data_5LLU
# 
_entry.id   5LLU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LLU         
WWPDB D_1200000959 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '5LLM contains a mutant of the same protein complexed with UCPH-101' 
_pdbx_database_related.db_id          5LLM 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LLU 
_pdbx_database_status.recvd_initial_deposition_date   2016-07-28 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Canul-Tec, J.' 1 ? 
'Assal, R.'     2 ? 
'Legrand, P.'   3 ? 
'Reyes, N.'     4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Nature 
_citation.journal_id_ASTM           NATUAS 
_citation.journal_id_CSD            0006 
_citation.journal_id_ISSN           1476-4687 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            544 
_citation.language                  ? 
_citation.page_first                446 
_citation.page_last                 451 
_citation.title                     'Structure and allosteric inhibition of excitatory amino acid transporter 1.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/nature22064 
_citation.pdbx_database_id_PubMed   28424515 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Canul-Tec, J.C.'  1 
primary 'Assal, R.'        2 
primary 'Cirri, E.'        3 
primary 'Legrand, P.'      4 
primary 'Brier, S.'        5 
primary 'Chamot-Rooke, J.' 6 
primary 'Reyes, N.'        7 
# 
_cell.entry_id           5LLU 
_cell.length_a           123.320 
_cell.length_b           123.320 
_cell.length_c           89.570 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              6 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5LLU 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Excitatory amino acid transporter 1,Neutral amino acid transporter B(0),Excitatory amino acid transporter 1' 
56460.324 1 ? ? ? ? 
2 non-polymer syn 'SODIUM ION'                                                                                                  
22.990    1 ? ? ? ? 
3 non-polymer syn 'ASPARTIC ACID'                                                                                               
133.103   1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;Sodium-dependent glutamate/aspartate transporter 1,GLAST-1,Solute carrier family 1 member 3,ATB(0),Baboon M7 virus receptor,RD114/simian type D retrovirus receptor,Sodium-dependent neutral amino acid transporter type 2,Solute carrier family 1 member 5,Sodium-dependent glutamate/aspartate transporter 1,GLAST-1,Solute carrier family 1 member 3
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVILGVVLGFLLRPYPLSPREVKY
FAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGA
AGSAENAPSKEVLDCFLDLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIALGKM
GEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLGMYMVTVIVGLVIHGLIVLPLIYFLI
TRKNPFVFIAGILQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYE
LDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAGIVEHLSRK
ELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MTKSNGEEPKMGGRMERFQQGVSKRTLLAKKKVQNITKEDVKSFLRRNALLLLTVLAVILGVVLGFLLRPYPLSPREVKY
FAFPGELLMRMLKMLILPLIVSSLITGLASLDAKASGRLGMRAVVYYMSTTIIAVVLGIILVLIIHPGAASAAITASVGA
AGSAENAPSKEVLDCFLDLARNIFPSNLVSAAFRSYSTTYEERTITGTRVKVPVGQEVEGMNILGLVVFSIVFGIALGKM
GEQGQLLVDFFNSLNEATMKLVAIIMWYAPLGILFLIAGKIVEMEDLEVLGGQLGMYMVTVIVGLVIHGLIVLPLIYFLI
TRKNPFVFIAGILQALITALGTSSSSATLPITFKCLEENNGVDKRITRFVLPVGATINMDGTALYEAVAAIFIAQVNNYE
LDFGQIITISITATAASIGAAGIPQAGLVTMVIVLTAVGLPTDDITLIIAVDWLLDRFRTMVNVLGDALGAGIVEHLSRK
ELEKQDAELGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   THR n 
1 3   LYS n 
1 4   SER n 
1 5   ASN n 
1 6   GLY n 
1 7   GLU n 
1 8   GLU n 
1 9   PRO n 
1 10  LYS n 
1 11  MET n 
1 12  GLY n 
1 13  GLY n 
1 14  ARG n 
1 15  MET n 
1 16  GLU n 
1 17  ARG n 
1 18  PHE n 
1 19  GLN n 
1 20  GLN n 
1 21  GLY n 
1 22  VAL n 
1 23  SER n 
1 24  LYS n 
1 25  ARG n 
1 26  THR n 
1 27  LEU n 
1 28  LEU n 
1 29  ALA n 
1 30  LYS n 
1 31  LYS n 
1 32  LYS n 
1 33  VAL n 
1 34  GLN n 
1 35  ASN n 
1 36  ILE n 
1 37  THR n 
1 38  LYS n 
1 39  GLU n 
1 40  ASP n 
1 41  VAL n 
1 42  LYS n 
1 43  SER n 
1 44  PHE n 
1 45  LEU n 
1 46  ARG n 
1 47  ARG n 
1 48  ASN n 
1 49  ALA n 
1 50  LEU n 
1 51  LEU n 
1 52  LEU n 
1 53  LEU n 
1 54  THR n 
1 55  VAL n 
1 56  LEU n 
1 57  ALA n 
1 58  VAL n 
1 59  ILE n 
1 60  LEU n 
1 61  GLY n 
1 62  VAL n 
1 63  VAL n 
1 64  LEU n 
1 65  GLY n 
1 66  PHE n 
1 67  LEU n 
1 68  LEU n 
1 69  ARG n 
1 70  PRO n 
1 71  TYR n 
1 72  PRO n 
1 73  LEU n 
1 74  SER n 
1 75  PRO n 
1 76  ARG n 
1 77  GLU n 
1 78  VAL n 
1 79  LYS n 
1 80  TYR n 
1 81  PHE n 
1 82  ALA n 
1 83  PHE n 
1 84  PRO n 
1 85  GLY n 
1 86  GLU n 
1 87  LEU n 
1 88  LEU n 
1 89  MET n 
1 90  ARG n 
1 91  MET n 
1 92  LEU n 
1 93  LYS n 
1 94  MET n 
1 95  LEU n 
1 96  ILE n 
1 97  LEU n 
1 98  PRO n 
1 99  LEU n 
1 100 ILE n 
1 101 VAL n 
1 102 SER n 
1 103 SER n 
1 104 LEU n 
1 105 ILE n 
1 106 THR n 
1 107 GLY n 
1 108 LEU n 
1 109 ALA n 
1 110 SER n 
1 111 LEU n 
1 112 ASP n 
1 113 ALA n 
1 114 LYS n 
1 115 ALA n 
1 116 SER n 
1 117 GLY n 
1 118 ARG n 
1 119 LEU n 
1 120 GLY n 
1 121 MET n 
1 122 ARG n 
1 123 ALA n 
1 124 VAL n 
1 125 VAL n 
1 126 TYR n 
1 127 TYR n 
1 128 MET n 
1 129 SER n 
1 130 THR n 
1 131 THR n 
1 132 ILE n 
1 133 ILE n 
1 134 ALA n 
1 135 VAL n 
1 136 VAL n 
1 137 LEU n 
1 138 GLY n 
1 139 ILE n 
1 140 ILE n 
1 141 LEU n 
1 142 VAL n 
1 143 LEU n 
1 144 ILE n 
1 145 ILE n 
1 146 HIS n 
1 147 PRO n 
1 148 GLY n 
1 149 ALA n 
1 150 ALA n 
1 151 SER n 
1 152 ALA n 
1 153 ALA n 
1 154 ILE n 
1 155 THR n 
1 156 ALA n 
1 157 SER n 
1 158 VAL n 
1 159 GLY n 
1 160 ALA n 
1 161 ALA n 
1 162 GLY n 
1 163 SER n 
1 164 ALA n 
1 165 GLU n 
1 166 ASN n 
1 167 ALA n 
1 168 PRO n 
1 169 SER n 
1 170 LYS n 
1 171 GLU n 
1 172 VAL n 
1 173 LEU n 
1 174 ASP n 
1 175 CYS n 
1 176 PHE n 
1 177 LEU n 
1 178 ASP n 
1 179 LEU n 
1 180 ALA n 
1 181 ARG n 
1 182 ASN n 
1 183 ILE n 
1 184 PHE n 
1 185 PRO n 
1 186 SER n 
1 187 ASN n 
1 188 LEU n 
1 189 VAL n 
1 190 SER n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 ARG n 
1 195 SER n 
1 196 TYR n 
1 197 SER n 
1 198 THR n 
1 199 THR n 
1 200 TYR n 
1 201 GLU n 
1 202 GLU n 
1 203 ARG n 
1 204 THR n 
1 205 ILE n 
1 206 THR n 
1 207 GLY n 
1 208 THR n 
1 209 ARG n 
1 210 VAL n 
1 211 LYS n 
1 212 VAL n 
1 213 PRO n 
1 214 VAL n 
1 215 GLY n 
1 216 GLN n 
1 217 GLU n 
1 218 VAL n 
1 219 GLU n 
1 220 GLY n 
1 221 MET n 
1 222 ASN n 
1 223 ILE n 
1 224 LEU n 
1 225 GLY n 
1 226 LEU n 
1 227 VAL n 
1 228 VAL n 
1 229 PHE n 
1 230 SER n 
1 231 ILE n 
1 232 VAL n 
1 233 PHE n 
1 234 GLY n 
1 235 ILE n 
1 236 ALA n 
1 237 LEU n 
1 238 GLY n 
1 239 LYS n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 GLN n 
1 244 GLY n 
1 245 GLN n 
1 246 LEU n 
1 247 LEU n 
1 248 VAL n 
1 249 ASP n 
1 250 PHE n 
1 251 PHE n 
1 252 ASN n 
1 253 SER n 
1 254 LEU n 
1 255 ASN n 
1 256 GLU n 
1 257 ALA n 
1 258 THR n 
1 259 MET n 
1 260 LYS n 
1 261 LEU n 
1 262 VAL n 
1 263 ALA n 
1 264 ILE n 
1 265 ILE n 
1 266 MET n 
1 267 TRP n 
1 268 TYR n 
1 269 ALA n 
1 270 PRO n 
1 271 LEU n 
1 272 GLY n 
1 273 ILE n 
1 274 LEU n 
1 275 PHE n 
1 276 LEU n 
1 277 ILE n 
1 278 ALA n 
1 279 GLY n 
1 280 LYS n 
1 281 ILE n 
1 282 VAL n 
1 283 GLU n 
1 284 MET n 
1 285 GLU n 
1 286 ASP n 
1 287 LEU n 
1 288 GLU n 
1 289 VAL n 
1 290 LEU n 
1 291 GLY n 
1 292 GLY n 
1 293 GLN n 
1 294 LEU n 
1 295 GLY n 
1 296 MET n 
1 297 TYR n 
1 298 MET n 
1 299 VAL n 
1 300 THR n 
1 301 VAL n 
1 302 ILE n 
1 303 VAL n 
1 304 GLY n 
1 305 LEU n 
1 306 VAL n 
1 307 ILE n 
1 308 HIS n 
1 309 GLY n 
1 310 LEU n 
1 311 ILE n 
1 312 VAL n 
1 313 LEU n 
1 314 PRO n 
1 315 LEU n 
1 316 ILE n 
1 317 TYR n 
1 318 PHE n 
1 319 LEU n 
1 320 ILE n 
1 321 THR n 
1 322 ARG n 
1 323 LYS n 
1 324 ASN n 
1 325 PRO n 
1 326 PHE n 
1 327 VAL n 
1 328 PHE n 
1 329 ILE n 
1 330 ALA n 
1 331 GLY n 
1 332 ILE n 
1 333 LEU n 
1 334 GLN n 
1 335 ALA n 
1 336 LEU n 
1 337 ILE n 
1 338 THR n 
1 339 ALA n 
1 340 LEU n 
1 341 GLY n 
1 342 THR n 
1 343 SER n 
1 344 SER n 
1 345 SER n 
1 346 SER n 
1 347 ALA n 
1 348 THR n 
1 349 LEU n 
1 350 PRO n 
1 351 ILE n 
1 352 THR n 
1 353 PHE n 
1 354 LYS n 
1 355 CYS n 
1 356 LEU n 
1 357 GLU n 
1 358 GLU n 
1 359 ASN n 
1 360 ASN n 
1 361 GLY n 
1 362 VAL n 
1 363 ASP n 
1 364 LYS n 
1 365 ARG n 
1 366 ILE n 
1 367 THR n 
1 368 ARG n 
1 369 PHE n 
1 370 VAL n 
1 371 LEU n 
1 372 PRO n 
1 373 VAL n 
1 374 GLY n 
1 375 ALA n 
1 376 THR n 
1 377 ILE n 
1 378 ASN n 
1 379 MET n 
1 380 ASP n 
1 381 GLY n 
1 382 THR n 
1 383 ALA n 
1 384 LEU n 
1 385 TYR n 
1 386 GLU n 
1 387 ALA n 
1 388 VAL n 
1 389 ALA n 
1 390 ALA n 
1 391 ILE n 
1 392 PHE n 
1 393 ILE n 
1 394 ALA n 
1 395 GLN n 
1 396 VAL n 
1 397 ASN n 
1 398 ASN n 
1 399 TYR n 
1 400 GLU n 
1 401 LEU n 
1 402 ASP n 
1 403 PHE n 
1 404 GLY n 
1 405 GLN n 
1 406 ILE n 
1 407 ILE n 
1 408 THR n 
1 409 ILE n 
1 410 SER n 
1 411 ILE n 
1 412 THR n 
1 413 ALA n 
1 414 THR n 
1 415 ALA n 
1 416 ALA n 
1 417 SER n 
1 418 ILE n 
1 419 GLY n 
1 420 ALA n 
1 421 ALA n 
1 422 GLY n 
1 423 ILE n 
1 424 PRO n 
1 425 GLN n 
1 426 ALA n 
1 427 GLY n 
1 428 LEU n 
1 429 VAL n 
1 430 THR n 
1 431 MET n 
1 432 VAL n 
1 433 ILE n 
1 434 VAL n 
1 435 LEU n 
1 436 THR n 
1 437 ALA n 
1 438 VAL n 
1 439 GLY n 
1 440 LEU n 
1 441 PRO n 
1 442 THR n 
1 443 ASP n 
1 444 ASP n 
1 445 ILE n 
1 446 THR n 
1 447 LEU n 
1 448 ILE n 
1 449 ILE n 
1 450 ALA n 
1 451 VAL n 
1 452 ASP n 
1 453 TRP n 
1 454 LEU n 
1 455 LEU n 
1 456 ASP n 
1 457 ARG n 
1 458 PHE n 
1 459 ARG n 
1 460 THR n 
1 461 MET n 
1 462 VAL n 
1 463 ASN n 
1 464 VAL n 
1 465 LEU n 
1 466 GLY n 
1 467 ASP n 
1 468 ALA n 
1 469 LEU n 
1 470 GLY n 
1 471 ALA n 
1 472 GLY n 
1 473 ILE n 
1 474 VAL n 
1 475 GLU n 
1 476 HIS n 
1 477 LEU n 
1 478 SER n 
1 479 ARG n 
1 480 LYS n 
1 481 GLU n 
1 482 LEU n 
1 483 GLU n 
1 484 LYS n 
1 485 GLN n 
1 486 ASP n 
1 487 ALA n 
1 488 GLU n 
1 489 LEU n 
1 490 GLY n 
1 491 ASN n 
1 492 SER n 
1 493 VAL n 
1 494 ILE n 
1 495 GLU n 
1 496 GLU n 
1 497 ASN n 
1 498 GLU n 
1 499 MET n 
1 500 LYS n 
1 501 LYS n 
1 502 PRO n 
1 503 TYR n 
1 504 GLN n 
1 505 LEU n 
1 506 ILE n 
1 507 ALA n 
1 508 GLN n 
1 509 ASP n 
1 510 ASN n 
1 511 GLU n 
1 512 THR n 
1 513 GLU n 
1 514 LYS n 
1 515 PRO n 
1 516 ILE n 
1 517 ASP n 
1 518 SER n 
1 519 GLU n 
1 520 THR n 
1 521 LYS n 
1 522 MET n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1   148 Human ? 'SLC1A3, EAAT1, GLAST, GLAST1'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
Human 'Homo sapiens' 9606 ? ? ? ? 'embrionic kidney' ? ? ? HEK-293F CRL-1573 ? embryonic ? ? 'Mammalian expresion' ? ? ? pcDNA3 ? 
? 
1 2 sample 'Biological sequence' 149 222 Human ? 'SLC1A5, ASCT2, M7V1, RDR, RDRC' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
Human 'Homo sapiens' 9606 ? ? ? ? 'embrionic kidney' ? ? ? HEK-293F CRL-1573 ? embryonic ? ? Plasmid               ? ? ? pcDNA3 ? 
? 
1 3 sample 'Biological sequence' 223 522 Human ? 'SLC1A3, EAAT1, GLAST, GLAST1'   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
Human 'Homo sapiens' 9606 ? ? ? ? 'embrionic kidney' ? ? ? HEK-293F CRL-1573 ? embryonic ? ? Plasmid               ? ? ? pcDNA3 ? 
? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP EAA1_HUMAN P43003 ? 1 
;MTKSNGEEPKMGGRMERFQQGVRKRTLLAKKKVQNITKEDVKSYLFRNAFVLLTVTAVIVGTILGFTLRPYRMSYREVKY
FSFPGELLMRMLQMLVLPLIISSLVTGMAALDSKASGKMGMRAVVYYMTTTIIAVVIGIIIVIIIHPG
;
1   
2 UNP AAAT_HUMAN Q15758 ? 1 AASAAINASVGAAGSAENAPSKEVLDSFLDLARNIFPSNLVSAAFRSYSTTYEERNITGTRVKVPVGQEVEGMN 157 
3 UNP EAA1_HUMAN P43003 ? 1 
;ALGLVVFSMCFGFVIGNMKEQGQALREFFDSLNEAIMRLVAVIMWYAPVGILFLIAGKIVEMEDMGVIGGQLAMYTVTVI
VGLLIHAVIVLPLLYFLVTRKNPWVFIGGLLQALITALGTSSSSATLPITFKCLEENNGVDKRVTRFVLPVGATINMDGT
ALYEALAAIFIAQVNNFELNFGQIITISITATAASIGAAGIPQAGLVTMVIVLTSVGLPTDDITLIIAVDWFLDRLRTTT
NVLGDSLGAGIVEHLSRHELKNRDVEMGNSVIEENEMKKPYQLIAQDNETEKPIDSETKM
;
243 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5LLU A 1   ? 148 ? P43003 1   ? 148 ? 1   148 
2 2 5LLU A 149 ? 222 ? Q15758 157 ? 230 ? 149 222 
3 3 5LLU A 223 ? 522 ? P43003 243 ? 542 ? 223 522 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5LLU SER A 23  ? UNP P43003 ARG 23  conflict 23  1  
1 5LLU PHE A 44  ? UNP P43003 TYR 44  conflict 44  2  
1 5LLU ARG A 46  ? UNP P43003 PHE 46  conflict 46  3  
1 5LLU LEU A 50  ? UNP P43003 PHE 50  conflict 50  4  
1 5LLU LEU A 51  ? UNP P43003 VAL 51  conflict 51  5  
1 5LLU LEU A 56  ? UNP P43003 THR 56  conflict 56  6  
1 5LLU LEU A 60  ? UNP P43003 VAL 60  conflict 60  7  
1 5LLU VAL A 62  ? UNP P43003 THR 62  conflict 62  8  
1 5LLU VAL A 63  ? UNP P43003 ILE 63  conflict 63  9  
1 5LLU LEU A 67  ? UNP P43003 THR 67  conflict 67  10 
1 5LLU PRO A 72  ? UNP P43003 ARG 72  conflict 72  11 
1 5LLU LEU A 73  ? UNP P43003 MET 73  conflict 73  12 
1 5LLU PRO A 75  ? UNP P43003 TYR 75  conflict 75  13 
1 5LLU ALA A 82  ? UNP P43003 SER 82  conflict 82  14 
1 5LLU LYS A 93  ? UNP P43003 GLN 93  conflict 93  15 
1 5LLU ILE A 96  ? UNP P43003 VAL 96  conflict 96  16 
1 5LLU VAL A 101 ? UNP P43003 ILE 101 conflict 101 17 
1 5LLU ILE A 105 ? UNP P43003 VAL 105 conflict 105 18 
1 5LLU LEU A 108 ? UNP P43003 MET 108 conflict 108 19 
1 5LLU SER A 110 ? UNP P43003 ALA 110 conflict 110 20 
1 5LLU ALA A 113 ? UNP P43003 SER 113 conflict 113 21 
1 5LLU ARG A 118 ? UNP P43003 LYS 118 conflict 118 22 
1 5LLU LEU A 119 ? UNP P43003 MET 119 conflict 119 23 
1 5LLU SER A 129 ? UNP P43003 THR 129 conflict 129 24 
1 5LLU LEU A 137 ? UNP P43003 ILE 137 conflict 137 25 
1 5LLU LEU A 141 ? UNP P43003 ILE 141 conflict 141 26 
1 5LLU LEU A 143 ? UNP P43003 ILE 143 conflict 143 27 
2 5LLU THR A 155 ? UNP Q15758 ASN 163 conflict 155 28 
2 5LLU CYS A 175 ? UNP Q15758 SER 183 conflict 175 29 
2 5LLU THR A 204 ? UNP Q15758 ASN 212 conflict 204 30 
3 5LLU ILE A 223 ? UNP P43003 ALA 243 conflict 223 31 
3 5LLU ILE A 231 ? UNP P43003 MET 251 conflict 231 32 
3 5LLU VAL A 232 ? UNP P43003 CYS 252 conflict 232 33 
3 5LLU ILE A 235 ? UNP P43003 PHE 255 conflict 235 34 
3 5LLU ALA A 236 ? UNP P43003 VAL 256 conflict 236 35 
3 5LLU LEU A 237 ? UNP P43003 ILE 257 conflict 237 36 
3 5LLU LYS A 239 ? UNP P43003 ASN 259 conflict 239 37 
3 5LLU GLY A 241 ? UNP P43003 LYS 261 conflict 241 38 
3 5LLU LEU A 246 ? UNP P43003 ALA 266 conflict 246 39 
3 5LLU VAL A 248 ? UNP P43003 ARG 268 conflict 248 40 
3 5LLU ASP A 249 ? UNP P43003 GLU 269 conflict 249 41 
3 5LLU ASN A 252 ? UNP P43003 ASP 272 conflict 252 42 
3 5LLU THR A 258 ? UNP P43003 ILE 278 conflict 258 43 
3 5LLU LYS A 260 ? UNP P43003 ARG 280 conflict 260 44 
3 5LLU ILE A 264 ? UNP P43003 VAL 284 conflict 264 45 
3 5LLU LEU A 271 ? UNP P43003 VAL 291 conflict 271 46 
3 5LLU LEU A 287 ? UNP P43003 MET 307 conflict 287 47 
3 5LLU GLU A 288 ? UNP P43003 GLY 308 conflict 288 48 
3 5LLU LEU A 290 ? UNP P43003 ILE 310 conflict 290 49 
3 5LLU GLY A 295 ? UNP P43003 ALA 315 conflict 295 50 
3 5LLU MET A 298 ? UNP P43003 THR 318 conflict 298 51 
3 5LLU VAL A 306 ? UNP P43003 LEU 326 conflict 306 52 
3 5LLU GLY A 309 ? UNP P43003 ALA 329 conflict 309 53 
3 5LLU LEU A 310 ? UNP P43003 VAL 330 conflict 310 54 
3 5LLU ILE A 316 ? UNP P43003 LEU 336 conflict 316 55 
3 5LLU ILE A 320 ? UNP P43003 VAL 340 conflict 320 56 
3 5LLU PHE A 326 ? UNP P43003 TRP 346 conflict 326 57 
3 5LLU ALA A 330 ? UNP P43003 GLY 350 conflict 330 58 
3 5LLU ILE A 332 ? UNP P43003 LEU 352 conflict 332 59 
3 5LLU ILE A 366 ? UNP P43003 VAL 386 conflict 366 60 
3 5LLU VAL A 388 ? UNP P43003 LEU 408 conflict 388 61 
3 5LLU TYR A 399 ? UNP P43003 PHE 419 conflict 399 62 
3 5LLU ASP A 402 ? UNP P43003 ASN 422 conflict 402 63 
3 5LLU ALA A 437 ? UNP P43003 SER 457 conflict 437 64 
3 5LLU LEU A 454 ? UNP P43003 PHE 474 conflict 454 65 
3 5LLU PHE A 458 ? UNP P43003 LEU 478 conflict 458 66 
3 5LLU MET A 461 ? UNP P43003 THR 481 conflict 461 67 
3 5LLU VAL A 462 ? UNP P43003 THR 482 conflict 462 68 
3 5LLU ALA A 468 ? UNP P43003 SER 488 conflict 468 69 
3 5LLU LYS A 480 ? UNP P43003 HIS 500 conflict 480 70 
3 5LLU GLU A 483 ? UNP P43003 LYS 503 conflict 483 71 
3 5LLU LYS A 484 ? UNP P43003 ASN 504 conflict 484 72 
3 5LLU GLN A 485 ? UNP P43003 ARG 505 conflict 485 73 
3 5LLU ALA A 487 ? UNP P43003 VAL 507 conflict 487 74 
3 5LLU LEU A 489 ? UNP P43003 MET 509 conflict 489 75 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
NA  non-polymer         . 'SODIUM ION'    ? 'Na 1'           22.990  
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LLU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.5 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         64.8 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              8.2 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '30% PEG400, 100 mM Tris pH 8.2, 50 mM Calcium chloride, 50 mM Barium chloride' 
_exptl_crystal_grow.pdbx_pH_range   8-8.4 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-02-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Channel-cut Si' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.009 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.009 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            137.12 
_reflns.entry_id                         5LLU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.32 
_reflns.d_resolution_low                 45.87 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       326273 
_reflns.number_obs                       11556 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  28.2 
_reflns.pdbx_Rmerge_I_obs                0.15 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            13 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.32 
_reflns_shell.d_res_low                   3.85 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                8.031 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             26.2 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.313 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5LLU 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     9251 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             20.00 
_refine.ls_d_res_high                            3.32 
_refine.ls_percent_reflns_obs                    80.44 
_refine.ls_R_factor_obs                          0.2096 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.2073 
_refine.ls_R_factor_R_free                       0.2541 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.81 
_refine.ls_number_reflns_R_free                  445 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.9287 
_refine.correlation_coeff_Fo_to_Fc_free          0.8871 
_refine.B_iso_mean                               137.20 
_refine.aniso_B[1][1]                            5.4518 
_refine.aniso_B[2][2]                            5.4518 
_refine.aniso_B[3][3]                            -10.9036 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      2NWX 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.494 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        5LLU 
_refine_analyze.Luzzati_coordinate_error_obs    0.464 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3007 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         10 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               3017 
_refine_hist.d_res_high                       3.32 
_refine_hist.d_res_low                        20.00 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
t_bond_d                  0.009 ? 2.00  3048 'X-RAY DIFFRACTION' HARMONIC     
t_angle_deg               1.05  ? 2.00  4139 'X-RAY DIFFRACTION' HARMONIC     
t_dihedral_angle_d        ?     ? 2.00  1042 'X-RAY DIFFRACTION' SINUSOIDAL   
t_incorr_chiral_ct        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_pseud_angle             ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_trig_c_planes           ?     ? 2.00  52   'X-RAY DIFFRACTION' HARMONIC     
t_gen_planes              ?     ? 5.00  438  'X-RAY DIFFRACTION' HARMONIC     
t_it                      ?     ? 20.00 3048 'X-RAY DIFFRACTION' HARMONIC     
t_nbd                     ?     ? 5.00  2    'X-RAY DIFFRACTION' SEMIHARMONIC 
t_omega_torsion           1.90  ? ?     ?    'X-RAY DIFFRACTION' ?            
t_other_torsion           20.69 ? ?     ?    'X-RAY DIFFRACTION' ?            
t_improper_torsion        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_chiral_improper_torsion ?     ? 5.00  432  'X-RAY DIFFRACTION' SEMIHARMONIC 
t_sum_occupancies         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_distance        ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_angle           ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_utility_torsion         ?     ? ?     ?    'X-RAY DIFFRACTION' ?            
t_ideal_dist_contact      ?     ? 4.00  3927 'X-RAY DIFFRACTION' SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   5 
_refine_ls_shell.d_res_high                       3.32 
_refine_ls_shell.d_res_low                        3.71 
_refine_ls_shell.number_reflns_R_work             1249 
_refine_ls_shell.R_factor_R_work                  0.1988 
_refine_ls_shell.percent_reflns_obs               40.07 
_refine_ls_shell.R_factor_R_free                  0.2294 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            3.85 
_refine_ls_shell.number_reflns_R_free             50 
_refine_ls_shell.number_reflns_all                1299 
_refine_ls_shell.R_factor_all                     0.1999 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
_struct.entry_id                     5LLU 
_struct.title                        'Structure of the thermostabilized EAAT1 cryst-II mutant in complex with L-ASP' 
_struct.pdbx_descriptor              
'Excitatory amino acid transporter 1,Neutral amino acid transporter B(0),Excitatory amino acid transporter 1' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LLU 
_struct_keywords.text            
'excitatory amino acid transporter 1, human glutamate transporter, SLC1A3, thermostabilized, transport protein' 
_struct_keywords.pdbx_keywords   'TRANSPORT PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 40  ? ASN A 48  ? ASP A 40  ASN A 48  1 ? 9  
HELX_P HELX_P2  AA2 ASN A 48  ? ARG A 69  ? ASN A 48  ARG A 69  1 ? 22 
HELX_P HELX_P3  AA3 SER A 74  ? SER A 110 ? SER A 74  SER A 110 1 ? 37 
HELX_P HELX_P4  AA4 ASP A 112 ? ILE A 145 ? ASP A 112 ILE A 145 1 ? 34 
HELX_P HELX_P5  AA5 VAL A 172 ? PHE A 184 ? VAL A 172 PHE A 184 1 ? 13 
HELX_P HELX_P6  AA6 ASN A 187 ? ALA A 192 ? ASN A 187 ALA A 192 1 ? 6  
HELX_P HELX_P7  AA7 ASN A 222 ? MET A 240 ? ASN A 222 MET A 240 1 ? 19 
HELX_P HELX_P8  AA8 GLY A 241 ? ILE A 281 ? GLY A 241 ILE A 281 1 ? 41 
HELX_P HELX_P9  AA9 GLY A 295 ? ILE A 311 ? GLY A 295 ILE A 311 1 ? 17 
HELX_P HELX_P10 AB1 ILE A 311 ? THR A 321 ? ILE A 311 THR A 321 1 ? 11 
HELX_P HELX_P11 AB2 ASN A 324 ? ILE A 332 ? ASN A 324 ILE A 332 1 ? 9  
HELX_P HELX_P12 AB3 ILE A 332 ? SER A 343 ? ILE A 332 SER A 343 1 ? 12 
HELX_P HELX_P13 AB4 THR A 348 ? GLU A 358 ? THR A 348 GLU A 358 1 ? 11 
HELX_P HELX_P14 AB5 ASP A 363 ? ILE A 377 ? ASP A 363 ILE A 377 1 ? 15 
HELX_P HELX_P15 AB6 MET A 379 ? ASN A 398 ? MET A 379 ASN A 398 1 ? 20 
HELX_P HELX_P16 AB7 GLN A 405 ? ALA A 420 ? GLN A 405 ALA A 420 1 ? 16 
HELX_P HELX_P17 AB8 GLN A 425 ? THR A 430 ? GLN A 425 THR A 430 1 ? 6  
HELX_P HELX_P18 AB9 THR A 430 ? GLY A 439 ? THR A 430 GLY A 439 1 ? 10 
HELX_P HELX_P19 AC1 PRO A 441 ? ASP A 443 ? PRO A 441 ASP A 443 5 ? 3  
HELX_P HELX_P20 AC2 ASP A 444 ? SER A 478 ? ASP A 444 SER A 478 1 ? 35 
HELX_P HELX_P21 AC3 SER A 478 ? GLY A 490 ? SER A 478 GLY A 490 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A THR 376 O ? ? ? 1_555 B NA . NA ? ? A THR 376 A NA 601 1_555 ? ? ? ? ? ? ? 2.239 ? 
metalc2 metalc ? ? A SER 417 O ? ? ? 1_555 B NA . NA ? ? A SER 417 A NA 601 1_555 ? ? ? ? ? ? ? 2.253 ? 
metalc3 metalc ? ? A ILE 418 O ? ? ? 1_555 B NA . NA ? ? A ILE 418 A NA 601 1_555 ? ? ? ? ? ? ? 2.977 ? 
metalc4 metalc ? ? A ALA 420 O ? ? ? 1_555 B NA . NA ? ? A ALA 420 A NA 601 1_555 ? ? ? ? ? ? ? 2.882 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A NA  601 ? 6  'binding site for residue NA A 601'  
AC2 Software A ASP 602 ? 14 'binding site for residue ASP A 602' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6  THR A 376 ? THR A 376 . ? 1_555 ? 
2  AC1 6  ILE A 377 ? ILE A 377 . ? 1_555 ? 
3  AC1 6  MET A 379 ? MET A 379 . ? 1_555 ? 
4  AC1 6  SER A 417 ? SER A 417 . ? 1_555 ? 
5  AC1 6  ILE A 418 ? ILE A 418 . ? 1_555 ? 
6  AC1 6  ALA A 420 ? ALA A 420 . ? 1_555 ? 
7  AC2 14 SER A 343 ? SER A 343 . ? 1_555 ? 
8  AC2 14 SER A 344 ? SER A 344 . ? 1_555 ? 
9  AC2 14 SER A 345 ? SER A 345 . ? 1_555 ? 
10 AC2 14 THR A 382 ? THR A 382 . ? 1_555 ? 
11 AC2 14 ALA A 421 ? ALA A 421 . ? 1_555 ? 
12 AC2 14 GLY A 422 ? GLY A 422 . ? 1_555 ? 
13 AC2 14 ILE A 423 ? ILE A 423 . ? 1_555 ? 
14 AC2 14 GLN A 425 ? GLN A 425 . ? 1_555 ? 
15 AC2 14 ALA A 426 ? ALA A 426 . ? 1_555 ? 
16 AC2 14 GLY A 427 ? GLY A 427 . ? 1_555 ? 
17 AC2 14 ASP A 456 ? ASP A 456 . ? 1_555 ? 
18 AC2 14 ARG A 459 ? ARG A 459 . ? 1_555 ? 
19 AC2 14 THR A 460 ? THR A 460 . ? 1_555 ? 
20 AC2 14 ASN A 463 ? ASN A 463 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LLU 
_atom_sites.fract_transf_matrix[1][1]   0.008109 
_atom_sites.fract_transf_matrix[1][2]   0.004682 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009363 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011164 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
NA 
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 39  ? 39.958  36.120 -14.134 1.00 211.74 ? 39  GLU A N   1 
ATOM   2    C  CA  . GLU A 1 39  ? 40.259  37.042 -15.226 1.00 211.72 ? 39  GLU A CA  1 
ATOM   3    C  C   . GLU A 1 39  ? 39.124  38.035 -15.493 1.00 212.83 ? 39  GLU A C   1 
ATOM   4    O  O   . GLU A 1 39  ? 39.391  39.223 -15.690 1.00 212.04 ? 39  GLU A O   1 
ATOM   5    C  CB  . GLU A 1 39  ? 40.593  36.272 -16.514 1.00 214.06 ? 39  GLU A CB  1 
ATOM   6    C  CG  . GLU A 1 39  ? 42.038  35.817 -16.603 1.00 222.34 ? 39  GLU A CG  1 
ATOM   7    C  CD  . GLU A 1 39  ? 42.461  35.350 -17.982 1.00 232.37 ? 39  GLU A CD  1 
ATOM   8    O  OE1 . GLU A 1 39  ? 42.089  34.219 -18.371 1.00 229.16 ? 39  GLU A OE1 1 
ATOM   9    O  OE2 . GLU A 1 39  ? 43.175  36.112 -18.672 1.00 230.49 ? 39  GLU A OE2 1 
ATOM   10   N  N   . ASP A 1 40  ? 37.866  37.542 -15.511 1.00 209.44 ? 40  ASP A N   1 
ATOM   11   C  CA  . ASP A 1 40  ? 36.647  38.315 -15.790 1.00 207.29 ? 40  ASP A CA  1 
ATOM   12   C  C   . ASP A 1 40  ? 36.100  39.123 -14.591 1.00 207.82 ? 40  ASP A C   1 
ATOM   13   O  O   . ASP A 1 40  ? 35.096  39.822 -14.747 1.00 205.71 ? 40  ASP A O   1 
ATOM   14   C  CB  . ASP A 1 40  ? 35.550  37.392 -16.364 1.00 208.23 ? 40  ASP A CB  1 
ATOM   15   C  CG  . ASP A 1 40  ? 35.933  36.681 -17.649 1.00 217.01 ? 40  ASP A CG  1 
ATOM   16   O  OD1 . ASP A 1 40  ? 36.680  35.679 -17.574 1.00 218.86 ? 40  ASP A OD1 1 
ATOM   17   O  OD2 . ASP A 1 40  ? 35.457  37.105 -18.725 1.00 220.57 ? 40  ASP A OD2 1 
ATOM   18   N  N   . VAL A 1 41  ? 36.756  39.047 -13.414 1.00 205.79 ? 41  VAL A N   1 
ATOM   19   C  CA  . VAL A 1 41  ? 36.320  39.754 -12.205 1.00 204.45 ? 41  VAL A CA  1 
ATOM   20   C  C   . VAL A 1 41  ? 36.637  41.273 -12.265 1.00 207.07 ? 41  VAL A C   1 
ATOM   21   O  O   . VAL A 1 41  ? 36.019  42.041 -11.525 1.00 205.35 ? 41  VAL A O   1 
ATOM   22   C  CB  . VAL A 1 41  ? 36.840  39.071 -10.909 1.00 207.97 ? 41  VAL A CB  1 
ATOM   23   C  CG1 . VAL A 1 41  ? 38.274  39.480 -10.574 1.00 209.36 ? 41  VAL A CG1 1 
ATOM   24   C  CG2 . VAL A 1 41  ? 35.904  39.323 -9.730  1.00 206.34 ? 41  VAL A CG2 1 
ATOM   25   N  N   . LYS A 1 42  ? 37.576  41.699 -13.145 1.00 206.06 ? 42  LYS A N   1 
ATOM   26   C  CA  . LYS A 1 42  ? 37.940  43.114 -13.311 1.00 205.71 ? 42  LYS A CA  1 
ATOM   27   C  C   . LYS A 1 42  ? 36.809  43.904 -13.991 1.00 206.17 ? 42  LYS A C   1 
ATOM   28   O  O   . LYS A 1 42  ? 36.500  45.020 -13.563 1.00 204.44 ? 42  LYS A O   1 
ATOM   29   C  CB  . LYS A 1 42  ? 39.291  43.271 -14.051 1.00 209.62 ? 42  LYS A CB  1 
ATOM   30   C  CG  . LYS A 1 42  ? 39.779  44.721 -14.257 1.00 222.30 ? 42  LYS A CG  1 
ATOM   31   C  CD  . LYS A 1 42  ? 39.923  45.531 -12.955 1.00 230.70 ? 42  LYS A CD  1 
ATOM   32   C  CE  . LYS A 1 42  ? 39.311  46.907 -13.085 1.00 236.65 ? 42  LYS A CE  1 
ATOM   33   N  NZ  . LYS A 1 42  ? 39.077  47.542 -11.761 1.00 240.99 ? 42  LYS A NZ  1 
ATOM   34   N  N   . SER A 1 43  ? 36.181  43.307 -15.028 1.00 203.07 ? 43  SER A N   1 
ATOM   35   C  CA  . SER A 1 43  ? 35.047  43.886 -15.755 1.00 200.84 ? 43  SER A CA  1 
ATOM   36   C  C   . SER A 1 43  ? 33.795  43.892 -14.866 1.00 200.41 ? 43  SER A C   1 
ATOM   37   O  O   . SER A 1 43  ? 32.940  44.765 -15.015 1.00 197.28 ? 43  SER A O   1 
ATOM   38   C  CB  . SER A 1 43  ? 34.783  43.111 -17.043 1.00 204.47 ? 43  SER A CB  1 
ATOM   39   O  OG  . SER A 1 43  ? 34.557  41.732 -16.797 1.00 212.17 ? 43  SER A OG  1 
ATOM   40   N  N   . PHE A 1 44  ? 33.710  42.926 -13.928 1.00 197.72 ? 44  PHE A N   1 
ATOM   41   C  CA  . PHE A 1 44  ? 32.629  42.778 -12.954 1.00 192.53 ? 44  PHE A CA  1 
ATOM   42   C  C   . PHE A 1 44  ? 32.680  43.901 -11.910 1.00 191.87 ? 44  PHE A C   1 
ATOM   43   O  O   . PHE A 1 44  ? 31.635  44.296 -11.394 1.00 186.97 ? 44  PHE A O   1 
ATOM   44   C  CB  . PHE A 1 44  ? 32.712  41.397 -12.280 1.00 196.48 ? 44  PHE A CB  1 
ATOM   45   C  CG  . PHE A 1 44  ? 31.583  41.066 -11.336 1.00 194.28 ? 44  PHE A CG  1 
ATOM   46   C  CD1 . PHE A 1 44  ? 30.358  40.623 -11.820 1.00 195.50 ? 44  PHE A CD1 1 
ATOM   47   C  CD2 . PHE A 1 44  ? 31.753  41.165 -9.962  1.00 195.36 ? 44  PHE A CD2 1 
ATOM   48   C  CE1 . PHE A 1 44  ? 29.314  40.312 -10.946 1.00 193.37 ? 44  PHE A CE1 1 
ATOM   49   C  CE2 . PHE A 1 44  ? 30.710  40.851 -9.088  1.00 195.22 ? 44  PHE A CE2 1 
ATOM   50   C  CZ  . PHE A 1 44  ? 29.498  40.426 -9.586  1.00 191.37 ? 44  PHE A CZ  1 
ATOM   51   N  N   . LEU A 1 45  ? 33.893  44.406 -11.602 1.00 189.85 ? 45  LEU A N   1 
ATOM   52   C  CA  . LEU A 1 45  ? 34.113  45.503 -10.656 1.00 186.82 ? 45  LEU A CA  1 
ATOM   53   C  C   . LEU A 1 45  ? 33.827  46.857 -11.313 1.00 186.65 ? 45  LEU A C   1 
ATOM   54   O  O   . LEU A 1 45  ? 33.324  47.765 -10.649 1.00 182.47 ? 45  LEU A O   1 
ATOM   55   C  CB  . LEU A 1 45  ? 35.550  45.475 -10.106 1.00 190.99 ? 45  LEU A CB  1 
ATOM   56   C  CG  . LEU A 1 45  ? 35.847  44.428 -9.036  1.00 197.47 ? 45  LEU A CG  1 
ATOM   57   C  CD1 . LEU A 1 45  ? 37.306  44.028 -9.064  1.00 200.83 ? 45  LEU A CD1 1 
ATOM   58   C  CD2 . LEU A 1 45  ? 35.463  44.924 -7.651  1.00 196.00 ? 45  LEU A CD2 1 
ATOM   59   N  N   . ARG A 1 46  ? 34.152  46.984 -12.614 1.00 183.85 ? 46  ARG A N   1 
ATOM   60   C  CA  . ARG A 1 46  ? 33.943  48.196 -13.407 1.00 181.22 ? 46  ARG A CA  1 
ATOM   61   C  C   . ARG A 1 46  ? 32.460  48.447 -13.695 1.00 178.95 ? 46  ARG A C   1 
ATOM   62   O  O   . ARG A 1 46  ? 32.002  49.580 -13.546 1.00 175.57 ? 46  ARG A O   1 
ATOM   63   C  CB  . ARG A 1 46  ? 34.737  48.126 -14.724 1.00 185.52 ? 46  ARG A CB  1 
ATOM   64   C  CG  . ARG A 1 46  ? 36.210  48.493 -14.588 1.00 198.41 ? 46  ARG A CG  1 
ATOM   65   C  CD  . ARG A 1 46  ? 36.956  48.281 -15.893 1.00 202.81 ? 46  ARG A CD  1 
ATOM   66   N  NE  . ARG A 1 46  ? 38.186  49.072 -15.961 1.00 206.84 ? 46  ARG A NE  1 
ATOM   67   C  CZ  . ARG A 1 46  ? 38.275  50.282 -16.508 1.00 214.00 ? 46  ARG A CZ  1 
ATOM   68   N  NH1 . ARG A 1 46  ? 37.203  50.859 -17.039 1.00 201.14 ? 46  ARG A NH1 1 
ATOM   69   N  NH2 . ARG A 1 46  ? 39.434  50.925 -16.527 1.00 204.07 ? 46  ARG A NH2 1 
ATOM   70   N  N   . ARG A 1 47  ? 31.715  47.394 -14.100 1.00 173.92 ? 47  ARG A N   1 
ATOM   71   C  CA  . ARG A 1 47  ? 30.289  47.460 -14.455 1.00 169.14 ? 47  ARG A CA  1 
ATOM   72   C  C   . ARG A 1 47  ? 29.340  47.600 -13.249 1.00 166.41 ? 47  ARG A C   1 
ATOM   73   O  O   . ARG A 1 47  ? 28.504  48.510 -13.237 1.00 161.87 ? 47  ARG A O   1 
ATOM   74   C  CB  . ARG A 1 47  ? 29.890  46.257 -15.330 1.00 171.33 ? 47  ARG A CB  1 
ATOM   75   C  CG  . ARG A 1 47  ? 30.463  46.308 -16.739 1.00 184.43 ? 47  ARG A CG  1 
ATOM   76   C  CD  . ARG A 1 47  ? 30.479  44.941 -17.381 1.00 195.13 ? 47  ARG A CD  1 
ATOM   77   N  NE  . ARG A 1 47  ? 30.911  45.003 -18.777 1.00 201.97 ? 47  ARG A NE  1 
ATOM   78   C  CZ  . ARG A 1 47  ? 31.075  43.940 -19.557 1.00 212.63 ? 47  ARG A CZ  1 
ATOM   79   N  NH1 . ARG A 1 47  ? 30.856  42.719 -19.084 1.00 205.11 ? 47  ARG A NH1 1 
ATOM   80   N  NH2 . ARG A 1 47  ? 31.463  44.088 -20.816 1.00 203.76 ? 47  ARG A NH2 1 
ATOM   81   N  N   . ASN A 1 48  ? 29.473  46.701 -12.246 1.00 161.90 ? 48  ASN A N   1 
ATOM   82   C  CA  . ASN A 1 48  ? 28.644  46.663 -11.031 1.00 157.35 ? 48  ASN A CA  1 
ATOM   83   C  C   . ASN A 1 48  ? 29.191  47.572 -9.898  1.00 157.37 ? 48  ASN A C   1 
ATOM   84   O  O   . ASN A 1 48  ? 28.972  47.283 -8.718  1.00 155.47 ? 48  ASN A O   1 
ATOM   85   C  CB  . ASN A 1 48  ? 28.477  45.206 -10.539 1.00 160.10 ? 48  ASN A CB  1 
ATOM   86   C  CG  . ASN A 1 48  ? 28.019  44.213 -11.587 1.00 182.87 ? 48  ASN A CG  1 
ATOM   87   O  OD1 . ASN A 1 48  ? 28.655  44.025 -12.629 1.00 178.55 ? 48  ASN A OD1 1 
ATOM   88   N  ND2 . ASN A 1 48  ? 26.944  43.500 -11.297 1.00 173.97 ? 48  ASN A ND2 1 
ATOM   89   N  N   . ALA A 1 49  ? 29.869  48.685 -10.272 1.00 152.65 ? 49  ALA A N   1 
ATOM   90   C  CA  . ALA A 1 49  ? 30.487  49.667 -9.373  1.00 151.07 ? 49  ALA A CA  1 
ATOM   91   C  C   . ALA A 1 49  ? 29.555  50.214 -8.293  1.00 149.32 ? 49  ALA A C   1 
ATOM   92   O  O   . ALA A 1 49  ? 29.920  50.182 -7.118  1.00 149.30 ? 49  ALA A O   1 
ATOM   93   C  CB  . ALA A 1 49  ? 31.103  50.805 -10.174 1.00 152.62 ? 49  ALA A CB  1 
ATOM   94   N  N   . LEU A 1 50  ? 28.353  50.688 -8.673  1.00 141.29 ? 50  LEU A N   1 
ATOM   95   C  CA  . LEU A 1 50  ? 27.388  51.216 -7.706  1.00 136.87 ? 50  LEU A CA  1 
ATOM   96   C  C   . LEU A 1 50  ? 26.769  50.105 -6.848  1.00 138.65 ? 50  LEU A C   1 
ATOM   97   O  O   . LEU A 1 50  ? 26.563  50.323 -5.653  1.00 137.14 ? 50  LEU A O   1 
ATOM   98   C  CB  . LEU A 1 50  ? 26.316  52.100 -8.382  1.00 133.71 ? 50  LEU A CB  1 
ATOM   99   C  CG  . LEU A 1 50  ? 25.360  52.911 -7.477  1.00 134.62 ? 50  LEU A CG  1 
ATOM   100  C  CD1 . LEU A 1 50  ? 26.111  53.793 -6.489  1.00 134.91 ? 50  LEU A CD1 1 
ATOM   101  C  CD2 . LEU A 1 50  ? 24.431  53.767 -8.306  1.00 135.18 ? 50  LEU A CD2 1 
ATOM   102  N  N   . LEU A 1 51  ? 26.518  48.912 -7.435  1.00 134.98 ? 51  LEU A N   1 
ATOM   103  C  CA  . LEU A 1 51  ? 25.956  47.767 -6.707  1.00 133.84 ? 51  LEU A CA  1 
ATOM   104  C  C   . LEU A 1 51  ? 26.930  47.265 -5.643  1.00 138.60 ? 51  LEU A C   1 
ATOM   105  O  O   . LEU A 1 51  ? 26.515  47.030 -4.511  1.00 136.74 ? 51  LEU A O   1 
ATOM   106  C  CB  . LEU A 1 51  ? 25.561  46.626 -7.659  1.00 135.21 ? 51  LEU A CB  1 
ATOM   107  C  CG  . LEU A 1 51  ? 24.741  45.498 -7.032  1.00 139.22 ? 51  LEU A CG  1 
ATOM   108  C  CD1 . LEU A 1 51  ? 23.462  45.280 -7.789  1.00 137.71 ? 51  LEU A CD1 1 
ATOM   109  C  CD2 . LEU A 1 51  ? 25.539  44.217 -6.969  1.00 145.52 ? 51  LEU A CD2 1 
ATOM   110  N  N   . LEU A 1 52  ? 28.218  47.117 -6.006  1.00 137.90 ? 52  LEU A N   1 
ATOM   111  C  CA  . LEU A 1 52  ? 29.264  46.645 -5.098  1.00 140.15 ? 52  LEU A CA  1 
ATOM   112  C  C   . LEU A 1 52  ? 29.538  47.623 -3.956  1.00 141.60 ? 52  LEU A C   1 
ATOM   113  O  O   . LEU A 1 52  ? 29.792  47.174 -2.837  1.00 142.69 ? 52  LEU A O   1 
ATOM   114  C  CB  . LEU A 1 52  ? 30.555  46.280 -5.853  1.00 144.56 ? 52  LEU A CB  1 
ATOM   115  C  CG  . LEU A 1 52  ? 30.479  45.049 -6.765  1.00 151.37 ? 52  LEU A CG  1 
ATOM   116  C  CD1 . LEU A 1 52  ? 31.593  45.059 -7.786  1.00 155.29 ? 52  LEU A CD1 1 
ATOM   117  C  CD2 . LEU A 1 52  ? 30.488  43.753 -5.965  1.00 155.50 ? 52  LEU A CD2 1 
ATOM   118  N  N   . LEU A 1 53  ? 29.440  48.949 -4.221  1.00 134.28 ? 53  LEU A N   1 
ATOM   119  C  CA  . LEU A 1 53  ? 29.633  49.991 -3.205  1.00 132.18 ? 53  LEU A CA  1 
ATOM   120  C  C   . LEU A 1 53  ? 28.553  49.944 -2.114  1.00 132.15 ? 53  LEU A C   1 
ATOM   121  O  O   . LEU A 1 53  ? 28.842  50.265 -0.959  1.00 131.49 ? 53  LEU A O   1 
ATOM   122  C  CB  . LEU A 1 53  ? 29.703  51.384 -3.842  1.00 130.71 ? 53  LEU A CB  1 
ATOM   123  C  CG  . LEU A 1 53  ? 31.077  51.828 -4.332  1.00 138.70 ? 53  LEU A CG  1 
ATOM   124  C  CD1 . LEU A 1 53  ? 30.953  52.914 -5.381  1.00 137.83 ? 53  LEU A CD1 1 
ATOM   125  C  CD2 . LEU A 1 53  ? 31.947  52.313 -3.182  1.00 142.66 ? 53  LEU A CD2 1 
ATOM   126  N  N   . THR A 1 54  ? 27.322  49.524 -2.482  1.00 125.88 ? 54  THR A N   1 
ATOM   127  C  CA  . THR A 1 54  ? 26.195  49.374 -1.557  1.00 122.73 ? 54  THR A CA  1 
ATOM   128  C  C   . THR A 1 54  ? 26.289  48.051 -0.780  1.00 128.12 ? 54  THR A C   1 
ATOM   129  O  O   . THR A 1 54  ? 25.778  47.977 0.340   1.00 127.03 ? 54  THR A O   1 
ATOM   130  C  CB  . THR A 1 54  ? 24.838  49.579 -2.252  1.00 125.71 ? 54  THR A CB  1 
ATOM   131  O  OG1 . THR A 1 54  ? 24.768  48.780 -3.430  1.00 126.71 ? 54  THR A OG1 1 
ATOM   132  C  CG2 . THR A 1 54  ? 24.564  51.035 -2.592  1.00 120.45 ? 54  THR A CG2 1 
ATOM   133  N  N   . VAL A 1 55  ? 26.946  47.014 -1.360  1.00 126.82 ? 55  VAL A N   1 
ATOM   134  C  CA  . VAL A 1 55  ? 27.155  45.729 -0.675  1.00 128.66 ? 55  VAL A CA  1 
ATOM   135  C  C   . VAL A 1 55  ? 28.213  45.984 0.401   1.00 134.41 ? 55  VAL A C   1 
ATOM   136  O  O   . VAL A 1 55  ? 28.012  45.613 1.557   1.00 133.99 ? 55  VAL A O   1 
ATOM   137  C  CB  . VAL A 1 55  ? 27.560  44.556 -1.612  1.00 135.31 ? 55  VAL A CB  1 
ATOM   138  C  CG1 . VAL A 1 55  ? 27.620  43.236 -0.844  1.00 137.35 ? 55  VAL A CG1 1 
ATOM   139  C  CG2 . VAL A 1 55  ? 26.610  44.428 -2.795  1.00 133.28 ? 55  VAL A CG2 1 
ATOM   140  N  N   . LEU A 1 56  ? 29.308  46.681 0.012   1.00 132.88 ? 56  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 56  ? 30.430  47.100 0.862   1.00 135.25 ? 56  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 56  ? 29.926  48.010 1.990   1.00 137.33 ? 56  LEU A C   1 
ATOM   143  O  O   . LEU A 1 56  ? 30.473  47.969 3.091   1.00 138.52 ? 56  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 56  ? 31.487  47.830 0.000   1.00 137.10 ? 56  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 56  ? 32.658  48.524 0.707   1.00 143.88 ? 56  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 56  ? 33.723  47.530 1.122   1.00 148.59 ? 56  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 56  ? 33.258  49.594 -0.178  1.00 146.33 ? 56  LEU A CD2 1 
ATOM   148  N  N   . ALA A 1 57  ? 28.873  48.815 1.706   1.00 130.38 ? 57  ALA A N   1 
ATOM   149  C  CA  . ALA A 1 57  ? 28.223  49.723 2.654   1.00 127.53 ? 57  ALA A CA  1 
ATOM   150  C  C   . ALA A 1 57  ? 27.587  48.941 3.798   1.00 130.43 ? 57  ALA A C   1 
ATOM   151  O  O   . ALA A 1 57  ? 27.601  49.413 4.932   1.00 130.10 ? 57  ALA A O   1 
ATOM   152  C  CB  . ALA A 1 57  ? 27.168  50.551 1.943   1.00 124.58 ? 57  ALA A CB  1 
ATOM   153  N  N   . VAL A 1 58  ? 27.047  47.743 3.503   1.00 126.39 ? 58  VAL A N   1 
ATOM   154  C  CA  . VAL A 1 58  ? 26.441  46.860 4.498   1.00 126.04 ? 58  VAL A CA  1 
ATOM   155  C  C   . VAL A 1 58  ? 27.555  46.162 5.303   1.00 132.97 ? 58  VAL A C   1 
ATOM   156  O  O   . VAL A 1 58  ? 27.538  46.213 6.532   1.00 132.76 ? 58  VAL A O   1 
ATOM   157  C  CB  . VAL A 1 58  ? 25.434  45.870 3.852   1.00 128.94 ? 58  VAL A CB  1 
ATOM   158  C  CG1 . VAL A 1 58  ? 24.923  44.848 4.864   1.00 129.82 ? 58  VAL A CG1 1 
ATOM   159  C  CG2 . VAL A 1 58  ? 24.267  46.620 3.221   1.00 124.87 ? 58  VAL A CG2 1 
ATOM   160  N  N   . ILE A 1 59  ? 28.535  45.553 4.600   1.00 132.22 ? 59  ILE A N   1 
ATOM   161  C  CA  . ILE A 1 59  ? 29.683  44.848 5.184   1.00 136.19 ? 59  ILE A CA  1 
ATOM   162  C  C   . ILE A 1 59  ? 30.493  45.765 6.116   1.00 141.38 ? 59  ILE A C   1 
ATOM   163  O  O   . ILE A 1 59  ? 30.772  45.375 7.249   1.00 142.90 ? 59  ILE A O   1 
ATOM   164  C  CB  . ILE A 1 59  ? 30.560  44.173 4.083   1.00 142.21 ? 59  ILE A CB  1 
ATOM   165  C  CG1 . ILE A 1 59  ? 29.730  43.264 3.119   1.00 141.71 ? 59  ILE A CG1 1 
ATOM   166  C  CG2 . ILE A 1 59  ? 31.763  43.422 4.670   1.00 147.77 ? 59  ILE A CG2 1 
ATOM   167  C  CD1 . ILE A 1 59  ? 28.788  42.150 3.747   1.00 148.66 ? 59  ILE A CD1 1 
ATOM   168  N  N   . LEU A 1 60  ? 30.834  46.983 5.650   1.00 137.07 ? 60  LEU A N   1 
ATOM   169  C  CA  . LEU A 1 60  ? 31.589  47.974 6.422   1.00 138.09 ? 60  LEU A CA  1 
ATOM   170  C  C   . LEU A 1 60  ? 30.714  48.678 7.476   1.00 139.39 ? 60  LEU A C   1 
ATOM   171  O  O   . LEU A 1 60  ? 31.229  49.060 8.530   1.00 140.92 ? 60  LEU A O   1 
ATOM   172  C  CB  . LEU A 1 60  ? 32.294  48.982 5.487   1.00 138.31 ? 60  LEU A CB  1 
ATOM   173  C  CG  . LEU A 1 60  ? 33.331  49.937 6.096   1.00 145.33 ? 60  LEU A CG  1 
ATOM   174  C  CD1 . LEU A 1 60  ? 34.579  49.195 6.570   1.00 150.52 ? 60  LEU A CD1 1 
ATOM   175  C  CD2 . LEU A 1 60  ? 33.726  50.999 5.099   1.00 147.53 ? 60  LEU A CD2 1 
ATOM   176  N  N   . GLY A 1 61  ? 29.413  48.806 7.192   1.00 131.77 ? 61  GLY A N   1 
ATOM   177  C  CA  . GLY A 1 61  ? 28.431  49.418 8.086   1.00 128.83 ? 61  GLY A CA  1 
ATOM   178  C  C   . GLY A 1 61  ? 28.178  48.617 9.351   1.00 133.80 ? 61  GLY A C   1 
ATOM   179  O  O   . GLY A 1 61  ? 27.985  49.201 10.422  1.00 133.42 ? 61  GLY A O   1 
ATOM   180  N  N   . VAL A 1 62  ? 28.177  47.269 9.236   1.00 131.13 ? 62  VAL A N   1 
ATOM   181  C  CA  . VAL A 1 62  ? 28.003  46.344 10.364  1.00 132.36 ? 62  VAL A CA  1 
ATOM   182  C  C   . VAL A 1 62  ? 29.282  46.395 11.240  1.00 140.11 ? 62  VAL A C   1 
ATOM   183  O  O   . VAL A 1 62  ? 29.185  46.406 12.470  1.00 140.74 ? 62  VAL A O   1 
ATOM   184  C  CB  . VAL A 1 62  ? 27.651  44.903 9.883   1.00 136.81 ? 62  VAL A CB  1 
ATOM   185  C  CG1 . VAL A 1 62  ? 27.693  43.895 11.030  1.00 139.61 ? 62  VAL A CG1 1 
ATOM   186  C  CG2 . VAL A 1 62  ? 26.288  44.861 9.201   1.00 132.76 ? 62  VAL A CG2 1 
ATOM   187  N  N   . VAL A 1 63  ? 30.468  46.463 10.590  1.00 138.82 ? 63  VAL A N   1 
ATOM   188  C  CA  . VAL A 1 63  ? 31.789  46.545 11.228  1.00 142.66 ? 63  VAL A CA  1 
ATOM   189  C  C   . VAL A 1 63  ? 31.916  47.835 12.056  1.00 146.68 ? 63  VAL A C   1 
ATOM   190  O  O   . VAL A 1 63  ? 32.275  47.768 13.231  1.00 148.41 ? 63  VAL A O   1 
ATOM   191  C  CB  . VAL A 1 63  ? 32.929  46.374 10.184  1.00 148.78 ? 63  VAL A CB  1 
ATOM   192  C  CG1 . VAL A 1 63  ? 34.285  46.801 10.741  1.00 152.44 ? 63  VAL A CG1 1 
ATOM   193  C  CG2 . VAL A 1 63  ? 32.992  44.938 9.673   1.00 150.60 ? 63  VAL A CG2 1 
ATOM   194  N  N   . LEU A 1 64  ? 31.587  48.992 11.445  1.00 141.36 ? 64  LEU A N   1 
ATOM   195  C  CA  . LEU A 1 64  ? 31.616  50.326 12.059  1.00 141.08 ? 64  LEU A CA  1 
ATOM   196  C  C   . LEU A 1 64  ? 30.758  50.417 13.340  1.00 144.87 ? 64  LEU A C   1 
ATOM   197  O  O   . LEU A 1 64  ? 31.221  50.959 14.349  1.00 146.46 ? 64  LEU A O   1 
ATOM   198  C  CB  . LEU A 1 64  ? 31.169  51.382 11.023  1.00 137.79 ? 64  LEU A CB  1 
ATOM   199  C  CG  . LEU A 1 64  ? 31.038  52.839 11.488  1.00 141.36 ? 64  LEU A CG  1 
ATOM   200  C  CD1 . LEU A 1 64  ? 32.403  53.505 11.629  1.00 145.04 ? 64  LEU A CD1 1 
ATOM   201  C  CD2 . LEU A 1 64  ? 30.168  53.631 10.530  1.00 139.59 ? 64  LEU A CD2 1 
ATOM   202  N  N   . GLY A 1 65  ? 29.534  49.887 13.272  1.00 139.11 ? 65  GLY A N   1 
ATOM   203  C  CA  . GLY A 1 65  ? 28.574  49.883 14.371  1.00 137.98 ? 65  GLY A CA  1 
ATOM   204  C  C   . GLY A 1 65  ? 29.032  49.122 15.596  1.00 145.57 ? 65  GLY A C   1 
ATOM   205  O  O   . GLY A 1 65  ? 28.955  49.651 16.708  1.00 145.72 ? 65  GLY A O   1 
ATOM   206  N  N   . PHE A 1 66  ? 29.537  47.882 15.397  1.00 145.16 ? 66  PHE A N   1 
ATOM   207  C  CA  . PHE A 1 66  ? 30.044  47.019 16.473  1.00 149.24 ? 66  PHE A CA  1 
ATOM   208  C  C   . PHE A 1 66  ? 31.321  47.559 17.117  1.00 157.53 ? 66  PHE A C   1 
ATOM   209  O  O   . PHE A 1 66  ? 31.601  47.258 18.280  1.00 160.04 ? 66  PHE A O   1 
ATOM   210  C  CB  . PHE A 1 66  ? 30.247  45.574 15.992  1.00 152.72 ? 66  PHE A CB  1 
ATOM   211  C  CG  . PHE A 1 66  ? 28.986  44.747 15.905  1.00 152.04 ? 66  PHE A CG  1 
ATOM   212  C  CD1 . PHE A 1 66  ? 28.084  44.707 16.964  1.00 154.62 ? 66  PHE A CD1 1 
ATOM   213  C  CD2 . PHE A 1 66  ? 28.727  43.963 14.789  1.00 153.19 ? 66  PHE A CD2 1 
ATOM   214  C  CE1 . PHE A 1 66  ? 26.923  43.937 16.886  1.00 153.95 ? 66  PHE A CE1 1 
ATOM   215  C  CE2 . PHE A 1 66  ? 27.569  43.184 14.715  1.00 154.48 ? 66  PHE A CE2 1 
ATOM   216  C  CZ  . PHE A 1 66  ? 26.676  43.175 15.766  1.00 152.10 ? 66  PHE A CZ  1 
ATOM   217  N  N   . LEU A 1 67  ? 32.084  48.360 16.355  1.00 154.63 ? 67  LEU A N   1 
ATOM   218  C  CA  . LEU A 1 67  ? 33.306  49.020 16.795  1.00 158.11 ? 67  LEU A CA  1 
ATOM   219  C  C   . LEU A 1 67  ? 32.929  50.173 17.748  1.00 161.69 ? 67  LEU A C   1 
ATOM   220  O  O   . LEU A 1 67  ? 33.545  50.310 18.807  1.00 165.01 ? 67  LEU A O   1 
ATOM   221  C  CB  . LEU A 1 67  ? 34.063  49.556 15.561  1.00 158.02 ? 67  LEU A CB  1 
ATOM   222  C  CG  . LEU A 1 67  ? 35.516  49.981 15.759  1.00 167.04 ? 67  LEU A CG  1 
ATOM   223  C  CD1 . LEU A 1 67  ? 36.469  48.819 15.504  1.00 171.25 ? 67  LEU A CD1 1 
ATOM   224  C  CD2 . LEU A 1 67  ? 35.863  51.144 14.848  1.00 167.78 ? 67  LEU A CD2 1 
ATOM   225  N  N   . LEU A 1 68  ? 31.893  50.966 17.382  1.00 153.76 ? 68  LEU A N   1 
ATOM   226  C  CA  . LEU A 1 68  ? 31.405  52.118 18.141  1.00 152.55 ? 68  LEU A CA  1 
ATOM   227  C  C   . LEU A 1 68  ? 30.365  51.802 19.230  1.00 156.86 ? 68  LEU A C   1 
ATOM   228  O  O   . LEU A 1 68  ? 30.080  52.678 20.052  1.00 156.38 ? 68  LEU A O   1 
ATOM   229  C  CB  . LEU A 1 68  ? 30.853  53.177 17.179  1.00 148.56 ? 68  LEU A CB  1 
ATOM   230  C  CG  . LEU A 1 68  ? 31.838  54.253 16.757  1.00 154.64 ? 68  LEU A CG  1 
ATOM   231  C  CD1 . LEU A 1 68  ? 32.485  53.911 15.429  1.00 154.93 ? 68  LEU A CD1 1 
ATOM   232  C  CD2 . LEU A 1 68  ? 31.156  55.600 16.664  1.00 154.14 ? 68  LEU A CD2 1 
ATOM   233  N  N   . ARG A 1 69  ? 29.813  50.568 19.250  1.00 154.28 ? 69  ARG A N   1 
ATOM   234  C  CA  . ARG A 1 69  ? 28.784  50.129 20.207  1.00 154.29 ? 69  ARG A CA  1 
ATOM   235  C  C   . ARG A 1 69  ? 29.166  50.229 21.715  1.00 163.95 ? 69  ARG A C   1 
ATOM   236  O  O   . ARG A 1 69  ? 28.295  50.668 22.471  1.00 162.55 ? 69  ARG A O   1 
ATOM   237  C  CB  . ARG A 1 69  ? 28.281  48.710 19.892  1.00 153.90 ? 69  ARG A CB  1 
ATOM   238  C  CG  . ARG A 1 69  ? 26.809  48.521 20.244  1.00 161.80 ? 69  ARG A CG  1 
ATOM   239  C  CD  . ARG A 1 69  ? 26.445  47.079 20.543  1.00 173.69 ? 69  ARG A CD  1 
ATOM   240  N  NE  . ARG A 1 69  ? 25.283  47.001 21.434  1.00 182.55 ? 69  ARG A NE  1 
ATOM   241  C  CZ  . ARG A 1 69  ? 24.025  46.844 21.031  1.00 193.94 ? 69  ARG A CZ  1 
ATOM   242  N  NH1 . ARG A 1 69  ? 23.744  46.721 19.739  1.00 179.72 ? 69  ARG A NH1 1 
ATOM   243  N  NH2 . ARG A 1 69  ? 23.039  46.796 21.917  1.00 179.14 ? 69  ARG A NH2 1 
ATOM   244  N  N   . PRO A 1 70  ? 30.387  49.839 22.200  1.00 166.61 ? 70  PRO A N   1 
ATOM   245  C  CA  . PRO A 1 70  ? 30.659  49.920 23.654  1.00 170.75 ? 70  PRO A CA  1 
ATOM   246  C  C   . PRO A 1 70  ? 30.703  51.323 24.272  1.00 176.82 ? 70  PRO A C   1 
ATOM   247  O  O   . PRO A 1 70  ? 30.449  51.471 25.469  1.00 178.53 ? 70  PRO A O   1 
ATOM   248  C  CB  . PRO A 1 70  ? 32.009  49.212 23.798  1.00 177.02 ? 70  PRO A CB  1 
ATOM   249  C  CG  . PRO A 1 70  ? 32.664  49.384 22.476  1.00 180.11 ? 70  PRO A CG  1 
ATOM   250  C  CD  . PRO A 1 70  ? 31.547  49.262 21.485  1.00 170.53 ? 70  PRO A CD  1 
ATOM   251  N  N   . TYR A 1 71  ? 31.025  52.339 23.453  1.00 172.96 ? 71  TYR A N   1 
ATOM   252  C  CA  . TYR A 1 71  ? 31.155  53.761 23.806  1.00 173.68 ? 71  TYR A CA  1 
ATOM   253  C  C   . TYR A 1 71  ? 29.834  54.386 24.343  1.00 175.85 ? 71  TYR A C   1 
ATOM   254  O  O   . TYR A 1 71  ? 28.778  53.790 24.112  1.00 172.63 ? 71  TYR A O   1 
ATOM   255  C  CB  . TYR A 1 71  ? 31.665  54.535 22.571  1.00 173.45 ? 71  TYR A CB  1 
ATOM   256  C  CG  . TYR A 1 71  ? 33.049  54.120 22.123  1.00 178.97 ? 71  TYR A CG  1 
ATOM   257  C  CD1 . TYR A 1 71  ? 33.231  53.046 21.256  1.00 180.49 ? 71  TYR A CD1 1 
ATOM   258  C  CD2 . TYR A 1 71  ? 34.178  54.807 22.556  1.00 184.01 ? 71  TYR A CD2 1 
ATOM   259  C  CE1 . TYR A 1 71  ? 34.505  52.648 20.854  1.00 185.11 ? 71  TYR A CE1 1 
ATOM   260  C  CE2 . TYR A 1 71  ? 35.457  54.425 22.154  1.00 188.61 ? 71  TYR A CE2 1 
ATOM   261  C  CZ  . TYR A 1 71  ? 35.616  53.344 21.300  1.00 196.79 ? 71  TYR A CZ  1 
ATOM   262  O  OH  . TYR A 1 71  ? 36.874  52.961 20.900  1.00 202.75 ? 71  TYR A OH  1 
ATOM   263  N  N   . PRO A 1 72  ? 29.852  55.567 25.042  1.00 174.03 ? 72  PRO A N   1 
ATOM   264  C  CA  . PRO A 1 72  ? 28.588  56.164 25.532  1.00 171.49 ? 72  PRO A CA  1 
ATOM   265  C  C   . PRO A 1 72  ? 27.511  56.324 24.454  1.00 168.90 ? 72  PRO A C   1 
ATOM   266  O  O   . PRO A 1 72  ? 27.611  57.169 23.557  1.00 166.10 ? 72  PRO A O   1 
ATOM   267  C  CB  . PRO A 1 72  ? 29.030  57.509 26.131  1.00 175.69 ? 72  PRO A CB  1 
ATOM   268  C  CG  . PRO A 1 72  ? 30.380  57.771 25.547  1.00 182.36 ? 72  PRO A CG  1 
ATOM   269  C  CD  . PRO A 1 72  ? 31.000  56.414 25.423  1.00 179.52 ? 72  PRO A CD  1 
ATOM   270  N  N   . LEU A 1 73  ? 26.479  55.468 24.556  1.00 162.92 ? 73  LEU A N   1 
ATOM   271  C  CA  . LEU A 1 73  ? 25.344  55.339 23.634  1.00 157.62 ? 73  LEU A CA  1 
ATOM   272  C  C   . LEU A 1 73  ? 24.270  56.454 23.789  1.00 157.80 ? 73  LEU A C   1 
ATOM   273  O  O   . LEU A 1 73  ? 23.079  56.166 23.620  1.00 154.93 ? 73  LEU A O   1 
ATOM   274  C  CB  . LEU A 1 73  ? 24.698  53.927 23.781  1.00 157.29 ? 73  LEU A CB  1 
ATOM   275  C  CG  . LEU A 1 73  ? 25.607  52.686 23.685  1.00 163.58 ? 73  LEU A CG  1 
ATOM   276  C  CD1 . LEU A 1 73  ? 25.971  52.159 25.071  1.00 168.23 ? 73  LEU A CD1 1 
ATOM   277  C  CD2 . LEU A 1 73  ? 24.928  51.581 22.922  1.00 162.69 ? 73  LEU A CD2 1 
ATOM   278  N  N   . SER A 1 74  ? 24.688  57.720 24.075  1.00 154.03 ? 74  SER A N   1 
ATOM   279  C  CA  . SER A 1 74  ? 23.783  58.869 24.261  1.00 151.57 ? 74  SER A CA  1 
ATOM   280  C  C   . SER A 1 74  ? 22.765  58.988 23.126  1.00 151.23 ? 74  SER A C   1 
ATOM   281  O  O   . SER A 1 74  ? 23.163  58.912 21.963  1.00 149.37 ? 74  SER A O   1 
ATOM   282  C  CB  . SER A 1 74  ? 24.564  60.168 24.424  1.00 155.57 ? 74  SER A CB  1 
ATOM   283  O  OG  . SER A 1 74  ? 23.738  61.316 24.300  1.00 158.81 ? 74  SER A OG  1 
ATOM   284  N  N   . PRO A 1 75  ? 21.452  59.125 23.439  1.00 146.11 ? 75  PRO A N   1 
ATOM   285  C  CA  . PRO A 1 75  ? 20.435  59.189 22.368  1.00 141.76 ? 75  PRO A CA  1 
ATOM   286  C  C   . PRO A 1 75  ? 20.632  60.317 21.349  1.00 143.05 ? 75  PRO A C   1 
ATOM   287  O  O   . PRO A 1 75  ? 20.409  60.096 20.156  1.00 139.44 ? 75  PRO A O   1 
ATOM   288  C  CB  . PRO A 1 75  ? 19.112  59.310 23.134  1.00 143.21 ? 75  PRO A CB  1 
ATOM   289  C  CG  . PRO A 1 75  ? 19.492  59.811 24.485  1.00 151.31 ? 75  PRO A CG  1 
ATOM   290  C  CD  . PRO A 1 75  ? 20.826  59.204 24.773  1.00 149.73 ? 75  PRO A CD  1 
ATOM   291  N  N   . ARG A 1 76  ? 21.088  61.503 21.816  1.00 141.08 ? 76  ARG A N   1 
ATOM   292  C  CA  . ARG A 1 76  ? 21.375  62.669 20.976  1.00 139.38 ? 76  ARG A CA  1 
ATOM   293  C  C   . ARG A 1 76  ? 22.597  62.383 20.099  1.00 142.90 ? 76  ARG A C   1 
ATOM   294  O  O   . ARG A 1 76  ? 22.617  62.783 18.936  1.00 140.40 ? 76  ARG A O   1 
ATOM   295  C  CB  . ARG A 1 76  ? 21.591  63.926 21.838  1.00 142.47 ? 76  ARG A CB  1 
ATOM   296  C  CG  . ARG A 1 76  ? 21.374  65.228 21.076  1.00 152.66 ? 76  ARG A CG  1 
ATOM   297  C  CD  . ARG A 1 76  ? 21.353  66.453 21.979  1.00 167.26 ? 76  ARG A CD  1 
ATOM   298  N  NE  . ARG A 1 76  ? 19.988  66.905 22.281  1.00 176.28 ? 76  ARG A NE  1 
ATOM   299  C  CZ  . ARG A 1 76  ? 19.293  67.772 21.546  1.00 186.54 ? 76  ARG A CZ  1 
ATOM   300  N  NH1 . ARG A 1 76  ? 18.065  68.123 21.909  1.00 169.50 ? 76  ARG A NH1 1 
ATOM   301  N  NH2 . ARG A 1 76  ? 19.817  68.291 20.442  1.00 172.55 ? 76  ARG A NH2 1 
ATOM   302  N  N   . GLU A 1 77  ? 23.593  61.658 20.654  1.00 141.69 ? 77  GLU A N   1 
ATOM   303  C  CA  . GLU A 1 77  ? 24.826  61.257 19.967  1.00 142.20 ? 77  GLU A CA  1 
ATOM   304  C  C   . GLU A 1 77  ? 24.564  60.195 18.895  1.00 141.75 ? 77  GLU A C   1 
ATOM   305  O  O   . GLU A 1 77  ? 25.211  60.229 17.848  1.00 140.52 ? 77  GLU A O   1 
ATOM   306  C  CB  . GLU A 1 77  ? 25.872  60.750 20.973  1.00 148.06 ? 77  GLU A CB  1 
ATOM   307  C  CG  . GLU A 1 77  ? 26.578  61.852 21.746  1.00 162.50 ? 77  GLU A CG  1 
ATOM   308  C  CD  . GLU A 1 77  ? 27.432  61.392 22.913  1.00 189.94 ? 77  GLU A CD  1 
ATOM   309  O  OE1 . GLU A 1 77  ? 28.166  60.387 22.768  1.00 188.96 ? 77  GLU A OE1 1 
ATOM   310  O  OE2 . GLU A 1 77  ? 27.377  62.052 23.975  1.00 187.37 ? 77  GLU A OE2 1 
ATOM   311  N  N   . VAL A 1 78  ? 23.632  59.250 19.164  1.00 136.18 ? 78  VAL A N   1 
ATOM   312  C  CA  . VAL A 1 78  ? 23.246  58.177 18.238  1.00 133.54 ? 78  VAL A CA  1 
ATOM   313  C  C   . VAL A 1 78  ? 22.571  58.808 17.008  1.00 134.11 ? 78  VAL A C   1 
ATOM   314  O  O   . VAL A 1 78  ? 22.880  58.426 15.875  1.00 132.49 ? 78  VAL A O   1 
ATOM   315  C  CB  . VAL A 1 78  ? 22.383  57.080 18.936  1.00 137.26 ? 78  VAL A CB  1 
ATOM   316  C  CG1 . VAL A 1 78  ? 21.746  56.125 17.931  1.00 134.55 ? 78  VAL A CG1 1 
ATOM   317  C  CG2 . VAL A 1 78  ? 23.213  56.290 19.939  1.00 140.94 ? 78  VAL A CG2 1 
ATOM   318  N  N   . LYS A 1 79  ? 21.707  59.821 17.244  1.00 129.34 ? 79  LYS A N   1 
ATOM   319  C  CA  . LYS A 1 79  ? 20.996  60.584 16.214  1.00 126.02 ? 79  LYS A CA  1 
ATOM   320  C  C   . LYS A 1 79  ? 21.983  61.321 15.287  1.00 129.92 ? 79  LYS A C   1 
ATOM   321  O  O   . LYS A 1 79  ? 21.771  61.371 14.070  1.00 127.22 ? 79  LYS A O   1 
ATOM   322  C  CB  . LYS A 1 79  ? 20.035  61.596 16.866  1.00 128.18 ? 79  LYS A CB  1 
ATOM   323  C  CG  . LYS A 1 79  ? 18.746  60.991 17.424  1.00 143.74 ? 79  LYS A CG  1 
ATOM   324  C  CD  . LYS A 1 79  ? 17.787  62.067 17.962  1.00 154.51 ? 79  LYS A CD  1 
ATOM   325  C  CE  . LYS A 1 79  ? 17.960  62.372 19.437  1.00 165.93 ? 79  LYS A CE  1 
ATOM   326  N  NZ  . LYS A 1 79  ? 17.134  63.533 19.865  1.00 171.86 ? 79  LYS A NZ  1 
ATOM   327  N  N   . TYR A 1 80  ? 23.062  61.883 15.878  1.00 129.24 ? 80  TYR A N   1 
ATOM   328  C  CA  . TYR A 1 80  ? 24.113  62.624 15.175  1.00 129.89 ? 80  TYR A CA  1 
ATOM   329  C  C   . TYR A 1 80  ? 24.961  61.687 14.325  1.00 133.43 ? 80  TYR A C   1 
ATOM   330  O  O   . TYR A 1 80  ? 25.317  62.029 13.196  1.00 131.90 ? 80  TYR A O   1 
ATOM   331  C  CB  . TYR A 1 80  ? 25.018  63.383 16.174  1.00 134.84 ? 80  TYR A CB  1 
ATOM   332  C  CG  . TYR A 1 80  ? 24.369  64.516 16.947  1.00 136.92 ? 80  TYR A CG  1 
ATOM   333  C  CD1 . TYR A 1 80  ? 23.134  65.037 16.564  1.00 135.93 ? 80  TYR A CD1 1 
ATOM   334  C  CD2 . TYR A 1 80  ? 25.005  65.091 18.041  1.00 141.37 ? 80  TYR A CD2 1 
ATOM   335  C  CE1 . TYR A 1 80  ? 22.534  66.074 17.274  1.00 137.40 ? 80  TYR A CE1 1 
ATOM   336  C  CE2 . TYR A 1 80  ? 24.421  66.139 18.750  1.00 142.98 ? 80  TYR A CE2 1 
ATOM   337  C  CZ  . TYR A 1 80  ? 23.190  66.636 18.355  1.00 148.20 ? 80  TYR A CZ  1 
ATOM   338  O  OH  . TYR A 1 80  ? 22.611  67.666 19.054  1.00 151.24 ? 80  TYR A OH  1 
ATOM   339  N  N   . PHE A 1 81  ? 25.293  60.511 14.885  1.00 131.41 ? 81  PHE A N   1 
ATOM   340  C  CA  . PHE A 1 81  ? 26.092  59.481 14.234  1.00 132.17 ? 81  PHE A CA  1 
ATOM   341  C  C   . PHE A 1 81  ? 25.357  58.904 13.031  1.00 131.21 ? 81  PHE A C   1 
ATOM   342  O  O   . PHE A 1 81  ? 25.962  58.733 11.975  1.00 130.72 ? 81  PHE A O   1 
ATOM   343  C  CB  . PHE A 1 81  ? 26.465  58.378 15.241  1.00 137.03 ? 81  PHE A CB  1 
ATOM   344  C  CG  . PHE A 1 81  ? 27.063  57.136 14.626  1.00 140.07 ? 81  PHE A CG  1 
ATOM   345  C  CD1 . PHE A 1 81  ? 28.407  57.093 14.275  1.00 146.53 ? 81  PHE A CD1 1 
ATOM   346  C  CD2 . PHE A 1 81  ? 26.284  56.009 14.400  1.00 141.09 ? 81  PHE A CD2 1 
ATOM   347  C  CE1 . PHE A 1 81  ? 28.957  55.948 13.693  1.00 148.86 ? 81  PHE A CE1 1 
ATOM   348  C  CE2 . PHE A 1 81  ? 26.834  54.866 13.818  1.00 145.36 ? 81  PHE A CE2 1 
ATOM   349  C  CZ  . PHE A 1 81  ? 28.167  54.841 13.471  1.00 146.38 ? 81  PHE A CZ  1 
ATOM   350  N  N   . ALA A 1 82  ? 24.059  58.606 13.194  1.00 124.21 ? 82  ALA A N   1 
ATOM   351  C  CA  . ALA A 1 82  ? 23.226  58.038 12.138  1.00 120.61 ? 82  ALA A CA  1 
ATOM   352  C  C   . ALA A 1 82  ? 22.766  59.061 11.095  1.00 120.53 ? 82  ALA A C   1 
ATOM   353  O  O   . ALA A 1 82  ? 22.253  58.644 10.058  1.00 118.26 ? 82  ALA A O   1 
ATOM   354  C  CB  . ALA A 1 82  ? 22.029  57.318 12.743  1.00 120.16 ? 82  ALA A CB  1 
ATOM   355  N  N   . PHE A 1 83  ? 22.985  60.383 11.338  1.00 116.25 ? 83  PHE A N   1 
ATOM   356  C  CA  . PHE A 1 83  ? 22.582  61.481 10.447  1.00 113.50 ? 83  PHE A CA  1 
ATOM   357  C  C   . PHE A 1 83  ? 22.891  61.265 8.940   1.00 115.66 ? 83  PHE A C   1 
ATOM   358  O  O   . PHE A 1 83  ? 21.978  61.520 8.158   1.00 112.54 ? 83  PHE A O   1 
ATOM   359  C  CB  . PHE A 1 83  ? 23.123  62.839 10.906  1.00 116.83 ? 83  PHE A CB  1 
ATOM   360  C  CG  . PHE A 1 83  ? 22.599  63.999 10.090  1.00 116.50 ? 83  PHE A CG  1 
ATOM   361  C  CD1 . PHE A 1 83  ? 21.292  64.447 10.245  1.00 117.57 ? 83  PHE A CD1 1 
ATOM   362  C  CD2 . PHE A 1 83  ? 23.406  64.631 9.152   1.00 119.34 ? 83  PHE A CD2 1 
ATOM   363  C  CE1 . PHE A 1 83  ? 20.804  65.510 9.479   1.00 116.94 ? 83  PHE A CE1 1 
ATOM   364  C  CE2 . PHE A 1 83  ? 22.919  65.702 8.396   1.00 120.64 ? 83  PHE A CE2 1 
ATOM   365  C  CZ  . PHE A 1 83  ? 21.620  66.130 8.558   1.00 116.46 ? 83  PHE A CZ  1 
ATOM   366  N  N   . PRO A 1 84  ? 24.078  60.797 8.464   1.00 114.10 ? 84  PRO A N   1 
ATOM   367  C  CA  . PRO A 1 84  ? 24.237  60.597 7.009   1.00 112.86 ? 84  PRO A CA  1 
ATOM   368  C  C   . PRO A 1 84  ? 23.256  59.581 6.417   1.00 114.30 ? 84  PRO A C   1 
ATOM   369  O  O   . PRO A 1 84  ? 23.039  59.568 5.207   1.00 112.48 ? 84  PRO A O   1 
ATOM   370  C  CB  . PRO A 1 84  ? 25.692  60.150 6.859   1.00 117.91 ? 84  PRO A CB  1 
ATOM   371  C  CG  . PRO A 1 84  ? 26.363  60.580 8.111   1.00 125.14 ? 84  PRO A CG  1 
ATOM   372  C  CD  . PRO A 1 84  ? 25.320  60.439 9.174   1.00 119.36 ? 84  PRO A CD  1 
ATOM   373  N  N   . GLY A 1 85  ? 22.662  58.763 7.285   1.00 110.75 ? 85  GLY A N   1 
ATOM   374  C  CA  . GLY A 1 85  ? 21.634  57.792 6.931   1.00 108.96 ? 85  GLY A CA  1 
ATOM   375  C  C   . GLY A 1 85  ? 20.263  58.441 6.937   1.00 110.42 ? 85  GLY A C   1 
ATOM   376  O  O   . GLY A 1 85  ? 19.377  58.042 6.175   1.00 108.42 ? 85  GLY A O   1 
ATOM   377  N  N   . GLU A 1 86  ? 20.092  59.461 7.805   1.00 106.80 ? 86  GLU A N   1 
ATOM   378  C  CA  . GLU A 1 86  ? 18.871  60.257 7.954   1.00 104.53 ? 86  GLU A CA  1 
ATOM   379  C  C   . GLU A 1 86  ? 18.715  61.155 6.728   1.00 106.45 ? 86  GLU A C   1 
ATOM   380  O  O   . GLU A 1 86  ? 17.588  61.370 6.284   1.00 104.04 ? 86  GLU A O   1 
ATOM   381  C  CB  . GLU A 1 86  ? 18.949  61.103 9.235   1.00 107.27 ? 86  GLU A CB  1 
ATOM   382  C  CG  . GLU A 1 86  ? 17.646  61.751 9.674   1.00 116.68 ? 86  GLU A CG  1 
ATOM   383  C  CD  . GLU A 1 86  ? 17.821  62.862 10.694  1.00 139.10 ? 86  GLU A CD  1 
ATOM   384  O  OE1 . GLU A 1 86  ? 17.292  63.968 10.444  1.00 119.88 ? 86  GLU A OE1 1 
ATOM   385  O  OE2 . GLU A 1 86  ? 18.488  62.638 11.733  1.00 139.50 ? 86  GLU A OE2 1 
ATOM   386  N  N   . LEU A 1 87  ? 19.840  61.662 6.173   1.00 103.82 ? 87  LEU A N   1 
ATOM   387  C  CA  . LEU A 1 87  ? 19.824  62.491 4.969   1.00 102.46 ? 87  LEU A CA  1 
ATOM   388  C  C   . LEU A 1 87  ? 19.379  61.704 3.745   1.00 104.37 ? 87  LEU A C   1 
ATOM   389  O  O   . LEU A 1 87  ? 18.706  62.271 2.887   1.00 102.46 ? 87  LEU A O   1 
ATOM   390  C  CB  . LEU A 1 87  ? 21.172  63.165 4.702   1.00 104.80 ? 87  LEU A CB  1 
ATOM   391  C  CG  . LEU A 1 87  ? 21.347  64.587 5.234   1.00 110.55 ? 87  LEU A CG  1 
ATOM   392  C  CD1 . LEU A 1 87  ? 22.676  65.152 4.795   1.00 113.43 ? 87  LEU A CD1 1 
ATOM   393  C  CD2 . LEU A 1 87  ? 20.245  65.515 4.749   1.00 110.83 ? 87  LEU A CD2 1 
ATOM   394  N  N   . LEU A 1 88  ? 19.735  60.403 3.666   1.00 101.26 ? 88  LEU A N   1 
ATOM   395  C  CA  . LEU A 1 88  ? 19.304  59.546 2.561   1.00 99.98  ? 88  LEU A CA  1 
ATOM   396  C  C   . LEU A 1 88  ? 17.801  59.303 2.678   1.00 101.44 ? 88  LEU A C   1 
ATOM   397  O  O   . LEU A 1 88  ? 17.090  59.378 1.677   1.00 100.03 ? 88  LEU A O   1 
ATOM   398  C  CB  . LEU A 1 88  ? 20.078  58.212 2.527   1.00 101.90 ? 88  LEU A CB  1 
ATOM   399  C  CG  . LEU A 1 88  ? 19.694  57.222 1.410   1.00 105.92 ? 88  LEU A CG  1 
ATOM   400  C  CD1 . LEU A 1 88  ? 20.095  57.734 0.030   1.00 106.01 ? 88  LEU A CD1 1 
ATOM   401  C  CD2 . LEU A 1 88  ? 20.290  55.865 1.662   1.00 110.19 ? 88  LEU A CD2 1 
ATOM   402  N  N   . MET A 1 89  ? 17.323  59.057 3.907   1.00 97.52  ? 89  MET A N   1 
ATOM   403  C  CA  . MET A 1 89  ? 15.914  58.832 4.218   1.00 95.73  ? 89  MET A CA  1 
ATOM   404  C  C   . MET A 1 89  ? 15.034  60.001 3.770   1.00 96.32  ? 89  MET A C   1 
ATOM   405  O  O   . MET A 1 89  ? 13.991  59.757 3.171   1.00 94.09  ? 89  MET A O   1 
ATOM   406  C  CB  . MET A 1 89  ? 15.736  58.551 5.715   1.00 99.30  ? 89  MET A CB  1 
ATOM   407  C  CG  . MET A 1 89  ? 16.067  57.133 6.101   1.00 104.80 ? 89  MET A CG  1 
ATOM   408  S  SD  . MET A 1 89  ? 14.713  56.004 5.707   1.00 108.28 ? 89  MET A SD  1 
ATOM   409  C  CE  . MET A 1 89  ? 14.526  55.182 7.291   1.00 106.76 ? 89  MET A CE  1 
ATOM   410  N  N   . ARG A 1 90  ? 15.476  61.261 4.025   1.00 92.55  ? 90  ARG A N   1 
ATOM   411  C  CA  . ARG A 1 90  ? 14.772  62.491 3.634   1.00 90.77  ? 90  ARG A CA  1 
ATOM   412  C  C   . ARG A 1 90  ? 14.685  62.584 2.096   1.00 94.33  ? 90  ARG A C   1 
ATOM   413  O  O   . ARG A 1 90  ? 13.619  62.901 1.566   1.00 93.58  ? 90  ARG A O   1 
ATOM   414  C  CB  . ARG A 1 90  ? 15.475  63.754 4.185   1.00 90.43  ? 90  ARG A CB  1 
ATOM   415  C  CG  . ARG A 1 90  ? 15.639  63.849 5.696   1.00 97.18  ? 90  ARG A CG  1 
ATOM   416  C  CD  . ARG A 1 90  ? 14.552  64.655 6.372   1.00 106.48 ? 90  ARG A CD  1 
ATOM   417  N  NE  . ARG A 1 90  ? 14.757  66.104 6.293   1.00 115.88 ? 90  ARG A NE  1 
ATOM   418  C  CZ  . ARG A 1 90  ? 13.865  67.003 6.706   1.00 136.40 ? 90  ARG A CZ  1 
ATOM   419  N  NH1 . ARG A 1 90  ? 12.701  66.612 7.213   1.00 128.20 ? 90  ARG A NH1 1 
ATOM   420  N  NH2 . ARG A 1 90  ? 14.125  68.298 6.606   1.00 125.76 ? 90  ARG A NH2 1 
ATOM   421  N  N   . MET A 1 91  ? 15.802  62.298 1.388   1.00 90.75  ? 91  MET A N   1 
ATOM   422  C  CA  . MET A 1 91  ? 15.895  62.331 -0.077  1.00 89.63  ? 91  MET A CA  1 
ATOM   423  C  C   . MET A 1 91  ? 14.916  61.359 -0.713  1.00 92.82  ? 91  MET A C   1 
ATOM   424  O  O   . MET A 1 91  ? 14.257  61.712 -1.688  1.00 91.39  ? 91  MET A O   1 
ATOM   425  C  CB  . MET A 1 91  ? 17.313  61.967 -0.534  1.00 93.49  ? 91  MET A CB  1 
ATOM   426  C  CG  . MET A 1 91  ? 18.312  63.069 -0.378  1.00 97.98  ? 91  MET A CG  1 
ATOM   427  S  SD  . MET A 1 91  ? 19.977  62.384 -0.298  1.00 104.76 ? 91  MET A SD  1 
ATOM   428  C  CE  . MET A 1 91  ? 20.377  62.283 -2.022  1.00 101.89 ? 91  MET A CE  1 
ATOM   429  N  N   . LEU A 1 92  ? 14.842  60.130 -0.165  1.00 90.42  ? 92  LEU A N   1 
ATOM   430  C  CA  . LEU A 1 92  ? 13.976  59.056 -0.640  1.00 90.14  ? 92  LEU A CA  1 
ATOM   431  C  C   . LEU A 1 92  ? 12.517  59.327 -0.333  1.00 94.18  ? 92  LEU A C   1 
ATOM   432  O  O   . LEU A 1 92  ? 11.683  59.103 -1.206  1.00 93.54  ? 92  LEU A O   1 
ATOM   433  C  CB  . LEU A 1 92  ? 14.402  57.694 -0.071  1.00 91.61  ? 92  LEU A CB  1 
ATOM   434  C  CG  . LEU A 1 92  ? 15.582  57.004 -0.755  1.00 98.26  ? 92  LEU A CG  1 
ATOM   435  C  CD1 . LEU A 1 92  ? 16.236  56.000 0.173   1.00 100.13 ? 92  LEU A CD1 1 
ATOM   436  C  CD2 . LEU A 1 92  ? 15.148  56.304 -2.022  1.00 101.32 ? 92  LEU A CD2 1 
ATOM   437  N  N   . LYS A 1 93  ? 12.205  59.811 0.893   1.00 91.57  ? 93  LYS A N   1 
ATOM   438  C  CA  . LYS A 1 93  ? 10.840  60.148 1.333   1.00 90.69  ? 93  LYS A CA  1 
ATOM   439  C  C   . LYS A 1 93  ? 10.251  61.230 0.416   1.00 94.54  ? 93  LYS A C   1 
ATOM   440  O  O   . LYS A 1 93  ? 9.091   61.136 0.014   1.00 93.01  ? 93  LYS A O   1 
ATOM   441  C  CB  . LYS A 1 93  ? 10.832  60.643 2.803   1.00 93.07  ? 93  LYS A CB  1 
ATOM   442  C  CG  . LYS A 1 93  ? 10.786  59.545 3.862   1.00 99.44  ? 93  LYS A CG  1 
ATOM   443  C  CD  . LYS A 1 93  ? 11.316  60.037 5.214   1.00 110.82 ? 93  LYS A CD  1 
ATOM   444  C  CE  . LYS A 1 93  ? 10.269  60.671 6.115   1.00 121.57 ? 93  LYS A CE  1 
ATOM   445  N  NZ  . LYS A 1 93  ? 10.858  61.249 7.363   1.00 125.52 ? 93  LYS A NZ  1 
ATOM   446  N  N   . MET A 1 94  ? 11.081  62.235 0.077   1.00 92.71  ? 94  MET A N   1 
ATOM   447  C  CA  . MET A 1 94  ? 10.786  63.383 -0.775  1.00 92.86  ? 94  MET A CA  1 
ATOM   448  C  C   . MET A 1 94  ? 10.109  62.995 -2.096  1.00 96.01  ? 94  MET A C   1 
ATOM   449  O  O   . MET A 1 94  ? 9.057   63.546 -2.428  1.00 95.58  ? 94  MET A O   1 
ATOM   450  C  CB  . MET A 1 94  ? 12.099  64.126 -1.051  1.00 96.66  ? 94  MET A CB  1 
ATOM   451  C  CG  . MET A 1 94  ? 11.973  65.321 -1.954  1.00 100.83 ? 94  MET A CG  1 
ATOM   452  S  SD  . MET A 1 94  ? 13.543  66.203 -1.978  1.00 107.69 ? 94  MET A SD  1 
ATOM   453  C  CE  . MET A 1 94  ? 14.523  65.124 -3.084  1.00 105.69 ? 94  MET A CE  1 
ATOM   454  N  N   . LEU A 1 95  ? 10.716  62.045 -2.825  1.00 91.52  ? 95  LEU A N   1 
ATOM   455  C  CA  . LEU A 1 95  ? 10.274  61.566 -4.125  1.00 90.45  ? 95  LEU A CA  1 
ATOM   456  C  C   . LEU A 1 95  ? 9.094   60.584 -4.119  1.00 92.87  ? 95  LEU A C   1 
ATOM   457  O  O   . LEU A 1 95  ? 8.545   60.345 -5.190  1.00 92.33  ? 95  LEU A O   1 
ATOM   458  C  CB  . LEU A 1 95  ? 11.464  60.939 -4.868  1.00 91.83  ? 95  LEU A CB  1 
ATOM   459  C  CG  . LEU A 1 95  ? 12.585  61.877 -5.308  1.00 97.57  ? 95  LEU A CG  1 
ATOM   460  C  CD1 . LEU A 1 95  ? 13.835  61.097 -5.627  1.00 99.54  ? 95  LEU A CD1 1 
ATOM   461  C  CD2 . LEU A 1 95  ? 12.182  62.698 -6.522  1.00 99.85  ? 95  LEU A CD2 1 
ATOM   462  N  N   . ILE A 1 96  ? 8.684   60.025 -2.959  1.00 89.13  ? 96  ILE A N   1 
ATOM   463  C  CA  . ILE A 1 96  ? 7.587   59.044 -2.947  1.00 88.89  ? 96  ILE A CA  1 
ATOM   464  C  C   . ILE A 1 96  ? 6.257   59.680 -3.407  1.00 91.84  ? 96  ILE A C   1 
ATOM   465  O  O   . ILE A 1 96  ? 5.613   59.113 -4.289  1.00 92.50  ? 96  ILE A O   1 
ATOM   466  C  CB  . ILE A 1 96  ? 7.434   58.197 -1.643  1.00 92.60  ? 96  ILE A CB  1 
ATOM   467  C  CG1 . ILE A 1 96  ? 6.676   58.924 -0.522  1.00 92.89  ? 96  ILE A CG1 1 
ATOM   468  C  CG2 . ILE A 1 96  ? 8.780   57.676 -1.145  1.00 94.37  ? 96  ILE A CG2 1 
ATOM   469  C  CD1 . ILE A 1 96  ? 5.903   57.988 0.410   1.00 104.75 ? 96  ILE A CD1 1 
ATOM   470  N  N   . LEU A 1 97  ? 5.887   60.863 -2.875  1.00 86.66  ? 97  LEU A N   1 
ATOM   471  C  CA  . LEU A 1 97  ? 4.651   61.561 -3.246  1.00 85.47  ? 97  LEU A CA  1 
ATOM   472  C  C   . LEU A 1 97  ? 4.571   61.887 -4.753  1.00 88.30  ? 97  LEU A C   1 
ATOM   473  O  O   . LEU A 1 97  ? 3.575   61.477 -5.355  1.00 87.90  ? 97  LEU A O   1 
ATOM   474  C  CB  . LEU A 1 97  ? 4.412   62.809 -2.370  1.00 85.10  ? 97  LEU A CB  1 
ATOM   475  C  CG  . LEU A 1 97  ? 3.386   63.845 -2.855  1.00 89.25  ? 97  LEU A CG  1 
ATOM   476  C  CD1 . LEU A 1 97  ? 1.965   63.329 -2.748  1.00 89.52  ? 97  LEU A CD1 1 
ATOM   477  C  CD2 . LEU A 1 97  ? 3.516   65.108 -2.069  1.00 91.80  ? 97  LEU A CD2 1 
ATOM   478  N  N   . PRO A 1 98  ? 5.568   62.558 -5.408  1.00 84.36  ? 98  PRO A N   1 
ATOM   479  C  CA  . PRO A 1 98  ? 5.431   62.814 -6.849  1.00 84.08  ? 98  PRO A CA  1 
ATOM   480  C  C   . PRO A 1 98  ? 5.548   61.543 -7.681  1.00 89.18  ? 98  PRO A C   1 
ATOM   481  O  O   . PRO A 1 98  ? 5.236   61.583 -8.861  1.00 89.22  ? 98  PRO A O   1 
ATOM   482  C  CB  . PRO A 1 98  ? 6.556   63.808 -7.140  1.00 85.77  ? 98  PRO A CB  1 
ATOM   483  C  CG  . PRO A 1 98  ? 7.588   63.501 -6.143  1.00 90.48  ? 98  PRO A CG  1 
ATOM   484  C  CD  . PRO A 1 98  ? 6.832   63.135 -4.898  1.00 85.89  ? 98  PRO A CD  1 
ATOM   485  N  N   . LEU A 1 99  ? 5.974   60.422 -7.065  1.00 86.86  ? 99  LEU A N   1 
ATOM   486  C  CA  . LEU A 1 99  ? 6.083   59.138 -7.748  1.00 88.00  ? 99  LEU A CA  1 
ATOM   487  C  C   . LEU A 1 99  ? 4.746   58.414 -7.737  1.00 92.31  ? 99  LEU A C   1 
ATOM   488  O  O   . LEU A 1 99  ? 4.146   58.275 -8.798  1.00 92.55  ? 99  LEU A O   1 
ATOM   489  C  CB  . LEU A 1 99  ? 7.201   58.263 -7.168  1.00 88.78  ? 99  LEU A CB  1 
ATOM   490  C  CG  . LEU A 1 99  ? 8.112   57.627 -8.210  1.00 94.85  ? 99  LEU A CG  1 
ATOM   491  C  CD1 . LEU A 1 99  ? 9.192   58.606 -8.688  1.00 94.70  ? 99  LEU A CD1 1 
ATOM   492  C  CD2 . LEU A 1 99  ? 8.742   56.389 -7.662  1.00 98.79  ? 99  LEU A CD2 1 
ATOM   493  N  N   . ILE A 1 100 ? 4.254   58.009 -6.540  1.00 88.48  ? 100 ILE A N   1 
ATOM   494  C  CA  . ILE A 1 100 ? 2.969   57.319 -6.321  1.00 88.59  ? 100 ILE A CA  1 
ATOM   495  C  C   . ILE A 1 100 ? 1.813   57.952 -7.143  1.00 92.34  ? 100 ILE A C   1 
ATOM   496  O  O   . ILE A 1 100 ? 1.133   57.242 -7.898  1.00 93.06  ? 100 ILE A O   1 
ATOM   497  C  CB  . ILE A 1 100 ? 2.664   57.241 -4.791  1.00 91.13  ? 100 ILE A CB  1 
ATOM   498  C  CG1 . ILE A 1 100 ? 3.570   56.205 -4.100  1.00 92.19  ? 100 ILE A CG1 1 
ATOM   499  C  CG2 . ILE A 1 100 ? 1.189   56.950 -4.503  1.00 92.35  ? 100 ILE A CG2 1 
ATOM   500  C  CD1 . ILE A 1 100 ? 4.026   56.592 -2.672  1.00 99.45  ? 100 ILE A CD1 1 
ATOM   501  N  N   . VAL A 1 101 ? 1.645   59.294 -7.014  1.00 86.85  ? 101 VAL A N   1 
ATOM   502  C  CA  . VAL A 1 101 ? 0.621   60.113 -7.671  1.00 85.69  ? 101 VAL A CA  1 
ATOM   503  C  C   . VAL A 1 101 ? 0.767   60.088 -9.213  1.00 89.96  ? 101 VAL A C   1 
ATOM   504  O  O   . VAL A 1 101 ? -0.179  59.687 -9.894  1.00 90.84  ? 101 VAL A O   1 
ATOM   505  C  CB  . VAL A 1 101 ? 0.585   61.548 -7.069  1.00 87.56  ? 101 VAL A CB  1 
ATOM   506  C  CG1 . VAL A 1 101 ? -0.243  62.505 -7.913  1.00 87.33  ? 101 VAL A CG1 1 
ATOM   507  C  CG2 . VAL A 1 101 ? 0.056   61.520 -5.646  1.00 87.13  ? 101 VAL A CG2 1 
ATOM   508  N  N   . SER A 1 102 ? 1.939   60.476 -9.750  1.00 85.36  ? 102 SER A N   1 
ATOM   509  C  CA  . SER A 1 102 ? 2.177   60.512 -11.193 1.00 85.84  ? 102 SER A CA  1 
ATOM   510  C  C   . SER A 1 102 ? 2.212   59.134 -11.861 1.00 90.42  ? 102 SER A C   1 
ATOM   511  O  O   . SER A 1 102 ? 1.876   59.030 -13.041 1.00 90.87  ? 102 SER A O   1 
ATOM   512  C  CB  . SER A 1 102 ? 3.457   61.272 -11.504 1.00 89.92  ? 102 SER A CB  1 
ATOM   513  O  OG  . SER A 1 102 ? 4.596   60.481 -11.206 1.00 101.33 ? 102 SER A OG  1 
ATOM   514  N  N   . SER A 1 103 ? 2.643   58.093 -11.126 1.00 87.14  ? 103 SER A N   1 
ATOM   515  C  CA  . SER A 1 103 ? 2.736   56.726 -11.642 1.00 88.50  ? 103 SER A CA  1 
ATOM   516  C  C   . SER A 1 103 ? 1.363   56.125 -11.892 1.00 93.18  ? 103 SER A C   1 
ATOM   517  O  O   . SER A 1 103 ? 1.122   55.625 -12.984 1.00 94.39  ? 103 SER A O   1 
ATOM   518  C  CB  . SER A 1 103 ? 3.531   55.828 -10.695 1.00 92.31  ? 103 SER A CB  1 
ATOM   519  O  OG  . SER A 1 103 ? 4.862   56.281 -10.514 1.00 100.50 ? 103 SER A OG  1 
ATOM   520  N  N   . LEU A 1 104 ? 0.460   56.179 -10.898 1.00 89.07  ? 104 LEU A N   1 
ATOM   521  C  CA  . LEU A 1 104 ? -0.873  55.592 -11.031 1.00 89.93  ? 104 LEU A CA  1 
ATOM   522  C  C   . LEU A 1 104 ? -1.805  56.373 -11.962 1.00 93.76  ? 104 LEU A C   1 
ATOM   523  O  O   . LEU A 1 104 ? -2.585  55.744 -12.680 1.00 95.21  ? 104 LEU A O   1 
ATOM   524  C  CB  . LEU A 1 104 ? -1.526  55.349 -9.666  1.00 89.52  ? 104 LEU A CB  1 
ATOM   525  C  CG  . LEU A 1 104 ? -0.906  54.236 -8.828  1.00 94.45  ? 104 LEU A CG  1 
ATOM   526  C  CD1 . LEU A 1 104 ? -1.127  54.483 -7.363  1.00 94.09  ? 104 LEU A CD1 1 
ATOM   527  C  CD2 . LEU A 1 104 ? -1.424  52.867 -9.235  1.00 98.12  ? 104 LEU A CD2 1 
ATOM   528  N  N   . ILE A 1 105 ? -1.716  57.722 -11.975 1.00 88.31  ? 105 ILE A N   1 
ATOM   529  C  CA  . ILE A 1 105 ? -2.547  58.551 -12.854 1.00 88.41  ? 105 ILE A CA  1 
