3.057  1.00 0.00 ? 31 SER A CB   6  
ATOM 3314 O OG   . SER A 1 31 ? 0.670   6.968   2.433  1.00 0.00 ? 31 SER A OG   6  
ATOM 3315 H H    . SER A 1 31 ? 1.940   4.736   4.974  1.00 0.00 ? 31 SER A H    6  
ATOM 3316 H HA   . SER A 1 31 ? 0.913   4.560   2.460  1.00 0.00 ? 31 SER A HA   6  
ATOM 3317 H HB2  . SER A 1 31 ? 1.778   6.634   4.112  1.00 0.00 ? 31 SER A HB2  6  
ATOM 3318 H HB3  . SER A 1 31 ? 2.698   6.850   2.623  1.00 0.00 ? 31 SER A HB3  6  
ATOM 3319 H HG   . SER A 1 31 ? 0.811   7.009   1.484  1.00 0.00 ? 31 SER A HG   6  
ATOM 3320 N N    . ASP A 1 32 ? 4.168   5.032   2.144  1.00 0.00 ? 32 ASP A N    6  
ATOM 3321 C CA   . ASP A 1 32 ? 5.316   4.758   1.286  1.00 0.00 ? 32 ASP A CA   6  
ATOM 3322 C C    . ASP A 1 32 ? 6.306   3.830   1.984  1.00 0.00 ? 32 ASP A C    6  
ATOM 3323 O O    . ASP A 1 32 ? 7.513   3.905   1.750  1.00 0.00 ? 32 ASP A O    6  
ATOM 3324 C CB   . ASP A 1 32 ? 6.010   6.063   0.895  1.00 0.00 ? 32 ASP A CB   6  
ATOM 3325 C CG   . ASP A 1 32 ? 5.987   7.089   2.011  1.00 0.00 ? 32 ASP A CG   6  
ATOM 3326 O OD1  . ASP A 1 32 ? 6.329   6.727   3.157  1.00 0.00 ? 32 ASP A OD1  6  
ATOM 3327 O OD2  . ASP A 1 32 ? 5.629   8.253   1.739  1.00 0.00 ? 32 ASP A OD2  6  
ATOM 3328 H H    . ASP A 1 32 ? 4.286   5.603   2.932  1.00 0.00 ? 32 ASP A H    6  
ATOM 3329 H HA   . ASP A 1 32 ? 4.954   4.271   0.393  1.00 0.00 ? 32 ASP A HA   6  
ATOM 3330 H HB2  . ASP A 1 32 ? 7.040   5.855   0.644  1.00 0.00 ? 32 ASP A HB2  6  
ATOM 3331 H HB3  . ASP A 1 32 ? 5.512   6.484   0.033  1.00 0.00 ? 32 ASP A HB3  6  
ATOM 3332 N N    . HIS A 1 33 ? 5.788   2.957   2.842  1.00 0.00 ? 33 HIS A N    6  
ATOM 3333 C CA   . HIS A 1 33 ? 6.627   2.015   3.574  1.00 0.00 ? 33 HIS A CA   6  
ATOM 3334 C C    . HIS A 1 33 ? 5.880   0.710   3.833  1.00 0.00 ? 33 HIS A C    6  
ATOM 3335 O O    . HIS A 1 33 ? 4.828   0.703   4.473  1.00 0.00 ? 33 HIS A O    6  
ATOM 3336 C CB   . HIS A 1 33 ? 7.082   2.628   4.899  1.00 0.00 ? 33 HIS A CB   6  
ATOM 3337 C CG   . HIS A 1 33 ? 7.773   3.948   4.742  1.00 0.00 ? 33 HIS A CG   6  
ATOM 3338 N ND1  . HIS A 1 33 ? 7.360   5.094   5.388  1.00 0.00 ? 33 HIS A ND1  6  
ATOM 3339 C CD2  . HIS A 1 33 ? 8.855   4.299   4.009  1.00 0.00 ? 33 HIS A CD2  6  
ATOM 3340 C CE1  . HIS A 1 33 ? 8.157   6.094   5.058  1.00 0.00 ? 33 HIS A CE1  6  
ATOM 3341 N NE2  . HIS A 1 33 ? 9.073   5.638   4.222  1.00 0.00 ? 33 HIS A NE2  6  
ATOM 3342 H H    . HIS A 1 33 ? 4.819   2.946   2.986  1.00 0.00 ? 33 HIS A H    6  
ATOM 3343 H HA   . HIS A 1 33 ? 7.495   1.804   2.968  1.00 0.00 ? 33 HIS A HA   6  
ATOM 3344 H HB2  . HIS A 1 33 ? 6.221   2.777   5.533  1.00 0.00 ? 33 HIS A HB2  6  
ATOM 3345 H HB3  . HIS A 1 33 ? 7.768   1.949   5.385  1.00 0.00 ? 33 HIS A HB3  6  
ATOM 3346 H HD1  . HIS A 1 33 ? 6.595   5.164   5.996  1.00 0.00 ? 33 HIS A HD1  6  
ATOM 3347 H HD2  . HIS A 1 33 ? 9.439   3.648   3.374  1.00 0.00 ? 33 HIS A HD2  6  
ATOM 3348 H HE1  . HIS A 1 33 ? 8.075   7.111   5.410  1.00 0.00 ? 33 HIS A HE1  6  
ATOM 3349 N N    . TRP A 1 34 ? 6.430   -0.390  3.333  1.00 0.00 ? 34 TRP A N    6  
ATOM 3350 C CA   . TRP A 1 34 ? 5.814   -1.700  3.510  1.00 0.00 ? 34 TRP A CA   6  
ATOM 3351 C C    . TRP A 1 34 ? 6.731   -2.631  4.297  1.00 0.00 ? 34 TRP A C    6  
ATOM 3352 O O    . TRP A 1 34 ? 7.901   -2.320  4.523  1.00 0.00 ? 34 TRP A O    6  
ATOM 3353 C CB   . TRP A 1 34 ? 5.484   -2.319  2.151  1.00 0.00 ? 34 TRP A CB   6  
ATOM 3354 C CG   . TRP A 1 34 ? 6.441   -1.921  1.068  1.00 0.00 ? 34 TRP A CG   6  
ATOM 3355 C CD1  . TRP A 1 34 ? 6.150   -1.212  -0.062 1.00 0.00 ? 34 TRP A CD1  6  
ATOM 3356 C CD2  . TRP A 1 34 ? 7.842   -2.210  1.014  1.00 0.00 ? 34 TRP A CD2  6  
ATOM 3357 N NE1  . TRP A 1 34 ? 7.286   -1.043  -0.816 1.00 0.00 ? 34 TRP A NE1  6  
ATOM 3358 C CE2  . TRP A 1 34 ? 8.337   -1.646  -0.178 1.00 0.00 ? 34 TRP A CE2  6  
ATOM 3359 C CE3  . TRP A 1 34 ? 8.726   -2.890  1.856  1.00 0.00 ? 34 TRP A CE3  6  
ATOM 3360 C CZ2  . TRP A 1 34 ? 9.677   -1.742  -0.546 1.00 0.00 ? 34 TRP A CZ2  6  
ATOM 3361 C CZ3  . TRP A 1 34 ? 10.055  -2.985  1.489  1.00 0.00 ? 34 TRP A CZ3  6  
ATOM 3362 C CH2  . TRP A 1 34 ? 10.520  -2.413  0.298  1.00 0.00 ? 34 TRP A CH2  6  
ATOM 3363 H H    . TRP A 1 34 ? 7.270   -0.320  2.832  1.00 0.00 ? 34 TRP A H    6  
ATOM 3364 H HA   . TRP A 1 34 ? 4.898   -1.563  4.065  1.00 0.00 ? 34 TRP A HA   6  
ATOM 3365 H HB2  . TRP A 1 34 ? 5.507   -3.395  2.237  1.00 0.00 ? 34 TRP A HB2  6  
ATOM 3366 H HB3  . TRP A 1 34 ? 4.493   -2.007  1.853  1.00 0.00 ? 34 TRP A HB3  6  
ATOM 3367 H HD1  . TRP A 1 34 ? 5.166   -0.846  -0.314 1.00 0.00 ? 34 TRP A HD1  6  
ATOM 3368 H HE1  . TRP A 1 34 ? 7.335   -0.567  -1.672 1.00 0.00 ? 34 TRP A HE1  6  
ATOM 3369 H HE3  . TRP A 1 34 ? 8.386   -3.337  2.778  1.00 0.00 ? 34 TRP A HE3  6  
ATOM 3370 H HZ2  . TRP A 1 34 ? 10.051  -1.306  -1.460 1.00 0.00 ? 34 TRP A HZ2  6  
ATOM 3371 H HZ3  . TRP A 1 34 ? 10.753  -3.507  2.127  1.00 0.00 ? 34 TRP A HZ3  6  
ATOM 3372 H HH2  . TRP A 1 34 ? 11.566  -2.512  0.051  1.00 0.00 ? 34 TRP A HH2  6  
ATOM 3373 N N    . CYS A 1 35 ? 6.194   -3.773  4.711  1.00 0.00 ? 35 CYS A N    6  
ATOM 3374 C CA   . CYS A 1 35 ? 6.963   -4.749  5.473  1.00 0.00 ? 35 CYS A CA   6  
ATOM 3375 C C    . CYS A 1 35 ? 7.323   -5.953  4.608  1.00 0.00 ? 35 CYS A C    6  
ATOM 3376 O O    . CYS A 1 35 ? 6.827   -6.098  3.490  1.00 0.00 ? 35 CYS A O    6  
ATOM 3377 C CB   . CYS A 1 35 ? 6.173   -5.207  6.700  1.00 0.00 ? 35 CYS A CB   6  
ATOM 3378 S SG   . CYS A 1 35 ? 6.306   -4.087  8.131  1.00 0.00 ? 35 CYS A SG   6  
ATOM 3379 H H    . CYS A 1 35 ? 5.255   -3.965  4.499  1.00 0.00 ? 35 CYS A H    6  
ATOM 3380 H HA   . CYS A 1 35 ? 7.874   -4.271  5.800  1.00 0.00 ? 35 CYS A HA   6  
ATOM 3381 H HB2  . CYS A 1 35 ? 5.128   -5.281  6.439  1.00 0.00 ? 35 CYS A HB2  6  
ATOM 3382 H HB3  . CYS A 1 35 ? 6.532   -6.178  7.008  1.00 0.00 ? 35 CYS A HB3  6  
ATOM 3383 N N    . ASP A 1 36 ? 8.188   -6.814  5.132  1.00 0.00 ? 36 ASP A N    6  
ATOM 3384 C CA   . ASP A 1 36 ? 8.614   -8.007  4.409  1.00 0.00 ? 36 ASP A CA   6  
ATOM 3385 C C    . ASP A 1 36 ? 7.418   -8.720  3.785  1.00 0.00 ? 36 ASP A C    6  
ATOM 3386 O O    . ASP A 1 36 ? 7.495   -9.217  2.662  1.00 0.00 ? 36 ASP A O    6  
ATOM 3387 C CB   . ASP A 1 36 ? 9.359   -8.959  5.346  1.00 0.00 ? 36 ASP A CB   6  
ATOM 3388 C CG   . ASP A 1 36 ? 10.843  -8.656  5.419  1.00 0.00 ? 36 ASP A CG   6  
ATOM 3389 O OD1  . ASP A 1 36 ? 11.561  -8.972  4.447  1.00 0.00 ? 36 ASP A OD1  6  
ATOM 3390 O OD2  . ASP A 1 36 ? 11.285  -8.102  6.446  1.00 0.00 ? 36 ASP A OD2  6  
ATOM 3391 H H    . ASP A 1 36 ? 8.549   -6.644  6.027  1.00 0.00 ? 36 ASP A H    6  
ATOM 3392 H HA   . ASP A 1 36 ? 9.282   -7.696  3.621  1.00 0.00 ? 36 ASP A HA   6  
ATOM 3393 H HB2  . ASP A 1 36 ? 8.944   -8.873  6.340  1.00 0.00 ? 36 ASP A HB2  6  
ATOM 3394 H HB3  . ASP A 1 36 ? 9.233   -9.972  4.994  1.00 0.00 ? 36 ASP A HB3  6  
ATOM 3395 N N    . ALA A 1 37 ? 6.313   -8.767  4.523  1.00 0.00 ? 37 ALA A N    6  
ATOM 3396 C CA   . ALA A 1 37 ? 5.101   -9.418  4.042  1.00 0.00 ? 37 ALA A CA   6  
ATOM 3397 C C    . ALA A 1 37 ? 4.169   -8.416  3.369  1.00 0.00 ? 37 ALA A C    6  
ATOM 3398 O O    . ALA A 1 37 ? 3.746   -7.438  3.984  1.00 0.00 ? 37 ALA A O    6  
ATOM 3399 C CB   . ALA A 1 37 ? 4.387   -10.118 5.189  1.00 0.00 ? 37 ALA A CB   6  
ATOM 3400 H H    . ALA A 1 37 ? 6.313   -8.353  5.411  1.00 0.00 ? 37 ALA A H    6  
ATOM 3401 H HA   . ALA A 1 37 ? 5.389   -10.168 3.319  1.00 0.00 ? 37 ALA A HA   6  
ATOM 3402 H HB1  . ALA A 1 37 ? 4.096   -11.111 4.879  1.00 0.00 ? 37 ALA A HB1  6  
ATOM 3403 H HB2  . ALA A 1 37 ? 5.050   -10.185 6.038  1.00 0.00 ? 37 ALA A HB2  6  
ATOM 3404 H HB3  . ALA A 1 37 ? 3.508   -9.554  5.463  1.00 0.00 ? 37 ALA A HB3  6  
ATOM 3405 N N    . SER A 1 38 ? 3.855   -8.666  2.102  1.00 0.00 ? 38 SER A N    6  
ATOM 3406 C CA   . SER A 1 38 ? 2.977   -7.783  1.343  1.00 0.00 ? 38 SER A CA   6  
ATOM 3407 C C    . SER A 1 38 ? 1.620   -7.647  2.028  1.00 0.00 ? 38 SER A C    6  
ATOM 3408 O O    . SER A 1 38 ? 0.642   -8.274  1.624  1.00 0.00 ? 38 SER A O    6  
ATOM 3409 C CB   . SER A 1 38 ? 2.791   -8.312  -0.080 1.00 0.00 ? 38 SER A CB   6  
ATOM 3410 O OG   . SER A 1 38 ? 3.993   -8.879  -0.574 1.00 0.00 ? 38 SER A OG   6  
ATOM 3411 H H    . SER A 1 38 ? 4.224   -9.463  1.666  1.00 0.00 ? 38 SER A H    6  
ATOM 3412 H HA   . SER A 1 38 ? 3.444   -6.810  1.299  1.00 0.00 ? 38 SER A HA   6  
ATOM 3413 H HB2  . SER A 1 38 ? 2.022   -9.069  -0.082 1.00 0.00 ? 38 SER A HB2  6  
ATOM 3414 H HB3  . SER A 1 38 ? 2.498   -7.499  -0.728 1.00 0.00 ? 38 SER A HB3  6  
ATOM 3415 H HG   . SER A 1 38 ? 4.727   -8.292  -0.381 1.00 0.00 ? 38 SER A HG   6  
ATOM 3416 N N    . GLY A 1 39 ? 1.570   -6.821  3.070  1.00 0.00 ? 39 GLY A N    6  
ATOM 3417 C CA   . GLY A 1 39 ? 0.330   -6.617  3.795  1.00 0.00 ? 39 GLY A CA   6  
ATOM 3418 C C    . GLY A 1 39 ? 0.536   -5.865  5.095  1.00 0.00 ? 39 GLY A C    6  
ATOM 3419 O O    . GLY A 1 39 ? -0.395  -5.255  5.621  1.00 0.00 ? 39 GLY A O    6  
ATOM 3420 H H    . GLY A 1 39 ? 2.382   -6.348  3.347  1.00 0.00 ? 39 GLY A H    6  
ATOM 3421 H HA2  . GLY A 1 39 ? -0.351  -6.057  3.171  1.00 0.00 ? 39 GLY A HA2  6  
ATOM 3422 H HA3  . GLY A 1 39 ? -0.108  -7.580  4.015  1.00 0.00 ? 39 GLY A HA3  6  
ATOM 3423 N N    . ASP A 1 40 ? 1.757   -5.909  5.615  1.00 0.00 ? 40 ASP A N    6  
ATOM 3424 C CA   . ASP A 1 40 ? 2.083   -5.227  6.862  1.00 0.00 ? 40 ASP A CA   6  
ATOM 3425 C C    . ASP A 1 40 ? 2.531   -3.793  6.597  1.00 0.00 ? 40 ASP A C    6  
ATOM 3426 O O    . ASP A 1 40 ? 3.382   -3.547  5.742  1.00 0.00 ? 40 ASP A O    6  
ATOM 3427 C CB   . ASP A 1 40 ? 3.178   -5.986  7.613  1.00 0.00 ? 40 ASP A CB   6  
ATOM 3428 C CG   . ASP A 1 40 ? 2.615   -6.995  8.594  1.00 0.00 ? 40 ASP A CG   6  
ATOM 3429 O OD1  . ASP A 1 40 ? 3.293   -7.285  9.602  1.00 0.00 ? 40 ASP A OD1  6  
ATOM 3430 O OD2  . ASP A 1 40 ? 1.496   -7.494  8.355  1.00 0.00 ? 40 ASP A OD2  6  
ATOM 3431 H H    . ASP A 1 40 ? 2.458   -6.412  5.148  1.00 0.00 ? 40 ASP A H    6  
ATOM 3432 H HA   . ASP A 1 40 ? 1.191   -5.205  7.471  1.00 0.00 ? 40 ASP A HA   6  
ATOM 3433 H HB2  . ASP A 1 40 ? 3.796   -6.512  6.900  1.00 0.00 ? 40 ASP A HB2  6  
ATOM 3434 H HB3  . ASP A 1 40 ? 3.786   -5.280  8.159  1.00 0.00 ? 40 ASP A HB3  6  
ATOM 3435 N N    . ARG A 1 41 ? 1.951   -2.851  7.334  1.00 0.00 ? 41 ARG A N    6  
ATOM 3436 C CA   . ARG A 1 41 ? 2.289   -1.442  7.176  1.00 0.00 ? 41 ARG A CA   6  
ATOM 3437 C C    . ARG A 1 41 ? 3.367   -1.027  8.172  1.00 0.00 ? 41 ARG A C    6  
ATOM 3438 O O    . ARG A 1 41 ? 3.261   -1.298  9.368  1.00 0.00 ? 41 ARG A O    6  
ATOM 3439 C CB   . ARG A 1 41 ? 1.044   -0.573  7.364  1.00 0.00 ? 41 ARG A CB   6  
ATOM 3440 C CG   . ARG A 1 41 ? -0.106  -1.296  8.045  1.00 0.00 ? 41 ARG A CG   6  
ATOM 3441 C CD   . ARG A 1 41 ? -1.201  -0.329  8.467  1.00 0.00 ? 41 ARG A CD   6  
ATOM 3442 N NE   . ARG A 1 41 ? -2.249  -0.212  7.457  1.00 0.00 ? 41 ARG A NE   6  
ATOM 3443 C CZ   . ARG A 1 41 ? -2.170  0.597   6.407  1.00 0.00 ? 41 ARG A CZ   6  
ATOM 3444 N NH1  . ARG A 1 41 ? -1.098  1.357   6.230  1.00 0.00 ? 41 ARG A NH1  6  
ATOM 3445 N NH2  . ARG A 1 41 ? -3.165  0.647   5.530  1.00 0.00 ? 41 ARG A NH2  6  
ATOM 3446 H H    . ARG A 1 41 ? 1.280   -3.110  7.999  1.00 0.00 ? 41 ARG A H    6  
ATOM 3447 H HA   . ARG A 1 41 ? 2.667   -1.301  6.175  1.00 0.00 ? 41 ARG A HA   6  
ATOM 3448 H HB2  . ARG A 1 41 ? 1.306   0.286   7.965  1.00 0.00 ? 41 ARG A HB2  6  
ATOM 3449 H HB3  . ARG A 1 41 ? 0.706   -0.236  6.396  1.00 0.00 ? 41 ARG A HB3  6  
ATOM 3450 H HG2  . ARG A 1 41 ? -0.524  -2.017  7.357  1.00 0.00 ? 41 ARG A HG2  6  
ATOM 3451 H HG3  . ARG A 1 41 ? 0.269   -1.807  8.919  1.00 0.00 ? 41 ARG A HG3  6  
ATOM 3452 H HD2  . ARG A 1 41 ? -1.640  -0.683  9.388  1.00 0.00 ? 41 ARG A HD2  6  
ATOM 3453 H HD3  . ARG A 1 41 ? -0.760  0.643   8.630  1.00 0.00 ? 41 ARG A HD3  6  
ATOM 3454 H HE   . ARG A 1 41 ? -3.050  -0.765  7.568  1.00 0.00 ? 41 ARG A HE   6  
ATOM 3455 H HH11 . ARG A 1 41 ? -0.346  1.321   6.888  1.00 0.00 ? 41 ARG A HH11 6  
ATOM 3456 H HH12 . ARG A 1 41 ? -1.041  1.965   5.438  1.00 0.00 ? 41 ARG A HH12 6  
ATOM 3457 H HH21 . ARG A 1 41 ? -3.975  0.076   5.660  1.00 0.00 ? 41 ARG A HH21 6  
ATOM 3458 H HH22 . ARG A 1 41 ? -3.105  1.257   4.740  1.00 0.00 ? 41 ARG A HH22 6  
ATOM 3459 N N    . CYS A 1 42 ? 4.406   -0.367  7.671  1.00 0.00 ? 42 CYS A N    6  
ATOM 3460 C CA   . CYS A 1 42 ? 5.505   0.086   8.515  1.00 0.00 ? 42 CYS A CA   6  
ATOM 3461 C C    . CYS A 1 42 ? 5.139   1.379   9.238  1.00 0.00 ? 42 CYS A C    6  
ATOM 3462 O O    . CYS A 1 42 ? 4.643   2.326   8.626  1.00 0.00 ? 42 CYS A O    6  
ATOM 3463 C CB   . CYS A 1 42 ? 6.767   0.297   7.676  1.00 0.00 ? 42 CYS A CB   6  
ATOM 3464 S SG   . CYS A 1 42 ? 7.852   -1.164  7.584  1.00 0.00 ? 42 CYS A SG   6  
ATOM 3465 H H    . CYS A 1 42 ? 4.435   -0.180  6.708  1.00 0.00 ? 42 CYS A H    6  
ATOM 3466 H HA   . CYS A 1 42 ? 5.697   -0.681  9.250  1.00 0.00 ? 42 CYS A HA   6  
ATOM 3467 H HB2  . CYS A 1 42 ? 6.480   0.555   6.667  1.00 0.00 ? 42 CYS A HB2  6  
ATOM 3468 H HB3  . CYS A 1 42 ? 7.341   1.107   8.100  1.00 0.00 ? 42 CYS A HB3  6  
ATOM 3469 N N    . CYS A 1 43 ? 5.388   1.412   10.543 1.00 0.00 ? 43 CYS A N    6  
ATOM 3470 C CA   . CYS A 1 43 ? 5.085   2.587   11.350 1.00 0.00 ? 43 CYS A CA   6  
ATOM 3471 C C    . CYS A 1 43 ? 6.321   3.467   11.514 1.00 0.00 ? 43 CYS A C    6  
ATOM 3472 O O    . CYS A 1 43 ? 7.448   3.018   11.308 1.00 0.00 ? 43 CYS A O    6  
ATOM 3473 C CB   . CYS A 1 43 ? 4.559   2.167   12.724 1.00 0.00 ? 43 CYS A CB   6  
ATOM 3474 S SG   . CYS A 1 43 ? 2.855   1.524   12.702 1.00 0.00 ? 43 CYS A SG   6  
ATOM 3475 H H    . CYS A 1 43 ? 5.784   0.625   10.974 1.00 0.00 ? 43 CYS A H    6  
ATOM 3476 H HA   . CYS A 1 43 ? 4.321   3.153   10.839 1.00 0.00 ? 43 CYS A HA   6  
ATOM 3477 H HB2  . CYS A 1 43 ? 5.197   1.391   13.123 1.00 0.00 ? 43 CYS A HB2  6  
ATOM 3478 H HB3  . CYS A 1 43 ? 4.581   3.020   13.386 1.00 0.00 ? 43 CYS A HB3  6  
ATOM 3479 N N    . CYS A 1 44 ? 6.100   4.724   11.886 1.00 0.00 ? 44 CYS A N    6  
ATOM 3480 C CA   . CYS A 1 44 ? 7.194   5.668   12.078 1.00 0.00 ? 44 CYS A CA   6  
ATOM 3481 C C    . CYS A 1 44 ? 6.987   6.490   13.347 1.00 0.00 ? 44 CYS A C    6  
ATOM 3482 O O    . CYS A 1 44 ? 5.917   7.057   13.564 1.00 0.00 ? 44 CYS A O    6  
ATOM 3483 C CB   . CYS A 1 44 ? 7.311   6.598   10.869 1.00 0.00 ? 44 CYS A CB   6  
ATOM 3484 S SG   . CYS A 1 44 ? 7.598   5.734   9.291  1.00 0.00 ? 44 CYS A SG   6  
ATOM 3485 H H    . CYS A 1 44 ? 5.178   5.024   12.036 1.00 0.00 ? 44 CYS A H    6  
ATOM 3486 H HA   . CYS A 1 44 ? 8.108   5.102   12.176 1.00 0.00 ? 44 CYS A HA   6  
ATOM 3487 H HB2  . CYS A 1 44 ? 6.396   7.164   10.771 1.00 0.00 ? 44 CYS A HB2  6  
ATOM 3488 H HB3  . CYS A 1 44 ? 8.134   7.279   11.026 1.00 0.00 ? 44 CYS A HB3  6  
ATOM 3489 N N    . ALA A 1 45 ? 8.019   6.548   14.182 1.00 0.00 ? 45 ALA A N    6  
ATOM 3490 C CA   . ALA A 1 45 ? 7.952   7.302   15.428 1.00 0.00 ? 45 ALA A CA   6  
ATOM 3491 C C    . ALA A 1 45 ? 8.150   8.793   15.180 1.00 0.00 ? 45 ALA A C    6  
ATOM 3492 O O    . ALA A 1 45 ? 8.018   9.608   16.094 1.00 0.00 ? 45 ALA A O    6  
ATOM 3493 C CB   . ALA A 1 45 ? 8.991   6.787   16.413 1.00 0.00 ? 45 ALA A CB   6  
ATOM 3494 H H    . ALA A 1 45 ? 8.846   6.075   13.954 1.00 0.00 ? 45 ALA A H    6  
ATOM 3495 H HA   . ALA A 1 45 ? 6.974   7.146   15.860 1.00 0.00 ? 45 ALA A HA   6  
ATOM 3496 H HB1  . ALA A 1 45 ? 9.245   5.766   16.166 1.00 0.00 ? 45 ALA A HB1  6  
ATOM 3497 H HB2  . ALA A 1 45 ? 9.876   7.402   16.357 1.00 0.00 ? 45 ALA A HB2  6  
ATOM 3498 H HB3  . ALA A 1 45 ? 8.588   6.825   17.414 1.00 0.00 ? 45 ALA A HB3  6  
ATOM 3499 N N    . CYS A 1 1  ? 1.287   0.047   -0.126 1.00 0.00 ? 1  CYS A N    7  
ATOM 3500 C CA   . CYS A 1 1  ? 2.105   0.040   -1.332 1.00 0.00 ? 1  CYS A CA   7  
ATOM 3501 C C    . CYS A 1 1  ? 2.729   -1.334  -1.560 1.00 0.00 ? 1  CYS A C    7  
ATOM 3502 O O    . CYS A 1 1  ? 2.872   -2.124  -0.626 1.00 0.00 ? 1  CYS A O    7  
ATOM 3503 C CB   . CYS A 1 1  ? 3.203   1.102   -1.235 1.00 0.00 ? 1  CYS A CB   7  
ATOM 3504 S SG   . CYS A 1 1  ? 3.981   1.218   0.408  1.00 0.00 ? 1  CYS A SG   7  
ATOM 3505 H H    . CYS A 1 1  ? 1.720   0.179   0.744  1.00 0.00 ? 1  CYS A H    7  
ATOM 3506 H HA   . CYS A 1 1  ? 1.464   0.274   -2.169 1.00 0.00 ? 1  CYS A HA   7  
ATOM 3507 H HB2  . CYS A 1 1  ? 3.979   0.871   -1.950 1.00 0.00 ? 1  CYS A HB2  7  
ATOM 3508 H HB3  . CYS A 1 1  ? 2.781   2.068   -1.469 1.00 0.00 ? 1  CYS A HB3  7  
ATOM 3509 N N    . TYR A 1 2  ? 3.098   -1.611  -2.805 1.00 0.00 ? 2  TYR A N    7  
ATOM 3510 C CA   . TYR A 1 2  ? 3.704   -2.889  -3.156 1.00 0.00 ? 2  TYR A CA   7  
ATOM 3511 C C    . TYR A 1 2  ? 5.209   -2.866  -2.904 1.00 0.00 ? 2  TYR A C    7  
ATOM 3512 O O    . TYR A 1 2  ? 5.848   -1.814  -2.904 1.00 0.00 ? 2  TYR A O    7  
ATOM 3513 C CB   . TYR A 1 2  ? 3.427   -3.224  -4.622 1.00 0.00 ? 2  TYR A CB   7  
ATOM 3514 C CG   . TYR A 1 2  ? 2.712   -4.542  -4.818 1.00 0.00 ? 2  TYR A CG   7  
ATOM 3515 C CD1  . TYR A 1 2  ? 1.613   -4.881  -4.037 1.00 0.00 ? 2  TYR A CD1  7  
ATOM 3516 C CD2  . TYR A 1 2  ? 3.135   -5.448  -5.783 1.00 0.00 ? 2  TYR A CD2  7  
ATOM 3517 C CE1  . TYR A 1 2  ? 0.957   -6.084  -4.212 1.00 0.00 ? 2  TYR A CE1  7  
ATOM 3518 C CE2  . TYR A 1 2  ? 2.483   -6.652  -5.965 1.00 0.00 ? 2  TYR A CE2  7  
ATOM 3519 C CZ   . TYR A 1 2  ? 1.395   -6.966  -5.177 1.00 0.00 ? 2  TYR A CZ   7  
ATOM 3520 O OH   . TYR A 1 2  ? 0.745   -8.165  -5.355 1.00 0.00 ? 2  TYR A OH   7  
ATOM 3521 H H    . TYR A 1 2  ? 2.958   -0.940  -3.506 1.00 0.00 ? 2  TYR A H    7  
ATOM 3522 H HA   . TYR A 1 2  ? 3.258   -3.650  -2.533 1.00 0.00 ? 2  TYR A HA   7  
ATOM 3523 H HB2  . TYR A 1 2  ? 2.814   -2.447  -5.052 1.00 0.00 ? 2  TYR A HB2  7  
ATOM 3524 H HB3  . TYR A 1 2  ? 4.365   -3.273  -5.157 1.00 0.00 ? 2  TYR A HB3  7  
ATOM 3525 H HD1  . TYR A 1 2  ? 1.272   -4.188  -3.282 1.00 0.00 ? 2  TYR A HD1  7  
ATOM 3526 H HD2  . TYR A 1 2  ? 3.988   -5.199  -6.398 1.00 0.00 ? 2  TYR A HD2  7  
ATOM 3527 H HE1  . TYR A 1 2  ? 0.105   -6.330  -3.596 1.00 0.00 ? 2  TYR A HE1  7  
ATOM 3528 H HE2  . TYR A 1 2  ? 2.827   -7.344  -6.721 1.00 0.00 ? 2  TYR A HE2  7  
ATOM 3529 H HH   . TYR A 1 2  ? 0.008   -8.224  -4.742 1.00 0.00 ? 2  TYR A HH   7  
ATOM 3530 N N    . PRO A 1 3  ? 5.789   -4.055  -2.683 1.00 0.00 ? 3  PRO A N    7  
ATOM 3531 C CA   . PRO A 1 3  ? 7.225   -4.200  -2.426 1.00 0.00 ? 3  PRO A CA   7  
ATOM 3532 C C    . PRO A 1 3  ? 8.068   -3.908  -3.663 1.00 0.00 ? 3  PRO A C    7  
ATOM 3533 O O    . PRO A 1 3  ? 8.500   -4.824  -4.361 1.00 0.00 ? 3  PRO A O    7  
ATOM 3534 C CB   . PRO A 1 3  ? 7.366   -5.668  -2.016 1.00 0.00 ? 3  PRO A CB   7  
ATOM 3535 C CG   . PRO A 1 3  ? 6.208   -6.353  -2.657 1.00 0.00 ? 3  PRO A CG   7  
ATOM 3536 C CD   . PRO A 1 3  ? 5.088   -5.350  -2.667 1.00 0.00 ? 3  PRO A CD   7  
ATOM 3537 H HA   . PRO A 1 3  ? 7.549   -3.565  -1.613 1.00 0.00 ? 3  PRO A HA   7  
ATOM 3538 H HB2  . PRO A 1 3  ? 8.307   -6.057  -2.380 1.00 0.00 ? 3  PRO A HB2  7  
ATOM 3539 H HB3  . PRO A 1 3  ? 7.327   -5.751  -0.940 1.00 0.00 ? 3  PRO A HB3  7  
ATOM 3540 H HG2  . PRO A 1 3  ? 6.464   -6.640  -3.666 1.00 0.00 ? 3  PRO A HG2  7  
ATOM 3541 H HG3  . PRO A 1 3  ? 5.929   -7.220  -2.078 1.00 0.00 ? 3  PRO A HG3  7  
ATOM 3542 H HD2  . PRO A 1 3  ? 4.482   -5.471  -3.553 1.00 0.00 ? 3  PRO A HD2  7  
ATOM 3543 H HD3  . PRO A 1 3  ? 4.484   -5.450  -1.777 1.00 0.00 ? 3  PRO A HD3  7  
ATOM 3544 N N    . GLY A 1 4  ? 8.298   -2.626  -3.928 1.00 0.00 ? 4  GLY A N    7  
ATOM 3545 C CA   . GLY A 1 4  ? 9.089   -2.237  -5.081 1.00 0.00 ? 4  GLY A CA   7  
ATOM 3546 C C    . GLY A 1 4  ? 8.411   -1.167  -5.914 1.00 0.00 ? 4  GLY A C    7  
ATOM 3547 O O    . GLY A 1 4  ? 8.822   -0.900  -7.043 1.00 0.00 ? 4  GLY A O    7  
ATOM 3548 H H    . GLY A 1 4  ? 7.928   -1.938  -3.336 1.00 0.00 ? 4  GLY A H    7  
ATOM 3549 H HA2  . GLY A 1 4  ? 10.043  -1.864  -4.740 1.00 0.00 ? 4  GLY A HA2  7  
ATOM 3550 H HA3  . GLY A 1 4  ? 9.254   -3.108  -5.699 1.00 0.00 ? 4  GLY A HA3  7  
ATOM 3551 N N    . GLN A 1 5  ? 7.371   -0.556  -5.357 1.00 0.00 ? 5  GLN A N    7  
ATOM 3552 C CA   . GLN A 1 5  ? 6.634   0.489   -6.059 1.00 0.00 ? 5  GLN A CA   7  
ATOM 3553 C C    . GLN A 1 5  ? 7.420   1.796   -6.068 1.00 0.00 ? 5  GLN A C    7  
ATOM 3554 O O    . GLN A 1 5  ? 8.273   2.042   -5.215 1.00 0.00 ? 5  GLN A O    7  
ATOM 3555 C CB   . GLN A 1 5  ? 5.268   0.705   -5.405 1.00 0.00 ? 5  GLN A CB   7  
ATOM 3556 C CG   . GLN A 1 5  ? 4.354   -0.506  -5.490 1.00 0.00 ? 5  GLN A CG   7  
ATOM 3557 C CD   . GLN A 1 5  ? 2.891   -0.126  -5.602 1.00 0.00 ? 5  GLN A CD   7  
ATOM 3558 O OE1  . GLN A 1 5  ? 2.308   0.426   -4.669 1.00 0.00 ? 5  GLN A OE1  7  
ATOM 3559 N NE2  . GLN A 1 5  ? 2.288   -0.421  -6.748 1.00 0.00 ? 5  GLN A NE2  7  
ATOM 3560 H H    . GLN A 1 5  ? 7.092   -0.814  -4.455 1.00 0.00 ? 5  GLN A H    7  
ATOM 3561 H HA   . GLN A 1 5  ? 6.488   0.164   -7.078 1.00 0.00 ? 5  GLN A HA   7  
ATOM 3562 H HB2  . GLN A 1 5  ? 5.415   0.947   -4.363 1.00 0.00 ? 5  GLN A HB2  7  
ATOM 3563 H HB3  . GLN A 1 5  ? 4.777   1.535   -5.893 1.00 0.00 ? 5  GLN A HB3  7  
ATOM 3564 H HG2  . GLN A 1 5  ? 4.627   -1.086  -6.360 1.00 0.00 ? 5  GLN A HG2  7  
ATOM 3565 H HG3  . GLN A 1 5  ? 4.489   -1.105  -4.602 1.00 0.00 ? 5  GLN A HG3  7  
ATOM 3566 H HE21 . GLN A 1 5  ? 2.815   -0.863  -7.447 1.00 0.00 ? 5  GLN A HE21 7  
ATOM 3567 H HE22 . GLN A 1 5  ? 1.343   -0.188  -6.847 1.00 0.00 ? 5  GLN A HE22 7  
ATOM 3568 N N    . PRO A 1 6  ? 7.127   2.656   -7.055 1.00 0.00 ? 6  PRO A N    7  
ATOM 3569 C CA   . PRO A 1 6  ? 7.795   3.953   -7.198 1.00 0.00 ? 6  PRO A CA   7  
ATOM 3570 C C    . PRO A 1 6  ? 7.404   4.932   -6.097 1.00 0.00 ? 6  PRO A C    7  
ATOM 3571 O O    . PRO A 1 6  ? 6.434   5.677   -6.230 1.00 0.00 ? 6  PRO A O    7  
ATOM 3572 C CB   . PRO A 1 6  ? 7.305   4.456   -8.559 1.00 0.00 ? 6  PRO A CB   7  
ATOM 3573 C CG   . PRO A 1 6  ? 5.996   3.774   -8.765 1.00 0.00 ? 6  PRO A CG   7  
ATOM 3574 C CD   . PRO A 1 6  ? 6.121   2.429   -8.105 1.00 0.00 ? 6  PRO A CD   7  
ATOM 3575 H HA   . PRO A 1 6  ? 8.869   3.846   -7.218 1.00 0.00 ? 6  PRO A HA   7  
ATOM 3576 H HB2  . PRO A 1 6  ? 7.191   5.530   -8.529 1.00 0.00 ? 6  PRO A HB2  7  
ATOM 3577 H HB3  . PRO A 1 6  ? 8.015   4.184   -9.324 1.00 0.00 ? 6  PRO A HB3  7  
ATOM 3578 H HG2  . PRO A 1 6  ? 5.207   4.347   -8.302 1.00 0.00 ? 6  PRO A HG2  7  
ATOM 3579 H HG3  . PRO A 1 6  ? 5.806   3.657   -9.821 1.00 0.00 ? 6  PRO A HG3  7  
ATOM 3580 H HD2  . PRO A 1 6  ? 5.176   2.130   -7.676 1.00 0.00 ? 6  PRO A HD2  7  
ATOM 3581 H HD3  . PRO A 1 6  ? 6.465   1.691   -8.815 1.00 0.00 ? 6  PRO A HD3  7  
ATOM 3582 N N    . GLY A 1 7  ? 8.166   4.925   -5.007 1.00 0.00 ? 7  GLY A N    7  
ATOM 3583 C CA   . GLY A 1 7  ? 7.883   5.817   -3.898 1.00 0.00 ? 7  GLY A CA   7  
ATOM 3584 C C    . GLY A 1 7  ? 7.907   5.105   -2.560 1.00 0.00 ? 7  GLY A C    7  
ATOM 3585 O O    . GLY A 1 7  ? 8.203   5.712   -1.530 1.00 0.00 ? 7  GLY A O    7  
ATOM 3586 H H    . GLY A 1 7  ? 8.927   4.310   -4.956 1.00 0.00 ? 7  GLY A H    7  
ATOM 3587 H HA2  . GLY A 1 7  ? 8.620   6.606   -3.888 1.00 0.00 ? 7  GLY A HA2  7  
ATOM 3588 H HA3  . GLY A 1 7  ? 6.906   6.254   -4.043 1.00 0.00 ? 7  GLY A HA3  7  
ATOM 3589 N N    . CYS A 1 8  ? 7.593   3.814   -2.574 1.00 0.00 ? 8  CYS A N    7  
ATOM 3590 C CA   . CYS A 1 8  ? 7.578   3.017   -1.353 1.00 0.00 ? 8  CYS A CA   7  
ATOM 3591 C C    . CYS A 1 8  ? 8.899   2.277   -1.169 1.00 0.00 ? 8  CYS A C    7  
ATOM 3592 O O    . CYS A 1 8  ? 9.740   2.254   -2.067 1.00 0.00 ? 8  CYS A O    7  
ATOM 3593 C CB   . CYS A 1 8  ? 6.420   2.017   -1.386 1.00 0.00 ? 8  CYS A CB   7  
ATOM 3594 S SG   . CYS A 1 8  ? 5.929   1.393   0.254  1.00 0.00 ? 8  CYS A SG   7  
ATOM 3595 H H    . CYS A 1 8  ? 7.367   3.385   -3.427 1.00 0.00 ? 8  CYS A H    7  
ATOM 3596 H HA   . CYS A 1 8  ? 7.437   3.689   -0.520 1.00 0.00 ? 8  CYS A HA   7  
ATOM 3597 H HB2  . CYS A 1 8  ? 5.557   2.493   -1.828 1.00 0.00 ? 8  CYS A HB2  7  
ATOM 3598 H HB3  . CYS A 1 8  ? 6.705   1.168   -1.990 1.00 0.00 ? 8  CYS A HB3  7  
ATOM 3599 N N    . GLY A 1 9  ? 9.074   1.671   0.001  1.00 0.00 ? 9  GLY A N    7  
ATOM 3600 C CA   . GLY A 1 9  ? 10.295  0.937   0.282  1.00 0.00 ? 9  GLY A CA   7  
ATOM 3601 C C    . GLY A 1 9  ? 10.339  0.407   1.701  1.00 0.00 ? 9  GLY A C    7  
ATOM 3602 O O    . GLY A 1 9  ? 9.399   0.598   2.473  1.00 0.00 ? 9  GLY A O    7  
ATOM 3603 H H    . GLY A 1 9  ? 8.369   1.723   0.680  1.00 0.00 ? 9  GLY A H    7  
ATOM 3604 H HA2  . GLY A 1 9  ? 10.368  0.107   -0.405 1.00 0.00 ? 9  GLY A HA2  7  
ATOM 3605 H HA3  . GLY A 1 9  ? 11.139  1.594   0.128  1.00 0.00 ? 9  GLY A HA3  7  
ATOM 3606 N N    . HIS A 1 10 ? 11.434  -0.263  2.047  1.00 0.00 ? 10 HIS A N    7  
ATOM 3607 C CA   . HIS A 1 10 ? 11.597  -0.824  3.383  1.00 0.00 ? 10 HIS A CA   7  
ATOM 3608 C C    . HIS A 1 10 ? 11.733  0.283   4.424  1.00 0.00 ? 10 HIS A C    7  
ATOM 3609 O O    . HIS A 1 10 ? 12.632  1.120   4.343  1.00 0.00 ? 10 HIS A O    7  
ATOM 3610 C CB   . HIS A 1 10 ? 12.823  -1.737  3.430  1.00 0.00 ? 10 HIS A CB   7  
ATOM 3611 C CG   . HIS A 1 10 ? 14.114  -0.998  3.606  1.00 0.00 ? 10 HIS A CG   7  
ATOM 3612 N ND1  . HIS A 1 10 ? 15.053  -1.340  4.555  1.00 0.00 ? 10 HIS A ND1  7  
ATOM 3613 C CD2  . HIS A 1 10 ? 14.620  0.070   2.945  1.00 0.00 ? 10 HIS A CD2  7  
ATOM 3614 C CE1  . HIS A 1 10 ? 16.081  -0.513  4.472  1.00 0.00 ? 10 HIS A CE1  7  
ATOM 3615 N NE2  . HIS A 1 10 ? 15.843  0.351   3.503  1.00 0.00 ? 10 HIS A NE2  7  
ATOM 3616 H H    . HIS A 1 10 ? 12.149  -0.382  1.388  1.00 0.00 ? 10 HIS A H    7  
ATOM 3617 H HA   . HIS A 1 10 ? 10.717  -1.406  3.608  1.00 0.00 ? 10 HIS A HA   7  
ATOM 3618 H HB2  . HIS A 1 10 ? 12.720  -2.425  4.256  1.00 0.00 ? 10 HIS A HB2  7  
ATOM 3619 H HB3  . HIS A 1 10 ? 12.883  -2.296  2.507  1.00 0.00 ? 10 HIS A HB3  7  
ATOM 3620 H HD1  . HIS A 1 10 ? 14.978  -2.077  5.195  1.00 0.00 ? 10 HIS A HD1  7  
ATOM 3621 H HD2  . HIS A 1 10 ? 14.149  0.603   2.131  1.00 0.00 ? 10 HIS A HD2  7  
ATOM 3622 H HE1  . HIS A 1 10 ? 16.965  -0.540  5.091  1.00 0.00 ? 10 HIS A HE1  7  
ATOM 3623 N N    . CYS A 1 11 ? 10.833  0.282   5.402  1.00 0.00 ? 11 CYS A N    7  
ATOM 3624 C CA   . CYS A 1 11 ? 10.850  1.286   6.459  1.00 0.00 ? 11 CYS A CA   7  
ATOM 3625 C C    . CYS A 1 11 ? 12.120  1.171   7.297  1.00 0.00 ? 11 CYS A C    7  
ATOM 3626 O O    . CYS A 1 11 ? 12.819  0.159   7.249  1.00 0.00 ? 11 CYS A O    7  
ATOM 3627 C CB   . CYS A 1 11 ? 9.620   1.135   7.355  1.00 0.00 ? 11 CYS A CB   7  
ATOM 3628 S SG   . CYS A 1 11 ? 9.480   -0.494  8.158  1.00 0.00 ? 11 CYS A SG   7  
ATOM 3629 H H    . CYS A 1 11 ? 10.139  -0.412  5.414  1.00 0.00 ? 11 CYS A H    7  
ATOM 3630 H HA   . CYS A 1 11 ? 10.828  2.259   5.993  1.00 0.00 ? 11 CYS A HA   7  
ATOM 3631 H HB2  . CYS A 1 11 ? 9.657   1.882   8.134  1.00 0.00 ? 11 CYS A HB2  7  
ATOM 3632 H HB3  . CYS A 1 11 ? 8.731   1.287   6.761  1.00 0.00 ? 11 CYS A HB3  7  
ATOM 3633 N N    . SER A 1 12 ? 12.412  2.216   8.065  1.00 0.00 ? 12 SER A N    7  
ATOM 3634 C CA   . SER A 1 12 ? 13.599  2.235   8.912  1.00 0.00 ? 12 SER A CA   7  
ATOM 3635 C C    . SER A 1 12 ? 13.387  3.135   10.125 1.00 0.00 ? 12 SER A C    7  
