data_5LXX
# 
_entry.id   5LXX 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LXX         
WWPDB D_1200001543 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LXX 
_pdbx_database_status.recvd_initial_deposition_date   2016-09-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Myllykoski, M.' 1 
'Hensley, K.'    2 
'Kursula, P.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   AT 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Amino Acids' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1438-2199 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            49 
_citation.language                  ? 
_citation.page_first                747 
_citation.page_last                 759 
_citation.title                     
;Collapsin response mediator protein 2: high-resolution crystal structure sheds light on small-molecule binding, post-translational modifications, and conformational flexibility.
;
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1007/s00726-016-2376-z 
_citation.pdbx_database_id_PubMed   28044206 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Myllykoski, M.' 1 
primary 'Baumann, A.'    2 
primary 'Hensley, K.'    3 
primary 'Kursula, P.'    4 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   122.54 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LXX 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     141.760 
_cell.length_a_esd                 ? 
_cell.length_b                     97.040 
_cell.length_b_esd                 ? 
_cell.length_c                     92.380 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LXX 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Dihydropyrimidinase-related protein 2'                            55096.969 2    ? ? ? ? 
2 non-polymer syn 'SULFATE ION'                                                      96.063    5    ? ? ? ? 
3 non-polymer syn '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 209.240   2    ? ? ? ? 
4 water       nat water                                                              18.015    1309 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'DRP-2,Collapsin response mediator protein 2,CRMP-2,N2A3,Unc-33-like phosphoprotein 2,ULIP-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MHHHHHHSSGVDLGTENLYFQSMTSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGG
IDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQ
EEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPE
EVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSP
DPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAA
KVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYI
PRKPFPDFVYKRIKARSRLAE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MHHHHHHSSGVDLGTENLYFQSMTSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGG
IDVHTRFQMPDQGMTSADDFFQGTKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQ
EEMEALVKDHGVNSFLVYMAFKDRFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPE
EVEAEAVNRAITIANQTNCPLYITKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSP
DPTTPDFLNSLLSCGDLQVTGSAHCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAA
KVFNLYPRKGRIAVGSDADLVIWDPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYI
PRKPFPDFVYKRIKARSRLAE
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   HIS n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   SER n 
1 9   SER n 
1 10  GLY n 
1 11  VAL n 
1 12  ASP n 
1 13  LEU n 
1 14  GLY n 
1 15  THR n 
1 16  GLU n 
1 17  ASN n 
1 18  LEU n 
1 19  TYR n 
1 20  PHE n 
1 21  GLN n 
1 22  SER n 
1 23  MET n 
1 24  THR n 
1 25  SER n 
1 26  ASP n 
1 27  ARG n 
1 28  LEU n 
1 29  LEU n 
1 30  ILE n 
1 31  LYS n 
1 32  GLY n 
1 33  GLY n 
1 34  LYS n 
1 35  ILE n 
1 36  VAL n 
1 37  ASN n 
1 38  ASP n 
1 39  ASP n 
1 40  GLN n 
1 41  SER n 
1 42  PHE n 
1 43  TYR n 
1 44  ALA n 
1 45  ASP n 
1 46  ILE n 
1 47  TYR n 
1 48  MET n 
1 49  GLU n 
1 50  ASP n 
1 51  GLY n 
1 52  LEU n 
1 53  ILE n 
1 54  LYS n 
1 55  GLN n 
1 56  ILE n 
1 57  GLY n 
1 58  GLU n 
1 59  ASN n 
1 60  LEU n 
1 61  ILE n 
1 62  VAL n 
1 63  PRO n 
1 64  GLY n 
1 65  GLY n 
1 66  VAL n 
1 67  LYS n 
1 68  THR n 
1 69  ILE n 
1 70  GLU n 
1 71  ALA n 
1 72  HIS n 
1 73  SER n 
1 74  ARG n 
1 75  MET n 
1 76  VAL n 
1 77  ILE n 
1 78  PRO n 
1 79  GLY n 
1 80  GLY n 
1 81  ILE n 
1 82  ASP n 
1 83  VAL n 
1 84  HIS n 
1 85  THR n 
1 86  ARG n 
1 87  PHE n 
1 88  GLN n 
1 89  MET n 
1 90  PRO n 
1 91  ASP n 
1 92  GLN n 
1 93  GLY n 
1 94  MET n 
1 95  THR n 
1 96  SER n 
1 97  ALA n 
1 98  ASP n 
1 99  ASP n 
1 100 PHE n 
1 101 PHE n 
1 102 GLN n 
1 103 GLY n 
1 104 THR n 
1 105 LYS n 
1 106 ALA n 
1 107 ALA n 
1 108 LEU n 
1 109 ALA n 
1 110 GLY n 
1 111 GLY n 
1 112 THR n 
1 113 THR n 
1 114 MET n 
1 115 ILE n 
1 116 ILE n 
1 117 ASP n 
1 118 HIS n 
1 119 VAL n 
1 120 VAL n 
1 121 PRO n 
1 122 GLU n 
1 123 PRO n 
1 124 GLY n 
1 125 THR n 
1 126 SER n 
1 127 LEU n 
1 128 LEU n 
1 129 ALA n 
1 130 ALA n 
1 131 PHE n 
1 132 ASP n 
1 133 GLN n 
1 134 TRP n 
1 135 ARG n 
1 136 GLU n 
1 137 TRP n 
1 138 ALA n 
1 139 ASP n 
1 140 SER n 
1 141 LYS n 
1 142 SER n 
1 143 CYS n 
1 144 CYS n 
1 145 ASP n 
1 146 TYR n 
1 147 SER n 
1 148 LEU n 
1 149 HIS n 
1 150 VAL n 
1 151 ASP n 
1 152 ILE n 
1 153 SER n 
1 154 GLU n 
1 155 TRP n 
1 156 HIS n 
1 157 LYS n 
1 158 GLY n 
1 159 ILE n 
1 160 GLN n 
1 161 GLU n 
1 162 GLU n 
1 163 MET n 
1 164 GLU n 
1 165 ALA n 
1 166 LEU n 
1 167 VAL n 
1 168 LYS n 
1 169 ASP n 
1 170 HIS n 
1 171 GLY n 
1 172 VAL n 
1 173 ASN n 
1 174 SER n 
1 175 PHE n 
1 176 LEU n 
1 177 VAL n 
1 178 TYR n 
1 179 MET n 
1 180 ALA n 
1 181 PHE n 
1 182 LYS n 
1 183 ASP n 
1 184 ARG n 
1 185 PHE n 
1 186 GLN n 
1 187 LEU n 
1 188 THR n 
1 189 ASP n 
1 190 CYS n 
1 191 GLN n 
1 192 ILE n 
1 193 TYR n 
1 194 GLU n 
1 195 VAL n 
1 196 LEU n 
1 197 SER n 
1 198 VAL n 
1 199 ILE n 
1 200 ARG n 
1 201 ASP n 
1 202 ILE n 
1 203 GLY n 
1 204 ALA n 
1 205 ILE n 
1 206 ALA n 
1 207 GLN n 
1 208 VAL n 
1 209 HIS n 
1 210 ALA n 
1 211 GLU n 
1 212 ASN n 
1 213 GLY n 
1 214 ASP n 
1 215 ILE n 
1 216 ILE n 
1 217 ALA n 
1 218 GLU n 
1 219 GLU n 
1 220 GLN n 
1 221 GLN n 
1 222 ARG n 
1 223 ILE n 
1 224 LEU n 
1 225 ASP n 
1 226 LEU n 
1 227 GLY n 
1 228 ILE n 
1 229 THR n 
1 230 GLY n 
1 231 PRO n 
1 232 GLU n 
1 233 GLY n 
1 234 HIS n 
1 235 VAL n 
1 236 LEU n 
1 237 SER n 
1 238 ARG n 
1 239 PRO n 
1 240 GLU n 
1 241 GLU n 
1 242 VAL n 
1 243 GLU n 
1 244 ALA n 
1 245 GLU n 
1 246 ALA n 
1 247 VAL n 
1 248 ASN n 
1 249 ARG n 
1 250 ALA n 
1 251 ILE n 
1 252 THR n 
1 253 ILE n 
1 254 ALA n 
1 255 ASN n 
1 256 GLN n 
1 257 THR n 
1 258 ASN n 
1 259 CYS n 
1 260 PRO n 
1 261 LEU n 
1 262 TYR n 
1 263 ILE n 
1 264 THR n 
1 265 LYS n 
1 266 VAL n 
1 267 MET n 
1 268 SER n 
1 269 LYS n 
1 270 SER n 
1 271 SER n 
1 272 ALA n 
1 273 GLU n 
1 274 VAL n 
1 275 ILE n 
1 276 ALA n 
1 277 GLN n 
1 278 ALA n 
1 279 ARG n 
1 280 LYS n 
1 281 LYS n 
1 282 GLY n 
1 283 THR n 
1 284 VAL n 
1 285 VAL n 
1 286 TYR n 
1 287 GLY n 
1 288 GLU n 
1 289 PRO n 
1 290 ILE n 
1 291 THR n 
1 292 ALA n 
1 293 SER n 
1 294 LEU n 
1 295 GLY n 
1 296 THR n 
1 297 ASP n 
1 298 GLY n 
1 299 SER n 
1 300 HIS n 
1 301 TYR n 
1 302 TRP n 
1 303 SER n 
1 304 LYS n 
1 305 ASN n 
1 306 TRP n 
1 307 ALA n 
1 308 LYS n 
1 309 ALA n 
1 310 ALA n 
1 311 ALA n 
1 312 PHE n 
1 313 VAL n 
1 314 THR n 
1 315 SER n 
1 316 PRO n 
1 317 PRO n 
1 318 LEU n 
1 319 SER n 
1 320 PRO n 
1 321 ASP n 
1 322 PRO n 
1 323 THR n 
1 324 THR n 
1 325 PRO n 
1 326 ASP n 
1 327 PHE n 
1 328 LEU n 
1 329 ASN n 
1 330 SER n 
1 331 LEU n 
1 332 LEU n 
1 333 SER n 
1 334 CYS n 
1 335 GLY n 
1 336 ASP n 
1 337 LEU n 
1 338 GLN n 
1 339 VAL n 
1 340 THR n 
1 341 GLY n 
1 342 SER n 
1 343 ALA n 
1 344 HIS n 
1 345 CYS n 
1 346 THR n 
1 347 PHE n 
1 348 ASN n 
1 349 THR n 
1 350 ALA n 
1 351 GLN n 
1 352 LYS n 
1 353 ALA n 
1 354 VAL n 
1 355 GLY n 
1 356 LYS n 
1 357 ASP n 
1 358 ASN n 
1 359 PHE n 
1 360 THR n 
1 361 LEU n 
1 362 ILE n 
1 363 PRO n 
1 364 GLU n 
1 365 GLY n 
1 366 THR n 
1 367 ASN n 
1 368 GLY n 
1 369 THR n 
1 370 GLU n 
1 371 GLU n 
1 372 ARG n 
1 373 MET n 
1 374 SER n 
1 375 VAL n 
1 376 ILE n 
1 377 TRP n 
1 378 ASP n 
1 379 LYS n 
1 380 ALA n 
1 381 VAL n 
1 382 VAL n 
1 383 THR n 
1 384 GLY n 
1 385 LYS n 
1 386 MET n 
1 387 ASP n 
1 388 GLU n 
1 389 ASN n 
1 390 GLN n 
1 391 PHE n 
1 392 VAL n 
1 393 ALA n 
1 394 VAL n 
1 395 THR n 
1 396 SER n 
1 397 THR n 
1 398 ASN n 
1 399 ALA n 
1 400 ALA n 
1 401 LYS n 
1 402 VAL n 
1 403 PHE n 
1 404 ASN n 
1 405 LEU n 
1 406 TYR n 
1 407 PRO n 
1 408 ARG n 
1 409 LYS n 
1 410 GLY n 
1 411 ARG n 
1 412 ILE n 
1 413 ALA n 
1 414 VAL n 
1 415 GLY n 
1 416 SER n 
1 417 ASP n 
1 418 ALA n 
1 419 ASP n 
1 420 LEU n 
1 421 VAL n 
1 422 ILE n 
1 423 TRP n 
1 424 ASP n 
1 425 PRO n 
1 426 ASP n 
1 427 SER n 
1 428 VAL n 
1 429 LYS n 
1 430 THR n 
1 431 ILE n 
1 432 SER n 
1 433 ALA n 
1 434 LYS n 
1 435 THR n 
1 436 HIS n 
1 437 ASN n 
1 438 SER n 
1 439 SER n 
1 440 LEU n 
1 441 GLU n 
1 442 TYR n 
1 443 ASN n 
1 444 ILE n 
1 445 PHE n 
1 446 GLU n 
1 447 GLY n 
1 448 MET n 
1 449 GLU n 
1 450 CYS n 
1 451 ARG n 
1 452 GLY n 
1 453 SER n 
1 454 PRO n 
1 455 LEU n 
1 456 VAL n 
1 457 VAL n 
1 458 ILE n 
1 459 SER n 
1 460 GLN n 
1 461 GLY n 
1 462 LYS n 
1 463 ILE n 
1 464 VAL n 
1 465 LEU n 
1 466 GLU n 
1 467 ASP n 
1 468 GLY n 
1 469 THR n 
1 470 LEU n 
1 471 HIS n 
1 472 VAL n 
1 473 THR n 
1 474 GLU n 
1 475 GLY n 
1 476 SER n 
1 477 GLY n 
1 478 ARG n 
1 479 TYR n 
1 480 ILE n 
1 481 PRO n 
1 482 ARG n 
1 483 LYS n 
1 484 PRO n 
1 485 PHE n 
1 486 PRO n 
1 487 ASP n 
1 488 PHE n 
1 489 VAL n 
1 490 TYR n 
1 491 LYS n 
1 492 ARG n 
1 493 ILE n 
1 494 LYS n 
1 495 ALA n 
1 496 ARG n 
1 497 SER n 
1 498 ARG n 
1 499 LEU n 
1 500 ALA n 
1 501 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   501 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'DPYSL2, CRMP2, ULIP2' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    DPYL2_HUMAN 
_struct_ref.pdbx_db_accession          Q16555 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;TSDRLLIKGGKIVNDDQSFYADIYMEDGLIKQIGENLIVPGGVKTIEAHSRMVIPGGIDVHTRFQMPDQGMTSADDFFQG
TKAALAGGTTMIIDHVVPEPGTSLLAAFDQWREWADSKSCCDYSLHVDISEWHKGIQEEMEALVKDHGVNSFLVYMAFKD
RFQLTDCQIYEVLSVIRDIGAIAQVHAENGDIIAEEQQRILDLGITGPEGHVLSRPEEVEAEAVNRAITIANQTNCPLYI
TKVMSKSSAEVIAQARKKGTVVYGEPITASLGTDGSHYWSKNWAKAAAFVTSPPLSPDPTTPDFLNSLLSCGDLQVTGSA
HCTFNTAQKAVGKDNFTLIPEGTNGTEERMSVIWDKAVVTGKMDENQFVAVTSTNAAKVFNLYPRKGRIAVGSDADLVIW
DPDSVKTISAKTHNSSLEYNIFEGMECRGSPLVVISQGKIVLEDGTLHVTEGSGRYIPRKPFPDFVYKRIKARSRLAE
;
_struct_ref.pdbx_align_begin           13 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5LXX A 24 ? 501 ? Q16555 13 ? 490 ? 13 490 
2 1 5LXX B 24 ? 501 ? Q16555 13 ? 490 ? 13 490 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5LXX MET A 1  ? UNP Q16555 ? ? 'initiating methionine' -10 1  
1 5LXX HIS A 2  ? UNP Q16555 ? ? 'expression tag'        -9  2  
1 5LXX HIS A 3  ? UNP Q16555 ? ? 'expression tag'        -8  3  
1 5LXX HIS A 4  ? UNP Q16555 ? ? 'expression tag'        -7  4  
1 5LXX HIS A 5  ? UNP Q16555 ? ? 'expression tag'        -6  5  
1 5LXX HIS A 6  ? UNP Q16555 ? ? 'expression tag'        -5  6  
1 5LXX HIS A 7  ? UNP Q16555 ? ? 'expression tag'        -4  7  
1 5LXX SER A 8  ? UNP Q16555 ? ? 'expression tag'        -3  8  
1 5LXX SER A 9  ? UNP Q16555 ? ? 'expression tag'        -2  9  
1 5LXX GLY A 10 ? UNP Q16555 ? ? 'expression tag'        -1  10 
1 5LXX VAL A 11 ? UNP Q16555 ? ? 'expression tag'        0   11 
1 5LXX ASP A 12 ? UNP Q16555 ? ? 'expression tag'        1   12 
1 5LXX LEU A 13 ? UNP Q16555 ? ? 'expression tag'        2   13 
1 5LXX GLY A 14 ? UNP Q16555 ? ? 'expression tag'        3   14 
1 5LXX THR A 15 ? UNP Q16555 ? ? 'expression tag'        4   15 
1 5LXX GLU A 16 ? UNP Q16555 ? ? 'expression tag'        5   16 
1 5LXX ASN A 17 ? UNP Q16555 ? ? 'expression tag'        6   17 
1 5LXX LEU A 18 ? UNP Q16555 ? ? 'expression tag'        7   18 
1 5LXX TYR A 19 ? UNP Q16555 ? ? 'expression tag'        8   19 
1 5LXX PHE A 20 ? UNP Q16555 ? ? 'expression tag'        9   20 
1 5LXX GLN A 21 ? UNP Q16555 ? ? 'expression tag'        10  21 
1 5LXX SER A 22 ? UNP Q16555 ? ? 'expression tag'        11  22 
1 5LXX MET A 23 ? UNP Q16555 ? ? 'expression tag'        12  23 
2 5LXX MET B 1  ? UNP Q16555 ? ? 'initiating methionine' -10 24 
2 5LXX HIS B 2  ? UNP Q16555 ? ? 'expression tag'        -9  25 
2 5LXX HIS B 3  ? UNP Q16555 ? ? 'expression tag'        -8  26 
2 5LXX HIS B 4  ? UNP Q16555 ? ? 'expression tag'        -7  27 
2 5LXX HIS B 5  ? UNP Q16555 ? ? 'expression tag'        -6  28 
2 5LXX HIS B 6  ? UNP Q16555 ? ? 'expression tag'        -5  29 
2 5LXX HIS B 7  ? UNP Q16555 ? ? 'expression tag'        -4  30 
2 5LXX SER B 8  ? UNP Q16555 ? ? 'expression tag'        -3  31 
2 5LXX SER B 9  ? UNP Q16555 ? ? 'expression tag'        -2  32 
2 5LXX GLY B 10 ? UNP Q16555 ? ? 'expression tag'        -1  33 
2 5LXX VAL B 11 ? UNP Q16555 ? ? 'expression tag'        0   34 
2 5LXX ASP B 12 ? UNP Q16555 ? ? 'expression tag'        1   35 
2 5LXX LEU B 13 ? UNP Q16555 ? ? 'expression tag'        2   36 
2 5LXX GLY B 14 ? UNP Q16555 ? ? 'expression tag'        3   37 
2 5LXX THR B 15 ? UNP Q16555 ? ? 'expression tag'        4   38 
2 5LXX GLU B 16 ? UNP Q16555 ? ? 'expression tag'        5   39 
2 5LXX ASN B 17 ? UNP Q16555 ? ? 'expression tag'        6   40 
2 5LXX LEU B 18 ? UNP Q16555 ? ? 'expression tag'        7   41 
2 5LXX TYR B 19 ? UNP Q16555 ? ? 'expression tag'        8   42 
2 5LXX PHE B 20 ? UNP Q16555 ? ? 'expression tag'        9   43 
2 5LXX GLN B 21 ? UNP Q16555 ? ? 'expression tag'        10  44 
2 5LXX SER B 22 ? UNP Q16555 ? ? 'expression tag'        11  45 
2 5LXX MET B 23 ? UNP Q16555 ? ? 'expression tag'        12  46 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                            ?                 'C3 H7 N O2'     
89.093  
ARG 'L-peptide linking' y ARGININE                                                           ?                 'C6 H15 N4 O2 1' 
175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                         ?                 'C4 H8 N2 O3'    
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                    ?                 'C4 H7 N O4'     
133.103 
BTB non-polymer         . '2-[BIS-(2-HYDROXY-ETHYL)-AMINO]-2-HYDROXYMETHYL-PROPANE-1,3-DIOL' 'BIS-TRIS BUFFER' 'C8 H19 N O5'    
209.240 
CYS 'L-peptide linking' y CYSTEINE                                                           ?                 'C3 H7 N O2 S'   
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                          ?                 'C5 H10 N2 O3'   
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                    ?                 'C5 H9 N O4'     
147.129 
GLY 'peptide linking'   y GLYCINE                                                            ?                 'C2 H5 N O2'     
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                          ?                 'C6 H10 N3 O2 1' 
156.162 
HOH non-polymer         . WATER                                                              ?                 'H2 O'           
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                         ?                 'C6 H13 N O2'    
131.173 
LEU 'L-peptide linking' y LEUCINE                                                            ?                 'C6 H13 N O2'    
131.173 
LYS 'L-peptide linking' y LYSINE                                                             ?                 'C6 H15 N2 O2 1' 
147.195 
MET 'L-peptide linking' y METHIONINE                                                         ?                 'C5 H11 N O2 S'  
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                      ?                 'C9 H11 N O2'    
165.189 
PRO 'L-peptide linking' y PROLINE                                                            ?                 'C5 H9 N O2'     
115.130 
SER 'L-peptide linking' y SERINE                                                             ?                 'C3 H7 N O3'     
105.093 
SO4 non-polymer         . 'SULFATE ION'                                                      ?                 'O4 S -2'        
96.063  
THR 'L-peptide linking' y THREONINE                                                          ?                 'C4 H9 N O3'     
119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                         ?                 'C11 H12 N2 O2'  
204.225 
TYR 'L-peptide linking' y TYROSINE                                                           ?                 'C9 H11 N O3'    
181.189 
VAL 'L-peptide linking' y VALINE                                                             ?                 'C5 H11 N O2'    
117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LXX 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.43 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         49.39 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'bis-tris, PEG3350, ammonium sulphate, glycerol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-09-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.03 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PETRA III, EMBL c/o DESY BEAMLINE P13 (MX1)' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.03 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   'P13 (MX1)' 
_diffrn_source.pdbx_synchrotron_site       'PETRA III, EMBL c/o DESY' 
# 
_reflns.B_iso_Wilson_estimate            19.5 
_reflns.entry_id                         5LXX 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.25 
_reflns.d_resolution_low                 80 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       269401 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             92.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.6 
_reflns.pdbx_Rmerge_I_obs                0.039 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            15.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.00 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.25 
_reflns_shell.d_res_low                   1.28 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.0 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        57.9 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.77 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             2.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.399 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LXX 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.250 
_refine.ls_d_res_low                             75.332 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     269386 
_refine.ls_number_reflns_R_free                  2000 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    92.88 
_refine.ls_percent_reflns_R_free                 0.74 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1038 
_refine.ls_R_factor_R_free                       0.1326 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1035 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.36 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      2GSE 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 15.32 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.13 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        7340 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         53 
_refine_hist.number_atoms_solvent             1309 
_refine_hist.number_atoms_total               8702 
_refine_hist.d_res_high                       1.250 
_refine_hist.d_res_low                        75.332 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  ? 8151  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.269  ? 11152 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 14.421 ? 3042  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.093  ? 1236  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.009  ? 1479  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.2500 1.2812  . . 89  11841 58.00 . . . 0.3286 . 0.3106 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.2812 1.3159  . . 111 14852 73.00 . . . 0.3301 . 0.2696 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3159 1.3546  . . 134 17879 87.00 . . . 0.2587 . 0.2222 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3546 1.3983  . . 149 20021 98.00 . . . 0.2391 . 0.1920 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.3983 1.4483  . . 152 20308 99.00 . . . 0.2086 . 0.1496 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.4483 1.5063  . . 151 20231 99.00 . . . 0.1656 . 0.1162 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5063 1.5748  . . 151 20106 98.00 . . . 0.1417 . 0.0964 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5748 1.6579  . . 152 20284 99.00 . . . 0.1293 . 0.0850 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6579 1.7618  . . 152 20298 99.00 . . . 0.1386 . 0.0796 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7618 1.8978  . . 150 20133 98.00 . . . 0.1152 . 0.0719 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8978 2.0888  . . 152 20393 99.00 . . . 0.1010 . 0.0720 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0888 2.3911  . . 151 20177 98.00 . . . 0.1055 . 0.0762 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.3911 3.0125  . . 152 20405 99.00 . . . 0.1211 . 0.0977 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0125 75.4687 . . 154 20458 98.00 . . . 0.1232 . 0.1124 . . . . . . . . . . 