ATOM   530  C  C   . ILE A 1 105 ? -2.244  58.221 -14.332 1.00 96.63  ? 105 ILE A C   1 
ATOM   531  O  O   . ILE A 1 105 ? -3.187  57.987 -15.091 1.00 98.32  ? 105 ILE A O   1 
ATOM   532  C  CB  . ILE A 1 105 ? -2.470  60.061 -12.505 1.00 89.04  ? 105 ILE A CB  1 
ATOM   533  C  CG1 . ILE A 1 105 ? -3.189  60.343 -11.171 1.00 87.98  ? 105 ILE A CG1 1 
ATOM   534  C  CG2 . ILE A 1 105 ? -3.046  60.934 -13.627 1.00 89.92  ? 105 ILE A CG2 1 
ATOM   535  C  CD1 . ILE A 1 105 ? -2.832  61.665 -10.517 1.00 89.55  ? 105 ILE A CD1 1 
ATOM   536  N  N   . THR A 1 106 ? -0.949  58.125 -14.720 1.00 94.37  ? 106 THR A N   1 
ATOM   537  C  CA  . THR A 1 106 ? -0.587  57.752 -16.096 1.00 96.47  ? 106 THR A CA  1 
ATOM   538  C  C   . THR A 1 106 ? -0.748  56.258 -16.335 1.00 104.57 ? 106 THR A C   1 
ATOM   539  O  O   . THR A 1 106 ? -1.179  55.869 -17.418 1.00 106.74 ? 106 THR A O   1 
ATOM   540  C  CB  . THR A 1 106 ? 0.814   58.221 -16.507 1.00 101.58 ? 106 THR A CB  1 
ATOM   541  O  OG1 . THR A 1 106 ? 1.791   57.687 -15.624 1.00 100.18 ? 106 THR A OG1 1 
ATOM   542  C  CG2 . THR A 1 106 ? 0.927   59.704 -16.577 1.00 98.19  ? 106 THR A CG2 1 
ATOM   543  N  N   . GLY A 1 107 ? -0.405  55.447 -15.329 1.00 101.88 ? 107 GLY A N   1 
ATOM   544  C  CA  . GLY A 1 107 ? -0.483  53.989 -15.375 1.00 104.19 ? 107 GLY A CA  1 
ATOM   545  C  C   . GLY A 1 107 ? -1.844  53.439 -15.754 1.00 111.25 ? 107 GLY A C   1 
ATOM   546  O  O   . GLY A 1 107 ? -1.931  52.528 -16.587 1.00 113.39 ? 107 GLY A O   1 
ATOM   547  N  N   . LEU A 1 108 ? -2.917  54.016 -15.170 1.00 107.37 ? 108 LEU A N   1 
ATOM   548  C  CA  . LEU A 1 108 ? -4.297  53.593 -15.417 1.00 109.09 ? 108 LEU A CA  1 
ATOM   549  C  C   . LEU A 1 108 ? -4.970  54.302 -16.606 1.00 114.75 ? 108 LEU A C   1 
ATOM   550  O  O   . LEU A 1 108 ? -5.901  53.737 -17.190 1.00 117.12 ? 108 LEU A O   1 
ATOM   551  C  CB  . LEU A 1 108 ? -5.135  53.708 -14.142 1.00 108.15 ? 108 LEU A CB  1 
ATOM   552  C  CG  . LEU A 1 108 ? -4.934  52.533 -13.192 1.00 113.45 ? 108 LEU A CG  1 
ATOM   553  C  CD1 . LEU A 1 108 ? -4.044  52.900 -12.030 1.00 111.26 ? 108 LEU A CD1 1 
ATOM   554  C  CD2 . LEU A 1 108 ? -6.244  52.008 -12.702 1.00 118.11 ? 108 LEU A CD2 1 
ATOM   555  N  N   . ALA A 1 109 ? -4.481  55.501 -16.991 1.00 109.69 ? 109 ALA A N   1 
ATOM   556  C  CA  . ALA A 1 109 ? -5.009  56.257 -18.130 1.00 110.51 ? 109 ALA A CA  1 
ATOM   557  C  C   . ALA A 1 109 ? -4.373  55.830 -19.467 1.00 117.47 ? 109 ALA A C   1 
ATOM   558  O  O   . ALA A 1 109 ? -5.020  55.953 -20.508 1.00 119.17 ? 109 ALA A O   1 
ATOM   559  C  CB  . ALA A 1 109 ? -4.820  57.744 -17.909 1.00 108.95 ? 109 ALA A CB  1 
ATOM   560  N  N   . SER A 1 110 ? -3.124  55.315 -19.436 1.00 114.50 ? 110 SER A N   1 
ATOM   561  C  CA  . SER A 1 110 ? -2.388  54.860 -20.623 1.00 116.89 ? 110 SER A CA  1 
ATOM   562  C  C   . SER A 1 110 ? -2.753  53.424 -21.055 1.00 125.77 ? 110 SER A C   1 
ATOM   563  O  O   . SER A 1 110 ? -2.175  52.894 -22.009 1.00 127.58 ? 110 SER A O   1 
ATOM   564  C  CB  . SER A 1 110 ? -0.885  54.977 -20.391 1.00 119.11 ? 110 SER A CB  1 
ATOM   565  O  OG  . SER A 1 110 ? -0.512  56.314 -20.099 1.00 125.74 ? 110 SER A OG  1 
ATOM   566  N  N   . LEU A 1 111 ? -3.714  52.807 -20.359 1.00 124.11 ? 111 LEU A N   1 
ATOM   567  C  CA  . LEU A 1 111 ? -4.178  51.444 -20.607 1.00 127.37 ? 111 LEU A CA  1 
ATOM   568  C  C   . LEU A 1 111 ? -5.656  51.458 -21.003 1.00 134.60 ? 111 LEU A C   1 
ATOM   569  O  O   . LEU A 1 111 ? -6.383  52.376 -20.614 1.00 132.41 ? 111 LEU A O   1 
ATOM   570  C  CB  . LEU A 1 111 ? -3.984  50.619 -19.319 1.00 126.57 ? 111 LEU A CB  1 
ATOM   571  C  CG  . LEU A 1 111 ? -2.723  49.750 -19.155 1.00 131.30 ? 111 LEU A CG  1 
ATOM   572  C  CD1 . LEU A 1 111 ? -1.427  50.555 -19.296 1.00 129.44 ? 111 LEU A CD1 1 
ATOM   573  C  CD2 . LEU A 1 111 ? -2.727  49.083 -17.799 1.00 132.64 ? 111 LEU A CD2 1 
ATOM   574  N  N   . ASP A 1 112 ? -6.103  50.434 -21.762 1.00 136.54 ? 112 ASP A N   1 
ATOM   575  C  CA  . ASP A 1 112 ? -7.500  50.296 -22.212 1.00 139.85 ? 112 ASP A CA  1 
ATOM   576  C  C   . ASP A 1 112 ? -8.434  50.033 -21.020 1.00 144.32 ? 112 ASP A C   1 
ATOM   577  O  O   . ASP A 1 112 ? -7.974  49.556 -19.983 1.00 142.44 ? 112 ASP A O   1 
ATOM   578  C  CB  . ASP A 1 112 ? -7.658  49.181 -23.277 1.00 146.15 ? 112 ASP A CB  1 
ATOM   579  C  CG  . ASP A 1 112 ? -6.539  49.056 -24.300 1.00 159.13 ? 112 ASP A CG  1 
ATOM   580  O  OD1 . ASP A 1 112 ? -6.183  50.083 -24.923 1.00 159.20 ? 112 ASP A OD1 1 
ATOM   581  O  OD2 . ASP A 1 112 ? -6.059  47.921 -24.518 1.00 167.32 ? 112 ASP A OD2 1 
ATOM   582  N  N   . ALA A 1 113 ? -9.739  50.349 -21.176 1.00 143.08 ? 113 ALA A N   1 
ATOM   583  C  CA  . ALA A 1 113 ? -10.781 50.192 -20.152 1.00 143.34 ? 113 ALA A CA  1 
ATOM   584  C  C   . ALA A 1 113 ? -10.724 48.850 -19.407 1.00 148.06 ? 113 ALA A C   1 
ATOM   585  O  O   . ALA A 1 113 ? -10.402 48.837 -18.217 1.00 145.19 ? 113 ALA A O   1 
ATOM   586  C  CB  . ALA A 1 113 ? -12.160 50.414 -20.763 1.00 147.08 ? 113 ALA A CB  1 
ATOM   587  N  N   . LYS A 1 114 ? -10.984 47.730 -20.109 1.00 148.43 ? 114 LYS A N   1 
ATOM   588  C  CA  . LYS A 1 114 ? -10.940 46.397 -19.511 1.00 150.09 ? 114 LYS A CA  1 
ATOM   589  C  C   . LYS A 1 114 ? -9.498  45.910 -19.309 1.00 152.41 ? 114 LYS A C   1 
ATOM   590  O  O   . LYS A 1 114 ? -9.260  45.131 -18.384 1.00 152.11 ? 114 LYS A O   1 
ATOM   591  C  CB  . LYS A 1 114 ? -11.799 45.386 -20.306 1.00 157.47 ? 114 LYS A CB  1 
ATOM   592  C  CG  . LYS A 1 114 ? -12.082 44.049 -19.590 1.00 169.84 ? 114 LYS A CG  1 
ATOM   593  C  CD  . LYS A 1 114 ? -13.019 44.167 -18.380 1.00 173.66 ? 114 LYS A CD  1 
ATOM   594  C  CE  . LYS A 1 114 ? -13.057 42.891 -17.579 1.00 178.72 ? 114 LYS A CE  1 
ATOM   595  N  NZ  . LYS A 1 114 ? -13.916 43.026 -16.377 1.00 184.35 ? 114 LYS A NZ  1 
ATOM   596  N  N   . ALA A 1 115 ? -8.537  46.390 -20.142 1.00 147.40 ? 115 ALA A N   1 
ATOM   597  C  CA  . ALA A 1 115 ? -7.119  46.028 -20.016 1.00 145.66 ? 115 ALA A CA  1 
ATOM   598  C  C   . ALA A 1 115 ? -6.561  46.498 -18.671 1.00 145.72 ? 115 ALA A C   1 
ATOM   599  O  O   . ALA A 1 115 ? -5.750  45.788 -18.077 1.00 145.30 ? 115 ALA A O   1 
ATOM   600  C  CB  . ALA A 1 115 ? -6.310  46.613 -21.158 1.00 145.95 ? 115 ALA A CB  1 
ATOM   601  N  N   . SER A 1 116 ? -7.046  47.665 -18.169 1.00 139.19 ? 116 SER A N   1 
ATOM   602  C  CA  . SER A 1 116 ? -6.691  48.245 -16.869 1.00 135.28 ? 116 SER A CA  1 
ATOM   603  C  C   . SER A 1 116 ? -7.212  47.329 -15.760 1.00 139.83 ? 116 SER A C   1 
ATOM   604  O  O   . SER A 1 116 ? -6.526  47.129 -14.760 1.00 137.98 ? 116 SER A O   1 
ATOM   605  C  CB  . SER A 1 116 ? -7.302  49.636 -16.712 1.00 136.31 ? 116 SER A CB  1 
ATOM   606  O  OG  . SER A 1 116 ? -6.857  50.547 -17.704 1.00 142.65 ? 116 SER A OG  1 
ATOM   607  N  N   . GLY A 1 117 ? -8.406  46.771 -15.967 1.00 139.13 ? 117 GLY A N   1 
ATOM   608  C  CA  . GLY A 1 117 ? -9.049  45.841 -15.046 1.00 140.71 ? 117 GLY A CA  1 
ATOM   609  C  C   . GLY A 1 117 ? -8.383  44.480 -15.028 1.00 146.44 ? 117 GLY A C   1 
ATOM   610  O  O   . GLY A 1 117 ? -8.311  43.844 -13.975 1.00 145.79 ? 117 GLY A O   1 
ATOM   611  N  N   . ARG A 1 118 ? -7.892  44.027 -16.202 1.00 145.26 ? 118 ARG A N   1 
ATOM   612  C  CA  . ARG A 1 118 ? -7.190  42.753 -16.382 1.00 147.52 ? 118 ARG A CA  1 
ATOM   613  C  C   . ARG A 1 118 ? -5.831  42.804 -15.690 1.00 149.17 ? 118 ARG A C   1 
ATOM   614  O  O   . ARG A 1 118 ? -5.512  41.901 -14.916 1.00 149.68 ? 118 ARG A O   1 
ATOM   615  C  CB  . ARG A 1 118 ? -7.036  42.409 -17.874 1.00 150.27 ? 118 ARG A CB  1 
ATOM   616  C  CG  . ARG A 1 118 ? -8.301  41.827 -18.496 1.00 164.32 ? 118 ARG A CG  1 
ATOM   617  C  CD  . ARG A 1 118 ? -8.107  41.485 -19.959 1.00 177.03 ? 118 ARG A CD  1 
ATOM   618  N  NE  . ARG A 1 118 ? -8.142  42.677 -20.806 1.00 185.50 ? 118 ARG A NE  1 
ATOM   619  C  CZ  . ARG A 1 118 ? -7.721  42.717 -22.066 1.00 203.14 ? 118 ARG A CZ  1 
ATOM   620  N  NH1 . ARG A 1 118 ? -7.217  41.631 -22.641 1.00 194.30 ? 118 ARG A NH1 1 
ATOM   621  N  NH2 . ARG A 1 118 ? -7.791  43.846 -22.759 1.00 189.49 ? 118 ARG A NH2 1 
ATOM   622  N  N   . LEU A 1 119 ? -5.058  43.889 -15.930 1.00 142.86 ? 119 LEU A N   1 
ATOM   623  C  CA  . LEU A 1 119 ? -3.752  44.146 -15.315 1.00 140.08 ? 119 LEU A CA  1 
ATOM   624  C  C   . LEU A 1 119 ? -3.887  44.168 -13.791 1.00 141.81 ? 119 LEU A C   1 
ATOM   625  O  O   . LEU A 1 119 ? -3.034  43.622 -13.089 1.00 141.17 ? 119 LEU A O   1 
ATOM   626  C  CB  . LEU A 1 119 ? -3.189  45.496 -15.813 1.00 137.50 ? 119 LEU A CB  1 
ATOM   627  C  CG  . LEU A 1 119 ? -2.098  45.491 -16.903 1.00 143.18 ? 119 LEU A CG  1 
ATOM   628  C  CD1 . LEU A 1 119 ? -0.842  44.775 -16.452 1.00 143.61 ? 119 LEU A CD1 1 
ATOM   629  C  CD2 . LEU A 1 119 ? -2.618  45.001 -18.259 1.00 149.13 ? 119 LEU A CD2 1 
ATOM   630  N  N   . GLY A 1 120 ? -4.978  44.773 -13.314 1.00 137.17 ? 120 GLY A N   1 
ATOM   631  C  CA  . GLY A 1 120 ? -5.325  44.871 -11.904 1.00 135.53 ? 120 GLY A CA  1 
ATOM   632  C  C   . GLY A 1 120 ? -5.712  43.526 -11.328 1.00 141.91 ? 120 GLY A C   1 
ATOM   633  O  O   . GLY A 1 120 ? -5.227  43.160 -10.257 1.00 141.07 ? 120 GLY A O   1 
ATOM   634  N  N   . MET A 1 121 ? -6.568  42.768 -12.055 1.00 141.45 ? 121 MET A N   1 
ATOM   635  C  CA  . MET A 1 121 ? -7.020  41.427 -11.664 1.00 144.51 ? 121 MET A CA  1 
ATOM   636  C  C   . MET A 1 121 ? -5.818  40.496 -11.502 1.00 146.13 ? 121 MET A C   1 
ATOM   637  O  O   . MET A 1 121 ? -5.742  39.791 -10.499 1.00 146.60 ? 121 MET A O   1 
ATOM   638  C  CB  . MET A 1 121 ? -8.022  40.856 -12.686 1.00 151.11 ? 121 MET A CB  1 
ATOM   639  C  CG  . MET A 1 121 ? -8.781  39.626 -12.195 1.00 159.30 ? 121 MET A CG  1 
ATOM   640  S  SD  . MET A 1 121 ? -10.006 39.970 -10.900 1.00 164.02 ? 121 MET A SD  1 
ATOM   641  C  CE  . MET A 1 121 ? -11.331 40.701 -11.884 1.00 161.86 ? 121 MET A CE  1 
ATOM   642  N  N   . ARG A 1 122 ? -4.862  40.541 -12.460 1.00 140.08 ? 122 ARG A N   1 
ATOM   643  C  CA  . ARG A 1 122 ? -3.627  39.754 -12.437 1.00 139.67 ? 122 ARG A CA  1 
ATOM   644  C  C   . ARG A 1 122 ? -2.814  40.092 -11.192 1.00 138.98 ? 122 ARG A C   1 
ATOM   645  O  O   . ARG A 1 122 ? -2.360  39.182 -10.501 1.00 139.69 ? 122 ARG A O   1 
ATOM   646  C  CB  . ARG A 1 122 ? -2.788  40.004 -13.699 1.00 139.43 ? 122 ARG A CB  1 
ATOM   647  C  CG  . ARG A 1 122 ? -3.347  39.352 -14.950 1.00 153.79 ? 122 ARG A CG  1 
ATOM   648  C  CD  . ARG A 1 122 ? -2.399  39.523 -16.115 1.00 166.11 ? 122 ARG A CD  1 
ATOM   649  N  NE  . ARG A 1 122 ? -3.096  39.556 -17.403 1.00 179.42 ? 122 ARG A NE  1 
ATOM   650  C  CZ  . ARG A 1 122 ? -3.335  38.490 -18.163 1.00 199.40 ? 122 ARG A CZ  1 
ATOM   651  N  NH1 . ARG A 1 122 ? -2.943  37.283 -17.771 1.00 189.96 ? 122 ARG A NH1 1 
ATOM   652  N  NH2 . ARG A 1 122 ? -3.973  38.621 -19.318 1.00 188.71 ? 122 ARG A NH2 1 
ATOM   653  N  N   . ALA A 1 123 ? -2.681  41.397 -10.882 1.00 131.04 ? 123 ALA A N   1 
ATOM   654  C  CA  . ALA A 1 123 ? -1.957  41.894 -9.715  1.00 127.76 ? 123 ALA A CA  1 
ATOM   655  C  C   . ALA A 1 123 ? -2.625  41.451 -8.407  1.00 131.80 ? 123 ALA A C   1 
ATOM   656  O  O   . ALA A 1 123 ? -1.948  40.846 -7.582  1.00 132.26 ? 123 ALA A O   1 
ATOM   657  C  CB  . ALA A 1 123 ? -1.832  43.410 -9.773  1.00 124.88 ? 123 ALA A CB  1 
ATOM   658  N  N   . VAL A 1 124 ? -3.952  41.688 -8.252  1.00 127.78 ? 124 VAL A N   1 
ATOM   659  C  CA  . VAL A 1 124 ? -4.747  41.322 -7.067  1.00 128.07 ? 124 VAL A CA  1 
ATOM   660  C  C   . VAL A 1 124 ? -4.706  39.800 -6.817  1.00 134.83 ? 124 VAL A C   1 
ATOM   661  O  O   . VAL A 1 124 ? -4.492  39.390 -5.673  1.00 134.60 ? 124 VAL A O   1 
ATOM   662  C  CB  . VAL A 1 124 ? -6.192  41.902 -7.118  1.00 132.10 ? 124 VAL A CB  1 
ATOM   663  C  CG1 . VAL A 1 124 ? -7.061  41.376 -5.976  1.00 133.61 ? 124 VAL A CG1 1 
ATOM   664  C  CG2 . VAL A 1 124 ? -6.170  43.427 -7.095  1.00 128.42 ? 124 VAL A CG2 1 
ATOM   665  N  N   . VAL A 1 125 ? -4.862  38.978 -7.884  1.00 133.90 ? 125 VAL A N   1 
ATOM   666  C  CA  . VAL A 1 125 ? -4.801  37.508 -7.814  1.00 137.33 ? 125 VAL A CA  1 
ATOM   667  C  C   . VAL A 1 125 ? -3.414  37.076 -7.329  1.00 141.42 ? 125 VAL A C   1 
ATOM   668  O  O   . VAL A 1 125 ? -3.316  36.226 -6.442  1.00 142.72 ? 125 VAL A O   1 
ATOM   669  C  CB  . VAL A 1 125 ? -5.223  36.833 -9.152  1.00 144.07 ? 125 VAL A CB  1 
ATOM   670  C  CG1 . VAL A 1 125 ? -4.724  35.392 -9.258  1.00 147.44 ? 125 VAL A CG1 1 
ATOM   671  C  CG2 . VAL A 1 125 ? -6.735  36.890 -9.336  1.00 145.62 ? 125 VAL A CG2 1 
ATOM   672  N  N   . TYR A 1 126 ? -2.358  37.707 -7.874  1.00 136.41 ? 126 TYR A N   1 
ATOM   673  C  CA  . TYR A 1 126 ? -0.971  37.451 -7.497  1.00 136.18 ? 126 TYR A CA  1 
ATOM   674  C  C   . TYR A 1 126 ? -0.699  37.850 -6.037  1.00 138.73 ? 126 TYR A C   1 
ATOM   675  O  O   . TYR A 1 126 ? -0.041  37.099 -5.321  1.00 139.84 ? 126 TYR A O   1 
ATOM   676  C  CB  . TYR A 1 126 ? -0.006  38.176 -8.455  1.00 135.84 ? 126 TYR A CB  1 
ATOM   677  C  CG  . TYR A 1 126 ? 1.432   38.170 -7.987  1.00 137.41 ? 126 TYR A CG  1 
ATOM   678  C  CD1 . TYR A 1 126 ? 2.262   37.081 -8.235  1.00 142.35 ? 126 TYR A CD1 1 
ATOM   679  C  CD2 . TYR A 1 126 ? 1.957   39.244 -7.274  1.00 135.08 ? 126 TYR A CD2 1 
ATOM   680  C  CE1 . TYR A 1 126 ? 3.579   37.057 -7.780  1.00 143.00 ? 126 TYR A CE1 1 
ATOM   681  C  CE2 . TYR A 1 126 ? 3.261   39.219 -6.787  1.00 135.61 ? 126 TYR A CE2 1 
ATOM   682  C  CZ  . TYR A 1 126 ? 4.075   38.129 -7.055  1.00 146.93 ? 126 TYR A CZ  1 
ATOM   683  O  OH  . TYR A 1 126 ? 5.377   38.117 -6.618  1.00 148.56 ? 126 TYR A OH  1 
ATOM   684  N  N   . TYR A 1 127 ? -1.180  39.035 -5.616  1.00 132.62 ? 127 TYR A N   1 
ATOM   685  C  CA  . TYR A 1 127 ? -0.991  39.590 -4.273  1.00 130.60 ? 127 TYR A CA  1 
ATOM   686  C  C   . TYR A 1 127 ? -1.591  38.726 -3.164  1.00 137.74 ? 127 TYR A C   1 
ATOM   687  O  O   . TYR A 1 127 ? -0.894  38.404 -2.199  1.00 136.99 ? 127 TYR A O   1 
ATOM   688  C  CB  . TYR A 1 127 ? -1.592  41.002 -4.188  1.00 128.61 ? 127 TYR A CB  1 
ATOM   689  C  CG  . TYR A 1 127 ? -0.907  42.079 -5.003  1.00 127.43 ? 127 TYR A CG  1 
ATOM   690  C  CD1 . TYR A 1 127 ? 0.425   41.953 -5.393  1.00 128.94 ? 127 TYR A CD1 1 
ATOM   691  C  CD2 . TYR A 1 127 ? -1.579  43.246 -5.351  1.00 126.16 ? 127 TYR A CD2 1 
ATOM   692  C  CE1 . TYR A 1 127 ? 1.073   42.968 -6.094  1.00 127.36 ? 127 TYR A CE1 1 
ATOM   693  C  CE2 . TYR A 1 127 ? -0.947  44.261 -6.063  1.00 124.68 ? 127 TYR A CE2 1 
ATOM   694  C  CZ  . TYR A 1 127 ? 0.379   44.119 -6.429  1.00 131.37 ? 127 TYR A CZ  1 
ATOM   695  O  OH  . TYR A 1 127 ? 0.992   45.123 -7.130  1.00 129.46 ? 127 TYR A OH  1 
ATOM   696  N  N   . MET A 1 128 ? -2.889  38.376 -3.303  1.00 137.56 ? 128 MET A N   1 
ATOM   697  C  CA  . MET A 1 128 ? -3.655  37.579 -2.341  1.00 140.44 ? 128 MET A CA  1 
ATOM   698  C  C   . MET A 1 128 ? -3.204  36.124 -2.241  1.00 146.43 ? 128 MET A C   1 
ATOM   699  O  O   . MET A 1 128 ? -3.359  35.527 -1.177  1.00 147.46 ? 128 MET A O   1 
ATOM   700  C  CB  . MET A 1 128 ? -5.167  37.666 -2.614  1.00 144.69 ? 128 MET A CB  1 
ATOM   701  C  CG  . MET A 1 128 ? -5.803  38.963 -2.119  1.00 146.16 ? 128 MET A CG  1 
ATOM   702  S  SD  . MET A 1 128 ? -5.605  39.284 -0.338  1.00 149.67 ? 128 MET A SD  1 
ATOM   703  C  CE  . MET A 1 128 ? -6.769  38.087 0.358   1.00 151.06 ? 128 MET A CE  1 
ATOM   704  N  N   . SER A 1 129 ? -2.657  35.554 -3.329  1.00 143.47 ? 129 SER A N   1 
ATOM   705  C  CA  . SER A 1 129 ? -2.158  34.182 -3.312  1.00 146.53 ? 129 SER A CA  1 
ATOM   706  C  C   . SER A 1 129 ? -0.809  34.120 -2.596  1.00 148.85 ? 129 SER A C   1 
ATOM   707  O  O   . SER A 1 129 ? -0.626  33.251 -1.748  1.00 150.46 ? 129 SER A O   1 
ATOM   708  C  CB  . SER A 1 129 ? -2.068  33.606 -4.721  1.00 152.19 ? 129 SER A CB  1 
ATOM   709  O  OG  . SER A 1 129 ? -1.312  34.437 -5.585  1.00 158.58 ? 129 SER A OG  1 
ATOM   710  N  N   . THR A 1 130 ? 0.105   35.074 -2.894  1.00 142.25 ? 130 THR A N   1 
ATOM   711  C  CA  . THR A 1 130 ? 1.440   35.178 -2.283  1.00 141.01 ? 130 THR A CA  1 
ATOM   712  C  C   . THR A 1 130 ? 1.375   35.472 -0.780  1.00 143.93 ? 130 THR A C   1 
ATOM   713  O  O   . THR A 1 130 ? 2.158   34.902 -0.016  1.00 144.55 ? 130 THR A O   1 
ATOM   714  C  CB  . THR A 1 130 ? 2.332   36.179 -3.031  1.00 146.27 ? 130 THR A CB  1 
ATOM   715  O  OG1 . THR A 1 130 ? 1.641   37.423 -3.184  1.00 143.23 ? 130 THR A OG1 1 
ATOM   716  C  CG2 . THR A 1 130 ? 2.824   35.647 -4.376  1.00 145.70 ? 130 THR A CG2 1 
ATOM   717  N  N   . THR A 1 131 ? 0.429   36.340 -0.355  1.00 138.82 ? 131 THR A N   1 
ATOM   718  C  CA  . THR A 1 131 ? 0.214   36.659 1.065   1.00 138.02 ? 131 THR A CA  1 
ATOM   719  C  C   . THR A 1 131 ? -0.478  35.486 1.790   1.00 145.02 ? 131 THR A C   1 
ATOM   720  O  O   . THR A 1 131 ? -0.491  35.456 3.023   1.00 145.72 ? 131 THR A O   1 
ATOM   721  C  CB  . THR A 1 131 ? -0.497  38.017 1.267   1.00 144.59 ? 131 THR A CB  1 
ATOM   722  O  OG1 . THR A 1 131 ? -1.636  38.112 0.411   1.00 146.86 ? 131 THR A OG1 1 
ATOM   723  C  CG2 . THR A 1 131 ? 0.427   39.209 1.051   1.00 139.14 ? 131 THR A CG2 1 
ATOM   724  N  N   . ILE A 1 132 ? -1.041  34.520 1.020   1.00 143.07 ? 132 ILE A N   1 
ATOM   725  C  CA  . ILE A 1 132 ? -1.685  33.310 1.537   1.00 146.20 ? 132 ILE A CA  1 
ATOM   726  C  C   . ILE A 1 132 ? -0.642  32.183 1.661   1.00 150.68 ? 132 ILE A C   1 
ATOM   727  O  O   . ILE A 1 132 ? -0.685  31.426 2.631   1.00 152.43 ? 132 ILE A O   1 
ATOM   728  C  CB  . ILE A 1 132 ? -2.968  32.943 0.725   1.00 151.51 ? 132 ILE A CB  1 
ATOM   729  C  CG1 . ILE A 1 132 ? -4.236  33.340 1.510   1.00 152.08 ? 132 ILE A CG1 1 
ATOM   730  C  CG2 . ILE A 1 132 ? -3.017  31.473 0.262   1.00 156.86 ? 132 ILE A CG2 1 
ATOM   731  C  CD1 . ILE A 1 132 ? -5.479  33.648 0.655   1.00 160.42 ? 132 ILE A CD1 1 
ATOM   732  N  N   . ILE A 1 133 ? 0.312   32.104 0.705   1.00 145.69 ? 133 ILE A N   1 
ATOM   733  C  CA  . ILE A 1 133 ? 1.391   31.110 0.707   1.00 147.53 ? 133 ILE A CA  1 
ATOM   734  C  C   . ILE A 1 133 ? 2.329   31.367 1.893   1.00 150.22 ? 133 ILE A C   1 
ATOM   735  O  O   . ILE A 1 133 ? 2.655   30.433 2.625   1.00 152.50 ? 133 ILE A O   1 
ATOM   736  C  CB  . ILE A 1 133 ? 2.144   31.059 -0.660  1.00 150.26 ? 133 ILE A CB  1 
ATOM   737  C  CG1 . ILE A 1 133 ? 1.208   30.718 -1.859  1.00 152.29 ? 133 ILE A CG1 1 
ATOM   738  C  CG2 . ILE A 1 133 ? 3.354   30.129 -0.617  1.00 153.40 ? 133 ILE A CG2 1 
ATOM   739  C  CD1 . ILE A 1 133 ? 0.336   29.388 -1.804  1.00 165.00 ? 133 ILE A CD1 1 
ATOM   740  N  N   . ALA A 1 134 ? 2.722   32.641 2.092   1.00 143.21 ? 134 ALA A N   1 
ATOM   741  C  CA  . ALA A 1 134 ? 3.598   33.106 3.173   1.00 141.82 ? 134 ALA A CA  1 
ATOM   742  C  C   . ALA A 1 134 ? 3.009   32.856 4.579   1.00 147.19 ? 134 ALA A C   1 
ATOM   743  O  O   . ALA A 1 134 ? 3.744   32.453 5.486   1.00 147.83 ? 134 ALA A O   1 
ATOM   744  C  CB  . ALA A 1 134 ? 3.906   34.585 2.987   1.00 138.17 ? 134 ALA A CB  1 
ATOM   745  N  N   . VAL A 1 135 ? 1.687   33.089 4.747   1.00 143.90 ? 135 VAL A N   1 
ATOM   746  C  CA  . VAL A 1 135 ? 0.981   32.884 6.013   1.00 145.39 ? 135 VAL A CA  1 
ATOM   747  C  C   . VAL A 1 135 ? 0.839   31.369 6.313   1.00 153.72 ? 135 VAL A C   1 
ATOM   748  O  O   . VAL A 1 135 ? 0.918   30.978 7.479   1.00 155.06 ? 135 VAL A O   1 
ATOM   749  C  CB  . VAL A 1 135 ? -0.354  33.687 6.101   1.00 148.07 ? 135 VAL A CB  1 
ATOM   750  C  CG1 . VAL A 1 135 ? -1.488  33.032 5.316   1.00 150.27 ? 135 VAL A CG1 1 
ATOM   751  C  CG2 . VAL A 1 135 ? -0.766  33.919 7.546   1.00 148.61 ? 135 VAL A CG2 1 
ATOM   752  N  N   . VAL A 1 136 ? 0.685   30.527 5.259   1.00 152.05 ? 136 VAL A N   1 
ATOM   753  C  CA  . VAL A 1 136 ? 0.585   29.067 5.392   1.00 156.46 ? 136 VAL A CA  1 
ATOM   754  C  C   . VAL A 1 136 ? 1.970   28.496 5.729   1.00 161.02 ? 136 VAL A C   1 
ATOM   755  O  O   . VAL A 1 136 ? 2.085   27.698 6.663   1.00 163.72 ? 136 VAL A O   1 
ATOM   756  C  CB  . VAL A 1 136 ? -0.099  28.395 4.164   1.00 162.44 ? 136 VAL A CB  1 
ATOM   757  C  CG1 . VAL A 1 136 ? 0.210   26.900 4.074   1.00 167.07 ? 136 VAL A CG1 1 
ATOM   758  C  CG2 . VAL A 1 136 ? -1.608  28.622 4.191   1.00 162.71 ? 136 VAL A CG2 1 
ATOM   759  N  N   . LEU A 1 137 ? 3.020   28.954 5.008   1.00 154.58 ? 137 LEU A N   1 
ATOM   760  C  CA  . LEU A 1 137 ? 4.413   28.553 5.228   1.00 154.95 ? 137 LEU A CA  1 
ATOM   761  C  C   . LEU A 1 137 ? 4.892   28.998 6.616   1.00 157.58 ? 137 LEU A C   1 
ATOM   762  O  O   . LEU A 1 137 ? 5.624   28.257 7.269   1.00 159.91 ? 137 LEU A O   1 
ATOM   763  C  CB  . LEU A 1 137 ? 5.325   29.129 4.129   1.00 152.35 ? 137 LEU A CB  1 
ATOM   764  C  CG  . LEU A 1 137 ? 6.732   28.540 4.017   1.00 158.62 ? 137 LEU A CG  1 
ATOM   765  C  CD1 . LEU A 1 137 ? 6.749   27.327 3.104   1.00 162.65 ? 137 LEU A CD1 1 
ATOM   766  C  CD2 . LEU A 1 137 ? 7.699   29.572 3.493   1.00 157.46 ? 137 LEU A CD2 1 
ATOM   767  N  N   . GLY A 1 138 ? 4.441   30.176 7.052   1.00 150.53 ? 138 GLY A N   1 
ATOM   768  C  CA  . GLY A 1 138 ? 4.768   30.751 8.353   1.00 149.21 ? 138 GLY A CA  1 
ATOM   769  C  C   . GLY A 1 138 ? 4.196   29.987 9.533   1.00 155.89 ? 138 GLY A C   1 
ATOM   770  O  O   . GLY A 1 138 ? 4.901   29.769 10.522  1.00 156.61 ? 138 GLY A O   1 
ATOM   771  N  N   . ILE A 1 139 ? 2.912   29.574 9.435   1.00 154.19 ? 139 ILE A N   1 
ATOM   772  C  CA  . ILE A 1 139 ? 2.189   28.818 10.470  1.00 157.74 ? 139 ILE A CA  1 
ATOM   773  C  C   . ILE A 1 139 ? 2.811   27.420 10.673  1.00 165.26 ? 139 ILE A C   1 
ATOM   774  O  O   . ILE A 1 139 ? 3.037   27.021 11.814  1.00 166.77 ? 139 ILE A O   1 
ATOM   775  C  CB  . ILE A 1 139 ? 0.651   28.795 10.182  1.00 161.84 ? 139 ILE A CB  1 
ATOM   776  C  CG1 . ILE A 1 139 ? -0.004  30.132 10.607  1.00 158.89 ? 139 ILE A CG1 1 
ATOM   777  C  CG2 . ILE A 1 139 ? -0.060  27.601 10.849  1.00 167.63 ? 139 ILE A CG2 1 
ATOM   778  C  CD1 . ILE A 1 139 ? -1.328  30.497 9.901   1.00 165.78 ? 139 ILE A CD1 1 
ATOM   779  N  N   . ILE A 1 140 ? 3.107   26.704 9.570   1.00 162.94 ? 140 ILE A N   1 
ATOM   780  C  CA  . ILE A 1 140 ? 3.714   25.367 9.591   1.00 166.96 ? 140 ILE A CA  1 
ATOM   781  C  C   . ILE A 1 140 ? 5.075   25.388 10.323  1.00 170.06 ? 140 ILE A C   1 
ATOM   782  O  O   . ILE A 1 140 ? 5.297   24.555 11.205  1.00 173.32 ? 140 ILE A O   1 
ATOM   783  C  CB  . ILE A 1 140 ? 3.775   24.759 8.155   1.00 171.21 ? 140 ILE A CB  1 
ATOM   784  C  CG1 . ILE A 1 140 ? 2.350   24.448 7.634   1.00 173.44 ? 140 ILE A CG1 1 
ATOM   785  C  CG2 . ILE A 1 140 ? 4.667   23.507 8.089   1.00 175.97 ? 140 ILE A CG2 1 
ATOM   786  C  CD1 . ILE A 1 140 ? 2.209   24.343 6.108   1.00 181.78 ? 140 ILE A CD1 1 
ATOM   787  N  N   . LEU A 1 141 ? 5.941   26.375 9.995   1.00 161.79 ? 141 LEU A N   1 
ATOM   788  C  CA  . LEU A 1 141 ? 7.276   26.562 10.579  1.00 160.76 ? 141 LEU A CA  1 
ATOM   789  C  C   . LEU A 1 141 ? 7.277   26.827 12.091  1.00 164.34 ? 141 LEU A C   1 
ATOM   790  O  O   . LEU A 1 141 ? 8.100   26.243 12.802  1.00 166.32 ? 141 LEU A O   1 
ATOM   791  C  CB  . LEU A 1 141 ? 8.048   27.668 9.841   1.00 156.35 ? 141 LEU A CB  1 
ATOM   792  C  CG  . LEU A 1 141 ? 8.752   27.255 8.552   1.00 161.34 ? 141 LEU A CG  1 
ATOM   793  C  CD1 . LEU A 1 141 ? 8.910   28.429 7.626   1.00 157.06 ? 141 LEU A CD1 1 
ATOM   794  C  CD2 . LEU A 1 141 ? 10.113  26.644 8.834   1.00 166.44 ? 141 LEU A CD2 1 
ATOM   795  N  N   . VAL A 1 142 ? 6.365   27.702 12.576  1.00 158.13 ? 142 VAL A N   1 
ATOM   796  C  CA  . VAL A 1 142 ? 6.241   28.053 13.999  1.00 158.15 ? 142 VAL A CA  1 
ATOM   797  C  C   . VAL A 1 142 ? 5.674   26.858 14.804  1.00 167.03 ? 142 VAL A C   1 
ATOM   798  O  O   . VAL A 1 142 ? 6.008   26.706 15.984  1.00 168.82 ? 142 VAL A O   1 
ATOM   799  C  CB  . VAL A 1 142 ? 5.484   29.396 14.234  1.00 157.97 ? 142 VAL A CB  1 
ATOM   800  C  CG1 . VAL A 1 142 ? 4.010   29.305 13.860  1.00 158.06 ? 142 VAL A CG1 1 
ATOM   801  C  CG2 . VAL A 1 142 ? 5.660   29.913 15.660  1.00 157.90 ? 142 VAL A CG2 1 
ATOM   802  N  N   . LEU A 1 143 ? 4.867   25.991 14.149  1.00 164.96 ? 143 LEU A N   1 
ATOM   803  C  CA  . LEU A 1 143 ? 4.319   24.786 14.776  1.00 169.17 ? 143 LEU A CA  1 
ATOM   804  C  C   . LEU A 1 143 ? 5.424   23.740 14.952  1.00 176.01 ? 143 LEU A C   1 
ATOM   805  O  O   . LEU A 1 143 ? 5.394   22.979 15.920  1.00 180.01 ? 143 LEU A O   1 
ATOM   806  C  CB  . LEU A 1 143 ? 3.147   24.210 13.968  1.00 170.60 ? 143 LEU A CB  1 
ATOM   807  C  CG  . LEU A 1 143 ? 1.838   25.007 13.985  1.00 172.85 ? 143 LEU A CG  1 
ATOM   808  C  CD1 . LEU A 1 143 ? 0.925   24.559 12.872  1.00 173.85 ? 143 LEU A CD1 1 
ATOM   809  C  CD2 . LEU A 1 143 ? 1.124   24.909 15.328  1.00 177.48 ? 143 LEU A CD2 1 
ATOM   810  N  N   . ILE A 1 144 ? 6.410   23.732 14.030  1.00 170.83 ? 144 ILE A N   1 
ATOM   811  C  CA  . ILE A 1 144 ? 7.573   22.842 14.064  1.00 173.76 ? 144 ILE A CA  1 
ATOM   812  C  C   . ILE A 1 144 ? 8.597   23.365 15.095  1.00 176.87 ? 144 ILE A C   1 
ATOM   813  O  O   . ILE A 1 144 ? 9.045   22.597 15.949  1.00 181.22 ? 144 ILE A O   1 
ATOM   814  C  CB  . ILE A 1 144 ? 8.172   22.612 12.638  1.00 176.22 ? 144 ILE A CB  1 
ATOM   815  C  CG1 . ILE A 1 144 ? 7.173   21.840 11.741  1.00 178.72 ? 144 ILE A CG1 1 
ATOM   816  C  CG2 . ILE A 1 144 ? 9.532   21.882 12.693  1.00 179.53 ? 144 ILE A CG2 1 
ATOM   817  C  CD1 . ILE A 1 144 ? 7.387   22.000 10.239  1.00 183.77 ? 144 ILE A CD1 1 
ATOM   818  N  N   . ILE A 1 145 ? 8.943   24.667 15.031  1.00 167.74 ? 145 ILE A N   1 
ATOM   819  C  CA  . ILE A 1 145 ? 9.899   25.283 15.958  1.00 186.25 ? 145 ILE A CA  1 
ATOM   820  C  C   . ILE A 1 145 ? 9.156   25.924 17.139  1.00 195.09 ? 145 ILE A C   1 
ATOM   821  O  O   . ILE A 1 145 ? 8.403   25.251 17.844  1.00 146.39 ? 145 ILE A O   1 
ATOM   822  C  CB  . ILE A 1 145 ? 10.857  26.294 15.251  1.00 184.99 ? 145 ILE A CB  1 
ATOM   823  C  CG1 . ILE A 1 145 ? 11.308  25.824 13.824  1.00 184.96 ? 145 ILE A CG1 1 
ATOM   824  C  CG2 . ILE A 1 145 ? 12.059  26.651 16.142  1.00 186.19 ? 145 ILE A CG2 1 
ATOM   825  C  CD1 . ILE A 1 145 ? 12.179  24.503 13.697  1.00 192.76 ? 145 ILE A CD1 1 
ATOM   826  N  N   . GLU A 1 171 ? -10.241 49.583 21.028  1.00 134.38 ? 171 GLU A N   1 
ATOM   827  C  CA  . GLU A 1 171 ? -9.488  50.392 20.068  1.00 129.86 ? 171 GLU A CA  1 
ATOM   828  C  C   . GLU A 1 171 ? -9.146  49.648 18.754  1.00 130.58 ? 171 GLU A C   1 
ATOM   829  O  O   . GLU A 1 171 ? -8.638  50.268 17.818  1.00 126.68 ? 171 GLU A O   1 
ATOM   830  C  CB  . GLU A 1 171 ? -8.225  50.972 20.729  1.00 130.17 ? 171 GLU A CB  1 
ATOM   831  C  CG  . GLU A 1 171 ? -7.876  52.374 20.251  1.00 139.45 ? 171 GLU A CG  1 
ATOM   832  C  CD  . GLU A 1 171 ? -6.771  53.070 21.023  1.00 163.05 ? 171 GLU A CD  1 
ATOM   833  O  OE1 . GLU A 1 171 ? -5.628  52.556 21.030  1.00 159.42 ? 171 GLU A OE1 1 
ATOM   834  O  OE2 . GLU A 1 171 ? -7.043  54.149 21.597  1.00 157.21 ? 171 GLU A OE2 1 
ATOM   835  N  N   . VAL A 1 172 ? -9.448  48.337 18.675  1.00 128.81 ? 172 VAL A N   1 
ATOM   836  C  CA  . VAL A 1 172 ? -9.183  47.514 17.484  1.00 126.89 ? 172 VAL A CA  1 
ATOM   837  C  C   . VAL A 1 172 ? -10.230 47.767 16.382  1.00 129.02 ? 172 VAL A C   1 
ATOM   838  O  O   . VAL A 1 172 ? -9.933  47.540 15.210  1.00 126.55 ? 172 VAL A O   1 
ATOM   839  C  CB  . VAL A 1 172 ? -8.989  46.003 17.784  1.00 133.77 ? 172 VAL A CB  1 
ATOM   840  C  CG1 . VAL A 1 172 ? -8.072  45.357 16.747  1.00 131.26 ? 172 VAL A CG1 1 
ATOM   841  C  CG2 . VAL A 1 172 ? -8.441  45.774 19.194  1.00 135.93 ? 172 VAL A CG2 1 
ATOM   842  N  N   . LEU A 1 173 ? -11.443 48.245 16.747  1.00 127.05 ? 173 LEU A N   1 
ATOM   843  C  CA  . LEU A 1 173 ? -12.467 48.620 15.765  1.00 126.52 ? 173 LEU A CA  1 
ATOM   844  C  C   . LEU A 1 173 ? -12.039 49.965 15.171  1.00 127.54 ? 173 LEU A C   1 
ATOM   845  O  O   . LEU A 1 173 ? -12.180 50.176 13.964  1.00 125.25 ? 173 LEU A O   1 
ATOM   846  C  CB  . LEU A 1 173 ? -13.879 48.714 16.389  1.00 130.13 ? 173 LEU A CB  1 
ATOM   847  C  CG  . LEU A 1 173 ? -14.979 49.441 15.570  1.00 134.31 ? 173 LEU A CG  1 
ATOM   848  C  CD1 . LEU A 1 173 ? -15.358 48.682 14.300  1.00 134.10 ? 173 LEU A CD1 1 
ATOM   849  C  CD2 . LEU A 1 173 ? -16.204 49.697 16.406  1.00 140.72 ? 173 LEU A CD2 1 
ATOM   850  N  N   . ASP A 1 174 ? -11.462 50.846 16.026  1.00 123.78 ? 174 ASP A N   1 
ATOM   851  C  CA  . ASP A 1 174 ? -10.930 52.155 15.647  1.00 120.61 ? 174 ASP A CA  1 
ATOM   852  C  C   . ASP A 1 174 ? -9.841  52.018 14.594  1.00 121.04 ? 174 ASP A C   1 
ATOM   853  O  O   . ASP A 1 174 ? -9.652  52.944 13.816  1.00 118.07 ? 174 ASP A O   1 
ATOM   854  C  CB  . ASP A 1 174 ? -10.404 52.919 16.869  1.00 123.03 ? 174 ASP A CB  1 
ATOM   855  C  CG  . ASP A 1 174 ? -11.484 53.581 17.700  1.00 137.79 ? 174 ASP A CG  1 
ATOM   856  O  OD1 . ASP A 1 174 ? -12.227 54.425 17.148  1.00 138.34 ? 174 ASP A OD1 1 
ATOM   857  O  OD2 . ASP A 1 174 ? -11.556 53.293 18.912  1.00 147.03 ? 174 ASP A OD2 1 
ATOM   858  N  N   . CYS A 1 175 ? -9.154  50.854 14.548  1.00 118.16 ? 175 CYS A N   1 
ATOM   859  C  CA  . CYS A 1 175 ? -8.142  50.536 13.542  1.00 115.74 ? 175 CYS A CA  1 
ATOM   860  C  C   . CYS A 1 175 ? -8.823  50.375 12.185  1.00 118.54 ? 175 CYS A C   1 
ATOM   861  O  O   . CYS A 1 175 ? -8.358  50.968 11.210  1.00 115.92 ? 175 CYS A O   1 
ATOM   862  C  CB  . CYS A 1 175 ? -7.356  49.284 13.919  1.00 117.69 ? 175 CYS A CB  1 
ATOM   863  S  SG  . CYS A 1 175 ? -6.216  49.507 15.310  1.00 122.63 ? 175 CYS A SG  1 
ATOM   864  N  N   . PHE A 1 176 ? -9.939  49.601 12.129  1.00 116.94 ? 176 PHE A N   1 
ATOM   865  C  CA  . PHE A 1 176 ? -10.722 49.370 10.909  1.00 116.54 ? 176 PHE A CA  1 
ATOM   866  C  C   . PHE A 1 176 ? -11.335 50.660 10.387  1.00 117.29 ? 176 PHE A C   1 
ATOM   867  O  O   . PHE A 1 176 ? -11.371 50.865 9.174   1.00 115.49 ? 176 PHE A O   1 
ATOM   868  C  CB  . PHE A 1 176 ? -11.827 48.334 11.138  1.00 122.58 ? 176 PHE A CB  1 
ATOM   869  C  CG  . PHE A 1 176 ? -11.355 46.904 11.232  1.00 126.35 ? 176 PHE A CG  1 
ATOM   870  C  CD1 . PHE A 1 176 ? -11.025 46.187 10.086  1.00 129.27 ? 176 PHE A CD1 1 
ATOM   871  C  CD2 . PHE A 1 176 ? -11.291 46.255 12.460  1.00 131.54 ? 176 PHE A CD2 1 
ATOM   872  C  CE1 . PHE A 1 176 ? -10.608 44.853 10.171  1.00 132.17 ? 176 PHE A CE1 1 
ATOM   873  C  CE2 . PHE A 1 176 ? -10.878 44.921 12.545  1.00 136.31 ? 176 PHE A CE2 1 
ATOM   874  C  CZ  . PHE A 1 176 ? -10.540 44.229 11.400  1.00 133.83 ? 176 PHE A CZ  1 
ATOM   875  N  N   . LEU A 1 177 ? -11.799 51.532 11.303  1.00 113.00 ? 177 LEU A N   1 
ATOM   876  C  CA  . LEU A 1 177 ? -12.407 52.822 10.973  1.00 111.07 ? 177 LEU A CA  1 
ATOM   877  C  C   . LEU A 1 177 ? -11.379 53.824 10.464  1.00 110.01 ? 177 LEU A C   1 
ATOM   878  O  O   . LEU A 1 177 ? -11.671 54.528 9.500   1.00 108.19 ? 177 LEU A O   1 
ATOM   879  C  CB  . LEU A 1 177 ? -13.159 53.411 12.171  1.00 113.34 ? 177 LEU A CB  1 
ATOM   880  C  CG  . LEU A 1 177 ? -14.281 52.573 12.745  1.00 121.88 ? 177 LEU A CG  1 
ATOM   881  C  CD1 . LEU A 1 177 ? -14.468 52.880 14.194  1.00 124.32 ? 177 LEU A CD1 1 
ATOM   882  C  CD2 . LEU A 1 177 ? -15.569 52.773 11.978  1.00 125.47 ? 177 LEU A CD2 1 
ATOM   883  N  N   . ASP A 1 178 ? -10.189 53.896 11.104  1.00 104.48 ? 178 ASP A N   1 
ATOM   884  C  CA  . ASP A 1 178 ? -9.113  54.802 10.692  1.00 101.10 ? 178 ASP A CA  1 
ATOM   885  C  C   . ASP A 1 178 ? -8.596  54.434 9.308   1.00 103.40 ? 178 ASP A C   1 
ATOM   886  O  O   . ASP A 1 178 ? -8.303  55.331 8.510   1.00 101.00 ? 178 ASP A O   1 
ATOM   887  C  CB  . ASP A 1 178 ? -7.967  54.827 11.715  1.00 102.54 ? 178 ASP A CB  1 
ATOM   888  C  CG  . ASP A 1 178 ? -8.282  55.568 13.004  1.00 114.82 ? 178 ASP A CG  1 
ATOM   889  O  OD1 . ASP A 1 178 ? -9.258  56.352 13.018  1.00 116.16 ? 178 ASP A OD1 1 
ATOM   890  O  OD2 . ASP A 1 178 ? -7.557  55.358 14.001  1.00 121.71 ? 178 ASP A OD2 1 
ATOM   891  N  N   . LEU A 1 179 ? -8.525  53.113 9.014   1.00 100.61 ? 179 LEU A N   1 
ATOM   892  C  CA  . LEU A 1 179 ? -8.114  52.585 7.715   1.00 98.84  ? 179 LEU A CA  1 
ATOM   893  C  C   . LEU A 1 179 ? -9.144  53.026 6.660   1.00 103.11 ? 179 LEU A C   1 
ATOM   894  O  O   . LEU A 1 179 ? -8.758  53.603 5.638   1.00 101.05 ? 179 LEU A O   1 
ATOM   895  C  CB  . LEU A 1 179 ? -7.985  51.048 7.766   1.00 100.51 ? 179 LEU A CB  1 
ATOM   896  C  CG  . LEU A 1 179 ? -7.578  50.351 6.459   1.00 104.37 ? 179 LEU A CG  1 
ATOM   897  C  CD1 . LEU A 1 179 ? -6.061  50.330 6.279   1.00 102.27 ? 179 LEU A CD1 1 
ATOM   898  C  CD2 . LEU A 1 179 ? -8.145  48.950 6.397   1.00 109.81 ? 179 LEU A CD2 1 
ATOM   899  N  N   . ALA A 1 180 ? -10.454 52.805 6.949   1.00 101.40 ? 180 ALA A N   1 
ATOM   900  C  CA  . ALA A 1 180 ? -11.582 53.186 6.094   1.00 101.36 ? 180 ALA A CA  1 
ATOM   901  C  C   . ALA A 1 180 ? -11.570 54.688 5.835   1.00 102.25 ? 180 ALA A C   1 
ATOM   902  O  O   . ALA A 1 180 ? -11.739 55.102 4.687   1.00 100.66 ? 180 ALA A O   1 
ATOM   903  C  CB  . ALA A 1 180 ? -12.893 52.772 6.741   1.00 105.57 ? 180 ALA A CB  1 
ATOM   904  N  N   . ARG A 1 181 ? -11.311 55.495 6.894   1.00 98.02  ? 181 ARG A N   1 
ATOM   905  C  CA  . ARG A 1 181 ? -11.207 56.954 6.831   1.00 96.07  ? 181 ARG A CA  1 
ATOM   906  C  C   . ARG A 1 181 ? -10.093 57.359 5.886   1.00 97.44  ? 181 ARG A C   1 
ATOM   907  O  O   . ARG A 1 181 ? -10.298 58.237 5.052   1.00 96.24  ? 181 ARG A O   1 
ATOM   908  C  CB  . ARG A 1 181 ? -10.940 57.552 8.218   1.00 95.54  ? 181 ARG A CB  1 
ATOM   909  C  CG  . ARG A 1 181 ? -12.198 57.786 9.023   1.00 107.70 ? 181 ARG A CG  1 
ATOM   910  C  CD  . ARG A 1 181 ? -11.911 58.589 10.267  1.00 116.28 ? 181 ARG A CD  1 
ATOM   911  N  NE  . ARG A 1 181 ? -11.702 57.745 11.442  1.00 123.41 ? 181 ARG A NE  1 
ATOM   912  C  CZ  . ARG A 1 181 ? -12.622 57.516 12.373  1.00 138.31 ? 181 ARG A CZ  1 
ATOM   913  N  NH1 . ARG A 1 181 ? -12.341 56.745 13.416  1.00 128.99 ? 181 ARG A NH1 1 
ATOM   914  N  NH2 . ARG A 1 181 ? -13.830 58.053 12.268  1.00 122.68 ? 181 ARG A NH2 1 
ATOM   915  N  N   . ASN A 1 182 ? -8.928  56.697 5.997   1.00 92.87  ? 182 ASN A N   1 
ATOM   916  C  CA  . ASN A 1 182 ? -7.754  56.976 5.178   1.00 90.12  ? 182 ASN A CA  1 
ATOM   917  C  C   . ASN A 1 182 ? -7.912  56.575 3.696   1.00 93.24  ? 182 ASN A C   1 
ATOM   918  O  O   . ASN A 1 182 ? -7.323  57.245 2.846   1.00 91.16  ? 182 ASN A O   1 
ATOM   919  C  CB  . ASN A 1 182 ? -6.503  56.371 5.803   1.00 90.50  ? 182 ASN A CB  1 
ATOM   920  C  CG  . ASN A 1 182 ? -6.032  57.135 7.016   1.00 108.35 ? 182 ASN A CG  1 
ATOM   921  O  OD1 . ASN A 1 182 ? -5.886  58.365 6.994   1.00 99.29  ? 182 ASN A OD1 1 
ATOM   922  N  ND2 . ASN A 1 182 ? -5.758  56.422 8.095   1.00 101.20 ? 182 ASN A ND2 1 
ATOM   923  N  N   . ILE A 1 183 ? -8.735  55.537 3.376   1.00 90.72  ? 183 ILE A N   1 
ATOM   924  C  CA  . ILE A 1 183 ? -9.011  55.123 1.983   1.00 89.88  ? 183 ILE A CA  1 
ATOM   925  C  C   . ILE A 1 183 ? -9.731  56.280 1.243   1.00 93.25  ? 183 ILE A C   1 
ATOM   926  O  O   . ILE A 1 183 ? -9.521  56.471 0.042   1.00 92.12  ? 183 ILE A O   1 
ATOM   927  C  CB  . ILE A 1 183 ? -9.791  53.773 1.922   1.00 95.04  ? 183 ILE A CB  1 
ATOM   928  C  CG1 . ILE A 1 183 ? -8.914  52.621 2.422   1.00 95.82  ? 183 ILE A CG1 1 
ATOM   929  C  CG2 . ILE A 1 183 ? -10.295 53.457 0.515   1.00 95.39  ? 183 ILE A CG2 1 
ATOM   930  C  CD1 . ILE A 1 183 ? -9.642  51.523 3.184   1.00 108.56 ? 183 ILE A CD1 1 
ATOM   931  N  N   . PHE A 1 184 ? -10.515 57.087 1.995   1.00 89.80  ? 184 PHE A N   1 
ATOM   932  C  CA  . PHE A 1 184 ? -11.263 58.234 1.483   1.00 88.94  ? 184 PHE A CA  1 
ATOM   933  C  C   . PHE A 1 184 ? -10.832 59.532 2.203   1.00 90.74  ? 184 PHE A C   1 
ATOM   934  O  O   . PHE A 1 184 ? -11.564 59.988 3.083   1.00 91.24  ? 184 PHE A O   1 
ATOM   935  C  CB  . PHE A 1 184 ? -12.776 57.981 1.624   1.00 93.42  ? 184 PHE A CB  1 
ATOM   936  C  CG  . PHE A 1 184 ? -13.256 56.688 1.003   1.00 96.36  ? 184 PHE A CG  1 
ATOM   937  C  CD1 . PHE A 1 184 ? -13.272 55.508 1.736   1.00 100.75 ? 184 PHE A CD1 1 
ATOM   938  C  CD2 . PHE A 1 184 ? -13.704 56.654 -0.309  1.00 98.33  ? 184 PHE A CD2 1 
ATOM   939  C  CE1 . PHE A 1 184 ? -13.722 54.318 1.165   1.00 103.35 ? 184 PHE A CE1 1 
ATOM   940  C  CE2 . PHE A 1 184 ? -14.155 55.462 -0.878  1.00 102.94 ? 184 PHE A CE2 1 
ATOM   941  C  CZ  . PHE A 1 184 ? -14.156 54.302 -0.139  1.00 102.50 ? 184 PHE A CZ  1 
ATOM   942  N  N   . PRO A 1 185 ? -9.651  60.135 1.866   1.00 85.28  ? 185 PRO A N   1 
ATOM   943  C  CA  . PRO A 1 185 ? -9.219  61.367 2.568   1.00 84.08  ? 185 PRO A CA  1 
ATOM   944  C  C   . PRO A 1 185 ? -10.120 62.579 2.354   1.00 87.97  ? 185 PRO A C   1 
ATOM   945  O  O   . PRO A 1 185 ? -10.576 62.812 1.242   1.00 87.56  ? 185 PRO A O   1 
ATOM   946  C  CB  . PRO A 1 185 ? -7.806  61.621 2.027   1.00 83.46  ? 185 PRO A CB  1 
ATOM   947  C  CG  . PRO A 1 185 ? -7.770  60.930 0.713   1.00 87.78  ? 185 PRO A CG  1 
ATOM   948  C  CD  . PRO A 1 185 ? -8.650  59.718 0.859   1.00 85.34  ? 185 PRO A CD  1 
ATOM   949  N  N   . SER A 1 186 ? -10.371 63.341 3.425   1.00 84.95  ? 186 SER A N   1 
ATOM   950  C  CA  . SER A 1 186 ? -11.211 64.537 3.407   1.00 85.83  ? 186 SER A CA  1 
ATOM   951  C  C   . SER A 1 186 ? -10.522 65.715 2.737   1.00 87.17  ? 186 SER A C   1 
ATOM   952  O  O   . SER A 1 186 ? -11.192 66.689 2.394   1.00 87.34  ? 186 SER A O   1 
ATOM   953  C  CB  . SER A 1 186 ? -11.591 64.929 4.828   1.00 92.92  ? 186 SER A CB  1 
ATOM   954  O  OG  . SER A 1 186 ? -10.435 65.141 5.625   1.00 105.29 ? 186 SER A OG  1 
ATOM   955  N  N   . ASN A 1 187 ? -9.179  65.652 2.600   1.00 81.67  ? 187 ASN A N   1 
ATOM   956  C  CA  . ASN A 1 187 ? -8.357  66.705 1.995   1.00 79.82  ? 187 ASN A CA  1 
ATOM   957  C  C   . ASN A 1 187 ? -7.096  66.130 1.341   1.00 82.10  ? 187 ASN A C   1 
ATOM   958  O  O   . ASN A 1 187 ? -6.304  65.470 2.016   1.00 80.94  ? 187 ASN A O   1 
ATOM   959  C  CB  . ASN A 1 187 ? -8.000  67.768 3.029   1.00 78.14  ? 187 ASN A CB  1 
ATOM   960  C  CG  . ASN A 1 187 ? -7.417  69.004 2.420   1.00 92.59  ? 187 ASN A CG  1 
ATOM   961  O  OD1 . ASN A 1 187 ? -6.202  69.111 2.230   1.00 83.82  ? 187 ASN A OD1 1 
ATOM   962  N  ND2 . ASN A 1 187 ? -8.282  69.950 2.075   1.00 84.48  ? 187 ASN A ND2 1 
ATOM   963  N  N   . LEU A 1 188 ? -6.919  66.387 0.027   1.00 78.03  ? 188 LEU A N   1 
ATOM   964  C  CA  . LEU A 1 188 ? -5.789  65.887 -0.762  1.00 76.56  ? 188 LEU A CA  1 
ATOM   965  C  C   . LEU A 1 188 ? -4.437  66.524 -0.406  1.00 80.92  ? 188 LEU A C   1 
ATOM   966  O  O   . LEU A 1 188 ? -3.434  65.807 -0.371  1.00 80.23  ? 188 LEU A O   1 
ATOM   967  C  CB  . LEU A 1 188 ? -6.063  66.019 -2.262  1.00 76.34  ? 188 LEU A CB  1 
ATOM   968  C  CG  . LEU A 1 188 ? -7.339  65.373 -2.796  1.00 82.62  ? 188 LEU A CG  1 
ATOM   969  C  CD1 . LEU A 1 188 ? -7.782  66.047 -4.081  1.00 83.25  ? 188 LEU A CD1 1 
ATOM   970  C  CD2 . LEU A 1 188 ? -7.155  63.883 -3.022  1.00 85.01  ? 188 LEU A CD2 1 
ATOM   971  N  N   . VAL A 1 189 ? -4.406  67.864 -0.163  1.00 77.95  ? 189 VAL A N   1 
ATOM   972  C  CA  . VAL A 1 189 ? -3.200  68.628 0.208   1.00 76.88  ? 189 VAL A CA  1 
ATOM   973  C  C   . VAL A 1 189 ? -2.720  68.149 1.576   1.00 82.53  ? 189 VAL A C   1 
ATOM   974  O  O   . VAL A 1 189 ? -1.518  67.974 1.769   1.00 81.80  ? 189 VAL A O   1 
ATOM   975  C  CB  . VAL A 1 189 ? -3.413  70.166 0.127   1.00 80.66  ? 189 VAL A CB  1 
ATOM   976  C  CG1 . VAL A 1 189 ? -2.231  70.932 0.706   1.00 80.21  ? 189 VAL A CG1 1 
ATOM   977  C  CG2 . VAL A 1 189 ? -3.640  70.597 -1.309  1.00 80.14  ? 189 VAL A CG2 1 
ATOM   978  N  N   . SER A 1 190 ? -3.672  67.873 2.494   1.00 81.10  ? 190 SER A N   1 
ATOM   979  C  CA  . SER A 1 190 ? -3.402  67.320 3.821   1.00 81.84  ? 190 SER A CA  1 
ATOM   980  C  C   . SER A 1 190 ? -2.827  65.897 3.664   1.00 86.90  ? 190 SER A C   1 
ATOM   981  O  O   . SER A 1 190 ? -1.712  65.648 4.124   1.00 85.93  ? 190 SER A O   1 
ATOM   982  C  CB  . SER A 1 190 ? -4.672  67.314 4.669   1.00 85.77  ? 190 SER A CB  1 
ATOM   983  O  OG  . SER A 1 190 ? -4.703  66.252 5.609   1.00 92.04  ? 190 SER A OG  1 
ATOM   984  N  N   . ALA A 1 191 ? -3.557  65.002 2.940   1.00 84.77  ? 191 ALA A N   1 
ATOM   985  C  CA  . ALA A 1 191 ? -3.207  63.599 2.659   1.00 84.65  ? 191 ALA A CA  1 
ATOM   986  C  C   . ALA A 1 191 ? -1.749  63.398 2.260   1.00 88.15  ? 191 ALA A C   1 
ATOM   987  O  O   . ALA A 1 191 ? -1.160  62.372 2.598   1.00 88.19  ? 191 ALA A O   1 
ATOM   988  C  CB  . ALA A 1 191 ? -4.119  63.034 1.581   1.00 85.66  ? 191 ALA A CB  1 
ATOM   989  N  N   . ALA A 1 192 ? -1.166  64.394 1.573   1.00 84.31  ? 192 ALA A N   1 
ATOM   990  C  CA  . ALA A 1 192 ? 0.222   64.395 1.109   1.00 83.47  ? 192 ALA A CA  1 
ATOM   991  C  C   . ALA A 1 192 ? 1.274   64.453 2.242   1.00 87.20  ? 192 ALA A C   1 
ATOM   992  O  O   . ALA A 1 192 ? 2.454   64.212 1.973   1.00 87.16  ? 192 ALA A O   1 
ATOM   993  C  CB  . ALA A 1 192 ? 0.436   65.540 0.130   1.00 83.53  ? 192 ALA A CB  1 
ATOM   994  N  N   . PHE A 1 193 ? 0.862   64.766 3.486   1.00 82.99  ? 193 PHE A N   1 
ATOM   995  C  CA  . PHE A 1 193 ? 1.784   64.860 4.616   1.00 83.34  ? 193 PHE A CA  1 
ATOM   996  C  C   . PHE A 1 193 ? 1.152   64.433 5.956   1.00 88.97  ? 193 PHE A C   1 
ATOM   997  O  O   . PHE A 1 193 ? 1.827   64.481 6.986   1.00 89.68  ? 193 PHE A O   1 
ATOM   998  C  CB  . PHE A 1 193 ? 2.369   66.289 4.702   1.00 85.33  ? 193 PHE A CB  1 
ATOM   999  C  CG  . PHE A 1 193 ? 1.403   67.340 5.201   1.00 88.18  ? 193 PHE A CG  1 
ATOM   1000 C  CD1 . PHE A 1 193 ? 0.545   67.992 4.323   1.00 91.31  ? 193 PHE A CD1 1 
ATOM   1001 C  CD2 . PHE A 1 193 ? 1.352   67.680 6.552   1.00 92.16  ? 193 PHE A CD2 1 
ATOM   1002 C  CE1 . PHE A 1 193 ? -0.361  68.949 4.791   1.00 93.57  ? 193 PHE A CE1 1 
ATOM   1003 C  CE2 . PHE A 1 193 ? 0.444   68.635 7.019   1.00 96.09  ? 193 PHE A CE2 1 
ATOM   1004 C  CZ  . PHE A 1 193 ? -0.424  69.240 6.141   1.00 94.06  ? 193 PHE A CZ  1 
ATOM   1005 N  N   . ARG A 1 194 ? -0.140  64.044 5.947   1.00 85.68  ? 194 ARG A N   1 
ATOM   1006 C  CA  . ARG A 1 194 ? -0.900  63.658 7.136   1.00 86.52  ? 194 ARG A CA  1 
ATOM   1007 C  C   . ARG A 1 194 ? -1.724  62.405 6.935   1.00 91.27  ? 194 ARG A C   1 
ATOM   1008 O  O   . ARG A 1 194 ? -2.347  62.225 5.887   1.00 90.26  ? 194 ARG A O   1 
ATOM   1009 C  CB  . ARG A 1 194 ? -1.872  64.774 7.513   1.00 86.85  ? 194 ARG A CB  1 
ATOM   1010 C  CG  . ARG A 1 194 ? -1.321  65.815 8.439   1.00 97.17  ? 194 ARG A CG  1 
ATOM   1011 C  CD  . ARG A 1 194 ? -2.378  66.867 8.653   1.00 108.08 ? 194 ARG A CD  1 
ATOM   1012 N  NE  . ARG A 1 194 ? -1.917  67.922 9.547   1.00 122.76 ? 194 ARG A NE  1 
ATOM   1013 C  CZ  . ARG A 1 194 ? -2.548  69.077 9.718   1.00 141.90 ? 194 ARG A CZ  1 
ATOM   1014 N  NH1 . ARG A 1 194 ? -3.665  69.338 9.048   1.00 127.10 ? 194 ARG A NH1 1 
ATOM   1015 N  NH2 . ARG A 1 194 ? -2.064  69.985 10.556  1.00 133.88 ? 194 ARG A NH2 1 
ATOM   1016 N  N   . SER A 1 195 ? -1.794  61.583 7.982   1.00 90.03  ? 195 SER A N   1 
ATOM   1017 C  CA  . SER A 1 195 ? -2.606  60.368 8.034   1.00 91.36  ? 195 SER A CA  1 
ATOM   1018 C  C   . SER A 1 195 ? -3.595  60.521 9.186   1.00 96.39  ? 195 SER A C   1 
ATOM   1019 O  O   . SER A 1 195 ? -3.358  61.340 10.070  1.00 96.33  ? 195 SER A O   1 
ATOM   1020 C  CB  . SER A 1 195 ? -1.727  59.141 8.259   1.00 96.64  ? 195 SER A CB  1 
ATOM   1021 O  OG  . SER A 1 195 ? -0.868  58.898 7.156   1.00 107.55 ? 195 SER A OG  1 
ATOM   1022 N  N   . TYR A 1 196 ? -4.703  59.767 9.177   1.00 94.39  ? 196 TYR A N   1 
ATOM   1023 C  CA  . TYR A 1 196 ? -5.681  59.844 10.262  1.00 96.74  ? 196 TYR A CA  1 
ATOM   1024 C  C   . TYR A 1 196 ? -5.381  58.767 11.306  1.00 105.06 ? 196 TYR A C   1 
ATOM   1025 O  O   . TYR A 1 196 ? -5.106  57.615 10.947  1.00 104.67 ? 196 TYR A O   1 
ATOM   1026 C  CB  . TYR A 1 196 ? -7.123  59.707 9.735   1.00 98.13  ? 196 TYR A CB  1 
ATOM   1027 C  CG  . TYR A 1 196 ? -8.184  60.225 10.683  1.00 101.02 ? 196 TYR A CG  1 
ATOM   1028 C  CD1 . TYR A 1 196 ? -8.619  59.459 11.761  1.00 105.30 ? 196 TYR A CD1 1 
ATOM   1029 C  CD2 . TYR A 1 196 ? -8.792  61.457 10.473  1.00 101.46 ? 196 TYR A CD2 1 
ATOM   1030 C  CE1 . TYR A 1 196 ? -9.584  59.935 12.647  1.00 107.92 ? 196 TYR A CE1 1 
ATOM   1031 C  CE2 . TYR A 1 196 ? -9.779  61.933 11.337  1.00 104.73 ? 196 TYR A CE2 1 
ATOM   1032 C  CZ  . TYR A 1 196 ? -10.177 61.165 12.420  1.00 113.11 ? 196 TYR A CZ  1 
ATOM   1033 O  OH  . TYR A 1 196 ? -11.149 61.619 13.277  1.00 114.76 ? 196 TYR A OH  1 
ATOM   1034 N  N   . SER A 1 197 ? -5.422  59.153 12.598  1.00 105.06 ? 197 SER A N   1 
ATOM   1035 C  CA  . SER A 1 197 ? -5.221  58.243 13.724  1.00 107.89 ? 197 SER A CA  1 
ATOM   1036 C  C   . SER A 1 197 ? -5.978  58.748 14.954  1.00 115.37 ? 197 SER A C   1 
ATOM   1037 O  O   . SER A 1 197 ? -5.431  59.511 15.756  1.00 115.98 ? 197 SER A O   1 
ATOM   1038 C  CB  . SER A 1 197 ? -3.739  58.037 14.015  1.00 112.01 ? 197 SER A CB  1 
ATOM   1039 O  OG  . SER A 1 197 ? -3.580  57.064 15.035  1.00 127.24 ? 197 SER A OG  1 
ATOM   1040 N  N   . THR A 1 198 ? -7.254  58.326 15.082  1.00 113.98 ? 198 THR A N   1 
ATOM   1041 C  CA  . THR A 1 198 ? -8.188  58.721 16.143  1.00 116.53 ? 198 THR A CA  1 
ATOM   1042 C  C   . THR A 1 198 ? -7.584  58.478 17.546  1.00 123.41 ? 198 THR A C   1 
ATOM   1043 O  O   . THR A 1 198 ? -6.825  57.521 17.738  1.00 123.14 ? 198 THR A O   1 
ATOM   1044 C  CB  . THR A 1 198 ? -9.574  58.078 15.900  1.00 122.42 ? 198 THR A CB  1 
ATOM   1045 O  OG1 . THR A 1 198 ? -10.590 58.885 16.481  1.00 123.36 ? 198 THR A OG1 1 
ATOM   1046 C  CG2 . THR A 1 198 ? -9.682  56.625 16.361  1.00 121.45 ? 198 THR A CG2 1 
ATOM   1047 N  N   . THR A 1 199 ? -7.864  59.404 18.491  1.00 122.34 ? 199 THR A N   1 
ATOM   1048 C  CA  . THR A 1 199 ? -7.351  59.372 19.871  1.00 155.46 ? 199 THR A CA  1 
ATOM   1049 C  C   . THR A 1 199 ? -8.489  59.375 20.898  1.00 194.07 ? 199 THR A C   1 
ATOM   1050 O  O   . THR A 1 199 ? -8.298  58.981 22.050  1.00 159.72 ? 199 THR A O   1 
ATOM   1051 C  CB  . THR A 1 199 ? -6.380  60.540 20.113  1.00 161.70 ? 199 THR A CB  1 
ATOM   1052 O  OG1 . THR A 1 199 ? -7.037  61.764 19.788  1.00 161.10 ? 199 THR A OG1 1 
ATOM   1053 C  CG2 . THR A 1 199 ? -5.083  60.413 19.312  1.00 157.12 ? 199 THR A CG2 1 
ATOM   1054 N  N   . GLN A 1 216 ? -6.528  64.400 16.064  1.00 119.60 ? 216 GLN A N   1 
ATOM   1055 C  CA  . GLN A 1 216 ? -6.802  63.062 15.537  1.00 119.04 ? 216 GLN A CA  1 
ATOM   1056 C  C   . GLN A 1 216 ? -6.125  62.769 14.171  1.00 119.93 ? 216 GLN A C   1 
ATOM   1057 O  O   . GLN A 1 216 ? -6.167  61.631 13.694  1.00 118.19 ? 216 GLN A O   1 
ATOM   1058 C  CB  . GLN A 1 216 ? -8.311  62.796 15.487  1.00 122.37 ? 216 GLN A CB  1 
ATOM   1059 C  CG  . GLN A 1 216 ? -8.877  62.454 16.860  1.00 147.59 ? 216 GLN A CG  1 
ATOM   1060 C  CD  . GLN A 1 216 ? -10.378 62.317 16.889  1.00 180.15 ? 216 GLN A CD  1 
ATOM   1061 O  OE1 . GLN A 1 216 ? -11.115 62.991 16.160  1.00 178.44 ? 216 GLN A OE1 1 
ATOM   1062 N  NE2 . GLN A 1 216 ? -10.870 61.479 17.788  1.00 178.67 ? 216 GLN A NE2 1 
ATOM   1063 N  N   . GLU A 1 217 ? -5.471  63.779 13.572  1.00 115.78 ? 217 GLU A N   1 
ATOM   1064 C  CA  . GLU A 1 217 ? -4.756  63.607 12.310  1.00 113.53 ? 217 GLU A CA  1 
ATOM   1065 C  C   . GLU A 1 217 ? -3.234  63.730 12.508  1.00 117.13 ? 217 GLU A C   1 
ATOM   1066 O  O   . GLU A 1 217 ? -2.688  64.841 12.538  1.00 116.76 ? 217 GLU A O   1 
ATOM   1067 C  CB  . GLU A 1 217 ? -5.296  64.547 11.216  1.00 113.87 ? 217 GLU A CB  1 
ATOM   1068 C  CG  . GLU A 1 217 ? -5.565  63.828 9.903   1.00 123.64 ? 217 GLU A CG  1 
ATOM   1069 C  CD  . GLU A 1 217 ? -6.378  64.581 8.866   1.00 150.10 ? 217 GLU A CD  1 
ATOM   1070 O  OE1 . GLU A 1 217 ? -6.105  65.785 8.651   1.00 150.41 ? 217 GLU A OE1 1 
ATOM   1071 O  OE2 . GLU A 1 217 ? -7.252  63.951 8.227   1.00 145.59 ? 217 GLU A OE2 1 
ATOM   1072 N  N   . VAL A 1 218 ? -2.564  62.564 12.677  1.00 113.10 ? 218 VAL A N   1 
ATOM   1073 C  CA  . VAL A 1 218 ? -1.115  62.420 12.883  1.00 111.70 ? 218 VAL A CA  1 
ATOM   1074 C  C   . VAL A 1 218 ? -0.304  62.810 11.619  1.00 111.12 ? 218 VAL A C   1 
ATOM   1075 O  O   . VAL A 1 218 ? -0.808  62.690 10.500  1.00 109.11 ? 218 VAL A O   1 
ATOM   1076 C  CB  . VAL A 1 218 ? -0.766  60.997 13.421  1.00 116.81 ? 218 VAL A CB  1 
ATOM   1077 C  CG1 . VAL A 1 218 ? -0.894  59.915 12.348  1.00 115.33 ? 218 VAL A CG1 1 
ATOM   1078 C  CG2 . VAL A 1 218 ? 0.612   60.959 14.076  1.00 117.22 ? 218 VAL A CG2 1 
ATOM   1079 N  N   . GLU A 1 219 ? 0.938   63.295 11.810  1.00 106.55 ? 219 GLU A N   1 
ATOM   1080 C  CA  . GLU A 1 219 ? 1.825   63.686 10.711  1.00 104.26 ? 219 GLU A CA  1 
ATOM   1081 C  C   . GLU A 1 219 ? 2.426   62.451 10.071  1.00 106.92 ? 219 GLU A C   1 
ATOM   1082 O  O   . GLU A 1 219 ? 2.630   61.440 10.738  1.00 107.52 ? 219 GLU A O   1 
ATOM   1083 C  CB  . GLU A 1 219 ? 2.913   64.684 11.155  1.00 106.08 ? 219 GLU A CB  1 
ATOM   1084 C  CG  . GLU A 1 219 ? 2.386   65.970 11.794  1.00 120.61 ? 219 GLU A CG  1 
ATOM   1085 C  CD  . GLU A 1 219 ? 1.386   66.807 11.010  1.00 141.78 ? 219 GLU A CD  1 
ATOM   1086 O  OE1 . GLU A 1 219 ? 1.593   66.997 9.789   1.00 142.42 ? 219 GLU A OE1 1 
ATOM   1087 O  OE2 . GLU A 1 219 ? 0.410   67.299 11.625  1.00 129.31 ? 219 GLU A OE2 1 
ATOM   1088 N  N   . GLY A 1 220 ? 2.663   62.538 8.773   1.00 102.23 ? 220 GLY A N   1 
ATOM   1089 C  CA  . GLY A 1 220 ? 3.174   61.448 7.955   1.00 101.31 ? 220 GLY A CA  1 
ATOM   1090 C  C   . GLY A 1 220 ? 2.170   61.114 6.874   1.00 103.68 ? 220 GLY A C   1 
ATOM   1091 O  O   . GLY A 1 220 ? 1.004   60.854 7.177   1.00 103.49 ? 220 GLY A O   1 
ATOM   1092 N  N   . MET A 1 221 ? 2.618   61.161 5.608   1.00 98.96  ? 221 MET A N   1 
ATOM   1093 C  CA  . MET A 1 221 ? 1.849   60.916 4.380   1.00 97.91  ? 221 MET A CA  1 
ATOM   1094 C  C   . MET A 1 221 ? 0.856   59.746 4.452   1.00 100.87 ? 221 MET A C   1 
ATOM   1095 O  O   . MET A 1 221 ? 1.175   58.690 5.002   1.00 101.77 ? 221 MET A O   1 
ATOM   1096 C  CB  . MET A 1 221 ? 2.823   60.725 3.199   1.00 99.58  ? 221 MET A CB  1 
ATOM   1097 C  CG  . MET A 1 221 ? 2.173   60.292 1.910   1.00 103.27 ? 221 MET A CG  1 
ATOM   1098 S  SD  . MET A 1 221 ? 3.161   60.793 0.501   1.00 107.31 ? 221 MET A SD  1 
ATOM   1099 C  CE  . MET A 1 221 ? 2.636   59.581 -0.708  1.00 104.52 ? 221 MET A CE  1 
ATOM   1100 N  N   . ASN A 1 222 ? -0.341  59.950 3.882   1.00 95.52  ? 222 ASN A N   1 
ATOM   1101 C  CA  . ASN A 1 222 ? -1.380  58.934 3.764   1.00 95.53  ? 222 ASN A CA  1 
ATOM   1102 C  C   . ASN A 1 222 ? -1.196  58.318 2.368   1.00 98.55  ? 222 ASN A C   1 
ATOM   1103 O  O   . ASN A 1 222 ? -1.859  58.739 1.413   1.00 98.19  ? 222 ASN A O   1 
ATOM   1104 C  CB  . ASN A 1 222 ? -2.773  59.567 3.940   1.00 92.97  ? 222 ASN A CB  1 
ATOM   1105 C  CG  . ASN A 1 222 ? -3.961  58.650 3.751   1.00 102.96 ? 222 ASN A CG  1 
ATOM   1106 O  OD1 . ASN A 1 222 ? -3.851  57.436 3.529   1.00 91.40  ? 222 ASN A OD1 1 
ATOM   1107 N  ND2 . ASN A 1 222 ? -5.142  59.231 3.826   1.00 96.61  ? 222 ASN A ND2 1 
ATOM   1108 N  N   . ILE A 1 223 ? -0.251  57.354 2.248   1.00 94.29  ? 223 ILE A N   1 
ATOM   1109 C  CA  . ILE A 1 223 ? 0.083   56.670 0.990   1.00 93.43  ? 223 ILE A CA  1 
ATOM   1110 C  C   . ILE A 1 223 ? -1.146  55.969 0.402   1.00 97.11  ? 223 ILE A C   1 
ATOM   1111 O  O   . ILE A 1 223 ? -1.475  56.221 -0.751  1.00 96.72  ? 223 ILE A O   1 
ATOM   1112 C  CB  . ILE A 1 223 ? 1.321   55.731 1.111   1.00 96.97  ? 223 ILE A CB  1 
ATOM   1113 C  CG1 . ILE A 1 223 ? 2.566   56.513 1.582   1.00 96.64  ? 223 ILE A CG1 1 
ATOM   1114 C  CG2 . ILE A 1 223 ? 1.610   55.005 -0.221  1.00 97.91  ? 223 ILE A CG2 1 
ATOM   1115 C  CD1 . ILE A 1 223 ? 3.524   55.720 2.453   1.00 106.12 ? 223 ILE A CD1 1 
ATOM   1116 N  N   . LEU A 1 224 ? -1.843  55.150 1.206   1.00 94.04  ? 224 LEU A N   1 
ATOM   1117 C  CA  . LEU A 1 224 ? -3.051  54.418 0.818   1.00 95.00  ? 224 LEU A CA  1 
ATOM   1118 C  C   . LEU A 1 224 ? -4.134  55.329 0.229   1.00 97.15  ? 224 LEU A C   1 
ATOM   1119 O  O   . LEU A 1 224 ? -4.666  55.010 -0.833  1.00 97.10  ? 224 LEU A O   1 
ATOM   1120 C  CB  . LEU A 1 224 ? -3.582  53.615 2.019   1.00 97.11  ? 224 LEU A CB  1 
ATOM   1121 C  CG  . LEU A 1 224 ? -5.001  53.050 1.952   1.00 104.18 ? 224 LEU A CG  1 
ATOM   1122 C  CD1 . LEU A 1 224 ? -5.081  51.848 1.015   1.00 105.68 ? 224 LEU A CD1 1 
ATOM   1123 C  CD2 . LEU A 1 224 ? -5.475  52.668 3.334   1.00 109.30 ? 224 LEU A CD2 1 
ATOM   1124 N  N   . GLY A 1 225 ? -4.415  56.448 0.905   1.00 92.22  ? 225 GLY A N   1 
ATOM   1125 C  CA  . GLY A 1 225 ? -5.392  57.446 0.476   1.00 91.63  ? 225 GLY A CA  1 
ATOM   1126 C  C   . GLY A 1 225 ? -5.061  58.095 -0.853  1.00 93.50  ? 225 GLY A C   1 
ATOM   1127 O  O   . GLY A 1 225 ? -5.966  58.425 -1.626  1.00 93.51  ? 225 GLY A O   1 
ATOM   1128 N  N   . LEU A 1 226 ? -3.751  58.266 -1.128  1.00 87.93  ? 226 LEU A N   1 
ATOM   1129 C  CA  . LEU A 1 226 ? -3.234  58.827 -2.376  1.00 86.26  ? 226 LEU A CA  1 
ATOM   1130 C  C   . LEU A 1 226 ? -3.200  57.771 -3.487  1.00 91.98  ? 226 LEU A C   1 
ATOM   1131 O  O   . LEU A 1 226 ? -3.491  58.103 -4.634  1.00 92.39  ? 226 LEU A O   1 
ATOM   1132 C  CB  . LEU A 1 226 ? -1.863  59.495 -2.175  1.00 84.44  ? 226 LEU A CB  1 
ATOM   1133 C  CG  . LEU A 1 226 ? -1.879  60.778 -1.342  1.00 88.11  ? 226 LEU A CG  1 
ATOM   1134 C  CD1 . LEU A 1 226 ? -0.497  61.186 -0.950  1.00 87.03  ? 226 LEU A CD1 1 
ATOM   1135 C  CD2 . LEU A 1 226 ? -2.570  61.918 -2.071  1.00 90.54  ? 226 LEU A CD2 1 
ATOM   1136 N  N   . VAL A 1 227 ? -2.885  56.497 -3.144  1.00 89.00  ? 227 VAL A N   1 
ATOM   1137 C  CA  . VAL A 1 227 ? -2.873  55.353 -4.069  1.00 89.41  ? 227 VAL A CA  1 
ATOM   1138 C  C   . VAL A 1 227 ? -4.313  55.170 -4.596  1.00 92.87  ? 227 VAL A C   1 
ATOM   1139 O  O   . VAL A 1 227 ? -4.502  55.084 -5.811  1.00 92.46  ? 227 VAL A O   1 
ATOM   1140 C  CB  . VAL A 1 227 ? -2.307  54.058 -3.398  1.00 94.52  ? 227 VAL A CB  1 
ATOM   1141 C  CG1 . VAL A 1 227 ? -2.575  52.814 -4.241  1.00 96.32  ? 227 VAL A CG1 1 
ATOM   1142 C  CG2 . VAL A 1 227 ? -0.815  54.181 -3.110  1.00 93.19  ? 227 VAL A CG2 1 
ATOM   1143 N  N   . VAL A 1 228 ? -5.322  55.184 -3.678  1.00 89.09  ? 228 VAL A N   1 
ATOM   1144 C  CA  . VAL A 1 228 ? -6.748  55.061 -4.006  1.00 89.91  ? 228 VAL A CA  1 
ATOM   1145 C  C   . VAL A 1 228 ? -7.139  56.178 -4.963  1.00 92.80  ? 228 VAL A C   1 
ATOM   1146 O  O   . VAL A 1 228 ? -7.420  55.883 -6.123  1.00 93.02  ? 228 VAL A O   1 
ATOM   1147 C  CB  . VAL A 1 228 ? -7.674  54.986 -2.757  1.00 94.44  ? 228 VAL A CB  1 
ATOM   1148 C  CG1 . VAL A 1 228 ? -9.150  55.055 -3.146  1.00 95.84  ? 228 VAL A CG1 1 
ATOM   1149 C  CG2 . VAL A 1 228 ? -7.402  53.722 -1.954  1.00 95.51  ? 228 VAL A CG2 1 
ATOM   1150 N  N   . PHE A 1 229 ? -7.070  57.451 -4.504  1.00 87.88  ? 229 PHE A N   1 
ATOM   1151 C  CA  . PHE A 1 229 ? -7.408  58.627 -5.305  1.00 87.26  ? 229 PHE A CA  1 
ATOM   1152 C  C   . PHE A 1 229 ? -6.715  58.658 -6.673  1.00 89.45  ? 229 PHE A C   1 
ATOM   1153 O  O   . PHE A 1 229 ? -7.382  58.958 -7.663  1.00 90.41  ? 229 PHE A O   1 
ATOM   1154 C  CB  . PHE A 1 229 ? -7.168  59.937 -4.535  1.00 88.19  ? 229 PHE A CB  1 
ATOM   1155 C  CG  . PHE A 1 229 ? -7.434  61.162 -5.377  1.00 90.08  ? 229 PHE A CG  1 
ATOM   1156 C  CD1 . PHE A 1 229 ? -8.734  61.603 -5.603  1.00 95.28  ? 229 PHE A CD1 1 
ATOM   1157 C  CD2 . PHE A 1 229 ? -6.388  61.838 -5.999  1.00 91.52  ? 229 PHE A CD2 1 
ATOM   1158 C  CE1 . PHE A 1 229 ? -8.985  62.703 -6.432  1.00 96.53  ? 229 PHE A CE1 1 
ATOM   1159 C  CE2 . PHE A 1 229 ? -6.639  62.939 -6.826  1.00 94.76  ? 229 PHE A CE2 1 
ATOM   1160 C  CZ  . PHE A 1 229 ? -7.936  63.366 -7.035  1.00 94.31  ? 229 PHE A CZ  1 
ATOM   1161 N  N   . SER A 1 230 ? -5.402  58.355 -6.734  1.00 83.38  ? 230 SER A N   1 
ATOM   1162 C  CA  . SER A 1 230 ? -4.661  58.331 -7.995  1.00 82.57  ? 230 SER A CA  1 
ATOM   1163 C  C   . SER A 1 230 ? -5.240  57.303 -8.977  1.00 89.36  ? 230 SER A C   1 
ATOM   1164 O  O   . SER A 1 230 ? -5.355  57.615 -10.166 1.00 89.77  ? 230 SER A O   1 
ATOM   1165 C  CB  . SER A 1 230 ? -3.181  58.062 -7.758  1.00 84.05  ? 230 SER A CB  1 
ATOM   1166 O  OG  . SER A 1 230 ? -2.598  59.107 -7.001  1.00 90.15  ? 230 SER A OG  1 
ATOM   1167 N  N   . ILE A 1 231 ? -5.634  56.095 -8.475  1.00 87.23  ? 231 ILE A N   1 
ATOM   1168 C  CA  . ILE A 1 231 ? -6.232  55.012 -9.276  1.00 88.89  ? 231 ILE A CA  1 
ATOM   1169 C  C   . ILE A 1 231 ? -7.539  55.488 -9.903  1.00 94.19  ? 231 ILE A C   1 
ATOM   1170 O  O   . ILE A 1 231 ? -7.709  55.350 -11.116 1.00 95.55  ? 231 ILE A O   1 
ATOM   1171 C  CB  . ILE A 1 231 ? -6.384  53.682 -8.476  1.00 93.05  ? 231 ILE A CB  1 
ATOM   1172 C  CG1 . ILE A 1 231 ? -5.019  52.986 -8.314  1.00 92.82  ? 231 ILE A CG1 1 
ATOM   1173 C  CG2 . ILE A 1 231 ? -7.399  52.731 -9.132  1.00 96.06  ? 231 ILE A CG2 1 
ATOM   1174 C  CD1 . ILE A 1 231 ? -4.881  52.085 -7.082  1.00 99.04  ? 231 ILE A CD1 1 
ATOM   1175 N  N   . VAL A 1 232 ? -8.434  56.090 -9.087  1.00 90.00  ? 232 VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 232 ? -9.720  56.620 -9.553  1.00 90.71  ? 232 VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 232 ? -9.530  57.798 -10.510 1.00 93.06  ? 232 VAL A C   1 
ATOM   1178 O  O   . VAL A 1 232 ? -10.268 57.909 -11.491 1.00 93.74  ? 232 VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 232 ? -10.740 56.952 -8.437  1.00 94.73  ? 232 VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 232 ? -12.134 56.508 -8.848  1.00 97.48  ? 232 VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 232 ? -10.358 56.326 -7.106  1.00 93.96  ? 232 VAL A CG2 1 
ATOM   1182 N  N   . PHE A 1 233 ? -8.529  58.658 -10.233 1.00 87.30  ? 233 PHE A N   1 
ATOM   1183 C  CA  . PHE A 1 233 ? -8.213  59.810 -11.072 1.00 86.43  ? 233 PHE A CA  1 
ATOM   1184 C  C   . PHE A 1 233 ? -7.657  59.364 -12.433 1.00 91.35  ? 233 PHE A C   1 
ATOM   1185 O  O   . PHE A 1 233 ? -7.975  59.986 -13.450 1.00 91.80  ? 233 PHE A O   1 
ATOM   1186 C  CB  . PHE A 1 233 ? -7.259  60.786 -10.358 1.00 85.93  ? 233 PHE A CB  1 
ATOM   1187 C  CG  . PHE A 1 233 ? -7.217  62.158 -10.990 1.00 87.11  ? 233 PHE A CG  1 
ATOM   1188 C  CD1 . PHE A 1 233 ? -8.153  63.126 -10.651 1.00 90.81  ? 233 PHE A CD1 1 
ATOM   1189 C  CD2 . PHE A 1 233 ? -6.253  62.477 -11.939 1.00 88.73  ? 233 PHE A CD2 1 
ATOM   1190 C  CE1 . PHE A 1 233 ? -8.123  64.390 -11.250 1.00 91.42  ? 233 PHE A CE1 1 
ATOM   1191 C  CE2 . PHE A 1 233 ? -6.226  63.740 -12.536 1.00 91.22  ? 233 PHE A CE2 1 
ATOM   1192 C  CZ  . PHE A 1 233 ? -7.159  64.688 -12.186 1.00 89.64  ? 233 PHE A CZ  1 
ATOM   1193 N  N   . GLY A 1 234 ? -6.858  58.291 -12.431 1.00 87.74  ? 234 GLY A N   1 
ATOM   1194 C  CA  . GLY A 1 234 ? -6.279  57.699 -13.635 1.00 88.46  ? 234 GLY A CA  1 
ATOM   1195 C  C   . GLY A 1 234 ? -7.361  57.171 -14.554 1.00 94.76  ? 234 GLY A C   1 
ATOM   1196 O  O   . GLY A 1 234 ? -7.367  57.456 -15.755 1.00 95.31  ? 234 GLY A O   1 
ATOM   1197 N  N   . ILE A 1 235 ? -8.321  56.443 -13.959 1.00 92.34  ? 235 ILE A N   1 
ATOM   1198 C  CA  . ILE A 1 235 ? -9.505  55.884 -14.610 1.00 94.69  ? 235 ILE A CA  1 
ATOM   1199 C  C   . ILE A 1 235 ? -10.345 57.018 -15.231 1.00 99.73  ? 235 ILE A C   1 
ATOM   1200 O  O   . ILE A 1 235 ? -10.786 56.882 -16.368 1.00 101.58 ? 235 ILE A O   1 
ATOM   1201 C  CB  . ILE A 1 235 ? -10.285 55.018 -13.576 1.00 98.61  ? 235 ILE A CB  1 
ATOM   1202 C  CG1 . ILE A 1 235 ? -9.623  53.633 -13.422 1.00 99.13  ? 235 ILE A CG1 1 
ATOM   1203 C  CG2 . ILE A 1 235 ? -11.789 54.904 -13.895 1.00 102.18 ? 235 ILE A CG2 1 
ATOM   1204 C  CD1 . ILE A 1 235 ? -9.863  52.943 -12.083 1.00 105.89 ? 235 ILE A CD1 1 
ATOM   1205 N  N   . ALA A 1 236 ? -10.517 58.137 -14.501 1.00 95.42  ? 236 ALA A N   1 
ATOM   1206 C  CA  . ALA A 1 236 ? -11.280 59.312 -14.929 1.00 96.24  ? 236 ALA A CA  1 
ATOM   1207 C  C   . ALA A 1 236 ? -10.683 59.991 -16.155 1.00 101.21 ? 236 ALA A C   1 
ATOM   1208 O  O   . ALA A 1 236 ? -11.440 60.475 -17.000 1.00 102.55 ? 236 ALA A O   1 
ATOM   1209 C  CB  . ALA A 1 236 ? -11.398 60.307 -13.789 1.00 95.39  ? 236 ALA A CB  1 
ATOM   1210 N  N   . LEU A 1 237 ? -9.332  60.030 -16.258 1.00 96.99  ? 237 LEU A N   1 
ATOM   1211 C  CA  . LEU A 1 237 ? -8.648  60.618 -17.418 1.00 97.18  ? 237 LEU A CA  1 
ATOM   1212 C  C   . LEU A 1 237 ? -8.726  59.664 -18.598 1.00 105.28 ? 237 LEU A C   1 
ATOM   1213 O  O   . LEU A 1 237 ? -8.794  60.107 -19.741 1.00 105.94 ? 237 LEU A O   1 
ATOM   1214 C  CB  . LEU A 1 237 ? -7.195  61.017 -17.118 1.00 94.68  ? 237 LEU A CB  1 
ATOM   1215 C  CG  . LEU A 1 237 ? -6.989  62.180 -16.143 1.00 97.10  ? 237 LEU A CG  1 
ATOM   1216 C  CD1 . LEU A 1 237 ? -5.532  62.392 -15.870 1.00 95.26  ? 237 LEU A CD1 1 
ATOM   1217 C  CD2 . LEU A 1 237 ? -7.592  63.470 -16.667 1.00 100.04 ? 237 LEU A CD2 1 
ATOM   1218 N  N   . GLY A 1 238 ? -8.750  58.365 -18.296 1.00 104.21 ? 238 GLY A N   1 
ATOM   1219 C  CA  . GLY A 1 238 ? -8.915  57.301 -19.275 1.00 107.14 ? 238 GLY A CA  1 
ATOM   1220 C  C   . GLY A 1 238 ? -10.313 57.325 -19.857 1.00 114.94 ? 238 GLY A C   1 
ATOM   1221 O  O   . GLY A 1 238 ? -10.480 57.068 -21.050 1.00 117.52 ? 238 GLY A O   1 
ATOM   1222 N  N   . LYS A 1 239 ? -11.324 57.672 -19.019 1.00 112.11 ? 239 LYS A N   1 
ATOM   1223 C  CA  . LYS A 1 239 ? -12.739 57.794 -19.391 1.00 115.26 ? 239 LYS A CA  1 
ATOM   1224 C  C   . LYS A 1 239 ? -12.926 58.936 -20.407 1.00 122.03 ? 239 LYS A C   1 
ATOM   1225 O  O   . LYS A 1 239 ? -13.607 58.738 -21.417 1.00 125.04 ? 239 LYS A O   1 
ATOM   1226 C  CB  . LYS A 1 239 ? -13.626 57.985 -18.146 1.00 117.25 ? 239 LYS A CB  1 
ATOM   1227 C  CG  . LYS A 1 239 ? -15.128 57.822 -18.396 1.00 135.66 ? 239 LYS A CG  1 
ATOM   1228 C  CD  . LYS A 1 239 ? -15.946 57.942 -17.103 1.00 146.87 ? 239 LYS A CD  1 
ATOM   1229 C  CE  . LYS A 1 239 ? -17.391 58.332 -17.338 1.00 158.17 ? 239 LYS A CE  1 
ATOM   1230 N  NZ  . LYS A 1 239 ? -18.115 58.595 -16.062 1.00 163.30 ? 239 LYS A NZ  1 
ATOM   1231 N  N   . MET A 1 240 ? -12.296 60.105 -20.166 1.00 117.08 ? 240 MET A N   1 
ATOM   1232 C  CA  . MET A 1 240 ? -12.359 61.226 -21.113 1.00 118.05 ? 240 MET A CA  1 
ATOM   1233 C  C   . MET A 1 240 ? -11.392 60.994 -22.275 1.00 123.05 ? 240 MET A C   1 
ATOM   1234 O  O   . MET A 1 240 ? -10.520 60.128 -22.189 1.00 122.17 ? 240 MET A O   1 
ATOM   1235 C  CB  . MET A 1 240 ? -12.146 62.592 -20.436 1.00 118.27 ? 240 MET A CB  1 
ATOM   1236 C  CG  . MET A 1 240 ? -10.921 62.666 -19.542 1.00 118.96 ? 240 MET A CG  1 
ATOM   1237 S  SD  . MET A 1 240 ? -10.875 64.124 -18.469 1.00 120.84 ? 240 MET A SD  1 
ATOM   1238 C  CE  . MET A 1 240 ? -12.122 63.733 -17.376 1.00 118.30 ? 240 MET A CE  1 
ATOM   1239 N  N   . GLY A 1 241 ? -11.572 61.742 -23.354 1.00 121.60 ? 241 GLY A N   1 
ATOM   1240 C  CA  . GLY A 1 241 ? -10.772 61.579 -24.562 1.00 122.64 ? 241 GLY A CA  1 
ATOM   1241 C  C   . GLY A 1 241 ? -9.451  62.309 -24.585 1.00 124.15 ? 241 GLY A C   1 
ATOM   1242 O  O   . GLY A 1 241 ? -8.587  62.079 -23.737 1.00 120.80 ? 241 GLY A O   1 
ATOM   1243 N  N   . GLU A 1 242 ? -9.292  63.174 -25.594 1.00 122.63 ? 242 GLU A N   1 
ATOM   1244 C  CA  . GLU A 1 242 ? -8.102  63.989 -25.826 1.00 121.45 ? 242 GLU A CA  1 
ATOM   1245 C  C   . GLU A 1 242 ? -7.968  65.096 -24.763 1.00 123.71 ? 242 GLU A C   1 
ATOM   1246 O  O   . GLU A 1 242 ? -6.862  65.597 -24.540 1.00 121.96 ? 242 GLU A O   1 
ATOM   1247 C  CB  . GLU A 1 242 ? -8.106  64.560 -27.253 1.00 125.41 ? 242 GLU A CB  1 
ATOM   1248 C  CG  . GLU A 1 242 ? -8.076  63.494 -28.342 1.00 141.67 ? 242 GLU A CG  1 
ATOM   1249 C  CD  . GLU A 1 242 ? -9.416  63.063 -28.918 1.00 170.86 ? 242 GLU A CD  1 
ATOM   1250 O  OE1 . GLU A 1 242 ? -10.277 62.583 -28.144 1.00 164.41 ? 242 GLU A OE1 1 
ATOM   1251 O  OE2 . GLU A 1 242 ? -9.587  63.162 -30.156 1.00 168.85 ? 242 GLU A OE2 1 
ATOM   1252 N  N   . GLN A 1 243 ? -9.089  65.457 -24.090 1.00 120.16 ? 243 GLN A N   1 
ATOM   1253 C  CA  . GLN A 1 243 ? -9.103  66.444 -23.006 1.00 117.55 ? 243 GLN A CA  1 
ATOM   1254 C  C   . GLN A 1 243 ? -8.245  65.898 -21.859 1.00 116.91 ? 243 GLN A C   1 
ATOM   1255 O  O   . GLN A 1 243 ? -7.429  66.631 -21.297 1.00 114.92 ? 243 GLN A O   1 
ATOM   1256 C  CB  . GLN A 1 243 ? -10.551 66.740 -22.546 1.00 120.27 ? 243 GLN A CB  1 
ATOM   1257 C  CG  . GLN A 1 243 ? -10.680 67.700 -21.349 1.00 138.79 ? 243 GLN A CG  1 
ATOM   1258 C  CD  . GLN A 1 243 ? -10.417 69.156 -21.676 1.00 160.69 ? 243 GLN A CD  1 
ATOM   1259 O  OE1 . GLN A 1 243 ? -9.280  69.577 -21.936 1.00 155.03 ? 243 GLN A OE1 1 
ATOM   1260 N  NE2 . GLN A 1 243 ? -11.459 69.971 -21.595 1.00 154.87 ? 243 GLN A NE2 1 
ATOM   1261 N  N   . GLY A 1 244 ? -8.397  64.603 -21.588 1.00 111.70 ? 244 GLY A N   1 
ATOM   1262 C  CA  . GLY A 1 244 ? -7.631  63.893 -20.577 1.00 108.65 ? 244 GLY A CA  1 
ATOM   1263 C  C   . GLY A 1 244 ? -6.162  63.756 -20.920 1.00 109.54 ? 244 GLY A C   1 
ATOM   1264 O  O   . GLY A 1 244 ? -5.329  63.758 -20.010 1.00 107.56 ? 244 GLY A O   1 
ATOM   1265 N  N   . GLN A 1 245 ? -5.831  63.673 -22.233 1.00 105.63 ? 245 GLN A N   1 
ATOM   1266 C  CA  . GLN A 1 245 ? -4.463  63.522 -22.744 1.00 104.49 ? 245 GLN A CA  1 
ATOM   1267 C  C   . GLN A 1 245 ? -3.489  64.563 -22.217 1.00 104.38 ? 245 GLN A C   1 
ATOM   1268 O  O   . GLN A 1 245 ? -2.360  64.188 -21.886 1.00 103.68 ? 245 GLN A O   1 
ATOM   1269 C  CB  . GLN A 1 245 ? -4.422  63.474 -24.280 1.00 108.75 ? 245 GLN A CB  1 
ATOM   1270 C  CG  . GLN A 1 245 ? -3.086  63.005 -24.882 1.00 128.67 ? 245 GLN A CG  1 
ATOM   1271 C  CD  . GLN A 1 245 ? -2.635  61.650 -24.381 1.00 154.54 ? 245 GLN A CD  1 
ATOM   1272 O  OE1 . GLN A 1 245 ? -3.374  60.659 -24.410 1.00 155.21 ? 245 GLN A OE1 1 
ATOM   1273 N  NE2 . GLN A 1 245 ? -1.402  61.577 -23.916 1.00 145.11 ? 245 GLN A NE2 1 
ATOM   1274 N  N   . LEU A 1 246 ? -3.913  65.850 -22.116 1.00 97.93  ? 246 LEU A N   1 
ATOM   1275 C  CA  . LEU A 1 246 ? -3.050  66.914 -21.585 1.00 94.63  ? 246 LEU A CA  1 
ATOM   1276 C  C   . LEU A 1 246 ? -2.527  66.579 -20.187 1.00 95.10  ? 246 LEU A C   1 
ATOM   1277 O  O   . LEU A 1 246 ? -1.313  66.631 -19.979 1.00 93.73  ? 246 LEU A O   1 
ATOM   1278 C  CB  . LEU A 1 246 ? -3.723  68.298 -21.610 1.00 94.31  ? 246 LEU A CB  1 
ATOM   1279 C  CG  . LEU A 1 246 ? -3.027  69.419 -20.818 1.00 96.34  ? 246 LEU A CG  1 
ATOM   1280 C  CD1 . LEU A 1 246 ? -1.631  69.720 -21.343 1.00 95.99  ? 246 LEU A CD1 1 
ATOM   1281 C  CD2 . LEU A 1 246 ? -3.830  70.659 -20.850 1.00 99.46  ? 246 LEU A CD2 1 
ATOM   1282 N  N   . LEU A 1 247 ? -3.434  66.213 -19.252 1.00 90.15  ? 247 LEU A N   1 
ATOM   1283 C  CA  . LEU A 1 247 ? -3.078  65.841 -17.885 1.00 87.73  ? 247 LEU A CA  1 
ATOM   1284 C  C   . LEU A 1 247 ? -2.263  64.562 -17.820 1.00 91.49  ? 247 LEU A C   1 
ATOM   1285 O  O   . LEU A 1 247 ? -1.392  64.453 -16.955 1.00 89.01  ? 247 LEU A O   1 
ATOM   1286 C  CB  . LEU A 1 247 ? -4.311  65.737 -16.998 1.00 87.61  ? 247 LEU A CB  1 
ATOM   1287 C  CG  . LEU A 1 247 ? -4.707  67.006 -16.269 1.00 91.79  ? 247 LEU A CG  1 
ATOM   1288 C  CD1 . LEU A 1 247 ? -6.059  66.847 -15.638 1.00 92.81  ? 247 LEU A CD1 1 
ATOM   1289 C  CD2 . LEU A 1 247 ? -3.719  67.338 -15.173 1.00 93.07  ? 247 LEU A CD2 1 
ATOM   1290 N  N   . VAL A 1 248 ? -2.516  63.610 -18.753 1.00 90.68  ? 248 VAL A N   1 
ATOM   1291 C  CA  . VAL A 1 248 ? -1.756  62.358 -18.851 1.00 91.57  ? 248 VAL A CA  1 
ATOM   1292 C  C   . VAL A 1 248 ? -0.317  62.726 -19.190 1.00 96.94  ? 248 VAL A C   1 
ATOM   1293 O  O   . VAL A 1 248 ? 0.592   62.341 -18.452 1.00 95.95  ? 248 VAL A O   1 
ATOM   1294 C  CB  . VAL A 1 248 ? -2.351  61.338 -19.854 1.00 97.93  ? 248 VAL A CB  1 
ATOM   1295 C  CG1 . VAL A 1 248 ? -1.453  60.109 -19.994 1.00 98.35  ? 248 VAL A CG1 1 
ATOM   1296 C  CG2 . VAL A 1 248 ? -3.751  60.919 -19.433 1.00 98.45  ? 248 VAL A CG2 1 
ATOM   1297 N  N   . ASP A 1 249 ? -0.126  63.544 -20.250 1.00 95.03  ? 249 ASP A N   1 
ATOM   1298 C  CA  . ASP A 1 249 ? 1.184   64.041 -20.676 1.00 95.31  ? 249 ASP A CA  1 
ATOM   1299 C  C   . ASP A 1 249 ? 1.886   64.843 -19.563 1.00 96.00  ? 249 ASP A C   1 
ATOM   1300 O  O   . ASP A 1 249 ? 3.099   64.698 -19.386 1.00 95.22  ? 249 ASP A O   1 
ATOM   1301 C  CB  . ASP A 1 249 ? 1.058   64.861 -21.968 1.00 99.53  ? 249 ASP A CB  1 
ATOM   1302 C  CG  . ASP A 1 249 ? 0.625   64.054 -23.182 1.00 118.96 ? 249 ASP A CG  1 
ATOM   1303 O  OD1 . ASP A 1 249 ? 1.005   62.859 -23.272 1.00 121.48 ? 249 ASP A OD1 1 
ATOM   1304 O  OD2 . ASP A 1 249 ? -0.069  64.625 -24.062 1.00 127.65 ? 249 ASP A OD2 1 
ATOM   1305 N  N   . PHE A 1 250 ? 1.111   65.647 -18.792 1.00 90.30  ? 250 PHE A N   1 
ATOM   1306 C  CA  . PHE A 1 250 ? 1.608   66.433 -17.662 1.00 87.83  ? 250 PHE A CA  1 
ATOM   1307 C  C   . PHE A 1 250 ? 2.148   65.496 -16.597 1.00 91.80  ? 250 PHE A C   1 
ATOM   1308 O  O   . PHE A 1 250 ? 3.263   65.706 -16.115 1.00 91.37  ? 250 PHE A O   1 
ATOM   1309 C  CB  . PHE A 1 250 ? 0.504   67.333 -17.070 1.00 88.42  ? 250 PHE A CB  1 
ATOM   1310 C  CG  . PHE A 1 250 ? 0.905   68.054 -15.800 1.00 88.01  ? 250 PHE A CG  1 
ATOM   1311 C  CD1 . PHE A 1 250 ? 0.791   67.432 -14.558 1.00 89.59  ? 250 PHE A CD1 1 
ATOM   1312 C  CD2 . PHE A 1 250 ? 1.393   69.352 -15.842 1.00 89.77  ? 250 PHE A CD2 1 
ATOM   1313 C  CE1 . PHE A 1 250 ? 1.186   68.085 -13.391 1.00 89.07  ? 250 PHE A CE1 1 
ATOM   1314 C  CE2 . PHE A 1 250 ? 1.759   70.015 -14.667 1.00 91.31  ? 250 PHE A CE2 1 
ATOM   1315 C  CZ  . PHE A 1 250 ? 1.667   69.373 -13.454 1.00 88.10  ? 250 PHE A CZ  1 
ATOM   1316 N  N   . PHE A 1 251 ? 1.353   64.476 -16.218 1.00 88.65  ? 251 PHE A N   1 
ATOM   1317 C  CA  . PHE A 1 251 ? 1.742   63.516 -15.189 1.00 88.02  ? 251 PHE A CA  1 
ATOM   1318 C  C   . PHE A 1 251 ? 2.820   62.529 -15.659 1.00 93.14  ? 251 PHE A C   1 
ATOM   1319 O  O   . PHE A 1 251 ? 3.516   61.944 -14.826 1.00 91.17  ? 251 PHE A O   1 
ATOM   1320 C  CB  . PHE A 1 251 ? 0.514   62.807 -14.609 1.00 89.85  ? 251 PHE A CB  1 
ATOM   1321 C  CG  . PHE A 1 251 ? -0.170  63.632 -13.543 1.00 90.32  ? 251 PHE A CG  1 
ATOM   1322 C  CD1 . PHE A 1 251 ? 0.288   63.617 -12.231 1.00 92.00  ? 251 PHE A CD1 1 
ATOM   1323 C  CD2 . PHE A 1 251 ? -1.258  64.438 -13.855 1.00 92.71  ? 251 PHE A CD2 1 
ATOM   1324 C  CE1 . PHE A 1 251 ? -0.337  64.385 -11.252 1.00 92.20  ? 251 PHE A CE1 1 
ATOM   1325 C  CE2 . PHE A 1 251 ? -1.878  65.211 -12.876 1.00 94.64  ? 251 PHE A CE2 1 
ATOM   1326 C  CZ  . PHE A 1 251 ? -1.416  65.177 -11.581 1.00 91.75  ? 251 PHE A CZ  1 
ATOM   1327 N  N   . ASN A 1 252 ? 2.979   62.378 -16.993 1.00 92.42  ? 252 ASN A N   1 
ATOM   1328 C  CA  . ASN A 1 252 ? 4.003   61.526 -17.592 1.00 93.62  ? 252 ASN A CA  1 
ATOM   1329 C  C   . ASN A 1 252 ? 5.361   62.216 -17.523 1.00 97.91  ? 252 ASN A C   1 
ATOM   1330 O  O   . ASN A 1 252 ? 6.361   61.569 -17.203 1.00 98.16  ? 252 ASN A O   1 
ATOM   1331 C  CB  . ASN A 1 252 ? 3.648   61.175 -19.022 1.00 95.54  ? 252 ASN A CB  1 
ATOM   1332 C  CG  . ASN A 1 252 ? 3.705   59.699 -19.276 1.00 126.23 ? 252 ASN A CG  1 
ATOM   1333 O  OD1 . ASN A 1 252 ? 4.668   59.019 -18.902 1.00 121.09 ? 252 ASN A OD1 1 
ATOM   1334 N  ND2 . ASN A 1 252 ? 2.680   59.172 -19.931 1.00 122.97 ? 252 ASN A ND2 1 
ATOM   1335 N  N   . SER A 1 253 ? 5.384   63.539 -17.796 1.00 93.84  ? 253 SER A N   1 
ATOM   1336 C  CA  . SER A 1 253 ? 6.578   64.378 -17.728 1.00 93.35  ? 253 SER A CA  1 
ATOM   1337 C  C   . SER A 1 253 ? 7.044   64.482 -16.277 1.00 95.17  ? 253 SER A C   1 
ATOM   1338 O  O   . SER A 1 253 ? 8.245   64.409 -16.019 1.00 94.98  ? 253 SER A O   1 
ATOM   1339 C  CB  . SER A 1 253 ? 6.287   65.767 -18.287 1.00 97.04  ? 253 SER A CB  1 
ATOM   1340 O  OG  . SER A 1 253 ? 5.891   65.717 -19.646 1.00 108.92 ? 253 SER A OG  1 
ATOM   1341 N  N   . LEU A 1 254 ? 6.089   64.611 -15.333 1.00 90.38  ? 254 LEU A N   1 
ATOM   1342 C  CA  . LEU A 1 254 ? 6.348   64.709 -13.894 1.00 89.29  ? 254 LEU A CA  1 
ATOM   1343 C  C   . LEU A 1 254 ? 6.918   63.399 -13.320 1.00 95.02  ? 254 LEU A C   1 
ATOM   1344 O  O   . LEU A 1 254 ? 7.677   63.438 -12.345 1.00 93.95  ? 254 LEU A O   1 
