data_5LXM
# 
_entry.id   5LXM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LXM         
WWPDB D_1200001525 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LXM 
_pdbx_database_status.recvd_initial_deposition_date   2016-09-22 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'McIntyre, P.J.' 1 
'Bayliss, R.'    2 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'ACS Chem. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1554-8937 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            11 
_citation.language                  ? 
_citation.page_first                3383 
_citation.page_last                 3390 
_citation.title                     
'A TPX2 Proteomimetic Has Enhanced Affinity for Aurora-A Due to Hydrocarbon Stapling of a Helix.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acschembio.6b00727 
_citation.pdbx_database_id_PubMed   27775325 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rennie, Y.K.'   1 ? 
primary 'McIntyre, P.J.' 2 ? 
primary 'Akindele, T.'   3 ? 
primary 'Bayliss, R.'    4 ? 
primary 'Jamieson, A.G.' 5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LXM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     79.780 
_cell.length_a_esd                 ? 
_cell.length_b                     79.780 
_cell.length_b_esd                 ? 
_cell.length_c                     140.260 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LXM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Aurora kinase A'                      32836.508 1  2.7.11.1 'C290A, C393A' ? ? 
2  polymer     syn 'Targeting protein for Xklp2'          4364.494  1  ?        ?              ? ? 
3  non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"             427.201   1  ?        ?              ? ? 
4  non-polymer syn 'TETRAETHYLENE GLYCOL'                 194.226   1  ?        ?              ? ? 
5  non-polymer syn 'SULFATE ION'                          96.063    1  ?        ?              ? ? 
6  non-polymer syn 'DI(HYDROXYETHYL)ETHER'                106.120   2  ?        ?              ? ? 
7  non-polymer syn '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' 195.237   1  ?        ?              ? ? 
8  non-polymer syn '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'    162.227   1  ?        ?              ? ? 
9  non-polymer syn 'CHLORIDE ION'                         35.453    1  ?        ?              ? ? 
10 non-polymer syn 'MAGNESIUM ION'                        24.305    2  ?        ?              ? ? 
11 non-polymer syn AMMONIA                                17.031    1  ?        ?              ? ? 
12 water       nat water                                  18.015    77 ?        ?              ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;Aurora 2,Aurora/IPL1-related kinase 1,hARK1,Breast tumor-amplified kinase,Serine/threonine-protein kinase 15,Serine/threonine-protein kinase 6,Serine/threonine-protein kinase aurora-A
;
2  
;Differentially expressed in cancerous and non-cancerous lung cells 2,DIL-2,Hepatocellular carcinoma-associated antigen 519,Hepatocellular carcinoma-associated antigen 90,Protein fls353,Restricted expression proliferation-associated protein 100,p100
;
11 
;Differentially expressed in cancerous and non-cancerous lung cells 2,DIL-2,Hepatocellular carcinoma-associated antigen 519,Hepatocellular carcinoma-associated antigen 90,Protein fls353,Restricted expression proliferation-associated protein 100,p100
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no yes 
;MESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF
HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH
APSSRRT(TPO)LAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGA
RDLISRLLKHNPSQRPMLREVLEHPWITANSSKPSNAQNKESASKQS
;
;MESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYF
HDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVH
APSSRRTTLAGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLI
SRLLKHNPSQRPMLREVLEHPWITANSSKPSNAQNKESASKQS
;
A ? 
2 'polypeptide(L)' no yes 'SSYSYDAPSDFINFSSLDDEGDTQNIDSWFE(MK8)KAN(MK8)EN' SSYSYDAPSDFINFSSLDDEGDTQNIDSWFELKANLEN D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLU n 
1 3   SER n 
1 4   LYS n 
1 5   LYS n 
1 6   ARG n 
1 7   GLN n 
1 8   TRP n 
1 9   ALA n 
1 10  LEU n 
1 11  GLU n 
1 12  ASP n 
1 13  PHE n 
1 14  GLU n 
1 15  ILE n 
1 16  GLY n 
1 17  ARG n 
1 18  PRO n 
1 19  LEU n 
1 20  GLY n 
1 21  LYS n 
1 22  GLY n 
1 23  LYS n 
1 24  PHE n 
1 25  GLY n 
1 26  ASN n 
1 27  VAL n 
1 28  TYR n 
1 29  LEU n 
1 30  ALA n 
1 31  ARG n 
1 32  GLU n 
1 33  LYS n 
1 34  GLN n 
1 35  SER n 
1 36  LYS n 
1 37  PHE n 
1 38  ILE n 
1 39  LEU n 
1 40  ALA n 
1 41  LEU n 
1 42  LYS n 
1 43  VAL n 
1 44  LEU n 
1 45  PHE n 
1 46  LYS n 
1 47  ALA n 
1 48  GLN n 
1 49  LEU n 
1 50  GLU n 
1 51  LYS n 
1 52  ALA n 
1 53  GLY n 
1 54  VAL n 
1 55  GLU n 
1 56  HIS n 
1 57  GLN n 
1 58  LEU n 
1 59  ARG n 
1 60  ARG n 
1 61  GLU n 
1 62  VAL n 
1 63  GLU n 
1 64  ILE n 
1 65  GLN n 
1 66  SER n 
1 67  HIS n 
1 68  LEU n 
1 69  ARG n 
1 70  HIS n 
1 71  PRO n 
1 72  ASN n 
1 73  ILE n 
1 74  LEU n 
1 75  ARG n 
1 76  LEU n 
1 77  TYR n 
1 78  GLY n 
1 79  TYR n 
1 80  PHE n 
1 81  HIS n 
1 82  ASP n 
1 83  ALA n 
1 84  THR n 
1 85  ARG n 
1 86  VAL n 
1 87  TYR n 
1 88  LEU n 
1 89  ILE n 
1 90  LEU n 
1 91  GLU n 
1 92  TYR n 
1 93  ALA n 
1 94  PRO n 
1 95  LEU n 
1 96  GLY n 
1 97  THR n 
1 98  VAL n 
1 99  TYR n 
1 100 ARG n 
1 101 GLU n 
1 102 LEU n 
1 103 GLN n 
1 104 LYS n 
1 105 LEU n 
1 106 SER n 
1 107 LYS n 
1 108 PHE n 
1 109 ASP n 
1 110 GLU n 
1 111 GLN n 
1 112 ARG n 
1 113 THR n 
1 114 ALA n 
1 115 THR n 
1 116 TYR n 
1 117 ILE n 
1 118 THR n 
1 119 GLU n 
1 120 LEU n 
1 121 ALA n 
1 122 ASN n 
1 123 ALA n 
1 124 LEU n 
1 125 SER n 
1 126 TYR n 
1 127 CYS n 
1 128 HIS n 
1 129 SER n 
1 130 LYS n 
1 131 ARG n 
1 132 VAL n 
1 133 ILE n 
1 134 HIS n 
1 135 ARG n 
1 136 ASP n 
1 137 ILE n 
1 138 LYS n 
1 139 PRO n 
1 140 GLU n 
1 141 ASN n 
1 142 LEU n 
1 143 LEU n 
1 144 LEU n 
1 145 GLY n 
1 146 SER n 
1 147 ALA n 
1 148 GLY n 
1 149 GLU n 
1 150 LEU n 
1 151 LYS n 
1 152 ILE n 
1 153 ALA n 
1 154 ASP n 
1 155 PHE n 
1 156 GLY n 
1 157 TRP n 
1 158 SER n 
1 159 VAL n 
1 160 HIS n 
1 161 ALA n 
1 162 PRO n 
1 163 SER n 
1 164 SER n 
1 165 ARG n 
1 166 ARG n 
1 167 THR n 
1 168 TPO n 
1 169 LEU n 
1 170 ALA n 
1 171 GLY n 
1 172 THR n 
1 173 LEU n 
1 174 ASP n 
1 175 TYR n 
1 176 LEU n 
1 177 PRO n 
1 178 PRO n 
1 179 GLU n 
1 180 MET n 
1 181 ILE n 
1 182 GLU n 
1 183 GLY n 
1 184 ARG n 
1 185 MET n 
1 186 HIS n 
1 187 ASP n 
1 188 GLU n 
1 189 LYS n 
1 190 VAL n 
1 191 ASP n 
1 192 LEU n 
1 193 TRP n 
1 194 SER n 
1 195 LEU n 
1 196 GLY n 
1 197 VAL n 
1 198 LEU n 
1 199 CYS n 
1 200 TYR n 
1 201 GLU n 
1 202 PHE n 
1 203 LEU n 
1 204 VAL n 
1 205 GLY n 
1 206 LYS n 
1 207 PRO n 
1 208 PRO n 
1 209 PHE n 
1 210 GLU n 
1 211 ALA n 
1 212 ASN n 
1 213 THR n 
1 214 TYR n 
1 215 GLN n 
1 216 GLU n 
1 217 THR n 
1 218 TYR n 
1 219 LYS n 
1 220 ARG n 
1 221 ILE n 
1 222 SER n 
1 223 ARG n 
1 224 VAL n 
1 225 GLU n 
1 226 PHE n 
1 227 THR n 
1 228 PHE n 
1 229 PRO n 
1 230 ASP n 
1 231 PHE n 
1 232 VAL n 
1 233 THR n 
1 234 GLU n 
1 235 GLY n 
1 236 ALA n 
1 237 ARG n 
1 238 ASP n 
1 239 LEU n 
1 240 ILE n 
1 241 SER n 
1 242 ARG n 
1 243 LEU n 
1 244 LEU n 
1 245 LYS n 
1 246 HIS n 
1 247 ASN n 
1 248 PRO n 
1 249 SER n 
1 250 GLN n 
1 251 ARG n 
1 252 PRO n 
1 253 MET n 
1 254 LEU n 
1 255 ARG n 
1 256 GLU n 
1 257 VAL n 
1 258 LEU n 
1 259 GLU n 
1 260 HIS n 
1 261 PRO n 
1 262 TRP n 
1 263 ILE n 
1 264 THR n 
1 265 ALA n 
1 266 ASN n 
1 267 SER n 
1 268 SER n 
1 269 LYS n 
1 270 PRO n 
1 271 SER n 
1 272 ASN n 
1 273 ALA n 
1 274 GLN n 
1 275 ASN n 
1 276 LYS n 
1 277 GLU n 
1 278 SER n 
1 279 ALA n 
1 280 SER n 
1 281 LYS n 
1 282 GLN n 
1 283 SER n 
2 1   SER n 
2 2   SER n 
2 3   TYR n 
2 4   SER n 
2 5   TYR n 
2 6   ASP n 
2 7   ALA n 
2 8   PRO n 
2 9   SER n 
2 10  ASP n 
2 11  PHE n 
2 12  ILE n 
2 13  ASN n 
2 14  PHE n 
2 15  SER n 
2 16  SER n 
2 17  LEU n 
2 18  ASP n 
2 19  ASP n 
2 20  GLU n 
2 21  GLY n 
2 22  ASP n 
2 23  THR n 
2 24  GLN n 
2 25  ASN n 
2 26  ILE n 
2 27  ASP n 
2 28  SER n 
2 29  TRP n 
2 30  PHE n 
2 31  GLU n 
2 32  MK8 n 
2 33  LYS n 
2 34  ALA n 
2 35  ASN n 
2 36  MK8 n 
2 37  GLU n 
2 38  ASN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   283 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AURKA, AIK, AIRK1, ARK1, AURA, AYK1, BTAK, IAK1, STK15, STK6' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2  1 sample 1 38 'Homo sapiens' Human 9606 ? 
11 1 sample 1 39 'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP AURKA_HUMAN O14965 ? 1 
;ESKKRQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFH
DATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHA
PSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLIS
RLLKHNPSQRPMLREVLEHPWITANSSKPSNCQNKESASKQS
;
122 
2 UNP TPX2_HUMAN  Q9ULW0 ? 2 SSYSYDAPSDFINFSSLDDEGDTQNIDSWFEEKANLEN 6   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5LXM A 2 ? 283 ? O14965 122 ? 403 ? 122 403 
2 2 5LXM D 1 ? 38  ? Q9ULW0 6   ? 43  ? 6   43  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5LXM MET A 1   ? UNP O14965 ?   ?   'initiating methionine' 121 1 
1 5LXM ALA A 170 ? UNP O14965 CYS 290 'engineered mutation'   290 2 
1 5LXM ALA A 273 ? UNP O14965 CYS 393 'engineered mutation'   393 3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"             ?                  'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                                ?                  'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                               ?                  'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                             ?                  'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                        ?                  'C4 H7 N O4'        133.103 
CL  non-polymer         . 'CHLORIDE ION'                         ?                  'Cl -1'             35.453  
CYS 'L-peptide linking' y CYSTEINE                               ?                  'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                              ?                  'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                        ?                  'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                ?                  'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                              ?                  'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                  ?                  'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                             ?                  'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                ?                  'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                 ?                  'C6 H15 N2 O2 1'    147.195 
MES non-polymer         . '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' ?                  'C6 H13 N O4 S'     195.237 
MET 'L-peptide linking' y METHIONINE                             ?                  'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                        ?                  'Mg 2'              24.305  
MK8 'L-peptide linking' n 2-methyl-L-norleucine                  ?                  'C7 H15 N O2'       145.199 
NH3 non-polymer         . AMMONIA                                ?                  'H3 N'              17.031  
P4G non-polymer         . '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'    ?                  'C8 H18 O3'         162.227 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER'                ?                  'C4 H10 O3'         106.120 
PG4 non-polymer         . 'TETRAETHYLENE GLYCOL'                 ?                  'C8 H18 O5'         194.226 
PHE 'L-peptide linking' y PHENYLALANINE                          ?                  'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                ?                  'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                 ?                  'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                          ?                  'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                              ?                  'C4 H9 N O3'        119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                       PHOSPHONOTHREONINE 'C4 H10 N O6 P'     199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                             ?                  'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                               ?                  'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                 ?                  'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LXM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.63 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         66.11 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'MORPHEUS Crystallization Screen condition C1' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-03-04 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5LXM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.08 
_reflns.d_resolution_low                 61.98 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       31554 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.40 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  9.6 
_reflns.pdbx_Rmerge_I_obs                ? 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.94 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                169.800 
_refine.B_iso_mean                               74.3780 
_refine.B_iso_min                                37.480 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LXM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.0800 
_refine.ls_d_res_low                             61.9800 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     31526 
_refine.ls_number_reflns_R_free                  1602 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.3100 
_refine.ls_percent_reflns_R_free                 5.0800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2018 
_refine.ls_R_factor_R_free                       0.2429 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1996 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4CEG 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.1300 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.3000 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.0800 
_refine_hist.d_res_low                        61.9800 
_refine_hist.pdbx_number_atoms_ligand         85 
_refine_hist.number_atoms_solvent             77 
_refine_hist.number_atoms_total               2582 
_refine_hist.pdbx_number_residues_total       301 
_refine_hist.pdbx_B_iso_mean_ligand           96.19 
_refine_hist.pdbx_B_iso_mean_solvent          66.44 
_refine_hist.pdbx_number_atoms_protein        2420 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
_struct.entry_id                     5LXM 
_struct.title                        'Crystal structure of Aurora-A bound to a hydrocarbon-stapled proteomimetic of TPX2' 
_struct.pdbx_descriptor              'Aurora kinase A (E.C.2.7.11.1), Targeting protein for Xklp2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LXM 
_struct_keywords.text            'Protein kinase, Proteomimetic, Stapled helix peptide, Mitosis, transferase' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 6  ? 
H N N 7  ? 
I N N 8  ? 
J N N 9  ? 
K N N 10 ? 
L N N 10 ? 
M N N 11 ? 
N N N 12 ? 
O N N 12 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 9   ? GLU A 11  ? ALA A 129 GLU A 131 5 ? 3  
HELX_P HELX_P2  AA2 LYS A 46  ? GLY A 53  ? LYS A 166 GLY A 173 1 ? 8  
HELX_P HELX_P3  AA3 VAL A 54  ? HIS A 67  ? VAL A 174 HIS A 187 1 ? 14 
HELX_P HELX_P4  AA4 THR A 97  ? SER A 106 ? THR A 217 SER A 226 1 ? 10 
HELX_P HELX_P5  AA5 ASP A 109 ? LYS A 130 ? ASP A 229 LYS A 250 1 ? 22 
HELX_P HELX_P6  AA6 LYS A 138 ? GLU A 140 ? LYS A 258 GLU A 260 5 ? 3  
HELX_P HELX_P7  AA7 THR A 172 ? LEU A 176 ? THR A 292 LEU A 296 5 ? 5  
HELX_P HELX_P8  AA8 PRO A 177 ? GLU A 182 ? PRO A 297 GLU A 302 1 ? 6  
HELX_P HELX_P9  AA9 LYS A 189 ? GLY A 205 ? LYS A 309 GLY A 325 1 ? 17 
HELX_P HELX_P10 AB1 THR A 213 ? VAL A 224 ? THR A 333 VAL A 344 1 ? 12 
HELX_P HELX_P11 AB2 THR A 233 ? LEU A 244 ? THR A 353 LEU A 364 1 ? 12 
HELX_P HELX_P12 AB3 ASN A 247 ? ARG A 251 ? ASN A 367 ARG A 371 5 ? 5  
HELX_P HELX_P13 AB4 MET A 253 ? GLU A 259 ? MET A 373 GLU A 379 1 ? 7  
HELX_P HELX_P14 AB5 HIS A 260 ? ALA A 265 ? HIS A 380 ALA A 385 1 ? 6  
HELX_P HELX_P15 AB6 GLN B 24  ? ILE B 26  ? GLN D 29  ILE D 31  5 ? 3  
HELX_P HELX_P16 AB7 ASP B 27  ? GLU B 37  ? ASP D 32  GLU D 42  1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ?    ? A ASN 141 OD1 ? ? ? 1_555 K MG  .   MG ? ? A ASN 261 A MG  509 1_555 ? ? ? ? ? ? ? 2.670 ? 
metalc2  metalc ?    ? A ASP 154 OD1 ? ? ? 1_555 L MG  .   MG ? ? A ASP 274 A MG  510 1_555 ? ? ? ? ? ? ? 2.450 ? 
metalc3  metalc ?    ? A ASP 154 OD2 ? ? ? 1_555 K MG  .   MG ? ? A ASP 274 A MG  509 1_555 ? ? ? ? ? ? ? 2.387 ? 
covale1  covale both ? A THR 167 C   ? ? ? 1_555 A TPO 168 N  ? ? A THR 287 A TPO 288 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale2  covale both ? A TPO 168 C   ? ? ? 1_555 A LEU 169 N  ? ? A TPO 288 A LEU 289 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3  covale both ? B GLU 31  C   ? ? ? 1_555 B MK8 32  N  ? ? D GLU 36  D MK8 37  1_555 ? ? ? ? ? ? ? 1.334 ? 
covale4  covale both ? B MK8 32  C   ? ? ? 1_555 B LYS 33  N  ? ? D MK8 37  D LYS 38  1_555 ? ? ? ? ? ? ? 1.331 ? 
covale5  covale none ? B MK8 32  CE  ? ? ? 1_555 B MK8 36  CE ? ? D MK8 37  D MK8 41  1_555 ? ? ? ? ? ? ? 1.332 ? 
covale6  covale both ? B ASN 35  C   ? ? ? 1_555 B MK8 36  N  ? ? D ASN 40  D MK8 41  1_555 ? ? ? ? ? ? ? 1.333 ? 
covale7  covale both ? B MK8 36  C   ? ? ? 1_555 B GLU 37  N  ? ? D MK8 41  D GLU 42  1_555 ? ? ? ? ? ? ? 1.329 ? 
covale8  covale one  ? B ASN 38  C   ? ? ? 1_555 M NH3 .   N  ? ? D ASN 43  D NH3 101 1_555 ? ? ? ? ? ? ? 1.330 ? 
metalc4  metalc ?    ? C ADP .   O1B ? ? ? 1_555 L MG  .   MG ? ? A ADP 501 A MG  510 1_555 ? ? ? ? ? ? ? 2.295 ? 
metalc5  metalc ?    ? C ADP .   O3B ? ? ? 1_555 K MG  .   MG ? ? A ADP 501 A MG  509 1_555 ? ? ? ? ? ? ? 2.245 ? 
metalc6  metalc ?    ? C ADP .   O2A ? ? ? 1_555 K MG  .   MG ? ? A ADP 501 A MG  509 1_555 ? ? ? ? ? ? ? 1.996 ? 
metalc7  metalc ?    ? G PEG .   O4  ? ? ? 1_555 L MG  .   MG ? ? A PEG 505 A MG  510 1_555 ? ? ? ? ? ? ? 2.939 ? 
metalc8  metalc ?    ? K MG  .   MG  ? ? ? 1_555 N HOH .   O  ? ? A MG  509 A HOH 654 1_555 ? ? ? ? ? ? ? 2.225 ? 
metalc9  metalc ?    ? K MG  .   MG  ? ? ? 1_555 N HOH .   O  ? ? A MG  509 A HOH 651 1_555 ? ? ? ? ? ? ? 2.050 ? 
metalc10 metalc ?    ? L MG  .   MG  ? ? ? 1_555 N HOH .   O  ? ? A MG  510 A HOH 631 1_555 ? ? ? ? ? ? ? 2.482 ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
covale ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 13  ? LYS A 21  ? PHE A 133 LYS A 141 
AA1 2 ASN A 26  ? GLU A 32  ? ASN A 146 GLU A 152 
AA1 3 PHE A 37  ? PHE A 45  ? PHE A 157 PHE A 165 
AA1 4 ARG A 85  ? LEU A 90  ? ARG A 205 LEU A 210 
AA1 5 LEU A 76  ? HIS A 81  ? LEU A 196 HIS A 201 
AA2 1 VAL A 132 ? ILE A 133 ? VAL A 252 ILE A 253 
AA2 2 VAL A 159 ? HIS A 160 ? VAL A 279 HIS A 280 
AA3 1 LEU A 142 ? LEU A 144 ? LEU A 262 LEU A 264 
AA3 2 LEU A 150 ? ILE A 152 ? LEU A 270 ILE A 272 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 19  ? N LEU A 139 O VAL A 27  ? O VAL A 147 
AA1 2 3 N ALA A 30  ? N ALA A 150 O LEU A 39  ? O LEU A 159 
AA1 3 4 N LEU A 44  ? N LEU A 164 O VAL A 86  ? O VAL A 206 
AA1 4 5 O TYR A 87  ? O TYR A 207 N PHE A 80  ? N PHE A 200 
AA2 1 2 N ILE A 133 ? N ILE A 253 O VAL A 159 ? O VAL A 279 
AA3 1 2 N LEU A 143 ? N LEU A 263 O LYS A 151 ? O LYS A 271 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ADP 501 ? 22 'binding site for residue ADP A 501' 
AC2 Software A PG4 502 ? 3  'binding site for residue PG4 A 502' 
AC3 Software A SO4 503 ? 5  'binding site for residue SO4 A 503' 
AC4 Software A PEG 504 ? 6  'binding site for residue PEG A 504' 
AC5 Software A PEG 505 ? 6  'binding site for residue PEG A 505' 
AC6 Software A MES 506 ? 10 'binding site for residue MES A 506' 
AC7 Software A P4G 507 ? 3  'binding site for residue P4G A 507' 
AC8 Software A MG  509 ? 5  'binding site for residue MG A 509'  
AC9 Software A MG  510 ? 5  'binding site for residue MG A 510'  
AD1 Software D NH3 101 ? 4  'binding site for residue NH3 D 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 22 LEU A 19  ? LEU A 139 . ? 1_555 ? 
2  AC1 22 GLY A 20  ? GLY A 140 . ? 1_555 ? 
3  AC1 22 GLY A 22  ? GLY A 142 . ? 1_555 ? 
4  AC1 22 LYS A 23  ? LYS A 143 . ? 1_555 ? 
5  AC1 22 VAL A 27  ? VAL A 147 . ? 1_555 ? 
6  AC1 22 ALA A 40  ? ALA A 160 . ? 1_555 ? 
7  AC1 22 LYS A 42  ? LYS A 162 . ? 1_555 ? 
8  AC1 22 LEU A 74  ? LEU A 194 . ? 1_555 ? 
9  AC1 22 GLU A 91  ? GLU A 211 . ? 1_555 ? 
10 AC1 22 ALA A 93  ? ALA A 213 . ? 1_555 ? 
11 AC1 22 THR A 97  ? THR A 217 . ? 1_555 ? 
12 AC1 22 GLU A 140 ? GLU A 260 . ? 1_555 ? 
13 AC1 22 ASN A 141 ? ASN A 261 . ? 1_555 ? 
14 AC1 22 LEU A 143 ? LEU A 263 . ? 1_555 ? 
15 AC1 22 ASP A 154 ? ASP A 274 . ? 1_555 ? 
16 AC1 22 PEG G .   ? PEG A 505 . ? 1_555 ? 
17 AC1 22 MG  K .   ? MG  A 509 . ? 1_555 ? 
18 AC1 22 MG  L .   ? MG  A 510 . ? 1_555 ? 
19 AC1 22 HOH N .   ? HOH A 643 . ? 1_555 ? 
20 AC1 22 HOH N .   ? HOH A 651 . ? 1_555 ? 
21 AC1 22 HOH N .   ? HOH A 652 . ? 1_555 ? 
22 AC1 22 HOH N .   ? HOH A 654 . ? 1_555 ? 
23 AC2 3  GLU A 101 ? GLU A 221 . ? 1_555 ? 
24 AC2 3  LYS A 104 ? LYS A 224 . ? 1_555 ? 
25 AC2 3  GLU A 182 ? GLU A 302 . ? 6_665 ? 
26 AC3 5  ARG A 100 ? ARG A 220 . ? 6_655 ? 
27 AC3 5  LYS A 104 ? LYS A 224 . ? 6_655 ? 
28 AC3 5  ARG A 184 ? ARG A 304 . ? 1_555 ? 
29 AC3 5  HIS A 246 ? HIS A 366 . ? 1_555 ? 
30 AC3 5  ASN A 247 ? ASN A 367 . ? 1_555 ? 
31 AC4 6  SER A 125 ? SER A 245 . ? 1_555 ? 
32 AC4 6  HIS A 128 ? HIS A 248 . ? 1_555 ? 
33 AC4 6  GLU A 188 ? GLU A 308 . ? 1_555 ? 
34 AC4 6  MET A 253 ? MET A 373 . ? 1_555 ? 
35 AC4 6  LEU A 254 ? LEU A 374 . ? 1_555 ? 
36 AC4 6  ARG A 255 ? ARG A 375 . ? 1_555 ? 
37 AC5 6  PHE A 24  ? PHE A 144 . ? 1_555 ? 
38 AC5 6  GLU A 61  ? GLU A 181 . ? 1_555 ? 
39 AC5 6  GLY A 156 ? GLY A 276 . ? 1_555 ? 
40 AC5 6  TRP A 157 ? TRP A 277 . ? 1_555 ? 
41 AC5 6  ADP C .   ? ADP A 501 . ? 1_555 ? 
42 AC5 6  MG  L .   ? MG  A 510 . ? 1_555 ? 
43 AC6 10 ARG A 60  ? ARG A 180 . ? 1_555 ? 
44 AC6 10 HIS A 160 ? HIS A 280 . ? 1_555 ? 
45 AC6 10 PRO A 162 ? PRO A 282 . ? 1_555 ? 
46 AC6 10 ARG A 166 ? ARG A 286 . ? 1_555 ? 
47 AC6 10 MET A 185 ? MET A 305 . ? 4_645 ? 
48 AC6 10 HOH N .   ? HOH A 612 . ? 1_555 ? 
49 AC6 10 HOH N .   ? HOH A 626 . ? 1_555 ? 
50 AC6 10 LYS B 33  ? LYS D 38  . ? 1_555 ? 
51 AC6 10 ALA B 34  ? ALA D 39  . ? 1_555 ? 
52 AC6 10 GLU B 37  ? GLU D 42  . ? 1_555 ? 
53 AC7 3  LEU A 169 ? LEU A 289 . ? 1_555 ? 
54 AC7 3  GLY A 171 ? GLY A 291 . ? 1_555 ? 
55 AC7 3  TYR A 218 ? TYR A 338 . ? 1_555 ? 
56 AC8 5  ASN A 141 ? ASN A 261 . ? 1_555 ? 
57 AC8 5  ASP A 154 ? ASP A 274 . ? 1_555 ? 
58 AC8 5  ADP C .   ? ADP A 501 . ? 1_555 ? 
59 AC8 5  HOH N .   ? HOH A 651 . ? 1_555 ? 
60 AC8 5  HOH N .   ? HOH A 654 . ? 1_555 ? 
61 AC9 5  ASP A 154 ? ASP A 274 . ? 1_555 ? 
62 AC9 5  GLY A 156 ? GLY A 276 . ? 1_555 ? 
63 AC9 5  ADP C .   ? ADP A 501 . ? 1_555 ? 
64 AC9 5  PEG G .   ? PEG A 505 . ? 1_555 ? 
65 AC9 5  HOH N .   ? HOH A 631 . ? 1_555 ? 
66 AD1 4  SER A 163 ? SER A 283 . ? 1_555 ? 
67 AD1 4  ALA B 34  ? ALA D 39  . ? 1_555 ? 
68 AD1 4  GLU B 37  ? GLU D 42  . ? 1_555 ? 
69 AD1 4  ASN B 38  ? ASN D 43  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LXM 
_atom_sites.fract_transf_matrix[1][1]   0.012534 
_atom_sites.fract_transf_matrix[1][2]   0.007237 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014474 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007130 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ARG A 1  6   ? 39.244 -0.115  -10.780 1.00 115.92 ? 126 ARG A N     1 
ATOM   2    C  CA    . ARG A 1  6   ? 38.884 -1.513  -10.576 1.00 114.88 ? 126 ARG A CA    1 
ATOM   3    C  C     . ARG A 1  6   ? 39.740 -2.151  -9.483  1.00 108.25 ? 126 ARG A C     1 
ATOM   4    O  O     . ARG A 1  6   ? 39.334 -3.127  -8.853  1.00 105.14 ? 126 ARG A O     1 
ATOM   5    C  CB    . ARG A 1  6   ? 39.028 -2.297  -11.883 1.00 115.97 ? 126 ARG A CB    1 
ATOM   6    C  CG    . ARG A 1  6   ? 38.561 -3.739  -11.795 1.00 114.01 ? 126 ARG A CG    1 
ATOM   7    C  CD    . ARG A 1  6   ? 38.640 -4.442  -13.136 1.00 148.51 ? 126 ARG A CD    1 
ATOM   8    N  NE    . ARG A 1  6   ? 38.212 -5.834  -13.034 1.00 148.26 ? 126 ARG A NE    1 
ATOM   9    C  CZ    . ARG A 1  6   ? 36.945 -6.230  -13.075 1.00 148.89 ? 126 ARG A CZ    1 
ATOM   10   N  NH1   . ARG A 1  6   ? 35.973 -5.339  -13.218 1.00 154.09 ? 126 ARG A NH1   1 
ATOM   11   N  NH2   . ARG A 1  6   ? 36.648 -7.518  -12.973 1.00 143.45 ? 126 ARG A NH2   1 
ATOM   12   N  N     . GLN A 1  7   ? 40.924 -1.590  -9.263  1.00 108.07 ? 127 GLN A N     1 
ATOM   13   C  CA    . GLN A 1  7   ? 41.868 -2.134  -8.294  1.00 104.17 ? 127 GLN A CA    1 
ATOM   14   C  C     . GLN A 1  7   ? 41.712 -1.474  -6.927  1.00 101.01 ? 127 GLN A C     1 
ATOM   15   O  O     . GLN A 1  7   ? 41.167 -0.376  -6.821  1.00 102.58 ? 127 GLN A O     1 
ATOM   16   C  CB    . GLN A 1  7   ? 43.302 -1.958  -8.798  1.00 106.11 ? 127 GLN A CB    1 
ATOM   17   C  CG    . GLN A 1  7   ? 44.189 -3.179  -8.614  1.00 121.15 ? 127 GLN A CG    1 
ATOM   18   C  CD    . GLN A 1  7   ? 43.815 -4.322  -9.540  1.00 105.85 ? 127 GLN A CD    1 
ATOM   19   O  OE1   . GLN A 1  7   ? 42.989 -4.165  -10.439 1.00 108.61 ? 127 GLN A OE1   1 
ATOM   20   N  NE2   . GLN A 1  7   ? 44.422 -5.481  -9.322  1.00 104.48 ? 127 GLN A NE2   1 
ATOM   21   N  N     . TRP A 1  8   ? 42.189 -2.148  -5.884  1.00 96.94  ? 128 TRP A N     1 
ATOM   22   C  CA    . TRP A 1  8   ? 42.162 -1.582  -4.539  1.00 94.67  ? 128 TRP A CA    1 
ATOM   23   C  C     . TRP A 1  8   ? 43.011 -0.315  -4.470  1.00 95.70  ? 128 TRP A C     1 
ATOM   24   O  O     . TRP A 1  8   ? 44.045 -0.211  -5.130  1.00 110.93 ? 128 TRP A O     1 
ATOM   25   C  CB    . TRP A 1  8   ? 42.663 -2.593  -3.500  1.00 89.57  ? 128 TRP A CB    1 
ATOM   26   C  CG    . TRP A 1  8   ? 41.706 -3.707  -3.182  1.00 87.41  ? 128 TRP A CG    1 
ATOM   27   C  CD1   . TRP A 1  8   ? 41.896 -5.041  -3.404  1.00 89.89  ? 128 TRP A CD1   1 
ATOM   28   C  CD2   . TRP A 1  8   ? 40.412 -3.583  -2.581  1.00 86.19  ? 128 TRP A CD2   1 
ATOM   29   N  NE1   . TRP A 1  8   ? 40.802 -5.754  -2.978  1.00 85.13  ? 128 TRP A NE1   1 
ATOM   30   C  CE2   . TRP A 1  8   ? 39.874 -4.881  -2.469  1.00 86.06  ? 128 TRP A CE2   1 
ATOM   31   C  CE3   . TRP A 1  8   ? 39.653 -2.499  -2.125  1.00 86.66  ? 128 TRP A CE3   1 
ATOM   32   C  CZ2   . TRP A 1  8   ? 38.617 -5.125  -1.922  1.00 86.73  ? 128 TRP A CZ2   1 
ATOM   33   C  CZ3   . TRP A 1  8   ? 38.404 -2.743  -1.584  1.00 92.43  ? 128 TRP A CZ3   1 
ATOM   34   C  CH2   . TRP A 1  8   ? 37.899 -4.045  -1.487  1.00 89.82  ? 128 TRP A CH2   1 
ATOM   35   N  N     . ALA A 1  9   ? 42.559 0.647   -3.675  1.00 95.19  ? 129 ALA A N     1 
ATOM   36   C  CA    . ALA A 1  9   ? 43.328 1.857   -3.412  1.00 100.62 ? 129 ALA A CA    1 
ATOM   37   C  C     . ALA A 1  9   ? 43.239 2.213   -1.931  1.00 93.55  ? 129 ALA A C     1 
ATOM   38   O  O     . ALA A 1  9   ? 42.280 1.842   -1.257  1.00 91.05  ? 129 ALA A O     1 
ATOM   39   C  CB    . ALA A 1  9   ? 42.831 3.006   -4.269  1.00 103.33 ? 129 ALA A CB    1 
ATOM   40   N  N     . LEU A 1  10  ? 44.241 2.931   -1.431  1.00 93.86  ? 130 LEU A N     1 
ATOM   41   C  CA    . LEU A 1  10  ? 44.264 3.355   -0.034  1.00 95.46  ? 130 LEU A CA    1 
ATOM   42   C  C     . LEU A 1  10  ? 43.119 4.321   0.253   1.00 98.36  ? 130 LEU A C     1 
ATOM   43   O  O     . LEU A 1  10  ? 42.650 4.429   1.387   1.00 90.29  ? 130 LEU A O     1 
ATOM   44   C  CB    . LEU A 1  10  ? 45.607 4.005   0.309   1.00 92.11  ? 130 LEU A CB    1 
ATOM   45   C  CG    . LEU A 1  10  ? 45.851 4.372   1.773   1.00 97.71  ? 130 LEU A CG    1 
ATOM   46   C  CD1   . LEU A 1  10  ? 45.762 3.138   2.659   1.00 84.21  ? 130 LEU A CD1   1 
ATOM   47   C  CD2   . LEU A 1  10  ? 47.198 5.058   1.937   1.00 103.22 ? 130 LEU A CD2   1 
ATOM   48   N  N     . GLU A 1  11  ? 42.667 5.009   -0.792  1.00 97.38  ? 131 GLU A N     1 
ATOM   49   C  CA    . GLU A 1  11  ? 41.576 5.968   -0.677  1.00 104.18 ? 131 GLU A CA    1 
ATOM   50   C  C     . GLU A 1  11  ? 40.234 5.280   -0.443  1.00 98.23  ? 131 GLU A C     1 
ATOM   51   O  O     . GLU A 1  11  ? 39.252 5.930   -0.096  1.00 99.94  ? 131 GLU A O     1 
ATOM   52   C  CB    . GLU A 1  11  ? 41.492 6.843   -1.935  1.00 106.09 ? 131 GLU A CB    1 
ATOM   53   C  CG    . GLU A 1  11  ? 42.668 7.792   -2.134  1.00 109.22 ? 131 GLU A CG    1 
ATOM   54   C  CD    . GLU A 1  11  ? 43.891 7.113   -2.725  1.00 130.68 ? 131 GLU A CD    1 
ATOM   55   O  OE1   . GLU A 1  11  ? 43.821 5.902   -3.026  1.00 123.10 ? 131 GLU A OE1   1 
ATOM   56   O  OE2   . GLU A 1  11  ? 44.925 7.794   -2.892  1.00 136.40 ? 131 GLU A OE2   1 
ATOM   57   N  N     . ASP A 1  12  ? 40.194 3.966   -0.636  1.00 95.21  ? 132 ASP A N     1 
ATOM   58   C  CA    . ASP A 1  12  ? 38.962 3.208   -0.452  1.00 93.69  ? 132 ASP A CA    1 
ATOM   59   C  C     . ASP A 1  12  ? 38.671 2.923   1.020   1.00 89.57  ? 132 ASP A C     1 
ATOM   60   O  O     . ASP A 1  12  ? 37.581 2.467   1.366   1.00 88.68  ? 132 ASP A O     1 
ATOM   61   C  CB    . ASP A 1  12  ? 39.027 1.890   -1.226  1.00 92.54  ? 132 ASP A CB    1 
ATOM   62   C  CG    . ASP A 1  12  ? 39.132 2.097   -2.727  1.00 96.88  ? 132 ASP A CG    1 
ATOM   63   O  OD1   . ASP A 1  12  ? 38.636 3.129   -3.222  1.00 101.02 ? 132 ASP A OD1   1 
ATOM   64   O  OD2   . ASP A 1  12  ? 39.708 1.224   -3.408  1.00 96.48  ? 132 ASP A OD2   1 
ATOM   65   N  N     . PHE A 1  13  ? 39.642 3.196   1.885   1.00 87.38  ? 133 PHE A N     1 
ATOM   66   C  CA    . PHE A 1  13  ? 39.515 2.837   3.296   1.00 91.60  ? 133 PHE A CA    1 
ATOM   67   C  C     . PHE A 1  13  ? 39.723 4.010   4.247   1.00 91.55  ? 133 PHE A C     1 
ATOM   68   O  O     . PHE A 1  13  ? 40.650 4.802   4.083   1.00 102.10 ? 133 PHE A O     1 
ATOM   69   C  CB    . PHE A 1  13  ? 40.511 1.730   3.650   1.00 80.78  ? 133 PHE A CB    1 
ATOM   70   C  CG    . PHE A 1  13  ? 40.362 0.488   2.820   1.00 86.57  ? 133 PHE A CG    1 
ATOM   71   C  CD1   . PHE A 1  13  ? 39.454 -0.495  3.176   1.00 89.30  ? 133 PHE A CD1   1 
ATOM   72   C  CD2   . PHE A 1  13  ? 41.134 0.301   1.684   1.00 91.56  ? 133 PHE A CD2   1 
ATOM   73   C  CE1   . PHE A 1  13  ? 39.317 -1.641  2.415   1.00 83.10  ? 133 PHE A CE1   1 
ATOM   74   C  CE2   . PHE A 1  13  ? 41.002 -0.842  0.919   1.00 80.79  ? 133 PHE A CE2   1 
ATOM   75   C  CZ    . PHE A 1  13  ? 40.092 -1.814  1.284   1.00 80.30  ? 133 PHE A CZ    1 
ATOM   76   N  N     . GLU A 1  14  ? 38.851 4.110   5.245   1.00 95.11  ? 134 GLU A N     1 
ATOM   77   C  CA    . GLU A 1  14  ? 39.092 4.984   6.385   1.00 88.83  ? 134 GLU A CA    1 
ATOM   78   C  C     . GLU A 1  14  ? 39.893 4.208   7.420   1.00 78.40  ? 134 GLU A C     1 
ATOM   79   O  O     . GLU A 1  14  ? 39.539 3.081   7.760   1.00 77.91  ? 134 GLU A O     1 
ATOM   80   C  CB    . GLU A 1  14  ? 37.781 5.486   6.990   1.00 88.52  ? 134 GLU A CB    1 
ATOM   81   C  CG    . GLU A 1  14  ? 37.074 6.548   6.168   1.00 96.28  ? 134 GLU A CG    1 
ATOM   82   C  CD    . GLU A 1  14  ? 35.841 7.091   6.865   1.00 112.97 ? 134 GLU A CD    1 
ATOM   83   O  OE1   . GLU A 1  14  ? 35.390 6.466   7.848   1.00 117.15 ? 134 GLU A OE1   1 
ATOM   84   O  OE2   . GLU A 1  14  ? 35.325 8.143   6.432   1.00 129.54 ? 134 GLU A OE2   1 
ATOM   85   N  N     . ILE A 1  15  ? 40.975 4.803   7.912   1.00 85.62  ? 135 ILE A N     1 
ATOM   86   C  CA    . ILE A 1  15  ? 41.843 4.124   8.870   1.00 78.75  ? 135 ILE A CA    1 
ATOM   87   C  C     . ILE A 1  15  ? 41.466 4.477   10.304  1.00 71.34  ? 135 ILE A C     1 
ATOM   88   O  O     . ILE A 1  15  ? 41.367 5.650   10.656  1.00 77.84  ? 135 ILE A O     1 
ATOM   89   C  CB    . ILE A 1  15  ? 43.326 4.475   8.639   1.00 78.20  ? 135 ILE A CB    1 
ATOM   90   C  CG1   . ILE A 1  15  ? 43.702 4.268   7.170   1.00 80.81  ? 135 ILE A CG1   1 
ATOM   91   C  CG2   . ILE A 1  15  ? 44.220 3.642   9.550   1.00 72.42  ? 135 ILE A CG2   1 
ATOM   92   C  CD1   . ILE A 1  15  ? 43.450 2.867   6.670   1.00 76.22  ? 135 ILE A CD1   1 
ATOM   93   N  N     . GLY A 1  16  ? 41.257 3.455   11.127  1.00 72.03  ? 136 GLY A N     1 
ATOM   94   C  CA    . GLY A 1  16  ? 40.894 3.658   12.518  1.00 69.41  ? 136 GLY A CA    1 
ATOM   95   C  C     . GLY A 1  16  ? 42.046 3.419   13.474  1.00 82.23  ? 136 GLY A C     1 
ATOM   96   O  O     . GLY A 1  16  ? 43.202 3.687   13.147  1.00 83.16  ? 136 GLY A O     1 
ATOM   97   N  N     . ARG A 1  17  ? 41.725 2.914   14.662  1.00 77.18  ? 137 ARG A N     1 
ATOM   98   C  CA    . ARG A 1  17  ? 42.731 2.640   15.679  1.00 71.68  ? 137 ARG A CA    1 
ATOM   99   C  C     . ARG A 1  17  ? 43.602 1.452   15.285  1.00 62.96  ? 137 ARG A C     1 
ATOM   100  O  O     . ARG A 1  17  ? 43.160 0.570   14.548  1.00 64.97  ? 137 ARG A O     1 
ATOM   101  C  CB    . ARG A 1  17  ? 42.065 2.368   17.033  1.00 72.39  ? 137 ARG A CB    1 
ATOM   102  C  CG    . ARG A 1  17  ? 41.320 1.042   17.092  1.00 69.89  ? 137 ARG A CG    1 
ATOM   103  C  CD    . ARG A 1  17  ? 40.826 0.734   18.492  1.00 68.37  ? 137 ARG A CD    1 
ATOM   104  N  NE    . ARG A 1  17  ? 40.119 -0.543  18.550  1.00 58.75  ? 137 ARG A NE    1 
ATOM   105  C  CZ    . ARG A 1  17  ? 40.690 -1.698  18.877  1.00 61.01  ? 137 ARG A CZ    1 
ATOM   106  N  NH1   . ARG A 1  17  ? 41.979 -1.741  19.184  1.00 62.68  ? 137 ARG A NH1   1 
ATOM   107  N  NH2   . ARG A 1  17  ? 39.969 -2.810  18.904  1.00 59.07  ? 137 ARG A NH2   1 
ATOM   108  N  N     . PRO A 1  18  ? 44.852 1.429   15.771  1.00 77.50  ? 138 PRO A N     1 
ATOM   109  C  CA    . PRO A 1  18  ? 45.715 0.257   15.588  1.00 77.15  ? 138 PRO A CA    1 
ATOM   110  C  C     . PRO A 1  18  ? 45.160 -0.957  16.326  1.00 75.38  ? 138 PRO A C     1 
ATOM   111  O  O     . PRO A 1  18  ? 44.818 -0.851  17.503  1.00 68.74  ? 138 PRO A O     1 
ATOM   112  C  CB    . PRO A 1  18  ? 47.052 0.701   16.193  1.00 68.12  ? 138 PRO A CB    1 
ATOM   113  C  CG    . PRO A 1  18  ? 47.003 2.195   16.186  1.00 77.89  ? 138 PRO A CG    1 
ATOM   114  C  CD    . PRO A 1  18  ? 45.567 2.544   16.416  1.00 73.31  ? 138 PRO A CD    1 
ATOM   115  N  N     . LEU A 1  19  ? 45.063 -2.088  15.637  1.00 73.92  ? 139 LEU A N     1 
ATOM   116  C  CA    . LEU A 1  19  ? 44.574 -3.317  16.249  1.00 68.29  ? 139 LEU A CA    1 
ATOM   117  C  C     . LEU A 1  19  ? 45.717 -4.082  16.905  1.00 76.69  ? 139 LEU A C     1 
ATOM   118  O  O     . LEU A 1  19  ? 45.504 -4.863  17.833  1.00 82.99  ? 139 LEU A O     1 
ATOM   119  C  CB    . LEU A 1  19  ? 43.874 -4.196  15.211  1.00 75.08  ? 139 LEU A CB    1 
ATOM   120  C  CG    . LEU A 1  19  ? 42.574 -3.639  14.626  1.00 74.03  ? 139 LEU A CG    1 
ATOM   121  C  CD1   . LEU A 1  19  ? 42.031 -4.559  13.543  1.00 63.44  ? 139 LEU A CD1   1 
ATOM   122  C  CD2   . LEU A 1  19  ? 41.543 -3.437  15.727  1.00 65.04  ? 139 LEU A CD2   1 
ATOM   123  N  N     . GLY A 1  20  ? 46.932 -3.849  16.417  1.00 66.43  ? 140 GLY A N     1 
ATOM   124  C  CA    . GLY A 1  20  ? 48.109 -4.492  16.969  1.00 59.91  ? 140 GLY A CA    1 
ATOM   125  C  C     . GLY A 1  20  ? 49.376 -4.119  16.227  1.00 67.63  ? 140 GLY A C     1 
ATOM   126  O  O     . GLY A 1  20  ? 49.330 -3.669  15.081  1.00 72.17  ? 140 GLY A O     1 
ATOM   127  N  N     . LYS A 1  21  ? 50.514 -4.304  16.887  1.00 68.94  ? 141 LYS A N     1 
ATOM   128  C  CA    . LYS A 1  21  ? 51.806 -4.010  16.283  1.00 69.48  ? 141 LYS A CA    1 
ATOM   129  C  C     . LYS A 1  21  ? 52.433 -5.277  15.715  1.00 81.85  ? 141 LYS A C     1 
ATOM   130  O  O     . LYS A 1  21  ? 52.287 -6.360  16.282  1.00 81.94  ? 141 LYS A O     1 
ATOM   131  C  CB    . LYS A 1  21  ? 52.746 -3.365  17.304  1.00 69.41  ? 141 LYS A CB    1 
ATOM   132  N  N     . GLY A 1  22  ? 53.126 -5.136  14.591  1.00 85.70  ? 142 GLY A N     1 
ATOM   133  C  CA    . GLY A 1  22  ? 53.770 -6.265  13.948  1.00 87.23  ? 142 GLY A CA    1 
ATOM   134  C  C     . GLY A 1  22  ? 55.259 -6.046  13.777  1.00 92.99  ? 142 GLY A C     1 
ATOM   135  O  O     . GLY A 1  22  ? 55.799 -5.024  14.202  1.00 92.54  ? 142 GLY A O     1 
ATOM   136  N  N     . LYS A 1  23  ? 55.924 -7.007  13.146  1.00 89.19  ? 143 LYS A N     1 
ATOM   137  C  CA    . LYS A 1  23  ? 57.372 -6.960  12.987  1.00 90.38  ? 143 LYS A CA    1 
ATOM   138  C  C     . LYS A 1  23  ? 57.800 -6.012  11.871  1.00 98.99  ? 143 LYS A C     1 
ATOM   139  O  O     . LYS A 1  23  ? 58.947 -5.568  11.833  1.00 107.79 ? 143 LYS A O     1 
ATOM   140  C  CB    . LYS A 1  23  ? 57.921 -8.363  12.716  1.00 85.60  ? 143 LYS A CB    1 
ATOM   141  N  N     . PHE A 1  24  ? 56.877 -5.704  10.965  1.00 95.83  ? 144 PHE A N     1 
ATOM   142  C  CA    . PHE A 1  24  ? 57.197 -4.877  9.806   1.00 89.04  ? 144 PHE A CA    1 
ATOM   143  C  C     . PHE A 1  24  ? 56.155 -3.790  9.567   1.00 87.55  ? 144 PHE A C     1 
ATOM   144  O  O     . PHE A 1  24  ? 56.151 -3.141  8.522   1.00 91.27  ? 144 PHE A O     1 
ATOM   145  C  CB    . PHE A 1  24  ? 57.334 -5.749  8.558   1.00 89.56  ? 144 PHE A CB    1 
ATOM   146  C  CG    . PHE A 1  24  ? 58.379 -6.819  8.679   1.00 93.21  ? 144 PHE A CG    1 
ATOM   147  C  CD1   . PHE A 1  24  ? 59.701 -6.554  8.360   1.00 94.02  ? 144 PHE A CD1   1 
ATOM   148  C  CD2   . PHE A 1  24  ? 58.041 -8.090  9.111   1.00 88.38  ? 144 PHE A CD2   1 
ATOM   149  C  CE1   . PHE A 1  24  ? 60.665 -7.537  8.470   1.00 97.96  ? 144 PHE A CE1   1 
ATOM   150  C  CE2   . PHE A 1  24  ? 59.002 -9.076  9.223   1.00 91.80  ? 144 PHE A CE2   1 
ATOM   151  C  CZ    . PHE A 1  24  ? 60.315 -8.799  8.902   1.00 95.85  ? 144 PHE A CZ    1 
ATOM   152  N  N     . GLY A 1  25  ? 55.273 -3.595  10.541  1.00 86.87  ? 145 GLY A N     1 
ATOM   153  C  CA    . GLY A 1  25  ? 54.233 -2.590  10.434  1.00 84.66  ? 145 GLY A CA    1 
ATOM   154  C  C     . GLY A 1  25  ? 53.043 -2.912  11.313  1.00 83.27  ? 145 GLY A C     1 
ATOM   155  O  O     . GLY A 1  25  ? 53.019 -3.941  11.984  1.00 83.22  ? 145 GLY A O     1 
ATOM   156  N  N     . ASN A 1  26  ? 52.048 -2.033  11.307  1.00 74.17  ? 146 ASN A N     1 
ATOM   157  C  CA    . ASN A 1  26  ? 50.887 -2.199  12.172  1.00 67.60  ? 146 ASN A CA    1 
ATOM   158  C  C     . ASN A 1  26  ? 49.649 -2.688  11.430  1.00 71.96  ? 146 ASN A C     1 
ATOM   159  O  O     . ASN A 1  26  ? 49.530 -2.528  10.213  1.00 64.93  ? 146 ASN A O     1 
ATOM   160  C  CB    . ASN A 1  26  ? 50.571 -0.883  12.883  1.00 79.25  ? 146 ASN A CB    1 
ATOM   161  C  CG    . ASN A 1  26  ? 51.667 -0.459  13.840  1.00 99.46  ? 146 ASN A CG    1 
ATOM   162  O  OD1   . ASN A 1  26  ? 52.802 -0.927  13.749  1.00 105.26 ? 146 ASN A OD1   1 
ATOM   163  N  ND2   . ASN A 1  26  ? 51.332 0.430   14.768  1.00 104.78 ? 146 ASN A ND2   1 
ATOM   164  N  N     . VAL A 1  27  ? 48.736 -3.297  12.180  1.00 67.99  ? 147 VAL A N     1 
ATOM   165  C  CA    . VAL A 1  27  ? 47.433 -3.693  11.660  1.00 67.72  ? 147 VAL A CA    1 
ATOM   166  C  C     . VAL A 1  27  ? 46.377 -2.733  12.186  1.00 70.43  ? 147 VAL A C     1 
ATOM   167  O  O     . VAL A 1  27  ? 46.234 -2.557  13.396  1.00 71.28  ? 147 VAL A O     1 
ATOM   168  C  CB    . VAL A 1  27  ? 47.065 -5.135  12.057  1.00 63.36  ? 147 VAL A CB    1 
ATOM   169  C  CG1   . VAL A 1  27  ? 45.618 -5.437  11.690  1.00 54.46  ? 147 VAL A CG1   1 
ATOM   170  C  CG2   . VAL A 1  27  ? 48.006 -6.121  11.392  1.00 69.09  ? 147 VAL A CG2   1 
ATOM   171  N  N     . TYR A 1  28  ? 45.642 -2.110  11.274  1.00 71.07  ? 148 TYR A N     1 
ATOM   172  C  CA    . TYR A 1  28  ? 44.685 -1.079  11.649  1.00 69.57  ? 148 TYR A CA    1 
ATOM   173  C  C     . TYR A 1  28  ? 43.245 -1.527  11.441  1.00 74.25  ? 148 TYR A C     1 
ATOM   174  O  O     . TYR A 1  28  ? 42.961 -2.373  10.593  1.00 71.24  ? 148 TYR A O     1 
ATOM   175  C  CB    . TYR A 1  28  ? 44.946 0.200   10.850  1.00 75.86  ? 148 TYR A CB    1 
ATOM   176  C  CG    . TYR A 1  28  ? 46.310 0.810   11.085  1.00 74.47  ? 148 TYR A CG    1 
ATOM   177  C  CD1   . TYR A 1  28  ? 47.405 0.432   10.317  1.00 82.11  ? 148 TYR A CD1   1 
ATOM   178  C  CD2   . TYR A 1  28  ? 46.500 1.771   12.069  1.00 75.10  ? 148 TYR A CD2   1 
ATOM   179  C  CE1   . TYR A 1  28  ? 48.653 0.991   10.528  1.00 86.08  ? 148 TYR A CE1   1 
ATOM   180  C  CE2   . TYR A 1  28  ? 47.742 2.335   12.286  1.00 69.99  ? 148 TYR A CE2   1 
ATOM   181  C  CZ    . TYR A 1  28  ? 48.814 1.942   11.516  1.00 74.22  ? 148 TYR A CZ    1 
ATOM   182  O  OH    . TYR A 1  28  ? 50.051 2.505   11.734  1.00 85.74  ? 148 TYR A OH    1 
ATOM   183  N  N     . LEU A 1  29  ? 42.340 -0.956  12.229  1.00 77.17  ? 149 LEU A N     1 
ATOM   184  C  CA    . LEU A 1  29  ? 40.914 -1.130  11.999  1.00 74.82  ? 149 LEU A CA    1 
ATOM   185  C  C     . LEU A 1  29  ? 40.523 -0.294  10.785  1.00 72.19  ? 149 LEU A C     1 
ATOM   186  O  O     . LEU A 1  29  ? 40.927 0.862   10.670  1.00 72.73  ? 149 LEU A O     1 
ATOM   187  C  CB    . LEU A 1  29  ? 40.107 -0.721  13.232  1.00 66.00  ? 149 LEU A CB    1 
ATOM   188  C  CG    . LEU A 1  29  ? 38.603 -0.991  13.177  1.00 73.89  ? 149 LEU A CG    1 
ATOM   189  C  CD1   . LEU A 1  29  ? 38.347 -2.461  12.902  1.00 81.05  ? 149 LEU A CD1   1 
ATOM   190  C  CD2   . LEU A 1  29  ? 37.936 -0.567  14.471  1.00 80.27  ? 149 LEU A CD2   1 
ATOM   191  N  N     . ALA A 1  30  ? 39.745 -0.876  9.880   1.00 74.18  ? 150 ALA A N     1 
ATOM   192  C  CA    . ALA A 1  30  ? 39.478 -0.226  8.601   1.00 70.21  ? 150 ALA A CA    1 
ATOM   193  C  C     . ALA A 1  30  ? 37.997 -0.218  8.230   1.00 78.36  ? 150 ALA A C     1 
ATOM   194  O  O     . ALA A 1  30  ? 37.233 -1.085  8.654   1.00 76.26  ? 150 ALA A O     1 
ATOM   195  C  CB    . ALA A 1  30  ? 40.288 -0.898  7.503   1.00 61.73  ? 150 ALA A CB    1 
ATOM   196  N  N     . ARG A 1  31  ? 37.610 0.770   7.428   1.00 81.07  ? 151 ARG A N     1 
ATOM   197  C  CA    . ARG A 1  31  ? 36.238 0.909   6.954   1.00 81.98  ? 151 ARG A CA    1 
ATOM   198  C  C     . ARG A 1  31  ? 36.213 1.187   5.453   1.00 87.76  ? 151 ARG A C     1 
ATOM   199  O  O     . ARG A 1  31  ? 36.702 2.222   5.000   1.00 90.93  ? 151 ARG A O     1 
ATOM   200  C  CB    . ARG A 1  31  ? 35.526 2.035   7.704   1.00 81.99  ? 151 ARG A CB    1 
ATOM   201  C  CG    . ARG A 1  31  ? 34.014 1.908   7.763   1.00 106.27 ? 151 ARG A CG    1 
ATOM   202  C  CD    . ARG A 1  31  ? 33.482 2.509   9.054   1.00 113.58 ? 151 ARG A CD    1 
ATOM   203  N  NE    . ARG A 1  31  ? 32.408 1.707   9.631   1.00 117.38 ? 151 ARG A NE    1 
ATOM   204  C  CZ    . ARG A 1  31  ? 31.791 1.998   10.772  1.00 123.55 ? 151 ARG A CZ    1 
ATOM   205  N  NH1   . ARG A 1  31  ? 30.826 1.211   11.227  1.00 132.66 ? 151 ARG A NH1   1 
ATOM   206  N  NH2   . ARG A 1  31  ? 32.146 3.073   11.463  1.00 122.79 ? 151 ARG A NH2   1 
ATOM   207  N  N     . GLU A 1  32  ? 35.655 0.260   4.680   1.00 74.09  ? 152 GLU A N     1 
ATOM   208  C  CA    . GLU A 1  32  ? 35.483 0.480   3.247   1.00 84.22  ? 152 GLU A CA    1 
ATOM   209  C  C     . GLU A 1  32  ? 34.464 1.594   3.046   1.00 91.83  ? 152 GLU A C     1 
ATOM   210  O  O     . GLU A 1  32  ? 33.296 1.442   3.395   1.00 96.62  ? 152 GLU A O     1 
ATOM   211  C  CB    . GLU A 1  32  ? 35.037 -0.804  2.543   1.00 76.01  ? 152 GLU A CB    1 
ATOM   212  C  CG    . GLU A 1  32  ? 35.265 -0.807  1.031   1.00 84.10  ? 152 GLU A CG    1 
ATOM   213  C  CD    . GLU A 1  32  ? 34.235 0.008   0.269   1.00 94.67  ? 152 GLU A CD    1 
ATOM   214  O  OE1   . GLU A 1  32  ? 33.030 -0.114  0.573   1.00 97.11  ? 152 GLU A OE1   1 
ATOM   215  O  OE2   . GLU A 1  32  ? 34.631 0.775   -0.634  1.00 107.91 ? 152 GLU A OE2   1 
ATOM   216  N  N     . LYS A 1  33  ? 34.917 2.708   2.477   1.00 92.13  ? 153 LYS A N     1 
ATOM   217  C  CA    . LYS A 1  33  ? 34.135 3.943   2.441   1.00 98.36  ? 153 LYS A CA    1 
ATOM   218  C  C     . LYS A 1  33  ? 32.759 3.812   1.788   1.00 102.26 ? 153 LYS A C     1 
ATOM   219  O  O     . LYS A 1  33  ? 31.810 4.477   2.203   1.00 110.11 ? 153 LYS A O     1 
ATOM   220  C  CB    . LYS A 1  33  ? 34.929 5.037   1.725   1.00 107.86 ? 153 LYS A CB    1 
ATOM   221  C  CG    . LYS A 1  33  ? 36.163 5.497   2.482   1.00 100.06 ? 153 LYS A CG    1 
ATOM   222  C  CD    . LYS A 1  33  ? 36.810 6.693   1.805   1.00 97.16  ? 153 LYS A CD    1 
ATOM   223  C  CE    . LYS A 1  33  ? 38.025 7.175   2.579   1.00 93.95  ? 153 LYS A CE    1 
ATOM   224  N  NZ    . LYS A 1  33  ? 38.723 8.285   1.873   1.00 101.12 ? 153 LYS A NZ    1 
ATOM   225  N  N     . GLN A 1  34  ? 32.645 2.961   0.774   1.00 94.03  ? 154 GLN A N     1 
ATOM   226  C  CA    . GLN A 1  34  ? 31.388 2.837   0.043   1.00 100.59 ? 154 GLN A CA    1 
ATOM   227  C  C     . GLN A 1  34  ? 30.364 1.972   0.778   1.00 97.57  ? 154 GLN A C     1 
ATOM   228  O  O     . GLN A 1  34  ? 29.223 2.388   0.977   1.00 102.14 ? 154 GLN A O     1 
ATOM   229  C  CB    . GLN A 1  34  ? 31.640 2.275   -1.360  1.00 102.70 ? 154 GLN A CB    1 
ATOM   230  C  CG    . GLN A 1  34  ? 32.399 3.223   -2.279  1.00 99.86  ? 154 GLN A CG    1 
ATOM   231  C  CD    . GLN A 1  34  ? 32.441 2.740   -3.717  1.00 116.33 ? 154 GLN A CD    1 
ATOM   232  O  OE1   . GLN A 1  34  ? 31.857 1.711   -4.057  1.00 119.99 ? 154 GLN A OE1   1 
ATOM   233  N  NE2   . GLN A 1  34  ? 33.134 3.485   -4.572  1.00 110.74 ? 154 GLN A NE2   1 
ATOM   234  N  N     . SER A 1  35  ? 30.772 0.774   1.184   1.00 95.23  ? 155 SER A N     1 
ATOM   235  C  CA    . SER A 1  35  ? 29.850 -0.169  1.813   1.00 106.06 ? 155 SER A CA    1 
ATOM   236  C  C     . SER A 1  35  ? 29.850 -0.075  3.338   1.00 109.86 ? 155 SER A C     1 
ATOM   237  O  O     . SER A 1  35  ? 29.065 -0.755  4.001   1.00 110.33 ? 155 SER A O     1 
ATOM   238  C  CB    . SER A 1  35  ? 30.187 -1.600  1.390   1.00 103.38 ? 155 SER A CB    1 
ATOM   239  O  OG    . SER A 1  35  ? 31.470 -1.979  1.857   1.00 95.42  ? 155 SER A OG    1 
ATOM   240  N  N     . LYS A 1  36  ? 30.733 0.762   3.880   1.00 102.40 ? 156 LYS A N     1 
ATOM   241  C  CA    . LYS A 1  36  ? 30.882 0.933   5.327   1.00 93.46  ? 156 LYS A CA    1 
ATOM   242  C  C     . LYS A 1  36  ? 31.206 -0.391  6.019   1.00 93.94  ? 156 LYS A C     1 
ATOM   243  O  O     . LYS A 1  36  ? 30.854 -0.601  7.180   1.00 93.55  ? 156 LYS A O     1 
ATOM   244  C  CB    . LYS A 1  36  ? 29.619 1.555   5.932   1.00 96.99  ? 156 LYS A CB    1 
ATOM   245  N  N     . PHE A 1  37  ? 31.887 -1.275  5.296   1.00 81.82  ? 157 PHE A N     1 
ATOM   246  C  CA    . PHE A 1  37  ? 32.219 -2.601  5.804   1.00 80.42  ? 157 PHE A CA    1 
ATOM   247  C  C     . PHE A 1  37  ? 33.493 -2.570  6.642   1.00 81.15  ? 157 PHE A C     1 
ATOM   248  O  O     . PHE A 1  37  ? 34.528 -2.074  6.197   1.00 83.37  ? 157 PHE A O     1 
ATOM   249  C  CB    . PHE A 1  37  ? 32.370 -3.589  4.644   1.00 87.02  ? 157 PHE A CB    1 
ATOM   250  C  CG    . PHE A 1  37  ? 32.443 -5.028  5.074   1.00 91.58  ? 157 PHE A CG    1 
ATOM   251  C  CD1   . PHE A 1  37  ? 31.303 -5.698  5.488   1.00 98.34  ? 157 PHE A CD1   1 
ATOM   252  C  CD2   . PHE A 1  37  ? 33.646 -5.714  5.049   1.00 84.80  ? 157 PHE A CD2   1 
ATOM   253  C  CE1   . PHE A 1  37  ? 31.364 -7.022  5.879   1.00 97.79  ? 157 PHE A CE1   1 
ATOM   254  C  CE2   . PHE A 1  37  ? 33.712 -7.040  5.439   1.00 77.02  ? 157 PHE A CE2   1 
ATOM   255  C  CZ    . PHE A 1  37  ? 32.570 -7.694  5.854   1.00 86.49  ? 157 PHE A CZ    1 
ATOM   256  N  N     . ILE A 1  38  ? 33.406 -3.107  7.856   1.00 75.79  ? 158 ILE A N     1 
ATOM   257  C  CA    . ILE A 1  38  ? 34.524 -3.092  8.794   1.00 72.02  ? 158 ILE A CA    1 
ATOM   258  C  C     . ILE A 1  38  ? 35.561 -4.159  8.471   1.00 66.33  ? 158 ILE A C     1 
ATOM   259  O  O     . ILE A 1  38  ? 35.241 -5.345  8.385   1.00 66.79  ? 158 ILE A O     1 
ATOM   260  C  CB    . ILE A 1  38  ? 34.049 -3.299  10.244  1.00 71.20  ? 158 ILE A CB    1 
ATOM   261  C  CG1   . ILE A 1  38  ? 33.244 -2.092  10.719  1.00 105.58 ? 158 ILE A CG1   1 
ATOM   262  C  CG2   . ILE A 1  38  ? 35.240 -3.491  11.158  1.00 67.62  ? 158 ILE A CG2   1 
ATOM   263  C  CD1   . ILE A 1  38  ? 34.077 -0.838  10.875  1.00 110.25 ? 158 ILE A CD1   1 
ATOM   264  N  N     . LEU A 1  39  ? 36.808 -3.731  8.308   1.00 66.06  ? 159 LEU A N     1 
ATOM   265  C  CA    . LEU A 1  39  ? 37.894 -4.645  7.984   1.00 62.16  ? 159 LEU A CA    1 
ATOM   266  C  C     . LEU A 1  39  ? 39.126 -4.393  8.847   1.00 57.32  ? 159 LEU A C     1 
ATOM   267  O  O     . LEU A 1  39  ? 39.159 -3.463  9.652   1.00 63.08  ? 159 LEU A O     1 
ATOM   268  C  CB    . LEU A 1  39  ? 38.265 -4.525  6.501   1.00 70.25  ? 159 LEU A CB    1 
ATOM   269  C  CG    . LEU A 1  39  ? 37.205 -4.954  5.485   1.00 77.16  ? 159 LEU A CG    1 
ATOM   270  C  CD1   . LEU A 1  39  ? 37.461 -4.321  4.125   1.00 67.76  ? 159 LEU A CD1   1 
ATOM   271  C  CD2   . LEU A 1  39  ? 37.182 -6.468  5.371   1.00 86.30  ? 159 LEU A CD2   1 
ATOM   272  N  N     . ALA A 1  40  ? 40.133 -5.242  8.677   1.00 59.87  ? 160 ALA A N     1 
ATOM   273  C  CA    . ALA A 1  40  ? 41.435 -5.024  9.289   1.00 60.64  ? 160 ALA A CA    1 
ATOM   274  C  C     . ALA A 1  40  ? 42.470 -4.836  8.188   1.00 69.08  ? 160 ALA A C     1 
ATOM   275  O  O     . ALA A 1  40  ? 42.543 -5.635  7.253   1.00 62.68  ? 160 ALA A O     1 
ATOM   276  C  CB    . ALA A 1  40  ? 41.812 -6.186  10.196  1.00 59.47  ? 160 ALA A CB    1 
ATOM   277  N  N     . LEU A 1  41  ? 43.258 -3.771  8.290   1.00 71.61  ? 161 LEU A N     1 
ATOM   278  C  CA    . LEU A 1  41  ? 44.246 -3.462  7.264   1.00 62.36  ? 161 LEU A CA    1 
ATOM   279  C  C     . LEU A 1  41  ? 45.664 -3.653  7.790   1.00 72.93  ? 161 LEU A C     1 
ATOM   280  O  O     . LEU A 1  41  ? 46.128 -2.903  8.650   1.00 72.26  ? 161 LEU A O     1 
ATOM   281  C  CB    . LEU A 1  41  ? 44.057 -2.031  6.751   1.00 61.31  ? 161 LEU A CB    1 
ATOM   282  C  CG    . LEU A 1  41  ? 44.807 -1.664  5.470   1.00 73.39  ? 161 LEU A CG    1 
ATOM   283  C  CD1   . LEU A 1  41  ? 44.454 -2.629  4.349   1.00 74.03  ? 161 LEU A CD1   1 
ATOM   284  C  CD2   . LEU A 1  41  ? 44.498 -0.232  5.056   1.00 72.03  ? 161 LEU A CD2   1 
ATOM   285  N  N     . LYS A 1  42  ? 46.344 -4.667  7.266   1.00 71.87  ? 162 LYS A N     1 
ATOM   286  C  CA    . LYS A 1  42  ? 47.713 -4.962  7.663   1.00 61.53  ? 162 LYS A CA    1 
ATOM   287  C  C     . LYS A 1  42  ? 48.697 -4.212  6.773   1.00 67.71  ? 162 LYS A C     1 
ATOM   288  O  O     . LYS A 1  42  ? 48.778 -4.458  5.568   1.00 64.38  ? 162 LYS A O     1 
ATOM   289  C  CB    . LYS A 1  42  ? 47.972 -6.468  7.608   1.00 66.96  ? 162 LYS A CB    1 
ATOM   290  C  CG    . LYS A 1  42  ? 49.336 -6.893  8.125   1.00 61.81  ? 162 LYS A CG    1 
ATOM   291  C  CD    . LYS A 1  42  ? 49.416 -8.405  8.243   1.00 65.61  ? 162 LYS A CD    1 
ATOM   292  C  CE    . LYS A 1  42  ? 50.766 -8.852  8.773   1.00 67.51  ? 162 LYS A CE    1 
ATOM   293  N  NZ    . LYS A 1  42  ? 50.816 -10.331 8.965   1.00 58.38  ? 162 LYS A NZ    1 
ATOM   294  N  N     . VAL A 1  43  ? 49.437 -3.289  7.378   1.00 70.64  ? 163 VAL A N     1 
ATOM   295  C  CA    . VAL A 1  43  ? 50.367 -2.442  6.644   1.00 73.85  ? 163 VAL A CA    1 
ATOM   296  C  C     . VAL A 1  43  ? 51.810 -2.886  6.859   1.00 79.31  ? 163 VAL A C     1 
ATOM   297  O  O     . VAL A 1  43  ? 52.272 -2.988  7.995   1.00 89.31  ? 163 VAL A O     1 
ATOM   298  C  CB    . VAL A 1  43  ? 50.229 -0.968  7.063   1.00 75.21  ? 163 VAL A CB    1 
ATOM   299  C  CG1   . VAL A 1  43  ? 51.217 -0.103  6.295   1.00 75.74  ? 163 VAL A CG1   1 
ATOM   300  C  CG2   . VAL A 1  43  ? 48.802 -0.488  6.847   1.00 79.19  ? 163 VAL A CG2   1 
ATOM   301  N  N     . LEU A 1  44  ? 52.515 -3.146  5.763   1.00 67.27  ? 164 LEU A N     1 
ATOM   302  C  CA    . LEU A 1  44  ? 53.909 -3.573  5.824   1.00 76.00  ? 164 LEU A CA    1 
ATOM   303  C  C     . LEU A 1  44  ? 54.802 -2.666  4.987   1.00 81.08  ? 164 LEU A C     1 
ATOM   304  O  O     . LEU A 1  44  ? 54.558 -2.474  3.799   1.00 81.32  ? 164 LEU A O     1 
ATOM   305  C  CB    . LEU A 1  44  ? 54.050 -5.016  5.341   1.00 75.48  ? 164 LEU A CB    1 
ATOM   306  C  CG    . LEU A 1  44  ? 53.133 -6.058  5.976   1.00 71.61  ? 164 LEU A CG    1 
ATOM   307  C  CD1   . LEU A 1  44  ? 53.397 -7.418  5.364   1.00 66.00  ? 164 LEU A CD1   1 
ATOM   308  C  CD2   . LEU A 1  44  ? 53.329 -6.099  7.482   1.00 80.00  ? 164 LEU A CD2   1 
ATOM   309  N  N     . PHE A 1  45  ? 55.841 -2.117  5.609   1.00 90.66  ? 165 PHE A N     1 
ATOM   310  C  CA    . PHE A 1  45  ? 56.788 -1.263  4.900   1.00 88.96  ? 165 PHE A CA    1 
ATOM   311  C  C     . PHE A 1  45  ? 57.737 -2.100  4.048   1.00 94.02  ? 165 PHE A C     1 
ATOM   312  O  O     . PHE A 1  45  ? 58.352 -3.047  4.538   1.00 101.98 ? 165 PHE A O     1 
ATOM   313  C  CB    . PHE A 1  45  ? 57.579 -0.403  5.886   1.00 92.86  ? 165 PHE A CB    1 
ATOM   314  C  CG    . PHE A 1  45  ? 56.721 0.506   6.718   1.00 105.79 ? 165 PHE A CG    1 
ATOM   315  C  CD1   . PHE A 1  45  ? 56.403 1.779   6.274   1.00 111.95 ? 165 PHE A CD1   1 
ATOM   316  C  CD2   . PHE A 1  45  ? 56.230 0.087   7.944   1.00 101.78 ? 165 PHE A CD2   1 
ATOM   317  C  CE1   . PHE A 1  45  ? 55.614 2.618   7.038   1.00 115.07 ? 165 PHE A CE1   1 
ATOM   318  C  CE2   . PHE A 1  45  ? 55.439 0.921   8.712   1.00 109.64 ? 165 PHE A CE2   1 
ATOM   319  C  CZ    . PHE A 1  45  ? 55.130 2.188   8.258   1.00 112.53 ? 165 PHE A CZ    1 
ATOM   320  N  N     . LYS A 1  46  ? 57.850 -1.745  2.772   1.00 96.54  ? 166 LYS A N     1 
ATOM   321  C  CA    . LYS A 1  46  ? 58.680 -2.495  1.836   1.00 92.78  ? 166 LYS A CA    1 
ATOM   322  C  C     . LYS A 1  46  ? 60.159 -2.425  2.196   1.00 95.53  ? 166 LYS A C     1 
ATOM   323  O  O     . LYS A 1  46  ? 60.911 -3.364  1.940   1.00 98.34  ? 166 LYS A O     1 
ATOM   324  C  CB    . LYS A 1  46  ? 58.468 -1.985  0.410   1.00 100.03 ? 166 LYS A CB    1 
ATOM   325  C  CG    . LYS A 1  46  ? 57.050 -2.164  -0.099  1.00 95.85  ? 166 LYS A CG    1 
ATOM   326  C  CD    . LYS A 1  46  ? 56.940 -1.799  -1.567  1.00 93.55  ? 166 LYS A CD    1 
ATOM   327  C  CE    . LYS A 1  46  ? 55.539 -2.067  -2.088  1.00 90.46  ? 166 LYS A CE    1 
ATOM   328  N  NZ    . LYS A 1  46  ? 55.447 -1.859  -3.555  1.00 85.88  ? 166 LYS A NZ    1 
ATOM   329  N  N     . ALA A 1  47  ? 60.570 -1.310  2.791   1.00 95.30  ? 167 ALA A N     1 
ATOM   330  C  CA    . ALA A 1  47  ? 61.962 -1.118  3.179   1.00 93.70  ? 167 ALA A CA    1 
ATOM   331  C  C     . ALA A 1  47  ? 62.396 -2.138  4.231   1.00 88.08  ? 167 ALA A C     1 
ATOM   332  O  O     . ALA A 1  47  ? 63.476 -2.719  4.133   1.00 93.17  ? 167 ALA A O     1 
ATOM   333  C  CB    . ALA A 1  47  ? 62.177 0.297   3.692   1.00 91.23  ? 167 ALA A CB    1 
ATOM   334  N  N     . GLN A 1  48  ? 61.548 -2.358  5.231   1.00 83.59  ? 168 GLN A N     1 
ATOM   335  C  CA    . GLN A 1  48  ? 61.858 -3.302  6.301   1.00 81.26  ? 168 GLN A CA    1 
ATOM   336  C  C     . GLN A 1  48  ? 61.836 -4.745  5.803   1.00 80.90  ? 168 GLN A C     1 
ATOM   337  O  O     . GLN A 1  48  ? 62.668 -5.561  6.200   1.00 82.96  ? 168 GLN A O     1 
ATOM   338  C  CB    . GLN A 1  48  ? 60.878 -3.135  7.465   1.00 78.64  ? 168 GLN A CB    1 
ATOM   339  C  CG    . GLN A 1  48  ? 60.959 -1.783  8.157   1.00 86.14  ? 168 GLN A CG    1 
ATOM   340  N  N     . LEU A 1  49  ? 60.880 -5.052  4.932   1.00 79.31  ? 169 LEU A N     1 
ATOM   341  C  CA    . LEU A 1  49  ? 60.745 -6.391  4.370   1.00 83.95  ? 169 LEU A CA    1 
ATOM   342  C  C     . LEU A 1  49  ? 61.945 -6.777  3.512   1.00 90.68  ? 169 LEU A C     1 
ATOM   343  O  O     . LEU A 1  49  ? 62.486 -7.875  3.641   1.00 96.11  ? 169 LEU A O     1 
ATOM   344  C  CB    . LEU A 1  49  ? 59.467 -6.490  3.538   1.00 94.03  ? 169 LEU A CB    1 
ATOM   345  C  CG    . LEU A 1  49  ? 58.153 -6.398  4.311   1.00 90.29  ? 169 LEU A CG    1 
ATOM   346  C  CD1   . LEU A 1  49  ? 56.983 -6.299  3.349   1.00 90.14  ? 169 LEU A CD1   1 
ATOM   347  C  CD2   . LEU A 1  49  ? 57.996 -7.596  5.233   1.00 91.30  ? 169 LEU A CD2   1 
ATOM   348  N  N     . GLU A 1  50  ? 62.354 -5.868  2.633   1.00 95.39  ? 170 GLU A N     1 
ATOM   349  C  CA    . GLU A 1  50  ? 63.464 -6.128  1.724   1.00 93.04  ? 170 GLU A CA    1 
ATOM   350  C  C     . GLU A 1  50  ? 64.801 -6.141  2.457   1.00 98.41  ? 170 GLU A C     1 
ATOM   351  O  O     . GLU A 1  50  ? 65.736 -6.824  2.042   1.00 112.91 ? 170 GLU A O     1 
ATOM   352  C  CB    . GLU A 1  50  ? 63.486 -5.089  0.602   1.00 97.55  ? 170 GLU A CB    1 
ATOM   353  C  CG    . GLU A 1  50  ? 62.283 -5.166  -0.321  1.00 102.57 ? 170 GLU A CG    1 
ATOM   354  C  CD    . GLU A 1  50  ? 62.190 -3.984  -1.262  1.00 111.92 ? 170 GLU A CD    1 
ATOM   355  O  OE1   . GLU A 1  50  ? 63.117 -3.147  -1.263  1.00 127.81 ? 170 GLU A OE1   1 
ATOM   356  O  OE2   . GLU A 1  50  ? 61.185 -3.890  -1.997  1.00 112.04 ? 170 GLU A OE2   1 
ATOM   357  N  N     . LYS A 1  51  ? 64.886 -5.385  3.546   1.00 99.13  ? 171 LYS A N     1 
ATOM   358  C  CA    . LYS A 1  51  ? 66.100 -5.350  4.352   1.00 102.54 ? 171 LYS A CA    1 
ATOM   359  C  C     . LYS A 1  51  ? 66.302 -6.676  5.075   1.00 97.16  ? 171 LYS A C     1 
ATOM   360  O  O     . LYS A 1  51  ? 67.410 -7.210  5.118   1.00 102.96 ? 171 LYS A O     1 
ATOM   361  C  CB    . LYS A 1  51  ? 66.048 -4.200  5.360   1.00 100.53 ? 171 LYS A CB    1 
ATOM   362  N  N     . ALA A 1  52  ? 65.220 -7.205  5.639   1.00 96.41  ? 172 ALA A N     1 
ATOM   363  C  CA    . ALA A 1  52  ? 65.266 -8.476  6.350   1.00 89.71  ? 172 ALA A CA    1 
ATOM   364  C  C     . ALA A 1  52  ? 65.233 -9.652  5.380   1.00 97.63  ? 172 ALA A C     1 
ATOM   365  O  O     . ALA A 1  52  ? 65.509 -10.790 5.761   1.00 100.21 ? 172 ALA A O     1 
ATOM   366  C  CB    . ALA A 1  52  ? 64.113 -8.572  7.337   1.00 85.05  ? 172 ALA A CB    1 
ATOM   367  N  N     . GLY A 1  53  ? 64.889 -9.369  4.127   1.00 97.70  ? 173 GLY A N     1 
ATOM   368  C  CA    . GLY A 1  53  ? 64.840 -10.388 3.094   1.00 92.92  ? 173 GLY A CA    1 
ATOM   369  C  C     . GLY A 1  53  ? 63.770 -11.437 3.331   1.00 88.42  ? 173 GLY A C     1 
ATOM   370  O  O     . GLY A 1  53  ? 64.046 -12.636 3.291   1.00 89.45  ? 173 GLY A O     1 
ATOM   371  N  N     . VAL A 1  54  ? 62.544 -10.986 3.577   1.00 82.39  ? 174 VAL A N     1 
ATOM   372  C  CA    . VAL A 1  54  ? 61.430 -11.897 3.815   1.00 77.80  ? 174 VAL A CA    1 
ATOM   373  C  C     . VAL A 1  54  ? 60.266 -11.612 2.871   1.00 69.75  ? 174 VAL A C     1 
ATOM   374  O  O     . VAL A 1  54  ? 59.121 -11.959 3.163   1.00 71.62  ? 174 VAL A O     1 
ATOM   375  C  CB    . VAL A 1  54  ? 60.929 -11.809 5.267   1.00 81.06  ? 174 VAL A CB    1 
ATOM   376  C  CG1   . VAL A 1  54  ? 61.976 -12.355 6.225   1.00 87.39  ? 174 VAL A CG1   1 
ATOM   377  C  CG2   . VAL A 1  54  ? 60.567 -10.374 5.617   1.00 87.07  ? 174 VAL A CG2   1 
ATOM   378  N  N     . GLU A 1  55  ? 60.568 -10.981 1.742   1.00 75.08  ? 175 GLU A N     1 
ATOM   379  C  CA    . GLU A 1  55  ? 59.550 -10.650 0.753   1.00 75.76  ? 175 GLU A CA    1 
ATOM   380  C  C     . GLU A 1  55  ? 58.890 -11.918 0.221   1.00 71.04  ? 175 GLU A C     1 
ATOM   381  O  O     . GLU A 1  55  ? 57.676 -11.958 0.017   1.00 67.05  ? 175 GLU A O     1 
ATOM   382  C  CB    . GLU A 1  55  ? 60.163 -9.838  -0.394  1.00 87.18  ? 175 GLU A CB    1 
ATOM   383  C  CG    . GLU A 1  55  ? 59.152 -9.181  -1.328  1.00 96.47  ? 175 GLU A CG    1 
ATOM   384  C  CD    . GLU A 1  55  ? 58.608 -10.132 -2.378  1.00 103.49 ? 175 GLU A CD    1 
ATOM   385  O  OE1   . GLU A 1  55  ? 59.314 -11.100 -2.731  1.00 101.23 ? 175 GLU A OE1   1 
ATOM   386  O  OE2   . GLU A 1  55  ? 57.472 -9.911  -2.849  1.00 109.24 ? 175 GLU A OE2   1 
ATOM   387  N  N     . HIS A 1  56  ? 59.697 -12.954 0.008   1.00 69.98  ? 176 HIS A N     1 
ATOM   388  C  CA    . HIS A 1  56  ? 59.202 -14.229 -0.500  1.00 65.49  ? 176 HIS A CA    1 
ATOM   389  C  C     . HIS A 1  56  ? 58.210 -14.844 0.473   1.00 67.67  ? 176 HIS A C     1 
ATOM   390  O  O     . HIS A 1  56  ? 57.284 -15.553 0.079   1.00 62.25  ? 176 HIS A O     1 
ATOM   391  C  CB    . HIS A 1  56  ? 60.360 -15.197 -0.747  1.00 72.27  ? 176 HIS A CB    1 
ATOM   392  C  CG    . HIS A 1  56  ? 61.015 -15.684 0.509   1.00 93.02  ? 176 HIS A CG    1 
ATOM   393  N  ND1   . HIS A 1  56  ? 61.814 -14.879 1.292   1.00 98.23  ? 176 HIS A ND1   1 
ATOM   394  C  CD2   . HIS A 1  56  ? 60.982 -16.891 1.121   1.00 93.85  ? 176 HIS A CD2   1 
ATOM   395  C  CE1   . HIS A 1  56  ? 62.249 -15.570 2.330   1.00 94.84  ? 176 HIS A CE1   1 
ATOM   396  N  NE2   . HIS A 1  56  ? 61.759 -16.794 2.251   1.00 88.71  ? 176 HIS A NE2   1 
ATOM   397  N  N     . GLN A 1  57  ? 58.408 -14.568 1.755   1.00 65.21  ? 177 GLN A N     1 
ATOM   398  C  CA    . GLN A 1  57  ? 57.532 -15.103 2.778   1.00 54.03  ? 177 GLN A CA    1 
ATOM   399  C  C     . GLN A 1  57  ? 56.197 -14.360 2.767   1.00 55.83  ? 177 GLN A C     1 
ATOM   400  O  O     . GLN A 1  57  ? 55.148 -14.950 3.029   1.00 51.49  ? 177 GLN A O     1 
ATOM   401  C  CB    . GLN A 1  57  ? 58.202 -15.011 4.150   1.00 65.86  ? 177 GLN A CB    1 
ATOM   402  C  CG    . GLN A 1  57  ? 57.549 -15.863 5.213   1.00 71.14  ? 177 GLN A CG    1 
ATOM   403  C  CD    . GLN A 1  57  ? 57.605 -17.350 4.913   1.00 68.36  ? 177 GLN A CD    1 
ATOM   404  O  OE1   . GLN A 1  57  ? 58.660 -17.890 4.582   1.00 77.64  ? 177 GLN A OE1   1 
ATOM   405  N  NE2   . GLN A 1  57  ? 56.464 -18.019 5.031   1.00 48.55  ? 177 GLN A NE2   1 
ATOM   406  N  N     . LEU A 1  58  ? 56.239 -13.068 2.452   1.00 59.63  ? 178 LEU A N     1 
ATOM   407  C  CA    . LEU A 1  58  ? 55.016 -12.279 2.328   1.00 67.17  ? 178 LEU A CA    1 
ATOM   408  C  C     . LEU A 1  58  ? 54.183 -12.765 1.145   1.00 62.72  ? 178 LEU A C     1 
ATOM   409  O  O     . LEU A 1  58  ? 52.951 -12.768 1.200   1.00 51.18  ? 178 LEU A O     1 
ATOM   410  C  CB    . LEU A 1  58  ? 55.332 -10.790 2.169   1.00 64.55  ? 178 LEU A CB    1 
ATOM   411  C  CG    . LEU A 1  58  ? 54.113 -9.899  1.903   1.00 58.31  ? 178 LEU A CG    1 
ATOM   412  C  CD1   . LEU A 1  58  ? 53.061 -10.080 2.996   1.00 53.67  ? 178 LEU A CD1   1 
ATOM   413  C  CD2   . LEU A 1  58  ? 54.514 -8.439  1.774   1.00 63.03  ? 178 LEU A CD2   1 
ATOM   414  N  N     . ARG A 1  59  ? 54.861 -13.170 0.076   1.00 60.96  ? 179 ARG A N     1 
ATOM   415  C  CA    . ARG A 1  59  ? 54.183 -13.765 -1.069  1.00 63.17  ? 179 ARG A CA    1 
ATOM   416  C  C     . ARG A 1  59  ? 53.417 -14.997 -0.608  1.00 64.14  ? 179 ARG A C     1 
ATOM   417  O  O     . ARG A 1  59  ? 52.236 -15.164 -0.919  1.00 53.25  ? 179 ARG A O     1 
ATOM   418  C  CB    . ARG A 1  59  ? 55.181 -14.135 -2.171  1.00 56.17  ? 179 ARG A CB    1 