# 
_struct.entry_id                     5LXX 
_struct.title                        'High-resolution structure of human collapsin response mediator protein 2' 
_struct.pdbx_descriptor              'Dihydropyrimidinase-related protein 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LXX 
_struct_keywords.text            'TIM barrel, tetramer, CRMP, transcription' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 2 ? 
I N N 3 ? 
J N N 4 ? 
K N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 99  ? GLY A 110 ? ASP A 88  GLY A 99  1 ? 12 
HELX_P HELX_P2  AA2 SER A 126 ? SER A 142 ? SER A 115 SER A 131 1 ? 17 
HELX_P HELX_P3  AA3 GLY A 158 ? GLY A 171 ? GLY A 147 GLY A 160 1 ? 14 
HELX_P HELX_P4  AA4 THR A 188 ? GLY A 203 ? THR A 177 GLY A 192 1 ? 16 
HELX_P HELX_P5  AA5 ASN A 212 ? LEU A 226 ? ASN A 201 LEU A 215 1 ? 15 
HELX_P HELX_P6  AA6 GLY A 230 ? ARG A 238 ? GLY A 219 ARG A 227 1 ? 9  
HELX_P HELX_P7  AA7 PRO A 239 ? ASN A 258 ? PRO A 228 ASN A 247 1 ? 20 
HELX_P HELX_P8  AA8 SER A 268 ? LYS A 281 ? SER A 257 LYS A 270 1 ? 14 
HELX_P HELX_P9  AA9 ILE A 290 ? THR A 296 ? ILE A 279 THR A 285 1 ? 7  
HELX_P HELX_P10 AB1 ASP A 297 ? SER A 303 ? ASP A 286 SER A 292 5 ? 7  
HELX_P HELX_P11 AB2 ASN A 305 ? PHE A 312 ? ASN A 294 PHE A 301 1 ? 8  
HELX_P HELX_P12 AB3 THR A 323 ? CYS A 334 ? THR A 312 CYS A 323 1 ? 12 
HELX_P HELX_P13 AB4 ASN A 348 ? ALA A 353 ? ASN A 337 ALA A 342 1 ? 6  
HELX_P HELX_P14 AB5 VAL A 354 ? LYS A 356 ? VAL A 343 LYS A 345 5 ? 3  
HELX_P HELX_P15 AB6 ASN A 358 ? ILE A 362 ? ASN A 347 ILE A 351 5 ? 5  
HELX_P HELX_P16 AB7 GLU A 371 ? VAL A 381 ? GLU A 360 VAL A 370 1 ? 11 
HELX_P HELX_P17 AB8 ASP A 387 ? SER A 396 ? ASP A 376 SER A 385 1 ? 10 
HELX_P HELX_P18 AB9 SER A 396 ? PHE A 403 ? SER A 385 PHE A 392 1 ? 8  
HELX_P HELX_P19 AC1 PRO A 486 ? ARG A 498 ? PRO A 475 ARG A 487 1 ? 13 
HELX_P HELX_P20 AC2 ASP B 99  ? GLY B 110 ? ASP B 88  GLY B 99  1 ? 12 
HELX_P HELX_P21 AC3 SER B 126 ? SER B 142 ? SER B 115 SER B 131 1 ? 17 
HELX_P HELX_P22 AC4 GLY B 158 ? HIS B 170 ? GLY B 147 HIS B 159 1 ? 13 
HELX_P HELX_P23 AC5 THR B 188 ? GLY B 203 ? THR B 177 GLY B 192 1 ? 16 
HELX_P HELX_P24 AC6 ASN B 212 ? LEU B 226 ? ASN B 201 LEU B 215 1 ? 15 
HELX_P HELX_P25 AC7 GLY B 230 ? SER B 237 ? GLY B 219 SER B 226 1 ? 8  
HELX_P HELX_P26 AC8 PRO B 239 ? ASN B 258 ? PRO B 228 ASN B 247 1 ? 20 
HELX_P HELX_P27 AC9 SER B 268 ? LYS B 281 ? SER B 257 LYS B 270 1 ? 14 
HELX_P HELX_P28 AD1 ILE B 290 ? THR B 296 ? ILE B 279 THR B 285 1 ? 7  
HELX_P HELX_P29 AD2 ASP B 297 ? SER B 303 ? ASP B 286 SER B 292 5 ? 7  
HELX_P HELX_P30 AD3 ASN B 305 ? PHE B 312 ? ASN B 294 PHE B 301 1 ? 8  
HELX_P HELX_P31 AD4 THR B 323 ? CYS B 334 ? THR B 312 CYS B 323 1 ? 12 
HELX_P HELX_P32 AD5 ASN B 348 ? ALA B 353 ? ASN B 337 ALA B 342 1 ? 6  
HELX_P HELX_P33 AD6 VAL B 354 ? LYS B 356 ? VAL B 343 LYS B 345 5 ? 3  
HELX_P HELX_P34 AD7 ASN B 358 ? ILE B 362 ? ASN B 347 ILE B 351 5 ? 5  
HELX_P HELX_P35 AD8 GLU B 371 ? VAL B 381 ? GLU B 360 VAL B 370 1 ? 11 
HELX_P HELX_P36 AD9 ASP B 387 ? SER B 396 ? ASP B 376 SER B 385 1 ? 10 
HELX_P HELX_P37 AE1 SER B 396 ? PHE B 403 ? SER B 385 PHE B 392 1 ? 8  
HELX_P HELX_P38 AE2 PRO B 486 ? ARG B 498 ? PRO B 475 ARG B 487 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 SER 315 A . ? SER 304 A PRO 316 A ? PRO 305 A 1 -10.83 
2 TYR 406 A . ? TYR 395 A PRO 407 A ? PRO 396 A 1 4.77   
3 SER 315 B . ? SER 304 B PRO 316 B ? PRO 305 B 1 -10.48 
4 TYR 406 B . ? TYR 395 B PRO 407 B ? PRO 396 B 1 7.71   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 7 ? 
AA3 ? 7 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 8 ? 
AA7 ? 7 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? anti-parallel 
AA2 4 5 ? anti-parallel 
AA2 5 6 ? anti-parallel 
AA2 6 7 ? anti-parallel 
AA3 1 2 ? parallel      
AA3 2 3 ? parallel      
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA3 5 6 ? parallel      
AA3 6 7 ? parallel      
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? parallel      
AA6 4 5 ? anti-parallel 
AA6 5 6 ? anti-parallel 
AA6 6 7 ? anti-parallel 
AA6 7 8 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? parallel      
AA7 3 4 ? parallel      
AA7 4 5 ? parallel      
AA7 5 6 ? parallel      
AA7 6 7 ? parallel      
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 52  ? GLY A 57  ? LEU A 41  GLY A 46  
AA1 2 ASP A 45  ? GLU A 49  ? ASP A 34  GLU A 38  
AA1 3 LEU A 28  ? LYS A 31  ? LEU A 17  LYS A 20  
AA1 4 LYS A 67  ? GLU A 70  ? LYS A 56  GLU A 59  
AA2 1 SER A 41  ? TYR A 43  ? SER A 30  TYR A 32  
AA2 2 LYS A 34  ? VAL A 36  ? LYS A 23  VAL A 25  
AA2 3 MET A 75  ? PRO A 78  ? MET A 64  PRO A 67  
AA2 4 LEU A 420 ? THR A 430 ? LEU A 409 THR A 419 
AA2 5 GLU A 449 ? SER A 459 ? GLU A 438 SER A 448 
AA2 6 LYS A 462 ? GLU A 466 ? LYS A 451 GLU A 455 
AA2 7 THR A 469 ? LEU A 470 ? THR A 458 LEU A 459 
AA3 1 GLY A 80  ? ASP A 82  ? GLY A 69  ASP A 71  
AA3 2 THR A 112 ? VAL A 119 ? THR A 101 VAL A 108 
AA3 3 ASP A 145 ? ASP A 151 ? ASP A 134 ASP A 140 
AA3 4 SER A 174 ? TYR A 178 ? SER A 163 TYR A 167 
AA3 5 ILE A 205 ? HIS A 209 ? ILE A 194 HIS A 198 
AA3 6 LEU A 261 ? VAL A 266 ? LEU A 250 VAL A 255 
AA3 7 VAL A 285 ? PRO A 289 ? VAL A 274 PRO A 278 
AA4 1 PRO A 90  ? ASP A 91  ? PRO A 79  ASP A 80  
AA4 2 MET A 94  ? THR A 95  ? MET A 83  THR A 84  
AA5 1 LEU B 52  ? GLY B 57  ? LEU B 41  GLY B 46  
AA5 2 SER B 41  ? GLU B 49  ? SER B 30  GLU B 38  
AA5 3 ARG B 27  ? VAL B 36  ? ARG B 16  VAL B 25  
AA5 4 LYS B 67  ? GLU B 70  ? LYS B 56  GLU B 59  
AA6 1 LEU B 52  ? GLY B 57  ? LEU B 41  GLY B 46  
AA6 2 SER B 41  ? GLU B 49  ? SER B 30  GLU B 38  
AA6 3 ARG B 27  ? VAL B 36  ? ARG B 16  VAL B 25  
AA6 4 MET B 75  ? PRO B 78  ? MET B 64  PRO B 67  
AA6 5 LEU B 420 ? THR B 430 ? LEU B 409 THR B 419 
AA6 6 GLU B 449 ? SER B 459 ? GLU B 438 SER B 448 
AA6 7 LYS B 462 ? GLU B 466 ? LYS B 451 GLU B 455 
AA6 8 THR B 469 ? LEU B 470 ? THR B 458 LEU B 459 
AA7 1 GLY B 80  ? ASP B 82  ? GLY B 69  ASP B 71  
AA7 2 THR B 112 ? VAL B 119 ? THR B 101 VAL B 108 
AA7 3 ASP B 145 ? ASP B 151 ? ASP B 134 ASP B 140 
AA7 4 SER B 174 ? TYR B 178 ? SER B 163 TYR B 167 
AA7 5 ILE B 205 ? HIS B 209 ? ILE B 194 HIS B 198 
AA7 6 LEU B 261 ? VAL B 266 ? LEU B 250 VAL B 255 
AA7 7 VAL B 285 ? PRO B 289 ? VAL B 274 PRO B 278 
AA8 1 PRO B 90  ? ASP B 91  ? PRO B 79  ASP B 80  
AA8 2 MET B 94  ? THR B 95  ? MET B 83  THR B 84  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLY A 57  ? O GLY A 46  N ASP A 45  ? N ASP A 34  
AA1 2 3 O MET A 48  ? O MET A 37  N LEU A 28  ? N LEU A 17  
AA1 3 4 N LYS A 31  ? N LYS A 20  O ILE A 69  ? O ILE A 58  
AA2 1 2 O PHE A 42  ? O PHE A 31  N ILE A 35  ? N ILE A 24  
AA2 2 3 N VAL A 36  ? N VAL A 25  O VAL A 76  ? O VAL A 65  
AA2 3 4 N ILE A 77  ? N ILE A 66  O VAL A 421 ? O VAL A 410 
AA2 4 5 N ILE A 422 ? N ILE A 411 O LEU A 455 ? O LEU A 444 
AA2 5 6 N VAL A 457 ? N VAL A 446 O VAL A 464 ? O VAL A 453 
AA2 6 7 N GLU A 466 ? N GLU A 455 O THR A 469 ? O THR A 458 
AA3 1 2 N ASP A 82  ? N ASP A 71  O MET A 114 ? O MET A 103 
AA3 2 3 N ASP A 117 ? N ASP A 106 O HIS A 149 ? O HIS A 138 
AA3 3 4 N VAL A 150 ? N VAL A 139 O SER A 174 ? O SER A 163 
AA3 4 5 N PHE A 175 ? N PHE A 164 O GLN A 207 ? O GLN A 196 
AA3 5 6 N ALA A 206 ? N ALA A 195 O TYR A 262 ? O TYR A 251 
AA3 6 7 N ILE A 263 ? N ILE A 252 O TYR A 286 ? O TYR A 275 
AA4 1 2 N ASP A 91  ? N ASP A 80  O MET A 94  ? O MET A 83  
AA5 1 2 O GLY B 57  ? O GLY B 46  N ASP B 45  ? N ASP B 34  
AA5 2 3 O ILE B 46  ? O ILE B 35  N ILE B 30  ? N ILE B 19  
AA5 3 4 N LYS B 31  ? N LYS B 20  O ILE B 69  ? O ILE B 58  
AA6 1 2 O GLY B 57  ? O GLY B 46  N ASP B 45  ? N ASP B 34  
AA6 2 3 O ILE B 46  ? O ILE B 35  N ILE B 30  ? N ILE B 19  
AA6 3 4 N VAL B 36  ? N VAL B 25  O VAL B 76  ? O VAL B 65  
AA6 4 5 N ILE B 77  ? N ILE B 66  O VAL B 421 ? O VAL B 410 
AA6 5 6 N ILE B 422 ? N ILE B 411 O LEU B 455 ? O LEU B 444 
AA6 6 7 N VAL B 457 ? N VAL B 446 O VAL B 464 ? O VAL B 453 
AA6 7 8 N GLU B 466 ? N GLU B 455 O THR B 469 ? O THR B 458 
AA7 1 2 N ASP B 82  ? N ASP B 71  O MET B 114 ? O MET B 103 
AA7 2 3 N ASP B 117 ? N ASP B 106 O HIS B 149 ? O HIS B 138 
AA7 3 4 N VAL B 150 ? N VAL B 139 O LEU B 176 ? O LEU B 165 
AA7 4 5 N PHE B 175 ? N PHE B 164 O GLN B 207 ? O GLN B 196 
AA7 5 6 N ALA B 206 ? N ALA B 195 O TYR B 262 ? O TYR B 251 
AA7 6 7 N ILE B 263 ? N ILE B 252 O TYR B 286 ? O TYR B 275 
AA8 1 2 N ASP B 91  ? N ASP B 80  O MET B 94  ? O MET B 83  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 501 ? 5  'binding site for residue SO4 A 501' 
AC2 Software A SO4 502 ? 3  'binding site for residue SO4 A 502' 
AC3 Software A SO4 503 ? 7  'binding site for residue SO4 A 503' 
AC4 Software A SO4 504 ? 12 'binding site for residue SO4 A 504' 
AC5 Software A BTB 505 ? 16 'binding site for residue BTB A 505' 
AC6 Software B SO4 501 ? 6  'binding site for residue SO4 B 501' 
AC7 Software B BTB 502 ? 15 'binding site for residue BTB B 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  MET A 94  ? MET A 83   . ? 1_555 ? 