ATOM   1345 C  CB  . LEU A 1 254 ? 5.061   65.113 -13.155 1.00 88.07  ? 254 LEU A CB  1 
ATOM   1346 C  CG  . LEU A 1 254 ? 5.189   65.411 -11.663 1.00 91.08  ? 254 LEU A CG  1 
ATOM   1347 C  CD1 . LEU A 1 254 ? 5.454   66.878 -11.424 1.00 91.00  ? 254 LEU A CD1 1 
ATOM   1348 C  CD2 . LEU A 1 254 ? 3.957   64.965 -10.923 1.00 92.13  ? 254 LEU A CD2 1 
ATOM   1349 N  N   . ASN A 1 255 ? 6.543   62.248 -13.920 1.00 93.48  ? 255 ASN A N   1 
ATOM   1350 C  CA  . ASN A 1 255 ? 7.017   60.933 -13.496 1.00 94.08  ? 255 ASN A CA  1 
ATOM   1351 C  C   . ASN A 1 255 ? 8.467   60.751 -13.907 1.00 100.59 ? 255 ASN A C   1 
ATOM   1352 O  O   . ASN A 1 255 ? 9.287   60.413 -13.061 1.00 100.09 ? 255 ASN A O   1 
ATOM   1353 C  CB  . ASN A 1 255 ? 6.145   59.821 -14.069 1.00 95.47  ? 255 ASN A CB  1 
ATOM   1354 C  CG  . ASN A 1 255 ? 6.478   58.458 -13.519 1.00 117.41 ? 255 ASN A CG  1 
ATOM   1355 O  OD1 . ASN A 1 255 ? 7.271   57.701 -14.100 1.00 114.28 ? 255 ASN A OD1 1 
ATOM   1356 N  ND2 . ASN A 1 255 ? 5.883   58.123 -12.382 1.00 105.77 ? 255 ASN A ND2 1 
ATOM   1357 N  N   . GLU A 1 256 ? 8.788   61.009 -15.190 1.00 99.93  ? 256 GLU A N   1 
ATOM   1358 C  CA  . GLU A 1 256 ? 10.140  60.900 -15.744 1.00 101.91 ? 256 GLU A CA  1 
ATOM   1359 C  C   . GLU A 1 256 ? 11.136  61.845 -15.039 1.00 105.67 ? 256 GLU A C   1 
ATOM   1360 O  O   . GLU A 1 256 ? 12.260  61.424 -14.744 1.00 106.19 ? 256 GLU A O   1 
ATOM   1361 C  CB  . GLU A 1 256 ? 10.119  61.119 -17.276 1.00 105.10 ? 256 GLU A CB  1 
ATOM   1362 C  CG  . GLU A 1 256 ? 11.451  60.924 -17.992 1.00 120.36 ? 256 GLU A CG  1 
ATOM   1363 C  CD  . GLU A 1 256 ? 12.275  59.712 -17.597 1.00 152.07 ? 256 GLU A CD  1 
ATOM   1364 O  OE1 . GLU A 1 256 ? 11.802  58.571 -17.807 1.00 158.79 ? 256 GLU A OE1 1 
ATOM   1365 O  OE2 . GLU A 1 256 ? 13.400  59.903 -17.081 1.00 147.16 ? 256 GLU A OE2 1 
ATOM   1366 N  N   . ALA A 1 257 ? 10.708  63.099 -14.747 1.00 100.79 ? 257 ALA A N   1 
ATOM   1367 C  CA  . ALA A 1 257 ? 11.532  64.114 -14.086 1.00 100.19 ? 257 ALA A CA  1 
ATOM   1368 C  C   . ALA A 1 257 ? 11.924  63.721 -12.667 1.00 103.66 ? 257 ALA A C   1 
ATOM   1369 O  O   . ALA A 1 257 ? 13.083  63.905 -12.290 1.00 104.41 ? 257 ALA A O   1 
ATOM   1370 C  CB  . ALA A 1 257 ? 10.839  65.465 -14.110 1.00 99.99  ? 257 ALA A CB  1 
ATOM   1371 N  N   . THR A 1 258 ? 10.986  63.132 -11.900 1.00 98.71  ? 258 THR A N   1 
ATOM   1372 C  CA  . THR A 1 258 ? 11.283  62.673 -10.543 1.00 97.95  ? 258 THR A CA  1 
ATOM   1373 C  C   . THR A 1 258 ? 12.113  61.386 -10.597 1.00 102.33 ? 258 THR A C   1 
ATOM   1374 O  O   . THR A 1 258 ? 12.908  61.137 -9.693  1.00 103.09 ? 258 THR A O   1 
ATOM   1375 C  CB  . THR A 1 258 ? 10.029  62.591 -9.661  1.00 107.19 ? 258 THR A CB  1 
ATOM   1376 O  OG1 . THR A 1 258 ? 9.119   61.618 -10.171 1.00 108.06 ? 258 THR A OG1 1 
ATOM   1377 C  CG2 . THR A 1 258 ? 9.343   63.942 -9.502  1.00 105.93 ? 258 THR A CG2 1 
ATOM   1378 N  N   . MET A 1 259 ? 11.971  60.604 -11.683 1.00 98.27  ? 259 MET A N   1 
ATOM   1379 C  CA  . MET A 1 259 ? 12.741  59.383 -11.899 1.00 99.19  ? 259 MET A CA  1 
ATOM   1380 C  C   . MET A 1 259 ? 14.185  59.728 -12.252 1.00 103.41 ? 259 MET A C   1 
ATOM   1381 O  O   . MET A 1 259 ? 15.079  58.917 -12.024 1.00 104.08 ? 259 MET A O   1 
ATOM   1382 C  CB  . MET A 1 259 ? 12.108  58.519 -12.996 1.00 102.64 ? 259 MET A CB  1 
ATOM   1383 C  CG  . MET A 1 259 ? 10.930  57.682 -12.519 1.00 105.71 ? 259 MET A CG  1 
ATOM   1384 S  SD  . MET A 1 259 ? 11.273  56.577 -11.124 1.00 110.29 ? 259 MET A SD  1 
ATOM   1385 C  CE  . MET A 1 259 ? 12.474  55.452 -11.877 1.00 109.84 ? 259 MET A CE  1 
ATOM   1386 N  N   . LYS A 1 260 ? 14.414  60.932 -12.812 1.00 99.49  ? 260 LYS A N   1 
ATOM   1387 C  CA  . LYS A 1 260 ? 15.758  61.415 -13.143 1.00 100.51 ? 260 LYS A CA  1 
ATOM   1388 C  C   . LYS A 1 260 ? 16.467  61.825 -11.853 1.00 102.80 ? 260 LYS A C   1 
ATOM   1389 O  O   . LYS A 1 260 ? 17.691  61.732 -11.764 1.00 104.22 ? 260 LYS A O   1 
ATOM   1390 C  CB  . LYS A 1 260 ? 15.709  62.585 -14.138 1.00 102.86 ? 260 LYS A CB  1 
ATOM   1391 C  CG  . LYS A 1 260 ? 15.436  62.141 -15.563 1.00 114.57 ? 260 LYS A CG  1 
ATOM   1392 C  CD  . LYS A 1 260 ? 15.882  63.181 -16.572 1.00 125.08 ? 260 LYS A CD  1 
ATOM   1393 C  CE  . LYS A 1 260 ? 15.721  62.716 -18.000 1.00 135.70 ? 260 LYS A CE  1 
ATOM   1394 N  NZ  . LYS A 1 260 ? 16.620  61.579 -18.329 1.00 148.33 ? 260 LYS A NZ  1 
ATOM   1395 N  N   . LEU A 1 261 ? 15.683  62.254 -10.849 1.00 96.02  ? 261 LEU A N   1 
ATOM   1396 C  CA  . LEU A 1 261 ? 16.190  62.655 -9.546  1.00 95.17  ? 261 LEU A CA  1 
ATOM   1397 C  C   . LEU A 1 261 ? 16.648  61.457 -8.700  1.00 100.61 ? 261 LEU A C   1 
ATOM   1398 O  O   . LEU A 1 261 ? 17.618  61.597 -7.952  1.00 101.49 ? 261 LEU A O   1 
ATOM   1399 C  CB  . LEU A 1 261 ? 15.155  63.502 -8.800  1.00 92.83  ? 261 LEU A CB  1 
ATOM   1400 C  CG  . LEU A 1 261 ? 15.050  64.948 -9.248  1.00 96.75  ? 261 LEU A CG  1 
ATOM   1401 C  CD1 . LEU A 1 261 ? 13.627  65.410 -9.246  1.00 95.19  ? 261 LEU A CD1 1 
ATOM   1402 C  CD2 . LEU A 1 261 ? 15.839  65.838 -8.350  1.00 99.23  ? 261 LEU A CD2 1 
ATOM   1403 N  N   . VAL A 1 262 ? 15.996  60.271 -8.855  1.00 96.81  ? 262 VAL A N   1 
ATOM   1404 C  CA  . VAL A 1 262 ? 16.345  59.054 -8.105  1.00 97.15  ? 262 VAL A CA  1 
ATOM   1405 C  C   . VAL A 1 262 ? 17.711  58.467 -8.589  1.00 104.48 ? 262 VAL A C   1 
ATOM   1406 O  O   . VAL A 1 262 ? 18.266  57.577 -7.941  1.00 104.62 ? 262 VAL A O   1 
ATOM   1407 C  CB  . VAL A 1 262 ? 15.185  58.012 -8.040  1.00 99.75  ? 262 VAL A CB  1 
ATOM   1408 C  CG1 . VAL A 1 262 ? 14.924  57.335 -9.370  1.00 100.29 ? 262 VAL A CG1 1 
ATOM   1409 C  CG2 . VAL A 1 262 ? 15.412  56.981 -6.943  1.00 100.25 ? 262 VAL A CG2 1 
ATOM   1410 N  N   . ALA A 1 263 ? 18.278  59.027 -9.675  1.00 103.88 ? 263 ALA A N   1 
ATOM   1411 C  CA  . ALA A 1 263 ? 19.597  58.643 -10.177 1.00 107.24 ? 263 ALA A CA  1 
ATOM   1412 C  C   . ALA A 1 263 ? 20.666  59.280 -9.280  1.00 113.99 ? 263 ALA A C   1 
ATOM   1413 O  O   . ALA A 1 263 ? 21.688  58.650 -9.003  1.00 115.72 ? 263 ALA A O   1 
ATOM   1414 C  CB  . ALA A 1 263 ? 19.768  59.109 -11.611 1.00 109.09 ? 263 ALA A CB  1 
ATOM   1415 N  N   . ILE A 1 264 ? 20.398  60.522 -8.806  1.00 110.54 ? 264 ILE A N   1 
ATOM   1416 C  CA  . ILE A 1 264 ? 21.253  61.317 -7.911  1.00 111.59 ? 264 ILE A CA  1 
ATOM   1417 C  C   . ILE A 1 264 ? 21.195  60.721 -6.503  1.00 115.68 ? 264 ILE A C   1 
ATOM   1418 O  O   . ILE A 1 264 ? 22.218  60.658 -5.819  1.00 116.99 ? 264 ILE A O   1 
ATOM   1419 C  CB  . ILE A 1 264 ? 20.846  62.824 -7.909  1.00 113.48 ? 264 ILE A CB  1 
ATOM   1420 C  CG1 . ILE A 1 264 ? 20.539  63.338 -9.329  1.00 113.98 ? 264 ILE A CG1 1 
ATOM   1421 C  CG2 . ILE A 1 264 ? 21.920  63.687 -7.241  1.00 116.04 ? 264 ILE A CG2 1 
ATOM   1422 C  CD1 . ILE A 1 264 ? 19.512  64.425 -9.388  1.00 119.76 ? 264 ILE A CD1 1 
ATOM   1423 N  N   . ILE A 1 265 ? 19.990  60.290 -6.082  1.00 110.86 ? 265 ILE A N   1 
ATOM   1424 C  CA  . ILE A 1 265 ? 19.712  59.665 -4.785  1.00 110.67 ? 265 ILE A CA  1 
ATOM   1425 C  C   . ILE A 1 265 ? 20.507  58.347 -4.648  1.00 117.06 ? 265 ILE A C   1 
ATOM   1426 O  O   . ILE A 1 265 ? 21.048  58.064 -3.575  1.00 117.31 ? 265 ILE A O   1 
ATOM   1427 C  CB  . ILE A 1 265 ? 18.159  59.503 -4.600  1.00 111.48 ? 265 ILE A CB  1 
ATOM   1428 C  CG1 . ILE A 1 265 ? 17.506  60.757 -3.955  1.00 110.39 ? 265 ILE A CG1 1 
ATOM   1429 C  CG2 . ILE A 1 265 ? 17.778  58.254 -3.797  1.00 112.10 ? 265 ILE A CG2 1 
ATOM   1430 C  CD1 . ILE A 1 265 ? 17.324  62.046 -4.816  1.00 115.77 ? 265 ILE A CD1 1 
ATOM   1431 N  N   . MET A 1 266 ? 20.606  57.582 -5.757  1.00 115.27 ? 266 MET A N   1 
ATOM   1432 C  CA  . MET A 1 266 ? 21.311  56.302 -5.856  1.00 117.74 ? 266 MET A CA  1 
ATOM   1433 C  C   . MET A 1 266 ? 22.824  56.391 -5.614  1.00 123.07 ? 266 MET A C   1 
ATOM   1434 O  O   . MET A 1 266 ? 23.430  55.398 -5.212  1.00 124.32 ? 266 MET A O   1 
ATOM   1435 C  CB  . MET A 1 266 ? 21.034  55.652 -7.212  1.00 121.22 ? 266 MET A CB  1 
ATOM   1436 C  CG  . MET A 1 266 ? 20.014  54.549 -7.149  1.00 124.83 ? 266 MET A CG  1 
ATOM   1437 S  SD  . MET A 1 266 ? 19.906  53.687 -8.736  1.00 131.37 ? 266 MET A SD  1 
ATOM   1438 C  CE  . MET A 1 266 ? 18.849  52.324 -8.285  1.00 127.86 ? 266 MET A CE  1 
ATOM   1439 N  N   . TRP A 1 267 ? 23.434  57.557 -5.882  1.00 119.46 ? 267 TRP A N   1 
ATOM   1440 C  CA  . TRP A 1 267 ? 24.868  57.753 -5.678  1.00 121.88 ? 267 TRP A CA  1 
ATOM   1441 C  C   . TRP A 1 267 ? 25.207  58.050 -4.228  1.00 123.64 ? 267 TRP A C   1 
ATOM   1442 O  O   . TRP A 1 267 ? 26.317  57.750 -3.790  1.00 126.18 ? 267 TRP A O   1 
ATOM   1443 C  CB  . TRP A 1 267 ? 25.431  58.831 -6.615  1.00 122.07 ? 267 TRP A CB  1 
ATOM   1444 C  CG  . TRP A 1 267 ? 25.664  58.332 -8.009  1.00 124.74 ? 267 TRP A CG  1 
ATOM   1445 C  CD1 . TRP A 1 267 ? 24.930  58.631 -9.117  1.00 126.49 ? 267 TRP A CD1 1 
ATOM   1446 C  CD2 . TRP A 1 267 ? 26.659  57.387 -8.428  1.00 127.88 ? 267 TRP A CD2 1 
ATOM   1447 N  NE1 . TRP A 1 267 ? 25.422  57.955 -10.207 1.00 128.28 ? 267 TRP A NE1 1 
ATOM   1448 C  CE2 . TRP A 1 267 ? 26.482  57.180 -9.813  1.00 132.43 ? 267 TRP A CE2 1 
ATOM   1449 C  CE3 . TRP A 1 267 ? 27.701  56.709 -7.770  1.00 131.88 ? 267 TRP A CE3 1 
ATOM   1450 C  CZ2 . TRP A 1 267 ? 27.302  56.319 -10.553 1.00 134.99 ? 267 TRP A CZ2 1 
ATOM   1451 C  CZ3 . TRP A 1 267 ? 28.501  55.842 -8.499  1.00 136.55 ? 267 TRP A CZ3 1 
ATOM   1452 C  CH2 . TRP A 1 267 ? 28.304  55.660 -9.876  1.00 137.76 ? 267 TRP A CH2 1 
ATOM   1453 N  N   . TYR A 1 268 ? 24.264  58.648 -3.489  1.00 115.70 ? 268 TYR A N   1 
ATOM   1454 C  CA  . TYR A 1 268 ? 24.451  58.958 -2.078  1.00 114.95 ? 268 TYR A CA  1 
ATOM   1455 C  C   . TYR A 1 268 ? 24.183  57.715 -1.246  1.00 117.39 ? 268 TYR A C   1 
ATOM   1456 O  O   . TYR A 1 268 ? 24.776  57.569 -0.180  1.00 117.95 ? 268 TYR A O   1 
ATOM   1457 C  CB  . TYR A 1 268 ? 23.541  60.118 -1.647  1.00 113.79 ? 268 TYR A CB  1 
ATOM   1458 C  CG  . TYR A 1 268 ? 23.713  60.517 -0.199  1.00 115.98 ? 268 TYR A CG  1 
ATOM   1459 C  CD1 . TYR A 1 268 ? 24.795  61.290 0.206   1.00 120.43 ? 268 TYR A CD1 1 
ATOM   1460 C  CD2 . TYR A 1 268 ? 22.801  60.110 0.769   1.00 115.28 ? 268 TYR A CD2 1 
ATOM   1461 C  CE1 . TYR A 1 268 ? 24.975  61.637 1.544   1.00 122.79 ? 268 TYR A CE1 1 
ATOM   1462 C  CE2 . TYR A 1 268 ? 22.967  60.455 2.109   1.00 117.09 ? 268 TYR A CE2 1 
ATOM   1463 C  CZ  . TYR A 1 268 ? 24.058  61.218 2.494   1.00 127.01 ? 268 TYR A CZ  1 
ATOM   1464 O  OH  . TYR A 1 268 ? 24.231  61.571 3.810   1.00 127.39 ? 268 TYR A OH  1 
ATOM   1465 N  N   . ALA A 1 269 ? 23.304  56.816 -1.751  1.00 112.49 ? 269 ALA A N   1 
ATOM   1466 C  CA  . ALA A 1 269 ? 22.899  55.553 -1.126  1.00 112.61 ? 269 ALA A CA  1 
ATOM   1467 C  C   . ALA A 1 269 ? 24.052  54.742 -0.490  1.00 120.97 ? 269 ALA A C   1 
ATOM   1468 O  O   . ALA A 1 269 ? 23.882  54.401 0.679   1.00 120.83 ? 269 ALA A O   1 
ATOM   1469 C  CB  . ALA A 1 269 ? 22.108  54.695 -2.099  1.00 112.47 ? 269 ALA A CB  1 
ATOM   1470 N  N   . PRO A 1 270 ? 25.235  54.469 -1.128  1.00 121.19 ? 270 PRO A N   1 
ATOM   1471 C  CA  . PRO A 1 270 ? 26.292  53.733 -0.399  1.00 124.25 ? 270 PRO A CA  1 
ATOM   1472 C  C   . PRO A 1 270 ? 26.710  54.405 0.917   1.00 128.19 ? 270 PRO A C   1 
ATOM   1473 O  O   . PRO A 1 270 ? 26.851  53.710 1.921   1.00 129.17 ? 270 PRO A O   1 
ATOM   1474 C  CB  . PRO A 1 270 ? 27.453  53.668 -1.402  1.00 128.88 ? 270 PRO A CB  1 
ATOM   1475 C  CG  . PRO A 1 270 ? 26.847  53.884 -2.722  1.00 131.57 ? 270 PRO A CG  1 
ATOM   1476 C  CD  . PRO A 1 270 ? 25.669  54.781 -2.508  1.00 123.59 ? 270 PRO A CD  1 
ATOM   1477 N  N   . LEU A 1 271 ? 26.851  55.755 0.926   1.00 123.20 ? 271 LEU A N   1 
ATOM   1478 C  CA  . LEU A 1 271 ? 27.225  56.530 2.118   1.00 123.24 ? 271 LEU A CA  1 
ATOM   1479 C  C   . LEU A 1 271 ? 26.135  56.460 3.197   1.00 123.78 ? 271 LEU A C   1 
ATOM   1480 O  O   . LEU A 1 271 ? 26.446  56.216 4.362   1.00 124.90 ? 271 LEU A O   1 
ATOM   1481 C  CB  . LEU A 1 271 ? 27.524  57.994 1.745   1.00 123.00 ? 271 LEU A CB  1 
ATOM   1482 C  CG  . LEU A 1 271 ? 28.576  58.711 2.591   1.00 130.31 ? 271 LEU A CG  1 
ATOM   1483 C  CD1 . LEU A 1 271 ? 29.339  59.710 1.757   1.00 131.96 ? 271 LEU A CD1 1 
ATOM   1484 C  CD2 . LEU A 1 271 ? 27.954  59.415 3.786   1.00 131.37 ? 271 LEU A CD2 1 
ATOM   1485 N  N   . GLY A 1 272 ? 24.883  56.660 2.785   1.00 116.13 ? 272 GLY A N   1 
ATOM   1486 C  CA  . GLY A 1 272 ? 23.712  56.637 3.650   1.00 113.34 ? 272 GLY A CA  1 
ATOM   1487 C  C   . GLY A 1 272 ? 23.415  55.288 4.268   1.00 117.31 ? 272 GLY A C   1 
ATOM   1488 O  O   . GLY A 1 272 ? 23.146  55.228 5.465   1.00 116.83 ? 272 GLY A O   1 
ATOM   1489 N  N   . ILE A 1 273 ? 23.471  54.193 3.464   1.00 114.80 ? 273 ILE A N   1 
ATOM   1490 C  CA  . ILE A 1 273 ? 23.195  52.810 3.907   1.00 115.60 ? 273 ILE A CA  1 
ATOM   1491 C  C   . ILE A 1 273 ? 24.164  52.386 5.011   1.00 121.92 ? 273 ILE A C   1 
ATOM   1492 O  O   . ILE A 1 273 ? 23.731  51.723 5.951   1.00 121.54 ? 273 ILE A O   1 
ATOM   1493 C  CB  . ILE A 1 273 ? 23.118  51.776 2.725   1.00 119.31 ? 273 ILE A CB  1 
ATOM   1494 C  CG1 . ILE A 1 273 ? 21.960  52.085 1.726   1.00 116.99 ? 273 ILE A CG1 1 
ATOM   1495 C  CG2 . ILE A 1 273 ? 23.054  50.309 3.202   1.00 121.80 ? 273 ILE A CG2 1 
ATOM   1496 C  CD1 . ILE A 1 273 ? 20.500  52.184 2.307   1.00 122.91 ? 273 ILE A CD1 1 
ATOM   1497 N  N   . LEU A 1 274 ? 25.447  52.808 4.919   1.00 121.08 ? 274 LEU A N   1 
ATOM   1498 C  CA  . LEU A 1 274 ? 26.498  52.526 5.905   1.00 124.41 ? 274 LEU A CA  1 
ATOM   1499 C  C   . LEU A 1 274 ? 26.095  53.035 7.297   1.00 127.85 ? 274 LEU A C   1 
ATOM   1500 O  O   . LEU A 1 274 ? 26.051  52.245 8.239   1.00 128.74 ? 274 LEU A O   1 
ATOM   1501 C  CB  . LEU A 1 274 ? 27.840  53.157 5.469   1.00 127.05 ? 274 LEU A CB  1 
ATOM   1502 C  CG  . LEU A 1 274 ? 29.065  52.821 6.333   1.00 135.85 ? 274 LEU A CG  1 
ATOM   1503 C  CD1 . LEU A 1 274 ? 29.997  51.891 5.605   1.00 139.10 ? 274 LEU A CD1 1 
ATOM   1504 C  CD2 . LEU A 1 274 ? 29.814  54.073 6.726   1.00 139.35 ? 274 LEU A CD2 1 
ATOM   1505 N  N   . PHE A 1 275 ? 25.775  54.343 7.400   1.00 122.59 ? 275 PHE A N   1 
ATOM   1506 C  CA  . PHE A 1 275 ? 25.375  55.024 8.633   1.00 121.99 ? 275 PHE A CA  1 
ATOM   1507 C  C   . PHE A 1 275 ? 23.972  54.667 9.121   1.00 124.04 ? 275 PHE A C   1 
ATOM   1508 O  O   . PHE A 1 275 ? 23.736  54.682 10.329  1.00 124.77 ? 275 PHE A O   1 
ATOM   1509 C  CB  . PHE A 1 275 ? 25.518  56.542 8.476   1.00 122.90 ? 275 PHE A CB  1 
ATOM   1510 C  CG  . PHE A 1 275 ? 26.947  57.022 8.439   1.00 127.38 ? 275 PHE A CG  1 
ATOM   1511 C  CD1 . PHE A 1 275 ? 27.625  57.330 9.612   1.00 133.06 ? 275 PHE A CD1 1 
ATOM   1512 C  CD2 . PHE A 1 275 ? 27.614  57.177 7.231   1.00 130.05 ? 275 PHE A CD2 1 
ATOM   1513 C  CE1 . PHE A 1 275 ? 28.943  57.787 9.578   1.00 137.17 ? 275 PHE A CE1 1 
ATOM   1514 C  CE2 . PHE A 1 275 ? 28.928  57.642 7.196   1.00 136.20 ? 275 PHE A CE2 1 
ATOM   1515 C  CZ  . PHE A 1 275 ? 29.586  57.938 8.371   1.00 136.93 ? 275 PHE A CZ  1 
ATOM   1516 N  N   . LEU A 1 276 ? 23.044  54.365 8.193   1.00 118.08 ? 276 LEU A N   1 
ATOM   1517 C  CA  . LEU A 1 276 ? 21.662  53.991 8.510   1.00 115.84 ? 276 LEU A CA  1 
ATOM   1518 C  C   . LEU A 1 276 ? 21.604  52.633 9.229   1.00 121.32 ? 276 LEU A C   1 
ATOM   1519 O  O   . LEU A 1 276 ? 20.792  52.468 10.142  1.00 120.57 ? 276 LEU A O   1 
ATOM   1520 C  CB  . LEU A 1 276 ? 20.805  53.989 7.227   1.00 113.22 ? 276 LEU A CB  1 
ATOM   1521 C  CG  . LEU A 1 276 ? 19.279  54.139 7.340   1.00 115.39 ? 276 LEU A CG  1 
ATOM   1522 C  CD1 . LEU A 1 276 ? 18.877  55.351 8.169   1.00 114.69 ? 276 LEU A CD1 1 
ATOM   1523 C  CD2 . LEU A 1 276 ? 18.655  54.259 5.961   1.00 115.66 ? 276 LEU A CD2 1 
ATOM   1524 N  N   . ILE A 1 277 ? 22.496  51.686 8.851   1.00 119.86 ? 277 ILE A N   1 
ATOM   1525 C  CA  . ILE A 1 277 ? 22.572  50.358 9.476   1.00 121.64 ? 277 ILE A CA  1 
ATOM   1526 C  C   . ILE A 1 277 ? 23.539  50.345 10.671  1.00 127.87 ? 277 ILE A C   1 
ATOM   1527 O  O   . ILE A 1 277 ? 23.314  49.579 11.607  1.00 128.69 ? 277 ILE A O   1 
ATOM   1528 C  CB  . ILE A 1 277 ? 22.849  49.188 8.487   1.00 125.85 ? 277 ILE A CB  1 
ATOM   1529 C  CG1 . ILE A 1 277 ? 24.252  49.269 7.858   1.00 128.57 ? 277 ILE A CG1 1 
ATOM   1530 C  CG2 . ILE A 1 277 ? 21.755  49.063 7.427   1.00 123.82 ? 277 ILE A CG2 1 
ATOM   1531 C  CD1 . ILE A 1 277 ? 24.941  47.992 7.818   1.00 140.42 ? 277 ILE A CD1 1 
ATOM   1532 N  N   . ALA A 1 278 ? 24.605  51.177 10.641  1.00 125.52 ? 278 ALA A N   1 
ATOM   1533 C  CA  . ALA A 1 278 ? 25.571  51.269 11.740  1.00 128.57 ? 278 ALA A CA  1 
ATOM   1534 C  C   . ALA A 1 278 ? 24.891  51.828 12.991  1.00 132.31 ? 278 ALA A C   1 
ATOM   1535 O  O   . ALA A 1 278 ? 25.108  51.307 14.087  1.00 134.53 ? 278 ALA A O   1 
ATOM   1536 C  CB  . ALA A 1 278 ? 26.751  52.142 11.346  1.00 130.65 ? 278 ALA A CB  1 
ATOM   1537 N  N   . GLY A 1 279 ? 24.046  52.845 12.799  1.00 125.83 ? 279 GLY A N   1 
ATOM   1538 C  CA  . GLY A 1 279 ? 23.274  53.487 13.856  1.00 124.99 ? 279 GLY A CA  1 
ATOM   1539 C  C   . GLY A 1 279 ? 22.274  52.551 14.506  1.00 128.81 ? 279 GLY A C   1 
ATOM   1540 O  O   . GLY A 1 279 ? 22.129  52.567 15.730  1.00 129.77 ? 279 GLY A O   1 
ATOM   1541 N  N   . LYS A 1 280 ? 21.597  51.706 13.690  1.00 124.03 ? 280 LYS A N   1 
ATOM   1542 C  CA  . LYS A 1 280 ? 20.608  50.734 14.168  1.00 123.66 ? 280 LYS A CA  1 
ATOM   1543 C  C   . LYS A 1 280 ? 21.220  49.573 14.943  1.00 130.30 ? 280 LYS A C   1 
ATOM   1544 O  O   . LYS A 1 280 ? 20.616  49.130 15.921  1.00 131.06 ? 280 LYS A O   1 
ATOM   1545 C  CB  . LYS A 1 280 ? 19.699  50.224 13.039  1.00 123.82 ? 280 LYS A CB  1 
ATOM   1546 C  CG  . LYS A 1 280 ? 18.340  50.920 12.999  1.00 140.57 ? 280 LYS A CG  1 
ATOM   1547 C  CD  . LYS A 1 280 ? 17.416  50.518 14.160  1.00 155.39 ? 280 LYS A CD  1 
ATOM   1548 C  CE  . LYS A 1 280 ? 16.234  51.451 14.286  1.00 168.87 ? 280 LYS A CE  1 
ATOM   1549 N  NZ  . LYS A 1 280 ? 15.430  51.167 15.505  1.00 180.24 ? 280 LYS A NZ  1 
ATOM   1550 N  N   . ILE A 1 281 ? 22.421  49.096 14.536  1.00 127.98 ? 281 ILE A N   1 
ATOM   1551 C  CA  . ILE A 1 281 ? 23.106  48.003 15.240  1.00 130.78 ? 281 ILE A CA  1 
ATOM   1552 C  C   . ILE A 1 281 ? 23.823  48.535 16.506  1.00 136.15 ? 281 ILE A C   1 
ATOM   1553 O  O   . ILE A 1 281 ? 24.425  47.751 17.245  1.00 138.97 ? 281 ILE A O   1 
ATOM   1554 C  CB  . ILE A 1 281 ? 24.021  47.118 14.336  1.00 135.46 ? 281 ILE A CB  1 
ATOM   1555 C  CG1 . ILE A 1 281 ? 25.349  47.802 13.986  1.00 137.18 ? 281 ILE A CG1 1 
ATOM   1556 C  CG2 . ILE A 1 281 ? 23.304  46.611 13.082  1.00 133.89 ? 281 ILE A CG2 1 
ATOM   1557 C  CD1 . ILE A 1 281 ? 26.485  46.906 14.248  1.00 147.93 ? 281 ILE A CD1 1 
ATOM   1558 N  N   . VAL A 1 282 ? 23.735  49.865 16.747  1.00 130.70 ? 282 VAL A N   1 
ATOM   1559 C  CA  . VAL A 1 282 ? 24.282  50.580 17.905  1.00 132.42 ? 282 VAL A CA  1 
ATOM   1560 C  C   . VAL A 1 282 ? 23.203  50.700 19.007  1.00 135.93 ? 282 VAL A C   1 
ATOM   1561 O  O   . VAL A 1 282 ? 23.509  50.460 20.177  1.00 138.45 ? 282 VAL A O   1 
ATOM   1562 C  CB  . VAL A 1 282 ? 24.921  51.941 17.481  1.00 135.22 ? 282 VAL A CB  1 
ATOM   1563 C  CG1 . VAL A 1 282 ? 24.730  53.043 18.523  1.00 135.39 ? 282 VAL A CG1 1 
ATOM   1564 C  CG2 . VAL A 1 282 ? 26.396  51.770 17.144  1.00 137.75 ? 282 VAL A CG2 1 
ATOM   1565 N  N   . GLU A 1 283 ? 21.942  51.025 18.611  1.00 128.94 ? 283 GLU A N   1 
ATOM   1566 C  CA  . GLU A 1 283 ? 20.759  51.210 19.474  1.00 151.65 ? 283 GLU A CA  1 
ATOM   1567 C  C   . GLU A 1 283 ? 20.537  50.076 20.485  1.00 177.53 ? 283 GLU A C   1 
ATOM   1568 O  O   . GLU A 1 283 ? 20.653  48.900 20.145  1.00 138.77 ? 283 GLU A O   1 
ATOM   1569 C  CB  . GLU A 1 283 ? 19.482  51.417 18.631  1.00 149.19 ? 283 GLU A CB  1 
ATOM   1570 C  CG  . GLU A 1 283 ? 19.506  52.631 17.714  1.00 155.44 ? 283 GLU A CG  1 
ATOM   1571 C  CD  . GLU A 1 283 ? 18.592  53.776 18.103  1.00 168.27 ? 283 GLU A CD  1 
ATOM   1572 O  OE1 . GLU A 1 283 ? 18.903  54.476 19.093  1.00 161.25 ? 283 GLU A OE1 1 
ATOM   1573 O  OE2 . GLU A 1 283 ? 17.589  54.002 17.388  1.00 155.24 ? 283 GLU A OE2 1 
ATOM   1574 N  N   . LEU A 1 294 ? 12.758  34.396 22.558  1.00 171.29 ? 294 LEU A N   1 
ATOM   1575 C  CA  . LEU A 1 294 ? 13.032  35.247 21.400  1.00 166.95 ? 294 LEU A CA  1 
ATOM   1576 C  C   . LEU A 1 294 ? 14.123  34.670 20.489  1.00 171.57 ? 294 LEU A C   1 
ATOM   1577 O  O   . LEU A 1 294 ? 14.240  35.087 19.332  1.00 167.77 ? 294 LEU A O   1 
ATOM   1578 C  CB  . LEU A 1 294 ? 13.384  36.683 21.836  1.00 164.59 ? 294 LEU A CB  1 
ATOM   1579 C  CG  . LEU A 1 294 ? 12.224  37.548 22.336  1.00 167.74 ? 294 LEU A CG  1 
ATOM   1580 C  CD1 . LEU A 1 294 ? 12.715  38.610 23.287  1.00 167.81 ? 294 LEU A CD1 1 
ATOM   1581 C  CD2 . LEU A 1 294 ? 11.471  38.192 21.182  1.00 167.06 ? 294 LEU A CD2 1 
ATOM   1582 N  N   . GLY A 1 295 ? 14.893  33.718 21.020  1.00 173.18 ? 295 GLY A N   1 
ATOM   1583 C  CA  . GLY A 1 295 ? 15.968  33.039 20.305  1.00 174.98 ? 295 GLY A CA  1 
ATOM   1584 C  C   . GLY A 1 295 ? 15.460  32.252 19.116  1.00 179.57 ? 295 GLY A C   1 
ATOM   1585 O  O   . GLY A 1 295 ? 15.842  32.538 17.978  1.00 176.98 ? 295 GLY A O   1 
ATOM   1586 N  N   . MET A 1 296 ? 14.561  31.280 19.377  1.00 179.50 ? 296 MET A N   1 
ATOM   1587 C  CA  . MET A 1 296 ? 13.938  30.442 18.348  1.00 180.16 ? 296 MET A CA  1 
ATOM   1588 C  C   . MET A 1 296 ? 13.036  31.259 17.427  1.00 179.82 ? 296 MET A C   1 
ATOM   1589 O  O   . MET A 1 296 ? 12.986  30.973 16.237  1.00 178.91 ? 296 MET A O   1 
ATOM   1590 C  CB  . MET A 1 296 ? 13.185  29.231 18.951  1.00 186.84 ? 296 MET A CB  1 
ATOM   1591 C  CG  . MET A 1 296 ? 12.050  29.592 19.913  1.00 190.72 ? 296 MET A CG  1 
ATOM   1592 S  SD  . MET A 1 296 ? 10.670  28.418 19.878  1.00 198.00 ? 296 MET A SD  1 
ATOM   1593 C  CE  . MET A 1 296 ? 11.258  27.187 21.020  1.00 200.67 ? 296 MET A CE  1 
ATOM   1594 N  N   . TYR A 1 297 ? 12.362  32.293 17.974  1.00 173.42 ? 297 TYR A N   1 
ATOM   1595 C  CA  . TYR A 1 297 ? 11.451  33.199 17.269  1.00 168.94 ? 297 TYR A CA  1 
ATOM   1596 C  C   . TYR A 1 297 ? 12.136  33.947 16.122  1.00 168.69 ? 297 TYR A C   1 
ATOM   1597 O  O   . TYR A 1 297 ? 11.682  33.848 14.979  1.00 166.30 ? 297 TYR A O   1 
ATOM   1598 C  CB  . TYR A 1 297 ? 10.804  34.173 18.270  1.00 168.68 ? 297 TYR A CB  1 
ATOM   1599 C  CG  . TYR A 1 297 ? 10.134  35.383 17.657  1.00 165.83 ? 297 TYR A CG  1 
ATOM   1600 C  CD1 . TYR A 1 297 ? 8.965   35.256 16.913  1.00 166.54 ? 297 TYR A CD1 1 
ATOM   1601 C  CD2 . TYR A 1 297 ? 10.640  36.661 17.864  1.00 164.01 ? 297 TYR A CD2 1 
ATOM   1602 C  CE1 . TYR A 1 297 ? 8.343   36.367 16.349  1.00 163.62 ? 297 TYR A CE1 1 
ATOM   1603 C  CE2 . TYR A 1 297 ? 10.020  37.782 17.317  1.00 161.31 ? 297 TYR A CE2 1 
ATOM   1604 C  CZ  . TYR A 1 297 ? 8.867   37.631 16.564  1.00 167.51 ? 297 TYR A CZ  1 
ATOM   1605 O  OH  . TYR A 1 297 ? 8.246   38.735 16.034  1.00 164.16 ? 297 TYR A OH  1 
ATOM   1606 N  N   . MET A 1 298 ? 13.230  34.678 16.434  1.00 164.23 ? 298 MET A N   1 
ATOM   1607 C  CA  . MET A 1 298 ? 14.037  35.443 15.479  1.00 161.13 ? 298 MET A CA  1 
ATOM   1608 C  C   . MET A 1 298 ? 14.581  34.513 14.382  1.00 163.91 ? 298 MET A C   1 
ATOM   1609 O  O   . MET A 1 298 ? 14.618  34.899 13.213  1.00 160.99 ? 298 MET A O   1 
ATOM   1610 C  CB  . MET A 1 298 ? 15.183  36.165 16.210  1.00 164.04 ? 298 MET A CB  1 
ATOM   1611 C  CG  . MET A 1 298 ? 15.930  37.160 15.344  1.00 165.41 ? 298 MET A CG  1 
ATOM   1612 S  SD  . MET A 1 298 ? 17.682  37.306 15.769  1.00 172.46 ? 298 MET A SD  1 
ATOM   1613 C  CE  . MET A 1 298 ? 18.348  35.814 14.982  1.00 172.68 ? 298 MET A CE  1 
ATOM   1614 N  N   . VAL A 1 299 ? 14.963  33.279 14.766  1.00 162.80 ? 299 VAL A N   1 
ATOM   1615 C  CA  . VAL A 1 299 ? 15.459  32.253 13.854  1.00 163.95 ? 299 VAL A CA  1 
ATOM   1616 C  C   . VAL A 1 299 ? 14.320  31.785 12.928  1.00 165.52 ? 299 VAL A C   1 
ATOM   1617 O  O   . VAL A 1 299 ? 14.492  31.838 11.712  1.00 163.76 ? 299 VAL A O   1 
ATOM   1618 C  CB  . VAL A 1 299 ? 16.170  31.101 14.619  1.00 172.54 ? 299 VAL A CB  1 
ATOM   1619 C  CG1 . VAL A 1 299 ? 16.410  29.884 13.727  1.00 175.07 ? 299 VAL A CG1 1 
ATOM   1620 C  CG2 . VAL A 1 299 ? 17.484  31.586 15.226  1.00 173.06 ? 299 VAL A CG2 1 
ATOM   1621 N  N   . THR A 1 300 ? 13.149  31.403 13.498  1.00 161.71 ? 300 THR A N   1 
ATOM   1622 C  CA  . THR A 1 300 ? 11.959  30.944 12.760  1.00 160.75 ? 300 THR A CA  1 
ATOM   1623 C  C   . THR A 1 300 ? 11.534  31.951 11.684  1.00 159.20 ? 300 THR A C   1 
ATOM   1624 O  O   . THR A 1 300 ? 11.259  31.545 10.552  1.00 158.70 ? 300 THR A O   1 
ATOM   1625 C  CB  . THR A 1 300 ? 10.815  30.570 13.726  1.00 169.22 ? 300 THR A CB  1 
ATOM   1626 O  OG1 . THR A 1 300 ? 11.298  29.611 14.661  1.00 172.98 ? 300 THR A OG1 1 
ATOM   1627 C  CG2 . THR A 1 300 ? 9.603   29.979 13.015  1.00 168.23 ? 300 THR A CG2 1 
ATOM   1628 N  N   . VAL A 1 301 ? 11.518  33.253 12.028  1.00 151.53 ? 301 VAL A N   1 
ATOM   1629 C  CA  . VAL A 1 301 ? 11.150  34.318 11.094  1.00 146.98 ? 301 VAL A CA  1 
ATOM   1630 C  C   . VAL A 1 301 ? 12.201  34.436 9.976   1.00 149.38 ? 301 VAL A C   1 
ATOM   1631 O  O   . VAL A 1 301 ? 11.835  34.317 8.808   1.00 148.16 ? 301 VAL A O   1 
ATOM   1632 C  CB  . VAL A 1 301 ? 10.838  35.675 11.794  1.00 147.81 ? 301 VAL A CB  1 
ATOM   1633 C  CG1 . VAL A 1 301 ? 10.504  36.768 10.782  1.00 143.68 ? 301 VAL A CG1 1 
ATOM   1634 C  CG2 . VAL A 1 301 ? 9.701   35.531 12.798  1.00 148.67 ? 301 VAL A CG2 1 
ATOM   1635 N  N   . ILE A 1 302 ? 13.496  34.615 10.336  1.00 145.98 ? 302 ILE A N   1 
ATOM   1636 C  CA  . ILE A 1 302 ? 14.607  34.765 9.384   1.00 145.22 ? 302 ILE A CA  1 
ATOM   1637 C  C   . ILE A 1 302 ? 14.709  33.551 8.443   1.00 151.14 ? 302 ILE A C   1 
ATOM   1638 O  O   . ILE A 1 302 ? 14.792  33.746 7.231   1.00 149.40 ? 302 ILE A O   1 
ATOM   1639 C  CB  . ILE A 1 302 ? 15.944  35.123 10.099  1.00 149.32 ? 302 ILE A CB  1 
ATOM   1640 C  CG1 . ILE A 1 302 ? 15.952  36.625 10.478  1.00 146.33 ? 302 ILE A CG1 1 
ATOM   1641 C  CG2 . ILE A 1 302 ? 17.180  34.776 9.245   1.00 151.74 ? 302 ILE A CG2 1 
ATOM   1642 C  CD1 . ILE A 1 302 ? 16.873  37.028 11.635  1.00 155.11 ? 302 ILE A CD1 1 
ATOM   1643 N  N   . VAL A 1 303 ? 14.650  32.319 8.986   1.00 151.24 ? 303 VAL A N   1 
ATOM   1644 C  CA  . VAL A 1 303 ? 14.687  31.086 8.184   1.00 153.96 ? 303 VAL A CA  1 
ATOM   1645 C  C   . VAL A 1 303 ? 13.412  31.002 7.317   1.00 155.85 ? 303 VAL A C   1 
ATOM   1646 O  O   . VAL A 1 303 ? 13.505  30.692 6.128   1.00 155.65 ? 303 VAL A O   1 
ATOM   1647 C  CB  . VAL A 1 303 ? 14.971  29.810 9.035   1.00 162.54 ? 303 VAL A CB  1 
ATOM   1648 C  CG1 . VAL A 1 303 ? 14.861  28.531 8.204   1.00 165.68 ? 303 VAL A CG1 1 
ATOM   1649 C  CG2 . VAL A 1 303 ? 16.348  29.889 9.694   1.00 163.88 ? 303 VAL A CG2 1 
ATOM   1650 N  N   . GLY A 1 304 ? 12.270  31.378 7.902   1.00 150.48 ? 304 GLY A N   1 
ATOM   1651 C  CA  . GLY A 1 304 ? 10.974  31.428 7.228   1.00 148.85 ? 304 GLY A CA  1 
ATOM   1652 C  C   . GLY A 1 304 ? 10.947  32.359 6.031   1.00 148.66 ? 304 GLY A C   1 
ATOM   1653 O  O   . GLY A 1 304 ? 10.297  32.056 5.027   1.00 148.49 ? 304 GLY A O   1 
ATOM   1654 N  N   . LEU A 1 305 ? 11.675  33.491 6.121   1.00 141.67 ? 305 LEU A N   1 
ATOM   1655 C  CA  . LEU A 1 305 ? 11.789  34.472 5.038   1.00 137.83 ? 305 LEU A CA  1 
ATOM   1656 C  C   . LEU A 1 305 ? 12.715  33.969 3.927   1.00 142.99 ? 305 LEU A C   1 
ATOM   1657 O  O   . LEU A 1 305 ? 12.557  34.388 2.783   1.00 141.19 ? 305 LEU A O   1 
ATOM   1658 C  CB  . LEU A 1 305 ? 12.269  35.846 5.554   1.00 134.56 ? 305 LEU A CB  1 
ATOM   1659 C  CG  . LEU A 1 305 ? 11.346  36.619 6.504   1.00 136.67 ? 305 LEU A CG  1 
ATOM   1660 C  CD1 . LEU A 1 305 ? 12.064  37.796 7.109   1.00 134.49 ? 305 LEU A CD1 1 
ATOM   1661 C  CD2 . LEU A 1 305 ? 10.081  37.084 5.812   1.00 136.61 ? 305 LEU A CD2 1 
ATOM   1662 N  N   . VAL A 1 306 ? 13.685  33.088 4.260   1.00 142.42 ? 306 VAL A N   1 
ATOM   1663 C  CA  . VAL A 1 306 ? 14.628  32.514 3.293   1.00 144.30 ? 306 VAL A CA  1 
ATOM   1664 C  C   . VAL A 1 306 ? 13.903  31.477 2.426   1.00 150.52 ? 306 VAL A C   1 
ATOM   1665 O  O   . VAL A 1 306 ? 14.065  31.485 1.206   1.00 149.75 ? 306 VAL A O   1 
ATOM   1666 C  CB  . VAL A 1 306 ? 15.913  31.958 3.971   1.00 151.11 ? 306 VAL A CB  1 
ATOM   1667 C  CG1 . VAL A 1 306 ? 16.797  31.201 2.979   1.00 153.96 ? 306 VAL A CG1 1 
ATOM   1668 C  CG2 . VAL A 1 306 ? 16.707  33.076 4.638   1.00 148.72 ? 306 VAL A CG2 1 
ATOM   1669 N  N   . ILE A 1 307 ? 13.080  30.613 3.059   1.00 149.72 ? 307 ILE A N   1 
ATOM   1670 C  CA  . ILE A 1 307 ? 12.283  29.583 2.381   1.00 152.39 ? 307 ILE A CA  1 
ATOM   1671 C  C   . ILE A 1 307 ? 11.285  30.255 1.431   1.00 154.43 ? 307 ILE A C   1 
ATOM   1672 O  O   . ILE A 1 307 ? 11.126  29.799 0.303   1.00 155.21 ? 307 ILE A O   1 
ATOM   1673 C  CB  . ILE A 1 307 ? 11.593  28.613 3.391   1.00 158.29 ? 307 ILE A CB  1 
ATOM   1674 C  CG1 . ILE A 1 307 ? 12.626  27.956 4.327   1.00 161.63 ? 307 ILE A CG1 1 
ATOM   1675 C  CG2 . ILE A 1 307 ? 10.767  27.537 2.667   1.00 162.10 ? 307 ILE A CG2 1 
ATOM   1676 C  CD1 . ILE A 1 307 ? 12.111  27.630 5.709   1.00 170.62 ? 307 ILE A CD1 1 
ATOM   1677 N  N   . HIS A 1 308 ? 10.655  31.360 1.870   1.00 148.24 ? 308 HIS A N   1 
ATOM   1678 C  CA  . HIS A 1 308 ? 9.699   32.093 1.045   1.00 145.82 ? 308 HIS A CA  1 
ATOM   1679 C  C   . HIS A 1 308 ? 10.377  32.946 -0.039  1.00 148.24 ? 308 HIS A C   1 
ATOM   1680 O  O   . HIS A 1 308 ? 10.043  32.812 -1.215  1.00 148.27 ? 308 HIS A O   1 
ATOM   1681 C  CB  . HIS A 1 308 ? 8.725   32.922 1.902   1.00 143.85 ? 308 HIS A CB  1 
ATOM   1682 C  CG  . HIS A 1 308 ? 7.618   33.542 1.106   1.00 145.18 ? 308 HIS A CG  1 
ATOM   1683 N  ND1 . HIS A 1 308 ? 6.497   32.817 0.742   1.00 148.96 ? 308 HIS A ND1 1 
ATOM   1684 C  CD2 . HIS A 1 308 ? 7.511   34.794 0.603   1.00 143.28 ? 308 HIS A CD2 1 
ATOM   1685 C  CE1 . HIS A 1 308 ? 5.745   33.649 0.040   1.00 145.91 ? 308 HIS A CE1 1 
ATOM   1686 N  NE2 . HIS A 1 308 ? 6.313   34.850 -0.069  1.00 142.79 ? 308 HIS A NE2 1 
ATOM   1687 N  N   . GLY A 1 309 ? 11.315  33.796 0.372   1.00 143.28 ? 309 GLY A N   1 
ATOM   1688 C  CA  . GLY A 1 309 ? 12.030  34.719 -0.504  1.00 141.23 ? 309 GLY A CA  1 
ATOM   1689 C  C   . GLY A 1 309 ? 13.016  34.115 -1.484  1.00 147.99 ? 309 GLY A C   1 
ATOM   1690 O  O   . GLY A 1 309 ? 13.114  34.589 -2.620  1.00 147.04 ? 309 GLY A O   1 
ATOM   1691 N  N   . LEU A 1 310 ? 13.774  33.090 -1.062  1.00 147.39 ? 310 LEU A N   1 
ATOM   1692 C  CA  . LEU A 1 310 ? 14.781  32.484 -1.933  1.00 149.71 ? 310 LEU A CA  1 
ATOM   1693 C  C   . LEU A 1 310 ? 14.392  31.115 -2.504  1.00 157.30 ? 310 LEU A C   1 
ATOM   1694 O  O   . LEU A 1 310 ? 15.133  30.591 -3.337  1.00 159.91 ? 310 LEU A O   1 
ATOM   1695 C  CB  . LEU A 1 310 ? 16.148  32.414 -1.231  1.00 151.16 ? 310 LEU A CB  1 
ATOM   1696 C  CG  . LEU A 1 310 ? 16.858  33.750 -1.016  1.00 152.78 ? 310 LEU A CG  1 
ATOM   1697 C  CD1 . LEU A 1 310 ? 17.749  33.695 0.201   1.00 154.22 ? 310 LEU A CD1 1 
ATOM   1698 C  CD2 . LEU A 1 310 ? 17.652  34.169 -2.247  1.00 155.01 ? 310 LEU A CD2 1 
ATOM   1699 N  N   . ILE A 1 311 ? 13.236  30.545 -2.103  1.00 153.86 ? 311 ILE A N   1 
ATOM   1700 C  CA  . ILE A 1 311 ? 12.810  29.241 -2.629  1.00 157.27 ? 311 ILE A CA  1 
ATOM   1701 C  C   . ILE A 1 311 ? 11.355  29.289 -3.162  1.00 159.41 ? 311 ILE A C   1 
ATOM   1702 O  O   . ILE A 1 311 ? 11.128  28.852 -4.292  1.00 160.84 ? 311 ILE A O   1 
ATOM   1703 C  CB  . ILE A 1 311 ? 13.078  28.080 -1.611  1.00 163.99 ? 311 ILE A CB  1 
ATOM   1704 C  CG1 . ILE A 1 311 ? 14.574  27.699 -1.576  1.00 166.75 ? 311 ILE A CG1 1 
ATOM   1705 C  CG2 . ILE A 1 311 ? 12.229  26.831 -1.882  1.00 168.41 ? 311 ILE A CG2 1 
ATOM   1706 C  CD1 . ILE A 1 311 ? 15.364  28.311 -0.442  1.00 172.61 ? 311 ILE A CD1 1 
ATOM   1707 N  N   . VAL A 1 312 ? 10.395  29.832 -2.380  1.00 152.58 ? 312 VAL A N   1 
ATOM   1708 C  CA  . VAL A 1 312 ? 8.979   29.902 -2.770  1.00 151.38 ? 312 VAL A CA  1 
ATOM   1709 C  C   . VAL A 1 312 ? 8.757   30.872 -3.944  1.00 152.43 ? 312 VAL A C   1 
ATOM   1710 O  O   . VAL A 1 312 ? 8.348   30.423 -5.016  1.00 153.73 ? 312 VAL A O   1 
ATOM   1711 C  CB  . VAL A 1 312 ? 8.032   30.183 -1.568  1.00 153.52 ? 312 VAL A CB  1 
ATOM   1712 C  CG1 . VAL A 1 312 ? 6.618   30.519 -2.025  1.00 152.08 ? 312 VAL A CG1 1 
ATOM   1713 C  CG2 . VAL A 1 312 ? 8.014   29.011 -0.592  1.00 157.01 ? 312 VAL A CG2 1 
ATOM   1714 N  N   . LEU A 1 313 ? 9.029   32.179 -3.744  1.00 145.09 ? 313 LEU A N   1 
ATOM   1715 C  CA  . LEU A 1 313 ? 8.854   33.226 -4.759  1.00 142.14 ? 313 LEU A CA  1 
ATOM   1716 C  C   . LEU A 1 313 ? 9.682   33.000 -6.047  1.00 147.88 ? 313 LEU A C   1 
ATOM   1717 O  O   . LEU A 1 313 ? 9.091   33.147 -7.121  1.00 147.44 ? 313 LEU A O   1 
ATOM   1718 C  CB  . LEU A 1 313 ? 9.096   34.640 -4.190  1.00 137.83 ? 313 LEU A CB  1 
ATOM   1719 C  CG  . LEU A 1 313 ? 8.072   35.176 -3.177  1.00 140.20 ? 313 LEU A CG  1 
ATOM   1720 C  CD1 . LEU A 1 313 ? 8.636   36.355 -2.414  1.00 136.93 ? 313 LEU A CD1 1 
ATOM   1721 C  CD2 . LEU A 1 313 ? 6.760   35.571 -3.852  1.00 141.41 ? 313 LEU A CD2 1 
ATOM   1722 N  N   . PRO A 1 314 ? 10.995  32.616 -6.009  1.00 146.48 ? 314 PRO A N   1 
ATOM   1723 C  CA  . PRO A 1 314 ? 11.729  32.402 -7.269  1.00 148.36 ? 314 PRO A CA  1 
ATOM   1724 C  C   . PRO A 1 314 ? 11.123  31.310 -8.153  1.00 156.64 ? 314 PRO A C   1 
ATOM   1725 O  O   . PRO A 1 314 ? 11.091  31.465 -9.376  1.00 156.72 ? 314 PRO A O   1 
ATOM   1726 C  CB  . PRO A 1 314 ? 13.141  32.040 -6.792  1.00 151.66 ? 314 PRO A CB  1 
ATOM   1727 C  CG  . PRO A 1 314 ? 13.245  32.628 -5.449  1.00 153.27 ? 314 PRO A CG  1 
ATOM   1728 C  CD  . PRO A 1 314 ? 11.895  32.394 -4.858  1.00 148.35 ? 314 PRO A CD  1 
ATOM   1729 N  N   . LEU A 1 315 ? 10.603  30.232 -7.524  1.00 156.39 ? 315 LEU A N   1 
ATOM   1730 C  CA  . LEU A 1 315 ? 9.953   29.098 -8.188  1.00 160.34 ? 315 LEU A CA  1 
ATOM   1731 C  C   . LEU A 1 315 ? 8.695   29.551 -8.933  1.00 163.74 ? 315 LEU A C   1 
ATOM   1732 O  O   . LEU A 1 315 ? 8.438   29.060 -10.031 1.00 166.02 ? 315 LEU A O   1 
ATOM   1733 C  CB  . LEU A 1 315 ? 9.605   28.013 -7.155  1.00 162.86 ? 315 LEU A CB  1 
ATOM   1734 C  CG  . LEU A 1 315 ? 8.979   26.730 -7.684  1.00 171.79 ? 315 LEU A CG  1 
ATOM   1735 C  CD1 . LEU A 1 315 ? 10.041  25.705 -8.021  1.00 176.26 ? 315 LEU A CD1 1 
ATOM   1736 C  CD2 . LEU A 1 315 ? 7.993   26.170 -6.687  1.00 174.59 ? 315 LEU A CD2 1 
ATOM   1737 N  N   . ILE A 1 316 ? 7.929   30.493 -8.337  1.00 156.96 ? 316 ILE A N   1 
ATOM   1738 C  CA  . ILE A 1 316 ? 6.708   31.071 -8.910  1.00 155.44 ? 316 ILE A CA  1 
ATOM   1739 C  C   . ILE A 1 316 ? 7.048   31.808 -10.224 1.00 159.21 ? 316 ILE A C   1 
ATOM   1740 O  O   . ILE A 1 316 ? 6.337   31.638 -11.220 1.00 160.49 ? 316 ILE A O   1 
ATOM   1741 C  CB  . ILE A 1 316 ? 5.954   31.954 -7.863  1.00 154.68 ? 316 ILE A CB  1 
ATOM   1742 C  CG1 . ILE A 1 316 ? 5.503   31.107 -6.648  1.00 156.74 ? 316 ILE A CG1 1 
ATOM   1743 C  CG2 . ILE A 1 316 ? 4.751   32.690 -8.482  1.00 153.73 ? 316 ILE A CG2 1 
ATOM   1744 C  CD1 . ILE A 1 316 ? 5.294   31.887 -5.342  1.00 158.89 ? 316 ILE A CD1 1 
ATOM   1745 N  N   . TYR A 1 317 ? 8.167   32.570 -10.233 1.00 154.14 ? 317 TYR A N   1 
ATOM   1746 C  CA  . TYR A 1 317 ? 8.665   33.307 -11.400 1.00 153.19 ? 317 TYR A CA  1 
ATOM   1747 C  C   . TYR A 1 317 ? 9.054   32.341 -12.536 1.00 162.06 ? 317 TYR A C   1 
ATOM   1748 O  O   . TYR A 1 317 ? 8.607   32.531 -13.666 1.00 162.27 ? 317 TYR A O   1 
ATOM   1749 C  CB  . TYR A 1 317 ? 9.836   34.224 -10.994 1.00 151.51 ? 317 TYR A CB  1 
ATOM   1750 C  CG  . TYR A 1 317 ? 10.390  35.091 -12.107 1.00 152.11 ? 317 TYR A CG  1 
ATOM   1751 C  CD1 . TYR A 1 317 ? 9.789   36.301 -12.441 1.00 150.65 ? 317 TYR A CD1 1 
ATOM   1752 C  CD2 . TYR A 1 317 ? 11.547  34.729 -12.787 1.00 155.47 ? 317 TYR A CD2 1 
ATOM   1753 C  CE1 . TYR A 1 317 ? 10.313  37.116 -13.445 1.00 150.51 ? 317 TYR A CE1 1 
ATOM   1754 C  CE2 . TYR A 1 317 ? 12.085  35.538 -13.787 1.00 155.63 ? 317 TYR A CE2 1 
ATOM   1755 C  CZ  . TYR A 1 317 ? 11.459  36.726 -14.121 1.00 158.68 ? 317 TYR A CZ  1 
ATOM   1756 O  OH  . TYR A 1 317 ? 11.982  37.512 -15.120 1.00 157.16 ? 317 TYR A OH  1 
ATOM   1757 N  N   . PHE A 1 318 ? 9.835   31.284 -12.220 1.00 162.63 ? 318 PHE A N   1 
ATOM   1758 C  CA  . PHE A 1 318 ? 10.257  30.256 -13.179 1.00 167.82 ? 318 PHE A CA  1 
ATOM   1759 C  C   . PHE A 1 318 ? 9.042   29.478 -13.711 1.00 174.77 ? 318 PHE A C   1 
ATOM   1760 O  O   . PHE A 1 318 ? 9.047   29.068 -14.868 1.00 177.55 ? 318 PHE A O   1 
ATOM   1761 C  CB  . PHE A 1 318 ? 11.261  29.283 -12.522 1.00 173.12 ? 318 PHE A CB  1 
ATOM   1762 C  CG  . PHE A 1 318 ? 12.269  28.627 -13.445 1.00 178.88 ? 318 PHE A CG  1 
ATOM   1763 C  CD1 . PHE A 1 318 ? 11.905  27.553 -14.253 1.00 186.36 ? 318 PHE A CD1 1 
ATOM   1764 C  CD2 . PHE A 1 318 ? 13.596  29.040 -13.458 1.00 180.80 ? 318 PHE A CD2 1 
ATOM   1765 C  CE1 . PHE A 1 318 ? 12.840  26.943 -15.096 1.00 190.91 ? 318 PHE A CE1 1 
ATOM   1766 C  CE2 . PHE A 1 318 ? 14.533  28.421 -14.294 1.00 187.15 ? 318 PHE A CE2 1 
ATOM   1767 C  CZ  . PHE A 1 318 ? 14.148  27.379 -15.108 1.00 189.36 ? 318 PHE A CZ  1 
ATOM   1768 N  N   . LEU A 1 319 ? 8.007   29.281 -12.870 1.00 170.83 ? 319 LEU A N   1 
ATOM   1769 C  CA  . LEU A 1 319 ? 6.790   28.553 -13.241 1.00 173.55 ? 319 LEU A CA  1 
ATOM   1770 C  C   . LEU A 1 319 ? 5.920   29.321 -14.242 1.00 176.15 ? 319 LEU A C   1 
ATOM   1771 O  O   . LEU A 1 319 ? 5.217   28.691 -15.038 1.00 179.19 ? 319 LEU A O   1 
ATOM   1772 C  CB  . LEU A 1 319 ? 5.973   28.197 -11.989 1.00 173.25 ? 319 LEU A CB  1 
ATOM   1773 C  CG  . LEU A 1 319 ? 5.165   26.907 -12.057 1.00 182.42 ? 319 LEU A CG  1 
ATOM   1774 C  CD1 . LEU A 1 319 ? 5.346   26.091 -10.798 1.00 183.95 ? 319 LEU A CD1 1 
ATOM   1775 C  CD2 . LEU A 1 319 ? 3.692   27.190 -12.296 1.00 184.01 ? 319 LEU A CD2 1 
ATOM   1776 N  N   . ILE A 1 320 ? 5.967   30.670 -14.204 1.00 167.94 ? 320 ILE A N   1 
ATOM   1777 C  CA  . ILE A 1 320 ? 5.165   31.531 -15.078 1.00 166.08 ? 320 ILE A CA  1 
ATOM   1778 C  C   . ILE A 1 320 ? 5.978   32.069 -16.267 1.00 170.53 ? 320 ILE A C   1 
ATOM   1779 O  O   . ILE A 1 320 ? 5.602   31.829 -17.416 1.00 173.15 ? 320 ILE A O   1 
ATOM   1780 C  CB  . ILE A 1 320 ? 4.453   32.661 -14.268 1.00 164.31 ? 320 ILE A CB  1 
ATOM   1781 C  CG1 . ILE A 1 320 ? 3.487   32.061 -13.216 1.00 165.40 ? 320 ILE A CG1 1 
ATOM   1782 C  CG2 . ILE A 1 320 ? 3.714   33.647 -15.195 1.00 163.01 ? 320 ILE A CG2 1 
ATOM   1783 C  CD1 . ILE A 1 320 ? 3.251   32.912 -11.966 1.00 167.50 ? 320 ILE A CD1 1 
ATOM   1784 N  N   . THR A 1 321 ? 7.070   32.803 -15.989 1.00 164.18 ? 321 THR A N   1 
ATOM   1785 C  CA  . THR A 1 321 ? 7.914   33.433 -17.012 1.00 163.73 ? 321 THR A CA  1 
ATOM   1786 C  C   . THR A 1 321 ? 8.850   32.465 -17.734 1.00 171.44 ? 321 THR A C   1 
ATOM   1787 O  O   . THR A 1 321 ? 9.184   32.701 -18.899 1.00 171.99 ? 321 THR A O   1 
ATOM   1788 C  CB  . THR A 1 321 ? 8.705   34.617 -16.426 1.00 168.83 ? 321 THR A CB  1 
ATOM   1789 O  OG1 . THR A 1 321 ? 9.715   34.127 -15.544 1.00 169.61 ? 321 THR A OG1 1 
ATOM   1790 C  CG2 . THR A 1 321 ? 7.817   35.644 -15.721 1.00 163.24 ? 321 THR A CG2 1 
ATOM   1791 N  N   . ARG A 1 322 ? 9.299   31.403 -17.028 1.00 170.21 ? 322 ARG A N   1 
ATOM   1792 C  CA  . ARG A 1 322 ? 10.254  30.387 -17.502 1.00 174.37 ? 322 ARG A CA  1 
ATOM   1793 C  C   . ARG A 1 322 ? 11.647  31.015 -17.741 1.00 176.30 ? 322 ARG A C   1 
ATOM   1794 O  O   . ARG A 1 322 ? 12.417  30.566 -18.598 1.00 179.37 ? 322 ARG A O   1 
ATOM   1795 C  CB  . ARG A 1 322 ? 9.718   29.573 -18.709 1.00 179.22 ? 322 ARG A CB  1 
ATOM   1796 C  CG  . ARG A 1 322 ? 8.458   28.751 -18.407 1.00 190.05 ? 322 ARG A CG  1 
ATOM   1797 C  CD  . ARG A 1 322 ? 8.759   27.410 -17.755 1.00 199.24 ? 322 ARG A CD  1 
ATOM   1798 N  NE  . ARG A 1 322 ? 7.583   26.862 -17.075 1.00 204.05 ? 322 ARG A NE  1 
ATOM   1799 C  CZ  . ARG A 1 322 ? 6.843   25.858 -17.536 1.00 211.68 ? 322 ARG A CZ  1 
ATOM   1800 N  NH1 . ARG A 1 322 ? 7.155   25.265 -18.682 1.00 199.90 ? 322 ARG A NH1 1 
ATOM   1801 N  NH2 . ARG A 1 322 ? 5.792   25.432 -16.849 1.00 200.48 ? 322 ARG A NH2 1 
ATOM   1802 N  N   . LYS A 1 323 ? 11.958  32.050 -16.930 1.00 167.42 ? 323 LYS A N   1 
ATOM   1803 C  CA  . LYS A 1 323 ? 13.206  32.819 -16.923 1.00 165.13 ? 323 LYS A CA  1 
ATOM   1804 C  C   . LYS A 1 323 ? 13.882  32.655 -15.553 1.00 166.96 ? 323 LYS A C   1 
ATOM   1805 O  O   . LYS A 1 323 ? 13.185  32.444 -14.555 1.00 164.86 ? 323 LYS A O   1 
ATOM   1806 C  CB  . LYS A 1 323 ? 12.921  34.310 -17.182 1.00 162.84 ? 323 LYS A CB  1 
ATOM   1807 C  CG  . LYS A 1 323 ? 12.150  34.604 -18.466 1.00 176.16 ? 323 LYS A CG  1 
ATOM   1808 C  CD  . LYS A 1 323 ? 11.631  36.033 -18.465 1.00 181.52 ? 323 LYS A CD  1 
ATOM   1809 C  CE  . LYS A 1 323 ? 10.615  36.283 -19.549 1.00 193.17 ? 323 LYS A CE  1 
ATOM   1810 N  NZ  . LYS A 1 323 ? 9.972   37.615 -19.398 1.00 198.39 ? 323 LYS A NZ  1 
ATOM   1811 N  N   . ASN A 1 324 ? 15.231  32.752 -15.507 1.00 163.83 ? 324 ASN A N   1 
ATOM   1812 C  CA  . ASN A 1 324 ? 16.012  32.608 -14.273 1.00 162.89 ? 324 ASN A CA  1 
ATOM   1813 C  C   . ASN A 1 324 ? 15.696  33.715 -13.266 1.00 161.34 ? 324 ASN A C   1 
ATOM   1814 O  O   . ASN A 1 324 ? 15.907  34.892 -13.568 1.00 158.52 ? 324 ASN A O   1 
ATOM   1815 C  CB  . ASN A 1 324 ? 17.510  32.509 -14.558 1.00 166.53 ? 324 ASN A CB  1 
ATOM   1816 C  CG  . ASN A 1 324 ? 17.949  31.122 -14.950 1.00 200.41 ? 324 ASN A CG  1 
ATOM   1817 O  OD1 . ASN A 1 324 ? 18.036  30.210 -14.117 1.00 197.60 ? 324 ASN A OD1 1 
ATOM   1818 N  ND2 . ASN A 1 324 ? 18.238  30.929 -16.231 1.00 196.94 ? 324 ASN A ND2 1 
ATOM   1819 N  N   . PRO A 1 325 ? 15.132  33.360 -12.090 1.00 156.18 ? 325 PRO A N   1 
ATOM   1820 C  CA  . PRO A 1 325 ? 14.756  34.396 -11.114 1.00 151.35 ? 325 PRO A CA  1 
ATOM   1821 C  C   . PRO A 1 325 ? 15.907  35.052 -10.359 1.00 154.17 ? 325 PRO A C   1 
ATOM   1822 O  O   . PRO A 1 325 ? 15.743  36.183 -9.901  1.00 150.19 ? 325 PRO A O   1 
ATOM   1823 C  CB  . PRO A 1 325 ? 13.806  33.664 -10.170 1.00 153.23 ? 325 PRO A CB  1 
ATOM   1824 C  CG  . PRO A 1 325 ? 14.221  32.254 -10.247 1.00 162.30 ? 325 PRO A CG  1 
ATOM   1825 C  CD  . PRO A 1 325 ? 14.778  32.010 -11.608 1.00 160.71 ? 325 PRO A CD  1 
ATOM   1826 N  N   . PHE A 1 326 ? 17.058  34.362 -10.228 1.00 153.83 ? 326 PHE A N   1 
ATOM   1827 C  CA  . PHE A 1 326 ? 18.219  34.880 -9.496  1.00 152.93 ? 326 PHE A CA  1 
ATOM   1828 C  C   . PHE A 1 326 ? 19.095  35.846 -10.325 1.00 155.65 ? 326 PHE A C   1 
ATOM   1829 O  O   . PHE A 1 326 ? 20.026  36.447 -9.780  1.00 154.57 ? 326 PHE A O   1 
ATOM   1830 C  CB  . PHE A 1 326 ? 19.033  33.735 -8.883  1.00 158.72 ? 326 PHE A CB  1 
ATOM   1831 C  CG  . PHE A 1 326 ? 18.229  32.940 -7.879  1.00 160.94 ? 326 PHE A CG  1 
ATOM   1832 C  CD1 . PHE A 1 326 ? 18.019  33.422 -6.591  1.00 161.61 ? 326 PHE A CD1 1 
ATOM   1833 C  CD2 . PHE A 1 326 ? 17.656  31.723 -8.230  1.00 166.50 ? 326 PHE A CD2 1 
ATOM   1834 C  CE1 . PHE A 1 326 ? 17.260  32.695 -5.669  1.00 163.19 ? 326 PHE A CE1 1 
ATOM   1835 C  CE2 . PHE A 1 326 ? 16.902  30.994 -7.305  1.00 170.03 ? 326 PHE A CE2 1 
ATOM   1836 C  CZ  . PHE A 1 326 ? 16.713  31.483 -6.031  1.00 165.51 ? 326 PHE A CZ  1 
ATOM   1837 N  N   . VAL A 1 327 ? 18.761  36.026 -11.623 1.00 151.87 ? 327 VAL A N   1 
ATOM   1838 C  CA  . VAL A 1 327 ? 19.397  36.981 -12.545 1.00 150.50 ? 327 VAL A CA  1 
ATOM   1839 C  C   . VAL A 1 327 ? 18.526  38.259 -12.490 1.00 147.80 ? 327 VAL A C   1 
ATOM   1840 O  O   . VAL A 1 327 ? 19.036  39.374 -12.616 1.00 145.46 ? 327 VAL A O   1 
ATOM   1841 C  CB  . VAL A 1 327 ? 19.547  36.415 -13.989 1.00 157.94 ? 327 VAL A CB  1 
ATOM   1842 C  CG1 . VAL A 1 327 ? 20.293  37.391 -14.898 1.00 157.54 ? 327 VAL A CG1 1 
ATOM   1843 C  CG2 . VAL A 1 327 ? 20.254  35.060 -13.981 1.00 162.61 ? 327 VAL A CG2 1 
ATOM   1844 N  N   . PHE A 1 328 ? 17.212  38.071 -12.255 1.00 141.32 ? 328 PHE A N   1 
ATOM   1845 C  CA  . PHE A 1 328 ? 16.214  39.125 -12.090 1.00 136.45 ? 328 PHE A CA  1 
ATOM   1846 C  C   . PHE A 1 328 ? 16.415  39.790 -10.717 1.00 135.89 ? 328 PHE A C   1 
ATOM   1847 O  O   . PHE A 1 328 ? 16.290  41.012 -10.616 1.00 132.47 ? 328 PHE A O   1 
ATOM   1848 C  CB  . PHE A 1 328 ? 14.800  38.526 -12.206 1.00 138.38 ? 328 PHE A CB  1 
ATOM   1849 C  CG  . PHE A 1 328 ? 13.655  39.514 -12.197 1.00 136.40 ? 328 PHE A CG  1 
ATOM   1850 C  CD1 . PHE A 1 328 ? 13.032  39.871 -11.007 1.00 136.58 ? 328 PHE A CD1 1 
ATOM   1851 C  CD2 . PHE A 1 328 ? 13.166  40.048 -13.383 1.00 138.16 ? 328 PHE A CD2 1 
ATOM   1852 C  CE1 . PHE A 1 328 ? 11.962  40.766 -11.002 1.00 134.33 ? 328 PHE A CE1 1 
ATOM   1853 C  CE2 . PHE A 1 328 ? 12.091  40.943 -13.377 1.00 137.68 ? 328 PHE A CE2 1 
ATOM   1854 C  CZ  . PHE A 1 328 ? 11.491  41.285 -12.189 1.00 132.99 ? 328 PHE A CZ  1 
ATOM   1855 N  N   . ILE A 1 329 ? 16.730  38.979 -9.668  1.00 132.28 ? 329 ILE A N   1 
ATOM   1856 C  CA  . ILE A 1 329 ? 17.000  39.431 -8.291  1.00 129.44 ? 329 ILE A CA  1 
ATOM   1857 C  C   . ILE A 1 329 ? 18.306  40.267 -8.252  1.00 132.71 ? 329 ILE A C   1 
ATOM   1858 O  O   . ILE A 1 329 ? 18.410  41.207 -7.462  1.00 129.32 ? 329 ILE A O   1 
ATOM   1859 C  CB  . ILE A 1 329 ? 16.953  38.236 -7.274  1.00 134.18 ? 329 ILE A CB  1 
ATOM   1860 C  CG1 . ILE A 1 329 ? 15.490  37.778 -7.036  1.00 133.40 ? 329 ILE A CG1 1 
ATOM   1861 C  CG2 . ILE A 1 329 ? 17.641  38.563 -5.933  1.00 133.91 ? 329 ILE A CG2 1 
ATOM   1862 C  CD1 . ILE A 1 329 ? 15.295  36.340 -6.488  1.00 141.25 ? 329 ILE A CD1 1 
ATOM   1863 N  N   . ALA A 1 330 ? 19.260  39.957 -9.154  1.00 132.40 ? 330 ALA A N   1 
ATOM   1864 C  CA  . ALA A 1 330 ? 20.531  40.672 -9.304  1.00 132.90 ? 330 ALA A CA  1 
ATOM   1865 C  C   . ALA A 1 330 ? 20.328  42.099 -9.853  1.00 133.98 ? 330 ALA A C   1 
ATOM   1866 O  O   . ALA A 1 330 ? 21.126  42.990 -9.555  1.00 132.69 ? 330 ALA A O   1 
ATOM   1867 C  CB  . ALA A 1 330 ? 21.464  39.887 -10.211 1.00 137.87 ? 330 ALA A CB  1 
ATOM   1868 N  N   . GLY A 1 331 ? 19.271  42.290 -10.646 1.00 129.38 ? 331 GLY A N   1 
ATOM   1869 C  CA  . GLY A 1 331 ? 18.898  43.585 -11.207 1.00 126.47 ? 331 GLY A CA  1 
ATOM   1870 C  C   . GLY A 1 331 ? 18.317  44.502 -10.146 1.00 126.61 ? 331 GLY A C   1 
ATOM   1871 O  O   . GLY A 1 331 ? 18.731  45.658 -10.023 1.00 124.70 ? 331 GLY A O   1 
ATOM   1872 N  N   . ILE A 1 332 ? 17.380  43.966 -9.337  1.00 121.76 ? 332 ILE A N   1 
ATOM   1873 C  CA  . ILE A 1 332 ? 16.716  44.680 -8.236  1.00 118.19 ? 332 ILE A CA  1 
ATOM   1874 C  C   . ILE A 1 332 ? 17.481  44.551 -6.905  1.00 121.75 ? 332 ILE A C   1 
ATOM   1875 O  O   . ILE A 1 332 ? 16.918  44.835 -5.846  1.00 119.08 ? 332 ILE A O   1 
ATOM   1876 C  CB  . ILE A 1 332 ? 15.214  44.281 -8.094  1.00 120.11 ? 332 ILE A CB  1 
ATOM   1877 C  CG1 . ILE A 1 332 ? 15.016  42.775 -7.815  1.00 123.03 ? 332 ILE A CG1 1 
ATOM   1878 C  CG2 . ILE A 1 332 ? 14.401  44.740 -9.290  1.00 119.88 ? 332 ILE A CG2 1 
ATOM   1879 C  CD1 . ILE A 1 332 ? 14.548  42.465 -6.418  1.00 127.44 ? 332 ILE A CD1 1 
ATOM   1880 N  N   . LEU A 1 333 ? 18.761  44.138 -6.966  1.00 121.09 ? 333 LEU A N   1 
ATOM   1881 C  CA  . LEU A 1 333 ? 19.602  43.932 -5.787  1.00 122.05 ? 333 LEU A CA  1 
ATOM   1882 C  C   . LEU A 1 333 ? 19.903  45.216 -5.013  1.00 123.82 ? 333 LEU A C   1 
ATOM   1883 O  O   . LEU A 1 333 ? 20.045  45.151 -3.790  1.00 123.27 ? 333 LEU A O   1 
ATOM   1884 C  CB  . LEU A 1 333 ? 20.888  43.186 -6.156  1.00 125.77 ? 333 LEU A CB  1 
ATOM   1885 C  CG  . LEU A 1 333 ? 21.464  42.273 -5.084  1.00 132.68 ? 333 LEU A CG  1 
ATOM   1886 C  CD1 . LEU A 1 333 ? 20.613  41.019 -4.900  1.00 133.79 ? 333 LEU A CD1 1 
ATOM   1887 C  CD2 . LEU A 1 333 ? 22.872  41.873 -5.437  1.00 139.11 ? 333 LEU A CD2 1 
ATOM   1888 N  N   . GLN A 1 334 ? 19.960  46.376 -5.712  1.00 118.58 ? 334 GLN A N   1 
ATOM   1889 C  CA  . GLN A 1 334 ? 20.187  47.697 -5.100  1.00 116.11 ? 334 GLN A CA  1 
ATOM   1890 C  C   . GLN A 1 334 ? 18.972  48.103 -4.248  1.00 116.18 ? 334 GLN A C   1 
ATOM   1891 O  O   . GLN A 1 334 ? 19.138  48.743 -3.207  1.00 114.23 ? 334 GLN A O   1 
ATOM   1892 C  CB  . GLN A 1 334 ? 20.458  48.765 -6.175  1.00 116.73 ? 334 GLN A CB  1 
ATOM   1893 C  CG  . GLN A 1 334 ? 21.792  48.610 -6.888  1.00 137.32 ? 334 GLN A CG  1 
ATOM   1894 C  CD  . GLN A 1 334 ? 21.857  49.435 -8.148  1.00 159.78 ? 334 GLN A CD  1 
ATOM   1895 O  OE1 . GLN A 1 334 ? 21.299  49.072 -9.194  1.00 155.44 ? 334 GLN A OE1 1 
ATOM   1896 N  NE2 . GLN A 1 334 ? 22.568  50.550 -8.086  1.00 153.51 ? 334 GLN A NE2 1 
ATOM   1897 N  N   . ALA A 1 335 ? 17.757  47.714 -4.701  1.00 111.48 ? 335 ALA A N   1 
ATOM   1898 C  CA  . ALA A 1 335 ? 16.478  47.973 -4.042  1.00 108.79 ? 335 ALA A CA  1 
ATOM   1899 C  C   . ALA A 1 335 ? 16.307  47.145 -2.768  1.00 113.79 ? 335 ALA A C   1 
ATOM   1900 O  O   . ALA A 1 335 ? 15.661  47.610 -1.828  1.00 112.09 ? 335 ALA A O   1 
ATOM   1901 C  CB  . ALA A 1 335 ? 15.331  47.710 -5.002  1.00 108.72 ? 335 ALA A CB  1 
ATOM   1902 N  N   . LEU A 1 336 ? 16.883  45.926 -2.734  1.00 112.72 ? 336 LEU A N   1 
ATOM   1903 C  CA  . LEU A 1 336 ? 16.816  45.038 -1.571  1.00 113.65 ? 336 LEU A CA  1 
ATOM   1904 C  C   . LEU A 1 336 ? 17.775  45.521 -0.485  1.00 118.49 ? 336 LEU A C   1 
ATOM   1905 O  O   . LEU A 1 336 ? 17.381  45.592 0.676   1.00 117.42 ? 336 LEU A O   1 
ATOM   1906 C  CB  . LEU A 1 336 ? 17.122  43.578 -1.953  1.00 116.70 ? 336 LEU A CB  1 
ATOM   1907 C  CG  . LEU A 1 336 ? 16.280  42.943 -3.062  1.00 121.48 ? 336 LEU A CG  1 
ATOM   1908 C  CD1 . LEU A 1 336 ? 16.952  41.700 -3.603  1.00 125.08 ? 336 LEU A CD1 1 
ATOM   1909 C  CD2 . LEU A 1 336 ? 14.865  42.638 -2.594  1.00 122.22 ? 336 LEU A CD2 1 
ATOM   1910 N  N   . ILE A 1 337 ? 19.023  45.881 -0.869  1.00 116.96 ? 337 ILE A N   1 
ATOM   1911 C  CA  . ILE A 1 337 ? 20.065  46.404 0.030   1.00 117.81 ? 337 ILE A CA  1 
ATOM   1912 C  C   . ILE A 1 337 ? 19.583  47.708 0.707   1.00 120.24 ? 337 ILE A C   1 
ATOM   1913 O  O   . ILE A 1 337 ? 19.829  47.900 1.903   1.00 120.03 ? 337 ILE A O   1 
ATOM   1914 C  CB  . ILE A 1 337 ? 21.439  46.523 -0.710  1.00 122.73 ? 337 ILE A CB  1 
ATOM   1915 C  CG1 . ILE A 1 337 ? 22.059  45.127 -0.924  1.00 126.41 ? 337 ILE A CG1 1 
ATOM   1916 C  CG2 . ILE A 1 337 ? 22.433  47.449 0.015   1.00 123.54 ? 337 ILE A CG2 1 
ATOM   1917 C  CD1 . ILE A 1 337 ? 22.941  44.995 -2.143  1.00 135.17 ? 337 ILE A CD1 1 
ATOM   1918 N  N   . THR A 1 338 ? 18.851  48.564 -0.047  1.00 115.25 ? 338 THR A N   1 
ATOM   1919 C  CA  . THR A 1 338 ? 18.281  49.809 0.477   1.00 112.87 ? 338 THR A CA  1 
ATOM   1920 C  C   . THR A 1 338 ? 17.072  49.526 1.381   1.00 117.10 ? 338 THR A C   1 
ATOM   1921 O  O   . THR A 1 338 ? 16.845  50.285 2.326   1.00 116.36 ? 338 THR A O   1 
ATOM   1922 C  CB  . THR A 1 338 ? 17.990  50.836 -0.624  1.00 116.32 ? 338 THR A CB  1 
ATOM   1923 O  OG1 . THR A 1 338 ? 17.231  50.222 -1.659  1.00 115.21 ? 338 THR A OG1 1 
ATOM   1924 C  CG2 . THR A 1 338 ? 19.253  51.460 -1.197  1.00 115.56 ? 338 THR A CG2 1 
ATOM   1925 N  N   . ALA A 1 339 ? 16.306  48.434 1.108   1.00 114.18 ? 339 ALA A N   1 
ATOM   1926 C  CA  . ALA A 1 339 ? 15.149  48.021 1.924   1.00 113.36 ? 339 ALA A CA  1 
ATOM   1927 C  C   . ALA A 1 339 ? 15.612  47.531 3.296   1.00 118.68 ? 339 ALA A C   1 
ATOM   1928 O  O   . ALA A 1 339 ? 14.900  47.707 4.283   1.00 117.33 ? 339 ALA A O   1 
ATOM   1929 C  CB  . ALA A 1 339 ? 14.356  46.935 1.218   1.00 114.75 ? 339 ALA A CB  1 
ATOM   1930 N  N   . LEU A 1 340 ? 16.817  46.931 3.345   1.00 117.85 ? 340 LEU A N   1 
ATOM   1931 C  CA  . LEU A 1 340 ? 17.487  46.444 4.549   1.00 119.98 ? 340 LEU A CA  1 
ATOM   1932 C  C   . LEU A 1 340 ? 17.886  47.646 5.414   1.00 122.80 ? 340 LEU A C   1 
ATOM   1933 O  O   . LEU A 1 340 ? 17.743  47.609 6.638   1.00 122.81 ? 340 LEU A O   1 
ATOM   1934 C  CB  . LEU A 1 340 ? 18.740  45.636 4.132   1.00 122.98 ? 340 LEU A CB  1 
ATOM   1935 C  CG  . LEU A 1 340 ? 19.726  45.199 5.220   1.00 130.63 ? 340 LEU A CG  1 
ATOM   1936 C  CD1 . LEU A 1 340 ? 19.263  43.929 5.923   1.00 132.94 ? 340 LEU A CD1 1 
ATOM   1937 C  CD2 . LEU A 1 340 ? 21.100  44.991 4.637   1.00 135.00 ? 340 LEU A CD2 1 
ATOM   1938 N  N   . GLY A 1 341 ? 18.381  48.691 4.756   1.00 118.26 ? 341 GLY A N   1 
ATOM   1939 C  CA  . GLY A 1 341 ? 18.827  49.919 5.396   1.00 117.64 ? 341 GLY A CA  1 
ATOM   1940 C  C   . GLY A 1 341 ? 17.707  50.766 5.958   1.00 119.39 ? 341 GLY A C   1 
ATOM   1941 O  O   . GLY A 1 341 ? 17.757  51.149 7.130   1.00 119.67 ? 341 GLY A O   1 
ATOM   1942 N  N   . THR A 1 342 ? 16.695  51.074 5.121   1.00 113.26 ? 342 THR A N   1 
ATOM   1943 C  CA  . THR A 1 342 ? 15.557  51.921 5.496   1.00 110.70 ? 342 THR A CA  1 
ATOM   1944 C  C   . THR A 1 342 ? 14.536  51.216 6.388   1.00 114.67 ? 342 THR A C   1 
ATOM   1945 O  O   . THR A 1 342 ? 14.043  51.823 7.345   1.00 113.56 ? 342 THR A O   1 
ATOM   1946 C  CB  . THR A 1 342 ? 14.857  52.487 4.254   1.00 114.09 ? 342 THR A CB  1 
ATOM   1947 O  OG1 . THR A 1 342 ? 14.265  51.410 3.531   1.00 112.43 ? 342 THR A OG1 1 
ATOM   1948 C  CG2 . THR A 1 342 ? 15.786  53.309 3.364   1.00 112.35 ? 342 THR A CG2 1 
ATOM   1949 N  N   . SER A 1 343 ? 14.198  49.946 6.045   1.00 112.08 ? 343 SER A N   1 
ATOM   1950 C  CA  . SER A 1 343 ? 13.185  49.101 6.697   1.00 112.54 ? 343 SER A CA  1 
ATOM   1951 C  C   . SER A 1 343 ? 11.776  49.616 6.356   1.00 114.59 ? 343 SER A C   1 
ATOM   1952 O  O   . SER A 1 343 ? 10.801  49.290 7.039   1.00 114.81 ? 343 SER A O   1 
ATOM   1953 C  CB  . SER A 1 343 ? 13.410  49.011 8.205   1.00 117.40 ? 343 SER A CB  1 
ATOM   1954 O  OG  . SER A 1 343 ? 13.028  47.743 8.706   1.00 126.74 ? 343 SER A OG  1 
ATOM   1955 N  N   . SER A 1 344 ? 11.682  50.393 5.263   1.00 108.90 ? 344 SER A N   1 
ATOM   1956 C  CA  . SER A 1 344 ? 10.459  51.003 4.767   1.00 106.80 ? 344 SER A CA  1 
ATOM   1957 C  C   . SER A 1 344 ? 10.381  50.758 3.272   1.00 110.88 ? 344 SER A C   1 
ATOM   1958 O  O   . SER A 1 344 ? 11.171  51.340 2.525   1.00 110.51 ? 344 SER A O   1 
ATOM   1959 C  CB  . SER A 1 344 ? 10.475  52.500 5.069   1.00 108.78 ? 344 SER A CB  1 
ATOM   1960 O  OG  . SER A 1 344 ? 9.338   53.189 4.578   1.00 116.00 ? 344 SER A OG  1 
ATOM   1961 N  N   . SER A 1 345 ? 9.454   49.871 2.834   1.00 107.96 ? 345 SER A N   1 
ATOM   1962 C  CA  . SER A 1 345 ? 9.253   49.518 1.417   1.00 107.47 ? 345 SER A CA  1 
ATOM   1963 C  C   . SER A 1 345 ? 8.708   50.693 0.598   1.00 109.70 ? 345 SER A C   1 
ATOM   1964 O  O   . SER A 1 345 ? 8.977   50.778 -0.605  1.00 109.04 ? 345 SER A O   1 
ATOM   1965 C  CB  . SER A 1 345 ? 8.375   48.277 1.269   1.00 111.54 ? 345 SER A CB  1 
ATOM   1966 O  OG  . SER A 1 345 ? 7.081   48.463 1.815   1.00 118.55 ? 345 SER A OG  1 
ATOM   1967 N  N   . SER A 1 346 ? 7.978   51.616 1.257   1.00 105.53 ? 346 SER A N   1 
ATOM   1968 C  CA  . SER A 1 346 ? 7.450   52.819 0.623   1.00 104.07 ? 346 SER A CA  1 
ATOM   1969 C  C   . SER A 1 346 ? 8.587   53.808 0.356   1.00 108.01 ? 346 SER A C   1 
ATOM   1970 O  O   . SER A 1 346 ? 8.564   54.490 -0.664  1.00 107.19 ? 346 SER A O   1 
ATOM   1971 C  CB  . SER A 1 346 ? 6.360   53.458 1.478   1.00 107.32 ? 346 SER A CB  1 
ATOM   1972 O  OG  . SER A 1 346 ? 6.856   53.948 2.713   1.00 117.62 ? 346 SER A OG  1 
ATOM   1973 N  N   . ALA A 1 347 ? 9.594   53.851 1.245   1.00 105.59 ? 347 ALA A N   1 
ATOM   1974 C  CA  . ALA A 1 347 ? 10.764  54.720 1.101   1.00 105.71 ? 347 ALA A CA  1 
ATOM   1975 C  C   . ALA A 1 347 ? 11.707  54.234 0.005   1.00 111.10 ? 347 ALA A C   1 
ATOM   1976 O  O   . ALA A 1 347 ? 12.331  55.064 -0.656  1.00 110.62 ? 347 ALA A O   1 
ATOM   1977 C  CB  . ALA A 1 347 ? 11.517  54.816 2.415   1.00 107.52 ? 347 ALA A CB  1 
ATOM   1978 N  N   . THR A 1 348 ? 11.824  52.901 -0.179  1.00 109.16 ? 348 THR A N   1 
ATOM   1979 C  CA  . THR A 1 348 ? 12.699  52.301 -1.195  1.00 110.17 ? 348 THR A CA  1 
ATOM   1980 C  C   . THR A 1 348 ? 11.993  52.083 -2.528  1.00 113.70 ? 348 THR A C   1 
ATOM   1981 O  O   . THR A 1 348 ? 12.621  51.607 -3.477  1.00 114.03 ? 348 THR A O   1 
ATOM   1982 C  CB  . THR A 1 348 ? 13.381  51.032 -0.686  1.00 118.45 ? 348 THR A CB  1 
ATOM   1983 O  OG1 . THR A 1 348 ? 12.413  50.109 -0.183  1.00 117.43 ? 348 THR A OG1 1 
ATOM   1984 C  CG2 . THR A 1 348 ? 14.419  51.334 0.345   1.00 117.11 ? 348 THR A CG2 1 
ATOM   1985 N  N   . LEU A 1 349 ? 10.704  52.469 -2.610  1.00 109.63 ? 349 LEU A N   1 
ATOM   1986 C  CA  . LEU A 1 349 ? 9.908   52.380 -3.832  1.00 109.58 ? 349 LEU A CA  1 
ATOM   1987 C  C   . LEU A 1 349 ? 10.570  53.134 -5.025  1.00 112.69 ? 349 LEU A C   1 
ATOM   1988 O  O   . LEU A 1 349 ? 10.662  52.517 -6.091  1.00 113.30 ? 349 LEU A O   1 
ATOM   1989 C  CB  . LEU A 1 349 ? 8.445   52.824 -3.599  1.00 108.54 ? 349 LEU A CB  1 
ATOM   1990 C  CG  . LEU A 1 349 ? 7.477   52.631 -4.776  1.00 113.73 ? 349 LEU A CG  1 
ATOM   1991 C  CD1 . LEU A 1 349 ? 7.146   51.161 -4.984  1.00 115.97 ? 349 LEU A CD1 1 
ATOM   1992 C  CD2 . LEU A 1 349 ? 6.211   53.444 -4.584  1.00 114.82 ? 349 LEU A CD2 1 
ATOM   1993 N  N   . PRO A 1 350 ? 11.109  54.389 -4.883  1.00 107.38 ? 350 PRO A N   1 
ATOM   1994 C  CA  . PRO A 1 350 ? 11.746  55.040 -6.047  1.00 106.88 ? 350 PRO A CA  1 
ATOM   1995 C  C   . PRO A 1 350 ? 12.959  54.303 -6.630  1.00 111.51 ? 350 PRO A C   1 
ATOM   1996 O  O   . PRO A 1 350 ? 13.169  54.363 -7.843  1.00 111.39 ? 350 PRO A O   1 
ATOM   1997 C  CB  . PRO A 1 350 ? 12.103  56.439 -5.529  1.00 107.42 ? 350 PRO A CB  1 
ATOM   1998 C  CG  . PRO A 1 350 ? 12.129  56.318 -4.061  1.00 111.70 ? 350 PRO A CG  1 
ATOM   1999 C  CD  . PRO A 1 350 ? 11.101  55.300 -3.715  1.00 107.45 ? 350 PRO A CD  1 
ATOM   2000 N  N   . ILE A 1 351 ? 13.735  53.590 -5.782  1.00 108.62 ? 351 ILE A N   1 
ATOM   2001 C  CA  . ILE A 1 351 ? 14.902  52.823 -6.225  1.00 110.20 ? 351 ILE A CA  1 
ATOM   2002 C  C   . ILE A 1 351 ? 14.456  51.502 -6.885  1.00 115.12 ? 351 ILE A C   1 
ATOM   2003 O  O   . ILE A 1 351 ? 15.073  51.100 -7.873  1.00 116.74 ? 351 ILE A O   1 
ATOM   2004 C  CB  . ILE A 1 351 ? 15.963  52.671 -5.099  1.00 114.01 ? 351 ILE A CB  1 
ATOM   2005 C  CG1 . ILE A 1 351 ? 16.865  53.925 -5.081  1.00 114.33 ? 351 ILE A CG1 1 
ATOM   2006 C  CG2 . ILE A 1 351 ? 16.807  51.395 -5.241  1.00 116.90 ? 351 ILE A CG2 1 
ATOM   2007 C  CD1 . ILE A 1 351 ? 17.666  54.167 -3.801  1.00 124.93 ? 351 ILE A CD1 1 
ATOM   2008 N  N   . THR A 1 352 ? 13.354  50.875 -6.399  1.00 110.47 ? 352 THR A N   1 
ATOM   2009 C  CA  . THR A 1 352 ? 12.802  49.642 -6.991  1.00 111.48 ? 352 THR A CA  1 
ATOM   2010 C  C   . THR A 1 352 ? 12.245  49.924 -8.389  1.00 114.40 ? 352 THR A C   1 
ATOM   2011 O  O   . THR A 1 352 ? 12.239  49.032 -9.240  1.00 115.65 ? 352 THR A O   1 
ATOM   2012 C  CB  . THR A 1 352 ? 11.771  48.970 -6.079  1.00 119.83 ? 352 THR A CB  1 
ATOM   2013 O  OG1 . THR A 1 352 ? 12.103  49.214 -4.713  1.00 122.34 ? 352 THR A OG1 1 
ATOM   2014 C  CG2 . THR A 1 352 ? 11.679  47.470 -6.317  1.00 119.56 ? 352 THR A CG2 1 
ATOM   2015 N  N   . PHE A 1 353 ? 11.808  51.179 -8.623  1.00 108.63 ? 353 PHE A N   1 
ATOM   2016 C  CA  . PHE A 1 353 ? 11.317  51.672 -9.907  1.00 107.99 ? 353 PHE A CA  1 
ATOM   2017 C  C   . PHE A 1 353 ? 12.495  51.753 -10.869 1.00 114.33 ? 353 PHE A C   1 
ATOM   2018 O  O   . PHE A 1 353 ? 12.419  51.178 -11.948 1.00 115.67 ? 353 PHE A O   1 
ATOM   2019 C  CB  . PHE A 1 353 ? 10.668  53.052 -9.746  1.00 107.08 ? 353 PHE A CB  1 
ATOM   2020 C  CG  . PHE A 1 353 ? 9.163   53.060 -9.742  1.00 107.34 ? 353 PHE A CG  1 
ATOM   2021 C  CD1 . PHE A 1 353 ? 8.452   53.210 -10.923 1.00 110.72 ? 353 PHE A CD1 1 
ATOM   2022 C  CD2 . PHE A 1 353 ? 8.456   52.959 -8.553  1.00 108.55 ? 353 PHE A CD2 1 
ATOM   2023 C  CE1 . PHE A 1 353 ? 7.057   53.235 -10.917 1.00 111.22 ? 353 PHE A CE1 1 
ATOM   2024 C  CE2 . PHE A 1 353 ? 7.063   53.002 -8.545  1.00 110.91 ? 353 PHE A CE2 1 
ATOM   2025 C  CZ  . PHE A 1 353 ? 6.372   53.134 -9.728  1.00 109.43 ? 353 PHE A CZ  1 
ATOM   2026 N  N   . LYS A 1 354 ? 13.604  52.410 -10.451 1.00 111.41 ? 354 LYS A N   1 
ATOM   2027 C  CA  . LYS A 1 354 ? 14.835  52.544 -11.237 1.00 113.40 ? 354 LYS A CA  1 
ATOM   2028 C  C   . LYS A 1 354 ? 15.502  51.175 -11.494 1.00 121.41 ? 354 LYS A C   1 
ATOM   2029 O  O   . LYS A 1 354 ? 16.118  50.984 -12.542 1.00 123.17 ? 354 LYS A O   1 
ATOM   2030 C  CB  . LYS A 1 354 ? 15.805  53.540 -10.573 1.00 115.08 ? 354 LYS A CB  1 
ATOM   2031 C  CG  . LYS A 1 354 ? 16.971  53.959 -11.465 1.00 129.98 ? 354 LYS A CG  1 
ATOM   2032 C  CD  . LYS A 1 354 ? 17.499  55.334 -11.119 1.00 139.32 ? 354 LYS A CD  1 
ATOM   2033 C  CE  . LYS A 1 354 ? 17.140  56.358 -12.169 1.00 149.81 ? 354 LYS A CE  1 
ATOM   2034 N  NZ  . LYS A 1 354 ? 18.094  56.358 -13.306 1.00 162.61 ? 354 LYS A NZ  1 
ATOM   2035 N  N   . CYS A 1 355 ? 15.345  50.221 -10.564 1.00 119.06 ? 355 CYS A N   1 
ATOM   2036 C  CA  . CYS A 1 355 ? 15.895  48.877 -10.721 1.00 121.99 ? 355 CYS A CA  1 
ATOM   2037 C  C   . CYS A 1 355 ? 15.082  48.044 -11.707 1.00 126.95 ? 355 CYS A C   1 
ATOM   2038 O  O   . CYS A 1 355 ? 15.666  47.394 -12.571 1.00 128.65 ? 355 CYS A O   1 
ATOM   2039 C  CB  . CYS A 1 355 ? 16.037  48.182 -9.372  1.00 122.64 ? 355 CYS A CB  1 
ATOM   2040 S  SG  . CYS A 1 355 ? 17.410  48.800 -8.369  1.00 126.71 ? 355 CYS A SG  1 
ATOM   2041 N  N   . LEU A 1 356 ? 13.742  48.076 -11.596 1.00 122.50 ? 356 LEU A N   1 
ATOM   2042 C  CA  . LEU A 1 356 ? 12.866  47.333 -12.499 1.00 123.99 ? 356 LEU A CA  1 
ATOM   2043 C  C   . LEU A 1 356 ? 12.792  47.956 -13.885 1.00 129.06 ? 356 LEU A C   1 
ATOM   2044 O  O   . LEU A 1 356 ? 12.696  47.224 -14.867 1.00 131.45 ? 356 LEU A O   1 
ATOM   2045 C  CB  . LEU A 1 356 ? 11.456  47.168 -11.919 1.00 122.62 ? 356 LEU A CB  1 
ATOM   2046 C  CG  . LEU A 1 356 ? 11.263  46.058 -10.891 1.00 128.38 ? 356 LEU A CG  1 
ATOM   2047 C  CD1 . LEU A 1 356 ? 9.893   46.111 -10.312 1.00 127.21 ? 356 LEU A CD1 1 
ATOM   2048 C  CD2 . LEU A 1 356 ? 11.442  44.694 -11.508 1.00 134.31 ? 356 LEU A CD2 1 
ATOM   2049 N  N   . GLU A 1 357 ? 12.826  49.294 -13.972 1.00 123.56 ? 357 GLU A N   1 
ATOM   2050 C  CA  . GLU A 1 357 ? 12.755  49.986 -15.257 1.00 123.81 ? 357 GLU A CA  1 
ATOM   2051 C  C   . GLU A 1 357 ? 14.075  49.970 -16.019 1.00 130.26 ? 357 GLU A C   1 
ATOM   2052 O  O   . GLU A 1 357 ? 14.047  49.797 -17.237 1.00 132.08 ? 357 GLU A O   1 
ATOM   2053 C  CB  . GLU A 1 357 ? 12.231  51.421 -15.105 1.00 122.38 ? 357 GLU A CB  1 
ATOM   2054 C  CG  . GLU A 1 357 ? 10.743  51.508 -14.802 1.00 131.71 ? 357 GLU A CG  1 
ATOM   2055 C  CD  . GLU A 1 357 ? 10.196  52.894 -14.504 1.00 154.87 ? 357 GLU A CD  1 
ATOM   2056 O  OE1 . GLU A 1 357 ? 10.978  53.873 -14.533 1.00 154.62 ? 357 GLU A OE1 1 
ATOM   2057 O  OE2 . GLU A 1 357 ? 8.972   53.001 -14.261 1.00 148.55 ? 357 GLU A OE2 1 
ATOM   2058 N  N   . GLU A 1 358 ? 15.223  50.143 -15.321 1.00 126.86 ? 358 GLU A N   1 
ATOM   2059 C  CA  . GLU A 1 358 ? 16.539  50.203 -15.969 1.00 129.18 ? 358 GLU A CA  1 
ATOM   2060 C  C   . GLU A 1 358 ? 17.341  48.893 -15.947 1.00 136.29 ? 358 GLU A C   1 
ATOM   2061 O  O   . GLU A 1 358 ? 17.718  48.419 -17.020 1.00 138.74 ? 358 GLU A O   1 
ATOM   2062 C  CB  . GLU A 1 358 ? 17.393  51.356 -15.417 1.00 129.39 ? 358 GLU A CB  1 
ATOM   2063 C  CG  . GLU A 1 358 ? 16.881  52.733 -15.803 1.00 138.88 ? 358 GLU A CG  1 
ATOM   2064 C  CD  . GLU A 1 358 ? 17.868  53.883 -15.708 1.00 166.21 ? 358 GLU A CD  1 
ATOM   2065 O  OE1 . GLU A 1 358 ? 17.419  55.047 -15.818 1.00 166.73 ? 358 GLU A OE1 1 
ATOM   2066 O  OE2 . GLU A 1 358 ? 19.085  53.630 -15.554 1.00 163.79 ? 358 GLU A OE2 1 
ATOM   2067 N  N   . ASN A 1 359 ? 17.638  48.335 -14.755 1.00 132.82 ? 359 ASN A N   1 
ATOM   2068 C  CA  . ASN A 1 359 ? 18.436  47.107 -14.617 1.00 135.91 ? 359 ASN A CA  1 
ATOM   2069 C  C   . ASN A 1 359 ? 17.769  45.874 -15.253 1.00 141.60 ? 359 ASN A C   1 
ATOM   2070 O  O   . ASN A 1 359 ? 18.468  45.032 -15.821 1.00 144.79 ? 359 ASN A O   1 
ATOM   2071 C  CB  . ASN A 1 359 ? 18.825  46.852 -13.156 1.00 137.93 ? 359 ASN A CB  1 
ATOM   2072 C  CG  . ASN A 1 359 ? 19.512  48.017 -12.466 1.00 167.92 ? 359 ASN A CG  1 
ATOM   2073 O  OD1 . ASN A 1 359 ? 20.278  48.780 -13.070 1.00 167.51 ? 359 ASN A OD1 1 
ATOM   2074 N  ND2 . ASN A 1 359 ? 19.274  48.166 -11.169 1.00 156.92 ? 359 ASN A ND2 1 
ATOM   2075 N  N   . ASN A 1 360 ? 16.422  45.791 -15.176 1.00 135.82 ? 360 ASN A N   1 
ATOM   2076 C  CA  . ASN A 1 360 ? 15.602  44.730 -15.780 1.00 136.98 ? 360 ASN A CA  1 
ATOM   2077 C  C   . ASN A 1 360 ? 14.755  45.342 -16.911 1.00 138.56 ? 360 ASN A C   1 
ATOM   2078 O  O   . ASN A 1 360 ? 14.583  46.563 -16.965 1.00 135.25 ? 360 ASN A O   1 
ATOM   2079 C  CB  . ASN A 1 360 ? 14.708  44.036 -14.731 1.00 137.72 ? 360 ASN A CB  1 
ATOM   2080 C  CG  . ASN A 1 360 ? 15.433  43.348 -13.587 1.00 163.38 ? 360 ASN A CG  1 
ATOM   2081 O  OD1 . ASN A 1 360 ? 16.576  42.884 -13.703 1.00 161.01 ? 360 ASN A OD1 1 
ATOM   2082 N  ND2 . ASN A 1 360 ? 14.753  43.225 -12.458 1.00 153.34 ? 360 ASN A ND2 1 
ATOM   2083 N  N   . GLY A 1 361 ? 14.255  44.498 -17.808 1.00 137.05 ? 361 GLY A N   1 
ATOM   2084 C  CA  . GLY A 1 361 ? 13.478  44.940 -18.963 1.00 136.79 ? 361 GLY A CA  1 
ATOM   2085 C  C   . GLY A 1 361 ? 11.984  45.019 -18.741 1.00 137.70 ? 361 GLY A C   1 
ATOM   2086 O  O   . GLY A 1 361 ? 11.206  44.672 -19.637 1.00 139.20 ? 361 GLY A O   1 
ATOM   2087 N  N   . VAL A 1 362 ? 11.575  45.502 -17.560 1.00 129.77 ? 362 VAL A N   1 
ATOM   2088 C  CA  . VAL A 1 362 ? 10.163  45.616 -17.196 1.00 127.27 ? 362 VAL A CA  1 
ATOM   2089 C  C   . VAL A 1 362 ? 9.559   46.909 -17.755 1.00 127.91 ? 362 VAL A C   1 
ATOM   2090 O  O   . VAL A 1 362 ? 10.229  47.946 -17.773 1.00 125.80 ? 362 VAL A O   1 
ATOM   2091 C  CB  . VAL A 1 362 ? 9.901   45.422 -15.678 1.00 129.02 ? 362 VAL A CB  1 
ATOM   2092 C  CG1 . VAL A 1 362 ? 8.487   44.921 -15.439 1.00 128.58 ? 362 VAL A CG1 1 
ATOM   2093 C  CG2 . VAL A 1 362 ? 10.896  44.437 -15.072 1.00 130.81 ? 362 VAL A CG2 1 
ATOM   2094 N  N   . ASP A 1 363 ? 8.307   46.819 -18.257 1.00 123.94 ? 363 ASP A N   1 
ATOM   2095 C  CA  . ASP A 1 363 ? 7.566   47.929 -18.860 1.00 121.75 ? 363 ASP A CA  1 
ATOM   2096 C  C   . ASP A 1 363 ? 7.081   48.916 -17.816 1.00 119.80 ? 363 ASP A C   1 
ATOM   2097 O  O   . ASP A 1 363 ? 6.613   48.510 -16.752 1.00 117.89 ? 363 ASP A O   1 
ATOM   2098 C  CB  . ASP A 1 363 ? 6.368   47.413 -19.683 1.00 125.60 ? 363 ASP A CB  1 
ATOM   2099 C  CG  . ASP A 1 363 ? 5.924   48.338 -20.807 1.00 134.76 ? 363 ASP A CG  1 
ATOM   2100 O  OD1 . ASP A 1 363 ? 5.440   49.451 -20.509 1.00 131.66 ? 363 ASP A OD1 1 
ATOM   2101 O  OD2 . ASP A 1 363 ? 6.017   47.927 -21.982 1.00 144.69 ? 363 ASP A OD2 1 
ATOM   2102 N  N   . LYS A 1 364 ? 7.172   50.217 -18.146 1.00 113.76 ? 364 LYS A N   1 
ATOM   2103 C  CA  . LYS A 1 364 ? 6.720   51.320 -17.303 1.00 110.09 ? 364 LYS A CA  1 
ATOM   2104 C  C   . LYS A 1 364 ? 5.209   51.239 -17.103 1.00 114.01 ? 364 LYS A C   1 
ATOM   2105 O  O   . LYS A 1 364 ? 4.743   51.466 -15.992 1.00 111.88 ? 364 LYS A O   1 
ATOM   2106 C  CB  . LYS A 1 364 ? 7.109   52.679 -17.910 1.00 110.89 ? 364 LYS A CB  1 
ATOM   2107 C  CG  . LYS A 1 364 ? 8.535   53.105 -17.607 1.00 119.71 ? 364 LYS A CG  1 
ATOM   2108 C  CD  . LYS A 1 364 ? 8.853   54.477 -18.194 1.00 128.85 ? 364 LYS A CD  1 
ATOM   2109 C  CE  . LYS A 1 364 ? 9.755   55.319 -17.316 1.00 140.43 ? 364 LYS A CE  1 
ATOM   2110 N  NZ  . LYS A 1 364 ? 11.147  54.789 -17.232 1.00 150.97 ? 364 LYS A NZ  1 
ATOM   2111 N  N   . ARG A 1 365 ? 4.454   50.852 -18.156 1.00 112.90 ? 365 ARG A N   1 
ATOM   2112 C  CA  . ARG A 1 365 ? 2.992   50.718 -18.125 1.00 113.11 ? 365 ARG A CA  1 
ATOM   2113 C  C   . ARG A 1 365 ? 2.499   49.727 -17.076 1.00 117.04 ? 365 ARG A C   1 
ATOM   2114 O  O   . ARG A 1 365 ? 1.367   49.866 -16.607 1.00 116.06 ? 365 ARG A O   1 
ATOM   2115 C  CB  . ARG A 1 365 ? 2.433   50.341 -19.505 1.00 117.19 ? 365 ARG A CB  1 
ATOM   2116 C  CG  . ARG A 1 365 ? 2.490   51.469 -20.529 1.00 129.54 ? 365 ARG A CG  1 
ATOM   2117 C  CD  . ARG A 1 365 ? 2.077   51.018 -21.917 1.00 143.59 ? 365 ARG A CD  1 
ATOM   2118 N  NE  . ARG A 1 365 ? 2.918   49.928 -22.411 1.00 158.30 ? 365 ARG A NE  1 
ATOM   2119 C  CZ  . ARG A 1 365 ? 3.034   49.585 -23.690 1.00 181.45 ? 365 ARG A CZ  1 
ATOM   2120 N  NH1 . ARG A 1 365 ? 2.388   50.266 -24.630 1.00 171.81 ? 365 ARG A NH1 1 
ATOM   2121 N  NH2 . ARG A 1 365 ? 3.813   48.570 -24.042 1.00 173.40 ? 365 ARG A NH2 1 
ATOM   2122 N  N   . ILE A 1 366 ? 3.341   48.741 -16.700 1.00 114.68 ? 366 ILE A N   1 
ATOM   2123 C  CA  . ILE A 1 366 ? 2.971   47.741 -15.698 1.00 115.10 ? 366 ILE A CA  1 
ATOM   2124 C  C   . ILE A 1 366 ? 3.639   48.025 -14.321 1.00 117.41 ? 366 ILE A C   1 
ATOM   2125 O  O   . ILE A 1 366 ? 3.037   47.677 -13.307 1.00 116.74 ? 366 ILE A O   1 
ATOM   2126 C  CB  . ILE A 1 366 ? 3.163   46.271 -16.184 1.00 121.50 ? 366 ILE A CB  1 
ATOM   2127 C  CG1 . ILE A 1 366 ? 4.630   45.841 -16.232 1.00 122.91 ? 366 ILE A CG1 1 
ATOM   2128 C  CG2 . ILE A 1 366 ? 2.474   46.011 -17.518 1.00 124.53 ? 366 ILE A CG2 1 
ATOM   2129 C  CD1 . ILE A 1 366 ? 5.009   45.109 -15.045 1.00 131.49 ? 366 ILE A CD1 1 
ATOM   2130 N  N   . THR A 1 367 ? 4.859   48.638 -14.278 1.00 113.24 ? 367 THR A N   1 
ATOM   2131 C  CA  . THR A 1 367 ? 5.542   48.982 -13.009 1.00 111.27 ? 367 THR A CA  1 
ATOM   2132 C  C   . THR A 1 367 ? 4.854   50.157 -12.314 1.00 112.57 ? 367 THR A C   1 
ATOM   2133 O  O   . THR A 1 367 ? 4.898   50.262 -11.091 1.00 109.90 ? 367 THR A O   1 
ATOM   2134 C  CB  . THR A 1 367 ? 7.054   49.256 -13.177 1.00 119.35 ? 367 THR A CB  1 
ATOM   2135 O  OG1 . THR A 1 367 ? 7.275   50.314 -14.108 1.00 118.86 ? 367 THR A OG1 1 
ATOM   2136 C  CG2 . THR A 1 367 ? 7.847   48.024 -13.557 1.00 120.68 ? 367 THR A CG2 1 
ATOM   2137 N  N   . ARG A 1 368 ? 4.204   51.028 -13.103 1.00 110.22 ? 368 ARG A N   1 
ATOM   2138 C  CA  . ARG A 1 368 ? 3.465   52.190 -12.618 1.00 108.75 ? 368 ARG A CA  1 
ATOM   2139 C  C   . ARG A 1 368 ? 2.212   51.789 -11.831 1.00 115.50 ? 368 ARG A C   1 
ATOM   2140 O  O   . ARG A 1 368 ? 1.686   52.604 -11.070 1.00 113.76 ? 368 ARG A O   1 
ATOM   2141 C  CB  . ARG A 1 368 ? 3.133   53.145 -13.771 1.00 107.31 ? 368 ARG A CB  1 
ATOM   2142 C  CG  . ARG A 1 368 ? 4.295   54.064 -14.124 1.00 111.14 ? 368 ARG A CG  1 
ATOM   2143 C  CD  . ARG A 1 368 ? 4.073   54.729 -15.459 1.00 115.19 ? 368 ARG A CD  1 
ATOM   2144 N  NE  . ARG A 1 368 ? 5.198   55.582 -15.842 1.00 116.41 ? 368 ARG A NE  1 
ATOM   2145 C  CZ  . ARG A 1 368 ? 5.121   56.551 -16.749 1.00 122.27 ? 368 ARG A CZ  1 
ATOM   2146 N  NH1 . ARG A 1 368 ? 3.970   56.808 -17.360 1.00 105.19 ? 368 ARG A NH1 1 
ATOM   2147 N  NH2 . ARG A 1 368 ? 6.190   57.282 -17.039 1.00 104.42 ? 368 ARG A NH2 1 
ATOM   2148 N  N   . PHE A 1 369 ? 1.748   50.532 -12.001 1.00 115.79 ? 369 PHE A N   1 
ATOM   2149 C  CA  . PHE A 1 369 ? 0.607   50.001 -11.264 1.00 116.93 ? 369 PHE A CA  1 
ATOM   2150 C  C   . PHE A 1 369 ? 1.050   48.997 -10.195 1.00 120.51 ? 369 PHE A C   1 
ATOM   2151 O  O   . PHE A 1 369 ? 0.681   49.163 -9.033  1.00 119.45 ? 369 PHE A O   1 
ATOM   2152 C  CB  . PHE A 1 369 ? -0.472  49.396 -12.191 1.00 121.65 ? 369 PHE A CB  1 
ATOM   2153 C  CG  . PHE A 1 369 ? -1.642  48.822 -11.419 1.00 125.17 ? 369 PHE A CG  1 
ATOM   2154 C  CD1 . PHE A 1 369 ? -2.679  49.641 -10.985 1.00 127.96 ? 369 PHE A CD1 1 
ATOM   2155 C  CD2 . PHE A 1 369 ? -1.677  47.473 -11.076 1.00 130.28 ? 369 PHE A CD2 1 
ATOM   2156 C  CE1 . PHE A 1 369 ? -3.739  49.119 -10.232 1.00 130.37 ? 369 PHE A CE1 1 
ATOM   2157 C  CE2 . PHE A 1 369 ? -2.733  46.954 -10.317 1.00 134.62 ? 369 PHE A CE2 1 
ATOM   2158 C  CZ  . PHE A 1 369 ? -3.760  47.779 -9.905  1.00 131.78 ? 369 PHE A CZ  1 
ATOM   2159 N  N   . VAL A 1 370 ? 1.805   47.949 -10.592 1.00 117.78 ? 370 VAL A N   1 
ATOM   2160 C  CA  . VAL A 1 370 ? 2.272   46.867 -9.716  1.00 118.34 ? 370 VAL A CA  1 