ATOM   419  C  CG    . ARG A 1  59  ? 54.575 -14.944 -3.310  1.00 58.23  ? 179 ARG A CG    1 
ATOM   420  C  CD    . ARG A 1  59  ? 55.618 -15.301 -4.365  1.00 66.43  ? 179 ARG A CD    1 
ATOM   421  N  NE    . ARG A 1  59  ? 56.174 -14.112 -5.005  1.00 73.58  ? 179 ARG A NE    1 
ATOM   422  C  CZ    . ARG A 1  59  ? 55.662 -13.544 -6.093  1.00 77.41  ? 179 ARG A CZ    1 
ATOM   423  N  NH1   . ARG A 1  59  ? 54.584 -14.061 -6.667  1.00 76.31  ? 179 ARG A NH1   1 
ATOM   424  N  NH2   . ARG A 1  59  ? 56.228 -12.462 -6.608  1.00 78.98  ? 179 ARG A NH2   1 
ATOM   425  N  N     . ARG A 1  60  ? 54.102 -15.842 0.155   1.00 51.48  ? 180 ARG A N     1 
ATOM   426  C  CA    . ARG A 1  60  ? 53.506 -17.050 0.708   1.00 64.53  ? 180 ARG A CA    1 
ATOM   427  C  C     . ARG A 1  60  ? 52.315 -16.735 1.613   1.00 68.22  ? 180 ARG A C     1 
ATOM   428  O  O     . ARG A 1  60  ? 51.283 -17.395 1.532   1.00 61.26  ? 180 ARG A O     1 
ATOM   429  C  CB    . ARG A 1  60  ? 54.558 -17.851 1.477   1.00 68.71  ? 180 ARG A CB    1 
ATOM   430  C  CG    . ARG A 1  60  ? 54.788 -19.243 0.920   1.00 72.46  ? 180 ARG A CG    1 
ATOM   431  C  CD    . ARG A 1  60  ? 56.262 -19.508 0.653   1.00 76.59  ? 180 ARG A CD    1 
ATOM   432  N  NE    . ARG A 1  60  ? 57.045 -19.558 1.881   1.00 77.02  ? 180 ARG A NE    1 
ATOM   433  C  CZ    . ARG A 1  60  ? 58.305 -19.975 1.947   1.00 78.46  ? 180 ARG A CZ    1 
ATOM   434  N  NH1   . ARG A 1  60  ? 58.931 -20.384 0.853   1.00 76.44  ? 180 ARG A NH1   1 
ATOM   435  N  NH2   . ARG A 1  60  ? 58.940 -19.988 3.111   1.00 72.35  ? 180 ARG A NH2   1 
ATOM   436  N  N     . GLU A 1  61  ? 52.453 -15.723 2.466   1.00 60.21  ? 181 GLU A N     1 
ATOM   437  C  CA    . GLU A 1  61  ? 51.366 -15.338 3.366   1.00 60.17  ? 181 GLU A CA    1 
ATOM   438  C  C     . GLU A 1  61  ? 50.128 -14.911 2.583   1.00 58.15  ? 181 GLU A C     1 
ATOM   439  O  O     . GLU A 1  61  ? 49.014 -15.340 2.883   1.00 49.27  ? 181 GLU A O     1 
ATOM   440  C  CB    . GLU A 1  61  ? 51.806 -14.209 4.308   1.00 57.50  ? 181 GLU A CB    1 
ATOM   441  C  CG    . GLU A 1  61  ? 50.694 -13.689 5.220   1.00 56.81  ? 181 GLU A CG    1 
ATOM   442  C  CD    . GLU A 1  61  ? 51.144 -12.542 6.115   1.00 55.35  ? 181 GLU A CD    1 
ATOM   443  O  OE1   . GLU A 1  61  ? 52.322 -12.136 6.024   1.00 58.61  ? 181 GLU A OE1   1 
ATOM   444  O  OE2   . GLU A 1  61  ? 50.317 -12.044 6.907   1.00 56.74  ? 181 GLU A OE2   1 
ATOM   445  N  N     . VAL A 1  62  ? 50.332 -14.082 1.565   1.00 54.94  ? 182 VAL A N     1 
ATOM   446  C  CA    . VAL A 1  62  ? 49.219 -13.521 0.808   1.00 56.90  ? 182 VAL A CA    1 
ATOM   447  C  C     . VAL A 1  62  ? 48.549 -14.565 -0.087  1.00 60.12  ? 182 VAL A C     1 
ATOM   448  O  O     . VAL A 1  62  ? 47.321 -14.654 -0.136  1.00 56.10  ? 182 VAL A O     1 
ATOM   449  C  CB    . VAL A 1  62  ? 49.678 -12.328 -0.049  1.00 65.66  ? 182 VAL A CB    1 
ATOM   450  C  CG1   . VAL A 1  62  ? 48.550 -11.841 -0.946  1.00 68.95  ? 182 VAL A CG1   1 
ATOM   451  C  CG2   . VAL A 1  62  ? 50.169 -11.202 0.842   1.00 52.63  ? 182 VAL A CG2   1 
ATOM   452  N  N     . GLU A 1  63  ? 49.354 -15.361 -0.781  1.00 54.82  ? 183 GLU A N     1 
ATOM   453  C  CA    . GLU A 1  63  ? 48.820 -16.353 -1.710  1.00 58.97  ? 183 GLU A CA    1 
ATOM   454  C  C     . GLU A 1  63  ? 48.141 -17.518 -0.985  1.00 64.65  ? 183 GLU A C     1 
ATOM   455  O  O     . GLU A 1  63  ? 47.052 -17.942 -1.371  1.00 60.97  ? 183 GLU A O     1 
ATOM   456  C  CB    . GLU A 1  63  ? 49.929 -16.875 -2.632  1.00 57.27  ? 183 GLU A CB    1 
ATOM   457  C  CG    . GLU A 1  63  ? 50.479 -15.820 -3.591  1.00 60.90  ? 183 GLU A CG    1 
ATOM   458  C  CD    . GLU A 1  63  ? 51.427 -16.392 -4.633  1.00 70.93  ? 183 GLU A CD    1 
ATOM   459  O  OE1   . GLU A 1  63  ? 51.689 -17.613 -4.603  1.00 70.54  ? 183 GLU A OE1   1 
ATOM   460  O  OE2   . GLU A 1  63  ? 51.904 -15.619 -5.493  1.00 61.06  ? 183 GLU A OE2   1 
ATOM   461  N  N     . ILE A 1  64  ? 48.777 -18.027 0.067   1.00 55.64  ? 184 ILE A N     1 
ATOM   462  C  CA    . ILE A 1  64  ? 48.240 -19.179 0.786   1.00 59.54  ? 184 ILE A CA    1 
ATOM   463  C  C     . ILE A 1  64  ? 46.958 -18.842 1.542   1.00 51.26  ? 184 ILE A C     1 
ATOM   464  O  O     . ILE A 1  64  ? 45.973 -19.578 1.458   1.00 49.39  ? 184 ILE A O     1 
ATOM   465  C  CB    . ILE A 1  64  ? 49.264 -19.756 1.782   1.00 62.56  ? 184 ILE A CB    1 
ATOM   466  C  CG1   . ILE A 1  64  ? 50.438 -20.383 1.033   1.00 61.76  ? 184 ILE A CG1   1 
ATOM   467  C  CG2   . ILE A 1  64  ? 48.612 -20.792 2.690   1.00 53.59  ? 184 ILE A CG2   1 
ATOM   468  C  CD1   . ILE A 1  64  ? 51.525 -20.907 1.943   1.00 60.54  ? 184 ILE A CD1   1 
ATOM   469  N  N     . GLN A 1  65  ? 46.966 -17.731 2.272   1.00 52.16  ? 185 GLN A N     1 
ATOM   470  C  CA    . GLN A 1  65  ? 45.825 -17.384 3.113   1.00 58.82  ? 185 GLN A CA    1 
ATOM   471  C  C     . GLN A 1  65  ? 44.601 -17.014 2.280   1.00 57.56  ? 185 GLN A C     1 
ATOM   472  O  O     . GLN A 1  65  ? 43.475 -17.320 2.667   1.00 51.70  ? 185 GLN A O     1 
ATOM   473  C  CB    . GLN A 1  65  ? 46.178 -16.237 4.067   1.00 53.63  ? 185 GLN A CB    1 
ATOM   474  C  CG    . GLN A 1  65  ? 45.062 -15.897 5.051   1.00 57.99  ? 185 GLN A CG    1 
ATOM   475  C  CD    . GLN A 1  65  ? 45.477 -14.888 6.106   1.00 62.56  ? 185 GLN A CD    1 
ATOM   476  O  OE1   . GLN A 1  65  ? 46.577 -14.338 6.062   1.00 71.19  ? 185 GLN A OE1   1 
ATOM   477  N  NE2   . GLN A 1  65  ? 44.588 -14.635 7.061   1.00 59.72  ? 185 GLN A NE2   1 
ATOM   478  N  N     . SER A 1  66  ? 44.824 -16.375 1.134   1.00 59.64  ? 186 SER A N     1 
ATOM   479  C  CA    . SER A 1  66  ? 43.722 -15.920 0.287   1.00 66.11  ? 186 SER A CA    1 
ATOM   480  C  C     . SER A 1  66  ? 42.954 -17.080 -0.339  1.00 70.21  ? 186 SER A C     1 
ATOM   481  O  O     . SER A 1  66  ? 41.780 -16.941 -0.674  1.00 77.15  ? 186 SER A O     1 
ATOM   482  C  CB    . SER A 1  66  ? 44.236 -14.995 -0.820  1.00 64.39  ? 186 SER A CB    1 
ATOM   483  O  OG    . SER A 1  66  ? 45.075 -15.695 -1.723  1.00 66.78  ? 186 SER A OG    1 
ATOM   484  N  N     . HIS A 1  67  ? 43.615 -18.223 -0.491  1.00 61.25  ? 187 HIS A N     1 
ATOM   485  C  CA    . HIS A 1  67  ? 42.992 -19.375 -1.136  1.00 70.87  ? 187 HIS A CA    1 
ATOM   486  C  C     . HIS A 1  67  ? 42.448 -20.389 -0.129  1.00 63.11  ? 187 HIS A C     1 
ATOM   487  O  O     . HIS A 1  67  ? 41.899 -21.421 -0.514  1.00 68.85  ? 187 HIS A O     1 
ATOM   488  C  CB    . HIS A 1  67  ? 43.988 -20.057 -2.079  1.00 69.32  ? 187 HIS A CB    1 
ATOM   489  C  CG    . HIS A 1  67  ? 44.341 -19.240 -3.284  1.00 71.44  ? 187 HIS A CG    1 
ATOM   490  N  ND1   . HIS A 1  67  ? 45.395 -18.352 -3.300  1.00 57.42  ? 187 HIS A ND1   1 
ATOM   491  C  CD2   . HIS A 1  67  ? 43.783 -19.182 -4.518  1.00 76.41  ? 187 HIS A CD2   1 
ATOM   492  C  CE1   . HIS A 1  67  ? 45.470 -17.782 -4.490  1.00 72.34  ? 187 HIS A CE1   1 
ATOM   493  N  NE2   . HIS A 1  67  ? 44.504 -18.268 -5.248  1.00 63.52  ? 187 HIS A NE2   1 
ATOM   494  N  N     . LEU A 1  68  ? 42.598 -20.093 1.158   1.00 62.55  ? 188 LEU A N     1 
ATOM   495  C  CA    . LEU A 1  68  ? 42.064 -20.959 2.205   1.00 56.38  ? 188 LEU A CA    1 
ATOM   496  C  C     . LEU A 1  68  ? 40.634 -20.568 2.567   1.00 54.02  ? 188 LEU A C     1 
ATOM   497  O  O     . LEU A 1  68  ? 40.304 -19.385 2.635   1.00 62.09  ? 188 LEU A O     1 
ATOM   498  C  CB    . LEU A 1  68  ? 42.951 -20.911 3.453   1.00 61.95  ? 188 LEU A CB    1 
ATOM   499  C  CG    . LEU A 1  68  ? 44.333 -21.559 3.347   1.00 59.14  ? 188 LEU A CG    1 
ATOM   500  C  CD1   . LEU A 1  68  ? 45.177 -21.212 4.558   1.00 57.66  ? 188 LEU A CD1   1 
ATOM   501  C  CD2   . LEU A 1  68  ? 44.227 -23.069 3.189   1.00 53.94  ? 188 LEU A CD2   1 
ATOM   502  N  N     . ARG A 1  69  ? 39.790 -21.569 2.794   1.00 61.93  ? 189 ARG A N     1 
ATOM   503  C  CA    . ARG A 1  69  ? 38.402 -21.337 3.184   1.00 63.90  ? 189 ARG A CA    1 
ATOM   504  C  C     . ARG A 1  69  ? 37.999 -22.249 4.333   1.00 71.65  ? 189 ARG A C     1 
ATOM   505  O  O     . ARG A 1  69  ? 37.790 -23.449 4.144   1.00 72.99  ? 189 ARG A O     1 
ATOM   506  C  CB    . ARG A 1  69  ? 37.457 -21.553 2.002   1.00 73.15  ? 189 ARG A CB    1 
ATOM   507  C  CG    . ARG A 1  69  ? 37.614 -20.552 0.877   1.00 74.27  ? 189 ARG A CG    1 
ATOM   508  C  CD    . ARG A 1  69  ? 37.247 -19.142 1.308   1.00 77.15  ? 189 ARG A CD    1 
ATOM   509  N  NE    . ARG A 1  69  ? 37.152 -18.245 0.159   1.00 87.39  ? 189 ARG A NE    1 
ATOM   510  C  CZ    . ARG A 1  69  ? 38.167 -17.536 -0.325  1.00 85.84  ? 189 ARG A CZ    1 
ATOM   511  N  NH1   . ARG A 1  69  ? 39.364 -17.611 0.244   1.00 73.72  ? 189 ARG A NH1   1 
ATOM   512  N  NH2   . ARG A 1  69  ? 37.986 -16.749 -1.377  1.00 78.35  ? 189 ARG A NH2   1 
ATOM   513  N  N     . HIS A 1  70  ? 37.887 -21.671 5.523   1.00 63.54  ? 190 HIS A N     1 
ATOM   514  C  CA    . HIS A 1  70  ? 37.508 -22.422 6.712   1.00 73.14  ? 190 HIS A CA    1 
ATOM   515  C  C     . HIS A 1  70  ? 36.966 -21.467 7.770   1.00 61.31  ? 190 HIS A C     1 
ATOM   516  O  O     . HIS A 1  70  ? 37.519 -20.386 7.970   1.00 66.60  ? 190 HIS A O     1 
ATOM   517  C  CB    . HIS A 1  70  ? 38.702 -23.209 7.258   1.00 64.34  ? 190 HIS A CB    1 
ATOM   518  C  CG    . HIS A 1  70  ? 38.324 -24.282 8.232   1.00 72.52  ? 190 HIS A CG    1 
ATOM   519  N  ND1   . HIS A 1  70  ? 38.091 -24.029 9.567   1.00 67.79  ? 190 HIS A ND1   1 
ATOM   520  C  CD2   . HIS A 1  70  ? 38.143 -25.614 8.064   1.00 65.12  ? 190 HIS A CD2   1 
ATOM   521  C  CE1   . HIS A 1  70  ? 37.779 -25.158 10.179  1.00 63.21  ? 190 HIS A CE1   1 
ATOM   522  N  NE2   . HIS A 1  70  ? 37.804 -26.134 9.289   1.00 75.95  ? 190 HIS A NE2   1 
ATOM   523  N  N     . PRO A 1  71  ? 35.872 -21.861 8.441   1.00 64.37  ? 191 PRO A N     1 
ATOM   524  C  CA    . PRO A 1  71  ? 35.237 -21.048 9.485   1.00 64.48  ? 191 PRO A CA    1 
ATOM   525  C  C     . PRO A 1  71  ? 36.199 -20.659 10.606  1.00 59.12  ? 191 PRO A C     1 
ATOM   526  O  O     . PRO A 1  71  ? 36.035 -19.604 11.215  1.00 62.86  ? 191 PRO A O     1 
ATOM   527  C  CB    . PRO A 1  71  ? 34.131 -21.966 10.016  1.00 59.65  ? 191 PRO A CB    1 
ATOM   528  C  CG    . PRO A 1  71  ? 33.817 -22.865 8.880   1.00 71.13  ? 191 PRO A CG    1 
ATOM   529  C  CD    . PRO A 1  71  ? 35.120 -23.099 8.174   1.00 71.20  ? 191 PRO A CD    1 
ATOM   530  N  N     . ASN A 1  72  ? 37.194 -21.502 10.862  1.00 58.44  ? 192 ASN A N     1 
ATOM   531  C  CA    . ASN A 1  72  ? 38.163 -21.251 11.921  1.00 60.13  ? 192 ASN A CA    1 
ATOM   532  C  C     . ASN A 1  72  ? 39.494 -20.739 11.378  1.00 68.60  ? 192 ASN A C     1 
ATOM   533  O  O     . ASN A 1  72  ? 40.533 -20.878 12.023  1.00 63.23  ? 192 ASN A O     1 
ATOM   534  C  CB    . ASN A 1  72  ? 38.387 -22.520 12.742  1.00 51.31  ? 192 ASN A CB    1 
ATOM   535  C  CG    . ASN A 1  72  ? 37.118 -23.015 13.402  1.00 62.78  ? 192 ASN A CG    1 
ATOM   536  O  OD1   . ASN A 1  72  ? 36.632 -24.104 13.099  1.00 76.74  ? 192 ASN A OD1   1 
ATOM   537  N  ND2   . ASN A 1  72  ? 36.573 -22.214 14.312  1.00 56.20  ? 192 ASN A ND2   1 
ATOM   538  N  N     . ILE A 1  73  ? 39.457 -20.159 10.184  1.00 60.74  ? 193 ILE A N     1 
ATOM   539  C  CA    . ILE A 1  73  ? 40.631 -19.516 9.606   1.00 58.10  ? 193 ILE A CA    1 
ATOM   540  C  C     . ILE A 1  73  ? 40.269 -18.110 9.151   1.00 60.85  ? 193 ILE A C     1 
ATOM   541  O  O     . ILE A 1  73  ? 39.287 -17.919 8.433   1.00 62.68  ? 193 ILE A O     1 
ATOM   542  C  CB    . ILE A 1  73  ? 41.204 -20.314 8.415   1.00 55.92  ? 193 ILE A CB    1 
ATOM   543  C  CG1   . ILE A 1  73  ? 41.650 -21.706 8.865   1.00 50.55  ? 193 ILE A CG1   1 
ATOM   544  C  CG2   . ILE A 1  73  ? 42.375 -19.569 7.781   1.00 46.64  ? 193 ILE A CG2   1 
ATOM   545  C  CD1   . ILE A 1  73  ? 42.300 -22.525 7.767   1.00 54.93  ? 193 ILE A CD1   1 
ATOM   546  N  N     . LEU A 1  74  ? 41.054 -17.127 9.583   1.00 56.41  ? 194 LEU A N     1 
ATOM   547  C  CA    . LEU A 1  74  ? 40.809 -15.738 9.214   1.00 55.54  ? 194 LEU A CA    1 
ATOM   548  C  C     . LEU A 1  74  ? 40.908 -15.556 7.702   1.00 59.76  ? 194 LEU A C     1 
ATOM   549  O  O     . LEU A 1  74  ? 41.808 -16.100 7.066   1.00 50.96  ? 194 LEU A O     1 
ATOM   550  C  CB    . LEU A 1  74  ? 41.797 -14.808 9.918   1.00 54.83  ? 194 LEU A CB    1 
ATOM   551  C  CG    . LEU A 1  74  ? 41.427 -13.324 9.903   1.00 62.42  ? 194 LEU A CG    1 
ATOM   552  C  CD1   . LEU A 1  74  ? 40.312 -13.046 10.905  1.00 56.56  ? 194 LEU A CD1   1 
ATOM   553  C  CD2   . LEU A 1  74  ? 42.641 -12.452 10.177  1.00 67.89  ? 194 LEU A CD2   1 
ATOM   554  N  N     . ARG A 1  75  ? 39.979 -14.791 7.137   1.00 59.35  ? 195 ARG A N     1 
ATOM   555  C  CA    . ARG A 1  75  ? 39.944 -14.545 5.701   1.00 66.49  ? 195 ARG A CA    1 
ATOM   556  C  C     . ARG A 1  75  ? 40.842 -13.384 5.291   1.00 74.62  ? 195 ARG A C     1 
ATOM   557  O  O     . ARG A 1  75  ? 40.899 -12.357 5.968   1.00 70.50  ? 195 ARG A O     1 
ATOM   558  C  CB    . ARG A 1  75  ? 38.510 -14.263 5.244   1.00 66.11  ? 195 ARG A CB    1 
ATOM   559  C  CG    . ARG A 1  75  ? 37.643 -15.500 5.097   1.00 71.98  ? 195 ARG A CG    1 
ATOM   560  C  CD    . ARG A 1  75  ? 38.026 -16.296 3.860   1.00 88.20  ? 195 ARG A CD    1 
ATOM   561  N  NE    . ARG A 1  75  ? 38.053 -15.459 2.663   1.00 86.49  ? 195 ARG A NE    1 
ATOM   562  C  CZ    . ARG A 1  75  ? 36.976 -15.121 1.961   1.00 89.72  ? 195 ARG A CZ    1 
ATOM   563  N  NH1   . ARG A 1  75  ? 35.776 -15.544 2.336   1.00 89.49  ? 195 ARG A NH1   1 
ATOM   564  N  NH2   . ARG A 1  75  ? 37.097 -14.354 0.886   1.00 83.98  ? 195 ARG A NH2   1 
ATOM   565  N  N     . LEU A 1  76  ? 41.545 -13.565 4.178   1.00 68.00  ? 196 LEU A N     1 
ATOM   566  C  CA    . LEU A 1  76  ? 42.280 -12.483 3.537   1.00 68.94  ? 196 LEU A CA    1 
ATOM   567  C  C     . LEU A 1  76  ? 41.589 -12.144 2.222   1.00 67.16  ? 196 LEU A C     1 
ATOM   568  O  O     . LEU A 1  76  ? 41.715 -12.877 1.245   1.00 64.30  ? 196 LEU A O     1 
ATOM   569  C  CB    . LEU A 1  76  ? 43.741 -12.876 3.305   1.00 65.09  ? 196 LEU A CB    1 
ATOM   570  C  CG    . LEU A 1  76  ? 44.597 -11.939 2.448   1.00 72.89  ? 196 LEU A CG    1 
ATOM   571  C  CD1   . LEU A 1  76  ? 44.566 -10.517 2.980   1.00 76.53  ? 196 LEU A CD1   1 
ATOM   572  C  CD2   . LEU A 1  76  ? 46.027 -12.448 2.367   1.00 73.32  ? 196 LEU A CD2   1 
ATOM   573  N  N     . TYR A 1  77  ? 40.849 -11.039 2.206   1.00 72.99  ? 197 TYR A N     1 
ATOM   574  C  CA    . TYR A 1  77  ? 40.008 -10.698 1.062   1.00 72.84  ? 197 TYR A CA    1 
ATOM   575  C  C     . TYR A 1  77  ? 40.803 -10.212 -0.145  1.00 77.87  ? 197 TYR A C     1 
ATOM   576  O  O     . TYR A 1  77  ? 40.409 -10.452 -1.285  1.00 71.06  ? 197 TYR A O     1 
ATOM   577  C  CB    . TYR A 1  77  ? 38.980 -9.635  1.457   1.00 75.59  ? 197 TYR A CB    1 
ATOM   578  C  CG    . TYR A 1  77  ? 38.020 -10.090 2.531   1.00 79.26  ? 197 TYR A CG    1 
ATOM   579  C  CD1   . TYR A 1  77  ? 37.021 -11.012 2.251   1.00 83.93  ? 197 TYR A CD1   1 
ATOM   580  C  CD2   . TYR A 1  77  ? 38.112 -9.595  3.826   1.00 76.34  ? 197 TYR A CD2   1 
ATOM   581  C  CE1   . TYR A 1  77  ? 36.140 -11.431 3.229   1.00 81.85  ? 197 TYR A CE1   1 
ATOM   582  C  CE2   . TYR A 1  77  ? 37.235 -10.008 4.811   1.00 68.87  ? 197 TYR A CE2   1 
ATOM   583  C  CZ    . TYR A 1  77  ? 36.252 -10.925 4.508   1.00 80.29  ? 197 TYR A CZ    1 
ATOM   584  O  OH    . TYR A 1  77  ? 35.378 -11.338 5.488   1.00 83.55  ? 197 TYR A OH    1 
ATOM   585  N  N     . GLY A 1  78  ? 41.914 -9.525  0.104   1.00 76.37  ? 198 GLY A N     1 
ATOM   586  C  CA    . GLY A 1  78  ? 42.725 -8.998  -0.979  1.00 82.73  ? 198 GLY A CA    1 
ATOM   587  C  C     . GLY A 1  78  ? 43.939 -8.225  -0.504  1.00 75.74  ? 198 GLY A C     1 
ATOM   588  O  O     . GLY A 1  78  ? 44.164 -8.079  0.698   1.00 66.17  ? 198 GLY A O     1 
ATOM   589  N  N     . TYR A 1  79  ? 44.722 -7.727  -1.456  1.00 70.55  ? 199 TYR A N     1 
ATOM   590  C  CA    . TYR A 1  79  ? 45.935 -6.980  -1.145  1.00 74.08  ? 199 TYR A CA    1 
ATOM   591  C  C     . TYR A 1  79  ? 46.232 -5.919  -2.203  1.00 76.39  ? 199 TYR A C     1 
ATOM   592  O  O     . TYR A 1  79  ? 45.711 -5.979  -3.318  1.00 80.96  ? 199 TYR A O     1 
ATOM   593  C  CB    . TYR A 1  79  ? 47.129 -7.929  -1.020  1.00 66.50  ? 199 TYR A CB    1 
ATOM   594  C  CG    . TYR A 1  79  ? 47.874 -8.144  -2.320  1.00 80.61  ? 199 TYR A CG    1 
ATOM   595  C  CD1   . TYR A 1  79  ? 47.369 -8.984  -3.304  1.00 79.76  ? 199 TYR A CD1   1 
ATOM   596  C  CD2   . TYR A 1  79  ? 49.084 -7.504  -2.563  1.00 87.64  ? 199 TYR A CD2   1 
ATOM   597  C  CE1   . TYR A 1  79  ? 48.047 -9.180  -4.494  1.00 87.89  ? 199 TYR A CE1   1 
ATOM   598  C  CE2   . TYR A 1  79  ? 49.768 -7.693  -3.749  1.00 81.05  ? 199 TYR A CE2   1 
ATOM   599  C  CZ    . TYR A 1  79  ? 49.246 -8.532  -4.710  1.00 83.14  ? 199 TYR A CZ    1 
ATOM   600  O  OH    . TYR A 1  79  ? 49.926 -8.723  -5.890  1.00 87.39  ? 199 TYR A OH    1 
ATOM   601  N  N     . PHE A 1  80  ? 47.078 -4.956  -1.843  1.00 69.12  ? 200 PHE A N     1 
ATOM   602  C  CA    . PHE A 1  80  ? 47.554 -3.937  -2.779  1.00 80.83  ? 200 PHE A CA    1 
ATOM   603  C  C     . PHE A 1  80  ? 48.786 -3.232  -2.213  1.00 82.22  ? 200 PHE A C     1 
ATOM   604  O  O     . PHE A 1  80  ? 49.082 -3.346  -1.024  1.00 82.88  ? 200 PHE A O     1 
ATOM   605  C  CB    . PHE A 1  80  ? 46.448 -2.922  -3.103  1.00 81.25  ? 200 PHE A CB    1 
ATOM   606  C  CG    . PHE A 1  80  ? 45.940 -2.156  -1.908  1.00 85.88  ? 200 PHE A CG    1 
ATOM   607  C  CD1   . PHE A 1  80  ? 45.050 -2.738  -1.017  1.00 75.54  ? 200 PHE A CD1   1 
ATOM   608  C  CD2   . PHE A 1  80  ? 46.330 -0.844  -1.694  1.00 86.85  ? 200 PHE A CD2   1 
ATOM   609  C  CE1   . PHE A 1  80  ? 44.573 -2.032  0.074   1.00 74.12  ? 200 PHE A CE1   1 
ATOM   610  C  CE2   . PHE A 1  80  ? 45.858 -0.133  -0.605  1.00 80.57  ? 200 PHE A CE2   1 
ATOM   611  C  CZ    . PHE A 1  80  ? 44.977 -0.727  0.280   1.00 78.55  ? 200 PHE A CZ    1 
ATOM   612  N  N     . HIS A 1  81  ? 49.507 -2.517  -3.071  1.00 80.01  ? 201 HIS A N     1 
ATOM   613  C  CA    . HIS A 1  81  ? 50.737 -1.842  -2.663  1.00 90.94  ? 201 HIS A CA    1 
ATOM   614  C  C     . HIS A 1  81  ? 50.895 -0.490  -3.357  1.00 97.34  ? 201 HIS A C     1 
ATOM   615  O  O     . HIS A 1  81  ? 50.168 -0.180  -4.300  1.00 103.55 ? 201 HIS A O     1 
ATOM   616  C  CB    . HIS A 1  81  ? 51.956 -2.727  -2.948  1.00 90.92  ? 201 HIS A CB    1 
ATOM   617  C  CG    . HIS A 1  81  ? 52.074 -3.165  -4.376  1.00 99.44  ? 201 HIS A CG    1 
ATOM   618  N  ND1   . HIS A 1  81  ? 53.176 -2.879  -5.154  1.00 99.64  ? 201 HIS A ND1   1 
ATOM   619  C  CD2   . HIS A 1  81  ? 51.236 -3.883  -5.163  1.00 105.16 ? 201 HIS A CD2   1 
ATOM   620  C  CE1   . HIS A 1  81  ? 53.008 -3.392  -6.359  1.00 93.17  ? 201 HIS A CE1   1 
ATOM   621  N  NE2   . HIS A 1  81  ? 51.839 -4.006  -6.391  1.00 98.29  ? 201 HIS A NE2   1 
ATOM   622  N  N     . ASP A 1  82  ? 51.848 0.310   -2.887  1.00 86.14  ? 202 ASP A N     1 
ATOM   623  C  CA    . ASP A 1  82  ? 52.032 1.664   -3.402  1.00 91.69  ? 202 ASP A CA    1 
ATOM   624  C  C     . ASP A 1  82  ? 53.498 2.094   -3.408  1.00 99.70  ? 202 ASP A C     1 
ATOM   625  O  O     . ASP A 1  82  ? 53.810 3.258   -3.154  1.00 110.14 ? 202 ASP A O     1 
ATOM   626  C  CB    . ASP A 1  82  ? 51.202 2.656   -2.582  1.00 102.03 ? 202 ASP A CB    1 
ATOM   627  C  CG    . ASP A 1  82  ? 51.620 2.703   -1.123  1.00 105.60 ? 202 ASP A CG    1 
ATOM   628  O  OD1   . ASP A 1  82  ? 52.181 1.702   -0.631  1.00 116.84 ? 202 ASP A OD1   1 
ATOM   629  O  OD2   . ASP A 1  82  ? 51.387 3.741   -0.468  1.00 102.21 ? 202 ASP A OD2   1 
ATOM   630  N  N     . ALA A 1  83  ? 54.385 1.142   -3.688  1.00 104.74 ? 203 ALA A N     1 
ATOM   631  C  CA    . ALA A 1  83  ? 55.822 1.395   -3.837  1.00 120.25 ? 203 ALA A CA    1 
ATOM   632  C  C     . ALA A 1  83  ? 56.486 1.912   -2.560  1.00 117.91 ? 203 ALA A C     1 
ATOM   633  O  O     . ALA A 1  83  ? 57.647 2.319   -2.579  1.00 126.21 ? 203 ALA A O     1 
ATOM   634  C  CB    . ALA A 1  83  ? 56.071 2.370   -4.989  1.00 125.27 ? 203 ALA A CB    1 
ATOM   635  N  N     . THR A 1  84  ? 55.749 1.895   -1.454  1.00 110.91 ? 204 THR A N     1 
ATOM   636  C  CA    . THR A 1  84  ? 56.297 2.268   -0.155  1.00 108.24 ? 204 THR A CA    1 
ATOM   637  C  C     . THR A 1  84  ? 55.857 1.262   0.898   1.00 98.98  ? 204 THR A C     1 
ATOM   638  O  O     . THR A 1  84  ? 56.643 0.846   1.749   1.00 88.67  ? 204 THR A O     1 
ATOM   639  C  CB    . THR A 1  84  ? 55.855 3.681   0.279   1.00 114.53 ? 204 THR A CB    1 
ATOM   640  O  OG1   . THR A 1  84  ? 54.424 3.757   0.284   1.00 116.00 ? 204 THR A OG1   1 
ATOM   641  C  CG2   . THR A 1  84  ? 56.414 4.738   -0.661  1.00 124.68 ? 204 THR A CG2   1 
ATOM   642  N  N     . ARG A 1  85  ? 54.587 0.876   0.828   1.00 96.78  ? 205 ARG A N     1 
ATOM   643  C  CA    . ARG A 1  85  ? 54.015 -0.073  1.771   1.00 88.49  ? 205 ARG A CA    1 
ATOM   644  C  C     . ARG A 1  85  ? 53.242 -1.169  1.044   1.00 84.36  ? 205 ARG A C     1 
ATOM   645  O  O     . ARG A 1  85  ? 52.897 -1.029  -0.130  1.00 79.15  ? 205 ARG A O     1 
ATOM   646  C  CB    . ARG A 1  85  ? 53.094 0.644   2.763   1.00 89.23  ? 205 ARG A CB    1 
ATOM   647  C  CG    . ARG A 1  85  ? 53.761 1.761   3.551   1.00 95.42  ? 205 ARG A CG    1 
ATOM   648  C  CD    . ARG A 1  85  ? 52.739 2.568   4.337   1.00 96.42  ? 205 ARG A CD    1 
ATOM   649  N  NE    . ARG A 1  85  ? 53.343 3.712   5.014   1.00 103.46 ? 205 ARG A NE    1 
ATOM   650  C  CZ    . ARG A 1  85  ? 53.535 4.899   4.446   1.00 115.53 ? 205 ARG A CZ    1 
ATOM   651  N  NH1   . ARG A 1  85  ? 53.174 5.100   3.186   1.00 112.33 ? 205 ARG A NH1   1 
ATOM   652  N  NH2   . ARG A 1  85  ? 54.092 5.885   5.137   1.00 121.75 ? 205 ARG A NH2   1 
ATOM   653  N  N     . VAL A 1  86  ? 52.986 -2.265  1.750   1.00 76.00  ? 206 VAL A N     1 
ATOM   654  C  CA    . VAL A 1  86  ? 52.129 -3.330  1.244   1.00 65.66  ? 206 VAL A CA    1 
ATOM   655  C  C     . VAL A 1  86  ? 50.915 -3.444  2.157   1.00 66.80  ? 206 VAL A C     1 
ATOM   656  O  O     . VAL A 1  86  ? 51.055 -3.477  3.377   1.00 73.33  ? 206 VAL A O     1 
ATOM   657  C  CB    . VAL A 1  86  ? 52.865 -4.681  1.177   1.00 63.74  ? 206 VAL A CB    1 
ATOM   658  C  CG1   . VAL A 1  86  ? 51.950 -5.761  0.616   1.00 58.73  ? 206 VAL A CG1   1 
ATOM   659  C  CG2   . VAL A 1  86  ? 54.127 -4.556  0.343   1.00 71.48  ? 206 VAL A CG2   1 
ATOM   660  N  N     . TYR A 1  87  ? 49.726 -3.497  1.567   1.00 66.32  ? 207 TYR A N     1 
ATOM   661  C  CA    . TYR A 1  87  ? 48.494 -3.490  2.345   1.00 65.66  ? 207 TYR A CA    1 
ATOM   662  C  C     . TYR A 1  87  ? 47.714 -4.790  2.187   1.00 67.58  ? 207 TYR A C     1 
ATOM   663  O  O     . TYR A 1  87  ? 47.342 -5.170  1.078   1.00 60.99  ? 207 TYR A O     1 
ATOM   664  C  CB    . TYR A 1  87  ? 47.614 -2.307  1.938   1.00 69.74  ? 207 TYR A CB    1 
ATOM   665  C  CG    . TYR A 1  87  ? 48.310 -0.967  2.008   1.00 79.83  ? 207 TYR A CG    1 
ATOM   666  C  CD1   . TYR A 1  87  ? 48.986 -0.455  0.907   1.00 76.82  ? 207 TYR A CD1   1 
ATOM   667  C  CD2   . TYR A 1  87  ? 48.286 -0.209  3.172   1.00 78.10  ? 207 TYR A CD2   1 
ATOM   668  C  CE1   . TYR A 1  87  ? 49.622 0.770   0.965   1.00 83.44  ? 207 TYR A CE1   1 
ATOM   669  C  CE2   . TYR A 1  87  ? 48.920 1.019   3.239   1.00 84.74  ? 207 TYR A CE2   1 
ATOM   670  C  CZ    . TYR A 1  87  ? 49.586 1.503   2.132   1.00 90.77  ? 207 TYR A CZ    1 
ATOM   671  O  OH    . TYR A 1  87  ? 50.219 2.724   2.190   1.00 95.33  ? 207 TYR A OH    1 
ATOM   672  N  N     . LEU A 1  88  ? 47.471 -5.462  3.307   1.00 66.66  ? 208 LEU A N     1 
ATOM   673  C  CA    . LEU A 1  88  ? 46.671 -6.681  3.325   1.00 64.29  ? 208 LEU A CA    1 
ATOM   674  C  C     . LEU A 1  88  ? 45.286 -6.404  3.899   1.00 67.25  ? 208 LEU A C     1 
ATOM   675  O  O     . LEU A 1  88  ? 45.152 -5.814  4.973   1.00 70.52  ? 208 LEU A O     1 
ATOM   676  C  CB    . LEU A 1  88  ? 47.367 -7.777  4.137   1.00 64.47  ? 208 LEU A CB    1 
ATOM   677  C  CG    . LEU A 1  88  ? 48.290 -8.745  3.393   1.00 56.32  ? 208 LEU A CG    1 
ATOM   678  C  CD1   . LEU A 1  88  ? 49.430 -8.009  2.704   1.00 54.66  ? 208 LEU A CD1   1 
ATOM   679  C  CD2   . LEU A 1  88  ? 48.832 -9.804  4.351   1.00 50.41  ? 208 LEU A CD2   1 
ATOM   680  N  N     . ILE A 1  89  ? 44.259 -6.839  3.178   1.00 59.99  ? 209 ILE A N     1 
ATOM   681  C  CA    . ILE A 1  89  ? 42.878 -6.626  3.591   1.00 62.93  ? 209 ILE A CA    1 
ATOM   682  C  C     . ILE A 1  89  ? 42.332 -7.874  4.272   1.00 69.40  ? 209 ILE A C     1 
ATOM   683  O  O     . ILE A 1  89  ? 41.913 -8.823  3.607   1.00 60.66  ? 209 ILE A O     1 
ATOM   684  C  CB    . ILE A 1  89  ? 41.987 -6.261  2.392   1.00 70.45  ? 209 ILE A CB    1 
ATOM   685  C  CG1   . ILE A 1  89  ? 42.657 -5.171  1.552   1.00 70.94  ? 209 ILE A CG1   1 
ATOM   686  C  CG2   . ILE A 1  89  ? 40.609 -5.823  2.864   1.00 64.09  ? 209 ILE A CG2   1 
ATOM   687  C  CD1   . ILE A 1  89  ? 41.873 -4.776  0.324   1.00 68.96  ? 209 ILE A CD1   1 
ATOM   688  N  N     . LEU A 1  90  ? 42.338 -7.860  5.602   1.00 68.43  ? 210 LEU A N     1 
ATOM   689  C  CA    . LEU A 1  90  ? 41.983 -9.034  6.391   1.00 64.89  ? 210 LEU A CA    1 
ATOM   690  C  C     . LEU A 1  90  ? 40.577 -8.953  6.975   1.00 61.70  ? 210 LEU A C     1 
ATOM   691  O  O     . LEU A 1  90  ? 40.020 -7.868  7.145   1.00 58.12  ? 210 LEU A O     1 
ATOM   692  C  CB    . LEU A 1  90  ? 42.995 -9.230  7.524   1.00 60.60  ? 210 LEU A CB    1 
ATOM   693  C  CG    . LEU A 1  90  ? 44.448 -9.464  7.108   1.00 62.74  ? 210 LEU A CG    1 
ATOM   694  C  CD1   . LEU A 1  90  ? 45.392 -9.229  8.275   1.00 67.29  ? 210 LEU A CD1   1 
ATOM   695  C  CD2   . LEU A 1  90  ? 44.615 -10.873 6.561   1.00 52.43  ? 210 LEU A CD2   1 
ATOM   696  N  N     . GLU A 1  91  ? 40.014 -10.118 7.278   1.00 49.41  ? 211 GLU A N     1 
ATOM   697  C  CA    . GLU A 1  91  ? 38.748 -10.204 7.990   1.00 53.81  ? 211 GLU A CA    1 
ATOM   698  C  C     . GLU A 1  91  ? 38.891 -9.635  9.403   1.00 58.56  ? 211 GLU A C     1 
ATOM   699  O  O     . GLU A 1  91  ? 39.895 -9.867  10.077  1.00 59.64  ? 211 GLU A O     1 
ATOM   700  C  CB    . GLU A 1  91  ? 38.269 -11.656 8.046   1.00 53.36  ? 211 GLU A CB    1 
ATOM   701  C  CG    . GLU A 1  91  ? 37.090 -11.886 8.977   1.00 68.67  ? 211 GLU A CG    1 
ATOM   702  C  CD    . GLU A 1  91  ? 36.755 -13.353 9.140   1.00 68.03  ? 211 GLU A CD    1 
ATOM   703  O  OE1   . GLU A 1  91  ? 35.848 -13.667 9.938   1.00 61.83  ? 211 GLU A OE1   1 
ATOM   704  O  OE2   . GLU A 1  91  ? 37.399 -14.191 8.472   1.00 59.25  ? 211 GLU A OE2   1 
ATOM   705  N  N     . TYR A 1  92  ? 37.887 -8.885  9.844   1.00 58.30  ? 212 TYR A N     1 
ATOM   706  C  CA    . TYR A 1  92  ? 37.914 -8.270  11.167  1.00 56.98  ? 212 TYR A CA    1 
ATOM   707  C  C     . TYR A 1  92  ? 37.484 -9.252  12.254  1.00 62.81  ? 212 TYR A C     1 
ATOM   708  O  O     . TYR A 1  92  ? 36.441 -9.898  12.145  1.00 54.05  ? 212 TYR A O     1 
ATOM   709  C  CB    . TYR A 1  92  ? 37.017 -7.031  11.190  1.00 59.93  ? 212 TYR A CB    1 
ATOM   710  C  CG    . TYR A 1  92  ? 36.775 -6.444  12.566  1.00 69.42  ? 212 TYR A CG    1 
ATOM   711  C  CD1   . TYR A 1  92  ? 37.831 -6.003  13.354  1.00 55.58  ? 212 TYR A CD1   1 
ATOM   712  C  CD2   . TYR A 1  92  ? 35.486 -6.316  13.068  1.00 76.98  ? 212 TYR A CD2   1 
ATOM   713  C  CE1   . TYR A 1  92  ? 37.606 -5.458  14.612  1.00 74.32  ? 212 TYR A CE1   1 
ATOM   714  C  CE2   . TYR A 1  92  ? 35.253 -5.771  14.315  1.00 75.79  ? 212 TYR A CE2   1 
ATOM   715  C  CZ    . TYR A 1  92  ? 36.315 -5.344  15.083  1.00 73.30  ? 212 TYR A CZ    1 
ATOM   716  O  OH    . TYR A 1  92  ? 36.078 -4.804  16.326  1.00 84.09  ? 212 TYR A OH    1 
ATOM   717  N  N     . ALA A 1  93  ? 38.298 -9.363  13.299  1.00 57.93  ? 213 ALA A N     1 
ATOM   718  C  CA    . ALA A 1  93  ? 37.973 -10.216 14.436  1.00 63.35  ? 213 ALA A CA    1 
ATOM   719  C  C     . ALA A 1  93  ? 37.668 -9.355  15.659  1.00 55.99  ? 213 ALA A C     1 
ATOM   720  O  O     . ALA A 1  93  ? 38.582 -8.850  16.309  1.00 56.93  ? 213 ALA A O     1 
ATOM   721  C  CB    . ALA A 1  93  ? 39.109 -11.180 14.721  1.00 51.58  ? 213 ALA A CB    1 
ATOM   722  N  N     . PRO A 1  94  ? 36.372 -9.189  15.969  1.00 52.36  ? 214 PRO A N     1 
ATOM   723  C  CA    . PRO A 1  94  ? 35.841 -8.230  16.948  1.00 53.87  ? 214 PRO A CA    1 
ATOM   724  C  C     . PRO A 1  94  ? 36.311 -8.434  18.390  1.00 63.66  ? 214 PRO A C     1 
ATOM   725  O  O     . PRO A 1  94  ? 36.387 -7.457  19.138  1.00 55.10  ? 214 PRO A O     1 
ATOM   726  C  CB    . PRO A 1  94  ? 34.324 -8.449  16.866  1.00 56.31  ? 214 PRO A CB    1 
ATOM   727  C  CG    . PRO A 1  94  ? 34.091 -9.102  15.564  1.00 63.77  ? 214 PRO A CG    1 
ATOM   728  C  CD    . PRO A 1  94  ? 35.294 -9.951  15.316  1.00 66.21  ? 214 PRO A CD    1 
ATOM   729  N  N     . LEU A 1  95  ? 36.602 -9.670  18.785  1.00 53.03  ? 215 LEU A N     1 
ATOM   730  C  CA    . LEU A 1  95  ? 36.912 -9.940  20.187  1.00 64.01  ? 215 LEU A CA    1 
ATOM   731  C  C     . LEU A 1  95  ? 38.410 -10.082 20.446  1.00 64.48  ? 215 LEU A C     1 
ATOM   732  O  O     . LEU A 1  95  ? 38.820 -10.528 21.517  1.00 68.47  ? 215 LEU A O     1 
ATOM   733  C  CB    . LEU A 1  95  ? 36.178 -11.195 20.665  1.00 62.30  ? 215 LEU A CB    1 
ATOM   734  C  CG    . LEU A 1  95  ? 34.648 -11.133 20.612  1.00 67.55  ? 215 LEU A CG    1 
ATOM   735  C  CD1   . LEU A 1  95  ? 34.031 -12.300 21.370  1.00 60.89  ? 215 LEU A CD1   1 
ATOM   736  C  CD2   . LEU A 1  95  ? 34.130 -9.807  21.144  1.00 73.44  ? 215 LEU A CD2   1 
ATOM   737  N  N     . GLY A 1  96  ? 39.221 -9.700  19.465  1.00 53.87  ? 216 GLY A N     1 
ATOM   738  C  CA    . GLY A 1  96  ? 40.659 -9.637  19.652  1.00 57.63  ? 216 GLY A CA    1 
ATOM   739  C  C     . GLY A 1  96  ? 41.354 -10.981 19.761  1.00 58.95  ? 216 GLY A C     1 
ATOM   740  O  O     . GLY A 1  96  ? 40.818 -12.009 19.350  1.00 62.97  ? 216 GLY A O     1 
ATOM   741  N  N     . THR A 1  97  ? 42.558 -10.966 20.326  1.00 53.69  ? 217 THR A N     1 
ATOM   742  C  CA    . THR A 1  97  ? 43.392 -12.160 20.396  1.00 51.93  ? 217 THR A CA    1 
ATOM   743  C  C     . THR A 1  97  ? 43.056 -13.056 21.575  1.00 58.44  ? 217 THR A C     1 
ATOM   744  O  O     . THR A 1  97  ? 42.466 -12.618 22.564  1.00 59.73  ? 217 THR A O     1 
ATOM   745  C  CB    . THR A 1  97  ? 44.888 -11.800 20.492  1.00 54.96  ? 217 THR A CB    1 
ATOM   746  O  OG1   . THR A 1  97  ? 45.114 -10.960 21.632  1.00 58.68  ? 217 THR A OG1   1 
ATOM   747  C  CG2   . THR A 1  97  ? 45.339 -11.080 19.240  1.00 54.99  ? 217 THR A CG2   1 
ATOM   748  N  N     . VAL A 1  98  ? 43.445 -14.320 21.460  1.00 58.42  ? 218 VAL A N     1 
ATOM   749  C  CA    . VAL A 1  98  ? 43.353 -15.246 22.576  1.00 62.38  ? 218 VAL A CA    1 
ATOM   750  C  C     . VAL A 1  98  ? 44.413 -14.855 23.604  1.00 60.81  ? 218 VAL A C     1 
ATOM   751  O  O     . VAL A 1  98  ? 44.241 -15.061 24.807  1.00 60.12  ? 218 VAL A O     1 
ATOM   752  C  CB    . VAL A 1  98  ? 43.538 -16.707 22.112  1.00 47.69  ? 218 VAL A CB    1 
ATOM   753  C  CG1   . VAL A 1  98  ? 43.473 -17.665 23.289  1.00 55.78  ? 218 VAL A CG1   1 
ATOM   754  C  CG2   . VAL A 1  98  ? 42.471 -17.066 21.089  1.00 52.11  ? 218 VAL A CG2   1 
ATOM   755  N  N     . TYR A 1  99  ? 45.501 -14.267 23.112  1.00 63.29  ? 219 TYR A N     1 
ATOM   756  C  CA    . TYR A 1  99  ? 46.576 -13.769 23.964  1.00 61.35  ? 219 TYR A CA    1 
ATOM   757  C  C     . TYR A 1  99  ? 46.068 -12.730 24.958  1.00 64.85  ? 219 TYR A C     1 
ATOM   758  O  O     . TYR A 1  99  ? 46.396 -12.780 26.145  1.00 64.47  ? 219 TYR A O     1 
ATOM   759  C  CB    . TYR A 1  99  ? 47.698 -13.169 23.113  1.00 59.71  ? 219 TYR A CB    1 
ATOM   760  C  CG    . TYR A 1  99  ? 48.811 -12.542 23.922  1.00 75.68  ? 219 TYR A CG    1 
ATOM   761  C  CD1   . TYR A 1  99  ? 49.786 -13.327 24.522  1.00 72.50  ? 219 TYR A CD1   1 
ATOM   762  C  CD2   . TYR A 1  99  ? 48.885 -11.164 24.088  1.00 80.65  ? 219 TYR A CD2   1 
ATOM   763  C  CE1   . TYR A 1  99  ? 50.805 -12.759 25.263  1.00 88.32  ? 219 TYR A CE1   1 
ATOM   764  C  CE2   . TYR A 1  99  ? 49.900 -10.587 24.829  1.00 83.30  ? 219 TYR A CE2   1 
ATOM   765  C  CZ    . TYR A 1  99  ? 50.856 -11.389 25.413  1.00 86.97  ? 219 TYR A CZ    1 
ATOM   766  O  OH    . TYR A 1  99  ? 51.868 -10.819 26.150  1.00 98.18  ? 219 TYR A OH    1 
ATOM   767  N  N     . ARG A 1  100 ? 45.270 -11.787 24.467  1.00 58.56  ? 220 ARG A N     1 
ATOM   768  C  CA    . ARG A 1  100 ? 44.677 -10.770 25.328  1.00 59.39  ? 220 ARG A CA    1 
ATOM   769  C  C     . ARG A 1  100 ? 43.689 -11.408 26.299  1.00 65.42  ? 220 ARG A C     1 
ATOM   770  O  O     . ARG A 1  100 ? 43.589 -11.001 27.459  1.00 63.26  ? 220 ARG A O     1 
ATOM   771  C  CB    . ARG A 1  100 ? 43.985 -9.690  24.494  1.00 63.23  ? 220 ARG A CB    1 
ATOM   772  C  CG    . ARG A 1  100 ? 43.412 -8.546  25.315  1.00 78.90  ? 220 ARG A CG    1 
ATOM   773  N  N     . GLU A 1  101 ? 42.966 -12.417 25.823  1.00 57.40  ? 221 GLU A N     1 
ATOM   774  C  CA    A GLU A 1  101 ? 41.997 -13.126 26.651  0.56 61.57  ? 221 GLU A CA    1 
ATOM   775  C  CA    B GLU A 1  101 ? 41.997 -13.113 26.662  0.44 61.56  ? 221 GLU A CA    1 
ATOM   776  C  C     . GLU A 1  101 ? 42.700 -13.906 27.758  1.00 66.87  ? 221 GLU A C     1 
ATOM   777  O  O     . GLU A 1  101 ? 42.243 -13.937 28.901  1.00 64.42  ? 221 GLU A O     1 
ATOM   778  C  CB    A GLU A 1  101 ? 41.150 -14.070 25.794  0.56 59.76  ? 221 GLU A CB    1 
ATOM   779  C  CB    B GLU A 1  101 ? 41.119 -14.043 25.825  0.44 60.01  ? 221 GLU A CB    1 
ATOM   780  C  CG    A GLU A 1  101 ? 40.013 -14.750 26.544  0.56 61.23  ? 221 GLU A CG    1 
ATOM   781  C  CG    B GLU A 1  101 ? 39.985 -14.677 26.616  0.44 60.92  ? 221 GLU A CG    1 
ATOM   782  C  CD    A GLU A 1  101 ? 38.855 -13.812 26.835  0.56 65.58  ? 221 GLU A CD    1 
ATOM   783  C  CD    B GLU A 1  101 ? 39.163 -15.643 25.790  0.44 61.76  ? 221 GLU A CD    1 
ATOM   784  O  OE1   A GLU A 1  101 ? 38.850 -12.679 26.307  0.56 62.04  ? 221 GLU A OE1   1 
ATOM   785  O  OE1   B GLU A 1  101 ? 37.925 -15.656 25.951  0.44 61.65  ? 221 GLU A OE1   1 
ATOM   786  O  OE2   A GLU A 1  101 ? 37.945 -14.211 27.592  0.56 82.98  ? 221 GLU A OE2   1 
ATOM   787  O  OE2   B GLU A 1  101 ? 39.754 -16.394 24.986  0.44 66.52  ? 221 GLU A OE2   1 
ATOM   788  N  N     . LEU A 1  102 ? 43.814 -14.540 27.405  1.00 59.47  ? 222 LEU A N     1 
ATOM   789  C  CA    . LEU A 1  102 ? 44.599 -15.301 28.366  1.00 64.21  ? 222 LEU A CA    1 
ATOM   790  C  C     . LEU A 1  102 ? 45.201 -14.372 29.416  1.00 66.58  ? 222 LEU A C     1 
ATOM   791  O  O     . LEU A 1  102 ? 45.262 -14.712 30.594  1.00 73.57  ? 222 LEU A O     1 
ATOM   792  C  CB    . LEU A 1  102 ? 45.703 -16.091 27.663  1.00 60.53  ? 222 LEU A CB    1 
ATOM   793  C  CG    . LEU A 1  102 ? 46.542 -16.982 28.582  1.00 71.00  ? 222 LEU A CG    1 
ATOM   794  C  CD1   . LEU A 1  102 ? 45.662 -18.011 29.277  1.00 59.30  ? 222 LEU A CD1   1 
ATOM   795  C  CD2   . LEU A 1  102 ? 47.663 -17.661 27.811  1.00 72.20  ? 222 LEU A CD2   1 
ATOM   796  N  N     . GLN A 1  103 ? 45.640 -13.198 28.974  1.00 65.56  ? 223 GLN A N     1 
ATOM   797  C  CA    . GLN A 1  103 ? 46.195 -12.192 29.868  1.00 72.53  ? 223 GLN A CA    1 
ATOM   798  C  C     . GLN A 1  103 ? 45.110 -11.653 30.799  1.00 70.35  ? 223 GLN A C     1 
ATOM   799  O  O     . GLN A 1  103 ? 45.368 -11.342 31.963  1.00 78.41  ? 223 GLN A O     1 
ATOM   800  C  CB    . GLN A 1  103 ? 46.827 -11.052 29.064  1.00 82.24  ? 223 GLN A CB    1 
ATOM   801  C  CG    . GLN A 1  103 ? 48.330 -10.918 29.244  1.00 97.77  ? 223 GLN A CG    1 
ATOM   802  C  CD    . GLN A 1  103 ? 48.889 -9.682  28.566  1.00 100.76 ? 223 GLN A CD    1 
ATOM   803  O  OE1   . GLN A 1  103 ? 48.210 -9.038  27.767  1.00 99.63  ? 223 GLN A OE1   1 
ATOM   804  N  NE2   . GLN A 1  103 ? 50.132 -9.343  28.886  1.00 116.87 ? 223 GLN A NE2   1 
ATOM   805  N  N     . LYS A 1  104 ? 43.895 -11.553 30.272  1.00 63.24  ? 224 LYS A N     1 
ATOM   806  C  CA    . LYS A 1  104 ? 42.748 -11.084 31.037  1.00 67.78  ? 224 LYS A CA    1 
ATOM   807  C  C     . LYS A 1  104 ? 42.309 -12.116 32.071  1.00 79.55  ? 224 LYS A C     1 
ATOM   808  O  O     . LYS A 1  104 ? 41.912 -11.766 33.179  1.00 73.29  ? 224 LYS A O     1 
ATOM   809  C  CB    . LYS A 1  104 ? 41.581 -10.758 30.101  1.00 84.45  ? 224 LYS A CB    1 
ATOM   810  C  CG    . LYS A 1  104 ? 40.570 -9.774  30.668  1.00 85.55  ? 224 LYS A CG    1 
ATOM   811  C  CD    . LYS A 1  104 ? 39.343 -9.673  29.772  1.00 99.08  ? 224 LYS A CD    1 
ATOM   812  C  CE    . LYS A 1  104 ? 38.709 -11.041 29.563  1.00 104.64 ? 224 LYS A CE    1 
ATOM   813  N  NZ    . LYS A 1  104 ? 37.555 -11.008 28.624  1.00 101.72 ? 224 LYS A NZ    1 
ATOM   814  N  N     . LEU A 1  105 ? 42.391 -13.389 31.702  1.00 73.12  ? 225 LEU A N     1 
ATOM   815  C  CA    . LEU A 1  105 ? 41.855 -14.467 32.527  1.00 62.91  ? 225 LEU A CA    1 
ATOM   816  C  C     . LEU A 1  105 ? 42.923 -15.237 33.296  1.00 83.01  ? 225 LEU A C     1 
ATOM   817  O  O     . LEU A 1  105 ? 42.595 -16.123 34.090  1.00 79.42  ? 225 LEU A O     1 
ATOM   818  C  CB    . LEU A 1  105 ? 41.061 -15.441 31.654  1.00 74.97  ? 225 LEU A CB    1 
ATOM   819  C  CG    . LEU A 1  105 ? 39.540 -15.454 31.796  1.00 81.99  ? 225 LEU A CG    1 
ATOM   820  C  CD1   . LEU A 1  105 ? 38.964 -14.067 31.586  1.00 77.89  ? 225 LEU A CD1   1 
ATOM   821  C  CD2   . LEU A 1  105 ? 38.941 -16.439 30.801  1.00 69.52  ? 225 LEU A CD2   1 
ATOM   822  N  N     . SER A 1  106 ? 44.189 -14.905 33.046  1.00 76.41  ? 226 SER A N     1 
ATOM   823  C  CA    . SER A 1  106 ? 45.345 -15.594 33.635  1.00 71.75  ? 226 SER A CA    1 
ATOM   824  C  C     . SER A 1  106 ? 45.486 -17.042 33.151  1.00 70.44  ? 226 SER A C     1 
ATOM   825  O  O     . SER A 1  106 ? 46.583 -17.479 32.804  1.00 68.65  ? 226 SER A O     1 
ATOM   826  C  CB    . SER A 1  106 ? 45.282 -15.562 35.166  1.00 81.86  ? 226 SER A CB    1 
ATOM   827  O  OG    . SER A 1  106 ? 46.570 -15.745 35.721  1.00 86.17  ? 226 SER A OG    1 
ATOM   828  N  N     . LYS A 1  107 ? 44.380 -17.781 33.131  1.00 66.11  ? 227 LYS A N     1 
ATOM   829  C  CA    . LYS A 1  107 ? 44.383 -19.162 32.661  1.00 74.80  ? 227 LYS A CA    1 
ATOM   830  C  C     . LYS A 1  107 ? 42.978 -19.618 32.280  1.00 76.30  ? 227 LYS A C     1 
ATOM   831  O  O     . LYS A 1  107 ? 41.991 -19.172 32.866  1.00 74.01  ? 227 LYS A O     1 
ATOM   832  C  CB    . LYS A 1  107 ? 44.964 -20.091 33.730  1.00 85.85  ? 227 LYS A CB    1 
ATOM   833  N  N     . PHE A 1  108 ? 42.896 -20.508 31.296  1.00 68.51  ? 228 PHE A N     1 
ATOM   834  C  CA    . PHE A 1  108 ? 41.618 -21.055 30.852  1.00 68.37  ? 228 PHE A CA    1 
ATOM   835  C  C     . PHE A 1  108 ? 41.293 -22.349 31.591  1.00 74.95  ? 228 PHE A C     1 
ATOM   836  O  O     . PHE A 1  108 ? 42.194 -23.122 31.920  1.00 75.24  ? 228 PHE A O     1 
ATOM   837  C  CB    . PHE A 1  108 ? 41.631 -21.323 29.343  1.00 59.64  ? 228 PHE A CB    1 
ATOM   838  C  CG    . PHE A 1  108 ? 41.922 -20.110 28.501  1.00 64.06  ? 228 PHE A CG    1 
ATOM   839  C  CD1   . PHE A 1  108 ? 41.616 -18.836 28.953  1.00 67.79  ? 228 PHE A CD1   1 
ATOM   840  C  CD2   . PHE A 1  108 ? 42.494 -20.250 27.244  1.00 56.89  ? 228 PHE A CD2   1 
ATOM   841  C  CE1   . PHE A 1  108 ? 41.881 -17.725 28.173  1.00 69.74  ? 228 PHE A CE1   1 
ATOM   842  C  CE2   . PHE A 1  108 ? 42.762 -19.143 26.458  1.00 61.75  ? 228 PHE A CE2   1 
ATOM   843  C  CZ    . PHE A 1  108 ? 42.455 -17.879 26.922  1.00 67.11  ? 228 PHE A CZ    1 
ATOM   844  N  N     . ASP A 1  109 ? 40.010 -22.594 31.841  1.00 73.82  ? 229 ASP A N     1 
ATOM   845  C  CA    . ASP A 1  109 ? 39.591 -23.870 32.410  1.00 66.27  ? 229 ASP A CA    1 
ATOM   846  C  C     . ASP A 1  109 ? 39.602 -24.943 31.325  1.00 78.73  ? 229 ASP A C     1 
ATOM   847  O  O     . ASP A 1  109 ? 39.862 -24.651 30.155  1.00 71.57  ? 229 ASP A O     1 
ATOM   848  C  CB    . ASP A 1  109 ? 38.206 -23.764 33.064  1.00 70.28  ? 229 ASP A CB    1 
ATOM   849  C  CG    . ASP A 1  109 ? 37.179 -23.090 32.173  1.00 84.00  ? 229 ASP A CG    1 
ATOM   850  O  OD1   . ASP A 1  109 ? 37.200 -23.310 30.945  1.00 89.86  ? 229 ASP A OD1   1 
ATOM   851  O  OD2   . ASP A 1  109 ? 36.336 -22.340 32.711  1.00 90.74  ? 229 ASP A OD2   1 
ATOM   852  N  N     . GLU A 1  110 ? 39.325 -26.184 31.711  1.00 67.15  ? 230 GLU A N     1 
ATOM   853  C  CA    . GLU A 1  110 ? 39.415 -27.303 30.780  1.00 68.22  ? 230 GLU A CA    1 
ATOM   854  C  C     . GLU A 1  110 ? 38.366 -27.228 29.673  1.00 79.30  ? 230 GLU A C     1 
ATOM   855  O  O     . GLU A 1  110 ? 38.613 -27.667 28.550  1.00 70.71  ? 230 GLU A O     1 
ATOM   856  C  CB    . GLU A 1  110 ? 39.296 -28.629 31.531  1.00 60.58  ? 230 GLU A CB    1 
ATOM   857  C  CG    . GLU A 1  110 ? 40.422 -28.862 32.522  1.00 71.71  ? 230 GLU A CG    1 
ATOM   858  C  CD    . GLU A 1  110 ? 40.526 -30.306 32.960  1.00 82.01  ? 230 GLU A CD    1 
ATOM   859  O  OE1   . GLU A 1  110 ? 39.618 -30.786 33.672  1.00 91.13  ? 230 GLU A OE1   1 
ATOM   860  O  OE2   . GLU A 1  110 ? 41.520 -30.963 32.587  1.00 85.37  ? 230 GLU A OE2   1 
ATOM   861  N  N     . GLN A 1  111 ? 37.203 -26.667 29.987  1.00 68.43  ? 231 GLN A N     1 
ATOM   862  C  CA    . GLN A 1  111 ? 36.140 -26.532 28.997  1.00 70.78  ? 231 GLN A CA    1 
ATOM   863  C  C     . GLN A 1  111 ? 36.538 -25.566 27.883  1.00 74.32  ? 231 GLN A C     1 
ATOM   864  O  O     . GLN A 1  111 ? 36.356 -25.857 26.701  1.00 78.01  ? 231 GLN A O     1 
ATOM   865  C  CB    . GLN A 1  111 ? 34.844 -26.065 29.658  1.00 87.73  ? 231 GLN A CB    1 
ATOM   866  C  CG    . GLN A 1  111 ? 33.690 -25.884 28.686  1.00 97.98  ? 231 GLN A CG    1 
ATOM   867  C  CD    . GLN A 1  111 ? 32.417 -25.436 29.374  1.00 105.06 ? 231 GLN A CD    1 
ATOM   868  O  OE1   . GLN A 1  111 ? 32.363 -25.332 30.599  1.00 119.84 ? 231 GLN A OE1   1 
ATOM   869  N  NE2   . GLN A 1  111 ? 31.382 -25.168 28.586  1.00 102.88 ? 231 GLN A NE2   1 
ATOM   870  N  N     . ARG A 1  112 ? 37.089 -24.419 28.268  1.00 65.42  ? 232 ARG A N     1 
ATOM   871  C  CA    . ARG A 1  112 ? 37.488 -23.398 27.308  1.00 71.13  ? 232 ARG A CA    1 
ATOM   872  C  C     . ARG A 1  112 ? 38.693 -23.850 26.491  1.00 79.84  ? 232 ARG A C     1 
ATOM   873  O  O     . ARG A 1  112 ? 38.746 -23.652 25.274  1.00 66.46  ? 232 ARG A O     1 
ATOM   874  C  CB    . ARG A 1  112 ? 37.804 -22.088 28.030  1.00 71.63  ? 232 ARG A CB    1 
ATOM   875  C  CG    . ARG A 1  112 ? 37.951 -20.889 27.112  1.00 76.44  ? 232 ARG A CG    1 
ATOM   876  C  CD    . ARG A 1  112 ? 38.199 -19.624 27.915  1.00 84.45  ? 232 ARG A CD    1 
ATOM   877  N  NE    . ARG A 1  112 ? 37.706 -18.438 27.223  1.00 96.34  ? 232 ARG A NE    1 
ATOM   878  C  CZ    . ARG A 1  112 ? 36.459 -17.988 27.315  1.00 107.00 ? 232 ARG A CZ    1 
ATOM   879  N  NH1   . ARG A 1  112 ? 35.576 -18.625 28.072  1.00 109.08 ? 232 ARG A NH1   1 
ATOM   880  N  NH2   . ARG A 1  112 ? 36.093 -16.901 26.650  1.00 116.87 ? 232 ARG A NH2   1 
ATOM   881  N  N     . THR A 1  113 ? 39.657 -24.459 27.173  1.00 76.09  ? 233 THR A N     1 
ATOM   882  C  CA    . THR A 1  113 ? 40.878 -24.932 26.536  1.00 66.50  ? 233 THR A CA    1 
ATOM   883  C  C     . THR A 1  113 ? 40.581 -25.989 25.476  1.00 66.62  ? 233 THR A C     1 
ATOM   884  O  O     . THR A 1  113 ? 41.040 -25.882 24.340  1.00 65.58  ? 233 THR A O     1 
ATOM   885  C  CB    . THR A 1  113 ? 41.859 -25.506 27.576  1.00 61.98  ? 233 THR A CB    1 
ATOM   886  O  OG1   . THR A 1  113 ? 42.325 -24.449 28.424  1.00 61.54  ? 233 THR A OG1   1 
ATOM   887  C  CG2   . THR A 1  113 ? 43.051 -26.157 26.893  1.00 57.82  ? 233 THR A CG2   1 
ATOM   888  N  N     . ALA A 1  114 ? 39.802 -27.000 25.851  1.00 57.41  ? 234 ALA A N     1 
ATOM   889  C  CA    . ALA A 1  114 ? 39.443 -28.078 24.936  1.00 58.73  ? 234 ALA A CA    1 
ATOM   890  C  C     . ALA A 1  114 ? 38.640 -27.561 23.745  1.00 67.34  ? 234 ALA A C     1 
ATOM   891  O  O     . ALA A 1  114 ? 38.762 -28.075 22.633  1.00 67.83  ? 234 ALA A O     1 
ATOM   892  C  CB    . ALA A 1  114 ? 38.663 -29.153 25.669  1.00 53.97  ? 234 ALA A CB    1 
ATOM   893  N  N     . THR A 1  115 ? 37.819 -26.544 23.987  1.00 64.93  ? 235 THR A N     1 
ATOM   894  C  CA    . THR A 1  115 ? 37.025 -25.934 22.929  1.00 65.48  ? 235 THR A CA    1 
ATOM   895  C  C     . THR A 1  115 ? 37.931 -25.247 21.911  1.00 67.25  ? 235 THR A C     1 
ATOM   896  O  O     . THR A 1  115 ? 37.760 -25.415 20.703  1.00 59.63  ? 235 THR A O     1 
ATOM   897  C  CB    . THR A 1  115 ? 36.017 -24.917 23.495  1.00 62.90  ? 235 THR A CB    1 
ATOM   898  O  OG1   . THR A 1  115 ? 35.169 -25.564 24.451  1.00 76.41  ? 235 THR A OG1   1 
ATOM   899  C  CG2   . THR A 1  115 ? 35.160 -24.334 22.383  1.00 59.94  ? 235 THR A CG2   1 
ATOM   900  N  N     . TYR A 1  116 ? 38.902 -24.485 22.408  1.00 57.62  ? 236 TYR A N     1 
ATOM   901  C  CA    . TYR A 1  116 ? 39.853 -23.789 21.549  1.00 60.07  ? 236 TYR A CA    1 
ATOM   902  C  C     . TYR A 1  116 ? 40.724 -24.764 20.762  1.00 63.20  ? 236 TYR A C     1 
ATOM   903  O  O     . TYR A 1  116 ? 41.034 -24.526 19.595  1.00 63.10  ? 236 TYR A O     1 
ATOM   904  C  CB    . TYR A 1  116 ? 40.741 -22.856 22.375  1.00 48.19  ? 236 TYR A CB    1 
ATOM   905  C  CG    . TYR A 1  116 ? 40.074 -21.561 22.780  1.00 55.19  ? 236 TYR A CG    1 
ATOM   906  C  CD1   . TYR A 1  116 ? 38.863 -21.175 22.221  1.00 63.82  ? 236 TYR A CD1   1 
ATOM   907  C  CD2   . TYR A 1  116 ? 40.656 -20.724 23.724  1.00 50.85  ? 236 TYR A CD2   1 
ATOM   908  C  CE1   . TYR A 1  116 ? 38.250 -19.992 22.591  1.00 71.23  ? 236 TYR A CE1   1 
ATOM   909  C  CE2   . TYR A 1  116 ? 40.051 -19.540 24.099  1.00 51.61  ? 236 TYR A CE2   1 
ATOM   910  C  CZ    . TYR A 1  116 ? 38.849 -19.179 23.531  1.00 60.80  ? 236 TYR A CZ    1 
ATOM   911  O  OH    . TYR A 1  116 ? 38.247 -17.999 23.902  1.00 62.93  ? 236 TYR A OH    1 
ATOM   912  N  N     . ILE A 1  117 ? 41.119 -25.856 21.409  1.00 57.70  ? 237 ILE A N     1 
ATOM   913  C  CA    . ILE A 1  117 ? 41.958 -26.862 20.770  1.00 52.25  ? 237 ILE A CA    1 
ATOM   914  C  C     . ILE A 1  117 ? 41.199 -27.557 19.646  1.00 64.33  ? 237 ILE A C     1 
ATOM   915  O  O     . ILE A 1  117 ? 41.753 -27.811 18.577  1.00 66.67  ? 237 ILE A O     1 
ATOM   916  C  CB    . ILE A 1  117 ? 42.459 -27.910 21.787  1.00 51.13  ? 237 ILE A CB    1 
ATOM   917  C  CG1   . ILE A 1  117 ? 43.374 -27.255 22.823  1.00 54.56  ? 237 ILE A CG1   1 
ATOM   918  C  CG2   . ILE A 1  117 ? 43.191 -29.043 21.086  1.00 50.60  ? 237 ILE A CG2   1 
ATOM   919  C  CD1   . ILE A 1  117 ? 44.555 -26.520 22.231  1.00 53.05  ? 237 ILE A CD1   1 
ATOM   920  N  N     . THR A 1  118 ? 39.926 -27.848 19.890  1.00 63.25  ? 238 THR A N     1 
ATOM   921  C  CA    . THR A 1  118 ? 39.074 -28.489 18.895  1.00 62.87  ? 238 THR A CA    1 
ATOM   922  C  C     . THR A 1  118 ? 38.921 -27.625 17.646  1.00 67.85  ? 238 THR A C     1 
ATOM   923  O  O     . THR A 1  118 ? 39.088 -28.107 16.524  1.00 60.95  ? 238 THR A O     1 
ATOM   924  C  CB    . THR A 1  118 ? 37.678 -28.798 19.466  1.00 64.06  ? 238 THR A CB    1 
ATOM   925  O  OG1   . THR A 1  118 ? 37.801 -29.721 20.556  1.00 67.45  ? 238 THR A OG1   1 
ATOM   926  C  CG2   . THR A 1  118 ? 36.785 -29.404 18.394  1.00 64.32  ? 238 THR A CG2   1 
ATOM   927  N  N     . GLU A 1  119 ? 38.602 -26.349 17.846  1.00 59.00  ? 239 GLU A N     1 
ATOM   928  C  CA    . GLU A 1  119 ? 38.470 -25.410 16.738  1.00 65.91  ? 239 GLU A CA    1 
ATOM   929  C  C     . GLU A 1  119 ? 39.782 -25.272 15.976  1.00 71.27  ? 239 GLU A C     1 
ATOM   930  O  O     . GLU A 1  119 ? 39.797 -25.212 14.746  1.00 74.19  ? 239 GLU A O     1 
ATOM   931  C  CB    . GLU A 1  119 ? 38.016 -24.040 17.243  1.00 57.77  ? 239 GLU A CB    1 
ATOM   932  C  CG    . GLU A 1  119 ? 36.579 -23.995 17.731  1.00 66.49  ? 239 GLU A CG    1 
ATOM   933  C  CD    . GLU A 1  119 ? 36.190 -22.624 18.247  1.00 73.85  ? 239 GLU A CD    1 
ATOM   934  O  OE1   . GLU A 1  119 ? 36.943 -22.065 19.070  1.00 69.29  ? 239 GLU A OE1   1 
ATOM   935  O  OE2   . GLU A 1  119 ? 35.139 -22.100 17.823  1.00 80.49  ? 239 GLU A OE2   1 
ATOM   936  N  N     . LEU A 1  120 ? 40.883 -25.229 16.719  1.00 62.14  ? 240 LEU A N     1 
ATOM   937  C  CA    . LEU A 1  120 ? 42.201 -25.068 16.124  1.00 54.64  ? 240 LEU A CA    1 
ATOM   938  C  C     . LEU A 1  120 ? 42.647 -26.325 15.384  1.00 66.56  ? 240 LEU A C     1 
ATOM   939  O  O     . LEU A 1  120 ? 43.221 -26.241 14.299  1.00 59.38  ? 240 LEU A O     1 
ATOM   940  C  CB    . LEU A 1  120 ? 43.227 -24.700 17.195  1.00 53.55  ? 240 LEU A CB    1 
ATOM   941  C  CG    . LEU A 1  120 ? 44.655 -24.488 16.691  1.00 65.53  ? 240 LEU A CG    1 
ATOM   942  C  CD1   . LEU A 1  120 ? 44.680 -23.477 15.567  1.00 61.50  ? 240 LEU A CD1   1 
ATOM   943  C  CD2   . LEU A 1  120 ? 45.546 -24.030 17.819  1.00 63.18  ? 240 LEU A CD2   1 
ATOM   944  N  N     . ALA A 1  121 ? 42.384 -27.488 15.974  1.00 58.72  ? 241 ALA A N     1 
ATOM   945  C  CA    . ALA A 1  121 ? 42.765 -28.752 15.355  1.00 57.37  ? 241 ALA A CA    1 
ATOM   946  C  C     . ALA A 1  121 ? 41.968 -28.985 14.076  1.00 60.95  ? 241 ALA A C     1 
ATOM   947  O  O     . ALA A 1  121 ? 42.485 -29.546 13.112  1.00 60.13  ? 241 ALA A O     1 
ATOM   948  C  CB    . ALA A 1  121 ? 42.567 -29.906 16.322  1.00 52.77  ? 241 ALA A CB    1 
ATOM   949  N  N     . ASN A 1  122 ? 40.710 -28.554 14.075  1.00 60.54  ? 242 ASN A N     1 
ATOM   950  C  CA    . ASN A 1  122 ? 39.879 -28.634 12.880  1.00 66.95  ? 242 ASN A CA    1 
ATOM   951  C  C     . ASN A 1  122 ? 40.457 -27.793 11.750  1.00 64.31  ? 242 ASN A C     1 
ATOM   952  O  O     . ASN A 1  122 ? 40.567 -28.250 10.613  1.00 69.42  ? 242 ASN A O     1 
ATOM   953  C  CB    . ASN A 1  122 ? 38.450 -28.185 13.182  1.00 62.43  ? 242 ASN A CB    1 
ATOM   954  C  CG    . ASN A 1  122 ? 37.657 -29.231 13.937  1.00 76.23  ? 242 ASN A CG    1 
ATOM   955  O  OD1   . ASN A 1  122 ? 37.869 -30.430 13.764  1.00 83.48  ? 242 ASN A OD1   1 
ATOM   956  N  ND2   . ASN A 1  122 ? 36.732 -28.781 14.776  1.00 75.93  ? 242 ASN A ND2   1 
ATOM   957  N  N     . ALA A 1  123 ? 40.830 -26.561 12.079  1.00 61.97  ? 243 ALA A N     1 
ATOM   958  C  CA    . ALA A 1  123 ? 41.389 -25.639 11.103  1.00 69.45  ? 243 ALA A CA    1 
ATOM   959  C  C     . ALA A 1  123 ? 42.742 -26.126 10.590  1.00 70.21  ? 243 ALA A C     1 
ATOM   960  O  O     . ALA A 1  123 ? 43.044 -26.008 9.403   1.00 63.99  ? 243 ALA A O     1 
ATOM   961  C  CB    . ALA A 1  123 ? 41.516 -24.254 11.706  1.00 48.50  ? 243 ALA A CB    1 
ATOM   962  N  N     . LEU A 1  124 ? 43.550 -26.676 11.491  1.00 56.79  ? 244 LEU A N     1 
ATOM   963  C  CA    . LEU A 1  124 ? 44.857 -27.204 11.121  1.00 56.53  ? 244 LEU A CA    1 
ATOM   964  C  C     . LEU A 1  124 ? 44.727 -28.464 10.273  1.00 65.08  ? 244 LEU A C     1 
ATOM   965  O  O     . LEU A 1  124 ? 45.508 -28.678 9.345   1.00 70.78  ? 244 LEU A O     1 
ATOM   966  C  CB    . LEU A 1  124 ? 45.692 -27.498 12.365  1.00 53.05  ? 244 LEU A CB    1 
ATOM   967  C  CG    . LEU A 1  124 ? 46.245 -26.301 13.137  1.00 58.57  ? 244 LEU A CG    1 
ATOM   968  C  CD1   . LEU A 1  124 ? 46.834 -26.767 14.456  1.00 61.25  ? 244 LEU A CD1   1 
ATOM   969  C  CD2   . LEU A 1  124 ? 47.289 -25.559 12.312  1.00 49.31  ? 244 LEU A CD2   1 
ATOM   970  N  N     . SER A 1  125 ? 43.743 -29.297 10.601  1.00 68.28  ? 245 SER A N     1 
ATOM   971  C  CA    . SER A 1  125 ? 43.492 -30.520 9.845   1.00 73.33  ? 245 SER A CA    1 
ATOM   972  C  C     . SER A 1  125 ? 43.149 -30.176 8.403   1.00 75.19  ? 245 SER A C     1 
ATOM   973  O  O     . SER A 1  125 ? 43.545 -30.876 7.470   1.00 68.64  ? 245 SER A O     1 
ATOM   974  C  CB    . SER A 1  125 ? 42.365 -31.334 10.484  1.00 70.87  ? 245 SER A CB    1 
ATOM   975  O  OG    . SER A 1  125 ? 42.190 -32.572 9.819   1.00 87.75  ? 245 SER A OG    1 
ATOM   976  N  N     . TYR A 1  126 ? 42.414 -29.083 8.232   1.00 69.27  ? 246 TYR A N     1 
ATOM   977  C  CA    . TYR A 1  126 ? 42.082 -28.581 6.908   1.00 66.27  ? 246 TYR A CA    1 
ATOM   978  C  C     . TYR A 1  126 ? 43.326 -28.050 6.200   1.00 70.91  ? 246 TYR A C     1 
ATOM   979  O  O     . TYR A 1  126 ? 43.501 -28.262 5.000   1.00 63.54  ? 246 TYR A O     1 
ATOM   980  C  CB    . TYR A 1  126 ? 41.012 -27.492 7.007   1.00 61.90  ? 246 TYR A CB    1 
ATOM   981  C  CG    . TYR A 1  126 ? 40.879 -26.635 5.770   1.00 71.34  ? 246 TYR A CG    1 
ATOM   982  C  CD1   . TYR A 1  126 ? 40.202 -27.097 4.646   1.00 74.02  ? 246 TYR A CD1   1 
ATOM   983  C  CD2   . TYR A 1  126 ? 41.425 -25.359 5.729   1.00 61.61  ? 246 TYR A CD2   1 
ATOM   984  C  CE1   . TYR A 1  126 ? 40.078 -26.311 3.513   1.00 66.40  ? 246 TYR A CE1   1 
ATOM   985  C  CE2   . TYR A 1  126 ? 41.306 -24.568 4.610   1.00 63.30  ? 246 TYR A CE2   1 
ATOM   986  C  CZ    . TYR A 1  126 ? 40.634 -25.047 3.505   1.00 75.68  ? 246 TYR A CZ    1 
ATOM   987  O  OH    . TYR A 1  126 ? 40.521 -24.249 2.394   1.00 74.55  ? 246 TYR A OH    1 
ATOM   988  N  N     . CYS A 1  127 ? 44.188 -27.365 6.948   1.00 58.63  ? 247 CYS A N     1 
ATOM   989  C  CA    . CYS A 1  127 ? 45.434 -26.839 6.394   1.00 57.82  ? 247 CYS A CA    1 
ATOM   990  C  C     . CYS A 1  127 ? 46.354 -27.948 5.897   1.00 62.48  ? 247 CYS A C     1 
ATOM   991  O  O     . CYS A 1  127 ? 46.935 -27.847 4.816   1.00 67.01  ? 247 CYS A O     1 
ATOM   992  C  CB    . CYS A 1  127 ? 46.175 -25.988 7.432   1.00 59.76  ? 247 CYS A CB    1 
ATOM   993  S  SG    . CYS A 1  127 ? 45.438 -24.369 7.754   1.00 61.78  ? 247 CYS A SG    1 
ATOM   994  N  N     . HIS A 1  128 ? 46.488 -29.004 6.693   1.00 57.32  ? 248 HIS A N     1 
ATOM   995  C  CA    . HIS A 1  128 ? 47.399 -30.094 6.364   1.00 59.67  ? 248 HIS A CA    1 
ATOM   996  C  C     . HIS A 1  128 ? 46.846 -30.962 5.237   1.00 64.00  ? 248 HIS A C     1 
ATOM   997  O  O     . HIS A 1  128 ? 47.601 -31.636 4.537   1.00 66.86  ? 248 HIS A O     1 
ATOM   998  C  CB    . HIS A 1  128 ? 47.686 -30.948 7.602   1.00 66.43  ? 248 HIS A CB    1 
ATOM   999  C  CG    . HIS A 1  128 ? 48.466 -30.230 8.662   1.00 56.53  ? 248 HIS A CG    1 
ATOM   1000 N  ND1   . HIS A 1  128 ? 49.088 -30.888 9.702   1.00 54.46  ? 248 HIS A ND1   1 
ATOM   1001 C  CD2   . HIS A 1  128 ? 48.722 -28.914 8.844   1.00 53.90  ? 248 HIS A CD2   1 
ATOM   1002 C  CE1   . HIS A 1  128 ? 49.696 -30.008 10.476  1.00 48.25  ? 248 HIS A CE1   1 
ATOM   1003 N  NE2   . HIS A 1  128 ? 49.489 -28.802 9.979   1.00 58.52  ? 248 HIS A NE2   1 
ATOM   1004 N  N     . SER A 1  129 ? 45.528 -30.941 5.061   1.00 69.77  ? 249 SER A N     1 
ATOM   1005 C  CA    . SER A 1  129 ? 44.907 -31.641 3.943   1.00 73.05  ? 249 SER A CA    1 
ATOM   1006 C  C     . SER A 1  129 ? 45.273 -30.940 2.643   1.00 65.79  ? 249 SER A C     1 
ATOM   1007 O  O     . SER A 1  129 ? 45.274 -31.548 1.576   1.00 70.82  ? 249 SER A O     1 
ATOM   1008 C  CB    . SER A 1  129 ? 43.387 -31.704 4.101   1.00 73.75  ? 249 SER A CB    1 
ATOM   1009 O  OG    . SER A 1  129 ? 42.806 -30.422 3.940   1.00 78.84  ? 249 SER A OG    1 
ATOM   1010 N  N     . LYS A 1  130 ? 45.580 -29.651 2.742   1.00 67.91  ? 250 LYS A N     1 
ATOM   1011 C  CA    . LYS A 1  130 ? 46.021 -28.879 1.588   1.00 73.18  ? 250 LYS A CA    1 
ATOM   1012 C  C     . LYS A 1  130 ? 47.541 -28.772 1.577   1.00 78.94  ? 250 LYS A C     1 
ATOM   1013 O  O     . LYS A 1  130 ? 48.115 -27.997 0.809   1.00 70.16  ? 250 LYS A O     1 
ATOM   1014 C  CB    . LYS A 1  130 ? 45.376 -27.493 1.596   1.00 75.91  ? 250 LYS A CB    1 
ATOM   1015 C  CG    . LYS A 1  130 ? 43.860 -27.535 1.475   1.00 71.99  ? 250 LYS A CG    1 
ATOM   1016 C  CD    . LYS A 1  130 ? 43.444 -28.259 0.196   1.00 76.05  ? 250 LYS A CD    1 
ATOM   1017 C  CE    . LYS A 1  130 ? 41.943 -28.492 0.155   1.00 85.93  ? 250 LYS A CE    1 
ATOM   1018 N  NZ    . LYS A 1  130 ? 41.522 -29.184 -1.097  1.00 87.89  ? 250 LYS A NZ    1 
ATOM   1019 N  N     . ARG A 1  131 ? 48.173 -29.568 2.438   1.00 65.09  ? 251 ARG A N     1 
ATOM   1020 C  CA    . ARG A 1  131 ? 49.629 -29.641 2.564   1.00 54.51  ? 251 ARG A CA    1 
ATOM   1021 C  C     . ARG A 1  131 ? 50.233 -28.303 2.987   1.00 51.28  ? 251 ARG A C     1 
ATOM   1022 O  O     . ARG A 1  131 ? 51.359 -27.971 2.616   1.00 54.55  ? 251 ARG A O     1 
ATOM   1023 C  CB    . ARG A 1  131 ? 50.264 -30.117 1.252   1.00 62.18  ? 251 ARG A CB    1 
ATOM   1024 C  CG    . ARG A 1  131 ? 49.636 -31.377 0.666   1.00 62.45  ? 251 ARG A CG    1 
ATOM   1025 C  CD    . ARG A 1  131 ? 49.576 -32.499 1.688   1.00 67.46  ? 251 ARG A CD    1 
ATOM   1026 N  NE    . ARG A 1  131 ? 50.902 -32.907 2.140   1.00 79.66  ? 251 ARG A NE    1 
ATOM   1027 C  CZ    . ARG A 1  131 ? 51.152 -33.439 3.333   1.00 101.97 ? 251 ARG A CZ    1 
ATOM   1028 N  NH1   . ARG A 1  131 ? 50.165 -33.620 4.202   1.00 98.38  ? 251 ARG A NH1   1 
ATOM   1029 N  NH2   . ARG A 1  131 ? 52.390 -33.783 3.662   1.00 109.10 ? 251 ARG A NH2   1 
ATOM   1030 N  N     . VAL A 1  132 ? 49.479 -27.545 3.773   1.00 59.14  ? 252 VAL A N     1 
ATOM   1031 C  CA    . VAL A 1  132 ? 49.941 -26.256 4.274   1.00 55.85  ? 252 VAL A CA    1 
ATOM   1032 C  C     . VAL A 1  132 ? 50.397 -26.367 5.727   1.00 50.50  ? 252 VAL A C     1 
ATOM   1033 O  O     . VAL A 1  132 ? 49.713 -26.968 6.555   1.00 54.41  ? 252 VAL A O     1 
ATOM   1034 C  CB    . VAL A 1  132 ? 48.834 -25.186 4.155   1.00 57.48  ? 252 VAL A CB    1 
ATOM   1035 C  CG1   . VAL A 1  132 ? 49.223 -23.910 4.890   1.00 50.67  ? 252 VAL A CG1   1 
ATOM   1036 C  CG2   . VAL A 1  132 ? 48.531 -24.900 2.687   1.00 53.96  ? 252 VAL A CG2   1 
ATOM   1037 N  N     . ILE A 1  133 ? 51.562 -25.801 6.028   1.00 51.93  ? 253 ILE A N     1 
ATOM   1038 C  CA    . ILE A 1  133 ? 52.055 -25.745 7.401   1.00 50.22  ? 253 ILE A CA    1 
ATOM   1039 C  C     . ILE A 1  133 ? 52.078 -24.301 7.893   1.00 50.36  ? 253 ILE A C     1 
ATOM   1040 O  O     . ILE A 1  133 ? 52.664 -23.434 7.250   1.00 46.45  ? 253 ILE A O     1 
ATOM   1041 C  CB    . ILE A 1  133 ? 53.468 -26.346 7.527   1.00 45.15  ? 253 ILE A CB    1 
ATOM   1042 C  CG1   . ILE A 1  133 ? 53.633 -27.545 6.594   1.00 48.87  ? 253 ILE A CG1   1 
ATOM   1043 C  CG2   . ILE A 1  133 ? 53.754 -26.730 8.979   1.00 49.36  ? 253 ILE A CG2   1 
ATOM   1044 C  CD1   . ILE A 1  133 ? 55.025 -28.143 6.597   1.00 47.47  ? 253 ILE A CD1   1 
ATOM   1045 N  N     . HIS A 1  134 ? 51.444 -24.043 9.035   1.00 54.32  ? 254 HIS A N     1 
ATOM   1046 C  CA    . HIS A 1  134 ? 51.353 -22.682 9.561   1.00 39.70  ? 254 HIS A CA    1 
ATOM   1047 C  C     . HIS A 1  134 ? 52.678 -22.207 10.152  1.00 44.77  ? 254 HIS A C     1 
ATOM   1048 O  O     . HIS A 1  134 ? 53.127 -21.093 9.871   1.00 38.94  ? 254 HIS A O     1 
ATOM   1049 C  CB    . HIS A 1  134 ? 50.251 -22.587 10.620  1.00 37.48  ? 254 HIS A CB    1 
ATOM   1050 C  CG    . HIS A 1  134 ? 49.977 -21.186 11.072  1.00 47.00  ? 254 HIS A CG    1 
ATOM   1051 N  ND1   . HIS A 1  134 ? 50.712 -20.564 12.059  1.00 38.13  ? 254 HIS A ND1   1 
ATOM   1052 C  CD2   . HIS A 1  134 ? 49.062 -20.279 10.656  1.00 43.83  ? 254 HIS A CD2   1 
ATOM   1053 C  CE1   . HIS A 1  134 ? 50.256 -19.337 12.236  1.00 50.80  ? 254 HIS A CE1   1 
ATOM   1054 N  NE2   . HIS A 1  134 ? 49.255 -19.139 11.397  1.00 51.38  ? 254 HIS A NE2   1 
ATOM   1055 N  N     . ARG A 1  135 ? 53.270 -23.053 10.995  1.00 45.29  ? 255 ARG A N     1 
ATOM   1056 C  CA    . ARG A 1  135 ? 54.596 -22.837 11.586  1.00 52.62  ? 255 ARG A CA    1 
ATOM   1057 C  C     . ARG A 1  135 ? 54.696 -21.663 12.572  1.00 45.37  ? 255 ARG A C     1 
ATOM   1058 O  O     . ARG A 1  135 ? 55.787 -21.349 13.045  1.00 51.57  ? 255 ARG A O     1 
ATOM   1059 C  CB    . ARG A 1  135 ? 55.646 -22.652 10.480  1.00 53.85  ? 255 ARG A CB    1 
ATOM   1060 C  CG    . ARG A 1  135 ? 55.719 -23.809 9.486   1.00 52.88  ? 255 ARG A CG    1 
ATOM   1061 C  CD    . ARG A 1  135 ? 57.027 -23.817 8.705   1.00 61.76  ? 255 ARG A CD    1 
ATOM   1062 N  NE    . ARG A 1  135 ? 57.199 -22.631 7.869   1.00 50.80  ? 255 ARG A NE    1 
ATOM   1063 C  CZ    . ARG A 1  135 ? 58.205 -22.459 7.016   1.00 52.31  ? 255 ARG A CZ    1 
ATOM   1064 N  NH1   . ARG A 1  135 ? 59.136 -23.396 6.886   1.00 44.18  ? 255 ARG A NH1   1 
ATOM   1065 N  NH2   . ARG A 1  135 ? 58.286 -21.350 6.295   1.00 51.50  ? 255 ARG A NH2   1 
ATOM   1066 N  N     . ASP A 1  136 ? 53.583 -21.011 12.889  1.00 48.55  ? 256 ASP A N     1 
ATOM   1067 C  CA    . ASP A 1  136 ? 53.639 -19.922 13.864  1.00 47.76  ? 256 ASP A CA    1 
ATOM   1068 C  C     . ASP A 1  136 ? 52.415 -19.885 14.784  1.00 46.24  ? 256 ASP A C     1 
ATOM   1069 O  O     . ASP A 1  136 ? 51.884 -18.818 15.094  1.00 48.77  ? 256 ASP A O     1 
ATOM   1070 C  CB    . ASP A 1  136 ? 53.803 -18.575 13.155  1.00 50.41  ? 256 ASP A CB    1 
ATOM   1071 C  CG    . ASP A 1  136 ? 54.293 -17.477 14.092  1.00 63.35  ? 256 ASP A CG    1 
ATOM   1072 O  OD1   . ASP A 1  136 ? 54.888 -17.808 15.141  1.00 69.24  ? 256 ASP A OD1   1 
ATOM   1073 O  OD2   . ASP A 1  136 ? 54.082 -16.285 13.786  1.00 64.73  ? 256 ASP A OD2   1 
ATOM   1074 N  N     . ILE A 1  137 ? 51.976 -21.057 15.225  1.00 43.24  ? 257 ILE A N     1 
ATOM   1075 C  CA    . ILE A 1  137 ? 50.869 -21.144 16.168  1.00 52.25  ? 257 ILE A CA    1 
ATOM   1076 C  C     . ILE A 1  137 ? 51.266 -20.565 17.526  1.00 46.34  ? 257 ILE A C     1 
ATOM   1077 O  O     . ILE A 1  137 ? 52.232 -21.019 18.139  1.00 49.57  ? 257 ILE A O     1 
ATOM   1078 C  CB    . ILE A 1  137 ? 50.402 -22.596 16.357  1.00 54.10  ? 257 ILE A CB    1 
ATOM   1079 C  CG1   . ILE A 1  137 ? 49.910 -23.175 15.032  1.00 61.47  ? 257 ILE A CG1   1 
ATOM   1080 C  CG2   . ILE A 1  137 ? 49.305 -22.672 17.413  1.00 56.80  ? 257 ILE A CG2   1 
ATOM   1081 C  CD1   . ILE A 1  137 ? 49.623 -24.656 15.096  1.00 62.11  ? 257 ILE A CD1   1 
ATOM   1082 N  N     . LYS A 1  138 ? 50.518 -19.557 17.973  1.00 45.62  ? 258 LYS A N     1 
ATOM   1083 C  CA    . LYS A 1  138 ? 50.712 -18.931 19.282  1.00 55.64  ? 258 LYS A CA    1 
ATOM   1084 C  C     . LYS A 1  138 ? 49.495 -18.051 19.579  1.00 53.12  ? 258 LYS A C     1 
ATOM   1085 O  O     . LYS A 1  138 ? 48.777 -17.668 18.652  1.00 49.00  ? 258 LYS A O     1 
ATOM   1086 C  CB    . LYS A 1  138 ? 52.013 -18.117 19.322  1.00 62.15  ? 258 LYS A CB    1 
ATOM   1087 C  CG    . LYS A 1  138 ? 52.035 -16.889 18.430  1.00 51.53  ? 258 LYS A CG    1 
ATOM   1088 C  CD    . LYS A 1  138 ? 53.375 -16.178 18.532  1.00 53.10  ? 258 LYS A CD    1 
ATOM   1089 C  CE    . LYS A 1  138 ? 53.427 -14.942 17.648  1.00 65.61  ? 258 LYS A CE    1 
ATOM   1090 N  NZ    . LYS A 1  138 ? 54.755 -14.267 17.716  1.00 71.02  ? 258 LYS A NZ    1 