2  AC1 5  THR A 95  ? THR A 84   . ? 1_555 ? 
3  AC1 5  GLN A 351 ? GLN A 340  . ? 1_555 ? 
4  AC1 5  HOH J .   ? HOH A 717  . ? 1_555 ? 
5  AC1 5  ARG B 498 ? ARG B 487  . ? 4_446 ? 
6  AC2 3  ARG A 135 ? ARG A 124  . ? 1_555 ? 
7  AC2 3  HOH J .   ? HOH A 603  . ? 1_555 ? 
8  AC2 3  HOH J .   ? HOH A 915  . ? 1_555 ? 
9  AC3 7  HIS A 300 ? HIS A 289  . ? 1_555 ? 
10 AC3 7  SER A 303 ? SER A 292  . ? 1_555 ? 
11 AC3 7  LYS A 308 ? LYS A 297  . ? 1_555 ? 
12 AC3 7  HOH J .   ? HOH A 664  . ? 1_555 ? 
13 AC3 7  HOH J .   ? HOH A 959  . ? 1_555 ? 
14 AC3 7  HOH J .   ? HOH A 987  . ? 1_555 ? 
15 AC3 7  HOH J .   ? HOH A 1061 . ? 1_555 ? 
16 AC4 12 ARG A 411 ? ARG A 400  . ? 1_555 ? 
17 AC4 12 HOH J .   ? HOH A 619  . ? 1_555 ? 
18 AC4 12 HOH J .   ? HOH A 631  . ? 1_555 ? 
19 AC4 12 HOH J .   ? HOH A 784  . ? 1_555 ? 
20 AC4 12 HOH J .   ? HOH A 862  . ? 1_555 ? 
21 AC4 12 HOH J .   ? HOH A 964  . ? 1_555 ? 
22 AC4 12 HOH J .   ? HOH A 974  . ? 1_555 ? 
23 AC4 12 HOH J .   ? HOH A 978  . ? 1_555 ? 
24 AC4 12 ARG B 411 ? ARG B 400  . ? 1_555 ? 
25 AC4 12 ALA B 413 ? ALA B 402  . ? 1_555 ? 
26 AC4 12 HOH K .   ? HOH B 912  . ? 1_555 ? 
27 AC4 12 HOH K .   ? HOH B 964  . ? 1_555 ? 
28 AC5 16 ARG A 86  ? ARG A 75   . ? 1_555 ? 
29 AC5 16 MET A 89  ? MET A 78   . ? 1_555 ? 
30 AC5 16 PRO A 90  ? PRO A 79   . ? 1_555 ? 
31 AC5 16 ASP A 91  ? ASP A 80   . ? 1_555 ? 
32 AC5 16 TYR A 178 ? TYR A 167  . ? 1_555 ? 
33 AC5 16 PHE A 181 ? PHE A 170  . ? 1_555 ? 
34 AC5 16 ARG A 184 ? ARG A 173  . ? 1_555 ? 
35 AC5 16 PHE A 185 ? PHE A 174  . ? 1_555 ? 
36 AC5 16 GLU A 364 ? GLU A 353  . ? 1_555 ? 
37 AC5 16 HOH J .   ? HOH A 606  . ? 1_555 ? 
38 AC5 16 HOH J .   ? HOH A 629  . ? 1_555 ? 
39 AC5 16 HOH J .   ? HOH A 657  . ? 1_555 ? 
40 AC5 16 HOH J .   ? HOH A 691  . ? 1_555 ? 
41 AC5 16 HOH J .   ? HOH A 714  . ? 1_555 ? 
42 AC5 16 HOH J .   ? HOH A 728  . ? 1_555 ? 
43 AC5 16 HOH J .   ? HOH A 1031 . ? 1_555 ? 
44 AC6 6  HIS B 300 ? HIS B 289  . ? 1_555 ? 
45 AC6 6  SER B 303 ? SER B 292  . ? 1_555 ? 
46 AC6 6  LYS B 308 ? LYS B 297  . ? 1_555 ? 
47 AC6 6  HOH K .   ? HOH B 652  . ? 1_555 ? 
48 AC6 6  HOH K .   ? HOH B 986  . ? 1_555 ? 
49 AC6 6  HOH K .   ? HOH B 1044 . ? 1_555 ? 
50 AC7 15 ARG B 86  ? ARG B 75   . ? 1_555 ? 
51 AC7 15 MET B 89  ? MET B 78   . ? 1_555 ? 
52 AC7 15 PRO B 90  ? PRO B 79   . ? 1_555 ? 
53 AC7 15 ASP B 91  ? ASP B 80   . ? 1_555 ? 
54 AC7 15 TYR B 178 ? TYR B 167  . ? 1_555 ? 
55 AC7 15 PHE B 181 ? PHE B 170  . ? 1_555 ? 
56 AC7 15 ARG B 184 ? ARG B 173  . ? 1_555 ? 
57 AC7 15 PHE B 185 ? PHE B 174  . ? 1_555 ? 
58 AC7 15 GLU B 364 ? GLU B 353  . ? 1_555 ? 
59 AC7 15 HOH K .   ? HOH B 603  . ? 1_555 ? 
60 AC7 15 HOH K .   ? HOH B 637  . ? 1_555 ? 
61 AC7 15 HOH K .   ? HOH B 662  . ? 1_555 ? 
62 AC7 15 HOH K .   ? HOH B 683  . ? 1_555 ? 
63 AC7 15 HOH K .   ? HOH B 713  . ? 1_555 ? 
64 AC7 15 HOH K .   ? HOH B 752  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LXX 
_atom_sites.fract_transf_matrix[1][1]   0.007054 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004501 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010305 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012841 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N    . SER A 1 25  ? -67.140 3.302   11.802  1.00 38.15 ? 14   SER A N    1 
ATOM   2     C CA   . SER A 1 25  ? -67.859 4.490   12.310  1.00 31.71 ? 14   SER A CA   1 
ATOM   3     C C    . SER A 1 25  ? -68.613 5.288   11.233  1.00 38.69 ? 14   SER A C    1 
ATOM   4     O O    . SER A 1 25  ? -68.155 5.558   10.061  1.00 34.30 ? 14   SER A O    1 
ATOM   5     C CB   . SER A 1 25  ? -66.929 5.436   13.133  1.00 32.14 ? 14   SER A CB   1 
ATOM   6     O OG   . SER A 1 25  ? -66.032 6.281   12.335  1.00 31.94 ? 14   SER A OG   1 
ATOM   7     H HA   . SER A 1 25  ? -68.533 4.169   12.929  1.00 38.05 ? 14   SER A HA   1 
ATOM   8     H HB2  . SER A 1 25  ? -67.490 6.016   13.671  1.00 38.57 ? 14   SER A HB2  1 
ATOM   9     H HB3  . SER A 1 25  ? -66.384 4.887   13.719  1.00 38.57 ? 14   SER A HB3  1 
ATOM   10    H HG   . SER A 1 25  ? -65.564 6.761   12.841  1.00 38.33 ? 14   SER A HG   1 
ATOM   11    N N    . ASP A 1 26  ? -69.791 5.697   11.656  1.00 33.38 ? 15   ASP A N    1 
ATOM   12    C CA   . ASP A 1 26  ? -70.557 6.569   10.838  1.00 34.53 ? 15   ASP A CA   1 
ATOM   13    C C    . ASP A 1 26  ? -69.859 7.913   10.828  1.00 29.25 ? 15   ASP A C    1 
ATOM   14    O O    . ASP A 1 26  ? -68.893 8.183   11.562  1.00 31.25 ? 15   ASP A O    1 
ATOM   15    C CB   . ASP A 1 26  ? -72.005 6.742   11.360  1.00 42.66 ? 15   ASP A CB   1 
ATOM   16    C CG   . ASP A 1 26  ? -72.790 5.430   11.497  1.00 49.23 ? 15   ASP A CG   1 
ATOM   17    O OD1  . ASP A 1 26  ? -72.611 4.473   10.706  1.00 46.20 ? 15   ASP A OD1  1 
ATOM   18    O OD2  . ASP A 1 26  ? -73.651 5.388   12.400  1.00 55.29 ? 15   ASP A OD2  1 
ATOM   19    H H    . ASP A 1 26  ? -70.156 5.481   12.404  1.00 40.06 ? 15   ASP A H    1 
ATOM   20    H HA   . ASP A 1 26  ? -70.590 6.226   9.931   1.00 41.44 ? 15   ASP A HA   1 
ATOM   21    H HB2  . ASP A 1 26  ? -71.971 7.158   12.235  1.00 51.19 ? 15   ASP A HB2  1 
ATOM   22    H HB3  . ASP A 1 26  ? -72.491 7.313   10.745  1.00 51.19 ? 15   ASP A HB3  1 
ATOM   23    N N    . ARG A 1 27  ? -70.348 8.741   9.947   1.00 34.33 ? 16   ARG A N    1 
ATOM   24    C CA   . ARG A 1 27  ? -69.928 10.109  9.873   1.00 29.52 ? 16   ARG A CA   1 
ATOM   25    C C    . ARG A 1 27  ? -70.133 10.813  11.213  1.00 23.78 ? 16   ARG A C    1 
ATOM   26    O O    . ARG A 1 27  ? -71.167 10.663  11.873  1.00 26.41 ? 16   ARG A O    1 
ATOM   27    C CB   . ARG A 1 27  ? -70.753 10.729  8.752   1.00 35.89 ? 16   ARG A CB   1 
ATOM   28    C CG   . ARG A 1 27  ? -70.512 9.955   7.467   1.00 41.77 ? 16   ARG A CG   1 
ATOM   29    C CD   . ARG A 1 27  ? -71.590 10.096  6.493   1.00 41.97 ? 16   ARG A CD   1 
ATOM   30    N NE   . ARG A 1 27  ? -71.614 8.886   5.678   1.00 51.54 ? 16   ARG A NE   1 
ATOM   31    C CZ   . ARG A 1 27  ? -72.563 8.595   4.806   1.00 57.22 ? 16   ARG A CZ   1 
ATOM   32    N NH1  . ARG A 1 27  ? -73.567 9.448   4.613   1.00 59.60 ? 16   ARG A NH1  1 
ATOM   33    N NH2  . ARG A 1 27  ? -72.502 7.451   4.125   1.00 63.18 ? 16   ARG A NH2  1 
ATOM   34    H H    . ARG A 1 27  ? -70.943 8.528   9.364   1.00 41.19 ? 16   ARG A H    1 
ATOM   35    H HA   . ARG A 1 27  ? -68.989 10.154  9.635   1.00 35.43 ? 16   ARG A HA   1 
ATOM   36    H HB2  . ARG A 1 27  ? -71.697 10.679  8.973   1.00 43.07 ? 16   ARG A HB2  1 
ATOM   37    H HB3  . ARG A 1 27  ? -70.481 11.651  8.616   1.00 43.07 ? 16   ARG A HB3  1 
ATOM   38    H HG2  . ARG A 1 27  ? -69.695 10.276  7.055   1.00 50.12 ? 16   ARG A HG2  1 
ATOM   39    H HG3  . ARG A 1 27  ? -70.425 9.012   7.680   1.00 50.12 ? 16   ARG A HG3  1 
ATOM   40    H HD2  . ARG A 1 27  ? -72.441 10.187  6.950   1.00 50.36 ? 16   ARG A HD2  1 
ATOM   41    H HD3  . ARG A 1 27  ? -71.420 10.860  5.919   1.00 50.36 ? 16   ARG A HD3  1 
ATOM   42    H HE   . ARG A 1 27  ? -70.969 8.325   5.772   1.00 61.84 ? 16   ARG A HE   1 
ATOM   43    H HH11 . ARG A 1 27  ? -73.601 10.181  5.061   1.00 71.52 ? 16   ARG A HH11 1 
ATOM   44    H HH12 . ARG A 1 27  ? -74.185 9.263   4.044   1.00 71.52 ? 16   ARG A HH12 1 
ATOM   45    H HH21 . ARG A 1 27  ? -71.846 6.910   4.253   1.00 75.81 ? 16   ARG A HH21 1 
ATOM   46    H HH22 . ARG A 1 27  ? -73.111 7.261   3.549   1.00 75.81 ? 16   ARG A HH22 1 
ATOM   47    N N    . LEU A 1 28  ? -69.157 11.619  11.601  1.00 21.57 ? 17   LEU A N    1 
ATOM   48    C CA   . LEU A 1 28  ? -69.290 12.435  12.788  1.00 20.97 ? 17   LEU A CA   1 
ATOM   49    C C    . LEU A 1 28  ? -68.583 13.755  12.529  1.00 19.25 ? 17   LEU A C    1 
ATOM   50    O O    . LEU A 1 28  ? -67.455 13.769  12.025  1.00 18.75 ? 17   LEU A O    1 
ATOM   51    C CB   . LEU A 1 28  ? -68.641 11.727  13.971  1.00 21.19 ? 17   LEU A CB   1 
ATOM   52    C CG   . LEU A 1 28  ? -68.662 12.446  15.319  1.00 20.49 ? 17   LEU A CG   1 
ATOM   53    C CD1  . LEU A 1 28  ? -70.076 12.684  15.832  1.00 22.48 ? 17   LEU A CD1  1 
ATOM   54    C CD2  . LEU A 1 28  ? -67.809 11.591  16.267  1.00 24.71 ? 17   LEU A CD2  1 
ATOM   55    H H    . LEU A 1 28  ? -68.407 11.709  11.191  1.00 25.89 ? 17   LEU A H    1 
ATOM   56    H HA   . LEU A 1 28  ? -70.225 12.602  12.983  1.00 25.17 ? 17   LEU A HA   1 
ATOM   57    H HB2  . LEU A 1 28  ? -69.090 10.877  14.095  1.00 25.42 ? 17   LEU A HB2  1 
ATOM   58    H HB3  . LEU A 1 28  ? -67.710 11.566  13.750  1.00 25.42 ? 17   LEU A HB3  1 
ATOM   59    H HG   . LEU A 1 28  ? -68.229 13.309  15.224  1.00 24.58 ? 17   LEU A HG   1 
ATOM   60    H HD11 . LEU A 1 28  ? -70.029 13.141  16.686  1.00 26.98 ? 17   LEU A HD11 1 
ATOM   61    H HD12 . LEU A 1 28  ? -70.556 13.230  15.190  1.00 26.98 ? 17   LEU A HD12 1 
ATOM   62    H HD13 . LEU A 1 28  ? -70.521 11.829  15.938  1.00 26.98 ? 17   LEU A HD13 1 
ATOM   63    H HD21 . LEU A 1 28  ? -66.909 11.531  15.912  1.00 29.65 ? 17   LEU A HD21 1 
ATOM   64    H HD22 . LEU A 1 28  ? -67.793 12.010  17.142  1.00 29.65 ? 17   LEU A HD22 1 
ATOM   65    H HD23 . LEU A 1 28  ? -68.201 10.706  16.331  1.00 29.65 ? 17   LEU A HD23 1 
ATOM   66    N N    . LEU A 1 29  ? -69.229 14.854  12.880  1.00 19.30 ? 18   LEU A N    1 
ATOM   67    C CA   . LEU A 1 29  ? -68.658 16.184  12.733  1.00 20.63 ? 18   LEU A CA   1 
ATOM   68    C C    . LEU A 1 29  ? -68.532 16.829  14.109  1.00 19.57 ? 18   LEU A C    1 
ATOM   69    O O    . LEU A 1 29  ? -69.492 16.825  14.892  1.00 23.10 ? 18   LEU A O    1 
ATOM   70    C CB   . LEU A 1 29  ? -69.563 17.007  11.800  1.00 24.24 ? 18   LEU A CB   1 
ATOM   71    C CG   . LEU A 1 29  ? -69.153 18.445  11.476  1.00 27.48 ? 18   LEU A CG   1 
ATOM   72    C CD1  . LEU A 1 29  ? -67.815 18.516  10.717  1.00 25.90 ? 18   LEU A CD1  1 
ATOM   73    C CD2  . LEU A 1 29  ? -70.297 19.146  10.692  1.00 31.57 ? 18   LEU A CD2  1 
ATOM   74    H H    . LEU A 1 29  ? -70.021 14.857  13.215  1.00 23.17 ? 18   LEU A H    1 
ATOM   75    H HA   . LEU A 1 29  ? -67.776 16.121  12.336  1.00 24.76 ? 18   LEU A HA   1 
ATOM   76    H HB2  . LEU A 1 29  ? -69.624 16.536  10.954  1.00 29.08 ? 18   LEU A HB2  1 
ATOM   77    H HB3  . LEU A 1 29  ? -70.444 17.050  12.202  1.00 29.08 ? 18   LEU A HB3  1 
ATOM   78    H HG   . LEU A 1 29  ? -69.037 18.925  12.311  1.00 32.98 ? 18   LEU A HG   1 
ATOM   79    H HD11 . LEU A 1 29  ? -67.603 19.445  10.538  1.00 31.09 ? 18   LEU A HD11 1 
ATOM   80    H HD12 . LEU A 1 29  ? -67.121 18.117  11.264  1.00 31.09 ? 18   LEU A HD12 1 
ATOM   81    H HD13 . LEU A 1 29  ? -67.900 18.028  9.882   1.00 31.09 ? 18   LEU A HD13 1 
ATOM   82    H HD21 . LEU A 1 29  ? -70.029 20.056  10.490  1.00 37.88 ? 18   LEU A HD21 1 
ATOM   83    H HD22 . LEU A 1 29  ? -70.459 18.658  9.869   1.00 37.88 ? 18   LEU A HD22 1 
ATOM   84    H HD23 . LEU A 1 29  ? -71.098 19.149  11.238  1.00 37.88 ? 18   LEU A HD23 1 
ATOM   85    N N    . ILE A 1 30  ? -67.351 17.366  14.424  1.00 20.17 ? 19   ILE A N    1 
ATOM   86    C CA   . ILE A 1 30  ? -67.175 18.221  15.596  1.00 19.17 ? 19   ILE A CA   1 
ATOM   87    C C    . ILE A 1 30  ? -66.993 19.629  15.082  1.00 19.96 ? 19   ILE A C    1 
ATOM   88    O O    . ILE A 1 30  ? -66.000 19.938  14.393  1.00 19.90 ? 19   ILE A O    1 
ATOM   89    C CB   . ILE A 1 30  ? -66.000 17.832  16.503  1.00 18.82 ? 19   ILE A CB   1 
ATOM   90    C CG1  . ILE A 1 30  ? -66.153 16.406  17.026  1.00 21.75 ? 19   ILE A CG1  1 
ATOM   91    C CG2  . ILE A 1 30  ? -65.919 18.806  17.699  1.00 21.04 ? 19   ILE A CG2  1 
ATOM   92    C CD1  . ILE A 1 30  ? -64.945 15.942  17.665  1.00 25.52 ? 19   ILE A CD1  1 
ATOM   93    H H    . ILE A 1 30  ? -66.631 17.247  13.970  1.00 24.20 ? 19   ILE A H    1 
ATOM   94    H HA   . ILE A 1 30  ? -67.986 18.197  16.129  1.00 23.00 ? 19   ILE A HA   1 
ATOM   95    H HB   . ILE A 1 30  ? -65.177 17.893  15.993  1.00 22.59 ? 19   ILE A HB   1 
ATOM   96    H HG12 . ILE A 1 30  ? -66.871 16.380  17.678  1.00 26.10 ? 19   ILE A HG12 1 
ATOM   97    H HG13 . ILE A 1 30  ? -66.351 15.813  16.284  1.00 26.10 ? 19   ILE A HG13 1 
ATOM   98    H HG21 . ILE A 1 30  ? -65.173 18.550  18.264  1.00 25.25 ? 19   ILE A HG21 1 
ATOM   99    H HG22 . ILE A 1 30  ? -65.788 19.707  17.364  1.00 25.25 ? 19   ILE A HG22 1 
ATOM   100   H HG23 . ILE A 1 30  ? -66.747 18.757  18.201  1.00 25.25 ? 19   ILE A HG23 1 
ATOM   101   H HD11 . ILE A 1 30  ? -65.084 15.036  17.982  1.00 30.63 ? 19   ILE A HD11 1 