ATOM   2161 C  C   . VAL A 1 370 ? 3.104   47.389 -8.517  1.00 120.63 ? 370 VAL A C   1 
ATOM   2162 O  O   . VAL A 1 370 ? 2.778   47.053 -7.374  1.00 120.24 ? 370 VAL A O   1 
ATOM   2163 C  CB  . VAL A 1 370 ? 3.000   45.744 -10.508 1.00 124.31 ? 370 VAL A CB  1 
ATOM   2164 C  CG1 . VAL A 1 370 ? 3.658   44.731 -9.576  1.00 125.26 ? 370 VAL A CG1 1 
ATOM   2165 C  CG2 . VAL A 1 370 ? 2.037   45.040 -11.457 1.00 126.46 ? 370 VAL A CG2 1 
ATOM   2166 N  N   . LEU A 1 371 ? 4.145   48.212 -8.765  1.00 115.57 ? 371 LEU A N   1 
ATOM   2167 C  CA  . LEU A 1 371 ? 4.996   48.734 -7.686  1.00 113.57 ? 371 LEU A CA  1 
ATOM   2168 C  C   . LEU A 1 371 ? 4.273   49.642 -6.657  1.00 114.84 ? 371 LEU A C   1 
ATOM   2169 O  O   . LEU A 1 371 ? 4.407   49.318 -5.479  1.00 114.49 ? 371 LEU A O   1 
ATOM   2170 C  CB  . LEU A 1 371 ? 6.257   49.427 -8.207  1.00 112.84 ? 371 LEU A CB  1 
ATOM   2171 C  CG  . LEU A 1 371 ? 7.379   48.536 -8.704  1.00 119.31 ? 371 LEU A CG  1 
ATOM   2172 C  CD1 . LEU A 1 371 ? 8.354   49.340 -9.517  1.00 119.21 ? 371 LEU A CD1 1 
ATOM   2173 C  CD2 . LEU A 1 371 ? 8.103   47.865 -7.552  1.00 122.13 ? 371 LEU A CD2 1 
ATOM   2174 N  N   . PRO A 1 372 ? 3.520   50.736 -7.005  1.00 109.42 ? 372 PRO A N   1 
ATOM   2175 C  CA  . PRO A 1 372 ? 2.878   51.545 -5.947  1.00 107.67 ? 372 PRO A CA  1 
ATOM   2176 C  C   . PRO A 1 372 ? 1.801   50.807 -5.147  1.00 112.97 ? 372 PRO A C   1 
ATOM   2177 O  O   . PRO A 1 372 ? 1.703   51.017 -3.935  1.00 112.18 ? 372 PRO A O   1 
ATOM   2178 C  CB  . PRO A 1 372 ? 2.304   52.749 -6.706  1.00 108.07 ? 372 PRO A CB  1 
ATOM   2179 C  CG  . PRO A 1 372 ? 2.982   52.745 -8.022  1.00 113.00 ? 372 PRO A CG  1 
ATOM   2180 C  CD  . PRO A 1 372 ? 3.225   51.307 -8.334  1.00 110.65 ? 372 PRO A CD  1 
ATOM   2181 N  N   . VAL A 1 373 ? 1.013   49.935 -5.812  1.00 111.32 ? 373 VAL A N   1 
ATOM   2182 C  CA  . VAL A 1 373 ? -0.035  49.138 -5.168  1.00 112.75 ? 373 VAL A CA  1 
ATOM   2183 C  C   . VAL A 1 373 ? 0.611   48.043 -4.302  1.00 119.13 ? 373 VAL A C   1 
ATOM   2184 O  O   . VAL A 1 373 ? 0.221   47.873 -3.145  1.00 119.30 ? 373 VAL A O   1 
ATOM   2185 C  CB  . VAL A 1 373 ? -1.082  48.599 -6.178  1.00 118.30 ? 373 VAL A CB  1 
ATOM   2186 C  CG1 . VAL A 1 373 ? -2.076  47.658 -5.511  1.00 120.17 ? 373 VAL A CG1 1 
ATOM   2187 C  CG2 . VAL A 1 373 ? -1.823  49.749 -6.852  1.00 117.07 ? 373 VAL A CG2 1 
ATOM   2188 N  N   . GLY A 1 374 ? 1.628   47.371 -4.846  1.00 116.98 ? 374 GLY A N   1 
ATOM   2189 C  CA  . GLY A 1 374 ? 2.379   46.332 -4.145  1.00 118.36 ? 374 GLY A CA  1 
ATOM   2190 C  C   . GLY A 1 374 ? 3.074   46.817 -2.884  1.00 120.85 ? 374 GLY A C   1 
ATOM   2191 O  O   . GLY A 1 374 ? 3.197   46.067 -1.913  1.00 121.37 ? 374 GLY A O   1 
ATOM   2192 N  N   . ALA A 1 375 ? 3.523   48.084 -2.891  1.00 115.62 ? 375 ALA A N   1 
ATOM   2193 C  CA  . ALA A 1 375 ? 4.212   48.722 -1.771  1.00 114.64 ? 375 ALA A CA  1 
ATOM   2194 C  C   . ALA A 1 375 ? 3.318   48.915 -0.557  1.00 118.94 ? 375 ALA A C   1 
ATOM   2195 O  O   . ALA A 1 375 ? 3.835   48.941 0.561   1.00 119.00 ? 375 ALA A O   1 
ATOM   2196 C  CB  . ALA A 1 375 ? 4.784   50.064 -2.200  1.00 113.43 ? 375 ALA A CB  1 
ATOM   2197 N  N   . THR A 1 376 ? 1.992   49.065 -0.763  1.00 115.27 ? 376 THR A N   1 
ATOM   2198 C  CA  . THR A 1 376 ? 1.058   49.290 0.342   1.00 114.83 ? 376 THR A CA  1 
ATOM   2199 C  C   . THR A 1 376 ? 0.204   48.054 0.709   1.00 119.42 ? 376 THR A C   1 
ATOM   2200 O  O   . THR A 1 376 ? -0.134  47.919 1.887   1.00 119.80 ? 376 THR A O   1 
ATOM   2201 C  CB  . THR A 1 376 ? 0.187   50.547 0.112   1.00 121.97 ? 376 THR A CB  1 
ATOM   2202 O  OG1 . THR A 1 376 ? -0.650  50.748 1.255   1.00 123.75 ? 376 THR A OG1 1 
ATOM   2203 C  CG2 . THR A 1 376 ? -0.656  50.489 -1.167  1.00 119.79 ? 376 THR A CG2 1 
ATOM   2204 N  N   . ILE A 1 377 ? -0.151  47.174 -0.261  1.00 115.91 ? 377 ILE A N   1 
ATOM   2205 C  CA  . ILE A 1 377 ? -1.002  46.021 0.061   1.00 117.62 ? 377 ILE A CA  1 
ATOM   2206 C  C   . ILE A 1 377 ? -0.243  44.674 0.019   1.00 123.89 ? 377 ILE A C   1 
ATOM   2207 O  O   . ILE A 1 377 ? -0.508  43.834 0.881   1.00 125.49 ? 377 ILE A O   1 
ATOM   2208 C  CB  . ILE A 1 377 ? -2.338  45.975 -0.744  1.00 121.08 ? 377 ILE A CB  1 
ATOM   2209 C  CG1 . ILE A 1 377 ? -2.141  45.668 -2.248  1.00 121.25 ? 377 ILE A CG1 1 
ATOM   2210 C  CG2 . ILE A 1 377 ? -3.149  47.267 -0.533  1.00 120.00 ? 377 ILE A CG2 1 
ATOM   2211 C  CD1 . ILE A 1 377 ? -3.393  45.136 -2.945  1.00 126.62 ? 377 ILE A CD1 1 
ATOM   2212 N  N   . ASN A 1 378 ? 0.691   44.467 -0.941  1.00 120.58 ? 378 ASN A N   1 
ATOM   2213 C  CA  . ASN A 1 378 ? 1.450   43.208 -1.049  1.00 122.72 ? 378 ASN A CA  1 
ATOM   2214 C  C   . ASN A 1 378 ? 2.624   43.135 -0.074  1.00 126.21 ? 378 ASN A C   1 
ATOM   2215 O  O   . ASN A 1 378 ? 3.724   43.622 -0.374  1.00 124.48 ? 378 ASN A O   1 
ATOM   2216 C  CB  . ASN A 1 378 ? 1.906   42.932 -2.491  1.00 124.32 ? 378 ASN A CB  1 
ATOM   2217 C  CG  . ASN A 1 378 ? 2.528   41.565 -2.736  1.00 148.97 ? 378 ASN A CG  1 
ATOM   2218 O  OD1 . ASN A 1 378 ? 3.541   41.438 -3.432  1.00 142.04 ? 378 ASN A OD1 1 
ATOM   2219 N  ND2 . ASN A 1 378 ? 1.902   40.501 -2.238  1.00 143.54 ? 378 ASN A ND2 1 
ATOM   2220 N  N   . MET A 1 379 ? 2.386   42.513 1.095   1.00 123.79 ? 379 MET A N   1 
ATOM   2221 C  CA  . MET A 1 379 ? 3.403   42.367 2.129   1.00 123.55 ? 379 MET A CA  1 
ATOM   2222 C  C   . MET A 1 379 ? 3.544   40.916 2.594   1.00 131.53 ? 379 MET A C   1 
ATOM   2223 O  O   . MET A 1 379 ? 3.017   40.539 3.641   1.00 132.78 ? 379 MET A O   1 
ATOM   2224 C  CB  . MET A 1 379 ? 3.156   43.346 3.285   1.00 124.12 ? 379 MET A CB  1 
ATOM   2225 C  CG  . MET A 1 379 ? 3.415   44.783 2.910   1.00 124.56 ? 379 MET A CG  1 
ATOM   2226 S  SD  . MET A 1 379 ? 2.859   45.946 4.162   1.00 127.17 ? 379 MET A SD  1 
ATOM   2227 C  CE  . MET A 1 379 ? 3.018   47.415 3.285   1.00 120.89 ? 379 MET A CE  1 
ATOM   2228 N  N   . ASP A 1 380 ? 4.264   40.103 1.795   1.00 130.15 ? 380 ASP A N   1 
ATOM   2229 C  CA  . ASP A 1 380 ? 4.518   38.676 2.043   1.00 133.49 ? 380 ASP A CA  1 
ATOM   2230 C  C   . ASP A 1 380 ? 5.396   38.444 3.284   1.00 138.16 ? 380 ASP A C   1 
ATOM   2231 O  O   . ASP A 1 380 ? 5.123   37.527 4.061   1.00 140.03 ? 380 ASP A O   1 
ATOM   2232 C  CB  . ASP A 1 380 ? 5.142   37.998 0.802   1.00 136.64 ? 380 ASP A CB  1 
ATOM   2233 C  CG  . ASP A 1 380 ? 4.448   38.280 -0.521  1.00 144.67 ? 380 ASP A CG  1 
ATOM   2234 O  OD1 . ASP A 1 380 ? 3.207   38.146 -0.583  1.00 145.29 ? 380 ASP A OD1 1 
ATOM   2235 O  OD2 . ASP A 1 380 ? 5.149   38.611 -1.499  1.00 149.75 ? 380 ASP A OD2 1 
ATOM   2236 N  N   . GLY A 1 381 ? 6.428   39.277 3.448   1.00 133.01 ? 381 GLY A N   1 
ATOM   2237 C  CA  . GLY A 1 381 ? 7.361   39.225 4.569   1.00 133.62 ? 381 GLY A CA  1 
ATOM   2238 C  C   . GLY A 1 381 ? 6.727   39.602 5.894   1.00 137.59 ? 381 GLY A C   1 
ATOM   2239 O  O   . GLY A 1 381 ? 7.105   39.064 6.940   1.00 139.33 ? 381 GLY A O   1 
ATOM   2240 N  N   . THR A 1 382 ? 5.756   40.533 5.855   1.00 131.85 ? 382 THR A N   1 
ATOM   2241 C  CA  . THR A 1 382 ? 5.005   40.978 7.028   1.00 131.38 ? 382 THR A CA  1 
ATOM   2242 C  C   . THR A 1 382 ? 3.986   39.897 7.415   1.00 138.44 ? 382 THR A C   1 
ATOM   2243 O  O   . THR A 1 382 ? 3.899   39.566 8.593   1.00 139.53 ? 382 THR A O   1 
ATOM   2244 C  CB  . THR A 1 382 ? 4.417   42.378 6.790   1.00 134.14 ? 382 THR A CB  1 
ATOM   2245 O  OG1 . THR A 1 382 ? 5.499   43.285 6.575   1.00 130.21 ? 382 THR A OG1 1 
ATOM   2246 C  CG2 . THR A 1 382 ? 3.560   42.876 7.952   1.00 132.37 ? 382 THR A CG2 1 
ATOM   2247 N  N   . ALA A 1 383 ? 3.260   39.320 6.423   1.00 136.26 ? 383 ALA A N   1 
ATOM   2248 C  CA  . ALA A 1 383 ? 2.265   38.250 6.613   1.00 139.37 ? 383 ALA A CA  1 
ATOM   2249 C  C   . ALA A 1 383 ? 2.857   36.997 7.281   1.00 146.96 ? 383 ALA A C   1 
ATOM   2250 O  O   . ALA A 1 383 ? 2.192   36.381 8.119   1.00 149.16 ? 383 ALA A O   1 
ATOM   2251 C  CB  . ALA A 1 383 ? 1.631   37.879 5.282   1.00 140.56 ? 383 ALA A CB  1 
ATOM   2252 N  N   . LEU A 1 384 ? 4.105   36.633 6.908   1.00 143.74 ? 384 LEU A N   1 
ATOM   2253 C  CA  . LEU A 1 384 ? 4.852   35.501 7.463   1.00 146.57 ? 384 LEU A CA  1 
ATOM   2254 C  C   . LEU A 1 384 ? 5.201   35.820 8.922   1.00 150.39 ? 384 LEU A C   1 
ATOM   2255 O  O   . LEU A 1 384 ? 5.009   34.973 9.791   1.00 152.81 ? 384 LEU A O   1 
ATOM   2256 C  CB  . LEU A 1 384 ? 6.130   35.261 6.633   1.00 146.65 ? 384 LEU A CB  1 
ATOM   2257 C  CG  . LEU A 1 384 ? 6.842   33.927 6.838   1.00 155.11 ? 384 LEU A CG  1 
ATOM   2258 C  CD1 . LEU A 1 384 ? 7.099   33.243 5.515   1.00 156.62 ? 384 LEU A CD1 1 
ATOM   2259 C  CD2 . LEU A 1 384 ? 8.146   34.116 7.585   1.00 157.48 ? 384 LEU A CD2 1 
ATOM   2260 N  N   . TYR A 1 385 ? 5.667   37.062 9.179   1.00 144.12 ? 385 TYR A N   1 
ATOM   2261 C  CA  . TYR A 1 385 ? 6.045   37.596 10.491  1.00 143.94 ? 385 TYR A CA  1 
ATOM   2262 C  C   . TYR A 1 385 ? 4.847   37.648 11.452  1.00 148.66 ? 385 TYR A C   1 
ATOM   2263 O  O   . TYR A 1 385 ? 4.992   37.272 12.613  1.00 150.10 ? 385 TYR A O   1 
ATOM   2264 C  CB  . TYR A 1 385 ? 6.689   38.989 10.317  1.00 141.87 ? 385 TYR A CB  1 
ATOM   2265 C  CG  . TYR A 1 385 ? 6.828   39.800 11.587  1.00 143.40 ? 385 TYR A CG  1 
ATOM   2266 C  CD1 . TYR A 1 385 ? 5.841   40.704 11.972  1.00 143.87 ? 385 TYR A CD1 1 
ATOM   2267 C  CD2 . TYR A 1 385 ? 7.970   39.707 12.374  1.00 145.53 ? 385 TYR A CD2 1 
ATOM   2268 C  CE1 . TYR A 1 385 ? 5.967   41.460 13.135  1.00 144.48 ? 385 TYR A CE1 1 
ATOM   2269 C  CE2 . TYR A 1 385 ? 8.116   40.472 13.528  1.00 146.39 ? 385 TYR A CE2 1 
ATOM   2270 C  CZ  . TYR A 1 385 ? 7.107   41.341 13.910  1.00 153.02 ? 385 TYR A CZ  1 
ATOM   2271 O  OH  . TYR A 1 385 ? 7.241   42.080 15.059  1.00 155.32 ? 385 TYR A OH  1 
ATOM   2272 N  N   . GLU A 1 386 ? 3.684   38.141 10.965  1.00 144.18 ? 386 GLU A N   1 
ATOM   2273 C  CA  . GLU A 1 386 ? 2.420   38.280 11.703  1.00 144.88 ? 386 GLU A CA  1 
ATOM   2274 C  C   . GLU A 1 386 ? 1.957   36.938 12.265  1.00 152.56 ? 386 GLU A C   1 
ATOM   2275 O  O   . GLU A 1 386 ? 1.564   36.866 13.428  1.00 153.79 ? 386 GLU A O   1 
ATOM   2276 C  CB  . GLU A 1 386 ? 1.311   38.854 10.790  1.00 144.40 ? 386 GLU A CB  1 
ATOM   2277 C  CG  . GLU A 1 386 ? 1.460   40.317 10.399  1.00 149.27 ? 386 GLU A CG  1 
ATOM   2278 C  CD  . GLU A 1 386 ? 1.197   41.367 11.461  1.00 167.56 ? 386 GLU A CD  1 
ATOM   2279 O  OE1 . GLU A 1 386 ? 1.563   42.538 11.215  1.00 160.55 ? 386 GLU A OE1 1 
ATOM   2280 O  OE2 . GLU A 1 386 ? 0.610   41.038 12.517  1.00 162.71 ? 386 GLU A OE2 1 
ATOM   2281 N  N   . ALA A 1 387 ? 2.007   35.881 11.430  1.00 150.79 ? 387 ALA A N   1 
ATOM   2282 C  CA  . ALA A 1 387 ? 1.605   34.522 11.783  1.00 154.74 ? 387 ALA A CA  1 
ATOM   2283 C  C   . ALA A 1 387 ? 2.535   33.895 12.823  1.00 160.55 ? 387 ALA A C   1 
ATOM   2284 O  O   . ALA A 1 387 ? 2.043   33.301 13.781  1.00 163.25 ? 387 ALA A O   1 
ATOM   2285 C  CB  . ALA A 1 387 ? 1.547   33.655 10.536  1.00 156.73 ? 387 ALA A CB  1 
ATOM   2286 N  N   . VAL A 1 388 ? 3.869   34.041 12.644  1.00 155.59 ? 388 VAL A N   1 
ATOM   2287 C  CA  . VAL A 1 388 ? 4.885   33.492 13.552  1.00 157.59 ? 388 VAL A CA  1 
ATOM   2288 C  C   . VAL A 1 388 ? 4.846   34.196 14.919  1.00 161.34 ? 388 VAL A C   1 
ATOM   2289 O  O   . VAL A 1 388 ? 4.844   33.515 15.943  1.00 164.07 ? 388 VAL A O   1 
ATOM   2290 C  CB  . VAL A 1 388 ? 6.312   33.458 12.925  1.00 160.54 ? 388 VAL A CB  1 
ATOM   2291 C  CG1 . VAL A 1 388 ? 7.346   32.927 13.916  1.00 163.03 ? 388 VAL A CG1 1 
ATOM   2292 C  CG2 . VAL A 1 388 ? 6.336   32.619 11.651  1.00 161.28 ? 388 VAL A CG2 1 
ATOM   2293 N  N   . ALA A 1 389 ? 4.783   35.541 14.932  1.00 154.72 ? 389 ALA A N   1 
ATOM   2294 C  CA  . ALA A 1 389 ? 4.748   36.337 16.162  1.00 154.52 ? 389 ALA A CA  1 
ATOM   2295 C  C   . ALA A 1 389 ? 3.482   36.152 17.007  1.00 161.60 ? 389 ALA A C   1 
ATOM   2296 O  O   . ALA A 1 389 ? 3.560   36.258 18.233  1.00 163.34 ? 389 ALA A O   1 
ATOM   2297 C  CB  . ALA A 1 389 ? 4.974   37.803 15.852  1.00 151.12 ? 389 ALA A CB  1 
ATOM   2298 N  N   . ALA A 1 390 ? 2.329   35.866 16.369  1.00 158.67 ? 390 ALA A N   1 
ATOM   2299 C  CA  . ALA A 1 390 ? 1.070   35.640 17.086  1.00 161.15 ? 390 ALA A CA  1 
ATOM   2300 C  C   . ALA A 1 390 ? 1.075   34.276 17.775  1.00 170.71 ? 390 ALA A C   1 
ATOM   2301 O  O   . ALA A 1 390 ? 0.551   34.156 18.882  1.00 172.95 ? 390 ALA A O   1 
ATOM   2302 C  CB  . ALA A 1 390 ? -0.112  35.743 16.135  1.00 160.92 ? 390 ALA A CB  1 
ATOM   2303 N  N   . ILE A 1 391 ? 1.688   33.260 17.128  1.00 169.30 ? 391 ILE A N   1 
ATOM   2304 C  CA  . ILE A 1 391 ? 1.788   31.889 17.637  1.00 174.04 ? 391 ILE A CA  1 
ATOM   2305 C  C   . ILE A 1 391 ? 2.993   31.745 18.599  1.00 180.64 ? 391 ILE A C   1 
ATOM   2306 O  O   . ILE A 1 391 ? 2.947   30.895 19.490  1.00 184.09 ? 391 ILE A O   1 
ATOM   2307 C  CB  . ILE A 1 391 ? 1.753   30.848 16.476  1.00 178.32 ? 391 ILE A CB  1 
ATOM   2308 C  CG1 . ILE A 1 391 ? 0.414   30.965 15.705  1.00 178.06 ? 391 ILE A CG1 1 
ATOM   2309 C  CG2 . ILE A 1 391 ? 1.951   29.406 16.981  1.00 184.20 ? 391 ILE A CG2 1 
ATOM   2310 C  CD1 . ILE A 1 391 ? 0.389   30.402 14.305  1.00 185.32 ? 391 ILE A CD1 1 
ATOM   2311 N  N   . PHE A 1 392 ? 4.033   32.604 18.463  1.00 175.37 ? 392 PHE A N   1 
ATOM   2312 C  CA  . PHE A 1 392 ? 5.181   32.583 19.378  1.00 177.03 ? 392 PHE A CA  1 
ATOM   2313 C  C   . PHE A 1 392 ? 4.756   33.043 20.774  1.00 183.89 ? 392 PHE A C   1 
ATOM   2314 O  O   . PHE A 1 392 ? 5.218   32.469 21.762  1.00 187.22 ? 392 PHE A O   1 
ATOM   2315 C  CB  . PHE A 1 392 ? 6.379   33.404 18.857  1.00 175.43 ? 392 PHE A CB  1 
ATOM   2316 C  CG  . PHE A 1 392 ? 7.517   33.543 19.848  1.00 178.26 ? 392 PHE A CG  1 
ATOM   2317 C  CD1 . PHE A 1 392 ? 8.298   32.444 20.195  1.00 185.05 ? 392 PHE A CD1 1 
ATOM   2318 C  CD2 . PHE A 1 392 ? 7.785   34.763 20.457  1.00 178.22 ? 392 PHE A CD2 1 
ATOM   2319 C  CE1 . PHE A 1 392 ? 9.332   32.568 21.130  1.00 187.41 ? 392 PHE A CE1 1 
ATOM   2320 C  CE2 . PHE A 1 392 ? 8.822   34.886 21.387  1.00 182.51 ? 392 PHE A CE2 1 
ATOM   2321 C  CZ  . PHE A 1 392 ? 9.588   33.789 21.716  1.00 184.22 ? 392 PHE A CZ  1 
ATOM   2322 N  N   . ILE A 1 393 ? 3.857   34.053 20.860  1.00 179.02 ? 393 ILE A N   1 
ATOM   2323 C  CA  . ILE A 1 393 ? 3.342   34.515 22.155  1.00 180.84 ? 393 ILE A CA  1 
ATOM   2324 C  C   . ILE A 1 393 ? 2.386   33.442 22.727  1.00 189.73 ? 393 ILE A C   1 
ATOM   2325 O  O   . ILE A 1 393 ? 2.307   33.270 23.945  1.00 191.83 ? 393 ILE A O   1 
ATOM   2326 C  CB  . ILE A 1 393 ? 2.761   35.967 22.159  1.00 180.61 ? 393 ILE A CB  1 
ATOM   2327 C  CG1 . ILE A 1 393 ? 1.340   36.052 21.589  1.00 180.45 ? 393 ILE A CG1 1 
ATOM   2328 C  CG2 . ILE A 1 393 ? 3.681   36.971 21.481  1.00 177.09 ? 393 ILE A CG2 1 
ATOM   2329 C  CD1 . ILE A 1 393 ? 0.360   36.460 22.636  1.00 188.94 ? 393 ILE A CD1 1 
ATOM   2330 N  N   . ALA A 1 394 ? 1.723   32.681 21.821  1.00 187.44 ? 394 ALA A N   1 
ATOM   2331 C  CA  . ALA A 1 394 ? 0.824   31.572 22.139  1.00 191.64 ? 394 ALA A CA  1 
ATOM   2332 C  C   . ALA A 1 394 ? 1.619   30.328 22.568  1.00 199.08 ? 394 ALA A C   1 
ATOM   2333 O  O   . ALA A 1 394 ? 1.041   29.411 23.145  1.00 202.26 ? 394 ALA A O   1 
ATOM   2334 C  CB  . ALA A 1 394 ? -0.059  31.250 20.942  1.00 191.63 ? 394 ALA A CB  1 
ATOM   2335 N  N   . GLN A 1 395 ? 2.940   30.293 22.286  1.00 194.78 ? 395 GLN A N   1 
ATOM   2336 C  CA  . GLN A 1 395 ? 3.814   29.194 22.700  1.00 198.58 ? 395 GLN A CA  1 
ATOM   2337 C  C   . GLN A 1 395 ? 4.093   29.321 24.195  1.00 204.05 ? 395 GLN A C   1 
ATOM   2338 O  O   . GLN A 1 395 ? 4.330   28.313 24.864  1.00 205.89 ? 395 GLN A O   1 
ATOM   2339 C  CB  . GLN A 1 395 ? 5.135   29.200 21.919  1.00 198.01 ? 395 GLN A CB  1 
ATOM   2340 C  CG  . GLN A 1 395 ? 5.073   28.452 20.590  1.00 206.62 ? 395 GLN A CG  1 
ATOM   2341 C  CD  . GLN A 1 395 ? 6.435   28.195 19.981  1.00 216.88 ? 395 GLN A CD  1 
ATOM   2342 O  OE1 . GLN A 1 395 ? 7.481   28.601 20.503  1.00 213.39 ? 395 GLN A OE1 1 
ATOM   2343 N  NE2 . GLN A 1 395 ? 6.452   27.499 18.855  1.00 209.40 ? 395 GLN A NE2 1 
ATOM   2344 N  N   . VAL A 1 396 ? 4.047   30.564 24.713  1.00 199.19 ? 396 VAL A N   1 
ATOM   2345 C  CA  . VAL A 1 396 ? 4.270   30.884 26.123  1.00 201.32 ? 396 VAL A CA  1 
ATOM   2346 C  C   . VAL A 1 396 ? 2.922   30.922 26.879  1.00 205.16 ? 396 VAL A C   1 
ATOM   2347 O  O   . VAL A 1 396 ? 2.778   30.249 27.903  1.00 206.76 ? 396 VAL A O   1 
ATOM   2348 C  CB  . VAL A 1 396 ? 5.081   32.202 26.306  1.00 201.69 ? 396 VAL A CB  1 
ATOM   2349 C  CG1 . VAL A 1 396 ? 5.559   32.359 27.748  1.00 203.04 ? 396 VAL A CG1 1 
ATOM   2350 C  CG2 . VAL A 1 396 ? 6.265   32.275 25.341  1.00 199.31 ? 396 VAL A CG2 1 
ATOM   2351 N  N   . ASN A 1 397 ? 1.942   31.695 26.351  1.00 201.40 ? 397 ASN A N   1 
ATOM   2352 C  CA  . ASN A 1 397 ? 0.608   31.902 26.931  1.00 202.81 ? 397 ASN A CA  1 
ATOM   2353 C  C   . ASN A 1 397 ? -0.376  30.738 26.739  1.00 206.55 ? 397 ASN A C   1 
ATOM   2354 O  O   . ASN A 1 397 ? -1.130  30.441 27.669  1.00 208.07 ? 397 ASN A O   1 
ATOM   2355 C  CB  . ASN A 1 397 ? -0.008  33.208 26.411  1.00 198.03 ? 397 ASN A CB  1 
ATOM   2356 C  CG  . ASN A 1 397 ? 0.728   34.456 26.836  1.00 209.80 ? 397 ASN A CG  1 
ATOM   2357 O  OD1 . ASN A 1 397 ? 1.928   34.626 26.587  1.00 202.99 ? 397 ASN A OD1 1 
ATOM   2358 N  ND2 . ASN A 1 397 ? 0.016   35.373 27.470  1.00 201.95 ? 397 ASN A ND2 1 
ATOM   2359 N  N   . ASN A 1 398 ? -0.379  30.101 25.537  1.00 203.97 ? 398 ASN A N   1 
ATOM   2360 C  CA  . ASN A 1 398 ? -1.234  28.979 25.098  1.00 221.26 ? 398 ASN A CA  1 
ATOM   2361 C  C   . ASN A 1 398 ? -2.728  29.252 25.262  1.00 237.74 ? 398 ASN A C   1 
ATOM   2362 O  O   . ASN A 1 398 ? -3.467  29.181 24.282  1.00 208.83 ? 398 ASN A O   1 
ATOM   2363 C  CB  . ASN A 1 398 ? -0.835  27.632 25.731  1.00 222.57 ? 398 ASN A CB  1 
ATOM   2364 C  CG  . ASN A 1 398 ? -0.968  27.539 27.231  1.00 234.94 ? 398 ASN A CG  1 
ATOM   2365 O  OD1 . ASN A 1 398 ? -2.061  27.357 27.777  1.00 231.80 ? 398 ASN A OD1 1 
ATOM   2366 N  ND2 . ASN A 1 398 ? 0.146   27.691 27.933  1.00 230.76 ? 398 ASN A ND2 1 
ATOM   2367 N  N   . GLY A 1 404 ? -6.585  24.626 16.267  1.00 194.24 ? 404 GLY A N   1 
ATOM   2368 C  CA  . GLY A 1 404 ? -7.831  24.547 15.517  1.00 195.59 ? 404 GLY A CA  1 
ATOM   2369 C  C   . GLY A 1 404 ? -8.264  25.861 14.895  1.00 195.37 ? 404 GLY A C   1 
ATOM   2370 O  O   . GLY A 1 404 ? -8.608  25.900 13.709  1.00 193.57 ? 404 GLY A O   1 
ATOM   2371 N  N   . GLN A 1 405 ? -8.248  26.948 15.701  1.00 190.01 ? 405 GLN A N   1 
ATOM   2372 C  CA  . GLN A 1 405 ? -8.632  28.312 15.304  1.00 185.14 ? 405 GLN A CA  1 
ATOM   2373 C  C   . GLN A 1 405 ? -7.434  29.116 14.734  1.00 182.95 ? 405 GLN A C   1 
ATOM   2374 O  O   . GLN A 1 405 ? -7.316  30.325 14.944  1.00 178.26 ? 405 GLN A O   1 
ATOM   2375 C  CB  . GLN A 1 405 ? -9.337  29.034 16.480  1.00 187.00 ? 405 GLN A CB  1 
ATOM   2376 C  CG  . GLN A 1 405 ? -10.224 30.224 16.095  1.00 199.54 ? 405 GLN A CG  1 
ATOM   2377 C  CD  . GLN A 1 405 ? -11.516 29.830 15.425  1.00 214.37 ? 405 GLN A CD  1 
ATOM   2378 O  OE1 . GLN A 1 405 ? -11.569 29.573 14.216  1.00 207.91 ? 405 GLN A OE1 1 
ATOM   2379 N  NE2 . GLN A 1 405 ? -12.595 29.818 16.193  1.00 211.01 ? 405 GLN A NE2 1 
ATOM   2380 N  N   . ILE A 1 406 ? -6.559  28.426 13.987  1.00 179.76 ? 406 ILE A N   1 
ATOM   2381 C  CA  . ILE A 1 406 ? -5.403  29.031 13.324  1.00 175.45 ? 406 ILE A CA  1 
ATOM   2382 C  C   . ILE A 1 406 ? -5.875  29.565 11.958  1.00 178.19 ? 406 ILE A C   1 
ATOM   2383 O  O   . ILE A 1 406 ? -5.149  30.310 11.291  1.00 173.95 ? 406 ILE A O   1 
ATOM   2384 C  CB  . ILE A 1 406 ? -4.183  28.060 13.233  1.00 180.06 ? 406 ILE A CB  1 
ATOM   2385 C  CG1 . ILE A 1 406 ? -4.026  27.157 14.500  1.00 184.92 ? 406 ILE A CG1 1 
ATOM   2386 C  CG2 . ILE A 1 406 ? -2.882  28.807 12.909  1.00 176.51 ? 406 ILE A CG2 1 
ATOM   2387 C  CD1 . ILE A 1 406 ? -3.662  27.859 15.884  1.00 188.48 ? 406 ILE A CD1 1 
ATOM   2388 N  N   . ILE A 1 407 ? -7.121  29.205 11.569  1.00 178.67 ? 407 ILE A N   1 
ATOM   2389 C  CA  . ILE A 1 407 ? -7.781  29.665 10.345  1.00 177.46 ? 407 ILE A CA  1 
ATOM   2390 C  C   . ILE A 1 407 ? -8.086  31.173 10.459  1.00 177.78 ? 407 ILE A C   1 
ATOM   2391 O  O   . ILE A 1 407 ? -7.914  31.901 9.481   1.00 173.85 ? 407 ILE A O   1 
ATOM   2392 C  CB  . ILE A 1 407 ? -9.010  28.778 9.944   1.00 185.36 ? 407 ILE A CB  1 
ATOM   2393 C  CG1 . ILE A 1 407 ? -9.583  29.160 8.553   1.00 184.44 ? 407 ILE A CG1 1 
ATOM   2394 C  CG2 . ILE A 1 407 ? -10.112 28.740 11.019  1.00 189.05 ? 407 ILE A CG2 1 
ATOM   2395 C  CD1 . ILE A 1 407 ? -8.794  28.627 7.335   1.00 188.78 ? 407 ILE A CD1 1 
ATOM   2396 N  N   . THR A 1 408 ? -8.471  31.639 11.673  1.00 175.10 ? 408 THR A N   1 
ATOM   2397 C  CA  . THR A 1 408 ? -8.735  33.053 11.970  1.00 171.43 ? 408 THR A CA  1 
ATOM   2398 C  C   . THR A 1 408 ? -7.421  33.825 11.934  1.00 170.42 ? 408 THR A C   1 
ATOM   2399 O  O   . THR A 1 408 ? -7.404  34.955 11.454  1.00 166.24 ? 408 THR A O   1 
ATOM   2400 C  CB  . THR A 1 408 ? -9.451  33.230 13.318  1.00 183.17 ? 408 THR A CB  1 
ATOM   2401 O  OG1 . THR A 1 408 ? -8.705  32.584 14.349  1.00 185.04 ? 408 THR A OG1 1 
ATOM   2402 C  CG2 . THR A 1 408 ? -10.887 32.724 13.295  1.00 186.48 ? 408 THR A CG2 1 
ATOM   2403 N  N   . ILE A 1 409 ? -6.321  33.195 12.418  1.00 167.24 ? 409 ILE A N   1 
ATOM   2404 C  CA  . ILE A 1 409 ? -4.961  33.748 12.422  1.00 163.31 ? 409 ILE A CA  1 
ATOM   2405 C  C   . ILE A 1 409 ? -4.498  33.929 10.975  1.00 163.60 ? 409 ILE A C   1 
ATOM   2406 O  O   . ILE A 1 409 ? -4.017  35.004 10.643  1.00 159.22 ? 409 ILE A O   1 
ATOM   2407 C  CB  . ILE A 1 409 ? -3.970  32.896 13.278  1.00 168.73 ? 409 ILE A CB  1 
ATOM   2408 C  CG1 . ILE A 1 409 ? -4.374  32.910 14.774  1.00 171.67 ? 409 ILE A CG1 1 
ATOM   2409 C  CG2 . ILE A 1 409 ? -2.506  33.361 13.099  1.00 166.06 ? 409 ILE A CG2 1 
ATOM   2410 C  CD1 . ILE A 1 409 ? -3.896  31.704 15.597  1.00 183.67 ? 409 ILE A CD1 1 
ATOM   2411 N  N   . SER A 1 410 ? -4.697  32.909 10.110  1.00 161.90 ? 410 SER A N   1 
ATOM   2412 C  CA  . SER A 1 410 ? -4.332  32.977 8.691   1.00 159.50 ? 410 SER A CA  1 
ATOM   2413 C  C   . SER A 1 410 ? -5.183  34.000 7.927   1.00 160.08 ? 410 SER A C   1 
ATOM   2414 O  O   . SER A 1 410 ? -4.693  34.604 6.976   1.00 156.46 ? 410 SER A O   1 
ATOM   2415 C  CB  . SER A 1 410 ? -4.427  31.603 8.036   1.00 166.64 ? 410 SER A CB  1 
ATOM   2416 O  OG  . SER A 1 410 ? -5.755  31.109 8.037   1.00 178.63 ? 410 SER A OG  1 
ATOM   2417 N  N   . ILE A 1 411 ? -6.444  34.202 8.355   1.00 157.76 ? 411 ILE A N   1 
ATOM   2418 C  CA  . ILE A 1 411 ? -7.360  35.164 7.746   1.00 155.62 ? 411 ILE A CA  1 
ATOM   2419 C  C   . ILE A 1 411 ? -6.991  36.593 8.164   1.00 156.10 ? 411 ILE A C   1 
ATOM   2420 O  O   . ILE A 1 411 ? -6.890  37.460 7.294   1.00 152.70 ? 411 ILE A O   1 
ATOM   2421 C  CB  . ILE A 1 411 ? -8.851  34.780 8.006   1.00 162.22 ? 411 ILE A CB  1 
ATOM   2422 C  CG1 . ILE A 1 411 ? -9.300  33.692 7.006   1.00 165.77 ? 411 ILE A CG1 1 
ATOM   2423 C  CG2 . ILE A 1 411 ? -9.801  35.992 7.952   1.00 160.99 ? 411 ILE A CG2 1 
ATOM   2424 C  CD1 . ILE A 1 411 ? -10.465 32.807 7.456   1.00 178.21 ? 411 ILE A CD1 1 
ATOM   2425 N  N   . THR A 1 412 ? -6.762  36.832 9.475   1.00 153.45 ? 412 THR A N   1 
ATOM   2426 C  CA  . THR A 1 412 ? -6.430  38.164 10.001  1.00 150.18 ? 412 THR A CA  1 
ATOM   2427 C  C   . THR A 1 412 ? -4.964  38.570 9.783   1.00 150.70 ? 412 THR A C   1 
ATOM   2428 O  O   . THR A 1 412 ? -4.712  39.770 9.694   1.00 147.08 ? 412 THR A O   1 
ATOM   2429 C  CB  . THR A 1 412 ? -6.853  38.349 11.467  1.00 162.45 ? 412 THR A CB  1 
ATOM   2430 O  OG1 . THR A 1 412 ? -6.320  37.301 12.279  1.00 166.35 ? 412 THR A OG1 1 
ATOM   2431 C  CG2 . THR A 1 412 ? -8.365  38.452 11.631  1.00 163.56 ? 412 THR A CG2 1 
ATOM   2432 N  N   . ALA A 1 413 ? -4.008  37.606 9.696   1.00 147.96 ? 413 ALA A N   1 
ATOM   2433 C  CA  . ALA A 1 413 ? -2.590  37.921 9.441   1.00 144.89 ? 413 ALA A CA  1 
ATOM   2434 C  C   . ALA A 1 413 ? -2.409  38.373 7.997   1.00 145.63 ? 413 ALA A C   1 
ATOM   2435 O  O   . ALA A 1 413 ? -1.569  39.232 7.731   1.00 142.66 ? 413 ALA A O   1 
ATOM   2436 C  CB  . ALA A 1 413 ? -1.695  36.731 9.740   1.00 147.99 ? 413 ALA A CB  1 
ATOM   2437 N  N   . THR A 1 414 ? -3.223  37.816 7.072   1.00 142.56 ? 414 THR A N   1 
ATOM   2438 C  CA  . THR A 1 414 ? -3.244  38.204 5.661   1.00 139.93 ? 414 THR A CA  1 
ATOM   2439 C  C   . THR A 1 414 ? -3.972  39.559 5.571   1.00 140.05 ? 414 THR A C   1 
ATOM   2440 O  O   . THR A 1 414 ? -3.591  40.399 4.755   1.00 137.11 ? 414 THR A O   1 
ATOM   2441 C  CB  . THR A 1 414 ? -3.871  37.093 4.798   1.00 149.70 ? 414 THR A CB  1 
ATOM   2442 O  OG1 . THR A 1 414 ? -3.214  35.861 5.089   1.00 151.12 ? 414 THR A OG1 1 
ATOM   2443 C  CG2 . THR A 1 414 ? -3.768  37.372 3.299   1.00 146.38 ? 414 THR A CG2 1 
ATOM   2444 N  N   . ALA A 1 415 ? -4.982  39.779 6.446   1.00 136.51 ? 415 ALA A N   1 
ATOM   2445 C  CA  . ALA A 1 415 ? -5.747  41.026 6.525   1.00 133.99 ? 415 ALA A CA  1 
ATOM   2446 C  C   . ALA A 1 415 ? -4.898  42.165 7.098   1.00 134.11 ? 415 ALA A C   1 
ATOM   2447 O  O   . ALA A 1 415 ? -5.058  43.313 6.676   1.00 131.06 ? 415 ALA A O   1 
ATOM   2448 C  CB  . ALA A 1 415 ? -6.997  40.826 7.366   1.00 137.41 ? 415 ALA A CB  1 
ATOM   2449 N  N   . ALA A 1 416 ? -3.993  41.841 8.050   1.00 130.82 ? 416 ALA A N   1 
ATOM   2450 C  CA  . ALA A 1 416 ? -3.074  42.786 8.692   1.00 128.19 ? 416 ALA A CA  1 
ATOM   2451 C  C   . ALA A 1 416 ? -1.976  43.195 7.717   1.00 129.44 ? 416 ALA A C   1 
ATOM   2452 O  O   . ALA A 1 416 ? -1.537  44.342 7.743   1.00 126.30 ? 416 ALA A O   1 
ATOM   2453 C  CB  . ALA A 1 416 ? -2.460  42.168 9.938   1.00 130.75 ? 416 ALA A CB  1 
ATOM   2454 N  N   . SER A 1 417 ? -1.549  42.252 6.852   1.00 127.02 ? 417 SER A N   1 
ATOM   2455 C  CA  . SER A 1 417 ? -0.542  42.435 5.808   1.00 125.06 ? 417 SER A CA  1 
ATOM   2456 C  C   . SER A 1 417 ? -1.003  43.496 4.790   1.00 126.74 ? 417 SER A C   1 
ATOM   2457 O  O   . SER A 1 417 ? -0.178  44.275 4.306   1.00 124.47 ? 417 SER A O   1 
ATOM   2458 C  CB  . SER A 1 417 ? -0.264  41.101 5.119   1.00 131.13 ? 417 SER A CB  1 
ATOM   2459 O  OG  . SER A 1 417 ? 0.414   41.244 3.882   1.00 140.53 ? 417 SER A OG  1 
ATOM   2460 N  N   . ILE A 1 418 ? -2.318  43.535 4.487   1.00 123.53 ? 418 ILE A N   1 
ATOM   2461 C  CA  . ILE A 1 418 ? -2.920  44.508 3.572   1.00 121.27 ? 418 ILE A CA  1 
ATOM   2462 C  C   . ILE A 1 418 ? -2.985  45.886 4.263   1.00 123.62 ? 418 ILE A C   1 
ATOM   2463 O  O   . ILE A 1 418 ? -2.544  46.886 3.692   1.00 120.36 ? 418 ILE A O   1 
ATOM   2464 C  CB  . ILE A 1 418 ? -4.311  44.017 3.067   1.00 126.22 ? 418 ILE A CB  1 
ATOM   2465 C  CG1 . ILE A 1 418 ? -4.189  42.678 2.307   1.00 128.73 ? 418 ILE A CG1 1 
ATOM   2466 C  CG2 . ILE A 1 418 ? -5.005  45.083 2.199   1.00 125.36 ? 418 ILE A CG2 1 
ATOM   2467 C  CD1 . ILE A 1 418 ? -5.443  41.826 2.324   1.00 138.57 ? 418 ILE A CD1 1 
ATOM   2468 N  N   . GLY A 1 419 ? -3.515  45.903 5.486   1.00 122.38 ? 419 GLY A N   1 
ATOM   2469 C  CA  . GLY A 1 419 ? -3.677  47.102 6.301   1.00 121.10 ? 419 GLY A CA  1 
ATOM   2470 C  C   . GLY A 1 419 ? -2.389  47.804 6.681   1.00 123.26 ? 419 GLY A C   1 
ATOM   2471 O  O   . GLY A 1 419 ? -2.357  49.038 6.724   1.00 120.79 ? 419 GLY A O   1 
ATOM   2472 N  N   . ALA A 1 420 ? -1.319  47.019 6.952   1.00 120.88 ? 420 ALA A N   1 
ATOM   2473 C  CA  . ALA A 1 420 ? 0.007   47.515 7.343   1.00 119.50 ? 420 ALA A CA  1 
ATOM   2474 C  C   . ALA A 1 420 ? 0.601   48.503 6.344   1.00 120.81 ? 420 ALA A C   1 
ATOM   2475 O  O   . ALA A 1 420 ? 0.375   48.383 5.136   1.00 119.97 ? 420 ALA A O   1 
ATOM   2476 C  CB  . ALA A 1 420 ? 0.969   46.357 7.573   1.00 121.86 ? 420 ALA A CB  1 
ATOM   2477 N  N   . ALA A 1 421 ? 1.338   49.493 6.870   1.00 115.66 ? 421 ALA A N   1 
ATOM   2478 C  CA  . ALA A 1 421 ? 1.979   50.553 6.102   1.00 113.13 ? 421 ALA A CA  1 
ATOM   2479 C  C   . ALA A 1 421 ? 3.372   50.152 5.630   1.00 117.31 ? 421 ALA A C   1 
ATOM   2480 O  O   . ALA A 1 421 ? 4.069   49.413 6.328   1.00 118.48 ? 421 ALA A O   1 
ATOM   2481 C  CB  . ALA A 1 421 ? 2.069   51.809 6.949   1.00 112.80 ? 421 ALA A CB  1 
ATOM   2482 N  N   . GLY A 1 422 ? 3.780   50.680 4.471   1.00 112.40 ? 422 GLY A N   1 
ATOM   2483 C  CA  . GLY A 1 422 ? 5.107   50.454 3.907   1.00 112.03 ? 422 GLY A CA  1 
ATOM   2484 C  C   . GLY A 1 422 ? 6.166   51.249 4.645   1.00 115.35 ? 422 GLY A C   1 
ATOM   2485 O  O   . GLY A 1 422 ? 7.192   51.608 4.069   1.00 114.90 ? 422 GLY A O   1 
ATOM   2486 N  N   . ILE A 1 423 ? 5.920   51.496 5.942   1.00 111.72 ? 423 ILE A N   1 
ATOM   2487 C  CA  . ILE A 1 423 ? 6.723   52.265 6.882   1.00 111.26 ? 423 ILE A CA  1 
ATOM   2488 C  C   . ILE A 1 423 ? 7.432   51.311 7.885   1.00 116.88 ? 423 ILE A C   1 
ATOM   2489 O  O   . ILE A 1 423 ? 6.953   50.187 8.057   1.00 117.89 ? 423 ILE A O   1 
ATOM   2490 C  CB  . ILE A 1 423 ? 5.738   53.306 7.530   1.00 113.76 ? 423 ILE A CB  1 
ATOM   2491 C  CG1 . ILE A 1 423 ? 6.083   54.753 7.116   1.00 112.80 ? 423 ILE A CG1 1 
ATOM   2492 C  CG2 . ILE A 1 423 ? 5.567   53.182 9.051   1.00 115.85 ? 423 ILE A CG2 1 
ATOM   2493 C  CD1 . ILE A 1 423 ? 5.559   55.199 5.698   1.00 118.14 ? 423 ILE A CD1 1 
ATOM   2494 N  N   . PRO A 1 424 ? 8.563   51.699 8.536   1.00 113.90 ? 424 PRO A N   1 
ATOM   2495 C  CA  . PRO A 1 424 ? 9.195   50.780 9.498   1.00 116.18 ? 424 PRO A CA  1 
ATOM   2496 C  C   . PRO A 1 424 ? 8.416   50.628 10.805  1.00 122.45 ? 424 PRO A C   1 
ATOM   2497 O  O   . PRO A 1 424 ? 7.699   51.546 11.208  1.00 120.44 ? 424 PRO A O   1 
ATOM   2498 C  CB  . PRO A 1 424 ? 10.578  51.389 9.719   1.00 118.01 ? 424 PRO A CB  1 
ATOM   2499 C  CG  . PRO A 1 424 ? 10.401  52.823 9.464   1.00 120.44 ? 424 PRO A CG  1 
ATOM   2500 C  CD  . PRO A 1 424 ? 9.291   52.983 8.467   1.00 114.23 ? 424 PRO A CD  1 
ATOM   2501 N  N   . GLN A 1 425 ? 8.549   49.445 11.446  1.00 123.31 ? 425 GLN A N   1 
ATOM   2502 C  CA  . GLN A 1 425 ? 7.893   49.034 12.701  1.00 125.98 ? 425 GLN A CA  1 
ATOM   2503 C  C   . GLN A 1 425 ? 6.348   48.916 12.586  1.00 130.72 ? 425 GLN A C   1 
ATOM   2504 O  O   . GLN A 1 425 ? 5.672   48.737 13.606  1.00 132.14 ? 425 GLN A O   1 
ATOM   2505 C  CB  . GLN A 1 425 ? 8.304   49.931 13.893  1.00 128.18 ? 425 GLN A CB  1 
ATOM   2506 C  CG  . GLN A 1 425 ? 9.722   49.692 14.408  1.00 146.77 ? 425 GLN A CG  1 
ATOM   2507 C  CD  . GLN A 1 425 ? 10.227  50.852 15.235  1.00 166.91 ? 425 GLN A CD  1 
ATOM   2508 O  OE1 . GLN A 1 425 ? 9.627   51.249 16.243  1.00 164.17 ? 425 GLN A OE1 1 
ATOM   2509 N  NE2 . GLN A 1 425 ? 11.358  51.415 14.832  1.00 157.74 ? 425 GLN A NE2 1 
ATOM   2510 N  N   . ALA A 1 426 ? 5.800   48.959 11.348  1.00 125.96 ? 426 ALA A N   1 
ATOM   2511 C  CA  . ALA A 1 426 ? 4.361   48.841 11.079  1.00 125.85 ? 426 ALA A CA  1 
ATOM   2512 C  C   . ALA A 1 426 ? 3.804   47.420 11.343  1.00 132.81 ? 426 ALA A C   1 
ATOM   2513 O  O   . ALA A 1 426 ? 2.586   47.244 11.435  1.00 132.91 ? 426 ALA A O   1 
ATOM   2514 C  CB  . ALA A 1 426 ? 4.059   49.273 9.654   1.00 124.34 ? 426 ALA A CB  1 
ATOM   2515 N  N   . GLY A 1 427 ? 4.700   46.440 11.466  1.00 131.38 ? 427 GLY A N   1 
ATOM   2516 C  CA  . GLY A 1 427 ? 4.359   45.046 11.721  1.00 134.03 ? 427 GLY A CA  1 
ATOM   2517 C  C   . GLY A 1 427 ? 3.907   44.774 13.139  1.00 140.91 ? 427 GLY A C   1 
ATOM   2518 O  O   . GLY A 1 427 ? 3.009   43.955 13.350  1.00 142.52 ? 427 GLY A O   1 
ATOM   2519 N  N   . LEU A 1 428 ? 4.530   45.446 14.128  1.00 138.09 ? 428 LEU A N   1 
ATOM   2520 C  CA  . LEU A 1 428 ? 4.184   45.259 15.539  1.00 140.56 ? 428 LEU A CA  1 
ATOM   2521 C  C   . LEU A 1 428 ? 2.871   45.970 15.929  1.00 144.37 ? 428 LEU A C   1 
ATOM   2522 O  O   . LEU A 1 428 ? 2.155   45.472 16.799  1.00 146.60 ? 428 LEU A O   1 
ATOM   2523 C  CB  . LEU A 1 428 ? 5.352   45.629 16.483  1.00 141.42 ? 428 LEU A CB  1 
ATOM   2524 C  CG  . LEU A 1 428 ? 5.790   47.096 16.562  1.00 144.26 ? 428 LEU A CG  1 
ATOM   2525 C  CD1 . LEU A 1 428 ? 5.279   47.756 17.837  1.00 145.95 ? 428 LEU A CD1 1 
ATOM   2526 C  CD2 . LEU A 1 428 ? 7.291   47.213 16.520  1.00 146.49 ? 428 LEU A CD2 1 
ATOM   2527 N  N   . VAL A 1 429 ? 2.556   47.116 15.288  1.00 138.15 ? 429 VAL A N   1 
ATOM   2528 C  CA  . VAL A 1 429 ? 1.338   47.884 15.570  1.00 137.80 ? 429 VAL A CA  1 
ATOM   2529 C  C   . VAL A 1 429 ? 0.084   47.184 14.973  1.00 143.16 ? 429 VAL A C   1 
ATOM   2530 O  O   . VAL A 1 429 ? -0.980  47.216 15.594  1.00 144.69 ? 429 VAL A O   1 
ATOM   2531 C  CB  . VAL A 1 429 ? 1.475   49.390 15.177  1.00 138.77 ? 429 VAL A CB  1 
ATOM   2532 C  CG1 . VAL A 1 429 ? 1.648   49.589 13.676  1.00 135.98 ? 429 VAL A CG1 1 
ATOM   2533 C  CG2 . VAL A 1 429 ? 0.318   50.230 15.711  1.00 139.00 ? 429 VAL A CG2 1 
ATOM   2534 N  N   . THR A 1 430 ? 0.229   46.514 13.807  1.00 139.08 ? 430 THR A N   1 
ATOM   2535 C  CA  . THR A 1 430 ? -0.862  45.790 13.133  1.00 139.85 ? 430 THR A CA  1 
ATOM   2536 C  C   . THR A 1 430 ? -1.102  44.393 13.729  1.00 147.08 ? 430 THR A C   1 
ATOM   2537 O  O   . THR A 1 430 ? -2.083  43.735 13.372  1.00 148.17 ? 430 THR A O   1 
ATOM   2538 C  CB  . THR A 1 430 ? -0.653  45.752 11.612  1.00 145.32 ? 430 THR A CB  1 
ATOM   2539 O  OG1 . THR A 1 430 ? 0.674   45.316 11.317  1.00 143.92 ? 430 THR A OG1 1 
ATOM   2540 C  CG2 . THR A 1 430 ? -0.918  47.092 10.959  1.00 141.72 ? 430 THR A CG2 1 
ATOM   2541 N  N   . MET A 1 431 ? -0.224  43.961 14.658  1.00 145.12 ? 431 MET A N   1 
ATOM   2542 C  CA  . MET A 1 431 ? -0.311  42.680 15.362  1.00 148.65 ? 431 MET A CA  1 
ATOM   2543 C  C   . MET A 1 431 ? -1.468  42.680 16.375  1.00 155.10 ? 431 MET A C   1 
ATOM   2544 O  O   . MET A 1 431 ? -1.863  41.620 16.864  1.00 157.64 ? 431 MET A O   1 
ATOM   2545 C  CB  . MET A 1 431 ? 1.016   42.377 16.064  1.00 151.86 ? 431 MET A CB  1 
ATOM   2546 C  CG  . MET A 1 431 ? 1.613   41.055 15.673  1.00 156.98 ? 431 MET A CG  1 
ATOM   2547 S  SD  . MET A 1 431 ? 3.328   40.930 16.211  1.00 161.56 ? 431 MET A SD  1 
ATOM   2548 C  CE  . MET A 1 431 ? 3.104   40.383 17.886  1.00 162.27 ? 431 MET A CE  1 
ATOM   2549 N  N   . VAL A 1 432 ? -2.006  43.879 16.679  1.00 150.62 ? 432 VAL A N   1 
ATOM   2550 C  CA  . VAL A 1 432 ? -3.138  44.119 17.576  1.00 152.69 ? 432 VAL A CA  1 
ATOM   2551 C  C   . VAL A 1 432 ? -4.383  43.407 17.013  1.00 157.93 ? 432 VAL A C   1 
ATOM   2552 O  O   . VAL A 1 432 ? -5.104  42.752 17.763  1.00 160.77 ? 432 VAL A O   1 
ATOM   2553 C  CB  . VAL A 1 432 ? -3.348  45.651 17.774  1.00 154.79 ? 432 VAL A CB  1 
ATOM   2554 C  CG1 . VAL A 1 432 ? -4.683  45.969 18.444  1.00 156.81 ? 432 VAL A CG1 1 
ATOM   2555 C  CG2 . VAL A 1 432 ? -2.196  46.267 18.565  1.00 154.09 ? 432 VAL A CG2 1 
ATOM   2556 N  N   . ILE A 1 433 ? -4.587  43.503 15.683  1.00 152.49 ? 433 ILE A N   1 
ATOM   2557 C  CA  . ILE A 1 433 ? -5.690  42.893 14.933  1.00 153.69 ? 433 ILE A CA  1 
ATOM   2558 C  C   . ILE A 1 433 ? -5.647  41.351 15.009  1.00 160.70 ? 433 ILE A C   1 
ATOM   2559 O  O   . ILE A 1 433 ? -6.663  40.738 15.344  1.00 163.58 ? 433 ILE A O   1 
ATOM   2560 C  CB  . ILE A 1 433 ? -5.728  43.449 13.467  1.00 153.58 ? 433 ILE A CB  1 
ATOM   2561 C  CG1 . ILE A 1 433 ? -6.368  44.855 13.416  1.00 152.17 ? 433 ILE A CG1 1 
ATOM   2562 C  CG2 . ILE A 1 433 ? -6.431  42.506 12.478  1.00 155.52 ? 433 ILE A CG2 1 
ATOM   2563 C  CD1 . ILE A 1 433 ? -5.385  46.025 13.467  1.00 157.57 ? 433 ILE A CD1 1 
ATOM   2564 N  N   . VAL A 1 434 ? -4.475  40.742 14.722  1.00 156.30 ? 434 VAL A N   1 
ATOM   2565 C  CA  . VAL A 1 434 ? -4.291  39.286 14.728  1.00 158.84 ? 434 VAL A CA  1 
ATOM   2566 C  C   . VAL A 1 434 ? -4.321  38.699 16.180  1.00 165.03 ? 434 VAL A C   1 
ATOM   2567 O  O   . VAL A 1 434 ? -4.716  37.542 16.338  1.00 168.20 ? 434 VAL A O   1 
ATOM   2568 C  CB  . VAL A 1 434 ? -3.045  38.850 13.891  1.00 161.31 ? 434 VAL A CB  1 
ATOM   2569 C  CG1 . VAL A 1 434 ? -1.724  39.158 14.593  1.00 160.27 ? 434 VAL A CG1 1 
ATOM   2570 C  CG2 . VAL A 1 434 ? -3.122  37.384 13.472  1.00 164.17 ? 434 VAL A CG2 1 
ATOM   2571 N  N   . LEU A 1 435 ? -3.964  39.499 17.222  1.00 159.79 ? 435 LEU A N   1 
ATOM   2572 C  CA  . LEU A 1 435 ? -3.999  39.042 18.624  1.00 162.40 ? 435 LEU A CA  1 
ATOM   2573 C  C   . LEU A 1 435 ? -5.405  39.065 19.221  1.00 168.26 ? 435 LEU A C   1 
ATOM   2574 O  O   . LEU A 1 435 ? -5.788  38.118 19.906  1.00 171.72 ? 435 LEU A O   1 
ATOM   2575 C  CB  . LEU A 1 435 ? -3.019  39.815 19.533  1.00 161.07 ? 435 LEU A CB  1 
ATOM   2576 C  CG  . LEU A 1 435 ? -1.524  39.490 19.406  1.00 164.36 ? 435 LEU A CG  1 
ATOM   2577 C  CD1 . LEU A 1 435 ? -0.708  40.321 20.363  1.00 163.65 ? 435 LEU A CD1 1 
ATOM   2578 C  CD2 . LEU A 1 435 ? -1.235  38.017 19.643  1.00 170.01 ? 435 LEU A CD2 1 
ATOM   2579 N  N   . THR A 1 436 ? -6.165  40.146 18.966  1.00 162.68 ? 436 THR A N   1 
ATOM   2580 C  CA  . THR A 1 436 ? -7.538  40.333 19.447  1.00 164.94 ? 436 THR A CA  1 
ATOM   2581 C  C   . THR A 1 436 ? -8.503  39.333 18.782  1.00 171.40 ? 436 THR A C   1 
ATOM   2582 O  O   . THR A 1 436 ? -9.449  38.881 19.432  1.00 174.89 ? 436 THR A O   1 
ATOM   2583 C  CB  . THR A 1 436 ? -7.968  41.804 19.274  1.00 170.31 ? 436 THR A CB  1 
ATOM   2584 O  OG1 . THR A 1 436 ? -6.937  42.658 19.777  1.00 166.73 ? 436 THR A OG1 1 
ATOM   2585 C  CG2 . THR A 1 436 ? -9.288  42.129 19.977  1.00 172.39 ? 436 THR A CG2 1 
ATOM   2586 N  N   . ALA A 1 437 ? -8.250  38.985 17.501  1.00 166.14 ? 437 ALA A N   1 
ATOM   2587 C  CA  . ALA A 1 437 ? -9.059  38.041 16.723  1.00 168.31 ? 437 ALA A CA  1 
ATOM   2588 C  C   . ALA A 1 437 ? -9.040  36.634 17.327  1.00 176.97 ? 437 ALA A C   1 
ATOM   2589 O  O   . ALA A 1 437 ? -10.100 36.021 17.475  1.00 180.37 ? 437 ALA A O   1 
ATOM   2590 C  CB  . ALA A 1 437 ? -8.580  38.000 15.283  1.00 166.06 ? 437 ALA A CB  1 
ATOM   2591 N  N   . VAL A 1 438 ? -7.842  36.137 17.692  1.00 173.49 ? 438 VAL A N   1 
ATOM   2592 C  CA  . VAL A 1 438 ? -7.666  34.818 18.300  1.00 177.62 ? 438 VAL A CA  1 
ATOM   2593 C  C   . VAL A 1 438 ? -8.077  34.851 19.798  1.00 184.80 ? 438 VAL A C   1 
ATOM   2594 O  O   . VAL A 1 438 ? -8.690  33.899 20.289  1.00 188.83 ? 438 VAL A O   1 
ATOM   2595 C  CB  . VAL A 1 438 ? -6.248  34.224 18.031  1.00 180.59 ? 438 VAL A CB  1 
ATOM   2596 C  CG1 . VAL A 1 438 ? -5.131  35.077 18.630  1.00 177.46 ? 438 VAL A CG1 1 
ATOM   2597 C  CG2 . VAL A 1 438 ? -6.142  32.771 18.486  1.00 185.22 ? 438 VAL A CG2 1 
ATOM   2598 N  N   . GLY A 1 439 ? -7.783  35.962 20.474  1.00 179.49 ? 439 GLY A N   1 
ATOM   2599 C  CA  . GLY A 1 439 ? -8.121  36.163 21.878  1.00 182.36 ? 439 GLY A CA  1 
ATOM   2600 C  C   . GLY A 1 439 ? -6.955  36.504 22.784  1.00 186.02 ? 439 GLY A C   1 
ATOM   2601 O  O   . GLY A 1 439 ? -7.169  36.865 23.945  1.00 188.01 ? 439 GLY A O   1 
ATOM   2602 N  N   . LEU A 1 440 ? -5.715  36.390 22.268  1.00 179.89 ? 440 LEU A N   1 
ATOM   2603 C  CA  . LEU A 1 440 ? -4.478  36.669 23.008  1.00 179.06 ? 440 LEU A CA  1 
ATOM   2604 C  C   . LEU A 1 440 ? -4.325  38.162 23.381  1.00 181.02 ? 440 LEU A C   1 
ATOM   2605 O  O   . LEU A 1 440 ? -4.843  39.008 22.648  1.00 178.02 ? 440 LEU A O   1 
ATOM   2606 C  CB  . LEU A 1 440 ? -3.262  36.179 22.208  1.00 177.00 ? 440 LEU A CB  1 
ATOM   2607 C  CG  . LEU A 1 440 ? -3.098  34.667 22.061  1.00 184.97 ? 440 LEU A CG  1 
ATOM   2608 C  CD1 . LEU A 1 440 ? -2.238  34.336 20.870  1.00 182.51 ? 440 LEU A CD1 1 
ATOM   2609 C  CD2 . LEU A 1 440 ? -2.517  34.040 23.323  1.00 191.51 ? 440 LEU A CD2 1 
ATOM   2610 N  N   . PRO A 1 441 ? -3.647  38.521 24.506  1.00 179.08 ? 441 PRO A N   1 
ATOM   2611 C  CA  . PRO A 1 441 ? -3.537  39.949 24.864  1.00 176.76 ? 441 PRO A CA  1 
ATOM   2612 C  C   . PRO A 1 441 ? -2.524  40.729 24.030  1.00 176.63 ? 441 PRO A C   1 
ATOM   2613 O  O   . PRO A 1 441 ? -1.432  40.229 23.752  1.00 175.44 ? 441 PRO A O   1 
ATOM   2614 C  CB  . PRO A 1 441 ? -3.171  39.922 26.348  1.00 181.77 ? 441 PRO A CB  1 
ATOM   2615 C  CG  . PRO A 1 441 ? -2.477  38.625 26.542  1.00 188.71 ? 441 PRO A CG  1 
ATOM   2616 C  CD  . PRO A 1 441 ? -2.982  37.659 25.508  1.00 184.32 ? 441 PRO A CD  1 
ATOM   2617 N  N   . THR A 1 442 ? -2.891  41.967 23.650  1.00 170.95 ? 442 THR A N   1 
ATOM   2618 C  CA  . THR A 1 442 ? -2.068  42.860 22.825  1.00 166.77 ? 442 THR A CA  1 
ATOM   2619 C  C   . THR A 1 442 ? -0.826  43.389 23.561  1.00 171.43 ? 442 THR A C   1 
ATOM   2620 O  O   . THR A 1 442 ? 0.111   43.851 22.910  1.00 168.18 ? 442 THR A O   1 
ATOM   2621 C  CB  . THR A 1 442 ? -2.912  43.996 22.220  1.00 171.40 ? 442 THR A CB  1 
ATOM   2622 O  OG1 . THR A 1 442 ? -3.488  44.775 23.267  1.00 172.96 ? 442 THR A OG1 1 
ATOM   2623 C  CG2 . THR A 1 442 ? -3.996  43.488 21.275  1.00 169.14 ? 442 THR A CG2 1 
ATOM   2624 N  N   . ASP A 1 443 ? -0.800  43.295 24.903  1.00 172.06 ? 443 ASP A N   1 
ATOM   2625 C  CA  . ASP A 1 443 ? 0.329   43.746 25.724  1.00 172.60 ? 443 ASP A CA  1 
ATOM   2626 C  C   . ASP A 1 443 ? 1.593   42.887 25.535  1.00 176.39 ? 443 ASP A C   1 
ATOM   2627 O  O   . ASP A 1 443 ? 2.679   43.306 25.938  1.00 175.82 ? 443 ASP A O   1 
ATOM   2628 C  CB  . ASP A 1 443 ? -0.071  43.815 27.210  1.00 178.65 ? 443 ASP A CB  1 
ATOM   2629 C  CG  . ASP A 1 443 ? -1.112  44.877 27.515  1.00 190.11 ? 443 ASP A CG  1 
ATOM   2630 O  OD1 . ASP A 1 443 ? -0.736  46.069 27.607  1.00 188.58 ? 443 ASP A OD1 1 
ATOM   2631 O  OD2 . ASP A 1 443 ? -2.297  44.515 27.674  1.00 198.94 ? 443 ASP A OD2 1 
ATOM   2632 N  N   . ASP A 1 444 ? 1.455   41.708 24.899  1.00 173.17 ? 444 ASP A N   1 
ATOM   2633 C  CA  . ASP A 1 444 ? 2.558   40.780 24.649  1.00 173.50 ? 444 ASP A CA  1 
ATOM   2634 C  C   . ASP A 1 444 ? 3.481   41.206 23.492  1.00 172.29 ? 444 ASP A C   1 
ATOM   2635 O  O   . ASP A 1 444 ? 4.536   40.592 23.306  1.00 172.35 ? 444 ASP A O   1 
ATOM   2636 C  CB  . ASP A 1 444 ? 2.021   39.354 24.453  1.00 178.37 ? 444 ASP A CB  1 
ATOM   2637 C  CG  . ASP A 1 444 ? 1.439   38.731 25.713  1.00 195.70 ? 444 ASP A CG  1 
ATOM   2638 O  OD1 . ASP A 1 444 ? 0.849   39.477 26.532  1.00 196.78 ? 444 ASP A OD1 1 
ATOM   2639 O  OD2 . ASP A 1 444 ? 1.553   37.497 25.870  1.00 206.15 ? 444 ASP A OD2 1 
ATOM   2640 N  N   . ILE A 1 445 ? 3.108   42.276 22.748  1.00 164.34 ? 445 ILE A N   1 
ATOM   2641 C  CA  . ILE A 1 445 ? 3.896   42.850 21.645  1.00 160.08 ? 445 ILE A CA  1 
ATOM   2642 C  C   . ILE A 1 445 ? 5.214   43.435 22.206  1.00 164.17 ? 445 ILE A C   1 
ATOM   2643 O  O   . ILE A 1 445 ? 6.246   43.382 21.532  1.00 162.13 ? 445 ILE A O   1 
ATOM   2644 C  CB  . ILE A 1 445 ? 3.047   43.880 20.827  1.00 159.59 ? 445 ILE A CB  1 
ATOM   2645 C  CG1 . ILE A 1 445 ? 1.879   43.177 20.096  1.00 160.09 ? 445 ILE A CG1 1 
ATOM   2646 C  CG2 . ILE A 1 445 ? 3.900   44.683 19.831  1.00 156.52 ? 445 ILE A CG2 1 
ATOM   2647 C  CD1 . ILE A 1 445 ? 0.748   44.085 19.599  1.00 163.27 ? 445 ILE A CD1 1 
ATOM   2648 N  N   . THR A 1 446 ? 5.172   43.927 23.466  1.00 163.23 ? 446 THR A N   1 
ATOM   2649 C  CA  . THR A 1 446 ? 6.283   44.517 24.232  1.00 163.83 ? 446 THR A CA  1 
ATOM   2650 C  C   . THR A 1 446 ? 7.541   43.636 24.294  1.00 169.73 ? 446 THR A C   1 
ATOM   2651 O  O   . THR A 1 446 ? 8.656   44.160 24.228  1.00 168.76 ? 446 THR A O   1 
ATOM   2652 C  CB  . THR A 1 446 ? 5.821   44.884 25.650  1.00 173.26 ? 446 THR A CB  1 
ATOM   2653 O  OG1 . THR A 1 446 ? 5.343   43.707 26.306  1.00 174.42 ? 446 THR A OG1 1 
ATOM   2654 C  CG2 . THR A 1 446 ? 4.758   45.981 25.662  1.00 170.65 ? 446 THR A CG2 1 
ATOM   2655 N  N   . LEU A 1 447 ? 7.356   42.308 24.433  1.00 168.64 ? 447 LEU A N   1 
ATOM   2656 C  CA  . LEU A 1 447 ? 8.438   41.323 24.507  1.00 170.53 ? 447 LEU A CA  1 
ATOM   2657 C  C   . LEU A 1 447 ? 9.186   41.200 23.176  1.00 171.80 ? 447 LEU A C   1 
ATOM   2658 O  O   . LEU A 1 447 ? 10.416  41.133 23.168  1.00 171.90 ? 447 LEU A O   1 
ATOM   2659 C  CB  . LEU A 1 447 ? 7.881   39.952 24.926  1.00 174.16 ? 447 LEU A CB  1 
ATOM   2660 C  CG  . LEU A 1 447 ? 7.256   39.880 26.315  1.00 182.34 ? 447 LEU A CG  1 
ATOM   2661 C  CD1 . LEU A 1 447 ? 5.884   39.246 26.260  1.00 183.69 ? 447 LEU A CD1 1 
ATOM   2662 C  CD2 . LEU A 1 447 ? 8.158   39.143 27.282  1.00 188.87 ? 447 LEU A CD2 1 
ATOM   2663 N  N   . ILE A 1 448 ? 8.432   41.190 22.058  1.00 165.78 ? 448 ILE A N   1 
ATOM   2664 C  CA  . ILE A 1 448 ? 8.916   41.050 20.683  1.00 163.17 ? 448 ILE A CA  1 
ATOM   2665 C  C   . ILE A 1 448 ? 9.635   42.319 20.173  1.00 164.24 ? 448 ILE A C   1 
ATOM   2666 O  O   . ILE A 1 448 ? 10.627  42.192 19.450  1.00 163.46 ? 448 ILE A O   1 
ATOM   2667 C  CB  . ILE A 1 448 ? 7.724   40.589 19.776  1.00 165.17 ? 448 ILE A CB  1 
ATOM   2668 C  CG1 . ILE A 1 448 ? 7.633   39.054 19.713  1.00 168.67 ? 448 ILE A CG1 1 
ATOM   2669 C  CG2 . ILE A 1 448 ? 7.741   41.180 18.359  1.00 162.24 ? 448 ILE A CG2 1 
ATOM   2670 C  CD1 . ILE A 1 448 ? 6.904   38.400 20.839  1.00 180.16 ? 448 ILE A CD1 1 
ATOM   2671 N  N   . ILE A 1 449 ? 9.147   43.522 20.572  1.00 159.03 ? 449 ILE A N   1 
ATOM   2672 C  CA  . ILE A 1 449 ? 9.625   44.866 20.192  1.00 155.89 ? 449 ILE A CA  1 
ATOM   2673 C  C   . ILE A 1 449 ? 11.170  44.999 20.150  1.00 159.63 ? 449 ILE A C   1 
ATOM   2674 O  O   . ILE A 1 449 ? 11.690  45.657 19.240  1.00 156.66 ? 449 ILE A O   1 
ATOM   2675 C  CB  . ILE A 1 449 ? 8.946   45.931 21.104  1.00 159.03 ? 449 ILE A CB  1 
ATOM   2676 C  CG1 . ILE A 1 449 ? 7.646   46.422 20.439  1.00 157.37 ? 449 ILE A CG1 1 
ATOM   2677 C  CG2 . ILE A 1 449 ? 9.865   47.118 21.467  1.00 159.06 ? 449 ILE A CG2 1 
ATOM   2678 C  CD1 . ILE A 1 449 ? 6.581   46.988 21.377  1.00 167.91 ? 449 ILE A CD1 1 
ATOM   2679 N  N   . ALA A 1 450 ? 11.883  44.358 21.104  1.00 159.05 ? 450 ALA A N   1 
ATOM   2680 C  CA  . ALA A 1 450 ? 13.346  44.382 21.208  1.00 159.71 ? 450 ALA A CA  1 
ATOM   2681 C  C   . ALA A 1 450 ? 14.076  43.862 19.947  1.00 161.94 ? 450 ALA A C   1 
ATOM   2682 O  O   . ALA A 1 450 ? 14.875  44.598 19.363  1.00 159.87 ? 450 ALA A O   1 
ATOM   2683 C  CB  . ALA A 1 450 ? 13.798  43.620 22.447  1.00 164.46 ? 450 ALA A CB  1 
ATOM   2684 N  N   . VAL A 1 451 ? 13.776  42.623 19.516  1.00 158.87 ? 451 VAL A N   1 
ATOM   2685 C  CA  . VAL A 1 451 ? 14.414  41.994 18.357  1.00 157.94 ? 451 VAL A CA  1 
ATOM   2686 C  C   . VAL A 1 451 ? 13.705  42.353 17.016  1.00 157.59 ? 451 VAL A C   1 
ATOM   2687 O  O   . VAL A 1 451 ? 14.248  42.061 15.948  1.00 156.47 ? 451 VAL A O   1 
ATOM   2688 C  CB  . VAL A 1 451 ? 14.570  40.461 18.588  1.00 165.22 ? 451 VAL A CB  1 
ATOM   2689 C  CG1 . VAL A 1 451 ? 13.307  39.684 18.219  1.00 164.98 ? 451 VAL A CG1 1 
ATOM   2690 C  CG2 . VAL A 1 451 ? 15.797  39.906 17.872  1.00 166.01 ? 451 VAL A CG2 1 
ATOM   2691 N  N   . ASP A 1 452 ? 12.523  43.009 17.086  1.00 151.66 ? 452 ASP A N   1 
ATOM   2692 C  CA  . ASP A 1 452 ? 11.700  43.426 15.938  1.00 148.28 ? 452 ASP A CA  1 
ATOM   2693 C  C   . ASP A 1 452 ? 12.462  44.181 14.838  1.00 148.67 ? 452 ASP A C   1 
ATOM   2694 O  O   . ASP A 1 452 ? 12.229  43.915 13.656  1.00 146.70 ? 452 ASP A O   1 
ATOM   2695 C  CB  . ASP A 1 452 ? 10.489  44.257 16.416  1.00 148.97 ? 452 ASP A CB  1 
ATOM   2696 C  CG  . ASP A 1 452 ? 9.680   44.932 15.315  1.00 156.55 ? 452 ASP A CG  1 
ATOM   2697 O  OD1 . ASP A 1 452 ? 10.067  46.044 14.885  1.00 154.60 ? 452 ASP A OD1 1 
ATOM   2698 O  OD2 . ASP A 1 452 ? 8.624   44.389 14.940  1.00 162.93 ? 452 ASP A OD2 1 
ATOM   2699 N  N   . TRP A 1 453 ? 13.329  45.141 15.232  1.00 144.22 ? 453 TRP A N   1 
ATOM   2700 C  CA  . TRP A 1 453 ? 14.090  46.007 14.326  1.00 141.63 ? 453 TRP A CA  1 
ATOM   2701 C  C   . TRP A 1 453 ? 14.841  45.237 13.226  1.00 144.53 ? 453 TRP A C   1 
ATOM   2702 O  O   . TRP A 1 453 ? 14.686  45.582 12.061  1.00 141.78 ? 453 TRP A O   1 
ATOM   2703 C  CB  . TRP A 1 453 ? 15.029  46.960 15.101  1.00 141.06 ? 453 TRP A CB  1 
ATOM   2704 C  CG  . TRP A 1 453 ? 16.257  46.310 15.667  1.00 145.21 ? 453 TRP A CG  1 
ATOM   2705 C  CD1 . TRP A 1 453 ? 16.371  45.678 16.869  1.00 151.11 ? 453 TRP A CD1 1 
ATOM   2706 C  CD2 . TRP A 1 453 ? 17.534  46.188 15.024  1.00 145.74 ? 453 TRP A CD2 1 
ATOM   2707 N  NE1 . TRP A 1 453 ? 17.640  45.169 17.018  1.00 153.17 ? 453 TRP A NE1 1 
ATOM   2708 C  CE2 . TRP A 1 453 ? 18.371  45.455 15.892  1.00 153.21 ? 453 TRP A CE2 1 
ATOM   2709 C  CE3 . TRP A 1 453 ? 18.041  46.593 13.777  1.00 145.28 ? 453 TRP A CE3 1 
ATOM   2710 C  CZ2 . TRP A 1 453 ? 19.698  45.153 15.572  1.00 154.29 ? 453 TRP A CZ2 1 
ATOM   2711 C  CZ3 . TRP A 1 453 ? 19.355  46.291 13.461  1.00 148.52 ? 453 TRP A CZ3 1 
ATOM   2712 C  CH2 . TRP A 1 453 ? 20.167  45.578 14.351  1.00 152.59 ? 453 TRP A CH2 1 
ATOM   2713 N  N   . LEU A 1 454 ? 15.606  44.185 13.590  1.00 143.23 ? 454 LEU A N   1 
ATOM   2714 C  CA  . LEU A 1 454 ? 16.389  43.378 12.651  1.00 143.58 ? 454 LEU A CA  1 
ATOM   2715 C  C   . LEU A 1 454 ? 15.500  42.540 11.737  1.00 145.62 ? 454 LEU A C   1 
ATOM   2716 O  O   . LEU A 1 454 ? 15.819  42.406 10.556  1.00 144.65 ? 454 LEU A O   1 
ATOM   2717 C  CB  . LEU A 1 454 ? 17.421  42.506 13.394  1.00 147.31 ? 454 LEU A CB  1 
ATOM   2718 C  CG  . LEU A 1 454 ? 18.500  41.815 12.546  1.00 153.69 ? 454 LEU A CG  1 
ATOM   2719 C  CD1 . LEU A 1 454 ? 19.508  42.814 11.980  1.00 152.79 ? 454 LEU A CD1 1 
ATOM   2720 C  CD2 . LEU A 1 454 ? 19.218  40.748 13.347  1.00 160.10 ? 454 LEU A CD2 1 
ATOM   2721 N  N   . LEU A 1 455 ? 14.375  42.006 12.271  1.00 141.48 ? 455 LEU A N   1 
ATOM   2722 C  CA  . LEU A 1 455 ? 13.398  41.213 11.510  1.00 140.42 ? 455 LEU A CA  1 
ATOM   2723 C  C   . LEU A 1 455 ? 12.672  42.098 10.504  1.00 139.66 ? 455 LEU A C   1 
ATOM   2724 O  O   . LEU A 1 455 ? 12.360  41.650 9.396   1.00 138.59 ? 455 LEU A O   1 
ATOM   2725 C  CB  . LEU A 1 455 ? 12.377  40.525 12.435  1.00 141.96 ? 455 LEU A CB  1 
ATOM   2726 C  CG  . LEU A 1 455 ? 12.909  39.489 13.420  1.00 150.05 ? 455 LEU A CG  1 
ATOM   2727 C  CD1 . LEU A 1 455 ? 11.845  39.110 14.413  1.00 151.71 ? 455 LEU A CD1 1 
ATOM   2728 C  CD2 . LEU A 1 455 ? 13.413  38.253 12.711  1.00 154.04 ? 455 LEU A CD2 1 
ATOM   2729 N  N   . ASP A 1 456 ? 12.428  43.364 10.892  1.00 133.27 ? 456 ASP A N   1 
ATOM   2730 C  CA  . ASP A 1 456 ? 11.785  44.367 10.052  1.00 129.75 ? 456 ASP A CA  1 
ATOM   2731 C  C   . ASP A 1 456 ? 12.601  44.618 8.779   1.00 131.60 ? 456 ASP A C   1 
ATOM   2732 O  O   . ASP A 1 456 ? 12.014  44.650 7.701   1.00 129.91 ? 456 ASP A O   1 
ATOM   2733 C  CB  . ASP A 1 456 ? 11.525  45.664 10.842  1.00 130.05 ? 456 ASP A CB  1 
ATOM   2734 C  CG  . ASP A 1 456 ? 10.572  46.647 10.186  1.00 135.33 ? 456 ASP A CG  1 
ATOM   2735 O  OD1 . ASP A 1 456 ? 9.564   46.198 9.600   1.00 135.29 ? 456 ASP A OD1 1 
ATOM   2736 O  OD2 . ASP A 1 456 ? 10.814  47.865 10.295  1.00 138.64 ? 456 ASP A OD2 1 
ATOM   2737 N  N   . ARG A 1 457 ? 13.953  44.716 8.897   1.00 128.14 ? 457 ARG A N   1 
ATOM   2738 C  CA  . ARG A 1 457 ? 14.877  44.928 7.766   1.00 126.85 ? 457 ARG A CA  1 
ATOM   2739 C  C   . ARG A 1 457 ? 14.784  43.786 6.763   1.00 130.74 ? 457 ARG A C   1 
ATOM   2740 O  O   . ARG A 1 457 ? 14.792  44.036 5.560   1.00 129.28 ? 457 ARG A O   1 
ATOM   2741 C  CB  . ARG A 1 457 ? 16.355  45.093 8.209   1.00 128.16 ? 457 ARG A CB  1 
ATOM   2742 C  CG  . ARG A 1 457 ? 16.626  45.749 9.567   1.00 138.61 ? 457 ARG A CG  1 
ATOM   2743 C  CD  . ARG A 1 457 ? 16.216  47.205 9.668   1.00 142.89 ? 457 ARG A CD  1 
ATOM   2744 N  NE  . ARG A 1 457 ? 17.350  48.113 9.531   1.00 150.88 ? 457 ARG A NE  1 
ATOM   2745 C  CZ  . ARG A 1 457 ? 17.307  49.409 9.822   1.00 164.37 ? 457 ARG A CZ  1 
ATOM   2746 N  NH1 . ARG A 1 457 ? 16.186  49.960 10.272  1.00 148.19 ? 457 ARG A NH1 1 
ATOM   2747 N  NH2 . ARG A 1 457 ? 18.386  50.164 9.667   1.00 154.28 ? 457 ARG A NH2 1 
ATOM   2748 N  N   . PHE A 1 458 ? 14.690  42.538 7.255   1.00 128.92 ? 458 PHE A N   1 
ATOM   2749 C  CA  . PHE A 1 458 ? 14.590  41.365 6.390   1.00 129.99 ? 458 PHE A CA  1 
ATOM   2750 C  C   . PHE A 1 458 ? 13.199  41.202 5.791   1.00 130.88 ? 458 PHE A C   1 
ATOM   2751 O  O   . PHE A 1 458 ? 13.092  40.881 4.604   1.00 130.21 ? 458 PHE A O   1 
ATOM   2752 C  CB  . PHE A 1 458 ? 15.051  40.082 7.109   1.00 135.43 ? 458 PHE A CB  1 
ATOM   2753 C  CG  . PHE A 1 458 ? 16.475  40.122 7.613   1.00 138.70 ? 458 PHE A CG  1 
ATOM   2754 C  CD1 . PHE A 1 458 ? 17.534  40.356 6.742   1.00 142.04 ? 458 PHE A CD1 1 
ATOM   2755 C  CD2 . PHE A 1 458 ? 16.759  39.896 8.952   1.00 142.47 ? 458 PHE A CD2 1 
ATOM   2756 C  CE1 . PHE A 1 458 ? 18.848  40.406 7.213   1.00 144.85 ? 458 PHE A CE1 1 
ATOM   2757 C  CE2 . PHE A 1 458 ? 18.073  39.940 9.420   1.00 147.23 ? 458 PHE A CE2 1 
ATOM   2758 C  CZ  . PHE A 1 458 ? 19.109  40.195 8.549   1.00 145.53 ? 458 PHE A CZ  1 
ATOM   2759 N  N   . ARG A 1 459 ? 12.134  41.445 6.591   1.00 125.18 ? 459 ARG A N   1 
ATOM   2760 C  CA  . ARG A 1 459 ? 10.765  41.309 6.097   1.00 123.40 ? 459 ARG A CA  1 
ATOM   2761 C  C   . ARG A 1 459 ? 10.430  42.383 5.051   1.00 123.15 ? 459 ARG A C   1 
ATOM   2762 O  O   . ARG A 1 459 ? 9.629   42.105 4.162   1.00 122.73 ? 459 ARG A O   1 
ATOM   2763 C  CB  . ARG A 1 459 ? 9.726   41.216 7.233   1.00 123.25 ? 459 ARG A CB  1 
ATOM   2764 C  CG  . ARG A 1 459 ? 9.318   42.520 7.899   1.00 128.40 ? 459 ARG A CG  1 
ATOM   2765 C  CD  . ARG A 1 459 ? 8.313   42.260 9.004   1.00 132.88 ? 459 ARG A CD  1 
ATOM   2766 N  NE  . ARG A 1 459 ? 8.915   42.416 10.328  1.00 133.77 ? 459 ARG A NE  1 
ATOM   2767 C  CZ  . ARG A 1 459 ? 8.571   43.351 11.208  1.00 141.80 ? 459 ARG A CZ  1 
ATOM   2768 N  NH1 . ARG A 1 459 ? 7.609   44.220 10.924  1.00 121.52 ? 459 ARG A NH1 1 
ATOM   2769 N  NH2 . ARG A 1 459 ? 9.188   43.427 12.378  1.00 132.23 ? 459 ARG A NH2 1 
ATOM   2770 N  N   . THR A 1 460 ? 11.089  43.570 5.117   1.00 116.74 ? 460 THR A N   1 
ATOM   2771 C  CA  . THR A 1 460 ? 10.930  44.659 4.138   1.00 113.48 ? 460 THR A CA  1 
ATOM   2772 C  C   . THR A 1 460 ? 11.527  44.200 2.802   1.00 117.29 ? 460 THR A C   1 
ATOM   2773 O  O   . THR A 1 460 ? 10.931  44.449 1.753   1.00 115.69 ? 460 THR A O   1 
ATOM   2774 C  CB  . THR A 1 460 ? 11.570  45.963 4.655   1.00 118.43 ? 460 THR A CB  1 
ATOM   2775 O  OG1 . THR A 1 460 ? 10.941  46.324 5.880   1.00 120.09 ? 460 THR A OG1 1 
ATOM   2776 C  CG2 . THR A 1 460 ? 11.432  47.123 3.682   1.00 113.24 ? 460 THR A CG2 1 
ATOM   2777 N  N   . MET A 1 461 ? 12.684  43.496 2.855   1.00 115.29 ? 461 MET A N   1 
ATOM   2778 C  CA  . MET A 1 461 ? 13.384  42.953 1.689   1.00 116.03 ? 461 MET A CA  1 
ATOM   2779 C  C   . MET A 1 461 ? 12.522  41.934 0.950   1.00 120.07 ? 461 MET A C   1 
ATOM   2780 O  O   . MET A 1 461 ? 12.544  41.916 -0.276  1.00 119.92 ? 461 MET A O   1 
ATOM   2781 C  CB  . MET A 1 461 ? 14.733  42.337 2.082   1.00 121.04 ? 461 MET A CB  1 
ATOM   2782 C  CG  . MET A 1 461 ? 15.772  43.361 2.481   1.00 124.10 ? 461 MET A CG  1 
ATOM   2783 S  SD  . MET A 1 461 ? 17.315  42.628 3.082   1.00 131.91 ? 461 MET A SD  1 
ATOM   2784 C  CE  . MET A 1 461 ? 18.202  42.421 1.533   1.00 129.67 ? 461 MET A CE  1 
ATOM   2785 N  N   . VAL A 1 462 ? 11.742  41.118 1.689   1.00 116.78 ? 462 VAL A N   1 
ATOM   2786 C  CA  . VAL A 1 462 ? 10.827  40.113 1.127   1.00 117.66 ? 462 VAL A CA  1 
ATOM   2787 C  C   . VAL A 1 462 ? 9.546   40.796 0.586   1.00 118.44 ? 462 VAL A C   1 
ATOM   2788 O  O   . VAL A 1 462 ? 8.999   40.358 -0.432  1.00 118.03 ? 462 VAL A O   1 
ATOM   2789 C  CB  . VAL A 1 462 ? 10.538  38.968 2.139   1.00 124.13 ? 462 VAL A CB  1 
ATOM   2790 C  CG1 . VAL A 1 462 ? 9.647   37.888 1.528   1.00 125.98 ? 462 VAL A CG1 1 
ATOM   2791 C  CG2 . VAL A 1 462 ? 11.838  38.350 2.649   1.00 126.32 ? 462 VAL A CG2 1 
ATOM   2792 N  N   . ASN A 1 463 ? 9.100   41.888 1.254   1.00 112.82 ? 463 ASN A N   1 
ATOM   2793 C  CA  . ASN A 1 463 ? 7.940   42.707 0.868   1.00 110.52 ? 463 ASN A CA  1 
ATOM   2794 C  C   . ASN A 1 463 ? 8.186   43.392 -0.485  1.00 113.36 ? 463 ASN A C   1 
ATOM   2795 O  O   . ASN A 1 463 ? 7.275   43.443 -1.317  1.00 112.59 ? 463 ASN A O   1 
ATOM   2796 C  CB  . ASN A 1 463 ? 7.640   43.767 1.942   1.00 108.02 ? 463 ASN A CB  1 
ATOM   2797 C  CG  . ASN A 1 463 ? 6.896   43.276 3.164   1.00 124.59 ? 463 ASN A CG  1 
ATOM   2798 O  OD1 . ASN A 1 463 ? 6.515   42.107 3.288   1.00 116.06 ? 463 ASN A OD1 1 
ATOM   2799 N  ND2 . ASN A 1 463 ? 6.676   44.173 4.109   1.00 115.94 ? 463 ASN A ND2 1 
ATOM   2800 N  N   . VAL A 1 464 ? 9.430   43.914 -0.687  1.00 109.15 ? 464 VAL A N   1 
ATOM   2801 C  CA  . VAL A 1 464 ? 9.923   44.575 -1.906  1.00 107.44 ? 464 VAL A CA  1 
ATOM   2802 C  C   . VAL A 1 464 ? 10.046  43.526 -3.020  1.00 112.82 ? 464 VAL A C   1 
ATOM   2803 O  O   . VAL A 1 464 ? 9.517   43.740 -4.109  1.00 111.69 ? 464 VAL A O   1 
ATOM   2804 C  CB  . VAL A 1 464 ? 11.266  45.332 -1.648  1.00 110.43 ? 464 VAL A CB  1 
ATOM   2805 C  CG1 . VAL A 1 464 ? 11.976  45.703 -2.949  1.00 110.20 ? 464 VAL A CG1 1 
ATOM   2806 C  CG2 . VAL A 1 464 ? 11.048  46.574 -0.791  1.00 107.83 ? 464 VAL A CG2 1 
ATOM   2807 N  N   . LEU A 1 465 ? 10.722  42.390 -2.723  1.00 112.08 ? 465 LEU A N   1 
ATOM   2808 C  CA  . LEU A 1 465 ? 10.968  41.246 -3.611  1.00 114.91 ? 465 LEU A CA  1 
ATOM   2809 C  C   . LEU A 1 465 ? 9.690   40.699 -4.254  1.00 119.54 ? 465 LEU A C   1 
ATOM   2810 O  O   . LEU A 1 465 ? 9.711   40.319 -5.427  1.00 119.71 ? 465 LEU A O   1 
ATOM   2811 C  CB  . LEU A 1 465 ? 11.676  40.137 -2.819  1.00 117.88 ? 465 LEU A CB  1 
ATOM   2812 C  CG  . LEU A 1 465 ? 12.323  39.008 -3.608  1.00 126.18 ? 465 LEU A CG  1 
ATOM   2813 C  CD1 . LEU A 1 465 ? 13.665  39.435 -4.176  1.00 126.88 ? 465 LEU A CD1 1 
ATOM   2814 C  CD2 . LEU A 1 465 ? 12.513  37.796 -2.734  1.00 131.09 ? 465 LEU A CD2 1 
ATOM   2815 N  N   . GLY A 1 466 ? 8.609   40.665 -3.472  1.00 116.52 ? 466 GLY A N   1 
ATOM   2816 C  CA  . GLY A 1 466 ? 7.291   40.220 -3.907  1.00 117.63 ? 466 GLY A CA  1 
ATOM   2817 C  C   . GLY A 1 466 ? 6.698   41.125 -4.969  1.00 120.72 ? 466 GLY A C   1 
ATOM   2818 O  O   . GLY A 1 466 ? 6.048   40.637 -5.894  1.00 121.84 ? 466 GLY A O   1 
ATOM   2819 N  N   . ASP A 1 467 ? 6.938   42.454 -4.852  1.00 114.94 ? 467 ASP A N   1 
ATOM   2820 C  CA  . ASP A 1 467 ? 6.479   43.467 -5.814  1.00 113.06 ? 467 ASP A CA  1 
ATOM   2821 C  C   . ASP A 1 467 ? 7.343   43.412 -7.082  1.00 116.42 ? 467 ASP A C   1 
ATOM   2822 O  O   . ASP A 1 467 ? 6.807   43.486 -8.192  1.00 115.51 ? 467 ASP A O   1 
ATOM   2823 C  CB  . ASP A 1 467 ? 6.541   44.889 -5.211  1.00 112.26 ? 467 ASP A CB  1 
ATOM   2824 C  CG  . ASP A 1 467 ? 5.915   45.092 -3.842  1.00 125.65 ? 467 ASP A CG  1 
ATOM   2825 O  OD1 . ASP A 1 467 ? 5.177   44.190 -3.380  1.00 128.69 ? 467 ASP A OD1 1 
ATOM   2826 O  OD2 . ASP A 1 467 ? 6.152   46.161 -3.237  1.00 130.95 ? 467 ASP A OD2 1 
ATOM   2827 N  N   . ALA A 1 468 ? 8.683   43.293 -6.898  1.00 113.49 ? 468 ALA A N   1 
ATOM   2828 C  CA  . ALA A 1 468 ? 9.689   43.220 -7.955  1.00 114.60 ? 468 ALA A CA  1 
ATOM   2829 C  C   . ALA A 1 468 ? 9.456   42.005 -8.839  1.00 123.19 ? 468 ALA A C   1 
ATOM   2830 O  O   . ALA A 1 468 ? 9.272   42.175 -10.045 1.00 124.06 ? 468 ALA A O   1 
ATOM   2831 C  CB  . ALA A 1 468 ? 11.085  43.190 -7.358  1.00 115.63 ? 468 ALA A CB  1 
ATOM   2832 N  N   . LEU A 1 469 ? 9.383   40.791 -8.246  1.00 122.18 ? 469 LEU A N   1 
ATOM   2833 C  CA  . LEU A 1 469 ? 9.094   39.568 -9.001  1.00 125.40 ? 469 LEU A CA  1 
ATOM   2834 C  C   . LEU A 1 469 ? 7.640   39.569 -9.489  1.00 129.41 ? 469 LEU A C   1 
ATOM   2835 O  O   . LEU A 1 469 ? 7.332   38.928 -10.495 1.00 131.23 ? 469 LEU A O   1 
ATOM   2836 C  CB  . LEU A 1 469 ? 9.408   38.305 -8.183  1.00 128.14 ? 469 LEU A CB  1 
ATOM   2837 C  CG  . LEU A 1 469 ? 10.891  37.950 -8.022  1.00 134.50 ? 469 LEU A CG  1 
ATOM   2838 C  CD1 . LEU A 1 469 ? 11.125  37.167 -6.750  1.00 136.11 ? 469 LEU A CD1 1 
ATOM   2839 C  CD2 . LEU A 1 469 ? 11.410  37.159 -9.211  1.00 140.05 ? 469 LEU A CD2 1 
ATOM   2840 N  N   . GLY A 1 470 ? 6.788   40.332 -8.798  1.00 123.86 ? 470 GLY A N   1 
ATOM   2841 C  CA  . GLY A 1 470 ? 5.384   40.525 -9.136  1.00 123.71 ? 470 GLY A CA  1 
ATOM   2842 C  C   . GLY A 1 470 ? 5.203   41.197 -10.476 1.00 128.21 ? 470 GLY A C   1 
ATOM   2843 O  O   . GLY A 1 470 ? 4.467   40.686 -11.325 1.00 130.22 ? 470 GLY A O   1 
ATOM   2844 N  N   . ALA A 1 471 ? 5.916   42.327 -10.688 1.00 122.43 ? 471 ALA A N   1 
ATOM   2845 C  CA  . ALA A 1 471 ? 5.908   43.090 -11.940 1.00 121.56 ? 471 ALA A CA  1 
ATOM   2846 C  C   . ALA A 1 471 ? 6.332   42.205 -13.119 1.00 128.44 ? 471 ALA A C   1 
ATOM   2847 O  O   . ALA A 1 471 ? 5.617   42.152 -14.114 1.00 128.69 ? 471 ALA A O   1 
ATOM   2848 C  CB  . ALA A 1 471 ? 6.813   44.308 -11.824 1.00 119.70 ? 471 ALA A CB  1 
ATOM   2849 N  N   . GLY A 1 472 ? 7.423   41.451 -12.947 1.00 127.18 ? 472 GLY A N   1 
ATOM   2850 C  CA  . GLY A 1 472 ? 7.934   40.511 -13.942 1.00 130.74 ? 472 GLY A CA  1 
ATOM   2851 C  C   . GLY A 1 472 ? 6.936   39.428 -14.315 1.00 137.80 ? 472 GLY A C   1 
ATOM   2852 O  O   . GLY A 1 472 ? 6.834   39.054 -15.490 1.00 140.23 ? 472 GLY A O   1 
ATOM   2853 N  N   . ILE A 1 473 ? 6.171   38.938 -13.312 1.00 133.67 ? 473 ILE A N   1 
ATOM   2854 C  CA  . ILE A 1 473 ? 5.135   37.916 -13.481 1.00 135.92 ? 473 ILE A CA  1 
ATOM   2855 C  C   . ILE A 1 473 ? 3.920   38.496 -14.238 1.00 138.98 ? 473 ILE A C   1 
ATOM   2856 O  O   . ILE A 1 473 ? 3.488   37.897 -15.225 1.00 141.48 ? 473 ILE A O   1 
ATOM   2857 C  CB  . ILE A 1 473 ? 4.786   37.242 -12.117 1.00 139.02 ? 473 ILE A CB  1 
ATOM   2858 C  CG1 . ILE A 1 473 ? 5.839   36.164 -11.770 1.00 142.02 ? 473 ILE A CG1 1 
ATOM   2859 C  CG2 . ILE A 1 473 ? 3.368   36.646 -12.096 1.00 141.27 ? 473 ILE A CG2 1 
ATOM   2860 C  CD1 . ILE A 1 473 ? 5.991   35.833 -10.284 1.00 149.25 ? 473 ILE A CD1 1 
ATOM   2861 N  N   . VAL A 1 474 ? 3.405   39.668 -13.797 1.00 131.68 ? 474 VAL A N   1 
ATOM   2862 C  CA  . VAL A 1 474 ? 2.246   40.345 -14.399 1.00 130.53 ? 474 VAL A CA  1 
ATOM   2863 C  C   . VAL A 1 474 ? 2.564   40.836 -15.827 1.00 135.46 ? 474 VAL A C   1 
ATOM   2864 O  O   . VAL A 1 474 ? 1.704   40.720 -16.702 1.00 136.80 ? 474 VAL A O   1 
ATOM   2865 C  CB  . VAL A 1 474 ? 1.654   41.460 -13.483 1.00 130.33 ? 474 VAL A CB  1 
ATOM   2866 C  CG1 . VAL A 1 474 ? 0.426   42.116 -14.110 1.00 129.53 ? 474 VAL A CG1 1 
ATOM   2867 C  CG2 . VAL A 1 474 ? 1.292   40.905 -12.109 1.00 130.19 ? 474 VAL A CG2 1 
ATOM   2868 N  N   . GLU A 1 475 ? 3.800   41.336 -16.067 1.00 131.46 ? 475 GLU A N   1 
ATOM   2869 C  CA  . GLU A 1 475 ? 4.266   41.816 -17.379 1.00 132.32 ? 475 GLU A CA  1 
ATOM   2870 C  C   . GLU A 1 475 ? 4.174   40.696 -18.417 1.00 141.03 ? 475 GLU A C   1 
ATOM   2871 O  O   . GLU A 1 475 ? 3.557   40.886 -19.466 1.00 141.64 ? 475 GLU A O   1 
ATOM   2872 C  CB  . GLU A 1 475 ? 5.718   42.328 -17.291 1.00 132.38 ? 475 GLU A CB  1 
ATOM   2873 C  CG  . GLU A 1 475 ? 6.223   43.030 -18.543 1.00 142.61 ? 475 GLU A CG  1 
ATOM   2874 C  CD  . GLU A 1 475 ? 7.724   42.986 -18.769 1.00 161.42 ? 475 GLU A CD  1 
ATOM   2875 O  OE1 . GLU A 1 475 ? 8.372   41.991 -18.366 1.00 150.38 ? 475 GLU A OE1 1 
ATOM   2876 O  OE2 . GLU A 1 475 ? 8.244   43.930 -19.408 1.00 155.10 ? 475 GLU A OE2 1 
ATOM   2877 N  N   . HIS A 1 476 ? 4.770   39.530 -18.098 1.00 140.82 ? 476 HIS A N   1 
ATOM   2878 C  CA  . HIS A 1 476 ? 4.791   38.338 -18.942 1.00 145.62 ? 476 HIS A CA  1 
ATOM   2879 C  C   . HIS A 1 476 ? 3.375   37.844 -19.242 1.00 152.74 ? 476 HIS A C   1 
ATOM   2880 O  O   . HIS A 1 476 ? 3.091   37.492 -20.386 1.00 155.54 ? 476 HIS A O   1 
ATOM   2881 C  CB  . HIS A 1 476 ? 5.626   37.237 -18.279 1.00 148.36 ? 476 HIS A CB  1 
ATOM   2882 C  CG  . HIS A 1 476 ? 5.973   36.112 -19.199 1.00 156.54 ? 476 HIS A CG  1 
ATOM   2883 N  ND1 . HIS A 1 476 ? 5.176   34.986 -19.293 1.00 161.82 ? 476 HIS A ND1 1 
ATOM   2884 C  CD2 . HIS A 1 476 ? 7.023   35.977 -20.041 1.00 160.29 ? 476 HIS A CD2 1 
ATOM   2885 C  CE1 . HIS A 1 476 ? 5.765   34.203 -20.182 1.00 165.24 ? 476 HIS A CE1 1 
ATOM   2886 N  NE2 . HIS A 1 476 ? 6.879   34.757 -20.660 1.00 164.85 ? 476 HIS A NE2 1 
ATOM   2887 N  N   . LEU A 1 477 ? 2.485   37.857 -18.224 1.00 148.64 ? 477 LEU A N   1 
ATOM   2888 C  CA  . LEU A 1 477 ? 1.083   37.439 -18.340 1.00 150.67 ? 477 LEU A CA  1 
ATOM   2889 C  C   . LEU A 1 477 ? 0.261   38.402 -19.213 1.00 154.90 ? 477 LEU A C   1 
ATOM   2890 O  O   . LEU A 1 477 ? -0.541  37.946 -20.032 1.00 157.44 ? 477 LEU A O   1 
ATOM   2891 C  CB  . LEU A 1 477 ? 0.436   37.280 -16.950 1.00 149.14 ? 477 LEU A CB  1 
ATOM   2892 C  CG  . LEU A 1 477 ? 0.800   36.034 -16.140 1.00 155.93 ? 477 LEU A CG  1 
ATOM   2893 C  CD1 . LEU A 1 477 ? 0.544   36.261 -14.672 1.00 153.43 ? 477 LEU A CD1 1 
ATOM   2894 C  CD2 . LEU A 1 477 ? 0.020   34.812 -16.608 1.00 163.10 ? 477 LEU A CD2 1 
ATOM   2895 N  N   . SER A 1 478 ? 0.476   39.726 -19.049 1.00 148.64 ? 478 SER A N   1 
ATOM   2896 C  CA  . SER A 1 478 ? -0.208  40.769 -19.819 1.00 147.91 ? 478 SER A CA  1 
ATOM   2897 C  C   . SER A 1 478 ? 0.584   41.127 -21.091 1.00 154.72 ? 478 SER A C   1 
ATOM   2898 O  O   . SER A 1 478 ? 0.815   42.302 -21.389 1.00 152.04 ? 478 SER A O   1 
ATOM   2899 C  CB  . SER A 1 478 ? -0.467  41.999 -18.951 1.00 146.33 ? 478 SER A CB  1 
ATOM   2900 O  OG  . SER A 1 478 ? -1.664  41.868 -18.203 1.00 152.77 ? 478 SER A OG  1 
ATOM   2901 N  N   . ARG A 1 479 ? 0.979   40.089 -21.845 1.00 156.41 ? 479 ARG A N   1 
ATOM   2902 C  CA  . ARG A 1 479 ? 1.755   40.166 -23.083 1.00 158.72 ? 479 ARG A CA  1 
ATOM   2903 C  C   . ARG A 1 479 ? 0.983   40.821 -24.245 1.00 164.45 ? 479 ARG A C   1 
ATOM   2904 O  O   . ARG A 1 479 ? 1.468   41.806 -24.805 1.00 162.40 ? 479 ARG A O   1 
ATOM   2905 C  CB  . ARG A 1 479 ? 2.310   38.771 -23.470 1.00 164.17 ? 479 ARG A CB  1 
ATOM   2906 C  CG  . ARG A 1 479 ? 1.312   37.609 -23.303 1.00 178.54 ? 479 ARG A CG  1 
ATOM   2907 C  CD  . ARG A 1 479 ? 1.937   36.233 -23.449 1.00 189.49 ? 479 ARG A CD  1 
ATOM   2908 N  NE  . ARG A 1 479 ? 1.022   35.184 -22.992 1.00 197.17 ? 479 ARG A NE  1 
ATOM   2909 C  CZ  . ARG A 1 479 ? 1.068   34.611 -21.792 1.00 207.52 ? 479 ARG A CZ  1 
ATOM   2910 N  NH1 . ARG A 1 479 ? 2.004   34.959 -20.918 1.00 189.65 ? 479 ARG A NH1 1 
ATOM   2911 N  NH2 . ARG A 1 479 ? 0.188   33.676 -21.462 1.00 197.31 ? 479 ARG A NH2 1 
ATOM   2912 N  N   . LYS A 1 480 ? -0.217  40.285 -24.584 1.00 164.54 ? 480 LYS A N   1 
ATOM   2913 C  CA  . LYS A 1 480 ? -1.094  40.747 -25.670 1.00 166.27 ? 480 LYS A CA  1 
ATOM   2914 C  C   . LYS A 1 480 ? -1.595  42.175 -25.449 1.00 167.46 ? 480 LYS A C   1 
ATOM   2915 O  O   . LYS A 1 480 ? -1.722  42.928 -26.415 1.00 167.45 ? 480 LYS A O   1 
ATOM   2916 C  CB  . LYS A 1 480 ? -2.278  39.780 -25.860 1.00 172.35 ? 480 LYS A CB  1 
ATOM   2917 C  CG  . LYS A 1 480 ? -3.010  39.938 -27.190 1.00 187.13 ? 480 LYS A CG  1 
ATOM   2918 C  CD  . LYS A 1 480 ? -4.416  39.367 -27.135 1.00 197.47 ? 480 LYS A CD  1 
ATOM   2919 C  CE  . LYS A 1 480 ? -5.219  39.751 -28.353 1.00 208.22 ? 480 LYS A CE  1 
ATOM   2920 N  NZ  . LYS A 1 480 ? -6.623  39.273 -28.261 1.00 216.31 ? 480 LYS A NZ  1 
ATOM   2921 N  N   . GLU A 1 481 ? -1.881  42.539 -24.184 1.00 161.72 ? 481 GLU A N   1 
ATOM   2922 C  CA  . GLU A 1 481 ? -2.350  43.873 -23.794 1.00 158.50 ? 481 GLU A CA  1 
ATOM   2923 C  C   . GLU A 1 481 ? -1.328  44.946 -24.199 1.00 160.87 ? 481 GLU A C   1 
ATOM   2924 O  O   . GLU A 1 481 ? -1.711  45.974 -24.763 1.00 159.48 ? 481 GLU A O   1 
ATOM   2925 C  CB  . GLU A 1 481 ? -2.644  43.932 -22.281 1.00 157.13 ? 481 GLU A CB  1 
ATOM   2926 C  CG  . GLU A 1 481 ? -3.904  43.189 -21.862 1.00 170.04 ? 481 GLU A CG  1 
ATOM   2927 C  CD  . GLU A 1 481 ? -3.727  41.708 -21.587 1.00 191.66 ? 481 GLU A CD  1 
ATOM   2928 O  OE1 . GLU A 1 481 ? -3.595  40.929 -22.558 1.00 178.08 ? 481 GLU A OE1 1 
ATOM   2929 O  OE2 . GLU A 1 481 ? -3.747  41.324 -20.395 1.00 189.63 ? 481 GLU A OE2 1 
ATOM   2930 N  N   . LEU A 1 482 ? -0.028  44.671 -23.953 1.00 157.52 ? 482 LEU A N   1 
ATOM   2931 C  CA  . LEU A 1 482 ? 1.086   45.552 -24.311 1.00 155.97 ? 482 LEU A CA  1 
ATOM   2932 C  C   . LEU A 1 482 ? 1.377   45.477 -25.816 1.00 163.76 ? 482 LEU A C   1 
ATOM   2933 O  O   . LEU A 1 482 ? 1.883   46.448 -26.381 1.00 162.35 ? 482 LEU A O   1 
ATOM   2934 C  CB  . LEU A 1 482 ? 2.352   45.223 -23.493 1.00 154.78 ? 482 LEU A CB  1 
ATOM   2935 C  CG  . LEU A 1 482 ? 2.244   45.301 -21.961 1.00 156.55 ? 482 LEU A CG  1 
ATOM   2936 C  CD1 . LEU A 1 482 ? 3.392   44.569 -21.300 1.00 157.02 ? 482 LEU A CD1 1 
ATOM   2937 C  CD2 . LEU A 1 482 ? 2.192   46.738 -21.464 1.00 155.15 ? 482 LEU A CD2 1 
ATOM   2938 N  N   . GLU A 1 483 ? 1.050   44.330 -26.462 1.00 164.97 ? 483 GLU A N   1 
ATOM   2939 C  CA  . GLU A 1 483 ? 1.221   44.113 -27.904 1.00 168.93 ? 483 GLU A CA  1 
ATOM   2940 C  C   . GLU A 1 483 ? 0.211   44.980 -28.673 1.00 174.15 ? 483 GLU A C   1 
ATOM   2941 O  O   . GLU A 1 483 ? 0.581   45.599 -29.672 1.00 174.95 ? 483 GLU A O   1 
ATOM   2942 C  CB  . GLU A 1 483 ? 1.051   42.621 -28.266 1.00 174.77 ? 483 GLU A CB  1 
ATOM   2943 C  CG  . GLU A 1 483 ? 1.446   42.276 -29.698 1.00 189.60 ? 483 GLU A CG  1 
ATOM   2944 C  CD  . GLU A 1 483 ? 0.795   41.047 -30.310 1.00 212.79 ? 483 GLU A CD  1 
ATOM   2945 O  OE1 . GLU A 1 483 ? -0.454  41.018 -30.411 1.00 205.45 ? 483 GLU A OE1 1 
ATOM   2946 O  OE2 . GLU A 1 483 ? 1.538   40.143 -30.754 1.00 208.44 ? 483 GLU A OE2 1 
ATOM   2947 N  N   . LYS A 1 484 ? -1.052  45.028 -28.193 1.00 170.62 ? 484 LYS A N   1 
ATOM   2948 C  CA  . LYS A 1 484 ? -2.148  45.807 -28.777 1.00 171.07 ? 484 LYS A CA  1 
ATOM   2949 C  C   . LYS A 1 484 ? -1.899  47.316 -28.641 1.00 172.30 ? 484 LYS A C   1 
ATOM   2950 O  O   . LYS A 1 484 ? -2.222  48.063 -29.561 1.00 172.72 ? 484 LYS A O   1 
ATOM   2951 C  CB  . LYS A 1 484 ? -3.491  45.413 -28.132 1.00 173.77 ? 484 LYS A CB  1 
ATOM   2952 C  CG  . LYS A 1 484 ? -4.730  45.861 -28.907 1.00 188.33 ? 484 LYS A CG  1 
ATOM   2953 C  CD  . LYS A 1 484 ? -5.276  44.765 -29.823 1.00 203.03 ? 484 LYS A CD  1 
ATOM   2954 C  CE  . LYS A 1 484 ? -6.429  45.237 -30.681 1.00 216.41 ? 484 LYS A CE  1 
ATOM   2955 N  NZ  . LYS A 1 484 ? -7.694  45.368 -29.908 1.00 225.08 ? 484 LYS A NZ  1 
ATOM   2956 N  N   . GLN A 1 485 ? -1.322  47.752 -27.504 1.00 165.91 ? 485 GLN A N   1 
ATOM   2957 C  CA  . GLN A 1 485 ? -1.010  49.158 -27.228 1.00 162.67 ? 485 GLN A CA  1 
ATOM   2958 C  C   . GLN A 1 485 ? 0.185   49.686 -28.035 1.00 168.47 ? 485 GLN A C   1 
ATOM   2959 O  O   . GLN A 1 485 ? 0.211   50.871 -28.372 1.00 166.61 ? 485 GLN A O   1 
ATOM   2960 C  CB  . GLN A 1 485 ? -0.791  49.377 -25.728 1.00 160.11 ? 485 GLN A CB  1 
ATOM   2961 C  CG  . GLN A 1 485 ? -2.081  49.635 -24.950 1.00 171.71 ? 485 GLN A CG  1 
ATOM   2962 C  CD  . GLN A 1 485 ? -2.420  51.104 -24.815 1.00 186.46 ? 485 GLN A CD  1 
ATOM   2963 O  OE1 . GLN A 1 485 ? -1.546  51.978 -24.738 1.00 179.92 ? 485 GLN A OE1 1 
ATOM   2964 N  NE2 . GLN A 1 485 ? -3.706  51.405 -24.730 1.00 177.45 ? 485 GLN A NE2 1 
ATOM   2965 N  N   . ASP A 1 486 ? 1.170   48.815 -28.336 1.00 168.45 ? 486 ASP A N   1 
ATOM   2966 C  CA  . ASP A 1 486 ? 2.366   49.169 -29.106 1.00 169.93 ? 486 ASP A CA  1 
ATOM   2967 C  C   . ASP A 1 486 ? 2.069   49.314 -30.595 1.00 179.07 ? 486 ASP A C   1 
ATOM   2968 O  O   . ASP A 1 486 ? 2.487   50.299 -31.207 1.00 178.48 ? 486 ASP A O   1 
ATOM   2969 C  CB  . ASP A 1 486 ? 3.496   48.149 -28.872 1.00 173.10 ? 486 ASP A CB  1 
ATOM   2970 C  CG  . ASP A 1 486 ? 4.318   48.377 -27.614 1.00 180.98 ? 486 ASP A CG  1 
ATOM   2971 O  OD1 . ASP A 1 486 ? 3.907   49.209 -26.773 1.00 178.12 ? 486 ASP A OD1 1 
ATOM   2972 O  OD2 . ASP A 1 486 ? 5.373   47.725 -27.471 1.00 188.58 ? 486 ASP A OD2 1 
ATOM   2973 N  N   . ALA A 1 487 ? 1.348   48.334 -31.174 1.00 180.42 ? 487 ALA A N   1 
ATOM   2974 C  CA  . ALA A 1 487 ? 0.966   48.306 -32.588 1.00 184.79 ? 487 ALA A CA  1 
ATOM   2975 C  C   . ALA A 1 487 ? -0.023  49.421 -32.945 1.00 189.12 ? 487 ALA A C   1 
ATOM   2976 O  O   . ALA A 1 487 ? 0.000   49.911 -34.076 1.00 191.21 ? 487 ALA A O   1 