ATOM   1091 N  N     . PRO A 1  139 ? 49.245 -17.742 20.868  1.00 49.27  ? 259 PRO A N     1 
ATOM   1092 C  CA    . PRO A 1  139 ? 48.054 -16.976 21.258  1.00 49.31  ? 259 PRO A CA    1 
ATOM   1093 C  C     . PRO A 1  139 ? 47.897 -15.636 20.539  1.00 51.18  ? 259 PRO A C     1 
ATOM   1094 O  O     . PRO A 1  139 ? 46.768 -15.219 20.283  1.00 45.38  ? 259 PRO A O     1 
ATOM   1095 C  CB    . PRO A 1  139 ? 48.264 -16.750 22.760  1.00 56.00  ? 259 PRO A CB    1 
ATOM   1096 C  CG    . PRO A 1  139 ? 49.085 -17.898 23.197  1.00 54.12  ? 259 PRO A CG    1 
ATOM   1097 C  CD    . PRO A 1  139 ? 50.016 -18.179 22.046  1.00 52.60  ? 259 PRO A CD    1 
ATOM   1098 N  N     . GLU A 1  140 ? 49.006 -14.973 20.227  1.00 53.59  ? 260 GLU A N     1 
ATOM   1099 C  CA    . GLU A 1  140 ? 48.955 -13.698 19.520  1.00 61.86  ? 260 GLU A CA    1 
ATOM   1100 C  C     . GLU A 1  140 ? 48.392 -13.862 18.106  1.00 47.88  ? 260 GLU A C     1 
ATOM   1101 O  O     . GLU A 1  140 ? 47.816 -12.929 17.546  1.00 49.29  ? 260 GLU A O     1 
ATOM   1102 C  CB    . GLU A 1  140 ? 50.345 -13.059 19.455  1.00 60.65  ? 260 GLU A CB    1 
ATOM   1103 C  CG    . GLU A 1  140 ? 50.958 -12.733 20.811  1.00 87.33  ? 260 GLU A CG    1 
ATOM   1104 C  CD    . GLU A 1  140 ? 51.821 -13.858 21.351  1.00 94.60  ? 260 GLU A CD    1 
ATOM   1105 O  OE1   . GLU A 1  140 ? 51.357 -15.018 21.362  1.00 86.87  ? 260 GLU A OE1   1 
ATOM   1106 O  OE2   . GLU A 1  140 ? 52.968 -13.581 21.762  1.00 101.52 ? 260 GLU A OE2   1 
ATOM   1107 N  N     . ASN A 1  141 ? 48.555 -15.051 17.536  1.00 49.01  ? 261 ASN A N     1 
ATOM   1108 C  CA    . ASN A 1  141 ? 48.112 -15.298 16.163  1.00 54.53  ? 261 ASN A CA    1 
ATOM   1109 C  C     . ASN A 1  141 ? 46.781 -16.032 16.091  1.00 57.51  ? 261 ASN A C     1 
ATOM   1110 O  O     . ASN A 1  141 ? 46.408 -16.560 15.043  1.00 54.62  ? 261 ASN A O     1 
ATOM   1111 C  CB    . ASN A 1  141 ? 49.166 -16.090 15.395  1.00 41.17  ? 261 ASN A CB    1 
ATOM   1112 C  CG    . ASN A 1  141 ? 50.427 -15.296 15.155  1.00 43.55  ? 261 ASN A CG    1 
ATOM   1113 O  OD1   . ASN A 1  141 ? 50.415 -14.066 15.200  1.00 46.17  ? 261 ASN A OD1   1 
ATOM   1114 N  ND2   . ASN A 1  141 ? 51.521 -15.994 14.877  1.00 44.27  ? 261 ASN A ND2   1 
ATOM   1115 N  N     . LEU A 1  142 ? 46.075 -16.073 17.214  1.00 52.56  ? 262 LEU A N     1 
ATOM   1116 C  CA    . LEU A 1  142 ? 44.752 -16.678 17.258  1.00 42.41  ? 262 LEU A CA    1 
ATOM   1117 C  C     . LEU A 1  142 ? 43.720 -15.618 17.612  1.00 55.66  ? 262 LEU A C     1 
ATOM   1118 O  O     . LEU A 1  142 ? 43.815 -14.971 18.658  1.00 53.11  ? 262 LEU A O     1 
ATOM   1119 C  CB    . LEU A 1  142 ? 44.717 -17.824 18.265  1.00 43.40  ? 262 LEU A CB    1 
ATOM   1120 C  CG    . LEU A 1  142 ? 45.710 -18.956 18.010  1.00 44.97  ? 262 LEU A CG    1 
ATOM   1121 C  CD1   . LEU A 1  142 ? 45.662 -19.958 19.149  1.00 49.60  ? 262 LEU A CD1   1 
ATOM   1122 C  CD2   . LEU A 1  142 ? 45.420 -19.635 16.681  1.00 46.21  ? 262 LEU A CD2   1 
ATOM   1123 N  N     . LEU A 1  143 ? 42.739 -15.439 16.735  1.00 48.33  ? 263 LEU A N     1 
ATOM   1124 C  CA    . LEU A 1  143 ? 41.747 -14.386 16.909  1.00 51.65  ? 263 LEU A CA    1 
ATOM   1125 C  C     . LEU A 1  143 ? 40.381 -14.947 17.276  1.00 51.56  ? 263 LEU A C     1 
ATOM   1126 O  O     . LEU A 1  143 ? 40.125 -16.139 17.114  1.00 58.02  ? 263 LEU A O     1 
ATOM   1127 C  CB    . LEU A 1  143 ? 41.644 -13.544 15.639  1.00 51.13  ? 263 LEU A CB    1 
ATOM   1128 C  CG    . LEU A 1  143 ? 42.937 -12.867 15.184  1.00 54.93  ? 263 LEU A CG    1 
ATOM   1129 C  CD1   . LEU A 1  143 ? 42.721 -12.119 13.879  1.00 51.01  ? 263 LEU A CD1   1 
ATOM   1130 C  CD2   . LEU A 1  143 ? 43.449 -11.925 16.257  1.00 55.05  ? 263 LEU A CD2   1 
ATOM   1131 N  N     . LEU A 1  144 ? 39.508 -14.075 17.773  1.00 52.23  ? 264 LEU A N     1 
ATOM   1132 C  CA    . LEU A 1  144 ? 38.167 -14.474 18.182  1.00 45.56  ? 264 LEU A CA    1 
ATOM   1133 C  C     . LEU A 1  144 ? 37.095 -13.744 17.377  1.00 60.92  ? 264 LEU A C     1 
ATOM   1134 O  O     . LEU A 1  144 ? 37.132 -12.520 17.242  1.00 56.30  ? 264 LEU A O     1 
ATOM   1135 C  CB    . LEU A 1  144 ? 37.968 -14.215 19.676  1.00 51.21  ? 264 LEU A CB    1 
ATOM   1136 C  CG    . LEU A 1  144 ? 38.909 -14.977 20.612  1.00 49.51  ? 264 LEU A CG    1 
ATOM   1137 C  CD1   . LEU A 1  144 ? 38.712 -14.534 22.056  1.00 49.44  ? 264 LEU A CD1   1 
ATOM   1138 C  CD2   . LEU A 1  144 ? 38.699 -16.476 20.472  1.00 54.70  ? 264 LEU A CD2   1 
ATOM   1139 N  N     . GLY A 1  145 ? 36.141 -14.503 16.847  1.00 63.28  ? 265 GLY A N     1 
ATOM   1140 C  CA    . GLY A 1  145 ? 35.060 -13.937 16.060  1.00 63.31  ? 265 GLY A CA    1 
ATOM   1141 C  C     . GLY A 1  145 ? 34.005 -13.258 16.913  1.00 65.32  ? 265 GLY A C     1 
ATOM   1142 O  O     . GLY A 1  145 ? 34.173 -13.115 18.123  1.00 65.51  ? 265 GLY A O     1 
ATOM   1143 N  N     . SER A 1  146 ? 32.911 -12.843 16.281  1.00 66.68  ? 266 SER A N     1 
ATOM   1144 C  CA    . SER A 1  146 ? 31.857 -12.107 16.973  1.00 72.97  ? 266 SER A CA    1 
ATOM   1145 C  C     . SER A 1  146 ? 31.102 -12.983 17.971  1.00 64.40  ? 266 SER A C     1 
ATOM   1146 O  O     . SER A 1  146 ? 30.446 -12.478 18.884  1.00 73.96  ? 266 SER A O     1 
ATOM   1147 C  CB    . SER A 1  146 ? 30.877 -11.509 15.962  1.00 71.90  ? 266 SER A CB    1 
ATOM   1148 O  OG    . SER A 1  146 ? 30.257 -12.525 15.194  1.00 76.93  ? 266 SER A OG    1 
ATOM   1149 N  N     . ALA A 1  147 ? 31.195 -14.296 17.790  1.00 74.26  ? 267 ALA A N     1 
ATOM   1150 C  CA    . ALA A 1  147 ? 30.527 -15.240 18.676  1.00 77.19  ? 267 ALA A CA    1 
ATOM   1151 C  C     . ALA A 1  147 ? 31.541 -15.997 19.528  1.00 76.22  ? 267 ALA A C     1 
ATOM   1152 O  O     . ALA A 1  147 ? 31.200 -16.967 20.203  1.00 83.15  ? 267 ALA A O     1 
ATOM   1153 C  CB    . ALA A 1  147 ? 29.675 -16.211 17.873  1.00 72.60  ? 267 ALA A CB    1 
ATOM   1154 N  N     . GLY A 1  148 ? 32.791 -15.549 19.485  1.00 76.09  ? 268 GLY A N     1 
ATOM   1155 C  CA    . GLY A 1  148 ? 33.840 -16.141 20.292  1.00 67.09  ? 268 GLY A CA    1 
ATOM   1156 C  C     . GLY A 1  148 ? 34.526 -17.332 19.651  1.00 67.68  ? 268 GLY A C     1 
ATOM   1157 O  O     . GLY A 1  148 ? 35.288 -18.040 20.310  1.00 71.81  ? 268 GLY A O     1 
ATOM   1158 N  N     . GLU A 1  149 ? 34.263 -17.560 18.368  1.00 68.25  ? 269 GLU A N     1 
ATOM   1159 C  CA    . GLU A 1  149 ? 34.900 -18.665 17.662  1.00 72.77  ? 269 GLU A CA    1 
ATOM   1160 C  C     . GLU A 1  149 ? 36.364 -18.341 17.384  1.00 66.31  ? 269 GLU A C     1 
ATOM   1161 O  O     . GLU A 1  149 ? 36.715 -17.198 17.088  1.00 60.84  ? 269 GLU A O     1 
ATOM   1162 C  CB    . GLU A 1  149 ? 34.163 -18.986 16.354  1.00 71.33  ? 269 GLU A CB    1 
ATOM   1163 C  CG    . GLU A 1  149 ? 34.224 -17.899 15.290  1.00 68.32  ? 269 GLU A CG    1 
ATOM   1164 C  CD    . GLU A 1  149 ? 33.178 -16.819 15.487  1.00 82.92  ? 269 GLU A CD    1 
ATOM   1165 O  OE1   . GLU A 1  149 ? 32.565 -16.772 16.574  1.00 79.97  ? 269 GLU A OE1   1 
ATOM   1166 O  OE2   . GLU A 1  149 ? 32.967 -16.019 14.552  1.00 87.80  ? 269 GLU A OE2   1 
ATOM   1167 N  N     . LEU A 1  150 ? 37.216 -19.352 17.498  1.00 57.60  ? 270 LEU A N     1 
ATOM   1168 C  CA    . LEU A 1  150 ? 38.644 -19.178 17.272  1.00 59.45  ? 270 LEU A CA    1 
ATOM   1169 C  C     . LEU A 1  150 ? 38.955 -19.192 15.779  1.00 56.01  ? 270 LEU A C     1 
ATOM   1170 O  O     . LEU A 1  150 ? 38.394 -19.988 15.027  1.00 60.63  ? 270 LEU A O     1 
ATOM   1171 C  CB    . LEU A 1  150 ? 39.435 -20.273 17.996  1.00 59.97  ? 270 LEU A CB    1 
ATOM   1172 C  CG    . LEU A 1  150 ? 40.965 -20.232 17.941  1.00 65.60  ? 270 LEU A CG    1 
ATOM   1173 C  CD1   . LEU A 1  150 ? 41.552 -20.754 19.241  1.00 60.78  ? 270 LEU A CD1   1 
ATOM   1174 C  CD2   . LEU A 1  150 ? 41.499 -21.040 16.765  1.00 64.19  ? 270 LEU A CD2   1 
ATOM   1175 N  N     . LYS A 1  151 ? 39.852 -18.305 15.359  1.00 54.47  ? 271 LYS A N     1 
ATOM   1176 C  CA    . LYS A 1  151 ? 40.294 -18.257 13.969  1.00 57.58  ? 271 LYS A CA    1 
ATOM   1177 C  C     . LYS A 1  151 ? 41.803 -18.052 13.883  1.00 63.33  ? 271 LYS A C     1 
ATOM   1178 O  O     . LYS A 1  151 ? 42.346 -17.129 14.492  1.00 48.11  ? 271 LYS A O     1 
ATOM   1179 C  CB    . LYS A 1  151 ? 39.568 -17.145 13.208  1.00 59.36  ? 271 LYS A CB    1 
ATOM   1180 C  CG    . LYS A 1  151 ? 38.074 -17.378 13.048  1.00 76.39  ? 271 LYS A CG    1 
ATOM   1181 C  CD    . LYS A 1  151 ? 37.412 -16.261 12.265  1.00 75.00  ? 271 LYS A CD    1 
ATOM   1182 C  CE    . LYS A 1  151 ? 35.919 -16.503 12.132  1.00 74.36  ? 271 LYS A CE    1 
ATOM   1183 N  NZ    . LYS A 1  151 ? 35.259 -15.451 11.316  1.00 84.72  ? 271 LYS A NZ    1 
ATOM   1184 N  N     . ILE A 1  152 ? 42.475 -18.919 13.130  1.00 58.01  ? 272 ILE A N     1 
ATOM   1185 C  CA    . ILE A 1  152 ? 43.909 -18.775 12.903  1.00 60.88  ? 272 ILE A CA    1 
ATOM   1186 C  C     . ILE A 1  152 ? 44.189 -17.556 12.038  1.00 57.59  ? 272 ILE A C     1 
ATOM   1187 O  O     . ILE A 1  152 ? 43.483 -17.303 11.062  1.00 64.01  ? 272 ILE A O     1 
ATOM   1188 C  CB    . ILE A 1  152 ? 44.520 -20.004 12.206  1.00 70.46  ? 272 ILE A CB    1 
ATOM   1189 C  CG1   . ILE A 1  152 ? 43.950 -21.301 12.770  1.00 78.12  ? 272 ILE A CG1   1 
ATOM   1190 C  CG2   . ILE A 1  152 ? 46.037 -19.989 12.331  1.00 73.71  ? 272 ILE A CG2   1 
ATOM   1191 C  CD1   . ILE A 1  152 ? 44.565 -22.528 12.137  1.00 82.67  ? 272 ILE A CD1   1 
ATOM   1192 N  N     . ALA A 1  153 ? 45.229 -16.811 12.391  1.00 52.30  ? 273 ALA A N     1 
ATOM   1193 C  CA    . ALA A 1  153 ? 45.633 -15.657 11.605  1.00 52.58  ? 273 ALA A CA    1 
ATOM   1194 C  C     . ALA A 1  153 ? 47.145 -15.642 11.423  1.00 48.90  ? 273 ALA A C     1 
ATOM   1195 O  O     . ALA A 1  153 ? 47.844 -16.535 11.911  1.00 54.87  ? 273 ALA A O     1 
ATOM   1196 C  CB    . ALA A 1  153 ? 45.157 -14.369 12.266  1.00 52.53  ? 273 ALA A CB    1 
ATOM   1197 N  N     . ASP A 1  154 ? 47.634 -14.624 10.720  1.00 51.10  ? 274 ASP A N     1 
ATOM   1198 C  CA    . ASP A 1  154 ? 49.062 -14.424 10.484  1.00 53.21  ? 274 ASP A CA    1 
ATOM   1199 C  C     . ASP A 1  154 ? 49.738 -15.642 9.857   1.00 49.63  ? 274 ASP A C     1 
ATOM   1200 O  O     . ASP A 1  154 ? 50.385 -16.432 10.544  1.00 50.74  ? 274 ASP A O     1 
ATOM   1201 C  CB    . ASP A 1  154 ? 49.773 -14.049 11.788  1.00 62.40  ? 274 ASP A CB    1 
ATOM   1202 C  CG    . ASP A 1  154 ? 51.243 -13.734 11.578  1.00 78.66  ? 274 ASP A CG    1 
ATOM   1203 O  OD1   . ASP A 1  154 ? 51.636 -13.448 10.425  1.00 72.43  ? 274 ASP A OD1   1 
ATOM   1204 O  OD2   . ASP A 1  154 ? 52.004 -13.764 12.568  1.00 78.79  ? 274 ASP A OD2   1 
ATOM   1205 N  N     . PHE A 1  155 ? 49.596 -15.777 8.542   1.00 51.34  ? 275 PHE A N     1 
ATOM   1206 C  CA    . PHE A 1  155 ? 50.265 -16.847 7.810   1.00 50.36  ? 275 PHE A CA    1 
ATOM   1207 C  C     . PHE A 1  155 ? 51.628 -16.376 7.320   1.00 43.46  ? 275 PHE A C     1 
ATOM   1208 O  O     . PHE A 1  155 ? 52.133 -16.838 6.300   1.00 52.35  ? 275 PHE A O     1 
ATOM   1209 C  CB    . PHE A 1  155 ? 49.392 -17.325 6.647   1.00 43.09  ? 275 PHE A CB    1 
ATOM   1210 C  CG    . PHE A 1  155 ? 48.258 -18.211 7.077   1.00 53.52  ? 275 PHE A CG    1 
ATOM   1211 C  CD1   . PHE A 1  155 ? 47.172 -17.688 7.764   1.00 53.42  ? 275 PHE A CD1   1 
ATOM   1212 C  CD2   . PHE A 1  155 ? 48.283 -19.568 6.804   1.00 48.32  ? 275 PHE A CD2   1 
ATOM   1213 C  CE1   . PHE A 1  155 ? 46.132 -18.503 8.171   1.00 57.03  ? 275 PHE A CE1   1 
ATOM   1214 C  CE2   . PHE A 1  155 ? 47.247 -20.389 7.209   1.00 52.70  ? 275 PHE A CE2   1 
ATOM   1215 C  CZ    . PHE A 1  155 ? 46.169 -19.856 7.891   1.00 53.46  ? 275 PHE A CZ    1 
ATOM   1216 N  N     . GLY A 1  156 ? 52.225 -15.463 8.081   1.00 46.32  ? 276 GLY A N     1 
ATOM   1217 C  CA    . GLY A 1  156 ? 53.493 -14.857 7.726   1.00 52.10  ? 276 GLY A CA    1 
ATOM   1218 C  C     . GLY A 1  156 ? 54.701 -15.762 7.862   1.00 60.06  ? 276 GLY A C     1 
ATOM   1219 O  O     . GLY A 1  156 ? 55.811 -15.351 7.547   1.00 66.03  ? 276 GLY A O     1 
ATOM   1220 N  N     . TRP A 1  157 ? 54.497 -16.982 8.347   1.00 49.24  ? 277 TRP A N     1 
ATOM   1221 C  CA    . TRP A 1  157 ? 55.575 -17.967 8.406   1.00 50.24  ? 277 TRP A CA    1 
ATOM   1222 C  C     . TRP A 1  157 ? 55.183 -19.248 7.680   1.00 50.22  ? 277 TRP A C     1 
ATOM   1223 O  O     . TRP A 1  157 ? 55.949 -20.214 7.647   1.00 51.30  ? 277 TRP A O     1 
ATOM   1224 C  CB    . TRP A 1  157 ? 55.945 -18.295 9.858   1.00 46.60  ? 277 TRP A CB    1 
ATOM   1225 C  CG    . TRP A 1  157 ? 56.948 -17.373 10.474  1.00 44.88  ? 277 TRP A CG    1 
ATOM   1226 C  CD1   . TRP A 1  157 ? 56.770 -16.596 11.583  1.00 52.16  ? 277 TRP A CD1   1 
ATOM   1227 C  CD2   . TRP A 1  157 ? 58.294 -17.139 10.035  1.00 51.75  ? 277 TRP A CD2   1 
ATOM   1228 N  NE1   . TRP A 1  157 ? 57.917 -15.890 11.857  1.00 51.56  ? 277 TRP A NE1   1 
ATOM   1229 C  CE2   . TRP A 1  157 ? 58.867 -16.207 10.924  1.00 54.93  ? 277 TRP A CE2   1 
ATOM   1230 C  CE3   . TRP A 1  157 ? 59.067 -17.624 8.976   1.00 60.97  ? 277 TRP A CE3   1 
ATOM   1231 C  CZ2   . TRP A 1  157 ? 60.176 -15.749 10.784  1.00 65.57  ? 277 TRP A CZ2   1 
ATOM   1232 C  CZ3   . TRP A 1  157 ? 60.367 -17.170 8.841   1.00 58.67  ? 277 TRP A CZ3   1 
ATOM   1233 C  CH2   . TRP A 1  157 ? 60.907 -16.242 9.739   1.00 60.57  ? 277 TRP A CH2   1 
ATOM   1234 N  N     . SER A 1  158 ? 53.986 -19.248 7.100   1.00 41.66  ? 278 SER A N     1 
ATOM   1235 C  CA    . SER A 1  158 ? 53.422 -20.450 6.501   1.00 50.28  ? 278 SER A CA    1 
ATOM   1236 C  C     . SER A 1  158 ? 54.101 -20.807 5.183   1.00 59.64  ? 278 SER A C     1 
ATOM   1237 O  O     . SER A 1  158 ? 54.761 -19.973 4.564   1.00 53.68  ? 278 SER A O     1 
ATOM   1238 C  CB    . SER A 1  158 ? 51.919 -20.281 6.274   1.00 57.22  ? 278 SER A CB    1 
ATOM   1239 O  OG    . SER A 1  158 ? 51.662 -19.343 5.244   1.00 60.15  ? 278 SER A OG    1 
ATOM   1240 N  N     . VAL A 1  159 ? 53.925 -22.054 4.760   1.00 48.07  ? 279 VAL A N     1 
ATOM   1241 C  CA    . VAL A 1  159 ? 54.509 -22.530 3.510   1.00 64.03  ? 279 VAL A CA    1 
ATOM   1242 C  C     . VAL A 1  159 ? 53.670 -23.666 2.925   1.00 60.64  ? 279 VAL A C     1 
ATOM   1243 O  O     . VAL A 1  159 ? 53.131 -24.499 3.658   1.00 60.51  ? 279 VAL A O     1 
ATOM   1244 C  CB    . VAL A 1  159 ? 55.976 -22.999 3.715   1.00 66.04  ? 279 VAL A CB    1 
ATOM   1245 C  CG1   . VAL A 1  159 ? 56.048 -24.148 4.713   1.00 48.58  ? 279 VAL A CG1   1 
ATOM   1246 C  CG2   . VAL A 1  159 ? 56.617 -23.390 2.388   1.00 65.00  ? 279 VAL A CG2   1 
ATOM   1247 N  N     . HIS A 1  160 ? 53.536 -23.671 1.602   1.00 56.71  ? 280 HIS A N     1 
ATOM   1248 C  CA    . HIS A 1  160 ? 52.860 -24.751 0.895   1.00 54.35  ? 280 HIS A CA    1 
ATOM   1249 C  C     . HIS A 1  160 ? 53.875 -25.828 0.534   1.00 62.98  ? 280 HIS A C     1 
ATOM   1250 O  O     . HIS A 1  160 ? 54.702 -25.637 -0.361  1.00 67.71  ? 280 HIS A O     1 
ATOM   1251 C  CB    . HIS A 1  160 ? 52.163 -24.224 -0.361  1.00 60.72  ? 280 HIS A CB    1 
ATOM   1252 C  CG    . HIS A 1  160 ? 51.379 -25.261 -1.101  1.00 74.64  ? 280 HIS A CG    1 
ATOM   1253 N  ND1   . HIS A 1  160 ? 50.903 -26.407 -0.499  1.00 75.14  ? 280 HIS A ND1   1 
ATOM   1254 C  CD2   . HIS A 1  160 ? 50.995 -25.332 -2.398  1.00 64.90  ? 280 HIS A CD2   1 
ATOM   1255 C  CE1   . HIS A 1  160 ? 50.254 -27.133 -1.390  1.00 77.43  ? 280 HIS A CE1   1 
ATOM   1256 N  NE2   . HIS A 1  160 ? 50.295 -26.504 -2.551  1.00 78.47  ? 280 HIS A NE2   1 
ATOM   1257 N  N     . ALA A 1  161 ? 53.812 -26.960 1.227   1.00 56.39  ? 281 ALA A N     1 
ATOM   1258 C  CA    . ALA A 1  161 ? 54.826 -27.999 1.066   1.00 60.54  ? 281 ALA A CA    1 
ATOM   1259 C  C     . ALA A 1  161 ? 54.241 -29.383 0.786   1.00 65.62  ? 281 ALA A C     1 
ATOM   1260 O  O     . ALA A 1  161 ? 54.235 -30.242 1.667   1.00 74.02  ? 281 ALA A O     1 
ATOM   1261 C  CB    . ALA A 1  161 ? 55.712 -28.052 2.310   1.00 57.71  ? 281 ALA A CB    1 
ATOM   1262 N  N     A PRO A 1  162 ? 53.741 -29.600 -0.440  0.38 70.68  ? 282 PRO A N     1 
ATOM   1263 N  N     B PRO A 1  162 ? 53.758 -29.606 -0.447  0.62 71.26  ? 282 PRO A N     1 
ATOM   1264 C  CA    A PRO A 1  162 ? 53.189 -30.910 -0.794  0.38 74.45  ? 282 PRO A CA    1 
ATOM   1265 C  CA    B PRO A 1  162 ? 53.265 -30.933 -0.826  0.62 74.68  ? 282 PRO A CA    1 
ATOM   1266 C  C     A PRO A 1  162 ? 54.280 -31.930 -1.099  0.38 79.33  ? 282 PRO A C     1 
ATOM   1267 C  C     B PRO A 1  162 ? 54.409 -31.880 -1.165  0.62 80.52  ? 282 PRO A C     1 
ATOM   1268 O  O     A PRO A 1  162 ? 54.063 -33.130 -0.933  0.38 85.60  ? 282 PRO A O     1 
ATOM   1269 O  O     B PRO A 1  162 ? 54.212 -33.093 -1.223  0.62 88.46  ? 282 PRO A O     1 
ATOM   1270 C  CB    A PRO A 1  162 ? 52.359 -30.610 -2.043  0.38 77.12  ? 282 PRO A CB    1 
ATOM   1271 C  CB    B PRO A 1  162 ? 52.414 -30.644 -2.062  0.62 77.15  ? 282 PRO A CB    1 
ATOM   1272 C  CG    A PRO A 1  162 ? 53.059 -29.460 -2.673  0.38 73.89  ? 282 PRO A CG    1 
ATOM   1273 C  CG    B PRO A 1  162 ? 53.083 -29.471 -2.686  0.62 72.33  ? 282 PRO A CG    1 
ATOM   1274 C  CD    A PRO A 1  162 ? 53.606 -28.628 -1.540  0.38 70.64  ? 282 PRO A CD    1 
ATOM   1275 C  CD    B PRO A 1  162 ? 53.604 -28.631 -1.541  0.62 70.19  ? 282 PRO A CD    1 
ATOM   1276 N  N     A SER A 1  163 ? 55.442 -31.452 -1.535  0.38 74.41  ? 283 SER A N     1 
ATOM   1277 N  N     B SER A 1  163 ? 55.595 -31.320 -1.385  0.62 74.54  ? 283 SER A N     1 
ATOM   1278 C  CA    A SER A 1  163 ? 56.532 -32.336 -1.925  0.38 74.53  ? 283 SER A CA    1 
ATOM   1279 C  CA    B SER A 1  163 ? 56.753 -32.108 -1.783  0.62 77.56  ? 283 SER A CA    1 
ATOM   1280 C  C     A SER A 1  163 ? 57.898 -31.784 -1.523  0.38 80.16  ? 283 SER A C     1 
ATOM   1281 C  C     B SER A 1  163 ? 57.878 -32.052 -0.748  0.62 87.81  ? 283 SER A C     1 
ATOM   1282 O  O     A SER A 1  163 ? 58.783 -31.631 -2.366  0.38 64.43  ? 283 SER A O     1 
ATOM   1283 O  O     B SER A 1  163 ? 58.212 -33.061 -0.125  0.62 97.07  ? 283 SER A O     1 
ATOM   1284 C  CB    A SER A 1  163 ? 56.496 -32.581 -3.435  0.38 80.99  ? 283 SER A CB    1 
ATOM   1285 C  CB    B SER A 1  163 ? 57.275 -31.630 -3.142  0.62 79.11  ? 283 SER A CB    1 
ATOM   1286 O  OG    A SER A 1  163 ? 55.272 -33.173 -3.836  0.38 83.56  ? 283 SER A OG    1 
ATOM   1287 O  OG    B SER A 1  163 ? 56.282 -31.741 -4.153  0.62 68.49  ? 283 SER A OG    1 
ATOM   1288 N  N     A SER A 1  164 ? 58.063 -31.498 -0.233  0.38 78.20  ? 284 SER A N     1 
ATOM   1289 N  N     B SER A 1  164 ? 58.452 -30.868 -0.564  0.62 79.29  ? 284 SER A N     1 
ATOM   1290 C  CA    A SER A 1  164 ? 59.331 -31.006 0.304   0.38 69.92  ? 284 SER A CA    1 
ATOM   1291 C  CA    B SER A 1  164 ? 59.662 -30.718 0.240   0.62 67.10  ? 284 SER A CA    1 
ATOM   1292 C  C     A SER A 1  164 ? 59.303 -30.962 1.828   0.38 68.11  ? 284 SER A C     1 
ATOM   1293 C  C     B SER A 1  164 ? 59.436 -30.750 1.748   0.62 68.53  ? 284 SER A C     1 
ATOM   1294 O  O     A SER A 1  164 ? 58.271 -30.660 2.426   0.38 63.50  ? 284 SER A O     1 
ATOM   1295 O  O     B SER A 1  164 ? 58.396 -30.326 2.251   0.62 62.98  ? 284 SER A O     1 
ATOM   1296 C  CB    A SER A 1  164 ? 59.650 -29.611 -0.244  0.38 63.57  ? 284 SER A CB    1 
ATOM   1297 C  CB    B SER A 1  164 ? 60.370 -29.409 -0.119  0.62 68.46  ? 284 SER A CB    1 
ATOM   1298 O  OG    A SER A 1  164 ? 58.604 -28.698 0.042   0.38 54.10  ? 284 SER A OG    1 
ATOM   1299 O  OG    B SER A 1  164 ? 60.937 -29.468 -1.412  0.62 86.51  ? 284 SER A OG    1 
ATOM   1300 N  N     . ARG A 1  165 ? 60.434 -31.267 2.456   1.00 69.87  ? 285 ARG A N     1 
ATOM   1301 C  CA    . ARG A 1  165 ? 60.555 -31.082 3.893   1.00 73.27  ? 285 ARG A CA    1 
ATOM   1302 C  C     . ARG A 1  165 ? 61.378 -29.814 4.056   1.00 74.16  ? 285 ARG A C     1 
ATOM   1303 O  O     . ARG A 1  165 ? 62.230 -29.515 3.219   1.00 86.88  ? 285 ARG A O     1 
ATOM   1304 C  CB    . ARG A 1  165 ? 61.211 -32.283 4.577   1.00 73.94  ? 285 ARG A CB    1 
ATOM   1305 C  CG    . ARG A 1  165 ? 60.343 -33.533 4.574   1.00 83.77  ? 285 ARG A CG    1 
ATOM   1306 C  CD    . ARG A 1  165 ? 60.943 -34.641 5.423   1.00 88.68  ? 285 ARG A CD    1 
ATOM   1307 N  NE    . ARG A 1  165 ? 60.612 -34.507 6.838   1.00 84.50  ? 285 ARG A NE    1 
ATOM   1308 C  CZ    . ARG A 1  165 ? 60.428 -35.536 7.660   1.00 79.78  ? 285 ARG A CZ    1 
ATOM   1309 N  NH1   . ARG A 1  165 ? 60.542 -36.778 7.208   1.00 81.07  ? 285 ARG A NH1   1 
ATOM   1310 N  NH2   . ARG A 1  165 ? 60.131 -35.324 8.933   1.00 92.14  ? 285 ARG A NH2   1 
ATOM   1311 N  N     . ARG A 1  166 ? 61.115 -29.056 5.111   1.00 59.98  ? 286 ARG A N     1 
ATOM   1312 C  CA    . ARG A 1  166 ? 61.641 -27.700 5.199   1.00 58.57  ? 286 ARG A CA    1 
ATOM   1313 C  C     . ARG A 1  166 ? 62.886 -27.590 6.071   1.00 60.71  ? 286 ARG A C     1 
ATOM   1314 O  O     . ARG A 1  166 ? 63.189 -28.482 6.861   1.00 75.46  ? 286 ARG A O     1 
ATOM   1315 C  CB    . ARG A 1  166 ? 60.558 -26.760 5.723   1.00 53.11  ? 286 ARG A CB    1 
ATOM   1316 C  CG    . ARG A 1  166 ? 59.202 -26.934 5.059   1.00 56.10  ? 286 ARG A CG    1 
ATOM   1317 C  CD    . ARG A 1  166 ? 59.300 -26.842 3.544   1.00 59.22  ? 286 ARG A CD    1 
ATOM   1318 N  NE    . ARG A 1  166 ? 59.972 -25.619 3.119   1.00 66.66  ? 286 ARG A NE    1 
ATOM   1319 C  CZ    . ARG A 1  166 ? 60.079 -25.228 1.854   1.00 64.13  ? 286 ARG A CZ    1 
ATOM   1320 N  NH1   . ARG A 1  166 ? 59.553 -25.965 0.887   1.00 65.18  ? 286 ARG A NH1   1 
ATOM   1321 N  NH2   . ARG A 1  166 ? 60.712 -24.100 1.558   1.00 55.01  ? 286 ARG A NH2   1 
ATOM   1322 N  N     . THR A 1  167 ? 63.602 -26.481 5.916   1.00 58.36  ? 287 THR A N     1 
ATOM   1323 C  CA    . THR A 1  167 ? 64.832 -26.238 6.660   1.00 63.47  ? 287 THR A CA    1 
ATOM   1324 C  C     . THR A 1  167 ? 64.830 -24.863 7.327   1.00 55.10  ? 287 THR A C     1 
ATOM   1325 O  O     . THR A 1  167 ? 65.771 -24.508 8.034   1.00 66.22  ? 287 THR A O     1 
ATOM   1326 C  CB    . THR A 1  167 ? 66.070 -26.341 5.747   1.00 65.54  ? 287 THR A CB    1 
ATOM   1327 O  OG1   . THR A 1  167 ? 65.963 -25.385 4.685   1.00 73.16  ? 287 THR A OG1   1 
ATOM   1328 C  CG2   . THR A 1  167 ? 66.190 -27.739 5.157   1.00 69.75  ? 287 THR A CG2   1 
HETATM 1329 N  N     . TPO A 1  168 ? 63.769 -24.095 7.098   1.00 48.70  ? 288 TPO A N     1 
HETATM 1330 C  CA    . TPO A 1  168 ? 63.690 -22.721 7.585   1.00 62.18  ? 288 TPO A CA    1 
HETATM 1331 C  CB    . TPO A 1  168 ? 62.634 -21.936 6.793   1.00 59.90  ? 288 TPO A CB    1 
HETATM 1332 C  CG2   . TPO A 1  168 ? 62.536 -20.505 7.327   1.00 55.36  ? 288 TPO A CG2   1 
HETATM 1333 O  OG1   . TPO A 1  168 ? 63.011 -21.896 5.418   1.00 58.83  ? 288 TPO A OG1   1 
HETATM 1334 P  P     . TPO A 1  168 ? 61.765 -22.346 4.499   1.00 60.01  ? 288 TPO A P     1 
HETATM 1335 O  O1P   . TPO A 1  168 ? 62.290 -22.537 2.988   1.00 78.05  ? 288 TPO A O1P   1 
HETATM 1336 O  O2P   . TPO A 1  168 ? 61.153 -23.736 5.028   1.00 57.18  ? 288 TPO A O2P   1 
HETATM 1337 O  O3P   . TPO A 1  168 ? 60.713 -21.306 4.525   1.00 59.27  ? 288 TPO A O3P   1 
HETATM 1338 C  C     . TPO A 1  168 ? 63.414 -22.628 9.088   1.00 61.94  ? 288 TPO A C     1 
HETATM 1339 O  O     . TPO A 1  168 ? 62.460 -23.216 9.597   1.00 60.67  ? 288 TPO A O     1 
ATOM   1340 N  N     . LEU A 1  169 ? 64.264 -21.892 9.796   1.00 61.05  ? 289 LEU A N     1 
ATOM   1341 C  CA    . LEU A 1  169 ? 64.004 -21.566 11.191  1.00 56.37  ? 289 LEU A CA    1 
ATOM   1342 C  C     . LEU A 1  169 ? 62.818 -20.605 11.233  1.00 58.83  ? 289 LEU A C     1 
ATOM   1343 O  O     . LEU A 1  169 ? 62.979 -19.398 11.051  1.00 73.75  ? 289 LEU A O     1 
ATOM   1344 C  CB    . LEU A 1  169 ? 65.247 -20.956 11.846  1.00 54.63  ? 289 LEU A CB    1 
ATOM   1345 C  CG    . LEU A 1  169 ? 65.319 -20.797 13.372  1.00 74.60  ? 289 LEU A CG    1 
ATOM   1346 C  CD1   . LEU A 1  169 ? 64.711 -19.478 13.818  1.00 85.50  ? 289 LEU A CD1   1 
ATOM   1347 C  CD2   . LEU A 1  169 ? 64.658 -21.967 14.096  1.00 59.01  ? 289 LEU A CD2   1 
ATOM   1348 N  N     . ALA A 1  170 ? 61.626 -21.152 11.452  1.00 54.34  ? 290 ALA A N     1 
ATOM   1349 C  CA    . ALA A 1  170 ? 60.395 -20.372 11.380  1.00 58.48  ? 290 ALA A CA    1 
ATOM   1350 C  C     . ALA A 1  170 ? 59.560 -20.494 12.651  1.00 64.56  ? 290 ALA A C     1 
ATOM   1351 O  O     . ALA A 1  170 ? 59.400 -21.584 13.191  1.00 64.75  ? 290 ALA A O     1 
ATOM   1352 C  CB    . ALA A 1  170 ? 59.572 -20.807 10.175  1.00 44.63  ? 290 ALA A CB    1 
ATOM   1353 N  N     . GLY A 1  171 ? 59.018 -19.371 13.113  1.00 69.87  ? 291 GLY A N     1 
ATOM   1354 C  CA    . GLY A 1  171 ? 58.132 -19.376 14.263  1.00 69.69  ? 291 GLY A CA    1 
ATOM   1355 C  C     . GLY A 1  171 ? 58.511 -18.382 15.343  1.00 70.33  ? 291 GLY A C     1 
ATOM   1356 O  O     . GLY A 1  171 ? 59.082 -17.327 15.061  1.00 67.86  ? 291 GLY A O     1 
ATOM   1357 N  N     . THR A 1  172 ? 58.182 -18.729 16.586  1.00 64.02  ? 292 THR A N     1 
ATOM   1358 C  CA    . THR A 1  172 ? 58.459 -17.886 17.745  1.00 59.35  ? 292 THR A CA    1 
ATOM   1359 C  C     . THR A 1  172 ? 59.154 -18.709 18.831  1.00 59.11  ? 292 THR A C     1 
ATOM   1360 O  O     . THR A 1  172 ? 58.831 -19.882 19.022  1.00 56.41  ? 292 THR A O     1 
ATOM   1361 C  CB    . THR A 1  172 ? 57.162 -17.258 18.306  1.00 69.51  ? 292 THR A CB    1 
ATOM   1362 O  OG1   . THR A 1  172 ? 56.501 -16.518 17.270  1.00 69.27  ? 292 THR A OG1   1 
ATOM   1363 C  CG2   . THR A 1  172 ? 57.459 -16.332 19.493  1.00 55.55  ? 292 THR A CG2   1 
ATOM   1364 N  N     . LEU A 1  173 ? 60.101 -18.080 19.528  1.00 48.85  ? 293 LEU A N     1 
ATOM   1365 C  CA    . LEU A 1  173 ? 60.983 -18.732 20.504  1.00 58.12  ? 293 LEU A CA    1 
ATOM   1366 C  C     . LEU A 1  173 ? 60.345 -19.818 21.374  1.00 58.37  ? 293 LEU A C     1 
ATOM   1367 O  O     . LEU A 1  173 ? 60.766 -20.973 21.331  1.00 57.87  ? 293 LEU A O     1 
ATOM   1368 C  CB    . LEU A 1  173 ? 61.601 -17.672 21.424  1.00 62.47  ? 293 LEU A CB    1 
ATOM   1369 C  CG    . LEU A 1  173 ? 62.429 -18.206 22.596  1.00 63.85  ? 293 LEU A CG    1 
ATOM   1370 C  CD1   . LEU A 1  173 ? 63.678 -18.904 22.088  1.00 65.81  ? 293 LEU A CD1   1 
ATOM   1371 C  CD2   . LEU A 1  173 ? 62.793 -17.094 23.569  1.00 63.23  ? 293 LEU A CD2   1 
ATOM   1372 N  N     . ASP A 1  174 ? 59.337 -19.449 22.161  1.00 59.95  ? 294 ASP A N     1 
ATOM   1373 C  CA    . ASP A 1  174 ? 58.779 -20.369 23.151  1.00 63.05  ? 294 ASP A CA    1 
ATOM   1374 C  C     . ASP A 1  174 ? 58.009 -21.529 22.531  1.00 63.16  ? 294 ASP A C     1 
ATOM   1375 O  O     . ASP A 1  174 ? 57.662 -22.489 23.221  1.00 51.19  ? 294 ASP A O     1 
ATOM   1376 C  CB    . ASP A 1  174 ? 57.867 -19.621 24.128  1.00 54.83  ? 294 ASP A CB    1 
ATOM   1377 C  CG    . ASP A 1  174 ? 58.646 -18.869 25.191  1.00 55.69  ? 294 ASP A CG    1 
ATOM   1378 O  OD1   . ASP A 1  174 ? 59.230 -19.535 26.068  1.00 57.75  ? 294 ASP A OD1   1 
ATOM   1379 O  OD2   . ASP A 1  174 ? 58.662 -17.620 25.160  1.00 53.45  ? 294 ASP A OD2   1 
ATOM   1380 N  N     . TYR A 1  175 ? 57.756 -21.445 21.229  1.00 50.38  ? 295 TYR A N     1 
ATOM   1381 C  CA    . TYR A 1  175 ? 56.920 -22.426 20.548  1.00 57.94  ? 295 TYR A CA    1 
ATOM   1382 C  C     . TYR A 1  175 ? 57.704 -23.224 19.513  1.00 51.37  ? 295 TYR A C     1 
ATOM   1383 O  O     . TYR A 1  175 ? 57.153 -24.106 18.854  1.00 51.18  ? 295 TYR A O     1 
ATOM   1384 C  CB    . TYR A 1  175 ? 55.725 -21.726 19.893  1.00 56.89  ? 295 TYR A CB    1 
ATOM   1385 C  CG    . TYR A 1  175 ? 54.875 -20.974 20.891  1.00 72.46  ? 295 TYR A CG    1 
ATOM   1386 C  CD1   . TYR A 1  175 ? 55.225 -19.694 21.302  1.00 85.24  ? 295 TYR A CD1   1 
ATOM   1387 C  CD2   . TYR A 1  175 ? 53.736 -21.549 21.438  1.00 64.54  ? 295 TYR A CD2   1 
ATOM   1388 C  CE1   . TYR A 1  175 ? 54.464 -19.007 22.224  1.00 79.76  ? 295 TYR A CE1   1 
ATOM   1389 C  CE2   . TYR A 1  175 ? 52.966 -20.866 22.364  1.00 62.36  ? 295 TYR A CE2   1 
ATOM   1390 C  CZ    . TYR A 1  175 ? 53.337 -19.595 22.750  1.00 71.30  ? 295 TYR A CZ    1 
ATOM   1391 O  OH    . TYR A 1  175 ? 52.584 -18.901 23.667  1.00 91.89  ? 295 TYR A OH    1 
ATOM   1392 N  N     . LEU A 1  176 ? 58.993 -22.923 19.386  1.00 52.70  ? 296 LEU A N     1 
ATOM   1393 C  CA    . LEU A 1  176 ? 59.839 -23.589 18.398  1.00 48.26  ? 296 LEU A CA    1 
ATOM   1394 C  C     . LEU A 1  176 ? 59.991 -25.078 18.689  1.00 48.15  ? 296 LEU A C     1 
ATOM   1395 O  O     . LEU A 1  176 ? 60.303 -25.468 19.814  1.00 52.13  ? 296 LEU A O     1 
ATOM   1396 C  CB    . LEU A 1  176 ? 61.219 -22.929 18.341  1.00 46.43  ? 296 LEU A CB    1 
ATOM   1397 C  CG    . LEU A 1  176 ? 61.319 -21.561 17.665  1.00 47.65  ? 296 LEU A CG    1 
ATOM   1398 C  CD1   . LEU A 1  176 ? 62.714 -20.990 17.851  1.00 48.87  ? 296 LEU A CD1   1 
ATOM   1399 C  CD2   . LEU A 1  176 ? 60.967 -21.659 16.181  1.00 52.73  ? 296 LEU A CD2   1 
ATOM   1400 N  N     . PRO A 1  177 ? 59.768 -25.918 17.669  1.00 52.39  ? 297 PRO A N     1 
ATOM   1401 C  CA    . PRO A 1  177 ? 59.947 -27.367 17.810  1.00 45.30  ? 297 PRO A CA    1 
ATOM   1402 C  C     . PRO A 1  177 ? 61.421 -27.745 17.937  1.00 45.75  ? 297 PRO A C     1 
ATOM   1403 O  O     . PRO A 1  177 ? 62.283 -26.986 17.489  1.00 47.21  ? 297 PRO A O     1 
ATOM   1404 C  CB    . PRO A 1  177 ? 59.345 -27.920 16.516  1.00 51.18  ? 297 PRO A CB    1 
ATOM   1405 C  CG    . PRO A 1  177 ? 59.504 -26.809 15.531  1.00 51.66  ? 297 PRO A CG    1 
ATOM   1406 C  CD    . PRO A 1  177 ? 59.296 -25.547 16.323  1.00 53.01  ? 297 PRO A CD    1 
ATOM   1407 N  N     . PRO A 1  178 ? 61.706 -28.905 18.548  1.00 45.25  ? 298 PRO A N     1 
ATOM   1408 C  CA    . PRO A 1  178 ? 63.081 -29.379 18.743  1.00 53.62  ? 298 PRO A CA    1 
ATOM   1409 C  C     . PRO A 1  178 ? 63.854 -29.560 17.439  1.00 48.26  ? 298 PRO A C     1 
ATOM   1410 O  O     . PRO A 1  178 ? 65.054 -29.284 17.414  1.00 50.53  ? 298 PRO A O     1 
ATOM   1411 C  CB    . PRO A 1  178 ? 62.888 -30.728 19.443  1.00 50.26  ? 298 PRO A CB    1 
ATOM   1412 C  CG    . PRO A 1  178 ? 61.570 -30.619 20.113  1.00 55.49  ? 298 PRO A CG    1 
ATOM   1413 C  CD    . PRO A 1  178 ? 60.724 -29.800 19.187  1.00 44.29  ? 298 PRO A CD    1 
ATOM   1414 N  N     . GLU A 1  179 ? 63.185 -30.011 16.378  1.00 49.72  ? 299 GLU A N     1 
ATOM   1415 C  CA    . GLU A 1  179 ? 63.868 -30.261 15.108  1.00 51.38  ? 299 GLU A CA    1 
ATOM   1416 C  C     . GLU A 1  179 ? 64.454 -28.980 14.522  1.00 51.14  ? 299 GLU A C     1 
ATOM   1417 O  O     . GLU A 1  179 ? 65.528 -29.003 13.922  1.00 55.61  ? 299 GLU A O     1 
ATOM   1418 C  CB    . GLU A 1  179 ? 62.924 -30.926 14.094  1.00 44.65  ? 299 GLU A CB    1 
ATOM   1419 C  CG    . GLU A 1  179 ? 61.562 -30.259 13.932  1.00 40.85  ? 299 GLU A CG    1 
ATOM   1420 C  CD    . GLU A 1  179 ? 60.523 -30.815 14.889  1.00 59.19  ? 299 GLU A CD    1 
ATOM   1421 O  OE1   . GLU A 1  179 ? 60.855 -31.025 16.078  1.00 48.15  ? 299 GLU A OE1   1 
ATOM   1422 O  OE2   . GLU A 1  179 ? 59.376 -31.047 14.451  1.00 51.56  ? 299 GLU A OE2   1 
ATOM   1423 N  N     . MET A 1  180 ? 63.758 -27.863 14.705  1.00 59.71  ? 300 MET A N     1 
ATOM   1424 C  CA    . MET A 1  180 ? 64.265 -26.577 14.236  1.00 57.88  ? 300 MET A CA    1 
ATOM   1425 C  C     . MET A 1  180 ? 65.463 -26.125 15.058  1.00 63.81  ? 300 MET A C     1 
ATOM   1426 O  O     . MET A 1  180 ? 66.462 -25.657 14.511  1.00 62.43  ? 300 MET A O     1 
ATOM   1427 C  CB    . MET A 1  180 ? 63.173 -25.510 14.287  1.00 54.46  ? 300 MET A CB    1 
ATOM   1428 C  CG    . MET A 1  180 ? 62.100 -25.660 13.231  1.00 47.90  ? 300 MET A CG    1 
ATOM   1429 S  SD    . MET A 1  180 ? 61.061 -24.192 13.160  1.00 53.76  ? 300 MET A SD    1 
ATOM   1430 C  CE    . MET A 1  180 ? 59.782 -24.735 12.027  1.00 53.87  ? 300 MET A CE    1 
ATOM   1431 N  N     . ILE A 1  181 ? 65.349 -26.260 16.377  1.00 56.14  ? 301 ILE A N     1 
ATOM   1432 C  CA    . ILE A 1  181 ? 66.422 -25.885 17.288  1.00 59.24  ? 301 ILE A CA    1 
ATOM   1433 C  C     . ILE A 1  181 ? 67.681 -26.698 17.014  1.00 57.37  ? 301 ILE A C     1 
ATOM   1434 O  O     . ILE A 1  181 ? 68.793 -26.169 17.032  1.00 54.03  ? 301 ILE A O     1 
ATOM   1435 C  CB    . ILE A 1  181 ? 66.008 -26.089 18.765  1.00 69.12  ? 301 ILE A CB    1 
ATOM   1436 C  CG1   . ILE A 1  181 ? 64.706 -25.347 19.070  1.00 69.45  ? 301 ILE A CG1   1 
ATOM   1437 C  CG2   . ILE A 1  181 ? 67.115 -25.634 19.703  1.00 71.11  ? 301 ILE A CG2   1 
ATOM   1438 C  CD1   . ILE A 1  181 ? 64.790 -23.861 18.845  1.00 75.34  ? 301 ILE A CD1   1 
ATOM   1439 N  N     . GLU A 1  182 ? 67.494 -27.989 16.755  1.00 48.59  ? 302 GLU A N     1 
ATOM   1440 C  CA    . GLU A 1  182 ? 68.611 -28.911 16.579  1.00 44.68  ? 302 GLU A CA    1 
ATOM   1441 C  C     . GLU A 1  182 ? 69.126 -28.931 15.139  1.00 66.51  ? 302 GLU A C     1 
ATOM   1442 O  O     . GLU A 1  182 ? 69.891 -29.817 14.757  1.00 71.03  ? 302 GLU A O     1 
ATOM   1443 C  CB    . GLU A 1  182 ? 68.193 -30.316 17.015  1.00 44.75  ? 302 GLU A CB    1 
ATOM   1444 C  CG    . GLU A 1  182 ? 67.878 -30.424 18.506  1.00 55.17  ? 302 GLU A CG    1 
ATOM   1445 C  CD    . GLU A 1  182 ? 67.047 -31.645 18.845  1.00 63.85  ? 302 GLU A CD    1 
ATOM   1446 O  OE1   . GLU A 1  182 ? 66.478 -32.256 17.914  1.00 64.74  ? 302 GLU A OE1   1 
ATOM   1447 O  OE2   . GLU A 1  182 ? 66.957 -31.992 20.043  1.00 69.17  ? 302 GLU A OE2   1 
ATOM   1448 N  N     . GLY A 1  183 ? 68.702 -27.950 14.347  1.00 60.01  ? 303 GLY A N     1 
ATOM   1449 C  CA    . GLY A 1  183 ? 69.180 -27.797 12.983  1.00 66.04  ? 303 GLY A CA    1 
ATOM   1450 C  C     . GLY A 1  183 ? 68.803 -28.942 12.061  1.00 56.28  ? 303 GLY A C     1 
ATOM   1451 O  O     . GLY A 1  183 ? 69.531 -29.258 11.122  1.00 62.59  ? 303 GLY A O     1 
ATOM   1452 N  N     . ARG A 1  184 ? 67.666 -29.569 12.336  1.00 61.53  ? 304 ARG A N     1 
ATOM   1453 C  CA    . ARG A 1  184 ? 67.182 -30.665 11.511  1.00 66.70  ? 304 ARG A CA    1 
ATOM   1454 C  C     . ARG A 1  184 ? 66.167 -30.146 10.501  1.00 66.08  ? 304 ARG A C     1 
ATOM   1455 O  O     . ARG A 1  184 ? 65.842 -28.960 10.491  1.00 67.40  ? 304 ARG A O     1 
ATOM   1456 C  CB    . ARG A 1  184 ? 66.553 -31.762 12.378  1.00 45.30  ? 304 ARG A CB    1 
ATOM   1457 C  CG    . ARG A 1  184 ? 67.391 -32.175 13.582  1.00 55.19  ? 304 ARG A CG    1 
ATOM   1458 C  CD    . ARG A 1  184 ? 66.647 -33.187 14.449  1.00 52.24  ? 304 ARG A CD    1 
ATOM   1459 N  NE    . ARG A 1  184 ? 66.599 -34.510 13.834  1.00 67.51  ? 304 ARG A NE    1 
ATOM   1460 C  CZ    . ARG A 1  184 ? 65.859 -35.518 14.284  1.00 66.75  ? 304 ARG A CZ    1 
ATOM   1461 N  NH1   . ARG A 1  184 ? 65.089 -35.353 15.350  1.00 69.96  ? 304 ARG A NH1   1 
ATOM   1462 N  NH2   . ARG A 1  184 ? 65.880 -36.689 13.662  1.00 69.39  ? 304 ARG A NH2   1 
ATOM   1463 N  N     . MET A 1  185 ? 65.672 -31.037 9.651   1.00 59.98  ? 305 MET A N     1 
ATOM   1464 C  CA    . MET A 1  185 ? 64.591 -30.685 8.741   1.00 56.23  ? 305 MET A CA    1 
ATOM   1465 C  C     . MET A 1  185 ? 63.253 -30.892 9.439   1.00 61.27  ? 305 MET A C     1 
ATOM   1466 O  O     . MET A 1  185 ? 63.169 -31.628 10.424  1.00 56.73  ? 305 MET A O     1 
ATOM   1467 C  CB    . MET A 1  185 ? 64.668 -31.513 7.460   1.00 51.50  ? 305 MET A CB    1 
ATOM   1468 C  CG    . MET A 1  185 ? 66.020 -31.436 6.775   1.00 59.33  ? 305 MET A CG    1 
ATOM   1469 S  SD    . MET A 1  185 ? 66.009 -32.178 5.138   1.00 70.23  ? 305 MET A SD    1 
ATOM   1470 C  CE    . MET A 1  185 ? 64.820 -31.121 4.324   1.00 62.55  ? 305 MET A CE    1 
ATOM   1471 N  N     . HIS A 1  186 ? 62.210 -30.239 8.940   1.00 49.87  ? 306 HIS A N     1 
ATOM   1472 C  CA    . HIS A 1  186 ? 60.903 -30.338 9.577   1.00 59.78  ? 306 HIS A CA    1 
ATOM   1473 C  C     . HIS A 1  186 ? 59.764 -30.430 8.566   1.00 60.86  ? 306 HIS A C     1 
ATOM   1474 O  O     . HIS A 1  186 ? 59.929 -30.100 7.388   1.00 56.17  ? 306 HIS A O     1 
ATOM   1475 C  CB    . HIS A 1  186 ? 60.681 -29.145 10.513  1.00 56.59  ? 306 HIS A CB    1 
ATOM   1476 C  CG    . HIS A 1  186 ? 60.465 -27.843 9.803   1.00 53.13  ? 306 HIS A CG    1 
ATOM   1477 N  ND1   . HIS A 1  186 ? 61.490 -26.960 9.538   1.00 52.03  ? 306 HIS A ND1   1 
ATOM   1478 C  CD2   . HIS A 1  186 ? 59.338 -27.267 9.321   1.00 44.63  ? 306 HIS A CD2   1 
ATOM   1479 C  CE1   . HIS A 1  186 ? 61.005 -25.900 8.917   1.00 49.67  ? 306 HIS A CE1   1 
ATOM   1480 N  NE2   . HIS A 1  186 ? 59.701 -26.060 8.774   1.00 48.63  ? 306 HIS A NE2   1 
ATOM   1481 N  N     . ASP A 1  187 ? 58.613 -30.897 9.043   1.00 52.36  ? 307 ASP A N     1 
ATOM   1482 C  CA    . ASP A 1  187 ? 57.410 -31.005 8.227   1.00 57.66  ? 307 ASP A CA    1 
ATOM   1483 C  C     . ASP A 1  187 ? 56.205 -30.453 8.987   1.00 56.78  ? 307 ASP A C     1 
ATOM   1484 O  O     . ASP A 1  187 ? 56.355 -29.604 9.863   1.00 52.63  ? 307 ASP A O     1 
ATOM   1485 C  CB    . ASP A 1  187 ? 57.159 -32.458 7.809   1.00 56.16  ? 307 ASP A CB    1 
ATOM   1486 C  CG    . ASP A 1  187 ? 57.230 -33.432 8.976   1.00 70.69  ? 307 ASP A CG    1 
ATOM   1487 O  OD1   . ASP A 1  187 ? 57.061 -33.004 10.138  1.00 68.18  ? 307 ASP A OD1   1 
ATOM   1488 O  OD2   . ASP A 1  187 ? 57.447 -34.636 8.727   1.00 72.97  ? 307 ASP A OD2   1 
ATOM   1489 N  N     . GLU A 1  188 ? 55.017 -30.953 8.660   1.00 54.56  ? 308 GLU A N     1 
ATOM   1490 C  CA    . GLU A 1  188 ? 53.778 -30.447 9.247   1.00 53.64  ? 308 GLU A CA    1 
ATOM   1491 C  C     . GLU A 1  188 ? 53.642 -30.779 10.731  1.00 57.23  ? 308 GLU A C     1 
ATOM   1492 O  O     . GLU A 1  188 ? 52.764 -30.249 11.412  1.00 58.97  ? 308 GLU A O     1 
ATOM   1493 C  CB    . GLU A 1  188 ? 52.571 -31.005 8.491   1.00 48.62  ? 308 GLU A CB    1 
ATOM   1494 C  CG    . GLU A 1  188 ? 52.399 -32.504 8.643   1.00 64.91  ? 308 GLU A CG    1 
ATOM   1495 C  CD    . GLU A 1  188 ? 51.334 -33.063 7.724   1.00 87.72  ? 308 GLU A CD    1 
ATOM   1496 O  OE1   . GLU A 1  188 ? 50.976 -34.249 7.883   1.00 96.10  ? 308 GLU A OE1   1 
ATOM   1497 O  OE2   . GLU A 1  188 ? 50.859 -32.319 6.840   1.00 95.44  ? 308 GLU A OE2   1 
ATOM   1498 N  N     . LYS A 1  189 ? 54.509 -31.655 11.229  1.00 59.43  ? 309 LYS A N     1 
ATOM   1499 C  CA    . LYS A 1  189 ? 54.463 -32.060 12.632  1.00 61.05  ? 309 LYS A CA    1 
ATOM   1500 C  C     . LYS A 1  189 ? 54.890 -30.941 13.577  1.00 55.70  ? 309 LYS A C     1 
ATOM   1501 O  O     . LYS A 1  189 ? 54.784 -31.081 14.796  1.00 52.87  ? 309 LYS A O     1 
ATOM   1502 C  CB    . LYS A 1  189 ? 55.338 -33.294 12.862  1.00 62.61  ? 309 LYS A CB    1 
ATOM   1503 C  CG    . LYS A 1  189 ? 54.766 -34.572 12.271  1.00 64.55  ? 309 LYS A CG    1 
ATOM   1504 C  CD    . LYS A 1  189 ? 53.388 -34.862 12.841  1.00 67.41  ? 309 LYS A CD    1 
ATOM   1505 C  CE    . LYS A 1  189 ? 52.804 -36.138 12.264  1.00 71.91  ? 309 LYS A CE    1 
ATOM   1506 N  NZ    . LYS A 1  189 ? 51.429 -36.393 12.774  1.00 77.75  ? 309 LYS A NZ    1 
ATOM   1507 N  N     . VAL A 1  190 ? 55.375 -29.834 13.021  1.00 45.98  ? 310 VAL A N     1 
ATOM   1508 C  CA    . VAL A 1  190 ? 55.740 -28.688 13.846  1.00 46.02  ? 310 VAL A CA    1 
ATOM   1509 C  C     . VAL A 1  190 ? 54.492 -27.990 14.381  1.00 58.59  ? 310 VAL A C     1 
ATOM   1510 O  O     . VAL A 1  190 ? 54.537 -27.359 15.437  1.00 56.80  ? 310 VAL A O     1 
ATOM   1511 C  CB    . VAL A 1  190 ? 56.613 -27.669 13.078  1.00 43.04  ? 310 VAL A CB    1 
ATOM   1512 C  CG1   . VAL A 1  190 ? 57.902 -28.320 12.613  1.00 47.92  ? 310 VAL A CG1   1 
ATOM   1513 C  CG2   . VAL A 1  190 ? 55.851 -27.063 11.902  1.00 39.62  ? 310 VAL A CG2   1 
ATOM   1514 N  N     . ASP A 1  191 ? 53.379 -28.115 13.659  1.00 50.70  ? 311 ASP A N     1 
ATOM   1515 C  CA    . ASP A 1  191 ? 52.119 -27.510 14.083  1.00 41.34  ? 311 ASP A CA    1 
ATOM   1516 C  C     . ASP A 1  191 ? 51.526 -28.243 15.284  1.00 55.86  ? 311 ASP A C     1 
ATOM   1517 O  O     . ASP A 1  191 ? 50.801 -27.653 16.085  1.00 52.75  ? 311 ASP A O     1 
ATOM   1518 C  CB    . ASP A 1  191 ? 51.101 -27.503 12.940  1.00 44.00  ? 311 ASP A CB    1 
ATOM   1519 C  CG    . ASP A 1  191 ? 51.391 -26.435 11.899  1.00 53.76  ? 311 ASP A CG    1 
ATOM   1520 O  OD1   . ASP A 1  191 ? 52.154 -25.491 12.193  1.00 49.02  ? 311 ASP A OD1   1 
ATOM   1521 O  OD2   . ASP A 1  191 ? 50.840 -26.539 10.784  1.00 53.28  ? 311 ASP A OD2   1 
ATOM   1522 N  N     . LEU A 1  192 ? 51.827 -29.532 15.398  1.00 54.45  ? 312 LEU A N     1 
ATOM   1523 C  CA    . LEU A 1  192 ? 51.298 -30.333 16.494  1.00 53.97  ? 312 LEU A CA    1 
ATOM   1524 C  C     . LEU A 1  192 ? 52.142 -30.190 17.753  1.00 56.49  ? 312 LEU A C     1 
ATOM   1525 O  O     . LEU A 1  192 ? 51.638 -30.350 18.866  1.00 62.72  ? 312 LEU A O     1 
ATOM   1526 C  CB    . LEU A 1  192 ? 51.190 -31.800 16.084  1.00 48.96  ? 312 LEU A CB    1 
ATOM   1527 C  CG    . LEU A 1  192 ? 50.028 -32.035 15.118  1.00 69.53  ? 312 LEU A CG    1 
ATOM   1528 C  CD1   . LEU A 1  192 ? 50.515 -32.201 13.685  1.00 50.91  ? 312 LEU A CD1   1 
ATOM   1529 C  CD2   . LEU A 1  192 ? 49.176 -33.213 15.562  1.00 82.48  ? 312 LEU A CD2   1 
ATOM   1530 N  N     . TRP A 1  193 ? 53.424 -29.889 17.576  1.00 49.27  ? 313 TRP A N     1 
ATOM   1531 C  CA    . TRP A 1  193 ? 54.271 -29.542 18.706  1.00 53.70  ? 313 TRP A CA    1 
ATOM   1532 C  C     . TRP A 1  193 ? 53.776 -28.234 19.305  1.00 58.14  ? 313 TRP A C     1 
ATOM   1533 O  O     . TRP A 1  193 ? 53.538 -28.147 20.507  1.00 47.63  ? 313 TRP A O     1 
ATOM   1534 C  CB    . TRP A 1  193 ? 55.738 -29.424 18.288  1.00 40.55  ? 313 TRP A CB    1 
ATOM   1535 C  CG    . TRP A 1  193 ? 56.604 -28.751 19.311  1.00 50.16  ? 313 TRP A CG    1 
ATOM   1536 C  CD1   . TRP A 1  193 ? 56.842 -27.411 19.431  1.00 52.34  ? 313 TRP A CD1   1 
ATOM   1537 C  CD2   . TRP A 1  193 ? 57.353 -29.385 20.357  1.00 53.05  ? 313 TRP A CD2   1 
ATOM   1538 N  NE1   . TRP A 1  193 ? 57.687 -27.172 20.487  1.00 55.00  ? 313 TRP A NE1   1 
ATOM   1539 C  CE2   . TRP A 1  193 ? 58.015 -28.367 21.073  1.00 56.53  ? 313 TRP A CE2   1 
ATOM   1540 C  CE3   . TRP A 1  193 ? 57.524 -30.714 20.760  1.00 55.60  ? 313 TRP A CE3   1 
ATOM   1541 C  CZ2   . TRP A 1  193 ? 58.838 -28.636 22.169  1.00 52.80  ? 313 TRP A CZ2   1 
ATOM   1542 C  CZ3   . TRP A 1  193 ? 58.342 -30.980 21.850  1.00 60.86  ? 313 TRP A CZ3   1 
ATOM   1543 C  CH2   . TRP A 1  193 ? 58.988 -29.945 22.541  1.00 53.22  ? 313 TRP A CH2   1 
ATOM   1544 N  N     . SER A 1  194 ? 53.606 -27.224 18.455  1.00 48.26  ? 314 SER A N     1 
ATOM   1545 C  CA    . SER A 1  194 ? 53.143 -25.915 18.909  1.00 54.74  ? 314 SER A CA    1 
ATOM   1546 C  C     . SER A 1  194 ? 51.735 -25.991 19.490  1.00 49.60  ? 314 SER A C     1 
ATOM   1547 O  O     . SER A 1  194 ? 51.364 -25.194 20.351  1.00 51.07  ? 314 SER A O     1 
ATOM   1548 C  CB    . SER A 1  194 ? 53.192 -24.904 17.762  1.00 56.57  ? 314 SER A CB    1 
ATOM   1549 O  OG    . SER A 1  194 ? 54.529 -24.692 17.341  1.00 46.36  ? 314 SER A OG    1 
ATOM   1550 N  N     . LEU A 1  195 ? 50.954 -26.955 19.015  1.00 52.22  ? 315 LEU A N     1 
ATOM   1551 C  CA    . LEU A 1  195 ? 49.624 -27.196 19.556  1.00 50.31  ? 315 LEU A CA    1 
ATOM   1552 C  C     . LEU A 1  195 ? 49.730 -27.693 20.996  1.00 55.70  ? 315 LEU A C     1 
ATOM   1553 O  O     . LEU A 1  195 ? 48.901 -27.364 21.843  1.00 54.83  ? 315 LEU A O     1 
ATOM   1554 C  CB    . LEU A 1  195 ? 48.871 -28.210 18.695  1.00 52.74  ? 315 LEU A CB    1 
ATOM   1555 C  CG    . LEU A 1  195 ? 47.419 -28.503 19.074  1.00 51.15  ? 315 LEU A CG    1 
ATOM   1556 C  CD1   . LEU A 1  195 ? 46.592 -27.235 19.012  1.00 46.07  ? 315 LEU A CD1   1 
ATOM   1557 C  CD2   . LEU A 1  195 ? 46.834 -29.569 18.163  1.00 59.23  ? 315 LEU A CD2   1 
ATOM   1558 N  N     . GLY A 1  196 ? 50.762 -28.489 21.259  1.00 60.93  ? 316 GLY A N     1 
ATOM   1559 C  CA    . GLY A 1  196 ? 51.015 -29.007 22.589  1.00 60.37  ? 316 GLY A CA    1 
ATOM   1560 C  C     . GLY A 1  196 ? 51.521 -27.923 23.518  1.00 59.42  ? 316 GLY A C     1 
ATOM   1561 O  O     . GLY A 1  196 ? 51.133 -27.863 24.685  1.00 52.40  ? 316 GLY A O     1 
ATOM   1562 N  N     . VAL A 1  197 ? 52.395 -27.067 22.998  1.00 54.21  ? 317 VAL A N     1 
ATOM   1563 C  CA    . VAL A 1  197 ? 52.887 -25.924 23.757  1.00 57.10  ? 317 VAL A CA    1 
ATOM   1564 C  C     . VAL A 1  197 ? 51.732 -24.989 24.091  1.00 62.51  ? 317 VAL A C     1 
ATOM   1565 O  O     . VAL A 1  197 ? 51.648 -24.453 25.197  1.00 51.04  ? 317 VAL A O     1 
ATOM   1566 C  CB    . VAL A 1  197 ? 53.967 -25.144 22.983  1.00 48.10  ? 317 VAL A CB    1 
ATOM   1567 C  CG1   . VAL A 1  197 ? 54.446 -23.952 23.799  1.00 46.70  ? 317 VAL A CG1   1 
ATOM   1568 C  CG2   . VAL A 1  197 ? 55.132 -26.057 22.627  1.00 48.94  ? 317 VAL A CG2   1 
ATOM   1569 N  N     . LEU A 1  198 ? 50.835 -24.814 23.126  1.00 51.13  ? 318 LEU A N     1 
ATOM   1570 C  CA    . LEU A 1  198 ? 49.699 -23.921 23.290  1.00 55.25  ? 318 LEU A CA    1 
ATOM   1571 C  C     . LEU A 1  198 ? 48.711 -24.433 24.335  1.00 55.24  ? 318 LEU A C     1 
ATOM   1572 O  O     . LEU A 1  198 ? 48.194 -23.659 25.138  1.00 56.30  ? 318 LEU A O     1 
ATOM   1573 C  CB    . LEU A 1  198 ? 48.976 -23.730 21.961  1.00 54.79  ? 318 LEU A CB    1 
ATOM   1574 C  CG    . LEU A 1  198 ? 47.823 -22.732 22.020  1.00 52.61  ? 318 LEU A CG    1 
ATOM   1575 C  CD1   . LEU A 1  198 ? 48.356 -21.314 22.088  1.00 48.32  ? 318 LEU A CD1   1 
ATOM   1576 C  CD2   . LEU A 1  198 ? 46.900 -22.908 20.838  1.00 56.98  ? 318 LEU A CD2   1 
ATOM   1577 N  N     . CYS A 1  199 ? 48.440 -25.735 24.308  1.00 48.22  ? 319 CYS A N     1 
ATOM   1578 C  CA    . CYS A 1  199 ? 47.489 -26.336 25.237  1.00 52.77  ? 319 CYS A CA    1 
ATOM   1579 C  C     . CYS A 1  199 ? 47.986 -26.200 26.671  1.00 50.18  ? 319 CYS A C     1 
ATOM   1580 O  O     . CYS A 1  199 ? 47.197 -26.031 27.600  1.00 55.83  ? 319 CYS A O     1 
ATOM   1581 C  CB    . CYS A 1  199 ? 47.255 -27.809 24.896  1.00 56.47  ? 319 CYS A CB    1 
ATOM   1582 S  SG    . CYS A 1  199 ? 45.876 -28.570 25.791  1.00 61.27  ? 319 CYS A SG    1 
ATOM   1583 N  N     . TYR A 1  200 ? 49.303 -26.273 26.835  1.00 52.20  ? 320 TYR A N     1 
ATOM   1584 C  CA    . TYR A 1  200 ? 49.933 -26.082 28.132  1.00 62.36  ? 320 TYR A CA    1 
ATOM   1585 C  C     . TYR A 1  200 ? 49.734 -24.651 28.614  1.00 68.49  ? 320 TYR A C     1 
ATOM   1586 O  O     . TYR A 1  200 ? 49.385 -24.423 29.771  1.00 69.00  ? 320 TYR A O     1 
ATOM   1587 C  CB    . TYR A 1  200 ? 51.427 -26.414 28.059  1.00 56.98  ? 320 TYR A CB    1 
ATOM   1588 C  CG    . TYR A 1  200 ? 52.142 -26.362 29.394  1.00 65.25  ? 320 TYR A CG    1 
ATOM   1589 C  CD1   . TYR A 1  200 ? 52.653 -25.167 29.888  1.00 67.28  ? 320 TYR A CD1   1 
ATOM   1590 C  CD2   . TYR A 1  200 ? 52.317 -27.511 30.156  1.00 52.25  ? 320 TYR A CD2   1 
ATOM   1591 C  CE1   . TYR A 1  200 ? 53.307 -25.115 31.103  1.00 63.55  ? 320 TYR A CE1   1 
ATOM   1592 C  CE2   . TYR A 1  200 ? 52.974 -27.469 31.371  1.00 66.61  ? 320 TYR A CE2   1 
ATOM   1593 C  CZ    . TYR A 1  200 ? 53.467 -26.269 31.840  1.00 64.82  ? 320 TYR A CZ    1 
ATOM   1594 O  OH    . TYR A 1  200 ? 54.120 -26.220 33.051  1.00 75.53  ? 320 TYR A OH    1 
ATOM   1595 N  N     . GLU A 1  201 ? 49.953 -23.687 27.724  1.00 58.91  ? 321 GLU A N     1 
ATOM   1596 C  CA    . GLU A 1  201 ? 49.866 -22.284 28.111  1.00 67.92  ? 321 GLU A CA    1 
ATOM   1597 C  C     . GLU A 1  201 ? 48.430 -21.868 28.411  1.00 58.00  ? 321 GLU A C     1 
ATOM   1598 O  O     . GLU A 1  201 ? 48.198 -20.966 29.211  1.00 59.56  ? 321 GLU A O     1 
ATOM   1599 C  CB    . GLU A 1  201 ? 50.457 -21.378 27.029  1.00 58.53  ? 321 GLU A CB    1 
ATOM   1600 C  CG    . GLU A 1  201 ? 50.652 -19.944 27.503  1.00 66.21  ? 321 GLU A CG    1 
ATOM   1601 C  CD    . GLU A 1  201 ? 51.178 -19.027 26.425  1.00 67.31  ? 321 GLU A CD    1 
ATOM   1602 O  OE1   . GLU A 1  201 ? 51.202 -19.440 25.247  1.00 74.22  ? 321 GLU A OE1   1 
ATOM   1603 O  OE2   . GLU A 1  201 ? 51.568 -17.888 26.758  1.00 62.30  ? 321 GLU A OE2   1 
ATOM   1604 N  N     . PHE A 1  202 ? 47.468 -22.523 27.768  1.00 57.63  ? 322 PHE A N     1 
ATOM   1605 C  CA    . PHE A 1  202 ? 46.058 -22.244 28.027  1.00 53.86  ? 322 PHE A CA    1 
ATOM   1606 C  C     . PHE A 1  202 ? 45.666 -22.647 29.450  1.00 61.00  ? 322 PHE A C     1 
ATOM   1607 O  O     . PHE A 1  202 ? 44.864 -21.975 30.100  1.00 67.11  ? 322 PHE A O     1 
ATOM   1608 C  CB    . PHE A 1  202 ? 45.168 -22.974 27.015  1.00 59.49  ? 322 PHE A CB    1 
ATOM   1609 C  CG    . PHE A 1  202 ? 45.089 -22.301 25.668  1.00 63.12  ? 322 PHE A CG    1 
ATOM   1610 C  CD1   . PHE A 1  202 ? 45.632 -21.041 25.470  1.00 61.89  ? 322 PHE A CD1   1 
ATOM   1611 C  CD2   . PHE A 1  202 ? 44.462 -22.928 24.604  1.00 61.13  ? 322 PHE A CD2   1 
ATOM   1612 C  CE1   . PHE A 1  202 ? 45.557 -20.422 24.236  1.00 64.23  ? 322 PHE A CE1   1 
ATOM   1613 C  CE2   . PHE A 1  202 ? 44.384 -22.313 23.365  1.00 61.50  ? 322 PHE A CE2   1 
ATOM   1614 C  CZ    . PHE A 1  202 ? 44.931 -21.059 23.182  1.00 63.47  ? 322 PHE A CZ    1 
ATOM   1615 N  N     . LEU A 1  203 ? 46.243 -23.745 29.929  1.00 58.84  ? 323 LEU A N     1 
ATOM   1616 C  CA    . LEU A 1  203 ? 45.892 -24.295 31.234  1.00 67.85  ? 323 LEU A CA    1 
ATOM   1617 C  C     . LEU A 1  203 ? 46.755 -23.734 32.360  1.00 71.56  ? 323 LEU A C     1 
ATOM   1618 O  O     . LEU A 1  203 ? 46.278 -23.526 33.476  1.00 79.21  ? 323 LEU A O     1 
ATOM   1619 C  CB    . LEU A 1  203 ? 46.004 -25.820 31.210  1.00 69.07  ? 323 LEU A CB    1 
ATOM   1620 C  CG    . LEU A 1  203 ? 44.996 -26.560 30.330  1.00 67.48  ? 323 LEU A CG    1 
ATOM   1621 C  CD1   . LEU A 1  203 ? 45.320 -28.042 30.276  1.00 65.80  ? 323 LEU A CD1   1 
ATOM   1622 C  CD2   . LEU A 1  203 ? 43.581 -26.338 30.841  1.00 76.64  ? 323 LEU A CD2   1 
ATOM   1623 N  N     . VAL A 1  204 ? 48.028 -23.496 32.064  1.00 64.86  ? 324 VAL A N     1 
ATOM   1624 C  CA    . VAL A 1  204 ? 48.972 -23.035 33.075  1.00 75.16  ? 324 VAL A CA    1 
ATOM   1625 C  C     . VAL A 1  204 ? 49.085 -21.513 33.089  1.00 72.35  ? 324 VAL A C     1 
ATOM   1626 O  O     . VAL A 1  204 ? 49.229 -20.903 34.149  1.00 66.43  ? 324 VAL A O     1 
ATOM   1627 C  CB    . VAL A 1  204 ? 50.366 -23.657 32.853  1.00 74.57  ? 324 VAL A CB    1 
ATOM   1628 C  CG1   . VAL A 1  204 ? 51.351 -23.160 33.898  1.00 69.09  ? 324 VAL A CG1   1 
ATOM   1629 C  CG2   . VAL A 1  204 ? 50.274 -25.174 32.890  1.00 59.72  ? 324 VAL A CG2   1 
ATOM   1630 N  N     . GLY A 1  205 ? 49.009 -20.900 31.913  1.00 58.09  ? 325 GLY A N     1 
ATOM   1631 C  CA    . GLY A 1  205 ? 49.113 -19.456 31.806  1.00 55.14  ? 325 GLY A CA    1 
ATOM   1632 C  C     . GLY A 1  205 ? 50.517 -19.027 31.435  1.00 56.95  ? 325 GLY A C     1 
ATOM   1633 O  O     . GLY A 1  205 ? 50.817 -17.836 31.358  1.00 61.23  ? 325 GLY A O     1 
ATOM   1634 N  N     . LYS A 1  206 ? 51.379 -20.011 31.198  1.00 61.94  ? 326 LYS A N     1 
ATOM   1635 C  CA    . LYS A 1  206 ? 52.771 -19.756 30.847  1.00 69.20  ? 326 LYS A CA    1 
ATOM   1636 C  C     . LYS A 1  206 ? 53.316 -20.891 29.976  1.00 62.13  ? 326 LYS A C     1 
ATOM   1637 O  O     . LYS A 1  206 ? 52.994 -22.056 30.204  1.00 59.49  ? 326 LYS A O     1 
ATOM   1638 C  CB    . LYS A 1  206 ? 53.611 -19.595 32.120  1.00 86.84  ? 326 LYS A CB    1 
ATOM   1639 C  CG    . LYS A 1  206 ? 55.071 -19.249 31.884  1.00 92.99  ? 326 LYS A CG    1 
ATOM   1640 N  N     . PRO A 1  207 ? 54.123 -20.551 28.957  1.00 61.97  ? 327 PRO A N     1 
ATOM   1641 C  CA    . PRO A 1  207 ? 54.789 -21.561 28.125  1.00 64.89  ? 327 PRO A CA    1 
ATOM   1642 C  C     . PRO A 1  207 ? 55.681 -22.492 28.949  1.00 53.94  ? 327 PRO A C     1 
ATOM   1643 O  O     . PRO A 1  207 ? 56.349 -22.028 29.870  1.00 70.59  ? 327 PRO A O     1 
ATOM   1644 C  CB    . PRO A 1  207 ? 55.622 -20.719 27.155  1.00 68.01  ? 327 PRO A CB    1 
ATOM   1645 C  CG    . PRO A 1  207 ? 54.893 -19.432 27.063  1.00 71.60  ? 327 PRO A CG    1 
ATOM   1646 C  CD    . PRO A 1  207 ? 54.318 -19.189 28.428  1.00 66.42  ? 327 PRO A CD    1 
ATOM   1647 N  N     . PRO A 1  208 ? 55.697 -23.792 28.611  1.00 62.75  ? 328 PRO A N     1 
ATOM   1648 C  CA    . PRO A 1  208 ? 56.372 -24.824 29.411  1.00 61.70  ? 328 PRO A CA    1 
ATOM   1649 C  C     . PRO A 1  208 ? 57.897 -24.748 29.397  1.00 68.77  ? 328 PRO A C     1 
ATOM   1650 O  O     . PRO A 1  208 ? 58.536 -25.323 30.277  1.00 72.71  ? 328 PRO A O     1 
ATOM   1651 C  CB    . PRO A 1  208 ? 55.902 -26.128 28.761  1.00 56.83  ? 328 PRO A CB    1 
ATOM   1652 C  CG    . PRO A 1  208 ? 55.604 -25.751 27.346  1.00 53.51  ? 328 PRO A CG    1 
ATOM   1653 C  CD    . PRO A 1  208 ? 55.041 -24.359 27.419  1.00 51.56  ? 328 PRO A CD    1 
ATOM   1654 N  N     . PHE A 1  209 ? 58.475 -24.064 28.416  1.00 60.02  ? 329 PHE A N     1 
ATOM   1655 C  CA    . PHE A 1  209 ? 59.928 -23.993 28.316  1.00 55.06  ? 329 PHE A CA    1 
ATOM   1656 C  C     . PHE A 1  209 ? 60.437 -22.573 28.530  1.00 60.22  ? 329 PHE A C     1 
ATOM   1657 O  O     . PHE A 1  209 ? 61.566 -22.248 28.159  1.00 59.80  ? 329 PHE A O     1 
ATOM   1658 C  CB    . PHE A 1  209 ? 60.398 -24.522 26.959  1.00 60.93  ? 329 PHE A CB    1 
ATOM   1659 C  CG    . PHE A 1  209 ? 59.817 -25.859 26.594  1.00 62.68  ? 329 PHE A CG    1 
ATOM   1660 C  CD1   . PHE A 1  209 ? 60.246 -27.012 27.230  1.00 64.05  ? 329 PHE A CD1   1 
ATOM   1661 C  CD2   . PHE A 1  209 ? 58.852 -25.964 25.604  1.00 58.88  ? 329 PHE A CD2   1 
ATOM   1662 C  CE1   . PHE A 1  209 ? 59.715 -28.245 26.895  1.00 60.76  ? 329 PHE A CE1   1 
ATOM   1663 C  CE2   . PHE A 1  209 ? 58.318 -27.194 25.263  1.00 55.32  ? 329 PHE A CE2   1 
ATOM   1664 C  CZ    . PHE A 1  209 ? 58.751 -28.336 25.909  1.00 53.35  ? 329 PHE A CZ    1 
ATOM   1665 N  N     . GLU A 1  210 ? 59.603 -21.734 29.136  1.00 55.22  ? 330 GLU A N     1 
ATOM   1666 C  CA    . GLU A 1  210 ? 59.939 -20.327 29.330  1.00 68.39  ? 330 GLU A CA    1 
ATOM   1667 C  C     . GLU A 1  210 ? 61.165 -20.153 30.223  1.00 62.89  ? 330 GLU A C     1 
ATOM   1668 O  O     . GLU A 1  210 ? 61.296 -20.814 31.253  1.00 76.20  ? 330 GLU A O     1 
ATOM   1669 C  CB    . GLU A 1  210 ? 58.746 -19.572 29.922  1.00 70.93  ? 330 GLU A CB    1 
ATOM   1670 C  CG    . GLU A 1  210 ? 58.956 -18.071 30.021  1.00 75.47  ? 330 GLU A CG    1 
ATOM   1671 C  CD    . GLU A 1  210 ? 57.725 -17.340 30.518  1.00 89.19  ? 330 GLU A CD    1 
ATOM   1672 O  OE1   . GLU A 1  210 ? 56.901 -16.919 29.678  1.00 82.14  ? 330 GLU A OE1   1 
ATOM   1673 O  OE2   . GLU A 1  210 ? 57.582 -17.185 31.749  1.00 108.67 ? 330 GLU A OE2   1 
ATOM   1674 N  N     . ALA A 1  211 ? 62.064 -19.265 29.811  1.00 58.41  ? 331 ALA A N     1 
ATOM   1675 C  CA    . ALA A 1  211 ? 63.272 -18.973 30.575  1.00 73.13  ? 331 ALA A CA    1 
ATOM   1676 C  C     . ALA A 1  211 ? 63.746 -17.548 30.303  1.00 82.62  ? 331 ALA A C     1 
ATOM   1677 O  O     . ALA A 1  211 ? 63.256 -16.885 29.388  1.00 77.11  ? 331 ALA A O     1 
ATOM   1678 C  CB    . ALA A 1  211 ? 64.368 -19.973 30.245  1.00 71.36  ? 331 ALA A CB    1 
ATOM   1679 N  N     . ASN A 1  212 ? 64.702 -17.084 31.102  1.00 84.20  ? 332 ASN A N     1 
ATOM   1680 C  CA    . ASN A 1  212 ? 65.206 -15.720 30.981  1.00 97.37  ? 332 ASN A CA    1 
ATOM   1681 C  C     . ASN A 1  212 ? 66.038 -15.516 29.720  1.00 97.23  ? 332 ASN A C     1 
ATOM   1682 O  O     . ASN A 1  212 ? 66.036 -14.433 29.134  1.00 109.94 ? 332 ASN A O     1 
ATOM   1683 C  CB    . ASN A 1  212 ? 66.030 -15.349 32.214  1.00 106.59 ? 332 ASN A CB    1 
ATOM   1684 C  CG    . ASN A 1  212 ? 65.214 -15.387 33.491  1.00 115.90 ? 332 ASN A CG    1 
ATOM   1685 O  OD1   . ASN A 1  212 ? 63.991 -15.249 33.463  1.00 115.80 ? 332 ASN A OD1   1 
ATOM   1686 N  ND2   . ASN A 1  212 ? 65.888 -15.572 34.620  1.00 122.57 ? 332 ASN A ND2   1 
ATOM   1687 N  N     . THR A 1  213 ? 66.751 -16.558 29.309  1.00 85.00  ? 333 THR A N     1 
ATOM   1688 C  CA    . THR A 1  213 ? 67.548 -16.505 28.089  1.00 85.82  ? 333 THR A CA    1 
ATOM   1689 C  C     . THR A 1  213 ? 67.012 -17.493 27.059  1.00 82.70  ? 333 THR A C     1 
ATOM   1690 O  O     . THR A 1  213 ? 66.324 -18.453 27.408  1.00 78.41  ? 333 THR A O     1 
ATOM   1691 C  CB    . THR A 1  213 ? 69.028 -16.813 28.363  1.00 83.29  ? 333 THR A CB    1 
ATOM   1692 O  OG1   . THR A 1  213 ? 69.151 -18.137 28.898  1.00 89.70  ? 333 THR A OG1   1 
ATOM   1693 C  CG2   . THR A 1  213 ? 69.605 -15.812 29.353  1.00 91.78  ? 333 THR A CG2   1 
ATOM   1694 N  N     . TYR A 1  214 ? 67.329 -17.259 25.790  1.00 80.30  ? 334 TYR A N     1 
ATOM   1695 C  CA    . TYR A 1  214 ? 66.850 -18.136 24.730  1.00 82.87  ? 334 TYR A CA    1 
ATOM   1696 C  C     . TYR A 1  214 ? 67.734 -19.376 24.611  1.00 72.73  ? 334 TYR A C     1 
ATOM   1697 O  O     . TYR A 1  214 ? 67.293 -20.414 24.118  1.00 66.62  ? 334 TYR A O     1 
ATOM   1698 C  CB    . TYR A 1  214 ? 66.779 -17.387 23.393  1.00 86.79  ? 334 TYR A CB    1 
ATOM   1699 C  CG    . TYR A 1  214 ? 68.117 -17.089 22.755  0.96 90.09  ? 334 TYR A CG    1 
ATOM   1700 C  CD1   . TYR A 1  214 ? 68.816 -15.931 23.066  0.89 93.71  ? 334 TYR A CD1   1 
ATOM   1701 C  CD2   . TYR A 1  214 ? 68.673 -17.958 21.824  0.82 87.35  ? 334 TYR A CD2   1 
ATOM   1702 C  CE1   . TYR A 1  214 ? 70.037 -15.653 22.478  0.00 96.53  ? 334 TYR A CE1   1 
ATOM   1703 C  CE2   . TYR A 1  214 ? 69.891 -17.691 21.233  0.73 89.82  ? 334 TYR A CE2   1 
ATOM   1704 C  CZ    . TYR A 1  214 ? 70.569 -16.538 21.562  0.99 92.27  ? 334 TYR A CZ    1 
ATOM   1705 O  OH    . TYR A 1  214 ? 71.783 -16.269 20.972  0.45 95.30  ? 334 TYR A OH    1 
ATOM   1706 N  N     . GLN A 1  215 ? 68.979 -19.264 25.066  1.00 76.85  ? 335 GLN A N     1 
ATOM   1707 C  CA    . GLN A 1  215 ? 69.887 -20.407 25.082  1.00 84.27  ? 335 GLN A CA    1 
ATOM   1708 C  C     . GLN A 1  215 ? 69.355 -21.490 26.013  1.00 83.05  ? 335 GLN A C     1 
ATOM   1709 O  O     . GLN A 1  215 ? 69.381 -22.676 25.683  1.00 72.65  ? 335 GLN A O     1 
ATOM   1710 C  CB    . GLN A 1  215 ? 71.294 -19.985 25.514  1.00 91.29  ? 335 GLN A CB    1 
ATOM   1711 C  CG    . GLN A 1  215 ? 72.007 -19.057 24.541  1.00 101.59 ? 335 GLN A CG    1 
ATOM   1712 C  CD    . GLN A 1  215 ? 71.660 -17.596 24.756  1.00 106.82 ? 335 GLN A CD    1 
ATOM   1713 O  OE1   . GLN A 1  215 ? 70.654 -17.268 25.385  1.00 110.33 ? 335 GLN A OE1   1 
ATOM   1714 N  NE2   . GLN A 1  215 ? 72.500 -16.708 24.235  1.00 108.09 ? 335 GLN A NE2   1 
ATOM   1715 N  N     . GLU A 1  216 ? 68.870 -21.068 27.177  1.00 82.15  ? 336 GLU A N     1 
ATOM   1716 C  CA    . GLU A 1  216 ? 68.266 -21.983 28.136  1.00 75.87  ? 336 GLU A CA    1 
ATOM   1717 C  C     . GLU A 1  216 ? 66.960 -22.547 27.588  1.00 63.02  ? 336 GLU A C     1 
ATOM   1718 O  O     . GLU A 1  216 ? 66.647 -23.720 27.785  1.00 67.73  ? 336 GLU A O     1 
ATOM   1719 C  CB    . GLU A 1  216 ? 68.022 -21.279 29.472  1.00 72.12  ? 336 GLU A CB    1 
ATOM   1720 C  CG    . GLU A 1  216 ? 68.836 -21.843 30.622  1.00 100.01 ? 336 GLU A CG    1 
ATOM   1721 C  CD    . GLU A 1  216 ? 68.455 -23.271 30.957  1.00 103.03 ? 336 GLU A CD    1 
ATOM   1722 O  OE1   . GLU A 1  216 ? 67.243 -23.557 31.055  1.00 105.22 ? 336 GLU A OE1   1 
ATOM   1723 O  OE2   . GLU A 1  216 ? 69.366 -24.108 31.118  1.00 107.00 ? 336 GLU A OE2   1 
ATOM   1724 N  N     . THR A 1  217 ? 66.203 -21.703 26.895  1.00 60.74  ? 337 THR A N     1 
ATOM   1725 C  CA    . THR A 1  217 ? 64.956 -22.132 26.275  1.00 60.64  ? 337 THR A CA    1 
ATOM   1726 C  C     . THR A 1  217 ? 65.228 -23.184 25.201  1.00 60.17  ? 337 THR A C     1 
ATOM   1727 O  O     . THR A 1  217 ? 64.512 -24.181 25.106  1.00 62.25  ? 337 THR A O     1 
ATOM   1728 C  CB    . THR A 1  217 ? 64.193 -20.944 25.658  1.00 74.88  ? 337 THR A CB    1 
ATOM   1729 O  OG1   . THR A 1  217 ? 63.959 -19.951 26.665  1.00 75.56  ? 337 THR A OG1   1 
ATOM   1730 C  CG2   . THR A 1  217 ? 62.859 -21.400 25.087  1.00 77.07  ? 337 THR A CG2   1 
ATOM   1731 N  N     . TYR A 1  218 ? 66.271 -22.962 24.405  1.00 65.78  ? 338 TYR A N     1 
ATOM   1732 C  CA    . TYR A 1  218 ? 66.688 -23.932 23.395  1.00 69.49  ? 338 TYR A CA    1 
ATOM   1733 C  C     . TYR A 1  218 ? 67.016 -25.272 24.039  1.00 62.99  ? 338 TYR A C     1 
ATOM   1734 O  O     . TYR A 1  218 ? 66.634 -26.328 23.531  1.00 56.08  ? 338 TYR A O     1 
ATOM   1735 C  CB    . TYR A 1  218 ? 67.902 -23.424 22.613  1.00 67.53  ? 338 TYR A CB    1 
ATOM   1736 C  CG    . TYR A 1  218 ? 67.592 -22.343 21.602  1.00 83.30  ? 338 TYR A CG    1 
ATOM   1737 C  CD1   . TYR A 1  218 ? 66.287 -21.928 21.376  1.00 85.41  ? 338 TYR A CD1   1 
ATOM   1738 C  CD2   . TYR A 1  218 ? 68.606 -21.745 20.867  1.00 94.41  ? 338 TYR A CD2   1 
ATOM   1739 C  CE1   . TYR A 1  218 ? 66.001 -20.944 20.450  1.00 87.95  ? 338 TYR A CE1   1 
ATOM   1740 C  CE2   . TYR A 1  218 ? 68.330 -20.760 19.939  1.00 103.85 ? 338 TYR A CE2   1 
ATOM   1741 C  CZ    . TYR A 1  218 ? 67.026 -20.362 19.735  1.00 102.23 ? 338 TYR A CZ    1 
ATOM   1742 O  OH    . TYR A 1  218 ? 66.746 -19.381 18.812  1.00 107.62 ? 338 TYR A OH    1 
ATOM   1743 N  N     . LYS A 1  219 ? 67.730 -25.218 25.159  1.00 57.06  ? 339 LYS A N     1 
ATOM   1744 C  CA    . LYS A 1  219 ? 68.092 -26.417 25.902  1.00 59.84  ? 339 LYS A CA    1 
ATOM   1745 C  C     . LYS A 1  219 ? 66.850 -27.170 26.370  1.00 58.41  ? 339 LYS A C     1 
ATOM   1746 O  O     . LYS A 1  219 ? 66.724 -28.373 26.145  1.00 59.21  ? 339 LYS A O     1 
ATOM   1747 C  CB    . LYS A 1  219 ? 68.973 -26.059 27.104  1.00 69.88  ? 339 LYS A CB    1 
ATOM   1748 C  CG    . LYS A 1  219 ? 69.322 -27.244 27.996  1.00 75.55  ? 339 LYS A CG    1 
ATOM   1749 C  CD    . LYS A 1  219 ? 69.963 -26.800 29.305  1.00 84.19  ? 339 LYS A CD    1 
ATOM   1750 C  CE    . LYS A 1  219 ? 71.264 -26.051 29.067  1.00 90.41  ? 339 LYS A CE    1 
ATOM   1751 N  N     . ARG A 1  220 ? 65.931 -26.452 27.010  1.00 60.59  ? 340 ARG A N     1 
ATOM   1752 C  CA    A ARG A 1  220 ? 64.721 -27.058 27.558  0.38 63.77  ? 340 ARG A CA    1 
ATOM   1753 C  CA    B ARG A 1  220 ? 64.730 -27.072 27.561  0.62 64.44  ? 340 ARG A CA    1 
ATOM   1754 C  C     . ARG A 1  220 ? 63.836 -27.651 26.467  1.00 56.24  ? 340 ARG A C     1 
ATOM   1755 O  O     . ARG A 1  220 ? 63.255 -28.722 26.640  1.00 59.03  ? 340 ARG A O     1 
ATOM   1756 C  CB    A ARG A 1  220 ? 63.932 -26.030 28.371  0.38 63.76  ? 340 ARG A CB    1 
ATOM   1757 C  CB    B ARG A 1  220 ? 63.952 -26.063 28.408  0.62 63.95  ? 340 ARG A CB    1 
ATOM   1758 C  CG    A ARG A 1  220 ? 64.621 -25.606 29.658  0.38 69.02  ? 340 ARG A CG    1 
ATOM   1759 C  CG    B ARG A 1  220 ? 64.737 -25.554 29.609  0.62 69.16  ? 340 ARG A CG    1 
ATOM   1760 C  CD    A ARG A 1  220 ? 63.729 -25.854 30.862  0.38 73.02  ? 340 ARG A CD    1 
ATOM   1761 C  CD    B ARG A 1  220 ? 63.900 -24.650 30.498  0.62 72.50  ? 340 ARG A CD    1 
ATOM   1762 N  NE    A ARG A 1  220 ? 62.640 -24.886 30.952  0.38 71.13  ? 340 ARG A NE    1 
ATOM   1763 N  NE    B ARG A 1  220 ? 64.691 -24.100 31.596  0.62 79.48  ? 340 ARG A NE    1 