ATOM   102   H HD12 . ILE A 1 30  ? -64.220 15.960  17.020  1.00 30.63 ? 19   ILE A HD12 1 
ATOM   103   H HD13 . ILE A 1 30  ? -64.739 16.526  18.412  1.00 30.63 ? 19   ILE A HD13 1 
ATOM   104   N N    . LYS A 1 31  ? -67.965 20.485  15.391  1.00 21.14 ? 20   LYS A N    1 
ATOM   105   C CA   . LYS A 1 31  ? -67.889 21.865  14.945  1.00 21.99 ? 20   LYS A CA   1 
ATOM   106   C C    . LYS A 1 31  ? -67.431 22.793  16.050  1.00 22.40 ? 20   LYS A C    1 
ATOM   107   O O    . LYS A 1 31  ? -67.804 22.624  17.207  1.00 21.99 ? 20   LYS A O    1 
ATOM   108   C CB   . LYS A 1 31  ? -69.255 22.363  14.482  1.00 24.67 ? 20   LYS A CB   1 
ATOM   109   C CG   . LYS A 1 31  ? -69.731 21.741  13.207  1.00 31.31 ? 20   LYS A CG   1 
ATOM   110   C CD   . LYS A 1 31  ? -70.973 22.445  12.661  1.00 37.05 ? 20   LYS A CD   1 
ATOM   111   C CE   . LYS A 1 31  ? -70.627 23.794  12.029  1.00 52.55 ? 20   LYS A CE   1 
ATOM   112   N NZ   . LYS A 1 31  ? -70.764 24.936  13.007  1.00 63.52 ? 20   LYS A NZ   1 
ATOM   113   H H    . LYS A 1 31  ? -68.666 20.292  15.851  1.00 25.36 ? 20   LYS A H    1 
ATOM   114   H HA   . LYS A 1 31  ? -67.267 21.934  14.204  1.00 26.39 ? 20   LYS A HA   1 
ATOM   115   H HB2  . LYS A 1 31  ? -69.909 22.163  15.170  1.00 29.60 ? 20   LYS A HB2  1 
ATOM   116   H HB3  . LYS A 1 31  ? -69.207 23.322  14.343  1.00 29.60 ? 20   LYS A HB3  1 
ATOM   117   H HG2  . LYS A 1 31  ? -69.029 21.804  12.540  1.00 37.57 ? 20   LYS A HG2  1 
ATOM   118   H HG3  . LYS A 1 31  ? -69.956 20.812  13.370  1.00 37.57 ? 20   LYS A HG3  1 
ATOM   119   H HD2  . LYS A 1 31  ? -71.384 21.888  11.981  1.00 44.46 ? 20   LYS A HD2  1 
ATOM   120   H HD3  . LYS A 1 31  ? -71.597 22.602  13.387  1.00 44.46 ? 20   LYS A HD3  1 
ATOM   121   H HE2  . LYS A 1 31  ? -69.708 23.772  11.717  1.00 63.06 ? 20   LYS A HE2  1 
ATOM   122   H HE3  . LYS A 1 31  ? -71.227 23.960  11.285  1.00 63.06 ? 20   LYS A HE3  1 
ATOM   123   H HZ1  . LYS A 1 31  ? -70.556 25.704  12.609  1.00 76.22 ? 20   LYS A HZ1  1 
ATOM   124   H HZ2  . LYS A 1 31  ? -71.601 24.982  13.305  1.00 76.22 ? 20   LYS A HZ2  1 
ATOM   125   H HZ3  . LYS A 1 31  ? -70.218 24.811  13.699  1.00 76.22 ? 20   LYS A HZ3  1 
ATOM   126   N N    . GLY A 1 32  ? -66.641 23.794  15.666  1.00 21.46 ? 21   GLY A N    1 
ATOM   127   C CA   . GLY A 1 32  ? -66.369 24.908  16.541  1.00 22.98 ? 21   GLY A CA   1 
ATOM   128   C C    . GLY A 1 32  ? -65.312 24.693  17.609  1.00 22.16 ? 21   GLY A C    1 
ATOM   129   O O    . GLY A 1 32  ? -65.188 25.533  18.511  1.00 25.60 ? 21   GLY A O    1 
ATOM   130   H H    . GLY A 1 32  ? -66.254 23.844  14.900  1.00 25.75 ? 21   GLY A H    1 
ATOM   131   H HA2  . GLY A 1 32  ? -66.089 25.663  16.000  1.00 27.57 ? 21   GLY A HA2  1 
ATOM   132   H HA3  . GLY A 1 32  ? -67.192 25.156  16.990  1.00 27.57 ? 21   GLY A HA3  1 
ATOM   133   N N    . GLY A 1 33  ? -64.552 23.618  17.540  1.00 20.12 ? 22   GLY A N    1 
ATOM   134   C CA   . GLY A 1 33  ? -63.552 23.334  18.539  1.00 21.07 ? 22   GLY A CA   1 
ATOM   135   C C    . GLY A 1 33  ? -62.230 24.055  18.279  1.00 18.77 ? 22   GLY A C    1 
ATOM   136   O O    . GLY A 1 33  ? -61.929 24.546  17.193  1.00 19.17 ? 22   GLY A O    1 
ATOM   137   H H    . GLY A 1 33  ? -64.598 23.030  16.914  1.00 24.15 ? 22   GLY A H    1 
ATOM   138   H HA2  . GLY A 1 33  ? -63.882 23.605  19.410  1.00 25.28 ? 22   GLY A HA2  1 
ATOM   139   H HA3  . GLY A 1 33  ? -63.380 22.380  18.560  1.00 25.28 ? 22   GLY A HA3  1 
ATOM   140   N N    . LYS A 1 34  ? -61.406 24.056  19.320  1.00 17.20 ? 23   LYS A N    1 
ATOM   141   C CA   . LYS A 1 34  ? -60.015 24.494  19.239  1.00 16.50 ? 23   LYS A CA   1 
ATOM   142   C C    . LYS A 1 34  ? -59.132 23.262  19.240  1.00 15.17 ? 23   LYS A C    1 
ATOM   143   O O    . LYS A 1 34  ? -58.996 22.597  20.274  1.00 16.18 ? 23   LYS A O    1 
ATOM   144   C CB   . LYS A 1 34  ? -59.669 25.380  20.421  1.00 17.72 ? 23   LYS A CB   1 
ATOM   145   C CG   . LYS A 1 34  ? -58.316 26.011  20.290  1.00 19.70 ? 23   LYS A CG   1 
ATOM   146   C CD   . LYS A 1 34  ? -57.857 26.711  21.557  1.00 20.24 ? 23   LYS A CD   1 
ATOM   147   C CE   . LYS A 1 34  ? -57.373 25.742  22.586  1.00 21.03 ? 23   LYS A CE   1 
ATOM   148   N NZ   . LYS A 1 34  ? -57.015 26.399  23.910  1.00 22.31 ? 23   LYS A NZ   1 
ATOM   149   H H    . LYS A 1 34  ? -61.635 23.799  20.108  1.00 20.64 ? 23   LYS A H    1 
ATOM   150   H HA   . LYS A 1 34  ? -59.869 24.988  18.418  1.00 19.80 ? 23   LYS A HA   1 
ATOM   151   H HB2  . LYS A 1 34  ? -60.326 26.090  20.488  1.00 21.26 ? 23   LYS A HB2  1 
ATOM   152   H HB3  . LYS A 1 34  ? -59.673 24.845  21.230  1.00 21.26 ? 23   LYS A HB3  1 
ATOM   153   H HG2  . LYS A 1 34  ? -57.666 25.323  20.078  1.00 23.64 ? 23   LYS A HG2  1 
ATOM   154   H HG3  . LYS A 1 34  ? -58.344 26.670  19.579  1.00 23.64 ? 23   LYS A HG3  1 
ATOM   155   H HD2  . LYS A 1 34  ? -57.128 27.314  21.342  1.00 24.29 ? 23   LYS A HD2  1 
ATOM   156   H HD3  . LYS A 1 34  ? -58.601 27.207  21.934  1.00 24.29 ? 23   LYS A HD3  1 
ATOM   157   H HE2  . LYS A 1 34  ? -58.070 25.089  22.756  1.00 25.23 ? 23   LYS A HE2  1 
ATOM   158   H HE3  . LYS A 1 34  ? -56.579 25.298  22.250  1.00 25.23 ? 23   LYS A HE3  1 
ATOM   159   H HZ1  . LYS A 1 34  ? -57.729 26.809  24.249  1.00 26.78 ? 23   LYS A HZ1  1 
ATOM   160   H HZ2  . LYS A 1 34  ? -56.733 25.784  24.489  1.00 26.78 ? 23   LYS A HZ2  1 
ATOM   161   H HZ3  . LYS A 1 34  ? -56.369 26.999  23.787  1.00 26.78 ? 23   LYS A HZ3  1 
ATOM   162   N N    . ILE A 1 35  ? -58.625 22.905  18.063  1.00 14.56 ? 24   ILE A N    1 
ATOM   163   C CA   . ILE A 1 35  ? -57.708 21.768  17.958  1.00 15.03 ? 24   ILE A CA   1 
ATOM   164   C C    . ILE A 1 35  ? -56.413 22.087  18.684  1.00 13.61 ? 24   ILE A C    1 
ATOM   165   O O    . ILE A 1 35  ? -55.800 23.143  18.473  1.00 15.59 ? 24   ILE A O    1 
ATOM   166   C CB   . ILE A 1 35  ? -57.446 21.456  16.482  1.00 15.46 ? 24   ILE A CB   1 
ATOM   167   C CG1  . ILE A 1 35  ? -58.743 20.957  15.867  1.00 19.61 ? 24   ILE A CG1  1 
ATOM   168   C CG2  . ILE A 1 35  ? -56.347 20.389  16.352  1.00 18.07 ? 24   ILE A CG2  1 
ATOM   169   C CD1  . ILE A 1 35  ? -58.724 20.736  14.380  1.00 21.16 ? 24   ILE A CD1  1 
ATOM   170   H H    . ILE A 1 35  ? -58.792 23.299  17.317  1.00 17.47 ? 24   ILE A H    1 
ATOM   171   H HA   . ILE A 1 35  ? -58.109 20.987  18.372  1.00 18.03 ? 24   ILE A HA   1 
ATOM   172   H HB   . ILE A 1 35  ? -57.165 22.265  16.028  1.00 18.55 ? 24   ILE A HB   1 
ATOM   173   H HG12 . ILE A 1 35  ? -58.972 20.111  16.282  1.00 23.53 ? 24   ILE A HG12 1 
ATOM   174   H HG13 . ILE A 1 35  ? -59.439 21.606  16.053  1.00 23.53 ? 24   ILE A HG13 1 
ATOM   175   H HG21 . ILE A 1 35  ? -56.195 20.206  15.411  1.00 21.69 ? 24   ILE A HG21 1 
ATOM   176   H HG22 . ILE A 1 35  ? -55.532 20.724  16.759  1.00 21.69 ? 24   ILE A HG22 1 
ATOM   177   H HG23 . ILE A 1 35  ? -56.635 19.582  16.805  1.00 21.69 ? 24   ILE A HG23 1 
ATOM   178   H HD11 . ILE A 1 35  ? -59.597 20.420  14.097  1.00 25.40 ? 24   ILE A HD11 1 
ATOM   179   H HD12 . ILE A 1 35  ? -58.516 21.575  13.939  1.00 25.40 ? 24   ILE A HD12 1 
ATOM   180   H HD13 . ILE A 1 35  ? -58.048 20.074  14.168  1.00 25.40 ? 24   ILE A HD13 1 
ATOM   181   N N    . VAL A 1 36  ? -56.015 21.188  19.545  1.00 13.60 ? 25   VAL A N    1 
ATOM   182   C CA   . VAL A 1 36  ? -54.788 21.305  20.308  1.00 13.53 ? 25   VAL A CA   1 
ATOM   183   C C    . VAL A 1 36  ? -53.920 20.103  19.973  1.00 13.68 ? 25   VAL A C    1 
ATOM   184   O O    . VAL A 1 36  ? -54.150 19.005  20.490  1.00 13.43 ? 25   VAL A O    1 
ATOM   185   C CB   . VAL A 1 36  ? -55.046 21.393  21.808  1.00 14.20 ? 25   VAL A CB   1 
ATOM   186   C CG1  . VAL A 1 36  ? -53.733 21.480  22.597  1.00 15.30 ? 25   VAL A CG1  1 
ATOM   187   C CG2  . VAL A 1 36  ? -55.955 22.581  22.133  1.00 16.84 ? 25   VAL A CG2  1 
ATOM   188   H H    . VAL A 1 36  ? -56.454 20.468  19.716  1.00 16.32 ? 25   VAL A H    1 
ATOM   189   H HA   . VAL A 1 36  ? -54.316 22.106  20.033  1.00 16.23 ? 25   VAL A HA   1 
ATOM   190   H HB   . VAL A 1 36  ? -55.505 20.587  22.091  1.00 17.05 ? 25   VAL A HB   1 
ATOM   191   H HG11 . VAL A 1 36  ? -53.938 21.534  23.544  1.00 18.36 ? 25   VAL A HG11 1 
ATOM   192   H HG12 . VAL A 1 36  ? -53.205 20.686  22.418  1.00 18.36 ? 25   VAL A HG12 1 
ATOM   193   H HG13 . VAL A 1 36  ? -53.248 22.271  22.317  1.00 18.36 ? 25   VAL A HG13 1 
ATOM   194   H HG21 . VAL A 1 36  ? -56.102 22.613  23.091  1.00 20.20 ? 25   VAL A HG21 1 
ATOM   195   H HG22 . VAL A 1 36  ? -55.524 23.398  21.836  1.00 20.20 ? 25   VAL A HG22 1 
ATOM   196   H HG23 . VAL A 1 36  ? -56.801 22.466  21.672  1.00 20.20 ? 25   VAL A HG23 1 
ATOM   197   N N    . ASN A 1 37  ? -52.928 20.293  19.079  1.00 13.03 ? 26   ASN A N    1 
ATOM   198   C CA   . ASN A 1 37  ? -51.949 19.252  18.836  1.00 12.93 ? 26   ASN A CA   1 
ATOM   199   C C    . ASN A 1 37  ? -50.700 19.586  19.635  1.00 12.03 ? 26   ASN A C    1 
ATOM   200   O O    . ASN A 1 37  ? -50.652 20.581  20.337  1.00 13.27 ? 26   ASN A O    1 
ATOM   201   C CB   . ASN A 1 37  ? -51.662 19.161  17.329  1.00 12.23 ? 26   ASN A CB   1 
ATOM   202   C CG   . ASN A 1 37  ? -52.702 18.387  16.601  1.00 13.26 ? 26   ASN A CG   1 
ATOM   203   O OD1  . ASN A 1 37  ? -53.252 17.399  17.130  1.00 14.11 ? 26   ASN A OD1  1 
ATOM   204   N ND2  . ASN A 1 37  ? -53.009 18.840  15.390  1.00 14.50 ? 26   ASN A ND2  1 
ATOM   205   H H    . ASN A 1 37  ? -52.813 21.008  18.615  1.00 15.63 ? 26   ASN A H    1 
ATOM   206   H HA   . ASN A 1 37  ? -52.295 18.399  19.140  1.00 15.52 ? 26   ASN A HA   1 
ATOM   207   H HB2  . ASN A 1 37  ? -51.636 20.056  16.956  1.00 14.67 ? 26   ASN A HB2  1 
ATOM   208   H HB3  . ASN A 1 37  ? -50.809 18.719  17.195  1.00 14.67 ? 26   ASN A HB3  1 
ATOM   209   H HD21 . ASN A 1 37  ? -53.604 18.435  14.918  1.00 17.40 ? 26   ASN A HD21 1 
ATOM   210   H HD22 . ASN A 1 37  ? -52.613 19.536  15.078  1.00 17.40 ? 26   ASN A HD22 1 
ATOM   211   N N    . ASP A 1 38  ? -49.647 18.779  19.497  1.00 12.16 ? 27   ASP A N    1 
ATOM   212   C CA   . ASP A 1 38  ? -48.466 19.059  20.286  1.00 11.75 ? 27   ASP A CA   1 
ATOM   213   C C    . ASP A 1 38  ? -47.675 20.251  19.757  1.00 12.66 ? 27   ASP A C    1 
ATOM   214   O O    . ASP A 1 38  ? -46.881 20.837  20.517  1.00 13.64 ? 27   ASP A O    1 
ATOM   215   C CB   . ASP A 1 38  ? -47.553 17.856  20.485  1.00 12.68 ? 27   ASP A CB   1 
ATOM   216   C CG   . ASP A 1 38  ? -46.773 17.487  19.271  1.00 14.95 ? 27   ASP A CG   1 
ATOM   217   O OD1  . ASP A 1 38  ? -47.361 17.384  18.177  1.00 13.90 ? 27   ASP A OD1  1 
ATOM   218   O OD2  . ASP A 1 38  ? -45.524 17.294  19.415  1.00 19.78 ? 27   ASP A OD2  1 
ATOM   219   H H    . ASP A 1 38  ? -49.596 18.096  18.976  1.00 14.59 ? 27   ASP A H    1 
ATOM   220   H HA   . ASP A 1 38  ? -48.771 19.312  21.171  1.00 14.11 ? 27   ASP A HA   1 
ATOM   221   H HB2  . ASP A 1 38  ? -46.921 18.057  21.194  1.00 15.21 ? 27   ASP A HB2  1 
ATOM   222   H HB3  . ASP A 1 38  ? -48.094 17.091  20.735  1.00 15.21 ? 27   ASP A HB3  1 
ATOM   223   N N    . ASP A 1 39  ? -47.895 20.627  18.500  1.00 11.75 ? 28   ASP A N    1 
ATOM   224   C CA   . ASP A 1 39  ? -47.089 21.657  17.856  1.00 13.82 ? 28   ASP A CA   1 
ATOM   225   C C    . ASP A 1 39  ? -47.754 23.019  17.793  1.00 13.59 ? 28   ASP A C    1 
ATOM   226   O O    . ASP A 1 39  ? -47.050 24.012  17.612  1.00 14.84 ? 28   ASP A O    1 
ATOM   227   C CB   . ASP A 1 39  ? -46.692 21.261  16.437  1.00 12.54 ? 28   ASP A CB   1 
ATOM   228   C CG   . ASP A 1 39  ? -47.868 21.007  15.490  1.00 13.63 ? 28   ASP A CG   1 
ATOM   229   O OD1  . ASP A 1 39  ? -48.887 20.446  15.937  1.00 13.81 ? 28   ASP A OD1  1 
ATOM   230   O OD2  . ASP A 1 39  ? -47.776 21.370  14.268  1.00 15.02 ? 28   ASP A OD2  1 
ATOM   231   H H    . ASP A 1 39  ? -48.509 20.299  17.996  1.00 14.10 ? 28   ASP A H    1 
ATOM   232   H HA   . ASP A 1 39  ? -46.270 21.761  18.365  1.00 16.58 ? 28   ASP A HA   1 
ATOM   233   H HB2  . ASP A 1 39  ? -46.156 21.973  16.055  1.00 15.05 ? 28   ASP A HB2  1 
ATOM   234   H HB3  . ASP A 1 39  ? -46.168 20.446  16.479  1.00 15.05 ? 28   ASP A HB3  1 
ATOM   235   N N    A GLN A 1 40  ? -49.069 23.085  17.979  0.51 12.69 ? 29   GLN A N    1 
ATOM   236   N N    B GLN A 1 40  ? -49.092 23.078  17.838  0.49 14.39 ? 29   GLN A N    1 
ATOM   237   C CA   A GLN A 1 40  ? -49.813 24.335  17.935  0.51 14.26 ? 29   GLN A CA   1 
ATOM   238   C CA   B GLN A 1 40  ? -49.878 24.294  17.609  0.49 13.82 ? 29   GLN A CA   1 