ATOM 3636 O O    . SER A 1 12 ? 12.679  4.140   10.050 1.00 0.00 ? 12 SER A O    7  
ATOM 3637 C CB   . SER A 1 12 ? 14.813  2.714   8.113  1.00 0.00 ? 12 SER A CB   7  
ATOM 3638 O OG   . SER A 1 12 ? 14.650  4.057   7.693  1.00 0.00 ? 12 SER A OG   7  
ATOM 3639 H H    . SER A 1 12 ? 11.816  2.994   8.060  1.00 0.00 ? 12 SER A H    7  
ATOM 3640 H HA   . SER A 1 12 ? 13.779  1.227   9.254  1.00 0.00 ? 12 SER A HA   7  
ATOM 3641 H HB2  . SER A 1 12 ? 15.696  2.647   8.731  1.00 0.00 ? 12 SER A HB2  7  
ATOM 3642 H HB3  . SER A 1 12 ? 14.936  2.088   7.241  1.00 0.00 ? 12 SER A HB3  7  
ATOM 3643 H HG   . SER A 1 12 ? 15.066  4.644   8.329  1.00 0.00 ? 12 SER A HG   7  
ATOM 3644 N N    . ARG A 1 13 ? 14.006  2.768   11.242 1.00 0.00 ? 13 ARG A N    7  
ATOM 3645 C CA   . ARG A 1 13 ? 13.885  3.541   12.473 1.00 0.00 ? 13 ARG A CA   7  
ATOM 3646 C C    . ARG A 1 13 ? 13.911  5.038   12.179 1.00 0.00 ? 13 ARG A C    7  
ATOM 3647 O O    . ARG A 1 13 ? 14.593  5.505   11.267 1.00 0.00 ? 13 ARG A O    7  
ATOM 3648 C CB   . ARG A 1 13 ? 15.015  3.180   13.440 1.00 0.00 ? 13 ARG A CB   7  
ATOM 3649 C CG   . ARG A 1 13 ? 14.867  1.801   14.061 1.00 0.00 ? 13 ARG A CG   7  
ATOM 3650 C CD   . ARG A 1 13 ? 13.714  1.757   15.052 1.00 0.00 ? 13 ARG A CD   7  
ATOM 3651 N NE   . ARG A 1 13 ? 14.037  0.961   16.233 1.00 0.00 ? 13 ARG A NE   7  
ATOM 3652 C CZ   . ARG A 1 13 ? 14.031  -0.368  16.248 1.00 0.00 ? 13 ARG A CZ   7  
ATOM 3653 N NH1  . ARG A 1 13 ? 13.720  -1.045  15.151 1.00 0.00 ? 13 ARG A NH1  7  
ATOM 3654 N NH2  . ARG A 1 13 ? 14.337  -1.021  17.361 1.00 0.00 ? 13 ARG A NH2  7  
ATOM 3655 H H    . ARG A 1 13 ? 14.557  1.957   11.239 1.00 0.00 ? 13 ARG A H    7  
ATOM 3656 H HA   . ARG A 1 13 ? 12.939  3.291   12.929 1.00 0.00 ? 13 ARG A HA   7  
ATOM 3657 H HB2  . ARG A 1 13 ? 15.953  3.212   12.906 1.00 0.00 ? 13 ARG A HB2  7  
ATOM 3658 H HB3  . ARG A 1 13 ? 15.037  3.910   14.235 1.00 0.00 ? 13 ARG A HB3  7  
ATOM 3659 H HG2  . ARG A 1 13 ? 14.682  1.081   13.278 1.00 0.00 ? 13 ARG A HG2  7  
ATOM 3660 H HG3  . ARG A 1 13 ? 15.783  1.549   14.576 1.00 0.00 ? 13 ARG A HG3  7  
ATOM 3661 H HD2  . ARG A 1 13 ? 13.484  2.765   15.361 1.00 0.00 ? 13 ARG A HD2  7  
ATOM 3662 H HD3  . ARG A 1 13 ? 12.854  1.326   14.562 1.00 0.00 ? 13 ARG A HD3  7  
ATOM 3663 H HE   . ARG A 1 13 ? 14.270  1.441   17.054 1.00 0.00 ? 13 ARG A HE   7  
ATOM 3664 H HH11 . ARG A 1 13 ? 13.490  -0.555  14.310 1.00 0.00 ? 13 ARG A HH11 7  
ATOM 3665 H HH12 . ARG A 1 13 ? 13.717  -2.045  15.165 1.00 0.00 ? 13 ARG A HH12 7  
ATOM 3666 H HH21 . ARG A 1 13 ? 14.572  -0.514  18.190 1.00 0.00 ? 13 ARG A HH21 7  
ATOM 3667 H HH22 . ARG A 1 13 ? 14.331  -2.020  17.372 1.00 0.00 ? 13 ARG A HH22 7  
ATOM 3668 N N    . PRO A 1 14 ? 13.149  5.809   12.969 1.00 0.00 ? 14 PRO A N    7  
ATOM 3669 C CA   . PRO A 1 14 ? 12.333  5.264   14.058 1.00 0.00 ? 14 PRO A CA   7  
ATOM 3670 C C    . PRO A 1 14 ? 11.149  4.452   13.543 1.00 0.00 ? 14 PRO A C    7  
ATOM 3671 O O    . PRO A 1 14 ? 10.228  4.135   14.295 1.00 0.00 ? 14 PRO A O    7  
ATOM 3672 C CB   . PRO A 1 14 ? 11.844  6.514   14.794 1.00 0.00 ? 14 PRO A CB   7  
ATOM 3673 C CG   . PRO A 1 14 ? 11.872  7.594   13.769 1.00 0.00 ? 14 PRO A CG   7  
ATOM 3674 C CD   . PRO A 1 14 ? 13.027  7.273   12.860 1.00 0.00 ? 14 PRO A CD   7  
ATOM 3675 H HA   . PRO A 1 14 ? 12.921  4.655   14.728 1.00 0.00 ? 14 PRO A HA   7  
ATOM 3676 H HB2  . PRO A 1 14 ? 10.843  6.347   15.167 1.00 0.00 ? 14 PRO A HB2  7  
ATOM 3677 H HB3  . PRO A 1 14 ? 12.508  6.734   15.617 1.00 0.00 ? 14 PRO A HB3  7  
ATOM 3678 H HG2  . PRO A 1 14 ? 10.947  7.596   13.213 1.00 0.00 ? 14 PRO A HG2  7  
ATOM 3679 H HG3  . PRO A 1 14 ? 12.027  8.550   14.247 1.00 0.00 ? 14 PRO A HG3  7  
ATOM 3680 H HD2  . PRO A 1 14 ? 12.802  7.566   11.846 1.00 0.00 ? 14 PRO A HD2  7  
ATOM 3681 H HD3  . PRO A 1 14 ? 13.926  7.761   13.206 1.00 0.00 ? 14 PRO A HD3  7  
ATOM 3682 N N    . ASN A 1 15 ? 11.180  4.119   12.257 1.00 0.00 ? 15 ASN A N    7  
ATOM 3683 C CA   . ASN A 1 15 ? 10.108  3.343   11.643 1.00 0.00 ? 15 ASN A CA   7  
ATOM 3684 C C    . ASN A 1 15 ? 10.320  1.849   11.867 1.00 0.00 ? 15 ASN A C    7  
ATOM 3685 O O    . ASN A 1 15 ? 11.454  1.368   11.884 1.00 0.00 ? 15 ASN A O    7  
ATOM 3686 C CB   . ASN A 1 15 ? 10.031  3.640   10.143 1.00 0.00 ? 15 ASN A CB   7  
ATOM 3687 C CG   . ASN A 1 15 ? 10.339  5.090   9.824  1.00 0.00 ? 15 ASN A CG   7  
ATOM 3688 O OD1  . ASN A 1 15 ? 10.125  5.978   10.649 1.00 0.00 ? 15 ASN A OD1  7  
ATOM 3689 N ND2  . ASN A 1 15 ? 10.845  5.336   8.621  1.00 0.00 ? 15 ASN A ND2  7  
ATOM 3690 H H    . ASN A 1 15 ? 11.941  4.401   11.708 1.00 0.00 ? 15 ASN A H    7  
ATOM 3691 H HA   . ASN A 1 15 ? 9.179   3.637   12.107 1.00 0.00 ? 15 ASN A HA   7  
ATOM 3692 H HB2  . ASN A 1 15 ? 10.744  3.017   9.623  1.00 0.00 ? 15 ASN A HB2  7  
ATOM 3693 H HB3  . ASN A 1 15 ? 9.037   3.415   9.788  1.00 0.00 ? 15 ASN A HB3  7  
ATOM 3694 H HD21 . ASN A 1 15 ? 10.988  4.579   8.015  1.00 0.00 ? 15 ASN A HD21 7  
ATOM 3695 H HD22 . ASN A 1 15 ? 11.054  6.264   8.388  1.00 0.00 ? 15 ASN A HD22 7  
ATOM 3696 N N    . TYR A 1 16 ? 9.223   1.121   12.038 1.00 0.00 ? 16 TYR A N    7  
ATOM 3697 C CA   . TYR A 1 16 ? 9.288   -0.318  12.263 1.00 0.00 ? 16 TYR A CA   7  
ATOM 3698 C C    . TYR A 1 16 ? 8.130   -1.031  11.572 1.00 0.00 ? 16 TYR A C    7  
ATOM 3699 O O    . TYR A 1 16 ? 7.347   -0.413  10.850 1.00 0.00 ? 16 TYR A O    7  
ATOM 3700 C CB   . TYR A 1 16 ? 9.268   -0.623  13.762 1.00 0.00 ? 16 TYR A CB   7  
ATOM 3701 C CG   . TYR A 1 16 ? 7.928   -0.366  14.414 1.00 0.00 ? 16 TYR A CG   7  
ATOM 3702 C CD1  . TYR A 1 16 ? 7.504   0.928   14.689 1.00 0.00 ? 16 TYR A CD1  7  
ATOM 3703 C CD2  . TYR A 1 16 ? 7.087   -1.418  14.756 1.00 0.00 ? 16 TYR A CD2  7  
ATOM 3704 C CE1  . TYR A 1 16 ? 6.281   1.167   15.285 1.00 0.00 ? 16 TYR A CE1  7  
ATOM 3705 C CE2  . TYR A 1 16 ? 5.861   -1.188  15.350 1.00 0.00 ? 16 TYR A CE2  7  
ATOM 3706 C CZ   . TYR A 1 16 ? 5.463   0.106   15.613 1.00 0.00 ? 16 TYR A CZ   7  
ATOM 3707 O OH   . TYR A 1 16 ? 4.244   0.340   16.207 1.00 0.00 ? 16 TYR A OH   7  
ATOM 3708 H H    . TYR A 1 16 ? 8.348   1.561   12.014 1.00 0.00 ? 16 TYR A H    7  
ATOM 3709 H HA   . TYR A 1 16 ? 10.218  -0.677  11.846 1.00 0.00 ? 16 TYR A HA   7  
ATOM 3710 H HB2  . TYR A 1 16 ? 9.517   -1.661  13.915 1.00 0.00 ? 16 TYR A HB2  7  
ATOM 3711 H HB3  . TYR A 1 16 ? 10.002  -0.005  14.258 1.00 0.00 ? 16 TYR A HB3  7  
ATOM 3712 H HD1  . TYR A 1 16 ? 8.146   1.757   14.430 1.00 0.00 ? 16 TYR A HD1  7  
ATOM 3713 H HD2  . TYR A 1 16 ? 7.402   -2.430  14.549 1.00 0.00 ? 16 TYR A HD2  7  
ATOM 3714 H HE1  . TYR A 1 16 ? 5.968   2.181   15.491 1.00 0.00 ? 16 TYR A HE1  7  
ATOM 3715 H HE2  . TYR A 1 16 ? 5.221   -2.018  15.608 1.00 0.00 ? 16 TYR A HE2  7  
ATOM 3716 H HH   . TYR A 1 16 ? 4.000   -0.417  16.746 1.00 0.00 ? 16 TYR A HH   7  
ATOM 3717 N N    . CYS A 1 17 ? 8.026   -2.336  11.800 1.00 0.00 ? 17 CYS A N    7  
ATOM 3718 C CA   . CYS A 1 17 ? 6.964   -3.135  11.201 1.00 0.00 ? 17 CYS A CA   7  
ATOM 3719 C C    . CYS A 1 17 ? 5.744   -3.192  12.116 1.00 0.00 ? 17 CYS A C    7  
ATOM 3720 O O    . CYS A 1 17 ? 5.873   -3.367  13.327 1.00 0.00 ? 17 CYS A O    7  
ATOM 3721 C CB   . CYS A 1 17 ? 7.465   -4.552  10.912 1.00 0.00 ? 17 CYS A CB   7  
ATOM 3722 S SG   . CYS A 1 17 ? 8.040   -4.803  9.202  1.00 0.00 ? 17 CYS A SG   7  
ATOM 3723 H H    . CYS A 1 17 ? 8.681   -2.773  12.386 1.00 0.00 ? 17 CYS A H    7  
ATOM 3724 H HA   . CYS A 1 17 ? 6.680   -2.667  10.271 1.00 0.00 ? 17 CYS A HA   7  
ATOM 3725 H HB2  . CYS A 1 17 ? 8.291   -4.775  11.572 1.00 0.00 ? 17 CYS A HB2  7  
ATOM 3726 H HB3  . CYS A 1 17 ? 6.665   -5.253  11.097 1.00 0.00 ? 17 CYS A HB3  7  
ATOM 3727 N N    . GLU A 1 18 ? 4.562   -3.043  11.527 1.00 0.00 ? 18 GLU A N    7  
ATOM 3728 C CA   . GLU A 1 18 ? 3.320   -3.077  12.289 1.00 0.00 ? 18 GLU A CA   7  
ATOM 3729 C C    . GLU A 1 18 ? 2.191   -3.686  11.462 1.00 0.00 ? 18 GLU A C    7  
ATOM 3730 O O    . GLU A 1 18 ? 1.776   -3.124  10.449 1.00 0.00 ? 18 GLU A O    7  
ATOM 3731 C CB   . GLU A 1 18 ? 2.933   -1.666  12.740 1.00 0.00 ? 18 GLU A CB   7  
ATOM 3732 C CG   . GLU A 1 18 ? 1.949   -1.646  13.897 1.00 0.00 ? 18 GLU A CG   7  
ATOM 3733 C CD   . GLU A 1 18 ? 2.089   -2.853  14.804 1.00 0.00 ? 18 GLU A CD   7  
ATOM 3734 O OE1  . GLU A 1 18 ? 2.783   -2.742  15.836 1.00 0.00 ? 18 GLU A OE1  7  
ATOM 3735 O OE2  . GLU A 1 18 ? 1.505   -3.909  14.481 1.00 0.00 ? 18 GLU A OE2  7  
ATOM 3736 H H    . GLU A 1 18 ? 4.525   -2.907  10.557 1.00 0.00 ? 18 GLU A H    7  
ATOM 3737 H HA   . GLU A 1 18 ? 3.482   -3.691  13.161 1.00 0.00 ? 18 GLU A HA   7  
ATOM 3738 H HB2  . GLU A 1 18 ? 3.827   -1.141  13.043 1.00 0.00 ? 18 GLU A HB2  7  
ATOM 3739 H HB3  . GLU A 1 18 ? 2.486   -1.145  11.906 1.00 0.00 ? 18 GLU A HB3  7  
ATOM 3740 H HG2  . GLU A 1 18 ? 2.120   -0.754  14.482 1.00 0.00 ? 18 GLU A HG2  7  
ATOM 3741 H HG3  . GLU A 1 18 ? 0.945   -1.627  13.499 1.00 0.00 ? 18 GLU A HG3  7  
ATOM 3742 N N    . GLY A 1 19 ? 1.698   -4.840  11.903 1.00 0.00 ? 19 GLY A N    7  
ATOM 3743 C CA   . GLY A 1 19 ? 0.623   -5.506  11.193 1.00 0.00 ? 19 GLY A CA   7  
ATOM 3744 C C    . GLY A 1 19 ? -0.727  -5.287  11.846 1.00 0.00 ? 19 GLY A C    7  
ATOM 3745 O O    . GLY A 1 19 ? -1.727  -5.875  11.435 1.00 0.00 ? 19 GLY A O    7  
ATOM 3746 H H    . GLY A 1 19 ? 2.068   -5.241  12.717 1.00 0.00 ? 19 GLY A H    7  
ATOM 3747 H HA2  . GLY A 1 19 ? 0.587   -5.131  10.181 1.00 0.00 ? 19 GLY A HA2  7  
ATOM 3748 H HA3  . GLY A 1 19 ? 0.828   -6.567  11.165 1.00 0.00 ? 19 GLY A HA3  7  
ATOM 3749 N N    . ALA A 1 20 ? -0.757  -4.438  12.869 1.00 0.00 ? 20 ALA A N    7  
ATOM 3750 C CA   . ALA A 1 20 ? -1.994  -4.143  13.580 1.00 0.00 ? 20 ALA A CA   7  
ATOM 3751 C C    . ALA A 1 20 ? -2.223  -2.638  13.682 1.00 0.00 ? 20 ALA A C    7  
ATOM 3752 O O    . ALA A 1 20 ? -3.093  -2.086  13.009 1.00 0.00 ? 20 ALA A O    7  
ATOM 3753 C CB   . ALA A 1 20 ? -1.969  -4.770  14.966 1.00 0.00 ? 20 ALA A CB   7  
ATOM 3754 H H    . ALA A 1 20 ? 0.073   -4.000  13.150 1.00 0.00 ? 20 ALA A H    7  
ATOM 3755 H HA   . ALA A 1 20 ? -2.811  -4.584  13.027 1.00 0.00 ? 20 ALA A HA   7  
ATOM 3756 H HB1  . ALA A 1 20 ? -2.059  -3.994  15.713 1.00 0.00 ? 20 ALA A HB1  7  
ATOM 3757 H HB2  . ALA A 1 20 ? -2.793  -5.461  15.063 1.00 0.00 ? 20 ALA A HB2  7  
ATOM 3758 H HB3  . ALA A 1 20 ? -1.037  -5.297  15.105 1.00 0.00 ? 20 ALA A HB3  7  
ATOM 3759 N N    . ARG A 1 21 ? -1.437  -1.981  14.529 1.00 0.00 ? 21 ARG A N    7  
ATOM 3760 C CA   . ARG A 1 21 ? -1.555  -0.541  14.720 1.00 0.00 ? 21 ARG A CA   7  
ATOM 3761 C C    . ARG A 1 21 ? -0.296  0.027   15.369 1.00 0.00 ? 21 ARG A C    7  
ATOM 3762 O O    . ARG A 1 21 ? 0.342   -0.631  16.192 1.00 0.00 ? 21 ARG A O    7  
ATOM 3763 C CB   . ARG A 1 21 ? -2.776  -0.218  15.583 1.00 0.00 ? 21 ARG A CB   7  
ATOM 3764 C CG   . ARG A 1 21 ? -3.742  0.758   14.931 1.00 0.00 ? 21 ARG A CG   7  
ATOM 3765 C CD   . ARG A 1 21 ? -5.159  0.569   15.449 1.00 0.00 ? 21 ARG A CD   7  
ATOM 3766 N NE   . ARG A 1 21 ? -6.003  -0.137  14.489 1.00 0.00 ? 21 ARG A NE   7  
ATOM 3767 C CZ   . ARG A 1 21 ? -7.312  -0.301  14.643 1.00 0.00 ? 21 ARG A CZ   7  
ATOM 3768 N NH1  . ARG A 1 21 ? -7.924  0.188   15.713 1.00 0.00 ? 21 ARG A NH1  7  
ATOM 3769 N NH2  . ARG A 1 21 ? -8.013  -0.955  13.726 1.00 0.00 ? 21 ARG A NH2  7  
ATOM 3770 H H    . ARG A 1 21 ? -0.762  -2.477  15.038 1.00 0.00 ? 21 ARG A H    7  
ATOM 3771 H HA   . ARG A 1 21 ? -1.682  -0.086  13.749 1.00 0.00 ? 21 ARG A HA   7  
ATOM 3772 H HB2  . ARG A 1 21 ? -3.310  -1.134  15.789 1.00 0.00 ? 21 ARG A HB2  7  
ATOM 3773 H HB3  . ARG A 1 21 ? -2.440  0.210   16.515 1.00 0.00 ? 21 ARG A HB3  7  
ATOM 3774 H HG2  . ARG A 1 21 ? -3.422  1.766   15.149 1.00 0.00 ? 21 ARG A HG2  7  
ATOM 3775 H HG3  . ARG A 1 21 ? -3.734  0.599   13.863 1.00 0.00 ? 21 ARG A HG3  7  
ATOM 3776 H HD2  . ARG A 1 21 ? -5.120  0.001   16.366 1.00 0.00 ? 21 ARG A HD2  7  
ATOM 3777 H HD3  . ARG A 1 21 ? -5.588  1.541   15.646 1.00 0.00 ? 21 ARG A HD3  7  
ATOM 3778 H HE   . ARG A 1 21 ? -5.572  -0.506  13.691 1.00 0.00 ? 21 ARG A HE   7  
ATOM 3779 H HH11 . ARG A 1 21 ? -7.399  0.682   16.406 1.00 0.00 ? 21 ARG A HH11 7  
ATOM 3780 H HH12 . ARG A 1 21 ? -8.910  0.064   15.827 1.00 0.00 ? 21 ARG A HH12 7  
ATOM 3781 H HH21 . ARG A 1 21 ? -7.555  -1.325  12.918 1.00 0.00 ? 21 ARG A HH21 7  
ATOM 3782 H HH22 . ARG A 1 21 ? -8.998  -1.079  13.843 1.00 0.00 ? 21 ARG A HH22 7  
ATOM 3783 N N    . CYS A 1 22 ? 0.057   1.251   14.992 1.00 0.00 ? 22 CYS A N    7  
ATOM 3784 C CA   . CYS A 1 22 ? 1.239   1.908   15.536 1.00 0.00 ? 22 CYS A CA   7  
ATOM 3785 C C    . CYS A 1 22 ? 1.164   1.992   17.057 1.00 0.00 ? 22 CYS A C    7  
ATOM 3786 O O    . CYS A 1 22 ? 0.090   2.186   17.625 1.00 0.00 ? 22 CYS A O    7  
ATOM 3787 C CB   . CYS A 1 22 ? 1.387   3.311   14.943 1.00 0.00 ? 22 CYS A CB   7  
ATOM 3788 S SG   . CYS A 1 22 ? 1.438   3.347   13.122 1.00 0.00 ? 22 CYS A SG   7  
ATOM 3789 H H    . CYS A 1 22 ? -0.492  1.725   14.331 1.00 0.00 ? 22 CYS A H    7  
ATOM 3790 H HA   . CYS A 1 22 ? 2.101   1.319   15.262 1.00 0.00 ? 22 CYS A HA   7  
ATOM 3791 H HB2  . CYS A 1 22 ? 0.551   3.917   15.260 1.00 0.00 ? 22 CYS A HB2  7  
ATOM 3792 H HB3  . CYS A 1 22 ? 2.303   3.752   15.307 1.00 0.00 ? 22 CYS A HB3  7  
ATOM 3793 N N    . GLU A 1 23 ? 2.312   1.846   17.710 1.00 0.00 ? 23 GLU A N    7  
ATOM 3794 C CA   . GLU A 1 23 ? 2.376   1.905   19.166 1.00 0.00 ? 23 GLU A CA   7  
ATOM 3795 C C    . GLU A 1 23 ? 2.136   3.327   19.664 1.00 0.00 ? 23 GLU A C    7  
ATOM 3796 O O    . GLU A 1 23 ? 2.183   4.283   18.890 1.00 0.00 ? 23 GLU A O    7  
ATOM 3797 C CB   . GLU A 1 23 ? 3.734   1.402   19.661 1.00 0.00 ? 23 GLU A CB   7  
ATOM 3798 C CG   . GLU A 1 23 ? 3.914   -0.100  19.520 1.00 0.00 ? 23 GLU A CG   7  
ATOM 3799 C CD   . GLU A 1 23 ? 3.957   -0.811  20.859 1.00 0.00 ? 23 GLU A CD   7  
ATOM 3800 O OE1  . GLU A 1 23 ? 2.985   -1.524  21.183 1.00 0.00 ? 23 GLU A OE1  7  
ATOM 3801 O OE2  . GLU A 1 23 ? 4.963   -0.654  21.582 1.00 0.00 ? 23 GLU A OE2  7  
ATOM 3802 H H    . GLU A 1 23 ? 3.136   1.694   17.202 1.00 0.00 ? 23 GLU A H    7  
ATOM 3803 H HA   . GLU A 1 23 ? 1.601   1.264   19.558 1.00 0.00 ? 23 GLU A HA   7  
ATOM 3804 H HB2  . GLU A 1 23 ? 4.513   1.892   19.096 1.00 0.00 ? 23 GLU A HB2  7  
ATOM 3805 H HB3  . GLU A 1 23 ? 3.841   1.660   20.704 1.00 0.00 ? 23 GLU A HB3  7  
ATOM 3806 H HG2  . GLU A 1 23 ? 3.090   -0.497  18.946 1.00 0.00 ? 23 GLU A HG2  7  
ATOM 3807 H HG3  . GLU A 1 23 ? 4.840   -0.291  18.998 1.00 0.00 ? 23 GLU A HG3  7  
ATOM 3808 N N    . SER A 1 24 ? 1.878   3.458   20.961 1.00 0.00 ? 24 SER A N    7  
ATOM 3809 C CA   . SER A 1 24 ? 1.626   4.763   21.562 1.00 0.00 ? 24 SER A CA   7  
ATOM 3810 C C    . SER A 1 24 ? 2.801   5.707   21.324 1.00 0.00 ? 24 SER A C    7  
ATOM 3811 O O    . SER A 1 24 ? 3.757   5.734   22.098 1.00 0.00 ? 24 SER A O    7  
ATOM 3812 C CB   . SER A 1 24 ? 1.372   4.615   23.064 1.00 0.00 ? 24 SER A CB   7  
ATOM 3813 O OG   . SER A 1 24 ? 0.387   3.629   23.320 1.00 0.00 ? 24 SER A OG   7  
ATOM 3814 H H    . SER A 1 24 ? 1.855   2.658   21.527 1.00 0.00 ? 24 SER A H    7  
ATOM 3815 H HA   . SER A 1 24 ? 0.746   5.178   21.096 1.00 0.00 ? 24 SER A HA   7  
ATOM 3816 H HB2  . SER A 1 24 ? 2.289   4.327   23.555 1.00 0.00 ? 24 SER A HB2  7  
ATOM 3817 H HB3  . SER A 1 24 ? 1.031   5.560   23.463 1.00 0.00 ? 24 SER A HB3  7  
ATOM 3818 H HG   . SER A 1 24 ? -0.427  3.865   22.870 1.00 0.00 ? 24 SER A HG   7  
ATOM 3819 N N    . GLY A 1 25 ? 2.722   6.480   20.246 1.00 0.00 ? 25 GLY A N    7  
ATOM 3820 C CA   . GLY A 1 25 ? 3.784   7.415   19.924 1.00 0.00 ? 25 GLY A CA   7  
ATOM 3821 C C    . GLY A 1 25 ? 4.187   7.354   18.464 1.00 0.00 ? 25 GLY A C    7  
ATOM 3822 O O    . GLY A 1 25 ? 4.763   8.303   17.931 1.00 0.00 ? 25 GLY A O    7  
ATOM 3823 H H    . GLY A 1 25 ? 1.935   6.416   19.664 1.00 0.00 ? 25 GLY A H    7  
ATOM 3824 H HA2  . GLY A 1 25 ? 3.450   8.416   20.153 1.00 0.00 ? 25 GLY A HA2  7  
ATOM 3825 H HA3  . GLY A 1 25 ? 4.646   7.187   20.533 1.00 0.00 ? 25 GLY A HA3  7  
ATOM 3826 N N    . PHE A 1 26 ? 3.885   6.235   17.815 1.00 0.00 ? 26 PHE A N    7  
ATOM 3827 C CA   . PHE A 1 26 ? 4.223   6.052   16.408 1.00 0.00 ? 26 PHE A CA   7  
ATOM 3828 C C    . PHE A 1 26 ? 3.044   6.425   15.513 1.00 0.00 ? 26 PHE A C    7  
ATOM 3829 O O    . PHE A 1 26 ? 1.905   6.515   15.973 1.00 0.00 ? 26 PHE A O    7  
ATOM 3830 C CB   . PHE A 1 26 ? 4.639   4.603   16.145 1.00 0.00 ? 26 PHE A CB   7  
ATOM 3831 C CG   . PHE A 1 26 ? 5.916   4.212   16.832 1.00 0.00 ? 26 PHE A CG   7  
ATOM 3832 C CD1  . PHE A 1 26 ? 5.929   3.925   18.187 1.00 0.00 ? 26 PHE A CD1  7  
ATOM 3833 C CD2  . PHE A 1 26 ? 7.103   4.133   16.122 1.00 0.00 ? 26 PHE A CD2  7  
ATOM 3834 C CE1  . PHE A 1 26 ? 7.103   3.565   18.822 1.00 0.00 ? 26 PHE A CE1  7  
ATOM 3835 C CE2  . PHE A 1 26 ? 8.280   3.772   16.752 1.00 0.00 ? 26 PHE A CE2  7  
ATOM 3836 C CZ   . PHE A 1 26 ? 8.280   3.489   18.103 1.00 0.00 ? 26 PHE A CZ   7  
ATOM 3837 H H    . PHE A 1 26 ? 3.425   5.514   18.294 1.00 0.00 ? 26 PHE A H    7  
ATOM 3838 H HA   . PHE A 1 26 ? 5.052   6.703   16.180 1.00 0.00 ? 26 PHE A HA   7  
ATOM 3839 H HB2  . PHE A 1 26 ? 3.859   3.943   16.495 1.00 0.00 ? 26 PHE A HB2  7  
ATOM 3840 H HB3  . PHE A 1 26 ? 4.775   4.463   15.083 1.00 0.00 ? 26 PHE A HB3  7  
ATOM 3841 H HD1  . PHE A 1 26 ? 5.009   3.984   18.751 1.00 0.00 ? 26 PHE A HD1  7  
ATOM 3842 H HD2  . PHE A 1 26 ? 7.105   4.355   15.065 1.00 0.00 ? 26 PHE A HD2  7  
ATOM 3843 H HE1  . PHE A 1 26 ? 7.099   3.344   19.879 1.00 0.00 ? 26 PHE A HE1  7  
ATOM 3844 H HE2  . PHE A 1 26 ? 9.199   3.714   16.187 1.00 0.00 ? 26 PHE A HE2  7  
ATOM 3845 H HZ   . PHE A 1 26 ? 9.198   3.207   18.597 1.00 0.00 ? 26 PHE A HZ   7  
ATOM 3846 N N    . HIS A 1 27 ? 3.326   6.642   14.232 1.00 0.00 ? 27 HIS A N    7  
ATOM 3847 C CA   . HIS A 1 27 ? 2.290   7.005   13.272 1.00 0.00 ? 27 HIS A CA   7  
ATOM 3848 C C    . HIS A 1 27 ? 2.320   6.075   12.063 1.00 0.00 ? 27 HIS A C    7  
ATOM 3849 O O    . HIS A 1 27 ? 3.389   5.690   11.590 1.00 0.00 ? 27 HIS A O    7  
ATOM 3850 C CB   . HIS A 1 27 ? 2.470   8.455   12.820 1.00 0.00 ? 27 HIS A CB   7  
ATOM 3851 C CG   . HIS A 1 27 ? 3.903   8.852   12.640 1.00 0.00 ? 27 HIS A CG   7  
ATOM 3852 N ND1  . HIS A 1 27 ? 4.615   9.553   13.591 1.00 0.00 ? 27 HIS A ND1  7  
ATOM 3853 C CD2  . HIS A 1 27 ? 4.757   8.642   11.611 1.00 0.00 ? 27 HIS A CD2  7  
ATOM 3854 C CE1  . HIS A 1 27 ? 5.845   9.758   13.154 1.00 0.00 ? 27 HIS A CE1  7  
ATOM 3855 N NE2  . HIS A 1 27 ? 5.957   9.215   11.955 1.00 0.00 ? 27 HIS A NE2  7  
ATOM 3856 H H    . HIS A 1 27 ? 4.253   6.555   13.926 1.00 0.00 ? 27 HIS A H    7  
ATOM 3857 H HA   . HIS A 1 27 ? 1.334   6.907   13.763 1.00 0.00 ? 27 HIS A HA   7  
ATOM 3858 H HB2  . HIS A 1 27 ? 1.966   8.595   11.875 1.00 0.00 ? 27 HIS A HB2  7  
ATOM 3859 H HB3  . HIS A 1 27 ? 2.033   9.112   13.557 1.00 0.00 ? 27 HIS A HB3  7  
ATOM 3860 H HD1  . HIS A 1 27 ? 4.269   9.856   14.456 1.00 0.00 ? 27 HIS A HD1  7  
ATOM 3861 H HD2  . HIS A 1 27 ? 4.537   8.122   10.690 1.00 0.00 ? 27 HIS A HD2  7  
ATOM 3862 H HE1  . HIS A 1 27 ? 6.626   10.280  13.686 1.00 0.00 ? 27 HIS A HE1  7  
ATOM 3863 N N    . ASP A 1 28 ? 1.140   5.718   11.569 1.00 0.00 ? 28 ASP A N    7  
ATOM 3864 C CA   . ASP A 1 28 ? 1.030   4.833   10.415 1.00 0.00 ? 28 ASP A CA   7  
ATOM 3865 C C    . ASP A 1 28 ? 1.600   5.497   9.165  1.00 0.00 ? 28 ASP A C    7  
ATOM 3866 O O    . ASP A 1 28 ? 1.062   6.491   8.677  1.00 0.00 ? 28 ASP A O    7  
ATOM 3867 C CB   . ASP A 1 28 ? -0.430  4.444   10.180 1.00 0.00 ? 28 ASP A CB   7  
ATOM 3868 C CG   . ASP A 1 28 ? -0.670  3.913   8.781  1.00 0.00 ? 28 ASP A CG   7  
ATOM 3869 O OD1  . ASP A 1 28 ? 0.306   3.475   8.136  1.00 0.00 ? 28 ASP A OD1  7  
ATOM 3870 O OD2  . ASP A 1 28 ? -1.834  3.934   8.330  1.00 0.00 ? 28 ASP A OD2  7  
ATOM 3871 H H    . ASP A 1 28 ? 0.322   6.058   11.990 1.00 0.00 ? 28 ASP A H    7  
ATOM 3872 H HA   . ASP A 1 28 ? 1.601   3.941   10.625 1.00 0.00 ? 28 ASP A HA   7  
ATOM 3873 H HB2  . ASP A 1 28 ? -0.711  3.678   10.889 1.00 0.00 ? 28 ASP A HB2  7  
ATOM 3874 H HB3  . ASP A 1 28 ? -1.055  5.312   10.328 1.00 0.00 ? 28 ASP A HB3  7  
ATOM 3875 N N    . CYS A 1 29 ? 2.693   4.941   8.652  1.00 0.00 ? 29 CYS A N    7  
ATOM 3876 C CA   . CYS A 1 29 ? 3.338   5.479   7.460  1.00 0.00 ? 29 CYS A CA   7  
ATOM 3877 C C    . CYS A 1 29 ? 3.410   4.426   6.359  1.00 0.00 ? 29 CYS A C    7  
ATOM 3878 O O    . CYS A 1 29 ? 4.268   4.491   5.479  1.00 0.00 ? 29 CYS A O    7  
ATOM 3879 C CB   . CYS A 1 29 ? 4.744   5.979   7.798  1.00 0.00 ? 29 CYS A CB   7  
ATOM 3880 S SG   . CYS A 1 29 ? 5.753   4.784   8.732  1.00 0.00 ? 29 CYS A SG   7  
ATOM 3881 H H    . CYS A 1 29 ? 3.076   4.149   9.086  1.00 0.00 ? 29 CYS A H    7  
ATOM 3882 H HA   . CYS A 1 29 ? 2.745   6.310   7.109  1.00 0.00 ? 29 CYS A HA   7  
ATOM 3883 H HB2  . CYS A 1 29 ? 5.268   6.202   6.880  1.00 0.00 ? 29 CYS A HB2  7  
ATOM 3884 H HB3  . CYS A 1 29 ? 4.666   6.878   8.390  1.00 0.00 ? 29 CYS A HB3  7  
ATOM 3885 N N    . GLY A 1 30 ? 2.503   3.455   6.414  1.00 0.00 ? 30 GLY A N    7  
ATOM 3886 C CA   . GLY A 1 30 ? 2.481   2.402   5.416  1.00 0.00 ? 30 GLY A CA   7  
ATOM 3887 C C    . GLY A 1 30 ? 2.390   2.944   4.004  1.00 0.00 ? 30 GLY A C    7  
ATOM 3888 O O    . GLY A 1 30 ? 2.577   2.207   3.036  1.00 0.00 ? 30 GLY A O    7  
ATOM 3889 H H    . GLY A 1 30 ? 1.843   3.455   7.139  1.00 0.00 ? 30 GLY A H    7  
ATOM 3890 H HA2  . GLY A 1 30 ? 3.383   1.815   5.508  1.00 0.00 ? 30 GLY A HA2  7  
ATOM 3891 H HA3  . GLY A 1 30 ? 1.629   1.765   5.601  1.00 0.00 ? 30 GLY A HA3  7  
ATOM 3892 N N    . SER A 1 31 ? 2.101   4.236   3.884  1.00 0.00 ? 31 SER A N    7  
ATOM 3893 C CA   . SER A 1 31 ? 1.979   4.874   2.579  1.00 0.00 ? 31 SER A CA   7  
ATOM 3894 C C    . SER A 1 31 ? 3.107   4.433   1.651  1.00 0.00 ? 31 SER A C    7  
ATOM 3895 O O    . SER A 1 31 ? 2.886   3.680   0.702  1.00 0.00 ? 31 SER A O    7  
ATOM 3896 C CB   . SER A 1 31 ? 1.994   6.397   2.730  1.00 0.00 ? 31 SER A CB   7  
ATOM 3897 O OG   . SER A 1 31 ? 1.263   6.804   3.873  1.00 0.00 ? 31 SER A OG   7  
ATOM 3898 H H    . SER A 1 31 ? 1.963   4.771   4.694  1.00 0.00 ? 31 SER A H    7  
ATOM 3899 H HA   . SER A 1 31 ? 1.036   4.573   2.149  1.00 0.00 ? 31 SER A HA   7  
ATOM 3900 H HB2  . SER A 1 31 ? 3.014   6.736   2.830  1.00 0.00 ? 31 SER A HB2  7  
ATOM 3901 H HB3  . SER A 1 31 ? 1.550   6.847   1.854  1.00 0.00 ? 31 SER A HB3  7  
ATOM 3902 H HG   . SER A 1 31 ? 0.424   7.180   3.600  1.00 0.00 ? 31 SER A HG   7  
ATOM 3903 N N    . ASP A 1 32 ? 4.316   4.907   1.932  1.00 0.00 ? 32 ASP A N    7  
ATOM 3904 C CA   . ASP A 1 32 ? 5.479   4.561   1.124  1.00 0.00 ? 32 ASP A CA   7  
ATOM 3905 C C    . ASP A 1 32 ? 6.431   3.656   1.901  1.00 0.00 ? 32 ASP A C    7  
ATOM 3906 O O    . ASP A 1 32 ? 7.647   3.708   1.713  1.00 0.00 ? 32 ASP A O    7  
ATOM 3907 C CB   . ASP A 1 32 ? 6.211   5.827   0.677  1.00 0.00 ? 32 ASP A CB   7  
ATOM 3908 C CG   . ASP A 1 32 ? 6.208   6.905   1.744  1.00 0.00 ? 32 ASP A CG   7  
ATOM 3909 O OD1  . ASP A 1 32 ? 5.187   7.614   1.868  1.00 0.00 ? 32 ASP A OD1  7  
ATOM 3910 O OD2  . ASP A 1 32 ? 7.226   7.038   2.455  1.00 0.00 ? 32 ASP A OD2  7  
ATOM 3911 H H    . ASP A 1 32 ? 4.428   5.503   2.702  1.00 0.00 ? 32 ASP A H    7  
ATOM 3912 H HA   . ASP A 1 32 ? 5.131   4.030   0.251  1.00 0.00 ? 32 ASP A HA   7  
ATOM 3913 H HB2  . ASP A 1 32 ? 7.237   5.580   0.445  1.00 0.00 ? 32 ASP A HB2  7  
ATOM 3914 H HB3  . ASP A 1 32 ? 5.731   6.219   -0.207 1.00 0.00 ? 32 ASP A HB3  7  
ATOM 3915 N N    . HIS A 1 33 ? 5.869   2.827   2.775  1.00 0.00 ? 33 HIS A N    7  
ATOM 3916 C CA   . HIS A 1 33 ? 6.668   1.911   3.582  1.00 0.00 ? 33 HIS A CA   7  
ATOM 3917 C C    . HIS A 1 33 ? 5.894   0.629   3.875  1.00 0.00 ? 33 HIS A C    7  
ATOM 3918 O O    . HIS A 1 33 ? 4.842   0.661   4.514  1.00 0.00 ? 33 HIS A O    7  
ATOM 3919 C CB   . HIS A 1 33 ? 7.084   2.580   4.892  1.00 0.00 ? 33 HIS A CB   7  
ATOM 3920 C CG   . HIS A 1 33 ? 7.748   3.909   4.701  1.00 0.00 ? 33 HIS A CG   7  
ATOM 3921 N ND1  . HIS A 1 33 ? 7.331   5.057   5.341  1.00 0.00 ? 33 HIS A ND1  7  
ATOM 3922 C CD2  . HIS A 1 33 ? 8.806   4.269   3.937  1.00 0.00 ? 33 HIS A CD2  7  
ATOM 3923 C CE1  . HIS A 1 33 ? 8.103   6.066   4.978  1.00 0.00 ? 33 HIS A CE1  7  
ATOM 3924 N NE2  . HIS A 1 33 ? 9.006   5.614   4.127  1.00 0.00 ? 33 HIS A NE2  7  
ATOM 3925 H H    . HIS A 1 33 ? 4.895   2.832   2.881  1.00 0.00 ? 33 HIS A H    7  
ATOM 3926 H HA   . HIS A 1 33 ? 7.554   1.660   3.019  1.00 0.00 ? 33 HIS A HA   7  
ATOM 3927 H HB2  . HIS A 1 33 ? 6.207   2.733   5.504  1.00 0.00 ? 33 HIS A HB2  7  
ATOM 3928 H HB3  . HIS A 1 33 ? 7.775   1.935   5.415  1.00 0.00 ? 33 HIS A HB3  7  
ATOM 3929 H HD1  . HIS A 1 33 ? 6.581   5.123   5.967  1.00 0.00 ? 33 HIS A HD1  7  
ATOM 3930 H HD2  . HIS A 1 33 ? 9.385   3.619   3.296  1.00 0.00 ? 33 HIS A HD2  7  
ATOM 3931 H HE1  . HIS A 1 33 ? 8.013   7.086   5.319  1.00 0.00 ? 33 HIS A HE1  7  
ATOM 3932 N N    . TRP A 1 34 ? 6.420   -0.495  3.403  1.00 0.00 ? 34 TRP A N    7  
ATOM 3933 C CA   . TRP A 1 34 ? 5.777   -1.787  3.614  1.00 0.00 ? 34 TRP A CA   7  
ATOM 3934 C C    . TRP A 1 34 ? 6.684   -2.724  4.405  1.00 0.00 ? 34 TRP A C    7  
ATOM 3935 O O    . TRP A 1 34 ? 7.861   -2.430  4.618  1.00 0.00 ? 34 TRP A O    7  
ATOM 3936 C CB   . TRP A 1 34 ? 5.411   -2.423  2.272  1.00 0.00 ? 34 TRP A CB   7  
ATOM 3937 C CG   . TRP A 1 34 ? 6.358   -2.065  1.167  1.00 0.00 ? 34 TRP A CG   7  
ATOM 3938 C CD1  . TRP A 1 34 ? 6.060   -1.384  0.021  1.00 0.00 ? 34 TRP A CD1  7  
ATOM 3939 C CD2  . TRP A 1 34 ? 7.756   -2.370  1.103  1.00 0.00 ? 34 TRP A CD2  7  
ATOM 3940 N NE1  . TRP A 1 34 ? 7.188   -1.248  -0.752 1.00 0.00 ? 34 TRP A NE1  7  
ATOM 3941 C CE2  . TRP A 1 34 ? 8.242   -1.843  -0.110 1.00 0.00 ? 34 TRP A CE2  7  
ATOM 3942 C CE3  . TRP A 1 34 ? 8.644   -3.034  1.953  1.00 0.00 ? 34 TRP A CE3  7  
ATOM 3943 C CZ2  . TRP A 1 34 ? 9.575   -1.963  -0.491 1.00 0.00 ? 34 TRP A CZ2  7  
ATOM 3944 C CZ3  . TRP A 1 34 ? 9.967   -3.153  1.572  1.00 0.00 ? 34 TRP A CZ3  7  
ATOM 3945 C CH2  . TRP A 1 34 ? 10.423  -2.618  0.360  1.00 0.00 ? 34 TRP A CH2  7  
ATOM 3946 H H    . TRP A 1 34 ? 7.261   -0.456  2.900  1.00 0.00 ? 34 TRP A H    7  
ATOM 3947 H HA   . TRP A 1 34 ? 4.873   -1.618  4.180  1.00 0.00 ? 34 TRP A HA   7  
ATOM 3948 H HB2  . TRP A 1 34 ? 5.414   -3.498  2.378  1.00 0.00 ? 34 TRP A HB2  7  
ATOM 3949 H HB3  . TRP A 1 34 ? 4.423   -2.096  1.985  1.00 0.00 ? 34 TRP A HB3  7  
ATOM 3950 H HD1  . TRP A 1 34 ? 5.077   -1.015  -0.229 1.00 0.00 ? 34 TRP A HD1  7  
ATOM 3951 H HE1  . TRP A 1 34 ? 7.231   -0.796  -1.621 1.00 0.00 ? 34 TRP A HE1  7  
ATOM 3952 H HE3  . TRP A 1 34 ? 8.312   -3.453  2.891  1.00 0.00 ? 34 TRP A HE3  7  
ATOM 3953 H HZ2  . TRP A 1 34 ? 9.942   -1.556  -1.422 1.00 0.00 ? 34 TRP A HZ2  7  
ATOM 3954 H HZ3  . TRP A 1 34 ? 10.668  -3.663  2.216  1.00 0.00 ? 34 TRP A HZ3  7  
ATOM 3955 H HH2  . TRP A 1 34 ? 11.464  -2.735  0.103  1.00 0.00 ? 34 TRP A HH2  7  
ATOM 3956 N N    . CYS A 1 35 ? 6.131   -3.852  4.836  1.00 0.00 ? 35 CYS A N    7  
ATOM 3957 C CA   . CYS A 1 35 ? 6.890   -4.832  5.604  1.00 0.00 ? 35 CYS A CA   7  
ATOM 3958 C C    . CYS A 1 35 ? 7.249   -6.038  4.741  1.00 0.00 ? 35 CYS A C    7  