ATOM   1764 C  CZ    A ARG A 1  220 ? 61.489 -25.115 31.577  0.38 62.56  ? 340 ARG A CZ    1 
ATOM   1765 C  CZ    B ARG A 1  220 ? 64.190 -23.374 32.590  0.62 73.32  ? 340 ARG A CZ    1 
ATOM   1766 N  NH1   A ARG A 1  220 ? 61.270 -26.288 32.154  0.38 63.46  ? 340 ARG A NH1   1 
ATOM   1767 N  NH1   B ARG A 1  220 ? 62.892 -23.111 32.634  0.62 78.77  ? 340 ARG A NH1   1 
ATOM   1768 N  NH2   A ARG A 1  220 ? 60.554 -24.176 31.617  0.38 64.99  ? 340 ARG A NH2   1 
ATOM   1769 N  NH2   B ARG A 1  220 ? 64.989 -22.914 33.542  0.62 72.25  ? 340 ARG A NH2   1 
ATOM   1770 N  N     . ILE A 1  221 ? 63.731 -26.948 25.344  1.00 47.56  ? 341 ILE A N     1 
ATOM   1771 C  CA    . ILE A 1  221 ? 62.949 -27.441 24.214  1.00 56.36  ? 341 ILE A CA    1 
ATOM   1772 C  C     . ILE A 1  221 ? 63.557 -28.724 23.653  1.00 46.67  ? 341 ILE A C     1 
ATOM   1773 O  O     . ILE A 1  221 ? 62.855 -29.709 23.423  1.00 55.02  ? 341 ILE A O     1 
ATOM   1774 C  CB    . ILE A 1  221 ? 62.852 -26.392 23.086  1.00 57.05  ? 341 ILE A CB    1 
ATOM   1775 C  CG1   . ILE A 1  221 ? 61.990 -25.209 23.527  1.00 54.14  ? 341 ILE A CG1   1 
ATOM   1776 C  CG2   . ILE A 1  221 ? 62.267 -27.015 21.833  1.00 46.35  ? 341 ILE A CG2   1 
ATOM   1777 C  CD1   . ILE A 1  221 ? 61.996 -24.060 22.543  1.00 53.57  ? 341 ILE A CD1   1 
ATOM   1778 N  N     . SER A 1  222 ? 64.870 -28.705 23.441  1.00 53.82  ? 342 SER A N     1 
ATOM   1779 C  CA    . SER A 1  222 ? 65.580 -29.848 22.873  1.00 57.18  ? 342 SER A CA    1 
ATOM   1780 C  C     . SER A 1  222 ? 65.473 -31.083 23.764  1.00 60.46  ? 342 SER A C     1 
ATOM   1781 O  O     . SER A 1  222 ? 65.392 -32.210 23.275  1.00 58.02  ? 342 SER A O     1 
ATOM   1782 C  CB    . SER A 1  222 ? 67.051 -29.498 22.642  1.00 55.54  ? 342 SER A CB    1 
ATOM   1783 O  OG    . SER A 1  222 ? 67.761 -30.605 22.112  1.00 65.33  ? 342 SER A OG    1 
ATOM   1784 N  N     . ARG A 1  223 ? 65.474 -30.863 25.073  1.00 55.80  ? 343 ARG A N     1 
ATOM   1785 C  CA    . ARG A 1  223 ? 65.338 -31.954 26.030  1.00 59.38  ? 343 ARG A CA    1 
ATOM   1786 C  C     . ARG A 1  223 ? 63.872 -32.305 26.269  1.00 64.09  ? 343 ARG A C     1 
ATOM   1787 O  O     . ARG A 1  223 ? 63.569 -33.357 26.832  1.00 72.61  ? 343 ARG A O     1 
ATOM   1788 C  CB    . ARG A 1  223 ? 65.998 -31.585 27.362  1.00 56.59  ? 343 ARG A CB    1 
ATOM   1789 C  CG    . ARG A 1  223 ? 67.492 -31.315 27.281  1.00 60.23  ? 343 ARG A CG    1 
ATOM   1790 C  CD    . ARG A 1  223 ? 68.019 -30.840 28.623  1.00 69.21  ? 343 ARG A CD    1 
ATOM   1791 N  NE    . ARG A 1  223 ? 69.472 -30.699 28.642  1.00 71.65  ? 343 ARG A NE    1 
ATOM   1792 C  CZ    . ARG A 1  223 ? 70.170 -30.351 29.718  1.00 79.66  ? 343 ARG A CZ    1 
ATOM   1793 N  NH1   . ARG A 1  223 ? 69.545 -30.111 30.864  1.00 68.20  ? 343 ARG A NH1   1 
ATOM   1794 N  NH2   . ARG A 1  223 ? 71.489 -30.247 29.652  1.00 86.97  ? 343 ARG A NH2   1 
ATOM   1795 N  N     . VAL A 1  224 ? 62.976 -31.426 25.820  1.00 52.84  ? 344 VAL A N     1 
ATOM   1796 C  CA    . VAL A 1  224 ? 61.566 -31.470 26.206  1.00 51.49  ? 344 VAL A CA    1 
ATOM   1797 C  C     . VAL A 1  224 ? 61.505 -31.508 27.734  1.00 61.72  ? 344 VAL A C     1 
ATOM   1798 O  O     . VAL A 1  224 ? 60.909 -32.401 28.338  1.00 55.66  ? 344 VAL A O     1 
ATOM   1799 C  CB    . VAL A 1  224 ? 60.819 -32.672 25.592  1.00 55.87  ? 344 VAL A CB    1 
ATOM   1800 C  CG1   . VAL A 1  224 ? 59.315 -32.471 25.704  1.00 49.11  ? 344 VAL A CG1   1 
ATOM   1801 C  CG2   . VAL A 1  224 ? 61.210 -32.840 24.121  1.00 57.39  ? 344 VAL A CG2   1 
ATOM   1802 N  N     . GLU A 1  225 ? 62.159 -30.526 28.343  1.00 58.61  ? 345 GLU A N     1 
ATOM   1803 C  CA    . GLU A 1  225 ? 62.307 -30.461 29.791  1.00 59.49  ? 345 GLU A CA    1 
ATOM   1804 C  C     . GLU A 1  225 ? 61.299 -29.499 30.406  1.00 59.04  ? 345 GLU A C     1 
ATOM   1805 O  O     . GLU A 1  225 ? 61.475 -28.282 30.347  1.00 66.07  ? 345 GLU A O     1 
ATOM   1806 C  CB    . GLU A 1  225 ? 63.732 -30.040 30.152  1.00 62.71  ? 345 GLU A CB    1 
ATOM   1807 C  CG    . GLU A 1  225 ? 63.968 -29.803 31.633  1.00 80.74  ? 345 GLU A CG    1 
ATOM   1808 C  CD    . GLU A 1  225 ? 65.353 -29.257 31.912  1.00 85.91  ? 345 GLU A CD    1 
ATOM   1809 O  OE1   . GLU A 1  225 ? 65.459 -28.253 32.648  1.00 102.41 ? 345 GLU A OE1   1 
ATOM   1810 O  OE2   . GLU A 1  225 ? 66.335 -29.833 31.396  1.00 85.58  ? 345 GLU A OE2   1 
ATOM   1811 N  N     . PHE A 1  226 ? 60.242 -30.053 30.990  1.00 68.74  ? 346 PHE A N     1 
ATOM   1812 C  CA    . PHE A 1  226 ? 59.212 -29.250 31.640  1.00 68.63  ? 346 PHE A CA    1 
ATOM   1813 C  C     . PHE A 1  226 ? 58.440 -30.080 32.660  1.00 76.54  ? 346 PHE A C     1 
ATOM   1814 O  O     . PHE A 1  226 ? 58.529 -31.307 32.667  1.00 78.22  ? 346 PHE A O     1 
ATOM   1815 C  CB    . PHE A 1  226 ? 58.246 -28.672 30.606  1.00 63.17  ? 346 PHE A CB    1 
ATOM   1816 C  CG    . PHE A 1  226 ? 57.256 -29.671 30.079  1.00 66.71  ? 346 PHE A CG    1 
ATOM   1817 C  CD1   . PHE A 1  226 ? 57.628 -30.588 29.110  1.00 68.18  ? 346 PHE A CD1   1 
ATOM   1818 C  CD2   . PHE A 1  226 ? 55.952 -29.691 30.550  1.00 63.65  ? 346 PHE A CD2   1 
ATOM   1819 C  CE1   . PHE A 1  226 ? 56.720 -31.510 28.622  1.00 67.78  ? 346 PHE A CE1   1 
ATOM   1820 C  CE2   . PHE A 1  226 ? 55.040 -30.611 30.066  1.00 68.65  ? 346 PHE A CE2   1 
ATOM   1821 C  CZ    . PHE A 1  226 ? 55.425 -31.522 29.100  1.00 67.11  ? 346 PHE A CZ    1 
ATOM   1822 N  N     . THR A 1  227 ? 57.681 -29.402 33.516  1.00 82.27  ? 347 THR A N     1 
ATOM   1823 C  CA    . THR A 1  227 ? 56.817 -30.076 34.478  1.00 65.78  ? 347 THR A CA    1 
ATOM   1824 C  C     . THR A 1  227 ? 55.416 -29.472 34.471  1.00 71.86  ? 347 THR A C     1 
ATOM   1825 O  O     . THR A 1  227 ? 55.216 -28.352 34.002  1.00 62.98  ? 347 THR A O     1 
ATOM   1826 C  CB    . THR A 1  227 ? 57.391 -30.007 35.910  1.00 79.23  ? 347 THR A CB    1 
ATOM   1827 O  OG1   . THR A 1  227 ? 57.635 -28.641 36.267  1.00 79.61  ? 347 THR A OG1   1 
ATOM   1828 C  CG2   . THR A 1  227 ? 58.691 -30.795 36.010  1.00 72.98  ? 347 THR A CG2   1 
ATOM   1829 N  N     . PHE A 1  228 ? 54.448 -30.226 34.984  1.00 75.60  ? 348 PHE A N     1 
ATOM   1830 C  CA    . PHE A 1  228 ? 53.087 -29.729 35.151  1.00 66.00  ? 348 PHE A CA    1 
ATOM   1831 C  C     . PHE A 1  228 ? 52.856 -29.245 36.575  1.00 72.24  ? 348 PHE A C     1 
ATOM   1832 O  O     . PHE A 1  228 ? 53.371 -29.838 37.524  1.00 73.73  ? 348 PHE A O     1 
ATOM   1833 C  CB    . PHE A 1  228 ? 52.055 -30.813 34.828  1.00 70.94  ? 348 PHE A CB    1 
ATOM   1834 C  CG    . PHE A 1  228 ? 52.066 -31.269 33.400  1.00 72.34  ? 348 PHE A CG    1 
ATOM   1835 C  CD1   . PHE A 1  228 ? 51.401 -30.547 32.423  1.00 69.59  ? 348 PHE A CD1   1 
ATOM   1836 C  CD2   . PHE A 1  228 ? 52.717 -32.438 33.039  1.00 77.70  ? 348 PHE A CD2   1 
ATOM   1837 C  CE1   . PHE A 1  228 ? 51.401 -30.973 31.106  1.00 69.97  ? 348 PHE A CE1   1 
ATOM   1838 C  CE2   . PHE A 1  228 ? 52.720 -32.868 31.725  1.00 76.45  ? 348 PHE A CE2   1 
ATOM   1839 C  CZ    . PHE A 1  228 ? 52.060 -32.135 30.758  1.00 67.80  ? 348 PHE A CZ    1 
ATOM   1840 N  N     . PRO A 1  229 ? 52.079 -28.164 36.734  1.00 70.58  ? 349 PRO A N     1 
ATOM   1841 C  CA    . PRO A 1  229 ? 51.569 -27.854 38.073  1.00 75.45  ? 349 PRO A CA    1 
ATOM   1842 C  C     . PRO A 1  229 ? 50.591 -28.944 38.496  1.00 75.98  ? 349 PRO A C     1 
ATOM   1843 O  O     . PRO A 1  229 ? 50.032 -29.613 37.626  1.00 72.92  ? 349 PRO A O     1 
ATOM   1844 C  CB    . PRO A 1  229 ? 50.868 -26.505 37.890  1.00 80.30  ? 349 PRO A CB    1 
ATOM   1845 C  CG    . PRO A 1  229 ? 51.443 -25.937 36.616  1.00 79.73  ? 349 PRO A CG    1 
ATOM   1846 C  CD    . PRO A 1  229 ? 51.738 -27.121 35.752  1.00 68.09  ? 349 PRO A CD    1 
ATOM   1847 N  N     . ASP A 1  230 ? 50.385 -29.118 39.797  1.00 80.71  ? 350 ASP A N     1 
ATOM   1848 C  CA    . ASP A 1  230 ? 49.622 -30.254 40.307  1.00 81.86  ? 350 ASP A CA    1 
ATOM   1849 C  C     . ASP A 1  230 ? 48.179 -30.315 39.805  1.00 85.79  ? 350 ASP A C     1 
ATOM   1850 O  O     . ASP A 1  230 ? 47.620 -31.401 39.654  1.00 79.01  ? 350 ASP A O     1 
ATOM   1851 C  CB    . ASP A 1  230 ? 49.628 -30.240 41.839  1.00 102.74 ? 350 ASP A CB    1 
ATOM   1852 C  CG    . ASP A 1  230 ? 51.002 -30.515 42.417  1.00 108.35 ? 350 ASP A CG    1 
ATOM   1853 O  OD1   . ASP A 1  230 ? 51.842 -31.104 41.702  1.00 110.11 ? 350 ASP A OD1   1 
ATOM   1854 O  OD2   . ASP A 1  230 ? 51.245 -30.143 43.583  1.00 114.22 ? 350 ASP A OD2   1 
ATOM   1855 N  N     . PHE A 1  231 ? 47.579 -29.162 39.538  1.00 82.45  ? 351 PHE A N     1 
ATOM   1856 C  CA    . PHE A 1  231 ? 46.161 -29.126 39.200  1.00 90.32  ? 351 PHE A CA    1 
ATOM   1857 C  C     . PHE A 1  231 ? 45.836 -29.617 37.790  1.00 80.57  ? 351 PHE A C     1 
ATOM   1858 O  O     . PHE A 1  231 ? 44.671 -29.845 37.466  1.00 87.37  ? 351 PHE A O     1 
ATOM   1859 C  CB    . PHE A 1  231 ? 45.623 -27.719 39.370  1.00 81.73  ? 351 PHE A CB    1 
ATOM   1860 C  CG    . PHE A 1  231 ? 46.290 -26.699 38.497  1.00 93.14  ? 351 PHE A CG    1 
ATOM   1861 C  CD1   . PHE A 1  231 ? 45.895 -26.526 37.171  1.00 89.55  ? 351 PHE A CD1   1 
ATOM   1862 C  CD2   . PHE A 1  231 ? 47.263 -25.856 39.020  1.00 88.26  ? 351 PHE A CD2   1 
ATOM   1863 C  CE1   . PHE A 1  231 ? 46.474 -25.548 36.383  1.00 74.04  ? 351 PHE A CE1   1 
ATOM   1864 C  CE2   . PHE A 1  231 ? 47.845 -24.878 38.232  1.00 81.75  ? 351 PHE A CE2   1 
ATOM   1865 C  CZ    . PHE A 1  231 ? 47.454 -24.729 36.913  1.00 80.81  ? 351 PHE A CZ    1 
ATOM   1866 N  N     . VAL A 1  232 ? 46.851 -29.759 36.946  1.00 76.41  ? 352 VAL A N     1 
ATOM   1867 C  CA    . VAL A 1  232 ? 46.620 -30.259 35.596  1.00 78.85  ? 352 VAL A CA    1 
ATOM   1868 C  C     . VAL A 1  232 ? 46.136 -31.707 35.653  1.00 78.79  ? 352 VAL A C     1 
ATOM   1869 O  O     . VAL A 1  232 ? 46.810 -32.574 36.207  1.00 84.48  ? 352 VAL A O     1 
ATOM   1870 C  CB    . VAL A 1  232 ? 47.886 -30.167 34.721  1.00 79.55  ? 352 VAL A CB    1 
ATOM   1871 C  CG1   . VAL A 1  232 ? 47.599 -30.700 33.331  1.00 60.43  ? 352 VAL A CG1   1 
ATOM   1872 C  CG2   . VAL A 1  232 ? 48.375 -28.728 34.644  1.00 71.57  ? 352 VAL A CG2   1 
ATOM   1873 N  N     . THR A 1  233 ? 44.960 -31.955 35.082  1.00 79.12  ? 353 THR A N     1 
ATOM   1874 C  CA    . THR A 1  233 ? 44.330 -33.271 35.141  1.00 75.46  ? 353 THR A CA    1 
ATOM   1875 C  C     . THR A 1  233 ? 45.089 -34.309 34.323  1.00 85.32  ? 353 THR A C     1 
ATOM   1876 O  O     . THR A 1  233 ? 45.883 -33.965 33.447  1.00 84.04  ? 353 THR A O     1 
ATOM   1877 C  CB    . THR A 1  233 ? 42.874 -33.218 34.644  1.00 75.40  ? 353 THR A CB    1 
ATOM   1878 O  OG1   . THR A 1  233 ? 42.849 -32.753 33.288  1.00 79.69  ? 353 THR A OG1   1 
ATOM   1879 C  CG2   . THR A 1  233 ? 42.048 -32.279 35.510  1.00 70.67  ? 353 THR A CG2   1 
ATOM   1880 N  N     . GLU A 1  234 ? 44.829 -35.582 34.612  1.00 88.94  ? 354 GLU A N     1 
ATOM   1881 C  CA    . GLU A 1  234 ? 45.511 -36.688 33.947  1.00 86.15  ? 354 GLU A CA    1 
ATOM   1882 C  C     . GLU A 1  234 ? 45.248 -36.703 32.444  1.00 84.70  ? 354 GLU A C     1 
ATOM   1883 O  O     . GLU A 1  234 ? 46.131 -37.046 31.658  1.00 78.56  ? 354 GLU A O     1 
ATOM   1884 C  CB    . GLU A 1  234 ? 45.085 -38.023 34.563  1.00 86.02  ? 354 GLU A CB    1 
ATOM   1885 N  N     . GLY A 1  235 ? 44.033 -36.334 32.053  1.00 82.08  ? 355 GLY A N     1 
ATOM   1886 C  CA    . GLY A 1  235 ? 43.667 -36.284 30.649  1.00 66.84  ? 355 GLY A CA    1 
ATOM   1887 C  C     . GLY A 1  235 ? 44.403 -35.184 29.911  1.00 73.64  ? 355 GLY A C     1 
ATOM   1888 O  O     . GLY A 1  235 ? 44.800 -35.351 28.756  1.00 69.16  ? 355 GLY A O     1 
ATOM   1889 N  N     . ALA A 1  236 ? 44.586 -34.052 30.582  1.00 70.48  ? 356 ALA A N     1 
ATOM   1890 C  CA    . ALA A 1  236 ? 45.311 -32.927 30.006  1.00 67.50  ? 356 ALA A CA    1 
ATOM   1891 C  C     . ALA A 1  236 ? 46.802 -33.238 29.911  1.00 73.39  ? 356 ALA A C     1 
ATOM   1892 O  O     . ALA A 1  236 ? 47.458 -32.883 28.931  1.00 66.10  ? 356 ALA A O     1 
ATOM   1893 C  CB    . ALA A 1  236 ? 45.079 -31.670 30.826  1.00 60.97  ? 356 ALA A CB    1 
ATOM   1894 N  N     . ARG A 1  237 ? 47.328 -33.902 30.936  1.00 72.37  ? 357 ARG A N     1 
ATOM   1895 C  CA    . ARG A 1  237 ? 48.730 -34.306 30.957  1.00 61.37  ? 357 ARG A CA    1 
ATOM   1896 C  C     . ARG A 1  237 ? 49.029 -35.283 29.828  1.00 72.64  ? 357 ARG A C     1 
ATOM   1897 O  O     . ARG A 1  237 ? 50.076 -35.206 29.187  1.00 73.66  ? 357 ARG A O     1 
ATOM   1898 C  CB    . ARG A 1  237 ? 49.090 -34.939 32.303  1.00 66.71  ? 357 ARG A CB    1 
ATOM   1899 C  CG    . ARG A 1  237 ? 49.105 -33.966 33.468  1.00 60.99  ? 357 ARG A CG    1 
ATOM   1900 C  CD    . ARG A 1  237 ? 49.176 -34.700 34.801  1.00 65.95  ? 357 ARG A CD    1 
ATOM   1901 N  NE    . ARG A 1  237 ? 49.231 -33.776 35.931  1.00 72.22  ? 357 ARG A NE    1 
ATOM   1902 C  CZ    . ARG A 1  237 ? 50.352 -33.410 36.543  1.00 83.50  ? 357 ARG A CZ    1 
ATOM   1903 N  NH1   . ARG A 1  237 ? 51.519 -33.894 36.141  1.00 81.83  ? 357 ARG A NH1   1 
ATOM   1904 N  NH2   . ARG A 1  237 ? 50.307 -32.564 37.565  1.00 80.91  ? 357 ARG A NH2   1 
ATOM   1905 N  N     . ASP A 1  238 ? 48.095 -36.198 29.594  1.00 74.44  ? 358 ASP A N     1 
ATOM   1906 C  CA    . ASP A 1  238 ? 48.246 -37.208 28.557  1.00 76.01  ? 358 ASP A CA    1 
ATOM   1907 C  C     . ASP A 1  238 ? 48.306 -36.589 27.162  1.00 67.43  ? 358 ASP A C     1 
ATOM   1908 O  O     . ASP A 1  238 ? 49.186 -36.922 26.369  1.00 74.39  ? 358 ASP A O     1 
ATOM   1909 C  CB    . ASP A 1  238 ? 47.101 -38.219 28.635  1.00 81.53  ? 358 ASP A CB    1 
ATOM   1910 C  CG    . ASP A 1  238 ? 47.130 -39.221 27.501  1.00 76.48  ? 358 ASP A CG    1 
ATOM   1911 O  OD1   . ASP A 1  238 ? 47.875 -40.218 27.606  1.00 82.34  ? 358 ASP A OD1   1 
ATOM   1912 O  OD2   . ASP A 1  238 ? 46.404 -39.014 26.507  1.00 86.04  ? 358 ASP A OD2   1 
ATOM   1913 N  N     . LEU A 1  239 ? 47.371 -35.688 26.871  1.00 67.01  ? 359 LEU A N     1 
ATOM   1914 C  CA    . LEU A 1  239 ? 47.302 -35.046 25.560  1.00 64.74  ? 359 LEU A CA    1 
ATOM   1915 C  C     . LEU A 1  239 ? 48.551 -34.223 25.264  1.00 68.64  ? 359 LEU A C     1 
ATOM   1916 O  O     . LEU A 1  239 ? 49.141 -34.334 24.187  1.00 61.97  ? 359 LEU A O     1 
ATOM   1917 C  CB    . LEU A 1  239 ? 46.061 -34.153 25.463  1.00 62.38  ? 359 LEU A CB    1 
ATOM   1918 C  CG    . LEU A 1  239 ? 45.944 -33.323 24.180  1.00 66.98  ? 359 LEU A CG    1 
ATOM   1919 C  CD1   . LEU A 1  239 ? 45.843 -34.224 22.959  1.00 68.46  ? 359 LEU A CD1   1 
ATOM   1920 C  CD2   . LEU A 1  239 ? 44.758 -32.373 24.247  1.00 69.43  ? 359 LEU A CD2   1 
ATOM   1921 N  N     . ILE A 1  240 ? 48.944 -33.394 26.226  1.00 56.07  ? 360 ILE A N     1 
ATOM   1922 C  CA    . ILE A 1  240 ? 50.114 -32.537 26.082  1.00 59.44  ? 360 ILE A CA    1 
ATOM   1923 C  C     . ILE A 1  240 ? 51.392 -33.347 25.879  1.00 66.93  ? 360 ILE A C     1 
ATOM   1924 O  O     . ILE A 1  240 ? 52.208 -33.028 25.012  1.00 67.32  ? 360 ILE A O     1 
ATOM   1925 C  CB    . ILE A 1  240 ? 50.274 -31.616 27.306  1.00 56.88  ? 360 ILE A CB    1 
ATOM   1926 C  CG1   . ILE A 1  240 ? 49.126 -30.607 27.352  1.00 59.18  ? 360 ILE A CG1   1 
ATOM   1927 C  CG2   . ILE A 1  240 ? 51.616 -30.901 27.282  1.00 51.82  ? 360 ILE A CG2   1 
ATOM   1928 C  CD1   . ILE A 1  240 ? 49.164 -29.695 28.550  1.00 63.75  ? 360 ILE A CD1   1 
ATOM   1929 N  N     . SER A 1  241 ? 51.552 -34.404 26.670  1.00 61.94  ? 361 SER A N     1 
ATOM   1930 C  CA    . SER A 1  241 ? 52.743 -35.246 26.597  1.00 56.55  ? 361 SER A CA    1 
ATOM   1931 C  C     . SER A 1  241 ? 52.869 -35.948 25.246  1.00 67.31  ? 361 SER A C     1 
ATOM   1932 O  O     . SER A 1  241 ? 53.976 -36.176 24.761  1.00 70.37  ? 361 SER A O     1 
ATOM   1933 C  CB    . SER A 1  241 ? 52.733 -36.282 27.723  1.00 61.36  ? 361 SER A CB    1 
ATOM   1934 O  OG    . SER A 1  241 ? 52.810 -35.653 28.991  1.00 76.10  ? 361 SER A OG    1 
ATOM   1935 N  N     . ARG A 1  242 ? 51.734 -36.289 24.643  1.00 66.11  ? 362 ARG A N     1 
ATOM   1936 C  CA    . ARG A 1  242 ? 51.732 -36.930 23.331  1.00 70.13  ? 362 ARG A CA    1 
ATOM   1937 C  C     . ARG A 1  242 ? 52.118 -35.941 22.237  1.00 60.65  ? 362 ARG A C     1 
ATOM   1938 O  O     . ARG A 1  242 ? 52.826 -36.291 21.296  1.00 60.59  ? 362 ARG A O     1 
ATOM   1939 C  CB    . ARG A 1  242 ? 50.362 -37.540 23.025  1.00 62.12  ? 362 ARG A CB    1 
ATOM   1940 C  CG    . ARG A 1  242 ? 50.008 -38.738 23.884  1.00 64.38  ? 362 ARG A CG    1 
ATOM   1941 C  CD    . ARG A 1  242 ? 48.622 -39.267 23.550  1.00 68.15  ? 362 ARG A CD    1 
ATOM   1942 N  NE    . ARG A 1  242 ? 48.218 -40.337 24.456  1.00 79.53  ? 362 ARG A NE    1 
ATOM   1943 C  CZ    . ARG A 1  242 ? 48.489 -41.624 24.263  1.00 88.06  ? 362 ARG A CZ    1 
ATOM   1944 N  NH1   . ARG A 1  242 ? 49.166 -42.009 23.189  1.00 86.68  ? 362 ARG A NH1   1 
ATOM   1945 N  NH2   . ARG A 1  242 ? 48.082 -42.527 25.145  1.00 89.18  ? 362 ARG A NH2   1 
ATOM   1946 N  N     . LEU A 1  243 ? 51.648 -34.704 22.371  1.00 59.23  ? 363 LEU A N     1 
ATOM   1947 C  CA    . LEU A 1  243 ? 51.934 -33.660 21.394  1.00 61.28  ? 363 LEU A CA    1 
ATOM   1948 C  C     . LEU A 1  243 ? 53.364 -33.142 21.507  1.00 64.34  ? 363 LEU A C     1 
ATOM   1949 O  O     . LEU A 1  243 ? 53.935 -32.654 20.529  1.00 55.86  ? 363 LEU A O     1 
ATOM   1950 C  CB    . LEU A 1  243 ? 50.949 -32.498 21.553  1.00 58.99  ? 363 LEU A CB    1 
ATOM   1951 C  CG    . LEU A 1  243 ? 49.505 -32.752 21.116  1.00 60.80  ? 363 LEU A CG    1 
ATOM   1952 C  CD1   . LEU A 1  243 ? 48.608 -31.599 21.536  1.00 45.44  ? 363 LEU A CD1   1 
ATOM   1953 C  CD2   . LEU A 1  243 ? 49.435 -32.964 19.607  1.00 58.11  ? 363 LEU A CD2   1 
ATOM   1954 N  N     . LEU A 1  244 ? 53.940 -33.243 22.700  1.00 61.63  ? 364 LEU A N     1 
ATOM   1955 C  CA    . LEU A 1  244 ? 55.289 -32.737 22.926  1.00 53.29  ? 364 LEU A CA    1 
ATOM   1956 C  C     . LEU A 1  244 ? 56.335 -33.847 22.881  1.00 60.58  ? 364 LEU A C     1 
ATOM   1957 O  O     . LEU A 1  244 ? 57.258 -33.871 23.692  1.00 67.94  ? 364 LEU A O     1 
ATOM   1958 C  CB    . LEU A 1  244 ? 55.369 -31.999 24.262  1.00 62.36  ? 364 LEU A CB    1 
ATOM   1959 C  CG    . LEU A 1  244 ? 54.559 -30.704 24.352  1.00 63.03  ? 364 LEU A CG    1 
ATOM   1960 C  CD1   . LEU A 1  244 ? 54.842 -29.990 25.663  1.00 62.28  ? 364 LEU A CD1   1 
ATOM   1961 C  CD2   . LEU A 1  244 ? 54.847 -29.795 23.166  1.00 52.23  ? 364 LEU A CD2   1 
ATOM   1962 N  N     . LYS A 1  245 ? 56.191 -34.763 21.930  1.00 63.85  ? 365 LYS A N     1 
ATOM   1963 C  CA    . LYS A 1  245 ? 57.203 -35.788 21.713  1.00 63.06  ? 365 LYS A CA    1 
ATOM   1964 C  C     . LYS A 1  245 ? 58.401 -35.184 20.988  1.00 61.42  ? 365 LYS A C     1 
ATOM   1965 O  O     . LYS A 1  245 ? 58.234 -34.367 20.083  1.00 45.77  ? 365 LYS A O     1 
ATOM   1966 C  CB    . LYS A 1  245 ? 56.631 -36.962 20.915  1.00 65.70  ? 365 LYS A CB    1 
ATOM   1967 C  CG    . LYS A 1  245 ? 55.620 -37.805 21.676  1.00 68.46  ? 365 LYS A CG    1 
ATOM   1968 C  CD    . LYS A 1  245 ? 56.278 -38.556 22.822  1.00 74.20  ? 365 LYS A CD    1 
ATOM   1969 C  CE    . LYS A 1  245 ? 55.261 -39.365 23.611  1.00 76.52  ? 365 LYS A CE    1 
ATOM   1970 N  NZ    . LYS A 1  245 ? 54.551 -40.356 22.757  1.00 82.73  ? 365 LYS A NZ    1 
ATOM   1971 N  N     . HIS A 1  246 ? 59.605 -35.573 21.392  1.00 60.91  ? 366 HIS A N     1 
ATOM   1972 C  CA    . HIS A 1  246 ? 60.809 -35.075 20.737  1.00 55.71  ? 366 HIS A CA    1 
ATOM   1973 C  C     . HIS A 1  246 ? 60.867 -35.576 19.298  1.00 62.49  ? 366 HIS A C     1 
ATOM   1974 O  O     . HIS A 1  246 ? 61.166 -34.814 18.380  1.00 55.38  ? 366 HIS A O     1 
ATOM   1975 C  CB    . HIS A 1  246 ? 62.065 -35.499 21.499  1.00 54.00  ? 366 HIS A CB    1 
ATOM   1976 C  CG    . HIS A 1  246 ? 63.331 -34.929 20.936  1.00 71.01  ? 366 HIS A CG    1 
ATOM   1977 N  ND1   . HIS A 1  246 ? 64.155 -35.636 20.088  1.00 66.94  ? 366 HIS A ND1   1 
ATOM   1978 C  CD2   . HIS A 1  246 ? 63.910 -33.715 21.097  1.00 58.72  ? 366 HIS A CD2   1 
ATOM   1979 C  CE1   . HIS A 1  246 ? 65.191 -34.886 19.756  1.00 55.22  ? 366 HIS A CE1   1 
ATOM   1980 N  NE2   . HIS A 1  246 ? 65.066 -33.716 20.355  1.00 57.24  ? 366 HIS A NE2   1 
ATOM   1981 N  N     . ASN A 1  247 ? 60.574 -36.861 19.114  1.00 61.55  ? 367 ASN A N     1 
ATOM   1982 C  CA    . ASN A 1  247 ? 60.486 -37.459 17.788  1.00 61.96  ? 367 ASN A CA    1 
ATOM   1983 C  C     . ASN A 1  247 ? 59.195 -37.027 17.096  1.00 66.72  ? 367 ASN A C     1 
ATOM   1984 O  O     . ASN A 1  247 ? 58.105 -37.406 17.523  1.00 69.47  ? 367 ASN A O     1 
ATOM   1985 C  CB    . ASN A 1  247 ? 60.559 -38.986 17.885  1.00 57.66  ? 367 ASN A CB    1 
ATOM   1986 C  CG    . ASN A 1  247 ? 60.842 -39.653 16.545  1.00 78.47  ? 367 ASN A CG    1 
ATOM   1987 O  OD1   . ASN A 1  247 ? 60.495 -39.129 15.485  1.00 82.66  ? 367 ASN A OD1   1 
ATOM   1988 N  ND2   . ASN A 1  247 ? 61.471 -40.822 16.591  1.00 67.84  ? 367 ASN A ND2   1 
ATOM   1989 N  N     . PRO A 1  248 ? 59.319 -36.231 16.022  1.00 62.42  ? 368 PRO A N     1 
ATOM   1990 C  CA    . PRO A 1  248 ? 58.174 -35.639 15.319  1.00 59.48  ? 368 PRO A CA    1 
ATOM   1991 C  C     . PRO A 1  248 ? 57.173 -36.675 14.819  1.00 55.36  ? 368 PRO A C     1 
ATOM   1992 O  O     . PRO A 1  248 ? 55.969 -36.418 14.828  1.00 59.32  ? 368 PRO A O     1 
ATOM   1993 C  CB    . PRO A 1  248 ? 58.826 -34.910 14.138  1.00 55.65  ? 368 PRO A CB    1 
ATOM   1994 C  CG    . PRO A 1  248 ? 60.227 -34.660 14.570  1.00 64.37  ? 368 PRO A CG    1 
ATOM   1995 C  CD    . PRO A 1  248 ? 60.600 -35.847 15.405  1.00 65.39  ? 368 PRO A CD    1 
ATOM   1996 N  N     . SER A 1  249 ? 57.669 -37.831 14.393  1.00 63.52  ? 369 SER A N     1 
ATOM   1997 C  CA    . SER A 1  249 ? 56.811 -38.865 13.828  1.00 71.56  ? 369 SER A CA    1 
ATOM   1998 C  C     . SER A 1  249 ? 56.037 -39.614 14.908  1.00 74.67  ? 369 SER A C     1 
ATOM   1999 O  O     . SER A 1  249 ? 55.115 -40.371 14.607  1.00 73.30  ? 369 SER A O     1 
ATOM   2000 C  CB    . SER A 1  249 ? 57.637 -39.850 12.997  1.00 66.58  ? 369 SER A CB    1 
ATOM   2001 O  OG    . SER A 1  249 ? 58.677 -40.425 13.768  1.00 80.35  ? 369 SER A OG    1 
ATOM   2002 N  N     . GLN A 1  250 ? 56.411 -39.400 16.165  1.00 73.37  ? 370 GLN A N     1 
ATOM   2003 C  CA    . GLN A 1  250 ? 55.730 -40.056 17.275  1.00 70.43  ? 370 GLN A CA    1 
ATOM   2004 C  C     . GLN A 1  250 ? 54.592 -39.193 17.810  1.00 66.64  ? 370 GLN A C     1 
ATOM   2005 O  O     . GLN A 1  250 ? 53.790 -39.646 18.626  1.00 70.64  ? 370 GLN A O     1 
ATOM   2006 C  CB    . GLN A 1  250 ? 56.717 -40.392 18.395  1.00 74.81  ? 370 GLN A CB    1 
ATOM   2007 C  CG    . GLN A 1  250 ? 57.745 -41.446 18.006  1.00 88.02  ? 370 GLN A CG    1 
ATOM   2008 C  CD    . GLN A 1  250 ? 58.741 -41.737 19.113  1.00 102.92 ? 370 GLN A CD    1 
ATOM   2009 O  OE1   . GLN A 1  250 ? 58.974 -40.906 19.991  1.00 103.84 ? 370 GLN A OE1   1 
ATOM   2010 N  NE2   . GLN A 1  250 ? 59.341 -42.922 19.071  1.00 104.54 ? 370 GLN A NE2   1 
ATOM   2011 N  N     . ARG A 1  251 ? 54.525 -37.948 17.349  1.00 61.33  ? 371 ARG A N     1 
ATOM   2012 C  CA    . ARG A 1  251 ? 53.417 -37.070 17.706  1.00 65.11  ? 371 ARG A CA    1 
ATOM   2013 C  C     . ARG A 1  251 ? 52.158 -37.546 16.991  1.00 71.16  ? 371 ARG A C     1 
ATOM   2014 O  O     . ARG A 1  251 ? 52.232 -38.033 15.863  1.00 71.86  ? 371 ARG A O     1 
ATOM   2015 C  CB    . ARG A 1  251 ? 53.734 -35.616 17.351  1.00 58.11  ? 371 ARG A CB    1 
ATOM   2016 C  CG    . ARG A 1  251 ? 54.954 -35.063 18.069  1.00 57.42  ? 371 ARG A CG    1 
ATOM   2017 C  CD    . ARG A 1  251 ? 55.344 -33.695 17.539  1.00 41.61  ? 371 ARG A CD    1 
ATOM   2018 N  NE    . ARG A 1  251 ? 56.746 -33.395 17.813  1.00 51.44  ? 371 ARG A NE    1 
ATOM   2019 C  CZ    . ARG A 1  251 ? 57.475 -32.536 17.109  1.00 56.02  ? 371 ARG A CZ    1 
ATOM   2020 N  NH1   . ARG A 1  251 ? 56.936 -31.892 16.082  1.00 54.29  ? 371 ARG A NH1   1 
ATOM   2021 N  NH2   . ARG A 1  251 ? 58.747 -32.329 17.423  1.00 46.45  ? 371 ARG A NH2   1 
ATOM   2022 N  N     . PRO A 1  252 ? 50.995 -37.415 17.646  1.00 73.88  ? 372 PRO A N     1 
ATOM   2023 C  CA    . PRO A 1  252 ? 49.754 -37.956 17.082  1.00 76.97  ? 372 PRO A CA    1 
ATOM   2024 C  C     . PRO A 1  252 ? 49.290 -37.201 15.843  1.00 77.94  ? 372 PRO A C     1 
ATOM   2025 O  O     . PRO A 1  252 ? 49.923 -36.230 15.436  1.00 70.66  ? 372 PRO A O     1 
ATOM   2026 C  CB    . PRO A 1  252 ? 48.752 -37.785 18.227  1.00 69.87  ? 372 PRO A CB    1 
ATOM   2027 C  CG    . PRO A 1  252 ? 49.261 -36.616 18.985  1.00 63.76  ? 372 PRO A CG    1 
ATOM   2028 C  CD    . PRO A 1  252 ? 50.759 -36.719 18.923  1.00 68.32  ? 372 PRO A CD    1 
ATOM   2029 N  N     . MET A 1  253 ? 48.197 -37.659 15.246  1.00 76.54  ? 373 MET A N     1 
ATOM   2030 C  CA    . MET A 1  253 ? 47.577 -36.935 14.147  1.00 73.74  ? 373 MET A CA    1 
ATOM   2031 C  C     . MET A 1  253 ? 46.474 -36.036 14.686  1.00 76.07  ? 373 MET A C     1 
ATOM   2032 O  O     . MET A 1  253 ? 45.974 -36.251 15.790  1.00 84.34  ? 373 MET A O     1 
ATOM   2033 C  CB    . MET A 1  253 ? 47.019 -37.901 13.101  1.00 75.33  ? 373 MET A CB    1 
ATOM   2034 C  CG    . MET A 1  253 ? 48.084 -38.693 12.361  1.00 85.53  ? 373 MET A CG    1 
ATOM   2035 S  SD    . MET A 1  253 ? 47.409 -39.624 10.974  1.00 136.96 ? 373 MET A SD    1 
ATOM   2036 C  CE    . MET A 1  253 ? 46.227 -40.675 11.812  1.00 69.67  ? 373 MET A CE    1 
ATOM   2037 N  N     . LEU A 1  254 ? 46.100 -35.027 13.907  1.00 68.61  ? 374 LEU A N     1 
ATOM   2038 C  CA    . LEU A 1  254 ? 45.076 -34.080 14.327  1.00 70.98  ? 374 LEU A CA    1 
ATOM   2039 C  C     . LEU A 1  254 ? 43.725 -34.765 14.487  1.00 71.93  ? 374 LEU A C     1 
ATOM   2040 O  O     . LEU A 1  254 ? 42.901 -34.347 15.297  1.00 69.04  ? 374 LEU A O     1 
ATOM   2041 C  CB    . LEU A 1  254 ? 44.981 -32.927 13.331  1.00 66.50  ? 374 LEU A CB    1 
ATOM   2042 C  CG    . LEU A 1  254 ? 46.205 -32.010 13.352  1.00 68.40  ? 374 LEU A CG    1 
ATOM   2043 C  CD1   . LEU A 1  254 ? 46.227 -31.098 12.141  1.00 66.76  ? 374 LEU A CD1   1 
ATOM   2044 C  CD2   . LEU A 1  254 ? 46.227 -31.195 14.641  1.00 59.17  ? 374 LEU A CD2   1 
ATOM   2045 N  N     . ARG A 1  255 ? 43.507 -35.823 13.714  1.00 77.12  ? 375 ARG A N     1 
ATOM   2046 C  CA    . ARG A 1  255 ? 42.299 -36.625 13.849  1.00 84.20  ? 375 ARG A CA    1 
ATOM   2047 C  C     . ARG A 1  255 ? 42.288 -37.338 15.198  1.00 85.80  ? 375 ARG A C     1 
ATOM   2048 O  O     . ARG A 1  255 ? 41.231 -37.552 15.790  1.00 88.21  ? 375 ARG A O     1 
ATOM   2049 C  CB    . ARG A 1  255 ? 42.193 -37.640 12.709  1.00 80.91  ? 375 ARG A CB    1 
ATOM   2050 N  N     . GLU A 1  256 ? 43.474 -37.697 15.680  1.00 86.23  ? 376 GLU A N     1 
ATOM   2051 C  CA    . GLU A 1  256 ? 43.608 -38.387 16.958  1.00 74.80  ? 376 GLU A CA    1 
ATOM   2052 C  C     . GLU A 1  256 ? 43.437 -37.421 18.123  1.00 78.08  ? 376 GLU A C     1 
ATOM   2053 O  O     . GLU A 1  256 ? 42.977 -37.807 19.198  1.00 85.88  ? 376 GLU A O     1 
ATOM   2054 C  CB    . GLU A 1  256 ? 44.964 -39.091 17.046  1.00 76.69  ? 376 GLU A CB    1 
ATOM   2055 C  CG    . GLU A 1  256 ? 45.122 -40.249 16.071  1.00 89.76  ? 376 GLU A CG    1 
ATOM   2056 C  CD    . GLU A 1  256 ? 46.509 -40.861 16.110  1.00 94.66  ? 376 GLU A CD    1 
ATOM   2057 O  OE1   . GLU A 1  256 ? 47.497 -40.099 16.102  1.00 92.22  ? 376 GLU A OE1   1 
ATOM   2058 O  OE2   . GLU A 1  256 ? 46.611 -42.105 16.150  1.00 101.24 ? 376 GLU A OE2   1 
ATOM   2059 N  N     . VAL A 1  257 ? 43.812 -36.166 17.904  1.00 72.36  ? 377 VAL A N     1 
ATOM   2060 C  CA    . VAL A 1  257 ? 43.642 -35.129 18.914  1.00 71.43  ? 377 VAL A CA    1 
ATOM   2061 C  C     . VAL A 1  257 ? 42.164 -34.786 19.078  1.00 76.71  ? 377 VAL A C     1 
ATOM   2062 O  O     . VAL A 1  257 ? 41.674 -34.607 20.194  1.00 76.04  ? 377 VAL A O     1 
ATOM   2063 C  CB    . VAL A 1  257 ? 44.433 -33.856 18.556  1.00 65.72  ? 377 VAL A CB    1 
ATOM   2064 C  CG1   . VAL A 1  257 ? 44.178 -32.760 19.580  1.00 65.83  ? 377 VAL A CG1   1 
ATOM   2065 C  CG2   . VAL A 1  257 ? 45.919 -34.168 18.462  1.00 60.66  ? 377 VAL A CG2   1 
ATOM   2066 N  N     . LEU A 1  258 ? 41.455 -34.710 17.955  1.00 70.59  ? 378 LEU A N     1 
ATOM   2067 C  CA    . LEU A 1  258 ? 40.030 -34.394 17.963  1.00 69.83  ? 378 LEU A CA    1 
ATOM   2068 C  C     . LEU A 1  258 ? 39.204 -35.503 18.608  1.00 75.79  ? 378 LEU A C     1 
ATOM   2069 O  O     . LEU A 1  258 ? 38.095 -35.264 19.087  1.00 84.60  ? 378 LEU A O     1 
ATOM   2070 C  CB    . LEU A 1  258 ? 39.538 -34.140 16.538  1.00 67.98  ? 378 LEU A CB    1 
ATOM   2071 C  CG    . LEU A 1  258 ? 40.045 -32.859 15.877  1.00 69.06  ? 378 LEU A CG    1 
ATOM   2072 C  CD1   . LEU A 1  258 ? 39.853 -32.923 14.368  1.00 56.93  ? 378 LEU A CD1   1 
ATOM   2073 C  CD2   . LEU A 1  258 ? 39.328 -31.653 16.462  1.00 69.60  ? 378 LEU A CD2   1 
ATOM   2074 N  N     . GLU A 1  259 ? 39.751 -36.714 18.617  1.00 75.70  ? 379 GLU A N     1 
ATOM   2075 C  CA    . GLU A 1  259 ? 39.055 -37.865 19.179  1.00 77.40  ? 379 GLU A CA    1 
ATOM   2076 C  C     . GLU A 1  259 ? 39.589 -38.228 20.561  1.00 73.93  ? 379 GLU A C     1 
ATOM   2077 O  O     . GLU A 1  259 ? 39.211 -39.251 21.130  1.00 75.21  ? 379 GLU A O     1 
ATOM   2078 C  CB    . GLU A 1  259 ? 39.172 -39.066 18.239  1.00 86.83  ? 379 GLU A CB    1 
ATOM   2079 C  CG    . GLU A 1  259 ? 38.506 -38.862 16.887  1.00 94.36  ? 379 GLU A CG    1 
ATOM   2080 C  CD    . GLU A 1  259 ? 38.803 -39.987 15.915  1.00 113.15 ? 379 GLU A CD    1 
ATOM   2081 O  OE1   . GLU A 1  259 ? 39.521 -40.935 16.299  1.00 114.75 ? 379 GLU A OE1   1 
ATOM   2082 O  OE2   . GLU A 1  259 ? 38.319 -39.924 14.764  1.00 122.38 ? 379 GLU A OE2   1 
ATOM   2083 N  N     . HIS A 1  260 ? 40.469 -37.387 21.095  1.00 71.35  ? 380 HIS A N     1 
ATOM   2084 C  CA    . HIS A 1  260 ? 41.040 -37.617 22.417  1.00 76.56  ? 380 HIS A CA    1 
ATOM   2085 C  C     . HIS A 1  260 ? 39.957 -37.510 23.487  1.00 77.57  ? 380 HIS A C     1 
ATOM   2086 O  O     . HIS A 1  260 ? 39.170 -36.564 23.482  1.00 84.93  ? 380 HIS A O     1 
ATOM   2087 C  CB    . HIS A 1  260 ? 42.170 -36.622 22.697  1.00 74.90  ? 380 HIS A CB    1 
ATOM   2088 C  CG    . HIS A 1  260 ? 42.999 -36.970 23.893  1.00 83.47  ? 380 HIS A CG    1 
ATOM   2089 N  ND1   . HIS A 1  260 ? 42.602 -36.687 25.183  1.00 84.72  ? 380 HIS A ND1   1 
ATOM   2090 C  CD2   . HIS A 1  260 ? 44.205 -37.577 23.996  1.00 81.70  ? 380 HIS A CD2   1 
ATOM   2091 C  CE1   . HIS A 1  260 ? 43.527 -37.106 26.028  1.00 80.22  ? 380 HIS A CE1   1 
ATOM   2092 N  NE2   . HIS A 1  260 ? 44.511 -37.649 25.334  1.00 81.13  ? 380 HIS A NE2   1 
ATOM   2093 N  N     . PRO A 1  261 ? 39.911 -38.491 24.403  1.00 83.18  ? 381 PRO A N     1 
ATOM   2094 C  CA    . PRO A 1  261 ? 38.900 -38.568 25.466  1.00 82.98  ? 381 PRO A CA    1 
ATOM   2095 C  C     . PRO A 1  261 ? 38.783 -37.282 26.280  1.00 83.17  ? 381 PRO A C     1 
ATOM   2096 O  O     . PRO A 1  261 ? 37.672 -36.863 26.602  1.00 99.96  ? 381 PRO A O     1 
ATOM   2097 C  CB    . PRO A 1  261 ? 39.402 -39.718 26.341  1.00 82.14  ? 381 PRO A CB    1 
ATOM   2098 C  CG    . PRO A 1  261 ? 40.166 -40.584 25.402  1.00 87.69  ? 381 PRO A CG    1 
ATOM   2099 C  CD    . PRO A 1  261 ? 40.832 -39.642 24.438  1.00 79.14  ? 381 PRO A CD    1 
ATOM   2100 N  N     . TRP A 1  262 ? 39.915 -36.664 26.599  1.00 77.20  ? 382 TRP A N     1 
ATOM   2101 C  CA    . TRP A 1  262 ? 39.916 -35.423 27.363  1.00 72.31  ? 382 TRP A CA    1 
ATOM   2102 C  C     . TRP A 1  262 ? 39.338 -34.269 26.548  1.00 78.16  ? 382 TRP A C     1 
ATOM   2103 O  O     . TRP A 1  262 ? 38.688 -33.377 27.093  1.00 84.59  ? 382 TRP A O     1 
ATOM   2104 C  CB    . TRP A 1  262 ? 41.332 -35.079 27.827  1.00 69.58  ? 382 TRP A CB    1 
ATOM   2105 C  CG    . TRP A 1  262 ? 41.401 -33.831 28.650  1.00 71.34  ? 382 TRP A CG    1 
ATOM   2106 C  CD1   . TRP A 1  262 ? 41.228 -33.730 30.001  1.00 70.62  ? 382 TRP A CD1   1 
ATOM   2107 C  CD2   . TRP A 1  262 ? 41.661 -32.506 28.179  1.00 70.44  ? 382 TRP A CD2   1 
ATOM   2108 N  NE1   . TRP A 1  262 ? 41.365 -32.422 30.398  1.00 67.67  ? 382 TRP A NE1   1 
ATOM   2109 C  CE2   . TRP A 1  262 ? 41.633 -31.649 29.296  1.00 58.87  ? 382 TRP A CE2   1 
ATOM   2110 C  CE3   . TRP A 1  262 ? 41.918 -31.957 26.916  1.00 69.84  ? 382 TRP A CE3   1 
ATOM   2111 C  CZ2   . TRP A 1  262 ? 41.849 -30.278 29.194  1.00 59.71  ? 382 TRP A CZ2   1 
ATOM   2112 C  CZ3   . TRP A 1  262 ? 42.132 -30.596 26.816  1.00 67.04  ? 382 TRP A CZ3   1 
ATOM   2113 C  CH2   . TRP A 1  262 ? 42.097 -29.772 27.947  1.00 66.06  ? 382 TRP A CH2   1 
ATOM   2114 N  N     . ILE A 1  263 ? 39.581 -34.292 25.241  1.00 71.14  ? 383 ILE A N     1 
ATOM   2115 C  CA    . ILE A 1  263 ? 39.065 -33.260 24.350  1.00 69.67  ? 383 ILE A CA    1 
ATOM   2116 C  C     . ILE A 1  263 ? 37.552 -33.373 24.199  1.00 76.42  ? 383 ILE A C     1 
ATOM   2117 O  O     . ILE A 1  263 ? 36.829 -32.389 24.351  1.00 81.38  ? 383 ILE A O     1 
ATOM   2118 C  CB    . ILE A 1  263 ? 39.721 -33.338 22.954  1.00 72.96  ? 383 ILE A CB    1 
ATOM   2119 C  CG1   . ILE A 1  263 ? 41.176 -32.873 23.019  1.00 68.70  ? 383 ILE A CG1   1 
ATOM   2120 C  CG2   . ILE A 1  263 ? 38.958 -32.487 21.953  1.00 68.95  ? 383 ILE A CG2   1 
ATOM   2121 C  CD1   . ILE A 1  263 ? 41.329 -31.401 23.342  1.00 65.05  ? 383 ILE A CD1   1 
ATOM   2122 N  N     . THR A 1  264 ? 37.079 -34.582 23.917  1.00 76.97  ? 384 THR A N     1 
ATOM   2123 C  CA    . THR A 1  264 ? 35.665 -34.812 23.640  1.00 82.39  ? 384 THR A CA    1 
ATOM   2124 C  C     . THR A 1  264 ? 34.788 -34.726 24.887  1.00 89.21  ? 384 THR A C     1 
ATOM   2125 O  O     . THR A 1  264 ? 33.561 -34.765 24.790  1.00 97.91  ? 384 THR A O     1 
ATOM   2126 C  CB    . THR A 1  264 ? 35.447 -36.187 22.986  1.00 87.37  ? 384 THR A CB    1 
ATOM   2127 O  OG1   . THR A 1  264 ? 35.927 -37.215 23.861  1.00 89.65  ? 384 THR A OG1   1 
ATOM   2128 C  CG2   . THR A 1  264 ? 36.191 -36.269 21.661  1.00 83.50  ? 384 THR A CG2   1 
ATOM   2129 N  N     . ALA A 1  265 ? 35.412 -34.612 26.055  1.00 86.63  ? 385 ALA A N     1 
ATOM   2130 C  CA    . ALA A 1  265 ? 34.666 -34.563 27.307  1.00 86.17  ? 385 ALA A CA    1 
ATOM   2131 C  C     . ALA A 1  265 ? 34.584 -33.147 27.868  1.00 90.59  ? 385 ALA A C     1 
ATOM   2132 O  O     . ALA A 1  265 ? 33.861 -32.897 28.829  1.00 83.64  ? 385 ALA A O     1 
ATOM   2133 C  CB    . ALA A 1  265 ? 35.291 -35.498 28.333  1.00 79.37  ? 385 ALA A CB    1 
ATOM   2134 N  N     . ASN A 1  266 ? 35.322 -32.220 27.266  1.00 93.01  ? 386 ASN A N     1 
ATOM   2135 C  CA    . ASN A 1  266 ? 35.351 -30.849 27.764  1.00 82.84  ? 386 ASN A CA    1 
ATOM   2136 C  C     . ASN A 1  266 ? 35.008 -29.817 26.695  1.00 84.58  ? 386 ASN A C     1 
ATOM   2137 O  O     . ASN A 1  266 ? 34.660 -28.680 27.013  1.00 84.60  ? 386 ASN A O     1 
ATOM   2138 C  CB    . ASN A 1  266 ? 36.723 -30.536 28.363  1.00 70.06  ? 386 ASN A CB    1 
ATOM   2139 C  CG    . ASN A 1  266 ? 37.048 -31.407 29.561  1.00 81.49  ? 386 ASN A CG    1 
ATOM   2140 O  OD1   . ASN A 1  266 ? 36.768 -31.041 30.702  1.00 87.51  ? 386 ASN A OD1   1 
ATOM   2141 N  ND2   . ASN A 1  266 ? 37.641 -32.568 29.307  1.00 79.15  ? 386 ASN A ND2   1 
ATOM   2142 N  N     . SER A 1  267 ? 35.102 -30.216 25.431  1.00 82.66  ? 387 SER A N     1 
ATOM   2143 C  CA    . SER A 1  267 ? 34.840 -29.300 24.327  1.00 74.65  ? 387 SER A CA    1 
ATOM   2144 C  C     . SER A 1  267 ? 33.358 -28.967 24.203  1.00 76.88  ? 387 SER A C     1 
ATOM   2145 O  O     . SER A 1  267 ? 32.497 -29.810 24.452  1.00 78.95  ? 387 SER A O     1 
ATOM   2146 C  CB    . SER A 1  267 ? 35.348 -29.888 23.009  1.00 76.07  ? 387 SER A CB    1 
ATOM   2147 O  OG    . SER A 1  267 ? 35.059 -29.025 21.925  1.00 76.38  ? 387 SER A OG    1 
ATOM   2148 N  N     . SER A 1  268 ? 33.071 -27.729 23.813  1.00 88.34  ? 388 SER A N     1 
ATOM   2149 C  CA    . SER A 1  268 ? 31.699 -27.285 23.599  1.00 90.91  ? 388 SER A CA    1 
ATOM   2150 C  C     . SER A 1  268 ? 31.342 -27.331 22.118  1.00 97.78  ? 388 SER A C     1 
ATOM   2151 O  O     . SER A 1  268 ? 30.210 -27.039 21.733  1.00 110.83 ? 388 SER A O     1 
ATOM   2152 C  CB    . SER A 1  268 ? 31.499 -25.871 24.147  1.00 89.88  ? 388 SER A CB    1 
ATOM   2153 O  OG    . SER A 1  268 ? 31.771 -25.819 25.536  1.00 92.99  ? 388 SER A OG    1 
ATOM   2154 N  N     . LYS A 1  269 ? 32.318 -27.695 21.292  1.00 90.93  ? 389 LYS A N     1 
ATOM   2155 C  CA    . LYS A 1  269 ? 32.117 -27.779 19.849  1.00 96.87  ? 389 LYS A CA    1 
ATOM   2156 C  C     . LYS A 1  269 ? 32.669 -29.089 19.291  1.00 98.20  ? 389 LYS A C     1 
ATOM   2157 O  O     . LYS A 1  269 ? 33.735 -29.544 19.706  1.00 91.44  ? 389 LYS A O     1 
ATOM   2158 C  CB    . LYS A 1  269 ? 32.770 -26.586 19.146  1.00 94.21  ? 389 LYS A CB    1 
ATOM   2159 C  CG    . LYS A 1  269 ? 32.156 -25.243 19.508  1.00 100.33 ? 389 LYS A CG    1 
ATOM   2160 C  CD    . LYS A 1  269 ? 32.817 -24.107 18.748  1.00 94.60  ? 389 LYS A CD    1 
ATOM   2161 N  N     . PRO A 1  270 ? 31.941 -29.699 18.343  1.00 102.79 ? 390 PRO A N     1 
ATOM   2162 C  CA    . PRO A 1  270 ? 32.332 -30.983 17.752  1.00 104.46 ? 390 PRO A CA    1 
ATOM   2163 C  C     . PRO A 1  270 ? 33.474 -30.856 16.749  1.00 111.85 ? 390 PRO A C     1 
ATOM   2164 O  O     . PRO A 1  270 ? 34.036 -29.774 16.579  1.00 112.88 ? 390 PRO A O     1 
ATOM   2165 C  CB    . PRO A 1  270 ? 31.052 -31.443 17.054  1.00 108.56 ? 390 PRO A CB    1 
ATOM   2166 C  CG    . PRO A 1  270 ? 30.378 -30.173 16.672  1.00 113.10 ? 390 PRO A CG    1 
ATOM   2167 C  CD    . PRO A 1  270 ? 30.666 -29.206 17.791  1.00 107.65 ? 390 PRO A CD    1 
ATOM   2168 N  N     . SER A 1  271 ? 33.805 -31.962 16.092  1.00 118.38 ? 391 SER A N     1 
ATOM   2169 C  CA    . SER A 1  271 ? 34.865 -31.977 15.092  1.00 113.36 ? 391 SER A CA    1 
ATOM   2170 C  C     . SER A 1  271 ? 34.359 -31.457 13.750  1.00 120.08 ? 391 SER A C     1 
ATOM   2171 O  O     . SER A 1  271 ? 33.222 -30.997 13.641  1.00 117.30 ? 391 SER A O     1 
ATOM   2172 C  CB    . SER A 1  271 ? 35.428 -33.390 14.935  1.00 112.51 ? 391 SER A CB    1 
ATOM   2173 O  OG    . SER A 1  271 ? 35.884 -33.896 16.178  1.00 109.38 ? 391 SER A OG    1 
ATOM   2174 N  N     . ASN A 1  272 ? 35.210 -31.533 12.731  1.00 123.46 ? 392 ASN A N     1 
ATOM   2175 C  CA    . ASN A 1  272 ? 34.861 -31.050 11.399  1.00 127.34 ? 392 ASN A CA    1 
ATOM   2176 C  C     . ASN A 1  272 ? 33.714 -31.837 10.771  1.00 134.63 ? 392 ASN A C     1 
ATOM   2177 O  O     . ASN A 1  272 ? 32.796 -31.258 10.190  1.00 141.63 ? 392 ASN A O     1 
ATOM   2178 C  CB    . ASN A 1  272 ? 36.086 -31.097 10.483  1.00 129.58 ? 392 ASN A CB    1 
ATOM   2179 C  CG    . ASN A 1  272 ? 36.801 -32.434 10.531  1.00 133.52 ? 392 ASN A CG    1 
ATOM   2180 O  OD1   . ASN A 1  272 ? 36.245 -33.435 10.985  1.00 139.84 ? 392 ASN A OD1   1 
ATOM   2181 N  ND2   . ASN A 1  272 ? 38.043 -32.457 10.061  1.00 127.61 ? 392 ASN A ND2   1 
ATOM   2182 N  N     . SER B 2  1   ? 57.948 -11.324 -10.440 1.00 119.02 ? 6   SER D N     1 
ATOM   2183 C  CA    . SER B 2  1   ? 58.253 -9.950  -10.058 1.00 118.38 ? 6   SER D CA    1 
ATOM   2184 C  C     . SER B 2  1   ? 57.822 -9.672  -8.622  1.00 108.42 ? 6   SER D C     1 
ATOM   2185 O  O     . SER B 2  1   ? 56.967 -10.366 -8.073  1.00 89.43  ? 6   SER D O     1 
ATOM   2186 C  CB    . SER B 2  1   ? 57.578 -8.964  -11.013 1.00 132.06 ? 6   SER D CB    1 
ATOM   2187 O  OG    . SER B 2  1   ? 56.306 -9.437  -11.421 1.00 134.22 ? 6   SER D OG    1 
ATOM   2188 N  N     . SER B 2  2   ? 58.419 -8.647  -8.022  1.00 111.95 ? 7   SER D N     1 
ATOM   2189 C  CA    . SER B 2  2   ? 58.167 -8.319  -6.625  1.00 109.05 ? 7   SER D CA    1 
ATOM   2190 C  C     . SER B 2  2   ? 56.770 -7.747  -6.405  1.00 102.38 ? 7   SER D C     1 
ATOM   2191 O  O     . SER B 2  2   ? 56.276 -6.957  -7.210  1.00 119.38 ? 7   SER D O     1 
ATOM   2192 C  CB    . SER B 2  2   ? 59.218 -7.329  -6.117  1.00 114.85 ? 7   SER D CB    1 
ATOM   2193 O  OG    . SER B 2  2   ? 60.516 -7.894  -6.165  1.00 114.19 ? 7   SER D OG    1 
ATOM   2194 N  N     . TYR B 2  3   ? 56.143 -8.175  -5.311  1.00 93.87  ? 8   TYR D N     1 
ATOM   2195 C  CA    . TYR B 2  3   ? 54.843 -7.666  -4.867  1.00 82.63  ? 8   TYR D CA    1 
ATOM   2196 C  C     . TYR B 2  3   ? 53.713 -7.910  -5.868  1.00 89.60  ? 8   TYR D C     1 
ATOM   2197 O  O     . TYR B 2  3   ? 52.623 -7.356  -5.727  1.00 88.83  ? 8   TYR D O     1 
ATOM   2198 C  CB    . TYR B 2  3   ? 54.945 -6.173  -4.545  1.00 82.70  ? 8   TYR D CB    1 
ATOM   2199 C  CG    . TYR B 2  3   ? 56.047 -5.847  -3.562  1.00 73.06  ? 8   TYR D CG    1 
ATOM   2200 C  CD1   . TYR B 2  3   ? 55.965 -6.257  -2.237  1.00 78.18  ? 8   TYR D CD1   1 
ATOM   2201 C  CD2   . TYR B 2  3   ? 57.171 -5.135  -3.959  1.00 85.10  ? 8   TYR D CD2   1 
ATOM   2202 C  CE1   . TYR B 2  3   ? 56.971 -5.965  -1.334  1.00 77.98  ? 8   TYR D CE1   1 
ATOM   2203 C  CE2   . TYR B 2  3   ? 58.182 -4.837  -3.064  1.00 83.09  ? 8   TYR D CE2   1 
ATOM   2204 C  CZ    . TYR B 2  3   ? 58.076 -5.255  -1.754  1.00 93.05  ? 8   TYR D CZ    1 
ATOM   2205 O  OH    . TYR B 2  3   ? 59.079 -4.962  -0.859  1.00 102.90 ? 8   TYR D OH    1 
ATOM   2206 N  N     . SER B 2  4   ? 53.976 -8.743  -6.870  1.00 91.54  ? 9   SER D N     1 
ATOM   2207 C  CA    . SER B 2  4   ? 52.944 -9.171  -7.805  1.00 81.89  ? 9   SER D CA    1 
ATOM   2208 C  C     . SER B 2  4   ? 52.528 -10.600 -7.477  1.00 76.65  ? 9   SER D C     1 
ATOM   2209 O  O     . SER B 2  4   ? 53.106 -11.560 -7.987  1.00 79.03  ? 9   SER D O     1 
ATOM   2210 C  CB    . SER B 2  4   ? 53.439 -9.071  -9.249  1.00 91.55  ? 9   SER D CB    1 
ATOM   2211 O  OG    . SER B 2  4   ? 52.435 -9.486  -10.156 1.00 95.36  ? 9   SER D OG    1 
ATOM   2212 N  N     . TYR B 2  5   ? 51.524 -10.733 -6.615  1.00 69.89  ? 10  TYR D N     1 
ATOM   2213 C  CA    . TYR B 2  5   ? 51.155 -12.032 -6.063  1.00 71.65  ? 10  TYR D CA    1 
ATOM   2214 C  C     . TYR B 2  5   ? 49.966 -12.665 -6.778  1.00 69.64  ? 10  TYR D C     1 
ATOM   2215 O  O     . TYR B 2  5   ? 49.123 -11.969 -7.340  1.00 75.39  ? 10  TYR D O     1 
ATOM   2216 C  CB    . TYR B 2  5   ? 50.839 -11.897 -4.570  1.00 60.40  ? 10  TYR D CB    1 
ATOM   2217 C  CG    . TYR B 2  5   ? 51.956 -11.285 -3.754  1.00 64.15  ? 10  TYR D CG    1 
ATOM   2218 C  CD1   . TYR B 2  5   ? 53.287 -11.475 -4.106  1.00 60.27  ? 10  TYR D CD1   1 
ATOM   2219 C  CD2   . TYR B 2  5   ? 51.679 -10.518 -2.629  1.00 64.58  ? 10  TYR D CD2   1 
ATOM   2220 C  CE1   . TYR B 2  5   ? 54.310 -10.915 -3.360  1.00 78.14  ? 10  TYR D CE1   1 
ATOM   2221 C  CE2   . TYR B 2  5   ? 52.694 -9.956  -1.877  1.00 56.44  ? 10  TYR D CE2   1 
ATOM   2222 C  CZ    . TYR B 2  5   ? 54.007 -10.158 -2.246  1.00 67.27  ? 10  TYR D CZ    1 
ATOM   2223 O  OH    . TYR B 2  5   ? 55.021 -9.601  -1.502  1.00 76.69  ? 10  TYR D OH    1 
ATOM   2224 N  N     . ASP B 2  6   ? 49.907 -13.993 -6.747  1.00 83.47  ? 11  ASP D N     1 
ATOM   2225 C  CA    . ASP B 2  6   ? 48.753 -14.722 -7.258  1.00 84.64  ? 11  ASP D CA    1 
ATOM   2226 C  C     . ASP B 2  6   ? 47.636 -14.684 -6.218  1.00 85.65  ? 11  ASP D C     1 
ATOM   2227 O  O     . ASP B 2  6   ? 47.404 -15.657 -5.499  1.00 81.89  ? 11  ASP D O     1 
ATOM   2228 C  CB    . ASP B 2  6   ? 49.136 -16.163 -7.605  1.00 86.44  ? 11  ASP D CB    1 
ATOM   2229 C  CG    . ASP B 2  6   ? 48.001 -16.931 -8.260  1.00 94.91  ? 11  ASP D CG    1 
ATOM   2230 O  OD1   . ASP B 2  6   ? 46.992 -16.302 -8.642  1.00 88.66  ? 11  ASP D OD1   1 
ATOM   2231 O  OD2   . ASP B 2  6   ? 48.129 -18.165 -8.415  1.00 89.80  ? 11  ASP D OD2   1 
ATOM   2232 N  N     . ALA B 2  7   ? 46.950 -13.549 -6.143  1.00 85.66  ? 12  ALA D N     1 
ATOM   2233 C  CA    . ALA B 2  7   ? 45.950 -13.319 -5.107  1.00 82.84  ? 12  ALA D CA    1 
ATOM   2234 C  C     . ALA B 2  7   ? 44.990 -12.207 -5.521  1.00 85.81  ? 12  ALA D C     1 
ATOM   2235 O  O     . ALA B 2  7   ? 45.347 -11.362 -6.341  1.00 84.46  ? 12  ALA D O     1 
ATOM   2236 C  CB    . ALA B 2  7   ? 46.633 -12.975 -3.787  1.00 77.67  ? 12  ALA D CB    1 
ATOM   2237 N  N     . PRO B 2  8   ? 43.767 -12.208 -4.958  1.00 92.65  ? 13  PRO D N     1 
ATOM   2238 C  CA    . PRO B 2  8   ? 42.793 -11.151 -5.257  1.00 87.44  ? 13  PRO D CA    1 
ATOM   2239 C  C     . PRO B 2  8   ? 43.355 -9.756  -4.996  1.00 91.64  ? 13  PRO D C     1 
ATOM   2240 O  O     . PRO B 2  8   ? 43.939 -9.516  -3.935  1.00 77.80  ? 13  PRO D O     1 
ATOM   2241 C  CB    . PRO B 2  8   ? 41.639 -11.454 -4.295  1.00 97.79  ? 13  PRO D CB    1 
ATOM   2242 C  CG    . PRO B 2  8   ? 41.743 -12.912 -4.031  1.00 91.15  ? 13  PRO D CG    1 
ATOM   2243 C  CD    . PRO B 2  8   ? 43.212 -13.223 -4.042  1.00 87.04  ? 13  PRO D CD    1 
ATOM   2244 N  N     . SER B 2  9   ? 43.186 -8.854  -5.958  1.00 81.06  ? 14  SER D N     1 
ATOM   2245 C  CA    . SER B 2  9   ? 43.671 -7.487  -5.814  1.00 88.03  ? 14  SER D CA    1 
ATOM   2246 C  C     . SER B 2  9   ? 42.667 -6.480  -6.367  1.00 86.85  ? 14  SER D C     1 
ATOM   2247 O  O     . SER B 2  9   ? 42.951 -5.285  -6.440  1.00 91.53  ? 14  SER D O     1 
ATOM   2248 C  CB    . SER B 2  9   ? 45.022 -7.321  -6.512  1.00 106.94 ? 14  SER D CB    1 
ATOM   2249 O  OG    . SER B 2  9   ? 45.513 -6.001  -6.364  1.00 114.46 ? 14  SER D OG    1 
ATOM   2250 N  N     . ASP B 2  10  ? 41.492 -6.969  -6.748  1.00 83.27  ? 15  ASP D N     1 
ATOM   2251 C  CA    . ASP B 2  10  ? 40.460 -6.118  -7.333  1.00 92.10  ? 15  ASP D CA    1 
ATOM   2252 C  C     . ASP B 2  10  ? 39.482 -5.618  -6.276  1.00 91.10  ? 15  ASP D C     1 
ATOM   2253 O  O     . ASP B 2  10  ? 39.335 -6.227  -5.220  1.00 83.21  ? 15  ASP D O     1 
ATOM   2254 C  CB    . ASP B 2  10  ? 39.696 -6.870  -8.425  1.00 87.80  ? 15  ASP D CB    1 
ATOM   2255 C  CG    . ASP B 2  10  ? 40.600 -7.358  -9.543  1.00 105.48 ? 15  ASP D CG    1 
ATOM   2256 O  OD1   . ASP B 2  10  ? 41.609 -6.682  -9.835  1.00 102.17 ? 15  ASP D OD1   1 
ATOM   2257 O  OD2   . ASP B 2  10  ? 40.296 -8.416  -10.133 1.00 100.99 ? 15  ASP D OD2   1 
ATOM   2258 N  N     . PHE B 2  11  ? 38.808 -4.511  -6.576  1.00 90.40  ? 16  PHE D N     1 
ATOM   2259 C  CA    . PHE B 2  11  ? 37.828 -3.934  -5.665  1.00 88.88  ? 16  PHE D CA    1 
ATOM   2260 C  C     . PHE B 2  11  ? 36.630 -4.860  -5.483  1.00 96.26  ? 16  PHE D C     1 
ATOM   2261 O  O     . PHE B 2  11  ? 36.046 -5.336  -6.456  1.00 89.55  ? 16  PHE D O     1 
ATOM   2262 C  CB    . PHE B 2  11  ? 37.363 -2.567  -6.175  1.00 90.93  ? 16  PHE D CB    1 
ATOM   2263 C  CG    . PHE B 2  11  ? 36.389 -1.878  -5.262  1.00 96.86  ? 16  PHE D CG    1 
ATOM   2264 C  CD1   . PHE B 2  11  ? 36.840 -1.134  -4.183  1.00 100.49 ? 16  PHE D CD1   1 
ATOM   2265 C  CD2   . PHE B 2  11  ? 35.025 -1.971  -5.482  1.00 90.44  ? 16  PHE D CD2   1 
ATOM   2266 C  CE1   . PHE B 2  11  ? 35.948 -0.499  -3.339  1.00 96.24  ? 16  PHE D CE1   1 
ATOM   2267 C  CE2   . PHE B 2  11  ? 34.129 -1.338  -4.642  1.00 93.71  ? 16  PHE D CE2   1 
ATOM   2268 C  CZ    . PHE B 2  11  ? 34.591 -0.601  -3.570  1.00 99.82  ? 16  PHE D CZ    1 
ATOM   2269 N  N     . ILE B 2  12  ? 36.270 -5.112  -4.229  1.00 98.72  ? 17  ILE D N     1 
ATOM   2270 C  CA    . ILE B 2  12  ? 35.139 -5.975  -3.912  1.00 96.58  ? 17  ILE D CA    1 
ATOM   2271 C  C     . ILE B 2  12  ? 33.973 -5.161  -3.363  1.00 91.98  ? 17  ILE D C     1 
ATOM   2272 O  O     . ILE B 2  12  ? 34.155 -4.309  -2.495  1.00 106.54 ? 17  ILE D O     1 
ATOM   2273 C  CB    . ILE B 2  12  ? 35.525 -7.060  -2.885  1.00 98.84  ? 17  ILE D CB    1 
ATOM   2274 C  CG1   . ILE B 2  12  ? 36.774 -7.814  -3.345  1.00 99.48  ? 17  ILE D CG1   1 
ATOM   2275 C  CG2   . ILE B 2  12  ? 34.367 -8.022  -2.658  1.00 99.39  ? 17  ILE D CG2   1 
ATOM   2276 C  CD1   . ILE B 2  12  ? 37.280 -8.823  -2.337  1.00 98.07  ? 17  ILE D CD1   1 
ATOM   2277 N  N     . ASN B 2  13  ? 32.776 -5.421  -3.877  1.00 93.24  ? 18  ASN D N     1 
ATOM   2278 C  CA    . ASN B 2  13  ? 31.578 -4.764  -3.377  1.00 97.86  ? 18  ASN D CA    1 
ATOM   2279 C  C     . ASN B 2  13  ? 31.000 -5.544  -2.202  1.00 105.08 ? 18  ASN D C     1 
ATOM   2280 O  O     . ASN B 2  13  ? 30.266 -6.514  -2.389  1.00 102.94 ? 18  ASN D O     1 
ATOM   2281 C  CB    . ASN B 2  13  ? 30.540 -4.619  -4.491  1.00 103.80 ? 18  ASN D CB    1 
ATOM   2282 C  CG    . ASN B 2  13  ? 29.485 -3.581  -4.171  1.00 108.19 ? 18  ASN D CG    1 
ATOM   2283 O  OD1   . ASN B 2  13  ? 29.662 -2.756  -3.274  1.00 113.42 ? 18  ASN D OD1   1 
ATOM   2284 N  ND2   . ASN B 2  13  ? 28.380 -3.612  -4.907  1.00 106.10 ? 18  ASN D ND2   1 
ATOM   2285 N  N     . PHE B 2  14  ? 31.337 -5.113  -0.989  1.00 102.82 ? 19  PHE D N     1 
ATOM   2286 C  CA    . PHE B 2  14  ? 30.990 -5.857  0.221   1.00 104.09 ? 19  PHE D CA    1 
ATOM   2287 C  C     . PHE B 2  14  ? 29.498 -5.847  0.545   1.00 113.36 ? 19  PHE D C     1 
ATOM   2288 O  O     . PHE B 2  14  ? 29.057 -6.536  1.463   1.00 113.44 ? 19  PHE D O     1 
ATOM   2289 C  CB    . PHE B 2  14  ? 31.772 -5.312  1.421   1.00 97.75  ? 19  PHE D CB    1 
ATOM   2290 C  CG    . PHE B 2  14  ? 33.231 -5.670  1.408   1.00 92.79  ? 19  PHE D CG    1 
ATOM   2291 C  CD1   . PHE B 2  14  ? 33.637 -6.973  1.639   1.00 89.15  ? 19  PHE D CD1   1 
ATOM   2292 C  CD2   . PHE B 2  14  ? 34.196 -4.703  1.178   1.00 92.67  ? 19  PHE D CD2   1 
ATOM   2293 C  CE1   . PHE B 2  14  ? 34.979 -7.309  1.632   1.00 85.75  ? 19  PHE D CE1   1 
ATOM   2294 C  CE2   . PHE B 2  14  ? 35.540 -5.033  1.171   1.00 84.51  ? 19  PHE D CE2   1 
ATOM   2295 C  CZ    . PHE B 2  14  ? 35.931 -6.337  1.399   1.00 83.68  ? 19  PHE D CZ    1 
ATOM   2296 N  N     . SER B 2  15  ? 28.724 -5.068  -0.200  1.00 125.03 ? 20  SER D N     1 
ATOM   2297 C  CA    . SER B 2  15  ? 27.286 -5.010  0.015   1.00 136.04 ? 20  SER D CA    1 
ATOM   2298 C  C     . SER B 2  15  ? 26.592 -6.179  -0.677  1.00 145.54 ? 20  SER D C     1 
ATOM   2299 O  O     . SER B 2  15  ? 25.555 -6.659  -0.217  1.00 152.97 ? 20  SER D O     1 
ATOM   2300 C  CB    . SER B 2  15  ? 26.720 -3.682  -0.488  1.00 138.25 ? 20  SER D CB    1 
ATOM   2301 O  OG    . SER B 2  15  ? 25.522 -3.347  0.190   1.00 146.70 ? 20  SER D OG    1 
ATOM   2302 N  N     . SER B 2  16  ? 27.179 -6.634  -1.780  1.00 144.35 ? 21  SER D N     1 
ATOM   2303 C  CA    . SER B 2  16  ? 26.600 -7.715  -2.570  1.00 148.94 ? 21  SER D CA    1 
ATOM   2304 C  C     . SER B 2  16  ? 26.722 -9.066  -1.869  1.00 150.13 ? 21  SER D C     1 
ATOM   2305 O  O     . SER B 2  16  ? 25.729 -9.629  -1.409  1.00 151.25 ? 21  SER D O     1 
ATOM   2306 C  CB    . SER B 2  16  ? 27.265 -7.782  -3.946  1.00 150.19 ? 21  SER D CB    1 
ATOM   2307 O  OG    . SER B 2  16  ? 28.657 -8.017  -3.828  1.00 148.48 ? 21  SER D OG    1 
ATOM   2308 N  N     . LEU B 2  17  ? 27.945 -9.582  -1.792  1.00 149.85 ? 22  LEU D N     1 
ATOM   2309 C  CA    . LEU B 2  17  ? 28.183 -10.903 -1.221  1.00 149.29 ? 22  LEU D CA    1 
ATOM   2310 C  C     . LEU B 2  17  ? 29.047 -10.817 0.034   1.00 140.66 ? 22  LEU D C     1 
ATOM   2311 O  O     . LEU B 2  17  ? 28.919 -11.636 0.945   1.00 138.79 ? 22  LEU D O     1 
ATOM   2312 C  CB    . LEU B 2  17  ? 28.839 -11.817 -2.262  1.00 149.29 ? 22  LEU D CB    1 
ATOM   2313 C  CG    . LEU B 2  17  ? 28.907 -13.323 -1.990  1.00 149.50 ? 22  LEU D CG    1 
ATOM   2314 C  CD1   . LEU B 2  17  ? 28.756 -14.094 -3.291  1.00 150.62 ? 22  LEU D CD1   1 
ATOM   2315 C  CD2   . LEU B 2  17  ? 30.210 -13.703 -1.301  1.00 144.40 ? 22  LEU D CD2   1 
ATOM   2316 N  N     . THR B 2  23  ? 33.256 -20.210 -2.833  1.00 104.04 ? 28  THR D N     1 
ATOM   2317 C  CA    . THR B 2  23  ? 32.996 -21.632 -2.685  1.00 112.61 ? 28  THR D CA    1 
ATOM   2318 C  C     . THR B 2  23  ? 34.165 -22.335 -1.999  1.00 112.55 ? 28  THR D C     1 
ATOM   2319 O  O     . THR B 2  23  ? 35.136 -21.700 -1.570  1.00 112.94 ? 28  THR D O     1 
ATOM   2320 C  CB    . THR B 2  23  ? 32.703 -22.290 -4.054  1.00 114.38 ? 28  THR D CB    1 
ATOM   2321 O  OG1   . THR B 2  23  ? 33.789 -22.040 -4.954  1.00 105.95 ? 28  THR D OG1   1 
ATOM   2322 C  CG2   . THR B 2  23  ? 31.422 -21.710 -4.651  1.00 118.64 ? 28  THR D CG2   1 
ATOM   2323 N  N     . GLN B 2  24  ? 34.046 -23.652 -1.886  1.00 114.77 ? 29  GLN D N     1 
ATOM   2324 C  CA    . GLN B 2  24  ? 35.021 -24.473 -1.186  1.00 112.20 ? 29  GLN D CA    1 
ATOM   2325 C  C     . GLN B 2  24  ? 36.040 -25.005 -2.197  1.00 116.55 ? 29  GLN D C     1 
ATOM   2326 O  O     . GLN B 2  24  ? 37.019 -25.639 -1.804  1.00 117.61 ? 29  GLN D O     1 
ATOM   2327 C  CB    . GLN B 2  24  ? 34.294 -25.606 -0.432  1.00 111.19 ? 29  GLN D CB    1 
ATOM   2328 C  CG    . GLN B 2  24  ? 35.111 -26.359 0.615   1.00 108.57 ? 29  GLN D CG    1 
ATOM   2329 C  CD    . GLN B 2  24  ? 35.466 -25.503 1.811   1.00 106.01 ? 29  GLN D CD    1 
ATOM   2330 O  OE1   . GLN B 2  24  ? 34.677 -24.666 2.249   1.00 102.47 ? 29  GLN D OE1   1 
ATOM   2331 N  NE2   . GLN B 2  24  ? 36.670 -25.695 2.336   1.00 99.23  ? 29  GLN D NE2   1 
ATOM   2332 N  N     . ASN B 2  25  ? 35.821 -24.715 -3.490  1.00 103.83 ? 30  ASN D N     1 
ATOM   2333 C  CA    . ASN B 2  25  ? 36.682 -25.268 -4.540  1.00 104.25 ? 30  ASN D CA    1 
ATOM   2334 C  C     . ASN B 2  25  ? 37.947 -24.452 -4.591  1.00 116.92 ? 30  ASN D C     1 
ATOM   2335 O  O     . ASN B 2  25  ? 38.988 -24.955 -4.997  1.00 102.92 ? 30  ASN D O     1 
ATOM   2336 C  CB    . ASN B 2  25  ? 36.105 -25.211 -5.953  1.00 110.26 ? 30  ASN D CB    1 
ATOM   2337 C  CG    . ASN B 2  25  ? 36.831 -26.169 -6.909  1.00 109.18 ? 30  ASN D CG    1 
ATOM   2338 O  OD1   . ASN B 2  25  ? 38.021 -26.426 -6.804  1.00 116.40 ? 30  ASN D OD1   1 
ATOM   2339 N  ND2   . ASN B 2  25  ? 36.175 -26.470 -7.969  1.00 125.14 ? 30  ASN D ND2   1 
ATOM   2340 N  N     . ILE B 2  26  ? 37.871 -23.187 -4.191  1.00 105.72 ? 31  ILE D N     1 
ATOM   2341 C  CA    . ILE B 2  26  ? 39.000 -22.296 -4.440  1.00 101.53 ? 31  ILE D CA    1 
ATOM   2342 C  C     . ILE B 2  26  ? 40.271 -22.870 -3.789  1.00 83.38  ? 31  ILE D C     1 
ATOM   2343 O  O     . ILE B 2  26  ? 41.409 -22.554 -4.169  1.00 84.52  ? 31  ILE D O     1 
ATOM   2344 C  CB    . ILE B 2  26  ? 38.721 -20.884 -3.936  1.00 101.30 ? 31  ILE D CB    1 
ATOM   2345 C  CG1   . ILE B 2  26  ? 39.753 -19.894 -4.493  1.00 102.92 ? 31  ILE D CG1   1 
ATOM   2346 C  CG2   . ILE B 2  26  ? 38.648 -20.888 -2.432  1.00 103.58 ? 31  ILE D CG2   1 
ATOM   2347 C  CD1   . ILE B 2  26  ? 39.632 -18.559 -3.887  1.00 109.64 ? 31  ILE D CD1   1 
ATOM   2348 N  N     . ASP B 2  27  ? 40.035 -23.787 -2.856  1.00 92.22  ? 32  ASP D N     1 
ATOM   2349 C  CA    . ASP B 2  27  ? 41.055 -24.653 -2.285  1.00 95.40  ? 32  ASP D CA    1 
ATOM   2350 C  C     . ASP B 2  27  ? 41.837 -25.444 -3.334  1.00 75.55  ? 32  ASP D C     1 
ATOM   2351 O  O     . ASP B 2  27  ? 42.967 -25.850 -3.078  1.00 72.85  ? 32  ASP D O     1 
ATOM   2352 C  CB    . ASP B 2  27  ? 40.407 -25.636 -1.311  1.00 103.70 ? 32  ASP D CB    1 
ATOM   2353 C  CG    . ASP B 2  27  ? 39.597 -24.948 -0.243  1.00 110.09 ? 32  ASP D CG    1 
ATOM   2354 O  OD1   . ASP B 2  27  ? 39.493 -23.705 -0.283  1.00 127.01 ? 32  ASP D OD1   1 
ATOM   2355 O  OD2   . ASP B 2  27  ? 39.046 -25.651 0.629   1.00 116.26 ? 32  ASP D OD2   1 
ATOM   2356 N  N     . SER B 2  28  ? 41.239 -25.673 -4.504  1.00 77.40  ? 33  SER D N     1 
ATOM   2357 C  CA    . SER B 2  28  ? 41.898 -26.460 -5.552  1.00 76.02  ? 33  SER D CA    1 
ATOM   2358 C  C     . SER B 2  28  ? 43.153 -25.787 -6.076  1.00 71.11  ? 33  SER D C     1 
ATOM   2359 O  O     . SER B 2  28  ? 43.956 -26.418 -6.760  1.00 69.23  ? 33  SER D O     1 
ATOM   2360 C  CB    . SER B 2  28  ? 40.957 -26.726 -6.725  1.00 85.01  ? 33  SER D CB    1 
ATOM   2361 O  OG    . SER B 2  28  ? 39.822 -27.468 -6.317  1.00 85.50  ? 33  SER D OG    1 
ATOM   2362 N  N     . TRP B 2  29  ? 43.311 -24.506 -5.764  1.00 73.98  ? 34  TRP D N     1 
ATOM   2363 C  CA    . TRP B 2  29  ? 44.507 -23.768 -6.143  1.00 73.46  ? 34  TRP D CA    1 
ATOM   2364 C  C     . TRP B 2  29  ? 45.760 -24.453 -5.607  1.00 70.38  ? 34  TRP D C     1 
ATOM   2365 O  O     . TRP B 2  29  ? 46.807 -24.451 -6.259  1.00 61.90  ? 34  TRP D O     1 
ATOM   2366 C  CB    . TRP B 2  29  ? 44.424 -22.329 -5.635  1.00 65.72  ? 34  TRP D CB    1 
ATOM   2367 C  CG    . TRP B 2  29  ? 45.633 -21.502 -5.941  1.00 71.99  ? 34  TRP D CG    1 
ATOM   2368 C  CD1   . TRP B 2  29  ? 45.929 -20.885 -7.124  1.00 66.17  ? 34  TRP D CD1   1 
ATOM   2369 C  CD2   . TRP B 2  29  ? 46.705 -21.187 -5.045  1.00 61.27  ? 34  TRP D CD2   1 
ATOM   2370 N  NE1   . TRP B 2  29  ? 47.123 -20.213 -7.020  1.00 68.35  ? 34  TRP D NE1   1 
ATOM   2371 C  CE2   . TRP B 2  29  ? 47.618 -20.381 -5.753  1.00 70.20  ? 34  TRP D CE2   1 
ATOM   2372 C  CE3   . TRP B 2  29  ? 46.983 -21.512 -3.713  1.00 68.63  ? 34  TRP D CE3   1 
ATOM   2373 C  CZ2   . TRP B 2  29  ? 48.789 -19.895 -5.174  1.00 62.25  ? 34  TRP D CZ2   1 
ATOM   2374 C  CZ3   . TRP B 2  29  ? 48.147 -21.029 -3.139  1.00 60.38  ? 34  TRP D CZ3   1 
ATOM   2375 C  CH2   . TRP B 2  29  ? 49.035 -20.229 -3.868  1.00 74.96  ? 34  TRP D CH2   1 
ATOM   2376 N  N     . PHE B 2  30  ? 45.647 -25.052 -4.425  1.00 64.32  ? 35  PHE D N     1 
ATOM   2377 C  CA    . PHE B 2  30  ? 46.781 -25.738 -3.813  1.00 64.94  ? 35  PHE D CA    1 
ATOM   2378 C  C     . PHE B 2  30  ? 47.176 -26.987 -4.602  1.00 62.48  ? 35  PHE D C     1 
ATOM   2379 O  O     . PHE B 2  30  ? 48.353 -27.204 -4.880  1.00 60.11  ? 35  PHE D O     1 
ATOM   2380 C  CB    . PHE B 2  30  ? 46.467 -26.103 -2.360  1.00 65.54  ? 35  PHE D CB    1 
ATOM   2381 C  CG    . PHE B 2  30  ? 46.298 -24.907 -1.465  1.00 67.19  ? 35  PHE D CG    1 
ATOM   2382 C  CD1   . PHE B 2  30  ? 47.402 -24.277 -0.914  1.00 64.58  ? 35  PHE D CD1   1 
ATOM   2383 C  CD2   . PHE B 2  30  ? 45.039 -24.400 -1.195  1.00 68.16  ? 35  PHE D CD2   1 
ATOM   2384 C  CE1   . PHE B 2  30  ? 47.251 -23.170 -0.107  1.00 65.42  ? 35  PHE D CE1   1 
ATOM   2385 C  CE2   . PHE B 2  30  ? 44.883 -23.293 -0.387  1.00 68.58  ? 35  PHE D CE2   1 
ATOM   2386 C  CZ    . PHE B 2  30  ? 45.991 -22.678 0.157   1.00 67.18  ? 35  PHE D CZ    1 
ATOM   2387 N  N     . GLU B 2  31  ? 46.191 -27.807 -4.950  1.00 65.27  ? 36  GLU D N     1 
ATOM   2388 C  CA    . GLU B 2  31  ? 46.437 -28.998 -5.756  1.00 75.80  ? 36  GLU D CA    1 
ATOM   2389 C  C     . GLU B 2  31  ? 47.028 -28.618 -7.108  1.00 62.73  ? 36  GLU D C     1 
ATOM   2390 O  O     . GLU B 2  31  ? 47.980 -29.248 -7.573  1.00 69.12  ? 36  GLU D O     1 
ATOM   2391 C  CB    . GLU B 2  31  ? 45.148 -29.800 -5.952  1.00 73.07  ? 36  GLU D CB    1 
ATOM   2392 C  CG    . GLU B 2  31  ? 44.714 -30.606 -4.733  1.00 97.82  ? 36  GLU D CG    1 
ATOM   2393 C  CD    . GLU B 2  31  ? 44.184 -29.740 -3.603  1.00 104.91 ? 36  GLU D CD    1 
ATOM   2394 O  OE1   . GLU B 2  31  ? 43.870 -28.556 -3.849  1.00 105.52 ? 36  GLU D OE1   1 
ATOM   2395 O  OE2   . GLU B 2  31  ? 44.084 -30.246 -2.465  1.00 107.95 ? 36  GLU D OE2   1 
HETATM 2396 C  C     . MK8 B 2  32  ? 48.359 -26.681 -8.906  1.00 65.00  ? 37  MK8 D C     1 
HETATM 2397 N  N     . MK8 B 2  32  ? 46.458 -27.577 -7.716  1.00 66.38  ? 37  MK8 D N     1 
HETATM 2398 O  O     . MK8 B 2  32  ? 49.167 -27.061 -9.795  1.00 64.74  ? 37  MK8 D O     1 
HETATM 2399 C  CA    . MK8 B 2  32  ? 46.897 -27.070 -8.977  1.00 74.43  ? 37  MK8 D CA    1 
HETATM 2400 C  CB    . MK8 B 2  32  ? 46.113 -25.816 -9.305  1.00 76.27  ? 37  MK8 D CB    1 
HETATM 2401 C  CD    . MK8 B 2  32  ? 47.020 -23.954 -10.681 1.00 69.06  ? 37  MK8 D CD    1 
HETATM 2402 C  CE    . MK8 B 2  32  ? 47.442 -23.544 -12.076 1.00 65.86  ? 37  MK8 D CE    1 
HETATM 2403 C  CG    . MK8 B 2  32  ? 46.452 -25.358 -10.709 1.00 72.78  ? 37  MK8 D CG    1 
HETATM 2404 C  CB1   . MK8 B 2  32  ? 46.667 -28.091 -10.072 1.00 63.16  ? 37  MK8 D CB1   1 
ATOM   2405 N  N     . LYS B 2  33  ? 48.715 -25.932 -7.865  1.00 62.64  ? 38  LYS D N     1 
ATOM   2406 C  CA    . LYS B 2  33  ? 50.078 -25.446 -7.682  1.00 56.52  ? 38  LYS D CA    1 
ATOM   2407 C  C     . LYS B 2  33  ? 51.077 -26.581 -7.488  1.00 53.38  ? 38  LYS D C     1 
ATOM   2408 O  O     . LYS B 2  33  ? 52.218 -26.496 -7.941  1.00 57.30  ? 38  LYS D O     1 
ATOM   2409 C  CB    . LYS B 2  33  ? 50.145 -24.492 -6.485  1.00 62.84  ? 38  LYS D CB    1 
ATOM   2410 C  CG    . LYS B 2  33  ? 49.845 -23.041 -6.824  1.00 71.52  ? 38  LYS D CG    1 
ATOM   2411 C  CD    . LYS B 2  33  ? 50.997 -22.410 -7.590  1.00 79.20  ? 38  LYS D CD    1 
ATOM   2412 C  CE    . LYS B 2  33  ? 50.730 -20.945 -7.887  1.00 93.83  ? 38  LYS D CE    1 
ATOM   2413 N  NZ    . LYS B 2  33  ? 51.905 -20.279 -8.513  1.00 103.67 ? 38  LYS D NZ    1 
ATOM   2414 N  N     . ALA B 2  34  ? 50.650 -27.637 -6.801  1.00 54.82  ? 39  ALA D N     1 
ATOM   2415 C  CA    . ALA B 2  34  ? 51.518 -28.785 -6.565  1.00 54.48  ? 39  ALA D CA    1 
ATOM   2416 C  C     . ALA B 2  34  ? 51.862 -29.478 -7.882  1.00 53.17  ? 39  ALA D C     1 
ATOM   2417 O  O     . ALA B 2  34  ? 52.994 -29.908 -8.091  1.00 52.36  ? 39  ALA D O     1 
ATOM   2418 C  CB    . ALA B 2  34  ? 50.862 -29.762 -5.606  1.00 57.45  ? 39  ALA D CB    1 
ATOM   2419 N  N     . ASN B 2  35  ? 50.879 -29.579 -8.769  1.00 55.25  ? 40  ASN D N     1 
ATOM   2420 C  CA    . ASN B 2  35  ? 51.100 -30.216 -10.062 1.00 60.92  ? 40  ASN D CA    1 
ATOM   2421 C  C     . ASN B 2  35  ? 51.953 -29.353 -10.990 1.00 51.48  ? 40  ASN D C     1 
ATOM   2422 O  O     . ASN B 2  35  ? 52.939 -29.831 -11.551 1.00 57.86  ? 40  ASN D O     1 
ATOM   2423 C  CB    . ASN B 2  35  ? 49.765 -30.546 -10.725 1.00 63.25  ? 40  ASN D CB    1 
ATOM   2424 C  CG    . ASN B 2  35  ? 49.006 -31.637 -9.996  1.00 76.87  ? 40  ASN D CG    1 
ATOM   2425 O  OD1   . ASN B 2  35  ? 49.598 -32.461 -9.297  1.00 76.55  ? 40  ASN D OD1   1 
ATOM   2426 N  ND2   . ASN B 2  35  ? 47.688 -31.651 -10.157 1.00 72.21  ? 40  ASN D ND2   1 
HETATM 2427 C  C     . MK8 B 2  36  ? 53.750 -27.104 -11.600 1.00 58.34  ? 41  MK8 D C     1 
HETATM 2428 N  N     . MK8 B 2  36  ? 51.568 -28.085 -11.134 1.00 51.92  ? 41  MK8 D N     1 
HETATM 2429 O  O     . MK8 B 2  36  ? 54.610 -27.170 -12.516 1.00 60.52  ? 41  MK8 D O     1 
HETATM 2430 C  CA    . MK8 B 2  36  ? 52.272 -27.136 -11.938 1.00 57.02  ? 41  MK8 D CA    1 
HETATM 2431 C  CB    . MK8 B 2  36  ? 51.739 -25.750 -11.637 1.00 58.73  ? 41  MK8 D CB    1 
HETATM 2432 C  CD    . MK8 B 2  36  ? 49.806 -24.243 -11.698 1.00 67.43  ? 41  MK8 D CD    1 
HETATM 2433 C  CE    . MK8 B 2  36  ? 48.676 -23.708 -12.550 1.00 59.98  ? 41  MK8 D CE    1 
HETATM 2434 C  CG    . MK8 B 2  36  ? 50.431 -25.461 -12.344 1.00 59.23  ? 41  MK8 D CG    1 
HETATM 2435 C  CB1   . MK8 B 2  36  ? 52.089 -27.447 -13.410 1.00 60.86  ? 41  MK8 D CB1   1 
ATOM   2436 N  N     . GLU B 2  37  ? 54.067 -27.008 -10.313 1.00 63.25  ? 42  GLU D N     1 