ATOM   239   C C    A GLN A 1 40  ? -51.262 24.008  18.230  0.51 12.61 ? 29   GLN A C    1 
ATOM   240   C C    B GLN A 1 40  ? -51.319 24.014  18.001  0.49 15.20 ? 29   GLN A C    1 
ATOM   241   O O    A GLN A 1 40  ? -51.663 22.841  18.302  0.51 11.47 ? 29   GLN A O    1 
ATOM   242   O O    B GLN A 1 40  ? -51.772 22.870  17.936  0.49 15.54 ? 29   GLN A O    1 
ATOM   243   C CB   A GLN A 1 40  ? -49.745 25.022  16.581  0.51 13.03 ? 29   GLN A CB   1 
ATOM   244   C CB   B GLN A 1 40  ? -49.825 24.758  16.137  0.49 16.72 ? 29   GLN A CB   1 
ATOM   245   C CG   A GLN A 1 40  ? -50.260 24.137  15.464  0.51 10.49 ? 29   GLN A CG   1 
ATOM   246   C CG   B GLN A 1 40  ? -50.250 23.701  15.109  0.49 19.18 ? 29   GLN A CG   1 
ATOM   247   C CD   A GLN A 1 40  ? -50.521 24.870  14.169  0.51 15.47 ? 29   GLN A CD   1 
ATOM   248   C CD   B GLN A 1 40  ? -50.090 24.154  13.645  0.49 18.93 ? 29   GLN A CD   1 
ATOM   249   O OE1  A GLN A 1 40  ? -50.505 26.102  14.097  0.51 21.53 ? 29   GLN A OE1  1 
ATOM   250   O OE1  B GLN A 1 40  ? -49.504 23.432  12.804  0.49 23.79 ? 29   GLN A OE1  1 
ATOM   251   N NE2  A GLN A 1 40  ? -50.796 24.109  13.142  0.51 19.73 ? 29   GLN A NE2  1 
ATOM   252   N NE2  B GLN A 1 40  ? -50.594 25.346  13.336  0.49 13.99 ? 29   GLN A NE2  1 
ATOM   253   H H    A GLN A 1 40  ? -49.563 22.399  18.137  0.51 15.23 ? 29   GLN A H    1 
ATOM   254   H H    B GLN A 1 40  ? -49.584 22.393  18.007  0.49 17.27 ? 29   GLN A H    1 
ATOM   255   H HA   A GLN A 1 40  ? -49.482 24.942  18.615  0.51 17.11 ? 29   GLN A HA   1 
ATOM   256   H HA   B GLN A 1 40  ? -49.539 25.009  18.169  0.49 16.59 ? 29   GLN A HA   1 
ATOM   257   H HB2  A GLN A 1 40  ? -50.287 25.826  16.604  0.51 15.64 ? 29   GLN A HB2  1 
ATOM   258   H HB2  B GLN A 1 40  ? -50.415 25.521  16.033  0.49 20.06 ? 29   GLN A HB2  1 
ATOM   259   H HB3  A GLN A 1 40  ? -48.822 25.248  16.385  0.51 15.64 ? 29   GLN A HB3  1 
ATOM   260   H HB3  B GLN A 1 40  ? -48.915 25.019  15.928  0.49 20.06 ? 29   GLN A HB3  1 
ATOM   261   H HG2  A GLN A 1 40  ? -49.604 23.446  15.286  0.51 12.59 ? 29   GLN A HG2  1 
ATOM   262   H HG2  B GLN A 1 40  ? -49.707 22.907  15.234  0.49 23.02 ? 29   GLN A HG2  1 
ATOM   263   H HG3  A GLN A 1 40  ? -51.095 23.732  15.748  0.51 12.59 ? 29   GLN A HG3  1 
ATOM   264   H HG3  B GLN A 1 40  ? -51.185 23.485  15.252  0.49 23.02 ? 29   GLN A HG3  1 
ATOM   265   H HE21 A GLN A 1 40  ? -50.819 23.254  13.233  0.51 23.68 ? 29   GLN A HE21 1 
ATOM   266   H HE21 B GLN A 1 40  ? -50.983 25.818  13.940  0.49 16.79 ? 29   GLN A HE21 1 
ATOM   267   H HE22 A GLN A 1 40  ? -50.955 24.464  12.374  0.51 23.68 ? 29   GLN A HE22 1 
ATOM   268   H HE22 B GLN A 1 40  ? -50.530 25.644  12.532  0.49 16.79 ? 29   GLN A HE22 1 
ATOM   269   N N    . SER A 1 41  ? -52.041 25.075  18.365  1.00 15.68 ? 30   SER A N    1 
ATOM   270   C CA   . SER A 1 41  ? -53.491 25.022  18.513  1.00 15.10 ? 30   SER A CA   1 
ATOM   271   C C    . SER A 1 41  ? -54.114 25.932  17.461  1.00 16.06 ? 30   SER A C    1 
ATOM   272   O O    . SER A 1 41  ? -53.538 26.980  17.120  1.00 19.67 ? 30   SER A O    1 
ATOM   273   C CB   . SER A 1 41  ? -53.905 25.526  19.897  1.00 17.10 ? 30   SER A CB   1 
ATOM   274   O OG   . SER A 1 41  ? -53.337 24.718  20.922  1.00 16.03 ? 30   SER A OG   1 
ATOM   275   H H    . SER A 1 41  ? -51.727 25.869  18.455  1.00 18.82 ? 30   SER A H    1 
ATOM   276   H HA   . SER A 1 41  ? -53.813 24.116  18.389  1.00 18.12 ? 30   SER A HA   1 
ATOM   277   H HB2  . SER A 1 41  ? -53.594 26.439  20.006  1.00 20.52 ? 30   SER A HB2  1 
ATOM   278   H HB3  . SER A 1 41  ? -54.871 25.494  19.969  1.00 20.52 ? 30   SER A HB3  1 
ATOM   279   H HG   . SER A 1 41  ? -53.597 23.924  20.839  1.00 19.23 ? 30   SER A HG   1 
ATOM   280   N N    . PHE A 1 42  ? -55.305 25.562  16.974  1.00 16.86 ? 31   PHE A N    1 
ATOM   281   C CA   . PHE A 1 42  ? -56.005 26.374  15.974  1.00 17.03 ? 31   PHE A CA   1 
ATOM   282   C C    . PHE A 1 42  ? -57.470 25.979  15.972  1.00 17.87 ? 31   PHE A C    1 
ATOM   283   O O    . PHE A 1 42  ? -57.832 24.866  16.351  1.00 18.24 ? 31   PHE A O    1 
ATOM   284   C CB   . PHE A 1 42  ? -55.373 26.221  14.574  1.00 18.13 ? 31   PHE A CB   1 
ATOM   285   C CG   . PHE A 1 42  ? -55.374 24.815  14.055  1.00 18.80 ? 31   PHE A CG   1 
ATOM   286   C CD1  . PHE A 1 42  ? -54.376 23.934  14.398  1.00 18.90 ? 31   PHE A CD1  1 
ATOM   287   C CD2  . PHE A 1 42  ? -56.359 24.392  13.187  1.00 18.75 ? 31   PHE A CD2  1 
ATOM   288   C CE1  . PHE A 1 42  ? -54.389 22.653  13.922  1.00 19.93 ? 31   PHE A CE1  1 
ATOM   289   C CE2  . PHE A 1 42  ? -56.377 23.089  12.707  1.00 21.13 ? 31   PHE A CE2  1 
ATOM   290   C CZ   . PHE A 1 42  ? -55.362 22.223  13.069  1.00 22.39 ? 31   PHE A CZ   1 
ATOM   291   H H    . PHE A 1 42  ? -55.726 24.849  17.206  1.00 20.23 ? 31   PHE A H    1 
ATOM   292   H HA   . PHE A 1 42  ? -55.946 27.308  16.229  1.00 20.43 ? 31   PHE A HA   1 
ATOM   293   H HB2  . PHE A 1 42  ? -55.870 26.769  13.946  1.00 21.76 ? 31   PHE A HB2  1 
ATOM   294   H HB3  . PHE A 1 42  ? -54.451 26.522  14.613  1.00 21.76 ? 31   PHE A HB3  1 
ATOM   295   H HD1  . PHE A 1 42  ? -53.702 24.204  14.978  1.00 22.68 ? 31   PHE A HD1  1 
ATOM   296   H HD2  . PHE A 1 42  ? -57.040 24.979  12.946  1.00 22.50 ? 31   PHE A HD2  1 
ATOM   297   H HE1  . PHE A 1 42  ? -53.709 22.069  14.169  1.00 23.92 ? 31   PHE A HE1  1 
ATOM   298   H HE2  . PHE A 1 42  ? -57.047 22.811  12.125  1.00 25.36 ? 31   PHE A HE2  1 
ATOM   299   H HZ   . PHE A 1 42  ? -55.355 21.349  12.752  1.00 26.87 ? 31   PHE A HZ   1 
ATOM   300   N N    . TYR A 1 43  ? -58.307 26.888  15.496  1.00 18.84 ? 32   TYR A N    1 
ATOM   301   C CA   . TYR A 1 43  ? -59.741 26.638  15.414  1.00 18.70 ? 32   TYR A CA   1 
ATOM   302   C C    . TYR A 1 43  ? -60.109 26.024  14.072  1.00 21.64 ? 32   TYR A C    1 
ATOM   303   O O    . TYR A 1 43  ? -59.771 26.564  13.016  1.00 22.16 ? 32   TYR A O    1 
ATOM   304   C CB   . TYR A 1 43  ? -60.500 27.939  15.629  1.00 22.74 ? 32   TYR A CB   1 
ATOM   305   C CG   . TYR A 1 43  ? -60.364 28.447  17.034  1.00 22.91 ? 32   TYR A CG   1 
ATOM   306   C CD1  . TYR A 1 43  ? -61.187 27.977  18.051  1.00 21.47 ? 32   TYR A CD1  1 
ATOM   307   C CD2  . TYR A 1 43  ? -59.380 29.349  17.375  1.00 26.22 ? 32   TYR A CD2  1 
ATOM   308   C CE1  . TYR A 1 43  ? -61.062 28.422  19.326  1.00 23.88 ? 32   TYR A CE1  1 
ATOM   309   C CE2  . TYR A 1 43  ? -59.238 29.782  18.682  1.00 29.10 ? 32   TYR A CE2  1 
ATOM   310   C CZ   . TYR A 1 43  ? -60.079 29.312  19.646  1.00 27.37 ? 32   TYR A CZ   1 
ATOM   311   O OH   . TYR A 1 43  ? -59.941 29.736  20.944  1.00 30.83 ? 32   TYR A OH   1 
ATOM   312   H H    . TYR A 1 43  ? -58.070 27.664  15.211  1.00 22.61 ? 32   TYR A H    1 
ATOM   313   H HA   . TYR A 1 43  ? -59.998 26.017  16.114  1.00 22.44 ? 32   TYR A HA   1 
ATOM   314   H HB2  . TYR A 1 43  ? -60.150 28.615  15.028  1.00 27.29 ? 32   TYR A HB2  1 
ATOM   315   H HB3  . TYR A 1 43  ? -61.443 27.790  15.452  1.00 27.29 ? 32   TYR A HB3  1 
ATOM   316   H HD1  . TYR A 1 43  ? -61.858 27.367  17.847  1.00 25.77 ? 32   TYR A HD1  1 
ATOM   317   H HD2  . TYR A 1 43  ? -58.802 29.668  16.721  1.00 31.46 ? 32   TYR A HD2  1 
ATOM   318   H HE1  . TYR A 1 43  ? -61.625 28.094  19.989  1.00 28.66 ? 32   TYR A HE1  1 
ATOM   319   H HE2  . TYR A 1 43  ? -58.575 30.396  18.901  1.00 34.92 ? 32   TYR A HE2  1 
ATOM   320   H HH   . TYR A 1 43  ? -59.302 30.279  21.003  1.00 37.00 ? 32   TYR A HH   1 
ATOM   321   N N    . ALA A 1 44  ? -60.833 24.914  14.111  1.00 19.01 ? 33   ALA A N    1 
ATOM   322   C CA   . ALA A 1 44  ? -61.305 24.307  12.869  1.00 20.06 ? 33   ALA A CA   1 
ATOM   323   C C    . ALA A 1 44  ? -62.327 23.256  13.240  1.00 20.96 ? 33   ALA A C    1 
ATOM   324   O O    . ALA A 1 44  ? -62.306 22.741  14.358  1.00 20.73 ? 33   ALA A O    1 
ATOM   325   C CB   . ALA A 1 44  ? -60.128 23.656  12.122  1.00 19.56 ? 33   ALA A CB   1 
ATOM   326   H H    . ALA A 1 44  ? -61.063 24.497  14.828  1.00 22.81 ? 33   ALA A H    1 
ATOM   327   H HA   . ALA A 1 44  ? -61.720 24.975  12.301  1.00 24.07 ? 33   ALA A HA   1 
ATOM   328   H HB1  . ALA A 1 44  ? -60.456 23.258  11.301  1.00 23.48 ? 33   ALA A HB1  1 
ATOM   329   H HB2  . ALA A 1 44  ? -59.467 24.337  11.919  1.00 23.48 ? 33   ALA A HB2  1 
ATOM   330   H HB3  . ALA A 1 44  ? -59.735 22.972  12.687  1.00 23.48 ? 33   ALA A HB3  1 
ATOM   331   N N    . ASP A 1 45  ? -63.194 22.926  12.279  1.00 19.39 ? 34   ASP A N    1 
ATOM   332   C CA   . ASP A 1 45  ? -64.109 21.793  12.375  1.00 17.34 ? 34   ASP A CA   1 
ATOM   333   C C    . ASP A 1 45  ? -63.378 20.503  12.005  1.00 18.15 ? 34   ASP A C    1 
ATOM   334   O O    . ASP A 1 45  ? -62.389 20.514  11.271  1.00 18.62 ? 34   ASP A O    1 
ATOM   335   C CB   . ASP A 1 45  ? -65.320 21.965  11.435  1.00 18.97 ? 34   ASP A CB   1 
ATOM   336   C CG   . ASP A 1 45  ? -66.183 23.179  11.760  1.00 24.59 ? 34   ASP A CG   1 
ATOM   337   O OD1  . ASP A 1 45  ? -66.061 23.782  12.859  1.00 23.34 ? 34   ASP A OD1  1 
ATOM   338   O OD2  . ASP A 1 45  ? -67.011 23.505  10.867  1.00 28.22 ? 34   ASP A OD2  1 
ATOM   339   H H    . ASP A 1 45  ? -63.271 23.360  11.541  1.00 23.27 ? 34   ASP A H    1 
ATOM   340   H HA   . ASP A 1 45  ? -64.434 21.714  13.285  1.00 20.81 ? 34   ASP A HA   1 
ATOM   341   H HB2  . ASP A 1 45  ? -64.998 22.065  10.525  1.00 22.76 ? 34   ASP A HB2  1 
ATOM   342   H HB3  . ASP A 1 45  ? -65.881 21.176  11.500  1.00 22.76 ? 34   ASP A HB3  1 
ATOM   343   N N    . ILE A 1 46  ? -63.881 19.380  12.515  1.00 17.55 ? 35   ILE A N    1 
ATOM   344   C CA   . ILE A 1 46  ? -63.282 18.069  12.276  1.00 16.75 ? 35   ILE A CA   1 
ATOM   345   C C    . ILE A 1 46  ? -64.369 17.113  11.795  1.00 17.15 ? 35   ILE A C    1 
ATOM   346   O O    . ILE A 1 46  ? -65.370 16.906  12.487  1.00 18.87 ? 35   ILE A O    1 
ATOM   347   C CB   . ILE A 1 46  ? -62.666 17.475  13.549  1.00 16.48 ? 35   ILE A CB   1 
ATOM   348   C CG1  . ILE A 1 46  ? -61.697 18.439  14.221  1.00 17.28 ? 35   ILE A CG1  1 
ATOM   349   C CG2  . ILE A 1 46  ? -61.964 16.164  13.214  1.00 17.23 ? 35   ILE A CG2  1 
ATOM   350   C CD1  . ILE A 1 46  ? -61.459 18.113  15.666  1.00 18.84 ? 35   ILE A CD1  1 
ATOM   351   H H    . ILE A 1 46  ? -64.582 19.352  13.012  1.00 21.06 ? 35   ILE A H    1 
ATOM   352   H HA   . ILE A 1 46  ? -62.596 18.136  11.594  1.00 20.10 ? 35   ILE A HA   1 
ATOM   353   H HB   . ILE A 1 46  ? -63.384 17.284  14.172  1.00 19.77 ? 35   ILE A HB   1 
ATOM   354   H HG12 . ILE A 1 46  ? -60.844 18.402  13.761  1.00 20.73 ? 35   ILE A HG12 1 
ATOM   355   H HG13 . ILE A 1 46  ? -62.061 19.337  14.172  1.00 20.73 ? 35   ILE A HG13 1 
ATOM   356   H HG21 . ILE A 1 46  ? -61.578 15.797  14.024  1.00 20.68 ? 35   ILE A HG21 1 
ATOM   357   H HG22 . ILE A 1 46  ? -62.613 15.544  12.846  1.00 20.68 ? 35   ILE A HG22 1 
ATOM   358   H HG23 . ILE A 1 46  ? -61.266 16.338  12.563  1.00 20.68 ? 35   ILE A HG23 1 
ATOM   359   H HD11 . ILE A 1 46  ? -60.837 18.759  16.037  1.00 22.61 ? 35   ILE A HD11 1 
ATOM   360   H HD12 . ILE A 1 46  ? -62.303 18.155  16.142  1.00 22.61 ? 35   ILE A HD12 1 
ATOM   361   H HD13 . ILE A 1 46  ? -61.086 17.220  15.731  1.00 22.61 ? 35   ILE A HD13 1 
ATOM   362   N N    . TYR A 1 47  ? -64.159 16.505  10.643  1.00 16.87 ? 36   TYR A N    1 
ATOM   363   C CA   . TYR A 1 47  ? -65.084 15.536  10.086  1.00 17.50 ? 36   TYR A CA   1 
ATOM   364   C C    . TYR A 1 47  ? -64.397 14.178  10.041  1.00 18.47 ? 36   TYR A C    1 
ATOM   365   O O    . TYR A 1 47  ? -63.269 14.051  9.531   1.00 18.35 ? 36   TYR A O    1 
ATOM   366   C CB   . TYR A 1 47  ? -65.514 15.963  8.679   1.00 18.77 ? 36   TYR A CB   1 
ATOM   367   C CG   . TYR A 1 47  ? -66.424 14.959  8.027   1.00 21.92 ? 36   TYR A CG   1 
ATOM   368   C CD1  . TYR A 1 47  ? -67.648 14.637  8.592   1.00 21.71 ? 36   TYR A CD1  1 
ATOM   369   C CD2  . TYR A 1 47  ? -66.042 14.291  6.875   1.00 25.43 ? 36   TYR A CD2  1 
ATOM   370   C CE1  . TYR A 1 47  ? -68.453 13.714  8.040   1.00 25.82 ? 36   TYR A CE1  1 
ATOM   371   C CE2  . TYR A 1 47  ? -66.866 13.362  6.298   1.00 27.68 ? 36   TYR A CE2  1 
ATOM   372   C CZ   . TYR A 1 47  ? -68.075 13.082  6.906   1.00 26.91 ? 36   TYR A CZ   1 
ATOM   373   O OH   . TYR A 1 47  ? -68.906 12.131  6.361   1.00 36.73 ? 36   TYR A OH   1 
ATOM   374   H H    . TYR A 1 47  ? -63.468 16.641  10.149  1.00 20.24 ? 36   TYR A H    1 