ATOM 3959 O O    . CYS A 1 35 ? 6.756   -6.183  3.622  1.00 0.00 ? 35 CYS A O    7  
ATOM 3960 C CB   . CYS A 1 35 ? 6.088   -5.286  6.825  1.00 0.00 ? 35 CYS A CB   7  
ATOM 3961 S SG   . CYS A 1 35 ? 6.234   -4.178  8.264  1.00 0.00 ? 35 CYS A SG   7  
ATOM 3962 H H    . CYS A 1 35 ? 5.187   -4.030  4.634  1.00 0.00 ? 35 CYS A H    7  
ATOM 3963 H HA   . CYS A 1 35 ? 7.801   -4.359  5.937  1.00 0.00 ? 35 CYS A HA   7  
ATOM 3964 H HB2  . CYS A 1 35 ? 5.043   -5.342  6.560  1.00 0.00 ? 35 CYS A HB2  7  
ATOM 3965 H HB3  . CYS A 1 35 ? 6.430   -6.265  7.127  1.00 0.00 ? 35 CYS A HB3  7  
ATOM 3966 N N    . ASP A 1 36 ? 8.111   -6.900  5.269  1.00 0.00 ? 36 ASP A N    7  
ATOM 3967 C CA   . ASP A 1 36 ? 8.536   -8.094  4.548  1.00 0.00 ? 36 ASP A CA   7  
ATOM 3968 C C    . ASP A 1 36 ? 7.334   -8.845  3.983  1.00 0.00 ? 36 ASP A C    7  
ATOM 3969 O O    . ASP A 1 36 ? 7.384   -9.368  2.870  1.00 0.00 ? 36 ASP A O    7  
ATOM 3970 C CB   . ASP A 1 36 ? 9.339   -9.013  5.471  1.00 0.00 ? 36 ASP A CB   7  
ATOM 3971 C CG   . ASP A 1 36 ? 10.817  -8.676  5.480  1.00 0.00 ? 36 ASP A CG   7  
ATOM 3972 O OD1  . ASP A 1 36 ? 11.358  -8.346  4.403  1.00 0.00 ? 36 ASP A OD1  7  
ATOM 3973 O OD2  . ASP A 1 36 ? 11.433  -8.740  6.564  1.00 0.00 ? 36 ASP A OD2  7  
ATOM 3974 H H    . ASP A 1 36 ? 8.470   -6.729  6.165  1.00 0.00 ? 36 ASP A H    7  
ATOM 3975 H HA   . ASP A 1 36 ? 9.167   -7.781  3.730  1.00 0.00 ? 36 ASP A HA   7  
ATOM 3976 H HB2  . ASP A 1 36 ? 8.962   -8.921  6.478  1.00 0.00 ? 36 ASP A HB2  7  
ATOM 3977 H HB3  . ASP A 1 36 ? 9.223   -10.035 5.140  1.00 0.00 ? 36 ASP A HB3  7  
ATOM 3978 N N    . ALA A 1 37 ? 6.256   -8.894  4.759  1.00 0.00 ? 37 ALA A N    7  
ATOM 3979 C CA   . ALA A 1 37 ? 5.041   -9.579  4.335  1.00 0.00 ? 37 ALA A CA   7  
ATOM 3980 C C    . ALA A 1 37 ? 4.068   -8.611  3.670  1.00 0.00 ? 37 ALA A C    7  
ATOM 3981 O O    . ALA A 1 37 ? 3.681   -7.603  4.261  1.00 0.00 ? 37 ALA A O    7  
ATOM 3982 C CB   . ALA A 1 37 ? 4.380   -10.264 5.522  1.00 0.00 ? 37 ALA A CB   7  
ATOM 3983 H H    . ALA A 1 37 ? 6.278   -8.458  5.636  1.00 0.00 ? 37 ALA A H    7  
ATOM 3984 H HA   . ALA A 1 37 ? 5.320   -10.341 3.621  1.00 0.00 ? 37 ALA A HA   7  
ATOM 3985 H HB1  . ALA A 1 37 ? 3.524   -9.686  5.838  1.00 0.00 ? 37 ALA A HB1  7  
ATOM 3986 H HB2  . ALA A 1 37 ? 4.060   -11.254 5.234  1.00 0.00 ? 37 ALA A HB2  7  
ATOM 3987 H HB3  . ALA A 1 37 ? 5.087   -10.335 6.335  1.00 0.00 ? 37 ALA A HB3  7  
ATOM 3988 N N    . SER A 1 38 ? 3.677   -8.924  2.439  1.00 0.00 ? 38 SER A N    7  
ATOM 3989 C CA   . SER A 1 38 ? 2.753   -8.079  1.693  1.00 0.00 ? 38 SER A CA   7  
ATOM 3990 C C    . SER A 1 38 ? 1.427   -7.938  2.434  1.00 0.00 ? 38 SER A C    7  
ATOM 3991 O O    . SER A 1 38 ? 0.436   -8.578  2.085  1.00 0.00 ? 38 SER A O    7  
ATOM 3992 C CB   . SER A 1 38 ? 2.511   -8.660  0.298  1.00 0.00 ? 38 SER A CB   7  
ATOM 3993 O OG   . SER A 1 38 ? 1.699   -7.797  -0.479 1.00 0.00 ? 38 SER A OG   7  
ATOM 3994 H H    . SER A 1 38 ? 4.021   -9.742  2.022  1.00 0.00 ? 38 SER A H    7  
ATOM 3995 H HA   . SER A 1 38 ? 3.202   -7.103  1.594  1.00 0.00 ? 38 SER A HA   7  
ATOM 3996 H HB2  . SER A 1 38 ? 3.457   -8.792  -0.203 1.00 0.00 ? 38 SER A HB2  7  
ATOM 3997 H HB3  . SER A 1 38 ? 2.015   -9.615  0.390  1.00 0.00 ? 38 SER A HB3  7  
ATOM 3998 H HG   . SER A 1 38 ? 0.774   -8.017  -0.343 1.00 0.00 ? 38 SER A HG   7  
ATOM 3999 N N    . GLY A 1 39 ? 1.417   -7.093  3.461  1.00 0.00 ? 39 GLY A N    7  
ATOM 4000 C CA   . GLY A 1 39 ? 0.209   -6.882  4.237  1.00 0.00 ? 39 GLY A CA   7  
ATOM 4001 C C    . GLY A 1 39 ? 0.461   -6.077  5.496  1.00 0.00 ? 39 GLY A C    7  
ATOM 4002 O O    . GLY A 1 39 ? -0.456  -5.466  6.045  1.00 0.00 ? 39 GLY A O    7  
ATOM 4003 H H    . GLY A 1 39 ? 2.237   -6.609  3.694  1.00 0.00 ? 39 GLY A H    7  
ATOM 4004 H HA2  . GLY A 1 39 ? -0.511  -6.359  3.626  1.00 0.00 ? 39 GLY A HA2  7  
ATOM 4005 H HA3  . GLY A 1 39 ? -0.200  -7.843  4.514  1.00 0.00 ? 39 GLY A HA3  7  
ATOM 4006 N N    . ASP A 1 40 ? 1.708   -6.077  5.956  1.00 0.00 ? 40 ASP A N    7  
ATOM 4007 C CA   . ASP A 1 40 ? 2.078   -5.341  7.159  1.00 0.00 ? 40 ASP A CA   7  
ATOM 4008 C C    . ASP A 1 40 ? 2.513   -3.920  6.815  1.00 0.00 ? 40 ASP A C    7  
ATOM 4009 O O    . ASP A 1 40 ? 3.350   -3.712  5.937  1.00 0.00 ? 40 ASP A O    7  
ATOM 4010 C CB   . ASP A 1 40 ? 3.203   -6.066  7.900  1.00 0.00 ? 40 ASP A CB   7  
ATOM 4011 C CG   . ASP A 1 40 ? 2.680   -7.035  8.942  1.00 0.00 ? 40 ASP A CG   7  
ATOM 4012 O OD1  . ASP A 1 40 ? 2.772   -6.717  10.147 1.00 0.00 ? 40 ASP A OD1  7  
ATOM 4013 O OD2  . ASP A 1 40 ? 2.178   -8.110  8.554  1.00 0.00 ? 40 ASP A OD2  7  
ATOM 4014 H H    . ASP A 1 40 ? 2.395   -6.583  5.474  1.00 0.00 ? 40 ASP A H    7  
ATOM 4015 H HA   . ASP A 1 40 ? 1.211   -5.294  7.800  1.00 0.00 ? 40 ASP A HA   7  
ATOM 4016 H HB2  . ASP A 1 40 ? 3.796   -6.620  7.187  1.00 0.00 ? 40 ASP A HB2  7  
ATOM 4017 H HB3  . ASP A 1 40 ? 3.829   -5.337  8.393  1.00 0.00 ? 40 ASP A HB3  7  
ATOM 4018 N N    . ARG A 1 41 ? 1.937   -2.946  7.512  1.00 0.00 ? 41 ARG A N    7  
ATOM 4019 C CA   . ARG A 1 41 ? 2.263   -1.544  7.279  1.00 0.00 ? 41 ARG A CA   7  
ATOM 4020 C C    . ARG A 1 41 ? 3.349   -1.071  8.241  1.00 0.00 ? 41 ARG A C    7  
ATOM 4021 O O    . ARG A 1 41 ? 3.285   -1.331  9.443  1.00 0.00 ? 41 ARG A O    7  
ATOM 4022 C CB   . ARG A 1 41 ? 1.014   -0.675  7.436  1.00 0.00 ? 41 ARG A CB   7  
ATOM 4023 C CG   . ARG A 1 41 ? -0.200  -1.439  7.939  1.00 0.00 ? 41 ARG A CG   7  
ATOM 4024 C CD   . ARG A 1 41 ? -0.137  -1.660  9.442  1.00 0.00 ? 41 ARG A CD   7  
ATOM 4025 N NE   . ARG A 1 41 ? -1.219  -0.974  10.142 1.00 0.00 ? 41 ARG A NE   7  
ATOM 4026 C CZ   . ARG A 1 41 ? -1.138  0.281   10.572 1.00 0.00 ? 41 ARG A CZ   7  
ATOM 4027 N NH1  . ARG A 1 41 ? -0.030  0.982   10.373 1.00 0.00 ? 41 ARG A NH1  7  
ATOM 4028 N NH2  . ARG A 1 41 ? -2.166  0.836   11.201 1.00 0.00 ? 41 ARG A NH2  7  
ATOM 4029 H H    . ARG A 1 41 ? 1.277   -3.175  8.200  1.00 0.00 ? 41 ARG A H    7  
ATOM 4030 H HA   . ARG A 1 41 ? 2.629   -1.452  6.267  1.00 0.00 ? 41 ARG A HA   7  
ATOM 4031 H HB2  . ARG A 1 41 ? 1.227   0.119   8.137  1.00 0.00 ? 41 ARG A HB2  7  
ATOM 4032 H HB3  . ARG A 1 41 ? 0.768   -0.242  6.478  1.00 0.00 ? 41 ARG A HB3  7  
ATOM 4033 H HG2  . ARG A 1 41 ? -1.091  -0.874  7.706  1.00 0.00 ? 41 ARG A HG2  7  
ATOM 4034 H HG3  . ARG A 1 41 ? -0.241  -2.398  7.444  1.00 0.00 ? 41 ARG A HG3  7  
ATOM 4035 H HD2  . ARG A 1 41 ? -0.207  -2.719  9.640  1.00 0.00 ? 41 ARG A HD2  7  
ATOM 4036 H HD3  . ARG A 1 41 ? 0.809   -1.287  9.807  1.00 0.00 ? 41 ARG A HD3  7  
ATOM 4037 H HE   . ARG A 1 41 ? -2.047  -1.474  10.299 1.00 0.00 ? 41 ARG A HE   7  
ATOM 4038 H HH11 . ARG A 1 41 ? 0.745   0.567   9.898  1.00 0.00 ? 41 ARG A HH11 7  
ATOM 4039 H HH12 . ARG A 1 41 ? 0.028   1.927   10.697 1.00 0.00 ? 41 ARG A HH12 7  
ATOM 4040 H HH21 . ARG A 1 41 ? -3.002  0.310   11.352 1.00 0.00 ? 41 ARG A HH21 7  
ATOM 4041 H HH22 . ARG A 1 41 ? -2.103  1.780   11.524 1.00 0.00 ? 41 ARG A HH22 7  
ATOM 4042 N N    . CYS A 1 42 ? 4.346   -0.375  7.703  1.00 0.00 ? 42 CYS A N    7  
ATOM 4043 C CA   . CYS A 1 42 ? 5.447   0.134   8.512  1.00 0.00 ? 42 CYS A CA   7  
ATOM 4044 C C    . CYS A 1 42 ? 5.041   1.411   9.241  1.00 0.00 ? 42 CYS A C    7  
ATOM 4045 O O    . CYS A 1 42 ? 4.510   2.343   8.636  1.00 0.00 ? 42 CYS A O    7  
ATOM 4046 C CB   . CYS A 1 42 ? 6.671   0.402   7.634  1.00 0.00 ? 42 CYS A CB   7  
ATOM 4047 S SG   . CYS A 1 42 ? 7.658   -1.083  7.261  1.00 0.00 ? 42 CYS A SG   7  
ATOM 4048 H H    . CYS A 1 42 ? 4.341   -0.200  6.738  1.00 0.00 ? 42 CYS A H    7  
ATOM 4049 H HA   . CYS A 1 42 ? 5.697   -0.619  9.243  1.00 0.00 ? 42 CYS A HA   7  
ATOM 4050 H HB2  . CYS A 1 42 ? 6.344   0.823   6.694  1.00 0.00 ? 42 CYS A HB2  7  
ATOM 4051 H HB3  . CYS A 1 42 ? 7.315   1.109   8.134  1.00 0.00 ? 42 CYS A HB3  7  
ATOM 4052 N N    . CYS A 1 43 ? 5.294   1.447   10.545 1.00 0.00 ? 43 CYS A N    7  
ATOM 4053 C CA   . CYS A 1 43 ? 4.955   2.609   11.358 1.00 0.00 ? 43 CYS A CA   7  
ATOM 4054 C C    . CYS A 1 43 ? 6.200   3.434   11.672 1.00 0.00 ? 43 CYS A C    7  
ATOM 4055 O O    . CYS A 1 43 ? 7.249   2.890   12.016 1.00 0.00 ? 43 CYS A O    7  
ATOM 4056 C CB   . CYS A 1 43 ? 4.281   2.168   12.659 1.00 0.00 ? 43 CYS A CB   7  
ATOM 4057 S SG   . CYS A 1 43 ? 2.508   1.787   12.485 1.00 0.00 ? 43 CYS A SG   7  
ATOM 4058 H H    . CYS A 1 43 ? 5.718   0.673   10.972 1.00 0.00 ? 43 CYS A H    7  
ATOM 4059 H HA   . CYS A 1 43 ? 4.266   3.220   10.795 1.00 0.00 ? 43 CYS A HA   7  
ATOM 4060 H HB2  . CYS A 1 43 ? 4.772   1.280   13.027 1.00 0.00 ? 43 CYS A HB2  7  
ATOM 4061 H HB3  . CYS A 1 43 ? 4.378   2.956   13.391 1.00 0.00 ? 43 CYS A HB3  7  
ATOM 4062 N N    . CYS A 1 44 ? 6.075   4.752   11.552 1.00 0.00 ? 44 CYS A N    7  
ATOM 4063 C CA   . CYS A 1 44 ? 7.188   5.654   11.822 1.00 0.00 ? 44 CYS A CA   7  
ATOM 4064 C C    . CYS A 1 44 ? 6.933   6.467   13.088 1.00 0.00 ? 44 CYS A C    7  
ATOM 4065 O O    . CYS A 1 44 ? 5.844   7.004   13.285 1.00 0.00 ? 44 CYS A O    7  
ATOM 4066 C CB   . CYS A 1 44 ? 7.410   6.593   10.635 1.00 0.00 ? 44 CYS A CB   7  
ATOM 4067 S SG   . CYS A 1 44 ? 7.580   5.741   9.034  1.00 0.00 ? 44 CYS A SG   7  
ATOM 4068 H H    . CYS A 1 44 ? 5.212   5.127   11.274 1.00 0.00 ? 44 CYS A H    7  
ATOM 4069 H HA   . CYS A 1 44 ? 8.073   5.054   11.967 1.00 0.00 ? 44 CYS A HA   7  
ATOM 4070 H HB2  . CYS A 1 44 ? 6.571   7.270   10.559 1.00 0.00 ? 44 CYS A HB2  7  
ATOM 4071 H HB3  . CYS A 1 44 ? 8.312   7.164   10.802 1.00 0.00 ? 44 CYS A HB3  7  
ATOM 4072 N N    . ALA A 1 45 ? 7.947   6.554   13.943 1.00 0.00 ? 45 ALA A N    7  
ATOM 4073 C CA   . ALA A 1 45 ? 7.835   7.303   15.188 1.00 0.00 ? 45 ALA A CA   7  
ATOM 4074 C C    . ALA A 1 45 ? 7.985   8.801   14.943 1.00 0.00 ? 45 ALA A C    7  
ATOM 4075 O O    . ALA A 1 45 ? 7.414   9.618   15.667 1.00 0.00 ? 45 ALA A O    7  
ATOM 4076 C CB   . ALA A 1 45 ? 8.876   6.824   16.188 1.00 0.00 ? 45 ALA A CB   7  
ATOM 4077 H H    . ALA A 1 45 ? 8.792   6.104   13.730 1.00 0.00 ? 45 ALA A H    7  
ATOM 4078 H HA   . ALA A 1 45 ? 6.857   7.113   15.605 1.00 0.00 ? 45 ALA A HA   7  
ATOM 4079 H HB1  . ALA A 1 45 ? 9.750   7.456   16.128 1.00 0.00 ? 45 ALA A HB1  7  
ATOM 4080 H HB2  . ALA A 1 45 ? 8.466   6.871   17.186 1.00 0.00 ? 45 ALA A HB2  7  
ATOM 4081 H HB3  . ALA A 1 45 ? 9.152   5.805   15.960 1.00 0.00 ? 45 ALA A HB3  7  
ATOM 4082 N N    . CYS A 1 1  ? 1.210   0.174   -0.092 1.00 0.00 ? 1  CYS A N    8  
ATOM 4083 C CA   . CYS A 1 1  ? 2.079   0.123   -1.261 1.00 0.00 ? 1  CYS A CA   8  
ATOM 4084 C C    . CYS A 1 1  ? 2.706   -1.260  -1.413 1.00 0.00 ? 1  CYS A C    8  
ATOM 4085 O O    . CYS A 1 1  ? 2.857   -1.995  -0.436 1.00 0.00 ? 1  CYS A O    8  
ATOM 4086 C CB   . CYS A 1 1  ? 3.176   1.184   -1.155 1.00 0.00 ? 1  CYS A CB   8  
ATOM 4087 S SG   . CYS A 1 1  ? 4.002   1.239   0.468  1.00 0.00 ? 1  CYS A SG   8  
ATOM 4088 H H    . CYS A 1 1  ? 1.383   0.845   0.603  1.00 0.00 ? 1  CYS A H    8  
ATOM 4089 H HA   . CYS A 1 1  ? 1.475   0.328   -2.132 1.00 0.00 ? 1  CYS A HA   8  
ATOM 4090 H HB2  . CYS A 1 1  ? 3.932   0.985   -1.901 1.00 0.00 ? 1  CYS A HB2  8  
ATOM 4091 H HB3  . CYS A 1 1  ? 2.744   2.157   -1.339 1.00 0.00 ? 1  CYS A HB3  8  
ATOM 4092 N N    . TYR A 1 2  ? 3.070   -1.607  -2.642 1.00 0.00 ? 2  TYR A N    8  
ATOM 4093 C CA   . TYR A 1 2  ? 3.679   -2.902  -2.922 1.00 0.00 ? 2  TYR A CA   8  
ATOM 4094 C C    . TYR A 1 2  ? 5.195   -2.838  -2.757 1.00 0.00 ? 2  TYR A C    8  
ATOM 4095 O O    . TYR A 1 2  ? 5.798   -1.765  -2.731 1.00 0.00 ? 2  TYR A O    8  
ATOM 4096 C CB   . TYR A 1 2  ? 3.328   -3.359  -4.339 1.00 0.00 ? 2  TYR A CB   8  
ATOM 4097 C CG   . TYR A 1 2  ? 2.157   -4.313  -4.395 1.00 0.00 ? 2  TYR A CG   8  
ATOM 4098 C CD1  . TYR A 1 2  ? 1.192   -4.202  -5.388 1.00 0.00 ? 2  TYR A CD1  8  
ATOM 4099 C CD2  . TYR A 1 2  ? 2.015   -5.326  -3.454 1.00 0.00 ? 2  TYR A CD2  8  
ATOM 4100 C CE1  . TYR A 1 2  ? 0.120   -5.072  -5.443 1.00 0.00 ? 2  TYR A CE1  8  
ATOM 4101 C CE2  . TYR A 1 2  ? 0.948   -6.201  -3.502 1.00 0.00 ? 2  TYR A CE2  8  
ATOM 4102 C CZ   . TYR A 1 2  ? 0.002   -6.070  -4.498 1.00 0.00 ? 2  TYR A CZ   8  
ATOM 4103 O OH   . TYR A 1 2  ? -1.064  -6.938  -4.548 1.00 0.00 ? 2  TYR A OH   8  
ATOM 4104 H H    . TYR A 1 2  ? 2.924   -0.979  -3.380 1.00 0.00 ? 2  TYR A H    8  
ATOM 4105 H HA   . TYR A 1 2  ? 3.281   -3.616  -2.215 1.00 0.00 ? 2  TYR A HA   8  
ATOM 4106 H HB2  . TYR A 1 2  ? 3.080   -2.495  -4.937 1.00 0.00 ? 2  TYR A HB2  8  
ATOM 4107 H HB3  . TYR A 1 2  ? 4.184   -3.857  -4.772 1.00 0.00 ? 2  TYR A HB3  8  
ATOM 4108 H HD1  . TYR A 1 2  ? 1.286   -3.419  -6.127 1.00 0.00 ? 2  TYR A HD1  8  
ATOM 4109 H HD2  . TYR A 1 2  ? 2.758   -5.426  -2.675 1.00 0.00 ? 2  TYR A HD2  8  
ATOM 4110 H HE1  . TYR A 1 2  ? -0.621  -4.969  -6.222 1.00 0.00 ? 2  TYR A HE1  8  
ATOM 4111 H HE2  . TYR A 1 2  ? 0.855   -6.982  -2.762 1.00 0.00 ? 2  TYR A HE2  8  
ATOM 4112 H HH   . TYR A 1 2  ? -1.756  -6.564  -5.098 1.00 0.00 ? 2  TYR A HH   8  
ATOM 4113 N N    . PRO A 1 3  ? 5.826   -4.016  -2.643 1.00 0.00 ? 3  PRO A N    8  
ATOM 4114 C CA   . PRO A 1 3  ? 7.279   -4.122  -2.479 1.00 0.00 ? 3  PRO A CA   8  
ATOM 4115 C C    . PRO A 1 3  ? 8.035   -3.728  -3.743 1.00 0.00 ? 3  PRO A C    8  
ATOM 4116 O O    . PRO A 1 3  ? 8.113   -4.501  -4.698 1.00 0.00 ? 3  PRO A O    8  
ATOM 4117 C CB   . PRO A 1 3  ? 7.493   -5.606  -2.168 1.00 0.00 ? 3  PRO A CB   8  
ATOM 4118 C CG   . PRO A 1 3  ? 6.323   -6.294  -2.781 1.00 0.00 ? 3  PRO A CG   8  
ATOM 4119 C CD   . PRO A 1 3  ? 5.171   -5.334  -2.665 1.00 0.00 ? 3  PRO A CD   8  
ATOM 4120 H HA   . PRO A 1 3  ? 7.630   -3.525  -1.650 1.00 0.00 ? 3  PRO A HA   8  
ATOM 4121 H HB2  . PRO A 1 3  ? 8.423   -5.938  -2.609 1.00 0.00 ? 3  PRO A HB2  8  
ATOM 4122 H HB3  . PRO A 1 3  ? 7.523   -5.753  -1.099 1.00 0.00 ? 3  PRO A HB3  8  
ATOM 4123 H HG2  . PRO A 1 3  ? 6.526   -6.512  -3.818 1.00 0.00 ? 3  PRO A HG2  8  
ATOM 4124 H HG3  . PRO A 1 3  ? 6.108   -7.204  -2.240 1.00 0.00 ? 3  PRO A HG3  8  
ATOM 4125 H HD2  . PRO A 1 3  ? 4.516   -5.425  -3.519 1.00 0.00 ? 3  PRO A HD2  8  
ATOM 4126 H HD3  . PRO A 1 3  ? 4.625   -5.508  -1.749 1.00 0.00 ? 3  PRO A HD3  8  
ATOM 4127 N N    . GLY A 1 4  ? 8.592   -2.521  -3.743 1.00 0.00 ? 4  GLY A N    8  
ATOM 4128 C CA   . GLY A 1 4  ? 9.335   -2.046  -4.895 1.00 0.00 ? 4  GLY A CA   8  
ATOM 4129 C C    . GLY A 1 4  ? 8.548   -1.050  -5.722 1.00 0.00 ? 4  GLY A C    8  
ATOM 4130 O O    . GLY A 1 4  ? 8.875   -0.801  -6.882 1.00 0.00 ? 4  GLY A O    8  
ATOM 4131 H H    . GLY A 1 4  ? 8.498   -1.948  -2.953 1.00 0.00 ? 4  GLY A H    8  
ATOM 4132 H HA2  . GLY A 1 4  ? 10.245  -1.576  -4.554 1.00 0.00 ? 4  GLY A HA2  8  
ATOM 4133 H HA3  . GLY A 1 4  ? 9.590   -2.891  -5.518 1.00 0.00 ? 4  GLY A HA3  8  
ATOM 4134 N N    . GLN A 1 5  ? 7.506   -0.479  -5.125 1.00 0.00 ? 5  GLN A N    8  
ATOM 4135 C CA   . GLN A 1 5  ? 6.669   0.494   -5.816 1.00 0.00 ? 5  GLN A CA   8  
ATOM 4136 C C    . GLN A 1 5  ? 7.372   1.844   -5.916 1.00 0.00 ? 5  GLN A C    8  
ATOM 4137 O O    . GLN A 1 5  ? 8.287   2.152   -5.153 1.00 0.00 ? 5  GLN A O    8  
ATOM 4138 C CB   . GLN A 1 5  ? 5.332   0.654   -5.090 1.00 0.00 ? 5  GLN A CB   8  
ATOM 4139 C CG   . GLN A 1 5  ? 4.387   -0.520  -5.288 1.00 0.00 ? 5  GLN A CG   8  
ATOM 4140 C CD   . GLN A 1 5  ? 2.941   -0.089  -5.427 1.00 0.00 ? 5  GLN A CD   8  
ATOM 4141 O OE1  . GLN A 1 5  ? 2.336   0.410   -4.477 1.00 0.00 ? 5  GLN A OE1  8  
ATOM 4142 N NE2  . GLN A 1 5  ? 2.377   -0.280  -6.614 1.00 0.00 ? 5  GLN A NE2  8  
ATOM 4143 H H    . GLN A 1 5  ? 7.296   -0.719  -4.199 1.00 0.00 ? 5  GLN A H    8  
ATOM 4144 H HA   . GLN A 1 5  ? 6.484   0.123   -6.813 1.00 0.00 ? 5  GLN A HA   8  
ATOM 4145 H HB2  . GLN A 1 5  ? 5.521   0.763   -4.033 1.00 0.00 ? 5  GLN A HB2  8  
ATOM 4146 H HB3  . GLN A 1 5  ? 4.843   1.546   -5.454 1.00 0.00 ? 5  GLN A HB3  8  
ATOM 4147 H HG2  . GLN A 1 5  ? 4.676   -1.051  -6.183 1.00 0.00 ? 5  GLN A HG2  8  
ATOM 4148 H HG3  . GLN A 1 5  ? 4.471   -1.180  -4.437 1.00 0.00 ? 5  GLN A HG3  8  
ATOM 4149 H HE21 . GLN A 1 5  ? 2.920   -0.684  -7.323 1.00 0.00 ? 5  GLN A HE21 8  
ATOM 4150 H HE22 . GLN A 1 5  ? 1.443   -0.011  -6.731 1.00 0.00 ? 5  GLN A HE22 8  
ATOM 4151 N N    . PRO A 1 6  ? 6.935   2.669   -6.880 1.00 0.00 ? 6  PRO A N    8  
ATOM 4152 C CA   . PRO A 1 6  ? 7.509   3.999   -7.103 1.00 0.00 ? 6  PRO A CA   8  
ATOM 4153 C C    . PRO A 1 6  ? 7.169   4.972   -5.979 1.00 0.00 ? 6  PRO A C    8  
ATOM 4154 O O    . PRO A 1 6  ? 6.151   5.662   -6.029 1.00 0.00 ? 6  PRO A O    8  
ATOM 4155 C CB   . PRO A 1 6  ? 6.862   4.449   -8.415 1.00 0.00 ? 6  PRO A CB   8  
ATOM 4156 C CG   . PRO A 1 6  ? 5.582   3.691   -8.485 1.00 0.00 ? 6  PRO A CG   8  
ATOM 4157 C CD   . PRO A 1 6  ? 5.848   2.366   -7.826 1.00 0.00 ? 6  PRO A CD   8  
ATOM 4158 H HA   . PRO A 1 6  ? 8.582   3.953   -7.225 1.00 0.00 ? 6  PRO A HA   8  
ATOM 4159 H HB2  . PRO A 1 6  ? 6.690   5.516   -8.386 1.00 0.00 ? 6  PRO A HB2  8  
ATOM 4160 H HB3  . PRO A 1 6  ? 7.511   4.206   -9.242 1.00 0.00 ? 6  PRO A HB3  8  
ATOM 4161 H HG2  . PRO A 1 6  ? 4.809   4.225   -7.955 1.00 0.00 ? 6  PRO A HG2  8  
ATOM 4162 H HG3  . PRO A 1 6  ? 5.298   3.545   -9.517 1.00 0.00 ? 6  PRO A HG3  8  
ATOM 4163 H HD2  . PRO A 1 6  ? 4.968   2.021   -7.304 1.00 0.00 ? 6  PRO A HD2  8  
ATOM 4164 H HD3  . PRO A 1 6  ? 6.166   1.638   -8.557 1.00 0.00 ? 6  PRO A HD3  8  
ATOM 4165 N N    . GLY A 1 7  ? 8.029   5.024   -4.966 1.00 0.00 ? 7  GLY A N    8  
ATOM 4166 C CA   . GLY A 1 7  ? 7.801   5.917   -3.845 1.00 0.00 ? 7  GLY A CA   8  
ATOM 4167 C C    . GLY A 1 7  ? 7.848   5.197   -2.512 1.00 0.00 ? 7  GLY A C    8  
ATOM 4168 O O    . GLY A 1 7  ? 8.145   5.802   -1.481 1.00 0.00 ? 7  GLY A O    8  
ATOM 4169 H H    . GLY A 1 7  ? 8.824   4.451   -4.980 1.00 0.00 ? 7  GLY A H    8  
ATOM 4170 H HA2  . GLY A 1 7  ? 8.557   6.687   -3.853 1.00 0.00 ? 7  GLY A HA2  8  
ATOM 4171 H HA3  . GLY A 1 7  ? 6.831   6.377   -3.958 1.00 0.00 ? 7  GLY A HA3  8  
ATOM 4172 N N    . CYS A 1 8  ? 7.553   3.901   -2.530 1.00 0.00 ? 8  CYS A N    8  
ATOM 4173 C CA   . CYS A 1 8  ? 7.561   3.097   -1.314 1.00 0.00 ? 8  CYS A CA   8  
ATOM 4174 C C    . CYS A 1 8  ? 8.896   2.377   -1.146 1.00 0.00 ? 8  CYS A C    8  
ATOM 4175 O O    . CYS A 1 8  ? 9.720   2.354   -2.059 1.00 0.00 ? 8  CYS A O    8  
ATOM 4176 C CB   . CYS A 1 8  ? 6.420   2.079   -1.343 1.00 0.00 ? 8  CYS A CB   8  
ATOM 4177 S SG   . CYS A 1 8  ? 5.934   1.459   0.300  1.00 0.00 ? 8  CYS A SG   8  
ATOM 4178 H H    . CYS A 1 8  ? 7.325   3.474   -3.383 1.00 0.00 ? 8  CYS A H    8  
ATOM 4179 H HA   . CYS A 1 8  ? 7.417   3.762   -0.476 1.00 0.00 ? 8  CYS A HA   8  
ATOM 4180 H HB2  . CYS A 1 8  ? 5.550   2.538   -1.791 1.00 0.00 ? 8  CYS A HB2  8  
ATOM 4181 H HB3  . CYS A 1 8  ? 6.720   1.230   -1.940 1.00 0.00 ? 8  CYS A HB3  8  
ATOM 4182 N N    . GLY A 1 9  ? 9.102   1.789   0.029  1.00 0.00 ? 9  GLY A N    8  
ATOM 4183 C CA   . GLY A 1 9  ? 10.337  1.076   0.295  1.00 0.00 ? 9  GLY A CA   8  
ATOM 4184 C C    . GLY A 1 9  ? 10.394  0.520   1.704  1.00 0.00 ? 9  GLY A C    8  
ATOM 4185 O O    . GLY A 1 9  ? 9.451   0.679   2.480  1.00 0.00 ? 9  GLY A O    8  
ATOM 4186 H H    . GLY A 1 9  ? 8.409   1.840   0.720  1.00 0.00 ? 9  GLY A H    8  
ATOM 4187 H HA2  . GLY A 1 9  ? 10.427  0.260   -0.406 1.00 0.00 ? 9  GLY A HA2  8  
ATOM 4188 H HA3  . GLY A 1 9  ? 11.167  1.752   0.154  1.00 0.00 ? 9  GLY A HA3  8  
ATOM 4189 N N    . HIS A 1 10 ? 11.502  -0.135  2.037  1.00 0.00 ? 10 HIS A N    8  
ATOM 4190 C CA   . HIS A 1 10 ? 11.677  -0.717  3.362  1.00 0.00 ? 10 HIS A CA   8  
ATOM 4191 C C    . HIS A 1 10 ? 11.786  0.373   4.424  1.00 0.00 ? 10 HIS A C    8  
ATOM 4192 O O    . HIS A 1 10 ? 12.670  1.228   4.363  1.00 0.00 ? 10 HIS A O    8  
ATOM 4193 C CB   . HIS A 1 10 ? 12.924  -1.602  3.393  1.00 0.00 ? 10 HIS A CB   8  
ATOM 4194 C CG   . HIS A 1 10 ? 13.159  -2.258  4.718  1.00 0.00 ? 10 HIS A CG   8  
ATOM 4195 N ND1  . HIS A 1 10 ? 12.142  -2.574  5.593  1.00 0.00 ? 10 HIS A ND1  8  
ATOM 4196 C CD2  . HIS A 1 10 ? 14.305  -2.661  5.316  1.00 0.00 ? 10 HIS A CD2  8  
ATOM 4197 C CE1  . HIS A 1 10 ? 12.651  -3.141  6.672  1.00 0.00 ? 10 HIS A CE1  8  
ATOM 4198 N NE2  . HIS A 1 10 ? 13.963  -3.206  6.529  1.00 0.00 ? 10 HIS A NE2  8  
ATOM 4199 H H    . HIS A 1 10 ? 12.218  -0.228  1.375  1.00 0.00 ? 10 HIS A H    8  
ATOM 4200 H HA   . HIS A 1 10 ? 10.810  -1.324  3.575  1.00 0.00 ? 10 HIS A HA   8  
ATOM 4201 H HB2  . HIS A 1 10 ? 12.823  -2.380  2.651  1.00 0.00 ? 10 HIS A HB2  8  
ATOM 4202 H HB3  . HIS A 1 10 ? 13.790  -1.000  3.161  1.00 0.00 ? 10 HIS A HB3  8  
ATOM 4203 H HD1  . HIS A 1 10 ? 11.188  -2.407  5.446  1.00 0.00 ? 10 HIS A HD1  8  
ATOM 4204 H HD2  . HIS A 1 10 ? 15.305  -2.570  4.913  1.00 0.00 ? 10 HIS A HD2  8  
ATOM 4205 H HE1  . HIS A 1 10 ? 12.092  -3.492  7.526  1.00 0.00 ? 10 HIS A HE1  8  
ATOM 4206 N N    . CYS A 1 11 ? 10.881  0.337   5.397  1.00 0.00 ? 11 CYS A N    8  
ATOM 4207 C CA   . CYS A 1 11 ? 10.874  1.322   6.472  1.00 0.00 ? 11 CYS A CA   8  
ATOM 4208 C C    . CYS A 1 11 ? 12.140  1.214   7.317  1.00 0.00 ? 11 CYS A C    8  
ATOM 4209 O O    . CYS A 1 11 ? 12.856  0.214   7.257  1.00 0.00 ? 11 CYS A O    8  
ATOM 4210 C CB   . CYS A 1 11 ? 9.640   1.134   7.356  1.00 0.00 ? 11 CYS A CB   8  
ATOM 4211 S SG   . CYS A 1 11 ? 9.526   -0.510  8.133  1.00 0.00 ? 11 CYS A SG   8  
ATOM 4212 H H    . CYS A 1 11 ? 10.200  -0.369  5.392  1.00 0.00 ? 11 CYS A H    8  
ATOM 4213 H HA   . CYS A 1 11 ? 10.838  2.303   6.023  1.00 0.00 ? 11 CYS A HA   8  
ATOM 4214 H HB2  . CYS A 1 11 ? 9.658   1.869   8.147  1.00 0.00 ? 11 CYS A HB2  8  
ATOM 4215 H HB3  . CYS A 1 11 ? 8.752   1.278   6.758  1.00 0.00 ? 11 CYS A HB3  8  
ATOM 4216 N N    . SER A 1 12 ? 12.410  2.250   8.104  1.00 0.00 ? 12 SER A N    8  
ATOM 4217 C CA   . SER A 1 12 ? 13.591  2.274   8.959  1.00 0.00 ? 12 SER A CA   8  
ATOM 4218 C C    . SER A 1 12 ? 13.342  3.116   10.207 1.00 0.00 ? 12 SER A C    8  
ATOM 4219 O O    . SER A 1 12 ? 12.611  4.106   10.165 1.00 0.00 ? 12 SER A O    8  
ATOM 4220 C CB   . SER A 1 12 ? 14.793  2.825   8.189  1.00 0.00 ? 12 SER A CB   8  
ATOM 4221 O OG   . SER A 1 12 ? 15.836  1.868   8.119  1.00 0.00 ? 12 SER A OG   8  
ATOM 4222 H H    . SER A 1 12 ? 11.801  3.018   8.108  1.00 0.00 ? 12 SER A H    8  
ATOM 4223 H HA   . SER A 1 12 ? 13.802  1.259   9.261  1.00 0.00 ? 12 SER A HA   8  
ATOM 4224 H HB2  . SER A 1 12 ? 14.488  3.081   7.186  1.00 0.00 ? 12 SER A HB2  8  
ATOM 4225 H HB3  . SER A 1 12 ? 15.163  3.708   8.690  1.00 0.00 ? 12 SER A HB3  8  
ATOM 4226 H HG   . SER A 1 12 ? 16.682  2.319   8.080  1.00 0.00 ? 12 SER A HG   8  
ATOM 4227 N N    . ARG A 1 13 ? 13.956  2.716   11.315 1.00 0.00 ? 13 ARG A N    8  
ATOM 4228 C CA   . ARG A 1 13 ? 13.801  3.433   12.575 1.00 0.00 ? 13 ARG A CA   8  
ATOM 4229 C C    . ARG A 1 13 ? 13.796  4.942   12.346 1.00 0.00 ? 13 ARG A C    8  
ATOM 4230 O O    . ARG A 1 13 ? 14.474  5.461   11.459 1.00 0.00 ? 13 ARG A O    8  
ATOM 4231 C CB   . ARG A 1 13 ? 14.925  3.057   13.542 1.00 0.00 ? 13 ARG A CB   8  
ATOM 4232 C CG   . ARG A 1 13 ? 14.892  1.601   13.977 1.00 0.00 ? 13 ARG A CG   8  
ATOM 4233 C CD   . ARG A 1 13 ? 16.187  1.195   14.664 1.00 0.00 ? 13 ARG A CD   8  
ATOM 4234 N NE   . ARG A 1 13 ? 16.146  1.448   16.102 1.00 0.00 ? 13 ARG A NE   8  
ATOM 4235 C CZ   . ARG A 1 13 ? 16.419  2.628   16.648 1.00 0.00 ? 13 ARG A CZ   8  
ATOM 4236 N NH1  . ARG A 1 13 ? 16.749  3.658   15.881 1.00 0.00 ? 13 ARG A NH1  8  
ATOM 4237 N NH2  . ARG A 1 13 ? 16.360  2.780   17.965 1.00 0.00 ? 13 ARG A NH2  8  
ATOM 4238 H H    . ARG A 1 13 ? 14.526  1.920   11.286 1.00 0.00 ? 13 ARG A H    8  
ATOM 4239 H HA   . ARG A 1 13 ? 12.855  3.144   13.007 1.00 0.00 ? 13 ARG A HA   8  
ATOM 4240 H HB2  . ARG A 1 13 ? 15.874  3.245   13.063 1.00 0.00 ? 13 ARG A HB2  8  
ATOM 4241 H HB3  . ARG A 1 13 ? 14.847  3.675   14.424 1.00 0.00 ? 13 ARG A HB3  8  
ATOM 4242 H HG2  . ARG A 1 13 ? 14.073  1.458   14.666 1.00 0.00 ? 13 ARG A HG2  8  
ATOM 4243 H HG3  . ARG A 1 13 ? 14.746  0.978   13.107 1.00 0.00 ? 13 ARG A HG3  8  
ATOM 4244 H HD2  . ARG A 1 13 ? 16.352  0.141   14.499 1.00 0.00 ? 13 ARG A HD2  8  
ATOM 4245 H HD3  . ARG A 1 13 ? 17.000  1.759   14.231 1.00 0.00 ? 13 ARG A HD3  8  
ATOM 4246 H HE   . ARG A 1 13 ? 15.905  0.701   16.688 1.00 0.00 ? 13 ARG A HE   8  
ATOM 4247 H HH11 . ARG A 1 13 ? 16.793  3.546   14.888 1.00 0.00 ? 13 ARG A HH11 8  
ATOM 4248 H HH12 . ARG A 1 13 ? 16.952  4.545   16.295 1.00 0.00 ? 13 ARG A HH12 8  
ATOM 4249 H HH21 . ARG A 1 13 ? 16.111  2.006   18.547 1.00 0.00 ? 13 ARG A HH21 8  
ATOM 4250 H HH22 . ARG A 1 13 ? 16.565  3.668   18.375 1.00 0.00 ? 13 ARG A HH22 8  
ATOM 4251 N N    . PRO A 1 14 ? 13.014  5.662   13.163 1.00 0.00 ? 14 PRO A N    8  
ATOM 4252 C CA   . PRO A 1 14 ? 12.203  5.055   14.222 1.00 0.00 ? 14 PRO A CA   8  
ATOM 4253 C C    . PRO A 1 14 ? 11.040  4.241   13.666 1.00 0.00 ? 14 PRO A C    8  
ATOM 4254 O O    . PRO A 1 14 ? 10.119  3.878   14.397 1.00 0.00 ? 14 PRO A O    8  
ATOM 4255 C CB   . PRO A 1 14 ? 11.685  6.261   15.009 1.00 0.00 ? 14 PRO A CB   8  
ATOM 4256 C CG   . PRO A 1 14 ? 11.695  7.384   14.030 1.00 0.00 ? 14 PRO A CG   8  
ATOM 4257 C CD   . PRO A 1 14 ? 12.862  7.126   13.116 1.00 0.00 ? 14 PRO A CD   8  
ATOM 4258 H HA   . PRO A 1 14 ? 12.800  4.430   14.871 1.00 0.00 ? 14 PRO A HA   8  
ATOM 4259 H HB2  . PRO A 1 14 ? 10.685  6.058   15.367 1.00 0.00 ? 14 PRO A HB2  8  
ATOM 4260 H HB3  . PRO A 1 14 ? 12.339  6.460   15.844 1.00 0.00 ? 14 PRO A HB3  8  
ATOM 4261 H HG2  . PRO A 1 14 ? 10.774  7.391   13.468 1.00 0.00 ? 14 PRO A HG2  8  
ATOM 4262 H HG3  . PRO A 1 14 ? 11.827  8.322   14.549 1.00 0.00 ? 14 PRO A HG3  8  
ATOM 4263 H HD2  . PRO A 1 14 ? 12.636  7.458   12.114 1.00 0.00 ? 14 PRO A HD2  8  
ATOM 4264 H HD3  . PRO A 1 14 ? 13.748  7.618   13.489 1.00 0.00 ? 14 PRO A HD3  8  
ATOM 4265 N N    . ASN A 1 15 ? 11.088  3.957   12.369 1.00 0.00 ? 15 ASN A N    8  
ATOM 4266 C CA   . ASN A 1 15 ? 10.037  3.186   11.715 1.00 0.00 ? 15 ASN A CA   8  
ATOM 4267 C C    . ASN A 1 15 ? 10.274  1.689   11.886 1.00 0.00 ? 15 ASN A C    8  
ATOM 4268 O O    . ASN A 1 15 ? 11.415  1.226   11.885 1.00 0.00 ? 15 ASN A O    8  
ATOM 4269 C CB   . ASN A 1 15 ? 9.970   3.536   10.227 1.00 0.00 ? 15 ASN A CB   8  
ATOM 4270 C CG   . ASN A 1 15 ? 10.251  5.003   9.964  1.00 0.00 ? 15 ASN A CG   8  
ATOM 4271 O OD1  . ASN A 1 15 ? 10.007  5.856   10.818 1.00 0.00 ? 15 ASN A OD1  8  
ATOM 4272 N ND2  . ASN A 1 15 ? 10.768  5.303   8.778  1.00 0.00 ? 15 ASN A ND2  8  
ATOM 4273 H H    . ASN A 1 15 ? 11.849  4.274   11.838 1.00 0.00 ? 15 ASN A H    8  
ATOM 4274 H HA   . ASN A 1 15 ? 9.098   3.446   12.179 1.00 0.00 ? 15 ASN A HA   8  
ATOM 4275 H HB2  . ASN A 1 15 ? 10.701  2.948   9.692  1.00 0.00 ? 15 ASN A HB2  8  
ATOM 4276 H HB3  . ASN A 1 15 ? 8.984   3.305   9.853  1.00 0.00 ? 15 ASN A HB3  8  
ATOM 4277 H HD21 . ASN A 1 15 ? 10.936  4.572   8.148  1.00 0.00 ? 15 ASN A HD21 8  
ATOM 4278 H HD22 . ASN A 1 15 ? 10.960  6.244   8.583  1.00 0.00 ? 15 ASN A HD22 8  
ATOM 4279 N N    . TYR A 1 16 ? 9.189   0.937   12.033 1.00 0.00 ? 16 TYR A N    8  
ATOM 4280 C CA   . TYR A 1 16 ? 9.279   -0.508  12.208 1.00 0.00 ? 16 TYR A CA   8  
ATOM 4281 C C    . TYR A 1 16 ? 8.128   -1.215  11.497 1.00 0.00 ? 16 TYR A C    8  