ATOM   2977 C  CB  . ALA A 1 487 ? 0.380   46.949 -32.942 1.00 189.52 ? 487 ALA A CB  1 
ATOM   2978 N  N   . GLU A 1 488 ? -0.878  49.823 -31.974 1.00 183.36 ? 488 GLU A N   1 
ATOM   2979 C  CA  . GLU A 1 488 ? -1.888  50.881 -32.102 1.00 182.53 ? 488 GLU A CA  1 
ATOM   2980 C  C   . GLU A 1 488 ? -1.239  52.209 -32.513 1.00 185.05 ? 488 GLU A C   1 
ATOM   2981 O  O   . GLU A 1 488 ? -1.745  52.884 -33.414 1.00 186.43 ? 488 GLU A O   1 
ATOM   2982 C  CB  . GLU A 1 488 ? -2.653  51.040 -30.771 1.00 180.78 ? 488 GLU A CB  1 
ATOM   2983 C  CG  . GLU A 1 488 ? -3.985  51.768 -30.869 1.00 193.30 ? 488 GLU A CG  1 
ATOM   2984 C  CD  . GLU A 1 488 ? -3.923  53.279 -30.742 1.00 215.06 ? 488 GLU A CD  1 
ATOM   2985 O  OE1 . GLU A 1 488 ? -3.390  53.776 -29.723 1.00 202.12 ? 488 GLU A OE1 1 
ATOM   2986 O  OE2 . GLU A 1 488 ? -4.431  53.968 -31.656 1.00 215.21 ? 488 GLU A OE2 1 
ATOM   2987 N  N   . LEU A 1 489 ? -0.106  52.554 -31.867 1.00 178.61 ? 489 LEU A N   1 
ATOM   2988 C  CA  . LEU A 1 489 ? 0.668   53.778 -32.099 1.00 176.69 ? 489 LEU A CA  1 
ATOM   2989 C  C   . LEU A 1 489 ? 1.305   53.849 -33.493 1.00 184.01 ? 489 LEU A C   1 
ATOM   2990 O  O   . LEU A 1 489 ? 1.509   54.950 -34.012 1.00 183.64 ? 489 LEU A O   1 
ATOM   2991 C  CB  . LEU A 1 489 ? 1.733   53.958 -31.005 1.00 173.27 ? 489 LEU A CB  1 
ATOM   2992 C  CG  . LEU A 1 489 ? 1.223   53.962 -29.565 1.00 174.42 ? 489 LEU A CG  1 
ATOM   2993 C  CD1 . LEU A 1 489 ? 2.312   53.550 -28.605 1.00 172.74 ? 489 LEU A CD1 1 
ATOM   2994 C  CD2 . LEU A 1 489 ? 0.633   55.311 -29.186 1.00 174.23 ? 489 LEU A CD2 1 
ATOM   2995 N  N   . GLY A 1 490 ? 1.590   52.687 -34.084 1.00 183.42 ? 490 GLY A N   1 
ATOM   2996 C  CA  . GLY A 1 490 ? 2.177   52.575 -35.416 1.00 209.53 ? 490 GLY A CA  1 
ATOM   2997 C  C   . GLY A 1 490 ? 1.248   52.995 -36.540 1.00 223.20 ? 490 GLY A C   1 
ATOM   2998 O  O   . GLY A 1 490 ? 0.050   53.208 -36.333 1.00 174.93 ? 490 GLY A O   1 
HETATM 2999 NA NA  . NA  B 2 .   ? 0.320   46.203 3.251   1.00 124.09 1 601 NA  A NA  1 
HETATM 3000 N  N   . ASP C 3 .   ? 8.712   47.425 7.250   1.00 107.19 ? 602 ASP A N   1 
HETATM 3001 C  CA  . ASP C 3 .   ? 7.653   46.869 6.409   1.00 110.71 ? 602 ASP A CA  1 
HETATM 3002 C  C   . ASP C 3 .   ? 7.571   47.561 5.048   1.00 122.89 ? 602 ASP A C   1 
HETATM 3003 O  O   . ASP C 3 .   ? 7.041   46.950 4.094   1.00 123.69 ? 602 ASP A O   1 
HETATM 3004 C  CB  . ASP C 3 .   ? 6.302   46.948 7.123   1.00 112.82 ? 602 ASP A CB  1 
HETATM 3005 C  CG  . ASP C 3 .   ? 6.322   46.277 8.468   1.00 126.58 ? 602 ASP A CG  1 
HETATM 3006 O  OD1 . ASP C 3 .   ? 6.100   45.054 8.519   1.00 129.21 ? 602 ASP A OD1 1 
HETATM 3007 O  OD2 . ASP C 3 .   ? 6.634   46.959 9.460   1.00 134.31 ? 602 ASP A OD2 1 
HETATM 3008 O  OXT . ASP C 3 .   ? 8.012   48.723 4.943   1.00 142.92 ? 602 ASP A OXT 1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . GLU A 39  ? 2.4774 2.7429 2.8247 0.8694  0.3489  -0.0461 39  GLU A N   
2    C  CA  . GLU A 39  ? 2.4538 2.7780 2.8123 0.8548  0.3780  -0.0544 39  GLU A CA  
3    C  C   . GLU A 39  ? 2.4975 2.8090 2.7801 0.8320  0.3841  -0.0435 39  GLU A C   
4    O  O   . GLU A 39  ? 2.4582 2.8377 2.7608 0.8215  0.3933  -0.0247 39  GLU A O   
5    C  CB  . GLU A 39  ? 2.4834 2.7891 2.8610 0.8393  0.3987  -0.1034 39  GLU A CB  
6    C  CG  . GLU A 39  ? 2.5176 2.8579 3.0723 0.7487  0.3585  -0.1632 39  GLU A CG  
7    C  CD  . GLU A 39  ? 2.6297 2.9425 3.2567 0.5836  0.3187  -0.2445 39  GLU A CD  
8    O  OE1 . GLU A 39  ? 2.6073 2.8799 3.2200 0.6066  0.3319  -0.2656 39  GLU A OE1 
9    O  OE2 . GLU A 39  ? 2.5666 2.9488 3.2419 0.6067  0.3544  -0.2599 39  GLU A OE2 
10   N  N   . ASP A 40  ? 2.5209 2.7484 2.6883 0.8624  0.3936  -0.0403 40  ASP A N   
11   C  CA  . ASP A 40  ? 2.5360 2.7370 2.6029 0.8661  0.4065  -0.0260 40  ASP A CA  
12   C  C   . ASP A 40  ? 2.5450 2.7567 2.5945 0.8622  0.3823  0.0111  40  ASP A C   
13   O  O   . ASP A 40  ? 2.5511 2.7438 2.5213 0.8660  0.3910  0.0239  40  ASP A O   
14   C  CB  . ASP A 40  ? 2.6097 2.7083 2.5937 0.8588  0.4087  -0.0595 40  ASP A CB  
15   C  CG  . ASP A 40  ? 2.6957 2.7925 2.7572 0.7831  0.4052  -0.1248 40  ASP A CG  
16   O  OD1 . ASP A 40  ? 2.6968 2.7917 2.8272 0.7788  0.3965  -0.1467 40  ASP A OD1 
17   O  OD2 . ASP A 40  ? 2.7458 2.8432 2.7914 0.7368  0.4133  -0.1512 40  ASP A OD2 
18   N  N   . VAL A 41  ? 2.4929 2.7399 2.5861 0.8918  0.3656  0.0422  41  VAL A N   
19   C  CA  . VAL A 41  ? 2.4772 2.7411 2.5500 0.9003  0.3450  0.0815  41  VAL A CA  
20   C  C   . VAL A 41  ? 2.4617 2.8208 2.5851 0.8700  0.3452  0.1026  41  VAL A C   
21   O  O   . VAL A 41  ? 2.4466 2.8187 2.5370 0.8721  0.3339  0.1319  41  VAL A O   
22   C  CB  . VAL A 41  ? 2.5040 2.7571 2.6409 0.8861  0.3030  0.0840  41  VAL A CB  
23   C  CG1 . VAL A 41  ? 2.4505 2.7985 2.7058 0.8757  0.2896  0.0944  41  VAL A CG1 
24   C  CG2 . VAL A 41  ? 2.5168 2.7351 2.5882 0.8968  0.2824  0.1122  41  VAL A CG2 
25   N  N   . LYS A 42  ? 2.4057 2.8396 2.5840 0.8757  0.3718  0.1029  42  LYS A N   
26   C  CA  . LYS A 42  ? 2.3552 2.8840 2.5769 0.8586  0.3799  0.1290  42  LYS A CA  
27   C  C   . LYS A 42  ? 2.3948 2.9017 2.5372 0.8450  0.3969  0.1307  42  LYS A C   
28   O  O   . LYS A 42  ? 2.3567 2.9120 2.4992 0.8361  0.3909  0.1625  42  LYS A O   
29   C  CB  . LYS A 42  ? 2.3489 2.9383 2.6774 0.8234  0.3856  0.1039  42  LYS A CB  
30   C  CG  . LYS A 42  ? 2.4649 3.0958 2.8858 0.7144  0.3559  0.0769  42  LYS A CG  
31   C  CD  . LYS A 42  ? 2.5481 3.1894 3.0282 0.6568  0.3014  0.0804  42  LYS A CD  
32   C  CE  . LYS A 42  ? 2.6289 3.2613 3.1015 0.5855  0.2845  0.0708  42  LYS A CE  
33   N  NZ  . LYS A 42  ? 2.6850 3.2919 3.1795 0.5342  0.2307  0.0692  42  LYS A NZ  
34   N  N   . SER A 43  ? 2.4054 2.8497 2.4607 0.8743  0.4285  0.1112  43  SER A N   
35   C  CA  . SER A 43  ? 2.4189 2.8284 2.3838 0.8714  0.4458  0.1097  43  SER A CA  
36   C  C   . SER A 43  ? 2.4602 2.8046 2.3499 0.8739  0.4222  0.1185  43  SER A C   
37   O  O   . SER A 43  ? 2.4353 2.7776 2.2830 0.8555  0.4214  0.1264  43  SER A O   
38   C  CB  . SER A 43  ? 2.5014 2.8413 2.4261 0.8555  0.4615  0.0608  43  SER A CB  
39   O  OG  . SER A 43  ? 2.6253 2.8755 2.5606 0.8180  0.4297  0.0142  43  SER A OG  
40   N  N   . PHE A 44  ? 2.4538 2.7499 2.3089 0.9223  0.4126  0.1277  44  PHE A N   
41   C  CA  . PHE A 44  ? 2.4251 2.6469 2.2433 0.8858  0.3737  0.1178  44  PHE A CA  
42   C  C   . PHE A 44  ? 2.3732 2.6609 2.2559 0.8400  0.3413  0.1413  44  PHE A C   
43   O  O   . PHE A 44  ? 2.3355 2.5801 2.1883 0.7951  0.3149  0.1330  44  PHE A O   
44   C  CB  . PHE A 44  ? 2.5067 2.6591 2.2995 0.9238  0.3642  0.1121  44  PHE A CB  
45   C  CG  . PHE A 44  ? 2.5227 2.5893 2.2697 0.8914  0.3290  0.1018  44  PHE A CG  
46   C  CD1 . PHE A 44  ? 2.5998 2.5661 2.2622 0.8744  0.3284  0.0725  44  PHE A CD1 
47   C  CD2 . PHE A 44  ? 2.5164 2.6023 2.3040 0.8794  0.2967  0.1218  44  PHE A CD2 
48   C  CE1 . PHE A 44  ? 2.6104 2.5018 2.2350 0.8438  0.2982  0.0652  44  PHE A CE1 
49   C  CE2 . PHE A 44  ? 2.5556 2.5629 2.2988 0.8507  0.2675  0.1139  44  PHE A CE2 
50   C  CZ  . PHE A 44  ? 2.5647 2.4771 2.2292 0.8329  0.2696  0.0864  44  PHE A CZ  
51   N  N   . LEU A 45  ? 2.2837 2.6753 2.2545 0.8515  0.3432  0.1699  45  LEU A N   
52   C  CA  . LEU A 45  ? 2.2003 2.6608 2.2371 0.8105  0.3125  0.1929  45  LEU A CA  
53   C  C   . LEU A 45  ? 2.1784 2.6844 2.2291 0.7670  0.3194  0.1960  45  LEU A C   
54   O  O   . LEU A 45  ? 2.1182 2.6330 2.1819 0.7196  0.2904  0.2013  45  LEU A O   
55   C  CB  . LEU A 45  ? 2.1913 2.7459 2.3194 0.8397  0.3099  0.2224  45  LEU A CB  
56   C  CG  . LEU A 45  ? 2.2836 2.8059 2.4135 0.8714  0.2883  0.2273  45  LEU A CG  
57   C  CD1 . LEU A 45  ? 2.2742 2.8534 2.5031 0.8774  0.2857  0.2262  45  LEU A CD1 
58   C  CD2 . LEU A 45  ? 2.2630 2.7794 2.4048 0.8306  0.2415  0.2363  45  LEU A CD2 
59   N  N   . ARG A 46  ? 2.1359 2.6685 2.1811 0.7847  0.3583  0.1932  46  ARG A N   
60   C  CA  . ARG A 46  ? 2.0864 2.6597 2.1396 0.7493  0.3705  0.1976  46  ARG A CA  
61   C  C   . ARG A 46  ? 2.1124 2.6014 2.0854 0.7122  0.3593  0.1724  46  ARG A C   
62   O  O   . ARG A 46  ? 2.0591 2.5671 2.0448 0.6656  0.3427  0.1783  46  ARG A O   
63   C  CB  . ARG A 46  ? 2.1212 2.7430 2.1848 0.7847  0.4182  0.2025  46  ARG A CB  
64   C  CG  . ARG A 46  ? 2.2113 2.9503 2.3770 0.8038  0.4310  0.2355  46  ARG A CG  
65   C  CD  . ARG A 46  ? 2.2584 2.9859 2.4615 0.7666  0.4485  0.1912  46  ARG A CD  
66   N  NE  . ARG A 46  ? 2.2469 3.0478 2.5643 0.7140  0.4379  0.1865  46  ARG A NE  
67   C  CZ  . ARG A 46  ? 2.3276 3.1167 2.6867 0.6138  0.4164  0.1512  46  ARG A CZ  
68   N  NH1 . ARG A 46  ? 2.1868 3.0002 2.4555 0.6634  0.4536  0.1997  46  ARG A NH1 
69   N  NH2 . ARG A 46  ? 2.1372 3.0425 2.5742 0.6363  0.4374  0.1912  46  ARG A NH2 
70   N  N   . ARG A 47  ? 2.1067 2.5025 1.9988 0.7328  0.3672  0.1446  47  ARG A N   
71   C  CA  . ARG A 47  ? 2.0999 2.4128 1.9139 0.7022  0.3575  0.1190  47  ARG A CA  
72   C  C   . ARG A 47  ? 2.0841 2.3517 1.8870 0.6638  0.3165  0.1148  47  ARG A C   
73   O  O   . ARG A 47  ? 2.0330 2.2937 1.8236 0.6202  0.3018  0.1115  47  ARG A O   
74   C  CB  . ARG A 47  ? 2.1818 2.4119 1.9158 0.7375  0.3788  0.0908  47  ARG A CB  
75   C  CG  . ARG A 47  ? 2.3426 2.6021 2.0629 0.7663  0.4206  0.0884  47  ARG A CG  
76   C  CD  . ARG A 47  ? 2.5239 2.7111 2.1791 0.8146  0.4421  0.0641  47  ARG A CD  
77   N  NE  . ARG A 47  ? 2.5964 2.8007 2.2767 0.7807  0.4602  0.0355  47  ARG A NE  
78   C  CZ  . ARG A 47  ? 2.7270 2.8855 2.4665 0.6973  0.4384  -0.0320 47  ARG A CZ  
79   N  NH1 . ARG A 47  ? 2.6788 2.7687 2.3458 0.7723  0.4471  -0.0275 47  ARG A NH1 
80   N  NH2 . ARG A 47  ? 2.6276 2.8067 2.3075 0.7585  0.4894  -0.0229 47  ARG A NH2 
81   N  N   . ASN A 48  ? 2.0365 2.2728 1.8423 0.6817  0.2994  0.1159  48  ASN A N   
82   C  CA  . ASN A 48  ? 1.9991 2.1890 1.7905 0.6517  0.2634  0.1131  48  ASN A CA  
83   C  C   . ASN A 48  ? 1.9525 2.2124 1.8145 0.6283  0.2372  0.1385  48  ASN A C   
84   O  O   . ASN A 48  ? 1.9371 2.1711 1.7988 0.6210  0.2102  0.1423  48  ASN A O   
85   C  CB  . ASN A 48  ? 2.0735 2.1857 1.8239 0.6825  0.2586  0.1018  48  ASN A CB  
86   C  CG  . ASN A 48  ? 2.4111 2.4470 2.0902 0.7071  0.2813  0.0754  48  ASN A CG  
87   O  OD1 . ASN A 48  ? 2.3503 2.4076 2.0263 0.7373  0.3119  0.0715  48  ASN A OD1 
88   N  ND2 . ASN A 48  ? 2.3488 2.2925 1.9686 0.6965  0.2669  0.0571  48  ASN A ND2 
89   N  N   . ALA A 49  ? 1.8456 2.1905 1.7640 0.6145  0.2447  0.1557  49  ALA A N   
90   C  CA  . ALA A 49  ? 1.7779 2.1954 1.7667 0.5904  0.2210  0.1795  49  ALA A CA  
91   C  C   . ALA A 49  ? 1.7734 2.1555 1.7445 0.5478  0.1851  0.1756  49  ALA A C   
92   O  O   . ALA A 49  ? 1.7595 2.1547 1.7584 0.5462  0.1589  0.1875  49  ALA A O   
93   C  CB  . ALA A 49  ? 1.7540 2.2525 1.7925 0.5760  0.2379  0.1947  49  ALA A CB  
94   N  N   . LEU A 50  ? 1.7026 2.0397 1.6260 0.5155  0.1836  0.1593  50  LEU A N   
95   C  CA  . LEU A 50  ? 1.6646 1.9672 1.5684 0.4767  0.1532  0.1544  50  LEU A CA  
96   C  C   . LEU A 50  ? 1.7275 1.9554 1.5853 0.4868  0.1391  0.1434  50  LEU A C   
97   O  O   . LEU A 50  ? 1.7097 1.9294 1.5717 0.4685  0.1119  0.1490  50  LEU A O   
98   C  CB  . LEU A 50  ? 1.6416 1.9246 1.5143 0.4413  0.1562  0.1422  50  LEU A CB  
99   C  CG  . LEU A 50  ? 1.6653 1.9246 1.5252 0.4000  0.1277  0.1387  50  LEU A CG  
100  C  CD1 . LEU A 50  ? 1.6322 1.9459 1.5478 0.3847  0.1033  0.1582  50  LEU A CD1 
101  C  CD2 . LEU A 50  ? 1.6827 1.9332 1.5203 0.3712  0.1339  0.1295  50  LEU A CD2 
102  N  N   . LEU A 51  ? 1.7142 1.8869 1.5274 0.5162  0.1576  0.1287  51  LEU A N   
103  C  CA  . LEU A 51  ? 1.7401 1.8369 1.5085 0.5269  0.1468  0.1195  51  LEU A CA  
104  C  C   . LEU A 51  ? 1.7810 1.9003 1.5849 0.5519  0.1323  0.1382  51  LEU A C   
105  O  O   . LEU A 51  ? 1.7750 1.8586 1.5620 0.5414  0.1095  0.1408  51  LEU A O   
106  C  CB  . LEU A 51  ? 1.7980 1.8285 1.5108 0.5522  0.1694  0.0988  51  LEU A CB  
107  C  CG  . LEU A 51  ? 1.8971 1.8370 1.5555 0.5533  0.1584  0.0867  51  LEU A CG  
108  C  CD1 . LEU A 51  ? 1.9194 1.7947 1.5184 0.5345  0.1658  0.0621  51  LEU A CD1 
109  C  CD2 . LEU A 51  ? 1.9874 1.9009 1.6408 0.6005  0.1668  0.0898  51  LEU A CD2 
110  N  N   . LEU A 52  ? 1.7353 1.9159 1.5885 0.5853  0.1458  0.1522  52  LEU A N   
111  C  CA  . LEU A 52  ? 1.7397 1.9516 1.6338 0.6132  0.1321  0.1718  52  LEU A CA  
112  C  C   . LEU A 52  ? 1.7260 1.9894 1.6646 0.5839  0.0998  0.1895  52  LEU A C   
113  O  O   . LEU A 52  ? 1.7413 1.9955 1.6846 0.5935  0.0770  0.2003  52  LEU A O   
114  C  CB  . LEU A 52  ? 1.7613 2.0308 1.7007 0.6581  0.1570  0.1822  52  LEU A CB  
115  C  CG  . LEU A 52  ? 1.8827 2.0937 1.7747 0.6986  0.1866  0.1652  52  LEU A CG  
116  C  CD1 . LEU A 52  ? 1.8953 2.1739 1.8311 0.7348  0.2180  0.1732  52  LEU A CD1 
117  C  CD2 . LEU A 52  ? 1.9683 2.1116 1.8283 0.7276  0.1755  0.1641  52  LEU A CD2 
118  N  N   . LEU A 53  ? 1.6085 1.9195 1.5739 0.5476  0.0965  0.1920  53  LEU A N   
119  C  CA  . LEU A 53  ? 1.5552 1.9093 1.5577 0.5158  0.0650  0.2057  53  LEU A CA  
120  C  C   . LEU A 53  ? 1.5938 1.8821 1.5453 0.4907  0.0397  0.1971  53  LEU A C   
121  O  O   . LEU A 53  ? 1.5730 1.8799 1.5430 0.4791  0.0103  0.2088  53  LEU A O   
122  C  CB  . LEU A 53  ? 1.5066 1.9162 1.5436 0.4834  0.0698  0.2089  53  LEU A CB  
123  C  CG  . LEU A 53  ? 1.5505 2.0546 1.6650 0.4969  0.0803  0.2292  53  LEU A CG  
124  C  CD1 . LEU A 53  ? 1.5231 2.0612 1.6527 0.4713  0.0980  0.2286  53  LEU A CD1 
125  C  CD2 . LEU A 53  ? 1.5618 2.1237 1.7350 0.4885  0.0468  0.2498  53  LEU A CD2 
126  N  N   . THR A 54  ? 1.5612 1.7736 1.4482 0.4826  0.0511  0.1769  54  THR A N   
127  C  CA  . THR A 54  ? 1.5603 1.7070 1.3960 0.4604  0.0333  0.1684  54  THR A CA  
128  C  C   . THR A 54  ? 1.6542 1.7512 1.4627 0.4890  0.0263  0.1727  54  THR A C   
129  O  O   . THR A 54  ? 1.6599 1.7239 1.4428 0.4751  0.0052  0.1757  54  THR A O   
130  C  CB  . THR A 54  ? 1.6309 1.7273 1.4184 0.4352  0.0465  0.1474  54  THR A CB  
131  O  OG1 . THR A 54  ? 1.6593 1.7295 1.4255 0.4586  0.0738  0.1354  54  THR A OG1 
132  C  CG2 . THR A 54  ? 1.5438 1.6806 1.3522 0.4003  0.0435  0.1459  54  THR A CG2 
133  N  N   . VAL A 55  ? 1.6388 1.7289 1.4508 0.5302  0.0445  0.1738  55  VAL A N   
134  C  CA  . VAL A 55  ? 1.6856 1.7283 1.4746 0.5617  0.0384  0.1800  55  VAL A CA  
135  C  C   . VAL A 55  ? 1.7231 1.8235 1.5605 0.5718  0.0124  0.2037  55  VAL A C   
136  O  O   . VAL A 55  ? 1.7367 1.8037 1.5508 0.5708  -0.0096 0.2116  55  VAL A O   
137  C  CB  . VAL A 55  ? 1.7840 1.7971 1.5598 0.6054  0.0651  0.1732  55  VAL A CB  
138  C  CG1 . VAL A 55  ? 1.8427 1.7910 1.5851 0.6335  0.0570  0.1787  55  VAL A CG1 
139  C  CG2 . VAL A 55  ? 1.7883 1.7549 1.5207 0.5941  0.0893  0.1488  55  VAL A CG2 
140  N  N   . LEU A 56  ? 1.6517 1.8405 1.5565 0.5785  0.0141  0.2154  56  LEU A N   
141  C  CA  . LEU A 56  ? 1.6383 1.8983 1.6022 0.5846  -0.0119 0.2381  56  LEU A CA  
142  C  C   . LEU A 56  ? 1.6687 1.9273 1.6218 0.5435  -0.0445 0.2405  56  LEU A C   
143  O  O   . LEU A 56  ? 1.6734 1.9490 1.6408 0.5489  -0.0735 0.2558  56  LEU A O   
144  C  CB  . LEU A 56  ? 1.6051 1.9604 1.6438 0.5908  0.0011  0.2479  56  LEU A CB  
145  C  CG  . LEU A 56  ? 1.6368 2.0808 1.7492 0.5870  -0.0267 0.2710  56  LEU A CG  
146  C  CD1 . LEU A 56  ? 1.6778 2.1459 1.8220 0.6340  -0.0337 0.2889  56  LEU A CD1 
147  C  CD2 . LEU A 56  ? 1.6192 2.1460 1.7946 0.5712  -0.0136 0.2768  56  LEU A CD2 
148  N  N   . ALA A 57  ? 1.5974 1.8338 1.5225 0.5043  -0.0400 0.2249  57  ALA A N   
149  C  CA  . ALA A 57  ? 1.5709 1.7973 1.4774 0.4650  -0.0659 0.2229  57  ALA A CA  
150  C  C   . ALA A 57  ? 1.6502 1.8067 1.4988 0.4678  -0.0813 0.2230  57  ALA A C   
151  O  O   . ALA A 57  ? 1.6472 1.8072 1.4889 0.4508  -0.1095 0.2296  57  ALA A O   
152  C  CB  . ALA A 57  ? 1.5462 1.7559 1.4312 0.4305  -0.0518 0.2052  57  ALA A CB  
153  N  N   . VAL A 58  ? 1.6353 1.7265 1.4404 0.4891  -0.0626 0.2161  58  VAL A N   
154  C  CA  . VAL A 58  ? 1.6733 1.6932 1.4225 0.4942  -0.0727 0.2185  58  VAL A CA  
155  C  C   . VAL A 58  ? 1.7485 1.7860 1.5179 0.5294  -0.0916 0.2399  58  VAL A C   
156  O  O   . VAL A 58  ? 1.7562 1.7818 1.5064 0.5235  -0.1179 0.2506  58  VAL A O   
157  C  CB  . VAL A 58  ? 1.7539 1.6947 1.4505 0.4991  -0.0468 0.2030  58  VAL A CB  
158  C  CG1 . VAL A 58  ? 1.8074 1.6747 1.4505 0.5070  -0.0554 0.2094  58  VAL A CG1 
159  C  CG2 . VAL A 58  ? 1.7141 1.6398 1.3904 0.4620  -0.0340 0.1836  58  VAL A CG2 
160  N  N   . ILE A 59  ? 1.7156 1.7844 1.5240 0.5671  -0.0783 0.2464  59  ILE A N   
161  C  CA  . ILE A 59  ? 1.7483 1.8415 1.5849 0.6067  -0.0935 0.2673  59  ILE A CA  
162  C  C   . ILE A 59  ? 1.7756 1.9394 1.6568 0.5946  -0.1292 0.2841  59  ILE A C   
163  O  O   . ILE A 59  ? 1.8047 1.9543 1.6705 0.6058  -0.1555 0.2987  59  ILE A O   
164  C  CB  . ILE A 59  ? 1.8016 1.9240 1.6777 0.6491  -0.0676 0.2688  59  ILE A CB  
165  C  CG1 . ILE A 59  ? 1.8387 1.8827 1.6630 0.6607  -0.0341 0.2492  59  ILE A CG1 
166  C  CG2 . ILE A 59  ? 1.8501 2.0030 1.7614 0.6938  -0.0830 0.2917  59  ILE A CG2 
167  C  CD1 . ILE A 59  ? 1.9876 1.9248 1.7360 0.6641  -0.0362 0.2454  59  ILE A CD1 
168  N  N   . LEU A 60  ? 1.6799 1.9155 1.6126 0.5704  -0.1312 0.2820  60  LEU A N   
169  C  CA  . LEU A 60  ? 1.6546 1.9590 1.6333 0.5531  -0.1659 0.2955  60  LEU A CA  
170  C  C   . LEU A 60  ? 1.7004 1.9665 1.6291 0.5145  -0.1906 0.2889  60  LEU A C   
171  O  O   . LEU A 60  ? 1.7078 1.9997 1.6468 0.5088  -0.2262 0.3011  60  LEU A O   
172  C  CB  . LEU A 60  ? 1.6040 1.9949 1.6564 0.5401  -0.1570 0.2966  60  LEU A CB  
173  C  CG  . LEU A 60  ? 1.6432 2.1182 1.7607 0.5252  -0.1917 0.3128  60  LEU A CG  
174  C  CD1 . LEU A 60  ? 1.6780 2.1994 1.8417 0.5652  -0.2099 0.3356  60  LEU A CD1 
175  C  CD2 . LEU A 60  ? 1.6271 2.1723 1.8062 0.5043  -0.1777 0.3118  60  LEU A CD2 
176  N  N   . GLY A 61  ? 1.6425 1.8474 1.5166 0.4905  -0.1719 0.2700  61  GLY A N   
177  C  CA  . GLY A 61  ? 1.6368 1.7997 1.4584 0.4562  -0.1878 0.2616  61  GLY A CA  
178  C  C   . GLY A 61  ? 1.7362 1.8443 1.5033 0.4680  -0.2064 0.2710  61  GLY A C   
179  O  O   . GLY A 61  ? 1.7412 1.8444 1.4840 0.4483  -0.2332 0.2732  61  GLY A O   
180  N  N   . VAL A 62  ? 1.7253 1.7881 1.4689 0.5010  -0.1918 0.2768  62  VAL A N   
181  C  CA  . VAL A 62  ? 1.7772 1.7833 1.4684 0.5172  -0.2064 0.2894  62  VAL A CA  
182  C  C   . VAL A 62  ? 1.8454 1.9052 1.5727 0.5375  -0.2427 0.3110  62  VAL A C   
183  O  O   . VAL A 62  ? 1.8730 1.9117 1.5626 0.5330  -0.2700 0.3205  62  VAL A O   
184  C  CB  . VAL A 62  ? 1.8661 1.8064 1.5258 0.5462  -0.1796 0.2891  62  VAL A CB  
185  C  CG1 . VAL A 62  ? 1.9339 1.8219 1.5485 0.5691  -0.1958 0.3075  62  VAL A CG1 
186  C  CG2 . VAL A 62  ? 1.8479 1.7307 1.4657 0.5211  -0.1504 0.2683  62  VAL A CG2 
187  N  N   . VAL A 63  ? 1.7803 1.9128 1.5816 0.5590  -0.2428 0.3189  63  VAL A N   
188  C  CA  . VAL A 63  ? 1.7891 1.9886 1.6426 0.5793  -0.2759 0.3399  63  VAL A CA  
189  C  C   . VAL A 63  ? 1.8231 2.0633 1.6866 0.5437  -0.3122 0.3400  63  VAL A C   
190  O  O   . VAL A 63  ? 1.8508 2.0908 1.6973 0.5491  -0.3476 0.3536  63  VAL A O   
191  C  CB  . VAL A 63  ? 1.8156 2.0870 1.7504 0.6082  -0.2600 0.3466  63  VAL A CB  
192  C  CG1 . VAL A 63  ? 1.8064 2.1708 1.8146 0.6158  -0.2950 0.3660  63  VAL A CG1 
193  C  CG2 . VAL A 63  ? 1.8586 2.0856 1.7777 0.6544  -0.2356 0.3514  63  VAL A CG2 
194  N  N   . LEU A 64  ? 1.7389 2.0079 1.6244 0.5076  -0.3039 0.3245  64  LEU A N   
195  C  CA  . LEU A 64  ? 1.7219 2.0230 1.6156 0.4701  -0.3348 0.3204  64  LEU A CA  
196  C  C   . LEU A 64  ? 1.8198 2.0543 1.6305 0.4531  -0.3548 0.3158  64  LEU A C   
197  O  O   . LEU A 64  ? 1.8340 2.0889 1.6421 0.4433  -0.3942 0.3225  64  LEU A O   
198  C  CB  . LEU A 64  ? 1.6636 1.9879 1.5838 0.4371  -0.3133 0.3031  64  LEU A CB  
199  C  CG  . LEU A 64  ? 1.7026 2.0451 1.6232 0.3946  -0.3392 0.2943  64  LEU A CG  
200  C  CD1 . LEU A 64  ? 1.6931 2.1246 1.6931 0.3896  -0.3704 0.3081  64  LEU A CD1 
201  C  CD2 . LEU A 64  ? 1.6883 2.0148 1.6006 0.3653  -0.3106 0.2746  64  LEU A CD2 
202  N  N   . GLY A 65  ? 1.7944 1.9519 1.5393 0.4499  -0.3275 0.3047  65  GLY A N   
203  C  CA  . GLY A 65  ? 1.8297 1.9200 1.4928 0.4353  -0.3367 0.3005  65  GLY A CA  
204  C  C   . GLY A 65  ? 1.9444 2.0136 1.5729 0.4595  -0.3652 0.3201  65  GLY A C   
205  O  O   . GLY A 65  ? 1.9628 2.0214 1.5525 0.4449  -0.3947 0.3213  65  GLY A O   
206  N  N   . PHE A 66  ? 1.9378 1.9994 1.5783 0.4983  -0.3572 0.3358  66  PHE A N   
207  C  CA  . PHE A 66  ? 2.0065 2.0470 1.6171 0.5275  -0.3832 0.3579  66  PHE A CA  
208  C  C   . PHE A 66  ? 2.0713 2.1848 1.7295 0.5335  -0.4292 0.3720  66  PHE A C   
209  O  O   . PHE A 66  ? 2.1204 2.2179 1.7423 0.5465  -0.4608 0.3876  66  PHE A O   
210  C  CB  . PHE A 66  ? 2.0608 2.0692 1.6725 0.5685  -0.3604 0.3699  66  PHE A CB  
211  C  CG  . PHE A 66  ? 2.1067 2.0223 1.6477 0.5659  -0.3281 0.3634  66  PHE A CG  
212  C  CD1 . PHE A 66  ? 2.1865 2.0396 1.6486 0.5508  -0.3354 0.3661  66  PHE A CD1 
213  C  CD2 . PHE A 66  ? 2.1259 2.0160 1.6786 0.5795  -0.2909 0.3557  66  PHE A CD2 
214  C  CE1 . PHE A 66  ? 2.2250 1.9966 1.6277 0.5461  -0.3051 0.3622  66  PHE A CE1 
215  C  CE2 . PHE A 66  ? 2.1915 1.9959 1.6820 0.5743  -0.2637 0.3500  66  PHE A CE2 
216  C  CZ  . PHE A 66  ? 2.2039 1.9518 1.6231 0.5567  -0.2709 0.3543  66  PHE A CZ  
217  N  N   . LEU A 67  ? 1.9809 2.1745 1.7199 0.5229  -0.4333 0.3674  67  LEU A N   
218  C  CA  . LEU A 67  ? 1.9782 2.2521 1.7770 0.5217  -0.4762 0.3791  67  LEU A CA  
219  C  C   . LEU A 67  ? 2.0400 2.3050 1.7984 0.4828  -0.5088 0.3683  67  LEU A C   
220  O  O   . LEU A 67  ? 2.0768 2.3623 1.8304 0.4859  -0.5533 0.3802  67  LEU A O   
221  C  CB  . LEU A 67  ? 1.9166 2.2740 1.8135 0.5184  -0.4620 0.3768  67  LEU A CB  
222  C  CG  . LEU A 67  ? 1.9701 2.4246 1.9519 0.5239  -0.4998 0.3935  67  LEU A CG  
223  C  CD1 . LEU A 67  ? 1.9963 2.4850 2.0255 0.5748  -0.4968 0.4160  67  LEU A CD1 
224  C  CD2 . LEU A 67  ? 1.9319 2.4557 1.9874 0.4938  -0.4915 0.3843  67  LEU A CD2 
225  N  N   . LEU A 68  ? 1.9616 2.1930 1.6876 0.4481  -0.4869 0.3456  68  LEU A N   
226  C  CA  . LEU A 68  ? 1.9656 2.1809 1.6495 0.4112  -0.5106 0.3310  68  LEU A CA  
227  C  C   . LEU A 68  ? 2.0838 2.2141 1.6622 0.4087  -0.5118 0.3274  68  LEU A C   
228  O  O   . LEU A 68  ? 2.0967 2.2122 1.6331 0.3842  -0.5364 0.3173  68  LEU A O   
229  C  CB  . LEU A 68  ? 1.9022 2.1305 1.6120 0.3771  -0.4866 0.3095  68  LEU A CB  
230  C  CG  . LEU A 68  ? 1.9235 2.2346 1.7173 0.3577  -0.5084 0.3096  68  LEU A CG  
231  C  CD1 . LEU A 68  ? 1.8805 2.2487 1.7574 0.3746  -0.4806 0.3176  68  LEU A CD1 
232  C  CD2 . LEU A 68  ? 1.9264 2.2252 1.7048 0.3157  -0.5077 0.2876  68  LEU A CD2 
233  N  N   . ARG A 69  ? 2.0845 2.1581 1.6193 0.4335  -0.4850 0.3358  69  ARG A N   
234  C  CA  . ARG A 69  ? 2.1445 2.1365 1.5813 0.4328  -0.4789 0.3359  69  ARG A CA  
235  C  C   . ARG A 69  ? 2.2889 2.2685 1.6720 0.4372  -0.5243 0.3475  69  ARG A C   
236  O  O   . ARG A 69  ? 2.3117 2.2431 1.6213 0.4182  -0.5252 0.3372  69  ARG A O   
237  C  CB  . ARG A 69  ? 2.1662 2.1043 1.5769 0.4596  -0.4443 0.3465  69  ARG A CB  
238  C  CG  . ARG A 69  ? 2.3208 2.1789 1.6479 0.4447  -0.4171 0.3383  69  ARG A CG  
239  C  CD  . ARG A 69  ? 2.5076 2.3030 1.7888 0.4717  -0.4001 0.3564  69  ARG A CD  
240  N  NE  . ARG A 69  ? 2.6725 2.3985 1.8649 0.4580  -0.3896 0.3560  69  ARG A NE  
241  C  CZ  . ARG A 69  ? 2.8426 2.5211 2.0050 0.4417  -0.3507 0.3455  69  ARG A CZ  
242  N  NH1 . ARG A 69  ? 2.6438 2.3316 1.8531 0.4372  -0.3203 0.3333  69  ARG A NH1 
243  N  NH2 . ARG A 69  ? 2.6995 2.3221 1.7848 0.4301  -0.3420 0.3478  69  ARG A NH2 
244  N  N   . PRO A 70  ? 2.2992 2.3188 1.7122 0.4624  -0.5618 0.3683  70  PRO A N   
245  C  CA  . PRO A 70  ? 2.3780 2.3797 1.7301 0.4662  -0.6061 0.3787  70  PRO A CA  
246  C  C   . PRO A 70  ? 2.4535 2.4739 1.7908 0.4322  -0.6407 0.3615  70  PRO A C   
247  O  O   . PRO A 70  ? 2.5137 2.4961 1.7737 0.4294  -0.6672 0.3630  70  PRO A O   
248  C  CB  . PRO A 70  ? 2.4233 2.4747 1.8281 0.5016  -0.6366 0.4045  70  PRO A CB  
249  C  CG  . PRO A 70  ? 2.4034 2.5259 1.9142 0.5033  -0.6206 0.4014  70  PRO A CG  
250  C  CD  . PRO A 70  ? 2.2994 2.3810 1.7991 0.4911  -0.5653 0.3843  70  PRO A CD  
251  N  N   . TYR A 71  ? 2.3629 2.4383 1.7708 0.4069  -0.6401 0.3456  71  TYR A N   
252  C  CA  . TYR A 71  ? 2.3644 2.4615 1.7733 0.3718  -0.6713 0.3273  71  TYR A CA  
253  C  C   . TYR A 71  ? 2.4469 2.4717 1.7629 0.3481  -0.6559 0.3056  71  TYR A C   
254  O  O   . TYR A 71  ? 2.4376 2.4096 1.7118 0.3541  -0.6123 0.3033  71  TYR A O   
255  C  CB  . TYR A 71  ? 2.3043 2.4714 1.8145 0.3525  -0.6628 0.3183  71  TYR A CB  
256  C  CG  . TYR A 71  ? 2.3151 2.5635 1.9213 0.3735  -0.6814 0.3392  71  TYR A CG  
257  C  CD1 . TYR A 71  ? 2.3161 2.5777 1.9640 0.4050  -0.6478 0.3534  71  TYR A CD1 
258  C  CD2 . TYR A 71  ? 2.3408 2.6536 1.9971 0.3621  -0.7328 0.3446  71  TYR A CD2 
259  C  CE1 . TYR A 71  ? 2.3196 2.6577 2.0561 0.4281  -0.6625 0.3731  71  TYR A CE1 
260  C  CE2 . TYR A 71  ? 2.3404 2.7349 2.0909 0.3823  -0.7491 0.3656  71  TYR A CE2 
261  C  CZ  . TYR A 71  ? 2.4262 2.8342 2.2169 0.4168  -0.7124 0.3800  71  TYR A CZ  
262  O  OH  . TYR A 71  ? 2.4428 2.9333 2.3273 0.4401  -0.7257 0.4009  71  TYR A OH  
263  N  N   . PRO A 72  ? 2.4364 2.4567 1.7193 0.3217  -0.6899 0.2894  72  PRO A N   
264  C  CA  . PRO A 72  ? 2.4566 2.4085 1.6509 0.3031  -0.6723 0.2684  72  PRO A CA  
265  C  C   . PRO A 72  ? 2.4253 2.3587 1.6333 0.2899  -0.6176 0.2531  72  PRO A C   
266  O  O   . PRO A 72  ? 2.3577 2.3270 1.6262 0.2683  -0.6111 0.2394  72  PRO A O   
267  C  CB  . PRO A 72  ? 2.5089 2.4740 1.6923 0.2761  -0.7191 0.2515  72  PRO A CB  
268  C  CG  . PRO A 72  ? 2.5305 2.5796 1.8188 0.2716  -0.7505 0.2605  72  PRO A CG  
269  C  CD  . PRO A 72  ? 2.4742 2.5493 1.7974 0.3077  -0.7461 0.2888  72  PRO A CD  
270  N  N   . LEU A 73  ? 2.3874 2.2643 1.5384 0.3033  -0.5789 0.2574  73  LEU A N   
271  C  CA  . LEU A 73  ? 2.3274 2.1795 1.4818 0.2955  -0.5256 0.2467  73  LEU A CA  
272  C  C   . LEU A 73  ? 2.3551 2.1749 1.4658 0.2682  -0.5122 0.2208  73  LEU A C   
273  O  O   . LEU A 73  ? 2.3447 2.1227 1.4194 0.2665  -0.4717 0.2154  73  LEU A O   
274  C  CB  . LEU A 73  ? 2.3549 2.1575 1.4640 0.3192  -0.4937 0.2635  73  LEU A CB  
275  C  CG  . LEU A 73  ? 2.4154 2.2372 1.5626 0.3502  -0.4977 0.2888  73  LEU A CG  
276  C  CD1 . LEU A 73  ? 2.5002 2.3010 1.5907 0.3712  -0.5323 0.3088  73  LEU A CD1 
277  C  CD2 . LEU A 73  ? 2.4179 2.2032 1.5605 0.3615  -0.4504 0.2949  73  LEU A CD2 
278  N  N   . SER A 74  ? 2.2986 2.1380 1.4160 0.2470  -0.5458 0.2051  74  SER A N   
279  C  CA  . SER A 74  ? 2.2917 2.0995 1.3678 0.2233  -0.5376 0.1796  74  SER A CA  
280  C  C   . SER A 74  ? 2.2804 2.0822 1.3836 0.2137  -0.4880 0.1688  74  SER A C   
281  O  O   . SER A 74  ? 2.2160 2.0613 1.3982 0.2114  -0.4760 0.1723  74  SER A O   
282  C  CB  . SER A 74  ? 2.3237 2.1613 1.4261 0.2009  -0.5808 0.1655  74  SER A CB  
283  O  OG  . SER A 74  ? 2.3848 2.1924 1.4569 0.1790  -0.5705 0.1402  74  SER A OG  
284  N  N   . PRO A 75  ? 2.2541 2.0043 1.2930 0.2096  -0.4581 0.1570  75  PRO A N   
285  C  CA  . PRO A 75  ? 2.1917 1.9377 1.2569 0.2012  -0.4122 0.1479  75  PRO A CA  
286  C  C   . PRO A 75  ? 2.1741 1.9565 1.3046 0.1798  -0.4139 0.1323  75  PRO A C   
287  O  O   . PRO A 75  ? 2.1027 1.9073 1.2882 0.1779  -0.3862 0.1336  75  PRO A O   
288  C  CB  . PRO A 75  ? 2.2568 1.9459 1.2384 0.2003  -0.3888 0.1381  75  PRO A CB  
289  C  CG  . PRO A 75  ? 2.3889 2.0554 1.3046 0.2011  -0.4265 0.1334  75  PRO A CG  
290  C  CD  . PRO A 75  ? 2.3512 2.0470 1.2909 0.2137  -0.4635 0.1524  75  PRO A CD  
291  N  N   . ARG A 76  ? 2.1504 1.9367 1.2731 0.1636  -0.4479 0.1184  76  ARG A N   
292  C  CA  . ARG A 76  ? 2.0998 1.9164 1.2798 0.1409  -0.4556 0.1050  76  ARG A CA  
293  C  C   . ARG A 76  ? 2.0926 1.9738 1.3633 0.1413  -0.4686 0.1201  76  ARG A C   
294  O  O   . ARG A 76  ? 2.0307 1.9417 1.3623 0.1299  -0.4520 0.1171  76  ARG A O   
295  C  CB  . ARG A 76  ? 2.1589 1.9551 1.2993 0.1242  -0.4929 0.0873  76  ARG A CB  
296  C  CG  . ARG A 76  ? 2.2732 2.0773 1.4499 0.0996  -0.4917 0.0695  76  ARG A CG  
297  C  CD  . ARG A 76  ? 2.4879 2.2558 1.6116 0.0842  -0.5241 0.0487  76  ARG A CD  
298  N  NE  . ARG A 76  ? 2.6423 2.3550 1.7006 0.0854  -0.4959 0.0298  76  ARG A NE  
299  C  CZ  . ARG A 76  ? 2.7687 2.4731 1.8458 0.0725  -0.4755 0.0154  76  ARG A CZ  
300  N  NH1 . ARG A 76  ? 2.5890 2.2455 1.6059 0.0774  -0.4504 -0.0005 76  ARG A NH1 
301  N  NH2 . ARG A 76  ? 2.5516 2.2967 1.7078 0.0557  -0.4790 0.0180  76  ARG A NH2 
302  N  N   . GLU A 77  ? 2.0674 1.9705 1.3457 0.1563  -0.4966 0.1376  77  GLU A N   
303  C  CA  . GLU A 77  ? 2.0239 1.9919 1.3870 0.1620  -0.5099 0.1548  77  GLU A CA  
304  C  C   . GLU A 77  ? 2.0008 1.9826 1.4025 0.1797  -0.4683 0.1666  77  GLU A C   
305  O  O   . GLU A 77  ? 1.9424 1.9757 1.4210 0.1776  -0.4622 0.1727  77  GLU A O   
306  C  CB  . GLU A 77  ? 2.0961 2.0799 1.4497 0.1763  -0.5525 0.1704  77  GLU A CB  
307  C  CG  . GLU A 77  ? 2.2768 2.2718 1.6258 0.1555  -0.6034 0.1612  77  GLU A CG  
308  C  CD  . GLU A 77  ? 2.6323 2.6318 1.9528 0.1694  -0.6483 0.1742  77  GLU A CD  
309  O  OE1 . GLU A 77  ? 2.5953 2.6303 1.9540 0.1924  -0.6519 0.1966  77  GLU A OE1 
310  O  OE2 . GLU A 77  ? 2.6320 2.5979 1.8895 0.1586  -0.6808 0.1615  77  GLU A OE2 
311  N  N   . VAL A 78  ? 1.9641 1.8990 1.3111 0.1967  -0.4401 0.1701  78  VAL A N   
312  C  CA  . VAL A 78  ? 1.9229 1.8575 1.2936 0.2129  -0.4010 0.1790  78  VAL A CA  
313  C  C   . VAL A 78  ? 1.9161 1.8587 1.3209 0.1955  -0.3698 0.1645  78  VAL A C   
314  O  O   . VAL A 78  ? 1.8654 1.8407 1.3280 0.2012  -0.3515 0.1699  78  VAL A O   
315  C  CB  . VAL A 78  ? 2.0126 1.8900 1.3127 0.2306  -0.3813 0.1864  78  VAL A CB  
316  C  CG1 . VAL A 78  ? 1.9757 1.8423 1.2943 0.2409  -0.3392 0.1904  78  VAL A CG1 
317  C  CG2 . VAL A 78  ? 2.0680 1.9431 1.3441 0.2522  -0.4111 0.2054  78  VAL A CG2 
318  N  N   . LYS A 79  ? 1.8778 1.7911 1.2456 0.1757  -0.3658 0.1461  79  LYS A N   
319  C  CA  . LYS A 79  ? 1.8269 1.7428 1.2184 0.1582  -0.3407 0.1315  79  LYS A CA  
320  C  C   . LYS A 79  ? 1.8317 1.8042 1.3004 0.1453  -0.3535 0.1325  79  LYS A C   
321  O  O   . LYS A 79  ? 1.7772 1.7687 1.2877 0.1417  -0.3278 0.1310  79  LYS A O   
322  C  CB  . LYS A 79  ? 1.8872 1.7614 1.2216 0.1426  -0.3416 0.1127  79  LYS A CB  
323  C  CG  . LYS A 79  ? 2.1234 1.9460 1.3920 0.1514  -0.3133 0.1098  79  LYS A CG  
324  C  CD  . LYS A 79  ? 2.2882 2.0752 1.5075 0.1381  -0.3094 0.0903  79  LYS A CD  
325  C  CE  . LYS A 79  ? 2.4649 2.2217 1.6178 0.1400  -0.3381 0.0860  79  LYS A CE  
326  N  NZ  . LYS A 79  ? 2.5657 2.2893 1.6750 0.1284  -0.3344 0.0649  79  LYS A NZ  
327  N  N   . TYR A 80  ? 1.8082 1.8077 1.2946 0.1377  -0.3938 0.1359  80  TYR A N   
328  C  CA  . TYR A 80  ? 1.7723 1.8289 1.3339 0.1228  -0.4105 0.1398  80  TYR A CA  
329  C  C   . TYR A 80  ? 1.7785 1.8864 1.4050 0.1413  -0.3992 0.1586  80  TYR A C   
330  O  O   . TYR A 80  ? 1.7249 1.8738 1.4130 0.1336  -0.3862 0.1614  80  TYR A O   
331  C  CB  . TYR A 80  ? 1.8311 1.9008 1.3916 0.1090  -0.4602 0.1391  80  TYR A CB  
332  C  CG  . TYR A 80  ? 1.8933 1.9147 1.3944 0.0889  -0.4757 0.1182  80  TYR A CG  
333  C  CD1 . TYR A 80  ? 1.9038 1.8860 1.3747 0.0804  -0.4458 0.1019  80  TYR A CD1 
334  C  CD2 . TYR A 80  ? 1.9602 1.9753 1.4361 0.0792  -0.5215 0.1143  80  TYR A CD2 
335  C  CE1 . TYR A 80  ? 1.9565 1.8925 1.3718 0.0656  -0.4583 0.0822  80  TYR A CE1 
336  C  CE2 . TYR A 80  ? 2.0168 1.9825 1.4333 0.0626  -0.5357 0.0931  80  TYR A CE2 
337  C  CZ  . TYR A 80  ? 2.1058 2.0320 1.4931 0.0567  -0.5028 0.0771  80  TYR A CZ  
338  O  OH  . TYR A 80  ? 2.1809 2.0567 1.5087 0.0438  -0.5150 0.0557  80  TYR A OH  
339  N  N   . PHE A 81  ? 1.7597 1.8635 1.3698 0.1672  -0.4038 0.1721  81  PHE A N   
340  C  CA  . PHE A 81  ? 1.7381 1.8832 1.4008 0.1913  -0.3937 0.1901  81  PHE A CA  
341  C  C   . PHE A 81  ? 1.7262 1.8605 1.3985 0.1996  -0.3476 0.1869  81  PHE A C   
342  O  O   . PHE A 81  ? 1.6843 1.8643 1.4182 0.2061  -0.3341 0.1943  81  PHE A O   
343  C  CB  . PHE A 81  ? 1.8158 1.9454 1.4455 0.2180  -0.4101 0.2043  81  PHE A CB  
344  C  CG  . PHE A 81  ? 1.8318 1.9880 1.5021 0.2486  -0.3938 0.2215  81  PHE A CG  
345  C  CD1 . PHE A 81  ? 1.8653 2.0913 1.6109 0.2578  -0.4110 0.2365  81  PHE A CD1 
346  C  CD2 . PHE A 81  ? 1.8718 1.9828 1.5061 0.2683  -0.3610 0.2226  81  PHE A CD2 
347  C  CE1 . PHE A 81  ? 1.8749 2.1243 1.6568 0.2896  -0.3938 0.2514  81  PHE A CE1 
348  C  CE2 . PHE A 81  ? 1.9087 2.0377 1.5767 0.2979  -0.3459 0.2366  81  PHE A CE2 
349  C  CZ  . PHE A 81  ? 1.8748 2.0722 1.6149 0.3102  -0.3617 0.2505  81  PHE A CZ  
350  N  N   . ALA A 82  ? 1.6776 1.7527 1.2889 0.1996  -0.3240 0.1761  82  ALA A N   
351  C  CA  . ALA A 82  ? 1.6378 1.6951 1.2497 0.2054  -0.2831 0.1712  82  ALA A CA  
352  C  C   . ALA A 82  ? 1.6240 1.6941 1.2615 0.1829  -0.2666 0.1581  82  ALA A C   
353  O  O   . ALA A 82  ? 1.5944 1.6584 1.2404 0.1872  -0.2354 0.1545  82  ALA A O   
354  C  CB  . ALA A 82  ? 1.6769 1.6700 1.2186 0.2120  -0.2662 0.1669  82  ALA A CB  
355  N  N   . PHE A 83  ? 1.5605 1.6467 1.2099 0.1592  -0.2886 0.1515  83  PHE A N   
356  C  CA  . PHE A 83  ? 1.5154 1.6103 1.1866 0.1368  -0.2769 0.1405  83  PHE A CA  
357  C  C   . PHE A 83  ? 1.5118 1.6445 1.2381 0.1415  -0.2508 0.1460  83  PHE A C   
358  O  O   . PHE A 83  ? 1.4821 1.5960 1.1980 0.1339  -0.2261 0.1359  83  PHE A O   
359  C  CB  . PHE A 83  ? 1.5469 1.6590 1.2333 0.1126  -0.3092 0.1366  83  PHE A CB  
360  C  CG  . PHE A 83  ? 1.5391 1.6490 1.2385 0.0897  -0.2976 0.1255  83  PHE A CG  
361  C  CD1 . PHE A 83  ? 1.5865 1.6461 1.2344 0.0818  -0.2843 0.1091  83  PHE A CD1 
362  C  CD2 . PHE A 83  ? 1.5370 1.6963 1.3012 0.0773  -0.2986 0.1331  83  PHE A CD2 
363  C  CE1 . PHE A 83  ? 1.5757 1.6320 1.2355 0.0633  -0.2744 0.1000  83  PHE A CE1 
364  C  CE2 . PHE A 83  ? 1.5523 1.7059 1.3256 0.0567  -0.2881 0.1248  83  PHE A CE2 
365  C  CZ  . PHE A 83  ? 1.5345 1.6355 1.2551 0.0507  -0.2768 0.1081  83  PHE A CZ  
366  N  N   . PRO A 84  ? 1.4561 1.6408 1.2383 0.1551  -0.2532 0.1614  84  PRO A N   
367  C  CA  . PRO A 84  ? 1.4164 1.6309 1.2407 0.1611  -0.2237 0.1648  84  PRO A CA  
368  C  C   . PRO A 84  ? 1.4598 1.6340 1.2490 0.1773  -0.1905 0.1578  84  PRO A C   
369  O  O   . PRO A 84  ? 1.4278 1.6115 1.2344 0.1777  -0.1651 0.1549  84  PRO A O   
370  C  CB  . PRO A 84  ? 1.4399 1.7153 1.3246 0.1775  -0.2335 0.1835  84  PRO A CB  
371  C  CG  . PRO A 84  ? 1.5265 1.8144 1.4138 0.1690  -0.2743 0.1890  84  PRO A CG  
372  C  CD  . PRO A 84  ? 1.5010 1.7223 1.3118 0.1671  -0.2816 0.1767  84  PRO A CD  
373  N  N   . GLY A 85  ? 1.4472 1.5753 1.1855 0.1890  -0.1919 0.1554  85  GLY A N   
374  C  CA  . GLY A 85  ? 1.4526 1.5350 1.1525 0.2002  -0.1645 0.1485  85  GLY A CA  
375  C  C   . GLY A 85  ? 1.4970 1.5405 1.1578 0.1795  -0.1547 0.1328  85  GLY A C   
376  O  O   . GLY A 85  ? 1.4849 1.5043 1.1304 0.1803  -0.1298 0.1249  85  GLY A O   
377  N  N   . GLU A 86  ? 1.4588 1.4961 1.1030 0.1615  -0.1755 0.1278  86  GLU A N   
378  C  CA  . GLU A 86  ? 1.4527 1.4570 1.0620 0.1430  -0.1693 0.1132  86  GLU A CA  
379  C  C   . GLU A 86  ? 1.4589 1.4849 1.1008 0.1285  -0.1571 0.1071  86  GLU A C   
380  O  O   . GLU A 86  ? 1.4433 1.4449 1.0650 0.1212  -0.1392 0.0965  86  GLU A O   
381  C  CB  . GLU A 86  ? 1.5003 1.4925 1.0829 0.1315  -0.1973 0.1097  86  GLU A CB  
382  C  CG  . GLU A 86  ? 1.6475 1.6003 1.1857 0.1179  -0.1907 0.0947  86  GLU A CG  
383  C  CD  . GLU A 86  ? 1.9411 1.8852 1.4587 0.1046  -0.2185 0.0881  86  GLU A CD  
384  O  OE1 . GLU A 86  ? 1.7021 1.6368 1.2161 0.0891  -0.2166 0.0763  86  GLU A OE1 
385  O  OE2 . GLU A 86  ? 1.9511 1.8952 1.4541 0.1101  -0.2433 0.0942  86  GLU A OE2 
386  N  N   . LEU A 87  ? 1.3926 1.4660 1.0860 0.1245  -0.1664 0.1153  87  LEU A N   
387  C  CA  . LEU A 87  ? 1.3569 1.4534 1.0827 0.1115  -0.1545 0.1133  87  LEU A CA  
388  C  C   . LEU A 87  ? 1.3808 1.4752 1.1096 0.1235  -0.1238 0.1117  87  LEU A C   
389  O  O   . LEU A 87  ? 1.3590 1.4477 1.0865 0.1130  -0.1097 0.1045  87  LEU A O   
390  C  CB  . LEU A 87  ? 1.3497 1.4999 1.1321 0.1039  -0.1703 0.1255  87  LEU A CB  
391  C  CG  . LEU A 87  ? 1.4198 1.5723 1.2081 0.0785  -0.1957 0.1225  87  LEU A CG  
392  C  CD1 . LEU A 87  ? 1.4160 1.6261 1.2677 0.0696  -0.2089 0.1372  87  LEU A CD1 
393  C  CD2 . LEU A 87  ? 1.4388 1.5640 1.2081 0.0621  -0.1840 0.1103  87  LEU A CD2 
394  N  N   . LEU A 88  ? 1.3408 1.4363 1.0705 0.1462  -0.1146 0.1180  88  LEU A N   
395  C  CA  . LEU A 88  ? 1.3293 1.4150 1.0546 0.1593  -0.0872 0.1145  88  LEU A CA  
396  C  C   . LEU A 88  ? 1.3802 1.4154 1.0584 0.1530  -0.0756 0.1010  88  LEU A C   
397  O  O   . LEU A 88  ? 1.3662 1.3940 1.0406 0.1488  -0.0579 0.0932  88  LEU A O   
398  C  CB  . LEU A 88  ? 1.3483 1.4407 1.0826 0.1868  -0.0822 0.1237  88  LEU A CB  
399  C  CG  . LEU A 88  ? 1.4079 1.4838 1.1328 0.2030  -0.0552 0.1186  88  LEU A CG  
400  C  CD1 . LEU A 88  ? 1.3855 1.4986 1.1437 0.2017  -0.0399 0.1194  88  LEU A CD1 
401  C  CD2 . LEU A 88  ? 1.4652 1.5334 1.1882 0.2311  -0.0531 0.1263  88  LEU A CD2 
402  N  N   . MET A 89  ? 1.3529 1.3562 0.9961 0.1518  -0.0860 0.0993  89  MET A N   
403  C  CA  . MET A 89  ? 1.3588 1.3184 0.9602 0.1450  -0.0756 0.0890  89  MET A CA  
404  C  C   . MET A 89  ? 1.3664 1.3260 0.9673 0.1256  -0.0718 0.0786  89  MET A C   
405  O  O   . MET A 89  ? 1.3484 1.2900 0.9366 0.1219  -0.0552 0.0705  89  MET A O   
406  C  CB  . MET A 89  ? 1.4250 1.3572 0.9907 0.1469  -0.0888 0.0919  89  MET A CB  
407  C  CG  . MET A 89  ? 1.5053 1.4194 1.0570 0.1667  -0.0865 0.1011  89  MET A CG  
408  S  SD  . MET A 89  ? 1.5753 1.4432 1.0958 0.1685  -0.0605 0.0950  89  MET A SD  
409  C  CE  . MET A 89  ? 1.5841 1.4129 1.0595 0.1762  -0.0680 0.1048  89  MET A CE  
410  N  N   . ARG A 90  ? 1.3070 1.2863 0.9232 0.1133  -0.0885 0.0791  90  ARG A N   
411  C  CA  . ARG A 90  ? 1.2845 1.2627 0.9018 0.0962  -0.0877 0.0706  90  ARG A CA  
412  C  C   . ARG A 90  ? 1.3151 1.3120 0.9571 0.0949  -0.0710 0.0701  90  ARG A C   
413  O  O   . ARG A 90  ? 1.3140 1.2969 0.9446 0.0876  -0.0605 0.0617  90  ARG A O   
414  C  CB  . ARG A 90  ? 1.2703 1.2641 0.9018 0.0838  -0.1111 0.0727  90  ARG A CB  
415  C  CG  . ARG A 90  ? 1.3720 1.3463 0.9743 0.0834  -0.1316 0.0714  90  ARG A CG  
416  C  CD  . ARG A 90  ? 1.5135 1.4538 1.0785 0.0740  -0.1327 0.0586  90  ARG A CD  
417  N  NE  . ARG A 90  ? 1.6268 1.5718 1.2043 0.0581  -0.1461 0.0539  90  ARG A NE  
418  C  CZ  . ARG A 90  ? 1.9053 1.8219 1.4552 0.0509  -0.1466 0.0421  90  ARG A CZ  
419  N  NH1 . ARG A 90  ? 1.8239 1.7115 1.3355 0.0579  -0.1328 0.0345  90  ARG A NH1 
420  N  NH2 . ARG A 90  ? 1.7667 1.6834 1.3281 0.0370  -0.1599 0.0384  90  ARG A NH2 
421  N  N   . MET A 91  ? 1.2479 1.2774 0.9227 0.1033  -0.0683 0.0797  91  MET A N   
422  C  CA  . MET A 91  ? 1.2204 1.2695 0.9155 0.1048  -0.0517 0.0809  91  MET A CA  
423  C  C   . MET A 91  ? 1.2782 1.3006 0.9479 0.1128  -0.0326 0.0719  91  MET A C   
424  O  O   . MET A 91  ? 1.2613 1.2822 0.9288 0.1066  -0.0221 0.0664  91  MET A O   
425  C  CB  . MET A 91  ? 1.2435 1.3328 0.9758 0.1168  -0.0503 0.0938  91  MET A CB  
426  C  CG  . MET A 91  ? 1.2756 1.4018 1.0453 0.1043  -0.0659 0.1042  91  MET A CG  
427  S  SD  . MET A 91  ? 1.3305 1.5051 1.1447 0.1212  -0.0705 0.1211  91  MET A SD  
428  C  CE  . MET A 91  ? 1.2752 1.4813 1.1149 0.1301  -0.0426 0.1269  91  MET A CE  
429  N  N   . LEU A 92  ? 1.2616 1.2619 0.9122 0.1259  -0.0296 0.0712  92  LEU A N   
430  C  CA  . LEU A 92  ? 1.2762 1.2462 0.9023 0.1324  -0.0140 0.0631  92  LEU A CA  
431  C  C   . LEU A 92  ? 1.3452 1.2872 0.9460 0.1183  -0.0121 0.0532  92  LEU A C   
432  O  O   . LEU A 92  ? 1.3435 1.2745 0.9360 0.1150  -0.0009 0.0452  92  LEU A O   
433  C  CB  . LEU A 92  ? 1.3052 1.2564 0.9191 0.1501  -0.0129 0.0675  92  LEU A CB  
434  C  CG  . LEU A 92  ? 1.3751 1.3477 1.0104 0.1706  -0.0068 0.0747  92  LEU A CG  
435  C  CD1 . LEU A 92  ? 1.4048 1.3657 1.0342 0.1878  -0.0139 0.0832  92  LEU A CD1 
436  C  CD2 . LEU A 92  ? 1.4226 1.3802 1.0469 0.1785  0.0119  0.0659  92  LEU A CD2 
437  N  N   . LYS A 93  ? 1.3201 1.2514 0.9079 0.1108  -0.0231 0.0535  93  LYS A N   
438  C  CA  . LYS A 93  ? 1.3237 1.2326 0.8897 0.0992  -0.0199 0.0454  93  LYS A CA  
439  C  C   . LYS A 93  ? 1.3640 1.2860 0.9420 0.0882  -0.0171 0.0393  93  LYS A C   
440  O  O   . LYS A 93  ? 1.3514 1.2618 0.9207 0.0827  -0.0080 0.0321  93  LYS A O   
441  C  CB  . LYS A 93  ? 1.3628 1.2617 0.9118 0.0960  -0.0323 0.0473  93  LYS A CB  
442  C  CG  . LYS A 93  ? 1.4604 1.3344 0.9836 0.1044  -0.0320 0.0523  93  LYS A CG  
443  C  CD  . LYS A 93  ? 1.6102 1.4817 1.1186 0.1052  -0.0493 0.0566  93  LYS A CD  
444  C  CE  . LYS A 93  ? 1.7628 1.6144 1.2421 0.0970  -0.0481 0.0501  93  LYS A CE  
445  N  NZ  . LYS A 93  ? 1.8213 1.6674 1.2805 0.0984  -0.0669 0.0524  93  LYS A NZ  
446  N  N   . MET A 94  ? 1.3253 1.2721 0.9252 0.0847  -0.0259 0.0435  94  MET A N   
447  C  CA  . MET A 94  ? 1.3185 1.2783 0.9315 0.0750  -0.0257 0.0413  94  MET A CA  
448  C  C   . MET A 94  ? 1.3581 1.3187 0.9710 0.0762  -0.0119 0.0368  94  MET A C   
449  O  O   . MET A 94  ? 1.3565 1.3111 0.9640 0.0689  -0.0096 0.0308  94  MET A O   
450  C  CB  . MET A 94  ? 1.3479 1.3362 0.9886 0.0728  -0.0351 0.0509  94  MET A CB  
451  C  CG  . MET A 94  ? 1.3917 1.3927 1.0468 0.0628  -0.0348 0.0522  94  MET A CG  
452  S  SD  . MET A 94  ? 1.4557 1.4897 1.1464 0.0562  -0.0471 0.0660  94  MET A SD  
453  C  CE  . MET A 94  ? 1.4140 1.4774 1.1245 0.0718  -0.0315 0.0749  94  MET A CE  
454  N  N   . LEU A 95  ? 1.2976 1.2648 0.9149 0.0867  -0.0038 0.0394  95  LEU A N   
455  C  CA  . LEU A 95  ? 1.2863 1.2519 0.8985 0.0897  0.0080  0.0343  95  LEU A CA  
456  C  C   . LEU A 95  ? 1.3340 1.2710 0.9237 0.0887  0.0140  0.0242  95  LEU A C   
457  O  O   . LEU A 95  ? 1.3306 1.2642 0.9135 0.0878  0.0200  0.0179  95  LEU A O   
458  C  CB  . LEU A 95  ? 1.2949 1.2768 0.9176 0.1037  0.0154  0.0402  95  LEU A CB  
459  C  CG  . LEU A 95  ? 1.3465 1.3640 0.9969 0.1030  0.0138  0.0515  95  LEU A CG  
460  C  CD1 . LEU A 95  ? 1.3606 1.3969 1.0247 0.1201  0.0219  0.0588  95  LEU A CD1 
461  C  CD2 . LEU A 95  ? 1.3722 1.3989 1.0228 0.0957  0.0191  0.0510  95  LEU A CD2 
462  N  N   . ILE A 96  ? 1.2976 1.2139 0.8749 0.0877  0.0121  0.0233  96  ILE A N   
463  C  CA  . ILE A 96  ? 1.3093 1.1991 0.8691 0.0841  0.0185  0.0159  96  ILE A CA  
464  C  C   . ILE A 96  ? 1.3453 1.2378 0.9063 0.0713  0.0189  0.0088  96  ILE A C   
465  O  O   . ILE A 96  ? 1.3583 1.2427 0.9136 0.0683  0.0227  0.0018  96  ILE A O   
466  C  CB  . ILE A 96  ? 1.3694 1.2348 0.9142 0.0857  0.0189  0.0191  96  ILE A CB  
467  C  CG1 . ILE A 96  ? 1.3753 1.2388 0.9152 0.0763  0.0159  0.0198  96  ILE A CG1 
468  C  CG2 . ILE A 96  ? 1.3914 1.2574 0.9370 0.1002  0.0154  0.0277  96  ILE A CG2 
469  C  CD1 . ILE A 96  ? 1.5410 1.3772 1.0619 0.0734  0.0219  0.0216  96  ILE A CD1 
470  N  N   . LEU A 97  ? 1.2737 1.1774 0.8418 0.0649  0.0137  0.0102  97  LEU A N   
471  C  CA  . LEU A 97  ? 1.2551 1.1646 0.8277 0.0558  0.0137  0.0049  97  LEU A CA  
472  C  C   . LEU A 97  ? 1.2847 1.2070 0.8634 0.0552  0.0129  0.0022  97  LEU A C   
473  O  O   . LEU A 97  ? 1.2819 1.2003 0.8578 0.0498  0.0144  -0.0043 97  LEU A O   
474  C  CB  . LEU A 97  ? 1.2472 1.1624 0.8236 0.0532  0.0088  0.0067  97  LEU A CB  
475  C  CG  . LEU A 97  ? 1.2932 1.2191 0.8788 0.0484  0.0071  0.0032  97  LEU A CG  
476  C  CD1 . LEU A 97  ? 1.2973 1.2207 0.8836 0.0429  0.0132  -0.0018 97  LEU A CD1 
477  C  CD2 . LEU A 97  ? 1.3251 1.2516 0.9114 0.0492  0.0011  0.0049  97  LEU A CD2 
478  N  N   . PRO A 98  ? 1.2271 1.1649 0.8132 0.0596  0.0106  0.0075  98  PRO A N   
479  C  CA  . PRO A 98  ? 1.2205 1.1680 0.8062 0.0596  0.0114  0.0061  98  PRO A CA  
480  C  C   . PRO A 98  ? 1.2935 1.2302 0.8647 0.0651  0.0175  0.0002  98  PRO A C   
481  O  O   . PRO A 98  ? 1.2956 1.2356 0.8589 0.0653  0.0178  -0.0033 98  PRO A O   
482  C  CB  . PRO A 98  ? 1.2318 1.1977 0.8296 0.0621  0.0094  0.0161  98  PRO A CB  
483  C  CG  . PRO A 98  ? 1.2891 1.2555 0.8930 0.0665  0.0088  0.0213  98  PRO A CG  
484  C  CD  . PRO A 98  ? 1.2397 1.1881 0.8355 0.0635  0.0066  0.0163  98  PRO A CD  
485  N  N   . LEU A 99  ? 1.2720 1.1923 0.8360 0.0705  0.0216  -0.0012 99  LEU A N   
486  C  CA  . LEU A 99  ? 1.2986 1.2000 0.8452 0.0770  0.0273  -0.0083 99  LEU A CA  
487  C  C   . LEU A 99  ? 1.3637 1.2436 0.9002 0.0661  0.0250  -0.0181 99  LEU A C   
488  O  O   . LEU A 99  ? 1.3711 1.2476 0.8979 0.0621  0.0226  -0.0262 99  LEU A O   
489  C  CB  . LEU A 99  ? 1.3123 1.2044 0.8566 0.0902  0.0325  -0.0039 99  LEU A CB  
490  C  CG  . LEU A 99  ? 1.3928 1.2838 0.9271 0.1057  0.0407  -0.0058 99  LEU A CG  
491  C  CD1 . LEU A 99  ? 1.3733 1.2993 0.9256 0.1126  0.0437  0.0049  99  LEU A CD1 
492  C  CD2 . LEU A 99  ? 1.4535 1.3213 0.9786 0.1185  0.0455  -0.0061 99  LEU A CD2 
493  N  N   . ILE A 100 ? 1.3185 1.1858 0.8577 0.0600  0.0251  -0.0164 100 ILE A N   
494  C  CA  . ILE A 100 ? 1.3267 1.1768 0.8625 0.0467  0.0244  -0.0225 100 ILE A CA  
495  C  C   . ILE A 100 ? 1.3660 1.2321 0.9104 0.0355  0.0179  -0.0283 100 ILE A C   
496  O  O   . ILE A 100 ? 1.3821 1.2354 0.9185 0.0279  0.0143  -0.0372 100 ILE A O   
497  C  CB  . ILE A 100 ? 1.3592 1.2036 0.8999 0.0423  0.0275  -0.0154 100 ILE A CB  
498  C  CG1 . ILE A 100 ? 1.3854 1.2053 0.9122 0.0523  0.0319  -0.0106 100 ILE A CG1 
499  C  CG2 . ILE A 100 ? 1.3740 1.2139 0.9209 0.0261  0.0284  -0.0182 100 ILE A CG2 
500  C  CD1 . ILE A 100 ? 1.4757 1.2991 1.0037 0.0563  0.0324  -0.0004 100 ILE A CD1 
501  N  N   . VAL A 101 ? 1.2825 1.1748 0.8423 0.0352  0.0149  -0.0232 101 VAL A N   
502  C  CA  . VAL A 101 ? 1.2577 1.1692 0.8289 0.0281  0.0080  -0.0258 101 VAL A CA  
503  C  C   . VAL A 101 ? 1.3156 1.2286 0.8740 0.0308  0.0025  -0.0313 101 VAL A C   
504  O  O   . VAL A 101 ? 1.3282 1.2391 0.8842 0.0221  -0.0044 -0.0390 101 VAL A O   
505  C  CB  . VAL A 101 ? 1.2696 1.2011 0.8561 0.0308  0.0069  -0.0185 101 VAL A CB  
506  C  CG1 . VAL A 101 ? 1.2568 1.2076 0.8538 0.0283  -0.0008 -0.0193 101 VAL A CG1 
507  C  CG2 . VAL A 101 ? 1.2627 1.1913 0.8567 0.0273  0.0122  -0.0158 101 VAL A CG2 
508  N  N   . SER A 102 ? 1.2588 1.1760 0.8083 0.0421  0.0055  -0.0271 102 SER A N   
509  C  CA  . SER A 102 ? 1.2702 1.1890 0.8024 0.0468  0.0032  -0.0308 102 SER A CA  
510  C  C   . SER A 102 ? 1.3454 1.2380 0.8521 0.0486  0.0044  -0.0425 102 SER A C   
511  O  O   . SER A 102 ? 1.3584 1.2478 0.8465 0.0485  -0.0013 -0.0497 102 SER A O   
512  C  CB  . SER A 102 ? 1.3169 1.2501 0.8494 0.0577  0.0091  -0.0206 102 SER A CB  
513  O  OG  . SER A 102 ? 1.4665 1.3906 0.9932 0.0679  0.0187  -0.0192 102 SER A OG  
514  N  N   . SER A 103 ? 1.3127 1.1833 0.8151 0.0512  0.0108  -0.0447 103 SER A N   
515  C  CA  . SER A 103 ? 1.3497 1.1871 0.8258 0.0542  0.0123  -0.0564 103 SER A CA  
516  C  C   . SER A 103 ? 1.4154 1.2376 0.8875 0.0368  0.0011  -0.0674 103 SER A C   
517  O  O   . SER A 103 ? 1.4440 1.2506 0.8918 0.0362  -0.0052 -0.0792 103 SER A O   
518  C  CB  . SER A 103 ? 1.4057 1.2217 0.8800 0.0624  0.0213  -0.0534 103 SER A CB  
519  O  OG  . SER A 103 ? 1.5017 1.3343 0.9825 0.0786  0.0299  -0.0433 103 SER A OG  
520  N  N   . LEU A 104 ? 1.3534 1.1815 0.8493 0.0225  -0.0016 -0.0636 104 LEU A N   
521  C  CA  . LEU A 104 ? 1.3654 1.1850 0.8666 0.0031  -0.0118 -0.0715 104 LEU A CA  
522  C  C   . LEU A 104 ? 1.4025 1.2483 0.9116 -0.0043 -0.0255 -0.0749 104 LEU A C   
523  O  O   . LEU A 104 ? 1.4282 1.2616 0.9276 -0.0160 -0.0378 -0.0860 104 LEU A O   
524  C  CB  . LEU A 104 ? 1.3516 1.1727 0.8771 -0.0090 -0.0071 -0.0641 104 LEU A CB  
525  C  CG  . LEU A 104 ? 1.4299 1.2162 0.9427 -0.0056 0.0027  -0.0618 104 LEU A CG  
526  C  CD1 . LEU A 104 ? 1.4151 1.2121 0.9477 -0.0089 0.0114  -0.0492 104 LEU A CD1 
527  C  CD2 . LEU A 104 ? 1.4947 1.2418 0.9916 -0.0184 -0.0028 -0.0726 104 LEU A CD2 
528  N  N   . ILE A 105 ? 1.3173 1.1960 0.8419 0.0024  -0.0251 -0.0655 105 ILE A N   
529  C  CA  . ILE A 105 ? 1.3082 1.2115 0.8396 -0.0014 -0.0384 -0.0662 105 ILE A CA  
530  C  C   . ILE A 105 ? 1.4292 1.3178 0.9244 0.0039  -0.0463 -0.0761 105 ILE A C   
531  O  O   . ILE A 105 ? 1.4518 1.3415 0.9425 -0.0065 -0.0622 -0.0845 105 ILE A O   
532  C  CB  . ILE A 105 ? 1.2989 1.2330 0.8512 0.0064  -0.0356 -0.0534 105 ILE A CB  
533  C  CG1 . ILE A 105 ? 1.2697 1.2185 0.8548 -0.0005 -0.0311 -0.0472 105 ILE A CG1 
534  C  CG2 . ILE A 105 ? 1.3040 1.2580 0.8545 0.0078  -0.0489 -0.0526 105 ILE A CG2 
535  C  CD1 . ILE A 105 ? 1.2789 1.2454 0.8780 0.0093  -0.0253 -0.0364 105 ILE A CD1 
536  N  N   . THR A 106 ? 1.4139 1.2888 0.8830 0.0198  -0.0353 -0.0755 106 THR A N   
537  C  CA  . THR A 106 ? 1.4594 1.3178 0.8881 0.0276  -0.0391 -0.0853 106 THR A CA  
538  C  C   . THR A 106 ? 1.5842 1.4023 0.9868 0.0223  -0.0430 -0.1022 106 THR A C   
539  O  O   . THR A 106 ? 1.6263 1.4297 0.9998 0.0190  -0.0559 -0.1148 106 THR A O   
540  C  CB  . THR A 106 ? 1.5283 1.3913 0.9401 0.0474  -0.0240 -0.0775 106 THR A CB  
541  O  OG1 . THR A 106 ? 1.5119 1.3641 0.9305 0.0556  -0.0088 -0.0739 106 THR A OG1 
542  C  CG2 . THR A 106 ? 1.4682 1.3647 0.8980 0.0505  -0.0236 -0.0621 106 THR A CG2 
543  N  N   . GLY A 107 ? 1.5545 1.3519 0.9648 0.0216  -0.0332 -0.1022 107 GLY A N   
544  C  CA  . GLY A 107 ? 1.6068 1.3587 0.9932 0.0168  -0.0355 -0.1166 107 GLY A CA  
545  C  C   . GLY A 107 ? 1.6998 1.4406 1.0867 -0.0064 -0.0559 -0.1286 107 GLY A C   
546  O  O   . GLY A 107 ? 1.7507 1.4565 1.1010 -0.0083 -0.0655 -0.1453 107 GLY A O   
547  N  N   . LEU A 108 ? 1.6262 1.3982 1.0551 -0.0238 -0.0630 -0.1202 108 LEU A N   
548  C  CA  . LEU A 108 ? 1.6431 1.4159 1.0859 -0.0485 -0.0827 -0.1281 108 LEU A CA  
549  C  C   . LEU A 108 ? 1.7094 1.5053 1.1453 -0.0514 -0.1026 -0.1333 108 LEU A C   
550  O  O   . LEU A 108 ? 1.7448 1.5299 1.1754 -0.0692 -0.1230 -0.1455 108 LEU A O   
551  C  CB  . LEU A 108 ? 1.6062 1.4044 1.0987 -0.0644 -0.0788 -0.1158 108 LEU A CB  
552  C  CG  . LEU A 108 ? 1.6850 1.4475 1.1779 -0.0724 -0.0683 -0.1152 108 LEU A CG  
553  C  CD1 . LEU A 108 ? 1.6539 1.4203 1.1532 -0.0559 -0.0468 -0.1014 108 LEU A CD1 
554  C  CD2 . LEU A 108 ? 1.7288 1.5014 1.2575 -0.0997 -0.0757 -0.1125 108 LEU A CD2 
555  N  N   . ALA A 109 ? 1.6362 1.4612 1.0703 -0.0346 -0.0981 -0.1239 109 ALA A N   
556  C  CA  . ALA A 109 ? 1.6433 1.4891 1.0664 -0.0337 -0.1159 -0.1259 109 ALA A CA  
557  C  C   . ALA A 109 ? 1.7622 1.5758 1.1252 -0.0220 -0.1203 -0.1396 109 ALA A C   
558  O  O   . ALA A 109 ? 1.7896 1.6055 1.1327 -0.0271 -0.1413 -0.1476 109 ALA A O   
559  C  CB  . ALA A 109 ? 1.6022 1.4886 1.0487 -0.0217 -0.1090 -0.1081 109 ALA A CB  
560  N  N   . SER A 110 ? 1.7446 1.5286 1.0775 -0.0052 -0.1007 -0.1424 110 SER A N   
561  C  CA  . SER A 110 ? 1.8055 1.5574 1.0786 0.0103  -0.0989 -0.1554 110 SER A CA  
562  C  C   . SER A 110 ? 1.9468 1.6471 1.1846 0.0001  -0.1119 -0.1787 110 SER A C   
563  O  O   . SER A 110 ? 1.9999 1.6652 1.1824 0.0141  -0.1098 -0.1928 110 SER A O   
564  C  CB  . SER A 110 ? 1.8385 1.5867 1.1003 0.0345  -0.0711 -0.1469 110 SER A CB  
565  O  OG  . SER A 110 ? 1.8985 1.6898 1.1893 0.0419  -0.0614 -0.1264 110 SER A OG  
566  N  N   . LEU A 111 ? 1.9175 1.6117 1.1864 -0.0244 -0.1246 -0.1825 111 LEU A N   
567  C  CA  . LEU A 111 ? 1.9839 1.6275 1.2280 -0.0400 -0.1390 -0.2030 111 LEU A CA  
568  C  C   . LEU A 111 ? 2.0636 1.7232 1.3275 -0.0683 -0.1704 -0.2091 111 LEU A C   
569  O  O   . LEU A 111 ? 2.0020 1.7133 1.3159 -0.0778 -0.1754 -0.1941 111 LEU A O   
570  C  CB  . LEU A 111 ? 1.9725 1.5943 1.2422 -0.0464 -0.1242 -0.1983 111 LEU A CB  
571  C  CG  . LEU A 111 ? 2.0604 1.6344 1.2941 -0.0246 -0.1034 -0.2041 111 LEU A CG  
572  C  CD1 . LEU A 111 ? 2.0330 1.6297 1.2555 0.0067  -0.0807 -0.1932 111 LEU A CD1 
573  C  CD2 . LEU A 111 ? 2.0713 1.6314 1.3369 -0.0335 -0.0922 -0.1951 111 LEU A CD2 
574  N  N   . ASP A 112 ? 2.1160 1.7305 1.3415 -0.0817 -0.1921 -0.2316 112 ASP A N   
575  C  CA  . ASP A 112 ? 2.1482 1.7746 1.3908 -0.1112 -0.2262 -0.2398 112 ASP A CA  
576  C  C   . ASP A 112 ? 2.1749 1.8230 1.4856 -0.1393 -0.2282 -0.2289 112 ASP A C   
577  O  O   . ASP A 112 ? 2.1520 1.7823 1.4778 -0.1383 -0.2065 -0.2220 112 ASP A O   
578  C  CB  . ASP A 112 ? 2.2693 1.8338 1.4500 -0.1199 -0.2497 -0.2684 112 ASP A CB  
579  C  CG  . ASP A 112 ? 2.4726 1.9985 1.5751 -0.0895 -0.2407 -0.2823 112 ASP A CG  
580  O  OD1 . ASP A 112 ? 2.4674 2.0265 1.5549 -0.0711 -0.2381 -0.2743 112 ASP A OD1 
581  O  OD2 . ASP A 112 ? 2.6142 2.0748 1.6683 -0.0841 -0.2367 -0.3012 112 ASP A OD2 
582  N  N   . ALA A 113 ? 2.1320 1.8205 1.4837 -0.1635 -0.2539 -0.2262 113 ALA A N   
583  C  CA  . ALA A 113 ? 2.1015 1.8216 1.5231 -0.1916 -0.2569 -0.2143 113 ALA A CA  
584  C  C   . ALA A 113 ? 2.1783 1.8471 1.6001 -0.2098 -0.2492 -0.2199 113 ALA A C   
585  O  O   . ALA A 113 ? 2.1295 1.8054 1.5816 -0.2070 -0.2236 -0.2043 113 ALA A O   
586  C  CB  . ALA A 113 ? 2.1259 1.8841 1.5783 -0.2161 -0.2922 -0.2174 113 ALA A CB  
587  N  N   . LYS A 114 ? 2.2145 1.8273 1.5977 -0.2270 -0.2716 -0.2422 114 LYS A N   
588  C  CA  . LYS A 114 ? 2.2571 1.8113 1.6343 -0.2451 -0.2670 -0.2487 114 LYS A CA  
589  C  C   . LYS A 114 ? 2.3225 1.8204 1.6478 -0.2149 -0.2395 -0.2530 114 LYS A C   
590  O  O   . LYS A 114 ? 2.3259 1.7923 1.6614 -0.2208 -0.2234 -0.2467 114 LYS A O   
591  C  CB  . LYS A 114 ? 2.3710 1.8832 1.7289 -0.2775 -0.3035 -0.2712 114 LYS A CB  
592  C  CG  . LYS A 114 ? 2.5419 2.0006 1.9105 -0.3063 -0.3029 -0.2737 114 LYS A CG  
593  C  CD  . LYS A 114 ? 2.5447 2.0559 1.9977 -0.3342 -0.2950 -0.2488 114 LYS A CD  
594  C  CE  . LYS A 114 ? 2.6268 2.0803 2.0835 -0.3564 -0.2864 -0.2468 114 LYS A CE  
595  N  NZ  . LYS A 114 ? 2.6544 2.1603 2.1898 -0.3814 -0.2742 -0.2204 114 LYS A NZ  
596  N  N   . ALA A 115 ? 2.2796 1.7685 1.5524 -0.1819 -0.2329 -0.2613 115 ALA A N   
597  C  CA  . ALA A 115 ? 2.2871 1.7323 1.5149 -0.1496 -0.2058 -0.2641 115 ALA A CA  
598  C  C   . ALA A 115 ? 2.2629 1.7397 1.5340 -0.1376 -0.1751 -0.2390 115 ALA A C   
599  O  O   . ALA A 115 ? 2.2768 1.7117 1.5322 -0.1260 -0.1565 -0.2379 115 ALA A O   
600  C  CB  . ALA A 115 ? 2.3082 1.7545 1.4829 -0.1184 -0.2029 -0.2732 115 ALA A CB  
601  N  N   . SER A 116 ? 2.1385 1.6867 1.4632 -0.1408 -0.1715 -0.2192 116 SER A N   
602  C  CA  . SER A 116 ? 2.0631 1.6464 1.4305 -0.1322 -0.1460 -0.1957 116 SER A CA  
603  C  C   . SER A 116 ? 2.1177 1.6803 1.5149 -0.1562 -0.1418 -0.1888 116 SER A C   
604  O  O   . SER A 116 ? 2.0978 1.6466 1.4983 -0.1448 -0.1195 -0.1775 116 SER A O   
605  C  CB  . SER A 116 ? 2.0360 1.6933 1.4498 -0.1333 -0.1481 -0.1802 116 SER A CB  
606  O  OG  . SER A 116 ? 2.1185 1.7954 1.5063 -0.1127 -0.1522 -0.1834 116 SER A OG  
607  N  N   . GLY A 117 ? 2.1026 1.6631 1.5206 -0.1896 -0.1641 -0.1950 117 GLY A N   
608  C  CA  . GLY A 117 ? 2.1196 1.6597 1.5670 -0.2182 -0.1626 -0.1881 117 GLY A CA  
609  C  C   . GLY A 117 ? 2.2358 1.6920 1.6364 -0.2167 -0.1590 -0.2002 117 GLY A C   
610  O  O   . GLY A 117 ? 2.2306 1.6639 1.6450 -0.2242 -0.1440 -0.1879 117 GLY A O   
611  N  N   . ARG A 118 ? 2.2566 1.6644 1.5981 -0.2050 -0.1722 -0.2241 118 ARG A N   
612  C  CA  . ARG A 118 ? 2.3322 1.6537 1.6192 -0.1974 -0.1699 -0.2398 118 ARG A CA  
613  C  C   . ARG A 118 ? 2.3623 1.6721 1.6331 -0.1610 -0.1388 -0.2287 118 ARG A C   
614  O  O   . ARG A 118 ? 2.3874 1.6490 1.6509 -0.1612 -0.1275 -0.2240 118 ARG A O   
615  C  CB  . ARG A 118 ? 2.4016 1.6810 1.6269 -0.1903 -0.1912 -0.2692 118 ARG A CB  
616  C  CG  . ARG A 118 ? 2.5850 1.8450 1.8133 -0.2304 -0.2265 -0.2852 118 ARG A CG  
617  C  CD  . ARG A 118 ? 2.7848 1.9981 1.9432 -0.2213 -0.2482 -0.3158 118 ARG A CD  
618  N  NE  . ARG A 118 ? 2.8740 2.1458 2.0284 -0.2066 -0.2558 -0.3165 118 ARG A NE  
619  C  CZ  . ARG A 118 ? 3.1278 2.3736 2.2171 -0.1873 -0.2663 -0.3380 118 ARG A CZ  
620  N  NH1 . ARG A 118 ? 3.0666 2.2280 2.0877 -0.1783 -0.2701 -0.3629 118 ARG A NH1 
621  N  NH2 . ARG A 118 ? 2.9365 2.2379 2.0255 -0.1752 -0.2722 -0.3344 118 ARG A NH2 
622  N  N   . LEU A 119 ? 2.2677 1.6239 1.5362 -0.1310 -0.1259 -0.2226 119 LEU A N   
623  C  CA  . LEU A 119 ? 2.2339 1.5934 1.4950 -0.0967 -0.0984 -0.2104 119 LEU A CA  
624  C  C   . LEU A 119 ? 2.2346 1.6128 1.5406 -0.1053 -0.0829 -0.1863 119 LEU A C   
625  O  O   . LEU A 119 ? 2.2414 1.5878 1.5347 -0.0882 -0.0661 -0.1792 119 LEU A O   
626  C  CB  . LEU A 119 ? 2.1811 1.5987 1.4444 -0.0724 -0.0911 -0.2052 119 LEU A CB  
627  C  CG  . LEU A 119 ? 2.2788 1.6737 1.4875 -0.0398 -0.0849 -0.2196 119 LEU A CG  
628  C  CD1 . LEU A 119 ? 2.3054 1.6599 1.4912 -0.0122 -0.0634 -0.2176 119 LEU A CD1 
629  C  CD2 . LEU A 119 ? 2.3823 1.7394 1.5444 -0.0483 -0.1078 -0.2457 119 LEU A CD2 
630  N  N   . GLY A 120 ? 2.1423 1.5710 1.4984 -0.1308 -0.0889 -0.1741 120 GLY A N   
631  C  CA  . GLY A 120 ? 2.0998 1.5511 1.4985 -0.1422 -0.0749 -0.1514 120 GLY A CA  
632  C  C   . GLY A 120 ? 2.2015 1.5947 1.5958 -0.1642 -0.0758 -0.1503 120 GLY A C   
633  O  O   . GLY A 120 ? 2.1966 1.5715 1.5921 -0.1564 -0.0582 -0.1353 120 GLY A O   
634  N  N   . MET A 121 ? 2.2091 1.5697 1.5957 -0.1920 -0.0979 -0.1661 121 MET A N   
635  C  CA  . MET A 121 ? 2.2707 1.5686 1.6514 -0.2179 -0.1027 -0.1670 121 MET A CA  
636  C  C   . MET A 121 ? 2.3332 1.5563 1.6627 -0.1920 -0.0909 -0.1721 121 MET A C   
637  O  O   . MET A 121 ? 2.3498 1.5376 1.6827 -0.1989 -0.0797 -0.1582 121 MET A O   
638  C  CB  . MET A 121 ? 2.3634 1.6385 1.7398 -0.2507 -0.1331 -0.1871 121 MET A CB  
639  C  CG  . MET A 121 ? 2.4794 1.7051 1.8680 -0.2886 -0.1403 -0.1834 121 MET A CG  
640  S  SD  . MET A 121 ? 2.4906 1.7821 1.9592 -0.3221 -0.1287 -0.1513 121 MET A SD  
641  C  CE  . MET A 121 ? 2.4246 1.7875 1.9379 -0.3494 -0.1571 -0.1602 121 MET A CE  
642  N  N   . ARG A 122 ? 2.2792 1.4811 1.5620 -0.1603 -0.0917 -0.1903 122 ARG A N   
643  C  CA  . ARG A 122 ? 2.3115 1.4492 1.5462 -0.1288 -0.0793 -0.1963 122 ARG A CA  
644  C  C   . ARG A 122 ? 2.2889 1.4500 1.5418 -0.1061 -0.0543 -0.1715 122 ARG A C   
645  O  O   . ARG A 122 ? 2.3216 1.4289 1.5570 -0.0976 -0.0449 -0.1648 122 ARG A O   
646  C  CB  . ARG A 122 ? 2.3271 1.4556 1.5153 -0.0975 -0.0818 -0.2182 122 ARG A CB  
647  C  CG  . ARG A 122 ? 2.5384 1.6174 1.6874 -0.1135 -0.1066 -0.2471 122 ARG A CG  
648  C  CD  . ARG A 122 ? 2.7180 1.7808 1.8127 -0.0772 -0.1038 -0.2673 122 ARG A CD  
649  N  NE  . ARG A 122 ? 2.9006 1.9510 1.9656 -0.0923 -0.1295 -0.2923 122 ARG A NE  
650  C  CZ  . ARG A 122 ? 3.1968 2.1678 2.2118 -0.1014 -0.1472 -0.3181 122 ARG A CZ  
651  N  NH1 . ARG A 122 ? 3.1114 2.0050 2.1013 -0.0970 -0.1410 -0.3220 122 ARG A NH1 
652  N  NH2 . ARG A 122 ? 3.0724 2.0378 2.0597 -0.1150 -0.1727 -0.3403 122 ARG A NH2 
653  N  N   . ALA A 123 ? 2.1510 1.3898 1.4382 -0.0972 -0.0455 -0.1575 123 ALA A N   
654  C  CA  . ALA A 123 ? 2.0933 1.3620 1.3991 -0.0775 -0.0251 -0.1347 123 ALA A CA  
655  C  C   . ALA A 123 ? 2.1383 1.3990 1.4706 -0.1013 -0.0189 -0.1142 123 ALA A C   
656  O  O   . ALA A 123 ? 2.1609 1.3855 1.4789 -0.0874 -0.0070 -0.1027 123 ALA A O   
657  C  CB  . ALA A 123 ? 2.0208 1.3692 1.3547 -0.0668 -0.0208 -0.1276 123 ALA A CB  
658  N  N   . VAL A 124 ? 2.0642 1.3571 1.4339 -0.1365 -0.0267 -0.1092 124 VAL A N   
659  C  CA  . VAL A 124 ? 2.0579 1.3513 1.4569 -0.1627 -0.0189 -0.0883 124 VAL A CA  
660  C  C   . VAL A 124 ? 2.1810 1.3896 1.5523 -0.1738 -0.0199 -0.0882 124 VAL A C   
661  O  O   . VAL A 124 ? 2.1843 1.3742 1.5557 -0.1715 -0.0051 -0.0679 124 VAL A O   
662  C  CB  . VAL A 124 ? 2.0739 1.4234 1.5219 -0.1971 -0.0273 -0.0846 124 VAL A CB  
663  C  CG1 . VAL A 124 ? 2.0839 1.4312 1.5615 -0.2258 -0.0172 -0.0627 124 VAL A CG1 
664  C  CG2 . VAL A 124 ? 1.9918 1.4208 1.4667 -0.1824 -0.0229 -0.0803 124 VAL A CG2 
665  N  N   . VAL A 125 ? 2.1970 1.3505 1.5400 -0.1839 -0.0376 -0.1109 125 VAL A N   
666  C  CA  . VAL A 125 ? 2.2815 1.3440 1.5923 -0.1939 -0.0414 -0.1146 125 VAL A CA  
667  C  C   . VAL A 125 ? 2.3604 1.3794 1.6336 -0.1537 -0.0258 -0.1088 125 VAL A C   
668  O  O   . VAL A 125 ? 2.3955 1.3668 1.6605 -0.1575 -0.0172 -0.0928 125 VAL A O   
669  C  CB  . VAL A 125 ? 2.3927 1.4049 1.6763 -0.2113 -0.0663 -0.1440 125 VAL A CB  
670  C  CG1 . VAL A 125 ? 2.4872 1.3938 1.7210 -0.2062 -0.0691 -0.1536 125 VAL A CG1 
671  C  CG2 . VAL A 125 ? 2.3881 1.4301 1.7147 -0.2598 -0.0833 -0.1435 125 VAL A CG2 
672  N  N   . TYR A 126 ? 2.2959 1.3368 1.5501 -0.1153 -0.0216 -0.1192 126 TYR A N   
673  C  CA  . TYR A 126 ? 2.3112 1.3258 1.5371 -0.0735 -0.0074 -0.1136 126 TYR A CA  
674  C  C   . TYR A 126 ? 2.3236 1.3728 1.5746 -0.0665 0.0092  -0.0835 126 TYR A C   
675  O  O   . TYR A 126 ? 2.3599 1.3626 1.5908 -0.0501 0.0178  -0.0714 126 TYR A O   
676  C  CB  . TYR A 126 ? 2.3023 1.3473 1.5118 -0.0382 -0.0060 -0.1296 126 TYR A CB  
677  C  CG  . TYR A 126 ? 2.3272 1.3706 1.5231 0.0051  0.0100  -0.1195 126 TYR A CG  
678  C  CD1 . TYR A 126 ? 2.4277 1.3990 1.5818 0.0315  0.0131  -0.1281 126 TYR A CD1 
679  C  CD2 . TYR A 126 ? 2.2644 1.3776 1.4902 0.0198  0.0208  -0.1013 126 TYR A CD2 
680  C  CE1 . TYR A 126 ? 2.4371 1.4118 1.5843 0.0722  0.0269  -0.1171 126 TYR A CE1 
681  C  CE2 . TYR A 126 ? 2.2732 1.3882 1.4913 0.0570  0.0327  -0.0905 126 TYR A CE2 
682  C  CZ  . TYR A 126 ? 2.4509 1.4999 1.6319 0.0837  0.0358  -0.0979 126 TYR A CZ  
683  O  OH  . TYR A 126 ? 2.4698 1.5266 1.6480 0.1222  0.0467  -0.0868 126 TYR A OH  
684  N  N   . TYR A 127 ? 2.2067 1.3346 1.4977 -0.0770 0.0130  -0.0722 127 TYR A N   
685  C  CA  . TYR A 127 ? 2.1606 1.3280 1.4734 -0.0711 0.0274  -0.0462 127 TYR A CA  
686  C  C   . TYR A 127 ? 2.2629 1.3926 1.5783 -0.0943 0.0340  -0.0258 127 TYR A C   
687  O  O   . TYR A 127 ? 2.2641 1.3747 1.5661 -0.0767 0.0448  -0.0076 127 TYR A O   
688  C  CB  . TYR A 127 ? 2.0938 1.3464 1.4464 -0.0812 0.0283  -0.0425 127 TYR A CB  
689  C  CG  . TYR A 127 ? 2.0628 1.3623 1.4167 -0.0567 0.0254  -0.0550 127 TYR A CG  
690  C  CD1 . TYR A 127 ? 2.0970 1.3784 1.4236 -0.0214 0.0284  -0.0614 127 TYR A CD1 
691  C  CD2 . TYR A 127 ? 2.0150 1.3790 1.3994 -0.0682 0.0210  -0.0583 127 TYR A CD2 
692  C  CE1 . TYR A 127 ? 2.0604 1.3879 1.3909 -0.0006 0.0281  -0.0695 127 TYR A CE1 
693  C  CE2 . TYR A 127 ? 1.9825 1.3874 1.3674 -0.0469 0.0192  -0.0669 127 TYR A CE2 
694  C  CZ  . TYR A 127 ? 2.0821 1.4691 1.4404 -0.0144 0.0233  -0.0720 127 TYR A CZ  
695  O  OH  . TYR A 127 ? 2.0430 1.4719 1.4040 0.0043  0.0231  -0.0782 127 TYR A OH  
696  N  N   . MET A 128 ? 2.2566 1.3789 1.5910 -0.1343 0.0271  -0.0273 128 MET A N   
697  C  CA  . MET A 128 ? 2.3010 1.3916 1.6435 -0.1636 0.0339  -0.0069 128 MET A CA  
698  C  C   . MET A 128 ? 2.4222 1.4171 1.7244 -0.1594 0.0327  -0.0053 128 MET A C   
699  O  O   . MET A 128 ? 2.4463 1.4118 1.7448 -0.1685 0.0437  0.0183  128 MET A O   
700  C  CB  . MET A 128 ? 2.3330 1.4504 1.7143 -0.2087 0.0258  -0.0091 128 MET A CB  
701  C  CG  . MET A 128 ? 2.3058 1.5153 1.7324 -0.2158 0.0338  0.0012  128 MET A CG  
702  S  SD  . MET A 128 ? 2.3386 1.5757 1.7726 -0.2063 0.0598  0.0348  128 MET A SD  
703  C  CE  . MET A 128 ? 2.3655 1.5611 1.8130 -0.2507 0.0671  0.0558  128 MET A CE  
704  N  N   . SER A 129 ? 2.4128 1.3566 1.6819 -0.1446 0.0203  -0.0299 129 SER A N   
705  C  CA  . SER A 129 ? 2.4981 1.3447 1.7245 -0.1354 0.0186  -0.0315 129 SER A CA  
706  C  C   . SER A 129 ? 2.5393 1.3741 1.7422 -0.0910 0.0317  -0.0173 129 SER A C   
707  O  O   . SER A 129 ? 2.5837 1.3642 1.7690 -0.0900 0.0385  0.0019  129 SER A O   
708  C  CB  . SER A 129 ? 2.5973 1.3924 1.7929 -0.1323 0.0016  -0.0644 129 SER A CB  
709  O  OG  . SER A 129 ? 2.6642 1.5058 1.8552 -0.1022 -0.0004 -0.0829 129 SER A OG  
710  N  N   . THR A 130 ? 2.4367 1.3258 1.6422 -0.0560 0.0347  -0.0244 130 THR A N   
711  C  CA  . THR A 130 ? 2.4248 1.3174 1.6156 -0.0129 0.0446  -0.0118 130 THR A CA  
712  C  C   . THR A 130 ? 2.4476 1.3677 1.6535 -0.0167 0.0560  0.0198  130 THR A C   
713  O  O   . THR A 130 ? 2.4746 1.3590 1.6587 0.0070  0.0616  0.0361  130 THR A O   
714  C  CB  . THR A 130 ? 2.4703 1.4205 1.6669 0.0192  0.0444  -0.0265 130 THR A CB  
715  O  OG1 . THR A 130 ? 2.3935 1.4224 1.6261 -0.0004 0.0426  -0.0291 130 THR A OG1 
716  C  CG2 . THR A 130 ? 2.4880 1.3944 1.6536 0.0384  0.0377  -0.0542 130 THR A CG2 
717  N  N   . THR A 131 ? 2.3509 1.3322 1.5916 -0.0451 0.0594  0.0284  131 THR A N   
718  C  CA  . THR A 131 ? 2.3285 1.3358 1.5799 -0.0511 0.0716  0.0571  131 THR A CA  
719  C  C   . THR A 131 ? 2.4436 1.3853 1.6814 -0.0766 0.0769  0.0761  131 THR A C   
720  O  O   . THR A 131 ? 2.4543 1.3962 1.6864 -0.0753 0.0882  0.1023  131 THR A O   
721  C  CB  . THR A 131 ? 2.3699 1.4634 1.6603 -0.0679 0.0757  0.0592  131 THR A CB  
722  O  OG1 . THR A 131 ? 2.3864 1.4926 1.7009 -0.1011 0.0684  0.0442  131 THR A OG1 
723  C  CG2 . THR A 131 ? 2.2775 1.4327 1.5764 -0.0377 0.0740  0.0514  131 THR A CG2 
724  N  N   . ILE A 132 ? 2.4409 1.3240 1.6710 -0.1001 0.0681  0.0630  132 ILE A N   
725  C  CA  . ILE A 132 ? 2.5089 1.3203 1.7258 -0.1275 0.0711  0.0791  132 ILE A CA  
726  C  C   . ILE A 132 ? 2.6105 1.3345 1.7803 -0.0971 0.0695  0.0825  132 ILE A C   
727  O  O   . ILE A 132 ? 2.6545 1.3303 1.8068 -0.1020 0.0776  0.1080  132 ILE A O   
728  C  CB  . ILE A 132 ? 2.5736 1.3713 1.8118 -0.1738 0.0606  0.0648  132 ILE A CB  
729  C  CG1 . ILE A 132 ? 2.5487 1.4003 1.8294 -0.2131 0.0715  0.0858  132 ILE A CG1 
730  C  CG2 . ILE A 132 ? 2.6875 1.3791 1.8933 -0.1867 0.0510  0.0585  132 ILE A CG2 
731  C  CD1 . ILE A 132 ? 2.6293 1.5157 1.9502 -0.2534 0.0600  0.0698  132 ILE A CD1 
732  N  N   . ILE A 133 ? 2.5600 1.2662 1.7092 -0.0633 0.0606  0.0584  133 ILE A N   
733  C  CA  . ILE A 133 ? 2.6233 1.2522 1.7300 -0.0274 0.0594  0.0588  133 ILE A CA  
734  C  C   . ILE A 133 ? 2.6526 1.3027 1.7523 0.0060  0.0693  0.0856  133 ILE A C   
735  O  O   . ILE A 133 ? 2.7126 1.2977 1.7842 0.0158  0.0727  0.1054  133 ILE A O   
736  C  CB  . ILE A 133 ? 2.6691 1.2825 1.7578 0.0019  0.0501  0.0255  133 ILE A CB  
737  C  CG1 . ILE A 133 ? 2.7039 1.2902 1.7922 -0.0314 0.0369  -0.0028 133 ILE A CG1 
738  C  CG2 . ILE A 133 ? 2.7472 1.2866 1.7946 0.0449  0.0511  0.0266  133 ILE A CG2 
739  C  CD1 . ILE A 133 ? 2.9026 1.3941 1.9724 -0.0690 0.0297  -0.0011 133 ILE A CD1 
740  N  N   . ALA A 134 ? 2.5258 1.2651 1.6503 0.0213  0.0724  0.0866  134 ALA A N   
741  C  CA  . ALA A 134 ? 2.4978 1.2710 1.6197 0.0509  0.0782  0.1090  134 ALA A CA  
742  C  C   . ALA A 134 ? 2.5726 1.3320 1.6879 0.0308  0.0877  0.1417  134 ALA A C   
743  O  O   . ALA A 134 ? 2.5982 1.3299 1.6889 0.0556  0.0899  0.1633  134 ALA A O   
744  C  CB  . ALA A 134 ? 2.4088 1.2792 1.5618 0.0608  0.0778  0.1004  134 ALA A CB  
745  N  N   . VAL A 135 ? 2.5168 1.2968 1.6540 -0.0129 0.0937  0.1463  135 VAL A N   
746  C  CA  . VAL A 135 ? 2.5398 1.3116 1.6727 -0.0358 0.1063  0.1774  135 VAL A CA  
747  C  C   . VAL A 135 ? 2.6901 1.3602 1.7903 -0.0455 0.1076  0.1930  135 VAL A C   
748  O  O   . VAL A 135 ? 2.7235 1.3669 1.8010 -0.0420 0.1165  0.2231  135 VAL A O   
749  C  CB  . VAL A 135 ? 2.5396 1.3749 1.7115 -0.0763 0.1146  0.1782  135 VAL A CB  
750  C  CG1 . VAL A 135 ? 2.5722 1.3760 1.7615 -0.1180 0.1109  0.1668  135 VAL A CG1 
751  C  CG2 . VAL A 135 ? 2.5417 1.3959 1.7088 -0.0861 0.1312  0.2106  135 VAL A CG2 
752  N  N   . VAL A 136 ? 2.6911 1.3012 1.7848 -0.0557 0.0978  0.1722  136 VAL A N   
753  C  CA  . VAL A 136 ? 2.7932 1.2974 1.8541 -0.0646 0.0965  0.1829  136 VAL A CA  
754  C  C   . VAL A 136 ? 2.8809 1.3352 1.9019 -0.0141 0.0937  0.1915  136 VAL A C   
755  O  O   . VAL A 136 ? 2.9437 1.3407 1.9364 -0.0112 0.0994  0.2201  136 VAL A O   
756  C  CB  . VAL A 136 ? 2.8845 1.3385 1.9488 -0.0930 0.0847  0.1556  136 VAL A CB  
757  C  CG1 . VAL A 136 ? 2.9976 1.3317 2.0187 -0.0869 0.0792  0.1586  136 VAL A CG1 
758  C  CG2 . VAL A 136 ? 2.8644 1.3510 1.9669 -0.1495 0.0882  0.1595  136 VAL A CG2 
759  N  N   . LEU A 137 ? 2.7899 1.2725 1.8111 0.0262  0.0858  0.1690  137 LEU A N   
760  C  CA  . LEU A 137 ? 2.8141 1.2664 1.8070 0.0786  0.0826  0.1750  137 LEU A CA  
761  C  C   . LEU A 137 ? 2.8361 1.3262 1.8249 0.0956  0.0885  0.2072  137 LEU A C   
762  O  O   . LEU A 137 ? 2.8937 1.3310 1.8511 0.1235  0.0875  0.2275  137 LEU A O   
763  C  CB  . LEU A 137 ? 2.7633 1.2578 1.7677 0.1132  0.0756  0.1448  137 LEU A CB  
764  C  CG  . LEU A 137 ? 2.8642 1.3195 1.8430 0.1679  0.0719  0.1440  137 LEU A CG  
765  C  CD1 . LEU A 137 ? 2.9589 1.3150 1.9063 0.1731  0.0676  0.1252  137 LEU A CD1 
766  C  CD2 . LEU A 137 ? 2.8141 1.3514 1.8172 0.2015  0.0698  0.1278  137 LEU A CD2 
767  N  N   . GLY A 138 ? 2.7085 1.2851 1.7260 0.0787  0.0937  0.2114  138 GLY A N   
768  C  CA  . GLY A 138 ? 2.6795 1.2983 1.6916 0.0905  0.0985  0.2384  138 GLY A CA  
769  C  C   . GLY A 138 ? 2.7917 1.3561 1.7752 0.0720  0.1083  0.2730  138 GLY A C   
770  O  O   . GLY A 138 ? 2.8161 1.3634 1.7710 0.0987  0.1074  0.2975  138 GLY A O   
771  N  N   . ILE A 139 ? 2.7762 1.3145 1.7679 0.0255  0.1175  0.2764  139 ILE A N   
772  C  CA  . ILE A 139 ? 2.8461 1.3325 1.8147 -0.0002 0.1301  0.3104  139 ILE A CA  
773  C  C   . ILE A 139 ? 2.9916 1.3717 1.9161 0.0206  0.1250  0.3258  139 ILE A C   
774  O  O   . ILE A 139 ? 3.0321 1.3807 1.9238 0.0304  0.1309  0.3589  139 ILE A O   
775  C  CB  . ILE A 139 ? 2.8857 1.3794 1.8843 -0.0570 0.1404  0.3081  139 ILE A CB  
776  C  CG1 . ILE A 139 ? 2.8032 1.3986 1.8354 -0.0738 0.1514  0.3092  139 ILE A CG1 
777  C  CG2 . ILE A 139 ? 2.9940 1.4062 1.9690 -0.0867 0.1512  0.3390  139 ILE A CG2 
778  C  CD1 . ILE A 139 ? 2.8620 1.4960 1.9408 -0.1194 0.1554  0.2930  139 ILE A CD1 
779  N  N   . ILE A 140 ? 2.9822 1.3060 1.9027 0.0294  0.1140  0.3013  140 ILE A N   
780  C  CA  . ILE A 140 ? 3.0825 1.2996 1.9616 0.0523  0.1081  0.3104  140 ILE A CA  
781  C  C   . ILE A 140 ? 3.1297 1.3491 1.9825 0.1072  0.1030  0.3281  140 ILE A C   
782  O  O   . ILE A 140 ? 3.2056 1.3588 2.0211 0.1172  0.1051  0.3590  140 ILE A O   
783  C  CB  . ILE A 140 ? 3.1531 1.3190 2.0332 0.0543  0.0971  0.2743  140 ILE A CB  
784  C  CG1 . ILE A 140 ? 3.1848 1.3234 2.0818 -0.0048 0.0992  0.2650  140 ILE A CG1 
785  C  CG2 . ILE A 140 ? 3.2620 1.3258 2.0985 0.0933  0.0898  0.2781  140 ILE A CG2 
786  C  CD1 . ILE A 140 ? 3.2908 1.4168 2.1994 -0.0110 0.0869  0.2221  140 ILE A CD1 
787  N  N   . LEU A 141 ? 2.9915 1.2901 1.8656 0.1403  0.0957  0.3103  141 LEU A N   
788  C  CA  . LEU A 141 ? 2.9766 1.2949 1.8366 0.1920  0.0876  0.3234  141 LEU A CA  
789  C  C   . LEU A 141 ? 3.0220 1.3603 1.8620 0.1922  0.0919  0.3604  141 LEU A C   
790  O  O   . LEU A 141 ? 3.0711 1.3695 1.8789 0.2264  0.0856  0.3838  141 LEU A O   
791  C  CB  . LEU A 141 ? 2.8793 1.2867 1.7745 0.2182  0.0798  0.2957  141 LEU A CB  
792  C  CG  . LEU A 141 ? 2.9495 1.3306 1.8501 0.2452  0.0733  0.2655  141 LEU A CG  
793  C  CD1 . LEU A 141 ? 2.8514 1.3234 1.7929 0.2466  0.0712  0.2356  141 LEU A CD1 
794  C  CD2 . LEU A 141 ? 3.0338 1.3777 1.9123 0.3006  0.0653  0.2770  141 LEU A CD2 
795  N  N   . VAL A 142 ? 2.9173 1.3166 1.7743 0.1565  0.1024  0.3656  142 VAL A N   
796  C  CA  . VAL A 142 ? 2.9175 1.3395 1.7519 0.1539  0.1088  0.3983  142 VAL A CA  
797  C  C   . VAL A 142 ? 3.0744 1.4049 1.8671 0.1361  0.1194  0.4331  142 VAL A C   
798  O  O   . VAL A 142 ? 3.1138 1.4309 1.8698 0.1511  0.1204  0.4652  142 VAL A O   
799  C  CB  . VAL A 142 ? 2.8743 1.3899 1.7381 0.1260  0.1182  0.3910  142 VAL A CB  
800  C  CG1 . VAL A 142 ? 2.8703 1.3801 1.7553 0.0732  0.1344  0.3863  142 VAL A CG1 
801  C  CG2 . VAL A 142 ? 2.8722 1.4193 1.7079 0.1359  0.1211  0.4191  142 VAL A CG2 
802  N  N   . LEU A 143 ? 3.0691 1.3333 1.8652 0.1052  0.1255  0.4270  143 LEU A N   
803  C  CA  . LEU A 143 ? 3.1663 1.3358 1.9258 0.0852  0.1351  0.4590  143 LEU A CA  
804  C  C   . LEU A 143 ? 3.2947 1.3803 2.0124 0.1300  0.1225  0.4730  143 LEU A C   
805  O  O   . LEU A 143 ? 3.3802 1.4035 2.0559 0.1315  0.1277  0.5099  143 LEU A O   
806  C  CB  . LEU A 143 ? 3.1919 1.3181 1.9719 0.0357  0.1425  0.4464  143 LEU A CB  
807  C  CG  . LEU A 143 ? 3.1848 1.3797 2.0031 -0.0152 0.1584  0.4440  143 LEU A CG  
808  C  CD1 . LEU A 143 ? 3.1963 1.3639 2.0454 -0.0560 0.1570  0.4201  143 LEU A CD1 
809  C  CD2 . LEU A 143 ? 3.2540 1.4399 2.0496 -0.0397 0.1786  0.4868  143 LEU A CD2 
810  N  N   . ILE A 144 ? 3.2250 1.3117 1.9540 0.1685  0.1070  0.4449  144 ILE A N   
811  C  CA  . ILE A 144 ? 3.2960 1.3136 1.9926 0.2184  0.0944  0.4536  144 ILE A CA  