ATOM   375   H HA   . TYR A 1 47  ? -65.872 15.470  10.648  1.00 20.99 ? 36   TYR A HA   1 
ATOM   376   H HB2  . TYR A 1 47  ? -65.989 16.807  8.736   1.00 22.53 ? 36   TYR A HB2  1 
ATOM   377   H HB3  . TYR A 1 47  ? -64.726 16.061  8.123   1.00 22.53 ? 36   TYR A HB3  1 
ATOM   378   H HD1  . TYR A 1 47  ? -67.914 15.063  9.374   1.00 26.05 ? 36   TYR A HD1  1 
ATOM   379   H HD2  . TYR A 1 47  ? -65.224 14.488  6.480   1.00 30.52 ? 36   TYR A HD2  1 
ATOM   380   H HE1  . TYR A 1 47  ? -69.271 13.515  8.434   1.00 30.98 ? 36   TYR A HE1  1 
ATOM   381   H HE2  . TYR A 1 47  ? -66.608 12.914  5.524   1.00 33.22 ? 36   TYR A HE2  1 
ATOM   382   H HH   . TYR A 1 47  ? -68.561 11.814  5.664   1.00 44.08 ? 36   TYR A HH   1 
ATOM   383   N N    A MET A 1 48  ? -65.105 13.181  10.561  0.56 18.44 ? 37   MET A N    1 
ATOM   384   N N    B MET A 1 48  ? -65.081 13.145  10.532  0.44 17.88 ? 37   MET A N    1 
ATOM   385   C CA   A MET A 1 48  ? -64.629 11.815  10.720  0.56 16.95 ? 37   MET A CA   1 
ATOM   386   C CA   B MET A 1 48  ? -64.529 11.790  10.564  0.44 16.77 ? 37   MET A CA   1 
ATOM   387   C C    A MET A 1 48  ? -65.592 10.852  10.045  0.56 20.61 ? 37   MET A C    1 
ATOM   388   C C    B MET A 1 48  ? -65.527 10.758  10.035  0.44 17.41 ? 37   MET A C    1 
ATOM   389   O O    A MET A 1 48  ? -66.786 11.136  9.875   0.56 20.16 ? 37   MET A O    1 
ATOM   390   O O    B MET A 1 48  ? -66.743 10.873  10.233  0.44 17.68 ? 37   MET A O    1 
ATOM   391   C CB   A MET A 1 48  ? -64.522 11.450  12.206  0.56 16.13 ? 37   MET A CB   1 
ATOM   392   C CB   B MET A 1 48  ? -64.032 11.398  11.966  0.44 22.06 ? 37   MET A CB   1 
ATOM   393   C CG   A MET A 1 48  ? -63.405 12.195  12.902  0.56 13.69 ? 37   MET A CG   1 
ATOM   394   C CG   B MET A 1 48  ? -65.035 11.522  13.078  0.44 22.16 ? 37   MET A CG   1 
ATOM   395   S SD   A MET A 1 48  ? -63.641 12.411  14.657  0.56 18.96 ? 37   MET A SD   1 
ATOM   396   S SD   B MET A 1 48  ? -64.219 11.883  14.655  0.44 21.42 ? 37   MET A SD   1 
ATOM   397   C CE   A MET A 1 48  ? -64.904 13.675  14.662  0.56 19.72 ? 37   MET A CE   1 
ATOM   398   C CE   B MET A 1 48  ? -64.661 13.598  14.858  0.44 24.04 ? 37   MET A CE   1 
ATOM   399   H H    A MET A 1 48  ? -65.911 13.282  10.844  0.56 22.13 ? 37   MET A H    1 
ATOM   400   H H    B MET A 1 48  ? -65.875 13.204  10.856  0.44 21.45 ? 37   MET A H    1 
ATOM   401   H HA   A MET A 1 48  ? -63.751 11.730  10.318  0.56 20.34 ? 37   MET A HA   1 
ATOM   402   H HA   B MET A 1 48  ? -63.755 11.775  9.980   0.44 20.13 ? 37   MET A HA   1 
ATOM   403   H HB2  A MET A 1 48  ? -65.356 11.674  12.649  0.56 19.35 ? 37   MET A HB2  1 
ATOM   404   H HB2  B MET A 1 48  ? -63.742 10.472  11.940  0.44 26.47 ? 37   MET A HB2  1 
ATOM   405   H HB3  A MET A 1 48  ? -64.347 10.499  12.288  0.56 19.35 ? 37   MET A HB3  1 
ATOM   406   H HB3  B MET A 1 48  ? -63.278 11.965  12.192  0.44 26.47 ? 37   MET A HB3  1 
ATOM   407   H HG2  A MET A 1 48  ? -62.578 11.703  12.775  0.56 16.42 ? 37   MET A HG2  1 
ATOM   408   H HG2  B MET A 1 48  ? -65.648 12.247  12.879  0.44 26.59 ? 37   MET A HG2  1 
ATOM   409   H HG3  A MET A 1 48  ? -63.325 13.076  12.505  0.56 16.42 ? 37   MET A HG3  1 
ATOM   410   H HG3  B MET A 1 48  ? -65.519 10.687  13.169  0.44 26.59 ? 37   MET A HG3  1 
ATOM   411   H HE1  A MET A 1 48  ? -65.130 13.890  15.580  0.56 23.67 ? 37   MET A HE1  1 
ATOM   412   H HE1  B MET A 1 48  ? -64.278 13.927  15.686  0.44 28.84 ? 37   MET A HE1  1 
ATOM   413   H HE2  A MET A 1 48  ? -64.563 14.463  14.211  0.56 23.67 ? 37   MET A HE2  1 
ATOM   414   H HE2  B MET A 1 48  ? -64.312 14.105  14.107  0.44 28.84 ? 37   MET A HE2  1 
ATOM   415   H HE3  A MET A 1 48  ? -65.687 13.339  14.198  0.56 23.67 ? 37   MET A HE3  1 
ATOM   416   H HE3  B MET A 1 48  ? -65.628 13.673  14.887  0.44 28.84 ? 37   MET A HE3  1 
ATOM   417   N N    A GLU A 1 49  ? -65.051 9.693   9.676   0.56 20.74 ? 38   GLU A N    1 
ATOM   418   N N    B GLU A 1 49  ? -64.985 9.731   9.378   0.44 18.72 ? 38   GLU A N    1 
ATOM   419   C CA   A GLU A 1 49  ? -65.859 8.576   9.206   0.56 20.16 ? 38   GLU A CA   1 
ATOM   420   C CA   B GLU A 1 49  ? -65.760 8.600   8.882   0.44 17.52 ? 38   GLU A CA   1 
ATOM   421   C C    A GLU A 1 49  ? -64.945 7.383   8.983   0.56 18.76 ? 38   GLU A C    1 
ATOM   422   C C    B GLU A 1 49  ? -64.874 7.368   8.984   0.44 19.58 ? 38   GLU A C    1 
ATOM   423   O O    A GLU A 1 49  ? -63.767 7.543   8.658   0.56 18.46 ? 38   GLU A O    1 
ATOM   424   O O    B GLU A 1 49  ? -63.644 7.483   8.929   0.44 19.60 ? 38   GLU A O    1 
ATOM   425   C CB   A GLU A 1 49  ? -66.598 8.931   7.914   0.56 24.13 ? 38   GLU A CB   1 
ATOM   426   C CB   B GLU A 1 49  ? -66.200 8.824   7.421   0.44 21.05 ? 38   GLU A CB   1 
ATOM   427   C CG   A GLU A 1 49  ? -65.665 9.389   6.865   0.56 24.31 ? 38   GLU A CG   1 
ATOM   428   C CG   B GLU A 1 49  ? -67.403 7.973   7.006   0.44 25.50 ? 38   GLU A CG   1 
ATOM   429   C CD   A GLU A 1 49  ? -66.296 9.633   5.499   0.56 25.98 ? 38   GLU A CD   1 
ATOM   430   C CD   B GLU A 1 49  ? -67.888 8.207   5.561   0.44 28.73 ? 38   GLU A CD   1 
ATOM   431   O OE1  A GLU A 1 49  ? -67.532 9.851   5.379   0.56 29.93 ? 38   GLU A OE1  1 
ATOM   432   O OE1  B GLU A 1 49  ? -67.204 8.893   4.758   0.44 31.23 ? 38   GLU A OE1  1 
ATOM   433   O OE2  A GLU A 1 49  ? -65.518 9.576   4.541   0.56 27.17 ? 38   GLU A OE2  1 
ATOM   434   O OE2  B GLU A 1 49  ? -68.965 7.670   5.216   0.44 26.67 ? 38   GLU A OE2  1 
ATOM   435   H H    A GLU A 1 49  ? -64.207 9.529   9.690   0.56 24.89 ? 38   GLU A H    1 
ATOM   436   H H    B GLU A 1 49  ? -64.145 9.669   9.204   0.44 22.46 ? 38   GLU A H    1 
ATOM   437   H HA   A GLU A 1 49  ? -66.514 8.341   9.882   0.56 24.19 ? 38   GLU A HA   1 
ATOM   438   H HA   B GLU A 1 49  ? -66.547 8.469   9.433   0.44 21.02 ? 38   GLU A HA   1 
ATOM   439   H HB2  A GLU A 1 49  ? -67.063 8.145   7.585   0.56 28.95 ? 38   GLU A HB2  1 
ATOM   440   H HB2  B GLU A 1 49  ? -66.441 9.756   7.306   0.44 25.26 ? 38   GLU A HB2  1 
ATOM   441   H HB3  A GLU A 1 49  ? -67.230 9.645   8.093   0.56 28.95 ? 38   GLU A HB3  1 
ATOM   442   H HB3  B GLU A 1 49  ? -65.461 8.600   6.833   0.44 25.26 ? 38   GLU A HB3  1 
ATOM   443   H HG2  A GLU A 1 49  ? -65.263 10.223  7.153   0.56 29.17 ? 38   GLU A HG2  1 
ATOM   444   H HG2  B GLU A 1 49  ? -67.163 7.036   7.087   0.44 30.60 ? 38   GLU A HG2  1 
ATOM   445   H HG3  A GLU A 1 49  ? -64.975 8.717   6.752   0.56 29.17 ? 38   GLU A HG3  1 
ATOM   446   H HG3  B GLU A 1 49  ? -68.144 8.172   7.600   0.44 30.60 ? 38   GLU A HG3  1 
ATOM   447   N N    . ASP A 1 50  ? -65.482 6.192   9.193   1.00 20.76 ? 39   ASP A N    1 
ATOM   448   C CA   . ASP A 1 50  ? -64.746 4.928   9.056   1.00 23.33 ? 39   ASP A CA   1 
ATOM   449   C C    . ASP A 1 50  ? -63.508 4.914   9.942   1.00 22.18 ? 39   ASP A C    1 
ATOM   450   O O    . ASP A 1 50  ? -62.467 4.363   9.572   1.00 25.41 ? 39   ASP A O    1 
ATOM   451   C CB   . ASP A 1 50  ? -64.381 4.668   7.602   1.00 27.32 ? 39   ASP A CB   1 
ATOM   452   C CG   . ASP A 1 50  ? -65.564 4.312   6.771   1.00 36.68 ? 39   ASP A CG   1 
ATOM   453   O OD1  . ASP A 1 50  ? -66.591 3.856   7.325   1.00 38.32 ? 39   ASP A OD1  1 
ATOM   454   O OD2  . ASP A 1 50  ? -65.454 4.471   5.547   1.00 41.13 ? 39   ASP A OD2  1 
ATOM   455   H H    . ASP A 1 50  ? -66.305 6.088   9.418   1.00 24.92 ? 39   ASP A H    1 
ATOM   456   H HA   . ASP A 1 50  ? -65.322 4.203   9.346   1.00 28.00 ? 39   ASP A HA   1 
ATOM   457   H HB2  . ASP A 1 50  ? -63.981 5.469   7.228   1.00 32.79 ? 39   ASP A HB2  1 
ATOM   458   H HB3  . ASP A 1 50  ? -63.751 3.932   7.560   1.00 32.79 ? 39   ASP A HB3  1 
ATOM   459   N N    . GLY A 1 51  ? -63.631 5.518   11.127  1.00 19.58 ? 40   GLY A N    1 
ATOM   460   C CA   . GLY A 1 51  ? -62.548 5.491   12.101  1.00 18.57 ? 40   GLY A CA   1 
ATOM   461   C C    . GLY A 1 51  ? -61.428 6.464   11.860  1.00 15.90 ? 40   GLY A C    1 
ATOM   462   O O    . GLY A 1 51  ? -60.440 6.424   12.594  1.00 14.89 ? 40   GLY A O    1 
ATOM   463   H H    . GLY A 1 51  ? -64.329 5.948   11.387  1.00 23.49 ? 40   GLY A H    1 
ATOM   464   H HA2  . GLY A 1 51  ? -62.914 5.673   12.980  1.00 22.29 ? 40   GLY A HA2  1 
ATOM   465   H HA3  . GLY A 1 51  ? -62.166 4.599   12.117  1.00 22.29 ? 40   GLY A HA3  1 
ATOM   466   N N    . LEU A 1 52  ? -61.535 7.317   10.845  1.00 16.21 ? 41   LEU A N    1 
ATOM   467   C CA   . LEU A 1 52  ? -60.463 8.201   10.433  1.00 16.02 ? 41   LEU A CA   1 
ATOM   468   C C    . LEU A 1 52  ? -60.934 9.644   10.403  1.00 15.53 ? 41   LEU A C    1 
ATOM   469   O O    . LEU A 1 52  ? -62.101 9.931   10.135  1.00 18.16 ? 41   LEU A O    1 
ATOM   470   C CB   . LEU A 1 52  ? -59.956 7.835   9.030   1.00 19.13 ? 41   LEU A CB   1 
ATOM   471   C CG   . LEU A 1 52  ? -59.392 6.427   8.885   1.00 20.40 ? 41   LEU A CG   1 
ATOM   472   C CD1  . LEU A 1 52  ? -59.172 6.178   7.411   1.00 28.73 ? 41   LEU A CD1  1 
ATOM   473   C CD2  . LEU A 1 52  ? -58.091 6.273   9.667   1.00 20.78 ? 41   LEU A CD2  1 
ATOM   474   H H    . LEU A 1 52  ? -62.246 7.401   10.368  1.00 19.45 ? 41   LEU A H    1 
ATOM   475   H HA   . LEU A 1 52  ? -59.724 8.129   11.058  1.00 19.22 ? 41   LEU A HA   1 
ATOM   476   H HB2  . LEU A 1 52  ? -60.694 7.919   8.406   1.00 22.95 ? 41   LEU A HB2  1 
ATOM   477   H HB3  . LEU A 1 52  ? -59.253 8.457   8.786   1.00 22.95 ? 41   LEU A HB3  1 
ATOM   478   H HG   . LEU A 1 52  ? -60.034 5.781   9.217   1.00 24.48 ? 41   LEU A HG   1 
ATOM   479   H HD11 . LEU A 1 52  ? -58.812 5.285   7.292   1.00 34.47 ? 41   LEU A HD11 1 
ATOM   480   H HD12 . LEU A 1 52  ? -60.021 6.257   6.948   1.00 34.47 ? 41   LEU A HD12 1 
ATOM   481   H HD13 . LEU A 1 52  ? -58.546 6.836   7.070   1.00 34.47 ? 41   LEU A HD13 1 
ATOM   482   H HD21 . LEU A 1 52  ? -57.760 5.369   9.554   1.00 24.93 ? 41   LEU A HD21 1 
ATOM   483   H HD22 . LEU A 1 52  ? -57.442 6.909   9.328   1.00 24.93 ? 41   LEU A HD22 1 
ATOM   484   H HD23 . LEU A 1 52  ? -58.265 6.447   10.606  1.00 24.93 ? 41   LEU A HD23 1 
ATOM   485   N N    . ILE A 1 53  ? -59.988 10.547  10.654  1.00 15.28 ? 42   ILE A N    1 
ATOM   486   C CA   . ILE A 1 53  ? -60.212 11.957  10.418  1.00 14.56 ? 42   ILE A CA   1 
ATOM   487   C C    . ILE A 1 53  ? -60.121 12.202  8.923   1.00 16.45 ? 42   ILE A C    1 
ATOM   488   O O    . ILE A 1 53  ? -59.071 11.974  8.316   1.00 17.99 ? 42   ILE A O    1 
ATOM   489   C CB   . ILE A 1 53  ? -59.201 12.790  11.208  1.00 16.24 ? 42   ILE A CB   1 
ATOM   490   C CG1  . ILE A 1 53  ? -59.369 12.549  12.723  1.00 16.46 ? 42   ILE A CG1  1 
ATOM   491   C CG2  . ILE A 1 53  ? -59.385 14.296  10.921  1.00 16.49 ? 42   ILE A CG2  1 
ATOM   492   C CD1  . ILE A 1 53  ? -58.229 13.027  13.576  1.00 16.59 ? 42   ILE A CD1  1 
ATOM   493   H H    . ILE A 1 53  ? -59.207 10.361  10.963  1.00 18.33 ? 42   ILE A H    1 
ATOM   494   H HA   . ILE A 1 53  ? -61.104 12.196  10.714  1.00 17.47 ? 42   ILE A HA   1 
ATOM   495   H HB   . ILE A 1 53  ? -58.305 12.527  10.946  1.00 19.48 ? 42   ILE A HB   1 
ATOM   496   H HG12 . ILE A 1 53  ? -60.169 13.009  13.021  1.00 19.75 ? 42   ILE A HG12 1 
ATOM   497   H HG13 . ILE A 1 53  ? -59.467 11.596  12.874  1.00 19.75 ? 42   ILE A HG13 1 
ATOM   498   H HG21 . ILE A 1 53  ? -58.732 14.797  11.434  1.00 19.79 ? 42   ILE A HG21 1 
ATOM   499   H HG22 . ILE A 1 53  ? -59.254 14.455  9.973   1.00 19.79 ? 42   ILE A HG22 1 
ATOM   500   H HG23 . ILE A 1 53  ? -60.282 14.559  11.179  1.00 19.79 ? 42   ILE A HG23 1 
ATOM   501   H HD11 . ILE A 1 53  ? -58.427 12.832  14.506  1.00 19.91 ? 42   ILE A HD11 1 
ATOM   502   H HD12 . ILE A 1 53  ? -57.418 12.567  13.307  1.00 19.91 ? 42   ILE A HD12 1 
ATOM   503   H HD13 . ILE A 1 53  ? -58.123 13.984  13.454  1.00 19.91 ? 42   ILE A HD13 1 
ATOM   504   N N    . LYS A 1 54  ? -61.199 12.711  8.336   1.00 18.82 ? 43   LYS A N    1 
ATOM   505   C CA   . LYS A 1 54  ? -61.255 12.878  6.890   1.00 20.82 ? 43   LYS A CA   1 
ATOM   506   C C    . LYS A 1 54  ? -61.056 14.313  6.431   1.00 18.75 ? 43   LYS A C    1 
ATOM   507   O O    . LYS A 1 54  ? -60.472 14.545  5.366   1.00 20.16 ? 43   LYS A O    1 
ATOM   508   C CB   . LYS A 1 54  ? -62.600 12.365  6.381   1.00 25.12 ? 43   LYS A CB   1 
ATOM   509   C CG   . LYS A 1 54  ? -62.782 10.808  6.420   1.00 32.35 ? 43   LYS A CG   1 
ATOM   510   C CD   . LYS A 1 54  ? -61.587 10.004  5.857   1.00 37.95 ? 43   LYS A CD   1 