ATOM 4282 O O    . TYR A 1 16 ? 7.350   -0.589  10.777 1.00 0.00 ? 16 TYR A O    8  
ATOM 4283 C CB   . TYR A 1 16 ? 9.270   -0.865  13.695 1.00 0.00 ? 16 TYR A CB   8  
ATOM 4284 C CG   . TYR A 1 16 ? 7.928   -0.655  14.360 1.00 0.00 ? 16 TYR A CG   8  
ATOM 4285 C CD1  . TYR A 1 16 ? 7.486   0.620   14.690 1.00 0.00 ? 16 TYR A CD1  8  
ATOM 4286 C CD2  . TYR A 1 16 ? 7.103   -1.732  14.659 1.00 0.00 ? 16 TYR A CD2  8  
ATOM 4287 C CE1  . TYR A 1 16 ? 6.262   0.817   15.298 1.00 0.00 ? 16 TYR A CE1  8  
ATOM 4288 C CE2  . TYR A 1 16 ? 5.876   -1.545  15.266 1.00 0.00 ? 16 TYR A CE2  8  
ATOM 4289 C CZ   . TYR A 1 16 ? 5.460   -0.269  15.584 1.00 0.00 ? 16 TYR A CZ   8  
ATOM 4290 O OH   . TYR A 1 16 ? 4.239   -0.078  16.190 1.00 0.00 ? 16 TYR A OH   8  
ATOM 4291 H H    . TYR A 1 16 ? 8.307   1.363   12.026 1.00 0.00 ? 16 TYR A H    8  
ATOM 4292 H HA   . TYR A 1 16 ? 10.212  -0.837  11.774 1.00 0.00 ? 16 TYR A HA   8  
ATOM 4293 H HB2  . TYR A 1 16 ? 9.538   -1.903  13.811 1.00 0.00 ? 16 TYR A HB2  8  
ATOM 4294 H HB3  . TYR A 1 16 ? 9.995   -0.251  14.210 1.00 0.00 ? 16 TYR A HB3  8  
ATOM 4295 H HD1  . TYR A 1 16 ? 8.116   1.469   14.465 1.00 0.00 ? 16 TYR A HD1  8  
ATOM 4296 H HD2  . TYR A 1 16 ? 7.432   -2.730  14.409 1.00 0.00 ? 16 TYR A HD2  8  
ATOM 4297 H HE1  . TYR A 1 16 ? 5.935   1.816   15.547 1.00 0.00 ? 16 TYR A HE1  8  
ATOM 4298 H HE2  . TYR A 1 16 ? 5.248   -2.395  15.490 1.00 0.00 ? 16 TYR A HE2  8  
ATOM 4299 H HH   . TYR A 1 16 ? 4.373   0.185   17.103 1.00 0.00 ? 16 TYR A HH   8  
ATOM 4300 N N    . CYS A 1 17 ? 8.028   -2.523  11.705 1.00 0.00 ? 17 CYS A N    8  
ATOM 4301 C CA   . CYS A 1 17 ? 6.974   -3.318  11.085 1.00 0.00 ? 17 CYS A CA   8  
ATOM 4302 C C    . CYS A 1 17 ? 5.751   -3.401  11.994 1.00 0.00 ? 17 CYS A C    8  
ATOM 4303 O O    . CYS A 1 17 ? 5.874   -3.623  13.198 1.00 0.00 ? 17 CYS A O    8  
ATOM 4304 C CB   . CYS A 1 17 ? 7.486   -4.725  10.770 1.00 0.00 ? 17 CYS A CB   8  
ATOM 4305 S SG   . CYS A 1 17 ? 8.089   -4.931  9.064  1.00 0.00 ? 17 CYS A SG   8  
ATOM 4306 H H    . CYS A 1 17 ? 8.679   -2.966  12.290 1.00 0.00 ? 17 CYS A H    8  
ATOM 4307 H HA   . CYS A 1 17 ? 6.691   -2.832  10.164 1.00 0.00 ? 17 CYS A HA   8  
ATOM 4308 H HB2  . CYS A 1 17 ? 8.302   -4.960  11.438 1.00 0.00 ? 17 CYS A HB2  8  
ATOM 4309 H HB3  . CYS A 1 17 ? 6.686   -5.433  10.925 1.00 0.00 ? 17 CYS A HB3  8  
ATOM 4310 N N    . GLU A 1 18 ? 4.571   -3.222  11.406 1.00 0.00 ? 18 GLU A N    8  
ATOM 4311 C CA   . GLU A 1 18 ? 3.326   -3.276  12.163 1.00 0.00 ? 18 GLU A CA   8  
ATOM 4312 C C    . GLU A 1 18 ? 2.196   -3.848  11.311 1.00 0.00 ? 18 GLU A C    8  
ATOM 4313 O O    . GLU A 1 18 ? 1.677   -3.179  10.419 1.00 0.00 ? 18 GLU A O    8  
ATOM 4314 C CB   . GLU A 1 18 ? 2.946   -1.881  12.664 1.00 0.00 ? 18 GLU A CB   8  
ATOM 4315 C CG   . GLU A 1 18 ? 1.962   -1.897  13.822 1.00 0.00 ? 18 GLU A CG   8  
ATOM 4316 C CD   . GLU A 1 18 ? 2.098   -3.136  14.685 1.00 0.00 ? 18 GLU A CD   8  
ATOM 4317 O OE1  . GLU A 1 18 ? 1.469   -4.163  14.352 1.00 0.00 ? 18 GLU A OE1  8  
ATOM 4318 O OE2  . GLU A 1 18 ? 2.832   -3.080  15.694 1.00 0.00 ? 18 GLU A OE2  8  
ATOM 4319 H H    . GLU A 1 18 ? 4.538   -3.049  10.443 1.00 0.00 ? 18 GLU A H    8  
ATOM 4320 H HA   . GLU A 1 18 ? 3.482   -3.923  13.013 1.00 0.00 ? 18 GLU A HA   8  
ATOM 4321 H HB2  . GLU A 1 18 ? 3.842   -1.371  12.985 1.00 0.00 ? 18 GLU A HB2  8  
ATOM 4322 H HB3  . GLU A 1 18 ? 2.501   -1.329  11.849 1.00 0.00 ? 18 GLU A HB3  8  
ATOM 4323 H HG2  . GLU A 1 18 ? 2.137   -1.028  14.437 1.00 0.00 ? 18 GLU A HG2  8  
ATOM 4324 H HG3  . GLU A 1 18 ? 0.958   -1.861  13.425 1.00 0.00 ? 18 GLU A HG3  8  
ATOM 4325 N N    . GLY A 1 19 ? 1.822   -5.093  11.593 1.00 0.00 ? 19 GLY A N    8  
ATOM 4326 C CA   . GLY A 1 19 ? 0.758   -5.735  10.844 1.00 0.00 ? 19 GLY A CA   8  
ATOM 4327 C C    . GLY A 1 19 ? -0.598  -5.560  11.499 1.00 0.00 ? 19 GLY A C    8  
ATOM 4328 O O    . GLY A 1 19 ? -1.594  -6.119  11.038 1.00 0.00 ? 19 GLY A O    8  
ATOM 4329 H H    . GLY A 1 19 ? 2.273   -5.579  12.315 1.00 0.00 ? 19 GLY A H    8  
ATOM 4330 H HA2  . GLY A 1 19 ? 0.724   -5.311  9.852  1.00 0.00 ? 19 GLY A HA2  8  
ATOM 4331 H HA3  . GLY A 1 19 ? 0.974   -6.790  10.767 1.00 0.00 ? 19 GLY A HA3  8  
ATOM 4332 N N    . ALA A 1 20 ? -0.638  -4.784  12.577 1.00 0.00 ? 20 ALA A N    8  
ATOM 4333 C CA   . ALA A 1 20 ? -1.882  -4.537  13.296 1.00 0.00 ? 20 ALA A CA   8  
ATOM 4334 C C    . ALA A 1 20 ? -2.159  -3.043  13.417 1.00 0.00 ? 20 ALA A C    8  
ATOM 4335 O O    . ALA A 1 20 ? -3.012  -2.501  12.713 1.00 0.00 ? 20 ALA A O    8  
ATOM 4336 C CB   . ALA A 1 20 ? -1.831  -5.180  14.674 1.00 0.00 ? 20 ALA A CB   8  
ATOM 4337 H H    . ALA A 1 20 ? 0.189   -4.366  12.896 1.00 0.00 ? 20 ALA A H    8  
ATOM 4338 H HA   . ALA A 1 20 ? -2.686  -4.998  12.740 1.00 0.00 ? 20 ALA A HA   8  
ATOM 4339 H HB1  . ALA A 1 20 ? -2.437  -4.606  15.360 1.00 0.00 ? 20 ALA A HB1  8  
ATOM 4340 H HB2  . ALA A 1 20 ? -2.212  -6.189  14.614 1.00 0.00 ? 20 ALA A HB2  8  
ATOM 4341 H HB3  . ALA A 1 20 ? -0.810  -5.200  15.024 1.00 0.00 ? 20 ALA A HB3  8  
ATOM 4342 N N    . ARG A 1 21 ? -1.434  -2.382  14.313 1.00 0.00 ? 21 ARG A N    8  
ATOM 4343 C CA   . ARG A 1 21 ? -1.603  -0.950  14.527 1.00 0.00 ? 21 ARG A CA   8  
ATOM 4344 C C    . ARG A 1 21 ? -0.403  -0.365  15.267 1.00 0.00 ? 21 ARG A C    8  
ATOM 4345 O O    . ARG A 1 21 ? 0.164   -1.003  16.154 1.00 0.00 ? 21 ARG A O    8  
ATOM 4346 C CB   . ARG A 1 21 ? -2.885  -0.679  15.318 1.00 0.00 ? 21 ARG A CB   8  
ATOM 4347 C CG   . ARG A 1 21 ? -3.890  0.182   14.571 1.00 0.00 ? 21 ARG A CG   8  
ATOM 4348 C CD   . ARG A 1 21 ? -5.013  0.648   15.485 1.00 0.00 ? 21 ARG A CD   8  
ATOM 4349 N NE   . ARG A 1 21 ? -5.348  2.053   15.269 1.00 0.00 ? 21 ARG A NE   8  
ATOM 4350 C CZ   . ARG A 1 21 ? -5.848  2.522   14.132 1.00 0.00 ? 21 ARG A CZ   8  
ATOM 4351 N NH1  . ARG A 1 21 ? -6.070  1.703   13.113 1.00 0.00 ? 21 ARG A NH1  8  
ATOM 4352 N NH2  . ARG A 1 21 ? -6.127  3.814   14.012 1.00 0.00 ? 21 ARG A NH2  8  
ATOM 4353 H H    . ARG A 1 21 ? -0.769  -2.869  14.844 1.00 0.00 ? 21 ARG A H    8  
ATOM 4354 H HA   . ARG A 1 21 ? -1.681  -0.477  13.560 1.00 0.00 ? 21 ARG A HA   8  
ATOM 4355 H HB2  . ARG A 1 21 ? -3.356  -1.622  15.552 1.00 0.00 ? 21 ARG A HB2  8  
ATOM 4356 H HB3  . ARG A 1 21 ? -2.626  -0.177  16.237 1.00 0.00 ? 21 ARG A HB3  8  
ATOM 4357 H HG2  . ARG A 1 21 ? -3.383  1.048   14.173 1.00 0.00 ? 21 ARG A HG2  8  
ATOM 4358 H HG3  . ARG A 1 21 ? -4.312  -0.394  13.761 1.00 0.00 ? 21 ARG A HG3  8  
ATOM 4359 H HD2  . ARG A 1 21 ? -5.888  0.045   15.294 1.00 0.00 ? 21 ARG A HD2  8  
ATOM 4360 H HD3  . ARG A 1 21 ? -4.702  0.514   16.511 1.00 0.00 ? 21 ARG A HD3  8  
ATOM 4361 H HE   . ARG A 1 21 ? -5.191  2.675   16.009 1.00 0.00 ? 21 ARG A HE   8  
ATOM 4362 H HH11 . ARG A 1 21 ? -5.861  0.730   13.201 1.00 0.00 ? 21 ARG A HH11 8  
ATOM 4363 H HH12 . ARG A 1 21 ? -6.448  2.060   12.258 1.00 0.00 ? 21 ARG A HH12 8  
ATOM 4364 H HH21 . ARG A 1 21 ? -5.961  4.434   14.778 1.00 0.00 ? 21 ARG A HH21 8  
ATOM 4365 H HH22 . ARG A 1 21 ? -6.503  4.167   13.156 1.00 0.00 ? 21 ARG A HH22 8  
ATOM 4366 N N    . CYS A 1 22 ? -0.022  0.853   14.895 1.00 0.00 ? 22 CYS A N    8  
ATOM 4367 C CA   . CYS A 1 22 ? 1.110   1.524   15.521 1.00 0.00 ? 22 CYS A CA   8  
ATOM 4368 C C    . CYS A 1 22 ? 0.914   1.628   17.031 1.00 0.00 ? 22 CYS A C    8  
ATOM 4369 O O    . CYS A 1 22 ? -0.204  1.814   17.510 1.00 0.00 ? 22 CYS A O    8  
ATOM 4370 C CB   . CYS A 1 22 ? 1.296   2.920   14.923 1.00 0.00 ? 22 CYS A CB   8  
ATOM 4371 S SG   . CYS A 1 22 ? 1.338   2.949   13.102 1.00 0.00 ? 22 CYS A SG   8  
ATOM 4372 H H    . CYS A 1 22 ? -0.515  1.311   14.181 1.00 0.00 ? 22 CYS A H    8  
ATOM 4373 H HA   . CYS A 1 22 ? 1.994   0.937   15.325 1.00 0.00 ? 22 CYS A HA   8  
ATOM 4374 H HB2  . CYS A 1 22 ? 0.480   3.552   15.242 1.00 0.00 ? 22 CYS A HB2  8  
ATOM 4375 H HB3  . CYS A 1 22 ? 2.227   3.335   15.281 1.00 0.00 ? 22 CYS A HB3  8  
ATOM 4376 N N    . GLU A 1 23 ? 2.010   1.507   17.774 1.00 0.00 ? 23 GLU A N    8  
ATOM 4377 C CA   . GLU A 1 23 ? 1.957   1.586   19.229 1.00 0.00 ? 23 GLU A CA   8  
ATOM 4378 C C    . GLU A 1 23 ? 1.627   3.005   19.685 1.00 0.00 ? 23 GLU A C    8  
ATOM 4379 O O    . GLU A 1 23 ? 1.825   3.968   18.944 1.00 0.00 ? 23 GLU A O    8  
ATOM 4380 C CB   . GLU A 1 23 ? 3.290   1.141   19.835 1.00 0.00 ? 23 GLU A CB   8  
ATOM 4381 C CG   . GLU A 1 23 ? 4.480   1.952   19.349 1.00 0.00 ? 23 GLU A CG   8  
ATOM 4382 C CD   . GLU A 1 23 ? 5.752   1.130   19.268 1.00 0.00 ? 23 GLU A CD   8  
ATOM 4383 O OE1  . GLU A 1 23 ? 6.347   0.853   20.330 1.00 0.00 ? 23 GLU A OE1  8  
ATOM 4384 O OE2  . GLU A 1 23 ? 6.152   0.764   18.143 1.00 0.00 ? 23 GLU A OE2  8  
ATOM 4385 H H    . GLU A 1 23 ? 2.873   1.360   17.334 1.00 0.00 ? 23 GLU A H    8  
ATOM 4386 H HA   . GLU A 1 23 ? 1.178   0.921   19.570 1.00 0.00 ? 23 GLU A HA   8  
ATOM 4387 H HB2  . GLU A 1 23 ? 3.233   1.233   20.909 1.00 0.00 ? 23 GLU A HB2  8  
ATOM 4388 H HB3  . GLU A 1 23 ? 3.459   0.106   19.580 1.00 0.00 ? 23 GLU A HB3  8  
ATOM 4389 H HG2  . GLU A 1 23 ? 4.258   2.340   18.366 1.00 0.00 ? 23 GLU A HG2  8  
ATOM 4390 H HG3  . GLU A 1 23 ? 4.643   2.773   20.031 1.00 0.00 ? 23 GLU A HG3  8  
ATOM 4391 N N    . SER A 1 24 ? 1.123   3.125   20.909 1.00 0.00 ? 24 SER A N    8  
ATOM 4392 C CA   . SER A 1 24 ? 0.761   4.424   21.463 1.00 0.00 ? 24 SER A CA   8  
ATOM 4393 C C    . SER A 1 24 ? 1.956   5.372   21.450 1.00 0.00 ? 24 SER A C    8  
ATOM 4394 O O    . SER A 1 24 ? 2.631   5.552   22.463 1.00 0.00 ? 24 SER A O    8  
ATOM 4395 C CB   . SER A 1 24 ? 0.237   4.265   22.891 1.00 0.00 ? 24 SER A CB   8  
ATOM 4396 O OG   . SER A 1 24 ? -1.179  4.213   22.912 1.00 0.00 ? 24 SER A OG   8  
ATOM 4397 H H    . SER A 1 24 ? 0.989   2.319   21.451 1.00 0.00 ? 24 SER A H    8  
ATOM 4398 H HA   . SER A 1 24 ? -0.021  4.841   20.846 1.00 0.00 ? 24 SER A HA   8  
ATOM 4399 H HB2  . SER A 1 24 ? 0.625   3.351   23.315 1.00 0.00 ? 24 SER A HB2  8  
ATOM 4400 H HB3  . SER A 1 24 ? 0.563   5.105   23.487 1.00 0.00 ? 24 SER A HB3  8  
ATOM 4401 H HG   . SER A 1 24 ? -1.535  4.999   22.492 1.00 0.00 ? 24 SER A HG   8  
ATOM 4402 N N    . GLY A 1 25 ? 2.212   5.977   20.294 1.00 0.00 ? 25 GLY A N    8  
ATOM 4403 C CA   . GLY A 1 25 ? 3.325   6.899   20.170 1.00 0.00 ? 25 GLY A CA   8  
ATOM 4404 C C    . GLY A 1 25 ? 3.828   7.012   18.744 1.00 0.00 ? 25 GLY A C    8  
ATOM 4405 O O    . GLY A 1 25 ? 4.418   8.024   18.365 1.00 0.00 ? 25 GLY A O    8  
ATOM 4406 H H    . GLY A 1 25 ? 1.640   5.795   19.519 1.00 0.00 ? 25 GLY A H    8  
ATOM 4407 H HA2  . GLY A 1 25 ? 3.010   7.875   20.508 1.00 0.00 ? 25 GLY A HA2  8  
ATOM 4408 H HA3  . GLY A 1 25 ? 4.134   6.556   20.798 1.00 0.00 ? 25 GLY A HA3  8  
ATOM 4409 N N    . PHE A 1 26 ? 3.597   5.970   17.952 1.00 0.00 ? 26 PHE A N    8  
ATOM 4410 C CA   . PHE A 1 26 ? 4.033   5.956   16.561 1.00 0.00 ? 26 PHE A CA   8  
ATOM 4411 C C    . PHE A 1 26 ? 2.897   6.372   15.631 1.00 0.00 ? 26 PHE A C    8  
ATOM 4412 O O    . PHE A 1 26 ? 1.782   6.643   16.077 1.00 0.00 ? 26 PHE A O    8  
ATOM 4413 C CB   . PHE A 1 26 ? 4.537   4.563   16.177 1.00 0.00 ? 26 PHE A CB   8  
ATOM 4414 C CG   . PHE A 1 26 ? 5.787   4.156   16.904 1.00 0.00 ? 26 PHE A CG   8  
ATOM 4415 C CD1  . PHE A 1 26 ? 6.936   3.827   16.204 1.00 0.00 ? 26 PHE A CD1  8  
ATOM 4416 C CD2  . PHE A 1 26 ? 5.812   4.103   18.289 1.00 0.00 ? 26 PHE A CD2  8  
ATOM 4417 C CE1  . PHE A 1 26 ? 8.088   3.453   16.870 1.00 0.00 ? 26 PHE A CE1  8  
ATOM 4418 C CE2  . PHE A 1 26 ? 6.961   3.730   18.960 1.00 0.00 ? 26 PHE A CE2  8  
ATOM 4419 C CZ   . PHE A 1 26 ? 8.100   3.403   18.250 1.00 0.00 ? 26 PHE A CZ   8  
ATOM 4420 H H    . PHE A 1 26 ? 3.121   5.192   18.313 1.00 0.00 ? 26 PHE A H    8  
ATOM 4421 H HA   . PHE A 1 26 ? 4.842   6.662   16.461 1.00 0.00 ? 26 PHE A HA   8  
ATOM 4422 H HB2  . PHE A 1 26 ? 3.771   3.836   16.403 1.00 0.00 ? 26 PHE A HB2  8  
ATOM 4423 H HB3  . PHE A 1 26 ? 4.746   4.543   15.118 1.00 0.00 ? 26 PHE A HB3  8  
ATOM 4424 H HD1  . PHE A 1 26 ? 6.927   3.865   15.123 1.00 0.00 ? 26 PHE A HD1  8  
ATOM 4425 H HD2  . PHE A 1 26 ? 4.922   4.357   18.846 1.00 0.00 ? 26 PHE A HD2  8  
ATOM 4426 H HE1  . PHE A 1 26 ? 8.976   3.198   16.311 1.00 0.00 ? 26 PHE A HE1  8  
ATOM 4427 H HE2  . PHE A 1 26 ? 6.968   3.692   20.039 1.00 0.00 ? 26 PHE A HE2  8  
ATOM 4428 H HZ   . PHE A 1 26 ? 8.999   3.112   18.772 1.00 0.00 ? 26 PHE A HZ   8  
ATOM 4429 N N    . HIS A 1 27 ? 3.190   6.421   14.335 1.00 0.00 ? 27 HIS A N    8  
ATOM 4430 C CA   . HIS A 1 27 ? 2.194   6.804   13.340 1.00 0.00 ? 27 HIS A CA   8  
ATOM 4431 C C    . HIS A 1 27 ? 2.275   5.900   12.114 1.00 0.00 ? 27 HIS A C    8  
ATOM 4432 O O    . HIS A 1 27 ? 3.361   5.625   11.604 1.00 0.00 ? 27 HIS A O    8  
ATOM 4433 C CB   . HIS A 1 27 ? 2.392   8.263   12.926 1.00 0.00 ? 27 HIS A CB   8  
ATOM 4434 C CG   . HIS A 1 27 ? 3.830   8.670   12.835 1.00 0.00 ? 27 HIS A CG   8  
ATOM 4435 N ND1  . HIS A 1 27 ? 4.486   9.347   13.841 1.00 0.00 ? 27 HIS A ND1  8  
ATOM 4436 C CD2  . HIS A 1 27 ? 4.740   8.491   11.849 1.00 0.00 ? 27 HIS A CD2  8  
ATOM 4437 C CE1  . HIS A 1 27 ? 5.736   9.568   13.478 1.00 0.00 ? 27 HIS A CE1  8  
ATOM 4438 N NE2  . HIS A 1 27 ? 5.917   9.058   12.273 1.00 0.00 ? 27 HIS A NE2  8  
ATOM 4439 H H    . HIS A 1 27 ? 4.096   6.193   14.041 1.00 0.00 ? 27 HIS A H    8  
ATOM 4440 H HA   . HIS A 1 27 ? 1.218   6.696   13.789 1.00 0.00 ? 27 HIS A HA   8  
ATOM 4441 H HB2  . HIS A 1 27 ? 1.941   8.419   11.957 1.00 0.00 ? 27 HIS A HB2  8  
ATOM 4442 H HB3  . HIS A 1 27 ? 1.909   8.904   13.650 1.00 0.00 ? 27 HIS A HB3  8  
ATOM 4443 H HD1  . HIS A 1 27 ? 4.092   9.626   14.694 1.00 0.00 ? 27 HIS A HD1  8  
ATOM 4444 H HD2  . HIS A 1 27 ? 4.573   7.994   10.904 1.00 0.00 ? 27 HIS A HD2  8  
ATOM 4445 H HE1  . HIS A 1 27 ? 6.485   10.079  14.065 1.00 0.00 ? 27 HIS A HE1  8  
ATOM 4446 N N    . ASP A 1 28 ? 1.119   5.440   11.648 1.00 0.00 ? 28 ASP A N    8  
ATOM 4447 C CA   . ASP A 1 28 ? 1.058   4.567   10.481 1.00 0.00 ? 28 ASP A CA   8  
ATOM 4448 C C    . ASP A 1 28 ? 1.593   5.277   9.242  1.00 0.00 ? 28 ASP A C    8  
ATOM 4449 O O    . ASP A 1 28 ? 1.031   6.278   8.796  1.00 0.00 ? 28 ASP A O    8  
ATOM 4450 C CB   . ASP A 1 28 ? -0.379  4.103   10.239 1.00 0.00 ? 28 ASP A CB   8  
ATOM 4451 C CG   . ASP A 1 28 ? -0.561  3.472   8.872  1.00 0.00 ? 28 ASP A CG   8  
ATOM 4452 O OD1  . ASP A 1 28 ? -1.681  3.552   8.325  1.00 0.00 ? 28 ASP A OD1  8  
ATOM 4453 O OD2  . ASP A 1 28 ? 0.417   2.898   8.350  1.00 0.00 ? 28 ASP A OD2  8  
ATOM 4454 H H    . ASP A 1 28 ? 0.286   5.695   12.098 1.00 0.00 ? 28 ASP A H    8  
ATOM 4455 H HA   . ASP A 1 28 ? 1.676   3.704   10.681 1.00 0.00 ? 28 ASP A HA   8  
ATOM 4456 H HB2  . ASP A 1 28 ? -0.647  3.375   10.990 1.00 0.00 ? 28 ASP A HB2  8  
ATOM 4457 H HB3  . ASP A 1 28 ? -1.042  4.953   10.314 1.00 0.00 ? 28 ASP A HB3  8  
ATOM 4458 N N    . CYS A 1 29 ? 2.683   4.754   8.690  1.00 0.00 ? 29 CYS A N    8  
ATOM 4459 C CA   . CYS A 1 29 ? 3.295   5.339   7.503  1.00 0.00 ? 29 CYS A CA   8  
ATOM 4460 C C    . CYS A 1 29 ? 3.369   4.319   6.371  1.00 0.00 ? 29 CYS A C    8  
ATOM 4461 O O    . CYS A 1 29 ? 4.239   4.398   5.505  1.00 0.00 ? 29 CYS A O    8  
ATOM 4462 C CB   . CYS A 1 29 ? 4.697   5.857   7.830  1.00 0.00 ? 29 CYS A CB   8  
ATOM 4463 S SG   . CYS A 1 29 ? 5.738   4.666   8.733  1.00 0.00 ? 29 CYS A SG   8  
ATOM 4464 H H    . CYS A 1 29 ? 3.086   3.955   9.091  1.00 0.00 ? 29 CYS A H    8  
ATOM 4465 H HA   . CYS A 1 29 ? 2.680   6.167   7.186  1.00 0.00 ? 29 CYS A HA   8  
ATOM 4466 H HB2  . CYS A 1 29 ? 5.205   6.103   6.909  1.00 0.00 ? 29 CYS A HB2  8  
ATOM 4467 H HB3  . CYS A 1 29 ? 4.612   6.746   8.437  1.00 0.00 ? 29 CYS A HB3  8  
ATOM 4468 N N    . GLY A 1 30 ? 2.448   3.360   6.384  1.00 0.00 ? 30 GLY A N    8  
ATOM 4469 C CA   . GLY A 1 30 ? 2.426   2.338   5.354  1.00 0.00 ? 30 GLY A CA   8  
ATOM 4470 C C    . GLY A 1 30 ? 2.369   2.923   3.958  1.00 0.00 ? 30 GLY A C    8  
ATOM 4471 O O    . GLY A 1 30 ? 2.586   2.218   2.972  1.00 0.00 ? 30 GLY A O    8  
ATOM 4472 H H    . GLY A 1 30 ? 1.778   3.346   7.100  1.00 0.00 ? 30 GLY A H    8  
ATOM 4473 H HA2  . GLY A 1 30 ? 3.316   1.733   5.444  1.00 0.00 ? 30 GLY A HA2  8  
ATOM 4474 H HA3  . GLY A 1 30 ? 1.560   1.710   5.505  1.00 0.00 ? 30 GLY A HA3  8  
ATOM 4475 N N    . SER A 1 31 ? 2.074   4.217   3.872  1.00 0.00 ? 31 SER A N    8  
ATOM 4476 C CA   . SER A 1 31 ? 1.983   4.896   2.584  1.00 0.00 ? 31 SER A CA   8  
ATOM 4477 C C    . SER A 1 31 ? 3.119   4.465   1.662  1.00 0.00 ? 31 SER A C    8  
ATOM 4478 O O    . SER A 1 31 ? 2.909   3.715   0.708  1.00 0.00 ? 31 SER A O    8  
ATOM 4479 C CB   . SER A 1 31 ? 2.017   6.413   2.781  1.00 0.00 ? 31 SER A CB   8  
ATOM 4480 O OG   . SER A 1 31 ? 2.077   6.748   4.156  1.00 0.00 ? 31 SER A OG   8  
ATOM 4481 H H    . SER A 1 31 ? 1.911   4.725   4.694  1.00 0.00 ? 31 SER A H    8  
ATOM 4482 H HA   . SER A 1 31 ? 1.043   4.621   2.130  1.00 0.00 ? 31 SER A HA   8  
ATOM 4483 H HB2  . SER A 1 31 ? 2.887   6.818   2.286  1.00 0.00 ? 31 SER A HB2  8  
ATOM 4484 H HB3  . SER A 1 31 ? 1.125   6.848   2.354  1.00 0.00 ? 31 SER A HB3  8  
ATOM 4485 H HG   . SER A 1 31 ? 1.266   7.191   4.414  1.00 0.00 ? 31 SER A HG   8  
ATOM 4486 N N    . ASP A 1 32 ? 4.323   4.946   1.952  1.00 0.00 ? 32 ASP A N    8  
ATOM 4487 C CA   . ASP A 1 32 ? 5.494   4.611   1.150  1.00 0.00 ? 32 ASP A CA   8  
ATOM 4488 C C    . ASP A 1 32 ? 6.448   3.712   1.930  1.00 0.00 ? 32 ASP A C    8  
ATOM 4489 O O    . ASP A 1 32 ? 7.666   3.790   1.765  1.00 0.00 ? 32 ASP A O    8  
ATOM 4490 C CB   . ASP A 1 32 ? 6.218   5.884   0.709  1.00 0.00 ? 32 ASP A CB   8  
ATOM 4491 C CG   . ASP A 1 32 ? 6.156   6.978   1.757  1.00 0.00 ? 32 ASP A CG   8  
ATOM 4492 O OD1  . ASP A 1 32 ? 7.223   7.525   2.109  1.00 0.00 ? 32 ASP A OD1  8  
ATOM 4493 O OD2  . ASP A 1 32 ? 5.041   7.287   2.226  1.00 0.00 ? 32 ASP A OD2  8  
ATOM 4494 H H    . ASP A 1 32 ? 4.427   5.540   2.725  1.00 0.00 ? 32 ASP A H    8  
ATOM 4495 H HA   . ASP A 1 32 ? 5.155   4.079   0.274  1.00 0.00 ? 32 ASP A HA   8  
ATOM 4496 H HB2  . ASP A 1 32 ? 7.256   5.653   0.519  1.00 0.00 ? 32 ASP A HB2  8  
ATOM 4497 H HB3  . ASP A 1 32 ? 5.763   6.253   -0.198 1.00 0.00 ? 32 ASP A HB3  8  
ATOM 4498 N N    . HIS A 1 33 ? 5.887   2.860   2.782  1.00 0.00 ? 33 HIS A N    8  
ATOM 4499 C CA   . HIS A 1 33 ? 6.688   1.947   3.589  1.00 0.00 ? 33 HIS A CA   8  
ATOM 4500 C C    . HIS A 1 33 ? 5.931   0.649   3.854  1.00 0.00 ? 33 HIS A C    8  
ATOM 4501 O O    . HIS A 1 33 ? 4.877   0.652   4.490  1.00 0.00 ? 33 HIS A O    8  
ATOM 4502 C CB   . HIS A 1 33 ? 7.072   2.606   4.914  1.00 0.00 ? 33 HIS A CB   8  
ATOM 4503 C CG   . HIS A 1 33 ? 7.731   3.941   4.751  1.00 0.00 ? 33 HIS A CG   8  
ATOM 4504 N ND1  . HIS A 1 33 ? 7.313   5.074   5.416  1.00 0.00 ? 33 HIS A ND1  8  
ATOM 4505 C CD2  . HIS A 1 33 ? 8.786   4.320   3.992  1.00 0.00 ? 33 HIS A CD2  8  
ATOM 4506 C CE1  . HIS A 1 33 ? 8.081   6.092   5.073  1.00 0.00 ? 33 HIS A CE1  8  
ATOM 4507 N NE2  . HIS A 1 33 ? 8.983   5.661   4.210  1.00 0.00 ? 33 HIS A NE2  8  
ATOM 4508 H H    . HIS A 1 33 ? 4.911   2.845   2.870  1.00 0.00 ? 33 HIS A H    8  
ATOM 4509 H HA   . HIS A 1 33 ? 7.587   1.718   3.037  1.00 0.00 ? 33 HIS A HA   8  
ATOM 4510 H HB2  . HIS A 1 33 ? 6.182   2.747   5.510  1.00 0.00 ? 33 HIS A HB2  8  
ATOM 4511 H HB3  . HIS A 1 33 ? 7.756   1.960   5.446  1.00 0.00 ? 33 HIS A HB3  8  
ATOM 4512 H HD1  . HIS A 1 33 ? 6.563   5.124   6.045  1.00 0.00 ? 33 HIS A HD1  8  
ATOM 4513 H HD2  . HIS A 1 33 ? 9.366   3.686   3.336  1.00 0.00 ? 33 HIS A HD2  8  
ATOM 4514 H HE1  . HIS A 1 33 ? 7.988   7.105   5.436  1.00 0.00 ? 33 HIS A HE1  8  
ATOM 4515 N N    . TRP A 1 34 ? 6.475   -0.458  3.361  1.00 0.00 ? 34 TRP A N    8  
ATOM 4516 C CA   . TRP A 1 34 ? 5.850   -1.763  3.543  1.00 0.00 ? 34 TRP A CA   8  
ATOM 4517 C C    . TRP A 1 34 ? 6.767   -2.702  4.319  1.00 0.00 ? 34 TRP A C    8  
ATOM 4518 O O    . TRP A 1 34 ? 7.928   -2.382  4.574  1.00 0.00 ? 34 TRP A O    8  
ATOM 4519 C CB   . TRP A 1 34 ? 5.499   -2.378  2.187  1.00 0.00 ? 34 TRP A CB   8  
ATOM 4520 C CG   . TRP A 1 34 ? 6.451   -1.992  1.096  1.00 0.00 ? 34 TRP A CG   8  
ATOM 4521 C CD1  . TRP A 1 34 ? 6.153   -1.304  -0.046 1.00 0.00 ? 34 TRP A CD1  8  
ATOM 4522 C CD2  . TRP A 1 34 ? 7.853   -2.273  1.043  1.00 0.00 ? 34 TRP A CD2  8  
ATOM 4523 N NE1  . TRP A 1 34 ? 7.287   -1.141  -0.805 1.00 0.00 ? 34 TRP A NE1  8  
ATOM 4524 C CE2  . TRP A 1 34 ? 8.343   -1.726  -0.159 1.00 0.00 ? 34 TRP A CE2  8  
ATOM 4525 C CE3  . TRP A 1 34 ? 8.744   -2.932  1.895  1.00 0.00 ? 34 TRP A CE3  8  
ATOM 4526 C CZ2  . TRP A 1 34 ? 9.682   -1.819  -0.528 1.00 0.00 ? 34 TRP A CZ2  8  
ATOM 4527 C CZ3  . TRP A 1 34 ? 10.073  -3.024  1.527  1.00 0.00 ? 34 TRP A CZ3  8  
ATOM 4528 C CH2  . TRP A 1 34 ? 10.532  -2.470  0.325  1.00 0.00 ? 34 TRP A CH2  8  
ATOM 4529 H H    . TRP A 1 34 ? 7.317   -0.397  2.862  1.00 0.00 ? 34 TRP A H    8  
ATOM 4530 H HA   . TRP A 1 34 ? 4.941   -1.618  4.109  1.00 0.00 ? 34 TRP A HA   8  
ATOM 4531 H HB2  . TRP A 1 34 ? 5.509   -3.454  2.273  1.00 0.00 ? 34 TRP A HB2  8  
ATOM 4532 H HB3  . TRP A 1 34 ? 4.509   -2.052  1.898  1.00 0.00 ? 34 TRP A HB3  8  
ATOM 4533 H HD1  . TRP A 1 34 ? 5.167   -0.949  -0.302 1.00 0.00 ? 34 TRP A HD1  8  
ATOM 4534 H HE1  . TRP A 1 34 ? 7.331   -0.679  -1.669 1.00 0.00 ? 34 TRP A HE1  8  
ATOM 4535 H HE3  . TRP A 1 34 ? 8.409   -3.365  2.826  1.00 0.00 ? 34 TRP A HE3  8  
ATOM 4536 H HZ2  . TRP A 1 34 ? 10.052  -1.397  -1.451 1.00 0.00 ? 34 TRP A HZ2  8  
ATOM 4537 H HZ3  . TRP A 1 34 ? 10.775  -3.530  2.173  1.00 0.00 ? 34 TRP A HZ3  8  
ATOM 4538 H HH2  . TRP A 1 34 ? 11.578  -2.566  0.078  1.00 0.00 ? 34 TRP A HH2  8  
ATOM 4539 N N    . CYS A 1 35 ? 6.239   -3.864  4.691  1.00 0.00 ? 35 CYS A N    8  
ATOM 4540 C CA   . CYS A 1 35 ? 7.010   -4.850  5.438  1.00 0.00 ? 35 CYS A CA   8  
ATOM 4541 C C    . CYS A 1 35 ? 7.417   -6.015  4.541  1.00 0.00 ? 35 CYS A C    8  
ATOM 4542 O O    . CYS A 1 35 ? 6.944   -6.137  3.411  1.00 0.00 ? 35 CYS A O    8  
ATOM 4543 C CB   . CYS A 1 35 ? 6.200   -5.367  6.628  1.00 0.00 ? 35 CYS A CB   8  
ATOM 4544 S SG   . CYS A 1 35 ? 6.293   -4.308  8.108  1.00 0.00 ? 35 CYS A SG   8  
ATOM 4545 H H    . CYS A 1 35 ? 5.307   -4.062  4.458  1.00 0.00 ? 35 CYS A H    8  
ATOM 4546 H HA   . CYS A 1 35 ? 7.903   -4.366  5.805  1.00 0.00 ? 35 CYS A HA   8  
ATOM 4547 H HB2  . CYS A 1 35 ? 5.161   -5.440  6.342  1.00 0.00 ? 35 CYS A HB2  8  
ATOM 4548 H HB3  . CYS A 1 35 ? 6.562   -6.347  6.901  1.00 0.00 ? 35 CYS A HB3  8  
ATOM 4549 N N    . ASP A 1 36 ? 8.297   -6.869  5.052  1.00 0.00 ? 36 ASP A N    8  
ATOM 4550 C CA   . ASP A 1 36 ? 8.767   -8.026  4.298  1.00 0.00 ? 36 ASP A CA   8  
ATOM 4551 C C    . ASP A 1 36 ? 7.596   -8.789  3.688  1.00 0.00 ? 36 ASP A C    8  
ATOM 4552 O O    . ASP A 1 36 ? 7.675   -9.265  2.556  1.00 0.00 ? 36 ASP A O    8  
ATOM 4553 C CB   . ASP A 1 36 ? 9.581   -8.953  5.202  1.00 0.00 ? 36 ASP A CB   8  
ATOM 4554 C CG   . ASP A 1 36 ? 11.050  -8.579  5.242  1.00 0.00 ? 36 ASP A CG   8  
ATOM 4555 O OD1  . ASP A 1 36 ? 11.618  -8.524  6.353  1.00 0.00 ? 36 ASP A OD1  8  
ATOM 4556 O OD2  . ASP A 1 36 ? 11.631  -8.344  4.162  1.00 0.00 ? 36 ASP A OD2  8  
ATOM 4557 H H    . ASP A 1 36 ? 8.638   -6.718  5.959  1.00 0.00 ? 36 ASP A H    8  
ATOM 4558 H HA   . ASP A 1 36 ? 9.401   -7.667  3.502  1.00 0.00 ? 36 ASP A HA   8  
ATOM 4559 H HB2  . ASP A 1 36 ? 9.189   -8.902  6.207  1.00 0.00 ? 36 ASP A HB2  8  
ATOM 4560 H HB3  . ASP A 1 36 ? 9.496   -9.966  4.837  1.00 0.00 ? 36 ASP A HB3  8  
ATOM 4561 N N    . ALA A 1 37 ? 6.510   -8.903  4.447  1.00 0.00 ? 37 ALA A N    8  
ATOM 4562 C CA   . ALA A 1 37 ? 5.323   -9.607  3.981  1.00 0.00 ? 37 ALA A CA   8  
ATOM 4563 C C    . ALA A 1 37 ? 4.325   -8.643  3.348  1.00 0.00 ? 37 ALA A C    8  
ATOM 4564 O O    . ALA A 1 37 ? 3.884   -7.686  3.984  1.00 0.00 ? 37 ALA A O    8  
ATOM 4565 C CB   . ALA A 1 37 ? 4.673   -10.364 5.130  1.00 0.00 ? 37 ALA A CB   8  
ATOM 4566 H H    . ALA A 1 37 ? 6.508   -8.501  5.341  1.00 0.00 ? 37 ALA A H    8  
ATOM 4567 H HA   . ALA A 1 37 ? 5.632   -10.328 3.237  1.00 0.00 ? 37 ALA A HA   8  
ATOM 4568 H HB1  . ALA A 1 37 ? 5.413   -10.569 5.889  1.00 0.00 ? 37 ALA A HB1  8  
ATOM 4569 H HB2  . ALA A 1 37 ? 3.880   -9.764  5.552  1.00 0.00 ? 37 ALA A HB2  8  
ATOM 4570 H HB3  . ALA A 1 37 ? 4.265   -11.294 4.763  1.00 0.00 ? 37 ALA A HB3  8  
ATOM 4571 N N    . SER A 1 38 ? 3.975   -8.901  2.092  1.00 0.00 ? 38 SER A N    8  
ATOM 4572 C CA   . SER A 1 38 ? 3.032   -8.053  1.372  1.00 0.00 ? 38 SER A CA   8  
ATOM 4573 C C    . SER A 1 38 ? 1.696   -7.982  2.103  1.00 0.00 ? 38 SER A C    8  
ATOM 4574 O O    . SER A 1 38 ? 0.732   -8.646  1.724  1.00 0.00 ? 38 SER A O    8  
ATOM 4575 C CB   . SER A 1 38 ? 2.822   -8.580  -0.049 1.00 0.00 ? 38 SER A CB   8  
ATOM 4576 O OG   . SER A 1 38 ? 1.605   -8.102  -0.595 1.00 0.00 ? 38 SER A OG   8  
ATOM 4577 H H    . SER A 1 38 ? 4.361   -9.679  1.638  1.00 0.00 ? 38 SER A H    8  
ATOM 4578 H HA   . SER A 1 38 ? 3.454   -7.060  1.319  1.00 0.00 ? 38 SER A HA   8  
ATOM 4579 H HB2  . SER A 1 38 ? 3.637   -8.253  -0.676 1.00 0.00 ? 38 SER A HB2  8  
ATOM 4580 H HB3  . SER A 1 38 ? 2.794   -9.660  -0.029 1.00 0.00 ? 38 SER A HB3  8  
ATOM 4581 H HG   . SER A 1 38 ? 1.109   -8.836  -0.965 1.00 0.00 ? 38 SER A HG   8  
ATOM 4582 N N    . GLY A 1 39 ? 1.646   -7.172  3.157  1.00 0.00 ? 39 GLY A N    8  
ATOM 4583 C CA   . GLY A 1 39 ? 0.424   -7.029  3.926  1.00 0.00 ? 39 GLY A CA   8  
ATOM 4584 C C    . GLY A 1 39 ? 0.635   -6.250  5.209  1.00 0.00 ? 39 GLY A C    8  
ATOM 4585 O O    . GLY A 1 39 ? -0.309  -5.685  5.762  1.00 0.00 ? 39 GLY A O    8  
ATOM 4586 H H    . GLY A 1 39 ? 2.446   -6.667  3.413  1.00 0.00 ? 39 GLY A H    8  
ATOM 4587 H HA2  . GLY A 1 39 ? -0.310  -6.517  3.323  1.00 0.00 ? 39 GLY A HA2  8  
ATOM 4588 H HA3  . GLY A 1 39 ? 0.051   -8.012  4.173  1.00 0.00 ? 39 GLY A HA3  8  
ATOM 4589 N N    . ASP A 1 40 ? 1.875   -6.221  5.685  1.00 0.00 ? 40 ASP A N    8  
ATOM 4590 C CA   . ASP A 1 40 ? 2.206   -5.507  6.912  1.00 0.00 ? 40 ASP A CA   8  
ATOM 4591 C C    . ASP A 1 40 ? 2.614   -4.068  6.610  1.00 0.00 ? 40 ASP A C    8  
ATOM 4592 O O    . ASP A 1 40 ? 3.436   -3.818  5.729  1.00 0.00 ? 40 ASP A O    8  
ATOM 4593 C CB   . ASP A 1 40 ? 3.334   -6.224  7.656  1.00 0.00 ? 40 ASP A CB   8  
ATOM 4594 C CG   . ASP A 1 40 ? 2.814   -7.218  8.676  1.00 0.00 ? 40 ASP A CG   8  
ATOM 4595 O OD1  . ASP A 1 40 ? 1.648   -7.646  8.547  1.00 0.00 ? 40 ASP A OD1  8  
ATOM 4596 O OD2  . ASP A 1 40 ? 3.574   -7.569  9.602  1.00 0.00 ? 40 ASP A OD2  8  
ATOM 4597 H H    . ASP A 1 40 ? 2.584   -6.692  5.199  1.00 0.00 ? 40 ASP A H    8  
ATOM 4598 H HA   . ASP A 1 40 ? 1.326   -5.494  7.537  1.00 0.00 ? 40 ASP A HA   8  
ATOM 4599 H HB2  . ASP A 1 40 ? 3.947   -6.755  6.943  1.00 0.00 ? 40 ASP A HB2  8  
ATOM 4600 H HB3  . ASP A 1 40 ? 3.940   -5.492  8.170  1.00 0.00 ? 40 ASP A HB3  8  
ATOM 4601 N N    . ARG A 1 41 ? 2.032   -3.126  7.346  1.00 0.00 ? 41 ARG A N    8  
ATOM 4602 C CA   . ARG A 1 41 ? 2.333   -1.713  7.155  1.00 0.00 ? 41 ARG A CA   8  
ATOM 4603 C C    . ARG A 1 41 ? 3.406   -1.248  8.135  1.00 0.00 ? 41 ARG A C    8  
ATOM 4604 O O    . ARG A 1 41 ? 3.347   -1.551  9.327  1.00 0.00 ? 41 ARG A O    8  