812  C  C   . ILE A 144 ? 3.3242 1.3904 2.0057 0.2606  0.0854  0.4760  144 ILE A C   
813  O  O   . ILE A 144 ? 3.4139 1.4185 2.0531 0.2838  0.0816  0.5083  144 ILE A O   
814  C  CB  . ILE A 144 ? 3.3268 1.3271 2.0417 0.2431  0.0843  0.4145  144 ILE A CB  
815  C  CG1 . ILE A 144 ? 3.3818 1.3106 2.0980 0.2014  0.0898  0.3963  144 ILE A CG1 
816  C  CG2 . ILE A 144 ? 3.3958 1.3423 2.0834 0.3037  0.0719  0.4224  144 ILE A CG2 
817  C  CD1 . ILE A 144 ? 3.4323 1.3755 2.1745 0.2090  0.0831  0.3504  144 ILE A CD1 
818  N  N   . ILE A 145 ? 3.1614 1.3356 1.8762 0.2691  0.0806  0.4596  145 ILE A N   
819  C  CA  . ILE A 145 ? 3.3809 1.6099 2.0859 0.3054  0.0687  0.4768  145 ILE A CA  
820  C  C   . ILE A 145 ? 3.4860 1.7526 2.1741 0.2763  0.0791  0.5009  145 ILE A C   
821  O  O   . ILE A 145 ? 2.9005 1.1072 1.5543 0.2517  0.0921  0.5291  145 ILE A O   
822  C  CB  . ILE A 145 ? 3.3201 1.6399 2.0688 0.3352  0.0553  0.4465  145 ILE A CB  
823  C  CG1 . ILE A 145 ? 3.3204 1.6145 2.0927 0.3535  0.0521  0.4144  145 ILE A CG1 
824  C  CG2 . ILE A 145 ? 3.3259 1.6851 2.0635 0.3795  0.0374  0.4654  145 ILE A CG2 
825  C  CD1 . ILE A 145 ? 3.3631 1.7065 2.2543 0.3621  0.0286  0.4205  145 ILE A CD1 
826  N  N   . GLU A 171 ? 2.0949 1.7640 1.2470 -0.0431 0.4458  0.3128  171 GLU A N   
827  C  CA  . GLU A 171 ? 2.0289 1.7056 1.1996 -0.0305 0.4098  0.2813  171 GLU A CA  
828  C  C   . GLU A 171 ? 2.0262 1.6906 1.2448 -0.0503 0.3831  0.2743  171 GLU A C   
829  O  O   . GLU A 171 ? 1.9643 1.6412 1.2076 -0.0435 0.3564  0.2497  171 GLU A O   
830  C  CB  . GLU A 171 ? 2.0678 1.7104 1.1675 -0.0008 0.3888  0.2709  171 GLU A CB  
831  C  CG  . GLU A 171 ? 2.1733 1.8417 1.2834 0.0180  0.3685  0.2399  171 GLU A CG  
832  C  CD  . GLU A 171 ? 2.5049 2.1444 1.5457 0.0453  0.3499  0.2299  171 GLU A CD  
833  O  OE1 . GLU A 171 ? 2.4795 2.0825 1.4950 0.0496  0.3228  0.2308  171 GLU A OE1 
834  O  OE2 . GLU A 171 ? 2.4356 2.0892 1.4483 0.0629  0.3614  0.2203  171 GLU A OE2 
835  N  N   . VAL A 172 ? 2.0087 1.6469 1.2385 -0.0750 0.3910  0.2959  172 VAL A N   
836  C  CA  . VAL A 172 ? 1.9779 1.5968 1.2467 -0.0943 0.3677  0.2898  172 VAL A CA  
837  C  C   . VAL A 172 ? 1.9617 1.6318 1.3086 -0.1167 0.3699  0.2787  172 VAL A C   
838  O  O   . VAL A 172 ? 1.9214 1.5857 1.3011 -0.1264 0.3452  0.2635  172 VAL A O   
839  C  CB  . VAL A 172 ? 2.0923 1.6526 1.3376 -0.1105 0.3705  0.3148  172 VAL A CB  
840  C  CG1 . VAL A 172 ? 2.0709 1.5927 1.3238 -0.1117 0.3370  0.3014  172 VAL A CG1 
841  C  CG2 . VAL A 172 ? 2.1578 1.6800 1.3271 -0.0922 0.3824  0.3360  172 VAL A CG2 
842  N  N   . LEU A 173 ? 1.9100 1.6313 1.2862 -0.1233 0.3989  0.2863  173 LEU A N   
843  C  CA  . LEU A 173 ? 1.8588 1.6370 1.3113 -0.1410 0.3999  0.2760  173 LEU A CA  
844  C  C   . LEU A 173 ? 1.8598 1.6662 1.3200 -0.1165 0.3792  0.2461  173 LEU A C   
845  O  O   . LEU A 173 ? 1.8074 1.6358 1.3159 -0.1257 0.3590  0.2291  173 LEU A O   
846  C  CB  . LEU A 173 ? 1.8771 1.7055 1.3619 -0.1534 0.4390  0.2958  173 LEU A CB  
847  C  CG  . LEU A 173 ? 1.8797 1.7809 1.4426 -0.1626 0.4421  0.2843  173 LEU A CG  
848  C  CD1 . LEU A 173 ? 1.8552 1.7608 1.4792 -0.1961 0.4210  0.2802  173 LEU A CD1 
849  C  CD2 . LEU A 173 ? 1.9360 1.8886 1.5219 -0.1657 0.4839  0.3043  173 LEU A CD2 
850  N  N   . ASP A 174 ? 1.8318 1.6319 1.2395 -0.0859 0.3822  0.2401  174 ASP A N   
851  C  CA  . ASP A 174 ? 1.7871 1.6042 1.1912 -0.0613 0.3628  0.2136  174 ASP A CA  
852  C  C   . ASP A 174 ? 1.8001 1.5911 1.2077 -0.0606 0.3255  0.1961  174 ASP A C   
853  O  O   . ASP A 174 ? 1.7483 1.5618 1.1763 -0.0503 0.3079  0.1748  174 ASP A O   
854  C  CB  . ASP A 174 ? 1.8449 1.6470 1.1828 -0.0317 0.3710  0.2122  174 ASP A CB  
855  C  CG  . ASP A 174 ? 2.0198 1.8587 1.3568 -0.0234 0.4069  0.2202  174 ASP A CG  
856  O  OD1 . ASP A 174 ? 1.9958 1.8827 1.3777 -0.0193 0.4116  0.2077  174 ASP A OD1 
857  O  OD2 . ASP A 174 ? 2.1596 1.9788 1.4482 -0.0187 0.4306  0.2392  174 ASP A OD2 
858  N  N   . CYS A 175 ? 1.7859 1.5295 1.1743 -0.0710 0.3147  0.2058  175 CYS A N   
859  C  CA  . CYS A 175 ? 1.7626 1.4799 1.1550 -0.0704 0.2828  0.1913  175 CYS A CA  
860  C  C   . CYS A 175 ? 1.7677 1.5129 1.2232 -0.0917 0.2739  0.1806  175 CYS A C   
861  O  O   . CYS A 175 ? 1.7243 1.4829 1.1972 -0.0839 0.2522  0.1600  175 CYS A O   
862  C  CB  . CYS A 175 ? 1.8195 1.4778 1.1742 -0.0737 0.2773  0.2062  175 CYS A CB  
863  S  SG  . CYS A 175 ? 1.9204 1.5426 1.1964 -0.0464 0.2797  0.2178  175 CYS A SG  
864  N  N   . PHE A 176 ? 1.7328 1.4880 1.2225 -0.1194 0.2903  0.1953  176 PHE A N   
865  C  CA  . PHE A 176 ? 1.6983 1.4808 1.2488 -0.1434 0.2813  0.1871  176 PHE A CA  
866  C  C   . PHE A 176 ? 1.6741 1.5179 1.2645 -0.1351 0.2802  0.1719  176 PHE A C   
867  O  O   . PHE A 176 ? 1.6345 1.4946 1.2592 -0.1414 0.2595  0.1556  176 PHE A O   
868  C  CB  . PHE A 176 ? 1.7646 1.5488 1.3443 -0.1760 0.3005  0.2086  176 PHE A CB  
869  C  CG  . PHE A 176 ? 1.8433 1.5621 1.3953 -0.1907 0.2954  0.2211  176 PHE A CG  
870  C  CD1 . PHE A 176 ? 1.8857 1.5744 1.4515 -0.2050 0.2703  0.2087  176 PHE A CD1 
871  C  CD2 . PHE A 176 ? 1.9346 1.6191 1.4443 -0.1898 0.3164  0.2458  176 PHE A CD2 
872  C  CE1 . PHE A 176 ? 1.9535 1.5764 1.4921 -0.2168 0.2659  0.2196  176 PHE A CE1 
873  C  CE2 . PHE A 176 ? 2.0252 1.6453 1.5088 -0.2024 0.3114  0.2588  176 PHE A CE2 
874  C  CZ  . PHE A 176 ? 1.9990 1.5878 1.4981 -0.2155 0.2863  0.2452  176 PHE A CZ  
875  N  N   . LEU A 177 ? 1.6125 1.4869 1.1941 -0.1189 0.3022  0.1771  177 LEU A N   
876  C  CA  . LEU A 177 ? 1.5588 1.4881 1.1734 -0.1063 0.3041  0.1641  177 LEU A CA  
877  C  C   . LEU A 177 ? 1.5555 1.4759 1.1486 -0.0818 0.2791  0.1416  177 LEU A C   
878  O  O   . LEU A 177 ? 1.5094 1.4617 1.1397 -0.0806 0.2653  0.1270  177 LEU A O   
879  C  CB  . LEU A 177 ? 1.5804 1.5392 1.1869 -0.0940 0.3376  0.1764  177 LEU A CB  
880  C  CG  . LEU A 177 ? 1.6732 1.6514 1.3062 -0.1174 0.3677  0.2014  177 LEU A CG  
881  C  CD1 . LEU A 177 ? 1.7187 1.6962 1.3089 -0.1002 0.4003  0.2160  177 LEU A CD1 
882  C  CD2 . LEU A 177 ? 1.6712 1.7136 1.3826 -0.1341 0.3724  0.2011  177 LEU A CD2 
883  N  N   . ASP A 178 ? 1.5188 1.3973 1.0535 -0.0632 0.2725  0.1399  178 ASP A N   
884  C  CA  . ASP A 178 ? 1.4861 1.3548 1.0004 -0.0422 0.2487  0.1208  178 ASP A CA  
885  C  C   . ASP A 178 ? 1.5108 1.3704 1.0476 -0.0515 0.2217  0.1086  178 ASP A C   
886  O  O   . ASP A 178 ? 1.4710 1.3465 1.0201 -0.0413 0.2049  0.0924  178 ASP A O   
887  C  CB  . ASP A 178 ? 1.5392 1.3671 0.9898 -0.0235 0.2460  0.1238  178 ASP A CB  
888  C  CG  . ASP A 178 ? 1.7032 1.5387 1.1206 -0.0065 0.2670  0.1284  178 ASP A CG  
889  O  OD1 . ASP A 178 ? 1.6981 1.5731 1.1424 -0.0028 0.2815  0.1245  178 ASP A OD1 
890  O  OD2 . ASP A 178 ? 1.8202 1.6213 1.1829 0.0046  0.2686  0.1357  178 ASP A OD2 
891  N  N   . LEU A 179 ? 1.4836 1.3155 1.0237 -0.0706 0.2185  0.1167  179 LEU A N   
892  C  CA  . LEU A 179 ? 1.4602 1.2783 1.0172 -0.0801 0.1955  0.1054  179 LEU A CA  
893  C  C   . LEU A 179 ? 1.4809 1.3443 1.0923 -0.0932 0.1907  0.0961  179 LEU A C   
894  O  O   . LEU A 179 ? 1.4479 1.3213 1.0703 -0.0866 0.1711  0.0801  179 LEU A O   
895  C  CB  . LEU A 179 ? 1.5002 1.2735 1.0453 -0.0975 0.1961  0.1169  179 LEU A CB  
896  C  CG  . LEU A 179 ? 1.5527 1.3036 1.1092 -0.1075 0.1742  0.1046  179 LEU A CG  
897  C  CD1 . LEU A 179 ? 1.5501 1.2661 1.0696 -0.0860 0.1579  0.0967  179 LEU A CD1 
898  C  CD2 . LEU A 179 ? 1.6281 1.3503 1.1940 -0.1346 0.1791  0.1157  179 LEU A CD2 
899  N  N   . ALA A 180 ? 1.4377 1.3316 1.0837 -0.1109 0.2089  0.1077  180 ALA A N   
900  C  CA  . ALA A 180 ? 1.4016 1.3452 1.1045 -0.1242 0.2056  0.1024  180 ALA A CA  
901  C  C   . ALA A 180 ? 1.3978 1.3775 1.1096 -0.1013 0.2006  0.0896  180 ALA A C   
902  O  O   . ALA A 180 ? 1.3607 1.3624 1.1015 -0.1036 0.1824  0.0773  180 ALA A O   
903  C  CB  . ALA A 180 ? 1.4335 1.4074 1.1704 -0.1435 0.2305  0.1207  180 ALA A CB  
904  N  N   . ARG A 181 ? 1.3542 1.3342 1.0360 -0.0788 0.2152  0.0922  181 ARG A N   
905  C  CA  . ARG A 181 ? 1.3217 1.3254 1.0032 -0.0551 0.2114  0.0803  181 ARG A CA  
906  C  C   . ARG A 181 ? 1.3511 1.3342 1.0171 -0.0458 0.1838  0.0646  181 ARG A C   
907  O  O   . ARG A 181 ? 1.3194 1.3281 1.0092 -0.0394 0.1717  0.0540  181 ARG A O   
908  C  CB  . ARG A 181 ? 1.3323 1.3257 0.9721 -0.0340 0.2304  0.0850  181 ARG A CB  
909  C  CG  . ARG A 181 ? 1.4671 1.4974 1.1277 -0.0336 0.2604  0.0968  181 ARG A CG  
910  C  CD  . ARG A 181 ? 1.5956 1.6136 1.2087 -0.0083 0.2766  0.0967  181 ARG A CD  
911  N  NE  . ARG A 181 ? 1.7099 1.6977 1.2814 -0.0118 0.2949  0.1126  181 ARG A NE  
912  C  CZ  . ARG A 181 ? 1.8924 1.8986 1.4643 -0.0128 0.3269  0.1281  181 ARG A CZ  
913  N  NH1 . ARG A 181 ? 1.7998 1.7736 1.3277 -0.0156 0.3420  0.1437  181 ARG A NH1 
914  N  NH2 . ARG A 181 ? 1.6622 1.7204 1.2787 -0.0099 0.3449  0.1295  181 ARG A NH2 
915  N  N   . ASN A 182 ? 1.3207 1.2591 0.9488 -0.0446 0.1744  0.0645  182 ASN A N   
916  C  CA  . ASN A 182 ? 1.2976 1.2167 0.9101 -0.0353 0.1512  0.0520  182 ASN A CA  
917  C  C   . ASN A 182 ? 1.3250 1.2512 0.9664 -0.0488 0.1334  0.0433  182 ASN A C   
918  O  O   . ASN A 182 ? 1.2972 1.2277 0.9388 -0.0392 0.1172  0.0322  182 ASN A O   
919  C  CB  . ASN A 182 ? 1.3321 1.2066 0.8997 -0.0284 0.1479  0.0562  182 ASN A CB  
920  C  CG  . ASN A 182 ? 1.5729 1.4392 1.1048 -0.0097 0.1551  0.0587  182 ASN A CG  
921  O  OD1 . ASN A 182 ? 1.4533 1.3349 0.9842 0.0043  0.1503  0.0498  182 ASN A OD1 
922  N  ND2 . ASN A 182 ? 1.5029 1.3409 1.0013 -0.0089 0.1651  0.0708  182 ASN A ND2 
923  N  N   . ILE A 183 ? 1.2851 1.2121 0.9496 -0.0715 0.1361  0.0485  183 ILE A N   
924  C  CA  . ILE A 183 ? 1.2647 1.1966 0.9537 -0.0861 0.1180  0.0390  183 ILE A CA  
925  C  C   . ILE A 183 ? 1.2800 1.2592 1.0038 -0.0815 0.1103  0.0314  183 ILE A C   
926  O  O   . ILE A 183 ? 1.2632 1.2447 0.9921 -0.0813 0.0911  0.0203  183 ILE A O   
927  C  CB  . ILE A 183 ? 1.3281 1.2487 1.0344 -0.1139 0.1217  0.0466  183 ILE A CB  
928  C  CG1 . ILE A 183 ? 1.3698 1.2341 1.0368 -0.1156 0.1235  0.0517  183 ILE A CG1 
929  C  CG2 . ILE A 183 ? 1.3187 1.2514 1.0542 -0.1310 0.1020  0.0358  183 ILE A CG2 
930  C  CD1 . ILE A 183 ? 1.5349 1.3830 1.2067 -0.1370 0.1391  0.0678  183 ILE A CD1 
931  N  N   . PHE A 184 ? 1.2183 1.2325 0.9612 -0.0747 0.1261  0.0378  184 PHE A N   
932  C  CA  . PHE A 184 ? 1.1812 1.2405 0.9576 -0.0664 0.1220  0.0332  184 PHE A CA  
933  C  C   . PHE A 184 ? 1.2105 1.2719 0.9654 -0.0397 0.1299  0.0312  184 PHE A C   
934  O  O   . PHE A 184 ? 1.2059 1.2898 0.9711 -0.0325 0.1493  0.0378  184 PHE A O   
935  C  CB  . PHE A 184 ? 1.2066 1.3101 1.0329 -0.0823 0.1340  0.0425  184 PHE A CB  
936  C  CG  . PHE A 184 ? 1.2374 1.3374 1.0866 -0.1122 0.1248  0.0446  184 PHE A CG  
937  C  CD1 . PHE A 184 ? 1.3059 1.3783 1.1439 -0.1296 0.1375  0.0552  184 PHE A CD1 
938  C  CD2 . PHE A 184 ? 1.2452 1.3663 1.1246 -0.1234 0.1023  0.0361  184 PHE A CD2 
939  C  CE1 . PHE A 184 ? 1.3351 1.3986 1.1932 -0.1589 0.1277  0.0565  184 PHE A CE1 
940  C  CE2 . PHE A 184 ? 1.2998 1.4137 1.1977 -0.1524 0.0913  0.0362  184 PHE A CE2 
941  C  CZ  . PHE A 184 ? 1.3078 1.3915 1.1954 -0.1706 0.1040  0.0460  184 PHE A CZ  
942  N  N   . PRO A 185 ? 1.1596 1.1967 0.8841 -0.0251 0.1159  0.0223  185 PRO A N   
943  C  CA  . PRO A 185 ? 1.1528 1.1865 0.8554 -0.0025 0.1209  0.0196  185 PRO A CA  
944  C  C   . PRO A 185 ? 1.1804 1.2505 0.9115 0.0096  0.1226  0.0168  185 PRO A C   
945  O  O   . PRO A 185 ? 1.1578 1.2507 0.9184 0.0056  0.1091  0.0132  185 PRO A O   
946  C  CB  . PRO A 185 ? 1.1644 1.1684 0.8381 0.0045  0.1026  0.0121  185 PRO A CB  
947  C  CG  . PRO A 185 ? 1.2133 1.2191 0.9030 -0.0091 0.0872  0.0083  185 PRO A CG  
948  C  CD  . PRO A 185 ? 1.1741 1.1857 0.8827 -0.0288 0.0960  0.0147  185 PRO A CD  
949  N  N   . SER A 186 ? 1.1453 1.2183 0.8642 0.0261  0.1389  0.0181  186 SER A N   
950  C  CA  . SER A 186 ? 1.1390 1.2419 0.8805 0.0426  0.1438  0.0155  186 SER A CA  
951  C  C   . SER A 186 ? 1.1643 1.2539 0.8938 0.0570  0.1249  0.0059  186 SER A C   
952  O  O   . SER A 186 ? 1.1518 1.2637 0.9029 0.0703  0.1239  0.0036  186 SER A O   
953  C  CB  . SER A 186 ? 1.2349 1.3374 0.9582 0.0577  0.1689  0.0187  186 SER A CB  
954  O  OG  . SER A 186 ? 1.4243 1.4827 1.0938 0.0670  0.1671  0.0142  186 SER A OG  
955  N  N   . ASN A 187 ? 1.1180 1.1712 0.8137 0.0553  0.1109  0.0017  187 ASN A N   
956  C  CA  . ASN A 187 ? 1.1044 1.1415 0.7869 0.0654  0.0931  -0.0052 187 ASN A CA  
957  C  C   . ASN A 187 ? 1.1465 1.1606 0.8121 0.0548  0.0771  -0.0063 187 ASN A C   
958  O  O   . ASN A 187 ? 1.1487 1.1389 0.7878 0.0512  0.0800  -0.0047 187 ASN A O   
959  C  CB  . ASN A 187 ? 1.1010 1.1155 0.7523 0.0837  0.0985  -0.0100 187 ASN A CB  
960  C  CG  . ASN A 187 ? 1.2904 1.2918 0.9360 0.0937  0.0819  -0.0158 187 ASN A CG  
961  O  OD1 . ASN A 187 ? 1.1946 1.1711 0.8192 0.0901  0.0679  -0.0177 187 ASN A OD1 
962  N  ND2 . ASN A 187 ? 1.1745 1.1940 0.8415 0.1064  0.0831  -0.0173 187 ASN A ND2 
963  N  N   . LEU A 188 ? 1.0875 1.1096 0.7677 0.0515  0.0610  -0.0082 188 LEU A N   
964  C  CA  . LEU A 188 ? 1.0790 1.0840 0.7458 0.0436  0.0479  -0.0090 188 LEU A CA  
965  C  C   . LEU A 188 ? 1.1525 1.1309 0.7911 0.0511  0.0414  -0.0104 188 LEU A C   
966  O  O   . LEU A 188 ? 1.1544 1.1166 0.7773 0.0461  0.0382  -0.0092 188 LEU A O   
967  C  CB  . LEU A 188 ? 1.0644 1.0859 0.7504 0.0392  0.0342  -0.0102 188 LEU A CB  
968  C  CG  . LEU A 188 ? 1.1240 1.1741 0.8409 0.0294  0.0346  -0.0096 188 LEU A CG  
969  C  CD1 . LEU A 188 ? 1.1209 1.1887 0.8534 0.0315  0.0190  -0.0107 188 LEU A CD1 
970  C  CD2 . LEU A 188 ? 1.1585 1.1994 0.8721 0.0128  0.0357  -0.0098 188 LEU A CD2 
971  N  N   . VAL A 189 ? 1.1181 1.0919 0.7519 0.0630  0.0383  -0.0127 189 VAL A N   
972  C  CA  . VAL A 189 ? 1.1206 1.0695 0.7309 0.0681  0.0297  -0.0141 189 VAL A CA  
973  C  C   . VAL A 189 ? 1.2075 1.1371 0.7914 0.0690  0.0367  -0.0146 189 VAL A C   
974  O  O   . VAL A 189 ? 1.2087 1.1225 0.7766 0.0662  0.0284  -0.0134 189 VAL A O   
975  C  CB  . VAL A 189 ? 1.1702 1.1135 0.7811 0.0795  0.0242  -0.0170 189 VAL A CB  
976  C  CG1 . VAL A 189 ? 1.1821 1.0967 0.7687 0.0816  0.0143  -0.0190 189 VAL A CG1 
977  C  CG2 . VAL A 189 ? 1.1511 1.1103 0.7837 0.0785  0.0148  -0.0140 189 VAL A CG2 
978  N  N   . SER A 190 ? 1.1891 1.1228 0.7696 0.0731  0.0523  -0.0150 190 SER A N   
979  C  CA  . SER A 190 ? 1.2140 1.1300 0.7657 0.0746  0.0614  -0.0138 190 SER A CA  
980  C  C   . SER A 190 ? 1.2799 1.1923 0.8296 0.0630  0.0609  -0.0077 190 SER A C   
981  O  O   . SER A 190 ? 1.2817 1.1745 0.8087 0.0633  0.0535  -0.0063 190 SER A O   
982  C  CB  . SER A 190 ? 1.2599 1.1866 0.8123 0.0814  0.0817  -0.0134 190 SER A CB  
983  O  OG  . SER A 190 ? 1.3500 1.2663 0.8807 0.0782  0.0941  -0.0081 190 SER A OG  
984  N  N   . ALA A 191 ? 1.2387 1.1691 0.8132 0.0531  0.0665  -0.0044 191 ALA A N   
985  C  CA  . ALA A 191 ? 1.2395 1.1632 0.8136 0.0420  0.0668  0.0003  191 ALA A CA  
986  C  C   . ALA A 191 ? 1.2932 1.2012 0.8549 0.0428  0.0529  0.0002  191 ALA A C   
987  O  O   . ALA A 191 ? 1.3037 1.1957 0.8515 0.0402  0.0540  0.0045  191 ALA A O   
988  C  CB  . ALA A 191 ? 1.2351 1.1795 0.8399 0.0309  0.0677  0.0002  191 ALA A CB  
989  N  N   . ALA A 192 ? 1.2411 1.1539 0.8085 0.0470  0.0406  -0.0034 192 ALA A N   
990  C  CA  . ALA A 192 ? 1.2347 1.1401 0.7966 0.0481  0.0285  -0.0022 192 ALA A CA  
991  C  C   . ALA A 192 ? 1.2958 1.1835 0.8341 0.0534  0.0237  0.0003  192 ALA A C   
992  O  O   . ALA A 192 ? 1.2963 1.1816 0.8337 0.0542  0.0147  0.0033  192 ALA A O   
993  C  CB  . ALA A 192 ? 1.2270 1.1439 0.8029 0.0495  0.0185  -0.0043 192 ALA A CB  
994  N  N   . PHE A 193 ? 1.2525 1.1294 0.7713 0.0577  0.0295  -0.0006 193 PHE A N   
995  C  CA  . PHE A 193 ? 1.2723 1.1307 0.7636 0.0627  0.0225  0.0009  193 PHE A CA  
996  C  C   . PHE A 193 ? 1.3576 1.2017 0.8213 0.0665  0.0352  0.0027  193 PHE A C   
997  O  O   . PHE A 193 ? 1.3821 1.2086 0.8167 0.0716  0.0289  0.0038  193 PHE A O   
998  C  CB  . PHE A 193 ? 1.2998 1.1543 0.7878 0.0658  0.0080  -0.0043 193 PHE A CB  
999  C  CG  . PHE A 193 ? 1.3410 1.1897 0.8196 0.0716  0.0136  -0.0116 193 PHE A CG  
1000 C  CD1 . PHE A 193 ? 1.3681 1.2314 0.8699 0.0720  0.0179  -0.0147 193 PHE A CD1 
1001 C  CD2 . PHE A 193 ? 1.4100 1.2377 0.8541 0.0787  0.0146  -0.0156 193 PHE A CD2 
1002 C  CE1 . PHE A 193 ? 1.4009 1.2590 0.8954 0.0808  0.0242  -0.0212 193 PHE A CE1 
1003 C  CE2 . PHE A 193 ? 1.4660 1.2863 0.8986 0.0873  0.0222  -0.0235 193 PHE A CE2 
1004 C  CZ  . PHE A 193 ? 1.4258 1.2623 0.8857 0.0890  0.0278  -0.0260 193 PHE A CZ  
1005 N  N   . ARG A 194 ? 1.3098 1.1631 0.7827 0.0638  0.0527  0.0038  194 ARG A N   
1006 C  CA  . ARG A 194 ? 1.3310 1.1754 0.7811 0.0668  0.0695  0.0075  194 ARG A CA  
1007 C  C   . ARG A 194 ? 1.3839 1.2354 0.8485 0.0570  0.0849  0.0155  194 ARG A C   
1008 O  O   . ARG A 194 ? 1.3537 1.2244 0.8513 0.0489  0.0863  0.0141  194 ARG A O   
1009 C  CB  . ARG A 194 ? 1.3330 1.1851 0.7820 0.0747  0.0788  0.0008  194 ARG A CB  
1010 C  CG  . ARG A 194 ? 1.4823 1.3131 0.8964 0.0860  0.0704  -0.0064 194 ARG A CG  
1011 C  CD  . ARG A 194 ? 1.6176 1.4551 1.0337 0.0960  0.0815  -0.0140 194 ARG A CD  
1012 N  NE  . ARG A 194 ? 1.8251 1.6359 1.2033 0.1074  0.0729  -0.0235 194 ARG A NE  
1013 C  CZ  . ARG A 194 ? 2.0702 1.8772 1.4440 0.1192  0.0772  -0.0331 194 ARG A CZ  
1014 N  NH1 . ARG A 194 ? 1.8625 1.6956 1.2711 0.1222  0.0899  -0.0329 194 ARG A NH1 
1015 N  NH2 . ARG A 194 ? 1.9925 1.7680 1.3264 0.1288  0.0673  -0.0433 194 ARG A NH2 
1016 N  N   . SER A 195 ? 1.3826 1.2174 0.8208 0.0571  0.0961  0.0242  195 SER A N   
1017 C  CA  . SER A 195 ? 1.3960 1.2319 0.8435 0.0460  0.1124  0.0340  195 SER A CA  
1018 C  C   . SER A 195 ? 1.4640 1.3028 0.8954 0.0495  0.1345  0.0394  195 SER A C   
1019 O  O   . SER A 195 ? 1.4768 1.3060 0.8772 0.0625  0.1348  0.0355  195 SER A O   
1020 C  CB  . SER A 195 ? 1.4783 1.2873 0.9063 0.0434  0.1074  0.0430  195 SER A CB  
1021 O  OG  . SER A 195 ? 1.6106 1.4195 1.0562 0.0413  0.0912  0.0387  195 SER A OG  
1022 N  N   . TYR A 196 ? 1.4276 1.2793 0.8793 0.0377  0.1531  0.0481  196 TYR A N   
1023 C  CA  . TYR A 196 ? 1.4592 1.3181 0.8983 0.0409  0.1781  0.0557  196 TYR A CA  
1024 C  C   . TYR A 196 ? 1.5876 1.4163 0.9881 0.0385  0.1880  0.0705  196 TYR A C   
1025 O  O   . TYR A 196 ? 1.5860 1.3991 0.9918 0.0262  0.1838  0.0786  196 TYR A O   
1026 C  CB  . TYR A 196 ? 1.4483 1.3446 0.9357 0.0289  0.1946  0.0594  196 TYR A CB  
1027 C  CG  . TYR A 196 ? 1.4795 1.3957 0.9630 0.0381  0.2208  0.0636  196 TYR A CG  
1028 C  CD1 . TYR A 196 ? 1.5432 1.4520 1.0057 0.0342  0.2450  0.0793  196 TYR A CD1 
1029 C  CD2 . TYR A 196 ? 1.4705 1.4128 0.9715 0.0516  0.2230  0.0529  196 TYR A CD2 
1030 C  CE1 . TYR A 196 ? 1.5715 1.5005 1.0287 0.0447  0.2724  0.0838  196 TYR A CE1 
1031 C  CE2 . TYR A 196 ? 1.5068 1.4682 1.0043 0.0634  0.2493  0.0563  196 TYR A CE2 
1032 C  CZ  . TYR A 196 ? 1.6218 1.5783 1.0977 0.0600  0.2750  0.0716  196 TYR A CZ  
1033 O  OH  . TYR A 196 ? 1.6372 1.6147 1.1085 0.0733  0.3041  0.0756  196 TYR A OH  
1034 N  N   . SER A 197 ? 1.6057 1.4226 0.9634 0.0517  0.2007  0.0739  197 SER A N   
1035 C  CA  . SER A 197 ? 1.6660 1.4538 0.9796 0.0520  0.2120  0.0896  197 SER A CA  
1036 C  C   . SER A 197 ? 1.7700 1.5619 1.0517 0.0637  0.2376  0.0937  197 SER A C   
1037 O  O   . SER A 197 ? 1.7994 1.5730 1.0344 0.0812  0.2317  0.0862  197 SER A O   
1038 C  CB  . SER A 197 ? 1.7428 1.4957 1.0173 0.0605  0.1878  0.0884  197 SER A CB  
1039 O  OG  . SER A 197 ? 1.9588 1.6826 1.1930 0.0602  0.1974  0.1060  197 SER A OG  
1040 N  N   . THR A 198 ? 1.7352 1.5522 1.0431 0.0537  0.2660  0.1054  198 THR A N   
1041 C  CA  . THR A 198 ? 1.7703 1.6001 1.0574 0.0643  0.2972  0.1115  198 THR A CA  
1042 C  C   . THR A 198 ? 1.8960 1.6857 1.1074 0.0768  0.3032  0.1203  198 THR A C   
1043 O  O   . THR A 198 ? 1.9111 1.6692 1.0985 0.0699  0.2924  0.1314  198 THR A O   
1044 C  CB  . THR A 198 ? 1.8153 1.6827 1.1536 0.0465  0.3252  0.1266  198 THR A CB  
1045 O  OG1 . THR A 198 ? 1.8161 1.7140 1.1569 0.0603  0.3527  0.1257  198 THR A OG1 
1046 C  CG2 . THR A 198 ? 1.8132 1.6609 1.1405 0.0281  0.3390  0.1506  198 THR A CG2 
1047 N  N   . THR A 199 ? 1.8964 1.6849 1.0672 0.0975  0.3178  0.1137  199 THR A N   
1048 C  CA  . THR A 199 ? 2.3553 2.1057 1.4459 0.1128  0.3228  0.1191  199 THR A CA  
1049 C  C   . THR A 199 ? 2.8476 2.6113 1.9150 0.1213  0.3652  0.1311  199 THR A C   
1050 O  O   . THR A 199 ? 2.4438 2.1785 1.4464 0.1296  0.3775  0.1430  199 THR A O   
1051 C  CB  . THR A 199 ? 2.4566 2.1821 1.5053 0.1320  0.2946  0.0964  199 THR A CB  
1052 O  OG1 . THR A 199 ? 2.4337 2.1834 1.5038 0.1440  0.3015  0.0787  199 THR A OG1 
1053 C  CG2 . THR A 199 ? 2.3981 2.1090 1.4626 0.1241  0.2545  0.0887  199 THR A CG2 
1054 N  N   . GLN A 216 ? 1.8408 1.6436 1.0597 0.1382  0.2343  0.0280  216 GLN A N   
1055 C  CA  . GLN A 216 ? 1.8147 1.6361 1.0724 0.1173  0.2415  0.0453  216 GLN A CA  
1056 C  C   . GLN A 216 ? 1.8090 1.6371 1.1107 0.1020  0.2142  0.0419  216 GLN A C   
1057 O  O   . GLN A 216 ? 1.7760 1.6107 1.1038 0.0849  0.2154  0.0537  216 GLN A O   
1058 C  CB  . GLN A 216 ? 1.8304 1.6919 1.1274 0.1133  0.2747  0.0555  216 GLN A CB  
1059 C  CG  . GLN A 216 ? 2.1668 2.0208 1.4201 0.1218  0.3065  0.0681  216 GLN A CG  
1060 C  CD  . GLN A 216 ? 2.5506 2.4499 1.8444 0.1209  0.3418  0.0780  216 GLN A CD  
1061 O  OE1 . GLN A 216 ? 2.5032 2.4364 1.8403 0.1276  0.3453  0.0688  216 GLN A OE1 
1062 N  NE2 . GLN A 216 ? 2.5362 2.4375 1.8152 0.1141  0.3698  0.0982  216 GLN A NE2 
1063 N  N   . GLU A 217 ? 1.7567 1.5796 1.0628 0.1085  0.1902  0.0262  217 GLU A N   
1064 C  CA  . GLU A 217 ? 1.7145 1.5431 1.0562 0.0966  0.1658  0.0230  217 GLU A CA  
1065 C  C   . GLU A 217 ? 1.7809 1.5790 1.0905 0.0992  0.1386  0.0185  217 GLU A C   
1066 O  O   . GLU A 217 ? 1.7838 1.5716 1.0808 0.1078  0.1223  0.0059  217 GLU A O   
1067 C  CB  . GLU A 217 ? 1.6946 1.5507 1.0813 0.0979  0.1611  0.0129  217 GLU A CB  
1068 C  CG  . GLU A 217 ? 1.7930 1.6736 1.2312 0.0808  0.1563  0.0178  217 GLU A CG  
1069 C  CD  . GLU A 217 ? 2.1025 2.0146 1.5862 0.0814  0.1543  0.0112  217 GLU A CD  
1070 O  OE1 . GLU A 217 ? 2.1096 2.0165 1.5890 0.0926  0.1421  0.0004  217 GLU A OE1 
1071 O  OE2 . GLU A 217 ? 2.0225 1.9630 1.5463 0.0696  0.1626  0.0174  217 GLU A OE2 
1072 N  N   . VAL A 218 ? 1.7389 1.5222 1.0361 0.0917  0.1338  0.0299  218 VAL A N   
1073 C  CA  . VAL A 218 ? 1.7371 1.4971 1.0097 0.0937  0.1090  0.0297  218 VAL A CA  
1074 C  C   . VAL A 218 ? 1.7136 1.4855 1.0230 0.0884  0.0860  0.0222  218 VAL A C   
1075 O  O   . VAL A 218 ? 1.6665 1.4606 1.0185 0.0803  0.0899  0.0212  218 VAL A O   
1076 C  CB  . VAL A 218 ? 1.8147 1.5566 1.0667 0.0895  0.1133  0.0461  218 VAL A CB  
1077 C  CG1 . VAL A 218 ? 1.7783 1.5314 1.0722 0.0756  0.1154  0.0535  218 VAL A CG1 
1078 C  CG2 . VAL A 218 ? 1.8408 1.5577 1.0551 0.0971  0.0901  0.0473  218 VAL A CG2 
1079 N  N   . GLU A 219 ? 1.6658 1.4242 0.9582 0.0928  0.0620  0.0176  219 GLU A N   
1080 C  CA  . GLU A 219 ? 1.6220 1.3925 0.9471 0.0880  0.0415  0.0129  219 GLU A CA  
1081 C  C   . GLU A 219 ? 1.6479 1.4225 0.9921 0.0821  0.0382  0.0229  219 GLU A C   
1082 O  O   . GLU A 219 ? 1.6682 1.4271 0.9899 0.0839  0.0419  0.0330  219 GLU A O   
1083 C  CB  . GLU A 219 ? 1.6558 1.4137 0.9611 0.0925  0.0170  0.0054  219 GLU A CB  
1084 C  CG  . GLU A 219 ? 1.8527 1.5976 1.1324 0.0998  0.0179  -0.0070 219 GLU A CG  
1085 C  CD  . GLU A 219 ? 2.1066 1.8664 1.4140 0.1002  0.0292  -0.0150 219 GLU A CD  
1086 O  OE1 . GLU A 219 ? 2.0950 1.8734 1.4428 0.0931  0.0223  -0.0152 219 GLU A OE1 
1087 O  OE2 . GLU A 219 ? 1.9579 1.7106 1.2448 0.1093  0.0449  -0.0206 219 GLU A OE2 
1088 N  N   . GLY A 220 ? 1.5695 1.3626 0.9523 0.0763  0.0324  0.0202  220 GLY A N   
1089 C  CA  . GLY A 220 ? 1.5500 1.3468 0.9526 0.0724  0.0306  0.0268  220 GLY A CA  
1090 C  C   . GLY A 220 ? 1.5647 1.3767 0.9980 0.0637  0.0431  0.0246  220 GLY A C   
1091 O  O   . GLY A 220 ? 1.5623 1.3750 0.9948 0.0595  0.0596  0.0261  220 GLY A O   
1092 N  N   . MET A 221 ? 1.4911 1.3170 0.9518 0.0610  0.0349  0.0213  221 MET A N   
1093 C  CA  . MET A 221 ? 1.4637 1.3042 0.9522 0.0531  0.0410  0.0177  221 MET A CA  
1094 C  C   . MET A 221 ? 1.5033 1.3362 0.9931 0.0449  0.0557  0.0219  221 MET A C   
1095 O  O   . MET A 221 ? 1.5272 1.3393 1.0003 0.0454  0.0588  0.0293  221 MET A O   
1096 C  CB  . MET A 221 ? 1.4770 1.3247 0.9818 0.0543  0.0305  0.0165  221 MET A CB  
1097 C  CG  . MET A 221 ? 1.5144 1.3705 1.0390 0.0471  0.0348  0.0126  221 MET A CG  
1098 S  SD  . MET A 221 ? 1.5555 1.4260 1.0958 0.0511  0.0241  0.0098  221 MET A SD  
1099 C  CE  . MET A 221 ? 1.5199 1.3849 1.0664 0.0447  0.0296  0.0053  221 MET A CE  
1100 N  N   . ASN A 222 ? 1.4227 1.2726 0.9339 0.0368  0.0634  0.0180  222 ASN A N   
1101 C  CA  . ASN A 222 ? 1.4201 1.2683 0.9413 0.0248  0.0752  0.0216  222 ASN A CA  
1102 C  C   . ASN A 222 ? 1.4530 1.3011 0.9904 0.0184  0.0671  0.0167  222 ASN A C   
1103 O  O   . ASN A 222 ? 1.4339 1.3025 0.9943 0.0127  0.0640  0.0105  222 ASN A O   
1104 C  CB  . ASN A 222 ? 1.3735 1.2457 0.9133 0.0201  0.0865  0.0205  222 ASN A CB  
1105 C  CG  . ASN A 222 ? 1.4914 1.3701 1.0506 0.0044  0.0980  0.0250  222 ASN A CG  
1106 O  OD1 . ASN A 222 ? 1.3523 1.2119 0.9087 -0.0053 0.0979  0.0287  222 ASN A OD1 
1107 N  ND2 . ASN A 222 ? 1.3942 1.3007 0.9758 0.0015  0.1077  0.0251  222 ASN A ND2 
1108 N  N   . ILE A 223 ? 1.4119 1.2359 0.9347 0.0215  0.0630  0.0193  223 ILE A N   
1109 C  CA  . ILE A 223 ? 1.4014 1.2180 0.9307 0.0191  0.0564  0.0137  223 ILE A CA  
1110 C  C   . ILE A 223 ? 1.4433 1.2593 0.9873 0.0023  0.0605  0.0105  223 ILE A C   
1111 O  O   . ILE A 223 ? 1.4286 1.2588 0.9876 -0.0020 0.0535  0.0020  223 ILE A O   
1112 C  CB  . ILE A 223 ? 1.4620 1.2508 0.9715 0.0292  0.0534  0.0177  223 ILE A CB  
1113 C  CG1 . ILE A 223 ? 1.4578 1.2546 0.9596 0.0443  0.0460  0.0211  223 ILE A CG1 
1114 C  CG2 . ILE A 223 ? 1.4764 1.2550 0.9887 0.0293  0.0488  0.0099  223 ILE A CG2 
1115 C  CD1 . ILE A 223 ? 1.5931 1.3655 1.0734 0.0547  0.0452  0.0305  223 ILE A CD1 
1116 N  N   . LEU A 224 ? 1.4108 1.2117 0.9508 -0.0080 0.0711  0.0181  224 LEU A N   
1117 C  CA  . LEU A 224 ? 1.4172 1.2177 0.9747 -0.0278 0.0749  0.0174  224 LEU A CA  
1118 C  C   . LEU A 224 ? 1.4206 1.2610 1.0096 -0.0355 0.0728  0.0119  224 LEU A C   
1119 O  O   . LEU A 224 ? 1.4131 1.2586 1.0177 -0.0469 0.0645  0.0044  224 LEU A O   
1120 C  CB  . LEU A 224 ? 1.4531 1.2349 1.0019 -0.0371 0.0895  0.0307  224 LEU A CB  
1121 C  CG  . LEU A 224 ? 1.5297 1.3238 1.1049 -0.0600 0.0978  0.0347  224 LEU A CG  
1122 C  CD1 . LEU A 224 ? 1.5553 1.3247 1.1355 -0.0765 0.0889  0.0287  224 LEU A CD1 
1123 C  CD2 . LEU A 224 ? 1.6010 1.3860 1.1660 -0.0646 0.1163  0.0509  224 LEU A CD2 
1124 N  N   . GLY A 225 ? 1.3473 1.2135 0.9430 -0.0277 0.0791  0.0150  225 GLY A N   
1125 C  CA  . GLY A 225 ? 1.3171 1.2219 0.9424 -0.0298 0.0779  0.0111  225 GLY A CA  
1126 C  C   . GLY A 225 ? 1.3342 1.2511 0.9671 -0.0249 0.0617  0.0008  225 GLY A C   
1127 O  O   . GLY A 225 ? 1.3174 1.2596 0.9761 -0.0322 0.0558  -0.0032 225 GLY A O   
1128 N  N   . LEU A 226 ? 1.2764 1.1769 0.8875 -0.0124 0.0544  -0.0021 226 LEU A N   
1129 C  CA  . LEU A 226 ? 1.2520 1.1606 0.8648 -0.0067 0.0413  -0.0095 226 LEU A CA  
1130 C  C   . LEU A 226 ? 1.3311 1.2241 0.9397 -0.0154 0.0339  -0.0161 226 LEU A C   
1131 O  O   . LEU A 226 ? 1.3287 1.2357 0.9461 -0.0180 0.0239  -0.0227 226 LEU A O   
1132 C  CB  . LEU A 226 ? 1.2371 1.1387 0.8325 0.0087  0.0381  -0.0081 226 LEU A CB  
1133 C  CG  . LEU A 226 ? 1.2787 1.1932 0.8758 0.0172  0.0405  -0.0050 226 LEU A CG  
1134 C  CD1 . LEU A 226 ? 1.2745 1.1778 0.8544 0.0281  0.0361  -0.0026 226 LEU A CD1 
1135 C  CD2 . LEU A 226 ? 1.2947 1.2345 0.9110 0.0186  0.0349  -0.0084 226 LEU A CD2 
1136 N  N   . VAL A 227 ? 1.3094 1.1706 0.9018 -0.0195 0.0382  -0.0147 227 VAL A N   
1137 C  CA  . VAL A 227 ? 1.3261 1.1623 0.9087 -0.0276 0.0319  -0.0224 227 VAL A CA  
1138 C  C   . VAL A 227 ? 1.3566 1.2088 0.9632 -0.0475 0.0263  -0.0265 227 VAL A C   
1139 O  O   . VAL A 227 ? 1.3515 1.2044 0.9571 -0.0517 0.0139  -0.0364 227 VAL A O   
1140 C  CB  . VAL A 227 ? 1.4119 1.2066 0.9729 -0.0275 0.0387  -0.0181 227 VAL A CB  
1141 C  CG1 . VAL A 227 ? 1.4484 1.2114 0.9997 -0.0391 0.0325  -0.0269 227 VAL A CG1 
1142 C  CG2 . VAL A 227 ? 1.4059 1.1885 0.9464 -0.0066 0.0404  -0.0149 227 VAL A CG2 
1143 N  N   . VAL A 228 ? 1.2960 1.1646 0.9246 -0.0586 0.0354  -0.0181 228 VAL A N   
1144 C  CA  . VAL A 228 ? 1.2874 1.1805 0.9482 -0.0782 0.0314  -0.0189 228 VAL A CA  
1145 C  C   . VAL A 228 ? 1.3063 1.2353 0.9844 -0.0730 0.0191  -0.0250 228 VAL A C   
1146 O  O   . VAL A 228 ? 1.3096 1.2369 0.9879 -0.0810 0.0037  -0.0344 228 VAL A O   
1147 C  CB  . VAL A 228 ? 1.3318 1.2414 1.0149 -0.0880 0.0478  -0.0062 228 VAL A CB  
1148 C  CG1 . VAL A 228 ? 1.3225 1.2704 1.0485 -0.1063 0.0435  -0.0056 228 VAL A CG1 
1149 C  CG2 . VAL A 228 ? 1.3650 1.2345 1.0295 -0.0970 0.0579  0.0010  228 VAL A CG2 
1150 N  N   . PHE A 229 ? 1.2323 1.1879 0.9189 -0.0582 0.0245  -0.0203 229 PHE A N   
1151 C  CA  . PHE A 229 ? 1.2090 1.1959 0.9107 -0.0505 0.0138  -0.0235 229 PHE A CA  
1152 C  C   . PHE A 229 ? 1.2479 1.2223 0.9286 -0.0458 -0.0017 -0.0326 229 PHE A C   
1153 O  O   . PHE A 229 ? 1.2492 1.2433 0.9427 -0.0500 -0.0155 -0.0371 229 PHE A O   
1154 C  CB  . PHE A 229 ? 1.2149 1.2175 0.9186 -0.0329 0.0225  -0.0178 229 PHE A CB  
1155 C  CG  . PHE A 229 ? 1.2261 1.2544 0.9422 -0.0234 0.0113  -0.0199 229 PHE A CG  
1156 C  CD1 . PHE A 229 ? 1.2684 1.3328 1.0192 -0.0270 0.0080  -0.0181 229 PHE A CD1 
1157 C  CD2 . PHE A 229 ? 1.2552 1.2724 0.9497 -0.0111 0.0040  -0.0221 229 PHE A CD2 
1158 C  CE1 . PHE A 229 ? 1.2739 1.3593 1.0345 -0.0168 -0.0038 -0.0188 229 PHE A CE1 
1159 C  CE2 . PHE A 229 ? 1.2868 1.3236 0.9900 -0.0030 -0.0065 -0.0220 229 PHE A CE2 
1160 C  CZ  . PHE A 229 ? 1.2600 1.3289 0.9946 -0.0051 -0.0110 -0.0205 229 PHE A CZ  
1161 N  N   . SER A 230 ? 1.1917 1.1357 0.8407 -0.0360 0.0009  -0.0346 230 SER A N   
1162 C  CA  . SER A 230 ? 1.1933 1.1248 0.8191 -0.0294 -0.0094 -0.0423 230 SER A CA  
1163 C  C   . SER A 230 ? 1.2859 1.2036 0.9057 -0.0440 -0.0216 -0.0527 230 SER A C   
1164 O  O   . SER A 230 ? 1.2912 1.2162 0.9034 -0.0426 -0.0347 -0.0592 230 SER A O   
1165 C  CB  . SER A 230 ? 1.2299 1.1350 0.8285 -0.0161 -0.0017 -0.0410 230 SER A CB  
1166 O  OG  . SER A 230 ? 1.3017 1.2193 0.9046 -0.0042 0.0051  -0.0327 230 SER A OG  
1167 N  N   . ILE A 231 ? 1.2659 1.1615 0.8870 -0.0588 -0.0181 -0.0540 231 ILE A N   
1168 C  CA  . ILE A 231 ? 1.2956 1.1712 0.9107 -0.0763 -0.0310 -0.0648 231 ILE A CA  
1169 C  C   . ILE A 231 ? 1.3402 1.2528 0.9856 -0.0897 -0.0462 -0.0668 231 ILE A C   
1170 O  O   . ILE A 231 ? 1.3635 1.2714 0.9954 -0.0935 -0.0637 -0.0777 231 ILE A O   
1171 C  CB  . ILE A 231 ? 1.3604 1.2022 0.9730 -0.0907 -0.0232 -0.0630 231 ILE A CB  
1172 C  CG1 . ILE A 231 ? 1.3855 1.1820 0.9594 -0.0759 -0.0154 -0.0656 231 ILE A CG1 
1173 C  CG2 . ILE A 231 ? 1.3988 1.2301 1.0208 -0.1166 -0.0382 -0.0716 231 ILE A CG2 
1174 C  CD1 . ILE A 231 ? 1.4745 1.2431 1.0455 -0.0800 -0.0016 -0.0564 231 ILE A CD1 
1175 N  N   . VAL A 232 ? 1.2613 1.2119 0.9462 -0.0943 -0.0397 -0.0562 232 VAL A N   
1176 C  CA  . VAL A 232 ? 1.2436 1.2374 0.9656 -0.1043 -0.0529 -0.0554 232 VAL A CA  
1177 C  C   . VAL A 232 ? 1.2686 1.2833 0.9839 -0.0877 -0.0645 -0.0574 232 VAL A C   
1178 O  O   . VAL A 232 ? 1.2664 1.3015 0.9938 -0.0951 -0.0839 -0.0620 232 VAL A O   
1179 C  CB  . VAL A 232 ? 1.2667 1.2980 1.0345 -0.1111 -0.0400 -0.0429 232 VAL A CB  
1180 C  CG1 . VAL A 232 ? 1.2791 1.3384 1.0864 -0.1353 -0.0540 -0.0437 232 VAL A CG1 
1181 C  CG2 . VAL A 232 ? 1.2672 1.2752 1.0276 -0.1126 -0.0179 -0.0350 232 VAL A CG2 
1182 N  N   . PHE A 233 ? 1.2041 1.2128 0.9000 -0.0665 -0.0539 -0.0531 233 PHE A N   
1183 C  CA  . PHE A 233 ? 1.1916 1.2145 0.8780 -0.0509 -0.0626 -0.0524 233 PHE A CA  
1184 C  C   . PHE A 233 ? 1.2743 1.2734 0.9231 -0.0502 -0.0764 -0.0630 233 PHE A C   
1185 O  O   . PHE A 233 ? 1.2760 1.2909 0.9210 -0.0461 -0.0914 -0.0642 233 PHE A O   
1186 C  CB  . PHE A 233 ? 1.1886 1.2096 0.8668 -0.0320 -0.0478 -0.0441 233 PHE A CB  
1187 C  CG  . PHE A 233 ? 1.1963 1.2373 0.8764 -0.0181 -0.0550 -0.0393 233 PHE A CG  
1188 C  CD1 . PHE A 233 ? 1.2217 1.2947 0.9341 -0.0139 -0.0560 -0.0326 233 PHE A CD1 
1189 C  CD2 . PHE A 233 ? 1.2317 1.2588 0.8809 -0.0084 -0.0598 -0.0403 233 PHE A CD2 
1190 C  CE1 . PHE A 233 ? 1.2250 1.3112 0.9374 -0.0003 -0.0636 -0.0274 233 PHE A CE1 
1191 C  CE2 . PHE A 233 ? 1.2581 1.3003 0.9076 0.0031  -0.0664 -0.0337 233 PHE A CE2 
1192 C  CZ  . PHE A 233 ? 1.2187 1.2881 0.8990 0.0071  -0.0691 -0.0273 233 PHE A CZ  
1193 N  N   . GLY A 234 ? 1.2514 1.2116 0.8707 -0.0526 -0.0710 -0.0703 234 GLY A N   
1194 C  CA  . GLY A 234 ? 1.2839 1.2152 0.8621 -0.0501 -0.0805 -0.0823 234 GLY A CA  
1195 C  C   . GLY A 234 ? 1.3619 1.2965 0.9421 -0.0672 -0.1034 -0.0928 234 GLY A C   
1196 O  O   . GLY A 234 ? 1.3755 1.3124 0.9334 -0.0624 -0.1183 -0.0984 234 GLY A O   
1197 N  N   . ILE A 235 ? 1.3207 1.2581 0.9298 -0.0883 -0.1068 -0.0939 235 ILE A N   
1198 C  CA  . ILE A 235 ? 1.3429 1.2885 0.9663 -0.1105 -0.1300 -0.1024 235 ILE A CA  
1199 C  C   . ILE A 235 ? 1.3822 1.3762 1.0307 -0.1071 -0.1461 -0.0971 235 ILE A C   
1200 O  O   . ILE A 235 ? 1.4105 1.4049 1.0443 -0.1132 -0.1699 -0.1065 235 ILE A O   
1201 C  CB  . ILE A 235 ? 1.3801 1.3266 1.0400 -0.1338 -0.1245 -0.0986 235 ILE A CB  
1202 C  CG1 . ILE A 235 ? 1.4174 1.3054 1.0436 -0.1401 -0.1171 -0.1072 235 ILE A CG1 
1203 C  CG2 . ILE A 235 ? 1.4014 1.3801 1.1007 -0.1584 -0.1471 -0.1006 235 ILE A CG2 
1204 C  CD1 . ILE A 235 ? 1.4961 1.3779 1.1493 -0.1542 -0.1004 -0.0971 235 ILE A CD1 
1205 N  N   . ALA A 236 ? 1.3042 1.3351 0.9860 -0.0956 -0.1338 -0.0825 236 ALA A N   
1206 C  CA  . ALA A 236 ? 1.2907 1.3666 0.9992 -0.0880 -0.1459 -0.0749 236 ALA A CA  
1207 C  C   . ALA A 236 ? 1.3699 1.4374 1.0383 -0.0716 -0.1573 -0.0773 236 ALA A C   
1208 O  O   . ALA A 236 ? 1.3755 1.4685 1.0523 -0.0717 -0.1786 -0.0767 236 ALA A O   
1209 C  CB  . ALA A 236 ? 1.2592 1.3633 1.0018 -0.0756 -0.1263 -0.0604 236 ALA A CB  
1210 N  N   . LEU A 237 ? 1.3417 1.3757 0.9676 -0.0572 -0.1430 -0.0787 237 LEU A N   
1211 C  CA  . LEU A 237 ? 1.3614 1.3854 0.9458 -0.0418 -0.1496 -0.0792 237 LEU A CA  
1212 C  C   . LEU A 237 ? 1.4858 1.4838 1.0305 -0.0506 -0.1684 -0.0954 237 LEU A C   
1213 O  O   . LEU A 237 ? 1.5026 1.5031 1.0196 -0.0435 -0.1836 -0.0967 237 LEU A O   
1214 C  CB  . LEU A 237 ? 1.3448 1.3486 0.9039 -0.0243 -0.1270 -0.0732 237 LEU A CB  
1215 C  CG  . LEU A 237 ? 1.3587 1.3839 0.9466 -0.0131 -0.1125 -0.0580 237 LEU A CG  
1216 C  CD1 . LEU A 237 ? 1.3500 1.3548 0.9148 -0.0002 -0.0935 -0.0533 237 LEU A CD1 
1217 C  CD2 . LEU A 237 ? 1.3825 1.4361 0.9824 -0.0045 -0.1249 -0.0483 237 LEU A CD2 
1218 N  N   . GLY A 238 ? 1.4830 1.4536 1.0229 -0.0661 -0.1678 -0.1073 238 GLY A N   
1219 C  CA  . GLY A 238 ? 1.5435 1.4819 1.0457 -0.0774 -0.1868 -0.1256 238 GLY A CA  
1220 C  C   . GLY A 238 ? 1.6251 1.5914 1.1508 -0.0951 -0.2176 -0.1295 238 GLY A C   
1221 O  O   . GLY A 238 ? 1.6757 1.6263 1.1633 -0.0977 -0.2399 -0.1419 238 GLY A O   
1222 N  N   . LYS A 239 ? 1.5536 1.5635 1.1425 -0.1061 -0.2189 -0.1184 239 LYS A N   
1223 C  CA  . LYS A 239 ? 1.5674 1.6170 1.1951 -0.1227 -0.2468 -0.1181 239 LYS A CA  
1224 C  C   . LYS A 239 ? 1.6491 1.7239 1.2637 -0.1061 -0.2641 -0.1125 239 LYS A C   
1225 O  O   . LYS A 239 ? 1.6889 1.7696 1.2925 -0.1157 -0.2949 -0.1209 239 LYS A O   
1226 C  CB  . LYS A 239 ? 1.5540 1.6474 1.2537 -0.1331 -0.2362 -0.1048 239 LYS A CB  
1227 C  CG  . LYS A 239 ? 1.7561 1.8922 1.5062 -0.1557 -0.2631 -0.1048 239 LYS A CG  
1228 C  CD  . LYS A 239 ? 1.8599 2.0398 1.6809 -0.1644 -0.2465 -0.0904 239 LYS A CD  
1229 C  CE  . LYS A 239 ? 1.9614 2.2047 1.8437 -0.1748 -0.2690 -0.0832 239 LYS A CE  
1230 N  NZ  . LYS A 239 ? 1.9886 2.2780 1.9381 -0.1772 -0.2472 -0.0675 239 LYS A NZ  
1231 N  N   . MET A 240 ? 1.5834 1.6694 1.1959 -0.0820 -0.2460 -0.0983 240 MET A N   
1232 C  CA  . MET A 240 ? 1.5957 1.6988 1.1907 -0.0645 -0.2596 -0.0903 240 MET A CA  
1233 C  C   . MET A 240 ? 1.6981 1.7585 1.2186 -0.0546 -0.2622 -0.0998 240 MET A C   
1234 O  O   . MET A 240 ? 1.7114 1.7316 1.1987 -0.0557 -0.2468 -0.1101 240 MET A O   
1235 C  CB  . MET A 240 ? 1.5810 1.7092 1.2034 -0.0444 -0.2409 -0.0711 240 MET A CB  
1236 C  CG  . MET A 240 ? 1.6021 1.7047 1.2130 -0.0348 -0.2080 -0.0674 240 MET A CG  
1237 S  SD  . MET A 240 ? 1.6043 1.7332 1.2540 -0.0168 -0.1882 -0.0479 240 MET A SD  
1238 C  CE  . MET A 240 ? 1.5384 1.7035 1.2530 -0.0310 -0.1879 -0.0471 240 MET A CE  
1239 N  N   . GLY A 241 ? 1.6856 1.7550 1.1795 -0.0440 -0.2812 -0.0958 241 GLY A N   
1240 C  CA  . GLY A 241 ? 1.7358 1.7683 1.1557 -0.0337 -0.2844 -0.1038 241 GLY A CA  
1241 C  C   . GLY A 241 ? 1.7694 1.7879 1.1599 -0.0112 -0.2569 -0.0912 241 GLY A C   
1242 O  O   . GLY A 241 ? 1.7293 1.7336 1.1268 -0.0079 -0.2291 -0.0896 241 GLY A O   
1243 N  N   . GLU A 242 ? 1.7602 1.7826 1.1168 0.0034  -0.2659 -0.0815 242 GLU A N   
1244 C  CA  . GLU A 242 ? 1.7586 1.7705 1.0854 0.0233  -0.2431 -0.0666 242 GLU A CA  
1245 C  C   . GLU A 242 ? 1.7619 1.7980 1.1407 0.0301  -0.2255 -0.0471 242 GLU A C   
1246 O  O   . GLU A 242 ? 1.7468 1.7719 1.1152 0.0409  -0.2007 -0.0367 242 GLU A O   
1247 C  CB  . GLU A 242 ? 1.8272 1.8358 1.1019 0.0350  -0.2602 -0.0603 242 GLU A CB  
1248 C  CG  . GLU A 242 ? 2.0652 2.0423 1.2751 0.0313  -0.2752 -0.0809 242 GLU A CG  
1249 C  CD  . GLU A 242 ? 2.4310 2.4183 1.6427 0.0166  -0.3154 -0.0941 242 GLU A CD  
1250 O  OE1 . GLU A 242 ? 2.3244 2.3307 1.5918 -0.0012 -0.3261 -0.1008 242 GLU A OE1 
1251 O  OE2 . GLU A 242 ? 2.4280 2.4039 1.5836 0.0221  -0.3365 -0.0978 242 GLU A OE2 
1252 N  N   . GLN A 243 ? 1.6870 1.7561 1.1225 0.0238  -0.2380 -0.0426 243 GLN A N   
1253 C  CA  . GLN A 243 ? 1.6311 1.7203 1.1150 0.0307  -0.2226 -0.0273 243 GLN A CA  
1254 C  C   . GLN A 243 ? 1.6245 1.6973 1.1201 0.0264  -0.1946 -0.0320 243 GLN A C   
1255 O  O   . GLN A 243 ? 1.5987 1.6672 1.1004 0.0360  -0.1746 -0.0205 243 GLN A O   
1256 C  CB  . GLN A 243 ? 1.6332 1.7619 1.1746 0.0254  -0.2404 -0.0247 243 GLN A CB  
1257 C  CG  . GLN A 243 ? 1.8452 1.9928 1.4353 0.0342  -0.2241 -0.0115 243 GLN A CG  
1258 C  CD  . GLN A 243 ? 2.1250 2.2734 1.7070 0.0537  -0.2237 0.0070  243 GLN A CD  
1259 O  OE1 . GLN A 243 ? 2.0739 2.1963 1.6201 0.0616  -0.2098 0.0143  243 GLN A OE1 
1260 N  NE2 . GLN A 243 ? 2.0288 2.2076 1.6478 0.0620  -0.2376 0.0162  243 GLN A NE2 
1261 N  N   . GLY A 244 ? 1.5628 1.6235 1.0577 0.0118  -0.1952 -0.0487 244 GLY A N   
1262 C  CA  . GLY A 244 ? 1.5283 1.5703 1.0295 0.0076  -0.1717 -0.0540 244 GLY A CA  
1263 C  C   . GLY A 244 ? 1.5645 1.5766 1.0209 0.0183  -0.1528 -0.0539 244 GLY A C   
1264 O  O   . GLY A 244 ? 1.5384 1.5428 1.0058 0.0214  -0.1312 -0.0502 244 GLY A O   
1265 N  N   . GLN A 245 ? 1.5368 1.5341 0.9427 0.0250  -0.1608 -0.0571 245 GLN A N   
1266 C  CA  . GLN A 245 ? 1.5454 1.5181 0.9065 0.0369  -0.1419 -0.0565 245 GLN A CA  
1267 C  C   . GLN A 245 ? 1.5364 1.5177 0.9118 0.0480  -0.1201 -0.0376 245 GLN A C   
1268 O  O   . GLN A 245 ? 1.5352 1.5029 0.9014 0.0531  -0.0990 -0.0378 245 GLN A O   
1269 C  CB  . GLN A 245 ? 1.6232 1.5826 0.9262 0.0439  -0.1542 -0.0608 245 GLN A CB  
1270 C  CG  . GLN A 245 ? 1.9014 1.8339 1.1537 0.0565  -0.1333 -0.0643 245 GLN A CG  
1271 C  CD  . GLN A 245 ? 2.2396 2.1458 1.4866 0.0529  -0.1217 -0.0817 245 GLN A CD  
1272 O  OE1 . GLN A 245 ? 2.2528 2.1446 1.5001 0.0399  -0.1372 -0.0994 245 GLN A OE1 
1273 N  NE2 . GLN A 245 ? 2.1239 2.0230 1.3668 0.0642  -0.0947 -0.0761 245 GLN A NE2 
1274 N  N   . LEU A 246 ? 1.4397 1.4424 0.8388 0.0516  -0.1258 -0.0213 246 LEU A N   
1275 C  CA  . LEU A 246 ? 1.3912 1.3988 0.8056 0.0593  -0.1082 -0.0034 246 LEU A CA  
1276 C  C   . LEU A 246 ? 1.3870 1.3927 0.8337 0.0551  -0.0914 -0.0059 246 LEU A C   
1277 O  O   . LEU A 246 ? 1.3741 1.3725 0.8145 0.0599  -0.0731 0.0002  246 LEU A O   
1278 C  CB  . LEU A 246 ? 1.3744 1.3991 0.8098 0.0637  -0.1196 0.0123  246 LEU A CB  
1279 C  CG  . LEU A 246 ? 1.3912 1.4176 0.8516 0.0680  -0.1052 0.0282  246 LEU A CG  
1280 C  CD1 . LEU A 246 ? 1.3996 1.4147 0.8330 0.0734  -0.0882 0.0404  246 LEU A CD1 
1281 C  CD2 . LEU A 246 ? 1.4208 1.4583 0.8999 0.0734  -0.1183 0.0404  246 LEU A CD2 
1282 N  N   . LEU A 247 ? 1.3101 1.3242 0.7910 0.0461  -0.0978 -0.0139 247 LEU A N   
1283 C  CA  . LEU A 247 ? 1.2714 1.2827 0.7794 0.0420  -0.0836 -0.0164 247 LEU A CA  
1284 C  C   . LEU A 247 ? 1.3330 1.3231 0.8200 0.0404  -0.0722 -0.0272 247 LEU A C   
1285 O  O   . LEU A 247 ? 1.3004 1.2849 0.7966 0.0428  -0.0567 -0.0239 247 LEU A O   
1286 C  CB  . LEU A 247 ? 1.2521 1.2786 0.7980 0.0333  -0.0915 -0.0209 247 LEU A CB  
1287 C  CG  . LEU A 247 ? 1.2888 1.3320 0.8667 0.0387  -0.0906 -0.0094 247 LEU A CG  
1288 C  CD1 . LEU A 247 ? 1.2831 1.3463 0.8968 0.0321  -0.0978 -0.0139 247 LEU A CD1 
1289 C  CD2 . LEU A 247 ? 1.3059 1.3391 0.8911 0.0421  -0.0730 -0.0040 247 LEU A CD2 
1290 N  N   . VAL A 248 ? 1.3374 1.3138 0.7941 0.0375  -0.0810 -0.0402 248 VAL A N   
1291 C  CA  . VAL A 248 ? 1.3663 1.3164 0.7966 0.0390  -0.0708 -0.0520 248 VAL A CA  
1292 C  C   . VAL A 248 ? 1.4424 1.3889 0.8519 0.0534  -0.0526 -0.0426 248 VAL A C   
1293 O  O   . VAL A 248 ? 1.4297 1.3694 0.8465 0.0576  -0.0368 -0.0415 248 VAL A O   
1294 C  CB  . VAL A 248 ? 1.4642 1.3949 0.8618 0.0329  -0.0861 -0.0696 248 VAL A CB  
1295 C  CG1 . VAL A 248 ? 1.4914 1.3890 0.8566 0.0385  -0.0738 -0.0819 248 VAL A CG1 
1296 C  CG2 . VAL A 248 ? 1.4582 1.3968 0.8858 0.0153  -0.1034 -0.0772 248 VAL A CG2 
1297 N  N   . ASP A 249 ? 1.4228 1.3774 0.8105 0.0609  -0.0549 -0.0332 249 ASP A N   
1298 C  CA  . ASP A 249 ? 1.4308 1.3880 0.8025 0.0731  -0.0367 -0.0205 249 ASP A CA  
1299 C  C   . ASP A 249 ? 1.4215 1.3936 0.8325 0.0726  -0.0249 -0.0055 249 ASP A C   
1300 O  O   . ASP A 249 ? 1.4112 1.3843 0.8225 0.0795  -0.0075 0.0003  249 ASP A O   
1301 C  CB  . ASP A 249 ? 1.4925 1.4552 0.8340 0.0789  -0.0429 -0.0110 249 ASP A CB  
1302 C  CG  . ASP A 249 ? 1.7610 1.7058 1.0533 0.0816  -0.0537 -0.0263 249 ASP A CG  
1303 O  OD1 . ASP A 249 ? 1.8075 1.7312 1.0771 0.0850  -0.0466 -0.0418 249 ASP A OD1 
1304 O  OD2 . ASP A 249 ? 1.8757 1.8250 1.1494 0.0813  -0.0704 -0.0229 249 ASP A OD2 
1305 N  N   . PHE A 250 ? 1.3344 1.3180 0.7786 0.0651  -0.0349 -0.0001 250 PHE A N   
1306 C  CA  . PHE A 250 ? 1.2889 1.2814 0.7669 0.0635  -0.0277 0.0111  250 PHE A CA  
1307 C  C   . PHE A 250 ? 1.3373 1.3226 0.8282 0.0621  -0.0177 0.0037  250 PHE A C   
1308 O  O   . PHE A 250 ? 1.3271 1.3165 0.8280 0.0655  -0.0059 0.0122  250 PHE A O   
1309 C  CB  . PHE A 250 ? 1.2845 1.2857 0.7894 0.0583  -0.0405 0.0145  250 PHE A CB  
1310 C  CG  . PHE A 250 ? 1.2687 1.2725 0.8030 0.0566  -0.0347 0.0221  250 PHE A CG  
1311 C  CD1 . PHE A 250 ? 1.2837 1.2842 0.8362 0.0525  -0.0311 0.0138  250 PHE A CD1 
1312 C  CD2 . PHE A 250 ? 1.2880 1.2945 0.8285 0.0586  -0.0335 0.0375  250 PHE A CD2 
1313 C  CE1 . PHE A 250 ? 1.2704 1.2704 0.8434 0.0517  -0.0271 0.0195  250 PHE A CE1 
1314 C  CE2 . PHE A 250 ? 1.3006 1.3047 0.8642 0.0561  -0.0307 0.0424  250 PHE A CE2 
1315 C  CZ  . PHE A 250 ? 1.2561 1.2573 0.8342 0.0532  -0.0278 0.0327  250 PHE A CZ  
1316 N  N   . PHE A 251 ? 1.3003 1.2755 0.7925 0.0565  -0.0234 -0.0109 251 PHE A N   
1317 C  CA  . PHE A 251 ? 1.2929 1.2571 0.7943 0.0553  -0.0150 -0.0172 251 PHE A CA  
1318 C  C   . PHE A 251 ? 1.3706 1.3210 0.8473 0.0648  -0.0031 -0.0218 251 PHE A C   
1319 O  O   . PHE A 251 ? 1.3451 1.2887 0.8301 0.0680  0.0060  -0.0222 251 PHE A O   
1320 C  CB  . PHE A 251 ? 1.3147 1.2720 0.8273 0.0446  -0.0237 -0.0284 251 PHE A CB  
1321 C  CG  . PHE A 251 ? 1.3051 1.2769 0.8497 0.0391  -0.0271 -0.0224 251 PHE A CG  
1322 C  CD1 . PHE A 251 ? 1.3218 1.2913 0.8826 0.0392  -0.0186 -0.0188 251 PHE A CD1 
1323 C  CD2 . PHE A 251 ? 1.3264 1.3135 0.8827 0.0359  -0.0390 -0.0205 251 PHE A CD2 
1324 C  CE1 . PHE A 251 ? 1.3132 1.2927 0.8973 0.0364  -0.0204 -0.0147 251 PHE A CE1 
1325 C  CE2 . PHE A 251 ? 1.3375 1.3368 0.9216 0.0343  -0.0399 -0.0157 251 PHE A CE2 
1326 C  CZ  . PHE A 251 ? 1.2987 1.2929 0.8946 0.0347  -0.0299 -0.0135 251 PHE A CZ  
1327 N  N   . ASN A 252 ? 1.3737 1.3197 0.8182 0.0714  -0.0027 -0.0247 252 ASN A N   
1328 C  CA  . ASN A 252 ? 1.4024 1.3356 0.8190 0.0843  0.0108  -0.0293 252 ASN A CA  
1329 C  C   . ASN A 252 ? 1.4459 1.3994 0.8749 0.0939  0.0268  -0.0125 252 ASN A C   
1330 O  O   . ASN A 252 ? 1.4494 1.4005 0.8797 0.1039  0.0402  -0.0124 252 ASN A O   
1331 C  CB  . ASN A 252 ? 1.4455 1.3657 0.8188 0.0886  0.0057  -0.0390 252 ASN A CB  
1332 C  CG  . ASN A 252 ? 1.8549 1.7428 1.1985 0.0933  0.0073  -0.0579 252 ASN A CG  
1333 O  OD1 . ASN A 252 ? 1.7934 1.6716 1.1360 0.1041  0.0221  -0.0592 252 ASN A OD1 
1334 N  ND2 . ASN A 252 ? 1.8282 1.6974 1.1466 0.0855  -0.0093 -0.0729 252 ASN A ND2 
1335 N  N   . SER A 253 ? 1.3837 1.3574 0.8243 0.0903  0.0246  0.0027  253 SER A N   
1336 C  CA  . SER A 253 ? 1.3645 1.3597 0.8227 0.0943  0.0373  0.0212  253 SER A CA  
1337 C  C   . SER A 253 ? 1.3727 1.3748 0.8686 0.0895  0.0376  0.0255  253 SER A C   
1338 O  O   . SER A 253 ? 1.3609 1.3765 0.8713 0.0955  0.0495  0.0343  253 SER A O   
1339 C  CB  . SER A 253 ? 1.4066 1.4140 0.8664 0.0889  0.0316  0.0359  253 SER A CB  
1340 O  OG  . SER A 253 ? 1.5723 1.5728 0.9935 0.0938  0.0291  0.0328  253 SER A OG  
1341 N  N   . LEU A 254 ? 1.3098 1.3038 0.8205 0.0796  0.0248  0.0192  254 LEU A N   
1342 C  CA  . LEU A 254 ? 1.2860 1.2818 0.8249 0.0749  0.0230  0.0214  254 LEU A CA  
1343 C  C   . LEU A 254 ? 1.3628 1.3482 0.8995 0.0819  0.0304  0.0138  254 LEU A C   
1344 O  O   . LEU A 254 ? 1.3402 1.3321 0.8972 0.0827  0.0325  0.0197  254 LEU A O   
1345 C  CB  . LEU A 254 ? 1.2694 1.2584 0.8186 0.0649  0.0101  0.0159  254 LEU A CB  
1346 C  CG  . LEU A 254 ? 1.3001 1.2884 0.8720 0.0605  0.0077  0.0179  254 LEU A CG  
1347 C  CD1 . LEU A 254 ? 1.2904 1.2886 0.8787 0.0565  0.0037  0.0302  254 LEU A CD1 
1348 C  CD2 . LEU A 254 ? 1.3162 1.2940 0.8903 0.0547  0.0014  0.0076  254 LEU A CD2 
1349 N  N   . ASN A 255 ? 1.3581 1.3248 0.8689 0.0872  0.0326  0.0006  255 ASN A N   
1350 C  CA  . ASN A 255 ? 1.3737 1.3233 0.8775 0.0956  0.0394  -0.0071 255 ASN A CA  
1351 C  C   . ASN A 255 ? 1.4518 1.4146 0.9553 0.1114  0.0543  0.0007  255 ASN A C   
1352 O  O   . ASN A 255 ? 1.4383 1.4057 0.9589 0.1177  0.0590  0.0056  255 ASN A O   
1353 C  CB  . ASN A 255 ? 1.4109 1.3311 0.8856 0.0946  0.0354  -0.0243 255 ASN A CB  
1354 C  CG  . ASN A 255 ? 1.6999 1.5945 1.1666 0.1018  0.0408  -0.0322 255 ASN A CG  
1355 O  OD1 . ASN A 255 ? 1.6704 1.5541 1.1178 0.1175  0.0513  -0.0361 255 ASN A OD1 
1356 N  ND2 . ASN A 255 ? 1.5517 1.4350 1.0319 0.0920  0.0348  -0.0338 255 ASN A ND2 
1357 N  N   . GLU A 256 ? 1.4468 1.4184 0.9318 0.1185  0.0621  0.0033  256 GLU A N   
1358 C  CA  . GLU A 256 ? 1.4656 1.4554 0.9510 0.1347  0.0798  0.0123  256 GLU A CA  
1359 C  C   . GLU A 256 ? 1.4878 1.5120 1.0152 0.1312  0.0826  0.0319  256 GLU A C   
1360 O  O   . GLU A 256 ? 1.4839 1.5230 1.0279 0.1432  0.0930  0.0382  256 GLU A O   
1361 C  CB  . GLU A 256 ? 1.5165 1.5081 0.9689 0.1416  0.0880  0.0121  256 GLU A CB  
1362 C  CG  . GLU A 256 ? 1.7050 1.7155 1.1526 0.1610  0.1105  0.0207  256 GLU A CG  
1363 C  CD  . GLU A 256 ? 2.1076 2.1114 1.5590 0.1791  0.1218  0.0150  256 GLU A CD  
1364 O  OE1 . GLU A 256 ? 2.2155 2.1822 1.6357 0.1865  0.1196  -0.0039 256 GLU A OE1 
1365 O  OE2 . GLU A 256 ? 2.0231 2.0584 1.5100 0.1857  0.1317  0.0300  256 GLU A OE2 
1366 N  N   . ALA A 257 ? 1.4164 1.4516 0.9615 0.1151  0.0717  0.0410  257 ALA A N   
1367 C  CA  . ALA A 257 ? 1.3873 1.4495 0.9700 0.1075  0.0701  0.0582  257 ALA A CA  
1368 C  C   . ALA A 257 ? 1.4233 1.4855 1.0299 0.1069  0.0637  0.0573  257 ALA A C   
1369 O  O   . ALA A 257 ? 1.4150 1.5025 1.0496 0.1097  0.0677  0.0696  257 ALA A O   
1370 C  CB  . ALA A 257 ? 1.3824 1.4454 0.9712 0.0916  0.0584  0.0649  257 ALA A CB  
1371 N  N   . THR A 258 ? 1.3733 1.4085 0.9688 0.1036  0.0540  0.0438  258 THR A N   
1372 C  CA  . THR A 258 ? 1.3602 1.3907 0.9706 0.1042  0.0481  0.0430  258 THR A CA  
1373 C  C   . THR A 258 ? 1.4179 1.4462 1.0238 0.1224  0.0590  0.0408  258 THR A C   
1374 O  O   . THR A 258 ? 1.4182 1.4555 1.0433 0.1273  0.0567  0.0468  258 THR A O   
1375 C  CB  . THR A 258 ? 1.4888 1.4939 1.0901 0.0938  0.0364  0.0326  258 THR A CB  
1376 O  OG1 . THR A 258 ? 1.5168 1.4971 1.0918 0.0965  0.0390  0.0189  258 THR A OG1 
1377 C  CG2 . THR A 258 ? 1.4689 1.4780 1.0779 0.0797  0.0265  0.0357  258 THR A CG2 
1378 N  N   . MET A 259 ? 1.3796 1.3953 0.9588 0.1338  0.0701  0.0323  259 MET A N   
1379 C  CA  . MET A 259 ? 1.3965 1.4055 0.9666 0.1546  0.0823  0.0287  259 MET A CA  
1380 C  C   . MET A 259 ? 1.4278 1.4772 1.0239 0.1669  0.0952  0.0445  259 MET A C   
1381 O  O   . MET A 259 ? 1.4317 1.4868 1.0361 0.1851  0.1035  0.0468  259 MET A O   
1382 C  CB  . MET A 259 ? 1.4646 1.4424 0.9930 0.1623  0.0889  0.0126  259 MET A CB  
1383 C  CG  . MET A 259 ? 1.5242 1.4604 1.0318 0.1542  0.0782  -0.0028 259 MET A CG  
1384 S  SD  . MET A 259 ? 1.5867 1.5016 1.1021 0.1627  0.0764  -0.0031 259 MET A SD  
1385 C  CE  . MET A 259 ? 1.5887 1.4966 1.0882 0.1934  0.0948  -0.0061 259 MET A CE  
1386 N  N   . LYS A 260 ? 1.3635 1.4420 0.9746 0.1570  0.0971  0.0567  260 LYS A N   
1387 C  CA  . LYS A 260 ? 1.3512 1.4741 0.9939 0.1639  0.1093  0.0750  260 LYS A CA  
1388 C  C   . LYS A 260 ? 1.3583 1.5037 1.0438 0.1561  0.0967  0.0865  260 LYS A C   
1389 O  O   . LYS A 260 ? 1.3542 1.5344 1.0714 0.1665  0.1042  0.0992  260 LYS A O   
1390 C  CB  . LYS A 260 ? 1.3745 1.5164 1.0174 0.1529  0.1147  0.0860  260 LYS A CB  
1391 C  CG  . LYS A 260 ? 1.5410 1.6701 1.1420 0.1655  0.1304  0.0785  260 LYS A CG  
1392 C  CD  . LYS A 260 ? 1.6624 1.8212 1.2689 0.1612  0.1425  0.0960  260 LYS A CD  
1393 C  CE  . LYS A 260 ? 1.8162 1.9635 1.3762 0.1767  0.1596  0.0894  260 LYS A CE  
1394 N  NZ  . LYS A 260 ? 1.9762 2.1304 1.5291 0.2039  0.1806  0.0855  260 LYS A NZ  
1395 N  N   . LEU A 261 ? 1.2791 1.4050 0.9644 0.1388  0.0773  0.0815  261 LEU A N   
1396 C  CA  . LEU A 261 ? 1.2538 1.3924 0.9697 0.1301  0.0616  0.0891  261 LEU A CA  
1397 C  C   . LEU A 261 ? 1.3246 1.4558 1.0424 0.1461  0.0599  0.0858  261 LEU A C   
1398 O  O   . LEU A 261 ? 1.3164 1.4735 1.0663 0.1470  0.0520  0.0969  261 LEU A O   
1399 C  CB  . LEU A 261 ? 1.2346 1.3503 0.9420 0.1098  0.0439  0.0833  261 LEU A CB  
1400 C  CG  . LEU A 261 ? 1.2767 1.4045 0.9949 0.0926  0.0400  0.0921  261 LEU A CG  
1401 C  CD1 . LEU A 261 ? 1.2757 1.3721 0.9688 0.0818  0.0315  0.0809  261 LEU A CD1 
1402 C  CD2 . LEU A 261 ? 1.2890 1.4389 1.0424 0.0801  0.0267  0.1046  261 LEU A CD2 
1403 N  N   . VAL A 262 ? 1.2996 1.3951 0.9835 0.1587  0.0662  0.0715  262 VAL A N   
1404 C  CA  . VAL A 262 ? 1.3103 1.3906 0.9904 0.1752  0.0653  0.0687  262 VAL A CA  
1405 C  C   . VAL A 262 ? 1.3857 1.4970 1.0871 0.1996  0.0801  0.0783  262 VAL A C   
1406 O  O   . VAL A 262 ? 1.3868 1.4942 1.0939 0.2162  0.0786  0.0803  262 VAL A O   
1407 C  CB  . VAL A 262 ? 1.3745 1.4024 1.0131 0.1774  0.0657  0.0515  262 VAL A CB  
1408 C  CG1 . VAL A 262 ? 1.3966 1.4071 1.0068 0.1894  0.0815  0.0407  262 VAL A CG1 
1409 C  CG2 . VAL A 262 ? 1.3889 1.3960 1.0240 0.1884  0.0599  0.0516  262 VAL A CG2 
1410 N  N   . ALA A 263 ? 1.3623 1.5070 1.0776 0.2023  0.0944  0.0862  263 ALA A N   
1411 C  CA  . ALA A 263 ? 1.3832 1.5666 1.1247 0.2251  0.1113  0.0977  263 ALA A CA  
1412 C  C   . ALA A 263 ? 1.4347 1.6657 1.2305 0.2188  0.0990  0.1165  263 ALA A C   
1413 O  O   . ALA A 263 ? 1.4394 1.6960 1.2614 0.2393  0.1034  0.1250  263 ALA A O   
1414 C  CB  . ALA A 263 ? 1.4016 1.6055 1.1377 0.2276  0.1317  0.1015  263 ALA A CB  
1415 N  N   . ILE A 264 ? 1.3828 1.6230 1.1943 0.1909  0.0820  0.1222  264 ILE A N   
1416 C  CA  . ILE A 264 ? 1.3674 1.6462 1.2264 0.1778  0.0645  0.1378  264 ILE A CA  
1417 C  C   . ILE A 264 ? 1.4275 1.6857 1.2820 0.1821  0.0446  0.1332  264 ILE A C   
1418 O  O   . ILE A 264 ? 1.4206 1.7125 1.3120 0.1882  0.0350  0.1454  264 ILE A O   
1419 C  CB  . ILE A 264 ? 1.3878 1.6696 1.2545 0.1467  0.0520  0.1419  264 ILE A CB  
1420 C  CG1 . ILE A 264 ? 1.3970 1.6826 1.2513 0.1425  0.0712  0.1439  264 ILE A CG1 
1421 C  CG2 . ILE A 264 ? 1.3879 1.7139 1.3073 0.1321  0.0357  0.1594  264 ILE A CG2 
1422 C  CD1 . ILE A 264 ? 1.4852 1.7446 1.3204 0.1182  0.0601  0.1390  264 ILE A CD1 
1423 N  N   . ILE A 265 ? 1.3994 1.6039 1.2090 0.1784  0.0385  0.1169  265 ILE A N   
1424 C  CA  . ILE A 265 ? 1.4122 1.5872 1.2055 0.1816  0.0225  0.1117  265 ILE A CA  
1425 C  C   . ILE A 265 ? 1.4900 1.6688 1.2888 0.2111  0.0296  0.1156  265 ILE A C   
1426 O  O   . ILE A 265 ? 1.4869 1.6718 1.2984 0.2166  0.0139  0.1226  265 ILE A O   
1427 C  CB  . ILE A 265 ? 1.4568 1.5769 1.2022 0.1711  0.0212  0.0947  265 ILE A CB  
1428 C  CG1 . ILE A 265 ? 1.4461 1.5592 1.1890 0.1452  0.0040  0.0928  265 ILE A CG1 
1429 C  CG2 . ILE A 265 ? 1.4878 1.5677 1.2039 0.1848  0.0198  0.0876  265 ILE A CG2 
1430 C  CD1 . ILE A 265 ? 1.5044 1.6349 1.2593 0.1274  0.0062  0.0951  265 ILE A CD1 
1431 N  N   . MET A 266 ? 1.4725 1.6472 1.2601 0.2311  0.0526  0.1112  266 MET A N   
1432 C  CA  . MET A 266 ? 1.5041 1.6771 1.2925 0.2632  0.0637  0.1130  266 MET A CA  
1433 C  C   . MET A 266 ? 1.5331 1.7665 1.3765 0.2778  0.0617  0.1323  266 MET A C   
1434 O  O   . MET A 266 ? 1.5473 1.7799 1.3964 0.3037  0.0623  0.1364  266 MET A O   
1435 C  CB  . MET A 266 ? 1.5644 1.7173 1.3241 0.2795  0.0891  0.1018  266 MET A CB  
1436 C  CG  . MET A 266 ? 1.6497 1.7356 1.3578 0.2859  0.0906  0.0843  266 MET A CG  
1437 S  SD  . MET A 266 ? 1.7530 1.8134 1.4249 0.3076  0.1178  0.0696  266 MET A SD  
1438 C  CE  . MET A 266 ? 1.7517 1.7331 1.3732 0.3137  0.1126  0.0528  266 MET A CE  
1439 N  N   . TRP A 267 ? 1.4559 1.7419 1.3413 0.2614  0.0593  0.1450  267 TRP A N   
1440 C  CA  . TRP A 267 ? 1.4445 1.7959 1.3906 0.2704  0.0558  0.1651  267 TRP A CA  
1441 C  C   . TRP A 267 ? 1.4568 1.8174 1.4235 0.2590  0.0239  0.1727  267 TRP A C   
1442 O  O   . TRP A 267 ? 1.4610 1.8637 1.4696 0.2743  0.0166  0.1870  267 TRP A O   
1443 C  CB  . TRP A 267 ? 1.4160 1.8210 1.4011 0.2567  0.0680  0.1778  267 TRP A CB  
1444 C  CG  . TRP A 267 ? 1.4492 1.8640 1.4262 0.2793  0.1021  0.1767  267 TRP A CG  
1445 C  CD1 . TRP A 267 ? 1.4895 1.8837 1.4330 0.2717  0.1197  0.1680  267 TRP A CD1 
1446 C  CD2 . TRP A 267 ? 1.4732 1.9159 1.4696 0.3162  0.1225  0.1833  267 TRP A CD2 
1447 N  NE1 . TRP A 267 ? 1.5098 1.9167 1.4476 0.3005  0.1499  0.1682  267 TRP A NE1 
1448 C  CE2 . TRP A 267 ? 1.5417 1.9780 1.5119 0.3290  0.1535  0.1771  267 TRP A CE2 
1449 C  CE3 . TRP A 267 ? 1.5015 1.9748 1.5346 0.3414  0.1175  0.1942  267 TRP A CE3 
1450 C  CZ2 . TRP A 267 ? 1.5650 2.0222 1.5420 0.3667  0.1813  0.1801  267 TRP A CZ2 
1451 C  CZ3 . TRP A 267 ? 1.5496 2.0451 1.5936 0.3796  0.1448  0.1981  267 TRP A CZ3 
1452 C  CH2 . TRP A 267 ? 1.5774 2.0642 1.5928 0.3923  0.1773  0.1905  267 TRP A CH2 
1453 N  N   . TYR A 268 ? 1.3790 1.7014 1.3156 0.2336  0.0046  0.1631  268 TYR A N   
1454 C  CA  . TYR A 268 ? 1.3674 1.6894 1.3110 0.2222  -0.0265 0.1674  268 TYR A CA  
1455 C  C   . TYR A 268 ? 1.4238 1.7039 1.3327 0.2434  -0.0318 0.1622  268 TYR A C   
1456 O  O   . TYR A 268 ? 1.4228 1.7141 1.3448 0.2475  -0.0542 0.1708  268 TYR A O   
1457 C  CB  . TYR A 268 ? 1.3682 1.6647 1.2904 0.1888  -0.0424 0.1590  268 TYR A CB  
1458 C  CG  . TYR A 268 ? 1.3965 1.6901 1.3201 0.1764  -0.0749 0.1617  268 TYR A CG  
1459 C  CD1 . TYR A 268 ? 1.4193 1.7634 1.3931 0.1642  -0.0954 0.1757  268 TYR A CD1 
1460 C  CD2 . TYR A 268 ? 1.4220 1.6625 1.2958 0.1760  -0.0856 0.1507  268 TYR A CD2 
1461 C  CE1 . TYR A 268 ? 1.4522 1.7908 1.4225 0.1529  -0.1280 0.1768  268 TYR A CE1 
1462 C  CE2 . TYR A 268 ? 1.4486 1.6838 1.3165 0.1664  -0.1151 0.1527  268 TYR A CE2 
1463 C  CZ  . TYR A 268 ? 1.5429 1.8258 1.4571 0.1552  -0.1375 0.1648  268 TYR A CZ  
1464 O  OH  . TYR A 268 ? 1.5539 1.8287 1.4576 0.1455  -0.1693 0.1652  268 TYR A OH  
1465 N  N   . ALA A 269 ? 1.3928 1.6241 1.2574 0.2563  -0.0122 0.1490  269 ALA A N   
1466 C  CA  . ALA A 269 ? 1.4234 1.6054 1.2498 0.2753  -0.0129 0.1436  269 ALA A CA  
1467 C  C   . ALA A 269 ? 1.5128 1.7183 1.3653 0.3027  -0.0224 0.1582  269 ALA A C   
1468 O  O   . ALA A 269 ? 1.5264 1.7060 1.3584 0.3030  -0.0415 0.1604  269 ALA A O   
1469 C  CB  . ALA A 269 ? 1.4485 1.5874 1.2375 0.2874  0.0122  0.1296  269 ALA A CB  
1470 N  N   . PRO A 270 ? 1.4832 1.7401 1.3816 0.3260  -0.0113 0.1700  270 PRO A N   
1471 C  CA  . PRO A 270 ? 1.5047 1.7858 1.4304 0.3528  -0.0239 0.1850  270 PRO A CA  
1472 C  C   . PRO A 270 ? 1.5395 1.8452 1.4858 0.3358  -0.0592 0.1959  270 PRO A C   
1473 O  O   . PRO A 270 ? 1.5628 1.8499 1.4953 0.3503  -0.0762 0.2017  270 PRO A O   
1474 C  CB  . PRO A 270 ? 1.5240 1.8685 1.5042 0.3749  -0.0043 0.1962  270 PRO A CB  
1475 C  CG  . PRO A 270 ? 1.5695 1.8999 1.5297 0.3692  0.0242  0.1835  270 PRO A CG  
1476 C  CD  . PRO A 270 ? 1.4911 1.7870 1.4176 0.3314  0.0140  0.1714  270 PRO A CD  
1477 N  N   . LEU A 271 ? 1.4550 1.7967 1.4291 0.3046  -0.0714 0.1982  271 LEU A N   
1478 C  CA  . LEU A 271 ? 1.4436 1.8053 1.4338 0.2847  -0.1070 0.2058  271 LEU A CA  
1479 C  C   . LEU A 271 ? 1.4938 1.7891 1.4201 0.2725  -0.1228 0.1941  271 LEU A C   
1480 O  O   . LEU A 271 ? 1.5126 1.8026 1.4305 0.2778  -0.1481 0.2009  271 LEU A O   
1481 C  CB  . LEU A 271 ? 1.4124 1.8185 1.4424 0.2528  -0.1138 0.2089  271 LEU A CB  
1482 C  CG  . LEU A 271 ? 1.4710 1.9299 1.5504 0.2393  -0.1479 0.2234  271 LEU A CG  
1483 C  CD1 . LEU A 271 ? 1.4489 1.9728 1.5923 0.2222  -0.1421 0.2346  271 LEU A CD1 
1484 C  CD2 . LEU A 271 ? 1.5105 1.9304 1.5508 0.2128  -0.1786 0.2141  271 LEU A CD2 
1485 N  N   . GLY A 272 ? 1.4273 1.6751 1.3098 0.2575  -0.1071 0.1779  272 GLY A N   
1486 C  CA  . GLY A 272 ? 1.4321 1.6191 1.2552 0.2449  -0.1152 0.1664  272 GLY A CA  
1487 C  C   . GLY A 272 ? 1.5110 1.6518 1.2943 0.2679  -0.1130 0.1674  272 GLY A C   
1488 O  O   . GLY A 272 ? 1.5240 1.6387 1.2764 0.2642  -0.1324 0.1691  272 GLY A O   
1489 N  N   . ILE A 273 ? 1.4846 1.6120 1.2652 0.2924  -0.0892 0.1666  273 ILE A N   
1490 C  CA  . ILE A 273 ? 1.5244 1.6012 1.2669 0.3155  -0.0842 0.1679  273 ILE A CA  
1491 C  C   . ILE A 273 ? 1.5952 1.6878 1.3494 0.3340  -0.1086 0.1848  273 ILE A C   
1492 O  O   . ILE A 273 ? 1.6203 1.6661 1.3315 0.3395  -0.1169 0.1874  273 ILE A O   
1493 C  CB  . ILE A 273 ? 1.5797 1.6365 1.3172 0.3384  -0.0549 0.1619  273 ILE A CB  
1494 C  CG1 . ILE A 273 ? 1.5673 1.5969 1.2808 0.3188  -0.0340 0.1438  273 ILE A CG1 
1495 C  CG2 . ILE A 273 ? 1.6396 1.6449 1.3434 0.3651  -0.0522 0.1660  273 ILE A CG2 
1496 C  CD1 . ILE A 273 ? 1.6777 1.6516 1.3405 0.2949  -0.0363 0.1329  273 ILE A CD1 
1497 N  N   . LEU A 274 ? 1.5426 1.7025 1.3552 0.3420  -0.1210 0.1976  274 LEU A N   
1498 C  CA  . LEU A 274 ? 1.5688 1.7559 1.4023 0.3591  -0.1482 0.2150  274 LEU A CA  
1499 C  C   . LEU A 274 ? 1.6321 1.7960 1.4297 0.3385  -0.1780 0.2150  274 LEU A C   
1500 O  O   . LEU A 274 ? 1.6665 1.7959 1.4291 0.3534  -0.1903 0.2223  274 LEU A O   
1501 C  CB  . LEU A 274 ? 1.5480 1.8205 1.4589 0.3636  -0.1563 0.2279  274 LEU A CB  
1502 C  CG  . LEU A 274 ? 1.6350 1.9472 1.5794 0.3846  -0.1848 0.2476  274 LEU A CG  
1503 C  CD1 . LEU A 274 ? 1.6498 1.9975 1.6377 0.4235  -0.1675 0.2592  274 LEU A CD1 
1504 C  CD2 . LEU A 274 ? 1.6434 2.0167 1.6346 0.3594  -0.2153 0.2549  274 LEU A CD2 
1505 N  N   . PHE A 275 ? 1.5593 1.7375 1.3609 0.3054  -0.1883 0.2066  275 PHE A N   
1506 C  CA  . PHE A 275 ? 1.5710 1.7275 1.3365 0.2842  -0.2154 0.2033  275 PHE A CA  
1507 C  C   . PHE A 275 ? 1.6455 1.7289 1.3386 0.2770  -0.2039 0.1919  275 PHE A C   
1508 O  O   . PHE A 275 ? 1.6777 1.7335 1.3293 0.2726  -0.2237 0.1936  275 PHE A O   
1509 C  CB  . PHE A 275 ? 1.5604 1.7535 1.3557 0.2529  -0.2289 0.1974  275 PHE A CB  
1510 C  CG  . PHE A 275 ? 1.5702 1.8358 1.4338 0.2538  -0.2516 0.2118  275 PHE A CG  
1511 C  CD1 . PHE A 275 ? 1.6364 1.9175 1.5019 0.2492  -0.2908 0.2196  275 PHE A CD1 
1512 C  CD2 . PHE A 275 ? 1.5651 1.8849 1.4912 0.2585  -0.2341 0.2180  275 PHE A CD2 
1513 C  CE1 . PHE A 275 ? 1.6417 1.9941 1.5761 0.2474  -0.3141 0.2336  275 PHE A CE1 
1514 C  CE2 . PHE A 275 ? 1.5956 1.9882 1.5911 0.2574  -0.2540 0.2332  275 PHE A CE2 
1515 C  CZ  . PHE A 275 ? 1.5971 2.0068 1.5990 0.2511  -0.2948 0.2411  275 PHE A CZ  
1516 N  N   . LEU A 276 ? 1.5850 1.6388 1.2627 0.2752  -0.1723 0.1809  276 LEU A N   
1517 C  CA  . LEU A 276 ? 1.5981 1.5881 1.2154 0.2669  -0.1582 0.1710  276 LEU A CA  
1518 C  C   . LEU A 276 ? 1.6944 1.6407 1.2743 0.2899  -0.1575 0.1814  276 LEU A C   
1519 O  O   . LEU A 276 ? 1.7176 1.6179 1.2456 0.2825  -0.1587 0.1802  276 LEU A O   
1520 C  CB  . LEU A 276 ? 1.5688 1.5458 1.1873 0.2575  -0.1280 0.1570  276 LEU A CB  
1521 C  CG  . LEU A 276 ? 1.6281 1.5565 1.1996 0.2384  -0.1146 0.1441  276 LEU A CG  
1522 C  CD1 . LEU A 276 ? 1.6242 1.5542 1.1792 0.2158  -0.1314 0.1387  276 LEU A CD1 
1523 C  CD2 . LEU A 276 ? 1.6279 1.5556 1.2109 0.2301  -0.0899 0.1316  276 LEU A CD2 
1524 N  N   . ILE A 277 ? 1.6624 1.6232 1.2685 0.3187  -0.1554 0.1928  277 ILE A N   
1525 C  CA  . ILE A 277 ? 1.7098 1.6284 1.2837 0.3439  -0.1559 0.2048  277 ILE A CA  
1526 C  C   . ILE A 277 ? 1.7817 1.7198 1.3572 0.3567  -0.1889 0.2218  277 ILE A C   
1527 O  O   . ILE A 277 ? 1.8222 1.7157 1.3516 0.3670  -0.1958 0.2314  277 ILE A O   
1528 C  CB  . ILE A 277 ? 1.7622 1.6687 1.3507 0.3714  -0.1333 0.2065  277 ILE A CB  
1529 C  CG1 . ILE A 277 ? 1.7531 1.7257 1.4061 0.3931  -0.1382 0.2149  277 ILE A CG1 
1530 C  CG2 . ILE A 277 ? 1.7524 1.6267 1.3255 0.3580  -0.1034 0.1889  277 ILE A CG2 
1531 C  CD1 . ILE A 277 ? 1.9062 1.8657 1.5634 0.4315  -0.1340 0.2270  277 ILE A CD1 
1532 N  N   . ALA A 278 ? 1.7121 1.7166 1.3405 0.3552  -0.2102 0.2267  278 ALA A N   
1533 C  CA  . ALA A 278 ? 1.7392 1.7704 1.3754 0.3648  -0.2464 0.2422  278 ALA A CA  
1534 C  C   . ALA A 278 ? 1.8174 1.8141 1.3957 0.3438  -0.2660 0.2384  278 ALA A C   
1535 O  O   . ALA A 278 ? 1.8642 1.8394 1.4080 0.3572  -0.2864 0.2511  278 ALA A O   
1536 C  CB  . ALA A 278 ? 1.7142 1.8260 1.4238 0.3606  -0.2638 0.2464  278 ALA A CB  
1537 N  N   . GLY A 279 ? 1.7426 1.7312 1.3074 0.3135  -0.2579 0.2212  279 GLY A N   
1538 C  CA  . GLY A 279 ? 1.7623 1.7164 1.2703 0.2933  -0.2705 0.2139  279 GLY A CA  
1539 C  C   . GLY A 279 ? 1.8562 1.7422 1.2957 0.3005  -0.2551 0.2170  279 GLY A C   
1540 O  O   . GLY A 279 ? 1.8941 1.7533 1.2832 0.3004  -0.2731 0.2224  279 GLY A O   
1541 N  N   . LYS A 280 ? 1.8066 1.6633 1.2428 0.3066  -0.2220 0.2142  280 LYS A N   
1542 C  CA  . LYS A 280 ? 1.8430 1.6346 1.2208 0.3109  -0.2039 0.2184  280 LYS A CA  
1543 C  C   . LYS A 280 ? 1.9427 1.7105 1.2974 0.3390  -0.2165 0.2396  280 LYS A C   
1544 O  O   . LYS A 280 ? 1.9880 1.7084 1.2834 0.3388  -0.2170 0.2475  280 LYS A O   
1545 C  CB  . LYS A 280 ? 1.8513 1.6185 1.2348 0.3058  -0.1685 0.2082  280 LYS A CB  
1546 C  CG  . LYS A 280 ? 2.0784 1.8259 1.4366 0.2773  -0.1517 0.1925  280 LYS A CG  
1547 C  CD  . LYS A 280 ? 2.3056 2.0001 1.5985 0.2721  -0.1468 0.1988  280 LYS A CD  
1548 C  CE  . LYS A 280 ? 2.4854 2.1728 1.7581 0.2459  -0.1346 0.1839  280 LYS A CE  
1549 N  NZ  . LYS A 280 ? 2.6651 2.3085 1.8748 0.2422  -0.1301 0.1916  280 LYS A NZ  
1550 N  N   . ILE A 281 ? 1.8867 1.6884 1.2874 0.3641  -0.2264 0.2502  281 ILE A N   
1551 C  CA  . ILE A 281 ? 1.9343 1.7168 1.3181 0.3948  -0.2407 0.2719  281 ILE A CA  
1552 C  C   . ILE A 281 ? 2.0004 1.8042 1.3686 0.3963  -0.2805 0.2827  281 ILE A C   
1553 O  O   . ILE A 281 ? 2.0483 1.8364 1.3956 0.4206  -0.2977 0.3021  281 ILE A O   
1554 C  CB  . ILE A 281 ? 1.9697 1.7737 1.4036 0.4263  -0.2337 0.2801  281 ILE A CB  
1555 C  CG1 . ILE A 281 ? 1.9407 1.8264 1.4450 0.4340  -0.2559 0.2831  281 ILE A CG1 
1556 C  CG2 . ILE A 281 ? 1.9553 1.7341 1.3978 0.4244  -0.1964 0.2668  281 ILE A CG2 
1557 C  CD1 . ILE A 281 ? 2.0645 1.9657 1.5906 0.4717  -0.2716 0.3038  281 ILE A CD1 
1558 N  N   . VAL A 282 ? 1.9181 1.7539 1.2939 0.3703  -0.2959 0.2697  282 VAL A N   
1559 C  CA  . VAL A 282 ? 1.9406 1.7936 1.2970 0.3649  -0.3349 0.2743  282 VAL A CA  
1560 C  C   . VAL A 282 ? 2.0335 1.8265 1.3046 0.3517  -0.3318 0.2712  282 VAL A C   
1561 O  O   . VAL A 282 ? 2.0870 1.8611 1.3122 0.3624  -0.3565 0.2844  282 VAL A O   
1562 C  CB  . VAL A 282 ? 1.9355 1.8535 1.3486 0.3445  -0.3543 0.2620  282 VAL A CB  
1563 C  CG1 . VAL A 282 ? 1.9538 1.8652 1.3252 0.3225  -0.3823 0.2532  282 VAL A CG1 
1564 C  CG2 . VAL A 282 ? 1.9220 1.9050 1.4070 0.3640  -0.3762 0.2756  282 VAL A CG2 
1565 N  N   . GLU A 283 ? 1.9617 1.7257 1.2117 0.3303  -0.3004 0.2552  283 GLU A N   
1566 C  CA  . GLU A 283 ? 2.2913 2.0032 1.4676 0.3162  -0.2887 0.2505  283 GLU A CA  
1567 C  C   . GLU A 283 ? 2.6578 2.3162 1.7712 0.3345  -0.2872 0.2714  283 GLU A C   
1568 O  O   . GLU A 283 ? 2.1698 1.8101 1.2928 0.3538  -0.2752 0.2853  283 GLU A O   
1569 C  CB  . GLU A 283 ? 2.2646 1.9595 1.4445 0.2962  -0.2500 0.2340  283 GLU A CB  
1570 C  CG  . GLU A 283 ? 2.3128 2.0514 1.5419 0.2757  -0.2495 0.2135  283 GLU A CG  
1571 C  CD  . GLU A 283 ? 2.4907 2.2176 1.6851 0.2524  -0.2474 0.1967  283 GLU A CD  
1572 O  OE1 . GLU A 283 ? 2.4125 2.1394 1.5749 0.2499  -0.2751 0.1958  283 GLU A OE1 
1573 O  OE2 . GLU A 283 ? 2.3264 2.0451 1.5269 0.2375  -0.2193 0.1837  283 GLU A OE2 
1574 N  N   . LEU A 294 ? 3.0056 1.8284 1.6742 0.3643  -0.0216 0.5045  294 LEU A N   
1575 C  CA  . LEU A 294 ? 2.9070 1.7942 1.6420 0.3607  -0.0263 0.4690  294 LEU A CA  
1576 C  C   . LEU A 294 ? 2.9539 1.8375 1.7275 0.3925  -0.0412 0.4616  294 LEU A C   
1577 O  O   . LEU A 294 ? 2.8752 1.7967 1.7025 0.3886  -0.0388 0.4338  294 LEU A O   
1578 C  CB  . LEU A 294 ? 2.8489 1.8127 1.5921 0.3603  -0.0430 0.4553  294 LEU A CB  
1579 C  CG  . LEU A 294 ? 2.8892 1.8725 1.6118 0.3269  -0.0241 0.4497  294 LEU A CG  
1580 C  CD1 . LEU A 294 ? 2.8845 1.9110 1.5806 0.3359  -0.0454 0.4500  294 LEU A CD1 
1581 C  CD2 . LEU A 294 ? 2.8498 1.8710 1.6267 0.2994  -0.0067 0.4189  294 LEU A CD2 
1582 N  N   . GLY A 295 ? 2.9994 1.8371 1.7437 0.4249  -0.0554 0.4871  295 GLY A N   
1583 C  CA  . GLY A 295 ? 3.0155 1.8429 1.7899 0.4614  -0.0686 0.4849  295 GLY A CA  
1584 C  C   . GLY A 295 ? 3.0819 1.8628 1.8782 0.4515  -0.0473 0.4701  295 GLY A C   
1585 O  O   . GLY A 295 ? 3.0203 1.8370 1.8673 0.4589  -0.0478 0.4442  295 GLY A O   
1586 N  N   . MET A 296 ? 3.1211 1.8215 1.8777 0.4327  -0.0282 0.4865  296 MET A N   
1587 C  CA  . MET A 296 ? 3.1442 1.7879 1.9131 0.4179  -0.0089 0.4739  296 MET A CA  
1588 C  C   . MET A 296 ? 3.1115 1.8006 1.9202 0.3796  0.0071  0.4420  296 MET A C   
1589 O  O   . MET A 296 ? 3.0939 1.7713 1.9327 0.3777  0.0136  0.4192  296 MET A O   
1590 C  CB  . MET A 296 ? 3.2792 1.8243 1.9955 0.4043  0.0055  0.5025  296 MET A CB  
1591 C  CG  . MET A 296 ? 3.3394 1.8842 2.0230 0.3648  0.0220  0.5185  296 MET A CG  
1592 S  SD  . MET A 296 ? 3.4719 1.9211 2.1299 0.3245  0.0505  0.5330  296 MET A SD  
1593 C  CE  . MET A 296 ? 3.5551 1.9202 2.1493 0.3521  0.0423  0.5798  296 MET A CE  
1594 N  N   . TYR A 297 ? 3.0138 1.7544 1.8207 0.3520  0.0125  0.4400  297 TYR A N   
1595 C  CA  . TYR A 297 ? 2.9290 1.7185 1.7714 0.3161  0.0267  0.4130  297 TYR A CA  
1596 C  C   . TYR A 297 ? 2.8866 1.7391 1.7838 0.3289  0.0168  0.3814  297 TYR A C   
1597 O  O   . TYR A 297 ? 2.8475 1.6972 1.7739 0.3129  0.0277  0.3586  297 TYR A O   
1598 C  CB  . TYR A 297 ? 2.9180 1.7496 1.7415 0.2941  0.0318  0.4205  297 TYR A CB  
1599 C  CG  . TYR A 297 ? 2.8462 1.7447 1.7097 0.2664  0.0406  0.3924  297 TYR A CG  
1600 C  CD1 . TYR A 297 ? 2.8524 1.7391 1.7364 0.2318  0.0615  0.3793  297 TYR A CD1 
1601 C  CD2 . TYR A 297 ? 2.7934 1.7653 1.6731 0.2738  0.0266  0.3800  297 TYR A CD2 
1602 C  CE1 . TYR A 297 ? 2.7825 1.7307 1.7035 0.2086  0.0683  0.3547  297 TYR A CE1 
1603 C  CE2 . TYR A 297 ? 2.7286 1.7575 1.6431 0.2499  0.0345  0.3553  297 TYR A CE2 
1604 C  CZ  . TYR A 297 ? 2.8040 1.8217 1.7388 0.2185  0.0556  0.3433  297 TYR A CZ  
1605 O  OH  . TYR A 297 ? 2.7315 1.8054 1.7003 0.1969  0.0624  0.3205  297 TYR A OH  
1606 N  N   . MET A 298 ? 2.8070 1.7158 1.7173 0.3566  -0.0044 0.3811  298 MET A N   
1607 C  CA  . MET A 298 ? 2.7282 1.7029 1.6910 0.3713  -0.0149 0.3560  298 MET A CA  
1608 C  C   . MET A 298 ? 2.7689 1.7083 1.7508 0.3944  -0.0125 0.3461  298 MET A C   
1609 O  O   . MET A 298 ? 2.7084 1.6791 1.7293 0.3901  -0.0070 0.3199  298 MET A O   
1610 C  CB  . MET A 298 ? 2.7445 1.7756 1.7129 0.3976  -0.0403 0.3646  298 MET A CB  
1611 C  CG  . MET A 298 ? 2.7167 1.8260 1.7420 0.4056  -0.0501 0.3408  298 MET A CG  
1612 S  SD  . MET A 298 ? 2.7838 1.9380 1.8308 0.4518  -0.0812 0.3530  298 MET A SD  
1613 C  CE  . MET A 298 ? 2.8067 1.8983 1.8560 0.4883  -0.0750 0.3592  298 MET A CE  
1614 N  N   . VAL A 299 ? 2.7883 1.6584 1.7388 0.4191  -0.0156 0.3672  299 VAL A N   
1615 C  CA  . VAL A 299 ? 2.8162 1.6383 1.7746 0.4451  -0.0126 0.3601  299 VAL A CA  
1616 C  C   . VAL A 299 ? 2.8531 1.6262 1.8098 0.4129  0.0081  0.3416  299 VAL A C   
1617 O  O   . VAL A 299 ? 2.8169 1.6019 1.8032 0.4185  0.0126  0.3158  299 VAL A O   
1618 C  CB  . VAL A 299 ? 2.9583 1.7168 1.8805 0.4818  -0.0231 0.3897  299 VAL A CB  
1619 C  CG1 . VAL A 299 ? 3.0155 1.7022 1.9342 0.5040  -0.0156 0.3828  299 VAL A CG1 
1620 C  CG2 . VAL A 299 ? 2.9395 1.7584 1.8775 0.5192  -0.0474 0.4020  299 VAL A CG2 
1621 N  N   . THR A 300 ? 2.8323 1.5559 1.7560 0.3779  0.0204  0.3545  300 THR A N   
1622 C  CA  . THR A 300 ? 2.8359 1.5133 1.7586 0.3415  0.0379  0.3402  300 THR A CA  
1623 C  C   . THR A 300 ? 2.7798 1.5225 1.7464 0.3197  0.0430  0.3069  300 THR A C   
1624 O  O   . THR A 300 ? 2.7787 1.4943 1.7568 0.3137  0.0489  0.2849  300 THR A O   
1625 C  CB  . THR A 300 ? 2.9699 1.6027 1.8571 0.3059  0.0501  0.3639  300 THR A CB  
1626 O  OG1 . THR A 300 ? 3.0531 1.6225 1.8968 0.3293  0.0446  0.3959  300 THR A OG1 
1627 C  CG2 . THR A 300 ? 2.9740 1.5554 1.8626 0.2670  0.0659  0.3523  300 THR A CG2 
1628 N  N   . VAL A 301 ? 2.6482 1.4731 1.6361 0.3097  0.0395  0.3030  301 VAL A N   
1629 C  CA  . VAL A 301 ? 2.5552 1.4456 1.5838 0.2904  0.0431  0.2743  301 VAL A CA  
1630 C  C   . VAL A 301 ? 2.5661 1.4845 1.6252 0.3217  0.0358  0.2536  301 VAL A C   
1631 O  O   . VAL A 301 ? 2.5489 1.4577 1.6227 0.3121  0.0431  0.2303  301 VAL A O   
1632 C  CB  . VAL A 301 ? 2.5374 1.5013 1.5773 0.2724  0.0414  0.2761  301 VAL A CB  
1633 C  CG1 . VAL A 301 ? 2.4501 1.4773 1.5318 0.2548  0.0445  0.2474  301 VAL A CG1 
1634 C  CG2 . VAL A 301 ? 2.5677 1.5043 1.5769 0.2416  0.0535  0.2954  301 VAL A CG2 
1635 N  N   . ILE A 302 ? 2.5092 1.4605 1.5767 0.3594  0.0216  0.2631  302 ILE A N   
1636 C  CA  . ILE A 302 ? 2.4768 1.4638 1.5772 0.3924  0.0161  0.2476  302 ILE A CA  
1637 C  C   . ILE A 302 ? 2.5789 1.4962 1.6677 0.4092  0.0245  0.2368  302 ILE A C   
1638 O  O   . ILE A 302 ? 2.5433 1.4789 1.6545 0.4115  0.0307  0.2119  302 ILE A O   
1639 C  CB  . ILE A 302 ? 2.5088 1.5430 1.6219 0.4283  -0.0021 0.2646  302 ILE A CB  
1640 C  CG1 . ILE A 302 ? 2.4339 1.5536 1.5725 0.4108  -0.0108 0.2612  302 ILE A CG1 
1641 C  CG2 . ILE A 302 ? 2.5255 1.5738 1.6660 0.4712  -0.0052 0.2568  302 ILE A CG2 
1642 C  CD1 . ILE A 302 ? 2.5329 1.6900 1.6706 0.4316  -0.0321 0.2824  302 ILE A CD1 
1643 N  N   . VAL A 303 ? 2.6209 1.4548 1.6709 0.4196  0.0250  0.2549  303 VAL A N   
1644 C  CA  . VAL A 303 ? 2.6884 1.4419 1.7195 0.4350  0.0321  0.2451  303 VAL A CA  
1645 C  C   . VAL A 303 ? 2.7238 1.4468 1.7509 0.3931  0.0443  0.2222  303 VAL A C   
1646 O  O   . VAL A 303 ? 2.7256 1.4305 1.7578 0.4016  0.0493  0.1975  303 VAL A O   
1647 C  CB  . VAL A 303 ? 2.8393 1.5077 1.8289 0.4576  0.0281  0.2723  303 VAL A CB  
1648 C  CG1 . VAL A 303 ? 2.9187 1.4926 1.8837 0.4684  0.0358  0.2602  303 VAL A CG1 
1649 C  CG2 . VAL A 303 ? 2.8410 1.5453 1.8405 0.5050  0.0135  0.2915  303 VAL A CG2 
1650 N  N   . GLY A 304 ? 2.6571 1.3831 1.6775 0.3495  0.0485  0.2299  304 GLY A N   
1651 C  CA  . GLY A 304 ? 2.6410 1.3506 1.6641 0.3052  0.0579  0.2117  304 GLY A CA  
1652 C  C   . GLY A 304 ? 2.6053 1.3792 1.6638 0.2987  0.0592  0.1810  304 GLY A C   
1653 O  O   . GLY A 304 ? 2.6134 1.3580 1.6707 0.2798  0.0637  0.1590  304 GLY A O   
1654 N  N   . LEU A 305 ? 2.4780 1.3381 1.5667 0.3142  0.0539  0.1798  305 LEU A N   
1655 C  CA  . LEU A 305 ? 2.3956 1.3226 1.5186 0.3117  0.0549  0.1544  305 LEU A CA  
1656 C  C   . LEU A 305 ? 2.4657 1.3765 1.5908 0.3481  0.0564  0.1372  305 LEU A C   