ATOM   2437 C  CA    . GLU B 2  37  ? 55.453 -26.868 -9.873  1.00 55.20  ? 42  GLU D CA    1 
ATOM   2438 C  C     . GLU B 2  37  ? 56.147 -28.213 -9.673  1.00 49.88  ? 42  GLU D C     1 
ATOM   2439 O  O     . GLU B 2  37  ? 57.330 -28.256 -9.326  1.00 57.94  ? 42  GLU D O     1 
ATOM   2440 C  CB    . GLU B 2  37  ? 55.518 -26.053 -8.578  1.00 52.58  ? 42  GLU D CB    1 
ATOM   2441 C  CG    . GLU B 2  37  ? 54.890 -24.672 -8.684  1.00 61.83  ? 42  GLU D CG    1 
ATOM   2442 C  CD    . GLU B 2  37  ? 55.027 -23.861 -7.408  1.00 69.69  ? 42  GLU D CD    1 
ATOM   2443 O  OE1   . GLU B 2  37  ? 55.860 -24.225 -6.553  1.00 73.10  ? 42  GLU D OE1   1 
ATOM   2444 O  OE2   . GLU B 2  37  ? 54.302 -22.856 -7.261  1.00 73.74  ? 42  GLU D OE2   1 
ATOM   2445 N  N     . ASN B 2  38  ? 55.409 -29.299 -9.895  1.00 52.88  ? 43  ASN D N     1 
ATOM   2446 C  CA    . ASN B 2  38  ? 55.938 -30.657 -9.761  1.00 67.67  ? 43  ASN D CA    1 
ATOM   2447 C  C     . ASN B 2  38  ? 56.461 -30.927 -8.351  1.00 76.89  ? 43  ASN D C     1 
ATOM   2448 O  O     . ASN B 2  38  ? 57.642 -31.210 -8.156  1.00 70.33  ? 43  ASN D O     1 
ATOM   2449 C  CB    . ASN B 2  38  ? 57.045 -30.910 -10.796 1.00 68.61  ? 43  ASN D CB    1 
ATOM   2450 C  CG    . ASN B 2  38  ? 57.466 -32.368 -10.863 1.00 64.83  ? 43  ASN D CG    1 
ATOM   2451 O  OD1   . ASN B 2  38  ? 56.644 -33.273 -10.712 1.00 74.09  ? 43  ASN D OD1   1 
ATOM   2452 N  ND2   . ASN B 2  38  ? 58.757 -32.602 -11.070 1.00 55.85  ? 43  ASN D ND2   1 
HETATM 2453 P  PB    . ADP C 3  .   ? 52.911 -10.013 11.891  1.00 163.92 ? 501 ADP A PB    1 
HETATM 2454 O  O1B   . ADP C 3  .   ? 52.391 -10.824 10.730  1.00 169.80 ? 501 ADP A O1B   1 
HETATM 2455 O  O2B   . ADP C 3  .   ? 53.850 -8.904  11.481  1.00 165.38 ? 501 ADP A O2B   1 
HETATM 2456 O  O3B   . ADP C 3  .   ? 53.369 -10.828 13.077  1.00 156.95 ? 501 ADP A O3B   1 
HETATM 2457 P  PA    . ADP C 3  .   ? 50.257 -9.985  12.875  1.00 78.32  ? 501 ADP A PA    1 
HETATM 2458 O  O1A   . ADP C 3  .   ? 49.181 -9.730  11.846  1.00 74.18  ? 501 ADP A O1A   1 
HETATM 2459 O  O2A   . ADP C 3  .   ? 50.540 -11.394 13.333  1.00 84.03  ? 501 ADP A O2A   1 
HETATM 2460 O  O3A   . ADP C 3  .   ? 51.619 -9.234  12.451  1.00 62.39  ? 501 ADP A O3A   1 
HETATM 2461 O  "O5'" . ADP C 3  .   ? 49.910 -9.149  14.201  1.00 93.80  ? 501 ADP A "O5'" 1 
HETATM 2462 C  "C5'" . ADP C 3  .   ? 48.979 -8.082  14.137  1.00 85.32  ? 501 ADP A "C5'" 1 
HETATM 2463 C  "C4'" . ADP C 3  .   ? 48.337 -7.881  15.495  1.00 80.05  ? 501 ADP A "C4'" 1 
HETATM 2464 O  "O4'" . ADP C 3  .   ? 47.182 -7.066  15.294  1.00 73.59  ? 501 ADP A "O4'" 1 
HETATM 2465 C  "C3'" . ADP C 3  .   ? 47.862 -9.199  16.084  1.00 83.67  ? 501 ADP A "C3'" 1 
HETATM 2466 O  "O3'" . ADP C 3  .   ? 48.724 -9.645  17.136  1.00 88.88  ? 501 ADP A "O3'" 1 
HETATM 2467 C  "C2'" . ADP C 3  .   ? 46.475 -8.895  16.604  1.00 84.18  ? 501 ADP A "C2'" 1 
HETATM 2468 O  "O2'" . ADP C 3  .   ? 46.568 -8.501  17.975  1.00 81.25  ? 501 ADP A "O2'" 1 
HETATM 2469 C  "C1'" . ADP C 3  .   ? 46.006 -7.703  15.793  1.00 77.25  ? 501 ADP A "C1'" 1 
HETATM 2470 N  N9    . ADP C 3  .   ? 45.203 -8.177  14.636  1.00 68.46  ? 501 ADP A N9    1 
HETATM 2471 C  C8    . ADP C 3  .   ? 45.706 -8.681  13.490  1.00 70.38  ? 501 ADP A C8    1 
HETATM 2472 N  N7    . ADP C 3  .   ? 44.724 -9.027  12.622  1.00 66.74  ? 501 ADP A N7    1 
HETATM 2473 C  C5    . ADP C 3  .   ? 43.552 -8.740  13.214  1.00 65.12  ? 501 ADP A C5    1 
HETATM 2474 C  C6    . ADP C 3  .   ? 42.124 -8.860  12.844  1.00 66.97  ? 501 ADP A C6    1 
HETATM 2475 N  N6    . ADP C 3  .   ? 41.758 -9.366  11.640  1.00 63.84  ? 501 ADP A N6    1 
HETATM 2476 N  N1    . ADP C 3  .   ? 41.204 -8.449  13.745  1.00 57.19  ? 501 ADP A N1    1 
HETATM 2477 C  C2    . ADP C 3  .   ? 41.568 -7.946  14.940  1.00 62.20  ? 501 ADP A C2    1 
HETATM 2478 N  N3    . ADP C 3  .   ? 42.846 -7.810  15.340  1.00 50.79  ? 501 ADP A N3    1 
HETATM 2479 C  C4    . ADP C 3  .   ? 43.870 -8.183  14.539  1.00 64.89  ? 501 ADP A C4    1 
HETATM 2480 O  O1    . PG4 D 4  .   ? 35.479 -13.033 28.419  1.00 106.86 ? 502 PG4 A O1    1 
HETATM 2481 C  C1    . PG4 D 4  .   ? 34.691 -13.244 29.586  1.00 106.90 ? 502 PG4 A C1    1 
HETATM 2482 C  C2    . PG4 D 4  .   ? 34.939 -12.110 30.585  1.00 106.14 ? 502 PG4 A C2    1 
HETATM 2483 O  O2    . PG4 D 4  .   ? 34.998 -10.881 29.907  1.00 105.15 ? 502 PG4 A O2    1 
HETATM 2484 C  C3    . PG4 D 4  .   ? 34.738 -9.762  30.737  1.00 107.53 ? 502 PG4 A C3    1 
HETATM 2485 C  C4    . PG4 D 4  .   ? 35.521 -8.522  30.226  1.00 111.53 ? 502 PG4 A C4    1 
HETATM 2486 O  O3    . PG4 D 4  .   ? 34.970 -8.072  28.967  1.00 111.29 ? 502 PG4 A O3    1 
HETATM 2487 C  C5    . PG4 D 4  .   ? 35.798 -8.385  27.809  1.00 108.30 ? 502 PG4 A C5    1 
HETATM 2488 C  C6    . PG4 D 4  .   ? 34.913 -8.573  26.578  1.00 105.36 ? 502 PG4 A C6    1 
HETATM 2489 O  O4    . PG4 D 4  .   ? 35.696 -8.437  25.407  1.00 98.75  ? 502 PG4 A O4    1 
HETATM 2490 C  C7    . PG4 D 4  .   ? 36.531 -9.556  25.129  1.00 97.95  ? 502 PG4 A C7    1 
HETATM 2491 C  C8    . PG4 D 4  .   ? 35.669 -10.764 24.792  1.00 96.15  ? 502 PG4 A C8    1 
HETATM 2492 O  O5    . PG4 D 4  .   ? 36.508 -11.956 24.694  1.00 93.91  ? 502 PG4 A O5    1 
HETATM 2493 S  S     . SO4 E 5  .   ? 64.800 -38.541 18.578  1.00 145.36 ? 503 SO4 A S     1 
HETATM 2494 O  O1    . SO4 E 5  .   ? 65.020 -37.997 17.240  1.00 145.76 ? 503 SO4 A O1    1 
HETATM 2495 O  O2    . SO4 E 5  .   ? 64.450 -39.955 18.477  1.00 146.12 ? 503 SO4 A O2    1 
HETATM 2496 O  O3    . SO4 E 5  .   ? 66.019 -38.396 19.369  1.00 143.47 ? 503 SO4 A O3    1 
HETATM 2497 O  O4    . SO4 E 5  .   ? 63.709 -37.818 19.223  1.00 142.69 ? 503 SO4 A O4    1 
HETATM 2498 C  C1    . PEG F 6  .   ? 44.489 -35.048 10.072  1.00 59.87  ? 504 PEG A C1    1 
HETATM 2499 O  O1    . PEG F 6  .   ? 44.590 -36.161 10.933  1.00 61.99  ? 504 PEG A O1    1 
HETATM 2500 C  C2    . PEG F 6  .   ? 45.823 -34.251 10.108  1.00 67.55  ? 504 PEG A C2    1 
HETATM 2501 O  O2    . PEG F 6  .   ? 46.919 -35.182 10.130  1.00 85.97  ? 504 PEG A O2    1 
HETATM 2502 C  C3    . PEG F 6  .   ? 47.861 -34.941 11.149  1.00 74.76  ? 504 PEG A C3    1 
HETATM 2503 C  C4    . PEG F 6  .   ? 49.119 -34.365 10.556  1.00 73.03  ? 504 PEG A C4    1 
HETATM 2504 O  O4    . PEG F 6  .   ? 48.841 -33.082 10.043  1.00 66.17  ? 504 PEG A O4    1 
HETATM 2505 C  C1    . PEG G 6  .   ? 58.183 -13.180 7.917   1.00 91.34  ? 505 PEG A C1    1 
HETATM 2506 O  O1    . PEG G 6  .   ? 58.629 -13.418 9.235   1.00 91.78  ? 505 PEG A O1    1 
HETATM 2507 C  C2    . PEG G 6  .   ? 57.323 -11.884 7.885   1.00 95.04  ? 505 PEG A C2    1 
HETATM 2508 O  O2    . PEG G 6  .   ? 56.420 -11.932 6.766   1.00 98.75  ? 505 PEG A O2    1 
HETATM 2509 C  C3    . PEG G 6  .   ? 55.441 -10.916 6.766   1.00 101.60 ? 505 PEG A C3    1 
HETATM 2510 C  C4    . PEG G 6  .   ? 54.582 -11.035 7.999   1.00 105.50 ? 505 PEG A C4    1 
HETATM 2511 O  O4    . PEG G 6  .   ? 54.915 -10.017 8.916   1.00 110.00 ? 505 PEG A O4    1 
HETATM 2512 O  O1    . MES H 7  .   ? 53.873 -26.991 -4.591  1.00 80.97  ? 506 MES A O1    1 
HETATM 2513 C  C2    . MES H 7  .   ? 53.431 -25.681 -4.866  1.00 83.98  ? 506 MES A C2    1 
HETATM 2514 C  C3    . MES H 7  .   ? 54.093 -24.650 -3.978  1.00 86.33  ? 506 MES A C3    1 
HETATM 2515 N  N4    . MES H 7  .   ? 55.299 -25.055 -3.331  1.00 79.67  ? 506 MES A N4    1 
HETATM 2516 C  C5    . MES H 7  .   ? 56.047 -26.110 -3.934  1.00 85.25  ? 506 MES A C5    1 
HETATM 2517 C  C6    . MES H 7  .   ? 55.267 -27.101 -4.772  1.00 82.55  ? 506 MES A C6    1 
HETATM 2518 C  C7    . MES H 7  .   ? 56.161 -23.906 -3.267  1.00 82.64  ? 506 MES A C7    1 
HETATM 2519 C  C8    . MES H 7  .   ? 56.978 -23.944 -1.995  1.00 89.12  ? 506 MES A C8    1 
HETATM 2520 S  S     . MES H 7  .   ? 58.144 -22.608 -1.998  1.00 112.13 ? 506 MES A S     1 
HETATM 2521 O  O1S   . MES H 7  .   ? 59.386 -22.962 -2.781  1.00 109.26 ? 506 MES A O1S   1 
HETATM 2522 O  O2S   . MES H 7  .   ? 57.500 -21.348 -2.527  1.00 96.44  ? 506 MES A O2S   1 
HETATM 2523 O  O3S   . MES H 7  .   ? 58.720 -22.388 -0.620  1.00 125.44 ? 506 MES A O3S   1 
HETATM 2524 C  C8    . P4G I 8  .   ? 68.367 -16.613 17.806  1.00 96.43  ? 507 P4G A C8    1 
HETATM 2525 C  C7    . P4G I 8  .   ? 67.029 -15.924 17.549  1.00 105.09 ? 507 P4G A C7    1 
HETATM 2526 O  O4    . P4G I 8  .   ? 65.987 -16.701 18.082  1.00 107.41 ? 507 P4G A O4    1 
HETATM 2527 C  C6    . P4G I 8  .   ? 64.761 -15.999 18.219  1.00 104.82 ? 507 P4G A C6    1 
HETATM 2528 C  C5    . P4G I 8  .   ? 63.617 -16.877 17.768  1.00 103.69 ? 507 P4G A C5    1 
HETATM 2529 O  O3    . P4G I 8  .   ? 63.557 -16.906 16.379  1.00 101.55 ? 507 P4G A O3    1 
HETATM 2530 C  C4    . P4G I 8  .   ? 62.250 -16.967 15.872  1.00 100.38 ? 507 P4G A C4    1 
HETATM 2531 C  C3    . P4G I 8  .   ? 62.278 -16.901 14.365  1.00 89.94  ? 507 P4G A C3    1 
HETATM 2532 O  O2    . P4G I 8  .   ? 63.328 -15.999 13.938  1.00 91.82  ? 507 P4G A O2    1 
HETATM 2533 C  C2    . P4G I 8  .   ? 63.534 -15.963 12.502  1.00 84.92  ? 507 P4G A C2    1 
HETATM 2534 C  C1    . P4G I 8  .   ? 64.560 -14.851 12.153  1.00 69.83  ? 507 P4G A C1    1 
HETATM 2535 CL CL    . CL  J 9  .   ? 70.770 -25.854 22.115  1.00 116.71 ? 508 CL  A CL    1 
HETATM 2536 MG MG    . MG  K 10 .   ? 52.081 -12.166 14.339  1.00 143.25 ? 509 MG  A MG    1 
HETATM 2537 MG MG    . MG  L 10 .   ? 53.867 -12.477 10.135  1.00 144.32 ? 510 MG  A MG    1 
HETATM 2538 N  N     . NH3 M 11 .   ? 55.571 -30.830 -7.368  1.00 49.41  ? 101 NH3 D N     1 
HETATM 2539 O  O     . HOH N 12 .   ? 59.675 -39.060 21.099  1.00 51.67  ? 601 HOH A O     1 
HETATM 2540 O  O     . HOH N 12 .   ? 39.767 -10.562 25.927  1.00 60.98  ? 602 HOH A O     1 
HETATM 2541 O  O     . HOH N 12 .   ? 44.389 -33.101 7.431   1.00 74.15  ? 603 HOH A O     1 
HETATM 2542 O  O     . HOH N 12 .   ? 36.056 -17.292 23.201  1.00 56.54  ? 604 HOH A O     1 
HETATM 2543 O  O     . HOH N 12 .   ? 37.119 -16.590 8.569   1.00 56.09  ? 605 HOH A O     1 
HETATM 2544 O  O     . HOH N 12 .   ? 48.341 -13.316 7.601   1.00 51.32  ? 606 HOH A O     1 
HETATM 2545 O  O     . HOH N 12 .   ? 43.990 -24.233 34.038  1.00 53.78  ? 607 HOH A O     1 
HETATM 2546 O  O     . HOH N 12 .   ? 39.466 -33.242 33.608  1.00 82.04  ? 608 HOH A O     1 
HETATM 2547 O  O     . HOH N 12 .   ? 40.826 -10.871 23.274  1.00 50.58  ? 609 HOH A O     1 
HETATM 2548 O  O     . HOH N 12 .   ? 57.086 -28.597 -1.967  1.00 51.43  ? 610 HOH A O     1 
HETATM 2549 O  O     . HOH N 12 .   ? 33.988 -23.044 15.757  1.00 70.07  ? 611 HOH A O     1 
HETATM 2550 O  O     . HOH N 12 .   ? 56.028 -19.313 -3.002  1.00 68.12  ? 612 HOH A O     1 
HETATM 2551 O  O     . HOH N 12 .   ? 35.812 -7.851  8.219   1.00 56.97  ? 613 HOH A O     1 
HETATM 2552 O  O     . HOH N 12 .   ? 64.193 -26.986 10.345  1.00 51.78  ? 614 HOH A O     1 
HETATM 2553 O  O     . HOH N 12 .   ? 31.007 -14.541 13.709  1.00 85.36  ? 615 HOH A O     1 
HETATM 2554 O  O     . HOH N 12 .   ? 63.691 -25.347 3.393   1.00 64.52  ? 616 HOH A O     1 
HETATM 2555 O  O     . HOH N 12 .   ? 56.961 -23.103 14.589  1.00 57.43  ? 617 HOH A O     1 
HETATM 2556 O  O     . HOH N 12 .   ? 55.301 -13.503 20.548  1.00 64.92  ? 618 HOH A O     1 
HETATM 2557 O  O     . HOH N 12 .   ? 58.906 -31.911 11.723  1.00 45.19  ? 619 HOH A O     1 
HETATM 2558 O  O     . HOH N 12 .   ? 58.491 -16.805 22.621  1.00 57.59  ? 620 HOH A O     1 
HETATM 2559 O  O     . HOH N 12 .   ? 35.738 -26.025 14.732  1.00 71.58  ? 621 HOH A O     1 
HETATM 2560 O  O     . HOH N 12 .   ? 61.478 -18.395 26.965  1.00 65.49  ? 622 HOH A O     1 
HETATM 2561 O  O     . HOH N 12 .   ? 52.461 -18.508 9.676   1.00 48.93  ? 623 HOH A O     1 
HETATM 2562 O  O     . HOH N 12 .   ? 55.799 -14.378 14.573  1.00 71.57  ? 624 HOH A O     1 
HETATM 2563 O  O     . HOH N 12 .   ? 35.676 -12.459 12.411  1.00 51.23  ? 625 HOH A O     1 
HETATM 2564 O  O     . HOH N 12 .   ? 60.933 -24.768 -1.526  1.00 78.40  ? 626 HOH A O     1 
HETATM 2565 O  O     . HOH N 12 .   ? 54.821 -22.204 -0.258  1.00 54.33  ? 627 HOH A O     1 
HETATM 2566 O  O     . HOH N 12 .   ? 43.810 -29.776 33.368  1.00 55.86  ? 628 HOH A O     1 
HETATM 2567 O  O     . HOH N 12 .   ? 64.028 -33.512 17.026  1.00 56.71  ? 629 HOH A O     1 
HETATM 2568 O  O     . HOH N 12 .   ? 50.760 -29.862 5.693   1.00 67.96  ? 630 HOH A O     1 
HETATM 2569 O  O     . HOH N 12 .   ? 54.180 -14.691 11.212  1.00 70.72  ? 631 HOH A O     1 
HETATM 2570 O  O     . HOH N 12 .   ? 63.820 -22.129 35.889  1.00 85.90  ? 632 HOH A O     1 
HETATM 2571 O  O     . HOH N 12 .   ? 60.848 -15.470 18.903  1.00 72.10  ? 633 HOH A O     1 
HETATM 2572 O  O     . HOH N 12 .   ? 35.115 -20.912 20.837  1.00 64.65  ? 634 HOH A O     1 
HETATM 2573 O  O     . HOH N 12 .   ? 58.648 -24.837 22.053  1.00 43.25  ? 635 HOH A O     1 
HETATM 2574 O  O     . HOH N 12 .   ? 58.906 -13.205 -4.587  1.00 69.77  ? 636 HOH A O     1 
HETATM 2575 O  O     . HOH N 12 .   ? 46.073 -12.849 9.139   1.00 42.88  ? 637 HOH A O     1 
HETATM 2576 O  O     . HOH N 12 .   ? 32.958 -12.524 13.436  1.00 59.79  ? 638 HOH A O     1 
HETATM 2577 O  O     . HOH N 12 .   ? 48.346 -35.107 7.137   1.00 79.44  ? 639 HOH A O     1 
HETATM 2578 O  O     . HOH N 12 .   ? 54.727 -19.978 17.188  1.00 48.40  ? 640 HOH A O     1 
HETATM 2579 O  O     . HOH N 12 .   ? 56.978 -21.324 16.811  1.00 50.02  ? 641 HOH A O     1 
HETATM 2580 O  O     . HOH N 12 .   ? 38.355 -20.352 31.149  1.00 66.37  ? 642 HOH A O     1 
HETATM 2581 O  O     . HOH N 12 .   ? 47.827 -12.010 14.077  1.00 77.55  ? 643 HOH A O     1 
HETATM 2582 O  O     . HOH N 12 .   ? 70.587 -30.711 25.970  1.00 63.80  ? 644 HOH A O     1 
HETATM 2583 O  O     . HOH N 12 .   ? 58.186 -22.252 26.129  1.00 53.31  ? 645 HOH A O     1 
HETATM 2584 O  O     . HOH N 12 .   ? 54.882 -11.771 16.211  1.00 89.51  ? 646 HOH A O     1 
HETATM 2585 O  O     . HOH N 12 .   ? 39.062 -19.000 5.624   1.00 57.97  ? 647 HOH A O     1 
HETATM 2586 O  O     . HOH N 12 .   ? 43.113 -4.382  19.739  1.00 65.71  ? 648 HOH A O     1 
HETATM 2587 O  O     . HOH N 12 .   ? 69.117 -32.444 23.977  1.00 65.12  ? 649 HOH A O     1 
HETATM 2588 O  O     . HOH N 12 .   ? 53.915 -19.180 -5.774  1.00 61.54  ? 650 HOH A O     1 
HETATM 2589 O  O     . HOH N 12 .   ? 53.761 -13.203 14.891  1.00 69.05  ? 651 HOH A O     1 
HETATM 2590 O  O     . HOH N 12 .   ? 46.481 -11.071 11.336  1.00 54.67  ? 652 HOH A O     1 
HETATM 2591 O  O     . HOH N 12 .   ? 53.269 -30.556 4.484   1.00 59.15  ? 653 HOH A O     1 
HETATM 2592 O  O     . HOH N 12 .   ? 51.354 -11.226 16.220  1.00 65.40  ? 654 HOH A O     1 
HETATM 2593 O  O     . HOH N 12 .   ? 53.130 -23.826 14.502  1.00 58.34  ? 655 HOH A O     1 
HETATM 2594 O  O     . HOH N 12 .   ? 35.811 -26.721 32.690  1.00 64.66  ? 656 HOH A O     1 
HETATM 2595 O  O     . HOH N 12 .   ? 60.238 -37.297 23.825  1.00 53.33  ? 657 HOH A O     1 
HETATM 2596 O  O     . HOH N 12 .   ? 53.380 -15.930 24.156  1.00 72.27  ? 658 HOH A O     1 
HETATM 2597 O  O     . HOH N 12 .   ? 65.472 -24.960 11.136  1.00 68.16  ? 659 HOH A O     1 
HETATM 2598 O  O     . HOH N 12 .   ? 63.718 -14.735 26.884  1.00 89.35  ? 660 HOH A O     1 
HETATM 2599 O  O     . HOH N 12 .   ? 56.731 -42.634 21.865  1.00 83.75  ? 661 HOH A O     1 
HETATM 2600 O  O     . HOH N 12 .   ? 47.481 -8.862  -8.075  1.00 68.98  ? 662 HOH A O     1 
HETATM 2601 O  O     . HOH N 12 .   ? 65.540 -35.378 24.163  1.00 89.44  ? 663 HOH A O     1 
HETATM 2602 O  O     . HOH N 12 .   ? 43.764 -7.981  21.155  1.00 70.88  ? 664 HOH A O     1 
HETATM 2603 O  O     . HOH N 12 .   ? 48.481 -29.499 -2.150  1.00 66.26  ? 665 HOH A O     1 
HETATM 2604 O  O     . HOH N 12 .   ? 44.810 -8.934  34.296  1.00 79.98  ? 666 HOH A O     1 
HETATM 2605 O  O     . HOH N 12 .   ? 27.872 4.407   -1.994  1.00 95.26  ? 667 HOH A O     1 
HETATM 2606 O  O     . HOH N 12 .   ? 53.315 -40.450 26.494  1.00 80.37  ? 668 HOH A O     1 
HETATM 2607 O  O     . HOH N 12 .   ? 40.579 -34.523 6.694   1.00 80.56  ? 669 HOH A O     1 
HETATM 2608 O  O     . HOH N 12 .   ? 65.887 -13.994 22.931  1.00 79.24  ? 670 HOH A O     1 
HETATM 2609 O  O     . HOH O 12 .   ? 58.420 -13.604 -9.885  1.00 80.57  ? 201 HOH D O     1 
HETATM 2610 O  O     . HOH O 12 .   ? 32.325 -2.541  -1.065  1.00 66.94  ? 202 HOH D O     1 
HETATM 2611 O  O     . HOH O 12 .   ? 44.256 -17.305 -8.068  1.00 79.81  ? 203 HOH D O     1 
HETATM 2612 O  O     . HOH O 12 .   ? 57.567 -36.178 -11.326 1.00 68.57  ? 204 HOH D O     1 
HETATM 2613 O  O     . HOH O 12 .   ? 59.344 -23.755 -7.289  1.00 80.66  ? 205 HOH D O     1 
HETATM 2614 O  O     . HOH O 12 .   ? 38.804 -24.852 -10.097 1.00 72.65  ? 206 HOH D O     1 
HETATM 2615 O  O     . HOH O 12 .   ? 63.449 -10.858 -7.552  1.00 96.96  ? 207 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ARG A 6   ? 1.8519 1.8894 0.6630 0.6855  -0.0708 0.0905  126 ARG A N   
2    C CA  . ARG A 6   ? 1.7946 1.8994 0.6711 0.6891  -0.0867 0.0492  126 ARG A CA  
3    C C   . ARG A 6   ? 1.6954 1.8005 0.6173 0.6721  -0.0742 0.0257  126 ARG A C   
4    O O   . ARG A 6   ? 1.6265 1.7626 0.6059 0.6761  -0.0891 -0.0039 126 ARG A O   
5    C CB  . ARG A 6   ? 1.7953 1.9556 0.6555 0.6791  -0.0928 0.0310  126 ARG A CB  
6    C CG  . ARG A 6   ? 1.7330 1.9501 0.6486 0.6800  -0.1121 -0.0109 126 ARG A CG  
7    C CD  . ARG A 6   ? 2.1635 2.4256 1.0537 0.6703  -0.1177 -0.0279 126 ARG A CD  
8    N NE  . ARG A 6   ? 2.1326 2.4340 1.0667 0.6664  -0.1363 -0.0679 126 ARG A NE  
9    C CZ  . ARG A 6   ? 2.1244 2.4532 1.0797 0.6728  -0.1621 -0.0743 126 ARG A CZ  
10   N NH1 . ARG A 6   ? 2.1941 2.5236 1.1372 0.6903  -0.1720 -0.0447 126 ARG A NH1 
11   N NH2 . ARG A 6   ? 2.0366 2.3909 1.0227 0.6601  -0.1780 -0.1100 126 ARG A NH2 
12   N N   . GLN A 7   ? 1.7138 1.7849 0.6075 0.6489  -0.0472 0.0401  127 GLN A N   
13   C CA  . GLN A 7   ? 1.6491 1.7262 0.5828 0.6302  -0.0326 0.0202  127 GLN A CA  
14   C C   . GLN A 7   ? 1.6226 1.6444 0.5711 0.6319  -0.0275 0.0362  127 GLN A C   
15   O O   . GLN A 7   ? 1.6728 1.6389 0.5857 0.6433  -0.0272 0.0673  127 GLN A O   
16   C CB  . GLN A 7   ? 1.6810 1.7688 0.5819 0.5978  -0.0036 0.0237  127 GLN A CB  
17   C CG  . GLN A 7   ? 1.8365 1.9808 0.7859 0.5876  0.0027  -0.0158 127 GLN A CG  
18   C CD  . GLN A 7   ? 1.6201 1.8171 0.5845 0.6021  -0.0161 -0.0484 127 GLN A CD  
19   O OE1 . GLN A 7   ? 1.6639 1.8644 0.5983 0.6138  -0.0308 -0.0400 127 GLN A OE1 
20   N NE2 . GLN A 7   ? 1.5757 1.8101 0.5840 0.6009  -0.0163 -0.0857 127 GLN A NE2 
21   N N   . TRP A 8   ? 1.5502 1.5839 0.5490 0.6212  -0.0240 0.0140  128 TRP A N   
22   C CA  . TRP A 8   ? 1.5339 1.5173 0.5458 0.6168  -0.0168 0.0271  128 TRP A CA  
23   C C   . TRP A 8   ? 1.5867 1.5089 0.5405 0.5911  0.0130  0.0629  128 TRP A C   
24   O O   . TRP A 8   ? 1.7839 1.7228 0.7083 0.5640  0.0329  0.0673  128 TRP A O   
25   C CB  . TRP A 8   ? 1.4397 1.4508 0.5129 0.6041  -0.0181 -0.0036 128 TRP A CB  
26   C CG  . TRP A 8   ? 1.3816 1.4292 0.5102 0.6210  -0.0499 -0.0352 128 TRP A CG  
27   C CD1 . TRP A 8   ? 1.3851 1.4796 0.5508 0.6180  -0.0639 -0.0716 128 TRP A CD1 
28   C CD2 . TRP A 8   ? 1.3615 1.4006 0.5128 0.6387  -0.0712 -0.0336 128 TRP A CD2 
29   N NE1 . TRP A 8   ? 1.3065 1.4160 0.5119 0.6262  -0.0932 -0.0909 128 TRP A NE1 
30   C CE2 . TRP A 8   ? 1.3278 1.4131 0.5291 0.6380  -0.0974 -0.0687 128 TRP A CE2 
31   C CE3 . TRP A 8   ? 1.3871 1.3841 0.5213 0.6542  -0.0699 -0.0070 128 TRP A CE3 
32   C CZ2 . TRP A 8   ? 1.3190 1.4204 0.5561 0.6450  -0.1207 -0.0774 128 TRP A CZ2 
33   C CZ3 . TRP A 8   ? 1.4394 1.4584 0.6139 0.6690  -0.0925 -0.0182 128 TRP A CZ3 
34   C CH2 . TRP A 8   ? 1.3701 1.4461 0.5967 0.6608  -0.1169 -0.0527 128 TRP A CH2 
35   N N   . ALA A 9   ? 1.6099 1.4613 0.5455 0.5965  0.0161  0.0873  129 ALA A N   
36   C CA  . ALA A 9   ? 1.7224 1.4992 0.6014 0.5649  0.0434  0.1205  129 ALA A CA  
37   C C   . ALA A 9   ? 1.6440 1.3679 0.5426 0.5588  0.0502  0.1253  129 ALA A C   
38   O O   . ALA A 9   ? 1.5953 1.3273 0.5368 0.5887  0.0306  0.1110  129 ALA A O   
39   C CB  . ALA A 9   ? 1.8010 1.5167 0.6085 0.5766  0.0412  0.1534  129 ALA A CB  
40   N N   . LEU A 10  ? 1.6750 1.3495 0.5419 0.5149  0.0780  0.1445  130 LEU A N   
41   C CA  . LEU A 10  ? 1.7108 1.3276 0.5887 0.5008  0.0882  0.1509  130 LEU A CA  
42   C C   . LEU A 10  ? 1.7860 1.3184 0.6330 0.5349  0.0778  0.1691  130 LEU A C   
43   O O   . LEU A 10  ? 1.6862 1.1869 0.5576 0.5440  0.0759  0.1650  130 LEU A O   
44   C CB  . LEU A 10  ? 1.6902 1.2739 0.5357 0.4378  0.1207  0.1693  130 LEU A CB  
45   C CG  . LEU A 10  ? 1.7741 1.3050 0.6334 0.4099  0.1352  0.1741  130 LEU A CG  
46   C CD1 . LEU A 10  ? 1.5538 1.1533 0.4923 0.4218  0.1254  0.1423  130 LEU A CD1 
47   C CD2 . LEU A 10  ? 1.8619 1.3718 0.6882 0.3393  0.1655  0.1929  130 LEU A CD2 
48   N N   . GLU A 11  ? 1.8019 1.3023 0.5959 0.5552  0.0710  0.1875  131 GLU A N   
49   C CA  . GLU A 11  ? 1.9237 1.3489 0.6857 0.5944  0.0609  0.2024  131 GLU A CA  
50   C C   . GLU A 11  ? 1.8071 1.2936 0.6315 0.6486  0.0335  0.1782  131 GLU A C   
51   O O   . GLU A 11  ? 1.8447 1.2907 0.6618 0.6842  0.0260  0.1820  131 GLU A O   
52   C CB  . GLU A 11  ? 1.9879 1.3682 0.6747 0.6004  0.0590  0.2282  131 GLU A CB  
53   C CG  . GLU A 11  ? 2.0769 1.3826 0.6904 0.5418  0.0840  0.2559  131 GLU A CG  
54   C CD  . GLU A 11  ? 2.3198 1.7035 0.9418 0.4927  0.0973  0.2503  131 GLU A CD  
55   O OE1 . GLU A 11  ? 2.1703 1.6562 0.8506 0.5094  0.0868  0.2236  131 GLU A OE1 
56   O OE2 . GLU A 11  ? 2.4214 1.7689 0.9921 0.4359  0.1179  0.2704  131 GLU A OE2 
57   N N   . ASP A 12  ? 1.7143 1.3029 0.6003 0.6515  0.0187  0.1504  132 ASP A N   
58   C CA  . ASP A 12  ? 1.6503 1.3099 0.5995 0.6894  -0.0087 0.1245  132 ASP A CA  
59   C C   . ASP A 12  ? 1.5800 1.2418 0.5814 0.6866  -0.0108 0.1090  132 ASP A C   
60   O O   . ASP A 12  ? 1.5333 1.2495 0.5864 0.7105  -0.0313 0.0885  132 ASP A O   
61   C CB  . ASP A 12  ? 1.5891 1.3477 0.5793 0.6865  -0.0254 0.0983  132 ASP A CB  
62   C CG  . ASP A 12  ? 1.6564 1.4249 0.5998 0.6919  -0.0267 0.1109  132 ASP A CG  
63   O OD1 . ASP A 12  ? 1.7426 1.4602 0.6357 0.7125  -0.0265 0.1357  132 ASP A OD1 
64   O OD2 . ASP A 12  ? 1.6283 1.4540 0.5834 0.6756  -0.0285 0.0947  132 ASP A OD2 
65   N N   . PHE A 13  ? 1.5745 1.1830 0.5624 0.6509  0.0112  0.1184  133 PHE A N   
66   C CA  . PHE A 13  ? 1.6104 1.2231 0.6469 0.6411  0.0093  0.1046  133 PHE A CA  
67   C C   . PHE A 13  ? 1.6576 1.1662 0.6548 0.6276  0.0327  0.1262  133 PHE A C   
68   O O   . PHE A 13  ? 1.8356 1.2710 0.7727 0.5957  0.0582  0.1494  133 PHE A O   
69   C CB  . PHE A 13  ? 1.4403 1.1066 0.5225 0.6003  0.0126  0.0840  133 PHE A CB  
70   C CG  . PHE A 13  ? 1.4713 1.2299 0.5880 0.6116  -0.0105 0.0572  133 PHE A CG  
71   C CD1 . PHE A 13  ? 1.4618 1.2865 0.6449 0.6245  -0.0403 0.0277  133 PHE A CD1 
72   C CD2 . PHE A 13  ? 1.5381 1.3170 0.6237 0.6029  -0.0017 0.0594  133 PHE A CD2 
73   C CE1 . PHE A 13  ? 1.3508 1.2476 0.5591 0.6289  -0.0613 0.0015  133 PHE A CE1 
74   C CE2 . PHE A 13  ? 1.3647 1.2208 0.4841 0.6110  -0.0213 0.0315  133 PHE A CE2 
75   C CZ  . PHE A 13  ? 1.3214 1.2303 0.4994 0.6237  -0.0511 0.0026  133 PHE A CZ  
76   N N   . GLU A 14  ? 1.6911 1.1976 0.7252 0.6460  0.0245  0.1154  134 GLU A N   
77   C CA  . GLU A 14  ? 1.6495 1.0654 0.6601 0.6268  0.0463  0.1276  134 GLU A CA  
78   C C   . GLU A 14  ? 1.4842 0.9334 0.5613 0.5709  0.0548  0.1101  134 GLU A C   
79   O O   . GLU A 14  ? 1.4192 0.9599 0.5810 0.5670  0.0346  0.0805  134 GLU A O   
80   C CB  . GLU A 14  ? 1.6391 1.0533 0.6709 0.6635  0.0378  0.1154  134 GLU A CB  
81   C CG  . GLU A 14  ? 1.7722 1.1426 0.7434 0.7033  0.0382  0.1278  134 GLU A CG  
82   C CD  . GLU A 14  ? 1.9772 1.3526 0.9626 0.7365  0.0325  0.1159  134 GLU A CD  
83   O OE1 . GLU A 14  ? 1.9856 1.4243 1.0411 0.7283  0.0236  0.0945  134 GLU A OE1 
84   O OE2 . GLU A 14  ? 2.2259 1.5444 1.1517 0.7696  0.0359  0.1279  134 GLU A OE2 
85   N N   . ILE A 15  ? 1.6106 0.9897 0.6530 0.5203  0.0845  0.1260  135 ILE A N   
86   C CA  . ILE A 15  ? 1.4882 0.9056 0.5984 0.4608  0.0944  0.1094  135 ILE A CA  
87   C C   . ILE A 15  ? 1.3981 0.7771 0.5355 0.4456  0.1010  0.1025  135 ILE A C   
88   O O   . ILE A 15  ? 1.5373 0.8138 0.6066 0.4481  0.1191  0.1222  135 ILE A O   
89   C CB  . ILE A 15  ? 1.5067 0.8929 0.5717 0.4057  0.1230  0.1289  135 ILE A CB  
90   C CG1 . ILE A 15  ? 1.5413 0.9620 0.5673 0.4209  0.1200  0.1370  135 ILE A CG1 
91   C CG2 . ILE A 15  ? 1.3873 0.8336 0.5306 0.3512  0.1289  0.1108  135 ILE A CG2 
92   C CD1 . ILE A 15  ? 1.4198 0.9546 0.5214 0.4429  0.0937  0.1061  135 ILE A CD1 
93   N N   . GLY A 16  ? 1.3499 0.8060 0.5807 0.4286  0.0857  0.0742  136 GLY A N   
94   C CA  . GLY A 16  ? 1.3126 0.7477 0.5768 0.4093  0.0906  0.0643  136 GLY A CA  
95   C C   . GLY A 16  ? 1.4651 0.8982 0.7611 0.3386  0.1080  0.0631  136 GLY A C   
96   O O   . GLY A 16  ? 1.4974 0.9056 0.7568 0.3034  0.1281  0.0806  136 GLY A O   
97   N N   . ARG A 17  ? 1.3676 0.8341 0.7309 0.3156  0.0997  0.0430  137 ARG A N   
98   C CA  . ARG A 17  ? 1.2844 0.7556 0.6836 0.2489  0.1126  0.0416  137 ARG A CA  
99   C C   . ARG A 17  ? 1.1300 0.6815 0.5808 0.2282  0.1000  0.0322  137 ARG A C   
100  O O   . ARG A 17  ? 1.1252 0.7380 0.6053 0.2622  0.0745  0.0165  137 ARG A O   
101  C CB  . ARG A 17  ? 1.2685 0.7577 0.7245 0.2310  0.1038  0.0221  137 ARG A CB  
102  C CG  . ARG A 17  ? 1.1779 0.7644 0.7131 0.2452  0.0675  -0.0060 137 ARG A CG  
103  C CD  . ARG A 17  ? 1.1333 0.7419 0.7225 0.2134  0.0600  -0.0235 137 ARG A CD  
104  N NE  . ARG A 17  ? 0.9606 0.6565 0.6154 0.2183  0.0237  -0.0488 137 ARG A NE  
105  C CZ  . ARG A 17  ? 0.9570 0.6976 0.6638 0.1808  0.0053  -0.0598 137 ARG A CZ  
106  N NH1 . ARG A 17  ? 0.9837 0.7043 0.6936 0.1400  0.0201  -0.0480 137 ARG A NH1 
107  N NH2 . ARG A 17  ? 0.8960 0.7009 0.6476 0.1835  -0.0293 -0.0821 137 ARG A NH2 
108  N N   . PRO A 18  ? 1.3113 0.8635 0.7700 0.1736  0.1176  0.0413  138 PRO A N   
109  C CA  . PRO A 18  ? 1.2614 0.8939 0.7760 0.1571  0.1050  0.0296  138 PRO A CA  
110  C C   . PRO A 18  ? 1.1933 0.8818 0.7890 0.1554  0.0729  0.0023  138 PRO A C   
111  O O   . PRO A 18  ? 1.1057 0.7790 0.7273 0.1272  0.0721  -0.0019 138 PRO A O   
112  C CB  . PRO A 18  ? 1.1549 0.7750 0.6585 0.0963  0.1327  0.0477  138 PRO A CB  
113  C CG  . PRO A 18  ? 1.3404 0.8628 0.7562 0.0850  0.1623  0.0731  138 PRO A CG  
114  C CD  . PRO A 18  ? 1.3006 0.7777 0.7071 0.1262  0.1508  0.0641  138 PRO A CD  
115  N N   . LEU A 19  ? 1.1443 0.8918 0.7725 0.1825  0.0465  -0.0165 139 LEU A N   
116  C CA  . LEU A 19  ? 1.0368 0.8281 0.7297 0.1770  0.0126  -0.0418 139 LEU A CA  
117  C C   . LEU A 19  ? 1.1182 0.9396 0.8560 0.1384  0.0091  -0.0450 139 LEU A C   
118  O O   . LEU A 19  ? 1.1767 1.0140 0.9626 0.1149  -0.0134 -0.0586 139 LEU A O   
119  C CB  . LEU A 19  ? 1.1093 0.9381 0.8053 0.2223  -0.0167 -0.0616 139 LEU A CB  
120  C CG  . LEU A 19  ? 1.1106 0.9287 0.7734 0.2633  -0.0218 -0.0613 139 LEU A CG  
121  C CD1 . LEU A 19  ? 0.9623 0.8237 0.6246 0.3006  -0.0504 -0.0800 139 LEU A CD1 
122  C CD2 . LEU A 19  ? 0.9899 0.8037 0.6775 0.2500  -0.0300 -0.0680 139 LEU A CD2 
123  N N   . GLY A 20  ? 0.9902 0.8237 0.7099 0.1315  0.0305  -0.0316 140 GLY A N   
124  C CA  . GLY A 20  ? 0.8807 0.7542 0.6415 0.1009  0.0292  -0.0324 140 GLY A CA  
125  C C   . GLY A 20  ? 0.9777 0.8803 0.7117 0.0989  0.0559  -0.0178 140 GLY A C   
126  O O   . GLY A 20  ? 1.0529 0.9504 0.7389 0.1277  0.0685  -0.0124 140 GLY A O   
127  N N   . LYS A 21  ? 0.9715 0.9120 0.7357 0.0626  0.0642  -0.0106 141 LYS A N   
128  C CA  . LYS A 21  ? 0.9682 0.9579 0.7137 0.0542  0.0897  0.0024  141 LYS A CA  
129  C C   . LYS A 21  ? 1.0869 1.1511 0.8719 0.0915  0.0696  -0.0195 141 LYS A C   
130  O O   . LYS A 21  ? 1.0674 1.1435 0.9026 0.1014  0.0384  -0.0381 141 LYS A O   
131  C CB  . LYS A 21  ? 0.9626 0.9617 0.7131 -0.0099 0.1133  0.0250  141 LYS A CB  
132  N N   . GLY A 22  ? 1.1302 1.2400 0.8862 0.1125  0.0873  -0.0179 142 GLY A N   
133  C CA  . GLY A 22  ? 1.1157 1.2976 0.9013 0.1544  0.0725  -0.0411 142 GLY A CA  
134  C C   . GLY A 22  ? 1.1575 1.4280 0.9477 0.1362  0.0993  -0.0298 142 GLY A C   
135  O O   . GLY A 22  ? 1.1578 1.4318 0.9266 0.0828  0.1284  -0.0023 142 GLY A O   
136  N N   . LYS A 23  ? 1.0765 1.4211 0.8910 0.1801  0.0896  -0.0522 143 LYS A N   
137  C CA  . LYS A 23  ? 1.0506 1.5036 0.8796 0.1701  0.1123  -0.0461 143 LYS A CA  
138  C C   . LYS A 23  ? 1.1688 1.6559 0.9367 0.1590  0.1489  -0.0317 143 LYS A C   
139  O O   . LYS A 23  ? 1.2523 1.8256 1.0176 0.1272  0.1762  -0.0169 143 LYS A O   
140  C CB  . LYS A 23  ? 0.9522 1.4728 0.8274 0.2297  0.0880  -0.0786 143 LYS A CB  
141  N N   . PHE A 24  ? 1.1671 1.5906 0.8832 0.1819  0.1483  -0.0348 144 PHE A N   
142  C CA  . PHE A 24  ? 1.0954 1.5423 0.7455 0.1747  0.1787  -0.0216 144 PHE A CA  
143  C C   . PHE A 24  ? 1.1362 1.4728 0.7175 0.1565  0.1863  0.0005  144 PHE A C   
144  O O   . PHE A 24  ? 1.2067 1.5380 0.7230 0.1573  0.2046  0.0115  144 PHE A O   
145  C CB  . PHE A 24  ? 1.0829 1.5886 0.7315 0.2374  0.1705  -0.0526 144 PHE A CB  
146  C CG  . PHE A 24  ? 1.0730 1.6866 0.7821 0.2675  0.1635  -0.0773 144 PHE A CG  
147  C CD1 . PHE A 24  ? 1.0429 1.7765 0.7527 0.2501  0.1931  -0.0706 144 PHE A CD1 
148  C CD2 . PHE A 24  ? 1.0005 1.5962 0.7612 0.3135  0.1263  -0.1070 144 PHE A CD2 
149  C CE1 . PHE A 24  ? 1.0378 1.8793 0.8050 0.2863  0.1862  -0.0945 144 PHE A CE1 
150  C CE2 . PHE A 24  ? 0.9975 1.6827 0.8077 0.3490  0.1176  -0.1297 144 PHE A CE2 
151  C CZ  . PHE A 24  ? 1.0044 1.8165 0.8211 0.3396  0.1479  -0.1241 144 PHE A CZ  
152  N N   . GLY A 25  ? 1.1522 1.4027 0.7459 0.1419  0.1717  0.0070  145 GLY A N   
153  C CA  . GLY A 25  ? 1.1796 1.3249 0.7123 0.1329  0.1766  0.0259  145 GLY A CA  
154  C C   . GLY A 25  ? 1.1737 1.2497 0.7404 0.1449  0.1486  0.0158  145 GLY A C   
155  O O   . GLY A 25  ? 1.1418 1.2452 0.7748 0.1556  0.1240  -0.0050 145 GLY A O   
156  N N   . ASN A 26  ? 1.2924 0.7840 0.7419 0.0040  0.1274  0.0127  146 ASN A N   
157  C CA  . ASN A 26  ? 1.2122 0.7086 0.6479 0.0373  0.1247  0.0023  146 ASN A CA  
158  C C   . ASN A 26  ? 1.2463 0.7957 0.6922 0.0672  0.1321  0.0064  146 ASN A C   
159  O O   . ASN A 26  ? 1.1551 0.7150 0.5968 0.0717  0.1367  0.0169  146 ASN A O   
160  C CB  . ASN A 26  ? 1.4065 0.8197 0.7848 0.0566  0.1172  -0.0017 146 ASN A CB  
161  C CG  . ASN A 26  ? 1.6824 1.0446 1.0521 0.0290  0.1029  -0.0133 146 ASN A CG  
162  O OD1 . ASN A 26  ? 1.7360 1.1206 1.1427 -0.0088 0.1002  -0.0124 146 ASN A OD1 
163  N ND2 . ASN A 26  ? 1.7876 1.0846 1.1088 0.0510  0.0914  -0.0278 146 ASN A ND2 
164  N N   . VAL A 27  ? 1.1781 0.7666 0.6387 0.0864  0.1326  -0.0005 147 VAL A N   
165  C CA  . VAL A 27  ? 1.1510 0.7943 0.6277 0.1143  0.1365  0.0021  147 VAL A CA  
166  C C   . VAL A 27  ? 1.2075 0.8265 0.6420 0.1554  0.1392  0.0018  147 VAL A C   
167  O O   . VAL A 27  ? 1.2279 0.8346 0.6457 0.1652  0.1406  -0.0049 147 VAL A O   
168  C CB  . VAL A 27  ? 1.0519 0.7680 0.5876 0.1038  0.1356  -0.0011 147 VAL A CB  
169  C CG1 . VAL A 27  ? 0.9118 0.6875 0.4700 0.1300  0.1374  0.0015  147 VAL A CG1 
170  C CG2 . VAL A 27  ? 1.1028 0.8421 0.6801 0.0730  0.1294  -0.0059 147 VAL A CG2 
171  N N   . TYR A 28  ? 1.2240 0.8389 0.6376 0.1843  0.1391  0.0080  148 TYR A N   
172  C CA  . TYR A 28  ? 1.2293 0.8147 0.5992 0.2310  0.1394  0.0060  148 TYR A CA  
173  C C   . TYR A 28  ? 1.2497 0.9211 0.6505 0.2647  0.1431  0.0062  148 TYR A C   
174  O O   . TYR A 28  ? 1.1750 0.9109 0.6209 0.2537  0.1405  0.0095  148 TYR A O   
175  C CB  . TYR A 28  ? 1.3559 0.8557 0.6707 0.2441  0.1328  0.0161  148 TYR A CB  
176  C CG  . TYR A 28  ? 1.3762 0.7886 0.6646 0.2082  0.1277  0.0185  148 TYR A CG  
177  C CD1 . TYR A 28  ? 1.4640 0.8816 0.7744 0.1642  0.1300  0.0304  148 TYR A CD1 
178  C CD2 . TYR A 28  ? 1.4265 0.7563 0.6704 0.2195  0.1190  0.0067  148 TYR A CD2 
179  C CE1 . TYR A 28  ? 1.5411 0.8915 0.8382 0.1275  0.1256  0.0347  148 TYR A CE1 
180  C CE2 . TYR A 28  ? 1.3933 0.6449 0.6210 0.1819  0.1096  0.0075  148 TYR A CE2 
181  C CZ  . TYR A 28  ? 1.4318 0.6979 0.6905 0.1336  0.1138  0.0237  148 TYR A CZ  
182  O OH  . TYR A 28  ? 1.6015 0.8019 0.8544 0.0925  0.1047  0.0264  148 TYR A OH  
183  N N   . LEU A 29  ? 1.2924 0.9690 0.6708 0.3070  0.1476  -0.0000 149 LEU A N   
184  C CA  . LEU A 29  ? 1.2251 0.9860 0.6317 0.3454  0.1510  0.0012  149 LEU A CA  
185  C C   . LEU A 29  ? 1.2124 0.9429 0.5875 0.3776  0.1398  0.0067  149 LEU A C   
186  O O   . LEU A 29  ? 1.2732 0.9049 0.5851 0.3948  0.1335  0.0083  149 LEU A O   
187  C CB  . LEU A 29  ? 1.1113 0.8956 0.5007 0.3867  0.1620  -0.0076 149 LEU A CB  
188  C CG  . LEU A 29  ? 1.1598 1.0555 0.5921 0.4245  0.1695  -0.0050 149 LEU A CG  
189  C CD1 . LEU A 29  ? 1.1879 1.1847 0.7071 0.3818  0.1719  0.0063  149 LEU A CD1 
190  C CD2 . LEU A 29  ? 1.2355 1.1605 0.6538 0.4618  0.1813  -0.0122 149 LEU A CD2 
191  N N   . ALA A 30  ? 1.1962 1.0078 0.6146 0.3851  0.1345  0.0105  150 ALA A N   
192  C CA  . ALA A 30  ? 1.1639 0.9528 0.5509 0.4125  0.1215  0.0186  150 ALA A CA  
193  C C   . ALA A 30  ? 1.2289 1.1055 0.6430 0.4609  0.1146  0.0158  150 ALA A C   
194  O O   . ALA A 30  ? 1.1457 1.1251 0.6268 0.4565  0.1191  0.0095  150 ALA A O   
195  C CB  . ALA A 30  ? 1.0502 0.8436 0.4518 0.3714  0.1152  0.0244  150 ALA A CB  
196  N N   . ARG A 31  ? 1.2931 1.1298 0.6575 0.5060  0.1024  0.0234  151 ARG A N   
197  C CA  . ARG A 31  ? 1.2706 1.1881 0.6559 0.5589  0.0912  0.0207  151 ARG A CA  
198  C C   . ARG A 31  ? 1.3586 1.2626 0.7132 0.5741  0.0716  0.0330  151 ARG A C   
199  O O   . ARG A 31  ? 1.4586 1.2580 0.7383 0.5915  0.0668  0.0496  151 ARG A O   
200  C CB  . ARG A 31  ? 1.2947 1.1806 0.6400 0.6228  0.0940  0.0156  151 ARG A CB  
201  C CG  . ARG A 31  ? 1.5444 1.5539 0.9396 0.6740  0.0908  0.0070  151 ARG A CG  
202  C CD  . ARG A 31  ? 1.6404 1.6535 1.0215 0.7191  0.1061  -0.0059 151 ARG A CD  
203  N NE  . ARG A 31  ? 1.6081 1.7753 1.0765 0.7175  0.1158  -0.0099 151 ARG A NE  
204  C CZ  . ARG A 31  ? 1.6702 1.8761 1.1479 0.7349  0.1250  -0.0142 151 ARG A CZ  
205  N NH1 . ARG A 31  ? 1.7094 2.0615 1.2696 0.7290  0.1371  -0.0122 151 ARG A NH1 
206  N NH2 . ARG A 31  ? 1.7202 1.8204 1.1250 0.7576  0.1217  -0.0209 151 ARG A NH2 
207  N N   . GLU A 32  ? 1.1321 1.1400 0.5430 0.5664  0.0586  0.0259  152 GLU A N   
208  C CA  . GLU A 32  ? 1.2693 1.2822 0.6485 0.5894  0.0373  0.0344  152 GLU A CA  
209  C C   . GLU A 32  ? 1.3810 1.3865 0.7215 0.6642  0.0245  0.0420  152 GLU A C   
210  O O   . GLU A 32  ? 1.3930 1.4928 0.7852 0.6982  0.0191  0.0287  152 GLU A O   
211  C CB  . GLU A 32  ? 1.1022 1.2321 0.5538 0.5674  0.0202  0.0166  152 GLU A CB  
212  C CG  . GLU A 32  ? 1.2189 1.3474 0.6290 0.5765  -0.0003 0.0214  152 GLU A CG  
213  C CD  . GLU A 32  ? 1.3567 1.5085 0.7319 0.6447  -0.0227 0.0297  152 GLU A CD  
214  O OE1 . GLU A 32  ? 1.3391 1.5802 0.7705 0.6758  -0.0340 0.0163  152 GLU A OE1 
215  O OE2 . GLU A 32  ? 1.5742 1.6591 0.8670 0.6678  -0.0287 0.0525  152 GLU A OE2 
216  N N   . LYS A 33  ? 1.4511 1.3462 0.7032 0.6895  0.0194  0.0656  153 LYS A N   
217  C CA  . LYS A 33  ? 1.5618 1.4125 0.7628 0.7634  0.0070  0.0755  153 LYS A CA  
218  C C   . LYS A 33  ? 1.5617 1.5275 0.7961 0.8196  -0.0169 0.0669  153 LYS A C   
219  O O   . LYS A 33  ? 1.6551 1.6378 0.8907 0.8735  -0.0212 0.0586  153 LYS A O   
220  C CB  . LYS A 33  ? 1.7623 1.4713 0.8646 0.7716  0.0018  0.1100  153 LYS A CB  
221  C CG  . LYS A 33  ? 1.7174 1.3001 0.7842 0.7274  0.0206  0.1191  153 LYS A CG  
222  C CD  . LYS A 33  ? 1.7482 1.2014 0.7420 0.7225  0.0174  0.1497  153 LYS A CD  
223  C CE  . LYS A 33  ? 1.7573 1.0887 0.7236 0.6764  0.0306  0.1578  153 LYS A CE  
224  N NZ  . LYS A 33  ? 1.9022 1.1222 0.8176 0.6555  0.0276  0.1897  153 LYS A NZ  
225  N N   . GLN A 34  ? 1.4198 1.4685 0.6845 0.8006  -0.0325 0.0628  154 GLN A N   
226  C CA  . GLN A 34  ? 1.4553 1.6151 0.7516 0.8513  -0.0614 0.0532  154 GLN A CA  
227  C C   . GLN A 34  ? 1.3309 1.6364 0.7399 0.8477  -0.0611 0.0244  154 GLN A C   
228  O O   . GLN A 34  ? 1.3600 1.7267 0.7941 0.8901  -0.0670 0.0150  154 GLN A O   
229  C CB  . GLN A 34  ? 1.4753 1.6685 0.7584 0.8324  -0.0815 0.0541  154 GLN A CB  
230  C CG  . GLN A 34  ? 1.5107 1.5840 0.6996 0.8322  -0.0755 0.0825  154 GLN A CG  
231  C CD  . GLN A 34  ? 1.7054 1.8292 0.8855 0.8251  -0.0936 0.0795  154 GLN A CD  
232  O OE1 . GLN A 34  ? 1.6918 1.9347 0.9325 0.8219  -0.1155 0.0507  154 GLN A OE1 
233  N NE2 . GLN A 34  ? 1.6879 1.7237 0.7960 0.8211  -0.0858 0.1087  154 GLN A NE2 
234  N N   . SER A 35  ? 1.2616 1.6165 0.7401 0.7787  -0.0489 0.0094  155 SER A N   
235  C CA  . SER A 35  ? 1.3138 1.8092 0.9068 0.7624  -0.0485 -0.0110 155 SER A CA  
236  C C   . SER A 35  ? 1.3553 1.8452 0.9738 0.7530  -0.0143 -0.0101 155 SER A C   
237  O O   . SER A 35  ? 1.2912 1.8989 1.0018 0.7412  -0.0072 -0.0191 155 SER A O   
238  C CB  . SER A 35  ? 1.2380 1.7921 0.8978 0.6941  -0.0596 -0.0272 155 SER A CB  
239  O OG  . SER A 35  ? 1.1735 1.6403 0.8117 0.6362  -0.0362 -0.0225 155 SER A OG  
240  N N   . LYS A 36  ? 1.3326 1.6887 0.8696 0.7569  0.0057  0.0018  156 LYS A N   
241  C CA  . LYS A 36  ? 1.2250 1.5595 0.7667 0.7514  0.0360  -0.0003 156 LYS A CA  
242  C C   . LYS A 36  ? 1.1841 1.5805 0.8044 0.6787  0.0529  -0.0053 156 LYS A C   
243  O O   . LYS A 36  ? 1.1491 1.5969 0.8084 0.6759  0.0755  -0.0070 156 LYS A O   
244  C CB  . LYS A 36  ? 1.2392 1.6462 0.7997 0.8165  0.0388  -0.0069 156 LYS A CB  
245  N N   . PHE A 37  ? 1.0267 1.4164 0.6658 0.6232  0.0414  -0.0065 157 PHE A N   
246  C CA  . PHE A 37  ? 0.9679 1.4060 0.6818 0.5548  0.0504  -0.0108 157 PHE A CA  
247  C C   . PHE A 37  ? 1.0261 1.3604 0.6967 0.5168  0.0738  -0.0042 157 PHE A C   
248  O O   . PHE A 37  ? 1.1137 1.3407 0.7133 0.5097  0.0723  0.0002  157 PHE A O   
249  C CB  . PHE A 37  ? 1.0262 1.5010 0.7790 0.5188  0.0227  -0.0221 157 PHE A CB  
250  C CG  . PHE A 37  ? 1.0331 1.5688 0.8776 0.4545  0.0230  -0.0285 157 PHE A CG  
251  C CD1 . PHE A 37  ? 1.0436 1.7046 0.9880 0.4461  0.0196  -0.0294 157 PHE A CD1 
252  C CD2 . PHE A 37  ? 0.9728 1.4418 0.8073 0.4026  0.0255  -0.0317 157 PHE A CD2 
253  C CE1 . PHE A 37  ? 0.9930 1.6995 1.0231 0.3833  0.0175  -0.0300 157 PHE A CE1 
254  C CE2 . PHE A 37  ? 0.8322 1.3452 0.7489 0.3467  0.0218  -0.0364 157 PHE A CE2 
255  C CZ  . PHE A 37  ? 0.8823 1.5081 0.8957 0.3352  0.0172  -0.0339 157 PHE A CZ  
256  N N   . ILE A 38  ? 0.9301 1.3037 0.6458 0.4917  0.0951  -0.0011 158 ILE A N   
257  C CA  . ILE A 38  ? 0.9237 1.2113 0.6015 0.4602  0.1152  0.0037  158 ILE A CA  
258  C C   . ILE A 38  ? 0.8522 1.1132 0.5548 0.3953  0.1086  0.0025  158 ILE A C   
259  O O   . ILE A 38  ? 0.8062 1.1433 0.5882 0.3591  0.1007  0.0007  158 ILE A O   
260  C CB  . ILE A 38  ? 0.8836 1.2286 0.5930 0.4614  0.1408  0.0097  158 ILE A CB  
261  C CG1 . ILE A 38  ? 1.3311 1.6832 0.9975 0.5338  0.1507  0.0054  158 ILE A CG1 
262  C CG2 . ILE A 38  ? 0.8756 1.1414 0.5522 0.4231  0.1558  0.0134  158 ILE A CG2 
263  C CD1 . ILE A 38  ? 1.4731 1.6817 1.0342 0.5625  0.1504  -0.0011 158 ILE A CD1 
264  N N   . LEU A 39  ? 0.9065 1.0592 0.5441 0.3810  0.1104  0.0031  159 LEU A N   
265  C CA  . LEU A 39  ? 0.8604 0.9862 0.5151 0.3274  0.1049  -0.0004 159 LEU A CA  
266  C C   . LEU A 39  ? 0.8421 0.8808 0.4550 0.3031  0.1202  0.0042  159 LEU A C   
267  O O   . LEU A 39  ? 0.9471 0.9377 0.5120 0.3270  0.1323  0.0078  159 LEU A O   
268  C CB  . LEU A 39  ? 0.9800 1.0831 0.6062 0.3317  0.0866  -0.0059 159 LEU A CB  
269  C CG  . LEU A 39  ? 1.0242 1.2150 0.6927 0.3505  0.0632  -0.0163 159 LEU A CG  
270  C CD1 . LEU A 39  ? 0.9376 1.0935 0.5435 0.3766  0.0493  -0.0158 159 LEU A CD1 
271  C CD2 . LEU A 39  ? 1.0915 1.3448 0.8427 0.3056  0.0490  -0.0310 159 LEU A CD2 
272  N N   . ALA A 40  ? 0.8737 0.8946 0.5064 0.2580  0.1162  0.0005  160 ALA A N   
273  C CA  . ALA A 40  ? 0.9216 0.8644 0.5182 0.2330  0.1256  0.0031  160 ALA A CA  
274  C C   . ALA A 40  ? 1.0547 0.9497 0.6202 0.2195  0.1190  0.0011  160 ALA A C   
275  O O   . ALA A 40  ? 0.9503 0.8846 0.5469 0.2072  0.1072  -0.0078 160 ALA A O   
276  C CB  . ALA A 40  ? 0.8812 0.8495 0.5291 0.1941  0.1288  0.0034  160 ALA A CB  
277  N N   . LEU A 41  ? 1.1345 0.9473 0.6392 0.2223  0.1258  0.0092  161 LEU A N   
278  C CA  . LEU A 41  ? 1.0409 0.8141 0.5145 0.2084  0.1247  0.0152  161 LEU A CA  
279  C C   . LEU A 41  ? 1.1873 0.9204 0.6634 0.1675  0.1309  0.0147  161 LEU A C   
280  O O   . LEU A 41  ? 1.2094 0.8803 0.6557 0.1623  0.1355  0.0190  161 LEU A O   
281  C CB  . LEU A 41  ? 1.0714 0.7812 0.4770 0.2397  0.1253  0.0318  161 LEU A CB  
282  C CG  . LEU A 41  ? 1.2443 0.9294 0.6149 0.2314  0.1262  0.0475  161 LEU A CG  
283  C CD1 . LEU A 41  ? 1.2150 0.9830 0.6148 0.2365  0.1175  0.0368  161 LEU A CD1 
284  C CD2 . LEU A 41  ? 1.2737 0.8870 0.5763 0.2636  0.1247  0.0707  161 LEU A CD2 
285  N N   . LYS A 42  ? 1.1489 0.9200 0.6619 0.1415  0.1279  0.0057  162 LYS A N   
286  C CA  . LYS A 42  ? 1.0215 0.7706 0.5459 0.1057  0.1319  0.0035  162 LYS A CA  
287  C C   . LYS A 42  ? 1.1227 0.8392 0.6108 0.0951  0.1399  0.0171  162 LYS A C   
288  O O   . LYS A 42  ? 1.0698 0.8219 0.5546 0.1011  0.1407  0.0175  162 LYS A O   
289  C CB  . LYS A 42  ? 1.0510 0.8571 0.6362 0.0877  0.1234  -0.0144 162 LYS A CB  
290  C CG  . LYS A 42  ? 0.9839 0.7764 0.5882 0.0564  0.1247  -0.0189 162 LYS A CG  
291  C CD  . LYS A 42  ? 0.9971 0.8345 0.6610 0.0455  0.1118  -0.0365 162 LYS A CD  
292  C CE  . LYS A 42  ? 1.0176 0.8454 0.7019 0.0209  0.1104  -0.0417 162 LYS A CE  
293  N NZ  . LYS A 42  ? 0.8733 0.7314 0.6135 0.0141  0.0941  -0.0572 162 LYS A NZ  
294  N N   . VAL A 43  ? 1.1909 0.8418 0.6513 0.0786  0.1451  0.0289  163 VAL A N   
295  C CA  . VAL A 43  ? 1.2539 0.8687 0.6836 0.0613  0.1540  0.0499  163 VAL A CA  
296  C C   . VAL A 43  ? 1.3061 0.9369 0.7704 0.0210  0.1584  0.0459  163 VAL A C   
297  O O   . VAL A 43  ? 1.4336 1.0434 0.9162 0.0031  0.1519  0.0357  163 VAL A O   
298  C CB  . VAL A 43  ? 1.3198 0.8408 0.6971 0.0674  0.1524  0.0679  163 VAL A CB  
299  C CG1 . VAL A 43  ? 1.3483 0.8293 0.7004 0.0410  0.1614  0.0972  163 VAL A CG1 
300  C CG2 . VAL A 43  ? 1.3856 0.8945 0.7289 0.1148  0.1471  0.0708  163 VAL A CG2 
301  N N   . LEU A 44  ? 1.1363 0.8113 0.6082 0.0104  0.1690  0.0533  164 LEU A N   
302  C CA  . LEU A 44  ? 1.2235 0.9307 0.7334 -0.0234 0.1751  0.0496  164 LEU A CA  
303  C C   . LEU A 44  ? 1.2978 0.9967 0.7862 -0.0462 0.1927  0.0815  164 LEU A C   
304  O O   . LEU A 44  ? 1.3027 1.0260 0.7611 -0.0305 0.2044  0.0984  164 LEU A O   
305  C CB  . LEU A 44  ? 1.1751 0.9652 0.7278 -0.0134 0.1725  0.0230  164 LEU A CB  
306  C CG  . LEU A 44  ? 1.1116 0.9162 0.6930 0.0049  0.1547  -0.0031 164 LEU A CG  
307  C CD1 . LEU A 44  ? 1.0043 0.8769 0.6267 0.0128  0.1479  -0.0298 164 LEU A CD1 
308  C CD2 . LEU A 44  ? 1.2241 0.9920 0.8237 -0.0114 0.1456  -0.0074 164 LEU A CD2 
309  N N   . PHE A 45  ? 1.4238 1.0922 0.9285 -0.0846 0.1937  0.0915  165 PHE A N   
310  C CA  . PHE A 45  ? 1.4060 1.0711 0.9029 -0.1167 0.2112  0.1272  165 PHE A CA  
311  C C   . PHE A 45  ? 1.4217 1.1935 0.9571 -0.1250 0.2296  0.1243  165 PHE A C   
312  O O   . PHE A 45  ? 1.4878 1.3119 1.0752 -0.1308 0.2235  0.0956  165 PHE A O   
313  C CB  . PHE A 45  ? 1.4729 1.0720 0.9835 -0.1591 0.2012  0.1358  165 PHE A CB  
314  C CG  . PHE A 45  ? 1.6876 1.1776 1.1542 -0.1464 0.1819  0.1344  165 PHE A CG  
315  C CD1 . PHE A 45  ? 1.8100 1.2174 1.2262 -0.1481 0.1833  0.1682  165 PHE A CD1 
316  C CD2 . PHE A 45  ? 1.6415 1.1117 1.1139 -0.1293 0.1624  0.1002  165 PHE A CD2 
317  C CE1 . PHE A 45  ? 1.8978 1.2027 1.2715 -0.1287 0.1633  0.1616  165 PHE A CE1 
318  C CE2 . PHE A 45  ? 1.7862 1.1652 1.2145 -0.1107 0.1464  0.0950  165 PHE A CE2 
319  C CZ  . PHE A 45  ? 1.8670 1.1622 1.2464 -0.1082 0.1457  0.1225  165 PHE A CZ  
320  N N   . LYS A 46  ? 1.4523 1.2575 0.9582 -0.1212 0.2519  0.1545  166 LYS A N   
321  C CA  . LYS A 46  ? 1.3591 1.2751 0.8910 -0.1197 0.2728  0.1509  166 LYS A CA  
322  C C   . LYS A 46  ? 1.3604 1.3186 0.9508 -0.1658 0.2834  0.1589  166 LYS A C   
323  O O   . LYS A 46  ? 1.3493 1.4033 0.9839 -0.1603 0.2915  0.1363  166 LYS A O   
324  C CB  . LYS A 46  ? 1.4606 1.4031 0.9370 -0.1048 0.2965  0.1879  166 LYS A CB  
325  C CG  . LYS A 46  ? 1.4322 1.3546 0.8551 -0.0545 0.2838  0.1763  166 LYS A CG  
326  C CD  . LYS A 46  ? 1.4083 1.3726 0.7734 -0.0346 0.3057  0.2101  166 LYS A CD  
327  C CE  . LYS A 46  ? 1.3876 1.3441 0.7052 0.0182  0.2877  0.1925  166 LYS A CE  
328  N NZ  . LYS A 46  ? 1.3227 1.3346 0.6056 0.0362  0.2930  0.2098  166 LYS A NZ  
329  N N   . ALA A 47  ? 1.3802 1.2672 0.9734 -0.2094 0.2804  0.1884  167 ALA A N   
330  C CA  . ALA A 47  ? 1.3264 1.2521 0.9817 -0.2596 0.2863  0.1981  167 ALA A CA  
331  C C   . ALA A 47  ? 1.2243 1.1842 0.9383 -0.2560 0.2644  0.1496  167 ALA A C   
332  O O   . ALA A 47  ? 1.2377 1.2921 1.0103 -0.2688 0.2736  0.1401  167 ALA A O   
333  C CB  . ALA A 47  ? 1.3323 1.1562 0.9776 -0.3074 0.2779  0.2340  167 ALA A CB  
334  N N   . GLN A 48  ? 1.1971 1.0846 0.8944 -0.2358 0.2362  0.1211  168 GLN A N   
335  C CA  . GLN A 48  ? 1.1453 1.0536 0.8884 -0.2302 0.2134  0.0810  168 GLN A CA  
336  C C   . GLN A 48  ? 1.1035 1.0994 0.8711 -0.1920 0.2169  0.0502  168 GLN A C   
337  O O   . GLN A 48  ? 1.0918 1.1465 0.9139 -0.1936 0.2088  0.0270  168 GLN A O   
338  C CB  . GLN A 48  ? 1.1548 0.9676 0.8657 -0.2162 0.1864  0.0644  168 GLN A CB  
339  C CG  . GLN A 48  ? 1.2894 1.0066 0.9770 -0.2485 0.1743  0.0822  168 GLN A CG  
340  N N   . LEU A 49  ? 1.0949 1.0962 0.8221 -0.1558 0.2249  0.0479  169 LEU A N   
341  C CA  . LEU A 49  ? 1.1243 1.1963 0.8690 -0.1173 0.2231  0.0145  169 LEU A CA  
342  C C   . LEU A 49  ? 1.1616 1.3415 0.9421 -0.1188 0.2448  0.0127  169 LEU A C   
343  O O   . LEU A 49  ? 1.1960 1.4342 1.0217 -0.1009 0.2354  -0.0212 169 LEU A O   
344  C CB  . LEU A 49  ? 1.2748 1.3311 0.9669 -0.0811 0.2243  0.0128  169 LEU A CB  
345  C CG  . LEU A 49  ? 1.2632 1.2380 0.9295 -0.0685 0.2029  0.0070  169 LEU A CG  
346  C CD1 . LEU A 49  ? 1.2786 1.2498 0.8964 -0.0361 0.2055  0.0106  169 LEU A CD1 
347  C CD2 . LEU A 49  ? 1.2612 1.2382 0.9695 -0.0577 0.1784  -0.0279 169 LEU A CD2 
348  N N   . GLU A 50  ? 1.2192 1.4268 0.9785 -0.1379 0.2743  0.0512  170 GLU A N   
349  C CA  . GLU A 50  ? 1.1404 1.4653 0.9293 -0.1384 0.3023  0.0560  170 GLU A CA  
350  C C   . GLU A 50  ? 1.1678 1.5398 1.0315 -0.1745 0.3012  0.0550  170 GLU A C   
351  O O   . GLU A 50  ? 1.2999 1.7811 1.2091 -0.1623 0.3140  0.0383  170 GLU A O   
352  C CB  . GLU A 50  ? 1.2077 1.5493 0.9496 -0.1526 0.3367  0.1075  170 GLU A CB  
353  C CG  . GLU A 50  ? 1.3028 1.6235 0.9708 -0.1091 0.3382  0.1064  170 GLU A CG  
354  C CD  . GLU A 50  ? 1.4431 1.7551 1.0544 -0.1247 0.3674  0.1661  170 GLU A CD  
355  O OE1 . GLU A 50  ? 1.6315 1.9589 1.2658 -0.1730 0.3894  0.2105  170 GLU A OE1 
356  O OE2 . GLU A 50  ? 1.4741 1.7633 1.0195 -0.0900 0.3664  0.1708  170 GLU A OE2 
357  N N   . LYS A 51  ? 1.1990 1.4922 1.0751 -0.2153 0.2838  0.0696  171 LYS A N   
358  C CA  . LYS A 51  ? 1.2053 1.5373 1.1534 -0.2514 0.2751  0.0661  171 LYS A CA  
359  C C   . LYS A 51  ? 1.1135 1.4751 1.1032 -0.2187 0.2480  0.0160  171 LYS A C   
360  O O   . LYS A 51  ? 1.1342 1.5899 1.1878 -0.2197 0.2499  0.0015  171 LYS A O   
361  C CB  . LYS A 51  ? 1.2163 1.4451 1.1585 -0.2993 0.2562  0.0878  171 LYS A CB  
362  N N   . ALA A 52  ? 1.0797 1.2865 1.2971 -0.3219 0.2640  0.1579  172 ALA A N   
363  C CA  . ALA A 52  ? 0.9480 1.2507 1.2098 -0.3078 0.2205  0.1609  172 ALA A CA  
364  C C   . ALA A 52  ? 1.0370 1.3626 1.3099 -0.2537 0.2347  0.1853  172 ALA A C   
365  O O   . ALA A 52  ? 1.0267 1.4324 1.3484 -0.2393 0.2120  0.1951  172 ALA A O   
366  C CB  . ALA A 52  ? 0.9156 1.1961 1.1199 -0.2985 0.1817  0.1384  172 ALA A CB  
367  N N   . GLY A 53  ? 1.0797 1.3307 1.3019 -0.2225 0.2744  0.1950  173 GLY A N   
368  C CA  . GLY A 53  ? 1.0174 1.2764 1.2366 -0.1734 0.2927  0.2140  173 GLY A CA  
369  C C   . GLY A 53  ? 0.9699 1.2364 1.1534 -0.1338 0.2619  0.2044  173 GLY A C   
370  O O   . GLY A 53  ? 0.9509 1.2739 1.1738 -0.1135 0.2564  0.2151  173 GLY A O   
371  N N   . VAL A 54  ? 0.9373 1.1451 1.0482 -0.1226 0.2457  0.1848  174 VAL A N   
372  C CA  . VAL A 54  ? 0.8883 1.1010 0.9669 -0.0888 0.2182  0.1727  174 VAL A CA  
373  C C   . VAL A 54  ? 0.8390 0.9785 0.8327 -0.0498 0.2303  0.1661  174 VAL A C   
374  O O   . VAL A 54  ? 0.8778 1.0084 0.8350 -0.0289 0.2065  0.1504  174 VAL A O   
375  C CB  . VAL A 54  ? 0.9225 1.1544 1.0030 -0.1103 0.1782  0.1541  174 VAL A CB  
376  C CG1 . VAL A 54  ? 0.9464 1.2665 1.1074 -0.1393 0.1584  0.1616  174 VAL A CG1 
377  C CG2 . VAL A 54  ? 1.0357 1.2026 1.0698 -0.1351 0.1813  0.1404  174 VAL A CG2 
378  N N   . GLU A 55  ? 0.9325 1.0239 0.8964 -0.0391 0.2679  0.1795  175 GLU A N   
379  C CA  . GLU A 55  ? 0.9905 1.0179 0.8701 0.0020  0.2803  0.1777  175 GLU A CA  
380  C C   . GLU A 55  ? 0.9277 0.9805 0.7909 0.0397  0.2667  0.1703  175 GLU A C   
381  O O   . GLU A 55  ? 0.9026 0.9344 0.7106 0.0677  0.2505  0.1566  175 GLU A O   
382  C CB  . GLU A 55  ? 1.1622 1.1362 1.0142 0.0090  0.3282  0.1982  175 GLU A CB  
383  C CG  . GLU A 55  ? 1.3357 1.2376 1.0922 0.0514  0.3427  0.2007  175 GLU A CG  
384  C CD  . GLU A 55  ? 1.4349 1.3466 1.1506 0.0976  0.3401  0.1997  175 GLU A CD  
385  O OE1 . GLU A 55  ? 1.3804 1.3310 1.1349 0.0975  0.3483  0.2045  175 GLU A OE1 
386  O OE2 . GLU A 55  ? 1.5413 1.4235 1.1858 0.1341  0.3304  0.1936  175 GLU A OE2 
387  N N   . HIS A 56  ? 0.8819 0.9814 0.7958 0.0393  0.2752  0.1789  176 HIS A N   
388  C CA  . HIS A 56  ? 0.8231 0.9410 0.7242 0.0696  0.2691  0.1696  176 HIS A CA  
389  C C   . HIS A 56  ? 0.8399 0.9846 0.7466 0.0692  0.2296  0.1472  176 HIS A C   
390  O O   . HIS A 56  ? 0.7833 0.9254 0.6566 0.0938  0.2191  0.1303  176 HIS A O   
391  C CB  . HIS A 56  ? 0.8753 1.0344 0.8361 0.0672  0.2913  0.1858  176 HIS A CB  
392  C CG  . HIS A 56  ? 1.0890 1.3133 1.1321 0.0397  0.2730  0.1910  176 HIS A CG  
393  N ND1 . HIS A 56  ? 1.1303 1.3796 1.2223 0.0031  0.2686  0.2013  176 HIS A ND1 
394  C CD2 . HIS A 56  ? 1.0712 1.3415 1.1533 0.0446  0.2583  0.1875  176 HIS A CD2 
395  C CE1 . HIS A 56  ? 1.0441 1.3592 1.2002 -0.0114 0.2478  0.2049  176 HIS A CE1 
396  N NE2 . HIS A 56  ? 0.9646 1.2907 1.1153 0.0158  0.2434  0.1991  176 HIS A NE2 
397  N N   . GLN A 57  ? 0.7862 0.9571 0.7346 0.0395  0.2088  0.1459  177 GLN A N   
398  C CA  . GLN A 57  ? 0.6350 0.8283 0.5896 0.0384  0.1755  0.1277  177 GLN A CA  
399  C C   . GLN A 57  ? 0.6931 0.8434 0.5846 0.0523  0.1610  0.1112  177 GLN A C   
400  O O   . GLN A 57  ? 0.6392 0.7989 0.5182 0.0667  0.1411  0.0935  177 GLN A O   
401  C CB  . GLN A 57  ? 0.7523 0.9869 0.7632 0.0045  0.1580  0.1328  177 GLN A CB  
402  C CG  . GLN A 57  ? 0.8036 1.0690 0.8302 0.0066  0.1304  0.1203  177 GLN A CG  
403  C CD  . GLN A 57  ? 0.7497 1.0451 0.8027 0.0276  0.1386  0.1224  177 GLN A CD  
404  O OE1 . GLN A 57  ? 0.8434 1.1680 0.9384 0.0282  0.1578  0.1412  177 GLN A OE1 
405  N NE2 . GLN A 57  ? 0.5090 0.7958 0.5397 0.0445  0.1274  0.1031  177 GLN A NE2 
406  N N   . LEU A 58  ? 0.7695 0.8724 0.6239 0.0491  0.1746  0.1183  178 LEU A N   
407  C CA  . LEU A 58  ? 0.9003 0.9596 0.6922 0.0695  0.1672  0.1088  178 LEU A CA  
408  C C   . LEU A 58  ? 0.8605 0.9157 0.6068 0.1103  0.1683  0.1027  178 LEU A C   
409  O O   . LEU A 58  ? 0.7246 0.7796 0.4403 0.1310  0.1490  0.0885  178 LEU A O   
410  C CB  . LEU A 58  ? 0.8980 0.8979 0.6568 0.0601  0.1907  0.1215  178 LEU A CB  
411  C CG  . LEU A 58  ? 0.8592 0.8080 0.5483 0.0900  0.1911  0.1188  178 LEU A CG  
412  C CD1 . LEU A 58  ? 0.7939 0.7590 0.4863 0.0895  0.1598  0.1002  178 LEU A CD1 
413  C CD2 . LEU A 58  ? 0.9535 0.8324 0.6091 0.0800  0.2231  0.1333  178 LEU A CD2 
414  N N   . ARG A 59  ? 0.8399 0.8947 0.5817 0.1213  0.1910  0.1128  179 ARG A N   
415  C CA  . ARG A 59  ? 0.8829 0.9386 0.5789 0.1563  0.1907  0.1033  179 ARG A CA  
416  C C   . ARG A 59  ? 0.8716 0.9723 0.5931 0.1564  0.1632  0.0779  179 ARG A C   
417  O O   . ARG A 59  ? 0.7425 0.8510 0.4298 0.1776  0.1443  0.0596  179 ARG A O   
418  C CB  . ARG A 59  ? 0.7991 0.8456 0.4894 0.1640  0.2233  0.1174  179 ARG A CB  
419  C CG  . ARG A 59  ? 0.8400 0.8904 0.4820 0.1952  0.2220  0.1022  179 ARG A CG  
420  C CD  . ARG A 59  ? 0.9531 0.9865 0.5845 0.2034  0.2595  0.1170  179 ARG A CD  
421  N NE  . ARG A 59  ? 1.0719 1.0573 0.6664 0.2129  0.2905  0.1439  179 ARG A NE  
422  C CZ  . ARG A 59  ? 1.1606 1.1088 0.6719 0.2482  0.3001  0.1488  179 ARG A CZ  
423  N NH1 . ARG A 59  ? 1.1590 1.1221 0.6182 0.2751  0.2756  0.1262  179 ARG A NH1 
424  N NH2 . ARG A 59  ? 1.2076 1.1053 0.6878 0.2566  0.3350  0.1765  179 ARG A NH2 
425  N N   . ARG A 60  ? 0.6796 0.8122 0.4640 0.1329  0.1627  0.0780  180 ARG A N   
426  C CA  . ARG A 60  ? 0.8232 0.9912 0.6374 0.1302  0.1447  0.0570  180 ARG A CA  
427  C C   . ARG A 60  ? 0.8691 1.0437 0.6793 0.1289  0.1160  0.0416  180 ARG A C   
428  O O   . ARG A 60  ? 0.7773 0.9693 0.5811 0.1393  0.1013  0.0189  180 ARG A O   
429  C CB  . ARG A 60  ? 0.8440 1.0415 0.7251 0.1092  0.1532  0.0684  180 ARG A CB  
430  C CG  . ARG A 60  ? 0.8824 1.0929 0.7779 0.1185  0.1698  0.0613  180 ARG A CG  
431  C CD  . ARG A 60  ? 0.9198 1.1382 0.8520 0.1139  0.1998  0.0875  180 ARG A CD  
432  N NE  . ARG A 60  ? 0.8915 1.1465 0.8884 0.0931  0.1937  0.1058  180 ARG A NE  
433  C CZ  . ARG A 60  ? 0.8835 1.1659 0.9319 0.0885  0.2149  0.1303  180 ARG A CZ  
434  N NH1 . ARG A 60  ? 0.8644 1.1335 0.9066 0.1033  0.2484  0.1398  180 ARG A NH1 
435  N NH2 . ARG A 60  ? 0.7725 1.0986 0.8777 0.0708  0.2028  0.1461  180 ARG A NH2 
436  N N   . GLU A 61  ? 0.7714 0.9308 0.5855 0.1145  0.1106  0.0524  181 GLU A N   
437  C CA  . GLU A 61  ? 0.7736 0.9321 0.5805 0.1148  0.0887  0.0404  181 GLU A CA  
438  C C   . GLU A 61  ? 0.7687 0.9165 0.5243 0.1458  0.0809  0.0301  181 GLU A C   
439  O O   . GLU A 61  ? 0.6467 0.8182 0.4072 0.1544  0.0626  0.0117  181 GLU A O   
440  C CB  . GLU A 61  ? 0.7483 0.8805 0.5559 0.0933  0.0894  0.0526  181 GLU A CB  
441  C CG  . GLU A 61  ? 0.7493 0.8690 0.5403 0.0963  0.0729  0.0419  181 GLU A CG  
442  C CD  . GLU A 61  ? 0.7461 0.8294 0.5277 0.0723  0.0770  0.0500  181 GLU A CD  
443  O OE1 . GLU A 61  ? 0.7868 0.8603 0.5800 0.0501  0.0906  0.0625  181 GLU A OE1 
444  O OE2 . GLU A 61  ? 0.7764 0.8404 0.5393 0.0743  0.0685  0.0424  181 GLU A OE2 
445  N N   . VAL A 62  ? 0.7543 0.8703 0.4627 0.1640  0.0960  0.0437  182 VAL A N   
446  C CA  . VAL A 62  ? 0.7998 0.9082 0.4541 0.1992  0.0887  0.0405  182 VAL A CA  
447  C C   . VAL A 62  ? 0.8299 0.9793 0.4752 0.2172  0.0751  0.0190  182 VAL A C   
448  O O   . VAL A 62  ? 0.7724 0.9509 0.4083 0.2347  0.0536  0.0031  182 VAL A O   
449  C CB  . VAL A 62  ? 0.9460 1.0029 0.5457 0.2175  0.1138  0.0653  182 VAL A CB  
450  C CG1 . VAL A 62  ? 1.0080 1.0646 0.5474 0.2622  0.1060  0.0662  182 VAL A CG1 
451  C CG2 . VAL A 62  ? 0.7950 0.8058 0.3989 0.1966  0.1283  0.0808  182 VAL A CG2 
452  N N   . GLU A 63  ? 0.7598 0.9132 0.4098 0.2113  0.0889  0.0170  183 GLU A N   
453  C CA  . GLU A 63  ? 0.8082 0.9914 0.4410 0.2241  0.0801  -0.0073 183 GLU A CA  
454  C C   . GLU A 63  ? 0.8496 1.0744 0.5326 0.2059  0.0621  -0.0366 183 GLU A C   
455  O O   . GLU A 63  ? 0.7952 1.0540 0.4675 0.2160  0.0420  -0.0624 183 GLU A O   
456  C CB  . GLU A 63  ? 0.7974 0.9621 0.4166 0.2231  0.1070  -0.0006 183 GLU A CB  
457  C CG  . GLU A 63  ? 0.8769 0.9994 0.4377 0.2457  0.1290  0.0261  183 GLU A CG  
458  C CD  . GLU A 63  ? 1.0168 1.1215 0.5566 0.2499  0.1577  0.0308  183 GLU A CD  
459  O OE1 . GLU A 63  ? 0.9954 1.1184 0.5663 0.2352  0.1616  0.0132  183 GLU A OE1 
460  O OE2 . GLU A 63  ? 0.9211 0.9883 0.4105 0.2699  0.1807  0.0531  183 GLU A OE2 
461  N N   . ILE A 64  ? 0.7170 0.9416 0.4554 0.1794  0.0700  -0.0321 184 ILE A N   
462  C CA  . ILE A 64  ? 0.7409 0.9954 0.5261 0.1632  0.0614  -0.0557 184 ILE A CA  
463  C C   . ILE A 64  ? 0.6250 0.9014 0.4212 0.1661  0.0377  -0.0678 184 ILE A C   
464  O O   . ILE A 64  ? 0.5858 0.8948 0.3959 0.1651  0.0253  -0.0959 184 ILE A O   
465  C CB  . ILE A 64  ? 0.7632 1.0129 0.6009 0.1405  0.0770  -0.0416 184 ILE A CB  
466  C CG1 . ILE A 64  ? 0.7567 0.9942 0.5956 0.1394  0.1039  -0.0321 184 ILE A CG1 
467  C CG2 . ILE A 64  ? 0.6274 0.8996 0.5090 0.1276  0.0714  -0.0610 184 ILE A CG2 
468  C CD1 . ILE A 64  ? 0.7217 0.9641 0.6145 0.1230  0.1195  -0.0122 184 ILE A CD1 
469  N N   . GLN A 65  ? 0.6446 0.9019 0.4354 0.1682  0.0340  -0.0478 185 GLN A N   
470  C CA  . GLN A 65  ? 0.7201 0.9920 0.5228 0.1722  0.0174  -0.0555 185 GLN A CA  
471  C C   . GLN A 65  ? 0.7053 1.0043 0.4773 0.2001  0.0002  -0.0677 185 GLN A C   
472  O O   . GLN A 65  ? 0.6109 0.9460 0.4076 0.2023  -0.0146 -0.0858 185 GLN A O   
473  C CB  . GLN A 65  ? 0.6691 0.9043 0.4643 0.1673  0.0218  -0.0324 185 GLN A CB  
474  C CG  . GLN A 65  ? 0.7185 0.9606 0.5243 0.1718  0.0104  -0.0385 185 GLN A CG  
475  C CD  . GLN A 65  ? 0.7946 0.9932 0.5892 0.1612  0.0175  -0.0206 185 GLN A CD  
476  O OE1 . GLN A 65  ? 0.9195 1.0857 0.6996 0.1488  0.0291  -0.0044 185 GLN A OE1 
477  N NE2 . GLN A 65  ? 0.7569 0.9541 0.5580 0.1643  0.0123  -0.0251 185 GLN A NE2 
478  N N   . SER A 66  ? 0.7536 1.0393 0.4731 0.2230  0.0031  -0.0566 186 SER A N   
479  C CA  . SER A 66  ? 0.8375 1.1539 0.5205 0.2562  -0.0149 -0.0626 186 SER A CA  
480  C C   . SER A 66  ? 0.8644 1.2403 0.5630 0.2526  -0.0338 -0.0990 186 SER A C   
481  O O   . SER A 66  ? 0.9373 1.3629 0.6312 0.2723  -0.0566 -0.1118 186 SER A O   
482  C CB  . SER A 66  ? 0.8495 1.1319 0.4650 0.2845  -0.0031 -0.0386 186 SER A CB  
483  O OG  . SER A 66  ? 0.8878 1.1630 0.4866 0.2771  0.0081  -0.0449 186 SER A OG  
484  N N   . HIS A 67  ? 0.7454 1.1178 0.4640 0.2268  -0.0228 -0.1161 187 HIS A N   
485  C CA  . HIS A 67  ? 0.8490 1.2664 0.5772 0.2170  -0.0350 -0.1553 187 HIS A CA  
486  C C   . HIS A 67  ? 0.7197 1.1613 0.5170 0.1874  -0.0356 -0.1801 187 HIS A C   
487  O O   . HIS A 67  ? 0.7753 1.2506 0.5901 0.1715  -0.0414 -0.2169 187 HIS A O   
488  C CB  . HIS A 67  ? 0.8486 1.2387 0.5466 0.2099  -0.0159 -0.1613 187 HIS A CB  
489  C CG  . HIS A 67  ? 0.9061 1.2785 0.5298 0.2409  -0.0147 -0.1436 187 HIS A CG  
490  N ND1 . HIS A 67  ? 0.7547 1.0740 0.3532 0.2517  0.0080  -0.1051 187 HIS A ND1 
491  C CD2 . HIS A 67  ? 0.9783 1.3788 0.5460 0.2633  -0.0319 -0.1587 187 HIS A CD2 
492  C CE1 . HIS A 67  ? 0.9702 1.2792 0.4991 0.2815  0.0091  -0.0951 187 HIS A CE1 
493  N NE2 . HIS A 67  ? 0.8479 1.2020 0.3635 0.2875  -0.0164 -0.1241 187 HIS A NE2 
494  N N   . LEU A 68  ? 0.7076 1.1287 0.5405 0.1790  -0.0273 -0.1613 188 LEU A N   
495  C CA  . LEU A 68  ? 0.6035 1.0413 0.4975 0.1556  -0.0236 -0.1792 188 LEU A CA  
496  C C   . LEU A 68  ? 0.5502 1.0357 0.4665 0.1660  -0.0446 -0.1900 188 LEU A C   
497  O O   . LEU A 68  ? 0.6608 1.1458 0.5526 0.1916  -0.0549 -0.1684 188 LEU A O   
498  C CB  . LEU A 68  ? 0.6806 1.0754 0.5979 0.1427  -0.0041 -0.1534 188 LEU A CB  
499  C CG  . LEU A 68  ? 0.6561 1.0168 0.5742 0.1295  0.0195  -0.1425 188 LEU A CG  
500  C CD1 . LEU A 68  ? 0.6412 0.9730 0.5766 0.1219  0.0300  -0.1127 188 LEU A CD1 
501  C CD2 . LEU A 68  ? 0.5773 0.9465 0.5259 0.1106  0.0346  -0.1711 188 LEU A CD2 
502  N N   . ARG A 69  ? 0.6211 1.1458 0.5861 0.1462  -0.0469 -0.2228 189 ARG A N   
503  C CA  . ARG A 69  ? 0.6161 1.1952 0.6168 0.1530  -0.0638 -0.2347 189 ARG A CA  
504  C C   . ARG A 69  ? 0.6927 1.2721 0.7578 0.1261  -0.0459 -0.2490 189 ARG A C   
505  O O   . ARG A 69  ? 0.6935 1.2886 0.7913 0.0992  -0.0369 -0.2818 189 ARG A O   
506  C CB  . ARG A 69  ? 0.7103 1.3620 0.7071 0.1586  -0.0910 -0.2668 189 ARG A CB  
507  C CG  . ARG A 69  ? 0.7446 1.4041 0.6732 0.1942  -0.1103 -0.2497 189 ARG A CG  
508  C CD  . ARG A 69  ? 0.7880 1.4433 0.6999 0.2310  -0.1161 -0.2127 189 ARG A CD  
509  N NE  . ARG A 69  ? 0.9329 1.6054 0.7820 0.2699  -0.1338 -0.1978 189 ARG A NE  
510  C CZ  . ARG A 69  ? 0.9545 1.5669 0.7402 0.2875  -0.1210 -0.1689 189 ARG A CZ  
511  N NH1 . ARG A 69  ? 0.8261 1.3658 0.6092 0.2670  -0.0940 -0.1536 189 ARG A NH1 
512  N NH2 . ARG A 69  ? 0.8742 1.5000 0.6029 0.3256  -0.1331 -0.1536 189 ARG A NH2 
513  N N   . HIS A 70  ? 0.5931 1.1494 0.6716 0.1336  -0.0374 -0.2246 190 HIS A N   
514  C CA  . HIS A 70  ? 0.6990 1.2488 0.8310 0.1137  -0.0171 -0.2318 190 HIS A CA  
515  C C   . HIS A 70  ? 0.5507 1.0922 0.6866 0.1319  -0.0164 -0.2083 190 HIS A C   
516  O O   . HIS A 70  ? 0.6454 1.1491 0.7361 0.1504  -0.0192 -0.1789 190 HIS A O   
517  C CB  . HIS A 70  ? 0.6068 1.0996 0.7381 0.0950  0.0098  -0.2220 190 HIS A CB  
518  C CG  . HIS A 70  ? 0.6953 1.1815 0.8788 0.0743  0.0356  -0.2341 190 HIS A CG  
519  N ND1 . HIS A 70  ? 0.6375 1.1028 0.8354 0.0788  0.0481  -0.2150 190 HIS A ND1 
520  C CD2 . HIS A 70  ? 0.5878 1.0786 0.8079 0.0495  0.0558  -0.2630 190 HIS A CD2 
521  C CE1 . HIS A 70  ? 0.5668 1.0259 0.8088 0.0602  0.0750  -0.2289 190 HIS A CE1 
522  N NE2 . HIS A 70  ? 0.7183 1.1909 0.9764 0.0413  0.0816  -0.2583 190 HIS A NE2 
523  N N   . PRO A 71  ? 0.5609 1.1344 0.7505 0.1255  -0.0091 -0.2225 191 PRO A N   
524  C CA  . PRO A 71  ? 0.5632 1.1278 0.7589 0.1434  -0.0030 -0.2024 191 PRO A CA  
525  C C   . PRO A 71  ? 0.5328 1.0209 0.6927 0.1436  0.0147  -0.1727 191 PRO A C   
526  O O   . PRO A 71  ? 0.5978 1.0601 0.7304 0.1629  0.0157  -0.1511 191 PRO A O   
527  C CB  . PRO A 71  ? 0.4642 1.0697 0.7326 0.1264  0.0112  -0.2269 191 PRO A CB  
528  C CG  . PRO A 71  ? 0.5807 1.2428 0.8791 0.1062  -0.0013 -0.2643 191 PRO A CG  
529  C CD  . PRO A 71  ? 0.6119 1.2328 0.8606 0.0993  -0.0037 -0.2613 191 PRO A CD  
530  N N   . ASN A 72  ? 0.5361 0.9897 0.6945 0.1229  0.0289  -0.1720 192 ASN A N   
531  C CA  . ASN A 72  ? 0.5875 0.9817 0.7155 0.1209  0.0416  -0.1455 192 ASN A CA  
532  C C   . ASN A 72  ? 0.7199 1.0857 0.8008 0.1216  0.0315  -0.1286 192 ASN A C   
533  O O   . ASN A 72  ? 0.6686 0.9993 0.7347 0.1127  0.0399  -0.1116 192 ASN A O   
534  C CB  . ASN A 72  ? 0.4703 0.8483 0.6310 0.1027  0.0675  -0.1492 192 ASN A CB  
535  C CG  . ASN A 72  ? 0.5928 0.9908 0.8017 0.1001  0.0847  -0.1636 192 ASN A CG  
536  O OD1 . ASN A 72  ? 0.7452 1.1687 1.0018 0.0838  0.0981  -0.1882 192 ASN A OD1 
537  N ND2 . ASN A 72  ? 0.5185 0.9016 0.7152 0.1148  0.0880  -0.1493 192 ASN A ND2 
538  N N   . ILE A 73  ? 0.6212 1.0065 0.6802 0.1331  0.0140  -0.1323 193 ILE A N   
539  C CA  . ILE A 73  ? 0.6123 0.9690 0.6262 0.1358  0.0080  -0.1147 193 ILE A CA  
540  C C   . ILE A 73  ? 0.6629 1.0132 0.6360 0.1601  -0.0040 -0.1027 193 ILE A C   
541  O O   . ILE A 73  ? 0.6709 1.0615 0.6490 0.1779  -0.0156 -0.1138 193 ILE A O   
542  C CB  . ILE A 73  ? 0.5780 0.9518 0.5949 0.1279  0.0069  -0.1278 193 ILE A CB  
543  C CG1 . ILE A 73  ? 0.4993 0.8685 0.5530 0.1069  0.0262  -0.1360 193 ILE A CG1 
544  C CG2 . ILE A 73  ? 0.4848 0.8299 0.4574 0.1329  0.0044  -0.1074 193 ILE A CG2 
545  C CD1 . ILE A 73  ? 0.5536 0.9276 0.6059 0.0990  0.0323  -0.1480 193 ILE A CD1 
546  N N   . LEU A 74  ? 0.6365 0.9374 0.5695 0.1609  0.0001  -0.0800 194 LEU A N   