ATOM 4605 C CB   . ARG A 1 41 ? 1.068   -0.872  7.331  1.00 0.00 ? 41 ARG A CB   8  
ATOM 4606 C CG   . ARG A 1 41 ? -0.082  -1.629  7.976  1.00 0.00 ? 41 ARG A CG   8  
ATOM 4607 C CD   . ARG A 1 41 ? -1.378  -0.836  7.910  1.00 0.00 ? 41 ARG A CD   8  
ATOM 4608 N NE   . ARG A 1 41 ? -2.080  -0.828  9.191  1.00 0.00 ? 41 ARG A NE   8  
ATOM 4609 C CZ   . ARG A 1 41 ? -1.781  -0.003  10.188 1.00 0.00 ? 41 ARG A CZ   8  
ATOM 4610 N NH1  . ARG A 1 41 ? -0.798  0.876   10.053 1.00 0.00 ? 41 ARG A NH1  8  
ATOM 4611 N NH2  . ARG A 1 41 ? -2.466  -0.056  11.323 1.00 0.00 ? 41 ARG A NH2  8  
ATOM 4612 H H    . ARG A 1 41 ? 1.385   -3.388  8.033  1.00 0.00 ? 41 ARG A H    8  
ATOM 4613 H HA   . ARG A 1 41 ? 2.702   -1.585  6.148  1.00 0.00 ? 41 ARG A HA   8  
ATOM 4614 H HB2  . ARG A 1 41 ? 1.300   -0.018  7.951  1.00 0.00 ? 41 ARG A HB2  8  
ATOM 4615 H HB3  . ARG A 1 41 ? 0.743   -0.525  6.362  1.00 0.00 ? 41 ARG A HB3  8  
ATOM 4616 H HG2  . ARG A 1 41 ? -0.220  -2.566  7.457  1.00 0.00 ? 41 ARG A HG2  8  
ATOM 4617 H HG3  . ARG A 1 41 ? 0.162   -1.820  9.011  1.00 0.00 ? 41 ARG A HG3  8  
ATOM 4618 H HD2  . ARG A 1 41 ? -1.148  0.181   7.631  1.00 0.00 ? 41 ARG A HD2  8  
ATOM 4619 H HD3  . ARG A 1 41 ? -2.017  -1.279  7.162  1.00 0.00 ? 41 ARG A HD3  8  
ATOM 4620 H HE   . ARG A 1 41 ? -2.810  -1.470  9.312  1.00 0.00 ? 41 ARG A HE   8  
ATOM 4621 H HH11 . ARG A 1 41 ? -0.280  0.920   9.199  1.00 0.00 ? 41 ARG A HH11 8  
ATOM 4622 H HH12 . ARG A 1 41 ? -0.575  1.497   10.805 1.00 0.00 ? 41 ARG A HH12 8  
ATOM 4623 H HH21 . ARG A 1 41 ? -3.208  -0.718  11.429 1.00 0.00 ? 41 ARG A HH21 8  
ATOM 4624 H HH22 . ARG A 1 41 ? -2.240  0.565   12.073 1.00 0.00 ? 41 ARG A HH22 8  
ATOM 4625 N N    . CYS A 1 42 ? 4.387   -0.510  7.625  1.00 0.00 ? 42 CYS A N    8  
ATOM 4626 C CA   . CYS A 1 42 ? 5.474   -0.004  8.453  1.00 0.00 ? 42 CYS A CA   8  
ATOM 4627 C C    . CYS A 1 42 ? 5.039   1.243   9.219  1.00 0.00 ? 42 CYS A C    8  
ATOM 4628 O O    . CYS A 1 42 ? 4.518   2.193   8.635  1.00 0.00 ? 42 CYS A O    8  
ATOM 4629 C CB   . CYS A 1 42 ? 6.696   0.315   7.589  1.00 0.00 ? 42 CYS A CB   8  
ATOM 4630 S SG   . CYS A 1 42 ? 7.733   -1.132  7.205  1.00 0.00 ? 42 CYS A SG   8  
ATOM 4631 H H    . CYS A 1 42 ? 4.379   -0.301  6.666  1.00 0.00 ? 42 CYS A H    8  
ATOM 4632 H HA   . CYS A 1 42 ? 5.737   -0.773  9.163  1.00 0.00 ? 42 CYS A HA   8  
ATOM 4633 H HB2  . CYS A 1 42 ? 6.364   0.739   6.652  1.00 0.00 ? 42 CYS A HB2  8  
ATOM 4634 H HB3  . CYS A 1 42 ? 7.313   1.036   8.105  1.00 0.00 ? 42 CYS A HB3  8  
ATOM 4635 N N    . CYS A 1 43 ? 5.258   1.231   10.530 1.00 0.00 ? 43 CYS A N    8  
ATOM 4636 C CA   . CYS A 1 43 ? 4.889   2.359   11.377 1.00 0.00 ? 43 CYS A CA   8  
ATOM 4637 C C    . CYS A 1 43 ? 6.114   3.199   11.727 1.00 0.00 ? 43 CYS A C    8  
ATOM 4638 O O    . CYS A 1 43 ? 7.168   2.666   12.075 1.00 0.00 ? 43 CYS A O    8  
ATOM 4639 C CB   . CYS A 1 43 ? 4.214   1.863   12.657 1.00 0.00 ? 43 CYS A CB   8  
ATOM 4640 S SG   . CYS A 1 43 ? 2.456   1.432   12.451 1.00 0.00 ? 43 CYS A SG   8  
ATOM 4641 H H    . CYS A 1 43 ? 5.677   0.444   10.938 1.00 0.00 ? 43 CYS A H    8  
ATOM 4642 H HA   . CYS A 1 43 ? 4.192   2.973   10.827 1.00 0.00 ? 43 CYS A HA   8  
ATOM 4643 H HB2  . CYS A 1 43 ? 4.729   0.981   13.008 1.00 0.00 ? 43 CYS A HB2  8  
ATOM 4644 H HB3  . CYS A 1 43 ? 4.278   2.634   13.410 1.00 0.00 ? 43 CYS A HB3  8  
ATOM 4645 N N    . CYS A 1 44 ? 5.968   4.517   11.632 1.00 0.00 ? 44 CYS A N    8  
ATOM 4646 C CA   . CYS A 1 44 ? 7.060   5.432   11.939 1.00 0.00 ? 44 CYS A CA   8  
ATOM 4647 C C    . CYS A 1 44 ? 6.781   6.200   13.227 1.00 0.00 ? 44 CYS A C    8  
ATOM 4648 O O    . CYS A 1 44 ? 5.684   6.721   13.427 1.00 0.00 ? 44 CYS A O    8  
ATOM 4649 C CB   . CYS A 1 44 ? 7.271   6.412   10.783 1.00 0.00 ? 44 CYS A CB   8  
ATOM 4650 S SG   . CYS A 1 44 ? 7.487   5.614   9.160  1.00 0.00 ? 44 CYS A SG   8  
ATOM 4651 H H    . CYS A 1 44 ? 5.103   4.883   11.349 1.00 0.00 ? 44 CYS A H    8  
ATOM 4652 H HA   . CYS A 1 44 ? 7.957   4.846   12.070 1.00 0.00 ? 44 CYS A HA   8  
ATOM 4653 H HB2  . CYS A 1 44 ? 6.413   7.066   10.715 1.00 0.00 ? 44 CYS A HB2  8  
ATOM 4654 H HB3  . CYS A 1 44 ? 8.153   7.004   10.979 1.00 0.00 ? 44 CYS A HB3  8  
ATOM 4655 N N    . ALA A 1 45 ? 7.783   6.266   14.099 1.00 0.00 ? 45 ALA A N    8  
ATOM 4656 C CA   . ALA A 1 45 ? 7.647   6.972   15.367 1.00 0.00 ? 45 ALA A CA   8  
ATOM 4657 C C    . ALA A 1 45 ? 7.783   8.478   15.174 1.00 0.00 ? 45 ALA A C    8  
ATOM 4658 O O    . ALA A 1 45 ? 7.542   9.256   16.098 1.00 0.00 ? 45 ALA A O    8  
ATOM 4659 C CB   . ALA A 1 45 ? 8.681   6.470   16.364 1.00 0.00 ? 45 ALA A CB   8  
ATOM 4660 H H    . ALA A 1 45 ? 8.633   5.830   13.883 1.00 0.00 ? 45 ALA A H    8  
ATOM 4661 H HA   . ALA A 1 45 ? 6.665   6.757   15.765 1.00 0.00 ? 45 ALA A HA   8  
ATOM 4662 H HB1  . ALA A 1 45 ? 8.984   5.469   16.093 1.00 0.00 ? 45 ALA A HB1  8  
ATOM 4663 H HB2  . ALA A 1 45 ? 9.540   7.123   16.350 1.00 0.00 ? 45 ALA A HB2  8  
ATOM 4664 H HB3  . ALA A 1 45 ? 8.251   6.460   17.354 1.00 0.00 ? 45 ALA A HB3  8  
ATOM 4665 N N    . CYS A 1 1  ? 1.224   -0.055  0.044  1.00 0.00 ? 1  CYS A N    9  
ATOM 4666 C CA   . CYS A 1 1  ? 1.985   -0.034  -1.199 1.00 0.00 ? 1  CYS A CA   9  
ATOM 4667 C C    . CYS A 1 1  ? 2.645   -1.386  -1.457 1.00 0.00 ? 1  CYS A C    9  
ATOM 4668 O O    . CYS A 1 1  ? 2.840   -2.178  -0.536 1.00 0.00 ? 1  CYS A O    9  
ATOM 4669 C CB   . CYS A 1 1  ? 3.050   1.064   -1.151 1.00 0.00 ? 1  CYS A CB   9  
ATOM 4670 S SG   . CYS A 1 1  ? 3.882   1.223   0.462  1.00 0.00 ? 1  CYS A SG   9  
ATOM 4671 H H    . CYS A 1 1  ? 1.688   -0.257  0.885  1.00 0.00 ? 1  CYS A H    9  
ATOM 4672 H HA   . CYS A 1 1  ? 1.299   0.178   -2.005 1.00 0.00 ? 1  CYS A HA   9  
ATOM 4673 H HB2  . CYS A 1 1  ? 3.808   0.853   -1.892 1.00 0.00 ? 1  CYS A HB2  9  
ATOM 4674 H HB3  . CYS A 1 1  ? 2.587   2.014   -1.378 1.00 0.00 ? 1  CYS A HB3  9  
ATOM 4675 N N    . TYR A 1 2  ? 2.985   -1.641  -2.715 1.00 0.00 ? 2  TYR A N    9  
ATOM 4676 C CA   . TYR A 1 2  ? 3.620   -2.897  -3.095 1.00 0.00 ? 2  TYR A CA   9  
ATOM 4677 C C    . TYR A 1 2  ? 5.130   -2.831  -2.882 1.00 0.00 ? 2  TYR A C    9  
ATOM 4678 O O    . TYR A 1 2  ? 5.737   -1.760  -2.892 1.00 0.00 ? 2  TYR A O    9  
ATOM 4679 C CB   . TYR A 1 2  ? 3.315   -3.225  -4.558 1.00 0.00 ? 2  TYR A CB   9  
ATOM 4680 C CG   . TYR A 1 2  ? 2.641   -4.566  -4.749 1.00 0.00 ? 2  TYR A CG   9  
ATOM 4681 C CD1  . TYR A 1 2  ? 3.035   -5.423  -5.770 1.00 0.00 ? 2  TYR A CD1  9  
ATOM 4682 C CD2  . TYR A 1 2  ? 1.611   -4.974  -3.911 1.00 0.00 ? 2  TYR A CD2  9  
ATOM 4683 C CE1  . TYR A 1 2  ? 2.422   -6.648  -5.949 1.00 0.00 ? 2  TYR A CE1  9  
ATOM 4684 C CE2  . TYR A 1 2  ? 0.994   -6.198  -4.082 1.00 0.00 ? 2  TYR A CE2  9  
ATOM 4685 C CZ   . TYR A 1 2  ? 1.403   -7.031  -5.103 1.00 0.00 ? 2  TYR A CZ   9  
ATOM 4686 O OH   . TYR A 1 2  ? 0.789   -8.251  -5.277 1.00 0.00 ? 2  TYR A OH   9  
ATOM 4687 H H    . TYR A 1 2  ? 2.803   -0.970  -3.406 1.00 0.00 ? 2  TYR A H    9  
ATOM 4688 H HA   . TYR A 1 2  ? 3.214   -3.677  -2.469 1.00 0.00 ? 2  TYR A HA   9  
ATOM 4689 H HB2  . TYR A 1 2  ? 2.662   -2.467  -4.961 1.00 0.00 ? 2  TYR A HB2  9  
ATOM 4690 H HB3  . TYR A 1 2  ? 4.238   -3.235  -5.118 1.00 0.00 ? 2  TYR A HB3  9  
ATOM 4691 H HD1  . TYR A 1 2  ? 3.834   -5.120  -6.431 1.00 0.00 ? 2  TYR A HD1  9  
ATOM 4692 H HD2  . TYR A 1 2  ? 1.293   -4.319  -3.113 1.00 0.00 ? 2  TYR A HD2  9  
ATOM 4693 H HE1  . TYR A 1 2  ? 2.742   -7.301  -6.748 1.00 0.00 ? 2  TYR A HE1  9  
ATOM 4694 H HE2  . TYR A 1 2  ? 0.195   -6.498  -3.420 1.00 0.00 ? 2  TYR A HE2  9  
ATOM 4695 H HH   . TYR A 1 2  ? 1.073   -8.635  -6.110 1.00 0.00 ? 2  TYR A HH   9  
ATOM 4696 N N    . PRO A 1 3  ? 5.750   -4.003  -2.685 1.00 0.00 ? 3  PRO A N    9  
ATOM 4697 C CA   . PRO A 1 3  ? 7.196   -4.107  -2.467 1.00 0.00 ? 3  PRO A CA   9  
ATOM 4698 C C    . PRO A 1 3  ? 7.997   -3.782  -3.723 1.00 0.00 ? 3  PRO A C    9  
ATOM 4699 O O    . PRO A 1 3  ? 8.441   -4.680  -4.437 1.00 0.00 ? 3  PRO A O    9  
ATOM 4700 C CB   . PRO A 1 3  ? 7.391   -5.573  -2.072 1.00 0.00 ? 3  PRO A CB   9  
ATOM 4701 C CG   . PRO A 1 3  ? 6.238   -6.287  -2.687 1.00 0.00 ? 3  PRO A CG   9  
ATOM 4702 C CD   . PRO A 1 3  ? 5.088   -5.318  -2.661 1.00 0.00 ? 3  PRO A CD   9  
ATOM 4703 H HA   . PRO A 1 3  ? 7.522   -3.468  -1.659 1.00 0.00 ? 3  PRO A HA   9  
ATOM 4704 H HB2  . PRO A 1 3  ? 8.333   -5.931  -2.462 1.00 0.00 ? 3  PRO A HB2  9  
ATOM 4705 H HB3  . PRO A 1 3  ? 7.383   -5.664  -0.996 1.00 0.00 ? 3  PRO A HB3  9  
ATOM 4706 H HG2  . PRO A 1 3  ? 6.475   -6.560  -3.704 1.00 0.00 ? 3  PRO A HG2  9  
ATOM 4707 H HG3  . PRO A 1 3  ? 6.000   -7.167  -2.107 1.00 0.00 ? 3  PRO A HG3  9  
ATOM 4708 H HD2  . PRO A 1 3  ? 4.463   -5.451  -3.531 1.00 0.00 ? 3  PRO A HD2  9  
ATOM 4709 H HD3  . PRO A 1 3  ? 4.511   -5.442  -1.756 1.00 0.00 ? 3  PRO A HD3  9  
ATOM 4710 N N    . GLY A 1 4  ? 8.178   -2.492  -3.988 1.00 0.00 ? 4  GLY A N    9  
ATOM 4711 C CA   . GLY A 1 4  ? 8.926   -2.072  -5.158 1.00 0.00 ? 4  GLY A CA   9  
ATOM 4712 C C    . GLY A 1 4  ? 8.192   -1.023  -5.970 1.00 0.00 ? 4  GLY A C    9  
ATOM 4713 O O    . GLY A 1 4  ? 8.557   -0.746  -7.112 1.00 0.00 ? 4  GLY A O    9  
ATOM 4714 H H    . GLY A 1 4  ? 7.801   -1.819  -3.383 1.00 0.00 ? 4  GLY A H    9  
ATOM 4715 H HA2  . GLY A 1 4  ? 9.875   -1.667  -4.840 1.00 0.00 ? 4  GLY A HA2  9  
ATOM 4716 H HA3  . GLY A 1 4  ? 9.106   -2.934  -5.784 1.00 0.00 ? 4  GLY A HA3  9  
ATOM 4717 N N    . GLN A 1 5  ? 7.153   -0.440  -5.380 1.00 0.00 ? 5  GLN A N    9  
ATOM 4718 C CA   . GLN A 1 5  ? 6.365   0.582   -6.057 1.00 0.00 ? 5  GLN A CA   9  
ATOM 4719 C C    . GLN A 1 5  ? 7.112   1.911   -6.091 1.00 0.00 ? 5  GLN A C    9  
ATOM 4720 O O    . GLN A 1 5  ? 7.986   2.182   -5.267 1.00 0.00 ? 5  GLN A O    9  
ATOM 4721 C CB   . GLN A 1 5  ? 5.015   0.760   -5.361 1.00 0.00 ? 5  GLN A CB   9  
ATOM 4722 C CG   . GLN A 1 5  ? 4.131   -0.475  -5.424 1.00 0.00 ? 5  GLN A CG   9  
ATOM 4723 C CD   . GLN A 1 5  ? 2.655   -0.134  -5.484 1.00 0.00 ? 5  GLN A CD   9  
ATOM 4724 O OE1  . GLN A 1 5  ? 2.097   0.429   -4.542 1.00 0.00 ? 5  GLN A OE1  9  
ATOM 4725 N NE2  . GLN A 1 5  ? 2.014   -0.472  -6.597 1.00 0.00 ? 5  GLN A NE2  9  
ATOM 4726 H H    . GLN A 1 5  ? 6.912   -0.704  -4.468 1.00 0.00 ? 5  GLN A H    9  
ATOM 4727 H HA   . GLN A 1 5  ? 6.196   0.252   -7.071 1.00 0.00 ? 5  GLN A HA   9  
ATOM 4728 H HB2  . GLN A 1 5  ? 5.188   1.001   -4.323 1.00 0.00 ? 5  GLN A HB2  9  
ATOM 4729 H HB3  . GLN A 1 5  ? 4.487   1.578   -5.829 1.00 0.00 ? 5  GLN A HB3  9  
ATOM 4730 H HG2  . GLN A 1 5  ? 4.389   -1.043  -6.305 1.00 0.00 ? 5  GLN A HG2  9  
ATOM 4731 H HG3  . GLN A 1 5  ? 4.311   -1.076  -4.545 1.00 0.00 ? 5  GLN A HG3  9  
ATOM 4732 H HE21 . GLN A 1 5  ? 2.523   -0.919  -7.306 1.00 0.00 ? 5  GLN A HE21 9  
ATOM 4733 H HE22 . GLN A 1 5  ? 1.059   -0.264  -6.663 1.00 0.00 ? 5  GLN A HE22 9  
ATOM 4734 N N    . PRO A 1 6  ? 6.762   2.762   -7.067 1.00 0.00 ? 6  PRO A N    9  
ATOM 4735 C CA   . PRO A 1 6  ? 7.388   4.078   -7.232 1.00 0.00 ? 6  PRO A CA   9  
ATOM 4736 C C    . PRO A 1 6  ? 7.005   5.045   -6.117 1.00 0.00 ? 6  PRO A C    9  
ATOM 4737 O O    . PRO A 1 6  ? 6.001   5.750   -6.211 1.00 0.00 ? 6  PRO A O    9  
ATOM 4738 C CB   . PRO A 1 6  ? 6.839   4.566   -8.575 1.00 0.00 ? 6  PRO A CB   9  
ATOM 4739 C CG   . PRO A 1 6  ? 5.544   3.847   -8.739 1.00 0.00 ? 6  PRO A CG   9  
ATOM 4740 C CD   . PRO A 1 6  ? 5.729   2.506   -8.085 1.00 0.00 ? 6  PRO A CD   9  
ATOM 4741 H HA   . PRO A 1 6  ? 8.464   4.002   -7.288 1.00 0.00 ? 6  PRO A HA   9  
ATOM 4742 H HB2  . PRO A 1 6  ? 6.696   5.637   -8.541 1.00 0.00 ? 6  PRO A HB2  9  
ATOM 4743 H HB3  . PRO A 1 6  ? 7.531   4.315   -9.364 1.00 0.00 ? 6  PRO A HB3  9  
ATOM 4744 H HG2  . PRO A 1 6  ? 4.754   4.397   -8.250 1.00 0.00 ? 6  PRO A HG2  9  
ATOM 4745 H HG3  . PRO A 1 6  ? 5.323   3.724   -9.789 1.00 0.00 ? 6  PRO A HG3  9  
ATOM 4746 H HD2  . PRO A 1 6  ? 4.808   2.180   -7.625 1.00 0.00 ? 6  PRO A HD2  9  
ATOM 4747 H HD3  . PRO A 1 6  ? 6.071   1.779   -8.806 1.00 0.00 ? 6  PRO A HD3  9  
ATOM 4748 N N    . GLY A 1 7  ? 7.813   5.075   -5.062 1.00 0.00 ? 7  GLY A N    9  
ATOM 4749 C CA   . GLY A 1 7  ? 7.542   5.960   -3.945 1.00 0.00 ? 7  GLY A CA   9  
ATOM 4750 C C    . GLY A 1 7  ? 7.613   5.246   -2.609 1.00 0.00 ? 7  GLY A C    9  
ATOM 4751 O O    . GLY A 1 7  ? 7.916   5.858   -1.585 1.00 0.00 ? 7  GLY A O    9  
ATOM 4752 H H    . GLY A 1 7  ? 8.600   4.491   -5.042 1.00 0.00 ? 7  GLY A H    9  
ATOM 4753 H HA2  . GLY A 1 7  ? 8.265   6.762   -3.951 1.00 0.00 ? 7  GLY A HA2  9  
ATOM 4754 H HA3  . GLY A 1 7  ? 6.554   6.379   -4.064 1.00 0.00 ? 7  GLY A HA3  9  
ATOM 4755 N N    . CYS A 1 8  ? 7.329   3.948   -2.619 1.00 0.00 ? 8  CYS A N    9  
ATOM 4756 C CA   . CYS A 1 8  ? 7.360   3.149   -1.399 1.00 0.00 ? 8  CYS A CA   9  
ATOM 4757 C C    . CYS A 1 8  ? 8.701   2.438   -1.248 1.00 0.00 ? 8  CYS A C    9  
ATOM 4758 O O    . CYS A 1 8  ? 9.511   2.415   -2.173 1.00 0.00 ? 8  CYS A O    9  
ATOM 4759 C CB   . CYS A 1 8  ? 6.224   2.124   -1.408 1.00 0.00 ? 8  CYS A CB   9  
ATOM 4760 S SG   . CYS A 1 8  ? 5.817   1.451   0.235  1.00 0.00 ? 8  CYS A SG   9  
ATOM 4761 H H    . CYS A 1 8  ? 7.094   3.516   -3.467 1.00 0.00 ? 8  CYS A H    9  
ATOM 4762 H HA   . CYS A 1 8  ? 7.224   3.817   -0.562 1.00 0.00 ? 8  CYS A HA   9  
ATOM 4763 H HB2  . CYS A 1 8  ? 5.332   2.590   -1.801 1.00 0.00 ? 8  CYS A HB2  9  
ATOM 4764 H HB3  . CYS A 1 8  ? 6.502   1.296   -2.043 1.00 0.00 ? 8  CYS A HB3  9  
ATOM 4765 N N    . GLY A 1 9  ? 8.927   1.857   -0.074 1.00 0.00 ? 9  GLY A N    9  
ATOM 4766 C CA   . GLY A 1 9  ? 10.171  1.152   0.178  1.00 0.00 ? 9  GLY A CA   9  
ATOM 4767 C C    . GLY A 1 9  ? 10.262  0.624   1.596  1.00 0.00 ? 9  GLY A C    9  
ATOM 4768 O O    . GLY A 1 9  ? 9.338   0.797   2.391  1.00 0.00 ? 9  GLY A O    9  
ATOM 4769 H H    . GLY A 1 9  ? 8.245   1.907   0.628  1.00 0.00 ? 9  GLY A H    9  
ATOM 4770 H HA2  . GLY A 1 9  ? 10.248  0.323   -0.510 1.00 0.00 ? 9  GLY A HA2  9  
ATOM 4771 H HA3  . GLY A 1 9  ? 10.996  1.828   0.005  1.00 0.00 ? 9  GLY A HA3  9  
ATOM 4772 N N    . HIS A 1 10 ? 11.378  -0.025  1.914  1.00 0.00 ? 10 HIS A N    9  
ATOM 4773 C CA   . HIS A 1 10 ? 11.585  -0.582  3.246  1.00 0.00 ? 10 HIS A CA   9  
ATOM 4774 C C    . HIS A 1 10 ? 11.741  0.529   4.280  1.00 0.00 ? 10 HIS A C    9  
ATOM 4775 O O    . HIS A 1 10 ? 12.629  1.374   4.171  1.00 0.00 ? 10 HIS A O    9  
ATOM 4776 C CB   . HIS A 1 10 ? 12.820  -1.483  3.258  1.00 0.00 ? 10 HIS A CB   9  
ATOM 4777 C CG   . HIS A 1 10 ? 12.893  -2.382  4.454  1.00 0.00 ? 10 HIS A CG   9  
ATOM 4778 N ND1  . HIS A 1 10 ? 13.422  -1.983  5.664  1.00 0.00 ? 10 HIS A ND1  9  
ATOM 4779 C CD2  . HIS A 1 10 ? 12.500  -3.666  4.622  1.00 0.00 ? 10 HIS A CD2  9  
ATOM 4780 C CE1  . HIS A 1 10 ? 13.352  -2.983  6.524  1.00 0.00 ? 10 HIS A CE1  9  
ATOM 4781 N NE2  . HIS A 1 10 ? 12.796  -4.016  5.917  1.00 0.00 ? 10 HIS A NE2  9  
ATOM 4782 H H    . HIS A 1 10 ? 12.078  -0.131  1.237  1.00 0.00 ? 10 HIS A H    9  
ATOM 4783 H HA   . HIS A 1 10 ? 10.717  -1.172  3.497  1.00 0.00 ? 10 HIS A HA   9  
ATOM 4784 H HB2  . HIS A 1 10 ? 12.811  -2.106  2.376  1.00 0.00 ? 10 HIS A HB2  9  
ATOM 4785 H HB3  . HIS A 1 10 ? 13.707  -0.867  3.250  1.00 0.00 ? 10 HIS A HB3  9  
ATOM 4786 H HD1  . HIS A 1 10 ? 13.794  -1.099  5.862  1.00 0.00 ? 10 HIS A HD1  9  
ATOM 4787 H HD2  . HIS A 1 10 ? 12.039  -4.299  3.877  1.00 0.00 ? 10 HIS A HD2  9  
ATOM 4788 H HE1  . HIS A 1 10 ? 13.691  -2.961  7.549  1.00 0.00 ? 10 HIS A HE1  9  
ATOM 4789 N N    . CYS A 1 11 ? 10.870  0.521   5.285  1.00 0.00 ? 11 CYS A N    9  
ATOM 4790 C CA   . CYS A 1 11 ? 10.910  1.527   6.339  1.00 0.00 ? 11 CYS A CA   9  
ATOM 4791 C C    . CYS A 1 11 ? 12.208  1.431   7.135  1.00 0.00 ? 11 CYS A C    9  
ATOM 4792 O O    . CYS A 1 11 ? 12.957  0.463   7.005  1.00 0.00 ? 11 CYS A O    9  
ATOM 4793 C CB   . CYS A 1 11 ? 9.711   1.363   7.275  1.00 0.00 ? 11 CYS A CB   9  
ATOM 4794 S SG   . CYS A 1 11 ? 9.771   -0.140  8.302  1.00 0.00 ? 11 CYS A SG   9  
ATOM 4795 H H    . CYS A 1 11 ? 10.184  -0.179  5.318  1.00 0.00 ? 11 CYS A H    9  
ATOM 4796 H HA   . CYS A 1 11 ? 10.860  2.499   5.872  1.00 0.00 ? 11 CYS A HA   9  
ATOM 4797 H HB2  . CYS A 1 11 ? 9.664   2.213   7.940  1.00 0.00 ? 11 CYS A HB2  9  
ATOM 4798 H HB3  . CYS A 1 11 ? 8.807   1.323   6.686  1.00 0.00 ? 11 CYS A HB3  9  
ATOM 4799 N N    . SER A 1 12 ? 12.467  2.441   7.959  1.00 0.00 ? 12 SER A N    9  
ATOM 4800 C CA   . SER A 1 12 ? 13.676  2.472   8.774  1.00 0.00 ? 12 SER A CA   9  
ATOM 4801 C C    . SER A 1 12 ? 13.463  3.313   10.029 1.00 0.00 ? 12 SER A C    9  
ATOM 4802 O O    . SER A 1 12 ? 12.715  4.291   10.015 1.00 0.00 ? 12 SER A O    9  
ATOM 4803 C CB   . SER A 1 12 ? 14.848  3.031   7.965  1.00 0.00 ? 12 SER A CB   9  
ATOM 4804 O OG   . SER A 1 12 ? 16.045  3.014   8.722  1.00 0.00 ? 12 SER A OG   9  
ATOM 4805 H H    . SER A 1 12 ? 11.831  3.185   8.018  1.00 0.00 ? 12 SER A H    9  
ATOM 4806 H HA   . SER A 1 12 ? 13.903  1.459   9.068  1.00 0.00 ? 12 SER A HA   9  
ATOM 4807 H HB2  . SER A 1 12 ? 14.988  2.432   7.078  1.00 0.00 ? 12 SER A HB2  9  
ATOM 4808 H HB3  . SER A 1 12 ? 14.631  4.051   7.679  1.00 0.00 ? 12 SER A HB3  9  
ATOM 4809 H HG   . SER A 1 12 ? 16.524  2.202   8.545  1.00 0.00 ? 12 SER A HG   9  
ATOM 4810 N N    . ARG A 1 13 ? 14.126  2.924   11.113 1.00 0.00 ? 13 ARG A N    9  
ATOM 4811 C CA   . ARG A 1 13 ? 14.009  3.640   12.378 1.00 0.00 ? 13 ARG A CA   9  
ATOM 4812 C C    . ARG A 1 13 ? 13.973  5.148   12.148 1.00 0.00 ? 13 ARG A C    9  
ATOM 4813 O O    . ARG A 1 13 ? 14.604  5.676   11.232 1.00 0.00 ? 13 ARG A O    9  
ATOM 4814 C CB   . ARG A 1 13 ? 15.176  3.282   13.301 1.00 0.00 ? 13 ARG A CB   9  
ATOM 4815 C CG   . ARG A 1 13 ? 15.080  1.884   13.890 1.00 0.00 ? 13 ARG A CG   9  
ATOM 4816 C CD   . ARG A 1 13 ? 14.206  1.863   15.135 1.00 0.00 ? 13 ARG A CD   9  
ATOM 4817 N NE   . ARG A 1 13 ? 14.815  1.095   16.217 1.00 0.00 ? 13 ARG A NE   9  
ATOM 4818 C CZ   . ARG A 1 13 ? 14.895  -0.231  16.223 1.00 0.00 ? 13 ARG A CZ   9  
ATOM 4819 N NH1  . ARG A 1 13 ? 14.408  -0.932  15.208 1.00 0.00 ? 13 ARG A NH1  9  
ATOM 4820 N NH2  . ARG A 1 13 ? 15.464  -0.858  17.244 1.00 0.00 ? 13 ARG A NH2  9  
ATOM 4821 H H    . ARG A 1 13 ? 14.707  2.136   11.062 1.00 0.00 ? 13 ARG A H    9  
ATOM 4822 H HA   . ARG A 1 13 ? 13.085  3.337   12.847 1.00 0.00 ? 13 ARG A HA   9  
ATOM 4823 H HB2  . ARG A 1 13 ? 16.097  3.350   12.740 1.00 0.00 ? 13 ARG A HB2  9  
ATOM 4824 H HB3  . ARG A 1 13 ? 15.206  3.991   14.114 1.00 0.00 ? 13 ARG A HB3  9  
ATOM 4825 H HG2  . ARG A 1 13 ? 14.652  1.221   13.152 1.00 0.00 ? 13 ARG A HG2  9  
ATOM 4826 H HG3  . ARG A 1 13 ? 16.071  1.545   14.150 1.00 0.00 ? 13 ARG A HG3  9  
ATOM 4827 H HD2  . ARG A 1 13 ? 14.054  2.879   15.468 1.00 0.00 ? 13 ARG A HD2  9  
ATOM 4828 H HD3  . ARG A 1 13 ? 13.254  1.421   14.882 1.00 0.00 ? 13 ARG A HD3  9  
ATOM 4829 H HE   . ARG A 1 13 ? 15.181  1.593   16.977 1.00 0.00 ? 13 ARG A HE   9  
ATOM 4830 H HH11 . ARG A 1 13 ? 13.980  -0.462  14.437 1.00 0.00 ? 13 ARG A HH11 9  
ATOM 4831 H HH12 . ARG A 1 13 ? 14.471  -1.930  15.214 1.00 0.00 ? 13 ARG A HH12 9  
ATOM 4832 H HH21 . ARG A 1 13 ? 15.832  -0.333  18.011 1.00 0.00 ? 13 ARG A HH21 9  
ATOM 4833 H HH22 . ARG A 1 13 ? 15.523  -1.856  17.248 1.00 0.00 ? 13 ARG A HH22 9  
ATOM 4834 N N    . PRO A 1 14 ? 13.217  5.859   12.997 1.00 0.00 ? 14 PRO A N    9  
ATOM 4835 C CA   . PRO A 1 14 ? 12.461  5.241   14.091 1.00 0.00 ? 14 PRO A CA   9  
ATOM 4836 C C    . PRO A 1 14 ? 11.287  4.410   13.587 1.00 0.00 ? 14 PRO A C    9  
ATOM 4837 O O    . PRO A 1 14 ? 10.403  4.036   14.357 1.00 0.00 ? 14 PRO A O    9  
ATOM 4838 C CB   . PRO A 1 14 ? 11.960  6.441   14.898 1.00 0.00 ? 14 PRO A CB   9  
ATOM 4839 C CG   . PRO A 1 14 ? 11.912  7.563   13.919 1.00 0.00 ? 14 PRO A CG   9  
ATOM 4840 C CD   . PRO A 1 14 ? 13.041  7.320   12.956 1.00 0.00 ? 14 PRO A CD   9  
ATOM 4841 H HA   . PRO A 1 14 ? 13.095  4.626   14.713 1.00 0.00 ? 14 PRO A HA   9  
ATOM 4842 H HB2  . PRO A 1 14 ? 10.980  6.224   15.300 1.00 0.00 ? 14 PRO A HB2  9  
ATOM 4843 H HB3  . PRO A 1 14 ? 12.647  6.650   15.704 1.00 0.00 ? 14 PRO A HB3  9  
ATOM 4844 H HG2  . PRO A 1 14 ? 10.967  7.555   13.398 1.00 0.00 ? 14 PRO A HG2  9  
ATOM 4845 H HG3  . PRO A 1 14 ? 12.052  8.503   14.431 1.00 0.00 ? 14 PRO A HG3  9  
ATOM 4846 H HD2  . PRO A 1 14 ? 12.768  7.647   11.963 1.00 0.00 ? 14 PRO A HD2  9  
ATOM 4847 H HD3  . PRO A 1 14 ? 13.936  7.825   13.288 1.00 0.00 ? 14 PRO A HD3  9  
ATOM 4848 N N    . ASN A 1 15 ? 11.284  4.123   12.289 1.00 0.00 ? 15 ASN A N    9  
ATOM 4849 C CA   . ASN A 1 15 ? 10.217  3.335   11.682 1.00 0.00 ? 15 ASN A CA   9  
ATOM 4850 C C    . ASN A 1 15 ? 10.494  1.842   11.828 1.00 0.00 ? 15 ASN A C    9  
ATOM 4851 O O    . ASN A 1 15 ? 11.642  1.403   11.756 1.00 0.00 ? 15 ASN A O    9  
ATOM 4852 C CB   . ASN A 1 15 ? 10.067  3.696   10.203 1.00 0.00 ? 15 ASN A CB   9  
ATOM 4853 C CG   . ASN A 1 15 ? 10.351  5.161   9.933  1.00 0.00 ? 15 ASN A CG   9  
ATOM 4854 O OD1  . ASN A 1 15 ? 10.160  6.012   10.802 1.00 0.00 ? 15 ASN A OD1  9  
ATOM 4855 N ND2  . ASN A 1 15 ? 10.808  5.462   8.723  1.00 0.00 ? 15 ASN A ND2  9  
ATOM 4856 H H    . ASN A 1 15 ? 12.017  4.449   11.726 1.00 0.00 ? 15 ASN A H    9  
ATOM 4857 H HA   . ASN A 1 15 ? 9.298   3.571   12.196 1.00 0.00 ? 15 ASN A HA   9  
ATOM 4858 H HB2  . ASN A 1 15 ? 10.759  3.103   9.622  1.00 0.00 ? 15 ASN A HB2  9  
ATOM 4859 H HB3  . ASN A 1 15 ? 9.058   3.478   9.886  1.00 0.00 ? 15 ASN A HB3  9  
ATOM 4860 H HD21 . ASN A 1 15 ? 10.935  4.732   8.081  1.00 0.00 ? 15 ASN A HD21 9  
ATOM 4861 H HD22 . ASN A 1 15 ? 11.000  6.402   8.522  1.00 0.00 ? 15 ASN A HD22 9  
ATOM 4862 N N    . TYR A 1 16 ? 9.434   1.067   12.033 1.00 0.00 ? 16 TYR A N    9  
ATOM 4863 C CA   . TYR A 1 16 ? 9.562   -0.376  12.190 1.00 0.00 ? 16 TYR A CA   9  
ATOM 4864 C C    . TYR A 1 16 ? 8.388   -1.102  11.539 1.00 0.00 ? 16 TYR A C    9  
ATOM 4865 O O    . TYR A 1 16 ? 7.552   -0.486  10.878 1.00 0.00 ? 16 TYR A O    9  
ATOM 4866 C CB   . TYR A 1 16 ? 9.644   -0.744  13.673 1.00 0.00 ? 16 TYR A CB   9  
ATOM 4867 C CG   . TYR A 1 16 ? 8.309   -0.703  14.382 1.00 0.00 ? 16 TYR A CG   9  
ATOM 4868 C CD1  . TYR A 1 16 ? 7.759   0.503   14.799 1.00 0.00 ? 16 TYR A CD1  9  
ATOM 4869 C CD2  . TYR A 1 16 ? 7.599   -1.870  14.634 1.00 0.00 ? 16 TYR A CD2  9  
ATOM 4870 C CE1  . TYR A 1 16 ? 6.540   0.545   15.448 1.00 0.00 ? 16 TYR A CE1  9  
ATOM 4871 C CE2  . TYR A 1 16 ? 6.378   -1.837  15.281 1.00 0.00 ? 16 TYR A CE2  9  
ATOM 4872 C CZ   . TYR A 1 16 ? 5.853   -0.627  15.686 1.00 0.00 ? 16 TYR A CZ   9  
ATOM 4873 O OH   . TYR A 1 16 ? 4.639   -0.591  16.331 1.00 0.00 ? 16 TYR A OH   9  
ATOM 4874 H H    . TYR A 1 16 ? 8.545   1.476   12.081 1.00 0.00 ? 16 TYR A H    9  
ATOM 4875 H HA   . TYR A 1 16 ? 10.476  -0.684  11.702 1.00 0.00 ? 16 TYR A HA   9  
ATOM 4876 H HB2  . TYR A 1 16 ? 10.039  -1.743  13.768 1.00 0.00 ? 16 TYR A HB2  9  
ATOM 4877 H HB3  . TYR A 1 16 ? 10.306  -0.051  14.172 1.00 0.00 ? 16 TYR A HB3  9  
ATOM 4878 H HD1  . TYR A 1 16 ? 8.299   1.419   14.611 1.00 0.00 ? 16 TYR A HD1  9  
ATOM 4879 H HD2  . TYR A 1 16 ? 8.013   -2.815  14.316 1.00 0.00 ? 16 TYR A HD2  9  
ATOM 4880 H HE1  . TYR A 1 16 ? 6.128   1.492   15.765 1.00 0.00 ? 16 TYR A HE1  9  
ATOM 4881 H HE2  . TYR A 1 16 ? 5.841   -2.755  15.468 1.00 0.00 ? 16 TYR A HE2  9  
ATOM 4882 H HH   . TYR A 1 16 ? 4.775   -0.691  17.276 1.00 0.00 ? 16 TYR A HH   9  
ATOM 4883 N N    . CYS A 1 17 ? 8.332   -2.415  11.733 1.00 0.00 ? 17 CYS A N    9  
ATOM 4884 C CA   . CYS A 1 17 ? 7.262   -3.227  11.166 1.00 0.00 ? 17 CYS A CA   9  
ATOM 4885 C C    . CYS A 1 17 ? 6.078   -3.311  12.125 1.00 0.00 ? 17 CYS A C    9  
ATOM 4886 O O    . CYS A 1 17 ? 6.247   -3.584  13.312 1.00 0.00 ? 17 CYS A O    9  
ATOM 4887 C CB   . CYS A 1 17 ? 7.775   -4.633  10.846 1.00 0.00 ? 17 CYS A CB   9  
ATOM 4888 S SG   . CYS A 1 17 ? 8.336   -4.846  9.126  1.00 0.00 ? 17 CYS A SG   9  
ATOM 4889 H H    . CYS A 1 17 ? 9.028   -2.850  12.270 1.00 0.00 ? 17 CYS A H    9  
ATOM 4890 H HA   . CYS A 1 17 ? 6.936   -2.755  10.252 1.00 0.00 ? 17 CYS A HA   9  
ATOM 4891 H HB2  . CYS A 1 17 ? 8.609   -4.859  11.494 1.00 0.00 ? 17 CYS A HB2  9  
ATOM 4892 H HB3  . CYS A 1 17 ? 6.983   -5.345  11.025 1.00 0.00 ? 17 CYS A HB3  9  
ATOM 4893 N N    . GLU A 1 18 ? 4.880   -3.075  11.598 1.00 0.00 ? 18 GLU A N    9  
ATOM 4894 C CA   . GLU A 1 18 ? 3.668   -3.124  12.408 1.00 0.00 ? 18 GLU A CA   9  
ATOM 4895 C C    . GLU A 1 18 ? 2.484   -3.623  11.584 1.00 0.00 ? 18 GLU A C    9  
ATOM 4896 O O    . GLU A 1 18 ? 2.066   -2.977  10.624 1.00 0.00 ? 18 GLU A O    9  
ATOM 4897 C CB   . GLU A 1 18 ? 3.356   -1.742  12.984 1.00 0.00 ? 18 GLU A CB   9  
ATOM 4898 C CG   . GLU A 1 18 ? 2.508   -1.784  14.244 1.00 0.00 ? 18 GLU A CG   9  
ATOM 4899 C CD   . GLU A 1 18 ? 2.778   -3.015  15.088 1.00 0.00 ? 18 GLU A CD   9  
ATOM 4900 O OE1  . GLU A 1 18 ? 3.706   -2.968  15.923 1.00 0.00 ? 18 GLU A OE1  9  
ATOM 4901 O OE2  . GLU A 1 18 ? 2.063   -4.023  14.913 1.00 0.00 ? 18 GLU A OE2  9  
ATOM 4902 H H    . GLU A 1 18 ? 4.810   -2.863  10.644 1.00 0.00 ? 18 GLU A H    9  
ATOM 4903 H HA   . GLU A 1 18 ? 3.840   -3.813  13.221 1.00 0.00 ? 18 GLU A HA   9  
ATOM 4904 H HB2  . GLU A 1 18 ? 4.286   -1.244  13.217 1.00 0.00 ? 18 GLU A HB2  9  
ATOM 4905 H HB3  . GLU A 1 18 ? 2.828   -1.166  12.239 1.00 0.00 ? 18 GLU A HB3  9  
ATOM 4906 H HG2  . GLU A 1 18 ? 2.721   -0.907  14.836 1.00 0.00 ? 18 GLU A HG2  9  
ATOM 4907 H HG3  . GLU A 1 18 ? 1.466   -1.782  13.961 1.00 0.00 ? 18 GLU A HG3  9  
ATOM 4908 N N    . GLY A 1 19 ? 1.947   -4.777  11.968 1.00 0.00 ? 19 GLY A N    9  
ATOM 4909 C CA   . GLY A 1 19 ? 0.817   -5.344  11.255 1.00 0.00 ? 19 GLY A CA   9  
ATOM 4910 C C    . GLY A 1 19 ? -0.500  -4.711  11.660 1.00 0.00 ? 19 GLY A C    9  
ATOM 4911 O O    . GLY A 1 19 ? -1.503  -4.848  10.960 1.00 0.00 ? 19 GLY A O    9  
ATOM 4912 H H    . GLY A 1 19 ? 2.322   -5.248  12.742 1.00 0.00 ? 19 GLY A H    9  
ATOM 4913 H HA2  . GLY A 1 19 ? 0.964   -5.198  10.195 1.00 0.00 ? 19 GLY A HA2  9  
ATOM 4914 H HA3  . GLY A 1 19 ? 0.772   -6.403  11.460 1.00 0.00 ? 19 GLY A HA3  9  
ATOM 4915 N N    . ALA A 1 20 ? -0.498  -4.018  12.794 1.00 0.00 ? 20 ALA A N    9  
ATOM 4916 C CA   . ALA A 1 20 ? -1.701  -3.362  13.290 1.00 0.00 ? 20 ALA A CA   9  
ATOM 4917 C C    . ALA A 1 20 ? -1.438  -1.891  13.595 1.00 0.00 ? 20 ALA A C    9  
ATOM 4918 O O    . ALA A 1 20 ? -0.467  -1.311  13.110 1.00 0.00 ? 20 ALA A O    9  
ATOM 4919 C CB   . ALA A 1 20 ? -2.218  -4.076  14.530 1.00 0.00 ? 20 ALA A CB   9  
ATOM 4920 H H    . ALA A 1 20 ? 0.333   -3.945  13.308 1.00 0.00 ? 20 ALA A H    9  
ATOM 4921 H HA   . ALA A 1 20 ? -2.459  -3.430  12.523 1.00 0.00 ? 20 ALA A HA   9  
ATOM 4922 H HB1  . ALA A 1 20 ? -1.636  -4.971  14.698 1.00 0.00 ? 20 ALA A HB1  9  
ATOM 4923 H HB2  . ALA A 1 20 ? -2.130  -3.423  15.385 1.00 0.00 ? 20 ALA A HB2  9  
ATOM 4924 H HB3  . ALA A 1 20 ? -3.254  -4.343  14.385 1.00 0.00 ? 20 ALA A HB3  9  
ATOM 4925 N N    . ARG A 1 21 ? -2.310  -1.294  14.402 1.00 0.00 ? 21 ARG A N    9  
ATOM 4926 C CA   . ARG A 1 21 ? -2.173  0.110   14.770 1.00 0.00 ? 21 ARG A CA   9  
ATOM 4927 C C    . ARG A 1 21 ? -0.899  0.338   15.579 1.00 0.00 ? 21 ARG A C    9  