1657 O  O   . LEU A 305 ? 2.4304 1.3644 1.5699 0.3418  0.0607  0.1127  305 LEU A O   
1658 C  CB  . LEU A 305 ? 2.3133 1.3325 1.4670 0.3154  0.0483  0.1611  305 LEU A CB  
1659 C  CG  . LEU A 305 ? 2.3300 1.3789 1.4839 0.2813  0.0483  0.1727  305 LEU A CG  
1660 C  CD1 . LEU A 305 ? 2.2703 1.3943 1.4456 0.2935  0.0383  0.1807  305 LEU A CD1 
1661 C  CD2 . LEU A 305 ? 2.3201 1.3834 1.4869 0.2419  0.0563  0.1544  305 LEU A CD2 
1662 N  N   . VAL A 306 ? 2.4765 1.3488 1.5861 0.3879  0.0533  0.1506  306 VAL A N   
1663 C  CA  . VAL A 306 ? 2.5070 1.3598 1.6160 0.4287  0.0570  0.1364  306 VAL A CA  
1664 C  C   . VAL A 306 ? 2.6268 1.3904 1.7020 0.4171  0.0639  0.1169  306 VAL A C   
1665 O  O   . VAL A 306 ? 2.6158 1.3807 1.6933 0.4270  0.0698  0.0912  306 VAL A O   
1666 C  CB  . VAL A 306 ? 2.5965 1.4414 1.7035 0.4773  0.0507  0.1582  306 VAL A CB  
1667 C  CG1 . VAL A 306 ? 2.6455 1.4571 1.7470 0.5216  0.0576  0.1439  306 VAL A CG1 
1668 C  CG2 . VAL A 306 ? 2.5211 1.4627 1.6667 0.4884  0.0411  0.1725  306 VAL A CG2 
1669 N  N   . ILE A 307 ? 2.6531 1.3397 1.6960 0.3940  0.0628  0.1292  307 ILE A N   
1670 C  CA  . ILE A 307 ? 2.7287 1.3231 1.7384 0.3760  0.0662  0.1130  307 ILE A CA  
1671 C  C   . ILE A 307 ? 2.7396 1.3643 1.7636 0.3365  0.0683  0.0865  307 ILE A C   
1672 O  O   . ILE A 307 ? 2.7681 1.3527 1.7762 0.3387  0.0701  0.0603  307 ILE A O   
1673 C  CB  . ILE A 307 ? 2.8415 1.3540 1.8189 0.3548  0.0646  0.1367  307 ILE A CB  
1674 C  CG1 . ILE A 307 ? 2.8992 1.3820 1.8600 0.3969  0.0608  0.1647  307 ILE A CG1 
1675 C  CG2 . ILE A 307 ? 2.9339 1.3469 1.8784 0.3337  0.0659  0.1194  307 ILE A CG2 
1676 C  CD1 . ILE A 307 ? 3.0289 1.4826 1.9713 0.3757  0.0588  0.1979  307 ILE A CD1 
1677 N  N   . HIS A 308 ? 2.6280 1.3242 1.6803 0.3035  0.0674  0.0929  308 HIS A N   
1678 C  CA  . HIS A 308 ? 2.5792 1.3121 1.6490 0.2671  0.0680  0.0710  308 HIS A CA  
1679 C  C   . HIS A 308 ? 2.5812 1.3784 1.6729 0.2885  0.0697  0.0490  308 HIS A C   
1680 O  O   . HIS A 308 ? 2.5914 1.3688 1.6733 0.2824  0.0705  0.0229  308 HIS A O   
1681 C  CB  . HIS A 308 ? 2.5306 1.3133 1.6219 0.2267  0.0679  0.0858  308 HIS A CB  
1682 C  CG  . HIS A 308 ? 2.5319 1.3434 1.6407 0.1878  0.0676  0.0656  308 HIS A CG  
1683 N  ND1 . HIS A 308 ? 2.6040 1.3571 1.6988 0.1523  0.0663  0.0578  308 HIS A ND1 
1684 C  CD2 . HIS A 308 ? 2.4711 1.3624 1.6105 0.1805  0.0671  0.0528  308 HIS A CD2 
1685 C  CE1 . HIS A 308 ? 2.5410 1.3435 1.6595 0.1257  0.0642  0.0405  308 HIS A CE1 
1686 N  NE2 . HIS A 308 ? 2.4656 1.3499 1.6098 0.1422  0.0651  0.0372  308 HIS A NE2 
1687 N  N   . GLY A 309 ? 2.4846 1.3557 1.6037 0.3124  0.0696  0.0604  309 GLY A N   
1688 C  CA  . GLY A 309 ? 2.4262 1.3681 1.5719 0.3316  0.0723  0.0455  309 GLY A CA  
1689 C  C   . GLY A 309 ? 2.5245 1.4410 1.6572 0.3737  0.0786  0.0302  309 GLY A C   
1690 O  O   . GLY A 309 ? 2.5013 1.4456 1.6399 0.3766  0.0835  0.0085  309 GLY A O   
1691 N  N   . LEU A 310 ? 2.5405 1.4054 1.6542 0.4088  0.0793  0.0418  310 LEU A N   
1692 C  CA  . LEU A 310 ? 2.5817 1.4232 1.6835 0.4548  0.0874  0.0285  310 LEU A CA  
1693 C  C   . LEU A 310 ? 2.7312 1.4621 1.7832 0.4592  0.0897  0.0116  310 LEU A C   
1694 O  O   . LEU A 310 ? 2.7780 1.4836 1.8142 0.4975  0.0981  -0.0039 310 LEU A O   
1695 C  CB  . LEU A 310 ? 2.5834 1.4551 1.7048 0.5009  0.0870  0.0509  310 LEU A CB  
1696 C  CG  . LEU A 310 ? 2.5495 1.5335 1.7221 0.5076  0.0853  0.0613  310 LEU A CG  
1697 C  CD1 . LEU A 310 ? 2.5544 1.5611 1.7441 0.5333  0.0764  0.0908  310 LEU A CD1 
1698 C  CD2 . LEU A 310 ? 2.5556 1.5868 1.7470 0.5354  0.0975  0.0436  310 LEU A CD2 
1699 N  N   . ILE A 311 ? 2.7180 1.3826 1.7451 0.4205  0.0831  0.0136  311 ILE A N   
1700 C  CA  . ILE A 311 ? 2.8143 1.3678 1.7934 0.4201  0.0828  -0.0028 311 ILE A CA  
1701 C  C   . ILE A 311 ? 2.8544 1.3807 1.8218 0.3652  0.0766  -0.0209 311 ILE A C   
1702 O  O   . ILE A 311 ? 2.8980 1.3763 1.8368 0.3651  0.0765  -0.0495 311 ILE A O   
1703 C  CB  . ILE A 311 ? 2.9351 1.4077 1.8881 0.4383  0.0802  0.0205  311 ILE A CB  
1704 C  CG1 . ILE A 311 ? 2.9692 1.4439 1.9225 0.5026  0.0864  0.0270  311 ILE A CG1 
1705 C  CG2 . ILE A 311 ? 3.0468 1.3996 1.9524 0.4173  0.0763  0.0089  311 ILE A CG2 
1706 C  CD1 . ILE A 311 ? 3.0070 1.5551 1.9963 0.5221  0.0833  0.0586  311 ILE A CD1 
1707 N  N   . VAL A 312 ? 2.7495 1.3087 1.7390 0.3204  0.0713  -0.0049 312 VAL A N   
1708 C  CA  . VAL A 312 ? 2.7405 1.2833 1.7278 0.2671  0.0647  -0.0181 312 VAL A CA  
1709 C  C   . VAL A 312 ? 2.7276 1.3331 1.7311 0.2576  0.0641  -0.0442 312 VAL A C   
1710 O  O   . VAL A 312 ? 2.7686 1.3269 1.7455 0.2494  0.0599  -0.0713 312 VAL A O   
1711 C  CB  . VAL A 312 ? 2.7547 1.3163 1.7621 0.2251  0.0623  0.0082  312 VAL A CB  
1712 C  CG1 . VAL A 312 ? 2.7291 1.3010 1.7484 0.1718  0.0564  -0.0049 312 VAL A CG1 
1713 C  CG2 . VAL A 312 ? 2.8359 1.3138 1.8160 0.2270  0.0623  0.0314  312 VAL A CG2 
1714 N  N   . LEU A 313 ? 2.5875 1.2941 1.6310 0.2591  0.0672  -0.0361 313 LEU A N   
1715 C  CA  . LEU A 313 ? 2.5221 1.2948 1.5837 0.2508  0.0671  -0.0560 313 LEU A CA  
1716 C  C   . LEU A 313 ? 2.6077 1.3657 1.6455 0.2876  0.0729  -0.0812 313 LEU A C   
1717 O  O   . LEU A 313 ? 2.6084 1.3609 1.6329 0.2707  0.0687  -0.1057 313 LEU A O   
1718 C  CB  . LEU A 313 ? 2.4175 1.2947 1.5249 0.2484  0.0695  -0.0398 313 LEU A CB  
1719 C  CG  . LEU A 313 ? 2.4294 1.3368 1.5609 0.2077  0.0651  -0.0215 313 LEU A CG  
1720 C  CD1 . LEU A 313 ? 2.3471 1.3412 1.5144 0.2170  0.0675  -0.0037 313 LEU A CD1 
1721 C  CD2 . LEU A 313 ? 2.4394 1.3558 1.5777 0.1646  0.0587  -0.0377 313 LEU A CD2 
1722 N  N   . PRO A 314 ? 2.5950 1.3453 1.6254 0.3378  0.0824  -0.0765 314 PRO A N   
1723 C  CA  . PRO A 314 ? 2.6308 1.3687 1.6373 0.3735  0.0912  -0.1008 314 PRO A CA  
1724 C  C   . PRO A 314 ? 2.7872 1.4247 1.7397 0.3662  0.0863  -0.1288 314 PRO A C   
1725 O  O   . PRO A 314 ? 2.7956 1.4325 1.7266 0.3720  0.0887  -0.1551 314 PRO A O   
1726 C  CB  . PRO A 314 ? 2.6687 1.4119 1.6819 0.4265  0.1017  -0.0849 314 PRO A CB  
1727 C  CG  . PRO A 314 ? 2.6576 1.4553 1.7107 0.4162  0.0971  -0.0534 314 PRO A CG  
1728 C  CD  . PRO A 314 ? 2.6117 1.3693 1.6558 0.3664  0.0858  -0.0486 314 PRO A CD  
1729 N  N   . LEU A 315 ? 2.8207 1.3721 1.7494 0.3511  0.0785  -0.1226 315 LEU A N   
1730 C  CA  . LEU A 315 ? 2.9236 1.3677 1.8008 0.3382  0.0703  -0.1467 315 LEU A CA  
1731 C  C   . LEU A 315 ? 2.9633 1.4186 1.8395 0.2892  0.0574  -0.1670 315 LEU A C   
1732 O  O   . LEU A 315 ? 3.0246 1.4246 1.8589 0.2891  0.0520  -0.1974 315 LEU A O   
1733 C  CB  . LEU A 315 ? 2.9874 1.3499 1.8506 0.3250  0.0642  -0.1278 315 LEU A CB  
1734 C  CG  . LEU A 315 ? 3.1593 1.3988 1.9692 0.3109  0.0543  -0.1489 315 LEU A CG  
1735 C  CD1 . LEU A 315 ? 3.2562 1.4185 2.0225 0.3664  0.0630  -0.1588 315 LEU A CD1 
1736 C  CD2 . LEU A 315 ? 3.2090 1.4007 2.0238 0.2665  0.0445  -0.1278 315 LEU A CD2 
1737 N  N   . ILE A 316 ? 2.8388 1.3653 1.7598 0.2496  0.0519  -0.1504 316 ILE A N   
1738 C  CA  . ILE A 316 ? 2.8067 1.3606 1.7387 0.2026  0.0391  -0.1641 316 ILE A CA  
1739 C  C   . ILE A 316 ? 2.8424 1.4413 1.7654 0.2198  0.0417  -0.1887 316 ILE A C   
1740 O  O   . ILE A 316 ? 2.8789 1.4451 1.7741 0.1999  0.0298  -0.2150 316 ILE A O   
1741 C  CB  . ILE A 316 ? 2.7551 1.3820 1.7402 0.1657  0.0368  -0.1375 316 ILE A CB  
1742 C  CG1 . ILE A 316 ? 2.7992 1.3714 1.7847 0.1455  0.0350  -0.1141 316 ILE A CG1 
1743 C  CG2 . ILE A 316 ? 2.7223 1.3923 1.7264 0.1222  0.0246  -0.1502 316 ILE A CG2 
1744 C  CD1 . ILE A 316 ? 2.7883 1.4300 1.8187 0.1300  0.0402  -0.0817 316 ILE A CD1 
1745 N  N   . TYR A 317 ? 2.7475 1.4173 1.6916 0.2572  0.0568  -0.1796 317 TYR A N   
1746 C  CA  . TYR A 317 ? 2.7214 1.4400 1.6592 0.2785  0.0638  -0.1973 317 TYR A CA  
1747 C  C   . TYR A 317 ? 2.8808 1.5198 1.7569 0.3076  0.0669  -0.2275 317 TYR A C   
1748 O  O   . TYR A 317 ? 2.8938 1.5287 1.7429 0.2985  0.0610  -0.2525 317 TYR A O   
1749 C  CB  . TYR A 317 ? 2.6575 1.4640 1.6353 0.3115  0.0801  -0.1765 317 TYR A CB  
1750 C  CG  . TYR A 317 ? 2.6455 1.5109 1.6231 0.3321  0.0901  -0.1892 317 TYR A CG  
1751 C  CD1 . TYR A 317 ? 2.5950 1.5308 1.5984 0.3042  0.0845  -0.1892 317 TYR A CD1 
1752 C  CD2 . TYR A 317 ? 2.7000 1.5535 1.6534 0.3815  0.1071  -0.1987 317 TYR A CD2 
1753 C  CE1 . TYR A 317 ? 2.5759 1.5647 1.5780 0.3226  0.0946  -0.1979 317 TYR A CE1 
1754 C  CE2 . TYR A 317 ? 2.6830 1.5935 1.6368 0.4005  0.1192  -0.2073 317 TYR A CE2 
1755 C  CZ  . TYR A 317 ? 2.6921 1.6683 1.6688 0.3698  0.1126  -0.2065 317 TYR A CZ  
1756 O  OH  . TYR A 317 ? 2.6561 1.6848 1.6303 0.3879  0.1251  -0.2132 317 TYR A OH  
1757 N  N   . PHE A 318 ? 2.9192 1.4906 1.7696 0.3425  0.0751  -0.2255 318 PHE A N   
1758 C  CA  . PHE A 318 ? 3.0346 1.5198 1.8222 0.3747  0.0795  -0.2542 318 PHE A CA  
1759 C  C   . PHE A 318 ? 3.1674 1.5629 1.9104 0.3357  0.0582  -0.2797 318 PHE A C   
1760 O  O   . PHE A 318 ? 3.2364 1.5830 1.9266 0.3479  0.0563  -0.3112 318 PHE A O   
1761 C  CB  . PHE A 318 ? 3.1235 1.5556 1.8986 0.4203  0.0919  -0.2428 318 PHE A CB  
1762 C  CG  . PHE A 318 ? 3.2247 1.6179 1.9541 0.4764  0.1086  -0.2649 318 PHE A CG  
1763 C  CD1 . PHE A 318 ? 3.3775 1.6653 2.0379 0.4800  0.1023  -0.2984 318 PHE A CD1 
1764 C  CD2 . PHE A 318 ? 3.2180 1.6781 1.9733 0.5262  0.1308  -0.2519 318 PHE A CD2 
1765 C  CE1 . PHE A 318 ? 3.4631 1.7134 2.0772 0.5349  0.1199  -0.3199 318 PHE A CE1 
1766 C  CE2 . PHE A 318 ? 3.3225 1.7505 2.0377 0.5804  0.1494  -0.2713 318 PHE A CE2 
1767 C  CZ  . PHE A 318 ? 3.4099 1.7323 2.0526 0.5859  0.1449  -0.3056 318 PHE A CZ  
1768 N  N   . LEU A 319 ? 3.1172 1.4923 1.8811 0.2882  0.0421  -0.2659 319 LEU A N   
1769 C  CA  . LEU A 319 ? 3.1889 1.4844 1.9210 0.2443  0.0196  -0.2861 319 LEU A CA  
1770 C  C   . LEU A 319 ? 3.2075 1.5460 1.9394 0.2123  0.0052  -0.3067 319 LEU A C   
1771 O  O   . LEU A 319 ? 3.2839 1.5526 1.9719 0.1916  -0.0127 -0.3349 319 LEU A O   
1772 C  CB  . LEU A 319 ? 3.1810 1.4570 1.9445 0.2021  0.0097  -0.2605 319 LEU A CB  
1773 C  CG  . LEU A 319 ? 3.3491 1.5087 2.0734 0.1711  -0.0085 -0.2747 319 LEU A CG  
1774 C  CD1 . LEU A 319 ? 3.3843 1.4902 2.1150 0.1714  -0.0038 -0.2471 319 LEU A CD1 
1775 C  CD2 . LEU A 319 ? 3.3570 1.5338 2.1007 0.1085  -0.0310 -0.2823 319 LEU A CD2 
1776 N  N   . ILE A 320 ? 3.0506 1.5005 1.8299 0.2083  0.0114  -0.2927 320 ILE A N   
1777 C  CA  . ILE A 320 ? 3.0075 1.5096 1.7932 0.1799  -0.0017 -0.3071 320 ILE A CA  
1778 C  C   . ILE A 320 ? 3.0642 1.5958 1.8192 0.2190  0.0103  -0.3260 320 ILE A C   
1779 O  O   . ILE A 320 ? 3.1279 1.6176 1.8333 0.2146  -0.0015 -0.3563 320 ILE A O   
1780 C  CB  . ILE A 320 ? 2.9295 1.5282 1.7854 0.1450  -0.0048 -0.2796 320 ILE A CB  
1781 C  CG1 . ILE A 320 ? 2.9467 1.5110 1.8267 0.1022  -0.0167 -0.2634 320 ILE A CG1 
1782 C  CG2 . ILE A 320 ? 2.8893 1.5496 1.7548 0.1218  -0.0171 -0.2921 320 ILE A CG2 
1783 C  CD1 . ILE A 320 ? 2.9250 1.5698 1.8694 0.0851  -0.0097 -0.2292 320 ILE A CD1 
1784 N  N   . THR A 321 ? 2.9500 1.5540 1.7341 0.2553  0.0332  -0.3076 321 THR A N   
1785 C  CA  . THR A 321 ? 2.9364 1.5831 1.7016 0.2921  0.0490  -0.3189 321 THR A CA  
1786 C  C   . THR A 321 ? 3.0788 1.6528 1.7822 0.3412  0.0635  -0.3406 321 THR A C   
1787 O  O   . THR A 321 ? 3.0964 1.6766 1.7616 0.3636  0.0714  -0.3607 321 THR A O   
1788 C  CB  . THR A 321 ? 2.9451 1.6996 1.7702 0.3084  0.0670  -0.2894 321 THR A CB  
1789 O  OG1 . THR A 321 ? 2.9521 1.6989 1.7934 0.3422  0.0831  -0.2709 321 THR A OG1 
1790 C  CG2 . THR A 321 ? 2.8313 1.6567 1.7143 0.2638  0.0544  -0.2691 321 THR A CG2 
1791 N  N   . ARG A 322 ? 3.0893 1.5956 1.7823 0.3603  0.0685  -0.3352 322 ARG A N   
1792 C  CA  . ARG A 322 ? 3.1848 1.6166 1.8238 0.4118  0.0839  -0.3524 322 ARG A CA  
1793 C  C   . ARG A 322 ? 3.1787 1.6843 1.8357 0.4653  0.1141  -0.3415 322 ARG A C   
1794 O  O   . ARG A 322 ? 3.2447 1.7162 1.8542 0.5101  0.1309  -0.3610 322 ARG A O   
1795 C  CB  . ARG A 322 ? 3.3054 1.6401 1.8640 0.4078  0.0707  -0.3937 322 ARG A CB  
1796 C  CG  . ARG A 322 ? 3.4761 1.7271 2.0181 0.3569  0.0406  -0.4036 322 ARG A CG  
1797 C  CD  . ARG A 322 ? 3.5670 1.8150 2.1882 0.3520  0.0440  -0.4015 322 ARG A CD  
1798 N  NE  . ARG A 322 ? 3.5863 1.8647 2.3020 0.2851  0.0219  -0.3963 322 ARG A NE  
1799 C  CZ  . ARG A 322 ? 3.5360 2.0047 2.5023 0.2192  0.0165  -0.4210 322 ARG A CZ  
1800 N  NH1 . ARG A 322 ? 3.4472 1.8249 2.3234 0.2474  0.0183  -0.4567 322 ARG A NH1 
1801 N  NH2 . ARG A 322 ? 3.4782 1.7955 2.3435 0.1939  -0.0081 -0.4129 322 ARG A NH2 
1802 N  N   . LYS A 323 ? 3.0090 1.6159 1.7366 0.4594  0.1208  -0.3093 323 LYS A N   
1803 C  CA  . LYS A 323 ? 2.9386 1.6329 1.7028 0.4997  0.1460  -0.2913 323 LYS A CA  
1804 C  C   . LYS A 323 ? 2.9382 1.6537 1.7519 0.5147  0.1514  -0.2598 323 LYS A C   
1805 O  O   . LYS A 323 ? 2.9120 1.6068 1.7452 0.4814  0.1347  -0.2462 323 LYS A O   
1806 C  CB  . LYS A 323 ? 2.8618 1.6591 1.6664 0.4742  0.1449  -0.2810 323 LYS A CB  
1807 C  CG  . LYS A 323 ? 3.0497 1.8349 1.8086 0.4564  0.1366  -0.3085 323 LYS A CG  
1808 C  CD  . LYS A 323 ? 3.0721 1.9490 1.8757 0.4214  0.1288  -0.2946 323 LYS A CD  
1809 C  CE  . LYS A 323 ? 3.2399 2.0984 2.0012 0.3942  0.1125  -0.3195 323 LYS A CE  
1810 N  NZ  . LYS A 323 ? 3.2632 2.2035 2.0712 0.3573  0.1014  -0.3041 323 LYS A NZ  
1811 N  N   . ASN A 324 ? 2.8773 1.6359 1.7115 0.5647  0.1746  -0.2472 324 ASN A N   
1812 C  CA  . ASN A 324 ? 2.8416 1.6254 1.7222 0.5846  0.1789  -0.2171 324 ASN A CA  
1813 C  C   . ASN A 324 ? 2.7713 1.6416 1.7173 0.5483  0.1681  -0.1885 324 ASN A C   
1814 O  O   . ASN A 324 ? 2.6954 1.6530 1.6745 0.5415  0.1739  -0.1819 324 ASN A O   
1815 C  CB  . ASN A 324 ? 2.8738 1.6895 1.7644 0.6465  0.2051  -0.2112 324 ASN A CB  
1816 C  CG  . ASN A 324 ? 3.3535 2.0714 2.1899 0.6873  0.2139  -0.2312 324 ASN A CG  
1817 O  OD1 . ASN A 324 ? 3.3425 1.9958 2.1695 0.6992  0.2075  -0.2223 324 ASN A OD1 
1818 N  ND2 . ASN A 324 ? 3.3300 2.0291 2.1236 0.7116  0.2293  -0.2586 324 ASN A ND2 
1819 N  N   . PRO A 325 ? 2.7105 1.5527 1.6711 0.5228  0.1523  -0.1722 325 PRO A N   
1820 C  CA  . PRO A 325 ? 2.6060 1.5232 1.6215 0.4879  0.1419  -0.1473 325 PRO A CA  
1821 C  C   . PRO A 325 ? 2.5954 1.5963 1.6658 0.5139  0.1506  -0.1193 325 PRO A C   
1822 O  O   . PRO A 325 ? 2.5051 1.5827 1.6188 0.4896  0.1454  -0.1041 325 PRO A O   
1823 C  CB  . PRO A 325 ? 2.6560 1.5062 1.6600 0.4559  0.1249  -0.1405 325 PRO A CB  
1824 C  CG  . PRO A 325 ? 2.8165 1.5725 1.7776 0.4890  0.1292  -0.1490 325 PRO A CG  
1825 C  CD  . PRO A 325 ? 2.8149 1.5522 1.7392 0.5240  0.1436  -0.1756 325 PRO A CD  
1826 N  N   . PHE A 326 ? 2.5964 1.5827 1.6659 0.5630  0.1627  -0.1126 326 PHE A N   
1827 C  CA  . PHE A 326 ? 2.5408 1.6054 1.6646 0.5900  0.1687  -0.0854 326 PHE A CA  
1828 C  C   . PHE A 326 ? 2.5352 1.6890 1.6899 0.6104  0.1859  -0.0856 326 PHE A C   
1829 O  O   . PHE A 326 ? 2.4783 1.7092 1.6856 0.6264  0.1892  -0.0628 326 PHE A O   
1830 C  CB  . PHE A 326 ? 2.6334 1.6486 1.7488 0.6330  0.1720  -0.0747 326 PHE A CB  
1831 C  CG  . PHE A 326 ? 2.6952 1.6325 1.7873 0.6098  0.1549  -0.0672 326 PHE A CG  
1832 C  CD1 . PHE A 326 ? 2.6807 1.6530 1.8066 0.5858  0.1406  -0.0407 326 PHE A CD1 
1833 C  CD2 . PHE A 326 ? 2.8219 1.6485 1.8558 0.6102  0.1531  -0.0867 326 PHE A CD2 
1834 C  CE1 . PHE A 326 ? 2.7321 1.6335 1.8348 0.5637  0.1273  -0.0318 326 PHE A CE1 
1835 C  CE2 . PHE A 326 ? 2.8972 1.6519 1.9114 0.5859  0.1383  -0.0774 326 PHE A CE2 
1836 C  CZ  . PHE A 326 ? 2.8152 1.6094 1.8642 0.5632  0.1268  -0.0490 326 PHE A CZ  
1837 N  N   . VAL A 327 ? 2.5013 1.6454 1.6235 0.6068  0.1955  -0.1102 327 VAL A N   
1838 C  CA  . VAL A 327 ? 2.4512 1.6732 1.5939 0.6198  0.2129  -0.1119 327 VAL A CA  
1839 C  C   . VAL A 327 ? 2.3909 1.6672 1.5576 0.5691  0.1998  -0.1075 327 VAL A C   
1840 O  O   . VAL A 327 ? 2.3181 1.6810 1.5279 0.5675  0.2065  -0.0941 327 VAL A O   
1841 C  CB  . VAL A 327 ? 2.5802 1.7550 1.6656 0.6473  0.2313  -0.1410 327 VAL A CB  
1842 C  CG1 . VAL A 327 ? 2.5402 1.7985 1.6470 0.6629  0.2525  -0.1388 327 VAL A CG1 
1843 C  CG2 . VAL A 327 ? 2.6724 1.7785 1.7274 0.6967  0.2426  -0.1478 327 VAL A CG2 
1844 N  N   . PHE A 328 ? 2.3349 1.5590 1.4755 0.5280  0.1808  -0.1177 328 PHE A N   
1845 C  CA  . PHE A 328 ? 2.2542 1.5165 1.4138 0.4795  0.1662  -0.1145 328 PHE A CA  
1846 C  C   . PHE A 328 ? 2.2102 1.5283 1.4248 0.4656  0.1562  -0.0858 328 PHE A C   
1847 O  O   . PHE A 328 ? 2.1320 1.5194 1.3819 0.4442  0.1527  -0.0759 328 PHE A O   
1848 C  CB  . PHE A 328 ? 2.3184 1.5038 1.4355 0.4443  0.1497  -0.1331 328 PHE A CB  
1849 C  CG  . PHE A 328 ? 2.2774 1.4961 1.4092 0.3965  0.1352  -0.1335 328 PHE A CG  
1850 C  CD1 . PHE A 328 ? 2.2639 1.4989 1.4267 0.3650  0.1212  -0.1162 328 PHE A CD1 
1851 C  CD2 . PHE A 328 ? 2.3025 1.5332 1.4137 0.3846  0.1357  -0.1513 328 PHE A CD2 
1852 C  CE1 . PHE A 328 ? 2.2203 1.4860 1.3976 0.3242  0.1093  -0.1168 328 PHE A CE1 
1853 C  CE2 . PHE A 328 ? 2.2814 1.5424 1.4074 0.3429  0.1215  -0.1509 328 PHE A CE2 
1854 C  CZ  . PHE A 328 ? 2.2047 1.4831 1.3651 0.3136  0.1088  -0.1341 328 PHE A CZ  
1855 N  N   . ILE A 329 ? 2.1747 1.4588 1.3927 0.4789  0.1510  -0.0728 329 ILE A N   
1856 C  CA  . ILE A 329 ? 2.1105 1.4364 1.3714 0.4710  0.1404  -0.0460 329 ILE A CA  
1857 C  C   . ILE A 329 ? 2.1053 1.5204 1.4168 0.4964  0.1493  -0.0288 329 ILE A C   
1858 O  O   . ILE A 329 ? 2.0290 1.5035 1.3811 0.4789  0.1394  -0.0109 329 ILE A O   
1859 C  CB  . ILE A 329 ? 2.2003 1.4561 1.4418 0.4802  0.1326  -0.0373 329 ILE A CB  
1860 C  CG1 . ILE A 329 ? 2.2236 1.4130 1.4322 0.4392  0.1201  -0.0467 329 ILE A CG1 
1861 C  CG2 . ILE A 329 ? 2.1685 1.4689 1.4504 0.4887  0.1245  -0.0084 329 ILE A CG2 
1862 C  CD1 . ILE A 329 ? 2.3669 1.4613 1.5384 0.4481  0.1163  -0.0462 329 ILE A CD1 
1863 N  N   . ALA A 330 ? 2.0993 1.5239 1.4076 0.5363  0.1682  -0.0352 330 ALA A N   
1864 C  CA  . ALA A 330 ? 2.0602 1.5710 1.4183 0.5619  0.1800  -0.0195 330 ALA A CA  
1865 C  C   . ALA A 330 ? 2.0411 1.6235 1.4261 0.5340  0.1814  -0.0182 330 ALA A C   
1866 O  O   . ALA A 330 ? 1.9811 1.6419 1.4186 0.5363  0.1817  0.0010  330 ALA A O   
1867 C  CB  . ALA A 330 ? 2.1332 1.6299 1.4754 0.6113  0.2032  -0.0288 330 ALA A CB  
1868 N  N   . GLY A 331 ? 2.0047 1.5577 1.3535 0.5078  0.1808  -0.0379 331 GLY A N   
1869 C  CA  . GLY A 331 ? 1.9440 1.5518 1.3094 0.4798  0.1805  -0.0379 331 GLY A CA  
1870 C  C   . GLY A 331 ? 1.9248 1.5638 1.3221 0.4420  0.1601  -0.0236 331 GLY A C   
1871 O  O   . GLY A 331 ? 1.8628 1.5724 1.3028 0.4326  0.1591  -0.0090 331 GLY A O   
1872 N  N   . ILE A 332 ? 1.8885 1.4731 1.2647 0.4207  0.1445  -0.0269 332 ILE A N   
1873 C  CA  . ILE A 332 ? 1.8297 1.4331 1.2278 0.3867  0.1265  -0.0148 332 ILE A CA  
1874 C  C   . ILE A 332 ? 1.8586 1.4809 1.2864 0.3995  0.1182  0.0070  332 ILE A C   
1875 O  O   . ILE A 332 ? 1.8233 1.4436 1.2575 0.3761  0.1035  0.0161  332 ILE A O   
1876 C  CB  . ILE A 332 ? 1.8857 1.4289 1.2489 0.3544  0.1155  -0.0278 332 ILE A CB  
1877 C  CG1 . ILE A 332 ? 1.9621 1.4242 1.2883 0.3671  0.1150  -0.0343 332 ILE A CG1 
1878 C  CG2 . ILE A 332 ? 1.8897 1.4317 1.2335 0.3350  0.1175  -0.0461 332 ILE A CG2 
1879 C  CD1 . ILE A 332 ? 2.0250 1.4630 1.3542 0.3510  0.1021  -0.0203 332 ILE A CD1 
1880 N  N   . LEU A 333 ? 1.8376 1.4802 1.2832 0.4376  0.1277  0.0157  333 LEU A N   
1881 C  CA  . LEU A 333 ? 1.8337 1.4958 1.3077 0.4546  0.1185  0.0368  333 LEU A CA  
1882 C  C   . LEU A 333 ? 1.8170 1.5506 1.3371 0.4350  0.1050  0.0541  333 LEU A C   
1883 O  O   . LEU A 333 ? 1.8063 1.5410 1.3365 0.4328  0.0894  0.0688  333 LEU A O   
1884 C  CB  . LEU A 333 ? 1.8744 1.5449 1.3596 0.5024  0.1325  0.0414  333 LEU A CB  
1885 C  CG  . LEU A 333 ? 1.9698 1.6145 1.4570 0.5273  0.1235  0.0563  333 LEU A CG  
1886 C  CD1 . LEU A 333 ? 2.0352 1.5815 1.4668 0.5257  0.1212  0.0451  333 LEU A CD1 
1887 C  CD2 . LEU A 333 ? 2.0313 1.7087 1.5456 0.5751  0.1370  0.0644  333 LEU A CD2 
1888 N  N   . GLN A 334 ? 1.7247 1.5126 1.2681 0.4200  0.1099  0.0521  334 GLN A N   
1889 C  CA  . GLN A 334 ? 1.6586 1.5097 1.2433 0.3980  0.0967  0.0661  334 GLN A CA  
1890 C  C   . GLN A 334 ? 1.6749 1.4987 1.2406 0.3622  0.0802  0.0636  334 GLN A C   
1891 O  O   . GLN A 334 ? 1.6343 1.4847 1.2210 0.3504  0.0640  0.0766  334 GLN A O   
1892 C  CB  . GLN A 334 ? 1.6404 1.5459 1.2488 0.3905  0.1081  0.0643  334 GLN A CB  
1893 C  CG  . GLN A 334 ? 1.8758 1.8269 1.5148 0.4243  0.1253  0.0722  334 GLN A CG  
1894 C  CD  . GLN A 334 ? 2.1449 2.1335 1.7923 0.4180  0.1417  0.0681  334 GLN A CD  
1895 O  OE1 . GLN A 334 ? 2.1149 2.0684 1.7227 0.4205  0.1558  0.0509  334 GLN A OE1 
1896 N  NE2 . GLN A 334 ? 2.0248 2.0847 1.7230 0.4100  0.1397  0.0846  334 GLN A NE2 
1897 N  N   . ALA A 335 ? 1.6464 1.4173 1.1721 0.3460  0.0842  0.0469  335 ALA A N   
1898 C  CA  . ALA A 335 ? 1.6280 1.3710 1.1347 0.3135  0.0728  0.0432  335 ALA A CA  
1899 C  C   . ALA A 335 ? 1.7104 1.4124 1.2005 0.3163  0.0631  0.0524  335 ALA A C   
1900 O  O   . ALA A 335 ? 1.6898 1.3912 1.1778 0.2938  0.0519  0.0580  335 ALA A O   
1901 C  CB  . ALA A 335 ? 1.6510 1.3545 1.1253 0.2976  0.0800  0.0237  335 ALA A CB  
1902 N  N   . LEU A 336 ? 1.7136 1.3796 1.1895 0.3451  0.0681  0.0546  336 LEU A N   
1903 C  CA  . LEU A 336 ? 1.7464 1.3686 1.2034 0.3516  0.0597  0.0656  336 LEU A CA  
1904 C  C   . LEU A 336 ? 1.7828 1.4500 1.2691 0.3612  0.0457  0.0861  336 LEU A C   
1905 O  O   . LEU A 336 ? 1.7773 1.4317 1.2525 0.3471  0.0334  0.0957  336 LEU A O   
1906 C  CB  . LEU A 336 ? 1.8130 1.3773 1.2436 0.3812  0.0691  0.0613  336 LEU A CB  
1907 C  CG  . LEU A 336 ? 1.9036 1.4130 1.2990 0.3741  0.0804  0.0394  336 LEU A CG  
1908 C  CD1 . LEU A 336 ? 1.9719 1.4344 1.3463 0.4108  0.0906  0.0342  336 LEU A CD1 
1909 C  CD2 . LEU A 336 ? 1.9394 1.3982 1.3062 0.3402  0.0744  0.0353  336 LEU A CD2 
1910 N  N   . ILE A 337 ? 1.7326 1.4548 1.2565 0.3845  0.0473  0.0929  337 ILE A N   
1911 C  CA  . ILE A 337 ? 1.7140 1.4885 1.2736 0.3940  0.0316  0.1120  337 ILE A CA  
1912 C  C   . ILE A 337 ? 1.7306 1.5372 1.3007 0.3599  0.0169  0.1145  337 ILE A C   
1913 O  O   . ILE A 337 ? 1.7248 1.5391 1.2967 0.3570  -0.0011 0.1275  337 ILE A O   
1914 C  CB  . ILE A 337 ? 1.7424 1.5745 1.3461 0.4232  0.0395  0.1177  337 ILE A CB  
1915 C  CG1 . ILE A 337 ? 1.8046 1.6018 1.3967 0.4641  0.0497  0.1198  337 ILE A CG1 
1916 C  CG2 . ILE A 337 ? 1.7126 1.6163 1.3651 0.4221  0.0215  0.1353  337 ILE A CG2 
1917 C  CD1 . ILE A 337 ? 1.8961 1.7268 1.5129 0.4925  0.0699  0.1155  337 ILE A CD1 
1918 N  N   . THR A 338 ? 1.6624 1.4823 1.2343 0.3353  0.0241  0.1015  338 THR A N   
1919 C  CA  . THR A 338 ? 1.6221 1.4658 1.2004 0.3041  0.0125  0.1013  338 THR A CA  
1920 C  C   . THR A 338 ? 1.7056 1.4993 1.2446 0.2849  0.0076  0.0989  338 THR A C   
1921 O  O   . THR A 338 ? 1.6919 1.4985 1.2306 0.2688  -0.0060 0.1043  338 THR A O   
1922 C  CB  . THR A 338 ? 1.6496 1.5253 1.2447 0.2876  0.0214  0.0907  338 THR A CB  
1923 O  OG1 . THR A 338 ? 1.6572 1.4946 1.2256 0.2868  0.0377  0.0755  338 THR A OG1 
1924 C  CG2 . THR A 338 ? 1.6039 1.5421 1.2448 0.3007  0.0235  0.0986  338 THR A CG2 
1925 N  N   . ALA A 339 ? 1.6990 1.4352 1.2044 0.2862  0.0188  0.0912  339 ALA A N   
1926 C  CA  . ALA A 339 ? 1.7162 1.4044 1.1866 0.2679  0.0172  0.0913  339 ALA A CA  
1927 C  C   . ALA A 339 ? 1.7934 1.4656 1.2504 0.2798  0.0049  0.1088  339 ALA A C   
1928 O  O   . ALA A 339 ? 1.7887 1.4447 1.2247 0.2631  -0.0006 0.1138  339 ALA A O   
1929 C  CB  . ALA A 339 ? 1.7617 1.3939 1.2045 0.2660  0.0307  0.0799  339 ALA A CB  
1930 N  N   . LEU A 340 ? 1.7767 1.4556 1.2456 0.3104  0.0011  0.1188  340 LEU A N   
1931 C  CA  . LEU A 340 ? 1.8098 1.4791 1.2697 0.3277  -0.0131 0.1373  340 LEU A CA  
1932 C  C   . LEU A 340 ? 1.8227 1.5421 1.3009 0.3172  -0.0323 0.1452  340 LEU A C   
1933 O  O   . LEU A 340 ? 1.8362 1.5396 1.2904 0.3136  -0.0450 0.1562  340 LEU A O   
1934 C  CB  . LEU A 340 ? 1.8399 1.5150 1.3179 0.3655  -0.0116 0.1442  340 LEU A CB  
1935 C  CG  . LEU A 340 ? 1.9339 1.6147 1.4148 0.3903  -0.0292 0.1651  340 LEU A CG  
1936 C  CD1 . LEU A 340 ? 2.0033 1.6105 1.4375 0.3985  -0.0282 0.1741  340 LEU A CD1 
1937 C  CD2 . LEU A 340 ? 1.9620 1.6837 1.4836 0.4244  -0.0286 0.1706  340 LEU A CD2 
1938 N  N   . GLY A 341 ? 1.7331 1.5095 1.2506 0.3120  -0.0343 0.1396  341 GLY A N   
1939 C  CA  . GLY A 341 ? 1.7019 1.5266 1.2411 0.3000  -0.0534 0.1448  341 GLY A CA  
1940 C  C   . GLY A 341 ? 1.7364 1.5487 1.2513 0.2697  -0.0561 0.1373  341 GLY A C   
1941 O  O   . GLY A 341 ? 1.7454 1.5573 1.2443 0.2639  -0.0730 0.1446  341 GLY A O   
1942 N  N   . THR A 342 ? 1.6634 1.4659 1.1741 0.2516  -0.0399 0.1226  342 THR A N   
1943 C  CA  . THR A 342 ? 1.6396 1.4342 1.1323 0.2246  -0.0394 0.1145  342 THR A CA  
1944 C  C   . THR A 342 ? 1.7218 1.4648 1.1701 0.2179  -0.0342 0.1174  342 THR A C   
1945 O  O   . THR A 342 ? 1.7154 1.4551 1.1442 0.2045  -0.0408 0.1185  342 THR A O   
1946 C  CB  . THR A 342 ? 1.6740 1.4799 1.1810 0.2094  -0.0253 0.0995  342 THR A CB  
1947 O  OG1 . THR A 342 ? 1.6702 1.4394 1.1622 0.2138  -0.0087 0.0934  342 THR A OG1 
1948 C  CG2 . THR A 342 ? 1.6207 1.4785 1.1697 0.2127  -0.0283 0.0983  342 THR A CG2 
1949 N  N   . SER A 343 ? 1.7087 1.4097 1.1400 0.2267  -0.0214 0.1184  343 SER A N   
1950 C  CA  . SER A 343 ? 1.7451 1.3934 1.1374 0.2187  -0.0128 0.1226  343 SER A CA  
1951 C  C   . SER A 343 ? 1.7742 1.4180 1.1618 0.1914  -0.0004 0.1103  343 SER A C   
1952 O  O   . SER A 343 ? 1.7962 1.4095 1.1568 0.1785  0.0067  0.1143  343 SER A O   
1953 C  CB  . SER A 343 ? 1.8202 1.4559 1.1846 0.2237  -0.0254 0.1384  343 SER A CB  
1954 O  OG  . SER A 343 ? 1.9678 1.5492 1.2984 0.2290  -0.0179 0.1491  343 SER A OG  
1955 N  N   . SER A 344 ? 1.6821 1.3581 1.0976 0.1835  0.0028  0.0967  344 SER A N   
1956 C  CA  . SER A 344 ? 1.6526 1.3337 1.0715 0.1605  0.0120  0.0845  344 SER A CA  
1957 C  C   . SER A 344 ? 1.6982 1.3811 1.1334 0.1610  0.0205  0.0721  344 SER A C   
1958 O  O   . SER A 344 ? 1.6746 1.3905 1.1337 0.1701  0.0171  0.0685  344 SER A O   
1959 C  CB  . SER A 344 ? 1.6595 1.3811 1.0927 0.1512  0.0030  0.0812  344 SER A CB  
1960 O  OG  . SER A 344 ? 1.7473 1.4757 1.1846 0.1316  0.0111  0.0707  344 SER A OG  
1961 N  N   . SER A 345 ? 1.6782 1.3246 1.0992 0.1510  0.0312  0.0662  345 SER A N   
1962 C  CA  . SER A 345 ? 1.6718 1.3117 1.0997 0.1505  0.0379  0.0525  345 SER A CA  
1963 C  C   . SER A 345 ? 1.6814 1.3579 1.1289 0.1354  0.0382  0.0410  345 SER A C   
1964 O  O   . SER A 345 ? 1.6670 1.3529 1.1232 0.1397  0.0408  0.0310  345 SER A O   
1965 C  CB  . SER A 345 ? 1.7485 1.3352 1.1543 0.1421  0.0455  0.0495  345 SER A CB  
1966 O  OG  . SER A 345 ? 1.8407 1.4213 1.2424 0.1167  0.0494  0.0497  345 SER A OG  
1967 N  N   . SER A 346 ? 1.6206 1.3165 1.0727 0.1197  0.0359  0.0430  346 SER A N   
1968 C  CA  . SER A 346 ? 1.5847 1.3142 1.0551 0.1071  0.0350  0.0341  346 SER A CA  
1969 C  C   . SER A 346 ? 1.6151 1.3833 1.1054 0.1178  0.0275  0.0359  346 SER A C   
1970 O  O   . SER A 346 ? 1.5923 1.3832 1.0974 0.1145  0.0282  0.0286  346 SER A O   
1971 C  CB  . SER A 346 ? 1.6252 1.3596 1.0929 0.0902  0.0364  0.0358  346 SER A CB  
1972 O  OG  . SER A 346 ? 1.7562 1.4966 1.2160 0.0956  0.0307  0.0454  346 SER A OG  
1973 N  N   . ALA A 347 ? 1.5820 1.3574 1.0727 0.1301  0.0197  0.0465  347 ALA A N   
1974 C  CA  . ALA A 347 ? 1.5629 1.3767 1.0770 0.1385  0.0109  0.0505  347 ALA A CA  
1975 C  C   . ALA A 347 ? 1.6228 1.4475 1.1511 0.1550  0.0157  0.0498  347 ALA A C   
1976 O  O   . ALA A 347 ? 1.5969 1.4573 1.1489 0.1563  0.0140  0.0501  347 ALA A O   
1977 C  CB  . ALA A 347 ? 1.5857 1.4036 1.0958 0.1455  -0.0016 0.0619  347 ALA A CB  
1978 N  N   . THR A 348 ? 1.6141 1.4066 1.1270 0.1682  0.0227  0.0495  348 THR A N   
1979 C  CA  . THR A 348 ? 1.6225 1.4198 1.1436 0.1882  0.0299  0.0477  348 THR A CA  
1980 C  C   . THR A 348 ? 1.6750 1.4588 1.1864 0.1827  0.0407  0.0331  348 THR A C   
1981 O  O   . THR A 348 ? 1.6786 1.4634 1.1908 0.1996  0.0488  0.0292  348 THR A O   
1982 C  CB  . THR A 348 ? 1.7407 1.5099 1.2500 0.2103  0.0304  0.0554  348 THR A CB  
1983 O  OG1 . THR A 348 ? 1.7551 1.4729 1.2338 0.2023  0.0327  0.0536  348 THR A OG1 
1984 C  CG2 . THR A 348 ? 1.7092 1.5053 1.2353 0.2214  0.0179  0.0704  348 THR A CG2 
1985 N  N   . LEU A 349 ? 1.6297 1.4036 1.1322 0.1601  0.0403  0.0251  349 LEU A N   
1986 C  CA  . LEU A 349 ? 1.6358 1.3991 1.1288 0.1514  0.0462  0.0111  349 LEU A CA  
1987 C  C   . LEU A 349 ? 1.6585 1.4572 1.1658 0.1587  0.0502  0.0081  349 LEU A C   
1988 O  O   . LEU A 349 ? 1.6766 1.4595 1.1690 0.1678  0.0577  -0.0014 349 LEU A O   
1989 C  CB  . LEU A 349 ? 1.6255 1.3834 1.1152 0.1260  0.0430  0.0062  349 LEU A CB  
1990 C  CG  . LEU A 349 ? 1.6989 1.4437 1.1786 0.1144  0.0451  -0.0081 349 LEU A CG  
1991 C  CD1 . LEU A 349 ? 1.7521 1.4470 1.2073 0.1163  0.0485  -0.0153 349 LEU A CD1 
1992 C  CD2 . LEU A 349 ? 1.7054 1.4631 1.1940 0.0918  0.0409  -0.0100 349 LEU A CD2 
1993 N  N   . PRO A 350 ? 1.5681 1.4109 1.1011 0.1560  0.0459  0.0164  350 PRO A N   
1994 C  CA  . PRO A 350 ? 1.5470 1.4214 1.0925 0.1622  0.0519  0.0161  350 PRO A CA  
1995 C  C   . PRO A 350 ? 1.6029 1.4832 1.1509 0.1879  0.0623  0.0190  350 PRO A C   
1996 O  O   . PRO A 350 ? 1.5995 1.4897 1.1431 0.1954  0.0724  0.0143  350 PRO A O   
1997 C  CB  . PRO A 350 ? 1.5315 1.4454 1.1046 0.1516  0.0434  0.0265  350 PRO A CB  
1998 C  CG  . PRO A 350 ? 1.5873 1.4937 1.1631 0.1498  0.0335  0.0334  350 PRO A CG  
1999 C  CD  . PRO A 350 ? 1.5573 1.4196 1.1057 0.1458  0.0353  0.0258  350 PRO A CD  
2000 N  N   . ILE A 351 ? 1.5665 1.4406 1.1200 0.2033  0.0606  0.0270  351 ILE A N   
2001 C  CA  . ILE A 351 ? 1.5829 1.4627 1.1415 0.2316  0.0708  0.0307  351 ILE A CA  
2002 C  C   . ILE A 351 ? 1.6751 1.5024 1.1965 0.2435  0.0803  0.0163  351 ILE A C   
2003 O  O   . ILE A 351 ? 1.6970 1.5263 1.2121 0.2639  0.0935  0.0118  351 ILE A O   
2004 C  CB  . ILE A 351 ? 1.6166 1.5157 1.1996 0.2446  0.0627  0.0465  351 ILE A CB  
2005 C  CG1 . ILE A 351 ? 1.5859 1.5470 1.2111 0.2407  0.0583  0.0595  351 ILE A CG1 
2006 C  CG2 . ILE A 351 ? 1.6613 1.5424 1.2381 0.2761  0.0714  0.0483  351 ILE A CG2 
2007 C  CD1 . ILE A 351 ? 1.7028 1.6891 1.3551 0.2442  0.0431  0.0747  351 ILE A CD1 
2008 N  N   . THR A 352 ? 1.6406 1.4207 1.1362 0.2293  0.0741  0.0086  352 THR A N   
2009 C  CA  . THR A 352 ? 1.6843 1.4080 1.1433 0.2345  0.0798  -0.0062 352 THR A CA  
2010 C  C   . THR A 352 ? 1.7271 1.4500 1.1696 0.2271  0.0849  -0.0213 352 THR A C   
2011 O  O   . THR A 352 ? 1.7649 1.4516 1.1777 0.2395  0.0921  -0.0348 352 THR A O   
2012 C  CB  . THR A 352 ? 1.8111 1.4894 1.2525 0.2172  0.0715  -0.0075 352 THR A CB  
2013 O  OG1 . THR A 352 ? 1.8321 1.5253 1.2908 0.2162  0.0640  0.0086  352 THR A OG1 
2014 C  CG2 . THR A 352 ? 1.8395 1.4552 1.2480 0.2295  0.0760  -0.0166 352 THR A CG2 
2015 N  N   . PHE A 353 ? 1.6357 1.3966 1.0950 0.2082  0.0804  -0.0191 353 PHE A N   
2016 C  CA  . PHE A 353 ? 1.6295 1.3979 1.0758 0.2008  0.0832  -0.0299 353 PHE A CA  
2017 C  C   . PHE A 353 ? 1.7013 1.4940 1.1487 0.2255  0.0979  -0.0280 353 PHE A C   
2018 O  O   . PHE A 353 ? 1.7369 1.5056 1.1525 0.2355  0.1056  -0.0417 353 PHE A O   
2019 C  CB  . PHE A 353 ? 1.5992 1.4028 1.0667 0.1773  0.0742  -0.0242 353 PHE A CB  
2020 C  CG  . PHE A 353 ? 1.6142 1.3954 1.0687 0.1531  0.0643  -0.0343 353 PHE A CG  
2021 C  CD1 . PHE A 353 ? 1.6653 1.4410 1.1007 0.1458  0.0627  -0.0463 353 PHE A CD1 
2022 C  CD2 . PHE A 353 ? 1.6313 1.3998 1.0934 0.1380  0.0564  -0.0307 353 PHE A CD2 
2023 C  CE1 . PHE A 353 ? 1.6784 1.4395 1.1080 0.1233  0.0517  -0.0546 353 PHE A CE1 
2024 C  CE2 . PHE A 353 ? 1.6674 1.4225 1.1241 0.1157  0.0487  -0.0383 353 PHE A CE2 
2025 C  CZ  . PHE A 353 ? 1.6540 1.4069 1.0971 0.1082  0.0456  -0.0501 353 PHE A CZ  
2026 N  N   . LYS A 354 ? 1.6369 1.4763 1.1199 0.2358  0.1018  -0.0110 354 LYS A N   
2027 C  CA  . LYS A 354 ? 1.6474 1.5202 1.1413 0.2595  0.1180  -0.0048 354 LYS A CA  
2028 C  C   . LYS A 354 ? 1.7662 1.6077 1.2393 0.2907  0.1306  -0.0116 354 LYS A C   
2029 O  O   . LYS A 354 ? 1.7899 1.6391 1.2508 0.3116  0.1474  -0.0154 354 LYS A O   
2030 C  CB  . LYS A 354 ? 1.6325 1.5642 1.1759 0.2584  0.1160  0.0162  354 LYS A CB  
2031 C  CG  . LYS A 354 ? 1.7995 1.7775 1.3617 0.2753  0.1335  0.0257  354 LYS A CG  
2032 C  CD  . LYS A 354 ? 1.8831 1.9182 1.4922 0.2609  0.1277  0.0448  354 LYS A CD  
2033 C  CE  . LYS A 354 ? 2.0110 2.0655 1.6158 0.2461  0.1327  0.0461  354 LYS A CE  
2034 N  NZ  . LYS A 354 ? 2.1610 2.2472 1.7704 0.2659  0.1557  0.0530  354 LYS A NZ  
2035 N  N   . CYS A 355 ? 1.7517 1.5548 1.2173 0.2949  0.1233  -0.0130 355 CYS A N   
2036 C  CA  . CYS A 355 ? 1.8092 1.5734 1.2525 0.3250  0.1333  -0.0196 355 CYS A CA  
2037 C  C   . CYS A 355 ? 1.9093 1.6144 1.2999 0.3254  0.1372  -0.0430 355 CYS A C   
2038 O  O   . CYS A 355 ? 1.9434 1.6338 1.3110 0.3526  0.1526  -0.0520 355 CYS A O   
2039 C  CB  . CYS A 355 ? 1.8225 1.5632 1.2739 0.3289  0.1232  -0.0110 355 CYS A CB  
2040 S  SG  . CYS A 355 ? 1.8335 1.6395 1.3413 0.3419  0.1198  0.0150  355 CYS A SG  
2041 N  N   . LEU A 356 ? 1.8700 1.5426 1.2417 0.2954  0.1230  -0.0532 356 LEU A N   
2042 C  CA  . LEU A 356 ? 1.9236 1.5402 1.2472 0.2899  0.1214  -0.0758 356 LEU A CA  
2043 C  C   . LEU A 356 ? 1.9873 1.6235 1.2929 0.2909  0.1286  -0.0854 356 LEU A C   
2044 O  O   . LEU A 356 ? 2.0457 1.6413 1.3075 0.3044  0.1349  -0.1036 356 LEU A O   
2045 C  CB  . LEU A 356 ? 1.9195 1.5034 1.2360 0.2559  0.1035  -0.0815 356 LEU A CB  
2046 C  CG  . LEU A 356 ? 2.0119 1.5451 1.3208 0.2553  0.0979  -0.0797 356 LEU A CG  
2047 C  CD1 . LEU A 356 ? 2.0025 1.5182 1.3127 0.2195  0.0831  -0.0815 356 LEU A CD1 
2048 C  CD2 . LEU A 356 ? 2.1235 1.5907 1.3890 0.2757  0.1038  -0.0964 356 LEU A CD2 
2049 N  N   . GLU A 357 ? 1.8887 1.5824 1.2237 0.2768  0.1272  -0.0734 357 GLU A N   
2050 C  CA  . GLU A 357 ? 1.8907 1.6050 1.2084 0.2768  0.1338  -0.0789 357 GLU A CA  
2051 C  C   . GLU A 357 ? 1.9644 1.7045 1.2802 0.3100  0.1572  -0.0740 357 GLU A C   
2052 O  O   . GLU A 357 ? 2.0068 1.7299 1.2816 0.3218  0.1669  -0.0875 357 GLU A O   
2053 C  CB  . GLU A 357 ? 1.8474 1.6081 1.1945 0.2501  0.1238  -0.0670 357 GLU A CB  
2054 C  CG  . GLU A 357 ? 1.9759 1.7128 1.3158 0.2190  0.1035  -0.0758 357 GLU A CG  
2055 C  CD  . GLU A 357 ? 2.2446 2.0239 1.6160 0.1955  0.0934  -0.0636 357 GLU A CD  
2056 O  OE1 . GLU A 357 ? 2.2171 2.0429 1.6149 0.2005  0.1009  -0.0481 357 GLU A OE1 
2057 O  OE2 . GLU A 357 ? 2.1694 1.9350 1.5398 0.1720  0.0782  -0.0694 357 GLU A OE2 
2058 N  N   . GLU A 358 ? 1.8930 1.6749 1.2522 0.3256  0.1662  -0.0548 358 GLU A N   
2059 C  CA  . GLU A 358 ? 1.9067 1.7254 1.2760 0.3569  0.1902  -0.0462 358 GLU A CA  
2060 C  C   . GLU A 358 ? 2.0127 1.7997 1.3660 0.3936  0.2039  -0.0529 358 GLU A C   
2061 O  O   . GLU A 358 ? 2.0630 1.8307 1.3779 0.4180  0.2216  -0.0655 358 GLU A O   
2062 C  CB  . GLU A 358 ? 1.8641 1.7570 1.2952 0.3519  0.1926  -0.0198 358 GLU A CB  
2063 C  CG  . GLU A 358 ? 1.9693 1.8961 1.4116 0.3237  0.1861  -0.0123 358 GLU A CG  
2064 C  CD  . GLU A 358 ? 2.2740 2.2719 1.7691 0.3215  0.1936  0.0124  358 GLU A CD  
2065 O  OE1 . GLU A 358 ? 2.2695 2.2899 1.7755 0.2968  0.1858  0.0198  358 GLU A OE1 
2066 O  OE2 . GLU A 358 ? 2.2218 2.2530 1.7484 0.3442  0.2068  0.0249  358 GLU A OE2 
2067 N  N   . ASN A 359 ? 1.9618 1.7430 1.3420 0.4000  0.1965  -0.0441 359 ASN A N   
2068 C  CA  . ASN A 359 ? 2.0141 1.7657 1.3841 0.4370  0.2081  -0.0474 359 ASN A CA  
2069 C  C   . ASN A 359 ? 2.1365 1.8034 1.4402 0.4466  0.2090  -0.0746 359 ASN A C   
2070 O  O   . ASN A 359 ? 2.1928 1.8366 1.4720 0.4832  0.2271  -0.0831 359 ASN A O   
2071 C  CB  . ASN A 359 ? 2.0246 1.7832 1.4330 0.4380  0.1955  -0.0314 359 ASN A CB  
2072 C  CG  . ASN A 359 ? 2.3569 2.1944 1.8288 0.4284  0.1910  -0.0061 359 ASN A CG  
2073 O  OD1 . ASN A 359 ? 2.3229 2.2195 1.8222 0.4360  0.2052  0.0045  359 ASN A OD1 
2074 N  ND2 . ASN A 359 ? 2.2094 2.0479 1.7048 0.4111  0.1712  0.0044  359 ASN A ND2 
2075 N  N   . ASN A 360 ? 2.0876 1.7094 1.3634 0.4138  0.1895  -0.0883 360 ASN A N   
2076 C  CA  . ASN A 360 ? 2.1500 1.6904 1.3641 0.4131  0.1847  -0.1149 360 ASN A CA  
2077 C  C   . ASN A 360 ? 2.1804 1.7213 1.3629 0.3928  0.1809  -0.1292 360 ASN A C   
2078 O  O   . ASN A 360 ? 2.1100 1.7073 1.3214 0.3731  0.1777  -0.1168 360 ASN A O   
2079 C  CB  . ASN A 360 ? 2.1783 1.6659 1.3886 0.3899  0.1638  -0.1176 360 ASN A CB  
2080 C  CG  . ASN A 360 ? 2.5012 1.9749 1.7315 0.4105  0.1653  -0.1046 360 ASN A CG  
2081 O  OD1 . ASN A 360 ? 2.4695 1.9467 1.7013 0.4496  0.1819  -0.1013 360 ASN A OD1 
2082 N  ND2 . ASN A 360 ? 2.3757 1.8312 1.6196 0.3859  0.1482  -0.0967 360 ASN A ND2 
2083 N  N   . GLY A 361 ? 2.2030 1.6793 1.3247 0.3987  0.1802  -0.1549 361 GLY A N   
2084 C  CA  . GLY A 361 ? 2.2147 1.6845 1.2979 0.3829  0.1747  -0.1706 361 GLY A CA  
2085 C  C   . GLY A 361 ? 2.2382 1.6796 1.3141 0.3405  0.1466  -0.1799 361 GLY A C   
2086 O  O   . GLY A 361 ? 2.2894 1.6846 1.3150 0.3312  0.1363  -0.2026 361 GLY A O   
2087 N  N   . VAL A 362 ? 2.1114 1.5820 1.2374 0.3149  0.1340  -0.1624 362 VAL A N   
2088 C  CA  . VAL A 362 ? 2.0847 1.5372 1.2136 0.2751  0.1096  -0.1676 362 VAL A CA  
2089 C  C   . VAL A 362 ? 2.0725 1.5744 1.2132 0.2534  0.1018  -0.1633 362 VAL A C   
2090 O  O   . VAL A 362 ? 2.0154 1.5778 1.1867 0.2604  0.1125  -0.1459 362 VAL A O   
2091 C  CB  . VAL A 362 ? 2.0950 1.5445 1.2628 0.2590  0.1006  -0.1531 362 VAL A CB  
2092 C  CG1 . VAL A 362 ? 2.1080 1.5137 1.2637 0.2246  0.0793  -0.1646 362 VAL A CG1 
2093 C  CG2 . VAL A 362 ? 2.1287 1.5475 1.2939 0.2887  0.1125  -0.1492 362 VAL A CG2 
2094 N  N   . ASP A 363 ? 2.0400 1.5140 1.1552 0.2278  0.0824  -0.1793 363 ASP A N   
2095 C  CA  . ASP A 363 ? 1.9981 1.5096 1.1182 0.2071  0.0711  -0.1776 363 ASP A CA  
2096 C  C   . ASP A 363 ? 1.9381 1.4982 1.1157 0.1830  0.0626  -0.1574 363 ASP A C   
2097 O  O   . ASP A 363 ? 1.9108 1.4568 1.1117 0.1683  0.0552  -0.1532 363 ASP A O   
2098 C  CB  . ASP A 363 ? 2.0766 1.5416 1.1542 0.1872  0.0496  -0.2014 363 ASP A CB  
2099 C  CG  . ASP A 363 ? 2.1903 1.6819 1.2480 0.1805  0.0418  -0.2052 363 ASP A CG  
2100 O  OD1 . ASP A 363 ? 2.1217 1.6632 1.2178 0.1623  0.0341  -0.1900 363 ASP A OD1 
2101 O  OD2 . ASP A 363 ? 2.3461 1.8049 1.3467 0.1938  0.0424  -0.2240 363 ASP A OD2 
2102 N  N   . LYS A 364 ? 1.8372 1.4513 1.0340 0.1796  0.0644  -0.1449 364 LYS A N   
2103 C  CA  . LYS A 364 ? 1.7588 1.4189 1.0052 0.1591  0.0566  -0.1270 364 LYS A CA  
2104 C  C   . LYS A 364 ? 1.8118 1.4573 1.0626 0.1285  0.0344  -0.1351 364 LYS A C   
2105 O  O   . LYS A 364 ? 1.7683 1.4269 1.0559 0.1126  0.0291  -0.1250 364 LYS A O   
2106 C  CB  . LYS A 364 ? 1.7476 1.4596 1.0059 0.1630  0.0628  -0.1136 364 LYS A CB  
2107 C  CG  . LYS A 364 ? 1.8403 1.5867 1.1216 0.1847  0.0834  -0.0965 364 LYS A CG  
2108 C  CD  . LYS A 364 ? 1.9359 1.7304 1.2295 0.1845  0.0888  -0.0818 364 LYS A CD  
2109 C  CE  . LYS A 364 ? 2.0506 1.8908 1.3943 0.1858  0.0966  -0.0592 364 LYS A CE  
2110 N  NZ  . LYS A 364 ? 2.1785 2.0279 1.5298 0.2115  0.1163  -0.0528 364 LYS A NZ  
2111 N  N   . ARG A 365 ? 1.8197 1.4376 1.0325 0.1207  0.0214  -0.1534 365 ARG A N   
2112 C  CA  . ARG A 365 ? 1.8240 1.4313 1.0422 0.0910  -0.0018 -0.1619 365 ARG A CA  
2113 C  C   . ARG A 365 ? 1.8797 1.4541 1.1133 0.0756  -0.0070 -0.1643 365 ARG A C   
2114 O  O   . ARG A 365 ? 1.8553 1.4392 1.1150 0.0493  -0.0216 -0.1624 365 ARG A O   
2115 C  CB  . ARG A 365 ? 1.9019 1.4803 1.0705 0.0879  -0.0163 -0.1830 365 ARG A CB  
2116 C  CG  . ARG A 365 ? 2.0502 1.6655 1.2064 0.0946  -0.0172 -0.1782 365 ARG A CG  
2117 C  CD  . ARG A 365 ? 2.2588 1.8406 1.3562 0.0955  -0.0310 -0.1999 365 ARG A CD  
2118 N  NE  . ARG A 365 ? 2.4792 2.0094 1.5260 0.1177  -0.0185 -0.2166 365 ARG A NE  
2119 C  CZ  . ARG A 365 ? 2.8039 2.3028 1.7877 0.1303  -0.0212 -0.2351 365 ARG A CZ  
2120 N  NH1 . ARG A 365 ? 2.6831 2.1989 1.6460 0.1223  -0.0370 -0.2378 365 ARG A NH1 
2121 N  NH2 . ARG A 365 ? 2.7335 2.1828 1.6722 0.1530  -0.0079 -0.2507 365 ARG A NH2 
2122 N  N   . ILE A 366 ? 1.8673 1.4043 1.0859 0.0926  0.0058  -0.1669 366 ILE A N   
2123 C  CA  . ILE A 366 ? 1.8817 1.3814 1.1102 0.0799  0.0026  -0.1669 366 ILE A CA  
2124 C  C   . ILE A 366 ? 1.8898 1.4146 1.1565 0.0877  0.0163  -0.1452 366 ILE A C   
2125 O  O   . ILE A 366 ? 1.8767 1.3933 1.1655 0.0696  0.0120  -0.1381 366 ILE A O   
2126 C  CB  . ILE A 366 ? 2.0033 1.4294 1.1836 0.0886  0.0015  -0.1871 366 ILE A CB  
2127 C  CG1 . ILE A 366 ? 2.0334 1.4433 1.1932 0.1261  0.0226  -0.1859 366 ILE A CG1 
2128 C  CG2 . ILE A 366 ? 2.0647 1.4638 1.2031 0.0795  -0.0151 -0.2101 366 ILE A CG2 
2129 C  CD1 . ILE A 366 ? 2.1444 1.5313 1.3203 0.1310  0.0300  -0.1751 366 ILE A CD1 
2130 N  N   . THR A 367 ? 1.8242 1.3801 1.0984 0.1134  0.0320  -0.1341 367 THR A N   
2131 C  CA  . THR A 367 ? 1.7787 1.3611 1.0878 0.1209  0.0416  -0.1140 367 THR A CA  
2132 C  C   . THR A 367 ? 1.7663 1.3960 1.1148 0.1004  0.0350  -0.1006 367 THR A C   
2133 O  O   . THR A 367 ? 1.7211 1.3601 1.0943 0.0960  0.0370  -0.0874 367 THR A O   
2134 C  CB  . THR A 367 ? 1.8729 1.4784 1.1835 0.1522  0.0582  -0.1058 367 THR A CB  
2135 O  OG1 . THR A 367 ? 1.8538 1.4983 1.1642 0.1562  0.0609  -0.1050 367 THR A OG1 
2136 C  CG2 . THR A 367 ? 1.9163 1.4752 1.1937 0.1778  0.0681  -0.1159 367 THR A CG2 
2137 N  N   . ARG A 368 ? 1.7268 1.3834 1.0776 0.0893  0.0269  -0.1044 368 ARG A N   
2138 C  CA  . ARG A 368 ? 1.6828 1.3816 1.0676 0.0719  0.0200  -0.0939 368 ARG A CA  
2139 C  C   . ARG A 368 ? 1.7672 1.4536 1.1676 0.0471  0.0106  -0.0945 368 ARG A C   
2140 O  O   . ARG A 368 ? 1.7245 1.4425 1.1555 0.0358  0.0087  -0.0840 368 ARG A O   
2141 C  CB  . ARG A 368 ? 1.6576 1.3831 1.0365 0.0696  0.0133  -0.0976 368 ARG A CB  
2142 C  CG  . ARG A 368 ? 1.6941 1.4521 1.0766 0.0886  0.0247  -0.0870 368 ARG A CG  
2143 C  CD  . ARG A 368 ? 1.7466 1.5192 1.1107 0.0893  0.0197  -0.0915 368 ARG A CD  
2144 N  NE  . ARG A 368 ? 1.7512 1.5536 1.1182 0.1063  0.0328  -0.0795 368 ARG A NE  
2145 C  CZ  . ARG A 368 ? 1.8193 1.6458 1.1807 0.1065  0.0309  -0.0748 368 ARG A CZ  
2146 N  NH1 . ARG A 368 ? 1.6063 1.4320 0.9585 0.0924  0.0149  -0.0816 368 ARG A NH1 
2147 N  NH2 . ARG A 368 ? 1.5825 1.4356 0.9493 0.1201  0.0445  -0.0617 368 ARG A NH2 
2148 N  N   . PHE A 369 ? 1.7938 1.4329 1.1730 0.0390  0.0058  -0.1064 369 PHE A N   
2149 C  CA  . PHE A 369 ? 1.8076 1.4325 1.2026 0.0139  -0.0013 -0.1054 369 PHE A CA  
2150 C  C   . PHE A 369 ? 1.8668 1.4546 1.2573 0.0177  0.0078  -0.0988 369 PHE A C   
2151 O  O   . PHE A 369 ? 1.8415 1.4410 1.2561 0.0069  0.0113  -0.0857 369 PHE A O   
2152 C  CB  . PHE A 369 ? 1.8800 1.4815 1.2606 -0.0064 -0.0178 -0.1222 369 PHE A CB  
2153 C  CG  . PHE A 369 ? 1.9207 1.5114 1.3238 -0.0347 -0.0241 -0.1189 369 PHE A CG  
2154 C  CD1 . PHE A 369 ? 1.9274 1.5639 1.3705 -0.0527 -0.0283 -0.1094 369 PHE A CD1 
2155 C  CD2 . PHE A 369 ? 2.0098 1.5447 1.3955 -0.0424 -0.0239 -0.1236 369 PHE A CD2 
2156 C  CE1 . PHE A 369 ? 1.9512 1.5832 1.4189 -0.0784 -0.0307 -0.1039 369 PHE A CE1 
2157 C  CE2 . PHE A 369 ? 2.0597 1.5864 1.4688 -0.0703 -0.0275 -0.1173 369 PHE A CE2 
2158 C  CZ  . PHE A 369 ? 1.9926 1.5706 1.4439 -0.0884 -0.0301 -0.1072 369 PHE A CZ  
2159 N  N   . VAL A 370 ? 1.8590 1.4003 1.2161 0.0343  0.0119  -0.1077 370 VAL A N   
2160 C  CA  . VAL A 370 ? 1.8839 1.3816 1.2309 0.0410  0.0193  -0.1019 370 VAL A CA  
2161 C  C   . VAL A 370 ? 1.8964 1.4225 1.2646 0.0554  0.0303  -0.0818 370 VAL A C   
2162 O  O   . VAL A 370 ? 1.8916 1.4068 1.2701 0.0453  0.0326  -0.0700 370 VAL A O   
2163 C  CB  . VAL A 370 ? 1.9922 1.4339 1.2969 0.0609  0.0216  -0.1168 370 VAL A CB  
2164 C  CG1 . VAL A 370 ? 2.0219 1.4204 1.3171 0.0737  0.0300  -0.1081 370 VAL A CG1 
2165 C  CG2 . VAL A 370 ? 2.0411 1.4429 1.3208 0.0418  0.0074  -0.1374 370 VAL A CG2 
2166 N  N   . LEU A 371 ? 1.8181 1.3807 1.1925 0.0773  0.0365  -0.0772 371 LEU A N   
2167 C  CA  . LEU A 371 ? 1.7769 1.3671 1.1710 0.0903  0.0434  -0.0595 371 LEU A CA  
2168 C  C   . LEU A 371 ? 1.7721 1.3967 1.1946 0.0719  0.0408  -0.0473 371 LEU A C   
2169 O  O   . LEU A 371 ? 1.7700 1.3845 1.1956 0.0729  0.0440  -0.0353 371 LEU A O   
2170 C  CB  . LEU A 371 ? 1.7549 1.3788 1.1538 0.1147  0.0495  -0.0567 371 LEU A CB  
2171 C  CG  . LEU A 371 ? 1.8534 1.4498 1.2300 0.1425  0.0578  -0.0617 371 LEU A CG  
2172 C  CD1 . LEU A 371 ? 1.8361 1.4733 1.2198 0.1610  0.0648  -0.0605 371 LEU A CD1 
2173 C  CD2 . LEU A 371 ? 1.8946 1.4724 1.2735 0.1570  0.0617  -0.0491 371 LEU A CD2 
2174 N  N   . PRO A 372 ? 1.6849 1.3471 1.1256 0.0574  0.0355  -0.0492 372 PRO A N   
2175 C  CA  . PRO A 372 ? 1.6454 1.3357 1.1100 0.0443  0.0353  -0.0380 372 PRO A CA  
2176 C  C   . PRO A 372 ? 1.7199 1.3864 1.1861 0.0246  0.0362  -0.0347 372 PRO A C   
2177 O  O   . PRO A 372 ? 1.7055 1.3776 1.1791 0.0226  0.0412  -0.0222 372 PRO A O   
2178 C  CB  . PRO A 372 ? 1.6319 1.3616 1.1127 0.0363  0.0294  -0.0425 372 PRO A CB  
2179 C  CG  . PRO A 372 ? 1.7003 1.4279 1.1651 0.0485  0.0278  -0.0524 372 PRO A CG  
2180 C  CD  . PRO A 372 ? 1.6957 1.3750 1.1336 0.0542  0.0297  -0.0608 372 PRO A CD  
2181 N  N   . VAL A 373 ? 1.7109 1.3498 1.1688 0.0094  0.0311  -0.0454 373 VAL A N   
2182 C  CA  . VAL A 373 ? 1.7357 1.3506 1.1978 -0.0130 0.0318  -0.0417 373 VAL A CA  
2183 C  C   . VAL A 373 ? 1.8383 1.4080 1.2800 -0.0040 0.0392  -0.0329 373 VAL A C   
2184 O  O   . VAL A 373 ? 1.8396 1.4058 1.2875 -0.0127 0.0459  -0.0191 373 VAL A O   
2185 C  CB  . VAL A 373 ? 1.8118 1.4104 1.2727 -0.0339 0.0209  -0.0562 373 VAL A CB  
2186 C  CG1 . VAL A 373 ? 1.8423 1.4136 1.3102 -0.0591 0.0219  -0.0507 373 VAL A CG1 
2187 C  CG2 . VAL A 373 ? 1.7723 1.4197 1.2561 -0.0425 0.0125  -0.0614 373 VAL A CG2 
2188 N  N   . GLY A 374 ? 1.8301 1.3676 1.2469 0.0160  0.0390  -0.0396 374 GLY A N   
2189 C  CA  . GLY A 374 ? 1.8695 1.3624 1.2653 0.0300  0.0447  -0.0315 374 GLY A CA  
2190 C  C   . GLY A 374 ? 1.8917 1.4057 1.2944 0.0438  0.0509  -0.0135 374 GLY A C   
2191 O  O   . GLY A 374 ? 1.9129 1.3951 1.3036 0.0455  0.0552  -0.0012 374 GLY A O   
2192 N  N   . ALA A 375 ? 1.8025 1.3678 1.2226 0.0528  0.0501  -0.0114 375 ALA A N   
2193 C  CA  . ALA A 375 ? 1.7802 1.3691 1.2066 0.0648  0.0523  0.0034  375 ALA A CA  
2194 C  C   . ALA A 375 ? 1.8310 1.4255 1.2627 0.0478  0.0562  0.0150  375 ALA A C   
2195 O  O   . ALA A 375 ? 1.8338 1.4289 1.2587 0.0572  0.0580  0.0281  375 ALA A O   
2196 C  CB  . ALA A 375 ? 1.7424 1.3812 1.1864 0.0748  0.0489  0.0009  375 ALA A CB  
2197 N  N   . THR A 376 ? 1.7783 1.3791 1.2222 0.0237  0.0575  0.0107  376 THR A N   
2198 C  CA  . THR A 376 ? 1.7668 1.3778 1.2183 0.0081  0.0647  0.0222  376 THR A CA  
2199 C  C   . THR A 376 ? 1.8410 1.4116 1.2848 -0.0111 0.0708  0.0284  376 THR A C   
2200 O  O   . THR A 376 ? 1.8490 1.4149 1.2878 -0.0166 0.0799  0.0434  376 THR A O   
2201 C  CB  . THR A 376 ? 1.8322 1.4920 1.3101 -0.0028 0.0640  0.0173  376 THR A CB  
2202 O  OG1 . THR A 376 ? 1.8495 1.5199 1.3324 -0.0131 0.0739  0.0291  376 THR A OG1 
2203 C  CG2 . THR A 376 ? 1.7968 1.4637 1.2908 -0.0190 0.0578  0.0038  376 THR A CG2 
2204 N  N   . ILE A 377 ? 1.8078 1.3478 1.2486 -0.0218 0.0657  0.0176  377 ILE A N   
2205 C  CA  . ILE A 377 ? 1.8444 1.3441 1.2807 -0.0440 0.0700  0.0238  377 ILE A CA  
2206 C  C   . ILE A 377 ? 1.9560 1.3905 1.3608 -0.0334 0.0686  0.0247  377 ILE A C   
2207 O  O   . ILE A 377 ? 1.9923 1.3904 1.3853 -0.0428 0.0756  0.0391  377 ILE A O   
2208 C  CB  . ILE A 377 ? 1.8757 1.3881 1.3368 -0.0731 0.0646  0.0137  377 ILE A CB  
2209 C  CG1 . ILE A 377 ? 1.8863 1.3814 1.3392 -0.0712 0.0504  -0.0078 377 ILE A CG1 
2210 C  CG2 . ILE A 377 ? 1.8298 1.4060 1.3237 -0.0811 0.0678  0.0159  377 ILE A CG2 
2211 C  CD1 . ILE A 377 ? 1.9537 1.4369 1.4205 -0.1024 0.0416  -0.0168 377 ILE A CD1 
2212 N  N   . ASN A 378 ? 1.9243 1.3430 1.3142 -0.0129 0.0611  0.0107  378 ASN A N   
2213 C  CA  . ASN A 378 ? 1.9827 1.3382 1.3418 0.0019  0.0604  0.0101  378 ASN A CA  
2214 C  C   . ASN A 378 ? 2.0338 1.3835 1.3783 0.0298  0.0652  0.0259  378 ASN A C   
2215 O  O   . ASN A 378 ? 2.0038 1.3773 1.3487 0.0561  0.0627  0.0222  378 ASN A O   
2216 C  CB  . ASN A 378 ? 2.0132 1.3507 1.3595 0.0138  0.0524  -0.0120 378 ASN A CB  
2217 C  CG  . ASN A 378 ? 2.3608 1.6259 1.6733 0.0281  0.0519  -0.0160 378 ASN A CG  
2218 O  OD1 . ASN A 378 ? 2.2821 1.5361 1.5786 0.0545  0.0506  -0.0278 378 ASN A OD1 
2219 N  ND2 . ASN A 378 ? 2.3138 1.5259 1.6143 0.0111  0.0536  -0.0068 378 ASN A ND2 
2220 N  N   . MET A 379 ? 2.0173 1.3366 1.3496 0.0233  0.0716  0.0448  379 MET A N   
2221 C  CA  . MET A 379 ? 2.0229 1.3333 1.3382 0.0480  0.0739  0.0619  379 MET A CA  
2222 C  C   . MET A 379 ? 2.1582 1.3955 1.4439 0.0515  0.0764  0.0734  379 MET A C   
2223 O  O   . MET A 379 ? 2.1840 1.4012 1.4597 0.0386  0.0832  0.0923  379 MET A O   
2224 C  CB  . MET A 379 ? 2.0119 1.3670 1.3371 0.0428  0.0788  0.0767  379 MET A CB  
2225 C  CG  . MET A 379 ? 1.9882 1.4079 1.3365 0.0499  0.0743  0.0670  379 MET A CG  
2226 S  SD  . MET A 379 ? 2.0022 1.4686 1.3610 0.0377  0.0806  0.0785  379 MET A SD  
2227 C  CE  . MET A 379 ? 1.8941 1.4202 1.2792 0.0447  0.0728  0.0626  379 MET A CE  
2228 N  N   . ASP A 380 ? 2.1602 1.3554 1.4296 0.0703  0.0718  0.0620  380 ASP A N   
2229 C  CA  . ASP A 380 ? 2.2387 1.3559 1.4772 0.0785  0.0726  0.0696  380 ASP A CA  
2230 C  C   . ASP A 380 ? 2.3072 1.4134 1.5288 0.1029  0.0744  0.0936  380 ASP A C   
2231 O  O   . ASP A 380 ? 2.3558 1.4092 1.5554 0.0958  0.0783  0.1109  380 ASP A O   
2232 C  CB  . ASP A 380 ? 2.2962 1.3755 1.5199 0.0985  0.0678  0.0487  380 ASP A CB  
2233 C  CG  . ASP A 380 ? 2.3920 1.4795 1.6253 0.0786  0.0632  0.0233  380 ASP A CG  
2234 O  OD1 . ASP A 380 ? 2.3971 1.4822 1.6409 0.0420  0.0623  0.0223  380 ASP A OD1 
2235 O  OD2 . ASP A 380 ? 2.4546 1.5507 1.6844 0.0999  0.0606  0.0053  380 ASP A OD2 
2236 N  N   . GLY A 381 ? 2.2220 1.3777 1.4542 0.1301  0.0704  0.0951  381 GLY A N   
2237 C  CA  . GLY A 381 ? 2.2336 1.3901 1.4532 0.1552  0.0678  0.1163  381 GLY A CA  
2238 C  C   . GLY A 381 ? 2.2817 1.4510 1.4950 0.1372  0.0719  0.1366  381 GLY A C   
2239 O  O   . GLY A 381 ? 2.3221 1.4614 1.5106 0.1491  0.0715  0.1579  381 GLY A O   
2240 N  N   . THR A 382 ? 2.1875 1.4011 1.4212 0.1100  0.0764  0.1304  382 THR A N   
2241 C  CA  . THR A 382 ? 2.1780 1.4078 1.4062 0.0918  0.0837  0.1471  382 THR A CA  
2242 C  C   . THR A 382 ? 2.2917 1.4653 1.5029 0.0668  0.0946  0.1600  382 THR A C   
2243 O  O   . THR A 382 ? 2.3208 1.4731 1.5075 0.0664  0.1005  0.1828  382 THR A O   
2244 C  CB  . THR A 382 ? 2.1805 1.4783 1.4379 0.0771  0.0850  0.1353  382 THR A CB  
2245 O  OG1 . THR A 382 ? 2.1122 1.4539 1.3813 0.1010  0.0742  0.1279  382 THR A OG1 
2246 C  CG2 . THR A 382 ? 2.1545 1.4698 1.4053 0.0598  0.0953  0.1504  382 THR A CG2 
2247 N  N   . ALA A 383 ? 2.2691 1.4166 1.4914 0.0460  0.0961  0.1460  383 ALA A N   
2248 C  CA  . ALA A 383 ? 2.3303 1.4226 1.5424 0.0177  0.1045  0.1563  383 ALA A CA  
2249 C  C   . ALA A 383 ? 2.4638 1.4825 1.6374 0.0330  0.1050  0.1762  383 ALA A C   
2250 O  O   . ALA A 383 ? 2.5082 1.4925 1.6666 0.0137  0.1152  0.1976  383 ALA A O   
2251 C  CB  . ALA A 383 ? 2.3455 1.4209 1.5744 -0.0024 0.0997  0.1336  383 ALA A CB  
2252 N  N   . LEU A 384 ? 2.4354 1.4315 1.5945 0.0686  0.0949  0.1705  384 LEU A N   
2253 C  CA  . LEU A 384 ? 2.5057 1.4341 1.6291 0.0914  0.0929  0.1884  384 LEU A CA  
2254 C  C   . LEU A 384 ? 2.5543 1.5003 1.6594 0.1035  0.0952  0.2154  384 LEU A C   
2255 O  O   . LEU A 384 ? 2.6127 1.5058 1.6876 0.0998  0.1007  0.2396  384 LEU A O   
2256 C  CB  . LEU A 384 ? 2.5118 1.4279 1.6323 0.1299  0.0823  0.1732  384 LEU A CB  
2257 C  CG  . LEU A 384 ? 2.6575 1.4926 1.7434 0.1551  0.0796  0.1856  384 LEU A CG  
2258 C  CD1 . LEU A 384 ? 2.6925 1.4832 1.7750 0.1658  0.0760  0.1615  384 LEU A CD1 
2259 C  CD2 . LEU A 384 ? 2.6838 1.5389 1.7609 0.1961  0.0722  0.2012  384 LEU A CD2 
2260 N  N   . TYR A 385 ? 2.4457 1.4636 1.5668 0.1162  0.0903  0.2111  385 TYR A N   
2261 C  CA  . TYR A 385 ? 2.4406 1.4843 1.5440 0.1281  0.0889  0.2317  385 TYR A CA  
2262 C  C   . TYR A 385 ? 2.5065 1.5456 1.5964 0.0975  0.1048  0.2498  385 TYR A C   
2263 O  O   . TYR A 385 ? 2.5455 1.5573 1.6003 0.1044  0.1077  0.2752  385 TYR A O   
2264 C  CB  . TYR A 385 ? 2.3800 1.5016 1.5089 0.1419  0.0791  0.2174  385 TYR A CB  
2265 C  CG  . TYR A 385 ? 2.3931 1.5493 1.5062 0.1456  0.0774  0.2324  385 TYR A CG  
2266 C  CD1 . TYR A 385 ? 2.3846 1.5773 1.5046 0.1205  0.0883  0.2308  385 TYR A CD1 
2267 C  CD2 . TYR A 385 ? 2.4281 1.5822 1.5194 0.1758  0.0637  0.2469  385 TYR A CD2 
2268 C  CE1 . TYR A 385 ? 2.3903 1.6098 1.4896 0.1254  0.0870  0.2424  385 TYR A CE1 
2269 C  CE2 . TYR A 385 ? 2.4357 1.6188 1.5075 0.1791  0.0594  0.2586  385 TYR A CE2 
2270 C  CZ  . TYR A 385 ? 2.5094 1.7224 1.5824 0.1540  0.0717  0.2556  385 TYR A CZ  
2271 O  OH  . TYR A 385 ? 2.5396 1.7752 1.5867 0.1586  0.0679  0.2654  385 TYR A OH  
2272 N  N   . GLU A 386 ? 2.4304 1.4991 1.5486 0.0651  0.1151  0.2374  386 GLU A N   
2273 C  CA  . GLU A 386 ? 2.4373 1.5136 1.5539 0.0337  0.1333  0.2519  386 GLU A CA  
2274 C  C   . GLU A 386 ? 2.5683 1.5718 1.6565 0.0195  0.1440  0.2766  386 GLU A C   
2275 O  O   . GLU A 386 ? 2.5942 1.5914 1.6578 0.0119  0.1572  0.3012  386 GLU A O   
2276 C  CB  . GLU A 386 ? 2.4030 1.5201 1.5633 0.0035  0.1394  0.2318  386 GLU A CB  
2277 C  CG  . GLU A 386 ? 2.4305 1.6227 1.6183 0.0108  0.1336  0.2120  386 GLU A CG  
2278 C  CD  . GLU A 386 ? 2.6493 1.8872 1.8299 0.0111  0.1425  0.2218  386 GLU A CD  
2279 O  OE1 . GLU A 386 ? 2.5381 1.8280 1.7341 0.0229  0.1343  0.2067  386 GLU A OE1 
2280 O  OE2 . GLU A 386 ? 2.6011 1.8215 1.7596 -0.0007 0.1582  0.2441  386 GLU A OE2 
2281 N  N   . ALA A 387 ? 2.5647 1.5109 1.6536 0.0159  0.1387  0.2700  387 ALA A N   
2282 C  CA  . ALA A 387 ? 2.6497 1.5169 1.7130 0.0010  0.1465  0.2913  387 ALA A CA  
2283 C  C   . ALA A 387 ? 2.7547 1.5751 1.7703 0.0308  0.1432  0.3177  387 ALA A C   
2284 O  O   . ALA A 387 ? 2.8107 1.5933 1.7987 0.0171  0.1562  0.3464  387 ALA A O   
2285 C  CB  . ALA A 387 ? 2.6881 1.5046 1.7622 -0.0073 0.1382  0.2724  387 ALA A CB  
2286 N  N   . VAL A 388 ? 2.6930 1.5187 1.7002 0.0713  0.1262  0.3095  388 VAL A N   
2287 C  CA  . VAL A 388 ? 2.7450 1.5320 1.7106 0.1048  0.1185  0.3330  388 VAL A CA  
2288 C  C   . VAL A 388 ? 2.7886 1.6113 1.7303 0.1077  0.1236  0.3549  388 VAL A C   
2289 O  O   . VAL A 388 ? 2.8527 1.6282 1.7528 0.1104  0.1292  0.3849  388 VAL A O   
2290 C  CB  . VAL A 388 ? 2.7798 1.5696 1.7504 0.1475  0.0988  0.3183  388 VAL A CB  
2291 C  CG1 . VAL A 388 ? 2.8355 1.5920 1.7668 0.1831  0.0889  0.3445  388 VAL A CG1 
2292 C  CG2 . VAL A 388 ? 2.8013 1.5427 1.7839 0.1472  0.0961  0.2984  388 VAL A CG2 
2293 N  N   . ALA A 389 ? 2.6710 1.5722 1.6353 0.1067  0.1219  0.3399  389 ALA A N   
2294 C  CA  . ALA A 389 ? 2.6647 1.6019 1.6043 0.1103  0.1256  0.3551  389 ALA A CA  
2295 C  C   . ALA A 389 ? 2.7659 1.6882 1.6860 0.0791  0.1505  0.3772  389 ALA A C   
2296 O  O   . ALA A 389 ? 2.8044 1.7200 1.6818 0.0873  0.1551  0.4008  389 ALA A O   
2297 C  CB  . ALA A 389 ? 2.5846 1.6025 1.5548 0.1147  0.1178  0.3310  389 ALA A CB  
2298 N  N   . ALA A 390 ? 2.7199 1.6382 1.6707 0.0437  0.1663  0.3705  390 ALA A N   
2299 C  CA  . ALA A 390 ? 2.7573 1.6665 1.6991 0.0110  0.1923  0.3923  390 ALA A CA  
2300 C  C   . ALA A 390 ? 2.9202 1.7468 1.8191 0.0087  0.1994  0.4254  390 ALA A C   
2301 O  O   . ALA A 390 ? 2.9627 1.7795 1.8291 -0.0009 0.2177  0.4535  390 ALA A O   
2302 C  CB  . ALA A 390 ? 2.7293 1.6620 1.7231 -0.0261 0.2034  0.3754  390 ALA A CB  
2303 N  N   . ILE A 391 ? 2.9238 1.6891 1.8197 0.0193  0.1856  0.4225  391 ILE A N   
2304 C  CA  . ILE A 391 ? 3.0268 1.7036 1.8823 0.0195  0.1893  0.4523  391 ILE A CA  
2305 C  C   . ILE A 391 ? 3.1351 1.7896 1.9389 0.0617  0.1758  0.4724  391 ILE A C   
2306 O  O   . ILE A 391 ? 3.2138 1.8081 1.9725 0.0624  0.1834  0.5058  391 ILE A O   
2307 C  CB  . ILE A 391 ? 3.0951 1.7105 1.9698 0.0091  0.1819  0.4388  391 ILE A CB  
2308 C  CG1 . ILE A 391 ? 3.0686 1.7065 1.9905 -0.0380 0.1951  0.4242  391 ILE A CG1 
2309 C  CG2 . ILE A 391 ? 3.2179 1.7328 2.0480 0.0127  0.1836  0.4694  391 ILE A CG2 
2310 C  CD1 . ILE A 391 ? 3.1614 1.7680 2.1120 -0.0473 0.1825  0.3964  391 ILE A CD1 
2311 N  N   . PHE A 392 ? 3.0491 1.7544 1.8598 0.0950  0.1557  0.4541  392 PHE A N   
2312 C  CA  . PHE A 392 ? 3.0878 1.7835 1.8549 0.1343  0.1393  0.4717  392 PHE A CA  
2313 C  C   . PHE A 392 ? 3.1832 1.8958 1.9080 0.1285  0.1522  0.4967  392 PHE A C   
2314 O  O   . PHE A 392 ? 3.2574 1.9270 1.9293 0.1475  0.1481  0.5262  392 PHE A O   
2315 C  CB  . PHE A 392 ? 3.0409 1.7918 1.8330 0.1675  0.1140  0.4459  392 PHE A CB  
2316 C  CG  . PHE A 392 ? 3.0887 1.8425 1.8419 0.2054  0.0943  0.4632  392 PHE A CG  
2317 C  CD1 . PHE A 392 ? 3.2075 1.8961 1.9274 0.2329  0.0830  0.4857  392 PHE A CD1 
2318 C  CD2 . PHE A 392 ? 3.0679 1.8872 1.8163 0.2135  0.0857  0.4573  392 PHE A CD2 
2319 C  CE1 . PHE A 392 ? 3.2472 1.9414 1.9322 0.2679  0.0623  0.5029  392 PHE A CE1 
2320 C  CE2 . PHE A 392 ? 3.1335 1.9558 1.8454 0.2466  0.0641  0.4729  392 PHE A CE2 
2321 C  CZ  . PHE A 392 ? 3.1851 1.9474 1.8668 0.2736  0.0521  0.4961  392 PHE A CZ  
2322 N  N   . ILE A 393 ? 3.0948 1.8674 1.8398 0.1037  0.1685  0.4856  393 ILE A N   
2323 C  CA  . ILE A 393 ? 3.1265 1.9152 1.8294 0.0976  0.1851  0.5075  393 ILE A CA  
2324 C  C   . ILE A 393 ? 3.2682 1.9966 1.9442 0.0704  0.2123  0.5415  393 ILE A C   
2325 O  O   . ILE A 393 ? 3.3208 2.0273 1.9406 0.0753  0.2230  0.5720  393 ILE A O   
2326 C  CB  . ILE A 393 ? 3.0879 1.9587 1.8157 0.0863  0.1936  0.4853  393 ILE A CB  
2327 C  CG1 . ILE A 393 ? 3.0636 1.9564 1.8364 0.0456  0.2203  0.4774  393 ILE A CG1 
2328 C  CG2 . ILE A 393 ? 3.0148 1.9397 1.7739 0.1090  0.1668  0.4525  393 ILE A CG2 
2329 C  CD1 . ILE A 393 ? 3.1721 2.0871 1.9197 0.0297  0.2486  0.4954  393 ILE A CD1 
2330 N  N   . ALA A 394 ? 3.2366 1.9345 1.9509 0.0424  0.2214  0.5364  394 ALA A N   
2331 C  CA  . ALA A 394 ? 3.3147 1.9514 2.0153 0.0116  0.2447  0.5662  394 ALA A CA  
2332 C  C   . ALA A 394 ? 3.4553 2.0021 2.1068 0.0330  0.2333  0.5936  394 ALA A C   
2333 O  O   . ALA A 394 ? 3.5243 2.0111 2.1497 0.0124  0.2514  0.6256  394 ALA A O   
2334 C  CB  . ALA A 394 ? 3.2944 1.9313 2.0555 -0.0253 0.2520  0.5470  394 ALA A CB  
2335 N  N   . GLN A 395 ? 3.4073 1.9451 2.0484 0.0743  0.2038  0.5822  395 GLN A N   
2336 C  CA  . GLN A 395 ? 3.4975 1.9549 2.0926 0.1019  0.1902  0.6074  395 GLN A CA  
2337 C  C   . GLN A 395 ? 3.5645 2.0552 2.1333 0.1126  0.1857  0.6408  395 GLN A C   
2338 O  O   . GLN A 395 ? 3.5695 2.0753 2.1783 0.1051  0.1711  0.6731  395 GLN A O   
2339 C  CB  . GLN A 395 ? 3.4833 1.9451 2.0952 0.1427  0.1584  0.5837  395 GLN A CB  
2340 C  CG  . GLN A 395 ? 3.5287 2.0467 2.2751 0.1219  0.1369  0.5599  395 GLN A CG  
2341 C  CD  . GLN A 395 ? 3.5332 2.2297 2.4775 0.1335  0.0800  0.5420  395 GLN A CD  
2342 O  OE1 . GLN A 395 ? 3.5191 2.1922 2.3964 0.1726  0.0711  0.5491  395 GLN A OE1 
2343 N  NE2 . GLN A 395 ? 3.5073 2.0672 2.3818 0.1500  0.0919  0.5264  395 GLN A NE2 
2344 N  N   . VAL A 396 ? 3.5069 2.0312 2.0304 0.1259  0.1929  0.6319  396 VAL A N   
2345 C  CA  . VAL A 396 ? 3.5550 2.0819 2.0123 0.1426  0.1945  0.6591  396 VAL A CA  
2346 C  C   . VAL A 396 ? 3.5536 2.1683 2.0731 0.0927  0.2145  0.6787  396 VAL A C   
2347 O  O   . VAL A 396 ? 3.5639 2.2000 2.0920 0.0816  0.2108  0.7148  396 VAL A O   
2348 C  CB  . VAL A 396 ? 3.5356 2.1347 1.9929 0.1717  0.1700  0.6353  396 VAL A CB  
2349 C  CG1 . VAL A 396 ? 3.5538 2.1855 1.9754 0.1847  0.1570  0.6614  396 VAL A CG1 
2350 C  CG2 . VAL A 396 ? 3.4910 2.0982 1.9836 0.2026  0.1360  0.6116  396 VAL A CG2 
2351 N  N   . ASN A 397 ? 3.5251 2.1141 2.0132 0.0760  0.2522  0.6587  397 ASN A N   
2352 C  CA  . ASN A 397 ? 3.5385 2.1466 2.0208 0.0421  0.2906  0.6758  397 ASN A CA  
2353 C  C   . ASN A 397 ? 3.5237 2.1924 2.1319 -0.0109 0.2871  0.6957  397 ASN A C   
2354 O  O   . ASN A 397 ? 3.5273 2.2303 2.1480 -0.0361 0.3039  0.7265  397 ASN A O   
2355 C  CB  . ASN A 397 ? 3.4313 2.1292 1.9637 0.0293  0.2987  0.6417  397 ASN A CB  
2356 C  CG  . ASN A 397 ? 3.5285 2.3433 2.0995 0.0511  0.2633  0.6201  397 ASN A CG  
2357 O  OD1 . ASN A 397 ? 3.4876 2.2347 1.9903 0.0931  0.2453  0.6094  397 ASN A OD1 
2358 N  ND2 . ASN A 397 ? 3.4579 2.2593 1.9560 0.0542  0.3002  0.6197  397 ASN A ND2 
2359 N  N   . ASN A 398 ? 3.5208 2.1039 2.1254 -0.0149 0.2888  0.6811  398 ASN A N   
2360 C  CA  . ASN A 398 ? 3.4764 2.4260 2.5043 -0.0856 0.1990  0.6878  398 ASN A CA  
2361 C  C   . ASN A 398 ? 3.5379 2.7219 2.7733 -0.1348 0.1739  0.6942  398 ASN A C   
2362 O  O   . ASN A 398 ? 3.4856 2.1557 2.2933 -0.1320 0.3192  0.6860  398 ASN A O   
2363 C  CB  . ASN A 398 ? 3.4403 2.4505 2.5658 -0.0932 0.1616  0.7248  398 ASN A CB  
2364 C  CG  . ASN A 398 ? 3.4257 2.7297 2.7711 -0.1068 0.1036  0.6910  398 ASN A CG  
2365 O  OD1 . ASN A 398 ? 3.3951 2.6931 2.7190 -0.1280 0.1257  0.7115  398 ASN A OD1 
2366 N  ND2 . ASN A 398 ? 3.4110 2.6727 2.6841 -0.0928 0.0921  0.7440  398 ASN A ND2 
2367 N  N   . GLY A 404 ? 3.3692 1.6646 2.3463 -0.3418 0.2884  0.5613  404 GLY A N   
2368 C  CA  . GLY A 404 ? 3.3566 1.6785 2.3963 -0.3971 0.2921  0.5520  404 GLY A CA  
2369 C  C   . GLY A 404 ? 3.2969 1.7333 2.3931 -0.3999 0.2904  0.5209  404 GLY A C   
2370 O  O   . GLY A 404 ? 3.2560 1.7046 2.3942 -0.4194 0.2722  0.4888  404 GLY A O   
2371 N  N   . GLN A 405 ? 3.2027 1.7206 2.2963 -0.3792 0.3085  0.5301  405 GLN A N   
2372 C  CA  . GLN A 405 ? 3.0881 1.7168 2.2295 -0.3765 0.3101  0.5048  405 GLN A CA  
2373 C  C   . GLN A 405 ? 3.0570 1.7111 2.1833 -0.3265 0.2861  0.4690  405 GLN A C   
2374 O  O   . GLN A 405 ? 2.9670 1.7019 2.1040 -0.3061 0.2907  0.4582  405 GLN A O   
2375 C  CB  . GLN A 405 ? 3.0868 1.7852 2.2330 -0.3832 0.3443  0.5338  405 GLN A CB  
2376 C  CG  . GLN A 405 ? 3.1879 1.9964 2.3975 -0.3974 0.3529  0.5154  405 GLN A CG  
2377 C  CD  . GLN A 405 ? 3.2602 2.2181 2.6666 -0.4203 0.3216  0.5245  405 GLN A CD  
2378 O  OE1 . GLN A 405 ? 3.2063 2.0973 2.5961 -0.4463 0.3114  0.4934  405 GLN A OE1 
2379 N  NE2 . GLN A 405 ? 3.1900 2.1972 2.6302 -0.4463 0.3483  0.5580  405 GLN A NE2 
2380 N  N   . ILE A 406 ? 3.0480 1.6315 2.1506 -0.3075 0.2610  0.4507  406 ILE A N   
2381 C  CA  . ILE A 406 ? 2.9910 1.5925 2.0828 -0.2625 0.2383  0.4178  406 ILE A CA  
2382 C  C   . ILE A 406 ? 2.9918 1.6412 2.1375 -0.2797 0.2233  0.3791  406 ILE A C   
2383 O  O   . ILE A 406 ? 2.9238 1.6110 2.0743 -0.2495 0.2078  0.3498  406 ILE A O   
2384 C  CB  . ILE A 406 ? 3.0981 1.6054 2.1379 -0.2286 0.2212  0.4181  406 ILE A CB  
2385 C  CG1 . ILE A 406 ? 3.2002 1.6368 2.1890 -0.2260 0.2356  0.4620  406 ILE A CG1 
2386 C  CG2 . ILE A 406 ? 3.0471 1.5866 2.0728 -0.1762 0.2040  0.3940  406 ILE A CG2 
2387 C  CD1 . ILE A 406 ? 3.2415 1.7219 2.1981 -0.2016 0.2525  0.4899  406 ILE A CD1 
2388 N  N   . ILE A 407 ? 2.9834 1.6343 2.1708 -0.3299 0.2281  0.3812  407 ILE A N   
2389 C  CA  . ILE A 407 ? 2.9346 1.6326 2.1756 -0.3535 0.2143  0.3491  407 ILE A CA  
2390 C  C   . ILE A 407 ? 2.8890 1.7003 2.1656 -0.3441 0.2231  0.3397  407 ILE A C   
2391 O  O   . ILE A 407 ? 2.8170 1.6715 2.1171 -0.3338 0.2063  0.3070  407 ILE A O   
2392 C  CB  . ILE A 407 ? 3.0335 1.6994 2.3099 -0.4116 0.2146  0.3568  407 ILE A CB  
2393 C  CG1 . ILE A 407 ? 2.9929 1.6964 2.3186 -0.4337 0.1930  0.3201  407 ILE A CG1 
2394 C  CG2 . ILE A 407 ? 3.0605 1.7608 2.3616 -0.4466 0.2452  0.3955  407 ILE A CG2 
2395 C  CD1 . ILE A 407 ? 3.0794 1.7153 2.3782 -0.4165 0.1628  0.2854  407 ILE A CD1 
2396 N  N   . THR A 408 ? 2.8417 1.6955 2.1159 -0.3443 0.2496  0.3684  408 THR A N   
2397 C  CA  . THR A 408 ? 2.7537 1.7067 2.0531 -0.3319 0.2610  0.3627  408 THR A CA  
2398 C  C   . THR A 408 ? 2.7477 1.7142 2.0133 -0.2806 0.2477  0.3443  408 THR A C   
2399 O  O   . THR A 408 ? 2.6632 1.6980 1.9550 -0.2683 0.2411  0.3211  408 THR A O   
2400 C  CB  . THR A 408 ? 2.8925 1.8767 2.1905 -0.3448 0.2946  0.3989  408 THR A CB  
2401 O  OG1 . THR A 408 ? 2.9580 1.8797 2.1929 -0.3240 0.3031  0.4259  408 THR A OG1 
2402 C  CG2 . THR A 408 ? 2.9146 1.9091 2.2618 -0.3983 0.3102  0.4166  408 THR A CG2 
2403 N  N   . ILE A 409 ? 2.7481 1.6487 1.9575 -0.2514 0.2425  0.3557  409 ILE A N   
2404 C  CA  . ILE A 409 ? 2.7073 1.6132 1.8844 -0.2030 0.2278  0.3416  409 ILE A CA  
2405 C  C   . ILE A 409 ? 2.7018 1.6132 1.9008 -0.1933 0.2030  0.3037  409 ILE A C   
2406 O  O   . ILE A 409 ? 2.6233 1.5926 1.8336 -0.1705 0.1951  0.2837  409 ILE A O   
2407 C  CB  . ILE A 409 ? 2.8211 1.6526 1.9373 -0.1761 0.2267  0.3650  409 ILE A CB  
2408 C  CG1 . ILE A 409 ? 2.8663 1.7021 1.9542 -0.1807 0.2519  0.4026  409 ILE A CG1 
2409 C  CG2 . ILE A 409 ? 2.7939 1.6301 1.8857 -0.1273 0.2067  0.3478  409 ILE A CG2 
2410 C  CD1 . ILE A 409 ? 3.0661 1.8133 2.0993 -0.1725 0.2553  0.4345  409 ILE A CD1 
2411 N  N   . SER A 410 ? 2.6986 1.5500 1.9029 -0.2127 0.1914  0.2938  410 SER A N   
2412 C  CA  . SER A 410 ? 2.6641 1.5130 1.8832 -0.2053 0.1688  0.2577  410 SER A CA  
2413 C  C   . SER A 410 ? 2.6268 1.5568 1.8988 -0.2255 0.1663  0.2364  410 SER A C   
2414 O  O   . SER A 410 ? 2.5685 1.5266 1.8497 -0.2070 0.1509  0.2080  410 SER A O   
2415 C  CB  . SER A 410 ? 2.7892 1.5475 1.9949 -0.2227 0.1576  0.2529  410 SER A CB  
2416 O  OG  . SER A 410 ? 2.9343 1.6837 2.1692 -0.2731 0.1652  0.2640  410 SER A OG  
2417 N  N   . ILE A 411 ? 2.5727 1.5418 1.8798 -0.2619 0.1822  0.2515  411 ILE A N   
2418 C  CA  . ILE A 411 ? 2.5009 1.5501 1.8618 -0.2813 0.1810  0.2354  411 ILE A CA  
2419 C  C   . ILE A 411 ? 2.4802 1.6060 1.8449 -0.2517 0.1877  0.2312  411 ILE A C   
2420 O  O   . ILE A 411 ? 2.4139 1.5867 1.8013 -0.2422 0.1748  0.2057  411 ILE A O   
2421 C  CB  . ILE A 411 ? 2.5655 1.6300 1.9680 -0.3310 0.1952  0.2538  411 ILE A CB  
2422 C  CG1 . ILE A 411 ? 2.6256 1.6322 2.0407 -0.3643 0.1768  0.2415  411 ILE A CG1 
2423 C  CG2 . ILE A 411 ? 2.4987 1.6633 1.9549 -0.3427 0.2044  0.2495  411 ILE A CG2 
2424 C  CD1 . ILE A 411 ? 2.7820 1.7667 2.2224 -0.4136 0.1897  0.2675  411 ILE A CD1 
2425 N  N   . THR A 412 ? 2.4527 1.5862 1.7913 -0.2366 0.2066  0.2559  412 THR A N   
2426 C  CA  . THR A 412 ? 2.3902 1.5891 1.7268 -0.2098 0.2129  0.2530  412 THR A CA  
2427 C  C   . THR A 412 ? 2.4107 1.6002 1.7150 -0.1672 0.1956  0.2376  412 THR A C   
2428 O  O   . THR A 412 ? 2.3425 1.5892 1.6566 -0.1489 0.1928  0.2247  412 THR A O   
2429 C  CB  . THR A 412 ? 2.5453 1.7610 1.8660 -0.2121 0.2400  0.2833  412 THR A CB  
2430 O  OG1 . THR A 412 ? 2.6344 1.7792 1.9070 -0.2064 0.2455  0.3081  412 THR A OG1 
2431 C  CG2 . THR A 412 ? 2.5290 1.7889 1.8966 -0.2496 0.2600  0.2948  412 THR A CG2 
2432 N  N   . ALA A 413 ? 2.4112 1.5309 1.6796 -0.1511 0.1843  0.2393  413 ALA A N   
2433 C  CA  . ALA A 413 ? 2.3822 1.4966 1.6264 -0.1106 0.1680  0.2258  413 ALA A CA  
2434 C  C   . ALA A 413 ? 2.3739 1.5132 1.6461 -0.1071 0.1508  0.1931  413 ALA A C   
2435 O  O   . ALA A 413 ? 2.3243 1.4996 1.5967 -0.0799 0.1416  0.1793  413 ALA A O   
2436 C  CB  . ALA A 413 ? 2.4623 1.4973 1.6635 -0.0929 0.1625  0.2385  413 ALA A CB  
2437 N  N   . THR A 414 ? 2.3333 1.4544 1.6289 -0.1361 0.1460  0.1815  414 THR A N   
2438 C  CA  . THR A 414 ? 2.2844 1.4277 1.6045 -0.1376 0.1300  0.1510  414 THR A CA  
2439 C  C   . THR A 414 ? 2.2445 1.4731 1.6038 -0.1464 0.1344  0.1441  414 THR A C   
2440 O  O   . THR A 414 ? 2.1903 1.4568 1.5624 -0.1319 0.1232  0.1230  414 THR A O   
2441 C  CB  . THR A 414 ? 2.4239 1.5139 1.7501 -0.1669 0.1215  0.1419  414 THR A CB  
2442 O  OG1 . THR A 414 ? 2.4831 1.4893 1.7694 -0.1571 0.1203  0.1521  414 THR A OG1 
2443 C  CG2 . THR A 414 ? 2.3733 1.4753 1.7132 -0.1647 0.1030  0.1094  414 THR A CG2 
2444 N  N   . ALA A 415 ? 2.1841 1.4419 1.5609 -0.1681 0.1521  0.1634  415 ALA A N   
2445 C  CA  . ALA A 415 ? 2.1141 1.4501 1.5269 -0.1746 0.1597  0.1603  415 ALA A CA  
2446 C  C   . ALA A 415 ? 2.1093 1.4816 1.5049 -0.1405 0.1611  0.1589  415 ALA A C   
2447 O  O   . ALA A 415 ? 2.0440 1.4721 1.4637 -0.1343 0.1567  0.1441  415 ALA A O   
2448 C  CB  . ALA A 415 ? 2.1454 1.4978 1.5779 -0.2038 0.1814  0.1835  415 ALA A CB  
2449 N  N   . ALA A 416 ? 2.0928 1.4313 1.4463 -0.1189 0.1652  0.1744  416 ALA A N   
2450 C  CA  . ALA A 416 ? 2.0579 1.4226 1.3903 -0.0873 0.1632  0.1744  416 ALA A CA  
2451 C  C   . ALA A 416 ? 2.0708 1.4423 1.4050 -0.0639 0.1428  0.1518  416 ALA A C   
2452 O  O   . ALA A 416 ? 2.0138 1.4304 1.3545 -0.0478 0.1381  0.1426  416 ALA A O   
2453 C  CB  . ALA A 416 ? 2.1200 1.4419 1.4062 -0.0725 0.1698  0.1980  416 ALA A CB  
2454 N  N   . SER A 417 ? 2.0575 1.3831 1.3857 -0.0627 0.1318  0.1430  417 SER A N   
2455 C  CA  . SER A 417 ? 2.0323 1.3583 1.3611 -0.0413 0.1153  0.1224  417 SER A CA  
2456 C  C   . SER A 417 ? 2.0231 1.4051 1.3874 -0.0490 0.1093  0.1014  417 SER A C   
2457 O  O   . SER A 417 ? 1.9842 1.3936 1.3516 -0.0280 0.1001  0.0889  417 SER A O   
2458 C  CB  . SER A 417 ? 2.1363 1.3964 1.4495 -0.0426 0.1086  0.1174  417 SER A CB  
2459 O  OG  . SER A 417 ? 2.2533 1.5157 1.5704 -0.0267 0.0955  0.0946  417 SER A OG  
2460 N  N   . ILE A 418 ? 1.9671 1.3672 1.3594 -0.0792 0.1143  0.0993  418 ILE A N   
2461 C  CA  . ILE A 418 ? 1.9093 1.3624 1.3362 -0.0883 0.1083  0.0821  418 ILE A CA  
2462 C  C   . ILE A 418 ? 1.9164 1.4268 1.3539 -0.0776 0.1153  0.0862  418 ILE A C   
2463 O  O   . ILE A 418 ? 1.8607 1.4054 1.3072 -0.0631 0.1065  0.0729  418 ILE A O   
2464 C  CB  . ILE A 418 ? 1.9620 1.4160 1.4179 -0.1242 0.1095  0.0803  418 ILE A CB  
2465 C  CG1 . ILE A 418 ? 2.0195 1.4106 1.4609 -0.1346 0.0989  0.0720  418 ILE A CG1 
2466 C  CG2 . ILE A 418 ? 1.9181 1.4329 1.4120 -0.1326 0.1032  0.0656  418 ILE A CG2 
2467 C  CD1 . ILE A 418 ? 2.1449 1.5154 1.6047 -0.1727 0.1026  0.0801  418 ILE A CD1 
2468 N  N   . GLY A 419 ? 1.9003 1.4164 1.3331 -0.0845 0.1314  0.1050  419 GLY A N   
2469 C  CA  . GLY A 419 ? 1.8679 1.4297 1.3038 -0.0751 0.1403  0.1097  419 GLY A CA  
2470 C  C   . GLY A 419 ? 1.9019 1.4684 1.3129 -0.0452 0.1322  0.1070  419 GLY A C   
2471 O  O   . GLY A 419 ? 1.8532 1.4614 1.2750 -0.0362 0.1300  0.0991  419 GLY A O   
2472 N  N   . ALA A 420 ? 1.8967 1.4202 1.2759 -0.0298 0.1266  0.1141  420 ALA A N   
2473 C  CA  . ALA A 420 ? 1.8858 1.4119 1.2430 -0.0019 0.1164  0.1139  420 ALA A CA  
2474 C  C   . ALA A 420 ? 1.8838 1.4446 1.2618 0.0094  0.1025  0.0948  420 ALA A C   
2475 O  O   . ALA A 420 ? 1.8659 1.4286 1.2639 0.0023  0.0970  0.0813  420 ALA A O   
2476 C  CB  . ALA A 420 ? 1.9426 1.4172 1.2702 0.0120  0.1113  0.1239  420 ALA A CB  
2477 N  N   . ALA A 421 ? 1.8121 1.3989 1.1834 0.0257  0.0965  0.0941  421 ALA A N   
2478 C  CA  . ALA A 421 ? 1.7624 1.3835 1.1525 0.0360  0.0842  0.0795  421 ALA A CA  
2479 C  C   . ALA A 421 ? 1.8219 1.4297 1.2058 0.0558  0.0716  0.0776  421 ALA A C   
2480 O  O   . ALA A 421 ? 1.8542 1.4332 1.2143 0.0678  0.0697  0.0895  421 ALA A O   
2481 C  CB  . ALA A 421 ? 1.7496 1.4010 1.1353 0.0421  0.0830  0.0800  421 ALA A CB  
2482 N  N   . GLY A 422 ? 1.7449 1.3759 1.1501 0.0603  0.0637  0.0640  422 GLY A N   
2483 C  CA  . GLY A 422 ? 1.7407 1.3694 1.1465 0.0802  0.0541  0.0617  422 GLY A CA  
2484 C  C   . GLY A 422 ? 1.7762 1.4273 1.1792 0.0958  0.0442  0.0681  422 GLY A C   
2485 O  O   . GLY A 422 ? 1.7593 1.4302 1.1761 0.1093  0.0356  0.0646  422 GLY A O   
2486 N  N   . ILE A 423 ? 1.7377 1.3853 1.1219 0.0935  0.0453  0.0780  423 ILE A N   
2487 C  CA  . ILE A 423 ? 1.7298 1.3935 1.1042 0.1045  0.0339  0.0839  423 ILE A CA  
2488 C  C   . ILE A 423 ? 1.8209 1.4536 1.1665 0.1189  0.0295  0.0997  423 ILE A C   
2489 O  O   . ILE A 423 ? 1.8514 1.4474 1.1806 0.1156  0.0395  0.1073  423 ILE A O   
2490 C  CB  . ILE A 423 ? 1.7581 1.4375 1.1268 0.0918  0.0393  0.0809  423 ILE A CB  
2491 C  CG1 . ILE A 423 ? 1.7266 1.4434 1.1160 0.0923  0.0288  0.0701  423 ILE A CG1 
2492 C  CG2 . ILE A 423 ? 1.8034 1.4635 1.1350 0.0944  0.0419  0.0932  423 ILE A CG2 
2493 C  CD1 . ILE A 423 ? 1.7765 1.5148 1.1976 0.0823  0.0333  0.0573  423 ILE A CD1 
2494 N  N   . PRO A 424 ? 1.7810 1.4261 1.1204 0.1341  0.0134  0.1058  424 PRO A N   
2495 C  CA  . PRO A 424 ? 1.8293 1.4450 1.1400 0.1490  0.0075  0.1222  424 PRO A CA  
2496 C  C   . PRO A 424 ? 1.9308 1.5206 1.2013 0.1421  0.0151  0.1332  424 PRO A C   
2497 O  O   . PRO A 424 ? 1.9027 1.5069 1.1667 0.1306  0.0197  0.1277  424 PRO A O   
2498 C  CB  . PRO A 424 ? 1.8389 1.4842 1.1607 0.1647  -0.0142 0.1242  424 PRO A CB  
2499 C  CG  . PRO A 424 ? 1.8516 1.5333 1.1913 0.1528  -0.0186 0.1115  424 PRO A CG  
2500 C  CD  . PRO A 424 ? 1.7657 1.4508 1.1238 0.1372  -0.0017 0.0992  424 PRO A CD  