ATOM   511   C CE   . LYS A 1 54  ? -61.906 8.498   5.706   1.00 39.56 ? 43   LYS A CE   1 
ATOM   512   N NZ   . LYS A 1 54  ? -62.927 8.314   4.581   1.00 41.71 ? 43   LYS A NZ   1 
ATOM   513   H H    . LYS A 1 54  ? -61.908 12.967  8.751   1.00 22.58 ? 43   LYS A H    1 
ATOM   514   H HA   . LYS A 1 54  ? -60.558 12.338  6.486   1.00 24.98 ? 43   LYS A HA   1 
ATOM   515   H HB2  . LYS A 1 54  ? -63.303 12.754  6.925   1.00 30.14 ? 43   LYS A HB2  1 
ATOM   516   H HB3  . LYS A 1 54  ? -62.708 12.649  5.460   1.00 30.14 ? 43   LYS A HB3  1 
ATOM   517   H HG2  . LYS A 1 54  ? -62.912 10.535  7.341   1.00 38.82 ? 43   LYS A HG2  1 
ATOM   518   H HG3  . LYS A 1 54  ? -63.565 10.575  5.897   1.00 38.82 ? 43   LYS A HG3  1 
ATOM   519   H HD2  . LYS A 1 54  ? -61.355 10.351  4.982   1.00 45.54 ? 43   LYS A HD2  1 
ATOM   520   H HD3  . LYS A 1 54  ? -60.833 10.093  6.461   1.00 45.54 ? 43   LYS A HD3  1 
ATOM   521   H HE2  . LYS A 1 54  ? -61.098 8.013   5.476   1.00 47.47 ? 43   LYS A HE2  1 
ATOM   522   H HE3  . LYS A 1 54  ? -62.287 8.159   6.532   1.00 47.47 ? 43   LYS A HE3  1 
ATOM   523   H HZ1  . LYS A 1 54  ? -63.120 7.451   4.484   1.00 50.05 ? 43   LYS A HZ1  1 
ATOM   524   H HZ2  . LYS A 1 54  ? -63.675 8.758   4.774   1.00 50.05 ? 43   LYS A HZ2  1 
ATOM   525   H HZ3  . LYS A 1 54  ? -62.596 8.625   3.816   1.00 50.05 ? 43   LYS A HZ3  1 
ATOM   526   N N    . GLN A 1 55  ? -61.553 15.290  7.179   1.00 18.76 ? 44   GLN A N    1 
ATOM   527   C CA   . GLN A 1 55  ? -61.396 16.689  6.812   1.00 20.12 ? 44   GLN A CA   1 
ATOM   528   C C    . GLN A 1 55  ? -61.231 17.506  8.068   1.00 19.03 ? 44   GLN A C    1 
ATOM   529   O O    . GLN A 1 55  ? -61.799 17.188  9.117   1.00 18.96 ? 44   GLN A O    1 
ATOM   530   C CB   . GLN A 1 55  ? -62.604 17.237  6.083   1.00 20.10 ? 44   GLN A CB   1 
ATOM   531   C CG   . GLN A 1 55  ? -62.878 16.622  4.752   1.00 23.31 ? 44   GLN A CG   1 
ATOM   532   C CD   . GLN A 1 55  ? -64.099 17.237  4.134   1.00 29.38 ? 44   GLN A CD   1 
ATOM   533   O OE1  . GLN A 1 55  ? -64.161 18.451  3.966   1.00 33.18 ? 44   GLN A OE1  1 
ATOM   534   N NE2  . GLN A 1 55  ? -65.093 16.416  3.817   1.00 32.30 ? 44   GLN A NE2  1 
ATOM   535   H H    . GLN A 1 55  ? -61.989 15.167  7.910   1.00 22.52 ? 44   GLN A H    1 
ATOM   536   H HA   . GLN A 1 55  ? -60.611 16.801  6.255   1.00 24.15 ? 44   GLN A HA   1 
ATOM   537   H HB2  . GLN A 1 55  ? -63.388 17.095  6.636   1.00 24.12 ? 44   GLN A HB2  1 
ATOM   538   H HB3  . GLN A 1 55  ? -62.474 18.188  5.943   1.00 24.12 ? 44   GLN A HB3  1 
ATOM   539   H HG2  . GLN A 1 55  ? -62.123 16.777  4.162   1.00 27.98 ? 44   GLN A HG2  1 
ATOM   540   H HG3  . GLN A 1 55  ? -63.034 15.671  4.860   1.00 27.98 ? 44   GLN A HG3  1 
ATOM   541   H HE21 . GLN A 1 55  ? -65.018 15.573  3.967   1.00 38.76 ? 44   GLN A HE21 1 
ATOM   542   H HE22 . GLN A 1 55  ? -65.811 16.728  3.461   1.00 38.76 ? 44   GLN A HE22 1 
ATOM   543   N N    . ILE A 1 56  ? -60.421 18.553  7.955   1.00 19.45 ? 45   ILE A N    1 
ATOM   544   C CA   . ILE A 1 56  ? -60.248 19.548  9.003   1.00 18.63 ? 45   ILE A CA   1 
ATOM   545   C C    . ILE A 1 56  ? -60.314 20.912  8.328   1.00 19.28 ? 45   ILE A C    1 
ATOM   546   O O    . ILE A 1 56  ? -59.608 21.139  7.340   1.00 22.94 ? 45   ILE A O    1 
ATOM   547   C CB   . ILE A 1 56  ? -58.893 19.378  9.726   1.00 17.73 ? 45   ILE A CB   1 
ATOM   548   C CG1  . ILE A 1 56  ? -58.850 18.064  10.491  1.00 16.42 ? 45   ILE A CG1  1 
ATOM   549   C CG2  . ILE A 1 56  ? -58.667 20.523  10.702  1.00 19.20 ? 45   ILE A CG2  1 
ATOM   550   C CD1  . ILE A 1 56  ? -57.469 17.751  11.096  1.00 16.41 ? 45   ILE A CD1  1 
ATOM   551   H H    . ILE A 1 56  ? -59.946 18.711  7.256   1.00 23.34 ? 45   ILE A H    1 
ATOM   552   H HA   . ILE A 1 56  ? -60.967 19.479  9.651   1.00 22.36 ? 45   ILE A HA   1 
ATOM   553   H HB   . ILE A 1 56  ? -58.182 19.381  9.067   1.00 21.28 ? 45   ILE A HB   1 
ATOM   554   H HG12 . ILE A 1 56  ? -59.491 18.103  11.218  1.00 19.71 ? 45   ILE A HG12 1 
ATOM   555   H HG13 . ILE A 1 56  ? -59.081 17.342  9.886   1.00 19.71 ? 45   ILE A HG13 1 
ATOM   556   H HG21 . ILE A 1 56  ? -57.813 20.396  11.144  1.00 23.04 ? 45   ILE A HG21 1 
ATOM   557   H HG22 . ILE A 1 56  ? -58.666 21.360  10.212  1.00 23.04 ? 45   ILE A HG22 1 
ATOM   558   H HG23 . ILE A 1 56  ? -59.382 20.524  11.358  1.00 23.04 ? 45   ILE A HG23 1 
ATOM   559   H HD11 . ILE A 1 56  ? -57.515 16.904  11.567  1.00 19.69 ? 45   ILE A HD11 1 
ATOM   560   H HD12 . ILE A 1 56  ? -56.816 17.697  10.381  1.00 19.69 ? 45   ILE A HD12 1 
ATOM   561   H HD13 . ILE A 1 56  ? -57.227 18.459  11.713  1.00 19.69 ? 45   ILE A HD13 1 
ATOM   562   N N    . GLY A 1 57  ? -61.118 21.822  8.871   1.00 19.78 ? 46   GLY A N    1 
ATOM   563   C CA   . GLY A 1 57  ? -61.185 23.169  8.313   1.00 23.56 ? 46   GLY A CA   1 
ATOM   564   C C    . GLY A 1 57  ? -62.540 23.793  8.580   1.00 25.81 ? 46   GLY A C    1 
ATOM   565   O O    . GLY A 1 57  ? -63.188 23.468  9.558   1.00 23.10 ? 46   GLY A O    1 
ATOM   566   H H    . GLY A 1 57  ? -61.627 21.689  9.551   1.00 23.73 ? 46   GLY A H    1 
ATOM   567   H HA2  . GLY A 1 57  ? -60.499 23.725  8.715   1.00 28.27 ? 46   GLY A HA2  1 
ATOM   568   H HA3  . GLY A 1 57  ? -61.039 23.135  7.354   1.00 28.27 ? 46   GLY A HA3  1 
ATOM   569   N N    . GLU A 1 58  ? -62.951 24.697  7.688   1.00 37.72 ? 47   GLU A N    1 
ATOM   570   C CA   . GLU A 1 58  ? -64.226 25.402  7.781   1.00 37.46 ? 47   GLU A CA   1 
ATOM   571   C C    . GLU A 1 58  ? -65.153 24.996  6.642   1.00 39.71 ? 47   GLU A C    1 
ATOM   572   O O    . GLU A 1 58  ? -64.695 24.624  5.556   1.00 42.78 ? 47   GLU A O    1 
ATOM   573   C CB   . GLU A 1 58  ? -63.991 26.902  7.698   1.00 40.95 ? 47   GLU A CB   1 
ATOM   574   C CG   . GLU A 1 58  ? -63.185 27.427  8.880   1.00 45.51 ? 47   GLU A CG   1 
ATOM   575   C CD   . GLU A 1 58  ? -63.947 27.249  10.166  1.00 54.11 ? 47   GLU A CD   1 
ATOM   576   O OE1  . GLU A 1 58  ? -65.201 27.344  10.120  1.00 57.12 ? 47   GLU A OE1  1 
ATOM   577   O OE2  . GLU A 1 58  ? -63.303 26.992  11.206  1.00 57.78 ? 47   GLU A OE2  1 
ATOM   578   H H    . GLU A 1 58  ? -62.490 24.925  6.998   1.00 45.27 ? 47   GLU A H    1 
ATOM   579   H HA   . GLU A 1 58  ? -64.657 25.197  8.626   1.00 44.95 ? 47   GLU A HA   1 
ATOM   580   H HB2  . GLU A 1 58  ? -63.499 27.102  6.886   1.00 49.14 ? 47   GLU A HB2  1 
ATOM   581   H HB3  . GLU A 1 58  ? -64.847 27.358  7.690   1.00 49.14 ? 47   GLU A HB3  1 
ATOM   582   H HG2  . GLU A 1 58  ? -62.352 26.934  8.947   1.00 54.62 ? 47   GLU A HG2  1 
ATOM   583   H HG3  . GLU A 1 58  ? -63.009 28.373  8.757   1.00 54.62 ? 47   GLU A HG3  1 
ATOM   584   N N    . ASN A 1 59  ? -66.467 25.079  6.900   1.00 38.23 ? 48   ASN A N    1 
ATOM   585   C CA   . ASN A 1 59  ? -67.485 24.835  5.885   1.00 40.14 ? 48   ASN A CA   1 
ATOM   586   C C    . ASN A 1 59  ? -67.256 23.494  5.193   1.00 41.06 ? 48   ASN A C    1 
ATOM   587   O O    . ASN A 1 59  ? -67.255 23.375  3.959   1.00 46.21 ? 48   ASN A O    1 
ATOM   588   C CB   . ASN A 1 59  ? -67.515 25.988  4.893   1.00 47.49 ? 48   ASN A CB   1 
ATOM   589   C CG   . ASN A 1 59  ? -67.738 27.312  5.584   1.00 55.08 ? 48   ASN A CG   1 
ATOM   590   O OD1  . ASN A 1 59  ? -68.667 27.451  6.384   1.00 56.28 ? 48   ASN A OD1  1 
ATOM   591   N ND2  . ASN A 1 59  ? -66.864 28.281  5.315   1.00 59.48 ? 48   ASN A ND2  1 
ATOM   592   H H    . ASN A 1 59  ? -66.791 25.279  7.671   1.00 45.88 ? 48   ASN A H    1 
ATOM   593   H HA   . ASN A 1 59  ? -68.352 24.797  6.318   1.00 48.17 ? 48   ASN A HA   1 
ATOM   594   H HB2  . ASN A 1 59  ? -66.667 26.029  4.425   1.00 56.98 ? 48   ASN A HB2  1 
ATOM   595   H HB3  . ASN A 1 59  ? -68.240 25.848  4.263   1.00 56.98 ? 48   ASN A HB3  1 
ATOM   596   H HD21 . ASN A 1 59  ? -66.951 29.052  5.685   1.00 71.37 ? 48   ASN A HD21 1 
ATOM   597   H HD22 . ASN A 1 59  ? -66.214 28.135  4.772   1.00 71.37 ? 48   ASN A HD22 1 
ATOM   598   N N    . LEU A 1 60  ? -67.059 22.471  6.007   1.00 39.06 ? 49   LEU A N    1 
ATOM   599   C CA   . LEU A 1 60  ? -66.694 21.177  5.460   1.00 37.77 ? 49   LEU A CA   1 
ATOM   600   C C    . LEU A 1 60  ? -67.839 20.588  4.634   1.00 43.05 ? 49   LEU A C    1 
ATOM   601   O O    . LEU A 1 60  ? -69.028 20.701  4.982   1.00 45.58 ? 49   LEU A O    1 
ATOM   602   C CB   . LEU A 1 60  ? -66.251 20.243  6.580   1.00 34.20 ? 49   LEU A CB   1 
ATOM   603   C CG   . LEU A 1 60  ? -65.034 20.716  7.412   1.00 29.27 ? 49   LEU A CG   1 
ATOM   604   C CD1  . LEU A 1 60  ? -64.639 19.659  8.434   1.00 27.49 ? 49   LEU A CD1  1 
ATOM   605   C CD2  . LEU A 1 60  ? -63.846 21.075  6.528   1.00 27.01 ? 49   LEU A CD2  1 
ATOM   606   H H    . LEU A 1 60  ? -67.128 22.498  6.864   1.00 46.87 ? 49   LEU A H    1 
ATOM   607   H HA   . LEU A 1 60  ? -65.938 21.296  4.864   1.00 45.32 ? 49   LEU A HA   1 
ATOM   608   H HB2  . LEU A 1 60  ? -66.994 20.128  7.192   1.00 41.04 ? 49   LEU A HB2  1 
ATOM   609   H HB3  . LEU A 1 60  ? -66.019 19.387  6.189   1.00 41.04 ? 49   LEU A HB3  1 
ATOM   610   H HG   . LEU A 1 60  ? -65.287 21.515  7.901   1.00 35.13 ? 49   LEU A HG   1 
ATOM   611   H HD11 . LEU A 1 60  ? -63.876 19.980  8.941   1.00 32.99 ? 49   LEU A HD11 1 
ATOM   612   H HD12 . LEU A 1 60  ? -65.388 19.499  9.029   1.00 32.99 ? 49   LEU A HD12 1 
ATOM   613   H HD13 . LEU A 1 60  ? -64.406 18.841  7.968   1.00 32.99 ? 49   LEU A HD13 1 
ATOM   614   H HD21 . LEU A 1 60  ? -63.110 21.364  7.091   1.00 32.41 ? 49   LEU A HD21 1 
ATOM   615   H HD22 . LEU A 1 60  ? -63.584 20.293  6.018   1.00 32.41 ? 49   LEU A HD22 1 
ATOM   616   H HD23 . LEU A 1 60  ? -64.104 21.791  5.928   1.00 32.41 ? 49   LEU A HD23 1 
ATOM   617   N N    . ILE A 1 61  ? -67.470 20.006  3.495   1.00 44.36 ? 50   ILE A N    1 
ATOM   618   C CA   . ILE A 1 61  ? -68.450 19.395  2.611   1.00 43.67 ? 50   ILE A CA   1 
ATOM   619   C C    . ILE A 1 61  ? -68.763 18.024  3.169   1.00 43.40 ? 50   ILE A C    1 
ATOM   620   O O    . ILE A 1 61  ? -67.937 17.102  3.133   1.00 41.03 ? 50   ILE A O    1 
ATOM   621   C CB   . ILE A 1 61  ? -67.991 19.322  1.153   1.00 50.08 ? 50   ILE A CB   1 
ATOM   622   C CG1  . ILE A 1 61  ? -68.151 20.706  0.512   1.00 52.20 ? 50   ILE A CG1  1 
ATOM   623   C CG2  . ILE A 1 61  ? -68.829 18.272  0.377   1.00 49.49 ? 50   ILE A CG2  1 
ATOM   624   C CD1  . ILE A 1 61  ? -67.743 20.776  -0.953  1.00 59.65 ? 50   ILE A CD1  1 
ATOM   625   H H    . ILE A 1 61  ? -66.659 19.953  3.215   1.00 53.24 ? 50   ILE A H    1 
ATOM   626   H HA   . ILE A 1 61  ? -69.266 19.920  2.639   1.00 52.40 ? 50   ILE A HA   1 
ATOM   627   H HB   . ILE A 1 61  ? -67.056 19.066  1.126   1.00 60.10 ? 50   ILE A HB   1 
ATOM   628   H HG12 . ILE A 1 61  ? -69.083 20.968  0.571   1.00 62.63 ? 50   ILE A HG12 1 
ATOM   629   H HG13 . ILE A 1 61  ? -67.602 21.339  1.001   1.00 62.63 ? 50   ILE A HG13 1 
ATOM   630   H HG21 . ILE A 1 61  ? -68.523 18.241  -0.543  1.00 59.38 ? 50   ILE A HG21 1 
ATOM   631   H HG22 . ILE A 1 61  ? -68.711 17.404  0.794   1.00 59.38 ? 50   ILE A HG22 1 
ATOM   632   H HG23 . ILE A 1 61  ? -69.763 18.530  0.406   1.00 59.38 ? 50   ILE A HG23 1 
ATOM   633   H HD11 . ILE A 1 61  ? -67.876 21.682  -1.274  1.00 71.58 ? 50   ILE A HD11 1 
ATOM   634   H HD12 . ILE A 1 61  ? -66.808 20.531  -1.032  1.00 71.58 ? 50   ILE A HD12 1 
ATOM   635   H HD13 . ILE A 1 61  ? -68.291 20.160  -1.463  1.00 71.58 ? 50   ILE A HD13 1 
ATOM   636   N N    . VAL A 1 62  ? -69.957 17.924  3.737   1.00 46.71 ? 51   VAL A N    1 
ATOM   637   C CA   . VAL A 1 62  ? -70.490 16.682  4.262   1.00 52.42 ? 51   VAL A CA   1 
ATOM   638   C C    . VAL A 1 62  ? -71.921 16.583  3.807   1.00 58.42 ? 51   VAL A C    1 
ATOM   639   O O    . VAL A 1 62  ? -72.574 17.604  3.555   1.00 57.71 ? 51   VAL A O    1 
ATOM   640   C CB   . VAL A 1 62  ? -70.449 16.688  5.803   1.00 48.93 ? 51   VAL A CB   1 
ATOM   641   C CG1  . VAL A 1 62  ? -69.007 16.985  6.318   1.00 48.63 ? 51   VAL A CG1  1 
ATOM   642   C CG2  . VAL A 1 62  ? -71.428 17.719  6.352   1.00 48.06 ? 51   VAL A CG2  1 
ATOM   643   H H    . VAL A 1 62  ? -70.494 18.589  3.831   1.00 56.05 ? 51   VAL A H    1 
ATOM   644   H HA   . VAL A 1 62  ? -69.987 15.924  3.925   1.00 62.91 ? 51   VAL A HA   1 
ATOM   645   H HB   . VAL A 1 62  ? -70.714 15.815  6.132   1.00 58.72 ? 51   VAL A HB   1 
ATOM   646   H HG11 . VAL A 1 62  ? -69.011 16.983  7.288   1.00 58.35 ? 51   VAL A HG11 1 