ATOM 4928 O O    . ARG A 1 21 ? -0.625  -0.381  16.541 1.00 0.00 ? 21 ARG A O    9  
ATOM 4929 C CB   . ARG A 1 21 ? -3.390  0.570   15.574 1.00 0.00 ? 21 ARG A CB   9  
ATOM 4930 C CG   . ARG A 1 21 ? -4.706  0.009   15.061 1.00 0.00 ? 21 ARG A CG   9  
ATOM 4931 C CD   . ARG A 1 21 ? -5.832  1.023   15.189 1.00 0.00 ? 21 ARG A CD   9  
ATOM 4932 N NE   . ARG A 1 21 ? -7.147  0.399   15.071 1.00 0.00 ? 21 ARG A NE   9  
ATOM 4933 C CZ   . ARG A 1 21 ? -8.279  1.002   15.417 1.00 0.00 ? 21 ARG A CZ   9  
ATOM 4934 N NH1  . ARG A 1 21 ? -8.257  2.237   15.898 1.00 0.00 ? 21 ARG A NH1  9  
ATOM 4935 N NH2  . ARG A 1 21 ? -9.437  0.368   15.281 1.00 0.00 ? 21 ARG A NH2  9  
ATOM 4936 H H    . ARG A 1 21 ? -3.064  -1.810  14.757 1.00 0.00 ? 21 ARG A H    9  
ATOM 4937 H HA   . ARG A 1 21 ? -2.115  0.688   13.860 1.00 0.00 ? 21 ARG A HA   9  
ATOM 4938 H HB2  . ARG A 1 21 ? -3.267  0.258   16.601 1.00 0.00 ? 21 ARG A HB2  9  
ATOM 4939 H HB3  . ARG A 1 21 ? -3.444  1.647   15.538 1.00 0.00 ? 21 ARG A HB3  9  
ATOM 4940 H HG2  . ARG A 1 21 ? -4.593  -0.257  14.021 1.00 0.00 ? 21 ARG A HG2  9  
ATOM 4941 H HG3  . ARG A 1 21 ? -4.959  -0.871  15.634 1.00 0.00 ? 21 ARG A HG3  9  
ATOM 4942 H HD2  . ARG A 1 21 ? -5.757  1.505   16.152 1.00 0.00 ? 21 ARG A HD2  9  
ATOM 4943 H HD3  . ARG A 1 21 ? -5.722  1.762   14.408 1.00 0.00 ? 21 ARG A HD3  9  
ATOM 4944 H HE   . ARG A 1 21 ? -7.187  -0.513  14.718 1.00 0.00 ? 21 ARG A HE   9  
ATOM 4945 H HH11 . ARG A 1 21 ? -7.386  2.717   16.001 1.00 0.00 ? 21 ARG A HH11 9  
ATOM 4946 H HH12 . ARG A 1 21 ? -9.111  2.689   16.157 1.00 0.00 ? 21 ARG A HH12 9  
ATOM 4947 H HH21 . ARG A 1 21 ? -9.458  -0.563  14.918 1.00 0.00 ? 21 ARG A HH21 9  
ATOM 4948 H HH22 . ARG A 1 21 ? -10.289 0.822   15.541 1.00 0.00 ? 21 ARG A HH22 9  
ATOM 4949 N N    . CYS A 1 22 ? -0.124  1.341   15.183 1.00 0.00 ? 22 CYS A N    9  
ATOM 4950 C CA   . CYS A 1 22 ? 1.121   1.664   15.869 1.00 0.00 ? 22 CYS A CA   9  
ATOM 4951 C C    . CYS A 1 22 ? 0.880   1.877   17.361 1.00 0.00 ? 22 CYS A C    9  
ATOM 4952 O O    . CYS A 1 22 ? -0.245  2.136   17.787 1.00 0.00 ? 22 CYS A O    9  
ATOM 4953 C CB   . CYS A 1 22 ? 1.753   2.917   15.261 1.00 0.00 ? 22 CYS A CB   9  
ATOM 4954 S SG   . CYS A 1 22 ? 1.608   3.017   13.447 1.00 0.00 ? 22 CYS A SG   9  
ATOM 4955 H H    . CYS A 1 22 ? -0.396  1.879   14.408 1.00 0.00 ? 22 CYS A H    9  
ATOM 4956 H HA   . CYS A 1 22 ? 1.796   0.832   15.741 1.00 0.00 ? 22 CYS A HA   9  
ATOM 4957 H HB2  . CYS A 1 22 ? 1.274   3.792   15.676 1.00 0.00 ? 22 CYS A HB2  9  
ATOM 4958 H HB3  . CYS A 1 22 ? 2.804   2.938   15.508 1.00 0.00 ? 22 CYS A HB3  9  
ATOM 4959 N N    . GLU A 1 23 ? 1.945   1.764   18.149 1.00 0.00 ? 23 GLU A N    9  
ATOM 4960 C CA   . GLU A 1 23 ? 1.848   1.943   19.593 1.00 0.00 ? 23 GLU A CA   9  
ATOM 4961 C C    . GLU A 1 23 ? 1.645   3.414   19.946 1.00 0.00 ? 23 GLU A C    9  
ATOM 4962 O O    . GLU A 1 23 ? 1.957   4.303   19.154 1.00 0.00 ? 23 GLU A O    9  
ATOM 4963 C CB   . GLU A 1 23 ? 3.107   1.412   20.280 1.00 0.00 ? 23 GLU A CB   9  
ATOM 4964 C CG   . GLU A 1 23 ? 3.776   0.272   19.530 1.00 0.00 ? 23 GLU A CG   9  
ATOM 4965 C CD   . GLU A 1 23 ? 4.803   -0.459  20.372 1.00 0.00 ? 23 GLU A CD   9  
ATOM 4966 O OE1  . GLU A 1 23 ? 4.784   -1.708  20.378 1.00 0.00 ? 23 GLU A OE1  9  
ATOM 4967 O OE2  . GLU A 1 23 ? 5.624   0.217   21.027 1.00 0.00 ? 23 GLU A OE2  9  
ATOM 4968 H H    . GLU A 1 23 ? 2.815   1.556   17.750 1.00 0.00 ? 23 GLU A H    9  
ATOM 4969 H HA   . GLU A 1 23 ? 0.995   1.381   19.941 1.00 0.00 ? 23 GLU A HA   9  
ATOM 4970 H HB2  . GLU A 1 23 ? 3.819   2.219   20.377 1.00 0.00 ? 23 GLU A HB2  9  
ATOM 4971 H HB3  . GLU A 1 23 ? 2.842   1.059   21.266 1.00 0.00 ? 23 GLU A HB3  9  
ATOM 4972 H HG2  . GLU A 1 23 ? 3.018   -0.432  19.222 1.00 0.00 ? 23 GLU A HG2  9  
ATOM 4973 H HG3  . GLU A 1 23 ? 4.269   0.674   18.656 1.00 0.00 ? 23 GLU A HG3  9  
ATOM 4974 N N    . SER A 1 24 ? 1.118   3.662   21.141 1.00 0.00 ? 24 SER A N    9  
ATOM 4975 C CA   . SER A 1 24 ? 0.868   5.024   21.599 1.00 0.00 ? 24 SER A CA   9  
ATOM 4976 C C    . SER A 1 24 ? 2.149   5.852   21.565 1.00 0.00 ? 24 SER A C    9  
ATOM 4977 O O    . SER A 1 24 ? 2.806   6.041   22.588 1.00 0.00 ? 24 SER A O    9  
ATOM 4978 C CB   . SER A 1 24 ? 0.293   5.010   23.017 1.00 0.00 ? 24 SER A CB   9  
ATOM 4979 O OG   . SER A 1 24 ? -0.909  4.262   23.072 1.00 0.00 ? 24 SER A OG   9  
ATOM 4980 H H    . SER A 1 24 ? 0.890   2.910   21.728 1.00 0.00 ? 24 SER A H    9  
ATOM 4981 H HA   . SER A 1 24 ? 0.147   5.471   20.931 1.00 0.00 ? 24 SER A HA   9  
ATOM 4982 H HB2  . SER A 1 24 ? 1.011   4.566   23.689 1.00 0.00 ? 24 SER A HB2  9  
ATOM 4983 H HB3  . SER A 1 24 ? 0.088   6.024   23.328 1.00 0.00 ? 24 SER A HB3  9  
ATOM 4984 H HG   . SER A 1 24 ? -0.704  3.325   23.061 1.00 0.00 ? 24 SER A HG   9  
ATOM 4985 N N    . GLY A 1 25 ? 2.498   6.343   20.380 1.00 0.00 ? 25 GLY A N    9  
ATOM 4986 C CA   . GLY A 1 25 ? 3.699   7.145   20.233 1.00 0.00 ? 25 GLY A CA   9  
ATOM 4987 C C    . GLY A 1 25 ? 4.168   7.228   18.794 1.00 0.00 ? 25 GLY A C    9  
ATOM 4988 O O    . GLY A 1 25 ? 4.723   8.243   18.373 1.00 0.00 ? 25 GLY A O    9  
ATOM 4989 H H    . GLY A 1 25 ? 1.936   6.159   19.598 1.00 0.00 ? 25 GLY A H    9  
ATOM 4990 H HA2  . GLY A 1 25 ? 3.498   8.142   20.594 1.00 0.00 ? 25 GLY A HA2  9  
ATOM 4991 H HA3  . GLY A 1 25 ? 4.485   6.707   20.831 1.00 0.00 ? 25 GLY A HA3  9  
ATOM 4992 N N    . PHE A 1 26 ? 3.946   6.158   18.038 1.00 0.00 ? 26 PHE A N    9  
ATOM 4993 C CA   . PHE A 1 26 ? 4.353   6.114   16.638 1.00 0.00 ? 26 PHE A CA   9  
ATOM 4994 C C    . PHE A 1 26 ? 3.194   6.498   15.723 1.00 0.00 ? 26 PHE A C    9  
ATOM 4995 O O    . PHE A 1 26 ? 2.084   6.765   16.186 1.00 0.00 ? 26 PHE A O    9  
ATOM 4996 C CB   . PHE A 1 26 ? 4.861   4.717   16.277 1.00 0.00 ? 26 PHE A CB   9  
ATOM 4997 C CG   . PHE A 1 26 ? 6.145   4.350   16.965 1.00 0.00 ? 26 PHE A CG   9  
ATOM 4998 C CD1  . PHE A 1 26 ? 7.250   3.951   16.231 1.00 0.00 ? 26 PHE A CD1  9  
ATOM 4999 C CD2  . PHE A 1 26 ? 6.246   4.403   18.346 1.00 0.00 ? 26 PHE A CD2  9  
ATOM 5000 C CE1  . PHE A 1 26 ? 8.433   3.612   16.861 1.00 0.00 ? 26 PHE A CE1  9  
ATOM 5001 C CE2  . PHE A 1 26 ? 7.426   4.066   18.981 1.00 0.00 ? 26 PHE A CE2  9  
ATOM 5002 C CZ   . PHE A 1 26 ? 8.521   3.669   18.238 1.00 0.00 ? 26 PHE A CZ   9  
ATOM 5003 H H    . PHE A 1 26 ? 3.499   5.380   18.431 1.00 0.00 ? 26 PHE A H    9  
ATOM 5004 H HA   . PHE A 1 26 ? 5.153   6.825   16.504 1.00 0.00 ? 26 PHE A HA   9  
ATOM 5005 H HB2  . PHE A 1 26 ? 4.116   3.987   16.555 1.00 0.00 ? 26 PHE A HB2  9  
ATOM 5006 H HB3  . PHE A 1 26 ? 5.028   4.667   15.212 1.00 0.00 ? 26 PHE A HB3  9  
ATOM 5007 H HD1  . PHE A 1 26 ? 7.182   3.906   15.153 1.00 0.00 ? 26 PHE A HD1  9  
ATOM 5008 H HD2  . PHE A 1 26 ? 5.391   4.712   18.929 1.00 0.00 ? 26 PHE A HD2  9  
ATOM 5009 H HE1  . PHE A 1 26 ? 9.287   3.303   16.276 1.00 0.00 ? 26 PHE A HE1  9  
ATOM 5010 H HE2  . PHE A 1 26 ? 7.492   4.111   20.058 1.00 0.00 ? 26 PHE A HE2  9  
ATOM 5011 H HZ   . PHE A 1 26 ? 9.444   3.406   18.732 1.00 0.00 ? 26 PHE A HZ   9  
ATOM 5012 N N    . HIS A 1 27 ? 3.460   6.525   14.421 1.00 0.00 ? 27 HIS A N    9  
ATOM 5013 C CA   . HIS A 1 27 ? 2.440   6.877   13.439 1.00 0.00 ? 27 HIS A CA   9  
ATOM 5014 C C    . HIS A 1 27 ? 2.503   5.946   12.232 1.00 0.00 ? 27 HIS A C    9  
ATOM 5015 O O    . HIS A 1 27 ? 3.572   5.724   11.663 1.00 0.00 ? 27 HIS A O    9  
ATOM 5016 C CB   . HIS A 1 27 ? 2.614   8.327   12.989 1.00 0.00 ? 27 HIS A CB   9  
ATOM 5017 C CG   . HIS A 1 27 ? 4.046   8.744   12.851 1.00 0.00 ? 27 HIS A CG   9  
ATOM 5018 N ND1  . HIS A 1 27 ? 4.728   9.430   13.834 1.00 0.00 ? 27 HIS A ND1  9  
ATOM 5019 C CD2  . HIS A 1 27 ? 4.927   8.566   11.839 1.00 0.00 ? 27 HIS A CD2  9  
ATOM 5020 C CE1  . HIS A 1 27 ? 5.966   9.658   13.431 1.00 0.00 ? 27 HIS A CE1  9  
ATOM 5021 N NE2  . HIS A 1 27 ? 6.112   9.143   12.223 1.00 0.00 ? 27 HIS A NE2  9  
ATOM 5022 H H    . HIS A 1 27 ? 4.363   6.303   14.113 1.00 0.00 ? 27 HIS A H    9  
ATOM 5023 H HA   . HIS A 1 27 ? 1.475   6.769   13.911 1.00 0.00 ? 27 HIS A HA   9  
ATOM 5024 H HB2  . HIS A 1 27 ? 2.137   8.459   12.028 1.00 0.00 ? 27 HIS A HB2  9  
ATOM 5025 H HB3  . HIS A 1 27 ? 2.146   8.981   13.711 1.00 0.00 ? 27 HIS A HB3  9  
ATOM 5026 H HD1  . HIS A 1 27 ? 4.359   9.711   14.697 1.00 0.00 ? 27 HIS A HD1  9  
ATOM 5027 H HD2  . HIS A 1 27 ? 4.734   8.063   10.901 1.00 0.00 ? 27 HIS A HD2  9  
ATOM 5028 H HE1  . HIS A 1 27 ? 6.728   10.176  13.992 1.00 0.00 ? 27 HIS A HE1  9  
ATOM 5029 N N    . ASP A 1 28 ? 1.353   5.403   11.848 1.00 0.00 ? 28 ASP A N    9  
ATOM 5030 C CA   . ASP A 1 28 ? 1.278   4.496   10.709 1.00 0.00 ? 28 ASP A CA   9  
ATOM 5031 C C    . ASP A 1 28 ? 1.707   5.200   9.425  1.00 0.00 ? 28 ASP A C    9  
ATOM 5032 O O    . ASP A 1 28 ? 1.043   6.128   8.962  1.00 0.00 ? 28 ASP A O    9  
ATOM 5033 C CB   . ASP A 1 28 ? -0.143  3.951   10.557 1.00 0.00 ? 28 ASP A CB   9  
ATOM 5034 C CG   . ASP A 1 28 ? -0.405  3.397   9.170  1.00 0.00 ? 28 ASP A CG   9  
ATOM 5035 O OD1  . ASP A 1 28 ? -1.513  3.624   8.640  1.00 0.00 ? 28 ASP A OD1  9  
ATOM 5036 O OD2  . ASP A 1 28 ? 0.498   2.737   8.615  1.00 0.00 ? 28 ASP A OD2  9  
ATOM 5037 H H    . ASP A 1 28 ? 0.535   5.619   12.343 1.00 0.00 ? 28 ASP A H    9  
ATOM 5038 H HA   . ASP A 1 28 ? 1.951   3.673   10.895 1.00 0.00 ? 28 ASP A HA   9  
ATOM 5039 H HB2  . ASP A 1 28 ? -0.297  3.160   11.275 1.00 0.00 ? 28 ASP A HB2  9  
ATOM 5040 H HB3  . ASP A 1 28 ? -0.849  4.747   10.746 1.00 0.00 ? 28 ASP A HB3  9  
ATOM 5041 N N    . CYS A 1 29 ? 2.821   4.753   8.855  1.00 0.00 ? 29 CYS A N    9  
ATOM 5042 C CA   . CYS A 1 29 ? 3.340   5.340   7.626  1.00 0.00 ? 29 CYS A CA   9  
ATOM 5043 C C    . CYS A 1 29 ? 3.373   4.308   6.502  1.00 0.00 ? 29 CYS A C    9  
ATOM 5044 O O    . CYS A 1 29 ? 4.185   4.401   5.583  1.00 0.00 ? 29 CYS A O    9  
ATOM 5045 C CB   . CYS A 1 29 ? 4.744   5.902   7.858  1.00 0.00 ? 29 CYS A CB   9  
ATOM 5046 S SG   . CYS A 1 29 ? 5.876   4.750   8.701  1.00 0.00 ? 29 CYS A SG   9  
ATOM 5047 H H    . CYS A 1 29 ? 3.307   4.010   9.272  1.00 0.00 ? 29 CYS A H    9  
ATOM 5048 H HA   . CYS A 1 29 ? 2.682   6.146   7.339  1.00 0.00 ? 29 CYS A HA   9  
ATOM 5049 H HB2  . CYS A 1 29 ? 5.184   6.155   6.904  1.00 0.00 ? 29 CYS A HB2  9  
ATOM 5050 H HB3  . CYS A 1 29 ? 4.672   6.793   8.463  1.00 0.00 ? 29 CYS A HB3  9  
ATOM 5051 N N    . GLY A 1 30 ? 2.481   3.325   6.583  1.00 0.00 ? 30 GLY A N    9  
ATOM 5052 C CA   . GLY A 1 30 ? 2.424   2.290   5.567  1.00 0.00 ? 30 GLY A CA   9  
ATOM 5053 C C    . GLY A 1 30 ? 2.288   2.858   4.168  1.00 0.00 ? 30 GLY A C    9  
ATOM 5054 O O    . GLY A 1 30 ? 2.477   2.147   3.182  1.00 0.00 ? 30 GLY A O    9  
ATOM 5055 H H    . GLY A 1 30 ? 1.858   3.302   7.339  1.00 0.00 ? 30 GLY A H    9  
ATOM 5056 H HA2  . GLY A 1 30 ? 3.327   1.700   5.619  1.00 0.00 ? 30 GLY A HA2  9  
ATOM 5057 H HA3  . GLY A 1 30 ? 1.577   1.651   5.768  1.00 0.00 ? 30 GLY A HA3  9  
ATOM 5058 N N    . SER A 1 31 ? 1.957   4.142   4.082  1.00 0.00 ? 31 SER A N    9  
ATOM 5059 C CA   . SER A 1 31 ? 1.790   4.804   2.794  1.00 0.00 ? 31 SER A CA   9  
ATOM 5060 C C    . SER A 1 31 ? 2.890   4.386   1.822  1.00 0.00 ? 31 SER A C    9  
ATOM 5061 O O    . SER A 1 31 ? 2.653   3.612   0.895  1.00 0.00 ? 31 SER A O    9  
ATOM 5062 C CB   . SER A 1 31 ? 1.801   6.323   2.971  1.00 0.00 ? 31 SER A CB   9  
ATOM 5063 O OG   . SER A 1 31 ? 2.954   6.745   3.680  1.00 0.00 ? 31 SER A OG   9  
ATOM 5064 H H    . SER A 1 31 ? 1.820   4.656   4.906  1.00 0.00 ? 31 SER A H    9  
ATOM 5065 H HA   . SER A 1 31 ? 0.835   4.504   2.389  1.00 0.00 ? 31 SER A HA   9  
ATOM 5066 H HB2  . SER A 1 31 ? 1.797   6.797   2.001  1.00 0.00 ? 31 SER A HB2  9  
ATOM 5067 H HB3  . SER A 1 31 ? 0.923   6.625   3.523  1.00 0.00 ? 31 SER A HB3  9  
ATOM 5068 H HG   . SER A 1 31 ? 2.896   7.688   3.853  1.00 0.00 ? 31 SER A HG   9  
ATOM 5069 N N    . ASP A 1 32 ? 4.093   4.904   2.042  1.00 0.00 ? 32 ASP A N    9  
ATOM 5070 C CA   . ASP A 1 32 ? 5.231   4.585   1.187  1.00 0.00 ? 32 ASP A CA   9  
ATOM 5071 C C    . ASP A 1 32 ? 6.242   3.718   1.930  1.00 0.00 ? 32 ASP A C    9  
ATOM 5072 O O    . ASP A 1 32 ? 7.448   3.817   1.700  1.00 0.00 ? 32 ASP A O    9  
ATOM 5073 C CB   . ASP A 1 32 ? 5.903   5.869   0.697  1.00 0.00 ? 32 ASP A CB   9  
ATOM 5074 C CG   . ASP A 1 32 ? 5.986   6.928   1.778  1.00 0.00 ? 32 ASP A CG   9  
ATOM 5075 O OD1  . ASP A 1 32 ? 4.929   7.295   2.333  1.00 0.00 ? 32 ASP A OD1  9  
ATOM 5076 O OD2  . ASP A 1 32 ? 7.109   7.390   2.071  1.00 0.00 ? 32 ASP A OD2  9  
ATOM 5077 H H    . ASP A 1 32 ? 4.219   5.516   2.797  1.00 0.00 ? 32 ASP A H    9  
ATOM 5078 H HA   . ASP A 1 32 ? 4.861   4.036   0.335  1.00 0.00 ? 32 ASP A HA   9  
ATOM 5079 H HB2  . ASP A 1 32 ? 6.906   5.639   0.367  1.00 0.00 ? 32 ASP A HB2  9  
ATOM 5080 H HB3  . ASP A 1 32 ? 5.339   6.269   -0.132 1.00 0.00 ? 32 ASP A HB3  9  
ATOM 5081 N N    . HIS A 1 33 ? 5.743   2.868   2.822  1.00 0.00 ? 33 HIS A N    9  
ATOM 5082 C CA   . HIS A 1 33 ? 6.603   1.984   3.600  1.00 0.00 ? 33 HIS A CA   9  
ATOM 5083 C C    . HIS A 1 33 ? 5.891   0.671   3.913  1.00 0.00 ? 33 HIS A C    9  
ATOM 5084 O O    . HIS A 1 33 ? 4.874   0.656   4.607  1.00 0.00 ? 33 HIS A O    9  
ATOM 5085 C CB   . HIS A 1 33 ? 7.033   2.667   4.898  1.00 0.00 ? 33 HIS A CB   9  
ATOM 5086 C CG   . HIS A 1 33 ? 7.661   4.010   4.689  1.00 0.00 ? 33 HIS A CG   9  
ATOM 5087 N ND1  . HIS A 1 33 ? 7.247   5.146   5.351  1.00 0.00 ? 33 HIS A ND1  9  
ATOM 5088 C CD2  . HIS A 1 33 ? 8.680   4.396   3.885  1.00 0.00 ? 33 HIS A CD2  9  
ATOM 5089 C CE1  . HIS A 1 33 ? 7.983   6.173   4.964  1.00 0.00 ? 33 HIS A CE1  9  
ATOM 5090 N NE2  . HIS A 1 33 ? 8.861   5.744   4.075  1.00 0.00 ? 33 HIS A NE2  9  
ATOM 5091 H H    . HIS A 1 33 ? 4.774   2.836   2.961  1.00 0.00 ? 33 HIS A H    9  
ATOM 5092 H HA   . HIS A 1 33 ? 7.481   1.770   3.008  1.00 0.00 ? 33 HIS A HA   9  
ATOM 5093 H HB2  . HIS A 1 33 ? 6.167   2.801   5.530  1.00 0.00 ? 33 HIS A HB2  9  
ATOM 5094 H HB3  . HIS A 1 33 ? 7.751   2.040   5.407  1.00 0.00 ? 33 HIS A HB3  9  
ATOM 5095 H HD1  . HIS A 1 33 ? 6.521   5.194   6.007  1.00 0.00 ? 33 HIS A HD1  9  
ATOM 5096 H HD2  . HIS A 1 33 ? 9.247   3.761   3.218  1.00 0.00 ? 33 HIS A HD2  9  
ATOM 5097 H HE1  . HIS A 1 33 ? 7.885   7.189   5.314  1.00 0.00 ? 33 HIS A HE1  9  
ATOM 5098 N N    . TRP A 1 34 ? 6.431   -0.427  3.397  1.00 0.00 ? 34 TRP A N    9  
ATOM 5099 C CA   . TRP A 1 34 ? 5.846   -1.744  3.621  1.00 0.00 ? 34 TRP A CA   9  
ATOM 5100 C C    . TRP A 1 34 ? 6.815   -2.648  4.376  1.00 0.00 ? 34 TRP A C    9  
ATOM 5101 O O    . TRP A 1 34 ? 7.974   -2.292  4.591  1.00 0.00 ? 34 TRP A O    9  
ATOM 5102 C CB   . TRP A 1 34 ? 5.462   -2.388  2.288  1.00 0.00 ? 34 TRP A CB   9  
ATOM 5103 C CG   . TRP A 1 34 ? 6.365   -1.997  1.158  1.00 0.00 ? 34 TRP A CG   9  
ATOM 5104 C CD1  . TRP A 1 34 ? 6.011   -1.332  0.019  1.00 0.00 ? 34 TRP A CD1  9  
ATOM 5105 C CD2  . TRP A 1 34 ? 7.770   -2.249  1.057  1.00 0.00 ? 34 TRP A CD2  9  
ATOM 5106 N NE1  . TRP A 1 34 ? 7.112   -1.156  -0.784 1.00 0.00 ? 34 TRP A NE1  9  
ATOM 5107 C CE2  . TRP A 1 34 ? 8.204   -1.709  -0.169 1.00 0.00 ? 34 TRP A CE2  9  
ATOM 5108 C CE3  . TRP A 1 34 ? 8.705   -2.878  1.884  1.00 0.00 ? 34 TRP A CE3  9  
ATOM 5109 C CZ2  . TRP A 1 34 ? 9.531   -1.779  -0.586 1.00 0.00 ? 34 TRP A CZ2  9  
ATOM 5110 C CZ3  . TRP A 1 34 ? 10.021  -2.947  1.469  1.00 0.00 ? 34 TRP A CZ3  9  
ATOM 5111 C CH2  . TRP A 1 34 ? 10.425  -2.400  0.244  1.00 0.00 ? 34 TRP A CH2  9  
ATOM 5112 H H    . TRP A 1 34 ? 7.242   -0.351  2.852  1.00 0.00 ? 34 TRP A H    9  
ATOM 5113 H HA   . TRP A 1 34 ? 4.955   -1.613  4.218  1.00 0.00 ? 34 TRP A HA   9  
ATOM 5114 H HB2  . TRP A 1 34 ? 5.500   -3.462  2.390  1.00 0.00 ? 34 TRP A HB2  9  
ATOM 5115 H HB3  . TRP A 1 34 ? 4.456   -2.090  2.030  1.00 0.00 ? 34 TRP A HB3  9  
ATOM 5116 H HD1  . TRP A 1 34 ? 5.008   -1.001  -0.206 1.00 0.00 ? 34 TRP A HD1  9  
ATOM 5117 H HE1  . TRP A 1 34 ? 7.115   -0.705  -1.655 1.00 0.00 ? 34 TRP A HE1  9  
ATOM 5118 H HE3  . TRP A 1 34 ? 8.414   -3.305  2.832  1.00 0.00 ? 34 TRP A HE3  9  
ATOM 5119 H HZ2  . TRP A 1 34 ? 9.857   -1.362  -1.527 1.00 0.00 ? 34 TRP A HZ2  9  
ATOM 5120 H HZ3  . TRP A 1 34 ? 10.758  -3.429  2.095  1.00 0.00 ? 34 TRP A HZ3  9  
ATOM 5121 H HH2  . TRP A 1 34 ? 11.463  -2.478  -0.040 1.00 0.00 ? 34 TRP A HH2  9  
ATOM 5122 N N    . CYS A 1 35 ? 6.333   -3.820  4.777  1.00 0.00 ? 35 CYS A N    9  
ATOM 5123 C CA   . CYS A 1 35 ? 7.156   -4.776  5.508  1.00 0.00 ? 35 CYS A CA   9  
ATOM 5124 C C    . CYS A 1 35 ? 7.557   -5.945  4.613  1.00 0.00 ? 35 CYS A C    9  
ATOM 5125 O O    . CYS A 1 35 ? 7.059   -6.084  3.496  1.00 0.00 ? 35 CYS A O    9  
ATOM 5126 C CB   . CYS A 1 35 ? 6.404   -5.294  6.736  1.00 0.00 ? 35 CYS A CB   9  
ATOM 5127 S SG   . CYS A 1 35 ? 6.539   -4.217  8.199  1.00 0.00 ? 35 CYS A SG   9  
ATOM 5128 H H    . CYS A 1 35 ? 5.400   -4.048  4.576  1.00 0.00 ? 35 CYS A H    9  
ATOM 5129 H HA   . CYS A 1 35 ? 8.049   -4.265  5.833  1.00 0.00 ? 35 CYS A HA   9  
ATOM 5130 H HB2  . CYS A 1 35 ? 5.355   -5.386  6.493  1.00 0.00 ? 35 CYS A HB2  9  
ATOM 5131 H HB3  . CYS A 1 35 ? 6.793   -6.264  7.004  1.00 0.00 ? 35 CYS A HB3  9  
ATOM 5132 N N    . ASP A 1 36 ? 8.458   -6.783  5.113  1.00 0.00 ? 36 ASP A N    9  
ATOM 5133 C CA   . ASP A 1 36 ? 8.926   -7.941  4.360  1.00 0.00 ? 36 ASP A CA   9  
ATOM 5134 C C    . ASP A 1 36 ? 7.750   -8.727  3.786  1.00 0.00 ? 36 ASP A C    9  
ATOM 5135 O O    . ASP A 1 36 ? 7.808   -9.212  2.657  1.00 0.00 ? 36 ASP A O    9  
ATOM 5136 C CB   . ASP A 1 36 ? 9.774   -8.848  5.253  1.00 0.00 ? 36 ASP A CB   9  
ATOM 5137 C CG   . ASP A 1 36 ? 11.237  -8.451  5.258  1.00 0.00 ? 36 ASP A CG   9  
ATOM 5138 O OD1  . ASP A 1 36 ? 12.093  -9.341  5.449  1.00 0.00 ? 36 ASP A OD1  9  
ATOM 5139 O OD2  . ASP A 1 36 ? 11.526  -7.251  5.070  1.00 0.00 ? 36 ASP A OD2  9  
ATOM 5140 H H    . ASP A 1 36 ? 8.818   -6.619  6.010  1.00 0.00 ? 36 ASP A H    9  
ATOM 5141 H HA   . ASP A 1 36 ? 9.535   -7.583  3.544  1.00 0.00 ? 36 ASP A HA   9  
ATOM 5142 H HB2  . ASP A 1 36 ? 9.402   -8.795  6.266  1.00 0.00 ? 36 ASP A HB2  9  
ATOM 5143 H HB3  . ASP A 1 36 ? 9.696   -9.866  4.899  1.00 0.00 ? 36 ASP A HB3  9  
ATOM 5144 N N    . ALA A 1 37 ? 6.686   -8.848  4.573  1.00 0.00 ? 37 ALA A N    9  
ATOM 5145 C CA   . ALA A 1 37 ? 5.497   -9.573  4.143  1.00 0.00 ? 37 ALA A CA   9  
ATOM 5146 C C    . ALA A 1 37 ? 4.468   -8.628  3.532  1.00 0.00 ? 37 ALA A C    9  
ATOM 5147 O O    . ALA A 1 37 ? 4.039   -7.667  4.170  1.00 0.00 ? 37 ALA A O    9  
ATOM 5148 C CB   . ALA A 1 37 ? 4.890   -10.333 5.313  1.00 0.00 ? 37 ALA A CB   9  
ATOM 5149 H H    . ALA A 1 37 ? 6.700   -8.438  5.463  1.00 0.00 ? 37 ALA A H    9  
ATOM 5150 H HA   . ALA A 1 37 ? 5.798   -10.293 3.395  1.00 0.00 ? 37 ALA A HA   9  
ATOM 5151 H HB1  . ALA A 1 37 ? 4.088   -9.750  5.742  1.00 0.00 ? 37 ALA A HB1  9  
ATOM 5152 H HB2  . ALA A 1 37 ? 4.502   -11.279 4.966  1.00 0.00 ? 37 ALA A HB2  9  
ATOM 5153 H HB3  . ALA A 1 37 ? 5.649   -10.507 6.061  1.00 0.00 ? 37 ALA A HB3  9  
ATOM 5154 N N    . SER A 1 38 ? 4.077   -8.907  2.293  1.00 0.00 ? 38 SER A N    9  
ATOM 5155 C CA   . SER A 1 38 ? 3.101   -8.078  1.595  1.00 0.00 ? 38 SER A CA   9  
ATOM 5156 C C    . SER A 1 38 ? 1.785   -8.022  2.365  1.00 0.00 ? 38 SER A C    9  
ATOM 5157 O O    . SER A 1 38 ? 0.825   -8.712  2.027  1.00 0.00 ? 38 SER A O    9  
ATOM 5158 C CB   . SER A 1 38 ? 2.856   -8.620  0.185  1.00 0.00 ? 38 SER A CB   9  
ATOM 5159 O OG   . SER A 1 38 ? 2.584   -10.010 0.213  1.00 0.00 ? 38 SER A OG   9  
ATOM 5160 H H    . SER A 1 38 ? 4.455   -9.688  1.837  1.00 0.00 ? 38 SER A H    9  
ATOM 5161 H HA   . SER A 1 38 ? 3.505   -7.080  1.522  1.00 0.00 ? 38 SER A HA   9  
ATOM 5162 H HB2  . SER A 1 38 ? 2.013   -8.109  -0.253 1.00 0.00 ? 38 SER A HB2  9  
ATOM 5163 H HB3  . SER A 1 38 ? 3.735   -8.449  -0.421 1.00 0.00 ? 38 SER A HB3  9  
ATOM 5164 H HG   . SER A 1 38 ? 2.015   -10.210 0.960  1.00 0.00 ? 38 SER A HG   9  
ATOM 5165 N N    . GLY A 1 39 ? 1.751   -7.194  3.405  1.00 0.00 ? 39 GLY A N    9  
ATOM 5166 C CA   . GLY A 1 39 ? 0.549   -7.062  4.208  1.00 0.00 ? 39 GLY A CA   9  
ATOM 5167 C C    . GLY A 1 39 ? 0.787   -6.273  5.481  1.00 0.00 ? 39 GLY A C    9  
ATOM 5168 O O    . GLY A 1 39 ? -0.148  -5.716  6.057  1.00 0.00 ? 39 GLY A O    9  
ATOM 5169 H H    . GLY A 1 39 ? 2.547   -6.668  3.628  1.00 0.00 ? 39 GLY A H    9  
ATOM 5170 H HA2  . GLY A 1 39 ? -0.209  -6.562  3.623  1.00 0.00 ? 39 GLY A HA2  9  
ATOM 5171 H HA3  . GLY A 1 39 ? 0.196   -8.048  4.471  1.00 0.00 ? 39 GLY A HA3  9  
ATOM 5172 N N    . ASP A 1 40 ? 2.039   -6.225  5.921  1.00 0.00 ? 40 ASP A N    9  
ATOM 5173 C CA   . ASP A 1 40 ? 2.397   -5.499  7.134  1.00 0.00 ? 40 ASP A CA   9  
ATOM 5174 C C    . ASP A 1 40 ? 2.778   -4.058  6.812  1.00 0.00 ? 40 ASP A C    9  
ATOM 5175 O O    . ASP A 1 40 ? 3.556   -3.802  5.892  1.00 0.00 ? 40 ASP A O    9  
ATOM 5176 C CB   . ASP A 1 40 ? 3.553   -6.198  7.850  1.00 0.00 ? 40 ASP A CB   9  
ATOM 5177 C CG   . ASP A 1 40 ? 3.075   -7.198  8.884  1.00 0.00 ? 40 ASP A CG   9  
ATOM 5178 O OD1  . ASP A 1 40 ? 3.130   -6.878  10.090 1.00 0.00 ? 40 ASP A OD1  9  
ATOM 5179 O OD2  . ASP A 1 40 ? 2.644   -8.301  8.487  1.00 0.00 ? 40 ASP A OD2  9  
ATOM 5180 H H    . ASP A 1 40 ? 2.741   -6.689  5.417  1.00 0.00 ? 40 ASP A H    9  
ATOM 5181 H HA   . ASP A 1 40 ? 1.534   -5.494  7.783  1.00 0.00 ? 40 ASP A HA   9  
ATOM 5182 H HB2  . ASP A 1 40 ? 4.155   -6.722  7.121  1.00 0.00 ? 40 ASP A HB2  9  
ATOM 5183 H HB3  . ASP A 1 40 ? 4.161   -5.457  8.347  1.00 0.00 ? 40 ASP A HB3  9  
ATOM 5184 N N    . ARG A 1 41 ? 2.225   -3.120  7.574  1.00 0.00 ? 41 ARG A N    9  
ATOM 5185 C CA   . ARG A 1 41 ? 2.505   -1.704  7.368  1.00 0.00 ? 41 ARG A CA   9  
ATOM 5186 C C    . ARG A 1 41 ? 3.594   -1.221  8.321  1.00 0.00 ? 41 ARG A C    9  
ATOM 5187 O O    . ARG A 1 41 ? 3.556   -1.504  9.519  1.00 0.00 ? 41 ARG A O    9  
ATOM 5188 C CB   . ARG A 1 41 ? 1.234   -0.877  7.567  1.00 0.00 ? 41 ARG A CB   9  
ATOM 5189 C CG   . ARG A 1 41 ? 0.155   -1.598  8.359  1.00 0.00 ? 41 ARG A CG   9  
ATOM 5190 C CD   . ARG A 1 41 ? -1.037  -0.694  8.628  1.00 0.00 ? 41 ARG A CD   9  
ATOM 5191 N NE   . ARG A 1 41 ? -2.022  -0.753  7.551  1.00 0.00 ? 41 ARG A NE   9  
ATOM 5192 C CZ   . ARG A 1 41 ? -1.951  -0.015  6.448  1.00 0.00 ? 41 ARG A CZ   9  
ATOM 5193 N NH1  . ARG A 1 41 ? -0.946  0.833   6.278  1.00 0.00 ? 41 ARG A NH1  9  
ATOM 5194 N NH2  . ARG A 1 41 ? -2.886  -0.125  5.513  1.00 0.00 ? 41 ARG A NH2  9  
ATOM 5195 H H    . ARG A 1 41 ? 1.613   -3.387  8.291  1.00 0.00 ? 41 ARG A H    9  
ATOM 5196 H HA   . ARG A 1 41 ? 2.850   -1.579  6.353  1.00 0.00 ? 41 ARG A HA   9  
ATOM 5197 H HB2  . ARG A 1 41 ? 1.488   0.032   8.093  1.00 0.00 ? 41 ARG A HB2  9  
ATOM 5198 H HB3  . ARG A 1 41 ? 0.830   -0.621  6.600  1.00 0.00 ? 41 ARG A HB3  9  
ATOM 5199 H HG2  . ARG A 1 41 ? -0.178  -2.457  7.796  1.00 0.00 ? 41 ARG A HG2  9  
ATOM 5200 H HG3  . ARG A 1 41 ? 0.570   -1.922  9.302  1.00 0.00 ? 41 ARG A HG3  9  
ATOM 5201 H HD2  . ARG A 1 41 ? -1.507  -1.004  9.549  1.00 0.00 ? 41 ARG A HD2  9  
ATOM 5202 H HD3  . ARG A 1 41 ? -0.686  0.322   8.727  1.00 0.00 ? 41 ARG A HD3  9  
ATOM 5203 H HE   . ARG A 1 41 ? -2.773  -1.373  7.656  1.00 0.00 ? 41 ARG A HE   9  
ATOM 5204 H HH11 . ARG A 1 41 ? -0.239  0.917   6.980  1.00 0.00 ? 41 ARG A HH11 9  
ATOM 5205 H HH12 . ARG A 1 41 ? -0.894  1.386   5.446  1.00 0.00 ? 41 ARG A HH12 9  
ATOM 5206 H HH21 . ARG A 1 41 ? -3.645  -0.763  5.638  1.00 0.00 ? 41 ARG A HH21 9  
ATOM 5207 H HH22 . ARG A 1 41 ? -2.831  0.430   4.684  1.00 0.00 ? 41 ARG A HH22 9  
ATOM 5208 N N    . CYS A 1 42 ? 4.565   -0.492  7.781  1.00 0.00 ? 42 CYS A N    9  
ATOM 5209 C CA   . CYS A 1 42 ? 5.666   0.030   8.582  1.00 0.00 ? 42 CYS A CA   9  
ATOM 5210 C C    . CYS A 1 42 ? 5.245   1.294   9.327  1.00 0.00 ? 42 CYS A C    9  
ATOM 5211 O O    . CYS A 1 42 ? 4.747   2.245   8.724  1.00 0.00 ? 42 CYS A O    9  
ATOM 5212 C CB   . CYS A 1 42 ? 6.875   0.326   7.693  1.00 0.00 ? 42 CYS A CB   9  
ATOM 5213 S SG   . CYS A 1 42 ? 8.035   -1.069  7.526  1.00 0.00 ? 42 CYS A SG   9  
ATOM 5214 H H    . CYS A 1 42 ? 4.541   -0.300  6.820  1.00 0.00 ? 42 CYS A H    9  
ATOM 5215 H HA   . CYS A 1 42 ? 5.937   -0.725  9.305  1.00 0.00 ? 42 CYS A HA   9  
ATOM 5216 H HB2  . CYS A 1 42 ? 6.529   0.585   6.703  1.00 0.00 ? 42 CYS A HB2  9  
ATOM 5217 H HB3  . CYS A 1 42 ? 7.421   1.160   8.108  1.00 0.00 ? 42 CYS A HB3  9  
ATOM 5218 N N    . CYS A 1 43 ? 5.450   1.297   10.639 1.00 0.00 ? 43 CYS A N    9  
ATOM 5219 C CA   . CYS A 1 43 ? 5.093   2.442   11.467 1.00 0.00 ? 43 CYS A CA   9  
ATOM 5220 C C    . CYS A 1 43 ? 6.319   3.301   11.765 1.00 0.00 ? 43 CYS A C    9  
ATOM 5221 O O    . CYS A 1 43 ? 7.391   2.785   12.083 1.00 0.00 ? 43 CYS A O    9  
ATOM 5222 C CB   . CYS A 1 43 ? 4.456   1.973   12.776 1.00 0.00 ? 43 CYS A CB   9  
ATOM 5223 S SG   . CYS A 1 43 ? 2.689   1.551   12.634 1.00 0.00 ? 43 CYS A SG   9  
ATOM 5224 H H    . CYS A 1 43 ? 5.852   0.508   11.063 1.00 0.00 ? 43 CYS A H    9  
ATOM 5225 H HA   . CYS A 1 43 ? 4.377   3.036   10.921 1.00 0.00 ? 43 CYS A HA   9  
ATOM 5226 H HB2  . CYS A 1 43 ? 4.976   1.093   13.126 1.00 0.00 ? 43 CYS A HB2  9  
ATOM 5227 H HB3  . CYS A 1 43 ? 4.548   2.756   13.514 1.00 0.00 ? 43 CYS A HB3  9  
ATOM 5228 N N    . CYS A 1 44 ? 6.153   4.615   11.660 1.00 0.00 ? 44 CYS A N    9  
ATOM 5229 C CA   . CYS A 1 44 ? 7.244   5.547   11.917 1.00 0.00 ? 44 CYS A CA   9  
ATOM 5230 C C    . CYS A 1 44 ? 7.002   6.326   13.207 1.00 0.00 ? 44 CYS A C    9  
ATOM 5231 O O    . CYS A 1 44 ? 5.913   6.853   13.431 1.00 0.00 ? 44 CYS A O    9  
ATOM 5232 C CB   . CYS A 1 44 ? 7.401   6.518   10.745 1.00 0.00 ? 44 CYS A CB   9  
ATOM 5233 S SG   . CYS A 1 44 ? 7.572   5.704   9.124  1.00 0.00 ? 44 CYS A SG   9  
ATOM 5234 H H    . CYS A 1 44 ? 5.275   4.968   11.402 1.00 0.00 ? 44 CYS A H    9  
ATOM 5235 H HA   . CYS A 1 44 ? 8.153   4.974   12.022 1.00 0.00 ? 44 CYS A HA   9  
ATOM 5236 H HB2  . CYS A 1 44 ? 6.533   7.159   10.700 1.00 0.00 ? 44 CYS A HB2  9  
ATOM 5237 H HB3  . CYS A 1 44 ? 8.281   7.123   10.904 1.00 0.00 ? 44 CYS A HB3  9  
ATOM 5238 N N    . ALA A 1 45 ? 8.026   6.393   14.052 1.00 0.00 ? 45 ALA A N    9  
ATOM 5239 C CA   . ALA A 1 45 ? 7.925   7.109   15.318 1.00 0.00 ? 45 ALA A CA   9  
ATOM 5240 C C    . ALA A 1 45 ? 8.076   8.612   15.112 1.00 0.00 ? 45 ALA A C    9  
ATOM 5241 O O    . ALA A 1 45 ? 8.205   9.370   16.075 1.00 0.00 ? 45 ALA A O    9  
ATOM 5242 C CB   . ALA A 1 45 ? 8.974   6.600   16.296 1.00 0.00 ? 45 ALA A CB   9  
ATOM 5243 H H    . ALA A 1 45 ? 8.868   5.952   13.818 1.00 0.00 ? 45 ALA A H    9  
ATOM 5244 H HA   . ALA A 1 45 ? 6.950   6.909   15.738 1.00 0.00 ? 45 ALA A HA   9  
ATOM 5245 H HB1  . ALA A 1 45 ? 9.825   7.266   16.288 1.00 0.00 ? 45 ALA A HB1  9  
ATOM 5246 H HB2  . ALA A 1 45 ? 8.553   6.566   17.290 1.00 0.00 ? 45 ALA A HB2  9  
ATOM 5247 H HB3  . ALA A 1 45 ? 9.288   5.610   16.004 1.00 0.00 ? 45 ALA A HB3  9  
ATOM 5248 N N    . CYS A 1 1  ? 0.512   0.747   -1.448 1.00 0.00 ? 1  CYS A N    10 
ATOM 5249 C CA   . CYS A 1 1  ? 1.670   0.695   -2.332 1.00 0.00 ? 1  CYS A CA   10 
ATOM 5250 C C    . CYS A 1 1  ? 2.136   -0.743  -2.536 1.00 0.00 ? 1  CYS A C    10 