547  C CA  . LEU A 74  ? 0.6480 0.9262 0.5361 0.1843  -0.0026 -0.0654 194 LEU A CA  
548  C C   . LEU A 74  ? 0.7018 1.0007 0.5681 0.2007  -0.0118 -0.0661 194 LEU A C   
549  O O   . LEU A 74  ? 0.5904 0.8902 0.4555 0.1879  -0.0112 -0.0684 194 LEU A O   
550  C CB  . LEU A 74  ? 0.6731 0.8880 0.5221 0.1731  0.0073  -0.0456 194 LEU A CB  
551  C CG  . LEU A 74  ? 0.7995 0.9719 0.6002 0.1951  0.0146  -0.0306 194 LEU A CG  
552  C CD1 . LEU A 74  ? 0.7255 0.8917 0.5319 0.2072  0.0210  -0.0324 194 LEU A CD1 
553  C CD2 . LEU A 74  ? 0.9027 1.0136 0.6631 0.1768  0.0250  -0.0160 194 LEU A CD2 
554  N N   . ARG A 75  ? 0.6974 1.0132 0.5442 0.2324  -0.0185 -0.0620 195 ARG A N   
555  C CA  . ARG A 75  ? 0.7904 1.1286 0.6074 0.2551  -0.0284 -0.0605 195 ARG A CA  
556  C C   . ARG A 75  ? 0.9337 1.2101 0.6913 0.2664  -0.0148 -0.0337 195 ARG A C   
557  O O   . ARG A 75  ? 0.9073 1.1319 0.6395 0.2721  -0.0004 -0.0158 195 ARG A O   
558  C CB  . ARG A 75  ? 0.7642 1.1595 0.5883 0.2891  -0.0434 -0.0652 195 ARG A CB  
559  C CG  . ARG A 75  ? 0.7929 1.2663 0.6757 0.2767  -0.0604 -0.0978 195 ARG A CG  
560  C CD  . ARG A 75  ? 0.9905 1.4957 0.8650 0.2682  -0.0733 -0.1175 195 ARG A CD  
561  N NE  . ARG A 75  ? 0.9869 1.4962 0.8031 0.3033  -0.0825 -0.1021 195 ARG A NE  
562  C CZ  . ARG A 75  ? 1.0086 1.5812 0.8190 0.3365  -0.1035 -0.1044 195 ARG A CZ  
563  N NH1 . ARG A 75  ? 0.9636 1.6058 0.8309 0.3355  -0.1180 -0.1237 195 ARG A NH1 
564  N NH2 . ARG A 75  ? 0.9575 1.5272 0.7063 0.3724  -0.1089 -0.0858 195 ARG A NH2 
565  N N   . LEU A 76  ? 0.8573 1.1348 0.5914 0.2681  -0.0155 -0.0323 196 LEU A N   
566  C CA  . LEU A 76  ? 0.9061 1.1301 0.5831 0.2836  0.0005  -0.0069 196 LEU A CA  
567  C C   . LEU A 76  ? 0.8862 1.1413 0.5244 0.3260  -0.0095 -0.0021 196 LEU A C   
568  O O   . LEU A 76  ? 0.8393 1.1305 0.4734 0.3271  -0.0206 -0.0156 196 LEU A O   
569  C CB  . LEU A 76  ? 0.8665 1.0629 0.5437 0.2549  0.0129  -0.0037 196 LEU A CB  
570  C CG  . LEU A 76  ? 0.9998 1.1456 0.6238 0.2675  0.0332  0.0204  196 LEU A CG  
571  C CD1 . LEU A 76  ? 1.0783 1.1614 0.6680 0.2768  0.0522  0.0423  196 LEU A CD1 
572  C CD2 . LEU A 76  ? 1.0050 1.1349 0.6461 0.2355  0.0462  0.0227  196 LEU A CD2 
573  N N   . TYR A 77  ? 0.9754 1.2161 0.5817 0.3629  -0.0043 0.0177  197 TYR A N   
574  C CA  . TYR A 77  ? 0.9709 1.2543 0.5425 0.4108  -0.0174 0.0254  197 TYR A CA  
575  C C   . TYR A 77  ? 1.0684 1.3150 0.5755 0.4304  -0.0036 0.0448  197 TYR A C   
576  O O   . TYR A 77  ? 0.9717 1.2631 0.4650 0.4532  -0.0193 0.0396  197 TYR A O   
577  C CB  . TYR A 77  ? 1.0124 1.2897 0.5701 0.4508  -0.0110 0.0465  197 TYR A CB  
578  C CG  . TYR A 77  ? 1.0236 1.3447 0.6433 0.4396  -0.0230 0.0292  197 TYR A CG  
579  C CD1 . TYR A 77  ? 1.0335 1.4538 0.7018 0.4428  -0.0539 0.0038  197 TYR A CD1 
580  C CD2 . TYR A 77  ? 1.0033 1.2656 0.6319 0.4240  -0.0015 0.0365  197 TYR A CD2 
581  C CE1 . TYR A 77  ? 0.9739 1.4330 0.7031 0.4319  -0.0598 -0.0109 197 TYR A CE1 
582  C CE2 . TYR A 77  ? 0.8794 1.1768 0.5607 0.4162  -0.0080 0.0226  197 TYR A CE2 
583  C CZ  . TYR A 77  ? 0.9736 1.3692 0.7078 0.4208  -0.0355 0.0003  197 TYR A CZ  
584  O OH  . TYR A 77  ? 0.9849 1.4141 0.7756 0.4123  -0.0370 -0.0124 197 TYR A OH  
585  N N   . GLY A 78  ? 1.0858 1.2487 0.5672 0.4150  0.0280  0.0646  198 GLY A N   
586  C CA  . GLY A 78  ? 1.2008 1.3192 0.6232 0.4322  0.0493  0.0860  198 GLY A CA  
587  C C   . GLY A 78  ? 1.1470 1.1750 0.5559 0.4059  0.0867  0.1047  198 GLY A C   
588  O O   . GLY A 78  ? 1.0238 1.0247 0.4657 0.3731  0.0928  0.0994  198 GLY A O   
589  N N   . TYR A 79  ? 1.1121 1.0947 0.4738 0.4184  0.1119  0.1252  199 TYR A N   
590  C CA  . TYR A 79  ? 1.1880 1.0884 0.5384 0.3910  0.1506  0.1422  199 TYR A CA  
591  C C   . TYR A 79  ? 1.2562 1.0952 0.5511 0.4233  0.1836  0.1715  199 TYR A C   
592  O O   . TYR A 79  ? 1.3098 1.1782 0.5880 0.4605  0.1717  0.1747  199 TYR A O   
593  C CB  . TYR A 79  ? 1.0709 0.9869 0.4690 0.3424  0.1490  0.1268  199 TYR A CB  
594  C CG  . TYR A 79  ? 1.2628 1.1714 0.6286 0.3551  0.1653  0.1376  199 TYR A CG  
595  C CD1 . TYR A 79  ? 1.2377 1.2020 0.5906 0.3796  0.1420  0.1248  199 TYR A CD1 
596  C CD2 . TYR A 79  ? 1.3773 1.2226 0.7300 0.3387  0.2050  0.1581  199 TYR A CD2 
597  C CE1 . TYR A 79  ? 1.3521 1.3041 0.6834 0.3872  0.1561  0.1314  199 TYR A CE1 
598  C CE2 . TYR A 79  ? 1.3075 1.1423 0.6298 0.3522  0.2248  0.1699  199 TYR A CE2 
599  C CZ  . TYR A 79  ? 1.3186 1.2055 0.6347 0.3756  0.1979  0.1552  199 TYR A CZ  
600  O OH  . TYR A 79  ? 1.3843 1.2567 0.6794 0.3848  0.2149  0.1629  199 TYR A OH  
601  N N   . PHE A 80  ? 1.1991 0.9534 0.4738 0.4045  0.2252  0.1897  200 PHE A N   
602  C CA  . PHE A 80  ? 1.3835 1.0691 0.6186 0.4258  0.2633  0.2152  200 PHE A CA  
603  C C   . PHE A 80  ? 1.4293 1.0330 0.6618 0.3817  0.3081  0.2252  200 PHE A C   
604  O O   . PHE A 80  ? 1.4288 1.0280 0.6923 0.3375  0.3053  0.2113  200 PHE A O   
605  C CB  . PHE A 80  ? 1.4083 1.0701 0.6088 0.4800  0.2704  0.2319  200 PHE A CB  
606  C CG  . PHE A 80  ? 1.4835 1.1003 0.6793 0.4752  0.2838  0.2346  200 PHE A CG  
607  C CD1 . PHE A 80  ? 1.3244 0.9982 0.5475 0.4728  0.2502  0.2175  200 PHE A CD1 
608  C CD2 . PHE A 80  ? 1.5414 1.0546 0.7040 0.4734  0.3333  0.2528  200 PHE A CD2 
609  C CE1 . PHE A 80  ? 1.3252 0.9521 0.5388 0.4703  0.2657  0.2203  200 PHE A CE1 
610  C CE2 . PHE A 80  ? 1.4820 0.9450 0.6344 0.4680  0.3492  0.2530  200 PHE A CE2 
611  C CZ  . PHE A 80  ? 1.4298 0.9491 0.6057 0.4677  0.3153  0.2377  200 PHE A CZ  
612  N N   . HIS A 81  ? 1.4288 0.9738 0.6373 0.3890  0.3460  0.2444  201 HIS A N   
613  C CA  . HIS A 81  ? 1.5900 1.0613 0.8041 0.3425  0.3914  0.2521  201 HIS A CA  
614  C C   . HIS A 81  ? 1.7146 1.0959 0.8880 0.3677  0.4389  0.2743  201 HIS A C   
615  O O   . HIS A 81  ? 1.8043 1.1863 0.9437 0.4253  0.4368  0.2869  201 HIS A O   
616  C CB  . HIS A 81  ? 1.5656 1.0716 0.8173 0.3057  0.3941  0.2480  201 HIS A CB  
617  C CG  . HIS A 81  ? 1.6696 1.2009 0.9077 0.3413  0.3907  0.2556  201 HIS A CG  
618  N ND1 . HIS A 81  ? 1.6849 1.1776 0.9235 0.3320  0.4287  0.2700  201 HIS A ND1 
619  C CD2 . HIS A 81  ? 1.7271 1.3180 0.9507 0.3832  0.3545  0.2485  201 HIS A CD2 
620  C CE1 . HIS A 81  ? 1.6002 1.1217 0.8180 0.3697  0.4171  0.2729  201 HIS A CE1 
621  N NE2 . HIS A 81  ? 1.6484 1.2300 0.8561 0.3992  0.3714  0.2589  201 HIS A NE2 
622  N N   . ASP A 82  ? 1.2530 1.1545 0.8653 0.3472  0.2644  0.2623  202 ASP A N   
623  C CA  . ASP A 82  ? 1.3567 1.1893 0.9378 0.3570  0.3082  0.2903  202 ASP A CA  
624  C C   . ASP A 82  ? 1.4493 1.2749 1.0641 0.3106  0.3300  0.3177  202 ASP A C   
625  O O   . ASP A 82  ? 1.6103 1.3643 1.2101 0.2793  0.3605  0.3300  202 ASP A O   
626  C CB  . ASP A 82  ? 1.5263 1.2808 1.0696 0.3446  0.3203  0.2766  202 ASP A CB  
627  C CG  . ASP A 82  ? 1.5709 1.3051 1.1365 0.2714  0.3036  0.2549  202 ASP A CG  
628  O OD1 . ASP A 82  ? 1.6756 1.4754 1.2882 0.2402  0.2715  0.2427  202 ASP A OD1 
629  O OD2 . ASP A 82  ? 1.5684 1.2173 1.0979 0.2477  0.3240  0.2506  202 ASP A OD2 
630  N N   . ALA A 83  ? 1.4738 1.3734 1.1325 0.3054  0.3156  0.3279  203 ALA A N   
631  C CA  . ALA A 83  ? 1.6490 1.5689 1.3510 0.2684  0.3355  0.3606  203 ALA A CA  
632  C C   . ALA A 83  ? 1.6138 1.5179 1.3485 0.1843  0.3285  0.3519  203 ALA A C   
633  O O   . ALA A 83  ? 1.7006 1.6204 1.4745 0.1418  0.3453  0.3787  203 ALA A O   
634  C CB  . ALA A 83  ? 1.7367 1.6104 1.4126 0.3010  0.3845  0.3988  203 ALA A CB  
635  N N   . THR A 84  ? 1.5400 1.4162 1.2579 0.1596  0.3033  0.3152  204 THR A N   
636  C CA  . THR A 84  ? 1.5038 1.3659 1.2427 0.0813  0.2894  0.3003  204 THR A CA  
637  C C   . THR A 84  ? 1.3688 1.2731 1.1189 0.0709  0.2456  0.2657  204 THR A C   
638  O O   . THR A 84  ? 1.2077 1.1625 0.9987 0.0214  0.2219  0.2607  204 THR A O   
639  C CB  . THR A 84  ? 1.6407 1.3851 1.3260 0.0540  0.3157  0.2916  204 THR A CB  
640  O OG1 . THR A 84  ? 1.6945 1.3894 1.3234 0.1055  0.3164  0.2712  204 THR A OG1 
641  C CG2 . THR A 84  ? 1.7901 1.4828 1.4642 0.0550  0.3644  0.3280  204 THR A CG2 
642  N N   . ARG A 85  ? 1.3584 1.2463 1.0727 0.1189  0.2359  0.2438  205 ARG A N   
643  C CA  . ARG A 85  ? 1.2406 1.1602 0.9615 0.1144  0.1998  0.2120  205 ARG A CA  
644  C C   . ARG A 85  ? 1.1741 1.1396 0.8916 0.1748  0.1867  0.2051  205 ARG A C   
645  O O   . ARG A 85  ? 1.1167 1.0774 0.8133 0.2241  0.2040  0.2197  205 ARG A O   
646  C CB  . ARG A 85  ? 1.2902 1.1327 0.9675 0.0976  0.1995  0.1855  205 ARG A CB  
647  C CG  . ARG A 85  ? 1.3945 1.1724 1.0587 0.0333  0.2113  0.1852  205 ARG A CG  
648  C CD  . ARG A 85  ? 1.4602 1.1413 1.0619 0.0313  0.2206  0.1622  205 ARG A CD  
649  N NE  . ARG A 85  ? 1.5864 1.1851 1.1593 -0.0310 0.2355  0.1591  205 ARG A NE  
650  C CZ  . ARG A 85  ? 1.7785 1.2949 1.3163 -0.0365 0.2755  0.1773  205 ARG A CZ  
651  N NH1 . ARG A 85  ? 1.7427 1.2545 1.2708 0.0229  0.3047  0.2025  205 ARG A NH1 
652  N NH2 . ARG A 85  ? 1.8946 1.3293 1.4022 -0.1019 0.2871  0.1698  205 ARG A NH2 
653  N N   . VAL A 86  ? 1.0487 1.0561 0.7828 0.1693  0.1566  0.1824  206 VAL A N   
654  C CA  . VAL A 86  ? 0.9094 0.9498 0.6357 0.2152  0.1416  0.1682  206 VAL A CA  
655  C C   . VAL A 86  ? 0.9364 0.9551 0.6466 0.2123  0.1259  0.1371  206 VAL A C   
656  O O   . VAL A 86  ? 1.0190 1.0288 0.7384 0.1734  0.1142  0.1233  206 VAL A O   
657  C CB  . VAL A 86  ? 0.8534 0.9585 0.6100 0.2167  0.1256  0.1713  206 VAL A CB  
658  C CG1 . VAL A 86  ? 0.7895 0.9135 0.5283 0.2582  0.1116  0.1527  206 VAL A CG1 
659  C CG2 . VAL A 86  ? 0.9356 1.0685 0.7117 0.2213  0.1444  0.2073  206 VAL A CG2 
660  N N   . TYR A 87  ? 0.9394 0.9549 0.6257 0.2546  0.1257  0.1280  207 TYR A N   
661  C CA  . TYR A 87  ? 0.9399 0.9405 0.6143 0.2568  0.1161  0.1046  207 TYR A CA  
662  C C   . TYR A 87  ? 0.9428 0.9952 0.6299 0.2756  0.0920  0.0844  207 TYR A C   
663  O O   . TYR A 87  ? 0.8525 0.9337 0.5312 0.3114  0.0886  0.0861  207 TYR A O   
664  C CB  . TYR A 87  ? 1.0191 0.9750 0.6558 0.2884  0.1387  0.1132  207 TYR A CB  
665  C CG  . TYR A 87  ? 1.1777 1.0644 0.7910 0.2701  0.1687  0.1328  207 TYR A CG  
666  C CD1 . TYR A 87  ? 1.1449 1.0231 0.7508 0.2870  0.1909  0.1596  207 TYR A CD1 
667  C CD2 . TYR A 87  ? 1.1836 1.0067 0.7769 0.2349  0.1768  0.1241  207 TYR A CD2 
668  C CE1 . TYR A 87  ? 1.2588 1.0679 0.8437 0.2649  0.2216  0.1778  207 TYR A CE1 
669  C CE2 . TYR A 87  ? 1.3019 1.0505 0.8672 0.2111  0.2051  0.1388  207 TYR A CE2 
670  C CZ  . TYR A 87  ? 1.3809 1.1232 0.9449 0.2242  0.2280  0.1659  207 TYR A CZ  
671  O OH  . TYR A 87  ? 1.4742 1.1370 1.0108 0.1956  0.2594  0.1808  207 TYR A OH  
672  N N   . LEU A 88  ? 0.9230 0.9834 0.6265 0.2498  0.0762  0.0645  208 LEU A N   
673  C CA  . LEU A 88  ? 0.8759 0.9754 0.5916 0.2590  0.0565  0.0434  208 LEU A CA  
674  C C   . LEU A 88  ? 0.9160 1.0111 0.6281 0.2664  0.0548  0.0297  208 LEU A C   
675  O O   . LEU A 88  ? 0.9712 1.0307 0.6775 0.2485  0.0623  0.0277  208 LEU A O   
676  C CB  . LEU A 88  ? 0.8663 0.9804 0.6030 0.2301  0.0446  0.0346  208 LEU A CB  
677  C CG  . LEU A 88  ? 0.7524 0.8934 0.4940 0.2380  0.0415  0.0425  208 LEU A CG  
678  C CD1 . LEU A 88  ? 0.7330 0.8709 0.4728 0.2424  0.0568  0.0709  208 LEU A CD1 
679  C CD2 . LEU A 88  ? 0.6687 0.8208 0.4258 0.2154  0.0339  0.0358  208 LEU A CD2 
680  N N   . ILE A 89  ? 0.8102 0.9446 0.5244 0.2931  0.0447  0.0209  209 ILE A N   
681  C CA  . ILE A 89  ? 0.8408 0.9906 0.5598 0.3050  0.0434  0.0128  209 ILE A CA  
682  C C   . ILE A 89  ? 0.9029 1.0835 0.6507 0.2830  0.0258  -0.0099 209 ILE A C   
683  O O   . ILE A 89  ? 0.7742 0.9975 0.5331 0.2864  0.0088  -0.0234 209 ILE A O   
684  C CB  . ILE A 89  ? 0.9266 1.1153 0.6347 0.3477  0.0419  0.0196  209 ILE A CB  
685  C CG1 . ILE A 89  ? 0.9552 1.1096 0.6308 0.3730  0.0628  0.0443  209 ILE A CG1 
686  C CG2 . ILE A 89  ? 0.8362 1.0472 0.5515 0.3649  0.0459  0.0199  209 ILE A CG2 
687  C CD1 . ILE A 89  ? 0.9233 1.1162 0.5808 0.4223  0.0633  0.0548  209 ILE A CD1 
688  N N   . LEU A 90  ? 0.8975 1.0505 0.6520 0.2596  0.0314  -0.0144 210 LEU A N   
689  C CA  . LEU A 90  ? 0.8387 1.0091 0.6177 0.2372  0.0211  -0.0324 210 LEU A CA  
690  C C   . LEU A 90  ? 0.7850 0.9782 0.5811 0.2441  0.0239  -0.0371 210 LEU A C   
691  O O   . LEU A 90  ? 0.7482 0.9292 0.5310 0.2650  0.0380  -0.0245 210 LEU A O   
692  C CB  . LEU A 90  ? 0.7988 0.9301 0.5734 0.2092  0.0254  -0.0324 210 LEU A CB  
693  C CG  . LEU A 90  ? 0.8308 0.9544 0.5986 0.1998  0.0231  -0.0240 210 LEU A CG  
694  C CD1 . LEU A 90  ? 0.9003 0.9941 0.6624 0.1741  0.0269  -0.0190 210 LEU A CD1 
695  C CD2 . LEU A 90  ? 0.6882 0.8384 0.4655 0.1995  0.0129  -0.0341 210 LEU A CD2 
696  N N   . GLU A 91  ? 0.6097 0.8339 0.4338 0.2276  0.0139  -0.0533 211 GLU A N   
697  C CA  . GLU A 91  ? 0.6478 0.8993 0.4975 0.2283  0.0187  -0.0557 211 GLU A CA  
698  C C   . GLU A 91  ? 0.7306 0.9298 0.5647 0.2241  0.0377  -0.0482 211 GLU A C   
699  O O   . GLU A 91  ? 0.7642 0.9197 0.5821 0.2047  0.0394  -0.0511 211 GLU A O   
700  C CB  . GLU A 91  ? 0.6198 0.9057 0.5019 0.2032  0.0067  -0.0751 211 GLU A CB  
701  C CG  . GLU A 91  ? 0.7937 1.1062 0.7093 0.1970  0.0156  -0.0755 211 GLU A CG  
702  C CD  . GLU A 91  ? 0.7700 1.1006 0.7143 0.1648  0.0089  -0.0946 211 GLU A CD  
703  O OE1 . GLU A 91  ? 0.6738 1.0256 0.6499 0.1555  0.0190  -0.0938 211 GLU A OE1 
704  O OE2 . GLU A 91  ? 0.6672 0.9853 0.5987 0.1499  -0.0029 -0.1091 211 GLU A OE2 
705  N N   . TYR A 92  ? 0.7249 0.9306 0.5598 0.2450  0.0522  -0.0372 212 TYR A N   
706  C CA  . TYR A 92  ? 0.7366 0.8840 0.5444 0.2459  0.0723  -0.0306 212 TYR A CA  
707  C C   . TYR A 92  ? 0.7996 0.9550 0.6320 0.2280  0.0757  -0.0390 212 TYR A C   
708  O O   . TYR A 92  ? 0.6546 0.8691 0.5300 0.2287  0.0741  -0.0407 212 TYR A O   
709  C CB  . TYR A 92  ? 0.7831 0.9234 0.5707 0.2836  0.0932  -0.0118 212 TYR A CB  
710  C CG  . TYR A 92  ? 0.9354 1.0137 0.6885 0.2903  0.1173  -0.0053 212 TYR A CG  
711  C CD1 . TYR A 92  ? 0.8049 0.7986 0.5081 0.2711  0.1220  -0.0111 212 TYR A CD1 
712  C CD2 . TYR A 92  ? 1.0164 1.1236 0.7847 0.3164  0.1353  0.0074  212 TYR A CD2 
713  C CE1 . TYR A 92  ? 1.0783 1.0075 0.7381 0.2776  0.1428  -0.0081 212 TYR A CE1 
714  C CE2 . TYR A 92  ? 1.0364 1.0794 0.7637 0.3281  0.1606  0.0145  212 TYR A CE2 
715  C CZ  . TYR A 92  ? 1.0560 1.0048 0.7243 0.3086  0.1637  0.0049  212 TYR A CZ  
716  O OH  . TYR A 92  ? 1.2335 1.1114 0.8500 0.3204  0.1876  0.0091  212 TYR A OH  
717  N N   . ALA A 93  ? 0.7658 0.8645 0.5709 0.2111  0.0806  -0.0432 213 ALA A N   
718  C CA  . ALA A 93  ? 0.8314 0.9261 0.6495 0.1994  0.0889  -0.0480 213 ALA A CA  
719  C C   . ALA A 93  ? 0.7694 0.8102 0.5478 0.2148  0.1106  -0.0389 213 ALA A C   
720  O O   . ALA A 93  ? 0.8179 0.7969 0.5482 0.2065  0.1111  -0.0414 213 ALA A O   
721  C CB  . ALA A 93  ? 0.6897 0.7669 0.5032 0.1738  0.0785  -0.0586 213 ALA A CB  
722  N N   . PRO A 94  ? 0.7088 0.7751 0.5056 0.2372  0.1286  -0.0277 214 PRO A N   
723  C CA  . PRO A 94  ? 0.7594 0.7747 0.5127 0.2639  0.1551  -0.0146 214 PRO A CA  
724  C C   . PRO A 94  ? 0.9186 0.8695 0.6307 0.2545  0.1648  -0.0200 214 PRO A C   
725  O O   . PRO A 94  ? 0.8555 0.7344 0.5037 0.2697  0.1807  -0.0157 214 PRO A O   
726  C CB  . PRO A 94  ? 0.7494 0.8362 0.5541 0.2872  0.1702  0.0009  214 PRO A CB  
727  C CG  . PRO A 94  ? 0.7954 0.9675 0.6602 0.2740  0.1469  -0.0052 214 PRO A CG  
728  C CD  . PRO A 94  ? 0.8332 0.9863 0.6961 0.2377  0.1243  -0.0261 214 PRO A CD  
729  N N   . LEU A 95  ? 0.7680 0.7387 0.5082 0.2321  0.1574  -0.0291 215 LEU A N   
730  C CA  . LEU A 95  ? 0.9372 0.8560 0.6390 0.2302  0.1688  -0.0310 215 LEU A CA  
731  C C   . LEU A 95  ? 0.9674 0.8498 0.6327 0.2056  0.1483  -0.0440 215 LEU A C   
732  O O   . LEU A 95  ? 1.0367 0.8902 0.6746 0.2018  0.1520  -0.0468 215 LEU A O   
733  C CB  . LEU A 95  ? 0.8861 0.8445 0.6364 0.2279  0.1824  -0.0272 215 LEU A CB  
734  C CG  . LEU A 95  ? 0.9215 0.9287 0.7163 0.2496  0.2047  -0.0106 215 LEU A CG  
735  C CD1 . LEU A 95  ? 0.8174 0.8462 0.6501 0.2436  0.2239  -0.0053 215 LEU A CD1 
736  C CD2 . LEU A 95  ? 1.0282 0.9907 0.7716 0.2863  0.2267  0.0046  215 LEU A CD2 
737  N N   . GLY A 96  ? 0.8303 0.7204 0.4963 0.1913  0.1278  -0.0493 216 GLY A N   
738  C CA  . GLY A 96  ? 0.8963 0.7621 0.5314 0.1681  0.1085  -0.0573 216 GLY A CA  
739  C C   . GLY A 96  ? 0.8930 0.7925 0.5545 0.1539  0.0982  -0.0604 216 GLY A C   
740  O O   . GLY A 96  ? 0.9154 0.8545 0.6225 0.1561  0.1033  -0.0598 216 GLY A O   
741  N N   . THR A 97  ? 0.8425 0.7254 0.4720 0.1390  0.0845  -0.0632 217 THR A N   
742  C CA  . THR A 97  ? 0.8034 0.7189 0.4507 0.1316  0.0764  -0.0614 217 THR A CA  
743  C C   . THR A 97  ? 0.8935 0.7973 0.5297 0.1440  0.0927  -0.0588 217 THR A C   
744  O O   . THR A 97  ? 0.9336 0.7995 0.5365 0.1553  0.1058  -0.0592 217 THR A O   
745  C CB  . THR A 97  ? 0.8477 0.7688 0.4718 0.1126  0.0540  -0.0603 217 THR A CB  
746  O OG1 . THR A 97  ? 0.9283 0.8048 0.4965 0.1058  0.0501  -0.0656 217 THR A OG1 
747  C CG2 . THR A 97  ? 0.8375 0.7736 0.4783 0.1001  0.0416  -0.0590 217 THR A CG2 
748  N N   . VAL A 98  ? 0.8770 0.8072 0.5353 0.1454  0.0958  -0.0546 218 VAL A N   
749  C CA  . VAL A 98  ? 0.9371 0.8535 0.5795 0.1591  0.1136  -0.0490 218 VAL A CA  
750  C C   . VAL A 98  ? 0.9382 0.8435 0.5289 0.1593  0.0995  -0.0465 218 VAL A C   
751  O O   . VAL A 98  ? 0.9497 0.8296 0.5051 0.1742  0.1118  -0.0434 218 VAL A O   
752  C CB  . VAL A 98  ? 0.7349 0.6715 0.4058 0.1620  0.1249  -0.0440 218 VAL A CB  
753  C CG1 . VAL A 98  ? 0.8518 0.7667 0.5007 0.1800  0.1490  -0.0350 218 VAL A CG1 
754  C CG2 . VAL A 98  ? 0.7712 0.7196 0.4892 0.1542  0.1340  -0.0510 218 VAL A CG2 
755  N N   . TYR A 99  ? 0.9633 0.8914 0.5500 0.1416  0.0730  -0.0475 219 TYR A N   
756  C CA  . TYR A 99  ? 0.9525 0.8832 0.4954 0.1321  0.0522  -0.0471 219 TYR A CA  
757  C C   . TYR A 99  ? 1.0344 0.9077 0.5220 0.1304  0.0530  -0.0584 219 TYR A C   
758  O O   . TYR A 99  ? 1.0504 0.9092 0.4901 0.1368  0.0493  -0.0589 219 TYR A O   
759  C CB  . TYR A 99  ? 0.9140 0.8822 0.4725 0.1066  0.0254  -0.0456 219 TYR A CB  
760  C CG  . TYR A 99  ? 1.1250 1.1057 0.6449 0.0862  -0.0009 -0.0470 219 TYR A CG  
761  C CD1 . TYR A 99  ? 1.0693 1.1010 0.5843 0.0943  -0.0106 -0.0338 219 TYR A CD1 
762  C CD2 . TYR A 99  ? 1.2126 1.1541 0.6976 0.0583  -0.0156 -0.0612 219 TYR A CD2 
763  C CE1 . TYR A 99  ? 1.2719 1.3292 0.7548 0.0722  -0.0395 -0.0354 219 TYR A CE1 
764  C CE2 . TYR A 99  ? 1.2550 1.2076 0.7026 0.0310  -0.0429 -0.0661 219 TYR A CE2 
765  C CZ  . TYR A 99  ? 1.2789 1.2966 0.7291 0.0365  -0.0575 -0.0536 219 TYR A CZ  
766  O OH  . TYR A 99  ? 1.4237 1.4665 0.8402 0.0061  -0.0894 -0.0588 219 TYR A OH  
767  N N   . ARG A 100 ? 0.9666 0.8046 0.4540 0.1258  0.0592  -0.0662 220 ARG A N   
768  C CA  . ARG A 100 ? 1.0199 0.7899 0.4467 0.1302  0.0670  -0.0753 220 ARG A CA  
769  C C   . ARG A 100 ? 1.1093 0.8550 0.5215 0.1621  0.0958  -0.0695 220 ARG A C   
770  O O   . ARG A 100 ? 1.1203 0.8161 0.4671 0.1719  0.1005  -0.0740 220 ARG A O   
771  C CB  . ARG A 100 ? 1.0776 0.8165 0.5083 0.1272  0.0745  -0.0792 220 ARG A CB  
772  C CG  . ARG A 100 ? 1.3286 0.9840 0.6851 0.1354  0.0872  -0.0869 220 ARG A CG  
773  N N   . GLU A 101 ? 0.9774 0.7558 0.4479 0.1767  0.1159  -0.0597 221 GLU A N   
774  C CA  A GLU A 101 ? 1.0360 0.7980 0.5053 0.2038  0.1476  -0.0508 221 GLU A CA  
775  C CA  B GLU A 101 ? 1.0365 0.7978 0.5049 0.2039  0.1475  -0.0509 221 GLU A CA  
776  C C   . GLU A 101 ? 1.1162 0.8756 0.5488 0.2154  0.1483  -0.0456 221 GLU A C   
777  O O   . GLU A 101 ? 1.1129 0.8335 0.5011 0.2384  0.1676  -0.0414 221 GLU A O   
778  C CB  A GLU A 101 ? 0.9750 0.7765 0.5192 0.2063  0.1661  -0.0436 221 GLU A CB  
779  C CB  B GLU A 101 ? 0.9792 0.7791 0.5220 0.2069  0.1667  -0.0435 221 GLU A CB  
780  C CG  A GLU A 101 ? 0.9941 0.7830 0.5493 0.2287  0.2027  -0.0323 221 GLU A CG  
781  C CG  B GLU A 101 ? 0.9928 0.7781 0.5438 0.2300  0.2033  -0.0322 221 GLU A CG  
782  C CD  A GLU A 101 ? 1.0618 0.8245 0.6053 0.2456  0.2214  -0.0279 221 GLU A CD  
783  C CD  B GLU A 101 ? 0.9645 0.7910 0.5909 0.2225  0.2193  -0.0276 221 GLU A CD  
784  O OE1 A GLU A 101 ? 1.0252 0.7774 0.5547 0.2406  0.2077  -0.0343 221 GLU A OE1 
785  O OE1 B GLU A 101 ? 0.9525 0.7834 0.6066 0.2328  0.2447  -0.0192 221 GLU A OE1 
786  O OE2 A GLU A 101 ? 1.2851 1.0361 0.8316 0.2671  0.2537  -0.0153 221 GLU A OE2 
787  O OE2 B GLU A 101 ? 1.0056 0.8603 0.6617 0.2058  0.2071  -0.0321 221 GLU A OE2 
788  N N   . LEU A 102 ? 1.0026 0.8056 0.4515 0.2043  0.1293  -0.0430 222 LEU A N   
789  C CA  . LEU A 102 ? 1.0705 0.8836 0.4855 0.2198  0.1286  -0.0342 222 LEU A CA  
790  C C   . LEU A 102 ? 1.1344 0.9215 0.4740 0.2159  0.1062  -0.0434 222 LEU A C   
791  O O   . LEU A 102 ? 1.2456 1.0143 0.5353 0.2393  0.1151  -0.0381 222 LEU A O   
792  C CB  . LEU A 102 ? 0.9934 0.8647 0.4418 0.2126  0.1140  -0.0255 222 LEU A CB  
793  C CG  . LEU A 102 ? 1.1298 1.0221 0.5460 0.2364  0.1167  -0.0104 222 LEU A CG  
794  C CD1 . LEU A 102 ? 0.9956 0.8525 0.4050 0.2690  0.1595  0.0011  222 LEU A CD1 
795  C CD2 . LEU A 102 ? 1.1144 1.0670 0.5619 0.2340  0.1045  0.0022  222 LEU A CD2 
796  N N   . GLN A 103 ? 1.1276 0.9088 0.4546 0.1853  0.0782  -0.0577 223 GLN A N   
797  C CA  . GLN A 103 ? 1.2530 0.9996 0.5033 0.1708  0.0543  -0.0720 223 GLN A CA  
798  C C   . GLN A 103 ? 1.2736 0.9376 0.4616 0.1939  0.0793  -0.0781 223 GLN A C   
799  O O   . GLN A 103 ? 1.4142 1.0411 0.5238 0.2006  0.0716  -0.0857 223 GLN A O   
800  C CB  . GLN A 103 ? 1.3739 1.1226 0.6283 0.1281  0.0249  -0.0857 223 GLN A CB  
801  C CG  . GLN A 103 ? 1.5564 1.3593 0.7992 0.0973  -0.0154 -0.0883 223 GLN A CG  
802  C CD  . GLN A 103 ? 1.5986 1.3908 0.8390 0.0504  -0.0401 -0.1022 223 GLN A CD  
803  O OE1 . GLN A 103 ? 1.5933 1.3437 0.8484 0.0458  -0.0252 -0.1066 223 GLN A OE1 
804  N NE2 . GLN A 103 ? 1.7952 1.6281 1.0172 0.0153  -0.0769 -0.1075 223 GLN A NE2 
805  N N   . LYS A 104 ? 1.1806 0.8201 0.4022 0.2081  0.1094  -0.0733 224 LYS A N   
806  C CA  . LYS A 104 ? 1.2778 0.8467 0.4508 0.2369  0.1404  -0.0723 224 LYS A CA  
807  C C   . LYS A 104 ? 1.4234 0.9968 0.6023 0.2692  0.1646  -0.0549 224 LYS A C   
808  O O   . LYS A 104 ? 1.3752 0.9004 0.5089 0.2863  0.1737  -0.0519 224 LYS A O   
809  C CB  . LYS A 104 ? 1.4723 1.0383 0.6981 0.2439  0.1645  -0.0657 224 LYS A CB  
810  C CG  . LYS A 104 ? 1.5235 1.0202 0.7066 0.2642  0.1868  -0.0625 224 LYS A CG  
811  C CD  . LYS A 104 ? 1.6690 1.1847 0.9111 0.2802  0.2144  -0.0494 224 LYS A CD  
812  C CE  . LYS A 104 ? 1.6923 1.2713 1.0122 0.2936  0.2365  -0.0335 224 LYS A CE  
813  N NZ  . LYS A 104 ? 1.6195 1.2375 1.0081 0.3025  0.2571  -0.0218 224 LYS A NZ  
814  N N   . LEU A 105 ? 1.3061 0.9324 0.5397 0.2775  0.1764  -0.0421 225 LEU A N   
815  C CA  . LEU A 105 ? 1.1703 0.7977 0.4225 0.3060  0.2056  -0.0220 225 LEU A CA  
816  C C   . LEU A 105 ? 1.4260 1.0767 0.6513 0.3150  0.1923  -0.0160 225 LEU A C   
817  O O   . LEU A 105 ? 1.3806 1.0249 0.6119 0.3410  0.2159  0.0021  225 LEU A O   
818  C CB  . LEU A 105 ? 1.2846 0.9452 0.6186 0.3079  0.2346  -0.0098 225 LEU A CB  
819  C CG  . LEU A 105 ? 1.3670 1.0107 0.7377 0.3216  0.2694  0.0038  225 LEU A CG  
820  C CD1 . LEU A 105 ? 1.3320 0.9465 0.6810 0.3204  0.2653  -0.0040 225 LEU A CD1 
821  C CD2 . LEU A 105 ? 1.1672 0.8540 0.6203 0.3114  0.2902  0.0100  225 LEU A CD2 
822  N N   . SER A 106 ? 1.3406 1.0229 0.5396 0.2940  0.1546  -0.0280 226 SER A N   
823  C CA  . SER A 106 ? 1.2732 0.9992 0.4538 0.3020  0.1368  -0.0196 226 SER A CA  
824  C C   . SER A 106 ? 1.2236 0.9920 0.4607 0.3189  0.1591  0.0014  226 SER A C   
825  O O   . SER A 106 ? 1.1793 1.0038 0.4252 0.3153  0.1401  0.0078  226 SER A O   
826  C CB  . SER A 106 ? 1.4306 1.1237 0.5561 0.3255  0.1397  -0.0158 226 SER A CB  
827  O OG  . SER A 106 ? 1.4793 1.2207 0.5739 0.3237  0.1083  -0.0150 226 SER A OG  
828  N N   . LYS A 107 ? 1.1648 0.9058 0.4413 0.3353  0.1993  0.0138  227 LYS A N   
829  C CA  . LYS A 107 ? 1.2511 1.0129 0.5782 0.3452  0.2239  0.0314  227 LYS A CA  
830  C C   . LYS A 107 ? 1.2625 0.9948 0.6418 0.3420  0.2609  0.0363  227 LYS A C   
831  O O   . LYS A 107 ? 1.2472 0.9449 0.6199 0.3483  0.2756  0.0376  227 LYS A O   
832  C CB  . LYS A 107 ? 1.3975 1.1635 0.7010 0.3766  0.2317  0.0518  227 LYS A CB  
833  N N   . PHE A 108 ? 1.1413 0.8899 0.5717 0.3310  0.2751  0.0396  228 PHE A N   
834  C CA  . PHE A 108 ? 1.1276 0.8585 0.6117 0.3202  0.3076  0.0423  228 PHE A CA  
835  C C   . PHE A 108 ? 1.2187 0.9204 0.7088 0.3360  0.3405  0.0645  228 PHE A C   
836  O O   . PHE A 108 ? 1.2297 0.9312 0.6980 0.3525  0.3395  0.0772  228 PHE A O   
837  C CB  . PHE A 108 ? 0.9932 0.7494 0.5233 0.2954  0.3058  0.0298  228 PHE A CB  
838  C CG  . PHE A 108 ? 1.0398 0.8235 0.5706 0.2779  0.2725  0.0109  228 PHE A CG  
839  C CD1 . PHE A 108 ? 1.0994 0.8723 0.6040 0.2785  0.2578  0.0036  228 PHE A CD1 
840  C CD2 . PHE A 108 ? 0.9271 0.7431 0.4914 0.2558  0.2507  0.0031  228 PHE A CD2 
841  C CE1 . PHE A 108 ? 1.1151 0.9067 0.6281 0.2557  0.2234  -0.0109 228 PHE A CE1 
842  C CE2 . PHE A 108 ? 0.9758 0.8177 0.5525 0.2345  0.2152  -0.0102 228 PHE A CE2 
843  C CZ  . PHE A 108 ? 1.0564 0.8851 0.6083 0.2335  0.2023  -0.0170 228 PHE A CZ  
844  N N   . ASP A 109 ? 1.2022 0.8808 0.7219 0.3323  0.3713  0.0715  229 ASP A N   
845  C CA  . ASP A 109 ? 1.1150 0.7594 0.6434 0.3415  0.4076  0.0925  229 ASP A CA  
846  C C   . ASP A 109 ? 1.2610 0.9031 0.8272 0.3189  0.4246  0.0876  229 ASP A C   
847  O O   . ASP A 109 ? 1.1538 0.8244 0.7412 0.2981  0.4074  0.0683  229 ASP A O   
848  C CB  . ASP A 109 ? 1.1662 0.7898 0.7142 0.3445  0.4380  0.1041  229 ASP A CB  
849  C CG  . ASP A 109 ? 1.3122 0.9656 0.9136 0.3199  0.4418  0.0895  229 ASP A CG  
850  O OD1 . ASP A 109 ? 1.3653 1.0435 1.0055 0.2938  0.4391  0.0730  229 ASP A OD1 
851  O OD2 . ASP A 109 ? 1.3976 1.0500 1.0001 0.3300  0.4488  0.0963  229 ASP A OD2 
852  N N   . GLU A 110 ? 1.0471 0.8091 0.6953 0.0297  0.2608  0.0791  230 GLU A N   
853  C CA  . GLU A 110 ? 1.0096 0.8120 0.7705 -0.0106 0.2485  0.0840  230 GLU A CA  
854  C C   . GLU A 110 ? 1.0921 0.9909 0.9299 0.0038  0.2612  0.0635  230 GLU A C   
855  O O   . GLU A 110 ? 0.9563 0.8672 0.8632 -0.0146 0.2409  0.0497  230 GLU A O   
856  C CB  . GLU A 110 ? 0.8927 0.7167 0.6925 -0.0579 0.2600  0.1206  230 GLU A CB  
857  C CG  . GLU A 110 ? 1.0840 0.8194 0.8212 -0.0777 0.2412  0.1471  230 GLU A CG  
858  C CD  . GLU A 110 ? 1.1925 0.9354 0.9879 -0.1281 0.2421  0.1860  230 GLU A CD  
859  O OE1 . GLU A 110 ? 1.2847 1.0886 1.0893 -0.1427 0.2725  0.2119  230 GLU A OE1 
860  O OE2 . GLU A 110 ? 1.2405 0.9293 1.0739 -0.1515 0.2131  0.1936  230 GLU A OE2 
861  N N   . GLN A 111 ? 0.9348 0.9068 0.7585 0.0391  0.2948  0.0619  231 GLN A N   
862  C CA  . GLN A 111 ? 0.9045 0.9826 0.8023 0.0553  0.3059  0.0484  231 GLN A CA  
863  C C   . GLN A 111 ? 0.9640 1.0091 0.8509 0.0888  0.2802  0.0186  231 GLN A C   
864  O O   . GLN A 111 ? 0.9692 1.0653 0.9295 0.0756  0.2654  0.0063  231 GLN A O   
865  C CB  . GLN A 111 ? 1.0927 1.2640 0.9769 0.0946  0.3504  0.0587  231 GLN A CB  
866  C CG  . GLN A 111 ? 1.1531 1.4506 1.1191 0.1140  0.3613  0.0516  231 GLN A CG  
867  C CD  . GLN A 111 ? 1.2094 1.6132 1.1692 0.1588  0.4091  0.0671  231 GLN A CD  
868  O OE1 . GLN A 111 ? 1.4258 1.8104 1.3171 0.1733  0.4373  0.0814  231 GLN A OE1 
869  N NE2 . GLN A 111 ? 1.1207 1.6369 1.1515 0.1791  0.4130  0.0637  231 GLN A NE2 
870  N N   . ARG A 112 ? 0.9129 0.8694 0.7033 0.1291  0.2729  0.0083  232 ARG A N   
871  C CA  . ARG A 112 ? 1.0051 0.9211 0.7762 0.1605  0.2477  -0.0127 232 ARG A CA  
872  C C   . ARG A 112 ? 1.1220 0.9883 0.9235 0.1213  0.2089  -0.0159 232 ARG A C   
873  O O   . ARG A 112 ? 0.9285 0.8237 0.7729 0.1257  0.1918  -0.0286 232 ARG A O   
874  C CB  . ARG A 112 ? 1.0841 0.9005 0.7369 0.2071  0.2464  -0.0213 232 ARG A CB  
875  C CG  . ARG A 112 ? 1.1648 0.9442 0.7953 0.2467  0.2251  -0.0377 232 ARG A CG  
876  C CD  . ARG A 112 ? 1.3458 1.0103 0.8526 0.2898  0.2223  -0.0480 232 ARG A CD  
877  N NE  . ARG A 112 ? 1.4909 1.1634 1.0061 0.3290  0.2067  -0.0532 232 ARG A NE  
878  C CZ  . ARG A 112 ? 1.5936 1.3397 1.1322 0.3690  0.2293  -0.0534 232 ARG A CZ  
879  N NH1 . ARG A 112 ? 1.5851 1.4126 1.1469 0.3725  0.2667  -0.0483 232 ARG A NH1 
880  N NH2 . ARG A 112 ? 1.7209 1.4606 1.2591 0.4045  0.2147  -0.0546 232 ARG A NH2 
881  N N   . THR A 113 ? 1.1048 0.9031 0.8832 0.0858  0.1965  -0.0018 233 THR A N   
882  C CA  . THR A 113 ? 0.9888 0.7427 0.7952 0.0539  0.1638  -0.0004 233 THR A CA  
883  C C   . THR A 113 ? 0.9319 0.7594 0.8401 0.0269  0.1633  -0.0098 233 THR A C   
884  O O   . THR A 113 ? 0.9070 0.7407 0.8440 0.0275  0.1435  -0.0242 233 THR A O   
885  C CB  . THR A 113 ? 0.9671 0.6488 0.7389 0.0227  0.1532  0.0232  233 THR A CB  
886  O OG1 . THR A 113 ? 1.0235 0.6242 0.6905 0.0424  0.1432  0.0272  233 THR A OG1 
887  C CG2 . THR A 113 ? 0.9078 0.5628 0.7261 -0.0057 0.1250  0.0281  233 THR A CG2 
888  N N   . ALA A 114 ? 0.7805 0.6627 0.7380 0.0013  0.1843  -0.0012 234 ALA A N   
889  C CA  . ALA A 114 ? 0.7479 0.6884 0.7952 -0.0312 0.1813  -0.0126 234 ALA A CA  
890  C C   . ALA A 114 ? 0.8177 0.8406 0.9003 -0.0105 0.1800  -0.0360 234 ALA A C   
891  O O   . ALA A 114 ? 0.7989 0.8467 0.9317 -0.0284 0.1642  -0.0559 234 ALA A O   
892  C CB  . ALA A 114 ? 0.6601 0.6415 0.7489 -0.0669 0.2023  0.0071  234 ALA A CB  
893  N N   . THR A 115 ? 0.7831 0.8480 0.8360 0.0301  0.1967  -0.0335 235 THR A N   
894  C CA  . THR A 115 ? 0.7519 0.8998 0.8361 0.0565  0.1948  -0.0483 235 THR A CA  
895  C C   . THR A 115 ? 0.7969 0.9000 0.8584 0.0731  0.1659  -0.0632 235 THR A C   
896  O O   . THR A 115 ? 0.6662 0.8258 0.7736 0.0658  0.1519  -0.0790 235 THR A O   
897  C CB  . THR A 115 ? 0.7146 0.9082 0.7672 0.1078  0.2212  -0.0388 235 THR A CB  
898  O OG1 . THR A 115 ? 0.8587 1.1100 0.9345 0.0923  0.2519  -0.0200 235 THR A OG1 
899  C CG2 . THR A 115 ? 0.6310 0.9207 0.7258 0.1367  0.2176  -0.0476 235 THR A CG2 
900  N N   . TYR A 116 ? 0.7321 0.7368 0.7205 0.0913  0.1555  -0.0560 236 TYR A N   
901  C CA  . TYR A 116 ? 0.7857 0.7464 0.7505 0.1023  0.1276  -0.0610 236 TYR A CA  
902  C C   . TYR A 116 ? 0.8105 0.7701 0.8208 0.0654  0.1103  -0.0701 236 TYR A C   
903  O O   . TYR A 116 ? 0.7950 0.7809 0.8214 0.0701  0.0940  -0.0803 236 TYR A O   
904  C CB  . TYR A 116 ? 0.7008 0.5519 0.5782 0.1185  0.1163  -0.0473 236 TYR A CB  
905  C CG  . TYR A 116 ? 0.8168 0.6473 0.6329 0.1680  0.1256  -0.0464 236 TYR A CG  
906  C CD1 . TYR A 116 ? 0.8866 0.8034 0.7351 0.2021  0.1409  -0.0529 236 TYR A CD1 
907  C CD2 . TYR A 116 ? 0.8288 0.5510 0.5524 0.1823  0.1175  -0.0394 236 TYR A CD2 
908  C CE1 . TYR A 116 ? 1.0065 0.9000 0.7998 0.2567  0.1518  -0.0521 236 TYR A CE1 
909  C CE2 . TYR A 116 ? 0.8720 0.5585 0.5306 0.2327  0.1264  -0.0440 236 TYR A CE2 
910  C CZ  . TYR A 116 ? 0.9479 0.7192 0.6432 0.2736  0.1456  -0.0502 236 TYR A CZ  
911  O OH  . TYR A 116 ? 1.0047 0.7425 0.6438 0.3244  0.1522  -0.0517 236 TYR A OH  
912  N N   . ILE A 117 ? 0.7451 0.6739 0.7732 0.0321  0.1152  -0.0650 237 ILE A N   
913  C CA  . ILE A 117 ? 0.6665 0.5832 0.7355 0.0040  0.1027  -0.0750 237 ILE A CA  
914  C C   . ILE A 117 ? 0.7722 0.7687 0.9033 -0.0103 0.1036  -0.1030 237 ILE A C   
915  O O   . ILE A 117 ? 0.7926 0.7991 0.9416 -0.0135 0.0903  -0.1218 237 ILE A O   
916  C CB  . ILE A 117 ? 0.6684 0.5294 0.7447 -0.0251 0.1079  -0.0592 237 ILE A CB  
917  C CG1 . ILE A 117 ? 0.7598 0.5427 0.7703 -0.0163 0.0997  -0.0315 237 ILE A CG1 
918  C CG2 . ILE A 117 ? 0.6501 0.4980 0.7744 -0.0468 0.0986  -0.0730 237 ILE A CG2 
919  C CD1 . ILE A 117 ? 0.7598 0.5105 0.7454 -0.0037 0.0755  -0.0268 237 ILE A CD1 
920  N N   . THR A 118 ? 0.7277 0.7862 0.8891 -0.0198 0.1190  -0.1048 238 THR A N   
921  C CA  . THR A 118 ? 0.6763 0.8168 0.8955 -0.0409 0.1154  -0.1294 238 THR A CA  
922  C C   . THR A 118 ? 0.7216 0.9204 0.9360 -0.0143 0.1015  -0.1440 238 THR A C   
923  O O   . THR A 118 ? 0.6175 0.8434 0.8548 -0.0288 0.0871  -0.1705 238 THR A O   
924  C CB  . THR A 118 ? 0.6548 0.8683 0.9107 -0.0565 0.1336  -0.1183 238 THR A CB  
925  O OG1 . THR A 118 ? 0.7113 0.8760 0.9754 -0.0880 0.1454  -0.1010 238 THR A OG1 
926  C CG2 . THR A 118 ? 0.6079 0.9123 0.9237 -0.0848 0.1229  -0.1418 238 THR A CG2 
927  N N   . GLU A 119 ? 0.6159 0.8299 0.7958 0.0262  0.1056  -0.1266 239 GLU A N   
928  C CA  . GLU A 119 ? 0.6897 0.9533 0.8614 0.0551  0.0913  -0.1310 239 GLU A CA  
929  C C   . GLU A 119 ? 0.7817 0.9976 0.9288 0.0555  0.0723  -0.1373 239 GLU A C   
930  O O   . GLU A 119 ? 0.7964 1.0665 0.9561 0.0564  0.0585  -0.1519 239 GLU A O   
931  C CB  . GLU A 119 ? 0.6013 0.8612 0.7323 0.1034  0.0992  -0.1080 239 GLU A CB  
932  C CG  . GLU A 119 ? 0.6745 1.0157 0.8360 0.1166  0.1208  -0.1000 239 GLU A CG  
933  C CD  . GLU A 119 ? 0.7895 1.1135 0.9031 0.1751  0.1318  -0.0813 239 GLU A CD  
934  O OE1 . GLU A 119 ? 0.7897 1.0067 0.8363 0.1909  0.1334  -0.0734 239 GLU A OE1 
935  O OE2 . GLU A 119 ? 0.8343 1.2490 0.9751 0.2062  0.1371  -0.0747 239 GLU A OE2 
936  N N   . LEU A 120 ? 0.7083 0.8319 0.8207 0.0541  0.0717  -0.1233 240 LEU A N   
937  C CA  . LEU A 120 ? 0.6319 0.7184 0.7257 0.0549  0.0559  -0.1204 240 LEU A CA  
938  C C   . LEU A 120 ? 0.7645 0.8674 0.8971 0.0295  0.0546  -0.1483 240 LEU A C   
939  O O   . LEU A 120 ? 0.6644 0.7953 0.7963 0.0352  0.0446  -0.1584 240 LEU A O   
940  C CB  . LEU A 120 ? 0.6641 0.6557 0.7147 0.0565  0.0527  -0.0934 240 LEU A CB  
941  C CG  . LEU A 120 ? 0.8297 0.7927 0.8675 0.0551  0.0358  -0.0804 240 LEU A CG  
942  C CD1 . LEU A 120 ? 0.7684 0.7758 0.7925 0.0746  0.0219  -0.0745 240 LEU A CD1 
943  C CD2 . LEU A 120 ? 0.8431 0.7200 0.8376 0.0516  0.0271  -0.0495 240 LEU A CD2 
944  N N   . ALA A 121 ? 0.6623 0.7443 0.8247 0.0029  0.0652  -0.1602 241 ALA A N   
945  C CA  . ALA A 121 ? 0.6363 0.7128 0.8306 -0.0191 0.0640  -0.1909 241 ALA A CA  
946  C C   . ALA A 121 ? 0.6476 0.8056 0.8626 -0.0269 0.0566  -0.2263 241 ALA A C   
947  O O   . ALA A 121 ? 0.6343 0.7982 0.8522 -0.0298 0.0510  -0.2560 241 ALA A O   
948  C CB  . ALA A 121 ? 0.5859 0.6125 0.8066 -0.0484 0.0741  -0.1906 241 ALA A CB  
949  N N   . ASN A 122 ? 0.6160 0.8409 0.8433 -0.0284 0.0566  -0.2228 242 ASN A N   
950  C CA  . ASN A 122 ? 0.6606 0.9767 0.9065 -0.0371 0.0445  -0.2499 242 ASN A CA  
951  C C   . ASN A 122 ? 0.6257 0.9772 0.8407 -0.0091 0.0325  -0.2509 242 ASN A C   
952  O O   . ASN A 122 ? 0.6780 1.0671 0.8924 -0.0183 0.0224  -0.2835 242 ASN A O   
953  C CB  . ASN A 122 ? 0.5689 0.9634 0.8397 -0.0374 0.0474  -0.2343 242 ASN A CB  
954  C CG  . ASN A 122 ? 0.7290 1.1246 1.0427 -0.0777 0.0561  -0.2378 242 ASN A CG  
955  O OD1 . ASN A 122 ? 0.8272 1.1856 1.1589 -0.1148 0.0509  -0.2650 242 ASN A OD1 
956  N ND2 . ASN A 122 ? 0.7060 1.1436 1.0353 -0.0695 0.0701  -0.2088 242 ASN A ND2 
957  N N   . ALA A 123 ? 0.6116 0.9471 0.7959 0.0234  0.0328  -0.2143 243 ALA A N   
958  C CA  . ALA A 123 ? 0.7058 1.0722 0.8608 0.0478  0.0205  -0.2029 243 ALA A CA  
959  C C   . ALA A 123 ? 0.7306 1.0644 0.8727 0.0450  0.0204  -0.2146 243 ALA A C   
960  O O   . ALA A 123 ? 0.6377 1.0257 0.7679 0.0516  0.0126  -0.2260 243 ALA A O   
961  C CB  . ALA A 123 ? 0.4621 0.7958 0.5850 0.0783  0.0184  -0.1595 243 ALA A CB  
962  N N   . LEU A 124 ? 0.5866 0.8396 0.7314 0.0378  0.0302  -0.2089 244 LEU A N   
963  C CA  . LEU A 124 ? 0.5935 0.8196 0.7348 0.0408  0.0337  -0.2158 244 LEU A CA  
964  C C   . LEU A 124 ? 0.6894 0.9362 0.8474 0.0275  0.0378  -0.2686 244 LEU A C   
965  O O   . LEU A 124 ? 0.7576 1.0278 0.9038 0.0401  0.0400  -0.2849 244 LEU A O   
966  C CB  . LEU A 124 ? 0.5772 0.7162 0.7221 0.0372  0.0408  -0.1916 244 LEU A CB  
967  C CG  . LEU A 124 ? 0.6695 0.7712 0.7848 0.0483  0.0326  -0.1419 244 LEU A CG  
968  C CD1 . LEU A 124 ? 0.7291 0.7505 0.8476 0.0377  0.0371  -0.1227 244 LEU A CD1 
969  C CD2 . LEU A 124 ? 0.5476 0.6800 0.6460 0.0627  0.0229  -0.1189 244 LEU A CD2 
970  N N   . SER A 125 ? 0.7250 0.9620 0.9075 0.0012  0.0387  -0.2952 245 SER A N   
971  C CA  . SER A 125 ? 0.7843 1.0248 0.9770 -0.0187 0.0373  -0.3498 245 SER A CA  
972  C C   . SER A 125 ? 0.7851 1.1164 0.9553 -0.0133 0.0252  -0.3757 245 SER A C   
973  O O   . SER A 125 ? 0.7064 1.0420 0.8595 -0.0122 0.0256  -0.4190 245 SER A O   
974  C CB  . SER A 125 ? 0.7486 0.9701 0.9742 -0.0571 0.0349  -0.3642 245 SER A CB  
975  O OG  . SER A 125 ? 0.9670 1.1690 1.1979 -0.0821 0.0292  -0.4184 245 SER A OG  
976  N N   . TYR A 126 ? 0.6876 1.0903 0.8539 -0.0065 0.0149  -0.3484 246 TYR A N   
977  C CA  . TYR A 126 ? 0.6254 1.1235 0.7691 0.0008  0.0007  -0.3602 246 TYR A CA  
978  C C   . TYR A 126 ? 0.6915 1.2023 0.8007 0.0307  0.0057  -0.3464 246 TYR A C   
979  O O   . TYR A 126 ? 0.5886 1.1546 0.6712 0.0343  0.0017  -0.3761 246 TYR A O   
980  C CB  . TYR A 126 ? 0.5439 1.1105 0.6977 0.0072  -0.0110 -0.3248 246 TYR A CB  
981  C CG  . TYR A 126 ? 0.6406 1.3019 0.7682 0.0244  -0.0264 -0.3150 246 TYR A CG  
982  C CD1 . TYR A 126 ? 0.6494 1.3923 0.7709 0.0053  -0.0429 -0.3529 246 TYR A CD1 
983  C CD2 . TYR A 126 ? 0.5227 1.1894 0.6285 0.0561  -0.0277 -0.2654 246 TYR A CD2 
984  C CE1 . TYR A 126 ? 0.5309 1.3666 0.6254 0.0206  -0.0584 -0.3391 246 TYR A CE1 
985  C CE2 . TYR A 126 ? 0.5235 1.2756 0.6060 0.0706  -0.0428 -0.2490 246 TYR A CE2 
986  C CZ  . TYR A 126 ? 0.6526 1.4932 0.7297 0.0544  -0.0571 -0.2847 246 TYR A CZ  
987  O OH  . TYR A 126 ? 0.6200 1.5409 0.6715 0.0689  -0.0693 -0.2605 246 TYR A OH  
988  N N   . CYS A 127 ? 0.5521 1.0161 0.6596 0.0496  0.0137  -0.3000 247 CYS A N   
989  C CA  . CYS A 127 ? 0.5441 1.0250 0.6278 0.0728  0.0181  -0.2759 247 CYS A CA  
990  C C   . CYS A 127 ? 0.6096 1.0753 0.6892 0.0789  0.0341  -0.3153 247 CYS A C   
991  O O   . CYS A 127 ? 0.6552 1.1816 0.7093 0.0952  0.0383  -0.3230 247 CYS A O   
992  C CB  . CYS A 127 ? 0.5872 1.0107 0.6728 0.0823  0.0188  -0.2185 247 CYS A CB  
993  S SG  . CYS A 127 ? 0.6136 1.0499 0.6839 0.0907  0.0006  -0.1673 247 CYS A SG  
994  N N   . HIS A 128 ? 0.5633 0.9481 0.6665 0.0690  0.0445  -0.3382 248 HIS A N   
995  C CA  . HIS A 128 ? 0.6043 0.9565 0.7065 0.0826  0.0618  -0.3740 248 HIS A CA  
996  C C   . HIS A 128 ? 0.6604 1.0301 0.7411 0.0707  0.0549  -0.4242 248 HIS A C   
997  O O   . HIS A 128 ? 0.7063 1.0652 0.7690 0.0879  0.0656  -0.4428 248 HIS A O   
998  C CB  . HIS A 128 ? 0.7132 0.9622 0.8487 0.0750  0.0706  -0.3716 248 HIS A CB  
999  C CG  . HIS A 128 ? 0.5929 0.8115 0.7437 0.0831  0.0718  -0.3078 248 HIS A CG  
1000 N ND1 . HIS A 128 ? 0.5843 0.7237 0.7614 0.0837  0.0800  -0.2933 248 HIS A ND1 
1001 C CD2 . HIS A 128 ? 0.5522 0.8040 0.6917 0.0881  0.0622  -0.2543 248 HIS A CD2 
1002 C CE1 . HIS A 128 ? 0.5074 0.6390 0.6867 0.0866  0.0743  -0.2353 248 HIS A CE1 
1003 N NE2 . HIS A 128 ? 0.6251 0.8179 0.7804 0.0883  0.0631  -0.2124 248 HIS A NE2 
1004 N N   . SER A 129 ? 0.7229 1.1230 0.8050 0.0424  0.0376  -0.4453 249 SER A N   
1005 C CA  . SER A 129 ? 0.7626 1.1899 0.8231 0.0266  0.0265  -0.4893 249 SER A CA  
1006 C C   . SER A 129 ? 0.6527 1.1716 0.6756 0.0478  0.0238  -0.4810 249 SER A C   
1007 O O   . SER A 129 ? 0.7216 1.2551 0.7141 0.0476  0.0220  -0.5150 249 SER A O   
1008 C CB  . SER A 129 ? 0.7562 1.2109 0.8349 -0.0120 0.0064  -0.5046 249 SER A CB  
1009 O OG  . SER A 129 ? 0.7901 1.3387 0.8670 -0.0074 -0.0057 -0.4748 249 SER A OG  
1010 N N   . LYS A 130 ? 0.6611 1.2371 0.6822 0.0652  0.0230  -0.4329 250 LYS A N   
1011 C CA  . LYS A 130 ? 0.7089 1.3732 0.6983 0.0843  0.0203  -0.4113 250 LYS A CA  
1012 C C   . LYS A 130 ? 0.7883 1.4402 0.7710 0.1139  0.0411  -0.3845 250 LYS A C   
1013 O O   . LYS A 130 ? 0.6595 1.3845 0.6218 0.1301  0.0415  -0.3520 250 LYS A O   
1014 C CB  . LYS A 130 ? 0.7191 1.4572 0.7081 0.0841  0.0036  -0.3671 250 LYS A CB  
1015 C CG  . LYS A 130 ? 0.6538 1.4282 0.6534 0.0589  -0.0167 -0.3868 250 LYS A CG  
1016 C CD  . LYS A 130 ? 0.6983 1.5137 0.6776 0.0457  -0.0241 -0.4273 250 LYS A CD  
1017 C CE  . LYS A 130 ? 0.8077 1.6532 0.8040 0.0143  -0.0434 -0.4460 250 LYS A CE  
1018 N NZ  . LYS A 130 ? 0.8309 1.7100 0.7986 -0.0022 -0.0530 -0.4846 250 LYS A NZ  
1019 N N   . ARG A 131 ? 0.6448 1.0231 0.8051 0.0298  0.0666  -0.2645 251 ARG A N   
1020 C CA  . ARG A 131 ? 0.5431 0.8699 0.6583 0.0315  0.0576  -0.2189 251 ARG A CA  
1021 C C   . ARG A 131 ? 0.5318 0.8275 0.5893 0.0434  0.0417  -0.1717 251 ARG A C   
1022 O O   . ARG A 131 ? 0.5827 0.8740 0.6158 0.0512  0.0290  -0.1482 251 ARG A O   
1023 C CB  . ARG A 131 ? 0.6159 0.9987 0.7479 0.0453  0.0407  -0.2341 251 ARG A CB  
1024 C CG  . ARG A 131 ? 0.5796 1.0105 0.7828 0.0337  0.0560  -0.2947 251 ARG A CG  
1025 C CD  . ARG A 131 ? 0.6643 1.0136 0.8852 0.0016  0.1000  -0.2995 251 ARG A CD  
1026 N NE  . ARG A 131 ? 0.8605 1.1373 1.0290 0.0057  0.1009  -0.2541 251 ARG A NE  
1027 C CZ  . ARG A 131 ? 1.1874 1.3676 1.3194 0.0012  0.1334  -0.2287 251 ARG A CZ  
1028 N NH1 . ARG A 131 ? 1.1545 1.2860 1.2975 -0.0140 0.1748  -0.2387 251 ARG A NH1 
1029 N NH2 . ARG A 131 ? 1.3105 1.4447 1.3899 0.0191  0.1267  -0.1952 251 ARG A NH2 
1030 N N   . VAL A 132 ? 0.6429 0.9175 0.6865 0.0415  0.0475  -0.1641 252 VAL A N   
1031 C CA  . VAL A 132 ? 0.6274 0.8688 0.6260 0.0482  0.0396  -0.1278 252 VAL A CA  
1032 C C   . VAL A 132 ? 0.5884 0.7655 0.5648 0.0355  0.0472  -0.1093 252 VAL A C   
1033 O O   . VAL A 132 ? 0.6467 0.7932 0.6273 0.0277  0.0658  -0.1167 252 VAL A O   
1034 C CB  . VAL A 132 ? 0.6446 0.9072 0.6323 0.0645  0.0387  -0.1307 252 VAL A CB  
1035 C CG1 . VAL A 132 ? 0.5884 0.8009 0.5358 0.0645  0.0409  -0.0970 252 VAL A CG1 
1036 C CG2 . VAL A 132 ? 0.5787 0.9074 0.5641 0.0997  0.0286  -0.1452 252 VAL A CG2 
1037 N N   . ILE A 133 ? 0.6196 0.7798 0.5735 0.0375  0.0370  -0.0910 253 ILE A N   
1038 C CA  . ILE A 133 ? 0.6201 0.7399 0.5483 0.0397  0.0363  -0.0824 253 ILE A CA  
1039 C C   . ILE A 133 ? 0.6275 0.7406 0.5454 0.0374  0.0326  -0.0752 253 ILE A C   
1040 O O   . ILE A 133 ? 0.5699 0.6978 0.4972 0.0325  0.0326  -0.0742 253 ILE A O   
1041 C CB  . ILE A 133 ? 0.5571 0.6806 0.4777 0.0490  0.0251  -0.0860 253 ILE A CB  
1042 C CG1 . ILE A 133 ? 0.5940 0.7318 0.5310 0.0490  0.0286  -0.0931 253 ILE A CG1 
1043 C CG2 . ILE A 133 ? 0.6361 0.7229 0.5165 0.0717  0.0254  -0.0833 253 ILE A CG2 
1044 C CD1 . ILE A 133 ? 0.5761 0.7237 0.5037 0.0626  0.0158  -0.0979 253 ILE A CD1 
1045 N N   . HIS A 134 ? 0.6938 0.7776 0.5925 0.0409  0.0369  -0.0710 254 HIS A N   
1046 C CA  . HIS A 134 ? 0.5135 0.5891 0.4057 0.0378  0.0356  -0.0681 254 HIS A CA  
1047 C C   . HIS A 134 ? 0.5723 0.6587 0.4702 0.0388  0.0247  -0.0837 254 HIS A C   
1048 O O   . HIS A 134 ? 0.4893 0.5822 0.4080 0.0250  0.0322  -0.0919 254 HIS A O   
1049 C CB  . HIS A 134 ? 0.5021 0.5486 0.3735 0.0432  0.0426  -0.0621 254 HIS A CB  
1050 C CG  . HIS A 134 ? 0.6275 0.6652 0.4932 0.0402  0.0425  -0.0597 254 HIS A CG  
1051 N ND1 . HIS A 134 ? 0.5178 0.5520 0.3790 0.0437  0.0341  -0.0710 254 HIS A ND1 
1052 C CD2 . HIS A 134 ? 0.5890 0.6237 0.4525 0.0385  0.0512  -0.0522 254 HIS A CD2 
1053 C CE1 . HIS A 134 ? 0.6821 0.7038 0.5443 0.0368  0.0416  -0.0693 254 HIS A CE1 
1054 N NE2 . HIS A 134 ? 0.6932 0.7091 0.5499 0.0361  0.0529  -0.0534 254 HIS A NE2 
1055 N N   . ARG A 135 ? 0.5846 0.6726 0.4635 0.0596  0.0125  -0.0929 255 ARG A N   
1056 C CA  . ARG A 135 ? 0.6622 0.7868 0.5505 0.0725  -0.0056 -0.1242 255 ARG A CA  
1057 C C   . ARG A 135 ? 0.5629 0.6999 0.4612 0.0728  -0.0109 -0.1479 255 ARG A C   
1058 O O   . ARG A 135 ? 0.6162 0.8034 0.5400 0.0813  -0.0262 -0.1913 255 ARG A O   
1059 C CB  . ARG A 135 ? 0.6494 0.8127 0.5838 0.0515  -0.0047 -0.1421 255 ARG A CB  
1060 C CG  . ARG A 135 ? 0.6391 0.8019 0.5680 0.0540  -0.0039 -0.1259 255 ARG A CG  
1061 C CD  . ARG A 135 ? 0.7239 0.9318 0.6910 0.0442  -0.0079 -0.1498 255 ARG A CD  
1062 N NE  . ARG A 135 ? 0.5719 0.7808 0.5773 0.0132  0.0166  -0.1530 255 ARG A NE  
1063 C CZ  . ARG A 135 ? 0.5697 0.8051 0.6127 -0.0023 0.0289  -0.1702 255 ARG A CZ  
1064 N NH1 . ARG A 135 ? 0.4497 0.7266 0.5023 0.0090  0.0094  -0.1896 255 ARG A NH1 
1065 N NH2 . ARG A 135 ? 0.5592 0.7725 0.6250 -0.0257 0.0672  -0.1667 255 ARG A NH2 
1066 N N   . ASP A 136 ? 0.6194 0.7208 0.5045 0.0646  0.0007  -0.1287 256 ASP A N   
1067 C CA  . ASP A 136 ? 0.6028 0.7143 0.4977 0.0657  -0.0036 -0.1533 256 ASP A CA  
1068 C C   . ASP A 136 ? 0.6119 0.6834 0.4614 0.0826  -0.0012 -0.1292 256 ASP A C   
1069 O O   . ASP A 136 ? 0.6450 0.7045 0.5034 0.0699  0.0060  -0.1312 256 ASP A O   
1070 C CB  . ASP A 136 ? 0.6207 0.7295 0.5651 0.0271  0.0200  -0.1649 256 ASP A CB  
1071 C CG  . ASP A 136 ? 0.7641 0.8985 0.7444 0.0210  0.0195  -0.2119 256 ASP A CG  
1072 O OD1 . ASP A 136 ? 0.8227 1.0068 0.8012 0.0504  -0.0093 -0.2497 256 ASP A OD1 
1073 O OD2 . ASP A 136 ? 0.7822 0.8877 0.7896 -0.0074 0.0505  -0.2146 256 ASP A OD2 
1074 N N   . ILE A 137 ? 0.5997 0.6435 0.3999 0.1116  0.0001  -0.1070 257 ILE A N   
1075 C CA  . ILE A 137 ? 0.7430 0.7433 0.4992 0.1294  0.0116  -0.0860 257 ILE A CA  
1076 C C   . ILE A 137 ? 0.6695 0.6895 0.4018 0.1642  -0.0070 -0.1100 257 ILE A C   
1077 O O   . ILE A 137 ? 0.7084 0.7592 0.4159 0.2073  -0.0258 -0.1329 257 ILE A O   
1078 C CB  . ILE A 137 ? 0.7985 0.7491 0.5080 0.1528  0.0347  -0.0598 257 ILE A CB  
1079 C CG1 . ILE A 137 ? 0.8814 0.8267 0.6275 0.1174  0.0524  -0.0495 257 ILE A CG1 
1080 C CG2 . ILE A 137 ? 0.8653 0.7632 0.5297 0.1714  0.0582  -0.0403 257 ILE A CG2 
1081 C CD1 . ILE A 137 ? 0.9155 0.8111 0.6331 0.1320  0.0846  -0.0349 257 ILE A CD1 
1082 N N   . LYS A 138 ? 0.6616 0.6716 0.4003 0.1517  -0.0038 -0.1095 258 LYS A N   
1083 C CA  . LYS A 138 ? 0.7877 0.8196 0.5069 0.1847  -0.0211 -0.1355 258 LYS A CA  
1084 C C   . LYS A 138 ? 0.7672 0.7659 0.4854 0.1655  -0.0079 -0.1184 258 LYS A C   
1085 O O   . LYS A 138 ? 0.7135 0.6903 0.4581 0.1261  0.0090  -0.0988 258 LYS A O   
1086 C CB  . LYS A 138 ? 0.8249 0.9332 0.6031 0.1786  -0.0449 -0.1969 258 LYS A CB  
1087 C CG  . LYS A 138 ? 0.6654 0.7757 0.5167 0.1184  -0.0278 -0.2107 258 LYS A CG  
1088 C CD  . LYS A 138 ? 0.6366 0.8204 0.5607 0.1067  -0.0375 -0.2833 258 LYS A CD  
1089 C CE  . LYS A 138 ? 0.7804 0.9411 0.7714 0.0476  -0.0004 -0.2938 258 LYS A CE  
1090 N NZ  . LYS A 138 ? 0.7958 1.0258 0.8769 0.0257  0.0049  -0.3758 258 LYS A NZ  
1091 N N   . PRO A 139 ? 0.7308 0.7296 0.4117 0.2018  -0.0166 -0.1270 259 PRO A N   
1092 C CA  . PRO A 139 ? 0.7444 0.7112 0.4180 0.1889  -0.0045 -0.1102 259 PRO A CA  
1093 C C   . PRO A 139 ? 0.7455 0.7206 0.4784 0.1407  -0.0005 -0.1231 259 PRO A C   
1094 O O   . PRO A 139 ? 0.6852 0.6264 0.4126 0.1235  0.0156  -0.0976 259 PRO A O   
1095 C CB  . PRO A 139 ? 0.8365 0.8236 0.4677 0.2427  -0.0229 -0.1327 259 PRO A CB  
1096 C CG  . PRO A 139 ? 0.8264 0.8246 0.4052 0.3001  -0.0316 -0.1362 259 PRO A CG  
1097 C CD  . PRO A 139 ? 0.7786 0.8095 0.4105 0.2689  -0.0385 -0.1522 259 PRO A CD  
1098 N N   . GLU A 140 ? 0.7441 0.7608 0.5312 0.1230  -0.0086 -0.1649 260 GLU A N   
1099 C CA  . GLU A 140 ? 0.8373 0.8398 0.6731 0.0809  0.0126  -0.1744 260 GLU A CA  
1100 C C   . GLU A 140 ? 0.6749 0.6378 0.5064 0.0576  0.0363  -0.1323 260 GLU A C   
1101 O O   . GLU A 140 ? 0.7039 0.6313 0.5376 0.0419  0.0598  -0.1178 260 GLU A O   
1102 C CB  . GLU A 140 ? 0.7824 0.8335 0.6887 0.0618  0.0135  -0.2365 260 GLU A CB  
1103 C CG  . GLU A 140 ? 1.0921 1.2083 1.0178 0.0892  -0.0137 -0.2993 260 GLU A CG  
1104 C CD  . GLU A 140 ? 1.1698 1.3506 1.0741 0.1373  -0.0494 -0.3250 260 GLU A CD  
1105 O OE1 . GLU A 140 ? 1.1064 1.2548 0.9393 0.1690  -0.0553 -0.2739 260 GLU A OE1 
1106 O OE2 . GLU A 140 ? 1.2106 1.4758 1.1711 0.1462  -0.0673 -0.4016 260 GLU A OE2 
1107 N N   . ASN A 141 ? 0.6906 0.6611 0.5105 0.0634  0.0308  -0.1151 261 ASN A N   
1108 C CA  . ASN A 141 ? 0.7666 0.7187 0.5865 0.0488  0.0476  -0.0862 261 ASN A CA  
1109 C C   . ASN A 141 ? 0.8194 0.7577 0.6079 0.0597  0.0497  -0.0580 261 ASN A C   
1110 O O   . ASN A 141 ? 0.7796 0.7237 0.5721 0.0556  0.0567  -0.0459 261 ASN A O   
1111 C CB  . ASN A 141 ? 0.5819 0.5587 0.4237 0.0425  0.0439  -0.0944 261 ASN A CB  
1112 C CG  . ASN A 141 ? 0.5900 0.5847 0.4802 0.0225  0.0535  -0.1296 261 ASN A CG  
1113 O OD1 . ASN A 141 ? 0.6238 0.5970 0.5337 0.0067  0.0759  -0.1416 261 ASN A OD1 
1114 N ND2 . ASN A 141 ? 0.5788 0.6105 0.4929 0.0214  0.0432  -0.1502 261 ASN A ND2 
1115 N N   . LEU A 142 ? 0.7694 0.6954 0.5324 0.0742  0.0465  -0.0549 262 LEU A N   
1116 C CA  . LEU A 142 ? 0.6503 0.5642 0.3971 0.0783  0.0585  -0.0389 262 LEU A CA  
1117 C C   . LEU A 142 ? 0.8248 0.7288 0.5614 0.0804  0.0622  -0.0357 262 LEU A C   
1118 O O   . LEU A 142 ? 0.8011 0.6938 0.5232 0.0895  0.0557  -0.0410 262 LEU A O   
1119 C CB  . LEU A 142 ? 0.6791 0.5727 0.3972 0.0974  0.0661  -0.0338 262 LEU A CB  
1120 C CG  . LEU A 142 ? 0.6996 0.5948 0.4144 0.1055  0.0655  -0.0347 262 LEU A CG  
1121 C CD1 . LEU A 142 ? 0.7895 0.6433 0.4517 0.1403  0.0835  -0.0230 262 LEU A CD1 
1122 C CD2 . LEU A 142 ? 0.6998 0.6078 0.4480 0.0826  0.0772  -0.0336 262 LEU A CD2 
1123 N N   . LEU A 143 ? 0.7257 0.6420 0.4687 0.0782  0.0702  -0.0320 263 LEU A N   
1124 C CA  . LEU A 143 ? 0.7746 0.6857 0.5023 0.0877  0.0728  -0.0298 263 LEU A CA  
1125 C C   . LEU A 143 ? 0.7666 0.6946 0.4980 0.0909  0.0813  -0.0373 263 LEU A C   
1126 O O   . LEU A 143 ? 0.8360 0.7787 0.5898 0.0816  0.0931  -0.0472 263 LEU A O   
1127 C CB  . LEU A 143 ? 0.7692 0.6846 0.4890 0.0990  0.0780  -0.0242 263 LEU A CB  
1128 C CG  . LEU A 143 ? 0.8266 0.7123 0.5481 0.0912  0.0872  -0.0187 263 LEU A CG  
1129 C CD1 . LEU A 143 ? 0.7909 0.6625 0.4848 0.1148  0.1063  -0.0044 263 LEU A CD1 
1130 C CD2 . LEU A 143 ? 0.8377 0.6919 0.5619 0.0813  0.0906  -0.0270 263 LEU A CD2 
1131 N N   . LEU A 144 ? 0.7819 0.7059 0.4967 0.1016  0.0813  -0.0374 264 LEU A N   
1132 C CA  . LEU A 144 ? 0.6865 0.6319 0.4127 0.1024  0.0933  -0.0522 264 LEU A CA  
1133 C C   . LEU A 144 ? 0.8659 0.8562 0.5925 0.1226  0.0875  -0.0677 264 LEU A C   
1134 O O   . LEU A 144 ? 0.8253 0.7972 0.5165 0.1433  0.0794  -0.0539 264 LEU A O   
1135 C CB  . LEU A 144 ? 0.7788 0.6870 0.4799 0.1058  0.0986  -0.0428 264 LEU A CB  
1136 C CG  . LEU A 144 ? 0.7764 0.6460 0.4589 0.1070  0.1045  -0.0306 264 LEU A CG  
1137 C CD1 . LEU A 144 ? 0.7975 0.6379 0.4431 0.1255  0.1053  -0.0229 264 LEU A CD1 
1138 C CD2 . LEU A 144 ? 0.8384 0.7009 0.5391 0.0963  0.1351  -0.0350 264 LEU A CD2 
1139 N N   . GLY A 145 ? 0.8619 0.9132 0.6292 0.1209  0.0954  -0.1023 265 GLY A N   
1140 C CA  . GLY A 145 ? 0.8391 0.9581 0.6082 0.1528  0.0848  -0.1308 265 GLY A CA  
1141 C C   . GLY A 145 ? 0.8668 0.9905 0.6245 0.1633  0.0867  -0.1391 265 GLY A C   
1142 O O   . GLY A 145 ? 0.8933 0.9601 0.6358 0.1463  0.0960  -0.1171 265 GLY A O   
1143 N N   . SER A 146 ? 0.8575 1.0570 0.6193 0.1986  0.0761  -0.1746 266 SER A N   
1144 C CA  . SER A 146 ? 0.9367 1.1508 0.6850 0.2156  0.0747  -0.1863 266 SER A CA  
1145 C C   . SER A 146 ? 0.8022 1.0320 0.6125 0.1745  0.1020  -0.2180 266 SER A C   
1146 O O   . SER A 146 ? 0.9317 1.1486 0.7298 0.1766  0.1076  -0.2167 266 SER A O   
1147 C CB  . SER A 146 ? 0.8966 1.1917 0.6435 0.2652  0.0499  -0.2138 266 SER A CB  
1148 O OG  . SER A 146 ? 0.9008 1.2929 0.7295 0.2538  0.0443  -0.2685 266 SER A OG  
1149 N N   . ALA A 147 ? 0.8989 1.1487 0.7740 0.1383  0.1265  -0.2462 267 ALA A N   
1150 C CA  . ALA A 147 ? 0.9183 1.1624 0.8523 0.0974  0.1729  -0.2755 267 ALA A CA  
1151 C C   . ALA A 147 ? 0.9501 1.0857 0.8602 0.0686  0.2031  -0.2270 267 ALA A C   
1152 O O   . ALA A 147 ? 1.0372 1.1398 0.9824 0.0385  0.2564  -0.2405 267 ALA A O   
1153 C CB  . ALA A 147 ? 0.7941 1.1351 0.8292 0.0774  0.1894  -0.3503 267 ALA A CB  
1154 N N   . GLY A 148 ? 0.9876 1.0674 0.8362 0.0828  0.1745  -0.1743 268 GLY A N   
1155 C CA  . GLY A 148 ? 0.9144 0.9064 0.7285 0.0721  0.1922  -0.1327 268 GLY A CA  
1156 C C   . GLY A 148 ? 0.9142 0.8997 0.7575 0.0537  0.2091  -0.1382 268 GLY A C   
1157 O O   . GLY A 148 ? 0.9999 0.9149 0.8136 0.0513  0.2318  -0.1095 268 GLY A O   
1158 N N   . GLU A 149 ? 0.8789 0.9405 0.7737 0.0488  0.1976  -0.1767 269 GLU A N   
1159 C CA  . GLU A 149 ? 0.9250 0.9876 0.8522 0.0313  0.2112  -0.1864 269 GLU A CA  
1160 C C   . GLU A 149 ? 0.8736 0.8983 0.7474 0.0460  0.1772  -0.1401 269 GLU A C   
1161 O O   . GLU A 149 ? 0.8137 0.8469 0.6508 0.0681  0.1405  -0.1210 269 GLU A O   
1162 C CB  . GLU A 149 ? 0.8453 1.0171 0.8478 0.0278  0.2051  -0.2514 269 GLU A CB  
1163 C CG  . GLU A 149 ? 0.7949 1.0322 0.7687 0.0693  0.1514  -0.2520 269 GLU A CG  
1164 C CD  . GLU A 149 ? 0.9705 1.2515 0.9284 0.0983  0.1350  -0.2677 269 GLU A CD  
1165 O OE1 . GLU A 149 ? 0.9410 1.1932 0.9043 0.0823  0.1587  -0.2686 269 GLU A OE1 
1166 O OE2 . GLU A 149 ? 1.0214 1.3614 0.9532 0.1438  0.1015  -0.2775 269 GLU A OE2 
1167 N N   . LEU A 150 ? 0.7362 0.8063 0.6461 0.1721  0.1117  -0.0031 270 LEU A N   
1168 C CA  . LEU A 150 ? 0.7836 0.8229 0.6523 0.1550  0.0946  -0.0125 270 LEU A CA  
1169 C C   . LEU A 150 ? 0.7125 0.8140 0.6017 0.1459  0.0739  -0.0314 270 LEU A C   
1170 O O   . LEU A 150 ? 0.7259 0.8979 0.6799 0.1412  0.0670  -0.0513 270 LEU A O   
1171 C CB  . LEU A 150 ? 0.7917 0.8079 0.6792 0.1376  0.0952  -0.0216 270 LEU A CB  
1172 C CG  . LEU A 150 ? 0.8836 0.8738 0.7351 0.1203  0.0783  -0.0306 270 LEU A CG  
1173 C CD1 . LEU A 150 ? 0.8447 0.7867 0.6779 0.1208  0.0866  -0.0239 270 LEU A CD1 
1174 C CD2 . LEU A 150 ? 0.8306 0.8785 0.7298 0.1015  0.0612  -0.0554 270 LEU A CD2 
1175 N N   . LYS A 151 ? 0.7195 0.7956 0.5546 0.1441  0.0652  -0.0261 271 LYS A N   
1176 C CA  . LYS A 151 ? 0.7376 0.8680 0.5821 0.1401  0.0488  -0.0389 271 LYS A CA  
1177 C C   . LYS A 151 ? 0.8329 0.9295 0.6439 0.1211  0.0395  -0.0408 271 LYS A C   
1178 O O   . LYS A 151 ? 0.6797 0.7112 0.4371 0.1193  0.0460  -0.0249 271 LYS A O   
1179 C CB  . LYS A 151 ? 0.7617 0.9148 0.5789 0.1678  0.0541  -0.0218 271 LYS A CB  
1180 C CG  . LYS A 151 ? 0.9434 1.1558 0.8034 0.1883  0.0591  -0.0227 271 LYS A CG  
1181 C CD  . LYS A 151 ? 0.9271 1.1678 0.7549 0.2224  0.0648  -0.0026 271 LYS A CD  
1182 C CE  . LYS A 151 ? 0.8793 1.1914 0.7548 0.2440  0.0679  -0.0042 271 LYS A CE  
1183 N NZ  . LYS A 151 ? 1.0084 1.3591 0.8516 0.2841  0.0733  0.0171  271 LYS A NZ  
1184 N N   . ILE A 152 ? 0.7387 0.8812 0.5841 0.1065  0.0246  -0.0622 272 ILE A N   
1185 C CA  . ILE A 152 ? 0.7883 0.9143 0.6105 0.0899  0.0160  -0.0632 272 ILE A CA  
1186 C C   . ILE A 152 ? 0.7597 0.8861 0.5424 0.0997  0.0186  -0.0462 272 ILE A C   
1187 O O   . ILE A 152 ? 0.8229 0.9983 0.6110 0.1205  0.0190  -0.0440 272 ILE A O   
1188 C CB  . ILE A 152 ? 0.8772 1.0557 0.7442 0.0775  0.0020  -0.0889 272 ILE A CB  
1189 C CG1 . ILE A 152 ? 0.9537 1.1416 0.8729 0.0723  0.0046  -0.1068 272 ILE A CG1 
1190 C CG2 . ILE A 152 ? 0.9322 1.0889 0.7797 0.0599  -0.0041 -0.0870 272 ILE A CG2 
1191 C CD1 . ILE A 152 ? 0.9842 1.2118 0.9453 0.0609  -0.0058 -0.1338 272 ILE A CD1 
1192 N N   . ALA A 153 ? 0.7224 0.7970 0.4678 0.0856  0.0216  -0.0342 273 ALA A N   
1193 C CA  . ALA A 153 ? 0.7400 0.8053 0.4525 0.0914  0.0301  -0.0149 273 ALA A CA  
1194 C C   . ALA A 153 ? 0.6953 0.7552 0.4075 0.0662  0.0239  -0.0169 273 ALA A C   
1195 O O   . ALA A 153 ? 0.7609 0.8284 0.4954 0.0475  0.0112  -0.0336 273 ALA A O   
1196 C CB  . ALA A 153 ? 0.7795 0.7722 0.4443 0.1011  0.0486  0.0071  273 ALA A CB  
1197 N N   . ASP A 154 ? 0.7345 0.7833 0.4237 0.0680  0.0359  0.0030  274 ASP A N   
1198 C CA  . ASP A 154 ? 0.7610 0.8066 0.4543 0.0434  0.0346  0.0060  274 ASP A CA  
1199 C C   . ASP A 154 ? 0.6795 0.7954 0.4108 0.0385  0.0182  -0.0115 274 ASP A C   
1200 O O   . ASP A 154 ? 0.6869 0.8037 0.4373 0.0192  0.0048  -0.0282 274 ASP A O   
1201 C CB  . ASP A 154 ? 0.9038 0.8835 0.5837 0.0135  0.0317  0.0004  274 ASP A CB  
1202 C CG  . ASP A 154 ? 1.1054 1.0867 0.7967 -0.0152 0.0306  0.0030  274 ASP A CG  
1203 O OD1 . ASP A 154 ? 1.0128 1.0268 0.7125 -0.0096 0.0413  0.0190  274 ASP A OD1 
1204 O OD2 . ASP A 154 ? 1.1153 1.0701 0.8081 -0.0415 0.0196  -0.0102 274 ASP A OD2 
1205 N N   . PHE A 155 ? 0.6791 0.8544 0.4174 0.0601  0.0205  -0.0070 275 PHE A N   
1206 C CA  . PHE A 155 ? 0.6350 0.8752 0.4032 0.0597  0.0075  -0.0239 275 PHE A CA  
1207 C C   . PHE A 155 ? 0.5462 0.7916 0.3133 0.0463  0.0158  -0.0066 275 PHE A C   
1208 O O   . PHE A 155 ? 0.6357 0.9388 0.4147 0.0579  0.0141  -0.0081 275 PHE A O   
1209 C CB  . PHE A 155 ? 0.5174 0.8267 0.2930 0.0926  0.0027  -0.0344 275 PHE A CB  
1210 C CG  . PHE A 155 ? 0.6367 0.9603 0.4364 0.0977  -0.0098 -0.0613 275 PHE A CG  
1211 C CD1 . PHE A 155 ? 0.6512 0.9394 0.4391 0.1043  -0.0029 -0.0533 275 PHE A CD1 
1212 C CD2 . PHE A 155 ? 0.5430 0.9129 0.3802 0.0956  -0.0254 -0.0942 275 PHE A CD2 
1213 C CE1 . PHE A 155 ? 0.6812 0.9861 0.4997 0.1074  -0.0110 -0.0754 275 PHE A CE1 
1214 C CE2 . PHE A 155 ? 0.5845 0.9645 0.4535 0.0961  -0.0329 -0.1188 275 PHE A CE2 
1215 C CZ  . PHE A 155 ? 0.6062 0.9567 0.4685 0.1012  -0.0255 -0.1084 275 PHE A CZ  
1216 N N   . GLY A 156 ? 0.6064 0.7918 0.3615 0.0212  0.0251  0.0079  276 GLY A N   
1217 C CA  . GLY A 156 ? 0.6775 0.8624 0.4397 0.0023  0.0364  0.0259  276 GLY A CA  
1218 C C   . GLY A 156 ? 0.7539 0.9787 0.5492 -0.0175 0.0212  0.0116  276 GLY A C   
1219 O O   . GLY A 156 ? 0.8208 1.0571 0.6309 -0.0342 0.0300  0.0261  276 GLY A O   
1220 N N   . TRP A 157 ? 0.6053 0.8507 0.4150 -0.0149 0.0015  -0.0146 277 TRP A N   
1221 C CA  . TRP A 157 ? 0.5944 0.8817 0.4329 -0.0250 -0.0108 -0.0268 277 TRP A CA  
1222 C C   . TRP A 157 ? 0.5720 0.9118 0.4242 0.0004  -0.0190 -0.0461 277 TRP A C   
1223 O O   . TRP A 157 ? 0.5672 0.9409 0.4410 -0.0008 -0.0270 -0.0576 277 TRP A O   
1224 C CB  . TRP A 157 ? 0.5567 0.8130 0.4007 -0.0469 -0.0247 -0.0406 277 TRP A CB  
1225 C CG  . TRP A 157 ? 0.5424 0.7747 0.3882 -0.0782 -0.0240 -0.0316 277 TRP A CG  
1226 C CD1 . TRP A 157 ? 0.6610 0.8337 0.4871 -0.0964 -0.0264 -0.0352 277 TRP A CD1 
1227 C CD2 . TRP A 157 ? 0.6078 0.8782 0.4802 -0.0964 -0.0210 -0.0210 277 TRP A CD2 
1228 N NE1 . TRP A 157 ? 0.6490 0.8202 0.4900 -0.1277 -0.0275 -0.0320 277 TRP A NE1 
1229 C CE2 . TRP A 157 ? 0.6602 0.8932 0.5337 -0.1295 -0.0234 -0.0215 277 TRP A CE2 
1230 C CE3 . TRP A 157 ? 0.6950 1.0296 0.5918 -0.0872 -0.0159 -0.0118 277 TRP A CE3 
1231 C CZ2 . TRP A 157 ? 0.7746 1.0360 0.6808 -0.1577 -0.0212 -0.0138 277 TRP A CZ2 
1232 C CZ3 . TRP A 157 ? 0.6471 1.0094 0.5728 -0.1112 -0.0112 0.0009  277 TRP A CZ3 
1233 C CH2 . TRP A 157 ? 0.6797 1.0075 0.6141 -0.1481 -0.0140 -0.0003 277 TRP A CH2 
1234 N N   . SER A 158 ? 0.4649 0.8126 0.3053 0.0240  -0.0169 -0.0513 278 SER A N   
1235 C CA  . SER A 158 ? 0.5536 0.9465 0.4105 0.0446  -0.0271 -0.0783 278 SER A CA  
1236 C C   . SER A 158 ? 0.6500 1.1056 0.5106 0.0628  -0.0256 -0.0791 278 SER A C   
1237 O O   . SER A 158 ? 0.5748 1.0427 0.4223 0.0659  -0.0126 -0.0524 278 SER A O   
1238 C CB  . SER A 158 ? 0.6442 1.0375 0.4923 0.0635  -0.0276 -0.0864 278 SER A CB  
1239 O OG  . SER A 158 ? 0.6821 1.0985 0.5049 0.0856  -0.0170 -0.0661 278 SER A OG  
1240 N N   . VAL A 159 ? 0.4849 0.9775 0.3640 0.0759  -0.0365 -0.1100 279 VAL A N   
1241 C CA  . VAL A 159 ? 0.6672 1.2202 0.5456 0.0981  -0.0365 -0.1169 279 VAL A CA  
1242 C C   . VAL A 159 ? 0.6081 1.1960 0.5000 0.1172  -0.0499 -0.1597 279 VAL A C   
1243 O O   . VAL A 159 ? 0.6063 1.1691 0.5236 0.1050  -0.0573 -0.1851 279 VAL A O   
1244 C CB  . VAL A 159 ? 0.6849 1.2464 0.5780 0.0864  -0.0337 -0.1094 279 VAL A CB  
1245 C CG1 . VAL A 159 ? 0.4637 0.9999 0.3820 0.0730  -0.0425 -0.1329 279 VAL A CG1 
1246 C CG2 . VAL A 159 ? 0.6529 1.2767 0.5402 0.1137  -0.0299 -0.1119 279 VAL A CG2 
1247 N N   . HIS A 160 ? 0.5441 1.1793 0.4314 0.1458  -0.0493 -0.1633 280 HIS A N   
1248 C CA  . HIS A 160 ? 0.4954 1.1581 0.4117 0.1611  -0.0602 -0.2024 280 HIS A CA  
1249 C C   . HIS A 160 ? 0.5948 1.2744 0.5237 0.1659  -0.0609 -0.2191 280 HIS A C   
1250 O O   . HIS A 160 ? 0.6481 1.3630 0.5617 0.1858  -0.0549 -0.2038 280 HIS A O   
1251 C CB  . HIS A 160 ? 0.5639 1.2728 0.4704 0.1931  -0.0612 -0.1994 280 HIS A CB  
1252 C CG  . HIS A 160 ? 0.7181 1.4625 0.6554 0.2074  -0.0743 -0.2434 280 HIS A CG  
1253 N ND1 . HIS A 160 ? 0.7190 1.4429 0.6931 0.1876  -0.0827 -0.2819 280 HIS A ND1 
1254 C CD2 . HIS A 160 ? 0.5760 1.3764 0.5137 0.2397  -0.0798 -0.2562 280 HIS A CD2 
1255 C CE1 . HIS A 160 ? 0.7266 1.4910 0.7243 0.2035  -0.0929 -0.3184 280 HIS A CE1 
1256 N NE2 . HIS A 160 ? 0.7310 1.5446 0.7058 0.2360  -0.0927 -0.3049 280 HIS A NE2 
1257 N N   . ALA A 161 ? 0.5108 1.1651 0.4667 0.1507  -0.0660 -0.2487 281 ALA A N   
1258 C CA  . ALA A 161 ? 0.5580 1.2206 0.5216 0.1560  -0.0643 -0.2630 281 ALA A CA  
1259 C C   . ALA A 161 ? 0.6119 1.2728 0.6088 0.1596  -0.0722 -0.3108 281 ALA A C   
1260 O O   . ALA A 161 ? 0.7239 1.3475 0.7412 0.1440  -0.0697 -0.3299 281 ALA A O   
1261 C CB  . ALA A 161 ? 0.5345 1.1653 0.4929 0.1356  -0.0579 -0.2471 281 ALA A CB  
1262 N N   A PRO A 162 ? 0.6604 1.3615 0.6636 0.1807  -0.0807 -0.3310 282 PRO A N   
1263 N N   B PRO A 162 ? 0.6677 1.3690 0.6707 0.1809  -0.0806 -0.3310 282 PRO A N   
1264 C CA  A PRO A 162 ? 0.6963 1.3983 0.7340 0.1813  -0.0894 -0.3799 282 PRO A CA  
1265 C CA  B PRO A 162 ? 0.6995 1.4022 0.7359 0.1823  -0.0892 -0.3795 282 PRO A CA  
1266 C C   A PRO A 162 ? 0.7603 1.4596 0.7943 0.1917  -0.0863 -0.3932 282 PRO A C   
1267 C C   B PRO A 162 ? 0.7757 1.4781 0.8056 0.1941  -0.0858 -0.3900 282 PRO A C   
1268 O O   A PRO A 162 ? 0.8390 1.5122 0.9012 0.1834  -0.0869 -0.4302 282 PRO A O   
1269 O O   B PRO A 162 ? 0.8737 1.5580 0.9295 0.1902  -0.0882 -0.4287 282 PRO A O   
1270 C CB  A PRO A 162 ? 0.7119 1.4676 0.7509 0.2038  -0.1006 -0.3935 282 PRO A CB  
1271 C CB  B PRO A 162 ? 0.7123 1.4682 0.7509 0.2044  -0.1005 -0.3938 282 PRO A CB  
1272 C CG  A PRO A 162 ? 0.6743 1.4614 0.6718 0.2269  -0.0945 -0.3508 282 PRO A CG  
1273 C CG  B PRO A 162 ? 0.6545 1.4419 0.6517 0.2272  -0.0945 -0.3508 282 PRO A CG  
1274 C CD  A PRO A 162 ? 0.6522 1.4001 0.6318 0.2060  -0.0819 -0.3107 282 PRO A CD  
1275 C CD  B PRO A 162 ? 0.6464 1.3943 0.6260 0.2060  -0.0819 -0.3108 282 PRO A CD  
1276 N N   A SER A 163 ? 0.7010 1.4247 0.7014 0.2100  -0.0802 -0.3620 283 SER A N   
1277 N N   B SER A 163 ? 0.7048 1.4258 0.7016 0.2083  -0.0779 -0.3546 283 SER A N   
1278 C CA  A SER A 163 ? 0.7043 1.4319 0.6955 0.2260  -0.0755 -0.3696 283 SER A CA  
1279 C CA  B SER A 163 ? 0.7445 1.4726 0.7300 0.2252  -0.0725 -0.3582 283 SER A CA  
1280 C C   A SER A 163 ? 0.7819 1.5164 0.7476 0.2298  -0.0608 -0.3261 283 SER A C   
1281 C C   B SER A 163 ? 0.8849 1.5910 0.8606 0.2160  -0.0566 -0.3301 283 SER A C   
1282 O O   A SER A 163 ? 0.5772 1.3492 0.5216 0.2538  -0.0570 -0.3080 283 SER A O   
1283 O O   B SER A 163 ? 1.0093 1.6808 0.9983 0.2120  -0.0482 -0.3465 283 SER A O   
1284 C CB  A SER A 163 ? 0.7738 1.5487 0.7547 0.2565  -0.0861 -0.3865 283 SER A CB  
1285 C CB  B SER A 163 ? 0.7545 1.5385 0.7128 0.2577  -0.0751 -0.3415 283 SER A CB  
1286 O OG  A SER A 163 ? 0.7956 1.5738 0.8054 0.2526  -0.1003 -0.4313 283 SER A OG  
1287 O OG  B SER A 163 ? 0.6072 1.4213 0.5736 0.2726  -0.0899 -0.3696 283 SER A OG  
1288 N N   A SER A 164 ? 0.7660 1.4689 0.7363 0.2069  -0.0520 -0.3096 284 SER A N   
1289 N N   B SER A 164 ? 0.7766 1.5041 0.7321 0.2137  -0.0498 -0.2870 284 SER A N   