2501 N  N   . GLN A 425 ? 1.9646 1.5140 1.2066 0.1505  0.0178  0.1494  425 GLN A N   
2502 C  CA  . GLN A 425 ? 2.0235 1.5413 1.2220 0.1460  0.0272  0.1647  425 GLN A CA  
2503 C  C   . GLN A 425 ? 2.0865 1.5951 1.2849 0.1224  0.0514  0.1626  425 GLN A C   
2504 O  O   . GLN A 425 ? 2.1217 1.6119 1.2870 0.1164  0.0632  0.1748  425 GLN A O   
2505 C  CB  . GLN A 425 ? 2.0565 1.5879 1.2259 0.1536  0.0135  0.1687  425 GLN A CB  
2506 C  CG  . GLN A 425 ? 2.2951 1.8265 1.4551 0.1763  -0.0111 0.1782  425 GLN A CG  
2507 C  CD  . GLN A 425 ? 2.5477 2.1030 1.6912 0.1801  -0.0303 0.1747  425 GLN A CD  
2508 O  OE1 . GLN A 425 ? 2.5310 2.0736 1.6333 0.1755  -0.0258 0.1783  425 GLN A OE1 
2509 N  NE2 . GLN A 425 ? 2.4099 1.9993 1.5842 0.1887  -0.0523 0.1678  425 GLN A NE2 
2510 N  N   . ALA A 426 ? 2.0096 1.5315 1.2448 0.1095  0.0588  0.1484  426 ALA A N   
2511 C  CA  . ALA A 426 ? 2.0054 1.5255 1.2508 0.0863  0.0788  0.1457  426 ALA A CA  
2512 C  C   . ALA A 426 ? 2.1153 1.5875 1.3433 0.0771  0.0924  0.1612  426 ALA A C   
2513 O  O   . ALA A 426 ? 2.1156 1.5852 1.3491 0.0561  0.1097  0.1640  426 ALA A O   
2514 C  CB  . ALA A 426 ? 1.9630 1.5107 1.2508 0.0769  0.0779  0.1264  426 ALA A CB  
2515 N  N   . GLY A 427 ? 2.1157 1.5512 1.3251 0.0927  0.0841  0.1718  427 GLY A N   
2516 C  CA  . GLY A 427 ? 2.1739 1.5554 1.3631 0.0867  0.0941  0.1878  427 GLY A CA  
2517 C  C   . GLY A 427 ? 2.2821 1.6409 1.4307 0.0832  0.1056  0.2103  427 GLY A C   
2518 O  O   . GLY A 427 ? 2.3149 1.6440 1.4561 0.0644  0.1227  0.2223  427 GLY A O   
2519 N  N   . LEU A 428 ? 2.2514 1.6231 1.3721 0.1003  0.0960  0.2169  428 LEU A N   
2520 C  CA  . LEU A 428 ? 2.3057 1.6559 1.3791 0.1004  0.1061  0.2384  428 LEU A CA  
2521 C  C   . LEU A 428 ? 2.3450 1.7205 1.4199 0.0802  0.1279  0.2368  428 LEU A C   
2522 O  O   . LEU A 428 ? 2.3910 1.7431 1.4360 0.0711  0.1467  0.2562  428 LEU A O   
2523 C  CB  . LEU A 428 ? 2.3277 1.6796 1.3658 0.1263  0.0856  0.2456  428 LEU A CB  
2524 C  CG  . LEU A 428 ? 2.3445 1.7455 1.3912 0.1333  0.0710  0.2282  428 LEU A CG  
2525 C  CD1 . LEU A 428 ? 2.3795 1.7837 1.3824 0.1317  0.0794  0.2351  428 LEU A CD1 
2526 C  CD2 . LEU A 428 ? 2.3691 1.7789 1.4181 0.1572  0.0421  0.2264  428 LEU A CD2 
2527 N  N   . VAL A 429 ? 2.2387 1.6618 1.3484 0.0741  0.1265  0.2151  429 VAL A N   
2528 C  CA  . VAL A 429 ? 2.2223 1.6745 1.3391 0.0586  0.1467  0.2115  429 VAL A CA  
2529 C  C   . VAL A 429 ? 2.2816 1.7285 1.4292 0.0321  0.1675  0.2156  429 VAL A C   
2530 O  O   . VAL A 429 ? 2.3032 1.7527 1.4418 0.0188  0.1907  0.2280  429 VAL A O   
2531 C  CB  . VAL A 429 ? 2.2107 1.7116 1.3502 0.0637  0.1367  0.1885  429 VAL A CB  
2532 C  CG1 . VAL A 429 ? 2.1510 1.6740 1.3417 0.0588  0.1256  0.1693  429 VAL A CG1 
2533 C  CG2 . VAL A 429 ? 2.2056 1.7326 1.3431 0.0543  0.1579  0.1868  429 VAL A CG2 
2534 N  N   . THR A 430 ? 2.2217 1.6594 1.4032 0.0245  0.1593  0.2063  430 THR A N   
2535 C  CA  . THR A 430 ? 2.2240 1.6536 1.4359 -0.0024 0.1733  0.2080  430 THR A CA  
2536 C  C   . THR A 430 ? 2.3431 1.7171 1.5281 -0.0120 0.1849  0.2328  430 THR A C   
2537 O  O   . THR A 430 ? 2.3530 1.7165 1.5602 -0.0379 0.1978  0.2380  430 THR A O   
2538 C  CB  . THR A 430 ? 2.2768 1.7155 1.5290 -0.0067 0.1588  0.1864  430 THR A CB  
2539 O  OG1 . THR A 430 ? 2.2727 1.6850 1.5105 0.0149  0.1399  0.1830  430 THR A OG1 
2540 C  CG2 . THR A 430 ? 2.2011 1.6966 1.4870 -0.0074 0.1547  0.1657  430 THR A CG2 
2541 N  N   . MET A 431 ? 2.3457 1.6847 1.4834 0.0079  0.1794  0.2490  431 MET A N   
2542 C  CA  . MET A 431 ? 2.4209 1.7024 1.5246 0.0030  0.1893  0.2758  431 MET A CA  
2543 C  C   . MET A 431 ? 2.5057 1.7928 1.5947 -0.0155 0.2178  0.2962  431 MET A C   
2544 O  O   . MET A 431 ? 2.5587 1.8022 1.6286 -0.0286 0.2317  0.3200  431 MET A O   
2545 C  CB  . MET A 431 ? 2.4877 1.7372 1.5450 0.0333  0.1728  0.2870  431 MET A CB  
2546 C  CG  . MET A 431 ? 2.5736 1.7664 1.6246 0.0403  0.1619  0.2934  431 MET A CG  
2547 S  SD  . MET A 431 ? 2.6508 1.8242 1.6636 0.0813  0.1364  0.3005  431 MET A SD  
2548 C  CE  . MET A 431 ? 2.6948 1.8270 1.6438 0.0832  0.1499  0.3366  431 MET A CE  
2549 N  N   . VAL A 432 ? 2.4283 1.7685 1.5262 -0.0157 0.2275  0.2874  432 VAL A N   
2550 C  CA  . VAL A 432 ? 2.4511 1.8102 1.5403 -0.0296 0.2572  0.3030  432 VAL A CA  
2551 C  C   . VAL A 432 ? 2.5020 1.8627 1.6359 -0.0644 0.2757  0.3100  432 VAL A C   
2552 O  O   . VAL A 432 ? 2.5485 1.8920 1.6682 -0.0804 0.2999  0.3355  432 VAL A O   
2553 C  CB  . VAL A 432 ? 2.4569 1.8729 1.5514 -0.0181 0.2595  0.2855  432 VAL A CB  
2554 C  CG1 . VAL A 432 ? 2.4706 1.9165 1.5709 -0.0331 0.2930  0.2970  432 VAL A CG1 
2555 C  CG2 . VAL A 432 ? 2.4687 1.8759 1.5103 0.0122  0.2429  0.2836  432 VAL A CG2 
2556 N  N   . ILE A 433 ? 2.4094 1.7887 1.5958 -0.0765 0.2628  0.2882  433 ILE A N   
2557 C  CA  . ILE A 433 ? 2.4071 1.7906 1.6419 -0.1106 0.2724  0.2895  433 ILE A CA  
2558 C  C   . ILE A 433 ? 2.5243 1.8394 1.7423 -0.1261 0.2740  0.3099  433 ILE A C   
2559 O  O   . ILE A 433 ? 2.5587 1.8672 1.7893 -0.1541 0.2954  0.3299  433 ILE A O   
2560 C  CB  . ILE A 433 ? 2.3772 1.7951 1.6631 -0.1148 0.2530  0.2586  433 ILE A CB  
2561 C  CG1 . ILE A 433 ? 2.3261 1.8146 1.6411 -0.1116 0.2604  0.2451  433 ILE A CG1 
2562 C  CG2 . ILE A 433 ? 2.3944 1.7949 1.7200 -0.1467 0.2504  0.2564  433 ILE A CG2 
2563 C  CD1 . ILE A 433 ? 2.3941 1.9031 1.6898 -0.0801 0.2444  0.2274  433 ILE A CD1 
2564 N  N   . VAL A 434 ? 2.4945 1.7592 1.6852 -0.1075 0.2524  0.3058  434 VAL A N   
2565 C  CA  . VAL A 434 ? 2.5576 1.7491 1.7283 -0.1173 0.2507  0.3228  434 VAL A CA  
2566 C  C   . VAL A 434 ? 2.6654 1.8198 1.7853 -0.1154 0.2701  0.3586  434 VAL A C   
2567 O  O   . VAL A 434 ? 2.7246 1.8282 1.8379 -0.1368 0.2798  0.3794  434 VAL A O   
2568 C  CB  . VAL A 434 ? 2.6059 1.7576 1.7657 -0.0945 0.2227  0.3060  434 VAL A CB  
2569 C  CG1 . VAL A 434 ? 2.6114 1.7530 1.7253 -0.0556 0.2110  0.3108  434 VAL A CG1 
2570 C  CG2 . VAL A 434 ? 2.6677 1.7468 1.8232 -0.1111 0.2196  0.3144  434 VAL A CG2 
2571 N  N   . LEU A 435 ? 2.6033 1.7816 1.6863 -0.0919 0.2760  0.3658  435 LEU A N   
2572 C  CA  . LEU A 435 ? 2.6654 1.8115 1.6936 -0.0878 0.2945  0.3995  435 LEU A CA  
2573 C  C   . LEU A 435 ? 2.7263 1.8983 1.7684 -0.1169 0.3295  0.4193  435 LEU A C   
2574 O  O   . LEU A 435 ? 2.7925 1.9219 1.8100 -0.1317 0.3477  0.4504  435 LEU A O   
2575 C  CB  . LEU A 435 ? 2.6626 1.8183 1.6389 -0.0512 0.2848  0.3996  435 LEU A CB  
2576 C  CG  . LEU A 435 ? 2.7262 1.8446 1.6740 -0.0200 0.2539  0.3941  435 LEU A CG  
2577 C  CD1 . LEU A 435 ? 2.7276 1.8623 1.6282 0.0109  0.2441  0.3952  435 LEU A CD1 
2578 C  CD2 . LEU A 435 ? 2.8332 1.8743 1.7521 -0.0220 0.2528  0.4191  435 LEU A CD2 
2579 N  N   . THR A 436 ? 2.6187 1.8610 1.7013 -0.1240 0.3397  0.4028  436 THR A N   
2580 C  CA  . THR A 436 ? 2.6265 1.9080 1.7325 -0.1488 0.3742  0.4188  436 THR A CA  
2581 C  C   . THR A 436 ? 2.6959 1.9638 1.8525 -0.1904 0.3829  0.4289  436 THR A C   
2582 O  O   . THR A 436 ? 2.7378 2.0082 1.8992 -0.2144 0.4129  0.4566  436 THR A O   
2583 C  CB  . THR A 436 ? 2.6589 2.0176 1.7944 -0.1393 0.3790  0.3958  436 THR A CB  
2584 O  OG1 . THR A 436 ? 2.6288 1.9898 1.7164 -0.1025 0.3644  0.3839  436 THR A OG1 
2585 C  CG2 . THR A 436 ? 2.6649 2.0688 1.8165 -0.1558 0.4178  0.4138  436 THR A CG2 
2586 N  N   . ALA A 437 ? 2.6228 1.8750 1.8149 -0.1993 0.3566  0.4068  437 ALA A N   
2587 C  CA  . ALA A 437 ? 2.6411 1.8742 1.8797 -0.2388 0.3570  0.4105  437 ALA A CA  
2588 C  C   . ALA A 437 ? 2.7879 1.9441 1.9921 -0.2547 0.3669  0.4435  437 ALA A C   
2589 O  O   . ALA A 437 ? 2.8218 1.9770 2.0544 -0.2918 0.3873  0.4645  437 ALA A O   
2590 C  CB  . ALA A 437 ? 2.6061 1.8302 1.8734 -0.2371 0.3240  0.3774  437 ALA A CB  
2591 N  N   . VAL A 438 ? 2.7847 1.8777 1.9296 -0.2269 0.3524  0.4495  438 VAL A N   
2592 C  CA  . VAL A 438 ? 2.8779 1.8894 1.9815 -0.2357 0.3590  0.4814  438 VAL A CA  
2593 C  C   . VAL A 438 ? 2.9812 1.9969 2.0436 -0.2354 0.3922  0.5187  438 VAL A C   
2594 O  O   . VAL A 438 ? 3.0475 2.0241 2.1032 -0.2630 0.4124  0.5509  438 VAL A O   
2595 C  CB  . VAL A 438 ? 2.9529 1.8954 2.0135 -0.2044 0.3295  0.4733  438 VAL A CB  
2596 C  CG1 . VAL A 438 ? 2.9209 1.8837 1.9380 -0.1585 0.3182  0.4657  438 VAL A CG1 
2597 C  CG2 . VAL A 438 ? 3.0546 1.9057 2.0771 -0.2152 0.3342  0.5052  438 VAL A CG2 
2598 N  N   . GLY A 439 ? 2.9072 1.9700 1.9428 -0.2060 0.3979  0.5136  439 GLY A N   
2599 C  CA  . GLY A 439 ? 2.9558 2.0276 1.9455 -0.2003 0.4287  0.5441  439 GLY A CA  
2600 C  C   . GLY A 439 ? 3.0346 2.0847 1.9486 -0.1572 0.4177  0.5479  439 GLY A C   
2601 O  O   . GLY A 439 ? 3.0704 2.1332 1.9399 -0.1474 0.4410  0.5681  439 GLY A O   
2602 N  N   . LEU A 440 ? 2.9726 1.9913 1.8712 -0.1308 0.3820  0.5288  440 LEU A N   
2603 C  CA  . LEU A 440 ? 2.9906 1.9889 1.8240 -0.0896 0.3639  0.5304  440 LEU A CA  
2604 C  C   . LEU A 440 ? 2.9966 2.0612 1.8202 -0.0671 0.3635  0.5105  440 LEU A C   
2605 O  O   . LEU A 440 ? 2.9208 2.0449 1.7983 -0.0768 0.3655  0.4848  440 LEU A O   
2606 C  CB  . LEU A 440 ? 2.9772 1.9355 1.8124 -0.0695 0.3267  0.5131  440 LEU A CB  
2607 C  CG  . LEU A 440 ? 3.1102 1.9854 1.9323 -0.0796 0.3225  0.5343  440 LEU A CG  
2608 C  CD1 . LEU A 440 ? 3.0771 1.9309 1.9265 -0.0673 0.2910  0.5073  440 LEU A CD1 
2609 C  CD2 . LEU A 440 ? 3.2378 2.0556 1.9832 -0.0586 0.3246  0.5694  440 LEU A CD2 
2610 N  N   . PRO A 441 ? 2.9987 2.0525 1.7531 -0.0373 0.3597  0.5213  441 PRO A N   
2611 C  CA  . PRO A 441 ? 2.9543 2.0651 1.6965 -0.0174 0.3580  0.5005  441 PRO A CA  
2612 C  C   . PRO A 441 ? 2.9358 2.0721 1.7031 0.0037  0.3211  0.4641  441 PRO A C   
2613 O  O   . PRO A 441 ? 2.9360 2.0370 1.6929 0.0202  0.2926  0.4618  441 PRO A O   
2614 C  CB  . PRO A 441 ? 3.0568 2.1380 1.7115 0.0044  0.3648  0.5263  441 PRO A CB  
2615 C  CG  . PRO A 441 ? 3.1798 2.1885 1.8018 0.0093  0.3514  0.5511  441 PRO A CG  
2616 C  CD  . PRO A 441 ? 3.1112 2.0987 1.7933 -0.0206 0.3554  0.5527  441 PRO A CD  
2617 N  N   . THR A 442 ? 2.8319 2.0304 1.6329 0.0041  0.3227  0.4368  442 THR A N   
2618 C  CA  . THR A 442 ? 2.7589 1.9888 1.5888 0.0207  0.2912  0.4023  442 THR A CA  
2619 C  C   . THR A 442 ? 2.8395 2.0603 1.6136 0.0542  0.2651  0.3983  442 THR A C   
2620 O  O   . THR A 442 ? 2.7863 2.0225 1.5812 0.0687  0.2352  0.3752  442 THR A O   
2621 C  CB  . THR A 442 ? 2.7786 2.0733 1.6605 0.0098  0.3017  0.3772  442 THR A CB  
2622 O  OG1 . THR A 442 ? 2.8025 2.1207 1.6484 0.0160  0.3248  0.3830  442 THR A OG1 
2623 C  CG2 . THR A 442 ? 2.7231 2.0322 1.6711 -0.0229 0.3178  0.3764  442 THR A CG2 
2624 N  N   . ASP A 443 ? 2.8794 2.0753 1.5829 0.0658  0.2755  0.4214  443 ASP A N   
2625 C  CA  . ASP A 443 ? 2.9097 2.0944 1.5538 0.0963  0.2493  0.4199  443 ASP A CA  
2626 C  C   . ASP A 443 ? 2.9751 2.1185 1.6085 0.1130  0.2173  0.4281  443 ASP A C   
2627 O  O   . ASP A 443 ? 2.9783 2.1217 1.5802 0.1379  0.1878  0.4220  443 ASP A O   
2628 C  CB  . ASP A 443 ? 3.0177 2.1859 1.5841 0.1037  0.2710  0.4427  443 ASP A CB  
2629 C  CG  . ASP A 443 ? 3.1467 2.3599 1.7167 0.0964  0.2994  0.4307  443 ASP A CG  
2630 O  OD1 . ASP A 443 ? 3.1201 2.3632 1.6820 0.1116  0.2837  0.4050  443 ASP A OD1 
2631 O  OD2 . ASP A 443 ? 3.2528 2.4711 1.8349 0.0757  0.3373  0.4474  443 ASP A OD2 
2632 N  N   . ASP A 444 ? 2.9364 2.0455 1.5980 0.0996  0.2220  0.4408  444 ASP A N   
2633 C  CA  . ASP A 444 ? 2.9570 2.0229 1.6121 0.1163  0.1956  0.4495  444 ASP A CA  
2634 C  C   . ASP A 444 ? 2.9146 2.0094 1.6223 0.1282  0.1650  0.4193  444 ASP A C   
2635 O  O   . ASP A 444 ? 2.9258 1.9936 1.6292 0.1480  0.1409  0.4239  444 ASP A O   
2636 C  CB  . ASP A 444 ? 3.0353 2.0465 1.6954 0.0978  0.2136  0.4743  444 ASP A CB  
2637 C  CG  . ASP A 444 ? 3.2884 2.2599 1.8874 0.0908  0.2398  0.5115  444 ASP A CG  
2638 O  OD1 . ASP A 444 ? 3.3032 2.3020 1.8714 0.0892  0.2580  0.5147  444 ASP A OD1 
2639 O  OD2 . ASP A 444 ? 3.4468 2.3581 2.0279 0.0870  0.2437  0.5377  444 ASP A OD2 
2640 N  N   . ILE A 445 ? 2.7793 1.9297 1.5353 0.1180  0.1664  0.3899  445 ILE A N   
2641 C  CA  . ILE A 445 ? 2.6969 1.8820 1.5034 0.1270  0.1411  0.3609  445 ILE A CA  
2642 C  C   . ILE A 445 ? 2.7544 1.9509 1.5322 0.1565  0.1089  0.3567  445 ILE A C   
2643 O  O   . ILE A 445 ? 2.7162 1.9213 1.5226 0.1713  0.0839  0.3458  445 ILE A O   
2644 C  CB  . ILE A 445 ? 2.6555 1.8944 1.5140 0.1075  0.1531  0.3343  445 ILE A CB  
2645 C  CG1 . ILE A 445 ? 2.6524 1.8813 1.5488 0.0782  0.1782  0.3377  445 ILE A CG1 
2646 C  CG2 . ILE A 445 ? 2.5888 1.8670 1.4914 0.1181  0.1273  0.3057  445 ILE A CG2 
2647 C  CD1 . ILE A 445 ? 2.6616 1.9410 1.6008 0.0570  0.1962  0.3198  445 ILE A CD1 
2648 N  N   . THR A 446 ? 2.7624 1.9574 1.4821 0.1648  0.1099  0.3669  446 THR A N   
2649 C  CA  . THR A 446 ? 2.7800 1.9831 1.4617 0.1897  0.0792  0.3651  446 THR A CA  
2650 C  C   . THR A 446 ? 2.8680 2.0415 1.5394 0.2130  0.0516  0.3801  446 THR A C   
2651 O  O   . THR A 446 ? 2.8449 2.0426 1.5247 0.2314  0.0194  0.3695  446 THR A O   
2652 C  CB  . THR A 446 ? 2.9277 2.1189 1.5364 0.1927  0.0907  0.3784  446 THR A CB  
2653 O  OG1 . THR A 446 ? 2.9732 2.1139 1.5400 0.1889  0.1123  0.4109  446 THR A OG1 
2654 C  CG2 . THR A 446 ? 2.8797 2.1074 1.4969 0.1771  0.1134  0.3598  446 THR A CG2 
2655 N  N   . LEU A 447 ? 2.8770 1.9986 1.5318 0.2123  0.0640  0.4056  447 LEU A N   
2656 C  CA  . LEU A 447 ? 2.9170 2.0023 1.5599 0.2360  0.0419  0.4232  447 LEU A CA  
2657 C  C   . LEU A 447 ? 2.9041 2.0094 1.6141 0.2436  0.0255  0.4041  447 LEU A C   
2658 O  O   . LEU A 447 ? 2.9014 2.0139 1.6163 0.2694  -0.0040 0.4051  447 LEU A O   
2659 C  CB  . LEU A 447 ? 2.9968 2.0158 1.6045 0.2298  0.0636  0.4550  447 LEU A CB  
2660 C  CG  . LEU A 447 ? 3.1339 2.1266 1.6676 0.2263  0.0806  0.4804  447 LEU A CG  
2661 C  CD1 . LEU A 447 ? 3.1592 2.1263 1.6938 0.1960  0.1213  0.4940  447 LEU A CD1 
2662 C  CD2 . LEU A 447 ? 3.2522 2.1987 1.7254 0.2536  0.0604  0.5100  447 LEU A CD2 
2663 N  N   . ILE A 448 ? 2.8070 1.9237 1.5680 0.2216  0.0447  0.3870  448 ILE A N   
2664 C  CA  . ILE A 448 ? 2.7483 1.8811 1.5704 0.2252  0.0358  0.3674  448 ILE A CA  
2665 C  C   . ILE A 448 ? 2.7273 1.9255 1.5877 0.2327  0.0147  0.3412  448 ILE A C   
2666 O  O   . ILE A 448 ? 2.7011 1.9138 1.5957 0.2505  -0.0038 0.3331  448 ILE A O   
2667 C  CB  . ILE A 448 ? 2.7681 1.8855 1.6220 0.1962  0.0636  0.3600  448 ILE A CB  
2668 C  CG1 . ILE A 448 ? 2.8416 1.8885 1.6785 0.1972  0.0720  0.3815  448 ILE A CG1 
2669 C  CG2 . ILE A 448 ? 2.6955 1.8558 1.6131 0.1889  0.0604  0.3290  448 ILE A CG2 
2670 C  CD1 . ILE A 448 ? 3.0216 2.0207 1.8028 0.1879  0.0898  0.4126  448 ILE A CD1 
2671 N  N   . ILE A 449 ? 2.6512 1.8867 1.5046 0.2202  0.0184  0.3291  449 ILE A N   
2672 C  CA  . ILE A 449 ? 2.5815 1.8754 1.4662 0.2217  0.0011  0.3046  449 ILE A CA  
2673 C  C   . ILE A 449 ? 2.6175 1.9321 1.5154 0.2480  -0.0337 0.3039  449 ILE A C   
2674 O  O   . ILE A 449 ? 2.5488 1.9065 1.4971 0.2489  -0.0451 0.2843  449 ILE A O   
2675 C  CB  . ILE A 449 ? 2.6276 1.9380 1.4766 0.2109  0.0084  0.3000  449 ILE A CB  
2676 C  CG1 . ILE A 449 ? 2.5900 1.9196 1.4698 0.1847  0.0364  0.2842  449 ILE A CG1 
2677 C  CG2 . ILE A 449 ? 2.6168 1.9650 1.4617 0.2228  -0.0216 0.2868  449 ILE A CG2 
2678 C  CD1 . ILE A 449 ? 2.7364 2.0668 1.5765 0.1729  0.0573  0.2866  449 ILE A CD1 
2679 N  N   . ALA A 450 ? 2.6342 1.9193 1.4895 0.2691  -0.0498 0.3267  450 ALA A N   
2680 C  CA  . ALA A 450 ? 2.6322 1.9372 1.4990 0.2957  -0.0842 0.3305  450 ALA A CA  
2681 C  C   . ALA A 450 ? 2.6353 1.9544 1.5631 0.3082  -0.0889 0.3233  450 ALA A C   
2682 O  O   . ALA A 450 ? 2.5772 1.9474 1.5499 0.3140  -0.1070 0.3084  450 ALA A O   
2683 C  CB  . ALA A 450 ? 2.7263 1.9898 1.5328 0.3158  -0.0973 0.3594  450 ALA A CB  
2684 N  N   . VAL A 451 ? 2.6117 1.8846 1.5400 0.3113  -0.0716 0.3334  451 VAL A N   
2685 C  CA  . VAL A 451 ? 2.5831 1.8587 1.5593 0.3263  -0.0731 0.3271  451 VAL A CA  
2686 C  C   . VAL A 451 ? 2.5563 1.8524 1.5789 0.3044  -0.0530 0.3016  451 VAL A C   
2687 O  O   . VAL A 451 ? 2.5243 1.8326 1.5884 0.3161  -0.0544 0.2914  451 VAL A O   
2688 C  CB  . VAL A 451 ? 2.7068 1.9157 1.6550 0.3448  -0.0686 0.3504  451 VAL A CB  
2689 C  CG1 . VAL A 451 ? 2.7257 1.8815 1.6612 0.3215  -0.0378 0.3513  451 VAL A CG1 
2690 C  CG2 . VAL A 451 ? 2.7012 1.9192 1.6872 0.3765  -0.0832 0.3501  451 VAL A CG2 
2691 N  N   . ASP A 452 ? 2.4820 1.7838 1.4967 0.2748  -0.0350 0.2917  452 ASP A N   
2692 C  CA  . ASP A 452 ? 2.4199 1.7410 1.4731 0.2517  -0.0169 0.2691  452 ASP A CA  
2693 C  C   . ASP A 452 ? 2.3886 1.7638 1.4965 0.2584  -0.0284 0.2483  452 ASP A C   
2694 O  O   . ASP A 452 ? 2.3535 1.7277 1.4925 0.2533  -0.0171 0.2350  452 ASP A O   
2695 C  CB  . ASP A 452 ? 2.4300 1.7632 1.4670 0.2244  -0.0018 0.2635  452 ASP A CB  
2696 C  CG  . ASP A 452 ? 2.5024 1.8652 1.5807 0.2017  0.0128  0.2402  452 ASP A CG  
2697 O  OD1 . ASP A 452 ? 2.4510 1.8631 1.5598 0.2016  0.0020  0.2230  452 ASP A OD1 
2698 O  OD2 . ASP A 452 ? 2.5916 1.9284 1.6706 0.1826  0.0340  0.2403  452 ASP A OD2 
2699 N  N   . TRP A 453 ? 2.3137 1.7350 1.4311 0.2676  -0.0505 0.2455  453 TRP A N   
2700 C  CA  . TRP A 453 ? 2.2447 1.7226 1.4140 0.2715  -0.0621 0.2286  453 TRP A CA  
2701 C  C   . TRP A 453 ? 2.2695 1.7474 1.4745 0.2908  -0.0607 0.2263  453 TRP A C   
2702 O  O   . TRP A 453 ? 2.2148 1.7161 1.4561 0.2828  -0.0513 0.2090  453 TRP A O   
2703 C  CB  . TRP A 453 ? 2.2236 1.7425 1.3936 0.2801  -0.0901 0.2313  453 TRP A CB  
2704 C  CG  . TRP A 453 ? 2.2791 1.7946 1.4435 0.3093  -0.1124 0.2497  453 TRP A CG  
2705 C  CD1 . TRP A 453 ? 2.3829 1.8612 1.4974 0.3214  -0.1214 0.2706  453 TRP A CD1 
2706 C  CD2 . TRP A 453 ? 2.2581 1.8098 1.4696 0.3316  -0.1272 0.2505  453 TRP A CD2 
2707 N  NE1 . TRP A 453 ? 2.4009 1.8897 1.5293 0.3505  -0.1432 0.2842  453 TRP A NE1 
2708 C  CE2 . TRP A 453 ? 2.3653 1.9005 1.5554 0.3577  -0.1462 0.2722  453 TRP A CE2 
2709 C  CE3 . TRP A 453 ? 2.2179 1.8146 1.4876 0.3332  -0.1247 0.2363  453 TRP A CE3 
2710 C  CZ2 . TRP A 453 ? 2.3551 1.9221 1.5849 0.3858  -0.1635 0.2796  453 TRP A CZ2 
2711 C  CZ3 . TRP A 453 ? 2.2359 1.8639 1.5434 0.3602  -0.1394 0.2439  453 TRP A CZ3 
2712 C  CH2 . TRP A 453 ? 2.2977 1.9125 1.5877 0.3865  -0.1586 0.2651  453 TRP A CH2 
2713 N  N   . LEU A 454 ? 2.2672 1.7162 1.4586 0.3172  -0.0689 0.2438  454 LEU A N   
2714 C  CA  . LEU A 454 ? 2.2636 1.7080 1.4837 0.3415  -0.0673 0.2430  454 LEU A CA  
2715 C  C   . LEU A 454 ? 2.3070 1.7041 1.5220 0.3314  -0.0426 0.2338  454 LEU A C   
2716 O  O   . LEU A 454 ? 2.2802 1.6889 1.5270 0.3396  -0.0358 0.2203  454 LEU A O   
2717 C  CB  . LEU A 454 ? 2.3229 1.7472 1.5271 0.3747  -0.0841 0.2658  454 LEU A CB  
2718 C  CG  . LEU A 454 ? 2.3895 1.8217 1.6285 0.4077  -0.0863 0.2665  454 LEU A CG  
2719 C  CD1 . LEU A 454 ? 2.3324 1.8445 1.6283 0.4152  -0.0992 0.2571  454 LEU A CD1 
2720 C  CD2 . LEU A 454 ? 2.4910 1.8871 1.7049 0.4396  -0.0994 0.2911  454 LEU A CD2 
2721 N  N   . LEU A 455 ? 2.2850 1.6303 1.4601 0.3122  -0.0293 0.2407  455 LEU A N   
2722 C  CA  . LEU A 455 ? 2.2898 1.5871 1.4583 0.2966  -0.0081 0.2327  455 LEU A CA  
2723 C  C   . LEU A 455 ? 2.2579 1.5914 1.4570 0.2711  0.0025  0.2086  455 LEU A C   
2724 O  O   . LEU A 455 ? 2.2466 1.5612 1.4580 0.2659  0.0138  0.1949  455 LEU A O   
2725 C  CB  . LEU A 455 ? 2.3440 1.5835 1.4663 0.2797  0.0028  0.2496  455 LEU A CB  
2726 C  CG  . LEU A 455 ? 2.4760 1.6652 1.5602 0.3031  -0.0049 0.2760  455 LEU A CG  
2727 C  CD1 . LEU A 455 ? 2.5265 1.6726 1.5653 0.2823  0.0066  0.2940  455 LEU A CD1 
2728 C  CD2 . LEU A 455 ? 2.5421 1.6820 1.6286 0.3244  -0.0020 0.2765  455 LEU A CD2 
2729 N  N   . ASP A 456 ? 2.1573 1.5405 1.3661 0.2565  -0.0027 0.2033  456 ASP A N   
2730 C  CA  . ASP A 456 ? 2.0901 1.5124 1.3276 0.2342  0.0047  0.1825  456 ASP A CA  
2731 C  C   . ASP A 456 ? 2.0888 1.5447 1.3666 0.2478  0.0014  0.1675  456 ASP A C   
2732 O  O   . ASP A 456 ? 2.0622 1.5183 1.3553 0.2348  0.0128  0.1513  456 ASP A O   
2733 C  CB  . ASP A 456 ? 2.0812 1.5440 1.3160 0.2210  -0.0023 0.1817  456 ASP A CB  
2734 C  CG  . ASP A 456 ? 2.1314 1.6237 1.3868 0.1956  0.0079  0.1637  456 ASP A CG  
2735 O  OD1 . ASP A 456 ? 2.1384 1.6077 1.3944 0.1784  0.0240  0.1575  456 ASP A OD1 
2736 O  OD2 . ASP A 456 ? 2.1535 1.6903 1.4238 0.1923  -0.0015 0.1564  456 ASP A OD2 
2737 N  N   . ARG A 457 ? 2.0306 1.5137 1.3246 0.2747  -0.0138 0.1741  457 ARG A N   
2738 C  CA  . ARG A 457 ? 1.9886 1.5087 1.3224 0.2914  -0.0154 0.1637  457 ARG A CA  
2739 C  C   . ARG A 457 ? 2.0534 1.5308 1.3834 0.3024  -0.0013 0.1564  457 ARG A C   
2740 O  O   . ARG A 457 ? 2.0208 1.5177 1.3738 0.3011  0.0068  0.1401  457 ARG A O   
2741 C  CB  . ARG A 457 ? 1.9859 1.5435 1.3401 0.3192  -0.0343 0.1761  457 ARG A CB  
2742 C  CG  . ARG A 457 ? 2.1157 1.6934 1.4574 0.3160  -0.0541 0.1893  457 ARG A CG  
2743 C  CD  . ARG A 457 ? 2.1518 1.7719 1.5055 0.2905  -0.0589 0.1786  457 ARG A CD  
2744 N  NE  . ARG A 457 ? 2.2189 1.9005 1.6132 0.2984  -0.0765 0.1782  457 ARG A NE  
2745 C  CZ  . ARG A 457 ? 2.3742 2.0926 1.7784 0.2808  -0.0880 0.1724  457 ARG A CZ  
2746 N  NH1 . ARG A 457 ? 2.1849 1.8858 1.5600 0.2575  -0.0826 0.1659  457 ARG A NH1 
2747 N  NH2 . ARG A 457 ? 2.2150 1.9878 1.6593 0.2864  -0.1047 0.1735  457 ARG A NH2 
2748 N  N   . PHE A 458 ? 2.0617 1.4775 1.3593 0.3132  0.0014  0.1683  458 PHE A N   
2749 C  CA  . PHE A 458 ? 2.0960 1.4596 1.3834 0.3242  0.0133  0.1609  458 PHE A CA  
2750 C  C   . PHE A 458 ? 2.1226 1.4531 1.3970 0.2923  0.0272  0.1463  458 PHE A C   
2751 O  O   . PHE A 458 ? 2.1169 1.4334 1.3971 0.2942  0.0356  0.1292  458 PHE A O   
2752 C  CB  . PHE A 458 ? 2.1941 1.4997 1.4522 0.3493  0.0098  0.1796  458 PHE A CB  
2753 C  CG  . PHE A 458 ? 2.2192 1.5577 1.4930 0.3841  -0.0057 0.1948  458 PHE A CG  
2754 C  CD1 . PHE A 458 ? 2.2333 1.6180 1.5457 0.4093  -0.0071 0.1872  458 PHE A CD1 
2755 C  CD2 . PHE A 458 ? 2.2795 1.6040 1.5298 0.3924  -0.0190 0.2179  458 PHE A CD2 
2756 C  CE1 . PHE A 458 ? 2.2491 1.6713 1.5831 0.4405  -0.0225 0.2026  458 PHE A CE1 
2757 C  CE2 . PHE A 458 ? 2.3227 1.6812 1.5900 0.4242  -0.0367 0.2324  458 PHE A CE2 
2758 C  CZ  . PHE A 458 ? 2.2695 1.6785 1.5816 0.4476  -0.0387 0.2247  458 PHE A CZ  
2759 N  N   . ARG A 459 ? 2.0599 1.3797 1.3169 0.2635  0.0296  0.1527  459 ARG A N   
2760 C  CA  . ARG A 459 ? 2.0478 1.3425 1.2984 0.2313  0.0417  0.1411  459 ARG A CA  
2761 C  C   . ARG A 459 ? 2.0171 1.3634 1.2986 0.2163  0.0440  0.1199  459 ARG A C   
2762 O  O   . ARG A 459 ? 2.0183 1.3446 1.3002 0.1991  0.0515  0.1052  459 ARG A O   
2763 C  CB  . ARG A 459 ? 2.0616 1.3331 1.2881 0.2065  0.0466  0.1560  459 ARG A CB  
2764 C  CG  . ARG A 459 ? 2.1061 1.4310 1.3414 0.1910  0.0444  0.1582  459 ARG A CG  
2765 C  CD  . ARG A 459 ? 2.1819 1.4782 1.3888 0.1707  0.0531  0.1745  459 ARG A CD  
2766 N  NE  . ARG A 459 ? 2.1993 1.5008 1.3825 0.1854  0.0444  0.1937  459 ARG A NE  
2767 C  CZ  . ARG A 459 ? 2.2934 1.6258 1.4686 0.1749  0.0442  0.1981  459 ARG A CZ  
2768 N  NH1 . ARG A 459 ? 2.0210 1.3832 1.2131 0.1505  0.0539  0.1856  459 ARG A NH1 
2769 N  NH2 . ARG A 459 ? 2.1811 1.5136 1.3294 0.1900  0.0337  0.2145  459 ARG A NH2 
2770 N  N   . THR A 460 ? 1.9064 1.3163 1.2131 0.2233  0.0360  0.1185  460 THR A N   
2771 C  CA  . THR A 460 ? 1.8384 1.2986 1.1745 0.2126  0.0372  0.1011  460 THR A CA  
2772 C  C   . THR A 460 ? 1.8853 1.3401 1.2311 0.2305  0.0414  0.0874  460 THR A C   
2773 O  O   . THR A 460 ? 1.8607 1.3213 1.2137 0.2167  0.0472  0.0706  460 THR A O   
2774 C  CB  . THR A 460 ? 1.8737 1.3951 1.2312 0.2157  0.0264  0.1058  460 THR A CB  
2775 O  OG1 . THR A 460 ? 1.9015 1.4199 1.2416 0.2007  0.0238  0.1164  460 THR A OG1 
2776 C  CG2 . THR A 460 ? 1.7820 1.3521 1.1685 0.2041  0.0276  0.0903  460 THR A CG2 
2777 N  N   . MET A 461 ? 1.8649 1.3070 1.2084 0.2626  0.0388  0.0950  461 MET A N   
2778 C  CA  . MET A 461 ? 1.8755 1.3090 1.2240 0.2864  0.0451  0.0837  461 MET A CA  
2779 C  C   . MET A 461 ? 1.9575 1.3262 1.2782 0.2764  0.0540  0.0698  461 MET A C   
2780 O  O   . MET A 461 ? 1.9545 1.3244 1.2776 0.2799  0.0603  0.0520  461 MET A O   
2781 C  CB  . MET A 461 ? 1.9388 1.3696 1.2905 0.3247  0.0407  0.0974  461 MET A CB  
2782 C  CG  . MET A 461 ? 1.9422 1.4443 1.3287 0.3363  0.0301  0.1082  461 MET A CG  
2783 S  SD  . MET A 461 ? 2.0373 1.5422 1.4326 0.3807  0.0215  0.1277  461 MET A SD  
2784 C  CE  . MET A 461 ? 1.9917 1.5221 1.4131 0.4096  0.0354  0.1141  461 MET A CE  
2785 N  N   . VAL A 462 ? 1.9437 1.2563 1.2372 0.2620  0.0541  0.0781  462 VAL A N   
2786 C  CA  . VAL A 462 ? 1.9857 1.2318 1.2532 0.2464  0.0599  0.0669  462 VAL A CA  
2787 C  C   . VAL A 462 ? 1.9855 1.2518 1.2630 0.2087  0.0616  0.0529  462 VAL A C   
2788 O  O   . VAL A 462 ? 1.9934 1.2303 1.2610 0.1986  0.0641  0.0349  462 VAL A O   
2789 C  CB  . VAL A 462 ? 2.0998 1.2793 1.3374 0.2444  0.0596  0.0845  462 VAL A CB  
2790 C  CG1 . VAL A 462 ? 2.1557 1.2630 1.3682 0.2254  0.0641  0.0732  462 VAL A CG1 
2791 C  CG2 . VAL A 462 ? 2.1362 1.2982 1.3652 0.2849  0.0562  0.0987  462 VAL A CG2 
2792 N  N   . ASN A 463 ? 1.8912 1.2080 1.1874 0.1900  0.0592  0.0606  463 ASN A N   
2793 C  CA  . ASN A 463 ? 1.8471 1.1938 1.1585 0.1580  0.0603  0.0502  463 ASN A CA  
2794 C  C   . ASN A 463 ? 1.8651 1.2487 1.1933 0.1632  0.0599  0.0310  463 ASN A C   
2795 O  O   . ASN A 463 ? 1.8566 1.2358 1.1856 0.1426  0.0603  0.0162  463 ASN A O   
2796 C  CB  . ASN A 463 ? 1.7957 1.1878 1.1209 0.1454  0.0586  0.0631  463 ASN A CB  
2797 C  CG  . ASN A 463 ? 2.0219 1.3826 1.3292 0.1297  0.0623  0.0800  463 ASN A CG  
2798 O  OD1 . ASN A 463 ? 1.9403 1.2428 1.2266 0.1241  0.0661  0.0845  463 ASN A OD1 
2799 N  ND2 . ASN A 463 ? 1.8985 1.2950 1.2115 0.1225  0.0619  0.0903  463 ASN A ND2 
2800 N  N   . VAL A 464 ? 1.7947 1.2158 1.1368 0.1905  0.0586  0.0329  464 VAL A N   
2801 C  CA  . VAL A 464 ? 1.7552 1.2143 1.1128 0.2006  0.0604  0.0190  464 VAL A CA  
2802 C  C   . VAL A 464 ? 1.8472 1.2582 1.1811 0.2136  0.0658  0.0032  464 VAL A C   
2803 O  O   . VAL A 464 ? 1.8334 1.2468 1.1637 0.2024  0.0669  -0.0138 464 VAL A O   
2804 C  CB  . VAL A 464 ? 1.7668 1.2798 1.1493 0.2248  0.0582  0.0295  464 VAL A CB  
2805 C  CG1 . VAL A 464 ? 1.7500 1.2927 1.1445 0.2412  0.0641  0.0181  464 VAL A CG1 
2806 C  CG2 . VAL A 464 ? 1.7107 1.2722 1.1144 0.2081  0.0511  0.0392  464 VAL A CG2 
2807 N  N   . LEU A 465 ? 1.8598 1.2242 1.1746 0.2380  0.0681  0.0086  465 LEU A N   
2808 C  CA  . LEU A 465 ? 1.9243 1.2315 1.2104 0.2561  0.0735  -0.0057 465 LEU A CA  
2809 C  C   . LEU A 465 ? 2.0074 1.2650 1.2695 0.2276  0.0713  -0.0231 465 LEU A C   
2810 O  O   . LEU A 465 ? 2.0245 1.2572 1.2669 0.2353  0.0741  -0.0428 465 LEU A O   
2811 C  CB  . LEU A 465 ? 1.9835 1.2425 1.2529 0.2818  0.0742  0.0078  465 LEU A CB  
2812 C  CG  . LEU A 465 ? 2.1150 1.3212 1.3580 0.3141  0.0811  -0.0040 465 LEU A CG  
2813 C  CD1 . LEU A 465 ? 2.0997 1.3575 1.3636 0.3512  0.0884  -0.0036 465 LEU A CD1 
2814 C  CD2 . LEU A 465 ? 2.2080 1.3462 1.4268 0.3273  0.0793  0.0088  465 LEU A CD2 
2815 N  N   . GLY A 466 ? 1.9727 1.2178 1.2366 0.1952  0.0664  -0.0153 466 GLY A N   
2816 C  CA  . GLY A 466 ? 2.0041 1.2107 1.2545 0.1623  0.0622  -0.0280 466 GLY A CA  
2817 C  C   . GLY A 466 ? 2.0252 1.2734 1.2882 0.1454  0.0588  -0.0450 466 GLY A C   
2818 O  O   . GLY A 466 ? 2.0573 1.2704 1.3018 0.1317  0.0541  -0.0635 466 GLY A O   
2819 N  N   . ASP A 467 ? 1.9177 1.2388 1.2106 0.1464  0.0596  -0.0388 467 ASP A N   
2820 C  CA  . ASP A 467 ? 1.8743 1.2407 1.1809 0.1336  0.0564  -0.0515 467 ASP A CA  
2821 C  C   . ASP A 467 ? 1.9219 1.2887 1.2128 0.1597  0.0607  -0.0667 467 ASP A C   
2822 O  O   . ASP A 467 ? 1.9161 1.2785 1.1944 0.1499  0.0568  -0.0843 467 ASP A O   
2823 C  CB  . ASP A 467 ? 1.8291 1.2662 1.1701 0.1281  0.0562  -0.0384 467 ASP A CB  
2824 C  CG  . ASP A 467 ? 1.9918 1.4359 1.3463 0.1103  0.0552  -0.0213 467 ASP A CG  
2825 O  OD1 . ASP A 467 ? 2.0496 1.4487 1.3914 0.0941  0.0549  -0.0187 467 ASP A OD1 
2826 O  OD2 . ASP A 467 ? 2.0356 1.5284 1.4116 0.1120  0.0551  -0.0105 467 ASP A OD2 
2827 N  N   . ALA A 468 ? 1.8819 1.2564 1.1738 0.1938  0.0688  -0.0589 468 ALA A N   
2828 C  CA  . ALA A 468 ? 1.8980 1.2781 1.1782 0.2244  0.0775  -0.0692 468 ALA A CA  
2829 C  C   . ALA A 468 ? 2.0455 1.3534 1.2818 0.2312  0.0782  -0.0898 468 ALA A C   
2830 O  O   . ALA A 468 ? 2.0627 1.3703 1.2808 0.2312  0.0788  -0.1078 468 ALA A O   
2831 C  CB  . ALA A 468 ? 1.8977 1.3014 1.1944 0.2578  0.0852  -0.0533 468 ALA A CB  
2832 N  N   . LEU A 469 ? 2.0613 1.3040 1.2770 0.2348  0.0768  -0.0876 469 LEU A N   
2833 C  CA  . LEU A 469 ? 2.1438 1.3065 1.3145 0.2387  0.0754  -0.1080 469 LEU A CA  
2834 C  C   . LEU A 469 ? 2.2051 1.3470 1.3648 0.1981  0.0622  -0.1232 469 LEU A C   
2835 O  O   . LEU A 469 ? 2.2571 1.3494 1.3797 0.1979  0.0582  -0.1459 469 LEU A O   
2836 C  CB  . LEU A 469 ? 2.2068 1.3026 1.3595 0.2523  0.0766  -0.0992 469 LEU A CB  
2837 C  CG  . LEU A 469 ? 2.2874 1.3839 1.4389 0.3003  0.0887  -0.0910 469 LEU A CG  
2838 C  CD1 . LEU A 469 ? 2.3206 1.3790 1.4718 0.3075  0.0869  -0.0709 469 LEU A CD1 
2839 C  CD2 . LEU A 469 ? 2.3879 1.4347 1.4985 0.3302  0.0967  -0.1140 469 LEU A CD2 
2840 N  N   . GLY A 470 ? 2.1102 1.2933 1.3026 0.1658  0.0553  -0.1109 470 GLY A N   
2841 C  CA  . GLY A 470 ? 2.1077 1.2894 1.3033 0.1262  0.0425  -0.1208 470 GLY A CA  
2842 C  C   . GLY A 470 ? 2.1580 1.3680 1.3452 0.1253  0.0383  -0.1394 470 GLY A C   
2843 O  O   . GLY A 470 ? 2.2054 1.3762 1.3663 0.1092  0.0272  -0.1593 470 GLY A O   
2844 N  N   . ALA A 471 ? 2.0561 1.3322 1.2635 0.1429  0.0463  -0.1325 471 ALA A N   
2845 C  CA  . ALA A 471 ? 2.0369 1.3458 1.2360 0.1463  0.0451  -0.1459 471 ALA A CA  
2846 C  C   . ALA A 471 ? 2.1590 1.4140 1.3071 0.1680  0.0479  -0.1688 471 ALA A C   
2847 O  O   . ALA A 471 ? 2.1760 1.4150 1.2988 0.1542  0.0371  -0.1878 471 ALA A O   
2848 C  CB  . ALA A 471 ? 1.9792 1.3603 1.2086 0.1644  0.0560  -0.1307 471 ALA A CB  
2849 N  N   . GLY A 472 ? 2.1593 1.3823 1.2906 0.2013  0.0609  -0.1675 472 GLY A N   
2850 C  CA  . GLY A 472 ? 2.2409 1.4058 1.3206 0.2279  0.0666  -0.1891 472 GLY A CA  
2851 C  C   . GLY A 472 ? 2.3706 1.4545 1.4106 0.2057  0.0507  -0.2103 472 GLY A C   
2852 O  O   . GLY A 472 ? 2.4294 1.4754 1.4231 0.2122  0.0471  -0.2349 472 GLY A O   
2853 N  N   . ILE A 473 ? 2.3216 1.3785 1.3787 0.1777  0.0405  -0.2005 473 ILE A N   
2854 C  CA  . ILE A 473 ? 2.3842 1.3665 1.4136 0.1491  0.0236  -0.2161 473 ILE A CA  
2855 C  C   . ILE A 473 ? 2.4144 1.4193 1.4468 0.1128  0.0048  -0.2293 473 ILE A C   
2856 O  O   . ILE A 473 ? 2.4779 1.4309 1.4669 0.1064  -0.0077 -0.2548 473 ILE A O   
2857 C  CB  . ILE A 473 ? 2.4266 1.3786 1.4768 0.1317  0.0220  -0.1967 473 ILE A CB  
2858 C  CG1 . ILE A 473 ? 2.4946 1.3845 1.5170 0.1681  0.0340  -0.1945 473 ILE A CG1 
2859 C  CG2 . ILE A 473 ? 2.4705 1.3790 1.5180 0.0853  0.0025  -0.2043 473 ILE A CG2 
2860 C  CD1 . ILE A 473 ? 2.5797 1.4636 1.6277 0.1659  0.0389  -0.1667 473 ILE A CD1 
2861 N  N   . VAL A 474 ? 2.2803 1.3614 1.3616 0.0915  0.0021  -0.2126 474 VAL A N   
2862 C  CA  . VAL A 474 ? 2.2504 1.3648 1.3445 0.0587  -0.0158 -0.2205 474 VAL A CA  
2863 C  C   . VAL A 474 ? 2.3192 1.4477 1.3798 0.0760  -0.0175 -0.2394 474 VAL A C   
2864 O  O   . VAL A 474 ? 2.3499 1.4596 1.3883 0.0553  -0.0367 -0.2583 474 VAL A O   
2865 C  CB  . VAL A 474 ? 2.2025 1.3925 1.3569 0.0368  -0.0156 -0.1967 474 VAL A CB  
2866 C  CG1 . VAL A 474 ? 2.1750 1.4015 1.3451 0.0063  -0.0342 -0.2040 474 VAL A CG1 
2867 C  CG2 . VAL A 474 ? 2.1990 1.3692 1.3785 0.0183  -0.0136 -0.1791 474 VAL A CG2 
2868 N  N   . GLU A 475 ? 2.2598 1.4198 1.3153 0.1134  0.0022  -0.2339 475 GLU A N   
2869 C  CA  . GLU A 475 ? 2.2768 1.4522 1.2987 0.1341  0.0060  -0.2482 475 GLU A CA  
2870 C  C   . GLU A 475 ? 2.4364 1.5309 1.3913 0.1416  -0.0020 -0.2784 475 GLU A C   
2871 O  O   . GLU A 475 ? 2.4558 1.5448 1.3811 0.1295  -0.0173 -0.2964 475 GLU A O   
2872 C  CB  . GLU A 475 ? 2.2604 1.4775 1.2920 0.1738  0.0318  -0.2343 475 GLU A CB  
2873 C  CG  . GLU A 475 ? 2.3909 1.6343 1.3934 0.1949  0.0401  -0.2435 475 GLU A CG  
2874 C  CD  . GLU A 475 ? 2.6276 1.8840 1.6217 0.2393  0.0673  -0.2377 475 GLU A CD  
2875 O  OE1 . GLU A 475 ? 2.5065 1.7188 1.4886 0.2614  0.0773  -0.2396 475 GLU A OE1 
2876 O  OE2 . GLU A 475 ? 2.5282 1.8382 1.5269 0.2528  0.0789  -0.2309 475 GLU A OE2 
2877 N  N   . HIS A 476 ? 2.4639 1.4931 1.3935 0.1615  0.0069  -0.2840 476 HIS A N   
2878 C  CA  . HIS A 476 ? 2.5769 1.5169 1.4392 0.1723  0.0009  -0.3134 476 HIS A CA  
2879 C  C   . HIS A 476 ? 2.6870 1.5819 1.5345 0.1281  -0.0299 -0.3308 476 HIS A C   
2880 O  O   . HIS A 476 ? 2.7553 1.6066 1.5478 0.1277  -0.0430 -0.3583 476 HIS A O   
2881 C  CB  . HIS A 476 ? 2.6358 1.5167 1.4845 0.1998  0.0156  -0.3109 476 HIS A CB  
2882 C  CG  . HIS A 476 ? 2.7935 1.5858 1.5686 0.2243  0.0164  -0.3410 476 HIS A CG  
2883 N  ND1 . HIS A 476 ? 2.9025 1.6053 1.6409 0.2006  -0.0047 -0.3615 476 HIS A ND1 
2884 C  CD2 . HIS A 476 ? 2.8590 1.6403 1.5912 0.2700  0.0362  -0.3536 476 HIS A CD2 
2885 C  CE1 . HIS A 476 ? 2.9907 1.6261 1.6615 0.2334  0.0018  -0.3876 476 HIS A CE1 
2886 N  NE2 . HIS A 476 ? 2.9728 1.6537 1.6370 0.2771  0.0276  -0.3838 476 HIS A NE2 
2887 N  N   . LEU A 477 ? 2.6139 1.5229 1.5109 0.0908  -0.0415 -0.3143 477 LEU A N   
2888 C  CA  . LEU A 477 ? 2.6489 1.5278 1.5482 0.0440  -0.0704 -0.3251 477 LEU A CA  
2889 C  C   . LEU A 477 ? 2.6826 1.6147 1.5883 0.0229  -0.0891 -0.3328 477 LEU A C   
2890 O  O   . LEU A 477 ? 2.7386 1.6302 1.6131 -0.0004 -0.1146 -0.3556 477 LEU A O   
2891 C  CB  . LEU A 477 ? 2.6064 1.4976 1.5627 0.0134  -0.0719 -0.3006 477 LEU A CB  
2892 C  CG  . LEU A 477 ? 2.7221 1.5373 1.6651 0.0185  -0.0648 -0.2964 477 LEU A CG  
2893 C  CD1 . LEU A 477 ? 2.6582 1.5117 1.6597 0.0034  -0.0554 -0.2642 477 LEU A CD1 
2894 C  CD2 . LEU A 477 ? 2.8542 1.5811 1.7619 -0.0113 -0.0886 -0.3188 477 LEU A CD2 
2895 N  N   . SER A 478 ? 2.5610 1.5811 1.5057 0.0315  -0.0780 -0.3137 478 SER A N   
2896 C  CA  . SER A 478 ? 2.5296 1.6064 1.4838 0.0164  -0.0933 -0.3164 478 SER A CA  
2897 C  C   . SER A 478 ? 2.6336 1.7115 1.5335 0.0500  -0.0856 -0.3316 478 SER A C   
2898 O  O   . SER A 478 ? 2.5719 1.7165 1.4885 0.0597  -0.0785 -0.3199 478 SER A O   
2899 C  CB  . SER A 478 ? 2.4568 1.6217 1.4813 0.0057  -0.0863 -0.2872 478 SER A CB  
2900 O  OG  . SER A 478 ? 2.5203 1.6946 1.5897 -0.0345 -0.1024 -0.2787 478 SER A OG  
2901 N  N   . ARG A 479 ? 2.7036 1.7035 1.5358 0.0675  -0.0866 -0.3576 479 ARG A N   
2902 C  CA  . ARG A 479 ? 2.7591 1.7443 1.5273 0.1022  -0.0769 -0.3755 479 ARG A CA  
2903 C  C   . ARG A 479 ? 2.8330 1.8400 1.5755 0.0864  -0.1002 -0.3888 479 ARG A C   
2904 O  O   . ARG A 479 ? 2.7912 1.8506 1.5286 0.1062  -0.0879 -0.3807 479 ARG A O   
2905 C  CB  . ARG A 479 ? 2.8833 1.7706 1.5840 0.1255  -0.0718 -0.4012 479 ARG A CB  
2906 C  CG  . ARG A 479 ? 3.0966 1.9050 1.7820 0.0908  -0.0998 -0.4193 479 ARG A CG  
2907 C  CD  . ARG A 479 ? 3.2893 1.9969 1.9135 0.1156  -0.0925 -0.4413 479 ARG A CD  
2908 N  NE  . ARG A 479 ? 3.4100 2.0469 2.0345 0.0786  -0.1170 -0.4510 479 ARG A NE  
2909 C  CZ  . ARG A 479 ? 3.5368 2.1509 2.1972 0.0712  -0.1094 -0.4341 479 ARG A CZ  
2910 N  NH1 . ARG A 479 ? 3.2847 1.9396 1.9814 0.1000  -0.0797 -0.4083 479 ARG A NH1 
2911 N  NH2 . ARG A 479 ? 3.4296 1.9787 2.0887 0.0344  -0.1322 -0.4422 479 ARG A NH2 
2912 N  N   . LYS A 480 ? 2.8519 1.8199 1.5801 0.0499  -0.1348 -0.4073 480 LYS A N   
2913 C  CA  . LYS A 480 ? 2.8781 1.8592 1.5802 0.0309  -0.1642 -0.4219 480 LYS A CA  
2914 C  C   . LYS A 480 ? 2.8403 1.9183 1.6041 0.0168  -0.1677 -0.3963 480 LYS A C   
2915 O  O   . LYS A 480 ? 2.8392 1.9461 1.5769 0.0225  -0.1764 -0.4003 480 LYS A O   
2916 C  CB  . LYS A 480 ? 2.9805 1.9007 1.6672 -0.0093 -0.2021 -0.4444 480 LYS A CB  
2917 C  CG  . LYS A 480 ? 3.1883 2.0976 1.8240 -0.0224 -0.2354 -0.4682 480 LYS A CG  
2918 C  CD  . LYS A 480 ? 3.3196 2.2067 1.9765 -0.0736 -0.2771 -0.4791 480 LYS A CD  
2919 C  CE  . LYS A 480 ? 3.4669 2.3597 2.0847 -0.0885 -0.3134 -0.4982 480 LYS A CE  
2920 N  NZ  . LYS A 480 ? 3.5032 2.4765 2.2390 -0.1392 -0.3330 -0.5077 480 LYS A NZ  
2921 N  N   . GLU A 481 ? 2.7261 1.8507 1.5677 -0.0005 -0.1609 -0.3702 481 GLU A N   
2922 C  CA  . GLU A 481 ? 2.6348 1.8479 1.5396 -0.0127 -0.1620 -0.3450 481 GLU A CA  
2923 C  C   . GLU A 481 ? 2.6522 1.9128 1.5471 0.0224  -0.1374 -0.3321 481 GLU A C   
2924 O  O   . GLU A 481 ? 2.6166 1.9258 1.5172 0.0189  -0.1472 -0.3258 481 GLU A O   
2925 C  CB  . GLU A 481 ? 2.5824 1.8255 1.5624 -0.0309 -0.1532 -0.3210 481 GLU A CB  
2926 C  CG  . GLU A 481 ? 2.7458 1.9633 1.7517 -0.0729 -0.1786 -0.3268 481 GLU A CG  
2927 C  CD  . GLU A 481 ? 3.0583 2.1903 2.0338 -0.0762 -0.1778 -0.3413 481 GLU A CD  
2928 O  OE1 . GLU A 481 ? 2.9308 1.9964 1.8391 -0.0688 -0.1891 -0.3688 481 GLU A OE1 
2929 O  OE2 . GLU A 481 ? 3.0202 2.1486 2.0364 -0.0863 -0.1664 -0.3252 481 GLU A OE2 
2930 N  N   . LEU A 482 ? 2.6204 1.8652 1.4996 0.0562  -0.1062 -0.3280 482 LEU A N   
2931 C  CA  . LEU A 482 ? 2.5896 1.8761 1.4606 0.0903  -0.0795 -0.3150 482 LEU A CA  
2932 C  C   . LEU A 482 ? 2.7234 1.9822 1.5164 0.1104  -0.0816 -0.3359 482 LEU A C   
2933 O  O   . LEU A 482 ? 2.6930 1.9965 1.4790 0.1277  -0.0690 -0.3245 482 LEU A O   
2934 C  CB  . LEU A 482 ? 2.5708 1.8530 1.4569 0.1186  -0.0471 -0.3030 482 LEU A CB  
2935 C  CG  . LEU A 482 ? 2.5622 1.8684 1.5174 0.1038  -0.0420 -0.2815 482 LEU A CG  
2936 C  CD1 . LEU A 482 ? 2.5779 1.8571 1.5311 0.1317  -0.0171 -0.2771 482 LEU A CD1 
2937 C  CD2 . LEU A 482 ? 2.4981 1.8853 1.5116 0.0968  -0.0373 -0.2549 482 LEU A CD2 
2938 N  N   . GLU A 483 ? 2.7845 1.9672 1.5165 0.1075  -0.0978 -0.3662 483 GLU A N   
2939 C  CA  . GLU A 483 ? 2.8757 2.0201 1.5226 0.1255  -0.1031 -0.3907 483 GLU A CA  
2940 C  C   . GLU A 483 ? 2.9316 2.1116 1.5738 0.1030  -0.1324 -0.3910 483 GLU A C   
2941 O  O   . GLU A 483 ? 2.9514 2.1471 1.5488 0.1229  -0.1263 -0.3921 483 GLU A O   
2942 C  CB  . GLU A 483 ? 3.0029 2.0499 1.5876 0.1245  -0.1167 -0.4244 483 GLU A CB  
2943 C  CG  . GLU A 483 ? 3.2399 2.2374 1.7265 0.1513  -0.1159 -0.4520 483 GLU A CG  
2944 C  CD  . GLU A 483 ? 3.5870 2.4914 2.0066 0.1370  -0.1460 -0.4895 483 GLU A CD  
2945 O  OE1 . GLU A 483 ? 3.4908 2.3922 1.9232 0.0963  -0.1850 -0.4972 483 GLU A OE1 
2946 O  OE2 . GLU A 483 ? 3.5777 2.4126 1.9297 0.1673  -0.1312 -0.5119 483 GLU A OE2 
2947 N  N   . LYS A 484 ? 2.8660 2.0609 1.5559 0.0626  -0.1633 -0.3884 484 LYS A N   
2948 C  CA  . LYS A 484 ? 2.8562 2.0893 1.5543 0.0385  -0.1950 -0.3868 484 LYS A CA  
2949 C  C   . LYS A 484 ? 2.8296 2.1457 1.5713 0.0484  -0.1796 -0.3561 484 LYS A C   
2950 O  O   . LYS A 484 ? 2.8354 2.1758 1.5513 0.0501  -0.1930 -0.3552 484 LYS A O   
2951 C  CB  . LYS A 484 ? 2.8732 2.1061 1.6232 -0.0061 -0.2275 -0.3889 484 LYS A CB  
2952 C  CG  . LYS A 484 ? 3.0501 2.3071 1.7985 -0.0324 -0.2678 -0.3950 484 LYS A CG  
2953 C  CD  . LYS A 484 ? 3.2845 2.4679 1.9620 -0.0458 -0.3009 -0.4305 484 LYS A CD  
2954 C  CE  . LYS A 484 ? 3.4470 2.6573 2.1183 -0.0687 -0.3429 -0.4364 484 LYS A CE  
2955 N  NZ  . LYS A 484 ? 3.5138 2.7676 2.2706 -0.1103 -0.3682 -0.4239 484 LYS A NZ  
2956 N  N   . GLN A 485 ? 2.7147 2.0703 1.5189 0.0550  -0.1526 -0.3311 485 GLN A N   
2957 C  CA  . GLN A 485 ? 2.6342 2.0630 1.4835 0.0636  -0.1366 -0.3016 485 GLN A CA  
2958 C  C   . GLN A 485 ? 2.7196 2.1577 1.5239 0.0995  -0.1094 -0.2960 485 GLN A C   
2959 O  O   . GLN A 485 ? 2.6754 2.1633 1.4915 0.1037  -0.1066 -0.2776 485 GLN A O   
2960 C  CB  . GLN A 485 ? 2.5658 2.0268 1.4910 0.0578  -0.1191 -0.2796 485 GLN A CB  
2961 C  CG  . GLN A 485 ? 2.6817 2.1722 1.6701 0.0228  -0.1421 -0.2713 485 GLN A CG  
2962 C  CD  . GLN A 485 ? 2.8313 2.3907 1.8625 0.0184  -0.1456 -0.2488 485 GLN A CD  
2963 O  OE1 . GLN A 485 ? 2.7339 2.3275 1.7749 0.0384  -0.1234 -0.2307 485 GLN A OE1 
2964 N  NE2 . GLN A 485 ? 2.6994 2.2813 1.7614 -0.0086 -0.1739 -0.2486 485 GLN A NE2 
2965 N  N   . ASP A 486 ? 2.7517 2.1424 1.5061 0.1259  -0.0883 -0.3104 486 ASP A N   
2966 C  CA  . ASP A 486 ? 2.7826 2.1808 1.4933 0.1621  -0.0584 -0.3057 486 ASP A CA  
2967 C  C   . ASP A 486 ? 2.9306 2.3095 1.5637 0.1688  -0.0726 -0.3215 486 ASP A C   
2968 O  O   . ASP A 486 ? 2.9146 2.3320 1.5349 0.1833  -0.0595 -0.3053 486 ASP A O   
2969 C  CB  . ASP A 486 ? 2.8442 2.2007 1.5322 0.1906  -0.0298 -0.3153 486 ASP A CB  
2970 C  CG  . ASP A 486 ? 2.9082 2.3026 1.6656 0.1987  -0.0036 -0.2908 486 ASP A CG  
2971 O  OD1 . ASP A 486 ? 2.8338 2.2753 1.6586 0.1767  -0.0114 -0.2704 486 ASP A OD1 
2972 O  OD2 . ASP A 486 ? 3.0152 2.3917 1.7583 0.2282  0.0240  -0.2924 486 ASP A OD2 
2973 N  N   . ALA A 487 ? 2.9862 2.3034 1.5657 0.1571  -0.1005 -0.3524 487 ALA A N   
2974 C  CA  . ALA A 487 ? 3.0788 2.3670 1.5755 0.1615  -0.1201 -0.3723 487 ALA A CA  
2975 C  C   . ALA A 487 ? 3.1100 2.4483 1.6274 0.1394  -0.1484 -0.3583 487 ALA A C   
2976 O  O   . ALA A 487 ? 3.1564 2.4951 1.6135 0.1512  -0.1540 -0.3612 487 ALA A O   
2977 C  CB  . ALA A 487 ? 3.1837 2.3911 1.6261 0.1499  -0.1469 -0.4094 487 ALA A CB  
2978 N  N   . GLU A 488 ? 2.9954 2.3752 1.5962 0.1097  -0.1650 -0.3424 488 GLU A N   
2979 C  CA  . GLU A 488 ? 2.9560 2.3876 1.5916 0.0887  -0.1918 -0.3269 488 GLU A CA  
2980 C  C   . GLU A 488 ? 2.9714 2.4538 1.6060 0.1099  -0.1698 -0.2997 488 GLU A C   
2981 O  O   . GLU A 488 ? 2.9940 2.4915 1.5978 0.1085  -0.1892 -0.2965 488 GLU A O   
2982 C  CB  . GLU A 488 ? 2.8903 2.3575 1.6208 0.0594  -0.2025 -0.3130 488 GLU A CB  
2983 C  CG  . GLU A 488 ? 3.0238 2.5309 1.7900 0.0324  -0.2393 -0.3060 488 GLU A CG  
2984 C  CD  . GLU A 488 ? 3.2636 2.8374 2.0702 0.0391  -0.2311 -0.2750 488 GLU A CD  
2985 O  OE1 . GLU A 488 ? 3.0687 2.6764 1.9347 0.0430  -0.2058 -0.2534 488 GLU A OE1 
2986 O  OE2 . GLU A 488 ? 3.2700 2.8594 2.0475 0.0399  -0.2518 -0.2723 488 GLU A OE2 
2987 N  N   . LEU A 489 ? 2.8707 2.3776 1.5378 0.1290  -0.1304 -0.2799 489 LEU A N   
2988 C  CA  . LEU A 489 ? 2.8276 2.3825 1.5035 0.1473  -0.1050 -0.2514 489 LEU A CA  
2989 C  C   . LEU A 489 ? 2.9555 2.4917 1.5442 0.1742  -0.0917 -0.2563 489 LEU A C   
2990 O  O   . LEU A 489 ? 2.9401 2.5131 1.5241 0.1821  -0.0838 -0.2339 489 LEU A O   
2991 C  CB  . LEU A 489 ? 2.7554 2.3376 1.4904 0.1579  -0.0692 -0.2316 489 LEU A CB  
2992 C  CG  . LEU A 489 ? 2.7359 2.3378 1.5536 0.1345  -0.0776 -0.2240 489 LEU A CG  
2993 C  CD1 . LEU A 489 ? 2.7035 2.3059 1.5540 0.1481  -0.0462 -0.2171 489 LEU A CD1 
2994 C  CD2 . LEU A 489 ? 2.6959 2.3536 1.5702 0.1190  -0.0889 -0.1993 489 LEU A CD2 
2995 N  N   . GLY A 490 ? 2.9911 2.4683 1.5097 0.1884  -0.0889 -0.2851 490 GLY A N   
2996 C  CA  . GLY A 490 ? 3.3615 2.8125 1.7871 0.2163  -0.0749 -0.2945 490 GLY A CA  
2997 C  C   . GLY A 490 ? 3.5560 3.0001 1.9246 0.2074  -0.1091 -0.3012 490 GLY A C   
2998 O  O   . GLY A 490 ? 2.9317 2.3848 1.3300 0.1784  -0.1485 -0.3041 490 GLY A O   
2999 NA NA  . NA  B .   ? 1.9404 1.4344 1.3401 -0.0146 0.0900  0.0673  601 NA  A NA  
3000 N  N   . ASP C .   ? 1.7440 1.2673 1.0615 0.1542  0.0339  0.1199  602 ASP A N   
3001 C  CA  . ASP C .   ? 1.7946 1.2955 1.1164 0.1355  0.0468  0.1104  602 ASP A CA  
3002 C  C   . ASP C .   ? 1.9273 1.4622 1.2799 0.1303  0.0464  0.0911  602 ASP A C   
3003 O  O   . ASP C .   ? 1.9434 1.4571 1.2993 0.1220  0.0525  0.0809  602 ASP A O   
3004 C  CB  . ASP C .   ? 1.8282 1.3206 1.1377 0.1113  0.0580  0.1159  602 ASP A CB  
3005 C  CG  . ASP C .   ? 2.0260 1.4830 1.3004 0.1153  0.0609  0.1366  602 ASP A CG  
3006 O  OD1 . ASP C .   ? 2.0810 1.4893 1.3392 0.1129  0.0673  0.1450  602 ASP A OD1 
3007 O  OD2 . ASP C .   ? 2.1226 1.5975 1.3829 0.1217  0.0554  0.1447  602 ASP A OD2 
3008 O  OXT . ASP C .   ? 2.1597 1.7399 1.5307 0.1336  0.0392  0.0864  602 ASP A OXT 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   THR 2   2   ?   ?   ?   A . n 
A 1 3   LYS 3   3   ?   ?   ?   A . n 
A 1 4   SER 4   4   ?   ?   ?   A . n 
A 1 5   ASN 5   5   ?   ?   ?   A . n 
A 1 6   GLY 6   6   ?   ?   ?   A . n 
A 1 7   GLU 7   7   ?   ?   ?   A . n 
A 1 8   GLU 8   8   ?   ?   ?   A . n 
A 1 9   PRO 9   9   ?   ?   ?   A . n 
A 1 10  LYS 10  10  ?   ?   ?   A . n 
A 1 11  MET 11  11  ?   ?   ?   A . n 
A 1 12  GLY 12  12  ?   ?   ?   A . n 
A 1 13  GLY 13  13  ?   ?   ?   A . n 
A 1 14  ARG 14  14  ?   ?   ?   A . n 
A 1 15  MET 15  15  ?   ?   ?   A . n 
A 1 16  GLU 16  16  ?   ?   ?   A . n 
A 1 17  ARG 17  17  ?   ?   ?   A . n 
A 1 18  PHE 18  18  ?   ?   ?   A . n 
A 1 19  GLN 19  19  ?   ?   ?   A . n 
A 1 20  GLN 20  20  ?   ?   ?   A . n 
A 1 21  GLY 21  21  ?   ?   ?   A . n 
A 1 22  VAL 22  22  ?   ?   ?   A . n 
A 1 23  SER 23  23  ?   ?   ?   A . n 
A 1 24  LYS 24  24  ?   ?   ?   A . n 
A 1 25  ARG 25  25  ?   ?   ?   A . n 
A 1 26  THR 26  26  ?   ?   ?   A . n 
A 1 27  LEU 27  27  ?   ?   ?   A . n 
A 1 28  LEU 28  28  ?   ?   ?   A . n 
A 1 29  ALA 29  29  ?   ?   ?   A . n 
A 1 30  LYS 30  30  ?   ?   ?   A . n 
A 1 31  LYS 31  31  ?   ?   ?   A . n 
A 1 32  LYS 32  32  ?   ?   ?   A . n 
A 1 33  VAL 33  33  ?   ?   ?   A . n 
A 1 34  GLN 34  34  ?   ?   ?   A . n 
A 1 35  ASN 35  35  ?   ?   ?   A . n 
A 1 36  ILE 36  36  ?   ?   ?   A . n 
A 1 37  THR 37  37  ?   ?   ?   A . n 
A 1 38  LYS 38  38  ?   ?   ?   A . n 
A 1 39  GLU 39  39  39  GLU GLU A . n 
A 1 40  ASP 40  40  40  ASP ASP A . n 
A 1 41  VAL 41  41  41  VAL VAL A . n 
A 1 42  LYS 42  42  42  LYS LYS A . n 
A 1 43  SER 43  43  43  SER SER A . n 
A 1 44  PHE 44  44  44  PHE PHE A . n 
A 1 45  LEU 45  45  45  LEU LEU A . n 
A 1 46  ARG 46  46  46  ARG ARG A . n 
A 1 47  ARG 47  47  47  ARG ARG A . n 
A 1 48  ASN 48  48  48  ASN ASN A . n 
A 1 49  ALA 49  49  49  ALA ALA A . n 
A 1 50  LEU 50  50  50  LEU LEU A . n 
A 1 51  LEU 51  51  51  LEU LEU A . n 
A 1 52  LEU 52  52  52  LEU LEU A . n 
A 1 53  LEU 53  53  53  LEU LEU A . n 
A 1 54  THR 54  54  54  THR THR A . n 
A 1 55  VAL 55  55  55  VAL VAL A . n 
A 1 56  LEU 56  56  56  LEU LEU A . n 
A 1 57  ALA 57  57  57  ALA ALA A . n 
A 1 58  VAL 58  58  58  VAL VAL A . n 
A 1 59  ILE 59  59  59  ILE ILE A . n 
A 1 60  LEU 60  60  60  LEU LEU A . n 
A 1 61  GLY 61  61  61  GLY GLY A . n 
A 1 62  VAL 62  62  62  VAL VAL A . n 
A 1 63  VAL 63  63  63  VAL VAL A . n 
A 1 64  LEU 64  64  64  LEU LEU A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  PHE 66  66  66  PHE PHE A . n 
A 1 67  LEU 67  67  67  LEU LEU A . n 
A 1 68  LEU 68  68  68  LEU LEU A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  PRO 70  70  70  PRO PRO A . n 
A 1 71  TYR 71  71  71  TYR TYR A . n 
A 1 72  PRO 72  72  72  PRO PRO A . n 
A 1 73  LEU 73  73  73  LEU LEU A . n 
A 1 74  SER 74  74  74  SER SER A . n 
A 1 75  PRO 75  75  75  PRO PRO A . n 
A 1 76  ARG 76  76  76  ARG ARG A . n 
A 1 77  GLU 77  77  77  GLU GLU A . n 
A 1 78  VAL 78  78  78  VAL VAL A . n 
A 1 79  LYS 79  79  79  LYS LYS A . n 
A 1 80  TYR 80  80  80  TYR TYR A . n 
A 1 81  PHE 81  81  81  PHE PHE A . n 
A 1 82  ALA 82  82  82  ALA ALA A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  PRO 84  84  84  PRO PRO A . n 
A 1 85  GLY 85  85  85  GLY GLY A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  LEU 87  87  87  LEU LEU A . n 
A 1 88  LEU 88  88  88  LEU LEU A . n 
A 1 89  MET 89  89  89  MET MET A . n 
A 1 90  ARG 90  90  90  ARG ARG A . n 
A 1 91  MET 91  91  91  MET MET A . n 
A 1 92  LEU 92  92  92  LEU LEU A . n 
A 1 93  LYS 93  93  93  LYS LYS A . n 
A 1 94  MET 94  94  94  MET MET A . n 
A 1 95  LEU 95  95  95  LEU LEU A . n 
A 1 96  ILE 96  96  96  ILE ILE A . n 
A 1 97  LEU 97  97  97  LEU LEU A . n 
A 1 98  PRO 98  98  98  PRO PRO A . n 
A 1 99  LEU 99  99  99  LEU LEU A . n 
A 1 100 ILE 100 100 100 ILE ILE A . n 
A 1 101 VAL 101 101 101 VAL VAL A . n 
A 1 102 SER 102 102 102 SER SER A . n 
A 1 103 SER 103 103 103 SER SER A . n 
A 1 104 LEU 104 104 104 LEU LEU A . n 
A 1 105 ILE 105 105 105 ILE ILE A . n 
A 1 106 THR 106 106 106 THR THR A . n 
A 1 107 GLY 107 107 107 GLY GLY A . n 
A 1 108 LEU 108 108 108 LEU LEU A . n 
A 1 109 ALA 109 109 109 ALA ALA A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 LEU 111 111 111 LEU LEU A . n 
A 1 112 ASP 112 112 112 ASP ASP A . n 
A 1 113 ALA 113 113 113 ALA ALA A . n 
A 1 114 LYS 114 114 114 LYS LYS A . n 
A 1 115 ALA 115 115 115 ALA ALA A . n 
A 1 116 SER 116 116 116 SER SER A . n 
A 1 117 GLY 117 117 117 GLY GLY A . n 
A 1 118 ARG 118 118 118 ARG ARG A . n 
A 1 119 LEU 119 119 119 LEU LEU A . n 
A 1 120 GLY 120 120 120 GLY GLY A . n 
A 1 121 MET 121 121 121 MET MET A . n 
A 1 122 ARG 122 122 122 ARG ARG A . n 
A 1 123 ALA 123 123 123 ALA ALA A . n 
A 1 124 VAL 124 124 124 VAL VAL A . n 
A 1 125 VAL 125 125 125 VAL VAL A . n 
A 1 126 TYR 126 126 126 TYR TYR A . n 
A 1 127 TYR 127 127 127 TYR TYR A . n 
A 1 128 MET 128 128 128 MET MET A . n 
A 1 129 SER 129 129 129 SER SER A . n 
A 1 130 THR 130 130 130 THR THR A . n 
A 1 131 THR 131 131 131 THR THR A . n 
A 1 132 ILE 132 132 132 ILE ILE A . n 
A 1 133 ILE 133 133 133 ILE ILE A . n 
A 1 134 ALA 134 134 134 ALA ALA A . n 
A 1 135 VAL 135 135 135 VAL VAL A . n 
A 1 136 VAL 136 136 136 VAL VAL A . n 
A 1 137 LEU 137 137 137 LEU LEU A . n 
A 1 138 GLY 138 138 138 GLY GLY A . n 
A 1 139 ILE 139 139 139 ILE ILE A . n 
A 1 140 ILE 140 140 140 ILE ILE A . n 
A 1 141 LEU 141 141 141 LEU LEU A . n 
A 1 142 VAL 142 142 142 VAL VAL A . n 
A 1 143 LEU 143 143 143 LEU LEU A . n 
A 1 144 ILE 144 144 144 ILE ILE A . n 
A 1 145 ILE 145 145 145 ILE ILE A . n 
A 1 146 HIS 146 146 ?   ?   ?   A . n 
A 1 147 PRO 147 147 ?   ?   ?   A . n 
A 1 148 GLY 148 148 ?   ?   ?   A . n 
A 1 149 ALA 149 149 ?   ?   ?   A . n 
A 1 150 ALA 150 150 ?   ?   ?   A . n 
A 1 151 SER 151 151 ?   ?   ?   A . n 
A 1 152 ALA 152 152 ?   ?   ?   A . n 
A 1 153 ALA 153 153 ?   ?   ?   A . n 
A 1 154 ILE 154 154 ?   ?   ?   A . n 
A 1 155 THR 155 155 ?   ?   ?   A . n 
A 1 156 ALA 156 156 ?   ?   ?   A . n 
A 1 157 SER 157 157 ?   ?   ?   A . n 
A 1 158 VAL 158 158 ?   ?   ?   A . n 
A 1 159 GLY 159 159 ?   ?   ?   A . n 
A 1 160 ALA 160 160 ?   ?   ?   A . n 
A 1 161 ALA 161 161 ?   ?   ?   A . n 
A 1 162 GLY 162 162 ?   ?   ?   A . n 
A 1 163 SER 163 163 ?   ?   ?   A . n 
A 1 164 ALA 164 164 ?   ?   ?   A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
A 1 166 ASN 166 166 ?   ?   ?   A . n 
A 1 167 ALA 167 167 ?   ?   ?   A . n 
A 1 168 PRO 168 168 ?   ?   ?   A . n 
A 1 169 SER 169 169 ?   ?   ?   A . n 
A 1 170 LYS 170 170 ?   ?   ?   A . n 
A 1 171 GLU 171 171 171 GLU GLU A . n 
A 1 172 VAL 172 172 172 VAL VAL A . n 
A 1 173 LEU 173 173 173 LEU LEU A . n 
A 1 174 ASP 174 174 174 ASP ASP A . n 
A 1 175 CYS 175 175 175 CYS CYS A . n 
A 1 176 PHE 176 176 176 PHE PHE A . n 
A 1 177 LEU 177 177 177 LEU LEU A . n 
A 1 178 ASP 178 178 178 ASP ASP A . n 
A 1 179 LEU 179 179 179 LEU LEU A . n 
A 1 180 ALA 180 180 180 ALA ALA A . n 
A 1 181 ARG 181 181 181 ARG ARG A . n 
A 1 182 ASN 182 182 182 ASN ASN A . n 
A 1 183 ILE 183 183 183 ILE ILE A . n 
A 1 184 PHE 184 184 184 PHE PHE A . n 
A 1 185 PRO 185 185 185 PRO PRO A . n 
A 1 186 SER 186 186 186 SER SER A . n 
A 1 187 ASN 187 187 187 ASN ASN A . n 
A 1 188 LEU 188 188 188 LEU LEU A . n 
A 1 189 VAL 189 189 189 VAL VAL A . n 
A 1 190 SER 190 190 190 SER SER A . n 
A 1 191 ALA 191 191 191 ALA ALA A . n 
A 1 192 ALA 192 192 192 ALA ALA A . n 
A 1 193 PHE 193 193 193 PHE PHE A . n 
A 1 194 ARG 194 194 194 ARG ARG A . n 
A 1 195 SER 195 195 195 SER SER A . n 
A 1 196 TYR 196 196 196 TYR TYR A . n 
A 1 197 SER 197 197 197 SER SER A . n 
A 1 198 THR 198 198 198 THR THR A . n 
A 1 199 THR 199 199 199 THR THR A . n 
A 1 200 TYR 200 200 ?   ?   ?   A . n 
A 1 201 GLU 201 201 ?   ?   ?   A . n 
A 1 202 GLU 202 202 ?   ?   ?   A . n 
A 1 203 ARG 203 203 ?   ?   ?   A . n 
A 1 204 THR 204 204 ?   ?   ?   A . n 
A 1 205 ILE 205 205 ?   ?   ?   A . n 
A 1 206 THR 206 206 ?   ?   ?   A . n 
A 1 207 GLY 207 207 ?   ?   ?   A . n 
A 1 208 THR 208 208 ?   ?   ?   A . n 
A 1 209 ARG 209 209 ?   ?   ?   A . n 
A 1 210 VAL 210 210 ?   ?   ?   A . n 
A 1 211 LYS 211 211 ?   ?   ?   A . n 
A 1 212 VAL 212 212 ?   ?   ?   A . n 
A 1 213 PRO 213 213 ?   ?   ?   A . n 
A 1 214 VAL 214 214 ?   ?   ?   A . n 
A 1 215 GLY 215 215 ?   ?   ?   A . n 
A 1 216 GLN 216 216 216 GLN GLN A . n 
A 1 217 GLU 217 217 217 GLU GLU A . n 
A 1 218 VAL 218 218 218 VAL VAL A . n 
A 1 219 GLU 219 219 219 GLU GLU A . n 
A 1 220 GLY 220 220 220 GLY GLY A . n 
A 1 221 MET 221 221 221 MET MET A . n 
A 1 222 ASN 222 222 222 ASN ASN A . n 
A 1 223 ILE 223 223 223 ILE ILE A . n 
A 1 224 LEU 224 224 224 LEU LEU A . n 
A 1 225 GLY 225 225 225 GLY GLY A . n 
A 1 226 LEU 226 226 226 LEU LEU A . n 
A 1 227 VAL 227 227 227 VAL VAL A . n 
A 1 228 VAL 228 228 228 VAL VAL A . n 
A 1 229 PHE 229 229 229 PHE PHE A . n 
A 1 230 SER 230 230 230 SER SER A . n 
A 1 231 ILE 231 231 231 ILE ILE A . n 
A 1 232 VAL 232 232 232 VAL VAL A . n 
A 1 233 PHE 233 233 233 PHE PHE A . n 
A 1 234 GLY 234 234 234 GLY GLY A . n 
A 1 235 ILE 235 235 235 ILE ILE A . n 
A 1 236 ALA 236 236 236 ALA ALA A . n 
A 1 237 LEU 237 237 237 LEU LEU A . n 
A 1 238 GLY 238 238 238 GLY GLY A . n 
A 1 239 LYS 239 239 239 LYS LYS A . n 
A 1 240 MET 240 240 240 MET MET A . n 
A 1 241 GLY 241 241 241 GLY GLY A . n 
A 1 242 GLU 242 242 242 GLU GLU A . n 
A 1 243 GLN 243 243 243 GLN GLN A . n 
A 1 244 GLY 244 244 244 GLY GLY A . n 
A 1 245 GLN 245 245 245 GLN GLN A . n 
A 1 246 LEU 246 246 246 LEU LEU A . n 
A 1 247 LEU 247 247 247 LEU LEU A . n 
A 1 248 VAL 248 248 248 VAL VAL A . n 
A 1 249 ASP 249 249 249 ASP ASP A . n 
A 1 250 PHE 250 250 250 PHE PHE A . n 
A 1 251 PHE 251 251 251 PHE PHE A . n 
A 1 252 ASN 252 252 252 ASN ASN A . n 
A 1 253 SER 253 253 253 SER SER A . n 
A 1 254 LEU 254 254 254 LEU LEU A . n 
A 1 255 ASN 255 255 255 ASN ASN A . n 
A 1 256 GLU 256 256 256 GLU GLU A . n 
A 1 257 ALA 257 257 257 ALA ALA A . n 
A 1 258 THR 258 258 258 THR THR A . n 
A 1 259 MET 259 259 259 MET MET A . n 
A 1 260 LYS 260 260 260 LYS LYS A . n 
A 1 261 LEU 261 261 261 LEU LEU A . n 
A 1 262 VAL 262 262 262 VAL VAL A . n 
A 1 263 ALA 263 263 263 ALA ALA A . n 
A 1 264 ILE 264 264 264 ILE ILE A . n 
A 1 265 ILE 265 265 265 ILE ILE A . n 
A 1 266 MET 266 266 266 MET MET A . n 
A 1 267 TRP 267 267 267 TRP TRP A . n 
A 1 268 TYR 268 268 268 TYR TYR A . n 
A 1 269 ALA 269 269 269 ALA ALA A . n 
A 1 270 PRO 270 270 270 PRO PRO A . n 
A 1 271 LEU 271 271 271 LEU LEU A . n 
A 1 272 GLY 272 272 272 GLY GLY A . n 
A 1 273 ILE 273 273 273 ILE ILE A . n 
A 1 274 LEU 274 274 274 LEU LEU A . n 
A 1 275 PHE 275 275 275 PHE PHE A . n 
A 1 276 LEU 276 276 276 LEU LEU A . n 
A 1 277 ILE 277 277 277 ILE ILE A . n 
A 1 278 ALA 278 278 278 ALA ALA A . n 
A 1 279 GLY 279 279 279 GLY GLY A . n 
A 1 280 LYS 280 280 280 LYS LYS A . n 
A 1 281 ILE 281 281 281 ILE ILE A . n 
A 1 282 VAL 282 282 282 VAL VAL A . n 
A 1 283 GLU 283 283 283 GLU GLU A . n 
A 1 284 MET 284 284 ?   ?   ?   A . n 
A 1 285 GLU 285 285 ?   ?   ?   A . n 
A 1 286 ASP 286 286 ?   ?   ?   A . n 
A 1 287 LEU 287 287 ?   ?   ?   A . n 
A 1 288 GLU 288 288 ?   ?   ?   A . n 
A 1 289 VAL 289 289 ?   ?   ?   A . n 
A 1 290 LEU 290 290 ?   ?   ?   A . n 
A 1 291 GLY 291 291 ?   ?   ?   A . n 
A 1 292 GLY 292 292 ?   ?   ?   A . n 
A 1 293 GLN 293 293 ?   ?   ?   A . n 
A 1 294 LEU 294 294 294 LEU LEU A . n 
A 1 295 GLY 295 295 295 GLY GLY A . n 
A 1 296 MET 296 296 296 MET MET A . n 
A 1 297 TYR 297 297 297 TYR TYR A . n 
A 1 298 MET 298 298 298 MET MET A . n 
A 1 299 VAL 299 299 299 VAL VAL A . n 
A 1 300 THR 300 300 300 THR THR A . n 
A 1 301 VAL 301 301 301 VAL VAL A . n 
A 1 302 ILE 302 302 302 ILE ILE A . n 
A 1 303 VAL 303 303 303 VAL VAL A . n 
A 1 304 GLY 304 304 304 GLY GLY A . n 
A 1 305 LEU 305 305 305 LEU LEU A . n 
A 1 306 VAL 306 306 306 VAL VAL A . n 
A 1 307 ILE 307 307 307 ILE ILE A . n 
A 1 308 HIS 308 308 308 HIS HIS A . n 
A 1 309 GLY 309 309 309 GLY GLY A . n 
A 1 310 LEU 310 310 310 LEU LEU A . n 
A 1 311 ILE 311 311 311 ILE ILE A . n 
A 1 312 VAL 312 312 312 VAL VAL A . n 
A 1 313 LEU 313 313 313 LEU LEU A . n 
A 1 314 PRO 314 314 314 PRO PRO A . n 
A 1 315 LEU 315 315 315 LEU LEU A . n 
A 1 316 ILE 316 316 316 ILE ILE A . n 
A 1 317 TYR 317 317 317 TYR TYR A . n 
A 1 318 PHE 318 318 318 PHE PHE A . n 
A 1 319 LEU 319 319 319 LEU LEU A . n 
A 1 320 ILE 320 320 320 ILE ILE A . n 
A 1 321 THR 321 321 321 THR THR A . n 
A 1 322 ARG 322 322 322 ARG ARG A . n 
A 1 323 LYS 323 323 323 LYS LYS A . n 
A 1 324 ASN 324 324 324 ASN ASN A . n 
A 1 325 PRO 325 325 325 PRO PRO A . n 
A 1 326 PHE 326 326 326 PHE PHE A . n 
A 1 327 VAL 327 327 327 VAL VAL A . n 
A 1 328 PHE 328 328 328 PHE PHE A . n 
A 1 329 ILE 329 329 329 ILE ILE A . n 
A 1 330 ALA 330 330 330 ALA ALA A . n 
A 1 331 GLY 331 331 331 GLY GLY A . n 
A 1 332 ILE 332 332 332 ILE ILE A . n 
A 1 333 LEU 333 333 333 LEU LEU A . n 
A 1 334 GLN 334 334 334 GLN GLN A . n 
A 1 335 ALA 335 335 335 ALA ALA A . n 
A 1 336 LEU 336 336 336 LEU LEU A . n 
A 1 337 ILE 337 337 337 ILE ILE A . n 
A 1 338 THR 338 338 338 THR THR A . n 
A 1 339 ALA 339 339 339 ALA ALA A . n 
A 1 340 LEU 340 340 340 LEU LEU A . n 
A 1 341 GLY 341 341 341 GLY GLY A . n 
A 1 342 THR 342 342 342 THR THR A . n 
A 1 343 SER 343 343 343 SER SER A . n 
A 1 344 SER 344 344 344 SER SER A . n 
A 1 345 SER 345 345 345 SER SER A . n 
A 1 346 SER 346 346 346 SER SER A . n 
A 1 347 ALA 347 347 347 ALA ALA A . n 
A 1 348 THR 348 348 348 THR THR A . n 
A 1 349 LEU 349 349 349 LEU LEU A . n 
A 1 350 PRO 350 350 350 PRO PRO A . n 
A 1 351 ILE 351 351 351 ILE ILE A . n 
A 1 352 THR 352 352 352 THR THR A . n 
A 1 353 PHE 353 353 353 PHE PHE A . n 
A 1 354 LYS 354 354 354 LYS LYS A . n 
A 1 355 CYS 355 355 355 CYS CYS A . n 
A 1 356 LEU 356 356 356 LEU LEU A . n 
A 1 357 GLU 357 357 357 GLU GLU A . n 
A 1 358 GLU 358 358 358 GLU GLU A . n 
A 1 359 ASN 359 359 359 ASN ASN A . n 
A 1 360 ASN 360 360 360 ASN ASN A . n 
A 1 361 GLY 361 361 361 GLY GLY A . n 
A 1 362 VAL 362 362 362 VAL VAL A . n 
A 1 363 ASP 363 363 363 ASP ASP A . n 
A 1 364 LYS 364 364 364 LYS LYS A . n 
A 1 365 ARG 365 365 365 ARG ARG A . n 
A 1 366 ILE 366 366 366 ILE ILE A . n 
A 1 367 THR 367 367 367 THR THR A . n 
A 1 368 ARG 368 368 368 ARG ARG A . n 
A 1 369 PHE 369 369 369 PHE PHE A . n 
A 1 370 VAL 370 370 370 VAL VAL A . n 
A 1 371 LEU 371 371 371 LEU LEU A . n 
A 1 372 PRO 372 372 372 PRO PRO A . n 
A 1 373 VAL 373 373 373 VAL VAL A . n 
A 1 374 GLY 374 374 374 GLY GLY A . n 
A 1 375 ALA 375 375 375 ALA ALA A . n 
A 1 376 THR 376 376 376 THR THR A . n 
A 1 377 ILE 377 377 377 ILE ILE A . n 
A 1 378 ASN 378 378 378 ASN ASN A . n 
A 1 379 MET 379 379 379 MET MET A . n 
A 1 380 ASP 380 380 380 ASP ASP A . n 
A 1 381 GLY 381 381 381 GLY GLY A . n 
A 1 382 THR 382 382 382 THR THR A . n 
A 1 383 ALA 383 383 383 ALA ALA A . n 
A 1 384 LEU 384 384 384 LEU LEU A . n 
A 1 385 TYR 385 385 385 TYR TYR A . n 
A 1 386 GLU 386 386 386 GLU GLU A . n 
A 1 387 ALA 387 387 387 ALA ALA A . n 
A 1 388 VAL 388 388 388 VAL VAL A . n 
A 1 389 ALA 389 389 389 ALA ALA A . n 
A 1 390 ALA 390 390 390 ALA ALA A . n 
A 1 391 ILE 391 391 391 ILE ILE A . n 
A 1 392 PHE 392 392 392 PHE PHE A . n 
A 1 393 ILE 393 393 393 ILE ILE A . n 
A 1 394 ALA 394 394 394 ALA ALA A . n 
A 1 395 GLN 395 395 395 GLN GLN A . n 
A 1 396 VAL 396 396 396 VAL VAL A . n 
A 1 397 ASN 397 397 397 ASN ASN A . n 
A 1 398 ASN 398 398 398 ASN ASN A . n 
A 1 399 TYR 399 399 ?   ?   ?   A . n 
A 1 400 GLU 400 400 ?   ?   ?   A . n 
A 1 401 LEU 401 401 ?   ?   ?   A . n 
A 1 402 ASP 402 402 ?   ?   ?   A . n 
A 1 403 PHE 403 403 ?   ?   ?   A . n 
A 1 404 GLY 404 404 404 GLY GLY A . n 
A 1 405 GLN 405 405 405 GLN GLN A . n 
A 1 406 ILE 406 406 406 ILE ILE A . n 
A 1 407 ILE 407 407 407 ILE ILE A . n 
A 1 408 THR 408 408 408 THR THR A . n 
A 1 409 ILE 409 409 409 ILE ILE A . n 
A 1 410 SER 410 410 410 SER SER A . n 
A 1 411 ILE 411 411 411 ILE ILE A . n 
A 1 412 THR 412 412 412 THR THR A . n 
A 1 413 ALA 413 413 413 ALA ALA A . n 
A 1 414 THR 414 414 414 THR THR A . n 
A 1 415 ALA 415 415 415 ALA ALA A . n 
A 1 416 ALA 416 416 416 ALA ALA A . n 
A 1 417 SER 417 417 417 SER SER A . n 
A 1 418 ILE 418 418 418 ILE ILE A . n 
A 1 419 GLY 419 419 419 GLY GLY A . n 
A 1 420 ALA 420 420 420 ALA ALA A . n 
A 1 421 ALA 421 421 421 ALA ALA A . n 
A 1 422 GLY 422 422 422 GLY GLY A . n 
A 1 423 ILE 423 423 423 ILE ILE A . n 
A 1 424 PRO 424 424 424 PRO PRO A . n 
A 1 425 GLN 425 425 425 GLN GLN A . n 
A 1 426 ALA 426 426 426 ALA ALA A . n 
A 1 427 GLY 427 427 427 GLY GLY A . n 
A 1 428 LEU 428 428 428 LEU LEU A . n 
A 1 429 VAL 429 429 429 VAL VAL A . n 
A 1 430 THR 430 430 430 THR THR A . n 
A 1 431 MET 431 431 431 MET MET A . n 
A 1 432 VAL 432 432 432 VAL VAL A . n 
A 1 433 ILE 433 433 433 ILE ILE A . n 
A 1 434 VAL 434 434 434 VAL VAL A . n 
A 1 435 LEU 435 435 435 LEU LEU A . n 
A 1 436 THR 436 436 436 THR THR A . n 
A 1 437 ALA 437 437 437 ALA ALA A . n 
A 1 438 VAL 438 438 438 VAL VAL A . n 
A 1 439 GLY 439 439 439 GLY GLY A . n 
A 1 440 LEU 440 440 440 LEU LEU A . n 
A 1 441 PRO 441 441 441 PRO PRO A . n 
A 1 442 THR 442 442 442 THR THR A . n 
A 1 443 ASP 443 443 443 ASP ASP A . n 
A 1 444 ASP 444 444 444 ASP ASP A . n 
A 1 445 ILE 445 445 445 ILE ILE A . n 
A 1 446 THR 446 446 446 THR THR A . n 
A 1 447 LEU 447 447 447 LEU LEU A . n 
A 1 448 ILE 448 448 448 ILE ILE A . n 
A 1 449 ILE 449 449 449 ILE ILE A . n 
A 1 450 ALA 450 450 450 ALA ALA A . n 
A 1 451 VAL 451 451 451 VAL VAL A . n 
A 1 452 ASP 452 452 452 ASP ASP A . n 
A 1 453 TRP 453 453 453 TRP TRP A . n 
A 1 454 LEU 454 454 454 LEU LEU A . n 
A 1 455 LEU 455 455 455 LEU LEU A . n 
A 1 456 ASP 456 456 456 ASP ASP A . n 
A 1 457 ARG 457 457 457 ARG ARG A . n 
A 1 458 PHE 458 458 458 PHE PHE A . n 
A 1 459 ARG 459 459 459 ARG ARG A . n 
A 1 460 THR 460 460 460 THR THR A . n 
A 1 461 MET 461 461 461 MET MET A . n 
A 1 462 VAL 462 462 462 VAL VAL A . n 
A 1 463 ASN 463 463 463 ASN ASN A . n 
A 1 464 VAL 464 464 464 VAL VAL A . n 
A 1 465 LEU 465 465 465 LEU LEU A . n 
A 1 466 GLY 466 466 466 GLY GLY A . n 
A 1 467 ASP 467 467 467 ASP ASP A . n 
A 1 468 ALA 468 468 468 ALA ALA A . n 
A 1 469 LEU 469 469 469 LEU LEU A . n 
A 1 470 GLY 470 470 470 GLY GLY A . n 
A 1 471 ALA 471 471 471 ALA ALA A . n 
A 1 472 GLY 472 472 472 GLY GLY A . n 
A 1 473 ILE 473 473 473 ILE ILE A . n 
A 1 474 VAL 474 474 474 VAL VAL A . n 
A 1 475 GLU 475 475 475 GLU GLU A . n 
A 1 476 HIS 476 476 476 HIS HIS A . n 
A 1 477 LEU 477 477 477 LEU LEU A . n 
A 1 478 SER 478 478 478 SER SER A . n 
A 1 479 ARG 479 479 479 ARG ARG A . n 
A 1 480 LYS 480 480 480 LYS LYS A . n 
A 1 481 GLU 481 481 481 GLU GLU A . n 
A 1 482 LEU 482 482 482 LEU LEU A . n 
A 1 483 GLU 483 483 483 GLU GLU A . n 
A 1 484 LYS 484 484 484 LYS LYS A . n 
A 1 485 GLN 485 485 485 GLN GLN A . n 
A 1 486 ASP 486 486 486 ASP ASP A . n 
A 1 487 ALA 487 487 487 ALA ALA A . n 
A 1 488 GLU 488 488 488 GLU GLU A . n 
A 1 489 LEU 489 489 489 LEU LEU A . n 
A 1 490 GLY 490 490 490 GLY GLY A . n 
A 1 491 ASN 491 491 ?   ?   ?   A . n 
A 1 492 SER 492 492 ?   ?   ?   A . n 
A 1 493 VAL 493 493 ?   ?   ?   A . n 
A 1 494 ILE 494 494 ?   ?   ?   A . n 
A 1 495 GLU 495 495 ?   ?   ?   A . n 
A 1 496 GLU 496 496 ?   ?   ?   A . n 
A 1 497 ASN 497 497 ?   ?   ?   A . n 
A 1 498 GLU 498 498 ?   ?   ?   A . n 
A 1 499 MET 499 499 ?   ?   ?   A . n 
A 1 500 LYS 500 500 ?   ?   ?   A . n 
A 1 501 LYS 501 501 ?   ?   ?   A . n 
A 1 502 PRO 502 502 ?   ?   ?   A . n 
A 1 503 TYR 503 503 ?   ?   ?   A . n 
A 1 504 GLN 504 504 ?   ?   ?   A . n 
A 1 505 LEU 505 505 ?   ?   ?   A . n 
A 1 506 ILE 506 506 ?   ?   ?   A . n 
A 1 507 ALA 507 507 ?   ?   ?   A . n 
A 1 508 GLN 508 508 ?   ?   ?   A . n 
A 1 509 ASP 509 509 ?   ?   ?   A . n 
A 1 510 ASN 510 510 ?   ?   ?   A . n 
A 1 511 GLU 511 511 ?   ?   ?   A . n 
A 1 512 THR 512 512 ?   ?   ?   A . n 
A 1 513 GLU 513 513 ?   ?   ?   A . n 
A 1 514 LYS 514 514 ?   ?   ?   A . n 
A 1 515 PRO 515 515 ?   ?   ?   A . n 
A 1 516 ILE 516 516 ?   ?   ?   A . n 
A 1 517 ASP 517 517 ?   ?   ?   A . n 
A 1 518 SER 518 518 ?   ?   ?   A . n 
A 1 519 GLU 519 519 ?   ?   ?   A . n 
A 1 520 THR 520 520 ?   ?   ?   A . n 
A 1 521 LYS 521 521 ?   ?   ?   A . n 
A 1 522 MET 522 522 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 NA  1 601 501 NA  NA  A . 
C 3 ASP 1 602 502 ASP ASP A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8070  ? 
1 MORE         -61   ? 
1 'SSA (A^2)'  47950 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z        1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000   0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_665 -y+1,x-y+1,z -0.5000000000 -0.8660254038 0.0000000000 61.6600000000  0.8660254038  
-0.5000000000 0.0000000000 106.7982527947 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -x+y,-x+1,z  -0.5000000000 0.8660254038  0.0000000000 -61.6600000000 -0.8660254038 
-0.5000000000 0.0000000000 106.7982527947 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 O ? A THR 376 ? A THR 376 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A SER 417 ? A SER 417 ? 1_555 153.7 ? 
2 O ? A THR 376 ? A THR 376 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A ILE 418 ? A ILE 418 ? 1_555 73.7  ? 
3 O ? A SER 417 ? A SER 417 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A ILE 418 ? A ILE 418 ? 1_555 85.1  ? 
4 O ? A THR 376 ? A THR 376 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A ALA 420 ? A ALA 420 ? 1_555 79.8  ? 
5 O ? A SER 417 ? A SER 417 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A ALA 420 ? A ALA 420 ? 1_555 110.2 ? 
6 O ? A ILE 418 ? A ILE 418 ? 1_555 NA ? B NA . ? A NA 601 ? 1_555 O ? A ALA 420 ? A ALA 420 ? 1_555 75.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-04-19 
2 'Structure model' 1 1 2017-05-03 
3 'Structure model' 1 2 2017-05-10 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
# 
_pdbx_refine_tls.pdbx_refine_id   'X-RAY DIFFRACTION' 
_pdbx_refine_tls.id               1 
_pdbx_refine_tls.details          ? 
_pdbx_refine_tls.method           refined 
_pdbx_refine_tls.origin_x         7.7803 
_pdbx_refine_tls.origin_y         47.6181 
_pdbx_refine_tls.origin_z         0.0854 
_pdbx_refine_tls.T[1][1]          0.1572 
_pdbx_refine_tls.T[2][2]          -0.2820 
_pdbx_refine_tls.T[3][3]          -0.4424 
_pdbx_refine_tls.T[1][2]          0.1343 
_pdbx_refine_tls.T[1][3]          0.0509 
_pdbx_refine_tls.T[2][3]          0.0347 
_pdbx_refine_tls.L[1][1]          2.2983 
_pdbx_refine_tls.L[2][2]          3.3609 
_pdbx_refine_tls.L[3][3]          3.3898 
_pdbx_refine_tls.L[1][2]          -0.5526 
_pdbx_refine_tls.L[1][3]          0.3356 
_pdbx_refine_tls.L[2][3]          -0.7569 
_pdbx_refine_tls.S[1][1]          -0.0298 
_pdbx_refine_tls.S[1][2]          -0.0387 
_pdbx_refine_tls.S[1][3]          -0.6500 
_pdbx_refine_tls.S[2][1]          0.1213 
_pdbx_refine_tls.S[2][2]          -0.0861 
_pdbx_refine_tls.S[2][3]          -0.0701 
_pdbx_refine_tls.S[3][1]          1.1128 
_pdbx_refine_tls.S[3][2]          0.2496 
_pdbx_refine_tls.S[3][3]          0.1159 
# 
_pdbx_refine_tls_group.pdbx_refine_id      'X-RAY DIFFRACTION' 
_pdbx_refine_tls_group.id                  1 
_pdbx_refine_tls_group.refine_tls_id       1 
_pdbx_refine_tls_group.beg_auth_asym_id    ? 
_pdbx_refine_tls_group.beg_auth_seq_id     ? 
_pdbx_refine_tls_group.beg_label_asym_id   ? 
_pdbx_refine_tls_group.beg_label_seq_id    ? 
_pdbx_refine_tls_group.end_auth_asym_id    ? 
_pdbx_refine_tls_group.end_auth_seq_id     ? 
_pdbx_refine_tls_group.end_label_asym_id   ? 
_pdbx_refine_tls_group.end_label_seq_id    ? 
_pdbx_refine_tls_group.selection           ? 
_pdbx_refine_tls_group.selection_details   '{ *|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER ? ? ? 2.10.2                                1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? 'VERSION May 1, 2016  BUILT=20160517' 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? 'VERSION May 1, 2016  BUILT=20160517' 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.1                                 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ASN A 48  ? ? -87.22  30.30  
2 1 PRO A 72  ? ? -52.11  107.69 
3 1 LEU A 73  ? ? -76.97  36.72  
4 1 PHE A 193 ? ? -147.15 -0.57  
5 1 SER A 197 ? ? -151.75 89.00  
6 1 GLN A 405 ? ? -89.02  36.96  
7 1 SER A 478 ? ? -90.62  49.22  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A MET 1   ? A MET 1   
2   1 Y 1 A THR 2   ? A THR 2   
3   1 Y 1 A LYS 3   ? A LYS 3   
4   1 Y 1 A SER 4   ? A SER 4   
5   1 Y 1 A ASN 5   ? A ASN 5   
6   1 Y 1 A GLY 6   ? A GLY 6   
7   1 Y 1 A GLU 7   ? A GLU 7   
8   1 Y 1 A GLU 8   ? A GLU 8   
9   1 Y 1 A PRO 9   ? A PRO 9   
10  1 Y 1 A LYS 10  ? A LYS 10  
11  1 Y 1 A MET 11  ? A MET 11  
12  1 Y 1 A GLY 12  ? A GLY 12  
13  1 Y 1 A GLY 13  ? A GLY 13  
14  1 Y 1 A ARG 14  ? A ARG 14  
15  1 Y 1 A MET 15  ? A MET 15  
16  1 Y 1 A GLU 16  ? A GLU 16  
17  1 Y 1 A ARG 17  ? A ARG 17  
18  1 Y 1 A PHE 18  ? A PHE 18  
19  1 Y 1 A GLN 19  ? A GLN 19  
20  1 Y 1 A GLN 20  ? A GLN 20  
21  1 Y 1 A GLY 21  ? A GLY 21  
22  1 Y 1 A VAL 22  ? A VAL 22  
23  1 Y 1 A SER 23  ? A SER 23  
24  1 Y 1 A LYS 24  ? A LYS 24  
25  1 Y 1 A ARG 25  ? A ARG 25  
26  1 Y 1 A THR 26  ? A THR 26  
27  1 Y 1 A LEU 27  ? A LEU 27  
28  1 Y 1 A LEU 28  ? A LEU 28  
29  1 Y 1 A ALA 29  ? A ALA 29  
30  1 Y 1 A LYS 30  ? A LYS 30  
31  1 Y 1 A LYS 31  ? A LYS 31  
32  1 Y 1 A LYS 32  ? A LYS 32  
33  1 Y 1 A VAL 33  ? A VAL 33  
34  1 Y 1 A GLN 34  ? A GLN 34  
35  1 Y 1 A ASN 35  ? A ASN 35  
36  1 Y 1 A ILE 36  ? A ILE 36  
37  1 Y 1 A THR 37  ? A THR 37  
38  1 Y 1 A LYS 38  ? A LYS 38  
39  1 Y 1 A HIS 146 ? A HIS 146 
40  1 Y 1 A PRO 147 ? A PRO 147 
41  1 Y 1 A GLY 148 ? A GLY 148 
42  1 Y 1 A ALA 149 ? A ALA 149 
43  1 Y 1 A ALA 150 ? A ALA 150 
44  1 Y 1 A SER 151 ? A SER 151 
45  1 Y 1 A ALA 152 ? A ALA 152 
46  1 Y 1 A ALA 153 ? A ALA 153 
47  1 Y 1 A ILE 154 ? A ILE 154 
48  1 Y 1 A THR 155 ? A THR 155 
49  1 Y 1 A ALA 156 ? A ALA 156 
50  1 Y 1 A SER 157 ? A SER 157 
51  1 Y 1 A VAL 158 ? A VAL 158 
52  1 Y 1 A GLY 159 ? A GLY 159 
53  1 Y 1 A ALA 160 ? A ALA 160 
54  1 Y 1 A ALA 161 ? A ALA 161 
55  1 Y 1 A GLY 162 ? A GLY 162 
56  1 Y 1 A SER 163 ? A SER 163 
57  1 Y 1 A ALA 164 ? A ALA 164 
58  1 Y 1 A GLU 165 ? A GLU 165 
59  1 Y 1 A ASN 166 ? A ASN 166 
60  1 Y 1 A ALA 167 ? A ALA 167 
61  1 Y 1 A PRO 168 ? A PRO 168 
62  1 Y 1 A SER 169 ? A SER 169 
63  1 Y 1 A LYS 170 ? A LYS 170 
64  1 Y 1 A TYR 200 ? A TYR 200 
65  1 Y 1 A GLU 201 ? A GLU 201 
66  1 Y 1 A GLU 202 ? A GLU 202 
67  1 Y 1 A ARG 203 ? A ARG 203 
68  1 Y 1 A THR 204 ? A THR 204 
69  1 Y 1 A ILE 205 ? A ILE 205 
70  1 Y 1 A THR 206 ? A THR 206 
71  1 Y 1 A GLY 207 ? A GLY 207 
72  1 Y 1 A THR 208 ? A THR 208 
73  1 Y 1 A ARG 209 ? A ARG 209 
74  1 Y 1 A VAL 210 ? A VAL 210 
75  1 Y 1 A LYS 211 ? A LYS 211 
76  1 Y 1 A VAL 212 ? A VAL 212 
77  1 Y 1 A PRO 213 ? A PRO 213 
78  1 Y 1 A VAL 214 ? A VAL 214 
79  1 Y 1 A GLY 215 ? A GLY 215 
80  1 Y 1 A MET 284 ? A MET 284 
81  1 Y 1 A GLU 285 ? A GLU 285 
82  1 Y 1 A ASP 286 ? A ASP 286 
83  1 Y 1 A LEU 287 ? A LEU 287 
84  1 Y 1 A GLU 288 ? A GLU 288 
85  1 Y 1 A VAL 289 ? A VAL 289 
86  1 Y 1 A LEU 290 ? A LEU 290 
87  1 Y 1 A GLY 291 ? A GLY 291 
88  1 Y 1 A GLY 292 ? A GLY 292 
89  1 Y 1 A GLN 293 ? A GLN 293 
90  1 Y 1 A TYR 399 ? A TYR 399 
91  1 Y 1 A GLU 400 ? A GLU 400 
92  1 Y 1 A LEU 401 ? A LEU 401 
93  1 Y 1 A ASP 402 ? A ASP 402 
94  1 Y 1 A PHE 403 ? A PHE 403 
95  1 Y 1 A ASN 491 ? A ASN 491 
96  1 Y 1 A SER 492 ? A SER 492 
97  1 Y 1 A VAL 493 ? A VAL 493 
98  1 Y 1 A ILE 494 ? A ILE 494 
99  1 Y 1 A GLU 495 ? A GLU 495 
100 1 Y 1 A GLU 496 ? A GLU 496 
101 1 Y 1 A ASN 497 ? A ASN 497 
102 1 Y 1 A GLU 498 ? A GLU 498 
103 1 Y 1 A MET 499 ? A MET 499 
104 1 Y 1 A LYS 500 ? A LYS 500 
105 1 Y 1 A LYS 501 ? A LYS 501 
106 1 Y 1 A PRO 502 ? A PRO 502 
107 1 Y 1 A TYR 503 ? A TYR 503 
108 1 Y 1 A GLN 504 ? A GLN 504 
109 1 Y 1 A LEU 505 ? A LEU 505 
110 1 Y 1 A ILE 506 ? A ILE 506 
111 1 Y 1 A ALA 507 ? A ALA 507 
112 1 Y 1 A GLN 508 ? A GLN 508 
113 1 Y 1 A ASP 509 ? A ASP 509 
114 1 Y 1 A ASN 510 ? A ASN 510 
115 1 Y 1 A GLU 511 ? A GLU 511 
116 1 Y 1 A THR 512 ? A THR 512 
117 1 Y 1 A GLU 513 ? A GLU 513 
118 1 Y 1 A LYS 514 ? A LYS 514 
119 1 Y 1 A PRO 515 ? A PRO 515 
120 1 Y 1 A ILE 516 ? A ILE 516 
121 1 Y 1 A ASP 517 ? A ASP 517 
122 1 Y 1 A SER 518 ? A SER 518 
123 1 Y 1 A GLU 519 ? A GLU 519 
124 1 Y 1 A THR 520 ? A THR 520 
125 1 Y 1 A LYS 521 ? A LYS 521 
126 1 Y 1 A MET 522 ? A MET 522 
# 
_pdbx_audit_support.funding_organization   'ERC starting grant' 
_pdbx_audit_support.country                France 
_pdbx_audit_support.grant_number           309657 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SODIUM ION'    NA  
3 'ASPARTIC ACID' ASP 
#