ATOM 5251 O O    . CYS A 1 1  ? 1.608   -1.671  -1.921 1.00 0.00 ? 1  CYS A O    10 
ATOM 5252 C CB   . CYS A 1 1  ? 2.813   1.537   -1.759 1.00 0.00 ? 1  CYS A CB   10 
ATOM 5253 S SG   . CYS A 1 1  ? 3.533   0.867   -0.226 1.00 0.00 ? 1  CYS A SG   10 
ATOM 5254 H H    . CYS A 1 1  ? 0.566   1.269   -0.619 1.00 0.00 ? 1  CYS A H    10 
ATOM 5255 H HA   . CYS A 1 1  ? 1.377   1.105   -3.287 1.00 0.00 ? 1  CYS A HA   10 
ATOM 5256 H HB2  . CYS A 1 1  ? 3.604   1.601   -2.492 1.00 0.00 ? 1  CYS A HB2  10 
ATOM 5257 H HB3  . CYS A 1 1  ? 2.446   2.529   -1.545 1.00 0.00 ? 1  CYS A HB3  10 
ATOM 5258 N N    . TYR A 1 2  ? 3.126   -0.921  -3.403 1.00 0.00 ? 2  TYR A N    10 
ATOM 5259 C CA   . TYR A 1 2  ? 3.662   -2.247  -3.690 1.00 0.00 ? 2  TYR A CA   10 
ATOM 5260 C C    . TYR A 1 2  ? 5.167   -2.290  -3.446 1.00 0.00 ? 2  TYR A C    10 
ATOM 5261 O O    . TYR A 1 2  ? 5.853   -1.268  -3.448 1.00 0.00 ? 2  TYR A O    10 
ATOM 5262 C CB   . TYR A 1 2  ? 3.357   -2.641  -5.136 1.00 0.00 ? 2  TYR A CB   10 
ATOM 5263 C CG   . TYR A 1 2  ? 2.536   -3.905  -5.258 1.00 0.00 ? 2  TYR A CG   10 
ATOM 5264 C CD1  . TYR A 1 2  ? 2.807   -4.839  -6.251 1.00 0.00 ? 2  TYR A CD1  10 
ATOM 5265 C CD2  . TYR A 1 2  ? 1.489   -4.165  -4.382 1.00 0.00 ? 2  TYR A CD2  10 
ATOM 5266 C CE1  . TYR A 1 2  ? 2.060   -5.995  -6.367 1.00 0.00 ? 2  TYR A CE1  10 
ATOM 5267 C CE2  . TYR A 1 2  ? 0.737   -5.319  -4.490 1.00 0.00 ? 2  TYR A CE2  10 
ATOM 5268 C CZ   . TYR A 1 2  ? 1.026   -6.231  -5.484 1.00 0.00 ? 2  TYR A CZ   10 
ATOM 5269 O OH   . TYR A 1 2  ? 0.279   -7.381  -5.596 1.00 0.00 ? 2  TYR A OH   10 
ATOM 5270 H H    . TYR A 1 2  ? 3.506   -0.143  -3.862 1.00 0.00 ? 2  TYR A H    10 
ATOM 5271 H HA   . TYR A 1 2  ? 3.181   -2.950  -3.026 1.00 0.00 ? 2  TYR A HA   10 
ATOM 5272 H HB2  . TYR A 1 2  ? 2.808   -1.843  -5.611 1.00 0.00 ? 2  TYR A HB2  10 
ATOM 5273 H HB3  . TYR A 1 2  ? 4.286   -2.796  -5.663 1.00 0.00 ? 2  TYR A HB3  10 
ATOM 5274 H HD1  . TYR A 1 2  ? 3.617   -4.652  -6.941 1.00 0.00 ? 2  TYR A HD1  10 
ATOM 5275 H HD2  . TYR A 1 2  ? 1.265   -3.449  -3.605 1.00 0.00 ? 2  TYR A HD2  10 
ATOM 5276 H HE1  . TYR A 1 2  ? 2.286   -6.709  -7.145 1.00 0.00 ? 2  TYR A HE1  10 
ATOM 5277 H HE2  . TYR A 1 2  ? -0.072  -5.504  -3.800 1.00 0.00 ? 2  TYR A HE2  10 
ATOM 5278 H HH   . TYR A 1 2  ? -0.241  -7.503  -4.798 1.00 0.00 ? 2  TYR A HH   10 
ATOM 5279 N N    . PRO A 1 3  ? 5.696   -3.504  -3.230 1.00 0.00 ? 3  PRO A N    10 
ATOM 5280 C CA   . PRO A 1 3  ? 7.125   -3.713  -2.982 1.00 0.00 ? 3  PRO A CA   10 
ATOM 5281 C C    . PRO A 1 3  ? 7.973   -3.456  -4.223 1.00 0.00 ? 3  PRO A C    10 
ATOM 5282 O O    . PRO A 1 3  ? 8.387   -4.391  -4.908 1.00 0.00 ? 3  PRO A O    10 
ATOM 5283 C CB   . PRO A 1 3  ? 7.203   -5.187  -2.576 1.00 0.00 ? 3  PRO A CB   10 
ATOM 5284 C CG   . PRO A 1 3  ? 6.013   -5.818  -3.211 1.00 0.00 ? 3  PRO A CG   10 
ATOM 5285 C CD   . PRO A 1 3  ? 4.938   -4.767  -3.213 1.00 0.00 ? 3  PRO A CD   10 
ATOM 5286 H HA   . PRO A 1 3  ? 7.481   -3.095  -2.170 1.00 0.00 ? 3  PRO A HA   10 
ATOM 5287 H HB2  . PRO A 1 3  ? 8.124   -5.616  -2.945 1.00 0.00 ? 3  PRO A HB2  10 
ATOM 5288 H HB3  . PRO A 1 3  ? 7.167   -5.270  -1.500 1.00 0.00 ? 3  PRO A HB3  10 
ATOM 5289 H HG2  . PRO A 1 3  ? 6.250   -6.114  -4.222 1.00 0.00 ? 3  PRO A HG2  10 
ATOM 5290 H HG3  . PRO A 1 3  ? 5.699   -6.674  -2.632 1.00 0.00 ? 3  PRO A HG3  10 
ATOM 5291 H HD2  . PRO A 1 3  ? 4.322   -4.859  -4.096 1.00 0.00 ? 3  PRO A HD2  10 
ATOM 5292 H HD3  . PRO A 1 3  ? 4.335   -4.842  -2.320 1.00 0.00 ? 3  PRO A HD3  10 
ATOM 5293 N N    . GLY A 1 4  ? 8.228   -2.183  -4.507 1.00 0.00 ? 4  GLY A N    10 
ATOM 5294 C CA   . GLY A 1 4  ? 9.026   -1.827  -5.666 1.00 0.00 ? 4  GLY A CA   10 
ATOM 5295 C C    . GLY A 1 4  ? 8.464   -0.633  -6.412 1.00 0.00 ? 4  GLY A C    10 
ATOM 5296 O O    . GLY A 1 4  ? 8.997   -0.233  -7.446 1.00 0.00 ? 4  GLY A O    10 
ATOM 5297 H H    . GLY A 1 4  ? 7.872   -1.479  -3.925 1.00 0.00 ? 4  GLY A H    10 
ATOM 5298 H HA2  . GLY A 1 4  ? 10.030  -1.596  -5.341 1.00 0.00 ? 4  GLY A HA2  10 
ATOM 5299 H HA3  . GLY A 1 4  ? 9.061   -2.672  -6.337 1.00 0.00 ? 4  GLY A HA3  10 
ATOM 5300 N N    . GLN A 1 5  ? 7.384   -0.063  -5.886 1.00 0.00 ? 5  GLN A N    10 
ATOM 5301 C CA   . GLN A 1 5  ? 6.749   1.091   -6.511 1.00 0.00 ? 5  GLN A CA   10 
ATOM 5302 C C    . GLN A 1 5  ? 7.563   2.357   -6.270 1.00 0.00 ? 5  GLN A C    10 
ATOM 5303 O O    . GLN A 1 5  ? 8.324   2.462   -5.308 1.00 0.00 ? 5  GLN A O    10 
ATOM 5304 C CB   . GLN A 1 5  ? 5.329   1.272   -5.972 1.00 0.00 ? 5  GLN A CB   10 
ATOM 5305 C CG   . GLN A 1 5  ? 4.418   0.086   -6.244 1.00 0.00 ? 5  GLN A CG   10 
ATOM 5306 C CD   . GLN A 1 5  ? 2.949   0.439   -6.122 1.00 0.00 ? 5  GLN A CD   10 
ATOM 5307 O OE1  . GLN A 1 5  ? 2.528   1.065   -5.149 1.00 0.00 ? 5  GLN A OE1  10 
ATOM 5308 N NE2  . GLN A 1 5  ? 2.160   0.037   -7.111 1.00 0.00 ? 5  GLN A NE2  10 
ATOM 5309 H H    . GLN A 1 5  ? 7.006   -0.428  -5.060 1.00 0.00 ? 5  GLN A H    10 
ATOM 5310 H HA   . GLN A 1 5  ? 6.699   0.906   -7.574 1.00 0.00 ? 5  GLN A HA   10 
ATOM 5311 H HB2  . GLN A 1 5  ? 5.379   1.423   -4.904 1.00 0.00 ? 5  GLN A HB2  10 
ATOM 5312 H HB3  . GLN A 1 5  ? 4.892   2.147   -6.430 1.00 0.00 ? 5  GLN A HB3  10 
ATOM 5313 H HG2  . GLN A 1 5  ? 4.605   -0.272  -7.245 1.00 0.00 ? 5  GLN A HG2  10 
ATOM 5314 H HG3  . GLN A 1 5  ? 4.646   -0.696  -5.535 1.00 0.00 ? 5  GLN A HG3  10 
ATOM 5315 H HE21 . GLN A 1 5  ? 2.565   -0.459  -7.854 1.00 0.00 ? 5  GLN A HE21 10 
ATOM 5316 H HE22 . GLN A 1 5  ? 1.206   0.251   -7.058 1.00 0.00 ? 5  GLN A HE22 10 
ATOM 5317 N N    . PRO A 1 6  ? 7.402   3.344   -7.165 1.00 0.00 ? 6  PRO A N    10 
ATOM 5318 C CA   . PRO A 1 6  ? 8.114   4.622   -7.070 1.00 0.00 ? 6  PRO A CA   10 
ATOM 5319 C C    . PRO A 1 6  ? 7.630   5.471   -5.900 1.00 0.00 ? 6  PRO A C    10 
ATOM 5320 O O    . PRO A 1 6  ? 6.801   6.364   -6.070 1.00 0.00 ? 6  PRO A O    10 
ATOM 5321 C CB   . PRO A 1 6  ? 7.789   5.308   -8.399 1.00 0.00 ? 6  PRO A CB   10 
ATOM 5322 C CG   . PRO A 1 6  ? 6.494   4.709   -8.828 1.00 0.00 ? 6  PRO A CG   10 
ATOM 5323 C CD   . PRO A 1 6  ? 6.512   3.288   -8.336 1.00 0.00 ? 6  PRO A CD   10 
ATOM 5324 H HA   . PRO A 1 6  ? 9.182   4.476   -6.990 1.00 0.00 ? 6  PRO A HA   10 
ATOM 5325 H HB2  . PRO A 1 6  ? 7.701   6.374   -8.245 1.00 0.00 ? 6  PRO A HB2  10 
ATOM 5326 H HB3  . PRO A 1 6  ? 8.573   5.106   -9.114 1.00 0.00 ? 6  PRO A HB3  10 
ATOM 5327 H HG2  . PRO A 1 6  ? 5.674   5.250   -8.382 1.00 0.00 ? 6  PRO A HG2  10 
ATOM 5328 H HG3  . PRO A 1 6  ? 6.419   4.732   -9.905 1.00 0.00 ? 6  PRO A HG3  10 
ATOM 5329 H HD2  . PRO A 1 6  ? 5.519   2.975   -8.051 1.00 0.00 ? 6  PRO A HD2  10 
ATOM 5330 H HD3  . PRO A 1 6  ? 6.914   2.632   -9.094 1.00 0.00 ? 6  PRO A HD3  10 
ATOM 5331 N N    . GLY A 1 7  ? 8.152   5.185   -4.711 1.00 0.00 ? 7  GLY A N    10 
ATOM 5332 C CA   . GLY A 1 7  ? 7.760   5.932   -3.530 1.00 0.00 ? 7  GLY A CA   10 
ATOM 5333 C C    . GLY A 1 7  ? 7.711   5.066   -2.287 1.00 0.00 ? 7  GLY A C    10 
ATOM 5334 O O    . GLY A 1 7  ? 7.933   5.549   -1.176 1.00 0.00 ? 7  GLY A O    10 
ATOM 5335 H H    . GLY A 1 7  ? 8.809   4.462   -4.635 1.00 0.00 ? 7  GLY A H    10 
ATOM 5336 H HA2  . GLY A 1 7  ? 8.468   6.731   -3.372 1.00 0.00 ? 7  GLY A HA2  10 
ATOM 5337 H HA3  . GLY A 1 7  ? 6.782   6.359   -3.696 1.00 0.00 ? 7  GLY A HA3  10 
ATOM 5338 N N    . CYS A 1 8  ? 7.417   3.784   -2.472 1.00 0.00 ? 8  CYS A N    10 
ATOM 5339 C CA   . CYS A 1 8  ? 7.336   2.848   -1.357 1.00 0.00 ? 8  CYS A CA   10 
ATOM 5340 C C    . CYS A 1 8  ? 8.651   2.092   -1.185 1.00 0.00 ? 8  CYS A C    10 
ATOM 5341 O O    . CYS A 1 8  ? 9.449   1.994   -2.116 1.00 0.00 ? 8  CYS A O    10 
ATOM 5342 C CB   . CYS A 1 8  ? 6.191   1.858   -1.576 1.00 0.00 ? 8  CYS A CB   10 
ATOM 5343 S SG   . CYS A 1 8  ? 5.430   1.248   -0.037 1.00 0.00 ? 8  CYS A SG   10 
ATOM 5344 H H    . CYS A 1 8  ? 7.249   3.458   -3.382 1.00 0.00 ? 8  CYS A H    10 
ATOM 5345 H HA   . CYS A 1 8  ? 7.143   3.417   -0.460 1.00 0.00 ? 8  CYS A HA   10 
ATOM 5346 H HB2  . CYS A 1 8  ? 5.416   2.339   -2.156 1.00 0.00 ? 8  CYS A HB2  10 
ATOM 5347 H HB3  . CYS A 1 8  ? 6.563   1.003   -2.120 1.00 0.00 ? 8  CYS A HB3  10 
ATOM 5348 N N    . GLY A 1 9  ? 8.868   1.559   0.014  1.00 0.00 ? 9  GLY A N    10 
ATOM 5349 C CA   . GLY A 1 9  ? 10.086  0.819   0.286  1.00 0.00 ? 9  GLY A CA   10 
ATOM 5350 C C    . GLY A 1 9  ? 10.161  0.333   1.720  1.00 0.00 ? 9  GLY A C    10 
ATOM 5351 O O    . GLY A 1 9  ? 9.222   0.517   2.495  1.00 0.00 ? 9  GLY A O    10 
ATOM 5352 H H    . GLY A 1 9  ? 8.197   1.670   0.719  1.00 0.00 ? 9  GLY A H    10 
ATOM 5353 H HA2  . GLY A 1 9  ? 10.132  -0.034  -0.375 1.00 0.00 ? 9  GLY A HA2  10 
ATOM 5354 H HA3  . GLY A 1 9  ? 10.934  1.459   0.091  1.00 0.00 ? 9  GLY A HA3  10 
ATOM 5355 N N    . HIS A 1 10 ? 11.281  -0.290  2.075  1.00 0.00 ? 10 HIS A N    10 
ATOM 5356 C CA   . HIS A 1 10 ? 11.474  -0.805  3.426  1.00 0.00 ? 10 HIS A CA   10 
ATOM 5357 C C    . HIS A 1 10 ? 11.615  0.337   4.427  1.00 0.00 ? 10 HIS A C    10 
ATOM 5358 O O    . HIS A 1 10 ? 12.499  1.185   4.298  1.00 0.00 ? 10 HIS A O    10 
ATOM 5359 C CB   . HIS A 1 10 ? 12.710  -1.703  3.480  1.00 0.00 ? 10 HIS A CB   10 
ATOM 5360 C CG   . HIS A 1 10 ? 12.679  -2.699  4.598  1.00 0.00 ? 10 HIS A CG   10 
ATOM 5361 N ND1  . HIS A 1 10 ? 13.816  -3.168  5.220  1.00 0.00 ? 10 HIS A ND1  10 
ATOM 5362 C CD2  . HIS A 1 10 ? 11.638  -3.315  5.206  1.00 0.00 ? 10 HIS A CD2  10 
ATOM 5363 C CE1  . HIS A 1 10 ? 13.476  -4.031  6.161  1.00 0.00 ? 10 HIS A CE1  10 
ATOM 5364 N NE2  . HIS A 1 10 ? 12.160  -4.137  6.173  1.00 0.00 ? 10 HIS A NE2  10 
ATOM 5365 H H    . HIS A 1 10 ? 11.993  -0.405  1.412  1.00 0.00 ? 10 HIS A H    10 
ATOM 5366 H HA   . HIS A 1 10 ? 10.604  -1.389  3.685  1.00 0.00 ? 10 HIS A HA   10 
ATOM 5367 H HB2  . HIS A 1 10 ? 12.792  -2.249  2.552  1.00 0.00 ? 10 HIS A HB2  10 
ATOM 5368 H HB3  . HIS A 1 10 ? 13.589  -1.087  3.608  1.00 0.00 ? 10 HIS A HB3  10 
ATOM 5369 H HD1  . HIS A 1 10 ? 14.735  -2.909  5.003  1.00 0.00 ? 10 HIS A HD1  10 
ATOM 5370 H HD2  . HIS A 1 10 ? 10.590  -3.184  4.973  1.00 0.00 ? 10 HIS A HD2  10 
ATOM 5371 H HE1  . HIS A 1 10 ? 14.158  -4.559  6.811  1.00 0.00 ? 10 HIS A HE1  10 
ATOM 5372 N N    . CYS A 1 11 ? 10.739  0.353   5.426  1.00 0.00 ? 11 CYS A N    10 
ATOM 5373 C CA   . CYS A 1 11 ? 10.764  1.391   6.450  1.00 0.00 ? 11 CYS A CA   10 
ATOM 5374 C C    . CYS A 1 11 ? 12.063  1.334   7.250  1.00 0.00 ? 11 CYS A C    10 
ATOM 5375 O O    . CYS A 1 11 ? 12.810  0.359   7.171  1.00 0.00 ? 11 CYS A O    10 
ATOM 5376 C CB   . CYS A 1 11 ? 9.566   1.240   7.389  1.00 0.00 ? 11 CYS A CB   10 
ATOM 5377 S SG   . CYS A 1 11 ? 9.612   -0.263  8.417  1.00 0.00 ? 11 CYS A SG   10 
ATOM 5378 H H    . CYS A 1 11 ? 10.057  -0.350  5.476  1.00 0.00 ? 11 CYS A H    10 
ATOM 5379 H HA   . CYS A 1 11 ? 10.704  2.348   5.954  1.00 0.00 ? 11 CYS A HA   10 
ATOM 5380 H HB2  . CYS A 1 11 ? 9.531   2.091   8.054  1.00 0.00 ? 11 CYS A HB2  10 
ATOM 5381 H HB3  . CYS A 1 11 ? 8.660   1.210   6.802  1.00 0.00 ? 11 CYS A HB3  10 
ATOM 5382 N N    . SER A 1 12 ? 12.323  2.386   8.020  1.00 0.00 ? 12 SER A N    10 
ATOM 5383 C CA   . SER A 1 12 ? 13.532  2.457   8.832  1.00 0.00 ? 12 SER A CA   10 
ATOM 5384 C C    . SER A 1 12 ? 13.306  3.323   10.068 1.00 0.00 ? 12 SER A C    10 
ATOM 5385 O O    . SER A 1 12 ? 12.538  4.285   10.033 1.00 0.00 ? 12 SER A O    10 
ATOM 5386 C CB   . SER A 1 12 ? 14.693  3.018   8.008  1.00 0.00 ? 12 SER A CB   10 
ATOM 5387 O OG   . SER A 1 12 ? 15.156  2.066   7.065  1.00 0.00 ? 12 SER A OG   10 
ATOM 5388 H H    . SER A 1 12 ? 11.688  3.132   8.040  1.00 0.00 ? 12 SER A H    10 
ATOM 5389 H HA   . SER A 1 12 ? 13.778  1.455   9.149  1.00 0.00 ? 12 SER A HA   10 
ATOM 5390 H HB2  . SER A 1 12 ? 14.364  3.899   7.480  1.00 0.00 ? 12 SER A HB2  10 
ATOM 5391 H HB3  . SER A 1 12 ? 15.508  3.278   8.669  1.00 0.00 ? 12 SER A HB3  10 
ATOM 5392 H HG   . SER A 1 12 ? 15.629  2.516   6.362  1.00 0.00 ? 12 SER A HG   10 
ATOM 5393 N N    . ARG A 1 13 ? 13.980  2.974   11.158 1.00 0.00 ? 13 ARG A N    10 
ATOM 5394 C CA   . ARG A 1 13 ? 13.853  3.718   12.406 1.00 0.00 ? 13 ARG A CA   10 
ATOM 5395 C C    . ARG A 1 13 ? 13.781  5.218   12.140 1.00 0.00 ? 13 ARG A C    10 
ATOM 5396 O O    . ARG A 1 13 ? 14.397  5.739   11.209 1.00 0.00 ? 13 ARG A O    10 
ATOM 5397 C CB   . ARG A 1 13 ? 15.032  3.409   13.331 1.00 0.00 ? 13 ARG A CB   10 
ATOM 5398 C CG   . ARG A 1 13 ? 15.039  1.981   13.853 1.00 0.00 ? 13 ARG A CG   10 
ATOM 5399 C CD   . ARG A 1 13 ? 15.076  1.943   15.372 1.00 0.00 ? 13 ARG A CD   10 
ATOM 5400 N NE   . ARG A 1 13 ? 15.872  0.826   15.873 1.00 0.00 ? 13 ARG A NE   10 
ATOM 5401 C CZ   . ARG A 1 13 ? 17.196  0.770   15.784 1.00 0.00 ? 13 ARG A CZ   10 
ATOM 5402 N NH1  . ARG A 1 13 ? 17.869  1.762   15.218 1.00 0.00 ? 13 ARG A NH1  10 
ATOM 5403 N NH2  . ARG A 1 13 ? 17.851  -0.281  16.263 1.00 0.00 ? 13 ARG A NH2  10 
ATOM 5404 H H    . ARG A 1 13 ? 14.577  2.198   11.124 1.00 0.00 ? 13 ARG A H    10 
ATOM 5405 H HA   . ARG A 1 13 ? 12.938  3.405   12.887 1.00 0.00 ? 13 ARG A HA   10 
ATOM 5406 H HB2  . ARG A 1 13 ? 15.952  3.576   12.791 1.00 0.00 ? 13 ARG A HB2  10 
ATOM 5407 H HB3  . ARG A 1 13 ? 14.994  4.078   14.177 1.00 0.00 ? 13 ARG A HB3  10 
ATOM 5408 H HG2  . ARG A 1 13 ? 14.145  1.479   13.513 1.00 0.00 ? 13 ARG A HG2  10 
ATOM 5409 H HG3  . ARG A 1 13 ? 15.909  1.471   13.467 1.00 0.00 ? 13 ARG A HG3  10 
ATOM 5410 H HD2  . ARG A 1 13 ? 15.504  2.867   15.732 1.00 0.00 ? 13 ARG A HD2  10 
ATOM 5411 H HD3  . ARG A 1 13 ? 14.066  1.847   15.741 1.00 0.00 ? 13 ARG A HD3  10 
ATOM 5412 H HE   . ARG A 1 13 ? 15.395  0.082   16.295 1.00 0.00 ? 13 ARG A HE   10 
ATOM 5413 H HH11 . ARG A 1 13 ? 17.379  2.555   14.857 1.00 0.00 ? 13 ARG A HH11 10 
ATOM 5414 H HH12 . ARG A 1 13 ? 18.866  1.718   15.154 1.00 0.00 ? 13 ARG A HH12 10 
ATOM 5415 H HH21 . ARG A 1 13 ? 17.347  -1.031  16.691 1.00 0.00 ? 13 ARG A HH21 10 
ATOM 5416 H HH22 . ARG A 1 13 ? 18.847  -0.322  16.196 1.00 0.00 ? 13 ARG A HH22 10 
ATOM 5417 N N    . PRO A 1 14 ? 13.012  5.932   12.975 1.00 0.00 ? 14 PRO A N    10 
ATOM 5418 C CA   . PRO A 1 14 ? 12.274  5.323   14.086 1.00 0.00 ? 14 PRO A CA   10 
ATOM 5419 C C    . PRO A 1 14 ? 11.117  4.454   13.607 1.00 0.00 ? 14 PRO A C    10 
ATOM 5420 O O    . PRO A 1 14 ? 10.245  4.078   14.389 1.00 0.00 ? 14 PRO A O    10 
ATOM 5421 C CB   . PRO A 1 14 ? 11.748  6.531   14.866 1.00 0.00 ? 14 PRO A CB   10 
ATOM 5422 C CG   . PRO A 1 14 ? 11.671  7.627   13.860 1.00 0.00 ? 14 PRO A CG   10 
ATOM 5423 C CD   . PRO A 1 14 ? 12.802  7.387   12.899 1.00 0.00 ? 14 PRO A CD   10 
ATOM 5424 H HA   . PRO A 1 14 ? 12.924  4.738   14.720 1.00 0.00 ? 14 PRO A HA   10 
ATOM 5425 H HB2  . PRO A 1 14 ? 10.775  6.301   15.277 1.00 0.00 ? 14 PRO A HB2  10 
ATOM 5426 H HB3  . PRO A 1 14 ? 12.433  6.775   15.664 1.00 0.00 ? 14 PRO A HB3  10 
ATOM 5427 H HG2  . PRO A 1 14 ? 10.724  7.585   13.343 1.00 0.00 ? 14 PRO A HG2  10 
ATOM 5428 H HG3  . PRO A 1 14 ? 11.791  8.582   14.349 1.00 0.00 ? 14 PRO A HG3  10 
ATOM 5429 H HD2  . PRO A 1 14 ? 12.518  7.684   11.900 1.00 0.00 ? 14 PRO A HD2  10 
ATOM 5430 H HD3  . PRO A 1 14 ? 13.686  7.921   13.216 1.00 0.00 ? 14 PRO A HD3  10 
ATOM 5431 N N    . ASN A 1 15 ? 11.116  4.137   12.316 1.00 0.00 ? 15 ASN A N    10 
ATOM 5432 C CA   . ASN A 1 15 ? 10.066  3.311   11.732 1.00 0.00 ? 15 ASN A CA   10 
ATOM 5433 C C    . ASN A 1 15 ? 10.380  1.828   11.907 1.00 0.00 ? 15 ASN A C    10 
ATOM 5434 O O    . ASN A 1 15 ? 11.538  1.416   11.837 1.00 0.00 ? 15 ASN A O    10 
ATOM 5435 C CB   . ASN A 1 15 ? 9.898   3.637   10.246 1.00 0.00 ? 15 ASN A CB   10 
ATOM 5436 C CG   . ASN A 1 15 ? 10.160  5.099   9.942  1.00 0.00 ? 15 ASN A CG   10 
ATOM 5437 O OD1  . ASN A 1 15 ? 9.967   5.966   10.794 1.00 0.00 ? 15 ASN A OD1  10 
ATOM 5438 N ND2  . ASN A 1 15 ? 10.603  5.379   8.722  1.00 0.00 ? 15 ASN A ND2  10 
ATOM 5439 H H    . ASN A 1 15 ? 11.839  4.467   11.742 1.00 0.00 ? 15 ASN A H    10 
ATOM 5440 H HA   . ASN A 1 15 ? 9.144   3.535   12.247 1.00 0.00 ? 15 ASN A HA   10 
ATOM 5441 H HB2  . ASN A 1 15 ? 10.592  3.040   9.673  1.00 0.00 ? 15 ASN A HB2  10 
ATOM 5442 H HB3  . ASN A 1 15 ? 8.889   3.400   9.943  1.00 0.00 ? 15 ASN A HB3  10 
ATOM 5443 H HD21 . ASN A 1 15 ? 10.733  4.637   8.095  1.00 0.00 ? 15 ASN A HD21 10 
ATOM 5444 H HD22 . ASN A 1 15 ? 10.781  6.316   8.498  1.00 0.00 ? 15 ASN A HD22 10 
ATOM 5445 N N    . TYR A 1 16 ? 9.341   1.032   12.132 1.00 0.00 ? 16 TYR A N    10 
ATOM 5446 C CA   . TYR A 1 16 ? 9.505   -0.405  12.319 1.00 0.00 ? 16 TYR A CA   10 
ATOM 5447 C C    . TYR A 1 16 ? 8.345   -1.172  11.692 1.00 0.00 ? 16 TYR A C    10 
ATOM 5448 O O    . TYR A 1 16 ? 7.489   -0.590  11.025 1.00 0.00 ? 16 TYR A O    10 
ATOM 5449 C CB   . TYR A 1 16 ? 9.606   -0.739  13.808 1.00 0.00 ? 16 TYR A CB   10 
ATOM 5450 C CG   . TYR A 1 16 ? 8.274   -0.730  14.523 1.00 0.00 ? 16 TYR A CG   10 
ATOM 5451 C CD1  . TYR A 1 16 ? 7.687   0.464   14.924 1.00 0.00 ? 16 TYR A CD1  10 
ATOM 5452 C CD2  . TYR A 1 16 ? 7.602   -1.915  14.797 1.00 0.00 ? 16 TYR A CD2  10 
ATOM 5453 C CE1  . TYR A 1 16 ? 6.470   0.477   15.578 1.00 0.00 ? 16 TYR A CE1  10 
ATOM 5454 C CE2  . TYR A 1 16 ? 6.384   -1.911  15.448 1.00 0.00 ? 16 TYR A CE2  10 
ATOM 5455 C CZ   . TYR A 1 16 ? 5.822   -0.713  15.837 1.00 0.00 ? 16 TYR A CZ   10 
ATOM 5456 O OH   . TYR A 1 16 ? 4.610   -0.706  16.488 1.00 0.00 ? 16 TYR A OH   10 
ATOM 5457 H H    . TYR A 1 16 ? 8.442   1.419   12.177 1.00 0.00 ? 16 TYR A H    10 
ATOM 5458 H HA   . TYR A 1 16 ? 10.422  -0.700  11.831 1.00 0.00 ? 16 TYR A HA   10 
ATOM 5459 H HB2  . TYR A 1 16 ? 10.036  -1.722  13.921 1.00 0.00 ? 16 TYR A HB2  10 
ATOM 5460 H HB3  . TYR A 1 16 ? 10.246  -0.014  14.290 1.00 0.00 ? 16 TYR A HB3  10 
ATOM 5461 H HD1  . TYR A 1 16 ? 8.196   1.394   14.720 1.00 0.00 ? 16 TYR A HD1  10 
ATOM 5462 H HD2  . TYR A 1 16 ? 8.045   -2.852  14.491 1.00 0.00 ? 16 TYR A HD2  10 
ATOM 5463 H HE1  . TYR A 1 16 ? 6.029   1.414   15.882 1.00 0.00 ? 16 TYR A HE1  10 
ATOM 5464 H HE2  . TYR A 1 16 ? 5.877   -2.843  15.652 1.00 0.00 ? 16 TYR A HE2  10 
ATOM 5465 H HH   . TYR A 1 16 ? 4.682   -0.187  17.292 1.00 0.00 ? 16 TYR A HH   10 
ATOM 5466 N N    . CYS A 1 17 ? 8.323   -2.482  11.911 1.00 0.00 ? 17 CYS A N    10 
ATOM 5467 C CA   . CYS A 1 17 ? 7.270   -3.331  11.370 1.00 0.00 ? 17 CYS A CA   10 
ATOM 5468 C C    . CYS A 1 17 ? 6.095   -3.428  12.339 1.00 0.00 ? 17 CYS A C    10 
ATOM 5469 O O    . CYS A 1 17 ? 6.280   -3.680  13.529 1.00 0.00 ? 17 CYS A O    10 
ATOM 5470 C CB   . CYS A 1 17 ? 7.815   -4.730  11.072 1.00 0.00 ? 17 CYS A CB   10 
ATOM 5471 S SG   . CYS A 1 17 ? 8.381   -4.957  9.355  1.00 0.00 ? 17 CYS A SG   10 
ATOM 5472 H H    . CYS A 1 17 ? 9.034   -2.889  12.452 1.00 0.00 ? 17 CYS A H    10 
ATOM 5473 H HA   . CYS A 1 17 ? 6.924   -2.886  10.449 1.00 0.00 ? 17 CYS A HA   10 
ATOM 5474 H HB2  . CYS A 1 17 ? 8.655   -4.926  11.723 1.00 0.00 ? 17 CYS A HB2  10 
ATOM 5475 H HB3  . CYS A 1 17 ? 7.041   -5.458  11.263 1.00 0.00 ? 17 CYS A HB3  10 
ATOM 5476 N N    . GLU A 1 18 ? 4.888   -3.224  11.821 1.00 0.00 ? 18 GLU A N    10 
ATOM 5477 C CA   . GLU A 1 18 ? 3.685   -3.288  12.641 1.00 0.00 ? 18 GLU A CA   10 
ATOM 5478 C C    . GLU A 1 18 ? 2.506   -3.829  11.837 1.00 0.00 ? 18 GLU A C    10 
ATOM 5479 O O    . GLU A 1 18 ? 2.065   -3.211  10.869 1.00 0.00 ? 18 GLU A O    10 
ATOM 5480 C CB   . GLU A 1 18 ? 3.345   -1.903  13.196 1.00 0.00 ? 18 GLU A CB   10 
ATOM 5481 C CG   . GLU A 1 18 ? 2.505   -1.943  14.461 1.00 0.00 ? 18 GLU A CG   10 
ATOM 5482 C CD   . GLU A 1 18 ? 2.813   -3.149  15.328 1.00 0.00 ? 18 GLU A CD   10 
ATOM 5483 O OE1  . GLU A 1 18 ? 3.751   -3.065  16.148 1.00 0.00 ? 18 GLU A OE1  10 
ATOM 5484 O OE2  . GLU A 1 18 ? 2.116   -4.175  15.185 1.00 0.00 ? 18 GLU A OE2  10 
ATOM 5485 H H    . GLU A 1 18 ? 4.806   -3.026  10.865 1.00 0.00 ? 18 GLU A H    10 
ATOM 5486 H HA   . GLU A 1 18 ? 3.880   -3.957  13.466 1.00 0.00 ? 18 GLU A HA   10 
ATOM 5487 H HB2  . GLU A 1 18 ? 4.264   -1.380  13.414 1.00 0.00 ? 18 GLU A HB2  10 
ATOM 5488 H HB3  . GLU A 1 18 ? 2.799   -1.352  12.444 1.00 0.00 ? 18 GLU A HB3  10 
ATOM 5489 H HG2  . GLU A 1 18 ? 2.698   -1.049  15.035 1.00 0.00 ? 18 GLU A HG2  10 
ATOM 5490 H HG3  . GLU A 1 18 ? 1.461   -1.973  14.185 1.00 0.00 ? 18 GLU A HG3  10 
ATOM 5491 N N    . GLY A 1 19 ? 2.001   -4.989  12.246 1.00 0.00 ? 19 GLY A N    10 
ATOM 5492 C CA   . GLY A 1 19 ? 0.879   -5.595  11.553 1.00 0.00 ? 19 GLY A CA   10 
ATOM 5493 C C    . GLY A 1 19 ? -0.451  -5.003  11.975 1.00 0.00 ? 19 GLY A C    10 
ATOM 5494 O O    . GLY A 1 19 ? -1.472  -5.226  11.325 1.00 0.00 ? 19 GLY A O    10 
ATOM 5495 H H    . GLY A 1 19 ? 2.393   -5.437  13.025 1.00 0.00 ? 19 GLY A H    10 
ATOM 5496 H HA2  . GLY A 1 19 ? 1.005   -5.450  10.491 1.00 0.00 ? 19 GLY A HA2  10 
ATOM 5497 H HA3  . GLY A 1 19 ? 0.871   -6.654  11.763 1.00 0.00 ? 19 GLY A HA3  10 
ATOM 5498 N N    . ALA A 1 20 ? -0.441  -4.247  13.068 1.00 0.00 ? 20 ALA A N    10 
ATOM 5499 C CA   . ALA A 1 20 ? -1.655  -3.621  13.576 1.00 0.00 ? 20 ALA A CA   10 
ATOM 5500 C C    . ALA A 1 20 ? -1.433  -2.139  13.857 1.00 0.00 ? 20 ALA A C    10 
ATOM 5501 O O    . ALA A 1 20 ? -0.488  -1.536  13.348 1.00 0.00 ? 20 ALA A O    10 
ATOM 5502 C CB   . ALA A 1 20 ? -2.130  -4.334  14.833 1.00 0.00 ? 20 ALA A CB   10 
ATOM 5503 H H    . ALA A 1 20 ? 0.404   -4.106  13.543 1.00 0.00 ? 20 ALA A H    10 
ATOM 5504 H HA   . ALA A 1 20 ? -2.423  -3.722  12.822 1.00 0.00 ? 20 ALA A HA   10 
ATOM 5505 H HB1  . ALA A 1 20 ? -3.210  -4.338  14.857 1.00 0.00 ? 20 ALA A HB1  10 
ATOM 5506 H HB2  . ALA A 1 20 ? -1.766  -5.350  14.830 1.00 0.00 ? 20 ALA A HB2  10 
ATOM 5507 H HB3  . ALA A 1 20 ? -1.753  -3.818  15.703 1.00 0.00 ? 20 ALA A HB3  10 
ATOM 5508 N N    . ARG A 1 21 ? -2.308  -1.558  14.671 1.00 0.00 ? 21 ARG A N    10 
ATOM 5509 C CA   . ARG A 1 21 ? -2.208  -0.145  15.018 1.00 0.00 ? 21 ARG A CA   10 
ATOM 5510 C C    . ARG A 1 21 ? -0.928  0.132   15.802 1.00 0.00 ? 21 ARG A C    10 
ATOM 5511 O O    . ARG A 1 21 ? -0.623  -0.556  16.776 1.00 0.00 ? 21 ARG A O    10 
ATOM 5512 C CB   . ARG A 1 21 ? -3.425  0.288   15.838 1.00 0.00 ? 21 ARG A CB   10 
ATOM 5513 C CG   . ARG A 1 21 ? -4.690  0.448   15.012 1.00 0.00 ? 21 ARG A CG   10 
ATOM 5514 C CD   . ARG A 1 21 ? -5.267  1.849   15.142 1.00 0.00 ? 21 ARG A CD   10 
ATOM 5515 N NE   . ARG A 1 21 ? -6.079  2.217   13.985 1.00 0.00 ? 21 ARG A NE   10 
ATOM 5516 C CZ   . ARG A 1 21 ? -6.607  3.423   13.811 1.00 0.00 ? 21 ARG A CZ   10 
ATOM 5517 N NH1  . ARG A 1 21 ? -6.408  4.374   14.714 1.00 0.00 ? 21 ARG A NH1  10 
ATOM 5518 N NH2  . ARG A 1 21 ? -7.334  3.681   12.732 1.00 0.00 ? 21 ARG A NH2  10 
ATOM 5519 H H    . ARG A 1 21 ? -3.040  -2.091  15.046 1.00 0.00 ? 21 ARG A H    10 
ATOM 5520 H HA   . ARG A 1 21 ? -2.184  0.421   14.100 1.00 0.00 ? 21 ARG A HA   10 
ATOM 5521 H HB2  . ARG A 1 21 ? -3.612  -0.453  16.602 1.00 0.00 ? 21 ARG A HB2  10 
ATOM 5522 H HB3  . ARG A 1 21 ? -3.207  1.233   16.311 1.00 0.00 ? 21 ARG A HB3  10 
ATOM 5523 H HG2  . ARG A 1 21 ? -4.457  0.262   13.974 1.00 0.00 ? 21 ARG A HG2  10 
ATOM 5524 H HG3  . ARG A 1 21 ? -5.424  -0.267  15.352 1.00 0.00 ? 21 ARG A HG3  10 
ATOM 5525 H HD2  . ARG A 1 21 ? -5.881  1.890   16.029 1.00 0.00 ? 21 ARG A HD2  10 
ATOM 5526 H HD3  . ARG A 1 21 ? -4.452  2.552   15.236 1.00 0.00 ? 21 ARG A HD3  10 
ATOM 5527 H HE   . ARG A 1 21 ? -6.238  1.529   13.306 1.00 0.00 ? 21 ARG A HE   10 
ATOM 5528 H HH11 . ARG A 1 21 ? -5.859  4.183   15.528 1.00 0.00 ? 21 ARG A HH11 10 
ATOM 5529 H HH12 . ARG A 1 21 ? -6.805  5.282   14.580 1.00 0.00 ? 21 ARG A HH12 10 
ATOM 5530 H HH21 . ARG A 1 21 ? -7.486  2.967   12.049 1.00 0.00 ? 21 ARG A HH21 10 
ATOM 5531 H HH22 . ARG A 1 21 ? -7.731  4.589   12.602 1.00 0.00 ? 21 ARG A HH22 10 
ATOM 5532 N N    . CYS A 1 22 ? -0.184  1.144   15.369 1.00 0.00 ? 22 CYS A N    10 
ATOM 5533 C CA   . CYS A 1 22 ? 1.063   1.513   16.028 1.00 0.00 ? 22 CYS A CA   10 
ATOM 5534 C C    . CYS A 1 22 ? 0.838   1.767   17.516 1.00 0.00 ? 22 CYS A C    10 
ATOM 5535 O O    . CYS A 1 22 ? -0.286  2.017   17.949 1.00 0.00 ? 22 CYS A O    10 
ATOM 5536 C CB   . CYS A 1 22 ? 1.662   2.759   15.372 1.00 0.00 ? 22 CYS A CB   10 
ATOM 5537 S SG   . CYS A 1 22 ? 1.466   2.813   13.562 1.00 0.00 ? 22 CYS A SG   10 
ATOM 5538 H H    . CYS A 1 22 ? -0.480  1.656   14.587 1.00 0.00 ? 22 CYS A H    10 
ATOM 5539 H HA   . CYS A 1 22 ? 1.754   0.691   15.916 1.00 0.00 ? 22 CYS A HA   10 
ATOM 5540 H HB2  . CYS A 1 22 ? 1.182   3.637   15.780 1.00 0.00 ? 22 CYS A HB2  10 
ATOM 5541 H HB3  . CYS A 1 22 ? 2.719   2.798   15.590 1.00 0.00 ? 22 CYS A HB3  10 
ATOM 5542 N N    . GLU A 1 23 ? 1.915   1.700   18.292 1.00 0.00 ? 23 GLU A N    10 
ATOM 5543 C CA   . GLU A 1 23 ? 1.834   1.922   19.731 1.00 0.00 ? 23 GLU A CA   10 
ATOM 5544 C C    . GLU A 1 23 ? 1.590   3.396   20.041 1.00 0.00 ? 23 GLU A C    10 
ATOM 5545 O O    . GLU A 1 23 ? 1.880   4.269   19.224 1.00 0.00 ? 23 GLU A O    10 
ATOM 5546 C CB   . GLU A 1 23 ? 3.120   1.451   20.415 1.00 0.00 ? 23 GLU A CB   10 
ATOM 5547 C CG   . GLU A 1 23 ? 3.824   0.324   19.678 1.00 0.00 ? 23 GLU A CG   10 
ATOM 5548 C CD   . GLU A 1 23 ? 4.463   -0.678  20.620 1.00 0.00 ? 23 GLU A CD   10 
ATOM 5549 O OE1  . GLU A 1 23 ? 3.807   -1.062  21.611 1.00 0.00 ? 23 GLU A OE1  10 
ATOM 5550 O OE2  . GLU A 1 23 ? 5.618   -1.079  20.366 1.00 0.00 ? 23 GLU A OE2  10 
ATOM 5551 H H    . GLU A 1 23 ? 2.784   1.496   17.887 1.00 0.00 ? 23 GLU A H    10 
ATOM 5552 H HA   . GLU A 1 23 ? 1.005   1.344   20.109 1.00 0.00 ? 23 GLU A HA   10 
ATOM 5553 H HB2  . GLU A 1 23 ? 3.801   2.287   20.488 1.00 0.00 ? 23 GLU A HB2  10 
ATOM 5554 H HB3  . GLU A 1 23 ? 2.878   1.107   21.410 1.00 0.00 ? 23 GLU A HB3  10 
ATOM 5555 H HG2  . GLU A 1 23 ? 3.103   -0.193  19.063 1.00 0.00 ? 23 GLU A HG2  10 
ATOM 5556 H HG3  . GLU A 1 23 ? 4.594   0.747   19.050 1.00 0.00 ? 23 GLU A HG3  10 
ATOM 5557 N N    . SER A 1 24 ? 1.055   3.664   21.228 1.00 0.00 ? 24 SER A N    10 
ATOM 5558 C CA   . SER A 1 24 ? 0.767   5.031   21.645 1.00 0.00 ? 24 SER A CA   10 
ATOM 5559 C C    . SER A 1 24 ? 2.019   5.899   21.564 1.00 0.00 ? 24 SER A C    10 
ATOM 5560 O O    . SER A 1 24 ? 2.707   6.111   22.562 1.00 0.00 ? 24 SER A O    10 
ATOM 5561 C CB   . SER A 1 24 ? 0.214   5.045   23.072 1.00 0.00 ? 24 SER A CB   10 
ATOM 5562 O OG   . SER A 1 24 ? -1.174  4.760   23.084 1.00 0.00 ? 24 SER A OG   10 
ATOM 5563 H H    . SER A 1 24 ? 0.846   2.924   21.836 1.00 0.00 ? 24 SER A H    10 
ATOM 5564 H HA   . SER A 1 24 ? 0.021   5.432   20.975 1.00 0.00 ? 24 SER A HA   10 
ATOM 5565 H HB2  . SER A 1 24 ? 0.727   4.302   23.661 1.00 0.00 ? 24 SER A HB2  10 
ATOM 5566 H HB3  . SER A 1 24 ? 0.372   6.022   23.506 1.00 0.00 ? 24 SER A HB3  10 
ATOM 5567 H HG   . SER A 1 24 ? -1.619  5.356   23.690 1.00 0.00 ? 24 SER A HG   10 
ATOM 5568 N N    . GLY A 1 25 ? 2.308   6.399   20.366 1.00 0.00 ? 25 GLY A N    10 
ATOM 5569 C CA   . GLY A 1 25 ? 3.477   7.238   20.175 1.00 0.00 ? 25 GLY A CA   10 
ATOM 5570 C C    . GLY A 1 25 ? 3.935   7.273   18.731 1.00 0.00 ? 25 GLY A C    10 
ATOM 5571 O O    . GLY A 1 25 ? 4.449   8.288   18.260 1.00 0.00 ? 25 GLY A O    10 
ATOM 5572 H H    . GLY A 1 25 ? 1.723   6.196   19.606 1.00 0.00 ? 25 GLY A H    10 
ATOM 5573 H HA2  . GLY A 1 25 ? 3.241   8.243   20.492 1.00 0.00 ? 25 GLY A HA2  10 