1290 C CA  A SER A 164 ? 0.6618 1.3780 0.6166 0.2061  -0.0381 -0.2710 284 SER A CA  
1291 C CA  B SER A 164 ? 0.6240 1.3527 0.5726 0.2080  -0.0353 -0.2576 284 SER A CA  
1292 C C   A SER A 164 ? 0.6489 1.3192 0.6199 0.1784  -0.0334 -0.2591 284 SER A C   
1293 C C   B SER A 164 ? 0.6529 1.3311 0.6200 0.1790  -0.0331 -0.2519 284 SER A C   
1294 O O   A SER A 164 ? 0.5986 1.2349 0.5791 0.1586  -0.0400 -0.2658 284 SER A O   
1295 O O   B SER A 164 ? 0.5904 1.2388 0.5638 0.1600  -0.0404 -0.2571 284 SER A O   
1296 C CB  A SER A 164 ? 0.5755 1.3310 0.5089 0.2095  -0.0355 -0.2307 284 SER A CB  
1297 C CB  B SER A 164 ? 0.6342 1.4039 0.5629 0.2100  -0.0278 -0.2116 284 SER A CB  
1298 O OG  A SER A 164 ? 0.4621 1.1994 0.3938 0.1928  -0.0417 -0.2251 284 SER A OG  
1299 O OG  B SER A 164 ? 0.8526 1.6647 0.7697 0.2397  -0.0253 -0.2032 284 SER A OG  
1300 N N   . ARG A 165 ? 0.6694 1.3364 0.6488 0.1778  -0.0236 -0.2351 285 ARG A N   
1301 C CA  . ARG A 165 ? 0.7206 1.3480 0.7152 0.1535  -0.0225 -0.2126 285 ARG A CA  
1302 C C   . ARG A 165 ? 0.7242 1.3820 0.7114 0.1395  -0.0235 -0.1703 285 ARG A C   
1303 O O   . ARG A 165 ? 0.8709 1.5792 0.8510 0.1528  -0.0181 -0.1543 285 ARG A O   
1304 C CB  . ARG A 165 ? 0.7311 1.3374 0.7410 0.1646  -0.0112 -0.2151 285 ARG A CB  
1305 C CG  . ARG A 165 ? 0.8657 1.4262 0.8909 0.1727  -0.0048 -0.2563 285 ARG A CG  
1306 C CD  . ARG A 165 ? 0.9342 1.4619 0.9733 0.1852  0.0123  -0.2504 285 ARG A CD  
1307 N NE  . ARG A 165 ? 0.8924 1.3769 0.9414 0.1685  0.0152  -0.2310 285 ARG A NE  
1308 C CZ  . ARG A 165 ? 0.8444 1.2776 0.9095 0.1770  0.0331  -0.2346 285 ARG A CZ  
1309 N NH1 . ARG A 165 ? 0.8638 1.2762 0.9403 0.1985  0.0505  -0.2588 285 ARG A NH1 
1310 N NH2 . ARG A 165 ? 1.0111 1.4108 1.0791 0.1666  0.0363  -0.2134 285 ARG A NH2 
1311 N N   . ARG A 166 ? 0.5539 1.1806 0.5443 0.1127  -0.0288 -0.1532 286 ARG A N   
1312 C CA  . ARG A 166 ? 0.5313 1.1768 0.5172 0.0933  -0.0302 -0.1205 286 ARG A CA  
1313 C C   . ARG A 166 ? 0.5472 1.2105 0.5491 0.0808  -0.0305 -0.0966 286 ARG A C   
1314 O O   . ARG A 166 ? 0.7346 1.3872 0.7454 0.0877  -0.0309 -0.1020 286 ARG A O   
1315 C CB  . ARG A 166 ? 0.4804 1.0818 0.4559 0.0719  -0.0363 -0.1191 286 ARG A CB  
1316 C CG  . ARG A 166 ? 0.5260 1.1142 0.4912 0.0839  -0.0388 -0.1450 286 ARG A CG  
1317 C CD  . ARG A 166 ? 0.5531 1.1922 0.5046 0.1085  -0.0352 -0.1488 286 ARG A CD  
1318 N NE  . ARG A 166 ? 0.6423 1.3072 0.5833 0.1035  -0.0267 -0.1124 286 ARG A NE  
1319 C CZ  . ARG A 166 ? 0.6016 1.3099 0.5252 0.1266  -0.0186 -0.1034 286 ARG A CZ  
1320 N NH1 . ARG A 166 ? 0.6100 1.3458 0.5206 0.1570  -0.0230 -0.1333 286 ARG A NH1 
1321 N NH2 . ARG A 166 ? 0.4820 1.2064 0.4018 0.1201  -0.0049 -0.0654 286 ARG A NH2 
1322 N N   . THR A 167 ? 0.5057 1.1985 0.5134 0.0633  -0.0290 -0.0700 287 THR A N   
1323 C CA  . THR A 167 ? 0.5524 1.2763 0.5827 0.0472  -0.0322 -0.0500 287 THR A CA  
1324 C C   . THR A 167 ? 0.4516 1.1558 0.4862 0.0097  -0.0385 -0.0361 287 THR A C   
1325 O O   . THR A 167 ? 0.5764 1.3066 0.6329 -0.0103 -0.0452 -0.0250 287 THR A O   
1326 C CB  . THR A 167 ? 0.5487 1.3444 0.5972 0.0610  -0.0209 -0.0312 287 THR A CB  
1327 O OG1 . THR A 167 ? 0.6420 1.4525 0.6853 0.0580  -0.0093 -0.0156 287 THR A OG1 
1328 C CG2 . THR A 167 ? 0.5987 1.4111 0.6402 0.1005  -0.0138 -0.0469 287 THR A CG2 
1329 N N   . TPO A 168 ? 0.3921 1.0520 0.4062 0.0012  -0.0364 -0.0389 288 TPO A N   
1330 C CA  . TPO A 168 ? 0.5726 1.2034 0.5865 -0.0319 -0.0376 -0.0263 288 TPO A CA  
1331 C CB  . TPO A 168 ? 0.5625 1.1612 0.5523 -0.0271 -0.0265 -0.0216 288 TPO A CB  
1332 C CG2 . TPO A 168 ? 0.5198 1.0765 0.5072 -0.0599 -0.0233 -0.0083 288 TPO A CG2 
1333 O OG1 . TPO A 168 ? 0.5325 1.1782 0.5247 -0.0070 -0.0107 -0.0066 288 TPO A OG1 
1334 P P   . TPO A 168 ? 0.5601 1.1984 0.5217 0.0270  -0.0088 -0.0233 288 TPO A P   
1335 O O1P . TPO A 168 ? 0.7690 1.4697 0.7269 0.0586  0.0063  -0.0111 288 TPO A O1P 
1336 O O2P . TPO A 168 ? 0.5301 1.1522 0.4903 0.0402  -0.0238 -0.0584 288 TPO A O2P 
1337 O O3P . TPO A 168 ? 0.5734 1.1661 0.5124 0.0205  -0.0045 -0.0168 288 TPO A O3P 
1338 C C   . TPO A 168 ? 0.5862 1.1735 0.5936 -0.0505 -0.0534 -0.0383 288 TPO A C   
1339 O O   . TPO A 168 ? 0.5901 1.1368 0.5781 -0.0378 -0.0582 -0.0546 288 TPO A O   
1340 N N   . LEU A 169 ? 0.5651 1.1641 0.5905 -0.0800 -0.0609 -0.0311 289 LEU A N   
1341 C CA  . LEU A 169 ? 0.5238 1.0818 0.5361 -0.0975 -0.0767 -0.0436 289 LEU A CA  
1342 C C   . LEU A 169 ? 0.5883 1.0753 0.5716 -0.1077 -0.0708 -0.0454 289 LEU A C   
1343 O O   . LEU A 169 ? 0.7813 1.2515 0.7694 -0.1333 -0.0640 -0.0357 289 LEU A O   
1344 C CB  . LEU A 169 ? 0.4790 1.0757 0.5209 -0.1283 -0.0889 -0.0415 289 LEU A CB  
1345 C CG  . LEU A 169 ? 0.7422 1.3205 0.7719 -0.1414 -0.1109 -0.0589 289 LEU A CG  
1346 C CD1 . LEU A 169 ? 0.9087 1.4205 0.9194 -0.1709 -0.1120 -0.0664 289 LEU A CD1 
1347 C CD2 . LEU A 169 ? 0.5618 1.1187 0.5617 -0.1066 -0.1161 -0.0683 289 LEU A CD2 
1348 N N   . ALA A 170 ? 0.5542 0.9997 0.5106 -0.0866 -0.0705 -0.0563 290 ALA A N   
1349 C CA  . ALA A 170 ? 0.6357 1.0218 0.5646 -0.0881 -0.0630 -0.0562 290 ALA A CA  
1350 C C   . ALA A 170 ? 0.7389 1.0718 0.6424 -0.0855 -0.0715 -0.0692 290 ALA A C   
1351 O O   . ALA A 170 ? 0.7396 1.0769 0.6435 -0.0675 -0.0763 -0.0783 290 ALA A O   
1352 C CB  . ALA A 170 ? 0.4587 0.8545 0.3826 -0.0621 -0.0514 -0.0554 290 ALA A CB  
1353 N N   . GLY A 171 ? 0.8317 1.1110 0.7119 -0.1005 -0.0695 -0.0678 291 GLY A N   
1354 C CA  . GLY A 171 ? 0.8571 1.0832 0.7076 -0.0939 -0.0742 -0.0776 291 GLY A CA  
1355 C C   . GLY A 171 ? 0.8831 1.0741 0.7151 -0.1177 -0.0840 -0.0842 291 GLY A C   
1356 O O   . GLY A 171 ? 0.8510 1.0364 0.6908 -0.1443 -0.0816 -0.0805 291 GLY A O   
1357 N N   . THR A 172 ? 0.8195 0.9855 0.6273 -0.1070 -0.0935 -0.0950 292 THR A N   
1358 C CA  . THR A 172 ? 0.7802 0.9129 0.5621 -0.1239 -0.1063 -0.1081 292 THR A CA  
1359 C C   . THR A 172 ? 0.7660 0.9345 0.5452 -0.1125 -0.1249 -0.1188 292 THR A C   
1360 O O   . THR A 172 ? 0.7271 0.9098 0.5065 -0.0827 -0.1205 -0.1130 292 THR A O   
1361 C CB  . THR A 172 ? 0.9489 1.0054 0.6869 -0.1134 -0.0967 -0.1091 292 THR A CB  
1362 O OG1 . THR A 172 ? 0.9546 0.9838 0.6934 -0.1175 -0.0779 -0.0959 292 THR A OG1 
1363 C CG2 . THR A 172 ? 0.7960 0.8132 0.5013 -0.1297 -0.1105 -0.1277 292 THR A CG2 
1364 N N   . LEU A 173 ? 0.7204 0.6337 0.5022 -0.0133 -0.1168 -0.0031 293 LEU A N   
1365 C CA  . LEU A 173 ? 0.8413 0.7592 0.6079 -0.0178 -0.1282 -0.0064 293 LEU A CA  
1366 C C   . LEU A 173 ? 0.8552 0.7746 0.5878 -0.0014 -0.1120 -0.0171 293 LEU A C   
1367 O O   . LEU A 173 ? 0.8359 0.7851 0.5778 0.0009  -0.1018 -0.0061 293 LEU A O   
1368 C CB  . LEU A 173 ? 0.9116 0.7951 0.6667 -0.0298 -0.1573 -0.0193 293 LEU A CB  
1369 C CG  . LEU A 173 ? 0.9345 0.8258 0.6658 -0.0329 -0.1744 -0.0251 293 LEU A CG  
1370 C CD1 . LEU A 173 ? 0.9311 0.8682 0.7012 -0.0442 -0.1792 0.0016  293 LEU A CD1 
1371 C CD2 . LEU A 173 ? 0.9458 0.7998 0.6568 -0.0438 -0.2049 -0.0488 293 LEU A CD2 
1372 N N   . ASP A 174 ? 0.8979 0.7849 0.5951 0.0116  -0.1068 -0.0360 294 ASP A N   
1373 C CA  . ASP A 174 ? 0.9477 0.8353 0.6125 0.0287  -0.0911 -0.0421 294 ASP A CA  
1374 C C   . ASP A 174 ? 0.9332 0.8470 0.6194 0.0382  -0.0614 -0.0337 294 ASP A C   
1375 O O   . ASP A 174 ? 0.7834 0.7038 0.4579 0.0509  -0.0443 -0.0315 294 ASP A O   
1376 C CB  . ASP A 174 ? 0.8717 0.7191 0.4926 0.0430  -0.0899 -0.0637 294 ASP A CB  
1377 C CG  . ASP A 174 ? 0.9025 0.7254 0.4882 0.0372  -0.1183 -0.0799 294 ASP A CG  
1378 O OD1 . ASP A 174 ? 0.9311 0.7709 0.4925 0.0410  -0.1248 -0.0771 294 ASP A OD1 
1379 O OD2 . ASP A 174 ? 0.8863 0.6744 0.4702 0.0294  -0.1342 -0.0959 294 ASP A OD2 
1380 N N   . TYR A 175 ? 0.7544 0.6854 0.4743 0.0319  -0.0553 -0.0285 295 TYR A N   
1381 C CA  . TYR A 175 ? 0.8346 0.7902 0.5767 0.0382  -0.0309 -0.0280 295 TYR A CA  
1382 C C   . TYR A 175 ? 0.7284 0.7197 0.5037 0.0285  -0.0272 -0.0180 295 TYR A C   
1383 O O   . TYR A 175 ? 0.7116 0.7246 0.5082 0.0308  -0.0090 -0.0224 295 TYR A O   
1384 C CB  . TYR A 175 ? 0.8201 0.7725 0.5688 0.0431  -0.0253 -0.0344 295 TYR A CB  
1385 C CG  . TYR A 175 ? 1.0397 0.9556 0.7579 0.0563  -0.0234 -0.0446 295 TYR A CG  
1386 C CD1 . TYR A 175 ? 1.2198 1.1012 0.9179 0.0541  -0.0418 -0.0497 295 TYR A CD1 
1387 C CD2 . TYR A 175 ? 0.9416 0.8562 0.6542 0.0716  -0.0016 -0.0496 295 TYR A CD2 
1388 C CE1 . TYR A 175 ? 1.1730 1.0177 0.8399 0.0684  -0.0379 -0.0631 295 TYR A CE1 
1389 C CE2 . TYR A 175 ? 0.9348 0.8174 0.6172 0.0873  0.0038  -0.0579 295 TYR A CE2 
1390 C CZ  . TYR A 175 ? 1.0687 0.9154 0.7251 0.0866  -0.0142 -0.0664 295 TYR A CZ  
1391 O OH  . TYR A 175 ? 1.3523 1.1636 0.9755 0.1042  -0.0070 -0.0788 295 TYR A OH  
1392 N N   . LEU A 176 ? 0.7409 0.7387 0.5227 0.0177  -0.0441 -0.0061 296 LEU A N   
1393 C CA  . LEU A 176 ? 0.6632 0.6952 0.4754 0.0110  -0.0389 0.0055  296 LEU A CA  
1394 C C   . LEU A 176 ? 0.6537 0.6985 0.4773 0.0175  -0.0186 0.0063  296 LEU A C   
1395 O O   . LEU A 176 ? 0.7117 0.7461 0.5228 0.0228  -0.0191 0.0120  296 LEU A O   
1396 C CB  . LEU A 176 ? 0.6347 0.6722 0.4574 -0.0012 -0.0603 0.0226  296 LEU A CB  
1397 C CG  . LEU A 176 ? 0.6487 0.6812 0.4805 -0.0100 -0.0758 0.0291  296 LEU A CG  
1398 C CD1 . LEU A 176 ? 0.6570 0.6926 0.5070 -0.0243 -0.0975 0.0463  296 LEU A CD1 
1399 C CD2 . LEU A 176 ? 0.6961 0.7605 0.5468 -0.0074 -0.0621 0.0347  296 LEU A CD2 
1400 N N   . PRO A 177 ? 0.6914 0.7598 0.5395 0.0182  -0.0002 0.0005  297 PRO A N   
1401 C CA  . PRO A 177 ? 0.5917 0.6684 0.4611 0.0238  0.0224  0.0001  297 PRO A CA  
1402 C C   . PRO A 177 ? 0.5881 0.6784 0.4719 0.0223  0.0198  0.0211  297 PRO A C   
1403 O O   . PRO A 177 ? 0.6018 0.7046 0.4874 0.0145  0.0028  0.0331  297 PRO A O   
1404 C CB  . PRO A 177 ? 0.6523 0.7499 0.5426 0.0221  0.0376  -0.0186 297 PRO A CB  
1405 C CG  . PRO A 177 ? 0.6557 0.7704 0.5370 0.0162  0.0207  -0.0157 297 PRO A CG  
1406 C CD  . PRO A 177 ? 0.6893 0.7787 0.5463 0.0149  0.0005  -0.0076 297 PRO A CD  
1407 N N   . PRO A 178 ? 0.5765 0.6665 0.4763 0.0307  0.0380  0.0292  298 PRO A N   
1408 C CA  . PRO A 178 ? 0.6704 0.7774 0.5894 0.0326  0.0382  0.0533  298 PRO A CA  
1409 C C   . PRO A 178 ? 0.5853 0.7179 0.5305 0.0286  0.0450  0.0555  298 PRO A C   
1410 O O   . PRO A 178 ? 0.6041 0.7553 0.5606 0.0257  0.0338  0.0781  298 PRO A O   
1411 C CB  . PRO A 178 ? 0.6234 0.7241 0.5620 0.0458  0.0655  0.0599  298 PRO A CB  
1412 C CG  . PRO A 178 ? 0.7045 0.7821 0.6219 0.0502  0.0696  0.0464  298 PRO A CG  
1413 C CD  . PRO A 178 ? 0.5676 0.6421 0.4731 0.0404  0.0603  0.0213  298 PRO A CD  
1414 N N   . GLU A 179 ? 0.5990 0.7363 0.5537 0.0291  0.0627  0.0321  299 GLU A N   
1415 C CA  . GLU A 179 ? 0.6051 0.7693 0.5778 0.0293  0.0729  0.0309  299 GLU A CA  
1416 C C   . GLU A 179 ? 0.5994 0.7829 0.5608 0.0216  0.0501  0.0460  299 GLU A C   
1417 O O   . GLU A 179 ? 0.6415 0.8504 0.6208 0.0230  0.0538  0.0638  299 GLU A O   
1418 C CB  . GLU A 179 ? 0.5169 0.6851 0.4946 0.0308  0.0921  -0.0039 299 GLU A CB  
1419 C CG  . GLU A 179 ? 0.4784 0.6403 0.4335 0.0249  0.0800  -0.0251 299 GLU A CG  
1420 C CD  . GLU A 179 ? 0.7180 0.8523 0.6788 0.0266  0.0891  -0.0364 299 GLU A CD  
1421 O OE1 . GLU A 179 ? 0.5836 0.6996 0.5463 0.0314  0.0907  -0.0167 299 GLU A OE1 
1422 O OE2 . GLU A 179 ? 0.6195 0.7551 0.5846 0.0237  0.0946  -0.0631 299 GLU A OE2 
1423 N N   . MET A 180 ? 0.7201 0.8913 0.6573 0.0145  0.0292  0.0417  300 MET A N   
1424 C CA  . MET A 180 ? 0.6937 0.8775 0.6280 0.0066  0.0087  0.0592  300 MET A CA  
1425 C C   . MET A 180 ? 0.7650 0.9476 0.7119 -0.0003 -0.0098 0.0865  300 MET A C   
1426 O O   . MET A 180 ? 0.7323 0.9389 0.7008 -0.0052 -0.0160 0.1094  300 MET A O   
1427 C CB  . MET A 180 ? 0.6643 0.8299 0.5749 0.0026  -0.0064 0.0481  300 MET A CB  
1428 C CG  . MET A 180 ? 0.5786 0.7602 0.4814 0.0075  0.0052  0.0273  300 MET A CG  
1429 S SD  . MET A 180 ? 0.6631 0.8320 0.5477 0.0052  -0.0129 0.0272  300 MET A SD  
1430 C CE  . MET A 180 ? 0.6562 0.8553 0.5354 0.0123  0.0009  0.0014  300 MET A CE  
1431 N N   . ILE A 181 ? 0.6800 0.8388 0.6143 -0.0004 -0.0192 0.0849  301 ILE A N   
1432 C CA  . ILE A 181 ? 0.7154 0.8773 0.6581 -0.0075 -0.0413 0.1063  301 ILE A CA  
1433 C C   . ILE A 181 ? 0.6682 0.8638 0.6479 -0.0034 -0.0296 0.1312  301 ILE A C   
1434 O O   . ILE A 181 ? 0.6110 0.8272 0.6148 -0.0126 -0.0469 0.1553  301 ILE A O   
1435 C CB  . ILE A 181 ? 0.8580 0.9956 0.7728 -0.0030 -0.0496 0.0988  301 ILE A CB  
1436 C CG1 . ILE A 181 ? 0.8855 0.9890 0.7641 -0.0033 -0.0560 0.0741  301 ILE A CG1 
1437 C CG2 . ILE A 181 ? 0.8786 1.0258 0.7975 -0.0115 -0.0783 0.1172  301 ILE A CG2 
1438 C CD1 . ILE A 181 ? 0.9658 1.0570 0.8399 -0.0170 -0.0814 0.0725  301 ILE A CD1 
1439 N N   . GLU A 182 ? 0.5521 0.7526 0.5417 0.0104  0.0010  0.1255  302 GLU A N   
1440 C CA  . GLU A 182 ? 0.4810 0.7090 0.5075 0.0190  0.0182  0.1486  302 GLU A CA  
1441 C C   . GLU A 182 ? 0.7412 0.9968 0.7892 0.0213  0.0343  0.1535  302 GLU A C   
1442 O O   . GLU A 182 ? 0.7815 1.0578 0.8593 0.0325  0.0576  0.1666  302 GLU A O   
1443 C CB  . GLU A 182 ? 0.4839 0.6993 0.5172 0.0344  0.0472  0.1409  302 GLU A CB  
1444 C CG  . GLU A 182 ? 0.6277 0.8260 0.6427 0.0374  0.0358  0.1466  302 GLU A CG  
1445 C CD  . GLU A 182 ? 0.7425 0.9207 0.7629 0.0515  0.0670  0.1355  302 GLU A CD  
1446 O OE1 . GLU A 182 ? 0.7520 0.9221 0.7856 0.0542  0.0923  0.1127  302 GLU A OE1 
1447 O OE2 . GLU A 182 ? 0.8142 0.9867 0.8273 0.0600  0.0661  0.1496  302 GLU A OE2 
1448 N N   . GLY A 183 ? 0.6633 0.9207 0.6960 0.0132  0.0241  0.1449  303 GLY A N   
1449 C CA  . GLY A 183 ? 0.7243 1.0139 0.7711 0.0172  0.0376  0.1539  303 GLY A CA  
1450 C C   . GLY A 183 ? 0.5992 0.8965 0.6426 0.0325  0.0719  0.1299  303 GLY A C   
1451 O O   . GLY A 183 ? 0.6635 0.9913 0.7233 0.0422  0.0913  0.1402  303 GLY A O   
1452 N N   . ARG A 184 ? 0.6813 0.9510 0.7054 0.0348  0.0802  0.0965  304 ARG A N   
1453 C CA  . ARG A 184 ? 0.7463 1.0181 0.7700 0.0456  0.1099  0.0651  304 ARG A CA  
1454 C C   . ARG A 184 ? 0.7450 1.0275 0.7383 0.0430  0.1051  0.0382  304 ARG A C   
1455 O O   . ARG A 184 ? 0.7664 1.0519 0.7426 0.0348  0.0818  0.0484  304 ARG A O   
1456 C CB  . ARG A 184 ? 0.4832 0.7216 0.5165 0.0488  0.1241  0.0463  304 ARG A CB  
1457 C CG  . ARG A 184 ? 0.6028 0.8329 0.6614 0.0529  0.1247  0.0778  304 ARG A CG  
1458 C CD  . ARG A 184 ? 0.5727 0.7712 0.6412 0.0580  0.1408  0.0645  304 ARG A CD  
1459 N NE  . ARG A 184 ? 0.7585 0.9506 0.8560 0.0687  0.1773  0.0437  304 ARG A NE  
1460 C CZ  . ARG A 184 ? 0.7518 0.9154 0.8691 0.0725  0.1984  0.0267  304 ARG A CZ  
1461 N NH1 . ARG A 184 ? 0.8024 0.9459 0.9099 0.0688  0.1878  0.0315  304 ARG A NH1 
1462 N NH2 . ARG A 184 ? 0.7776 0.9319 0.9269 0.0808  0.2318  0.0045  304 ARG A NH2 
1463 N N   . MET A 185 ? 0.6670 0.9564 0.6558 0.0505  0.1268  0.0033  305 MET A N   
1464 C CA  . MET A 185 ? 0.6238 0.9292 0.5835 0.0484  0.1203  -0.0261 305 MET A CA  
1465 C C   . MET A 185 ? 0.6992 0.9736 0.6550 0.0397  0.1128  -0.0526 305 MET A C   
1466 O O   . MET A 185 ? 0.6456 0.8877 0.6222 0.0387  0.1217  -0.0548 305 MET A O   
1467 C CB  . MET A 185 ? 0.5569 0.8898 0.5102 0.0597  0.1437  -0.0565 305 MET A CB  
1468 C CG  . MET A 185 ? 0.6434 1.0084 0.6026 0.0725  0.1581  -0.0288 305 MET A CG  
1469 S SD  . MET A 185 ? 0.7763 1.1804 0.7117 0.0892  0.1837  -0.0681 305 MET A SD  
1470 C CE  . MET A 185 ? 0.6822 1.1215 0.5730 0.0842  0.1575  -0.0806 305 MET A CE  
1471 N N   . HIS A 186 ? 0.5580 0.8462 0.4906 0.0353  0.0979  -0.0680 306 HIS A N   
1472 C CA  . HIS A 186 ? 0.6914 0.9556 0.6244 0.0279  0.0909  -0.0891 306 HIS A CA  
1473 C C   . HIS A 186 ? 0.7000 0.9924 0.6201 0.0262  0.0876  -0.1250 306 HIS A C   
1474 O O   . HIS A 186 ? 0.6333 0.9676 0.5332 0.0317  0.0848  -0.1286 306 HIS A O   
1475 C CB  . HIS A 186 ? 0.6612 0.9057 0.5832 0.0228  0.0686  -0.0614 306 HIS A CB  
1476 C CG  . HIS A 186 ? 0.6158 0.8863 0.5166 0.0227  0.0502  -0.0474 306 HIS A CG  
1477 N ND1 . HIS A 186 ? 0.5977 0.8822 0.4969 0.0240  0.0421  -0.0134 306 HIS A ND1 
1478 C CD2 . HIS A 186 ? 0.5073 0.7942 0.3941 0.0224  0.0395  -0.0585 306 HIS A CD2 
1479 C CE1 . HIS A 186 ? 0.5656 0.8708 0.4510 0.0251  0.0292  -0.0032 306 HIS A CE1 
1480 N NE2 . HIS A 186 ? 0.5545 0.8629 0.4304 0.0252  0.0271  -0.0296 306 HIS A NE2 
1481 N N   . ASP A 187 ? 0.5938 0.8678 0.5277 0.0193  0.0881  -0.1497 307 ASP A N   
1482 C CA  . ASP A 187 ? 0.6528 0.9559 0.5821 0.0149  0.0810  -0.1847 307 ASP A CA  
1483 C C   . ASP A 187 ? 0.6447 0.9336 0.5792 0.0092  0.0678  -0.1801 307 ASP A C   
1484 O O   . ASP A 187 ? 0.6027 0.8681 0.5287 0.0112  0.0595  -0.1480 307 ASP A O   
1485 C CB  . ASP A 187 ? 0.6259 0.9269 0.5810 0.0107  0.1000  -0.2310 307 ASP A CB  
1486 C CG  . ASP A 187 ? 0.8132 1.0634 0.8093 0.0076  0.1202  -0.2301 307 ASP A CG  
1487 O OD1 . ASP A 187 ? 0.7892 1.0116 0.7897 0.0074  0.1160  -0.2011 307 ASP A OD1 
1488 O OD2 . ASP A 187 ? 0.8368 1.0752 0.8607 0.0069  0.1419  -0.2585 307 ASP A OD2 
1489 N N   . GLU A 188 ? 0.6061 0.9100 0.5571 0.0022  0.0663  -0.2140 308 GLU A N   
1490 C CA  . GLU A 188 ? 0.5928 0.8920 0.5531 -0.0014 0.0558  -0.2097 308 GLU A CA  
1491 C C   . GLU A 188 ? 0.6480 0.8956 0.6311 -0.0019 0.0689  -0.1950 308 GLU A C   
1492 O O   . GLU A 188 ? 0.6722 0.9098 0.6586 -0.0008 0.0636  -0.1838 308 GLU A O   
1493 C CB  . GLU A 188 ? 0.5104 0.8453 0.4915 -0.0105 0.0505  -0.2502 308 GLU A CB  
1494 C CG  . GLU A 188 ? 0.7088 1.0232 0.7341 -0.0209 0.0701  -0.2868 308 GLU A CG  
1495 C CD  . GLU A 188 ? 0.9767 1.3321 1.0242 -0.0332 0.0607  -0.3339 308 GLU A CD  
1496 O OE1 . GLU A 188 ? 1.0731 1.4099 1.1683 -0.0450 0.0755  -0.3666 308 GLU A OE1 
1497 O OE2 . GLU A 188 ? 1.0657 1.4742 1.0864 -0.0312 0.0382  -0.3375 308 GLU A OE2 
1498 N N   . LYS A 189 ? 0.6804 0.8985 0.6790 -0.0008 0.0879  -0.1926 309 LYS A N   
1499 C CA  . LYS A 189 ? 0.7085 0.8842 0.7270 0.0021  0.1025  -0.1746 309 LYS A CA  
1500 C C   . LYS A 189 ? 0.6584 0.8147 0.6434 0.0100  0.0904  -0.1371 309 LYS A C   
1501 O O   . LYS A 189 ? 0.6309 0.7575 0.6205 0.0152  0.0990  -0.1204 309 LYS A O   
1502 C CB  . LYS A 189 ? 0.7260 0.8804 0.7727 0.0038  0.1267  -0.1773 309 LYS A CB  
1503 C CG  . LYS A 189 ? 0.7343 0.8914 0.8269 -0.0051 0.1442  -0.2179 309 LYS A CG  
1504 C CD  . LYS A 189 ? 0.7614 0.9099 0.8900 -0.0119 0.1490  -0.2265 309 LYS A CD  
1505 C CE  . LYS A 189 ? 0.7993 0.9489 0.9840 -0.0248 0.1646  -0.2698 309 LYS A CE  
1506 N NZ  . LYS A 189 ? 0.8592 1.0061 1.0887 -0.0333 0.1688  -0.2756 309 LYS A NZ  
1507 N N   . VAL A 190 ? 0.5403 0.7141 0.4927 0.0115  0.0711  -0.1243 310 VAL A N   
1508 C CA  . VAL A 190 ? 0.5569 0.7101 0.4816 0.0162  0.0571  -0.0948 310 VAL A CA  
1509 C C   . VAL A 190 ? 0.7216 0.8650 0.6396 0.0192  0.0509  -0.0944 310 VAL A C   
1510 O O   . VAL A 190 ? 0.7149 0.8291 0.6142 0.0247  0.0464  -0.0776 310 VAL A O   
1511 C CB  . VAL A 190 ? 0.5199 0.6926 0.4229 0.0159  0.0403  -0.0784 310 VAL A CB  
1512 C CG1 . VAL A 190 ? 0.5752 0.7592 0.4864 0.0156  0.0490  -0.0743 310 VAL A CG1 
1513 C CG2 . VAL A 190 ? 0.4663 0.6764 0.3628 0.0158  0.0302  -0.0876 310 VAL A CG2 
1514 N N   . ASP A 191 ? 0.6077 0.7777 0.5410 0.0163  0.0506  -0.1139 311 ASP A N   
1515 C CA  . ASP A 191 ? 0.4897 0.6566 0.4244 0.0208  0.0475  -0.1118 311 ASP A CA  
1516 C C   . ASP A 191 ? 0.6765 0.8150 0.6311 0.0244  0.0665  -0.1118 311 ASP A C   
1517 O O   . ASP A 191 ? 0.6454 0.7673 0.5916 0.0331  0.0679  -0.1010 311 ASP A O   
1518 C CB  . ASP A 191 ? 0.5023 0.7156 0.4541 0.0165  0.0402  -0.1306 311 ASP A CB  
1519 C CG  . ASP A 191 ? 0.6233 0.8687 0.5508 0.0194  0.0215  -0.1197 311 ASP A CG  
1520 O OD1 . ASP A 191 ? 0.5784 0.8029 0.4814 0.0244  0.0143  -0.0953 311 ASP A OD1 
1521 O OD2 . ASP A 191 ? 0.5983 0.8924 0.5335 0.0167  0.0138  -0.1349 311 ASP A OD2 
1522 N N   . LEU A 192 ? 0.6508 0.7839 0.6340 0.0196  0.0839  -0.1221 312 LEU A N   
1523 C CA  . LEU A 192 ? 0.6436 0.7533 0.6536 0.0243  0.1062  -0.1167 312 LEU A CA  
1524 C C   . LEU A 192 ? 0.6961 0.7727 0.6776 0.0358  0.1113  -0.0898 312 LEU A C   
1525 O O   . LEU A 192 ? 0.7806 0.8387 0.7638 0.0464  0.1257  -0.0760 312 LEU A O   
1526 C CB  . LEU A 192 ? 0.5604 0.6765 0.6232 0.0144  0.1253  -0.1379 312 LEU A CB  
1527 C CG  . LEU A 192 ? 0.7980 0.9480 0.8960 0.0023  0.1204  -0.1680 312 LEU A CG  
1528 C CD1 . LEU A 192 ? 0.5535 0.7347 0.6463 -0.0080 0.1072  -0.1962 312 LEU A CD1 
1529 C CD2 . LEU A 192 ? 0.9432 1.0851 1.1056 -0.0035 0.1446  -0.1775 312 LEU A CD2 
1530 N N   . TRP A 193 ? 0.6141 0.6881 0.5698 0.0347  0.0993  -0.0813 313 TRP A N   
1531 C CA  . TRP A 193 ? 0.6886 0.7392 0.6124 0.0439  0.0955  -0.0575 313 TRP A CA  
1532 C C   . TRP A 193 ? 0.7628 0.7987 0.6474 0.0510  0.0806  -0.0514 313 TRP A C   
1533 O O   . TRP A 193 ? 0.6431 0.6586 0.5082 0.0631  0.0874  -0.0402 313 TRP A O   
1534 C CB  . TRP A 193 ? 0.5235 0.5809 0.4364 0.0389  0.0831  -0.0493 313 TRP A CB  
1535 C CG  . TRP A 193 ? 0.6624 0.7033 0.5400 0.0445  0.0686  -0.0280 313 TRP A CG  
1536 C CD1 . TRP A 193 ? 0.7043 0.7367 0.5478 0.0423  0.0440  -0.0245 313 TRP A CD1 
1537 C CD2 . TRP A 193 ? 0.7023 0.7354 0.5779 0.0528  0.0764  -0.0083 313 TRP A CD2 
1538 N NE1 . TRP A 193 ? 0.7504 0.7700 0.5694 0.0463  0.0334  -0.0093 313 TRP A NE1 
1539 C CE2 . TRP A 193 ? 0.7628 0.7866 0.5983 0.0539  0.0520  0.0026  313 TRP A CE2 
1540 C CE3 . TRP A 193 ? 0.7238 0.7580 0.6308 0.0601  0.1018  0.0024  313 TRP A CE3 
1541 C CZ2 . TRP A 193 ? 0.7209 0.7437 0.5415 0.0618  0.0488  0.0227  313 TRP A CZ2 
1542 C CZ3 . TRP A 193 ? 0.7951 0.8276 0.6896 0.0707  0.1022  0.0283  313 TRP A CZ3 
1543 C CH2 . TRP A 193 ? 0.7144 0.7446 0.5633 0.0714  0.0741  0.0377  313 TRP A CH2 
1544 N N   . SER A 194 ? 0.6379 0.6846 0.5111 0.0455  0.0624  -0.0584 314 SER A N   
1545 C CA  . SER A 194 ? 0.7365 0.7652 0.5783 0.0525  0.0498  -0.0540 314 SER A CA  
1546 C C   . SER A 194 ? 0.6708 0.6934 0.5203 0.0637  0.0659  -0.0571 314 SER A C   
1547 O O   . SER A 194 ? 0.7075 0.7055 0.5274 0.0757  0.0648  -0.0522 314 SER A O   
1548 C CB  . SER A 194 ? 0.7547 0.8002 0.5945 0.0459  0.0315  -0.0556 314 SER A CB  
1549 O OG  . SER A 194 ? 0.6260 0.6761 0.4593 0.0375  0.0180  -0.0474 314 SER A OG  
1550 N N   . LEU A 195 ? 0.6824 0.7277 0.5742 0.0597  0.0816  -0.0664 315 LEU A N   
1551 C CA  . LEU A 195 ? 0.6512 0.6966 0.5637 0.0690  0.1000  -0.0657 315 LEU A CA  
1552 C C   . LEU A 195 ? 0.7325 0.7520 0.6319 0.0832  0.1194  -0.0503 315 LEU A C   
1553 O O   . LEU A 195 ? 0.7291 0.7368 0.6174 0.0988  0.1316  -0.0422 315 LEU A O   
1554 C CB  . LEU A 195 ? 0.6519 0.7298 0.6222 0.0572  0.1101  -0.0813 315 LEU A CB  
1555 C CG  . LEU A 195 ? 0.6159 0.7033 0.6241 0.0631  0.1283  -0.0799 315 LEU A CG  
1556 C CD1 . LEU A 195 ? 0.5558 0.6489 0.5457 0.0733  0.1183  -0.0747 315 LEU A CD1 
1557 C CD2 . LEU A 195 ? 0.6862 0.8067 0.7577 0.0460  0.1337  -0.1007 315 LEU A CD2 
1558 N N   . GLY A 196 ? 0.8001 0.8144 0.7005 0.0802  0.1236  -0.0438 316 GLY A N   
1559 C CA  . GLY A 196 ? 0.8034 0.8009 0.6895 0.0954  0.1409  -0.0240 316 GLY A CA  
1560 C C   . GLY A 196 ? 0.8206 0.7961 0.6409 0.1075  0.1247  -0.0171 316 GLY A C   
1561 O O   . GLY A 196 ? 0.7446 0.7078 0.5383 0.1265  0.1378  -0.0054 316 GLY A O   
1562 N N   . VAL A 197 ? 0.7642 0.7360 0.5595 0.0968  0.0965  -0.0250 317 VAL A N   
1563 C CA  . VAL A 197 ? 0.8275 0.7758 0.5663 0.1033  0.0764  -0.0255 317 VAL A CA  
1564 C C   . VAL A 197 ? 0.9087 0.8395 0.6270 0.1161  0.0806  -0.0335 317 VAL A C   
1565 O O   . VAL A 197 ? 0.7864 0.6946 0.4584 0.1319  0.0807  -0.0339 317 VAL A O   
1566 C CB  . VAL A 197 ? 0.7157 0.6643 0.4475 0.0862  0.0467  -0.0312 317 VAL A CB  
1567 C CG1 . VAL A 197 ? 0.7242 0.6448 0.4055 0.0899  0.0247  -0.0361 317 VAL A CG1 
1568 C CG2 . VAL A 197 ? 0.7121 0.6806 0.4667 0.0760  0.0450  -0.0213 317 VAL A CG2 
1569 N N   . LEU A 198 ? 0.7487 0.6929 0.5012 0.1109  0.0846  -0.0402 318 LEU A N   
1570 C CA  . LEU A 198 ? 0.8079 0.7403 0.5511 0.1239  0.0902  -0.0444 318 LEU A CA  
1571 C C   . LEU A 198 ? 0.8092 0.7384 0.5514 0.1450  0.1198  -0.0354 318 LEU A C   
1572 O O   . LEU A 198 ? 0.8423 0.7485 0.5485 0.1639  0.1259  -0.0368 318 LEU A O   
1573 C CB  . LEU A 198 ? 0.7787 0.7382 0.5650 0.1140  0.0869  -0.0490 318 LEU A CB  
1574 C CG  . LEU A 198 ? 0.7544 0.7061 0.5383 0.1285  0.0922  -0.0489 318 LEU A CG  
1575 C CD1 . LEU A 198 ? 0.7238 0.6425 0.4697 0.1308  0.0726  -0.0532 318 LEU A CD1 
1576 C CD2 . LEU A 198 ? 0.7787 0.7721 0.6142 0.1214  0.0936  -0.0489 318 LEU A CD2 
1577 N N   . CYS A 199 ? 0.6984 0.6501 0.4837 0.1425  0.1404  -0.0258 319 CYS A N   
1578 C CA  . CYS A 199 ? 0.7511 0.7053 0.5485 0.1620  0.1727  -0.0108 319 CYS A CA  
1579 C C   . CYS A 199 ? 0.7463 0.6785 0.4819 0.1835  0.1787  -0.0003 319 CYS A C   
1580 O O   . CYS A 199 ? 0.8270 0.7522 0.5420 0.2076  0.2005  0.0089  319 CYS A O   
1581 C CB  . CYS A 199 ? 0.7670 0.7465 0.6321 0.1520  0.1932  -0.0019 319 CYS A CB  
1582 S SG  . CYS A 199 ? 0.8107 0.8006 0.7168 0.1724  0.2365  0.0212  319 CYS A SG  
1583 N N   . TYR A 200 ? 0.7837 0.7099 0.4897 0.1757  0.1591  -0.0012 320 TYR A N   
1584 C CA  . TYR A 200 ? 0.9383 0.8509 0.5803 0.1936  0.1564  0.0055  320 TYR A CA  
1585 C C   . TYR A 200 ? 1.0463 0.9287 0.6272 0.2048  0.1418  -0.0142 320 TYR A C   
1586 O O   . TYR A 200 ? 1.0727 0.9442 0.6045 0.2303  0.1550  -0.0116 320 TYR A O   
1587 C CB  . TYR A 200 ? 0.8711 0.7903 0.5037 0.1794  0.1337  0.0086  320 TYR A CB  
1588 C CG  . TYR A 200 ? 0.9974 0.9141 0.5676 0.1969  0.1277  0.0178  320 TYR A CG  
1589 C CD1 . TYR A 200 ? 1.0517 0.9468 0.5579 0.1981  0.0986  -0.0034 320 TYR A CD1 
1590 C CD2 . TYR A 200 ? 0.8232 0.7613 0.4008 0.2124  0.1507  0.0477  320 TYR A CD2 
1591 C CE1 . TYR A 200 ? 1.0234 0.9223 0.4690 0.2134  0.0889  0.0006  320 TYR A CE1 
1592 C CE2 . TYR A 200 ? 1.0229 0.9681 0.5399 0.2306  0.1434  0.0585  320 TYR A CE2 
1593 C CZ  . TYR A 200 ? 1.0290 0.9565 0.4772 0.2305  0.1106  0.0327  320 TYR A CZ  
1594 O OH  . TYR A 200 ? 1.1819 1.1220 0.5659 0.2480  0.0992  0.0391  320 TYR A OH  
1595 N N   . GLU A 201 ? 0.9283 0.7969 0.5131 0.1875  0.1165  -0.0336 321 GLU A N   
1596 C CA  . GLU A 201 ? 1.0709 0.9041 0.6058 0.1957  0.1019  -0.0543 321 GLU A CA  
1597 C C   . GLU A 201 ? 0.9489 0.7718 0.4830 0.2191  0.1288  -0.0546 321 GLU A C   
1598 O O   . GLU A 201 ? 0.9966 0.7881 0.4781 0.2377  0.1297  -0.0693 321 GLU A O   
1599 C CB  . GLU A 201 ? 0.9502 0.7723 0.5015 0.1719  0.0719  -0.0682 321 GLU A CB  
1600 C CG  . GLU A 201 ? 1.0779 0.8564 0.5816 0.1767  0.0537  -0.0911 321 GLU A CG  
1601 C CD  . GLU A 201 ? 1.0866 0.8541 0.6167 0.1545  0.0285  -0.0982 321 GLU A CD  
1602 O OE1 . GLU A 201 ? 1.1472 0.9447 0.7280 0.1393  0.0276  -0.0848 321 GLU A OE1 
1603 O OE2 . GLU A 201 ? 1.0457 0.7748 0.5467 0.1528  0.0102  -0.1173 321 GLU A OE2 
1604 N N   . PHE A 202 ? 0.9149 0.7653 0.5094 0.2181  0.1507  -0.0399 322 PHE A N   
1605 C CA  . PHE A 202 ? 0.8636 0.7134 0.4695 0.2405  0.1787  -0.0343 322 PHE A CA  
1606 C C   . PHE A 202 ? 0.9684 0.8147 0.5346 0.2712  0.2080  -0.0222 322 PHE A C   
1607 O O   . PHE A 202 ? 1.0615 0.8901 0.5980 0.2974  0.2260  -0.0255 322 PHE A O   
1608 C CB  . PHE A 202 ? 0.8948 0.7835 0.5822 0.2291  0.1922  -0.0211 322 PHE A CB  
1609 C CG  . PHE A 202 ? 0.9270 0.8241 0.6471 0.2101  0.1700  -0.0310 322 PHE A CG  
1610 C CD1 . PHE A 202 ? 0.9337 0.7999 0.6179 0.2076  0.1465  -0.0456 322 PHE A CD1 
1611 C CD2 . PHE A 202 ? 0.8651 0.8035 0.6540 0.1952  0.1728  -0.0251 322 PHE A CD2 
1612 C CE1 . PHE A 202 ? 0.9487 0.8269 0.6649 0.1934  0.1292  -0.0476 322 PHE A CE1 
1613 C CE2 . PHE A 202 ? 0.8562 0.8107 0.6700 0.1810  0.1523  -0.0313 322 PHE A CE2 
1614 C CZ  . PHE A 202 ? 0.9029 0.8283 0.6803 0.1816  0.1320  -0.0392 322 PHE A CZ  
1615 N N   . LEU A 203 ? 0.9348 0.7998 0.5010 0.2704  0.2148  -0.0057 323 LEU A N   
1616 C CA  . LEU A 203 ? 1.0571 0.9290 0.5918 0.3011  0.2460  0.0146  323 LEU A CA  
1617 C C   . LEU A 203 ? 1.1425 0.9930 0.5834 0.3169  0.2304  0.0010  323 LEU A C   
1618 O O   . LEU A 203 ? 1.2544 1.1009 0.6546 0.3436  0.2463  0.0058  323 LEU A O   
1619 C CB  . LEU A 203 ? 1.0428 0.9485 0.6332 0.2953  0.2658  0.0453  323 LEU A CB  
1620 C CG  . LEU A 203 ? 0.9824 0.9131 0.6685 0.2829  0.2870  0.0583  323 LEU A CG  
1621 C CD1 . LEU A 203 ? 0.9341 0.8888 0.6770 0.2733  0.3032  0.0827  323 LEU A CD1 
1622 C CD2 . LEU A 203 ? 1.0927 1.0287 0.7907 0.3096  0.3217  0.0720  323 LEU A CD2 
1623 N N   . VAL A 204 ? 1.0668 0.9093 0.4881 0.2941  0.1925  -0.0151 324 VAL A N   
1624 C CA  . VAL A 204 ? 1.2291 1.0585 0.5680 0.3034  0.1707  -0.0301 324 VAL A CA  
1625 C C   . VAL A 204 ? 1.2241 1.0094 0.5156 0.3008  0.1450  -0.0705 324 VAL A C   
1626 O O   . VAL A 204 ? 1.1707 0.9430 0.4103 0.3119  0.1350  -0.0868 324 VAL A O   
1627 C CB  . VAL A 204 ? 1.2116 1.0614 0.5604 0.2804  0.1433  -0.0222 324 VAL A CB  
1628 C CG1 . VAL A 204 ? 1.1715 1.0155 0.4383 0.2882  0.1157  -0.0385 324 VAL A CG1 
1629 C CG2 . VAL A 204 ? 0.9940 0.8818 0.3932 0.2852  0.1721  0.0180  324 VAL A CG2 
1630 N N   . GLY A 205 ? 1.1570 0.5420 0.5083 0.1763  0.2686  -0.0389 325 GLY A N   
1631 C CA  . GLY A 205 ? 1.1195 0.4974 0.4780 0.1700  0.2427  -0.0474 325 GLY A CA  
1632 C C   . GLY A 205 ? 1.1352 0.5404 0.4882 0.1544  0.1844  -0.0530 325 GLY A C   
1633 O O   . GLY A 205 ? 1.1863 0.5839 0.5562 0.1461  0.1606  -0.0605 325 GLY A O   
1634 N N   . LYS A 206 ? 1.1921 0.6283 0.5331 0.1505  0.1657  -0.0489 326 LYS A N   
1635 C CA  . LYS A 206 ? 1.2717 0.7396 0.6178 0.1366  0.1140  -0.0526 326 LYS A CA  
1636 C C   . LYS A 206 ? 1.1503 0.6804 0.5300 0.1268  0.1064  -0.0391 326 LYS A C   
1637 O O   . LYS A 206 ? 1.1263 0.6481 0.4860 0.1382  0.1349  -0.0353 326 LYS A O   
1638 C CB  . LYS A 206 ? 1.5439 0.9570 0.7985 0.1549  0.0891  -0.0751 326 LYS A CB  
1639 C CG  . LYS A 206 ? 1.6041 1.0507 0.8786 0.1399  0.0327  -0.0852 326 LYS A CG  
1640 N N   . PRO A 207 ? 1.1095 0.6994 0.5457 0.1071  0.0740  -0.0309 327 PRO A N   
1641 C CA  . PRO A 207 ? 1.1181 0.7663 0.5812 0.0999  0.0651  -0.0216 327 PRO A CA  
1642 C C   . PRO A 207 ? 1.0078 0.6310 0.4109 0.1142  0.0554  -0.0273 327 PRO A C   
1643 O O   . PRO A 207 ? 1.2470 0.8338 0.6012 0.1235  0.0298  -0.0388 327 PRO A O   
1644 C CB  . PRO A 207 ? 1.1209 0.8213 0.6420 0.0823  0.0345  -0.0095 327 PRO A CB  
1645 C CG  . PRO A 207 ? 1.1621 0.8467 0.7115 0.0788  0.0416  -0.0049 327 PRO A CG  
1646 C CD  . PRO A 207 ? 1.1435 0.7491 0.6312 0.0926  0.0547  -0.0256 327 PRO A CD  
1647 N N   . PRO A 208 ? 1.1096 0.7544 0.5200 0.1182  0.0743  -0.0215 328 PRO A N   
1648 C CA  . PRO A 208 ? 1.1245 0.7409 0.4788 0.1392  0.0765  -0.0192 328 PRO A CA  
1649 C C   . PRO A 208 ? 1.2055 0.8504 0.5570 0.1384  0.0297  -0.0184 328 PRO A C   
1650 O O   . PRO A 208 ? 1.2835 0.9020 0.5772 0.1624  0.0208  -0.0169 328 PRO A O   
1651 C CB  . PRO A 208 ? 1.0416 0.6811 0.4366 0.1372  0.1136  -0.0149 328 PRO A CB  
1652 C CG  . PRO A 208 ? 0.9503 0.6595 0.4233 0.1121  0.1050  -0.0193 328 PRO A CG  
1653 C CD  . PRO A 208 ? 0.9278 0.6271 0.4043 0.1056  0.0950  -0.0195 328 PRO A CD  
1654 N N   . PHE A 209 ? 1.0546 0.7548 0.4710 0.1148  0.0029  -0.0162 329 PHE A N   
1655 C CA  . PHE A 209 ? 0.9737 0.7080 0.4105 0.1113  -0.0369 -0.0146 329 PHE A CA  
1656 C C   . PHE A 209 ? 1.0312 0.7635 0.4933 0.0976  -0.0732 -0.0259 329 PHE A C   
1657 O O   . PHE A 209 ? 0.9945 0.7672 0.5104 0.0856  -0.1032 -0.0239 329 PHE A O   
1658 C CB  . PHE A 209 ? 1.0030 0.8061 0.5062 0.0977  -0.0312 0.0000  329 PHE A CB  
1659 C CG  . PHE A 209 ? 1.0254 0.8332 0.5231 0.1060  0.0059  0.0016  329 PHE A CG  
1660 C CD1 . PHE A 209 ? 1.0621 0.8469 0.5248 0.1267  0.0150  0.0040  329 PHE A CD1 
1661 C CD2 . PHE A 209 ? 0.9550 0.7926 0.4895 0.0951  0.0311  -0.0011 329 PHE A CD2 
1662 C CE1 . PHE A 209 ? 1.0173 0.8003 0.4911 0.1322  0.0547  0.0028  329 PHE A CE1 
1663 C CE2 . PHE A 209 ? 0.9041 0.7479 0.4498 0.0994  0.0631  -0.0102 329 PHE A CE2 
1664 C CZ  . PHE A 209 ? 0.8980 0.7106 0.4183 0.1158  0.0779  -0.0087 329 PHE A CZ  
1665 N N   . GLU A 210 ? 0.9939 0.6773 0.4269 0.0993  -0.0667 -0.0392 330 GLU A N   
1666 C CA  . GLU A 210 ? 1.1528 0.8254 0.6205 0.0845  -0.0944 -0.0551 330 GLU A CA  
1667 C C   . GLU A 210 ? 1.0897 0.7578 0.5422 0.0908  -0.1446 -0.0820 330 GLU A C   
1668 O O   . GLU A 210 ? 1.2962 0.9356 0.6634 0.1190  -0.1557 -0.0956 330 GLU A O   
1669 C CB  . GLU A 210 ? 1.2168 0.8301 0.6480 0.0903  -0.0731 -0.0680 330 GLU A CB  
1670 C CG  . GLU A 210 ? 1.2636 0.8597 0.7444 0.0734  -0.0931 -0.0856 330 GLU A CG  
1671 C CD  . GLU A 210 ? 1.4669 1.0044 0.9174 0.0809  -0.0658 -0.0963 330 GLU A CD  
1672 O OE1 . GLU A 210 ? 1.3560 0.9074 0.8574 0.0721  -0.0356 -0.0718 330 GLU A OE1 
1673 O OE2 . GLU A 210 ? 1.7587 1.2388 1.1315 0.0999  -0.0743 -0.1287 330 GLU A OE2 
1674 N N   . ALA A 211 ? 0.9927 0.6927 0.5337 0.0669  -0.1737 -0.0886 331 ALA A N   
1675 C CA  . ALA A 211 ? 1.1719 0.8800 0.7267 0.0680  -0.2285 -0.1223 331 ALA A CA  
1676 C C   . ALA A 211 ? 1.2540 0.9682 0.9169 0.0369  -0.2472 -0.1398 331 ALA A C   
1677 O O   . ALA A 211 ? 1.1614 0.8794 0.8891 0.0176  -0.2132 -0.1133 331 ALA A O   
1678 C CB  . ALA A 211 ? 1.1219 0.8880 0.7016 0.0735  -0.2461 -0.1064 331 ALA A CB  
1679 N N   . ASN A 212 ? 1.2648 0.9819 0.9524 0.0344  -0.3010 -0.1850 332 ASN A N   
1680 C CA  . ASN A 212 ? 1.3921 1.1090 1.1985 0.0028  -0.3194 -0.2114 332 ASN A CA  
1681 C C   . ASN A 212 ? 1.3221 1.1006 1.2717 -0.0258 -0.3049 -0.1728 332 ASN A C   
1682 O O   . ASN A 212 ? 1.4498 1.2224 1.5051 -0.0518 -0.2841 -0.1630 332 ASN A O   
1683 C CB  . ASN A 212 ? 1.5129 1.2238 1.3133 0.0088  -0.3878 -0.2816 332 ASN A CB  
1684 C CG  . ASN A 212 ? 1.7023 1.3476 1.3537 0.0425  -0.3989 -0.3215 332 ASN A CG  
1685 O OD1 . ASN A 212 ? 1.7391 1.3322 1.3286 0.0500  -0.3520 -0.3042 332 ASN A OD1 
1686 N ND2 . ASN A 212 ? 1.8045 1.4557 1.3970 0.0671  -0.4606 -0.3748 332 ASN A ND2 
1687 N N   . THR A 213 ? 1.1472 0.9818 1.1006 -0.0176 -0.3102 -0.1478 333 THR A N   
1688 C CA  . THR A 213 ? 1.0963 0.9915 1.1729 -0.0381 -0.2892 -0.1065 333 THR A CA  
1689 C C   . THR A 213 ? 1.0650 0.9849 1.0922 -0.0244 -0.2409 -0.0517 333 THR A C   
1690 O O   . THR A 213 ? 1.0550 0.9558 0.9682 -0.0005 -0.2342 -0.0516 333 THR A O   
1691 C CB  . THR A 213 ? 1.0203 0.9715 1.1729 -0.0420 -0.3369 -0.1274 333 THR A CB  
1692 O OG1 . THR A 213 ? 1.1326 1.0966 1.1791 -0.0095 -0.3574 -0.1300 333 THR A OG1 
1693 C CG2 . THR A 213 ? 1.1114 1.0480 1.3280 -0.0572 -0.3926 -0.1933 333 THR A CG2 
1694 N N   . TYR A 214 ? 0.9909 0.9534 1.1067 -0.0375 -0.2049 -0.0067 334 TYR A N   
1695 C CA  . TYR A 214 ? 1.0282 1.0209 1.0996 -0.0229 -0.1625 0.0374  334 TYR A CA  
1696 C C   . TYR A 214 ? 0.8865 0.9263 0.9506 -0.0106 -0.1737 0.0420  334 TYR A C   
1697 O O   . TYR A 214 ? 0.8259 0.8794 0.8258 0.0063  -0.1495 0.0589  334 TYR A O   
1698 C CB  . TYR A 214 ? 1.0424 1.0626 1.1924 -0.0319 -0.1165 0.0867  334 TYR A CB  
1699 C CG  . TYR A 214 ? 1.0253 1.0963 1.3014 -0.0453 -0.1098 0.1104  334 TYR A CG  
1700 C CD1 . TYR A 214 ? 1.0341 1.0946 1.4320 -0.0702 -0.1220 0.0981  334 TYR A CD1 
1701 C CD2 . TYR A 214 ? 0.9692 1.0978 1.2520 -0.0332 -0.0868 0.1431  334 TYR A CD2 
1702 C CE1 . TYR A 214 ? 1.0094 1.1172 1.5412 -0.0837 -0.1094 0.1216  334 TYR A CE1 
1703 C CE2 . TYR A 214 ? 0.9449 1.1201 1.3479 -0.0431 -0.0732 0.1686  334 TYR A CE2 
1704 C CZ  . TYR A 214 ? 0.9362 1.1017 1.4680 -0.0689 -0.0833 0.1599  334 TYR A CZ  
1705 O OH  . TYR A 214 ? 0.9129 1.1258 1.5824 -0.0801 -0.0638 0.1869  334 TYR A OH  
1706 N N   . GLN A 215 ? 0.9049 0.9712 1.0440 -0.0188 -0.2108 0.0235  335 GLN A N   
1707 C CA  . GLN A 215 ? 0.9839 1.0947 1.1233 -0.0039 -0.2253 0.0266  335 GLN A CA  
1708 C C   . GLN A 215 ? 1.0231 1.1005 1.0320 0.0246  -0.2423 0.0061  335 GLN A C   
1709 O O   . GLN A 215 ? 0.8994 0.9942 0.8667 0.0433  -0.2231 0.0237  335 GLN A O   
1710 C CB  . GLN A 215 ? 1.0212 1.1707 1.2769 -0.0169 -0.2693 0.0051  335 GLN A CB  
1711 C CG  . GLN A 215 ? 1.0878 1.2753 1.4969 -0.0439 -0.2423 0.0329  335 GLN A CG  
1712 C CD  . GLN A 215 ? 1.1465 1.2944 1.6177 -0.0696 -0.2434 0.0164  335 GLN A CD  
1713 O OE1 . GLN A 215 ? 1.2391 1.3291 1.6238 -0.0661 -0.2521 -0.0077 335 GLN A OE1 
1714 N NE2 . GLN A 215 ? 1.1000 1.2764 1.7305 -0.0947 -0.2291 0.0305  335 GLN A NE2 
1715 N N   . GLU A 216 ? 1.0495 1.0756 0.9962 0.0300  -0.2732 -0.0305 336 GLU A N   
1716 C CA  . GLU A 216 ? 1.0271 1.0118 0.8438 0.0619  -0.2804 -0.0440 336 GLU A CA  
1717 C C   . GLU A 216 ? 0.8976 0.8527 0.6442 0.0683  -0.2257 -0.0201 336 GLU A C   
1718 O O   . GLU A 216 ? 0.9846 0.9275 0.6614 0.0920  -0.2084 -0.0117 336 GLU A O   
1719 C CB  . GLU A 216 ? 1.0142 0.9504 0.7756 0.0698  -0.3217 -0.0892 336 GLU A CB  
1720 C CG  . GLU A 216 ? 1.3798 1.3265 1.0937 0.1011  -0.3757 -0.1159 336 GLU A CG  
1721 C CD  . GLU A 216 ? 1.4613 1.3889 1.0646 0.1409  -0.3520 -0.0914 336 GLU A CD  
1722 O OE1 . GLU A 216 ? 1.5351 1.4085 1.0543 0.1507  -0.3093 -0.0800 336 GLU A OE1 
1723 O OE2 . GLU A 216 ? 1.4959 1.4625 1.1069 0.1631  -0.3728 -0.0822 336 GLU A OE2 
1724 N N   . THR A 217 ? 0.8624 0.8080 0.6374 0.0482  -0.1981 -0.0097 337 THR A N   
1725 C CA  . THR A 217 ? 0.8820 0.8131 0.6091 0.0528  -0.1522 0.0082  337 THR A CA  
1726 C C   . THR A 217 ? 0.8530 0.8344 0.5988 0.0577  -0.1251 0.0328  337 THR A C   
1727 O O   . THR A 217 ? 0.9013 0.8710 0.5932 0.0712  -0.0995 0.0334  337 THR A O   
1728 C CB  . THR A 217 ? 1.0528 0.9758 0.8167 0.0350  -0.1320 0.0186  337 THR A CB  
1729 O OG1 . THR A 217 ? 1.0825 0.9540 0.8343 0.0302  -0.1546 -0.0094 337 THR A OG1 
1730 C CG2 . THR A 217 ? 1.0980 1.0147 0.8155 0.0430  -0.0928 0.0307  337 THR A CG2 
1731 N N   . TYR A 218 ? 0.8784 0.9140 0.7070 0.0472  -0.1278 0.0507  338 TYR A N   
1732 C CA  . TYR A 218 ? 0.9028 0.9880 0.7495 0.0550  -0.1026 0.0707  338 TYR A CA  
1733 C C   . TYR A 218 ? 0.8391 0.9145 0.6398 0.0761  -0.1093 0.0598  338 TYR A C   
1734 O O   . TYR A 218 ? 0.7589 0.8407 0.5314 0.0873  -0.0794 0.0629  338 TYR A O   
1735 C CB  . TYR A 218 ? 0.8255 0.9670 0.7733 0.0438  -0.1025 0.0935  338 TYR A CB  
1736 C CG  . TYR A 218 ? 1.0034 1.1630 0.9988 0.0314  -0.0758 0.1206  338 TYR A CG  
1737 C CD1 . TYR A 218 ? 1.0550 1.1888 1.0015 0.0325  -0.0583 0.1222  338 TYR A CD1 
1738 C CD2 . TYR A 218 ? 1.0963 1.3003 1.1906 0.0225  -0.0637 0.1493  338 TYR A CD2 
1739 C CE1 . TYR A 218 ? 1.0678 1.2199 1.0538 0.0289  -0.0327 0.1537  338 TYR A CE1 
1740 C CE2 . TYR A 218 ? 1.1979 1.4151 1.3330 0.0181  -0.0314 0.1836  338 TYR A CE2 
1741 C CZ  . TYR A 218 ? 1.2056 1.3969 1.2817 0.0233  -0.0174 0.1867  338 TYR A CZ  
1742 O OH  . TYR A 218 ? 1.2568 1.4628 1.3695 0.0262  0.0157  0.2272  338 TYR A OH  
1743 N N   . LYS A 219 ? 0.7701 0.8312 0.5666 0.0841  -0.1491 0.0455  339 LYS A N   
1744 C CA  . LYS A 219 ? 0.8253 0.8746 0.5739 0.1123  -0.1572 0.0420  339 LYS A CA  
1745 C C   . LYS A 219 ? 0.8577 0.8489 0.5127 0.1291  -0.1274 0.0372  339 LYS A C   
1746 O O   . LYS A 219 ? 0.8749 0.8631 0.5118 0.1447  -0.0972 0.0455  339 LYS A O   
1747 C CB  . LYS A 219 ? 0.9528 1.0003 0.7021 0.1238  -0.2134 0.0242  339 LYS A CB  
1748 C CG  . LYS A 219 ? 1.0502 1.0838 0.7367 0.1632  -0.2238 0.0268  339 LYS A CG  
1749 C CD  . LYS A 219 ? 1.1691 1.1995 0.8301 0.1824  -0.2863 0.0025  339 LYS A CD  
1750 C CE  . LYS A 219 ? 1.1858 1.2831 0.9662 0.1624  -0.3323 -0.0097 339 LYS A CE  
1751 N N   . ARG A 220 ? 0.9177 0.8610 0.5237 0.1256  -0.1313 0.0233  340 ARG A N   
1752 C CA  A ARG A 220 ? 1.0037 0.8887 0.5305 0.1417  -0.0990 0.0201  340 ARG A CA  
1753 C CA  B ARG A 220 ? 1.0122 0.8974 0.5390 0.1420  -0.0990 0.0202  340 ARG A CA  
1754 C C   . ARG A 220 ? 0.8974 0.7945 0.4449 0.1308  -0.0516 0.0255  340 ARG A C   
1755 O O   . ARG A 220 ? 0.9522 0.8210 0.4697 0.1455  -0.0174 0.0260  340 ARG A O   
1756 C CB  A ARG A 220 ? 1.0356 0.8714 0.5157 0.1392  -0.1100 0.0035  340 ARG A CB  
1757 C CB  B ARG A 220 ? 1.0389 0.8740 0.5170 0.1404  -0.1104 0.0036  340 ARG A CB  
1758 C CG  A ARG A 220 ? 1.1239 0.9387 0.5597 0.1585  -0.1577 -0.0138 340 ARG A CG  
1759 C CG  B ARG A 220 ? 1.1213 0.9417 0.5650 0.1566  -0.1615 -0.0142 340 ARG A CG  
1760 C CD  A ARG A 220 ? 1.2348 0.9783 0.5615 0.1892  -0.1421 -0.0201 340 ARG A CD  
1761 C CD  B ARG A 220 ? 1.2028 0.9661 0.5858 0.1601  -0.1674 -0.0362 340 ARG A CD  
1762 N NE  A ARG A 220 ? 1.2282 0.9338 0.5405 0.1741  -0.1274 -0.0338 340 ARG A NE  
1763 N NE  B ARG A 220 ? 1.3041 1.0607 0.6553 0.1761  -0.2235 -0.0643 340 ARG A NE  
1764 C CZ  A ARG A 220 ? 1.1636 0.8096 0.4039 0.1923  -0.0897 -0.0322 340 ARG A CZ  
1765 C CZ  B ARG A 220 ? 1.2655 0.9717 0.5486 0.1881  -0.2379 -0.0922 340 ARG A CZ  
1766 N NH1 A ARG A 220 ? 1.1999 0.8192 0.3921 0.2228  -0.0577 -0.0146 340 ARG A NH1 
1767 N NH1 B ARG A 220 ? 1.3643 1.0199 0.6087 0.1856  -0.1951 -0.0895 340 ARG A NH1 
1768 N NH2 A ARG A 220 ? 1.2048 0.8214 0.4432 0.1788  -0.0772 -0.0445 340 ARG A NH2 
1769 N NH2 B ARG A 220 ? 1.2598 0.9694 0.5160 0.2045  -0.2963 -0.1266 340 ARG A NH2 
1770 N N   . ILE A 221 ? 0.7548 0.6953 0.3570 0.1073  -0.0488 0.0286  341 ILE A N   
1771 C CA  . ILE A 221 ? 0.8512 0.8181 0.4720 0.1004  -0.0136 0.0271  341 ILE A CA  
1772 C C   . ILE A 221 ? 0.7123 0.7083 0.3529 0.1104  0.0040  0.0281  341 ILE A C   
1773 O O   . ILE A 221 ? 0.8242 0.8091 0.4572 0.1155  0.0357  0.0149  341 ILE A O   
1774 C CB  . ILE A 221 ? 0.8287 0.8438 0.4950 0.0831  -0.0161 0.0369  341 ILE A CB  
1775 C CG1 . ILE A 221 ? 0.8077 0.7892 0.4602 0.0747  -0.0228 0.0349  341 ILE A CG1 
1776 C CG2 . ILE A 221 ? 0.6741 0.7332 0.3537 0.0839  0.0115  0.0313  341 ILE A CG2 
1777 C CD1 . ILE A 221 ? 0.7713 0.7929 0.4712 0.0631  -0.0234 0.0540  341 ILE A CD1 
1778 N N   . SER A 222 ? 0.7785 0.8114 0.4552 0.1125  -0.0145 0.0414  342 SER A N   
1779 C CA  . SER A 222 ? 0.8025 0.8653 0.5047 0.1238  0.0033  0.0441  342 SER A CA  
1780 C C   . SER A 222 ? 0.8723 0.8864 0.5384 0.1463  0.0198  0.0404  342 SER A C   
1781 O O   . SER A 222 ? 0.8357 0.8530 0.5157 0.1539  0.0524  0.0327  342 SER A O   
1782 C CB  . SER A 222 ? 0.7479 0.8578 0.5046 0.1237  -0.0200 0.0624  342 SER A CB  
1783 O OG  . SER A 222 ? 0.8539 0.9915 0.6368 0.1374  0.0005  0.0660  342 SER A OG  
1784 N N   . ARG A 223 ? 0.8446 0.8118 0.4637 0.1601  -0.0002 0.0458  343 ARG A N   
1785 C CA  . ARG A 223 ? 0.9225 0.8370 0.4965 0.1898  0.0203  0.0525  343 ARG A CA  
1786 C C   . ARG A 223 ? 1.0111 0.8715 0.5527 0.1886  0.0616  0.0417  343 ARG A C   
1787 O O   . ARG A 223 ? 1.1416 0.9551 0.6619 0.2112  0.0977  0.0494  343 ARG A O   
1788 C CB  . ARG A 223 ? 0.9111 0.8033 0.4358 0.2146  -0.0202 0.0637  343 ARG A CB  
1789 C CG  . ARG A 223 ? 0.9225 0.8716 0.4945 0.2181  -0.0648 0.0709  343 ARG A CG  
1790 C CD  . ARG A 223 ? 1.0579 0.9919 0.5798 0.2427  -0.1149 0.0697  343 ARG A CD  
1791 N NE  . ARG A 223 ? 1.0493 1.0433 0.6296 0.2491  -0.1610 0.0729  343 ARG A NE  
1792 C CZ  . ARG A 223 ? 1.1572 1.1588 0.7109 0.2731  -0.2162 0.0652  343 ARG A CZ  
1793 N NH1 . ARG A 223 ? 1.0630 1.0112 0.5171 0.2963  -0.2294 0.0553  343 ARG A NH1 
1794 N NH2 . ARG A 223 ? 1.2035 1.2695 0.8313 0.2765  -0.2588 0.0649  343 ARG A NH2 
1795 N N   . VAL A 224 ? 0.7963 0.6635 0.5480 0.2342  -0.0110 0.1026  344 VAL A N   
1796 C CA  . VAL A 224 ? 0.8063 0.6276 0.5226 0.2330  0.0042  0.0857  344 VAL A CA  
1797 C C   . VAL A 224 ? 0.9416 0.7874 0.6160 0.2499  -0.0071 0.1082  344 VAL A C   
1798 O O   . VAL A 224 ? 0.8726 0.7017 0.5404 0.2703  0.0205  0.1295  344 VAL A O   
1799 C CB  . VAL A 224 ? 0.8693 0.6425 0.6111 0.2397  0.0532  0.0879  344 VAL A CB  
1800 C CG1 . VAL A 224 ? 0.8058 0.5418 0.5183 0.2279  0.0630  0.0657  344 VAL A CG1 
1801 C CG2 . VAL A 224 ? 0.8795 0.6411 0.6602 0.2213  0.0680  0.0708  344 VAL A CG2 
1802 N N   . GLU A 225 ? 0.8986 0.7863 0.5418 0.2366  -0.0473 0.1030  345 GLU A N   
1803 C CA  . GLU A 225 ? 0.9134 0.8397 0.5075 0.2430  -0.0639 0.1227  345 GLU A CA  
1804 C C   . GLU A 225 ? 0.9407 0.8324 0.4702 0.2259  -0.0699 0.0824  345 GLU A C   
1805 O O   . GLU A 225 ? 1.0399 0.9274 0.5431 0.1986  -0.0952 0.0475  345 GLU A O   
1806 C CB  . GLU A 225 ? 0.9280 0.9316 0.5232 0.2318  -0.1036 0.1432  345 GLU A CB  
1807 C CG  . GLU A 225 ? 1.1589 1.2169 0.6918 0.2248  -0.1287 0.1595  345 GLU A CG  
1808 C CD  . GLU A 225 ? 1.1960 1.3398 0.7282 0.2017  -0.1734 0.1760  345 GLU A CD  
1809 O OE1 . GLU A 225 ? 1.4214 1.5837 0.8861 0.1656  -0.2041 0.1472  345 GLU A OE1 
1810 O OE2 . GLU A 225 ? 1.1531 1.3461 0.7525 0.2175  -0.1749 0.2171  345 GLU A OE2 
1811 N N   . PHE A 226 ? 1.0803 0.9438 0.5878 0.2423  -0.0416 0.0881  346 PHE A N   
1812 C CA  . PHE A 226 ? 1.1089 0.9394 0.5593 0.2325  -0.0372 0.0538  346 PHE A CA  
1813 C C   . PHE A 226 ? 1.2190 1.0491 0.6400 0.2539  -0.0107 0.0781  346 PHE A C   
1814 O O   . PHE A 226 ? 1.2256 1.0667 0.6796 0.2765  0.0088  0.1199  346 PHE A O   
1815 C CB  . PHE A 226 ? 1.0499 0.8243 0.5260 0.2237  -0.0224 0.0190  346 PHE A CB  
1816 C CG  . PHE A 226 ? 1.0917 0.8381 0.6048 0.2390  0.0138  0.0330  346 PHE A CG  
1817 C CD1 . PHE A 226 ? 1.0923 0.8390 0.6592 0.2422  0.0256  0.0511  346 PHE A CD1 
1818 C CD2 . PHE A 226 ? 1.0687 0.7882 0.5616 0.2464  0.0393  0.0262  346 PHE A CD2 
1819 C CE1 . PHE A 226 ? 1.0879 0.8053 0.6821 0.2466  0.0606  0.0584  346 PHE A CE1 
1820 C CE2 . PHE A 226 ? 1.1273 0.8269 0.6540 0.2531  0.0709  0.0394  346 PHE A CE2 
1821 C CZ  . PHE A 226 ? 1.0928 0.7896 0.6674 0.2501  0.0808  0.0536  346 PHE A CZ  
1822 N N   . THR A 227 ? 1.3176 1.1307 0.6777 0.2468  -0.0054 0.0518  347 THR A N   
1823 C CA  . THR A 227 ? 1.1199 0.9313 0.4480 0.2647  0.0227  0.0712  347 THR A CA  
1824 C C   . THR A 227 ? 1.2199 0.9781 0.5325 0.2642  0.0504  0.0352  347 THR A C   
1825 O O   . THR A 227 ? 1.1179 0.8449 0.4300 0.2493  0.0445  -0.0051 347 THR A O   
1826 C CB  . THR A 227 ? 1.2961 1.1630 0.5514 0.2582  0.0047  0.0869  347 THR A CB  
1827 O OG1 . THR A 227 ? 1.3224 1.1842 0.5182 0.2266  -0.0169 0.0375  347 THR A OG1 
1828 C CG2 . THR A 227 ? 1.1844 1.1206 0.4680 0.2660  -0.0188 0.1410  347 THR A CG2 
1829 N N   . PHE A 228 ? 1.2718 1.0221 0.5787 0.2821  0.0830  0.0551  348 PHE A N   
1830 C CA  . PHE A 228 ? 1.1668 0.8799 0.4611 0.2856  0.1133  0.0296  348 PHE A CA  
1831 C C   . PHE A 228 ? 1.2712 0.9931 0.4805 0.2837  0.1219  0.0151  348 PHE A C   
1832 O O   . PHE A 228 ? 1.2901 1.0548 0.4563 0.2857  0.1144  0.0436  348 PHE A O   
1833 C CB  . PHE A 228 ? 1.2180 0.9193 0.5581 0.3013  0.1475  0.0580  348 PHE A CB  
1834 C CG  . PHE A 228 ? 1.2156 0.9028 0.6301 0.2951  0.1468  0.0637  348 PHE A CG  
1835 C CD1 . PHE A 228 ? 1.1754 0.8420 0.6268 0.2839  0.1489  0.0387  348 PHE A CD1 
1836 C CD2 . PHE A 228 ? 1.2697 0.9653 0.7174 0.2998  0.1482  0.0962  348 PHE A CD2 
1837 C CE1 . PHE A 228 ? 1.1620 0.8239 0.6726 0.2708  0.1475  0.0429  348 PHE A CE1 
1838 C CE2 . PHE A 228 ? 1.2402 0.9180 0.7466 0.2884  0.1533  0.0943  348 PHE A CE2 
1839 C CZ  . PHE A 228 ? 1.1262 0.7906 0.6592 0.2706  0.1508  0.0661  348 PHE A CZ  
1840 N N   . PRO A 229 ? 1.2711 0.9544 0.4562 0.2794  0.1407  -0.0273 349 PRO A N   
1841 C CA  . PRO A 229 ? 1.3598 1.0427 0.4644 0.2797  0.1647  -0.0433 349 PRO A CA  
1842 C C   . PRO A 229 ? 1.3579 1.0543 0.4746 0.3028  0.1985  -0.0050 349 PRO A C   
1843 O O   . PRO A 229 ? 1.2971 0.9854 0.4881 0.3152  0.2099  0.0189  349 PRO A O   
1844 C CB  . PRO A 229 ? 1.4417 1.0673 0.5420 0.2765  0.1880  -0.0946 349 PRO A CB  
1845 C CG  . PRO A 229 ? 1.4206 1.0279 0.5809 0.2658  0.1602  -0.1062 349 PRO A CG  
1846 C CD  . PRO A 229 ? 1.2399 0.8801 0.4671 0.2738  0.1425  -0.0609 349 PRO A CD  
1847 N N   . ASP A 230 ? 1.4353 1.1539 0.4774 0.3037  0.2148  0.0002  350 ASP A N   
1848 C CA  . ASP A 230 ? 1.4405 1.1802 0.4897 0.3233  0.2438  0.0447  350 ASP A CA  
1849 C C   . ASP A 230 ? 1.4819 1.1895 0.5882 0.3402  0.2849  0.0433  350 ASP A C   
1850 O O   . ASP A 230 ? 1.3779 1.0968 0.5273 0.3521  0.3023  0.0844  350 ASP A O   
1851 C CB  . ASP A 230 ? 1.7165 1.4953 0.6918 0.3093  0.2487  0.0451  350 ASP A CB  
1852 C CG  . ASP A 230 ? 1.7825 1.6203 0.7138 0.2904  0.2065  0.0680  350 ASP A CG  
1853 O OD1 . ASP A 230 ? 1.7866 1.6398 0.7574 0.3002  0.1807  0.1021  350 ASP A OD1 
1854 O OD2 . ASP A 230 ? 1.8684 1.7424 0.7291 0.2631  0.2002  0.0537  350 ASP A OD2 
1855 N N   . PHE A 231 ? 1.4487 1.1197 0.5642 0.3390  0.3006  -0.0000 351 PHE A N   
1856 C CA  . PHE A 231 ? 1.5325 1.1905 0.7088 0.3539  0.3384  0.0051  351 PHE A CA  
1857 C C   . PHE A 231 ? 1.3792 1.0358 0.6463 0.3574  0.3333  0.0282  351 PHE A C   
1858 O O   . PHE A 231 ? 1.4455 1.1085 0.7655 0.3665  0.3621  0.0447  351 PHE A O   
1859 C CB  . PHE A 231 ? 1.4341 1.0597 0.6115 0.3516  0.3571  -0.0398 351 PHE A CB  
1860 C CG  . PHE A 231 ? 1.5849 1.1759 0.7779 0.3429  0.3344  -0.0719 351 PHE A CG  
1861 C CD1 . PHE A 231 ? 1.5160 1.0961 0.7904 0.3528  0.3341  -0.0617 351 PHE A CD1 
1862 C CD2 . PHE A 231 ? 1.5504 1.1242 0.6789 0.3201  0.3145  -0.1123 351 PHE A CD2 
1863 C CE1 . PHE A 231 ? 1.3235 0.8729 0.6167 0.3444  0.3140  -0.0878 351 PHE A CE1 
1864 C CE2 . PHE A 231 ? 1.4736 1.0122 0.6205 0.3094  0.2956  -0.1413 351 PHE A CE2 
1865 C CZ  . PHE A 231 ? 1.4385 0.9632 0.6689 0.3236  0.2954  -0.1275 351 PHE A CZ  
1866 N N   . VAL A 232 ? 1.3182 0.9744 0.6107 0.3436  0.2940  0.0294  352 VAL A N   
1867 C CA  . VAL A 232 ? 1.3202 0.9792 0.6965 0.3360  0.2857  0.0473  352 VAL A CA  
1868 C C   . VAL A 232 ? 1.3057 0.9816 0.7062 0.3372  0.3043  0.0887  352 VAL A C   
1869 O O   . VAL A 232 ? 1.3846 1.0689 0.7564 0.3398  0.2989  0.1119  352 VAL A O   
1870 C CB  . VAL A 232 ? 1.3250 0.9800 0.7176 0.3204  0.2442  0.0391  352 VAL A CB  
1871 C CG1 . VAL A 232 ? 1.0562 0.7146 0.5254 0.3071  0.2403  0.0532  352 VAL A CG1 
1872 C CG2 . VAL A 232 ? 1.2380 0.8725 0.6088 0.3148  0.2265  -0.0010 352 VAL A CG2 
1873 N N   . THR A 233 ? 1.2884 0.9722 0.7454 0.3338  0.3273  0.1014  353 THR A N   
1874 C CA  . THR A 233 ? 1.2304 0.9254 0.7114 0.3288  0.3510  0.1372  353 THR A CA  
1875 C C   . THR A 233 ? 1.3498 1.0322 0.8596 0.3108  0.3360  0.1512  353 THR A C   
1876 O O   . THR A 233 ? 1.3312 1.0046 0.8576 0.2996  0.3080  0.1333  353 THR A O   
1877 C CB  . THR A 233 ? 1.2030 0.9200 0.7420 0.3217  0.3764  0.1472  353 THR A CB  
1878 O OG1 . THR A 233 ? 1.2364 0.9603 0.8313 0.3019  0.3553  0.1358  353 THR A OG1 
1879 C CG2 . THR A 233 ? 1.1466 0.8736 0.6650 0.3457  0.4032  0.1380  353 THR A CG2 
1880 N N   . GLU A 234 ? 1.3948 1.0728 0.9118 0.3081  0.3598  0.1834  354 GLU A N   
1881 C CA  . GLU A 234 ? 1.3586 1.0120 0.9027 0.2939  0.3591  0.1977  354 GLU A CA  
1882 C C   . GLU A 234 ? 1.3244 0.9713 0.9223 0.2600  0.3529  0.1786  354 GLU A C   
1883 O O   . GLU A 234 ? 1.2490 0.8742 0.8619 0.2479  0.3411  0.1704  354 GLU A O   
1884 C CB  . GLU A 234 ? 1.3600 1.0016 0.9067 0.2961  0.3953  0.2372  354 GLU A CB  
1885 N N   . GLY A 235 ? 1.2727 0.9457 0.9002 0.2437  0.3619  0.1744  355 GLY A N   
1886 C CA  . GLY A 235 ? 1.0597 0.7450 0.7351 0.2054  0.3531  0.1610  355 GLY A CA  
1887 C C   . GLY A 235 ? 1.1425 0.8340 0.8215 0.2055  0.3169  0.1347  355 GLY A C   
1888 O O   . GLY A 235 ? 1.0795 0.7672 0.7812 0.1759  0.3036  0.1217  355 GLY A O   
1889 N N   . ALA A 236 ? 1.1088 0.8071 0.7622 0.2357  0.3039  0.1250  356 ALA A N   
1890 C CA  . ALA A 236 ? 1.0704 0.7688 0.7253 0.2371  0.2717  0.1011  356 ALA A CA  
1891 C C   . ALA A 236 ? 1.1622 0.8340 0.7923 0.2385  0.2512  0.0916  356 ALA A C   
1892 O O   . ALA A 236 ? 1.0639 0.7355 0.7120 0.2224  0.2279  0.0765  356 ALA A O   
1893 C CB  . ALA A 236 ? 0.9951 0.6956 0.6258 0.2658  0.2719  0.0898  356 ALA A CB  
1894 N N   . ARG A 237 ? 1.1668 0.8237 0.7593 0.2584  0.2608  0.1058  357 ARG A N   
1895 C CA  . ARG A 237 ? 1.0369 0.6802 0.6149 0.2646  0.2449  0.1088  357 ARG A CA  
1896 C C   . ARG A 237 ? 1.1725 0.7966 0.7909 0.2411  0.2544  0.1114  357 ARG A C   
1897 O O   . ARG A 237 ? 1.1841 0.8026 0.8120 0.2363  0.2367  0.1015  357 ARG A O   
1898 C CB  . ARG A 237 ? 1.1175 0.7619 0.6552 0.2904  0.2566  0.1367  357 ARG A CB  
1899 C CG  . ARG A 237 ? 1.0579 0.7209 0.5385 0.3078  0.2453  0.1274  357 ARG A CG  
1900 C CD  . ARG A 237 ? 1.1303 0.8063 0.5693 0.3273  0.2613  0.1613  357 ARG A CD  
1901 N NE  . ARG A 237 ? 1.2255 0.9212 0.5973 0.3362  0.2521  0.1467  357 ARG A NE  
1902 C CZ  . ARG A 237 ? 1.3760 1.0949 0.7016 0.3380  0.2240  0.1459  357 ARG A CZ  
1903 N NH1 . ARG A 237 ? 1.3432 1.0739 0.6922 0.3382  0.2021  0.1657  357 ARG A NH1 
1904 N NH2 . ARG A 237 ? 1.3619 1.0950 0.6173 0.3371  0.2201  0.1252  357 ARG A NH2 
1905 N N   . ASP A 238 ? 1.1915 0.8047 0.8320 0.2235  0.2858  0.1227  358 ASP A N   
1906 C CA  . ASP A 238 ? 1.2107 0.7955 0.8818 0.1935  0.3046  0.1188  358 ASP A CA  
1907 C C   . ASP A 238 ? 1.0894 0.6895 0.7831 0.1593  0.2833  0.0896  358 ASP A C   
1908 O O   . ASP A 238 ? 1.1810 0.7611 0.8845 0.1464  0.2825  0.0771  358 ASP A O   
1909 C CB  . ASP A 238 ? 1.2805 0.8520 0.9654 0.1726  0.3429  0.1332  358 ASP A CB  
1910 C CG  . ASP A 238 ? 1.2202 0.7558 0.9300 0.1299  0.3675  0.1196  358 ASP A CG  
1911 O OD1 . ASP A 238 ? 1.3101 0.7957 1.0227 0.1394  0.3944  0.1298  358 ASP A OD1 
1912 O OD2 . ASP A 238 ? 1.3278 0.8867 1.0545 0.0856  0.3626  0.1002  358 ASP A OD2 
1913 N N   . LEU A 239 ? 1.0672 0.7067 0.7723 0.1464  0.2686  0.0831  359 LEU A N   
1914 C CA  . LEU A 239 ? 1.0208 0.6883 0.7506 0.1127  0.2467  0.0649  359 LEU A CA  
1915 C C   . LEU A 239 ? 1.0739 0.7388 0.7954 0.1261  0.2155  0.0497  359 LEU A C   
1916 O O   . LEU A 239 ? 0.9859 0.6495 0.7190 0.0996  0.2079  0.0347  359 LEU A O   
1917 C CB  . LEU A 239 ? 0.9661 0.6847 0.7192 0.1066  0.2380  0.0739  359 LEU A CB  
1918 C CG  . LEU A 239 ? 0.9999 0.7617 0.7834 0.0763  0.2115  0.0668  359 LEU A CG  
1919 C CD1 . LEU A 239 ? 1.0122 0.7822 0.8067 0.0193  0.2193  0.0569  359 LEU A CD1 
1920 C CD2 . LEU A 239 ? 1.0018 0.8174 0.8190 0.0830  0.2064  0.0874  359 LEU A CD2 
1921 N N   . ILE A 240 ? 0.9222 0.5875 0.6205 0.1629  0.1994  0.0518  360 ILE A N   
1922 C CA  . ILE A 240 ? 0.9681 0.6337 0.6565 0.1730  0.1685  0.0381  360 ILE A CA  
1923 C C   . ILE A 240 ? 1.0708 0.7159 0.7563 0.1748  0.1707  0.0384  360 ILE A C   
1924 O O   . ILE A 240 ? 1.0696 0.7203 0.7679 0.1612  0.1532  0.0255  360 ILE A O   
1925 C CB  . ILE A 240 ? 0.9476 0.6127 0.6010 0.2053  0.1564  0.0367  360 ILE A CB  
1926 C CG1 . ILE A 240 ? 0.9676 0.6476 0.6334 0.2073  0.1585  0.0338  360 ILE A CG1 
1927 C CG2 . ILE A 240 ? 0.8887 0.5534 0.5267 0.2103  0.1255  0.0233  360 ILE A CG2 
1928 C CD1 . ILE A 240 ? 1.0428 0.7108 0.6685 0.2347  0.1572  0.0243  360 ILE A CD1 
1929 N N   . SER A 241 ? 1.0186 0.6423 0.6927 0.1933  0.1954  0.0578  361 SER A N   
1930 C CA  . SER A 241 ? 0.9539 0.5589 0.6357 0.2039  0.2052  0.0684  361 SER A CA  
1931 C C   . SER A 241 ? 1.0878 0.6704 0.7991 0.1711  0.2260  0.0526  361 SER A C   
1932 O O   . SER A 241 ? 1.1246 0.6996 0.8497 0.1742  0.2267  0.0502  361 SER A O   
1933 C CB  . SER A 241 ? 1.0241 0.6119 0.6956 0.2318  0.2331  0.1017  361 SER A CB  
1934 O OG  . SER A 241 ? 1.2141 0.8287 0.8487 0.2584  0.2131  0.1151  361 SER A OG  
1935 N N   . ARG A 242 ? 1.0721 0.6483 0.7916 0.1368  0.2446  0.0417  362 ARG A N   
1936 C CA  . ARG A 242 ? 1.1239 0.6811 0.8596 0.0935  0.2660  0.0198  362 ARG A CA  
1937 C C   . ARG A 242 ? 0.9900 0.5824 0.7319 0.0693  0.2331  -0.0020 362 ARG A C   
1938 O O   . ARG A 242 ? 0.9915 0.5700 0.7405 0.0484  0.2440  -0.0195 362 ARG A O   
1939 C CB  . ARG A 242 ? 1.0231 0.5761 0.7613 0.0540  0.2910  0.0153  362 ARG A CB  
1940 C CG  . ARG A 242 ? 1.0674 0.5750 0.8035 0.0680  0.3331  0.0353  362 ARG A CG  
1941 C CD  . ARG A 242 ? 1.1129 0.6238 0.8526 0.0215  0.3549  0.0301  362 ARG A CD  
1942 N NE  . ARG A 242 ? 1.2716 0.7398 1.0105 0.0354  0.3947  0.0530  362 ARG A NE  
1943 C CZ  . ARG A 242 ? 1.4005 0.8001 1.1452 0.0216  0.4433  0.0495  362 ARG A CZ  
1944 N NH1 . ARG A 242 ? 1.3938 0.7581 1.1418 -0.0071 0.4609  0.0191  362 ARG A NH1 
1945 N NH2 . ARG A 242 ? 1.4261 0.7886 1.1736 0.0365  0.4789  0.0767  362 ARG A NH2 
1946 N N   . LEU A 243 ? 0.9581 0.5934 0.6988 0.0733  0.1972  0.0006  363 LEU A N   
1947 C CA  . LEU A 243 ? 0.9686 0.6400 0.7197 0.0526  0.1650  -0.0121 363 LEU A CA  
1948 C C   . LEU A 243 ? 1.0092 0.6779 0.7575 0.0770  0.1438  -0.0149 363 LEU A C   
1949 O O   . LEU A 243 ? 0.8922 0.5798 0.6505 0.0562  0.1273  -0.0269 363 LEU A O   
1950 C CB  . LEU A 243 ? 0.9232 0.6350 0.6832 0.0544  0.1405  -0.0022 363 LEU A CB  
1951 C CG  . LEU A 243 ? 0.9303 0.6731 0.7067 0.0211  0.1524  0.0062  363 LEU A CG  
1952 C CD1 . LEU A 243 ? 0.7174 0.4970 0.5120 0.0397  0.1354  0.0249  363 LEU A CD1 
1953 C CD2 . LEU A 243 ? 0.8826 0.6555 0.6697 -0.0356 0.1497  -0.0061 363 LEU A CD2 
1954 N N   . LEU A 244 ? 1.0036 0.6280 0.7101 0.0673  0.0932  -0.0195 364 LEU A N   
1955 C CA  . LEU A 244 ? 0.8921 0.5552 0.5775 0.0755  0.0668  -0.0149 364 LEU A CA  
1956 C C   . LEU A 244 ? 0.9742 0.6517 0.6758 0.1050  0.0609  -0.0159 364 LEU A C   
1957 O O   . LEU A 244 ? 1.0724 0.7618 0.7472 0.1261  0.0453  -0.0017 364 LEU A O   
1958 C CB  . LEU A 244 ? 1.0373 0.6690 0.6631 0.0775  0.0598  0.0076  364 LEU A CB  
1959 C CG  . LEU A 244 ? 1.0617 0.6770 0.6562 0.0529  0.0656  0.0111  364 LEU A CG  
1960 C CD1 . LEU A 244 ? 1.0862 0.6671 0.6128 0.0545  0.0567  0.0295  364 LEU A CD1 
1961 C CD2 . LEU A 244 ? 0.9013 0.5708 0.5123 0.0303  0.0572  -0.0078 364 LEU A CD2 
1962 N N   . LYS A 245 ? 1.0022 0.6805 0.7435 0.1090  0.0738  -0.0335 365 LYS A N   
1963 C CA  . LYS A 245 ? 0.9845 0.6743 0.7372 0.1415  0.0725  -0.0349 365 LYS A CA  
1964 C C   . LYS A 245 ? 0.9270 0.7071 0.6998 0.1404  0.0467  -0.0452 365 LYS A C   
1965 O O   . LYS A 245 ? 0.7091 0.5289 0.5009 0.1122  0.0408  -0.0618 365 LYS A O   
1966 C CB  . LYS A 245 ? 1.0226 0.6711 0.8028 0.1428  0.0990  -0.0536 365 LYS A CB  
1967 C CG  . LYS A 245 ? 1.0944 0.6491 0.8575 0.1445  0.1319  -0.0440 365 LYS A CG  
1968 C CD  . LYS A 245 ? 1.1993 0.7019 0.9180 0.1903  0.1415  -0.0149 365 LYS A CD  
1969 C CE  . LYS A 245 ? 1.2716 0.6690 0.9669 0.1915  0.1819  -0.0027 365 LYS A CE  
1970 N NZ  . LYS A 245 ? 1.3447 0.7193 1.0792 0.1636  0.2076  -0.0281 365 LYS A NZ  
1971 N N   . HIS A 246 ? 0.9105 0.7261 0.6776 0.1735  0.0337  -0.0341 366 HIS A N   
1972 C CA  . HIS A 246 ? 0.8038 0.7154 0.5976 0.1720  0.0122  -0.0436 366 HIS A CA  
1973 C C   . HIS A 246 ? 0.8715 0.7994 0.7037 0.1734  0.0241  -0.0652 366 HIS A C   
1974 O O   . HIS A 246 ? 0.7548 0.7396 0.6099 0.1503  0.0164  -0.0803 366 HIS A O   
1975 C CB  . HIS A 246 ? 0.7686 0.7296 0.5536 0.2132  -0.0043 -0.0269 366 HIS A CB  
1976 C CG  . HIS A 246 ? 0.9344 1.0097 0.7539 0.2071  -0.0261 -0.0367 366 HIS A CG  
1977 N ND1 . HIS A 246 ? 0.8549 0.9797 0.7088 0.2371  -0.0216 -0.0422 366 HIS A ND1 
1978 C CD2 . HIS A 246 ? 0.7531 0.9005 0.5776 0.1716  -0.0484 -0.0429 366 HIS A CD2 
1979 C CE1 . HIS A 246 ? 0.6606 0.8922 0.5455 0.2213  -0.0407 -0.0499 366 HIS A CE1 
1980 N NE2 . HIS A 246 ? 0.6868 0.9328 0.5552 0.1782  -0.0567 -0.0520 366 HIS A NE2 
1981 N N   . ASN A 247 ? 0.8791 0.7484 0.7109 0.2005  0.0463  -0.0671 367 ASN A N   
1982 C CA  . ASN A 247 ? 0.8764 0.7434 0.7344 0.2013  0.0603  -0.0912 367 ASN A CA  
1983 C C   . ASN A 247 ? 0.9412 0.7838 0.8099 0.1593  0.0679  -0.1132 367 ASN A C   
1984 O O   . ASN A 247 ? 1.0015 0.7776 0.8603 0.1470  0.0841  -0.1139 367 ASN A O   
1985 C CB  . ASN A 247 ? 0.8505 0.6469 0.6934 0.2414  0.0865  -0.0880 367 ASN A CB  
1986 C CG  . ASN A 247 ? 1.1063 0.9072 0.9680 0.2514  0.0989  -0.1124 367 ASN A CG  
1987 O OD1 . ASN A 247 ? 1.1407 0.9741 1.0258 0.2210  0.0933  -0.1369 367 ASN A OD1 
1988 N ND2 . ASN A 247 ? 0.9903 0.7535 0.8336 0.2991  0.1182  -0.1045 367 ASN A ND2 
1989 N N   . PRO A 248 ? 0.8605 0.7620 0.7492 0.1397  0.0578  -0.1304 368 PRO A N   
1990 C CA  . PRO A 248 ? 0.8222 0.7208 0.7171 0.1074  0.0608  -0.1492 368 PRO A CA  
1991 C C   . PRO A 248 ? 0.7834 0.6315 0.6887 0.1020  0.0793  -0.1726 368 PRO A C   
1992 O O   . PRO A 248 ? 0.8373 0.6707 0.7460 0.0770  0.0841  -0.1814 368 PRO A O   
1993 C CB  . PRO A 248 ? 0.7465 0.7135 0.6543 0.1039  0.0519  -0.1619 368 PRO A CB  
1994 C CG  . PRO A 248 ? 0.8403 0.8549 0.7504 0.1190  0.0407  -0.1445 368 PRO A CG  
1995 C CD  . PRO A 248 ? 0.8666 0.8460 0.7719 0.1514  0.0455  -0.1313 368 PRO A CD  
1996 N N   . SER A 249 ? 0.8937 0.7169 0.8028 0.1244  0.0914  -0.1838 369 SER A N   
1997 C CA  . SER A 249 ? 1.0111 0.7813 0.9265 0.1130  0.1116  -0.2131 369 SER A CA  
1998 C C   . SER A 249 ? 1.0823 0.7693 0.9856 0.1058  0.1342  -0.2036 369 SER A C   
1999 O O   . SER A 249 ? 1.0777 0.7180 0.9893 0.0830  0.1542  -0.2294 369 SER A O   
2000 C CB  . SER A 249 ? 0.9539 0.7102 0.8656 0.1408  0.1224  -0.2288 369 SER A CB  
2001 O OG  . SER A 249 ? 1.1429 0.8746 1.0355 0.1821  0.1300  -0.2008 369 SER A OG  
2002 N N   . GLN A 250 ? 1.0788 0.7480 0.9609 0.1234  0.1325  -0.1682 370 GLN A N   
2003 C CA  . GLN A 250 ? 1.0763 0.6609 0.9389 0.1221  0.1577  -0.1534 370 GLN A CA  
2004 C C   . GLN A 250 ? 1.0228 0.6165 0.8929 0.0885  0.1540  -0.1477 370 GLN A C   
2005 O O   . GLN A 250 ? 1.0981 0.6269 0.9589 0.0791  0.1783  -0.1389 370 GLN A O   
2006 C CB  . GLN A 250 ? 1.1539 0.7092 0.9795 0.1682  0.1601  -0.1168 370 GLN A CB  
2007 C CG  . GLN A 250 ? 1.3334 0.8663 1.1448 0.2117  0.1729  -0.1175 370 GLN A CG  
2008 C CD  . GLN A 250 ? 1.5383 1.0602 1.3120 0.2662  0.1722  -0.0793 370 GLN A CD  
2009 O OE1 . GLN A 250 ? 1.5391 1.1025 1.3039 0.2692  0.1492  -0.0564 370 GLN A OE1 
2010 N NE2 . GLN A 250 ? 1.5841 1.0552 1.3326 0.3092  0.1960  -0.0723 370 GLN A NE2 
2011 N N   . ARG A 251 ? 0.9260 0.5957 0.8086 0.0733  0.1284  -0.1509 371 ARG A N   
2012 C CA  . ARG A 251 ? 0.9687 0.6508 0.8545 0.0470  0.1271  -0.1459 371 ARG A CA  
2013 C C   . ARG A 251 ? 1.0334 0.7167 0.9537 0.0165  0.1420  -0.1783 371 ARG A C   
2014 O O   . ARG A 251 ? 1.0281 0.7332 0.9690 0.0107  0.1402  -0.2104 371 ARG A O   
2015 C CB  . ARG A 251 ? 0.8594 0.6106 0.7378 0.0437  0.1017  -0.1398 371 ARG A CB  
2016 C CG  . ARG A 251 ? 0.8572 0.6185 0.7061 0.0628  0.0857  -0.1138 371 ARG A CG  
2017 C CD  . ARG A 251 ? 0.6398 0.4606 0.4807 0.0524  0.0678  -0.1142 371 ARG A CD  
2018 N NE  . ARG A 251 ? 0.7575 0.6096 0.5875 0.0647  0.0520  -0.1027 371 ARG A NE  
2019 C CZ  . ARG A 251 ? 0.7963 0.7037 0.6287 0.0568  0.0411  -0.1088 371 ARG A CZ  
2020 N NH1 . ARG A 251 ? 0.7663 0.6941 0.6023 0.0436  0.0455  -0.1233 371 ARG A NH1 
2021 N NH2 . ARG A 251 ? 0.6626 0.6088 0.4934 0.0633  0.0277  -0.1007 371 ARG A NH2 
2022 N N   . PRO A 252 ? 1.0717 0.7367 0.9988 -0.0036 0.1570  -0.1718 372 PRO A N   
2023 C CA  . PRO A 252 ? 1.0933 0.7697 1.0614 -0.0376 0.1727  -0.2049 372 PRO A CA  
2024 C C   . PRO A 252 ? 1.0652 0.8373 1.0589 -0.0491 0.1501  -0.2319 372 PRO A C   
2025 O O   . PRO A 252 ? 0.9646 0.7810 0.9392 -0.0302 0.1273  -0.2217 372 PRO A O   
2026 C CB  . PRO A 252 ? 1.0138 0.6596 0.9812 -0.0500 0.1937  -0.1825 372 PRO A CB  
2027 C CG  . PRO A 252 ? 0.9483 0.6002 0.8740 -0.0251 0.1768  -0.1440 372 PRO A CG  
2028 C CD  . PRO A 252 ? 1.0194 0.6594 0.9170 0.0031  0.1602  -0.1351 372 PRO A CD  
2029 N N   . MET A 253 ? 1.0230 0.8275 1.0577 -0.0799 0.1581  -0.2671 373 MET A N   
2030 C CA  . MET A 253 ? 0.9470 0.8516 1.0034 -0.0856 0.1367  -0.2915 373 MET A CA  
2031 C C   . MET A 253 ? 0.9586 0.9077 1.0242 -0.0896 0.1392  -0.2727 373 MET A C   
2032 O O   . MET A 253 ? 1.0776 0.9807 1.1464 -0.0999 0.1617  -0.2523 373 MET A O   
2033 C CB  . MET A 253 ? 0.9442 0.8783 1.0397 -0.1157 0.1386  -0.3458 373 MET A CB  