ATOM 5574 H HA3  . GLY A 1 25 ? 4.282   6.858   20.787 1.00 0.00 ? 25 GLY A HA3  10 
ATOM 5575 N N    . PHE A 1 26 ? 3.752   6.162   18.026 1.00 0.00 ? 26 PHE A N    10 
ATOM 5576 C CA   . PHE A 1 26 ? 4.153   6.069   16.627 1.00 0.00 ? 26 PHE A CA   10 
ATOM 5577 C C    . PHE A 1 26 ? 2.979   6.378   15.703 1.00 0.00 ? 26 PHE A C    10 
ATOM 5578 O O    . PHE A 1 26 ? 1.860   6.615   16.160 1.00 0.00 ? 26 PHE A O    10 
ATOM 5579 C CB   . PHE A 1 26 ? 4.701   4.673   16.324 1.00 0.00 ? 26 PHE A CB   10 
ATOM 5580 C CG   . PHE A 1 26 ? 5.984   4.364   17.041 1.00 0.00 ? 26 PHE A CG   10 
ATOM 5581 C CD1  . PHE A 1 26 ? 6.060   4.451   18.422 1.00 0.00 ? 26 PHE A CD1  10 
ATOM 5582 C CD2  . PHE A 1 26 ? 7.115   3.987   16.334 1.00 0.00 ? 26 PHE A CD2  10 
ATOM 5583 C CE1  . PHE A 1 26 ? 7.239   4.167   19.085 1.00 0.00 ? 26 PHE A CE1  10 
ATOM 5584 C CE2  . PHE A 1 26 ? 8.297   3.702   16.992 1.00 0.00 ? 26 PHE A CE2  10 
ATOM 5585 C CZ   . PHE A 1 26 ? 8.359   3.793   18.368 1.00 0.00 ? 26 PHE A CZ   10 
ATOM 5586 H H    . PHE A 1 26 ? 3.337   5.385   18.458 1.00 0.00 ? 26 PHE A H    10 
ATOM 5587 H HA   . PHE A 1 26 ? 4.931   6.797   16.457 1.00 0.00 ? 26 PHE A HA   10 
ATOM 5588 H HB2  . PHE A 1 26 ? 3.971   3.935   16.619 1.00 0.00 ? 26 PHE A HB2  10 
ATOM 5589 H HB3  . PHE A 1 26 ? 4.884   4.589   15.263 1.00 0.00 ? 26 PHE A HB3  10 
ATOM 5590 H HD1  . PHE A 1 26 ? 5.184   4.744   18.983 1.00 0.00 ? 26 PHE A HD1  10 
ATOM 5591 H HD2  . PHE A 1 26 ? 7.068   3.916   15.257 1.00 0.00 ? 26 PHE A HD2  10 
ATOM 5592 H HE1  . PHE A 1 26 ? 7.284   4.239   20.161 1.00 0.00 ? 26 PHE A HE1  10 
ATOM 5593 H HE2  . PHE A 1 26 ? 9.171   3.410   16.429 1.00 0.00 ? 26 PHE A HE2  10 
ATOM 5594 H HZ   . PHE A 1 26 ? 9.281   3.570   18.884 1.00 0.00 ? 26 PHE A HZ   10 
ATOM 5595 N N    . HIS A 1 27 ? 3.242   6.375   14.400 1.00 0.00 ? 27 HIS A N    10 
ATOM 5596 C CA   . HIS A 1 27 ? 2.208   6.655   13.410 1.00 0.00 ? 27 HIS A CA   10 
ATOM 5597 C C    . HIS A 1 27 ? 2.299   5.681   12.239 1.00 0.00 ? 27 HIS A C    10 
ATOM 5598 O O    . HIS A 1 27 ? 3.375   5.464   11.682 1.00 0.00 ? 27 HIS A O    10 
ATOM 5599 C CB   . HIS A 1 27 ? 2.334   8.093   12.904 1.00 0.00 ? 27 HIS A CB   10 
ATOM 5600 C CG   . HIS A 1 27 ? 3.750   8.561   12.776 1.00 0.00 ? 27 HIS A CG   10 
ATOM 5601 N ND1  . HIS A 1 27 ? 4.394   9.287   13.756 1.00 0.00 ? 27 HIS A ND1  10 
ATOM 5602 C CD2  . HIS A 1 27 ? 4.648   8.402   11.776 1.00 0.00 ? 27 HIS A CD2  10 
ATOM 5603 C CE1  . HIS A 1 27 ? 5.627   9.556   13.363 1.00 0.00 ? 27 HIS A CE1  10 
ATOM 5604 N NE2  . HIS A 1 27 ? 5.806   9.029   12.165 1.00 0.00 ? 27 HIS A NE2  10 
ATOM 5605 H H    . HIS A 1 27 ? 4.153   6.179   14.097 1.00 0.00 ? 27 HIS A H    10 
ATOM 5606 H HA   . HIS A 1 27 ? 1.249   6.534   13.890 1.00 0.00 ? 27 HIS A HA   10 
ATOM 5607 H HB2  . HIS A 1 27 ? 1.871   8.166   11.931 1.00 0.00 ? 27 HIS A HB2  10 
ATOM 5608 H HB3  . HIS A 1 27 ? 1.825   8.755   13.590 1.00 0.00 ? 27 HIS A HB3  10 
ATOM 5609 H HD1  . HIS A 1 27 ? 4.005   9.565   14.611 1.00 0.00 ? 27 HIS A HD1  10 
ATOM 5610 H HD2  . HIS A 1 27 ? 4.485   7.879   10.844 1.00 0.00 ? 27 HIS A HD2  10 
ATOM 5611 H HE1  . HIS A 1 27 ? 6.363   10.111  13.925 1.00 0.00 ? 27 HIS A HE1  10 
ATOM 5612 N N    . ASP A 1 28 ? 1.163   5.098   11.873 1.00 0.00 ? 28 ASP A N    10 
ATOM 5613 C CA   . ASP A 1 28 ? 1.114   4.147   10.768 1.00 0.00 ? 28 ASP A CA   10 
ATOM 5614 C C    . ASP A 1 28 ? 1.504   4.819   9.455  1.00 0.00 ? 28 ASP A C    10 
ATOM 5615 O O    . ASP A 1 28 ? 0.772   5.660   8.933  1.00 0.00 ? 28 ASP A O    10 
ATOM 5616 C CB   . ASP A 1 28 ? -0.286  3.543   10.649 1.00 0.00 ? 28 ASP A CB   10 
ATOM 5617 C CG   . ASP A 1 28 ? -0.549  2.956   9.276  1.00 0.00 ? 28 ASP A CG   10 
ATOM 5618 O OD1  . ASP A 1 28 ? -1.623  3.238   8.705  1.00 0.00 ? 28 ASP A OD1  10 
ATOM 5619 O OD2  . ASP A 1 28 ? 0.320   2.214   8.773  1.00 0.00 ? 28 ASP A OD2  10 
ATOM 5620 H H    . ASP A 1 28 ? 0.337   5.313   12.356 1.00 0.00 ? 28 ASP A H    10 
ATOM 5621 H HA   . ASP A 1 28 ? 1.819   3.358   10.978 1.00 0.00 ? 28 ASP A HA   10 
ATOM 5622 H HB2  . ASP A 1 28 ? -0.396  2.758   11.383 1.00 0.00 ? 28 ASP A HB2  10 
ATOM 5623 H HB3  . ASP A 1 28 ? -1.021  4.312   10.838 1.00 0.00 ? 28 ASP A HB3  10 
ATOM 5624 N N    . CYS A 1 29 ? 2.664   4.443   8.927  1.00 0.00 ? 29 CYS A N    10 
ATOM 5625 C CA   . CYS A 1 29 ? 3.154   5.010   7.676  1.00 0.00 ? 29 CYS A CA   10 
ATOM 5626 C C    . CYS A 1 29 ? 3.204   3.948   6.581  1.00 0.00 ? 29 CYS A C    10 
ATOM 5627 O O    . CYS A 1 29 ? 3.991   4.048   5.640  1.00 0.00 ? 29 CYS A O    10 
ATOM 5628 C CB   . CYS A 1 29 ? 4.545   5.617   7.877  1.00 0.00 ? 29 CYS A CB   10 
ATOM 5629 S SG   . CYS A 1 29 ? 5.712   4.526   8.752  1.00 0.00 ? 29 CYS A SG   10 
ATOM 5630 H H    . CYS A 1 29 ? 3.205   3.768   9.390  1.00 0.00 ? 29 CYS A H    10 
ATOM 5631 H HA   . CYS A 1 29 ? 2.471   5.789   7.374  1.00 0.00 ? 29 CYS A HA   10 
ATOM 5632 H HB2  . CYS A 1 29 ? 4.971   5.846   6.911  1.00 0.00 ? 29 CYS A HB2  10 
ATOM 5633 H HB3  . CYS A 1 29 ? 4.452   6.527   8.450  1.00 0.00 ? 29 CYS A HB3  10 
ATOM 5634 N N    . GLY A 1 30 ? 2.357   2.932   6.710  1.00 0.00 ? 30 GLY A N    10 
ATOM 5635 C CA   . GLY A 1 30 ? 2.320   1.867   5.725  1.00 0.00 ? 30 GLY A CA   10 
ATOM 5636 C C    . GLY A 1 30 ? 2.139   2.388   4.314  1.00 0.00 ? 30 GLY A C    10 
ATOM 5637 O O    . GLY A 1 30 ? 2.337   1.656   3.344  1.00 0.00 ? 30 GLY A O    10 
ATOM 5638 H H    . GLY A 1 30 ? 1.752   2.905   7.481  1.00 0.00 ? 30 GLY A H    10 
ATOM 5639 H HA2  . GLY A 1 30 ? 3.245   1.311   5.777  1.00 0.00 ? 30 GLY A HA2  10 
ATOM 5640 H HA3  . GLY A 1 30 ? 1.500   1.204   5.960  1.00 0.00 ? 30 GLY A HA3  10 
ATOM 5641 N N    . SER A 1 31 ? 1.761   3.657   4.197  1.00 0.00 ? 31 SER A N    10 
ATOM 5642 C CA   . SER A 1 31 ? 1.548   4.275   2.894  1.00 0.00 ? 31 SER A CA   10 
ATOM 5643 C C    . SER A 1 31 ? 2.657   3.886   1.921  1.00 0.00 ? 31 SER A C    10 
ATOM 5644 O O    . SER A 1 31 ? 2.451   3.072   1.021  1.00 0.00 ? 31 SER A O    10 
ATOM 5645 C CB   . SER A 1 31 ? 1.484   5.797   3.031  1.00 0.00 ? 31 SER A CB   10 
ATOM 5646 O OG   . SER A 1 31 ? 0.503   6.183   3.977  1.00 0.00 ? 31 SER A OG   10 
ATOM 5647 H H    . SER A 1 31 ? 1.619   4.190   5.008  1.00 0.00 ? 31 SER A H    10 
ATOM 5648 H HA   . SER A 1 31 ? 0.605   3.917   2.508  1.00 0.00 ? 31 SER A HA   10 
ATOM 5649 H HB2  . SER A 1 31 ? 2.445   6.167   3.356  1.00 0.00 ? 31 SER A HB2  10 
ATOM 5650 H HB3  . SER A 1 31 ? 1.236   6.232   2.074  1.00 0.00 ? 31 SER A HB3  10 
ATOM 5651 H HG   . SER A 1 31 ? 0.622   7.109   4.203  1.00 0.00 ? 31 SER A HG   10 
ATOM 5652 N N    . ASP A 1 32 ? 3.833   4.475   2.109  1.00 0.00 ? 32 ASP A N    10 
ATOM 5653 C CA   . ASP A 1 32 ? 4.976   4.191   1.249  1.00 0.00 ? 32 ASP A CA   10 
ATOM 5654 C C    . ASP A 1 32 ? 6.017   3.356   1.988  1.00 0.00 ? 32 ASP A C    10 
ATOM 5655 O O    . ASP A 1 32 ? 7.216   3.473   1.733  1.00 0.00 ? 32 ASP A O    10 
ATOM 5656 C CB   . ASP A 1 32 ? 5.606   5.494   0.755  1.00 0.00 ? 32 ASP A CB   10 
ATOM 5657 C CG   . ASP A 1 32 ? 5.435   6.631   1.744  1.00 0.00 ? 32 ASP A CG   10 
ATOM 5658 O OD1  . ASP A 1 32 ? 5.455   6.365   2.964  1.00 0.00 ? 32 ASP A OD1  10 
ATOM 5659 O OD2  . ASP A 1 32 ? 5.283   7.787   1.297  1.00 0.00 ? 32 ASP A OD2  10 
ATOM 5660 H H    . ASP A 1 32 ? 3.934   5.116   2.844  1.00 0.00 ? 32 ASP A H    10 
ATOM 5661 H HA   . ASP A 1 32 ? 4.620   3.629   0.399  1.00 0.00 ? 32 ASP A HA   10 
ATOM 5662 H HB2  . ASP A 1 32 ? 6.663   5.338   0.595  1.00 0.00 ? 32 ASP A HB2  10 
ATOM 5663 H HB3  . ASP A 1 32 ? 5.143   5.780   -0.178 1.00 0.00 ? 32 ASP A HB3  10 
ATOM 5664 N N    . HIS A 1 33 ? 5.551   2.515   2.906  1.00 0.00 ? 33 HIS A N    10 
ATOM 5665 C CA   . HIS A 1 33 ? 6.442   1.661   3.683  1.00 0.00 ? 33 HIS A CA   10 
ATOM 5666 C C    . HIS A 1 33 ? 5.771   0.330   4.009  1.00 0.00 ? 33 HIS A C    10 
ATOM 5667 O O    . HIS A 1 33 ? 4.763   0.290   4.715  1.00 0.00 ? 33 HIS A O    10 
ATOM 5668 C CB   . HIS A 1 33 ? 6.861   2.365   4.973  1.00 0.00 ? 33 HIS A CB   10 
ATOM 5669 C CG   . HIS A 1 33 ? 7.484   3.708   4.748  1.00 0.00 ? 33 HIS A CG   10 
ATOM 5670 N ND1  . HIS A 1 33 ? 7.079   4.847   5.412  1.00 0.00 ? 33 HIS A ND1  10 
ATOM 5671 C CD2  . HIS A 1 33 ? 8.490   4.091   3.928  1.00 0.00 ? 33 HIS A CD2  10 
ATOM 5672 C CE1  . HIS A 1 33 ? 7.807   5.872   5.008  1.00 0.00 ? 33 HIS A CE1  10 
ATOM 5673 N NE2  . HIS A 1 33 ? 8.672   5.440   4.108  1.00 0.00 ? 33 HIS A NE2  10 
ATOM 5674 H H    . HIS A 1 33 ? 4.585   2.468   3.064  1.00 0.00 ? 33 HIS A H    10 
ATOM 5675 H HA   . HIS A 1 33 ? 7.321   1.469   3.086  1.00 0.00 ? 33 HIS A HA   10 
ATOM 5676 H HB2  . HIS A 1 33 ? 5.991   2.504   5.598  1.00 0.00 ? 33 HIS A HB2  10 
ATOM 5677 H HB3  . HIS A 1 33 ? 7.579   1.749   5.496  1.00 0.00 ? 33 HIS A HB3  10 
ATOM 5678 H HD1  . HIS A 1 33 ? 6.362   4.896   6.079  1.00 0.00 ? 33 HIS A HD1  10 
ATOM 5679 H HD2  . HIS A 1 33 ? 9.048   3.454   3.255  1.00 0.00 ? 33 HIS A HD2  10 
ATOM 5680 H HE1  . HIS A 1 33 ? 7.713   6.890   5.355  1.00 0.00 ? 33 HIS A HE1  10 
ATOM 5681 N N    . TRP A 1 34 ? 6.336   -0.754  3.491  1.00 0.00 ? 34 TRP A N    10 
ATOM 5682 C CA   . TRP A 1 34 ? 5.791   -2.086  3.728  1.00 0.00 ? 34 TRP A CA   10 
ATOM 5683 C C    . TRP A 1 34 ? 6.793   -2.960  4.475  1.00 0.00 ? 34 TRP A C    10 
ATOM 5684 O O    . TRP A 1 34 ? 7.970   -2.617  4.583  1.00 0.00 ? 34 TRP A O    10 
ATOM 5685 C CB   . TRP A 1 34 ? 5.409   -2.746  2.402  1.00 0.00 ? 34 TRP A CB   10 
ATOM 5686 C CG   . TRP A 1 34 ? 6.286   -2.334  1.259  1.00 0.00 ? 34 TRP A CG   10 
ATOM 5687 C CD1  . TRP A 1 34 ? 5.912   -1.626  0.152  1.00 0.00 ? 34 TRP A CD1  10 
ATOM 5688 C CD2  . TRP A 1 34 ? 7.684   -2.607  1.109  1.00 0.00 ? 34 TRP A CD2  10 
ATOM 5689 N NE1  . TRP A 1 34 ? 6.993   -1.442  -0.676 1.00 0.00 ? 34 TRP A NE1  10 
ATOM 5690 C CE2  . TRP A 1 34 ? 8.092   -2.033  -0.111 1.00 0.00 ? 34 TRP A CE2  10 
ATOM 5691 C CE3  . TRP A 1 34 ? 8.630   -3.277  1.888  1.00 0.00 ? 34 TRP A CE3  10 
ATOM 5692 C CZ2  . TRP A 1 34 ? 9.405   -2.112  -0.568 1.00 0.00 ? 34 TRP A CZ2  10 
ATOM 5693 C CZ3  . TRP A 1 34 ? 9.933   -3.355  1.433  1.00 0.00 ? 34 TRP A CZ3  10 
ATOM 5694 C CH2  . TRP A 1 34 ? 10.311  -2.775  0.215  1.00 0.00 ? 34 TRP A CH2  10 
ATOM 5695 H H    . TRP A 1 34 ? 7.138   -0.658  2.936  1.00 0.00 ? 34 TRP A H    10 
ATOM 5696 H HA   . TRP A 1 34 ? 4.903   -1.978  4.334  1.00 0.00 ? 34 TRP A HA   10 
ATOM 5697 H HB2  . TRP A 1 34 ? 5.480   -3.819  2.507  1.00 0.00 ? 34 TRP A HB2  10 
ATOM 5698 H HB3  . TRP A 1 34 ? 4.391   -2.479  2.155  1.00 0.00 ? 34 TRP A HB3  10 
ATOM 5699 H HD1  . TRP A 1 34 ? 4.910   -1.271  -0.032 1.00 0.00 ? 34 TRP A HD1  10 
ATOM 5700 H HE1  . TRP A 1 34 ? 6.979   -0.963  -1.531 1.00 0.00 ? 34 TRP A HE1  10 
ATOM 5701 H HE3  . TRP A 1 34 ? 8.358   -3.731  2.830  1.00 0.00 ? 34 TRP A HE3  10 
ATOM 5702 H HZ2  . TRP A 1 34 ? 9.712   -1.670  -1.504 1.00 0.00 ? 34 TRP A HZ2  10 
ATOM 5703 H HZ3  . TRP A 1 34 ? 10.678  -3.870  2.021  1.00 0.00 ? 34 TRP A HZ3  10 
ATOM 5704 H HH2  . TRP A 1 34 ? 11.339  -2.861  -0.101 1.00 0.00 ? 34 TRP A HH2  10 
ATOM 5705 N N    . CYS A 1 35 ? 6.319   -4.090  4.988  1.00 0.00 ? 35 CYS A N    10 
ATOM 5706 C CA   . CYS A 1 35 ? 7.173   -5.013  5.725  1.00 0.00 ? 35 CYS A CA   10 
ATOM 5707 C C    . CYS A 1 35 ? 7.580   -6.195  4.849  1.00 0.00 ? 35 CYS A C    10 
ATOM 5708 O O    . CYS A 1 35 ? 7.094   -6.346  3.728  1.00 0.00 ? 35 CYS A O    10 
ATOM 5709 C CB   . CYS A 1 35 ? 6.454   -5.516  6.978  1.00 0.00 ? 35 CYS A CB   10 
ATOM 5710 S SG   . CYS A 1 35 ? 6.575   -4.393  8.407  1.00 0.00 ? 35 CYS A SG   10 
ATOM 5711 H H    . CYS A 1 35 ? 5.370   -4.309  4.868  1.00 0.00 ? 35 CYS A H    10 
ATOM 5712 H HA   . CYS A 1 35 ? 8.062   -4.478  6.021  1.00 0.00 ? 35 CYS A HA   10 
ATOM 5713 H HB2  . CYS A 1 35 ? 5.405   -5.649  6.753  1.00 0.00 ? 35 CYS A HB2  10 
ATOM 5714 H HB3  . CYS A 1 35 ? 6.877   -6.466  7.270  1.00 0.00 ? 35 CYS A HB3  10 
ATOM 5715 N N    . ASP A 1 36 ? 8.473   -7.029  5.370  1.00 0.00 ? 36 ASP A N    10 
ATOM 5716 C CA   . ASP A 1 36 ? 8.944   -8.199  4.637  1.00 0.00 ? 36 ASP A CA   10 
ATOM 5717 C C    . ASP A 1 36 ? 7.771   -9.016  4.105  1.00 0.00 ? 36 ASP A C    10 
ATOM 5718 O O    . ASP A 1 36 ? 7.815   -9.529  2.988  1.00 0.00 ? 36 ASP A O    10 
ATOM 5719 C CB   . ASP A 1 36 ? 9.824   -9.070  5.535  1.00 0.00 ? 36 ASP A CB   10 
ATOM 5720 C CG   . ASP A 1 36 ? 11.278  -8.643  5.511  1.00 0.00 ? 36 ASP A CG   10 
ATOM 5721 O OD1  . ASP A 1 36 ? 11.580  -7.533  5.995  1.00 0.00 ? 36 ASP A OD1  10 
ATOM 5722 O OD2  . ASP A 1 36 ? 12.116  -9.421  5.007  1.00 0.00 ? 36 ASP A OD2  10 
ATOM 5723 H H    . ASP A 1 36 ? 8.823   -6.855  6.269  1.00 0.00 ? 36 ASP A H    10 
ATOM 5724 H HA   . ASP A 1 36 ? 9.533   -7.851  3.801  1.00 0.00 ? 36 ASP A HA   10 
ATOM 5725 H HB2  . ASP A 1 36 ? 9.466   -9.003  6.552  1.00 0.00 ? 36 ASP A HB2  10 
ATOM 5726 H HB3  . ASP A 1 36 ? 9.762   -10.096 5.203  1.00 0.00 ? 36 ASP A HB3  10 
ATOM 5727 N N    . ALA A 1 37 ? 6.724   -9.134  4.915  1.00 0.00 ? 37 ALA A N    10 
ATOM 5728 C CA   . ALA A 1 37 ? 5.539   -9.889  4.526  1.00 0.00 ? 37 ALA A CA   10 
ATOM 5729 C C    . ALA A 1 37 ? 4.485   -8.976  3.908  1.00 0.00 ? 37 ALA A C    10 
ATOM 5730 O O    . ALA A 1 37 ? 4.045   -8.010  4.531  1.00 0.00 ? 37 ALA A O    10 
ATOM 5731 C CB   . ALA A 1 37 ? 4.964   -10.624 5.727  1.00 0.00 ? 37 ALA A CB   10 
ATOM 5732 H H    . ALA A 1 37 ? 6.748   -8.702  5.794  1.00 0.00 ? 37 ALA A H    10 
ATOM 5733 H HA   . ALA A 1 37 ? 5.837   -10.625 3.793  1.00 0.00 ? 37 ALA A HA   10 
ATOM 5734 H HB1  . ALA A 1 37 ? 4.188   -10.023 6.178  1.00 0.00 ? 37 ALA A HB1  10 
ATOM 5735 H HB2  . ALA A 1 37 ? 4.548   -11.568 5.406  1.00 0.00 ? 37 ALA A HB2  10 
ATOM 5736 H HB3  . ALA A 1 37 ? 5.747   -10.802 6.448  1.00 0.00 ? 37 ALA A HB3  10 
ATOM 5737 N N    . SER A 1 38 ? 4.086   -9.287  2.679  1.00 0.00 ? 38 SER A N    10 
ATOM 5738 C CA   . SER A 1 38 ? 3.088   -8.492  1.974  1.00 0.00 ? 38 SER A CA   10 
ATOM 5739 C C    . SER A 1 38 ? 1.783   -8.436  2.763  1.00 0.00 ? 38 SER A C    10 
ATOM 5740 O O    . SER A 1 38 ? 0.829   -9.151  2.458  1.00 0.00 ? 38 SER A O    10 
ATOM 5741 C CB   . SER A 1 38 ? 2.831   -9.073  0.582  1.00 0.00 ? 38 SER A CB   10 
ATOM 5742 O OG   . SER A 1 38 ? 3.983   -8.965  -0.235 1.00 0.00 ? 38 SER A OG   10 
ATOM 5743 H H    . SER A 1 38 ? 4.475   -10.070 2.234  1.00 0.00 ? 38 SER A H    10 
ATOM 5744 H HA   . SER A 1 38 ? 3.475   -7.489  1.871  1.00 0.00 ? 38 SER A HA   10 
ATOM 5745 H HB2  . SER A 1 38 ? 2.565   -10.115 0.673  1.00 0.00 ? 38 SER A HB2  10 
ATOM 5746 H HB3  . SER A 1 38 ? 2.020   -8.533  0.114  1.00 0.00 ? 38 SER A HB3  10 
ATOM 5747 H HG   . SER A 1 38 ? 3.879   -8.228  -0.841 1.00 0.00 ? 38 SER A HG   10 
ATOM 5748 N N    . GLY A 1 39 ? 1.749   -7.581  3.780  1.00 0.00 ? 39 GLY A N    10 
ATOM 5749 C CA   . GLY A 1 39 ? 0.558   -7.447  4.598  1.00 0.00 ? 39 GLY A CA   10 
ATOM 5750 C C    . GLY A 1 39 ? 0.802   -6.624  5.848  1.00 0.00 ? 39 GLY A C    10 
ATOM 5751 O O    . GLY A 1 39 ? -0.132  -6.066  6.424  1.00 0.00 ? 39 GLY A O    10 
ATOM 5752 H H    . GLY A 1 39 ? 2.540   -7.036  3.977  1.00 0.00 ? 39 GLY A H    10 
ATOM 5753 H HA2  . GLY A 1 39 ? -0.216  -6.973  4.013  1.00 0.00 ? 39 GLY A HA2  10 
ATOM 5754 H HA3  . GLY A 1 39 ? 0.222   -8.431  4.889  1.00 0.00 ? 39 GLY A HA3  10 
ATOM 5755 N N    . ASP A 1 40 ? 2.059   -6.550  6.269  1.00 0.00 ? 40 ASP A N    10 
ATOM 5756 C CA   . ASP A 1 40 ? 2.423   -5.790  7.459  1.00 0.00 ? 40 ASP A CA   10 
ATOM 5757 C C    . ASP A 1 40 ? 2.758   -4.345  7.100  1.00 0.00 ? 40 ASP A C    10 
ATOM 5758 O O    . ASP A 1 40 ? 3.531   -4.088  6.177  1.00 0.00 ? 40 ASP A O    10 
ATOM 5759 C CB   . ASP A 1 40 ? 3.614   -6.443  8.163  1.00 0.00 ? 40 ASP A CB   10 
ATOM 5760 C CG   . ASP A 1 40 ? 3.185   -7.440  9.221  1.00 0.00 ? 40 ASP A CG   10 
ATOM 5761 O OD1  . ASP A 1 40 ? 2.037   -7.337  9.703  1.00 0.00 ? 40 ASP A OD1  10 
ATOM 5762 O OD2  . ASP A 1 40 ? 3.997   -8.323  9.568  1.00 0.00 ? 40 ASP A OD2  10 
ATOM 5763 H H    . ASP A 1 40 ? 2.760   -7.017  5.767  1.00 0.00 ? 40 ASP A H    10 
ATOM 5764 H HA   . ASP A 1 40 ? 1.576   -5.794  8.127  1.00 0.00 ? 40 ASP A HA   10 
ATOM 5765 H HB2  . ASP A 1 40 ? 4.217   -6.960  7.431  1.00 0.00 ? 40 ASP A HB2  10 
ATOM 5766 H HB3  . ASP A 1 40 ? 4.209   -5.676  8.636  1.00 0.00 ? 40 ASP A HB3  10 
ATOM 5767 N N    . ARG A 1 41 ? 2.171   -3.407  7.836  1.00 0.00 ? 41 ARG A N    10 
ATOM 5768 C CA   . ARG A 1 41 ? 2.406   -1.988  7.593  1.00 0.00 ? 41 ARG A CA   10 
ATOM 5769 C C    . ARG A 1 41 ? 3.496   -1.452  8.516  1.00 0.00 ? 41 ARG A C    10 
ATOM 5770 O O    . ARG A 1 41 ? 3.482   -1.701  9.722  1.00 0.00 ? 41 ARG A O    10 
ATOM 5771 C CB   . ARG A 1 41 ? 1.114   -1.194  7.796  1.00 0.00 ? 41 ARG A CB   10 
ATOM 5772 C CG   . ARG A 1 41 ? 0.060   -1.941  8.598  1.00 0.00 ? 41 ARG A CG   10 
ATOM 5773 C CD   . ARG A 1 41 ? -1.140  -1.057  8.899  1.00 0.00 ? 41 ARG A CD   10 
ATOM 5774 N NE   . ARG A 1 41 ? -2.090  -1.026  7.790  1.00 0.00 ? 41 ARG A NE   10 
ATOM 5775 C CZ   . ARG A 1 41 ? -1.983  -0.200  6.754  1.00 0.00 ? 41 ARG A CZ   10 
ATOM 5776 N NH1  . ARG A 1 41 ? -0.974  0.657   6.687  1.00 0.00 ? 41 ARG A NH1  10 
ATOM 5777 N NH2  . ARG A 1 41 ? -2.887  -0.232  5.783  1.00 0.00 ? 41 ARG A NH2  10 
ATOM 5778 H H    . ARG A 1 41 ? 1.566   -3.674  8.558  1.00 0.00 ? 41 ARG A H    10 
ATOM 5779 H HA   . ARG A 1 41 ? 2.730   -1.876  6.569  1.00 0.00 ? 41 ARG A HA   10 
ATOM 5780 H HB2  . ARG A 1 41 ? 1.347   -0.277  8.317  1.00 0.00 ? 41 ARG A HB2  10 
ATOM 5781 H HB3  . ARG A 1 41 ? 0.697   -0.955  6.830  1.00 0.00 ? 41 ARG A HB3  10 
ATOM 5782 H HG2  . ARG A 1 41 ? -0.272  -2.797  8.029  1.00 0.00 ? 41 ARG A HG2  10 
ATOM 5783 H HG3  . ARG A 1 41 ? 0.496   -2.271  9.529  1.00 0.00 ? 41 ARG A HG3  10 
ATOM 5784 H HD2  . ARG A 1 41 ? -1.640  -1.438  9.777  1.00 0.00 ? 41 ARG A HD2  10 
ATOM 5785 H HD3  . ARG A 1 41 ? -0.792  -0.053  9.091  1.00 0.00 ? 41 ARG A HD3  10 
ATOM 5786 H HE   . ARG A 1 41 ? -2.843  -1.651  7.819  1.00 0.00 ? 41 ARG A HE   10 
ATOM 5787 H HH11 . ARG A 1 41 ? -0.291  0.683   7.416  1.00 0.00 ? 41 ARG A HH11 10 
ATOM 5788 H HH12 . ARG A 1 41 ? -0.896  1.277   5.905  1.00 0.00 ? 41 ARG A HH12 10 
ATOM 5789 H HH21 . ARG A 1 41 ? -3.649  -0.877  5.831  1.00 0.00 ? 41 ARG A HH21 10 
ATOM 5790 H HH22 . ARG A 1 41 ? -2.806  0.390   5.005  1.00 0.00 ? 41 ARG A HH22 10 
ATOM 5791 N N    . CYS A 1 42 ? 4.440   -0.715  7.941  1.00 0.00 ? 42 CYS A N    10 
ATOM 5792 C CA   . CYS A 1 42 ? 5.539   -0.143  8.711  1.00 0.00 ? 42 CYS A CA   10 
ATOM 5793 C C    . CYS A 1 42 ? 5.092   1.119   9.442  1.00 0.00 ? 42 CYS A C    10 
ATOM 5794 O O    . CYS A 1 42 ? 4.542   2.039   8.836  1.00 0.00 ? 42 CYS A O    10 
ATOM 5795 C CB   . CYS A 1 42 ? 6.720   0.177   7.792  1.00 0.00 ? 42 CYS A CB   10 
ATOM 5796 S SG   . CYS A 1 42 ? 7.900   -1.196  7.592  1.00 0.00 ? 42 CYS A SG   10 
ATOM 5797 H H    . CYS A 1 42 ? 4.398   -0.550  6.975  1.00 0.00 ? 42 CYS A H    10 
ATOM 5798 H HA   . CYS A 1 42 ? 5.850   -0.876  9.440  1.00 0.00 ? 42 CYS A HA   10 
ATOM 5799 H HB2  . CYS A 1 42 ? 6.344   0.432   6.812  1.00 0.00 ? 42 CYS A HB2  10 
ATOM 5800 H HB3  . CYS A 1 42 ? 7.261   1.020   8.195  1.00 0.00 ? 42 CYS A HB3  10 
ATOM 5801 N N    . CYS A 1 43 ? 5.333   1.156   10.748 1.00 0.00 ? 43 CYS A N    10 
ATOM 5802 C CA   . CYS A 1 43 ? 4.956   2.305   11.564 1.00 0.00 ? 43 CYS A CA   10 
ATOM 5803 C C    . CYS A 1 43 ? 6.165   3.192   11.844 1.00 0.00 ? 43 CYS A C    10 
ATOM 5804 O O    . CYS A 1 43 ? 7.240   2.704   12.196 1.00 0.00 ? 43 CYS A O    10 
ATOM 5805 C CB   . CYS A 1 43 ? 4.335   1.839   12.882 1.00 0.00 ? 43 CYS A CB   10 
ATOM 5806 S SG   . CYS A 1 43 ? 2.580   1.366   12.751 1.00 0.00 ? 43 CYS A SG   10 
ATOM 5807 H H    . CYS A 1 43 ? 5.775   0.392   11.175 1.00 0.00 ? 43 CYS A H    10 
ATOM 5808 H HA   . CYS A 1 43 ? 4.225   2.877   11.014 1.00 0.00 ? 43 CYS A HA   10 
ATOM 5809 H HB2  . CYS A 1 43 ? 4.880   0.979   13.244 1.00 0.00 ? 43 CYS A HB2  10 
ATOM 5810 H HB3  . CYS A 1 43 ? 4.408   2.636   13.607 1.00 0.00 ? 43 CYS A HB3  10 
ATOM 5811 N N    . CYS A 1 44 ? 5.982   4.499   11.687 1.00 0.00 ? 44 CYS A N    10 
ATOM 5812 C CA   . CYS A 1 44 ? 7.056   5.456   11.922 1.00 0.00 ? 44 CYS A CA   10 
ATOM 5813 C C    . CYS A 1 44 ? 6.798   6.261   13.193 1.00 0.00 ? 44 CYS A C    10 
ATOM 5814 O O    . CYS A 1 44 ? 5.698   6.769   13.406 1.00 0.00 ? 44 CYS A O    10 
ATOM 5815 C CB   . CYS A 1 44 ? 7.197   6.401   10.727 1.00 0.00 ? 44 CYS A CB   10 
ATOM 5816 S SG   . CYS A 1 44 ? 7.385   5.552   9.127  1.00 0.00 ? 44 CYS A SG   10 
ATOM 5817 H H    . CYS A 1 44 ? 5.102   4.828   11.404 1.00 0.00 ? 44 CYS A H    10 
ATOM 5818 H HA   . CYS A 1 44 ? 7.974   4.902   12.042 1.00 0.00 ? 44 CYS A HA   10 
ATOM 5819 H HB2  . CYS A 1 44 ? 6.317   7.025   10.666 1.00 0.00 ? 44 CYS A HB2  10 
ATOM 5820 H HB3  . CYS A 1 44 ? 8.065   7.026   10.873 1.00 0.00 ? 44 CYS A HB3  10 
ATOM 5821 N N    . ALA A 1 45 ? 7.821   6.372   14.034 1.00 0.00 ? 45 ALA A N    10 
ATOM 5822 C CA   . ALA A 1 45 ? 7.707   7.117   15.282 1.00 0.00 ? 45 ALA A CA   10 
ATOM 5823 C C    . ALA A 1 45 ? 7.824   8.617   15.039 1.00 0.00 ? 45 ALA A C    10 
ATOM 5824 O O    . ALA A 1 45 ? 7.635   9.421   15.954 1.00 0.00 ? 45 ALA A O    10 
ATOM 5825 C CB   . ALA A 1 45 ? 8.768   6.656   16.271 1.00 0.00 ? 45 ALA A CB   10 
ATOM 5826 H H    . ALA A 1 45 ? 8.674   5.945   13.809 1.00 0.00 ? 45 ALA A H    10 
ATOM 5827 H HA   . ALA A 1 45 ? 6.737   6.906   15.709 1.00 0.00 ? 45 ALA A HA   10 
ATOM 5828 H HB1  . ALA A 1 45 ? 9.605   7.338   16.242 1.00 0.00 ? 45 ALA A HB1  10 
ATOM 5829 H HB2  . ALA A 1 45 ? 8.350   6.640   17.266 1.00 0.00 ? 45 ALA A HB2  10 
ATOM 5830 H HB3  . ALA A 1 45 ? 9.102   5.664   16.004 1.00 0.00 ? 45 ALA A HB3  10 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  CYS 1  1  1  CYS CYS A . n 
A 1 2  TYR 2  2  2  TYR TYR A . n 
A 1 3  PRO 3  3  3  PRO PRO A . n 
A 1 4  GLY 4  4  4  GLY GLY A . n 
A 1 5  GLN 5  5  5  GLN GLN A . n 
A 1 6  PRO 6  6  6  PRO PRO A . n 
A 1 7  GLY 7  7  7  GLY GLY A . n 
A 1 8  CYS 8  8  8  CYS CYS A . n 
A 1 9  GLY 9  9  9  GLY GLY A . n 
A 1 10 HIS 10 10 10 HIS HIS A . n 
A 1 11 CYS 11 11 11 CYS CYS A . n 
A 1 12 SER 12 12 12 SER SER A . n 
A 1 13 ARG 13 13 13 ARG ARG A . n 
A 1 14 PRO 14 14 14 PRO PRO A . n 
A 1 15 ASN 15 15 15 ASN ASN A . n 
A 1 16 TYR 16 16 16 TYR TYR A . n 
A 1 17 CYS 17 17 17 CYS CYS A . n 
A 1 18 GLU 18 18 18 GLU GLU A . n 
A 1 19 GLY 19 19 19 GLY GLY A . n 
A 1 20 ALA 20 20 20 ALA ALA A . n 
A 1 21 ARG 21 21 21 ARG ARG A . n 
A 1 22 CYS 22 22 22 CYS CYS A . n 
A 1 23 GLU 23 23 23 GLU GLU A . n 
A 1 24 SER 24 24 24 SER SER A . n 
A 1 25 GLY 25 25 25 GLY GLY A . n 
A 1 26 PHE 26 26 26 PHE PHE A . n 
A 1 27 HIS 27 27 27 HIS HIS A . n 
A 1 28 ASP 28 28 28 ASP ASP A . n 
A 1 29 CYS 29 29 29 CYS CYS A . n 
A 1 30 GLY 30 30 30 GLY GLY A . n 
A 1 31 SER 31 31 31 SER SER A . n 
A 1 32 ASP 32 32 32 ASP ASP A . n 
A 1 33 HIS 33 33 33 HIS HIS A . n 
A 1 34 TRP 34 34 34 TRP TRP A . n 
A 1 35 CYS 35 35 35 CYS CYS A . n 
A 1 36 ASP 36 36 36 ASP ASP A . n 
A 1 37 ALA 37 37 37 ALA ALA A . n 
A 1 38 SER 38 38 38 SER SER A . n 
A 1 39 GLY 39 39 39 GLY GLY A . n 
A 1 40 ASP 40 40 40 ASP ASP A . n 
A 1 41 ARG 41 41 41 ARG ARG A . n 
A 1 42 CYS 42 42 42 CYS CYS A . n 
A 1 43 CYS 43 43 43 CYS CYS A . n 
A 1 44 CYS 44 44 44 CYS CYS A . n 
A 1 45 ALA 45 45 45 ALA ALA A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 0    ? 
1 MORE         0    ? 
1 'SSA (A^2)'  3060 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   ? 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-05-10 
2 'Structure model' 1 1 2017-05-24 
3 'Structure model' 1 2 2018-01-17 
4 'Structure model' 1 3 2019-05-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Structure summary'   
3 4 'Structure model' 'Data collection'     
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' audit_author      
2 4 'Structure model' pdbx_nmr_software 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 3 'Structure model' '_audit_author.name'      
2 4 'Structure model' '_pdbx_nmr_software.name' 
# 
loop_
_pdbx_nmr_exptl_sample.solution_id 
_pdbx_nmr_exptl_sample.component 
_pdbx_nmr_exptl_sample.concentration 
_pdbx_nmr_exptl_sample.concentration_range 
_pdbx_nmr_exptl_sample.concentration_units 
_pdbx_nmr_exptl_sample.isotopic_labeling 
1 'tau-AnmTx Ueq 12-1' 0.5 ? mM 'natural abundance' 
1 'sodium azide'       1   ? mM 'natural abundance' 
2 'tau-AnmTx Ueq 12-1' 0.5 ? mM 'natural abundance' 
2 'sodium azide'       1   ? mM 'natural abundance' 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1  PRO A 3  ? ? -69.80  83.52   
2  1  PRO A 6  ? ? -69.78  91.65   
3  1  PRO A 14 ? ? -69.76  13.90   
4  1  ALA A 20 ? ? -127.20 -81.21  
5  1  SER A 24 ? ? -71.19  35.99   
6  1  SER A 38 ? ? -58.87  78.71   
7  2  PRO A 3  ? ? -69.79  79.59   
8  2  PRO A 6  ? ? -69.70  81.64   
9  2  PRO A 14 ? ? -69.71  12.92   
10 2  ALA A 20 ? ? -140.26 -77.52  
11 2  SER A 24 ? ? -71.23  38.26   
12 2  SER A 31 ? ? -43.64  -74.54  
13 2  SER A 38 ? ? -57.55  79.01   
14 3  PRO A 3  ? ? -69.71  82.90   
15 3  PRO A 6  ? ? -69.73  91.15   
16 3  PRO A 14 ? ? -69.79  13.72   
17 3  ALA A 20 ? ? -134.64 -74.45  
18 3  SER A 24 ? ? -57.57  88.68   
19 3  SER A 31 ? ? -43.80  -73.56  
20 3  SER A 38 ? ? -71.72  44.96   
21 4  PRO A 3  ? ? -69.77  79.79   
22 4  PRO A 14 ? ? -69.75  13.51   
23 4  ALA A 20 ? ? -128.54 -158.69 
24 4  SER A 24 ? ? -56.82  82.00   
25 4  SER A 31 ? ? -44.85  -71.43  
26 4  SER A 38 ? ? -59.59  79.08   
27 5  PRO A 3  ? ? -69.76  84.27   
28 5  PRO A 6  ? ? -69.80  84.53   
29 5  ARG A 13 ? ? -39.89  145.84  
30 5  PRO A 14 ? ? -69.72  13.77   
31 5  ALA A 20 ? ? -126.56 -72.96  
32 5  SER A 24 ? ? -56.67  91.37   
33 5  SER A 38 ? ? -58.65  78.60   
34 6  PRO A 3  ? ? -69.67  81.05   
35 6  PRO A 14 ? ? -69.77  13.41   
36 6  ALA A 20 ? ? -132.69 -76.50  
37 6  SER A 24 ? ? -71.39  39.00   
38 6  SER A 31 ? ? -44.87  -70.79  
39 6  SER A 38 ? ? -58.05  78.61   
40 7  PRO A 3  ? ? -69.72  81.06   
41 7  PRO A 6  ? ? -69.78  90.57   
42 7  ARG A 13 ? ? -39.76  145.57  
43 7  PRO A 14 ? ? -69.82  13.68   
44 7  ALA A 20 ? ? -128.63 -72.64  
45 7  SER A 24 ? ? -57.53  92.70   
46 7  SER A 31 ? ? -43.88  -71.48  
47 7  SER A 38 ? ? -59.62  77.69   
48 8  PRO A 6  ? ? -69.76  90.35   
49 8  ARG A 13 ? ? -39.82  146.04  
50 8  PRO A 14 ? ? -69.75  13.98   
51 8  ALA A 20 ? ? -124.80 -75.61  
52 8  SER A 24 ? ? -56.81  81.10   
53 8  SER A 31 ? ? -42.46  -73.55  
54 8  SER A 38 ? ? -58.27  78.28   
55 9  PRO A 3  ? ? -69.70  80.80   
56 9  PRO A 6  ? ? -69.79  91.56   
57 9  ARG A 13 ? ? -39.88  146.31  
58 9  PRO A 14 ? ? -69.76  14.11   
59 9  ALA A 20 ? ? -127.64 -160.92 
60 9  SER A 24 ? ? -56.58  80.61   
61 9  SER A 31 ? ? -42.19  -74.11  
62 9  SER A 38 ? ? -58.89  79.01   
63 10 PRO A 3  ? ? -69.69  79.31   
64 10 PRO A 6  ? ? -69.72  82.57   
65 10 ARG A 13 ? ? -39.68  146.24  
66 10 PRO A 14 ? ? -69.77  14.09   
67 10 SER A 24 ? ? -55.60  82.83   
68 10 SER A 31 ? ? -43.11  -74.49  
69 10 SER A 38 ? ? -58.42  79.11   
# 
_pdbx_audit_support.funding_organization   'Russian Science Foundation' 
_pdbx_audit_support.country                'Russian Federation' 
_pdbx_audit_support.grant_number           16-15-00167 
_pdbx_audit_support.ordinal                1 
#