2034 C CG  . MET A 253 ? 1.0917 0.9881 1.1701 -0.1052 0.1351  -0.3633 373 MET A CG  
2035 S SD  . MET A 253 ? 1.7154 1.6614 1.8272 -0.1352 0.1281  -0.4127 373 MET A SD  
2036 C CE  . MET A 253 ? 0.8652 0.7668 1.0151 -0.1856 0.1642  -0.4272 373 MET A CE  
2037 N N   . LEU A 254 ? 0.8361 0.8708 0.8999 -0.0761 0.1196  -0.2774 374 LEU A N   
2038 C CA  . LEU A 254 ? 0.8502 0.9318 0.9147 -0.0695 0.1233  -0.2568 374 LEU A CA  
2039 C C   . LEU A 254 ? 0.8289 0.9508 0.9533 -0.1035 0.1393  -0.2802 374 LEU A C   
2040 O O   . LEU A 254 ? 0.7874 0.9179 0.9180 -0.1033 0.1548  -0.2565 374 LEU A O   
2041 C CB  . LEU A 254 ? 0.7742 0.9361 0.8164 -0.0405 0.1028  -0.2579 374 LEU A CB  
2042 C CG  . LEU A 254 ? 0.8335 0.9524 0.8132 -0.0114 0.0952  -0.2285 374 LEU A CG  
2043 C CD1 . LEU A 254 ? 0.7989 0.9844 0.7534 0.0161  0.0808  -0.2361 374 LEU A CD1 
2044 C CD2 . LEU A 254 ? 0.7497 0.8112 0.6873 -0.0011 0.1090  -0.1831 374 LEU A CD2 
2045 N N   . ARG A 255 ? 0.8722 1.0179 1.0399 -0.1350 0.1379  -0.3283 375 ARG A N   
2046 C CA  . ARG A 255 ? 0.9293 1.1099 1.1601 -0.1799 0.1566  -0.3585 375 ARG A CA  
2047 C C   . ARG A 255 ? 0.9863 1.0579 1.2160 -0.1993 0.1944  -0.3347 375 ARG A C   
2048 O O   . ARG A 255 ? 0.9970 1.0875 1.2670 -0.2261 0.2184  -0.3348 375 ARG A O   
2049 C CB  . ARG A 255 ? 0.8641 1.0790 1.1312 -0.2147 0.1481  -0.4205 375 ARG A CB  
2050 N N   . GLU A 256 ? 1.0440 1.0061 1.2260 -0.1820 0.2011  -0.3130 376 GLU A N   
2051 C CA  . GLU A 256 ? 0.9427 0.7914 1.1081 -0.1888 0.2372  -0.2865 376 GLU A CA  
2052 C C   . GLU A 256 ? 1.0007 0.8320 1.1340 -0.1618 0.2434  -0.2339 376 GLU A C   
2053 O O   . GLU A 256 ? 1.1199 0.8900 1.2530 -0.1719 0.2770  -0.2133 376 GLU A O   
2054 C CB  . GLU A 256 ? 1.0147 0.7639 1.1353 -0.1696 0.2402  -0.2800 376 GLU A CB  
2055 C CG  . GLU A 256 ? 1.1787 0.9121 1.3197 -0.1965 0.2460  -0.3300 376 GLU A CG  
2056 C CD  . GLU A 256 ? 1.2827 0.9403 1.3737 -0.1616 0.2435  -0.3085 376 GLU A CD  
2057 O OE1 . GLU A 256 ? 1.2611 0.9242 1.3186 -0.1240 0.2209  -0.2885 376 GLU A OE1 
2058 O OE2 . GLU A 256 ? 1.3883 0.9861 1.4724 -0.1708 0.2654  -0.3113 376 GLU A OE2 
2059 N N   . VAL A 257 ? 0.9243 0.8010 1.0241 -0.1276 0.2148  -0.2128 377 VAL A N   
2060 C CA  . VAL A 257 ? 0.9319 0.7907 0.9913 -0.1021 0.2199  -0.1666 377 VAL A CA  
2061 C C   . VAL A 257 ? 0.9622 0.8902 1.0621 -0.1148 0.2357  -0.1663 377 VAL A C   
2062 O O   . VAL A 257 ? 0.9723 0.8590 1.0580 -0.1104 0.2609  -0.1344 377 VAL A O   
2063 C CB  . VAL A 257 ? 0.8696 0.7506 0.8769 -0.0672 0.1905  -0.1482 377 VAL A CB  
2064 C CG1 . VAL A 257 ? 0.8965 0.7507 0.8542 -0.0445 0.1992  -0.1046 377 VAL A CG1 
2065 C CG2 . VAL A 257 ? 0.8346 0.6611 0.8091 -0.0553 0.1760  -0.1469 377 VAL A CG2 
2066 N N   . LEU A 258 ? 0.8309 0.8703 0.9808 -0.1278 0.2208  -0.2022 378 LEU A N   
2067 C CA  . LEU A 258 ? 0.7734 0.9080 0.9719 -0.1373 0.2320  -0.2063 378 LEU A CA  
2068 C C   . LEU A 258 ? 0.8367 0.9502 1.0929 -0.1835 0.2694  -0.2197 378 LEU A C   
2069 O O   . LEU A 258 ? 0.9194 1.0850 1.2099 -0.1900 0.2902  -0.2087 378 LEU A O   
2070 C CB  . LEU A 258 ? 0.6916 0.9619 0.9294 -0.1377 0.2032  -0.2462 378 LEU A CB  
2071 C CG  . LEU A 258 ? 0.7132 1.0179 0.8929 -0.0871 0.1751  -0.2287 378 LEU A CG  
2072 C CD1 . LEU A 258 ? 0.5125 0.9284 0.7222 -0.0874 0.1459  -0.2742 378 LEU A CD1 
2073 C CD2 . LEU A 258 ? 0.7204 1.0538 0.8701 -0.0500 0.1865  -0.1868 378 LEU A CD2 
2074 N N   . GLU A 259 ? 0.8598 0.8929 1.1235 -0.2141 0.2824  -0.2423 379 GLU A N   
2075 C CA  . GLU A 259 ? 0.8795 0.8712 1.1902 -0.2628 0.3256  -0.2580 379 GLU A CA  
2076 C C   . GLU A 259 ? 0.9036 0.7462 1.1591 -0.2482 0.3605  -0.2138 379 GLU A C   
2077 O O   . GLU A 259 ? 0.9361 0.7096 1.2120 -0.2827 0.4041  -0.2202 379 GLU A O   
2078 C CB  . GLU A 259 ? 0.9860 0.9773 1.3360 -0.3095 0.3260  -0.3169 379 GLU A CB  
2079 C CG  . GLU A 259 ? 1.0103 1.1560 1.4191 -0.3298 0.2933  -0.3679 379 GLU A CG  
2080 C CD  . GLU A 259 ? 1.2463 1.3774 1.6756 -0.3714 0.2896  -0.4274 379 GLU A CD  
2081 O OE1 . GLU A 259 ? 1.3233 1.3185 1.7182 -0.3806 0.3160  -0.4252 379 GLU A OE1 
2082 O OE2 . GLU A 259 ? 1.3081 1.5619 1.7800 -0.3894 0.2608  -0.4750 379 GLU A OE2 
2083 N N   . HIS A 260 ? 0.9123 0.7046 1.0939 -0.1976 0.3429  -0.1703 380 HIS A N   
2084 C CA  . HIS A 260 ? 1.0423 0.7045 1.1619 -0.1751 0.3687  -0.1273 380 HIS A CA  
2085 C C   . HIS A 260 ? 1.0562 0.7040 1.1870 -0.1819 0.4092  -0.0997 380 HIS A C   
2086 O O   . HIS A 260 ? 1.1163 0.8474 1.2631 -0.1724 0.4029  -0.0883 380 HIS A O   
2087 C CB  . HIS A 260 ? 1.0564 0.6902 1.0991 -0.1250 0.3357  -0.0931 380 HIS A CB  
2088 C CG  . HIS A 260 ? 1.2286 0.7390 1.2038 -0.0986 0.3519  -0.0569 380 HIS A CG  
2089 N ND1 . HIS A 260 ? 1.2761 0.7300 1.2128 -0.0818 0.3780  -0.0169 380 HIS A ND1 
2090 C CD2 . HIS A 260 ? 1.2404 0.6869 1.1768 -0.0796 0.3428  -0.0537 380 HIS A CD2 
2091 C CE1 . HIS A 260 ? 1.2521 0.6632 1.1326 -0.0479 0.3652  0.0040  380 HIS A CE1 
2092 N NE2 . HIS A 260 ? 1.2651 0.6712 1.1462 -0.0469 0.3460  -0.0139 380 HIS A NE2 
2093 N N   . PRO A 261 ? 1.1680 0.7063 1.2860 -0.1941 0.4552  -0.0869 381 PRO A N   
2094 C CA  . PRO A 261 ? 1.1683 0.6933 1.2912 -0.1930 0.4912  -0.0626 381 PRO A CA  
2095 C C   . PRO A 261 ? 1.1872 0.7136 1.2592 -0.1503 0.4849  -0.0150 381 PRO A C   
2096 O O   . PRO A 261 ? 1.3718 0.9505 1.4758 -0.1563 0.5053  -0.0039 381 PRO A O   
2097 C CB  . PRO A 261 ? 1.2080 0.6329 1.2801 -0.1718 0.5085  -0.0519 381 PRO A CB  
2098 C CG  . PRO A 261 ? 1.2791 0.6928 1.3598 -0.1881 0.4959  -0.0857 381 PRO A CG  
2099 C CD  . PRO A 261 ? 1.1535 0.6167 1.2366 -0.1831 0.4535  -0.0958 381 PRO A CD  
2100 N N   . TRP A 262 ? 1.1538 0.6338 1.1457 -0.1051 0.4524  0.0096  382 TRP A N   
2101 C CA  . TRP A 262 ? 1.1128 0.5916 1.0431 -0.0623 0.4375  0.0471  382 TRP A CA  
2102 C C   . TRP A 262 ? 1.1470 0.7213 1.1014 -0.0659 0.4280  0.0468  382 TRP A C   
2103 O O   . TRP A 262 ? 1.2316 0.8214 1.1612 -0.0430 0.4380  0.0751  382 TRP A O   
2104 C CB  . TRP A 262 ? 1.1181 0.5579 0.9677 -0.0214 0.3960  0.0600  382 TRP A CB  
2105 C CG  . TRP A 262 ? 1.1587 0.6043 0.9477 0.0153  0.3744  0.0841  382 TRP A CG  
2106 C CD1 . TRP A 262 ? 1.1695 0.5922 0.9215 0.0403  0.3775  0.0995  382 TRP A CD1 
2107 C CD2 . TRP A 262 ? 1.1469 0.6238 0.9056 0.0286  0.3467  0.0890  382 TRP A CD2 
2108 N NE1 . TRP A 262 ? 1.1412 0.5807 0.8492 0.0638  0.3515  0.1079  382 TRP A NE1 
2109 C CE2 . TRP A 262 ? 1.0186 0.4896 0.7286 0.0582  0.3319  0.1019  382 TRP A CE2 
2110 C CE3 . TRP A 262 ? 1.1257 0.6363 0.8918 0.0171  0.3356  0.0812  382 TRP A CE3 
2111 C CZ2 . TRP A 262 ? 1.0338 0.5262 0.7086 0.0743  0.3046  0.1029  382 TRP A CZ2 
2112 C CZ3 . TRP A 262 ? 1.0979 0.6314 0.8180 0.0400  0.3090  0.0887  382 TRP A CZ3 
2113 C CH2 . TRP A 262 ? 1.1031 0.6241 0.7829 0.0666  0.2926  0.0971  382 TRP A CH2 
2114 N N   . ILE A 263 ? 1.0162 0.6729 1.0138 -0.0813 0.3947  0.0082  383 ILE A N   
2115 C CA  . ILE A 263 ? 0.9518 0.7253 0.9699 -0.0705 0.3700  -0.0015 383 ILE A CA  
2116 C C   . ILE A 263 ? 0.9778 0.8511 1.0747 -0.0915 0.3956  -0.0123 383 ILE A C   
2117 O O   . ILE A 263 ? 1.0260 0.9542 1.1118 -0.0642 0.4002  0.0104  383 ILE A O   
2118 C CB  . ILE A 263 ? 0.9652 0.8004 1.0066 -0.0791 0.3297  -0.0411 383 ILE A CB  
2119 C CG1 . ILE A 263 ? 0.9601 0.7256 0.9246 -0.0522 0.3016  -0.0267 383 ILE A CG1 
2120 C CG2 . ILE A 263 ? 0.8601 0.8268 0.9330 -0.0688 0.3112  -0.0554 383 ILE A CG2 
2121 C CD1 . ILE A 263 ? 0.9405 0.6987 0.8323 -0.0146 0.2911  0.0066  383 ILE A CD1 
2122 N N   . THR A 264 ? 0.9512 0.8473 1.1259 -0.1404 0.4149  -0.0475 384 THR A N   
2123 C CA  . THR A 264 ? 0.9501 0.9633 1.2169 -0.1722 0.4364  -0.0687 384 THR A CA  
2124 C C   . THR A 264 ? 1.0471 1.0287 1.3138 -0.1672 0.4856  -0.0301 384 THR A C   
2125 O O   . THR A 264 ? 1.0960 1.1852 1.4390 -0.1880 0.5068  -0.0403 384 THR A O   
2126 C CB  . THR A 264 ? 0.9781 1.0154 1.3262 -0.2367 0.4466  -0.1239 384 THR A CB  
2127 O OG1 . THR A 264 ? 1.0658 0.9544 1.3861 -0.2553 0.4844  -0.1133 384 THR A OG1 
2128 C CG2 . THR A 264 ? 0.9133 0.9947 1.2648 -0.2405 0.3992  -0.1651 384 THR A CG2 
2129 N N   . ALA A 265 ? 1.0896 0.9309 1.2710 -0.1384 0.5037  0.0137  385 ALA A N   
2130 C CA  . ALA A 265 ? 1.1064 0.9002 1.2673 -0.1220 0.5331  0.0493  385 ALA A CA  
2131 C C   . ALA A 265 ? 1.1891 0.9782 1.2747 -0.0633 0.5179  0.0925  385 ALA A C   
2132 O O   . ALA A 265 ? 1.1135 0.8819 1.1824 -0.0432 0.5342  0.1196  385 ALA A O   
2133 C CB  . ALA A 265 ? 1.0869 0.7328 1.1961 -0.1178 0.5458  0.0593  385 ALA A CB  
2134 N N   . ASN A 266 ? 1.2318 1.0345 1.2677 -0.0356 0.4857  0.0959  386 ASN A N   
2135 C CA  . ASN A 266 ? 1.1383 0.9181 1.0912 0.0182  0.4632  0.1300  386 ASN A CA  
2136 C C   . ASN A 266 ? 1.1200 1.0134 1.0802 0.0392  0.4444  0.1245  386 ASN A C   
2137 O O   . ASN A 266 ? 1.1379 1.0303 1.0461 0.0798  0.4303  0.1490  386 ASN A O   
2138 C CB  . ASN A 266 ? 1.0477 0.7076 0.9067 0.0430  0.4302  0.1394  386 ASN A CB  
2139 C CG  . ASN A 266 ? 1.2301 0.7957 1.0704 0.0432  0.4405  0.1417  386 ASN A CG  
2140 O OD1 . ASN A 266 ? 1.3310 0.8592 1.1348 0.0717  0.4417  0.1564  386 ASN A OD1 
2141 N ND2 . ASN A 266 ? 1.2024 0.7379 1.0671 0.0148  0.4479  0.1223  386 ASN A ND2 
2142 N N   . SER A 267 ? 1.0425 1.0307 1.0676 0.0144  0.4391  0.0868  387 SER A N   
2143 C CA  . SER A 267 ? 0.9025 1.0026 0.9311 0.0422  0.4115  0.0762  387 SER A CA  
2144 C C   . SER A 267 ? 0.8667 1.0998 0.9547 0.0566  0.4310  0.0818  387 SER A C   
2145 O O   . SER A 267 ? 0.8445 1.1348 1.0205 0.0206  0.4592  0.0689  387 SER A O   
2146 C CB  . SER A 267 ? 0.8810 1.0468 0.9624 0.0125  0.3734  0.0253  387 SER A CB  
2147 O OG  . SER A 267 ? 0.8489 1.1241 0.9292 0.0445  0.3488  0.0162  387 SER A OG  
2148 N N   . SER A 268 ? 1.0147 1.2895 1.0523 0.1047  0.4065  0.0962  388 SER A N   
2149 C CA  . SER A 268 ? 0.9904 1.3903 1.0737 0.1254  0.4116  0.0986  388 SER A CA  
2150 C C   . SER A 268 ? 1.0012 1.5612 1.1527 0.1268  0.3877  0.0603  388 SER A C   
2151 O O   . SER A 268 ? 1.1113 1.7896 1.3100 0.1435  0.3835  0.0560  388 SER A O   
2152 C CB  . SER A 268 ? 1.0358 1.3600 1.0192 0.1798  0.3989  0.1403  388 SER A CB  
2153 O OG  . SER A 268 ? 1.1404 1.3257 1.0673 0.1806  0.4125  0.1712  388 SER A OG  
2154 N N   . LYS A 269 ? 0.9140 1.4747 1.0662 0.1119  0.3664  0.0328  389 LYS A N   
2155 C CA  . LYS A 269 ? 0.9265 1.6236 1.1306 0.1111  0.3295  -0.0090 389 LYS A CA  
2156 C C   . LYS A 269 ? 0.9141 1.6281 1.1891 0.0456  0.3128  -0.0635 389 LYS A C   
2157 O O   . LYS A 269 ? 0.8879 1.4623 1.1240 0.0212  0.3119  -0.0622 389 LYS A O   
2158 C CB  . LYS A 269 ? 0.9444 1.5887 1.0465 0.1624  0.2967  0.0068  389 LYS A CB  
2159 C CG  . LYS A 269 ? 1.0594 1.6656 1.0872 0.2168  0.2967  0.0518  389 LYS A CG  
2160 C CD  . LYS A 269 ? 1.0359 1.5854 0.9732 0.2571  0.2661  0.0657  389 LYS A CD  
2161 N N   . PRO A 270 ? 0.8866 1.7591 1.2600 0.0160  0.2949  -0.1132 390 PRO A N   
2162 C CA  . PRO A 270 ? 0.8852 1.7608 1.3229 -0.0521 0.2776  -0.1710 390 PRO A CA  
2163 C C   . PRO A 270 ? 1.0092 1.8465 1.3939 -0.0391 0.2387  -0.1910 390 PRO A C   
2164 O O   . PRO A 270 ? 1.0655 1.8616 1.3620 0.0182  0.2280  -0.1586 390 PRO A O   
2165 C CB  . PRO A 270 ? 0.8481 1.8922 1.3845 -0.0792 0.2627  -0.2103 390 PRO A CB  
2166 C CG  . PRO A 270 ? 0.8933 2.0170 1.3872 -0.0058 0.2448  -0.1773 390 PRO A CG  
2167 C CD  . PRO A 270 ? 0.8912 1.8997 1.2995 0.0448  0.2781  -0.1120 390 PRO A CD  
2168 N N   . SER A 271 ? 1.0723 1.9180 1.5076 -0.0934 0.2224  -0.2446 391 SER A N   
2169 C CA  . SER A 271 ? 1.0330 1.8482 1.4260 -0.0844 0.1881  -0.2674 391 SER A CA  
2170 C C   . SER A 271 ? 1.0593 2.0357 1.4673 -0.0529 0.1537  -0.2954 391 SER A C   
2171 O O   . SER A 271 ? 0.9760 2.0693 1.4116 -0.0309 0.1514  -0.2885 391 SER A O   
2172 C CB  . SER A 271 ? 1.0316 1.7808 1.4625 -0.1497 0.1885  -0.3122 391 SER A CB  
2173 O OG  . SER A 271 ? 1.0483 1.6492 1.4585 -0.1707 0.2222  -0.2839 391 SER A OG  
2174 N N   . ASN A 272 ? 1.1172 2.0806 1.4929 -0.0460 0.1239  -0.3211 392 ASN A N   
2175 C CA  . ASN A 272 ? 1.1214 2.2221 1.4947 -0.0096 0.0900  -0.3467 392 ASN A CA  
2176 C C   . ASN A 272 ? 1.1481 2.3711 1.5960 -0.0511 0.0703  -0.3970 392 ASN A C   
2177 O O   . ASN A 272 ? 1.2047 2.5341 1.6424 -0.0153 0.0510  -0.3942 392 ASN A O   
2178 C CB  . ASN A 272 ? 1.1887 2.2278 1.5069 0.0014  0.0664  -0.3636 392 ASN A CB  
2179 C CG  . ASN A 272 ? 1.2582 2.2077 1.6073 -0.0643 0.0677  -0.4009 392 ASN A CG  
2180 O OD1 . ASN A 272 ? 1.3117 2.2694 1.7322 -0.1235 0.0828  -0.4282 392 ASN A OD1 
2181 N ND2 . ASN A 272 ? 1.2320 2.0922 1.5245 -0.0525 0.0564  -0.4012 392 ASN A ND2 
2182 N N   . SER B 1   ? 1.5869 1.8065 1.1289 -0.0836 0.6242  -0.2299 6   SER D N   
2183 C CA  . SER B 1   ? 1.6242 1.7511 1.1224 -0.1039 0.6581  -0.1586 6   SER D CA  
2184 C C   . SER B 1   ? 1.4598 1.5973 1.0623 -0.1135 0.5957  -0.1315 6   SER D C   
2185 O O   . SER B 1   ? 1.1743 1.3788 0.8447 -0.0796 0.4954  -0.1432 6   SER D O   
2186 C CB  . SER B 1   ? 1.9108 1.9397 1.1673 -0.0595 0.6593  -0.0984 6   SER D CB  
2187 O OG  . SER B 1   ? 1.9710 2.0224 1.1064 -0.0043 0.5896  -0.1019 6   SER D OG  
2188 N N   . SER B 2   ? 1.5214 1.5883 1.1440 -0.1550 0.6386  -0.0888 7   SER D N   
2189 C CA  . SER B 2   ? 1.4519 1.5132 1.1785 -0.1654 0.5747  -0.0596 7   SER D CA  
2190 C C   . SER B 2   ? 1.4446 1.4352 1.0102 -0.1017 0.5066  0.0015  7   SER D C   
2191 O O   . SER B 2   ? 1.7658 1.6599 1.1102 -0.0699 0.5414  0.0477  7   SER D O   
2192 C CB  . SER B 2   ? 1.5336 1.5232 1.3071 -0.2296 0.6311  -0.0309 7   SER D CB  
2193 O OG  . SER B 2   ? 1.4381 1.5075 1.3932 -0.2755 0.6548  -0.0760 7   SER D OG  
2194 N N   . TYR B 3   ? 1.2796 1.3242 0.9629 -0.0794 0.4108  0.0047  8   TYR D N   
2195 C CA  . TYR B 3   ? 1.1944 1.1831 0.7619 -0.0173 0.3425  0.0695  8   TYR D CA  
2196 C C   . TYR B 3   ? 1.3328 1.3352 0.7362 0.0494  0.3094  0.0861  8   TYR D C   
2197 O O   . TYR B 3   ? 1.3831 1.3337 0.6583 0.1060  0.2677  0.1525  8   TYR D O   
2198 C CB  . TYR B 3   ? 1.2958 1.1243 0.7221 -0.0288 0.3942  0.1399  8   TYR D CB  
2199 C CG  . TYR B 3   ? 1.1331 0.9376 0.7053 -0.1021 0.4215  0.1268  8   TYR D CG  
2200 C CD1 . TYR B 3   ? 1.1240 0.9798 0.8666 -0.1067 0.3467  0.1175  8   TYR D CD1 
2201 C CD2 . TYR B 3   ? 1.3165 1.0538 0.8633 -0.1661 0.5134  0.1246  8   TYR D CD2 
2202 C CE1 . TYR B 3   ? 1.0848 0.9218 0.9564 -0.1765 0.3648  0.1058  8   TYR D CE1 
2203 C CE2 . TYR B 3   ? 1.2456 0.9749 0.9364 -0.2329 0.5178  0.1119  8   TYR D CE2 
2204 C CZ  . TYR B 3   ? 1.3079 1.0790 1.1488 -0.2463 0.4571  0.1050  8   TYR D CZ  
2205 O OH  . TYR B 3   ? 1.3846 1.1649 1.3603 -0.2951 0.4287  0.0882  8   TYR D OH  
2206 N N   . SER B 4   ? 1.3338 1.4051 0.7391 0.0432  0.3277  0.0280  9   SER D N   
2207 C CA  . SER B 4   ? 1.2469 1.3482 0.5162 0.0980  0.2827  0.0311  9   SER D CA  
2208 C C   . SER B 4   ? 1.0782 1.3176 0.5166 0.1088  0.1896  -0.0257 9   SER D C   
2209 O O   . SER B 4   ? 1.0607 1.3659 0.5761 0.0834  0.2062  -0.0996 9   SER D O   
2210 C CB  . SER B 4   ? 1.4340 1.4953 0.5490 0.0877  0.3677  0.0073  9   SER D CB  
2211 O OG  . SER B 4   ? 1.5086 1.5937 0.5212 0.1227  0.3057  0.0059  9   SER D OG  
2212 N N   . TYR B 5   ? 0.9616 1.2387 0.4552 0.1486  0.0957  0.0118  10  TYR D N   
2213 C CA  . TYR B 5   ? 0.8787 1.2832 0.5605 0.1555  0.0061  -0.0352 10  TYR D CA  
2214 C C   . TYR B 5   ? 0.8632 1.3246 0.4580 0.2007  -0.0714 -0.0327 10  TYR D C   
2215 O O   . TYR B 5   ? 1.0125 1.4056 0.4463 0.2319  -0.0772 0.0289  10  TYR D O   
2216 C CB  . TYR B 5   ? 0.6830 1.1041 0.5076 0.1688  -0.0514 0.0021  10  TYR D CB  
2217 C CG  . TYR B 5   ? 0.7192 1.0853 0.6330 0.1199  0.0099  0.0008  10  TYR D CG  
2218 C CD1 . TYR B 5   ? 0.6442 1.0179 0.6280 0.0583  0.0888  -0.0579 10  TYR D CD1 
2219 C CD2 . TYR B 5   ? 0.7410 1.0462 0.6667 0.1349  -0.0117 0.0610  10  TYR D CD2 
2220 C CE1 . TYR B 5   ? 0.8540 1.1873 0.9275 0.0070  0.1385  -0.0556 10  TYR D CE1 
2221 C CE2 . TYR B 5   ? 0.6316 0.8816 0.6312 0.0835  0.0369  0.0581  10  TYR D CE2 
2222 C CZ  . TYR B 5   ? 0.7357 1.0058 0.8143 0.0167  0.1088  0.0003  10  TYR D CZ  
2223 O OH  . TYR B 5   ? 0.8430 1.0680 1.0028 -0.0406 0.1514  0.0007  10  TYR D OH  
2224 N N   . ASP B 6   ? 1.0515 1.6455 0.4746 0.3842  0.0882  0.0806  11  ASP D N   
2225 C CA  . ASP B 6   ? 1.0852 1.6581 0.4725 0.3787  0.0786  0.0408  11  ASP D CA  
2226 C C   . ASP B 6   ? 1.0987 1.6602 0.4955 0.3505  0.0680  0.0149  11  ASP D C   
2227 O O   . ASP B 6   ? 1.0687 1.5930 0.4497 0.3345  0.0724  -0.0084 11  ASP D O   
2228 C CB  . ASP B 6   ? 1.1342 1.6687 0.4814 0.3882  0.0880  0.0223  11  ASP D CB  
2229 C CG  . ASP B 6   ? 1.2628 1.7743 0.5689 0.3853  0.0744  -0.0166 11  ASP D CG  
2230 O OD1 . ASP B 6   ? 1.1758 1.7081 0.4849 0.3810  0.0583  -0.0268 11  ASP D OD1 
2231 O OD2 . ASP B 6   ? 1.2230 1.6962 0.4927 0.3892  0.0773  -0.0371 11  ASP D OD2 
2232 N N   . ALA B 7   ? 1.0797 1.6740 0.5010 0.3456  0.0551  0.0196  12  ALA D N   
2233 C CA  . ALA B 7   ? 1.0392 1.6331 0.4750 0.3231  0.0485  -0.0012 12  ALA D CA  
2234 C C   . ALA B 7   ? 1.0566 1.6938 0.5099 0.3267  0.0295  -0.0043 12  ALA D C   
2235 O O   . ALA B 7   ? 1.0286 1.6913 0.4891 0.3432  0.0220  0.0205  12  ALA D O   
2236 C CB  . ALA B 7   ? 0.9723 1.5506 0.4281 0.3121  0.0566  0.0180  12  ALA D CB  
2237 N N   . PRO B 8   ? 1.1374 1.7849 0.5979 0.3117  0.0224  -0.0351 13  PRO D N   
2238 C CA  . PRO B 8   ? 1.0496 1.7430 0.5298 0.3168  0.0013  -0.0422 13  PRO D CA  
2239 C C   . PRO B 8   ? 1.0877 1.7995 0.5946 0.3242  -0.0060 -0.0059 13  PRO D C   
2240 O O   . PRO B 8   ? 0.9143 1.6087 0.4329 0.3162  0.0036  0.0099  13  PRO D O   
2241 C CB  . PRO B 8   ? 1.1740 1.8763 0.6651 0.2975  0.0046  -0.0792 13  PRO D CB  
2242 C CG  . PRO B 8   ? 1.1123 1.7726 0.5783 0.2833  0.0220  -0.0984 13  PRO D CG  
2243 C CD  . PRO B 8   ? 1.0787 1.6985 0.5299 0.2898  0.0345  -0.0660 13  PRO D CD  
2244 N N   . SER B 9   ? 0.9422 1.6823 0.4555 0.3388  -0.0257 0.0075  14  SER D N   
2245 C CA  . SER B 9   ? 1.0169 1.7705 0.5572 0.3438  -0.0372 0.0430  14  SER D CA  
2246 C C   . SER B 9   ? 0.9866 1.7712 0.5422 0.3506  -0.0677 0.0348  14  SER D C   
2247 O O   . SER B 9   ? 1.0366 1.8257 0.6153 0.3536  -0.0827 0.0627  14  SER D O   
2248 C CB  . SER B 9   ? 1.2604 2.0054 0.7974 0.3539  -0.0261 0.0841  14  SER D CB  
2249 O OG  . SER B 9   ? 1.3426 2.0964 0.9099 0.3539  -0.0384 0.1198  14  SER D OG  
2250 N N   . ASP B 10  ? 0.9385 1.7405 0.4850 0.3514  -0.0801 -0.0045 15  ASP D N   
2251 C CA  . ASP B 10  ? 1.0343 1.8652 0.5998 0.3589  -0.1145 -0.0174 15  ASP D CA  
2252 C C   . ASP B 10  ? 0.9987 1.8600 0.6026 0.3532  -0.1285 -0.0423 15  ASP D C   
2253 O O   . ASP B 10  ? 0.8985 1.7452 0.5178 0.3361  -0.1030 -0.0606 15  ASP D O   
2254 C CB  . ASP B 10  ? 0.9873 1.8219 0.5269 0.3654  -0.1290 -0.0477 15  ASP D CB  
2255 C CG  . ASP B 10  ? 1.2374 2.0392 0.7313 0.3761  -0.1160 -0.0262 15  ASP D CG  
2256 O OD1 . ASP B 10  ? 1.1991 1.9908 0.6920 0.3817  -0.1062 0.0148  15  ASP D OD1 
2257 O OD2 . ASP B 10  ? 1.1970 1.9835 0.6567 0.3794  -0.1164 -0.0513 15  ASP D OD2 
2258 N N   . PHE B 11  ? 0.9714 1.8530 0.6104 0.3608  -0.1612 -0.0435 16  PHE D N   
2259 C CA  . PHE B 11  ? 0.9271 1.8220 0.6279 0.3532  -0.1685 -0.0687 16  PHE D CA  
2260 C C   . PHE B 11  ? 1.0042 1.9137 0.7397 0.3385  -0.1587 -0.1173 16  PHE D C   
2261 O O   . PHE B 11  ? 0.9161 1.8385 0.6479 0.3412  -0.1770 -0.1368 16  PHE D O   
2262 C CB  . PHE B 11  ? 0.9375 1.8515 0.6658 0.3688  -0.2114 -0.0604 16  PHE D CB  
2263 C CG  . PHE B 11  ? 0.9867 1.9140 0.7795 0.3667  -0.2189 -0.0860 16  PHE D CG  
2264 C CD1 . PHE B 11  ? 1.0368 1.9434 0.8382 0.3676  -0.2126 -0.0693 16  PHE D CD1 
2265 C CD2 . PHE B 11  ? 0.8772 1.8362 0.7229 0.3659  -0.2336 -0.1271 16  PHE D CD2 
2266 C CE1 . PHE B 11  ? 0.9629 1.8783 0.8157 0.3708  -0.2171 -0.0945 16  PHE D CE1 
2267 C CE2 . PHE B 11  ? 0.8918 1.8680 0.8007 0.3676  -0.2358 -0.1508 16  PHE D CE2 
2268 C CZ  . PHE B 11  ? 0.9770 1.9305 0.8852 0.3716  -0.2257 -0.1352 16  PHE D CZ  
2269 N N   . ILE B 12  ? 1.0262 1.9306 0.7942 0.3228  -0.1307 -0.1353 17  ILE D N   
2270 C CA  . ILE B 12  ? 0.9791 1.9003 0.7903 0.3048  -0.1158 -0.1770 17  ILE D CA  
2271 C C   . ILE B 12  ? 0.8843 1.8388 0.7718 0.3063  -0.1239 -0.2004 17  ILE D C   
2272 O O   . ILE B 12  ? 1.0686 2.0142 0.9651 0.3131  -0.1173 -0.1898 17  ILE D O   
2273 C CB  . ILE B 12  ? 1.0255 1.9152 0.8146 0.2836  -0.0707 -0.1813 17  ILE D CB  
2274 C CG1 . ILE B 12  ? 1.0695 1.9250 0.7853 0.2861  -0.0622 -0.1572 17  ILE D CG1 
2275 C CG2 . ILE B 12  ? 1.0113 1.9187 0.8465 0.2614  -0.0556 -0.2201 17  ILE D CG2 
2276 C CD1 . ILE B 12  ? 1.0739 1.8906 0.7617 0.2676  -0.0232 -0.1582 17  ILE D CD1 
2277 N N   . ASN B 13  ? 0.8693 1.8606 0.8128 0.3017  -0.1405 -0.2328 18  ASN D N   
2278 C CA  . ASN B 13  ? 0.8862 1.9175 0.9145 0.3040  -0.1449 -0.2586 18  ASN D CA  
2279 C C   . ASN B 13  ? 0.9626 2.0003 1.0295 0.2807  -0.0961 -0.2807 18  ASN D C   
2280 O O   . ASN B 13  ? 0.9164 1.9738 1.0210 0.2610  -0.0884 -0.3045 18  ASN D O   
2281 C CB  . ASN B 13  ? 0.9306 2.0014 1.0118 0.3107  -0.1898 -0.2818 18  ASN D CB  
2282 C CG  . ASN B 13  ? 0.9436 2.0568 1.1103 0.3235  -0.2061 -0.3012 18  ASN D CG  
2283 O OD1 . ASN B 13  ? 1.0101 2.1176 1.1817 0.3341  -0.1912 -0.2928 18  ASN D OD1 
2284 N ND2 . ASN B 13  ? 0.8814 2.0344 1.1155 0.3249  -0.2402 -0.3284 18  ASN D ND2 
2285 N N   . PHE B 14  ? 0.9452 1.9619 0.9996 0.2829  -0.0647 -0.2713 19  PHE D N   
2286 C CA  . PHE B 14  ? 0.9590 1.9684 1.0275 0.2616  -0.0120 -0.2854 19  PHE D CA  
2287 C C   . PHE B 14  ? 1.0239 2.0906 1.1925 0.2551  0.0017  -0.3191 19  PHE D C   
2288 O O   . PHE B 14  ? 1.0174 2.0859 1.2068 0.2348  0.0485  -0.3311 19  PHE D O   
2289 C CB  . PHE B 14  ? 0.9115 1.8738 0.9286 0.2702  0.0132  -0.2660 19  PHE D CB  
2290 C CG  . PHE B 14  ? 0.8975 1.8021 0.8260 0.2677  0.0138  -0.2339 19  PHE D CG  
2291 C CD1 . PHE B 14  ? 0.8740 1.7491 0.7641 0.2444  0.0430  -0.2331 19  PHE D CD1 
2292 C CD2 . PHE B 14  ? 0.9173 1.7975 0.8063 0.2885  -0.0158 -0.2036 19  PHE D CD2 
2293 C CE1 . PHE B 14  ? 0.8724 1.6976 0.6883 0.2447  0.0431  -0.2046 19  PHE D CE1 
2294 C CE2 . PHE B 14  ? 0.8522 1.6862 0.6726 0.2863  -0.0141 -0.1724 19  PHE D CE2 
2295 C CZ  . PHE B 14  ? 0.8623 1.6701 0.6471 0.2658  0.0157  -0.1740 19  PHE D CZ  
2296 N N   . SER B 15  ? 1.1348 2.2484 1.3674 0.2723  -0.0383 -0.3329 20  SER D N   
2297 C CA  . SER B 15  ? 1.2167 2.3933 1.5591 0.2687  -0.0295 -0.3647 20  SER D CA  
2298 C C   . SER B 15  ? 1.3106 2.5162 1.7031 0.2417  -0.0367 -0.3833 20  SER D C   
2299 O O   . SER B 15  ? 1.3616 2.6108 1.8397 0.2236  -0.0091 -0.4050 20  SER D O   
2300 C CB  . SER B 15  ? 1.2148 2.4276 1.6103 0.2999  -0.0748 -0.3734 20  SER D CB  
2301 O OG  . SER B 15  ? 1.2710 2.5381 1.7650 0.3050  -0.0519 -0.4000 20  SER D OG  
2302 N N   . SER B 16  ? 1.3224 2.5016 1.6605 0.2397  -0.0738 -0.3736 21  SER D N   
2303 C CA  . SER B 16  ? 1.3645 2.5582 1.7365 0.2178  -0.0928 -0.3915 21  SER D CA  
2304 C C   . SER B 16  ? 1.3927 2.5629 1.7487 0.1834  -0.0455 -0.3926 21  SER D C   
2305 O O   . SER B 16  ? 1.3662 2.5737 1.8068 0.1595  -0.0220 -0.4117 21  SER D O   
2306 C CB  . SER B 16  ? 1.4149 2.5767 1.7149 0.2313  -0.1450 -0.3806 21  SER D CB  
2307 O OG  . SER B 16  ? 1.4493 2.5532 1.6390 0.2348  -0.1272 -0.3516 21  SER D OG  
2308 N N   . LEU B 17  ? 1.4446 2.5535 1.6955 0.1807  -0.0322 -0.3706 22  LEU D N   
2309 C CA  . LEU B 17  ? 1.4586 2.5335 1.6802 0.1496  0.0055  -0.3701 22  LEU D CA  
2310 C C   . LEU B 17  ? 1.3851 2.4166 1.5427 0.1485  0.0549  -0.3495 22  LEU D C   
2311 O O   . LEU B 17  ? 1.3674 2.3814 1.5245 0.1224  0.0987  -0.3516 22  LEU D O   
2312 C CB  . LEU B 17  ? 1.4960 2.5290 1.6476 0.1467  -0.0252 -0.3665 22  LEU D CB  
2313 C CG  . LEU B 17  ? 1.5176 2.5151 1.6476 0.1142  -0.0034 -0.3723 22  LEU D CG  
2314 C CD1 . LEU B 17  ? 1.5407 2.5251 1.6568 0.1128  -0.0522 -0.3863 22  LEU D CD1 
2315 C CD2 . LEU B 17  ? 1.5073 2.4419 1.5374 0.1140  0.0306  -0.3483 22  LEU D CD2 
2316 N N   . THR B 23  ? 1.2101 1.8488 0.8942 0.0692  0.0033  -0.3579 28  THR D N   
2317 C CA  . THR B 23  ? 1.3375 1.9295 1.0115 0.0394  0.0004  -0.3731 28  THR D CA  
2318 C C   . THR B 23  ? 1.3870 1.9125 0.9769 0.0392  0.0282  -0.3575 28  THR D C   
2319 O O   . THR B 23  ? 1.4078 1.9273 0.9561 0.0599  0.0508  -0.3345 28  THR D O   
2320 C CB  . THR B 23  ? 1.3726 1.9464 1.0271 0.0501  -0.0544 -0.3959 28  THR D CB  
2321 O OG1 . THR B 23  ? 1.3035 1.8544 0.8678 0.0948  -0.0710 -0.3864 28  THR D OG1 
2322 C CG2 . THR B 23  ? 1.3751 2.0097 1.1228 0.0448  -0.0871 -0.4136 28  THR D CG2 
2323 N N   . GLN B 24  ? 1.4395 1.9128 1.0086 0.0145  0.0224  -0.3700 29  GLN D N   
2324 C CA  . GLN B 24  ? 1.4549 1.8587 0.9497 0.0096  0.0447  -0.3587 29  GLN D CA  
2325 C C   . GLN B 24  ? 1.5549 1.9132 0.9603 0.0463  0.0156  -0.3620 29  GLN D C   
2326 O O   . GLN B 24  ? 1.6100 1.9110 0.9477 0.0525  0.0282  -0.3529 29  GLN D O   
2327 C CB  . GLN B 24  ? 1.4445 1.8133 0.9669 -0.0395 0.0556  -0.3686 29  GLN D CB  
2328 C CG  . GLN B 24  ? 1.4570 1.7540 0.9141 -0.0534 0.0853  -0.3547 29  GLN D CG  
2329 C CD  . GLN B 24  ? 1.4206 1.7293 0.8781 -0.0543 0.1316  -0.3312 29  GLN D CD  
2330 O OE1 . GLN B 24  ? 1.3338 1.6993 0.8601 -0.0654 0.1528  -0.3286 29  GLN D OE1 
2331 N NE2 . GLN B 24  ? 1.3796 1.6317 0.7592 -0.0399 0.1448  -0.3149 29  GLN D NE2 
2332 N N   . ASN B 25  ? 1.3866 1.7692 0.7894 0.0733  -0.0225 -0.3746 30  ASN D N   
2333 C CA  . ASN B 25  ? 1.4364 1.7748 0.7498 0.1113  -0.0491 -0.3805 30  ASN D CA  
2334 C C   . ASN B 25  ? 1.6084 1.9596 0.8743 0.1503  -0.0268 -0.3524 30  ASN D C   
2335 O O   . ASN B 25  ? 1.4702 1.7807 0.6595 0.1799  -0.0281 -0.3479 30  ASN D O   
2336 C CB  . ASN B 25  ? 1.5098 1.8605 0.8191 0.1323  -0.0978 -0.4019 30  ASN D CB  
2337 C CG  . ASN B 25  ? 1.5518 1.8365 0.7598 0.1654  -0.1252 -0.4152 30  ASN D CG  
2338 O OD1 . ASN B 25  ? 1.6773 1.9297 0.8157 0.1907  -0.1047 -0.4014 30  ASN D OD1 
2339 N ND2 . ASN B 25  ? 1.7614 2.0337 0.9596 0.1745  -0.1726 -0.4401 30  ASN D ND2 
2340 N N   . ILE B 26  ? 0.8130 2.1861 1.0178 0.1806  -0.0737 -0.5652 31  ILE D N   
2341 C CA  . ILE B 26  ? 0.8055 2.0984 0.9538 0.2218  -0.0840 -0.4946 31  ILE D CA  
2342 C C   . ILE B 26  ? 0.5991 1.8487 0.7203 0.1791  -0.0527 -0.4447 31  ILE D C   
2343 O O   . ILE B 26  ? 0.6578 1.8218 0.7318 0.1986  -0.0540 -0.3999 31  ILE D O   
2344 C CB  . ILE B 26  ? 0.8146 2.0990 0.9352 0.2541  -0.0908 -0.4735 31  ILE D CB  
2345 C CG1 . ILE B 26  ? 0.8981 2.0640 0.9484 0.2992  -0.0931 -0.4209 31  ILE D CG1 
2346 C CG2 . ILE B 26  ? 0.8375 2.1438 0.9542 0.2022  -0.0600 -0.4601 31  ILE D CG2 
2347 C CD1 . ILE B 26  ? 1.0114 2.1349 1.0196 0.3143  -0.0855 -0.3997 31  ILE D CD1 
2348 N N   . ASP B 27  ? 0.6896 1.9710 0.8434 0.1217  -0.0114 -0.4467 32  ASP D N   
2349 C CA  . ASP B 27  ? 0.7442 1.9899 0.8907 0.0833  0.0269  -0.3950 32  ASP D CA  
2350 C C   . ASP B 27  ? 0.4976 1.7145 0.6583 0.0866  0.0209  -0.3887 32  ASP D C   
2351 O O   . ASP B 27  ? 0.4991 1.6464 0.6224 0.0689  0.0311  -0.3316 32  ASP D O   
2352 C CB  . ASP B 27  ? 0.8189 2.0937 1.0276 0.0296  0.0814  -0.3924 32  ASP D CB  
2353 C CG  . ASP B 27  ? 0.8953 2.1954 1.0921 0.0263  0.0943  -0.3983 32  ASP D CG  
2354 O OD1 . ASP B 27  ? 1.1244 2.4274 1.2739 0.0626  0.0562  -0.4068 32  ASP D OD1 
2355 O OD2 . ASP B 27  ? 0.9580 2.2648 1.1946 -0.0114 0.1484  -0.3919 32  ASP D OD2 
2356 N N   . SER B 28  ? 0.5002 1.7392 0.7015 0.1083  -0.0072 -0.4415 33  SER D N   
2357 C CA  . SER B 28  ? 0.4863 1.6958 0.7062 0.1130  -0.0161 -0.4391 33  SER D CA  
2358 C C   . SER B 28  ? 0.4920 1.5987 0.6111 0.1515  -0.0384 -0.3918 33  SER D C   
2359 O O   . SER B 28  ? 0.4913 1.5351 0.6039 0.1473  -0.0422 -0.3677 33  SER D O   
2360 C CB  . SER B 28  ? 0.5772 1.8172 0.8354 0.1387  -0.0482 -0.5133 33  SER D CB  
2361 O OG  . SER B 28  ? 0.5328 1.8296 0.8861 0.0912  -0.0227 -0.5615 33  SER D OG  
2362 N N   . TRP B 29  ? 0.5596 1.6357 0.6154 0.1842  -0.0482 -0.3754 34  TRP D N   
2363 C CA  . TRP B 29  ? 0.6138 1.5741 0.6034 0.2103  -0.0525 -0.3281 34  TRP D CA  
2364 C C   . TRP B 29  ? 0.5934 1.5193 0.5613 0.1686  -0.0332 -0.2872 34  TRP D C   
2365 O O   . TRP B 29  ? 0.5235 1.3670 0.4613 0.1807  -0.0353 -0.2624 34  TRP D O   
2366 C CB  . TRP B 29  ? 0.5376 1.4619 0.4974 0.2315  -0.0516 -0.3130 34  TRP D CB  
2367 C CG  . TRP B 29  ? 0.6747 1.4833 0.5773 0.2488  -0.0421 -0.2801 34  TRP D CG  
2368 C CD1 . TRP B 29  ? 0.6481 1.3609 0.5052 0.2965  -0.0443 -0.2727 34  TRP D CD1 
2369 C CD2 . TRP B 29  ? 0.5541 1.3335 0.4405 0.2187  -0.0239 -0.2577 34  TRP D CD2 
2370 N NE1 . TRP B 29  ? 0.7196 1.3394 0.5381 0.2906  -0.0182 -0.2500 34  TRP D NE1 
2371 C CE2 . TRP B 29  ? 0.7177 1.3879 0.5618 0.2440  -0.0098 -0.2471 34  TRP D CE2 
2372 C CE3 . TRP B 29  ? 0.6232 1.4592 0.5251 0.1769  -0.0170 -0.2483 34  TRP D CE3 
2373 C CZ2 . TRP B 29  ? 0.6316 1.2653 0.4684 0.2236  0.0112  -0.2418 34  TRP D CZ2 
2374 C CZ3 . TRP B 29  ? 0.5349 1.3382 0.4212 0.1651  -0.0079 -0.2383 34  TRP D CZ3 
2375 C CH2 . TRP B 29  ? 0.7572 1.4701 0.6206 0.1856  0.0057  -0.2424 34  TRP D CH2 
2376 N N   . PHE B 30  ? 0.4926 1.4598 0.4917 0.1207  -0.0134 -0.2666 35  PHE D N   
2377 C CA  . PHE B 30  ? 0.5180 1.4412 0.5081 0.0885  0.0000  -0.2132 35  PHE D CA  
2378 C C   . PHE B 30  ? 0.4887 1.3728 0.5122 0.0709  0.0045  -0.1955 35  PHE D C   
2379 O O   . PHE B 30  ? 0.4874 1.3066 0.4898 0.0713  0.0003  -0.1616 35  PHE D O   
2380 C CB  . PHE B 30  ? 0.5097 1.4778 0.5026 0.0588  0.0260  -0.1933 35  PHE D CB  
2381 C CG  . PHE B 30  ? 0.5331 1.5336 0.4863 0.0745  0.0210  -0.2055 35  PHE D CG  
2382 C CD1 . PHE B 30  ? 0.5233 1.4979 0.4323 0.0840  0.0100  -0.1885 35  PHE D CD1 
2383 C CD2 . PHE B 30  ? 0.5192 1.5822 0.4884 0.0798  0.0275  -0.2426 35  PHE D CD2 
2384 C CE1 . PHE B 30  ? 0.5335 1.5214 0.4306 0.0942  0.0046  -0.2012 35  PHE D CE1 
2385 C CE2 . PHE B 30  ? 0.5310 1.5971 0.4776 0.0910  0.0192  -0.2450 35  PHE D CE2 
2386 C CZ  . PHE B 30  ? 0.5381 1.5621 0.4525 0.0969  0.0094  -0.2231 35  PHE D CZ  
2387 N N   . GLU B 31  ? 0.4888 1.4168 0.5742 0.0535  0.0161  -0.2253 36  GLU D N   
2388 C CA  . GLU B 31  ? 0.6190 1.5150 0.7459 0.0348  0.0240  -0.2197 36  GLU D CA  
2389 C C   . GLU B 31  ? 0.4833 1.3228 0.5774 0.0761  -0.0095 -0.2284 36  GLU D C   
2390 O O   . GLU B 31  ? 0.5893 1.3611 0.6758 0.0679  -0.0064 -0.1938 36  GLU D O   
2391 C CB  . GLU B 31  ? 0.5296 1.4976 0.7490 0.0089  0.0447  -0.2740 36  GLU D CB  
2392 C CG  . GLU B 31  ? 0.8232 1.8110 1.0825 -0.0407 0.1044  -0.2544 36  GLU D CG  
2393 C CD  . GLU B 31  ? 0.9076 1.9405 1.1380 -0.0344 0.1122  -0.2553 36  GLU D CD  
2394 O OE1 . GLU B 31  ? 0.9122 1.9810 1.1162 0.0028  0.0721  -0.2877 36  GLU D OE1 
2395 O OE2 . GLU B 31  ? 0.9508 1.9747 1.1760 -0.0614 0.1635  -0.2213 36  GLU D OE2 
2396 C C   . MK8 B 32  ? 0.6059 1.2987 0.5652 0.1829  -0.0460 -0.2255 37  MK8 D C   
2397 N N   . MK8 B 32  ? 0.5321 1.3922 0.5978 0.1270  -0.0361 -0.2719 37  MK8 D N   
2398 O O   . MK8 B 32  ? 0.6340 1.2491 0.5769 0.1940  -0.0457 -0.2061 37  MK8 D O   
2399 C CA  . MK8 B 32  ? 0.6739 1.4681 0.6859 0.1828  -0.0580 -0.2799 37  MK8 D CA  
2400 C CB  . MK8 B 32  ? 0.7043 1.5252 0.6686 0.2473  -0.0760 -0.3231 37  MK8 D CB  
2401 C CD  . MK8 B 32  ? 0.7185 1.3439 0.5616 0.3442  -0.0763 -0.2796 37  MK8 D CD  
2402 C CE  . MK8 B 32  ? 0.7393 1.2466 0.5165 0.4020  -0.0791 -0.2601 37  MK8 D CE  
2403 C CG  . MK8 B 32  ? 0.7099 1.4371 0.6184 0.3140  -0.0909 -0.3184 37  MK8 D CG  
2404 C CB1 . MK8 B 32  ? 0.5171 1.3141 0.5687 0.1867  -0.0698 -0.3068 37  MK8 D CB1 
2405 N N   . LYS B 33  ? 0.5808 1.2780 0.5210 0.1708  -0.0350 -0.2079 38  LYS D N   
2406 C CA  . LYS B 33  ? 0.5376 1.1602 0.4498 0.1687  -0.0228 -0.1755 38  LYS D CA  
2407 C C   . LYS B 33  ? 0.4963 1.0931 0.4388 0.1295  -0.0178 -0.1336 38  LYS D C   
2408 O O   . LYS B 33  ? 0.5736 1.0967 0.5067 0.1351  -0.0111 -0.1151 38  LYS D O   
2409 C CB  . LYS B 33  ? 0.6092 1.2679 0.5105 0.1607  -0.0160 -0.1806 38  LYS D CB  
2410 C CG  . LYS B 33  ? 0.7447 1.3736 0.5991 0.2072  -0.0064 -0.2110 38  LYS D CG  
2411 C CD  . LYS B 33  ? 0.8892 1.4045 0.7157 0.2311  0.0189  -0.2041 38  LYS D CD  
2412 C CE  . LYS B 33  ? 1.1109 1.5526 0.9018 0.2653  0.0392  -0.2141 38  LYS D CE  
2413 N NZ  . LYS B 33  ? 1.2831 1.5994 1.0566 0.2764  0.0827  -0.2075 38  LYS D NZ  
2414 N N   . ALA B 34  ? 0.4845 1.1359 0.4626 0.0928  -0.0133 -0.1190 39  ALA D N   
2415 C CA  . ALA B 34  ? 0.4839 1.1071 0.4790 0.0641  -0.0025 -0.0747 39  ALA D CA  
2416 C C   . ALA B 34  ? 0.4847 1.0437 0.4918 0.0689  -0.0034 -0.0694 39  ALA D C   
2417 O O   . ALA B 34  ? 0.4941 0.9959 0.4993 0.0634  0.0006  -0.0361 39  ALA D O   
2418 C CB  . ALA B 34  ? 0.4965 1.1713 0.5149 0.0319  0.0201  -0.0587 39  ALA D CB  
2419 N N   . ASN B 35  ? 0.5010 1.0766 0.5217 0.0838  -0.0113 -0.1080 40  ASN D N   
2420 C CA  . ASN B 35  ? 0.5891 1.1105 0.6153 0.0959  -0.0160 -0.1121 40  ASN D CA  
2421 C C   . ASN B 35  ? 0.5193 0.9492 0.4876 0.1423  -0.0217 -0.1065 40  ASN D C   
2422 O O   . ASN B 35  ? 0.6264 0.9813 0.5907 0.1392  -0.0133 -0.0769 40  ASN D O   
2423 C CB  . ASN B 35  ? 0.5857 1.1697 0.6477 0.1071  -0.0286 -0.1712 40  ASN D CB  
2424 C CG  . ASN B 35  ? 0.7089 1.3626 0.8494 0.0520  -0.0033 -0.1810 40  ASN D CG  
2425 O OD1 . ASN B 35  ? 0.7093 1.3356 0.8635 0.0115  0.0277  -0.1319 40  ASN D OD1 
2426 N ND2 . ASN B 35  ? 0.6032 1.3447 0.7959 0.0549  -0.0104 -0.2477 40  ASN D ND2 
2427 C C   . MK8 B 36  ? 0.6933 0.9546 0.5686 0.2074  0.0102  -0.0921 41  MK8 D C   
2428 N N   . MK8 B 36  ? 0.5407 0.9686 0.4632 0.1866  -0.0270 -0.1339 41  MK8 D N   
2429 O O   . MK8 B 36  ? 0.7609 0.9224 0.6161 0.2259  0.0284  -0.0760 41  MK8 D O   
2430 C CA  . MK8 B 36  ? 0.6601 0.9863 0.5203 0.2357  -0.0132 -0.1299 41  MK8 D CA  
2431 C CB  . MK8 B 36  ? 0.6923 1.0303 0.5089 0.2733  -0.0071 -0.1563 41  MK8 D CB  
2432 C CD  . MK8 B 36  ? 0.7987 1.2029 0.5603 0.3468  -0.0265 -0.2135 41  MK8 D CD  
2433 C CE  . MK8 B 36  ? 0.7124 1.1152 0.4512 0.4000  -0.0544 -0.2289 41  MK8 D CE  
2434 C CG  . MK8 B 36  ? 0.6988 1.0751 0.4766 0.3328  -0.0290 -0.2007 41  MK8 D CG  
2435 C CB1 . MK8 B 36  ? 0.7418 1.0091 0.5615 0.2864  -0.0207 -0.1436 41  MK8 D CB1 
2436 N N   . GLU B 37  ? 0.7241 1.0437 0.6354 0.1679  0.0100  -0.0830 42  GLU D N   
2437 C CA  . GLU B 37  ? 0.6245 0.9105 0.5624 0.1471  0.0248  -0.0649 42  GLU D CA  
2438 C C   . GLU B 37  ? 0.5423 0.8354 0.5174 0.1134  0.0171  -0.0275 42  GLU D C   
2439 O O   . GLU B 37  ? 0.6395 0.9184 0.6436 0.1007  0.0226  -0.0161 42  GLU D O   
2440 C CB  . GLU B 37  ? 0.5633 0.9176 0.5168 0.1332  0.0227  -0.0836 42  GLU D CB  
2441 C CG  . GLU B 37  ? 0.6970 1.0384 0.6139 0.1652  0.0381  -0.1192 42  GLU D CG  
2442 C CD  . GLU B 37  ? 0.7675 1.1752 0.7053 0.1486  0.0379  -0.1432 42  GLU D CD  
2443 O OE1 . GLU B 37  ? 0.7816 1.2348 0.7612 0.1209  0.0261  -0.1385 42  GLU D OE1 
2444 O OE2 . GLU B 37  ? 0.8254 1.2425 0.7340 0.1693  0.0480  -0.1698 42  GLU D OE2 
2445 N N   . ASN B 38  ? 0.5707 0.8880 0.5507 0.1012  0.0081  -0.0148 43  ASN D N   
2446 C CA  . ASN B 38  ? 0.7510 1.0621 0.7580 0.0727  0.0115  0.0240  43  ASN D CA  
2447 C C   . ASN B 38  ? 0.8451 1.2126 0.8636 0.0542  0.0093  0.0475  43  ASN D C   
2448 O O   . ASN B 38  ? 0.7646 1.1117 0.7959 0.0531  0.0091  0.0692  43  ASN D O   
2449 C CB  . ASN B 38  ? 0.7943 1.0098 0.8028 0.0819  0.0219  0.0419  43  ASN D CB  
2450 C CG  . ASN B 38  ? 0.7444 0.9436 0.7752 0.0574  0.0284  0.0817  43  ASN D CG  
2451 O OD1 . ASN B 38  ? 0.8471 1.0794 0.8887 0.0381  0.0331  0.0871  43  ASN D OD1 
2452 N ND2 . ASN B 38  ? 0.6438 0.7901 0.6882 0.0571  0.0356  0.1061  43  ASN D ND2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   121 ?   ?   ?   A . n 
A 1 2   GLU 2   122 ?   ?   ?   A . n 
A 1 3   SER 3   123 ?   ?   ?   A . n 
A 1 4   LYS 4   124 ?   ?   ?   A . n 
A 1 5   LYS 5   125 ?   ?   ?   A . n 
A 1 6   ARG 6   126 126 ARG ARG A . n 
A 1 7   GLN 7   127 127 GLN GLN A . n 
A 1 8   TRP 8   128 128 TRP TRP A . n 
A 1 9   ALA 9   129 129 ALA ALA A . n 
A 1 10  LEU 10  130 130 LEU LEU A . n 
A 1 11  GLU 11  131 131 GLU GLU A . n 
A 1 12  ASP 12  132 132 ASP ASP A . n 
A 1 13  PHE 13  133 133 PHE PHE A . n 
A 1 14  GLU 14  134 134 GLU GLU A . n 
A 1 15  ILE 15  135 135 ILE ILE A . n 
A 1 16  GLY 16  136 136 GLY GLY A . n 
A 1 17  ARG 17  137 137 ARG ARG A . n 
A 1 18  PRO 18  138 138 PRO PRO A . n 
A 1 19  LEU 19  139 139 LEU LEU A . n 
A 1 20  GLY 20  140 140 GLY GLY A . n 
A 1 21  LYS 21  141 141 LYS LYS A . n 
A 1 22  GLY 22  142 142 GLY GLY A . n 
A 1 23  LYS 23  143 143 LYS LYS A . n 
A 1 24  PHE 24  144 144 PHE PHE A . n 
A 1 25  GLY 25  145 145 GLY GLY A . n 
A 1 26  ASN 26  146 146 ASN ASN A . n 
A 1 27  VAL 27  147 147 VAL VAL A . n 
A 1 28  TYR 28  148 148 TYR TYR A . n 
A 1 29  LEU 29  149 149 LEU LEU A . n 
A 1 30  ALA 30  150 150 ALA ALA A . n 
A 1 31  ARG 31  151 151 ARG ARG A . n 
A 1 32  GLU 32  152 152 GLU GLU A . n 
A 1 33  LYS 33  153 153 LYS LYS A . n 
A 1 34  GLN 34  154 154 GLN GLN A . n 
A 1 35  SER 35  155 155 SER SER A . n 
A 1 36  LYS 36  156 156 LYS LYS A . n 
A 1 37  PHE 37  157 157 PHE PHE A . n 
A 1 38  ILE 38  158 158 ILE ILE A . n 
A 1 39  LEU 39  159 159 LEU LEU A . n 
A 1 40  ALA 40  160 160 ALA ALA A . n 
A 1 41  LEU 41  161 161 LEU LEU A . n 
A 1 42  LYS 42  162 162 LYS LYS A . n 
A 1 43  VAL 43  163 163 VAL VAL A . n 
A 1 44  LEU 44  164 164 LEU LEU A . n 
A 1 45  PHE 45  165 165 PHE PHE A . n 
A 1 46  LYS 46  166 166 LYS LYS A . n 
A 1 47  ALA 47  167 167 ALA ALA A . n 
A 1 48  GLN 48  168 168 GLN GLN A . n 
A 1 49  LEU 49  169 169 LEU LEU A . n 
A 1 50  GLU 50  170 170 GLU GLU A . n 
A 1 51  LYS 51  171 171 LYS LYS A . n 
A 1 52  ALA 52  172 172 ALA ALA A . n 
A 1 53  GLY 53  173 173 GLY GLY A . n 
A 1 54  VAL 54  174 174 VAL VAL A . n 
A 1 55  GLU 55  175 175 GLU GLU A . n 
A 1 56  HIS 56  176 176 HIS HIS A . n 
A 1 57  GLN 57  177 177 GLN GLN A . n 
A 1 58  LEU 58  178 178 LEU LEU A . n 
A 1 59  ARG 59  179 179 ARG ARG A . n 
A 1 60  ARG 60  180 180 ARG ARG A . n 
A 1 61  GLU 61  181 181 GLU GLU A . n 
A 1 62  VAL 62  182 182 VAL VAL A . n 
A 1 63  GLU 63  183 183 GLU GLU A . n 
A 1 64  ILE 64  184 184 ILE ILE A . n 
A 1 65  GLN 65  185 185 GLN GLN A . n 
A 1 66  SER 66  186 186 SER SER A . n 
A 1 67  HIS 67  187 187 HIS HIS A . n 
A 1 68  LEU 68  188 188 LEU LEU A . n 
A 1 69  ARG 69  189 189 ARG ARG A . n 
A 1 70  HIS 70  190 190 HIS HIS A . n 
A 1 71  PRO 71  191 191 PRO PRO A . n 
A 1 72  ASN 72  192 192 ASN ASN A . n 
A 1 73  ILE 73  193 193 ILE ILE A . n 
A 1 74  LEU 74  194 194 LEU LEU A . n 
A 1 75  ARG 75  195 195 ARG ARG A . n 
A 1 76  LEU 76  196 196 LEU LEU A . n 
A 1 77  TYR 77  197 197 TYR TYR A . n 
A 1 78  GLY 78  198 198 GLY GLY A . n 
A 1 79  TYR 79  199 199 TYR TYR A . n 
A 1 80  PHE 80  200 200 PHE PHE A . n 
A 1 81  HIS 81  201 201 HIS HIS A . n 
A 1 82  ASP 82  202 202 ASP ASP A . n 
A 1 83  ALA 83  203 203 ALA ALA A . n 
A 1 84  THR 84  204 204 THR THR A . n 
A 1 85  ARG 85  205 205 ARG ARG A . n 
A 1 86  VAL 86  206 206 VAL VAL A . n 
A 1 87  TYR 87  207 207 TYR TYR A . n 
A 1 88  LEU 88  208 208 LEU LEU A . n 
A 1 89  ILE 89  209 209 ILE ILE A . n 
A 1 90  LEU 90  210 210 LEU LEU A . n 
A 1 91  GLU 91  211 211 GLU GLU A . n 
A 1 92  TYR 92  212 212 TYR TYR A . n 
A 1 93  ALA 93  213 213 ALA ALA A . n 
A 1 94  PRO 94  214 214 PRO PRO A . n 
A 1 95  LEU 95  215 215 LEU LEU A . n 
A 1 96  GLY 96  216 216 GLY GLY A . n 
A 1 97  THR 97  217 217 THR THR A . n 
A 1 98  VAL 98  218 218 VAL VAL A . n 
A 1 99  TYR 99  219 219 TYR TYR A . n 
A 1 100 ARG 100 220 220 ARG ARG A . n 
A 1 101 GLU 101 221 221 GLU GLU A . n 
A 1 102 LEU 102 222 222 LEU LEU A . n 
A 1 103 GLN 103 223 223 GLN GLN A . n 
A 1 104 LYS 104 224 224 LYS LYS A . n 
A 1 105 LEU 105 225 225 LEU LEU A . n 
A 1 106 SER 106 226 226 SER SER A . n 
A 1 107 LYS 107 227 227 LYS LYS A . n 
A 1 108 PHE 108 228 228 PHE PHE A . n 
A 1 109 ASP 109 229 229 ASP ASP A . n 
A 1 110 GLU 110 230 230 GLU GLU A . n 
A 1 111 GLN 111 231 231 GLN GLN A . n 
A 1 112 ARG 112 232 232 ARG ARG A . n 
A 1 113 THR 113 233 233 THR THR A . n 
A 1 114 ALA 114 234 234 ALA ALA A . n 
A 1 115 THR 115 235 235 THR THR A . n 
A 1 116 TYR 116 236 236 TYR TYR A . n 
A 1 117 ILE 117 237 237 ILE ILE A . n 
A 1 118 THR 118 238 238 THR THR A . n 
A 1 119 GLU 119 239 239 GLU GLU A . n 
A 1 120 LEU 120 240 240 LEU LEU A . n 
A 1 121 ALA 121 241 241 ALA ALA A . n 
A 1 122 ASN 122 242 242 ASN ASN A . n 
A 1 123 ALA 123 243 243 ALA ALA A . n 
A 1 124 LEU 124 244 244 LEU LEU A . n 
A 1 125 SER 125 245 245 SER SER A . n 
A 1 126 TYR 126 246 246 TYR TYR A . n 
A 1 127 CYS 127 247 247 CYS CYS A . n 
A 1 128 HIS 128 248 248 HIS HIS A . n 
A 1 129 SER 129 249 249 SER SER A . n 
A 1 130 LYS 130 250 250 LYS LYS A . n 
A 1 131 ARG 131 251 251 ARG ARG A . n 
A 1 132 VAL 132 252 252 VAL VAL A . n 
A 1 133 ILE 133 253 253 ILE ILE A . n 
A 1 134 HIS 134 254 254 HIS HIS A . n 
A 1 135 ARG 135 255 255 ARG ARG A . n 
A 1 136 ASP 136 256 256 ASP ASP A . n 
A 1 137 ILE 137 257 257 ILE ILE A . n 
A 1 138 LYS 138 258 258 LYS LYS A . n 
A 1 139 PRO 139 259 259 PRO PRO A . n 
A 1 140 GLU 140 260 260 GLU GLU A . n 
A 1 141 ASN 141 261 261 ASN ASN A . n 
A 1 142 LEU 142 262 262 LEU LEU A . n 
A 1 143 LEU 143 263 263 LEU LEU A . n 
A 1 144 LEU 144 264 264 LEU LEU A . n 
A 1 145 GLY 145 265 265 GLY GLY A . n 
A 1 146 SER 146 266 266 SER SER A . n 
A 1 147 ALA 147 267 267 ALA ALA A . n 
A 1 148 GLY 148 268 268 GLY GLY A . n 
A 1 149 GLU 149 269 269 GLU GLU A . n 
A 1 150 LEU 150 270 270 LEU LEU A . n 
A 1 151 LYS 151 271 271 LYS LYS A . n 
A 1 152 ILE 152 272 272 ILE ILE A . n 
A 1 153 ALA 153 273 273 ALA ALA A . n 
A 1 154 ASP 154 274 274 ASP ASP A . n 
A 1 155 PHE 155 275 275 PHE PHE A . n 
A 1 156 GLY 156 276 276 GLY GLY A . n 
A 1 157 TRP 157 277 277 TRP TRP A . n 
A 1 158 SER 158 278 278 SER SER A . n 
A 1 159 VAL 159 279 279 VAL VAL A . n 
A 1 160 HIS 160 280 280 HIS HIS A . n 
A 1 161 ALA 161 281 281 ALA ALA A . n 
A 1 162 PRO 162 282 282 PRO PRO A . n 
A 1 163 SER 163 283 283 SER SER A . n 
A 1 164 SER 164 284 284 SER SER A . n 
A 1 165 ARG 165 285 285 ARG ARG A . n 
A 1 166 ARG 166 286 286 ARG ARG A . n 
A 1 167 THR 167 287 287 THR THR A . n 
A 1 168 TPO 168 288 288 TPO TPO A . n 
A 1 169 LEU 169 289 289 LEU LEU A . n 
A 1 170 ALA 170 290 290 ALA ALA A . n 
A 1 171 GLY 171 291 291 GLY GLY A . n 
A 1 172 THR 172 292 292 THR THR A . n 
A 1 173 LEU 173 293 293 LEU LEU A . n 
A 1 174 ASP 174 294 294 ASP ASP A . n 
A 1 175 TYR 175 295 295 TYR TYR A . n 
A 1 176 LEU 176 296 296 LEU LEU A . n 
A 1 177 PRO 177 297 297 PRO PRO A . n 
A 1 178 PRO 178 298 298 PRO PRO A . n 
A 1 179 GLU 179 299 299 GLU GLU A . n 
A 1 180 MET 180 300 300 MET MET A . n 
A 1 181 ILE 181 301 301 ILE ILE A . n 
A 1 182 GLU 182 302 302 GLU GLU A . n 
A 1 183 GLY 183 303 303 GLY GLY A . n 
A 1 184 ARG 184 304 304 ARG ARG A . n 
A 1 185 MET 185 305 305 MET MET A . n 
A 1 186 HIS 186 306 306 HIS HIS A . n 
A 1 187 ASP 187 307 307 ASP ASP A . n 
A 1 188 GLU 188 308 308 GLU GLU A . n 
A 1 189 LYS 189 309 309 LYS LYS A . n 
A 1 190 VAL 190 310 310 VAL VAL A . n 
A 1 191 ASP 191 311 311 ASP ASP A . n 
A 1 192 LEU 192 312 312 LEU LEU A . n 
A 1 193 TRP 193 313 313 TRP TRP A . n 
A 1 194 SER 194 314 314 SER SER A . n 
A 1 195 LEU 195 315 315 LEU LEU A . n 
A 1 196 GLY 196 316 316 GLY GLY A . n 
A 1 197 VAL 197 317 317 VAL VAL A . n 
A 1 198 LEU 198 318 318 LEU LEU A . n 
A 1 199 CYS 199 319 319 CYS CYS A . n 
A 1 200 TYR 200 320 320 TYR TYR A . n 
A 1 201 GLU 201 321 321 GLU GLU A . n 
A 1 202 PHE 202 322 322 PHE PHE A . n 
A 1 203 LEU 203 323 323 LEU LEU A . n 
A 1 204 VAL 204 324 324 VAL VAL A . n 
A 1 205 GLY 205 325 325 GLY GLY A . n 
A 1 206 LYS 206 326 326 LYS LYS A . n 
A 1 207 PRO 207 327 327 PRO PRO A . n 
A 1 208 PRO 208 328 328 PRO PRO A . n 
A 1 209 PHE 209 329 329 PHE PHE A . n 
A 1 210 GLU 210 330 330 GLU GLU A . n 
A 1 211 ALA 211 331 331 ALA ALA A . n 
A 1 212 ASN 212 332 332 ASN ASN A . n 
A 1 213 THR 213 333 333 THR THR A . n 
A 1 214 TYR 214 334 334 TYR TYR A . n 
A 1 215 GLN 215 335 335 GLN GLN A . n 
A 1 216 GLU 216 336 336 GLU GLU A . n 
A 1 217 THR 217 337 337 THR THR A . n 
A 1 218 TYR 218 338 338 TYR TYR A . n 
A 1 219 LYS 219 339 339 LYS LYS A . n 
A 1 220 ARG 220 340 340 ARG ARG A . n 
A 1 221 ILE 221 341 341 ILE ILE A . n 
A 1 222 SER 222 342 342 SER SER A . n 
A 1 223 ARG 223 343 343 ARG ARG A . n 
A 1 224 VAL 224 344 344 VAL VAL A . n 
A 1 225 GLU 225 345 345 GLU GLU A . n 
A 1 226 PHE 226 346 346 PHE PHE A . n 
A 1 227 THR 227 347 347 THR THR A . n 
A 1 228 PHE 228 348 348 PHE PHE A . n 
A 1 229 PRO 229 349 349 PRO PRO A . n 
A 1 230 ASP 230 350 350 ASP ASP A . n 
A 1 231 PHE 231 351 351 PHE PHE A . n 
A 1 232 VAL 232 352 352 VAL VAL A . n 
A 1 233 THR 233 353 353 THR THR A . n 
A 1 234 GLU 234 354 354 GLU GLU A . n 
A 1 235 GLY 235 355 355 GLY GLY A . n 
A 1 236 ALA 236 356 356 ALA ALA A . n 
A 1 237 ARG 237 357 357 ARG ARG A . n 
A 1 238 ASP 238 358 358 ASP ASP A . n 
A 1 239 LEU 239 359 359 LEU LEU A . n 
A 1 240 ILE 240 360 360 ILE ILE A . n 
A 1 241 SER 241 361 361 SER SER A . n 
A 1 242 ARG 242 362 362 ARG ARG A . n 
A 1 243 LEU 243 363 363 LEU LEU A . n 
A 1 244 LEU 244 364 364 LEU LEU A . n 
A 1 245 LYS 245 365 365 LYS LYS A . n 
A 1 246 HIS 246 366 366 HIS HIS A . n 
A 1 247 ASN 247 367 367 ASN ASN A . n 
A 1 248 PRO 248 368 368 PRO PRO A . n 
A 1 249 SER 249 369 369 SER SER A . n 
A 1 250 GLN 250 370 370 GLN GLN A . n 
A 1 251 ARG 251 371 371 ARG ARG A . n 
A 1 252 PRO 252 372 372 PRO PRO A . n 
A 1 253 MET 253 373 373 MET MET A . n 
A 1 254 LEU 254 374 374 LEU LEU A . n 
A 1 255 ARG 255 375 375 ARG ARG A . n 
A 1 256 GLU 256 376 376 GLU GLU A . n 
A 1 257 VAL 257 377 377 VAL VAL A . n 
A 1 258 LEU 258 378 378 LEU LEU A . n 
A 1 259 GLU 259 379 379 GLU GLU A . n 
A 1 260 HIS 260 380 380 HIS HIS A . n 
A 1 261 PRO 261 381 381 PRO PRO A . n 
A 1 262 TRP 262 382 382 TRP TRP A . n 
A 1 263 ILE 263 383 383 ILE ILE A . n 
A 1 264 THR 264 384 384 THR THR A . n 
A 1 265 ALA 265 385 385 ALA ALA A . n 
A 1 266 ASN 266 386 386 ASN ASN A . n 
A 1 267 SER 267 387 387 SER SER A . n 
A 1 268 SER 268 388 388 SER SER A . n 
A 1 269 LYS 269 389 389 LYS LYS A . n 
A 1 270 PRO 270 390 390 PRO PRO A . n 
A 1 271 SER 271 391 391 SER SER A . n 
A 1 272 ASN 272 392 392 ASN ASN A . n 
A 1 273 ALA 273 393 ?   ?   ?   A . n 
A 1 274 GLN 274 394 ?   ?   ?   A . n 
A 1 275 ASN 275 395 ?   ?   ?   A . n 
A 1 276 LYS 276 396 ?   ?   ?   A . n 
A 1 277 GLU 277 397 ?   ?   ?   A . n 
A 1 278 SER 278 398 ?   ?   ?   A . n 
A 1 279 ALA 279 399 ?   ?   ?   A . n 
A 1 280 SER 280 400 ?   ?   ?   A . n 
A 1 281 LYS 281 401 ?   ?   ?   A . n 
A 1 282 GLN 282 402 ?   ?   ?   A . n 
A 1 283 SER 283 403 ?   ?   ?   A . n 
B 2 1   SER 1   6   6   SER SER D . n 
B 2 2   SER 2   7   7   SER SER D . n 
B 2 3   TYR 3   8   8   TYR TYR D . n 
B 2 4   SER 4   9   9   SER SER D . n 
B 2 5   TYR 5   10  10  TYR TYR D . n 
B 2 6   ASP 6   11  11  ASP ASP D . n 
B 2 7   ALA 7   12  12  ALA ALA D . n 
B 2 8   PRO 8   13  13  PRO PRO D . n 
B 2 9   SER 9   14  14  SER SER D . n 
B 2 10  ASP 10  15  15  ASP ASP D . n 
B 2 11  PHE 11  16  16  PHE PHE D . n 
B 2 12  ILE 12  17  17  ILE ILE D . n 
B 2 13  ASN 13  18  18  ASN ASN D . n 
B 2 14  PHE 14  19  19  PHE PHE D . n 
B 2 15  SER 15  20  20  SER SER D . n 
B 2 16  SER 16  21  21  SER SER D . n 
B 2 17  LEU 17  22  22  LEU LEU D . n 
B 2 18  ASP 18  23  ?   ?   ?   D . n 
B 2 19  ASP 19  24  ?   ?   ?   D . n 
B 2 20  GLU 20  25  ?   ?   ?   D . n 
B 2 21  GLY 21  26  ?   ?   ?   D . n 
B 2 22  ASP 22  27  ?   ?   ?   D . n 
B 2 23  THR 23  28  28  THR THR D . n 
B 2 24  GLN 24  29  29  GLN GLN D . n 
B 2 25  ASN 25  30  30  ASN ASN D . n 
B 2 26  ILE 26  31  31  ILE ILE D . n 
B 2 27  ASP 27  32  32  ASP ASP D . n 
B 2 28  SER 28  33  33  SER SER D . n 
B 2 29  TRP 29  34  34  TRP TRP D . n 
B 2 30  PHE 30  35  35  PHE PHE D . n 
B 2 31  GLU 31  36  36  GLU GLU D . n 
B 2 32  MK8 32  37  37  MK8 MK8 D . n 
B 2 33  LYS 33  38  38  LYS LYS D . n 
B 2 34  ALA 34  39  39  ALA ALA D . n 
B 2 35  ASN 35  40  40  ASN ASN D . n 
B 2 36  MK8 36  41  41  MK8 MK8 D . n 
B 2 37  GLU 37  42  42  GLU GLU D . n 
B 2 38  ASN 38  43  43  ASN ASN D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 3  ADP 1  501 1   ADP ADP A . 
D 4  PG4 1  502 1   PG4 P6G A . 
E 5  SO4 1  503 1   SO4 SO4 A . 
F 6  PEG 1  504 1   PEG PEG A . 
G 6  PEG 1  505 2   PEG PEG A . 
H 7  MES 1  506 1   MES MES A . 
I 8  P4G 1  507 1   P4G P4G A . 
J 9  CL  1  508 1   CL  CL  A . 
K 10 MG  1  509 3   MG  MG  A . 
L 10 MG  1  510 4   MG  MG  A . 
M 11 NH3 1  101 44  NH3 ALA D . 
N 12 HOH 1  601 33  HOH HOH A . 
N 12 HOH 2  602 35  HOH HOH A . 
N 12 HOH 3  603 108 HOH HOH A . 
N 12 HOH 4  604 37  HOH HOH A . 
N 12 HOH 5  605 23  HOH HOH A . 
N 12 HOH 6  606 6   HOH HOH A . 
N 12 HOH 7  607 115 HOH HOH A . 
N 12 HOH 8  608 49  HOH HOH A . 
N 12 HOH 9  609 14  HOH HOH A . 
N 12 HOH 10 610 189 HOH HOH A . 
N 12 HOH 11 611 128 HOH HOH A . 
N 12 HOH 12 612 172 HOH HOH A . 
N 12 HOH 13 613 105 HOH HOH A . 
N 12 HOH 14 614 11  HOH HOH A . 
N 12 HOH 15 615 113 HOH HOH A . 
N 12 HOH 16 616 114 HOH HOH A . 
N 12 HOH 17 617 18  HOH HOH A . 
N 12 HOH 18 618 153 HOH HOH A . 
N 12 HOH 19 619 3   HOH HOH A . 
N 12 HOH 20 620 17  HOH HOH A . 
N 12 HOH 21 621 147 HOH HOH A . 
N 12 HOH 22 622 24  HOH HOH A . 
N 12 HOH 23 623 4   HOH HOH A . 
N 12 HOH 24 624 203 HOH HOH A . 
N 12 HOH 25 625 39  HOH HOH A . 
N 12 HOH 26 626 188 HOH HOH A . 
N 12 HOH 27 627 127 HOH HOH A . 
N 12 HOH 28 628 22  HOH HOH A . 
N 12 HOH 29 629 111 HOH HOH A . 
N 12 HOH 30 630 34  HOH HOH A . 
N 12 HOH 31 631 205 HOH HOH A . 
N 12 HOH 32 632 80  HOH HOH A . 
N 12 HOH 33 633 16  HOH HOH A . 
N 12 HOH 34 634 15  HOH HOH A . 
N 12 HOH 35 635 7   HOH HOH A . 
N 12 HOH 36 636 50  HOH HOH A . 
N 12 HOH 37 637 10  HOH HOH A . 
N 12 HOH 38 638 13  HOH HOH A . 
N 12 HOH 39 639 136 HOH HOH A . 
N 12 HOH 40 640 110 HOH HOH A . 
N 12 HOH 41 641 19  HOH HOH A . 
N 12 HOH 42 642 32  HOH HOH A . 
N 12 HOH 43 643 200 HOH HOH A . 
N 12 HOH 44 644 20  HOH HOH A . 
N 12 HOH 45 645 5   HOH HOH A . 
N 12 HOH 46 646 204 HOH HOH A . 
N 12 HOH 47 647 36  HOH HOH A . 
N 12 HOH 48 648 132 HOH HOH A . 
N 12 HOH 49 649 143 HOH HOH A . 
N 12 HOH 50 650 25  HOH HOH A . 
N 12 HOH 51 651 202 HOH HOH A . 
N 12 HOH 52 652 116 HOH HOH A . 
N 12 HOH 53 653 38  HOH HOH A . 
N 12 HOH 54 654 201 HOH HOH A . 
N 12 HOH 55 655 8   HOH HOH A . 
N 12 HOH 56 656 74  HOH HOH A . 
N 12 HOH 57 657 45  HOH HOH A . 
N 12 HOH 58 658 101 HOH HOH A . 
N 12 HOH 59 659 126 HOH HOH A . 
N 12 HOH 60 660 181 HOH HOH A . 
N 12 HOH 61 661 117 HOH HOH A . 
N 12 HOH 62 662 99  HOH HOH A . 
N 12 HOH 63 663 184 HOH HOH A . 
N 12 HOH 64 664 106 HOH HOH A . 
N 12 HOH 65 665 121 HOH HOH A . 
N 12 HOH 66 666 86  HOH HOH A . 
N 12 HOH 67 667 66  HOH HOH A . 
N 12 HOH 68 668 195 HOH HOH A . 
N 12 HOH 69 669 76  HOH HOH A . 
N 12 HOH 70 670 100 HOH HOH A . 
O 12 HOH 1  201 196 HOH HOH D . 
O 12 HOH 2  202 62  HOH HOH D . 
O 12 HOH 3  203 61  HOH HOH D . 
O 12 HOH 4  204 144 HOH HOH D . 
O 12 HOH 5  205 63  HOH HOH D . 
O 12 HOH 6  206 134 HOH HOH D . 
O 12 HOH 7  207 197 HOH HOH D . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 168 A TPO 288 ? THR 'modified residue' 
2 B MK8 32  D MK8 37  ? GLU 'modified residue' 
3 B MK8 36  D MK8 41  ? LEU 'modified residue' 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N,O 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6020  ? 
1 MORE         -39   ? 
1 'SSA (A^2)'  13510 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1 ? A ASN 141 ? A ASN 261 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 OD2 ? A ASP 154 ? A ASP 274 ? 1_555 75.1  ? 
2  OD1 ? A ASN 141 ? A ASN 261 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O3B ? C ADP .   ? A ADP 501 ? 1_555 164.4 ? 
3  OD2 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O3B ? C ADP .   ? A ADP 501 ? 1_555 90.0  ? 
4  OD1 ? A ASN 141 ? A ASN 261 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O2A ? C ADP .   ? A ADP 501 ? 1_555 87.5  ? 
5  OD2 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O2A ? C ADP .   ? A ADP 501 ? 1_555 82.0  ? 
6  O3B ? C ADP .   ? A ADP 501 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O2A ? C ADP .   ? A ADP 501 ? 1_555 85.9  ? 
7  OD1 ? A ASN 141 ? A ASN 261 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 654 ? 1_555 79.9  ? 
8  OD2 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 654 ? 1_555 154.1 ? 
9  O3B ? C ADP .   ? A ADP 501 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 654 ? 1_555 114.3 ? 
10 O2A ? C ADP .   ? A ADP 501 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 654 ? 1_555 90.6  ? 
11 OD1 ? A ASN 141 ? A ASN 261 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 651 ? 1_555 93.7  ? 
12 OD2 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 651 ? 1_555 83.5  ? 
13 O3B ? C ADP .   ? A ADP 501 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 651 ? 1_555 89.0  ? 
14 O2A ? C ADP .   ? A ADP 501 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 651 ? 1_555 164.6 ? 
15 O   ? N HOH .   ? A HOH 654 ? 1_555 MG ? K MG . ? A MG 509 ? 1_555 O   ? N HOH .   ? A HOH 651 ? 1_555 104.7 ? 
16 OD1 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O1B ? C ADP .   ? A ADP 501 ? 1_555 70.7  ? 
17 OD1 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O4  ? G PEG .   ? A PEG 505 ? 1_555 134.9 ? 
18 O1B ? C ADP .   ? A ADP 501 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O4  ? G PEG .   ? A PEG 505 ? 1_555 74.6  ? 
19 OD1 ? A ASP 154 ? A ASP 274 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O   ? N HOH .   ? A HOH 631 ? 1_555 73.1  ? 
20 O1B ? C ADP .   ? A ADP 501 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O   ? N HOH .   ? A HOH 631 ? 1_555 127.7 ? 
21 O4  ? G PEG .   ? A PEG 505 ? 1_555 MG ? L MG . ? A MG 510 ? 1_555 O   ? N HOH .   ? A HOH 631 ? 1_555 151.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2016-11-02 
2 'Structure model' 1 1 2016-12-28 
3 'Structure model' 1 2 2017-09-13 
4 'Structure model' 1 3 2019-10-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'        
2 3 'Structure model' Advisory                     
3 3 'Structure model' 'Author supporting evidence' 
4 4 'Structure model' 'Data collection'            
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 3 'Structure model' pdbx_audit_support           
2 3 'Structure model' pdbx_unobs_or_zero_occ_atoms 
3 4 'Structure model' reflns_shell                 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1  ? refined 44.3288 -0.4605  4.9321  1.2402 1.0177 0.4606 0.4579  0.0547  0.0368  2.5061 1.4398 9.2684 1.6527 
0.9430  0.1678  0.6606  -0.4275 -0.1914 1.4377  0.1701  0.0909  -1.0330 -1.5824 0.2503  
'X-RAY DIFFRACTION' 2  ? refined 45.4526 -1.9274  6.1031  0.9790 0.6515 0.3662 0.2053  0.1308  0.0424  7.4140 4.6060 7.2480 
-2.2399 2.4045  -0.1056 0.1488  -0.1934 0.1519  0.7824  0.3781  0.0927  -0.3136 -1.6278 -0.7413 
'X-RAY DIFFRACTION' 3  ? refined 47.7404 -14.5040 2.2049  0.6390 0.8040 0.3466 0.1894  0.0527  0.0083  4.0051 4.8779 5.6751 
-1.0571 -3.6942 -0.5861 0.4328  -0.5265 0.0919  0.8040  0.0535  -0.2232 -0.7920 -0.8537 -0.4889 
'X-RAY DIFFRACTION' 4  ? refined 44.2690 -9.7729  17.1404 0.7123 0.6470 0.3808 0.1113  0.0485  -0.0577 3.0054 4.1290 8.0559 
-1.9471 -2.7790 -2.1541 0.0769  -0.0872 0.0029  0.0012  0.1690  0.1588  0.6573  -0.8531 0.1678  
'X-RAY DIFFRACTION' 5  ? refined 41.1669 -26.6159 16.4901 0.3625 0.4838 0.5146 0.0189  0.0728  -0.1451 6.9728 4.6476 8.8121 0.1430 
1.3372  -3.2212 -0.0385 -0.1145 0.1226  0.8399  -0.8983 0.5168  0.3546  0.0636  -1.4266 
'X-RAY DIFFRACTION' 6  ? refined 46.3099 -19.1357 14.3136 0.5541 0.5171 0.3559 0.0565  0.0611  -0.0425 7.3088 5.9213 8.2372 
-6.5604 -6.3273 6.5726  -0.2356 0.1933  -0.0530 0.0219  -0.0580 -0.0384 0.4981  0.0304  0.0752  
'X-RAY DIFFRACTION' 7  ? refined 54.8994 -23.3001 6.6908  0.3944 0.8374 0.3070 0.0421  -0.0440 -0.1225 5.7880 3.4650 5.0774 
-3.2392 -2.4357 -0.2685 0.3587  -0.4680 0.1401  1.1181  -0.1583 -0.0572 -0.0895 -0.3247 0.3108  
'X-RAY DIFFRACTION' 8  ? refined 56.3319 -26.8770 18.7879 0.5148 0.5528 0.3585 0.0388  0.0385  -0.0334 7.0177 3.7890 2.8578 
-1.5462 -1.3636 -1.6163 -0.4241 -0.0489 0.4253  0.0854  -0.3772 0.0865  0.4294  -0.2026 0.0712  
'X-RAY DIFFRACTION' 9  ? refined 63.8247 -22.7575 27.3874 0.8344 0.6983 0.4445 0.0766  -0.1420 -0.0097 9.6347 8.2205 3.3593 
-4.3188 -3.1339 0.5506  -0.4598 0.2501  0.2256  -0.3734 1.0283  -1.0344 1.3912  -0.1340 0.8045  
'X-RAY DIFFRACTION' 10 ? refined 51.1755 -32.4961 31.0889 0.9624 0.6216 0.4940 0.2751  0.1735  0.0748  8.0290 4.1471 6.3059 2.8623 
-3.6624 -3.1142 -0.5826 0.2523  0.2915  -1.2020 -0.4722 0.2063  1.0263  0.1075  0.1610  
'X-RAY DIFFRACTION' 11 ? refined 44.8878 -34.8757 19.7330 0.6314 0.4023 0.6239 -0.0737 0.2150  -0.1316 3.2405 4.1690 9.1654 
-2.2350 -3.8145 0.3629  -0.3765 0.0093  0.4601  0.9076  -1.5239 0.8896  0.7212  0.8306  -0.9730 
'X-RAY DIFFRACTION' 12 ? refined 55.0643 -8.9193  -5.8914 1.0472 1.1517 0.6666 -0.0178 0.3465  -0.0054 2.8199 6.2261 6.5969 
-1.4471 -2.1307 -4.0982 0.8717  0.3918  -1.4791 2.7928  -0.4633 -2.2087 -3.2333 -2.8133 0.1009  
'X-RAY DIFFRACTION' 13 ? refined 36.1666 -11.3314 -3.6083 0.9483 1.7635 0.6268 0.2431  -0.0275 -0.2136 2.2457 6.6810 3.2309 
-1.3224 2.3754  -0.7533 0.0521  -0.6806 0.5041  0.6747  -0.0416 1.3814  -0.4256 0.5661  -0.6815 
'X-RAY DIFFRACTION' 14 ? refined 48.0302 -26.0654 -6.7796 0.4946 1.2702 0.4645 0.1410  -0.0294 -0.2137 6.5902 8.9596 6.8846 
-6.5617 -6.8137 6.0179  0.4102  -1.0850 0.6534  -0.6725 -0.7575 0.5542  -0.2491 -0.2808 -1.6172 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1  A 126 A 145 
;chain 'A' and (resid 126 through 145 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 146 A 171 
;chain 'A' and (resid 146 through 171 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 172 A 201 
;chain 'A' and (resid 172 through 201 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 202 A 229 
;chain 'A' and (resid 202 through 229 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 230 A 250 
;chain 'A' and (resid 230 through 250 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 251 A 269 
;chain 'A' and (resid 251 through 269 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  A 270 A 292 
;chain 'A' and (resid 270 through 292 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  A 293 A 324 
;chain 'A' and (resid 293 through 324 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  A 325 A 343 
;chain 'A' and (resid 325 through 343 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 A 344 A 363 
;chain 'A' and (resid 344 through 363 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 A 364 A 392 
;chain 'A' and (resid 364 through 392 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 D 6   D 10  
;chain 'D' and (resid 6 through 10 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 13 13 D 11  D 30  
;chain 'D' and (resid 11 through 30 )
;
? ? ? ? ? 
'X-RAY DIFFRACTION' 14 14 D 31  D 43  
;chain 'D' and (resid 31 through 43 )
;
? ? ? ? ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .    1 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.20 2 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? xia2        ? ? ? .    3 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? xia2        ? ? ? .    4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OD1 D ASN 30  ? ? OG  D SER 33  ? ? 2.14 
2 1 OH  A TYR 295 ? ? OE1 A GLU 321 ? ? 2.17 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 202 ? ? -146.31 35.77   
2  1 THR A 204 ? ? -135.11 -42.42  
3  1 SER A 226 ? ? 66.56   -45.50  
4  1 ASP A 256 ? ? -142.20 41.36   
5  1 ASP A 274 ? ? 54.70   80.97   
6  1 PHE A 275 ? ? -90.80  30.12   
7  1 SER A 283 ? A -142.63 55.87   
8  1 SER A 284 ? A -171.46 143.77  
9  1 LEU A 289 ? ? -68.89  96.09   
10 1 ASP A 307 ? ? -133.84 -153.06 
11 1 LEU A 364 ? ? -99.58  41.54   
12 1 SER D 21  ? ? -72.19  -70.65  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 141 ? CG  ? A LYS 21  CG  
2  1 Y 1 A LYS 141 ? CD  ? A LYS 21  CD  
3  1 Y 1 A LYS 141 ? CE  ? A LYS 21  CE  
4  1 Y 1 A LYS 141 ? NZ  ? A LYS 21  NZ  
5  1 Y 1 A LYS 143 ? CG  ? A LYS 23  CG  
6  1 Y 1 A LYS 143 ? CD  ? A LYS 23  CD  
7  1 Y 1 A LYS 143 ? CE  ? A LYS 23  CE  
8  1 Y 1 A LYS 143 ? NZ  ? A LYS 23  NZ  
9  1 Y 1 A LYS 156 ? CG  ? A LYS 36  CG  
10 1 Y 1 A LYS 156 ? CD  ? A LYS 36  CD  
11 1 Y 1 A LYS 156 ? CE  ? A LYS 36  CE  
12 1 Y 1 A LYS 156 ? NZ  ? A LYS 36  NZ  
13 1 Y 1 A GLN 168 ? CD  ? A GLN 48  CD  
14 1 Y 1 A GLN 168 ? OE1 ? A GLN 48  OE1 
15 1 Y 1 A GLN 168 ? NE2 ? A GLN 48  NE2 
16 1 Y 1 A LYS 171 ? CG  ? A LYS 51  CG  
17 1 Y 1 A LYS 171 ? CD  ? A LYS 51  CD  
18 1 Y 1 A LYS 171 ? CE  ? A LYS 51  CE  
19 1 Y 1 A LYS 171 ? NZ  ? A LYS 51  NZ  
20 1 Y 1 A ARG 220 ? CD  ? A ARG 100 CD  
21 1 Y 1 A ARG 220 ? NE  ? A ARG 100 NE  
22 1 Y 1 A ARG 220 ? CZ  ? A ARG 100 CZ  
23 1 Y 1 A ARG 220 ? NH1 ? A ARG 100 NH1 
24 1 Y 1 A ARG 220 ? NH2 ? A ARG 100 NH2 
25 1 Y 1 A LYS 227 ? CG  ? A LYS 107 CG  
26 1 Y 1 A LYS 227 ? CD  ? A LYS 107 CD  
27 1 Y 1 A LYS 227 ? CE  ? A LYS 107 CE  
28 1 Y 1 A LYS 227 ? NZ  ? A LYS 107 NZ  
29 1 Y 1 A LYS 326 ? CD  ? A LYS 206 CD  
30 1 Y 1 A LYS 326 ? CE  ? A LYS 206 CE  
31 1 Y 1 A LYS 326 ? NZ  ? A LYS 206 NZ  
32 1 Y 1 A LYS 339 ? NZ  ? A LYS 219 NZ  
33 1 Y 1 A GLU 354 ? CG  ? A GLU 234 CG  
34 1 Y 1 A GLU 354 ? CD  ? A GLU 234 CD  
35 1 Y 1 A GLU 354 ? OE1 ? A GLU 234 OE1 
36 1 Y 1 A GLU 354 ? OE2 ? A GLU 234 OE2 
37 1 Y 1 A ARG 375 ? CG  ? A ARG 255 CG  
38 1 Y 1 A ARG 375 ? CD  ? A ARG 255 CD  
39 1 Y 1 A ARG 375 ? NE  ? A ARG 255 NE  
40 1 Y 1 A ARG 375 ? CZ  ? A ARG 255 CZ  
41 1 Y 1 A ARG 375 ? NH1 ? A ARG 255 NH1 
42 1 Y 1 A ARG 375 ? NH2 ? A ARG 255 NH2 
43 1 Y 1 A LYS 389 ? CE  ? A LYS 269 CE  
44 1 Y 1 A LYS 389 ? NZ  ? A LYS 269 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 121 ? A MET 1   
2  1 Y 1 A GLU 122 ? A GLU 2   
3  1 Y 1 A SER 123 ? A SER 3   
4  1 Y 1 A LYS 124 ? A LYS 4   
5  1 Y 1 A LYS 125 ? A LYS 5   
6  1 Y 1 A ALA 393 ? A ALA 273 
7  1 Y 1 A GLN 394 ? A GLN 274 
8  1 Y 1 A ASN 395 ? A ASN 275 
9  1 Y 1 A LYS 396 ? A LYS 276 
10 1 Y 1 A GLU 397 ? A GLU 277 
11 1 Y 1 A SER 398 ? A SER 278 
12 1 Y 1 A ALA 399 ? A ALA 279 
13 1 Y 1 A SER 400 ? A SER 280 
14 1 Y 1 A LYS 401 ? A LYS 281 
15 1 Y 1 A GLN 402 ? A GLN 282 
16 1 Y 1 A SER 403 ? A SER 283 
17 1 Y 1 D ASP 23  ? B ASP 18  
18 1 Y 1 D ASP 24  ? B ASP 19  
19 1 Y 1 D GLU 25  ? B GLU 20  
20 1 Y 1 D GLY 26  ? B GLY 21  
21 1 Y 1 D ASP 27  ? B ASP 22  
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'Medical Research Council (United Kingdom)' 'United Kingdom' MR/K016903/1  1 
'Cancer Research UK'                        'United Kingdom' C24461/A12772 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3  "ADENOSINE-5'-DIPHOSPHATE"             ADP 
4  'TETRAETHYLENE GLYCOL'                 PG4 
5  'SULFATE ION'                          SO4 
6  'DI(HYDROXYETHYL)ETHER'                PEG 
7  '2-(N-MORPHOLINO)-ETHANESULFONIC ACID' MES 
8  '1-ETHOXY-2-(2-ETHOXYETHOXY)ETHANE'    P4G 
9  'CHLORIDE ION'                         CL  
10 'MAGNESIUM ION'                        MG  
11 AMMONIA                                NH3 
12 water                                  HOH 
#