ATOM   647   H HG12 . VAL A 1 62  ? -68.407 16.298  5.988   1.00 58.35 ? 51   VAL A HG12 1 
ATOM   648   H HG13 . VAL A 1 62  ? -68.728 17.855  5.990   1.00 58.35 ? 51   VAL A HG13 1 
ATOM   649   H HG21 . VAL A 1 62  ? -71.388 17.708  7.322   1.00 57.67 ? 51   VAL A HG21 1 
ATOM   650   H HG22 . VAL A 1 62  ? -71.181 18.597  6.021   1.00 57.67 ? 51   VAL A HG22 1 
ATOM   651   H HG23 . VAL A 1 62  ? -72.324 17.493  6.055   1.00 57.67 ? 51   VAL A HG23 1 
ATOM   652   N N    . PRO A 1 63  ? -72.431 15.369  3.643   1.00 60.50 ? 52   PRO A N    1 
ATOM   653   C CA   . PRO A 1 63  ? -73.864 15.246  3.371   1.00 60.39 ? 52   PRO A CA   1 
ATOM   654   C C    . PRO A 1 63  ? -74.680 15.814  4.524   1.00 57.18 ? 52   PRO A C    1 
ATOM   655   O O    . PRO A 1 63  ? -74.203 16.000  5.649   1.00 51.27 ? 52   PRO A O    1 
ATOM   656   C CB   . PRO A 1 63  ? -74.084 13.734  3.221   1.00 60.92 ? 52   PRO A CB   1 
ATOM   657   C CG   . PRO A 1 63  ? -72.729 13.171  2.938   1.00 61.33 ? 52   PRO A CG   1 
ATOM   658   C CD   . PRO A 1 63  ? -71.750 14.063  3.641   1.00 58.89 ? 52   PRO A CD   1 
ATOM   659   H HA   . PRO A 1 63  ? -74.099 15.697  2.546   1.00 72.46 ? 52   PRO A HA   1 
ATOM   660   H HB2  . PRO A 1 63  ? -74.440 13.371  4.046   1.00 73.11 ? 52   PRO A HB2  1 
ATOM   661   H HB3  . PRO A 1 63  ? -74.687 13.563  2.481   1.00 73.11 ? 52   PRO A HB3  1 
ATOM   662   H HG2  . PRO A 1 63  ? -72.675 12.267  3.285   1.00 73.59 ? 52   PRO A HG2  1 
ATOM   663   H HG3  . PRO A 1 63  ? -72.568 13.178  1.981   1.00 73.59 ? 52   PRO A HG3  1 
ATOM   664   H HD2  . PRO A 1 63  ? -71.603 13.756  4.550   1.00 70.67 ? 52   PRO A HD2  1 
ATOM   665   H HD3  . PRO A 1 63  ? -70.919 14.115  3.143   1.00 70.67 ? 52   PRO A HD3  1 
ATOM   666   N N    . GLY A 1 64  ? -75.932 16.116  4.229   1.00 55.57 ? 53   GLY A N    1 
ATOM   667   C CA   . GLY A 1 64  ? -76.874 16.318  5.302   1.00 54.90 ? 53   GLY A CA   1 
ATOM   668   C C    . GLY A 1 64  ? -76.917 15.108  6.211   1.00 47.40 ? 53   GLY A C    1 
ATOM   669   O O    . GLY A 1 64  ? -76.503 14.003  5.852   1.00 48.43 ? 53   GLY A O    1 
ATOM   670   H H    . GLY A 1 64  ? -76.252 16.206  3.436   1.00 66.69 ? 53   GLY A H    1 
ATOM   671   H HA2  . GLY A 1 64  ? -76.616 17.094  5.825   1.00 65.88 ? 53   GLY A HA2  1 
ATOM   672   H HA3  . GLY A 1 64  ? -77.761 16.468  4.937   1.00 65.88 ? 53   GLY A HA3  1 
ATOM   673   N N    . GLY A 1 65  ? -77.393 15.334  7.424   1.00 47.27 ? 54   GLY A N    1 
ATOM   674   C CA   . GLY A 1 65  ? -77.669 14.228  8.305   1.00 46.35 ? 54   GLY A CA   1 
ATOM   675   C C    . GLY A 1 65  ? -76.464 13.652  8.997   1.00 43.19 ? 54   GLY A C    1 
ATOM   676   O O    . GLY A 1 65  ? -76.493 12.481  9.381   1.00 50.90 ? 54   GLY A O    1 
ATOM   677   H H    . GLY A 1 65  ? -77.562 16.110  7.754   1.00 56.73 ? 54   GLY A H    1 
ATOM   678   H HA2  . GLY A 1 65  ? -78.294 14.517  8.987   1.00 55.62 ? 54   GLY A HA2  1 
ATOM   679   H HA3  . GLY A 1 65  ? -78.089 13.517  7.796   1.00 55.62 ? 54   GLY A HA3  1 
ATOM   680   N N    . VAL A 1 66  ? -75.404 14.423  9.165   1.00 35.52 ? 55   VAL A N    1 
ATOM   681   C CA   . VAL A 1 66  ? -74.254 13.956  9.924   1.00 30.56 ? 55   VAL A CA   1 
ATOM   682   C C    . VAL A 1 66  ? -74.441 14.311  11.387  1.00 29.56 ? 55   VAL A C    1 
ATOM   683   O O    . VAL A 1 66  ? -74.692 15.472  11.730  1.00 30.93 ? 55   VAL A O    1 
ATOM   684   C CB   . VAL A 1 66  ? -72.957 14.550  9.375   1.00 30.61 ? 55   VAL A CB   1 
ATOM   685   C CG1  . VAL A 1 66  ? -71.802 14.172  10.268  1.00 30.71 ? 55   VAL A CG1  1 
ATOM   686   C CG2  . VAL A 1 66  ? -72.695 14.018  7.975   1.00 35.15 ? 55   VAL A CG2  1 
ATOM   687   H H    . VAL A 1 66  ? -75.323 15.220  8.852   1.00 42.63 ? 55   VAL A H    1 
ATOM   688   H HA   . VAL A 1 66  ? -74.198 12.990  9.853   1.00 36.67 ? 55   VAL A HA   1 
ATOM   689   H HB   . VAL A 1 66  ? -73.024 15.517  9.338   1.00 36.74 ? 55   VAL A HB   1 
ATOM   690   H HG11 . VAL A 1 66  ? -70.987 14.555  9.908   1.00 36.85 ? 55   VAL A HG11 1 
ATOM   691   H HG12 . VAL A 1 66  ? -71.966 14.519  11.159  1.00 36.85 ? 55   VAL A HG12 1 
ATOM   692   H HG13 . VAL A 1 66  ? -71.729 13.205  10.298  1.00 36.85 ? 55   VAL A HG13 1 
ATOM   693   H HG21 . VAL A 1 66  ? -71.870 14.404  7.641   1.00 42.18 ? 55   VAL A HG21 1 
ATOM   694   H HG22 . VAL A 1 66  ? -72.618 13.052  8.014   1.00 42.18 ? 55   VAL A HG22 1 
ATOM   695   H HG23 . VAL A 1 66  ? -73.435 14.268  7.399   1.00 42.18 ? 55   VAL A HG23 1 
ATOM   696   N N    . LYS A 1 67  ? -74.283 13.317  12.253  1.00 26.81 ? 56   LYS A N    1 
ATOM   697   C CA   . LYS A 1 67  ? -74.238 13.579  13.686  1.00 28.45 ? 56   LYS A CA   1 
ATOM   698   C C    . LYS A 1 67  ? -73.185 14.629  13.989  1.00 24.75 ? 56   LYS A C    1 
ATOM   699   O O    . LYS A 1 67  ? -72.018 14.480  13.612  1.00 23.88 ? 56   LYS A O    1 
ATOM   700   C CB   . LYS A 1 67  ? -73.922 12.307  14.459  1.00 29.80 ? 56   LYS A CB   1 
ATOM   701   C CG   . LYS A 1 67  ? -74.053 12.555  15.937  1.00 34.97 ? 56   LYS A CG   1 
ATOM   702   C CD   . LYS A 1 67  ? -74.012 11.332  16.798  1.00 43.93 ? 56   LYS A CD   1 
ATOM   703   C CE   . LYS A 1 67  ? -74.248 11.716  18.271  1.00 50.51 ? 56   LYS A CE   1 
ATOM   704   N NZ   . LYS A 1 67  ? -75.512 12.507  18.525  1.00 56.76 ? 56   LYS A NZ   1 
ATOM   705   H H    . LYS A 1 67  ? -74.200 12.488  12.039  1.00 32.17 ? 56   LYS A H    1 
ATOM   706   H HA   . LYS A 1 67  ? -75.100 13.913  13.982  1.00 34.14 ? 56   LYS A HA   1 
ATOM   707   H HB2  . LYS A 1 67  ? -74.547 11.610  14.206  1.00 35.76 ? 56   LYS A HB2  1 
ATOM   708   H HB3  . LYS A 1 67  ? -73.011 12.032  14.272  1.00 35.76 ? 56   LYS A HB3  1 
ATOM   709   H HG2  . LYS A 1 67  ? -73.326 13.133  16.217  1.00 41.96 ? 56   LYS A HG2  1 
ATOM   710   H HG3  . LYS A 1 67  ? -74.900 12.998  16.100  1.00 41.96 ? 56   LYS A HG3  1 
ATOM   711   H HD2  . LYS A 1 67  ? -74.711 10.718  16.523  1.00 52.71 ? 56   LYS A HD2  1 
ATOM   712   H HD3  . LYS A 1 67  ? -73.141 10.912  16.724  1.00 52.71 ? 56   LYS A HD3  1 
ATOM   713   H HE2  . LYS A 1 67  ? -74.300 10.903  18.798  1.00 60.61 ? 56   LYS A HE2  1 
ATOM   714   H HE3  . LYS A 1 67  ? -73.500 12.253  18.575  1.00 60.61 ? 56   LYS A HE3  1 
ATOM   715   H HZ1  . LYS A 1 67  ? -75.585 12.694  19.392  1.00 68.11 ? 56   LYS A HZ1  1 
ATOM   716   H HZ2  . LYS A 1 67  ? -75.491 13.269  18.066  1.00 68.11 ? 56   LYS A HZ2  1 
ATOM   717   H HZ3  . LYS A 1 67  ? -76.222 12.035  18.270  1.00 68.11 ? 56   LYS A HZ3  1 
ATOM   718   N N    . THR A 1 68  ? -73.593 15.666  14.700  1.00 25.96 ? 57   THR A N    1 
ATOM   719   C CA   . THR A 1 68  ? -72.763 16.839  14.906  1.00 24.04 ? 57   THR A CA   1 
ATOM   720   C C    . THR A 1 68  ? -72.682 17.166  16.386  1.00 24.03 ? 57   THR A C    1 
ATOM   721   O O    . THR A 1 68  ? -73.706 17.277  17.065  1.00 27.79 ? 57   THR A O    1 
ATOM   722   C CB   . THR A 1 68  ? -73.291 18.041  14.118  1.00 26.07 ? 57   THR A CB   1 
ATOM   723   O OG1  . THR A 1 68  ? -73.318 17.730  12.717  1.00 29.30 ? 57   THR A OG1  1 
ATOM   724   C CG2  . THR A 1 68  ? -72.451 19.274  14.360  1.00 28.52 ? 57   THR A CG2  1 
ATOM   725   H H    . THR A 1 68  ? -74.362 15.715  15.082  1.00 31.15 ? 57   THR A H    1 
ATOM   726   H HA   . THR A 1 68  ? -71.865 16.648  14.593  1.00 28.85 ? 57   THR A HA   1 
ATOM   727   H HB   . THR A 1 68  ? -74.194 18.235  14.413  1.00 31.28 ? 57   THR A HB   1 
ATOM   728   H HG1  . THR A 1 68  ? -73.819 17.070  12.578  1.00 35.16 ? 57   THR A HG1  1 
ATOM   729   H HG21 . THR A 1 68  ? -72.805 20.021  13.851  1.00 34.23 ? 57   THR A HG21 1 
ATOM   730   H HG22 . THR A 1 68  ? -72.461 19.502  15.303  1.00 34.23 ? 57   THR A HG22 1 
ATOM   731   H HG23 . THR A 1 68  ? -71.536 19.111  14.085  1.00 34.23 ? 57   THR A HG23 1 
ATOM   732   N N    . ILE A 1 69  ? -71.462 17.311  16.870  1.00 22.98 ? 58   ILE A N    1 
ATOM   733   C CA   . ILE A 1 69  ? -71.187 17.816  18.211  1.00 25.42 ? 58   ILE A CA   1 
ATOM   734   C C    . ILE A 1 69  ? -70.738 19.256  18.063  1.00 22.34 ? 58   ILE A C    1 
ATOM   735   O O    . ILE A 1 69  ? -69.826 19.540  17.272  1.00 24.47 ? 58   ILE A O    1 
ATOM   736   C CB   . ILE A 1 69  ? -70.056 17.008  18.875  1.00 24.60 ? 58   ILE A CB   1 
ATOM   737   C CG1  . ILE A 1 69  ? -70.489 15.559  19.094  1.00 28.50 ? 58   ILE A CG1  1 
ATOM   738   C CG2  . ILE A 1 69  ? -69.661 17.649  20.205  1.00 26.53 ? 58   ILE A CG2  1 
ATOM   739   C CD1  . ILE A 1 69  ? -69.340 14.663  19.512  1.00 32.88 ? 58   ILE A CD1  1 
ATOM   740   H H    . ILE A 1 69  ? -70.749 17.117  16.428  1.00 27.58 ? 58   ILE A H    1 
ATOM   741   H HA   . ILE A 1 69  ? -71.984 17.777  18.763  1.00 30.51 ? 58   ILE A HA   1 
ATOM   742   H HB   . ILE A 1 69  ? -69.285 17.015  18.286  1.00 29.51 ? 58   ILE A HB   1 
ATOM   743   H HG12 . ILE A 1 69  ? -71.160 15.532  19.794  1.00 34.20 ? 58   ILE A HG12 1 
ATOM   744   H HG13 . ILE A 1 69  ? -70.857 15.210  18.267  1.00 34.20 ? 58   ILE A HG13 1 
ATOM   745   H HG21 . ILE A 1 69  ? -68.948 17.128  20.606  1.00 31.83 ? 58   ILE A HG21 1 
ATOM   746   H HG22 . ILE A 1 69  ? -69.355 18.555  20.040  1.00 31.83 ? 58   ILE A HG22 1 
ATOM   747   H HG23 . ILE A 1 69  ? -70.433 17.662  20.791  1.00 31.83 ? 58   ILE A HG23 1 
ATOM   748   H HD11 . ILE A 1 69  ? -69.673 13.761  19.636  1.00 39.45 ? 58   ILE A HD11 1 
ATOM   749   H HD12 . ILE A 1 69  ? -68.663 14.674  18.817  1.00 39.45 ? 58   ILE A HD12 1 
ATOM   750   H HD13 . ILE A 1 69  ? -68.967 14.996  20.343  1.00 39.45 ? 58   ILE A HD13 1 
ATOM   751   N N    . GLU A 1 70  ? -71.328 20.149  18.858  1.00 23.78 ? 59   GLU A N    1 
ATOM   752   C CA   . GLU A 1 70  ? -70.872 21.533  18.939  1.00 24.61 ? 59   GLU A CA   1 
ATOM   753   C C    . GLU A 1 70  ? -69.886 21.658  20.098  1.00 25.75 ? 59   GLU A C    1 
ATOM   754   O O    . GLU A 1 70  ? -70.243 21.436  21.262  1.00 28.61 ? 59   GLU A O    1 
ATOM   755   C CB   . GLU A 1 70  ? -72.048 22.483  19.148  1.00 29.42 ? 59   GLU A CB   1 
ATOM   756   C CG   . GLU A 1 70  ? -72.942 22.567  17.941  1.00 34.13 ? 59   GLU A CG   1 
ATOM   757   C CD   . GLU A 1 70  ? -72.331 23.374  16.796  1.00 40.89 ? 59   GLU A CD   1 
ATOM   758   O OE1  . GLU A 1 70  ? -71.304 24.067  17.011  1.00 43.55 ? 59   GLU A OE1  1 
ATOM   759   O OE2  . GLU A 1 70  ? -72.879 23.302  15.672  1.00 44.93 ? 59   GLU A OE2  1 
ATOM   760   H H    . GLU A 1 70  ? -72.001 19.975  19.364  1.00 28.54 ? 59   GLU A H    1 
ATOM   761   H HA   . GLU A 1 70  ? -70.418 21.776  18.117  1.00 29.54 ? 59   GLU A HA   1 
ATOM   762   H HB2  . GLU A 1 70  ? -72.581 22.168  19.895  1.00 35.30 ? 59   GLU A HB2  1 
ATOM   763   H HB3  . GLU A 1 70  ? -71.708 23.372  19.333  1.00 35.30 ? 59   GLU A HB3  1 
ATOM   764   H HG2  . GLU A 1 70  ? -73.115 21.671  17.614  1.00 40.96 ? 59   GLU A HG2  1 
ATOM   765   H HG3  . GLU A 1 70  ? -73.775 22.994  18.195  1.00 40.96 ? 59   GLU A HG3  1 
ATOM   766   N N    . ALA A 1 71  ? -68.639 21.996  19.785  1.00 21.26 ? 60   ALA A N    1 
ATOM   767   C CA   . ALA A 1 71  ? -67.596 22.062  20.799  1.00 22.87 ? 60   ALA A CA   1 
ATOM   768   C C    . ALA A 1 71  ? -67.518 23.406  21.501  1.00 22.92 ? 60   ALA A C    1 
ATOM   769   O O    . ALA A 1 71  ? -66.852 23.511  22.547  1.00 25.32 ? 60   ALA A O    1 
ATOM   770   C CB   . ALA A 1 71  ? -66.253 21.785  20.145  1.00 21.33 ? 60   ALA A CB   1 
ATOM   771   H H    . ALA A 1 71  ? -68.372 22.191  18.991  1.00 25.51 ? 60   ALA A H    1 
ATOM   772   H HA   . ALA A 1 71  ? -67.756 21.378  21.468  1.00 27.44 ? 60   ALA A HA   1 
ATOM   773   H HB1  . ALA A 1 71  ? -65.559 21.830  20.821  1.00 25.59 ? 60   ALA A HB1  1 
ATOM   774   H HB2  . ALA A 1 71  ? -66.273 20.901  19.748  1.00 25.59 ? 60   ALA A HB2  1 
ATOM   775   H HB3  . ALA A 1 71  ? -66.092 22.453  19.460  1.00 25.59 ? 60   ALA A HB3  1 
ATOM   776   N N    . HIS A 1 72  ? -68.169 24.434  20.954  1.00 24.16 ? 61   HIS A N    1 
ATOM   777   C CA   . HIS A 1 72  ? -68.226 25.749  21.600  1.00 27.01 ? 61   HIS A CA   1 
ATOM   778   C C    . HIS A 1 72  ? -66.859 26.287  22.014  1.00 26.03 ? 61   HIS A C    1 
ATOM   779   O O    . HIS A 1 72  ? -66.678 26.752  23.138  1.00 29.90 ? 61   HIS A O    1 
ATOM   780   C CB   . HIS A 1 72  ? -69.156 25.719  22.816  1.00 30.52 ? 61   HIS A CB   1 
ATOM   781   C CG   . HIS A 1 72  ? -70.530 25.220  22.512  1.00 39.99 ? 61   HIS A CG   1 
ATOM   782   N ND1  . HIS A 1 72  ? -71.409 25.925  21.718  1.00 46.01 ? 61   HIS A ND1  1 
ATOM   783   C CD2  . HIS A 1 72  ? -71.183 24.099  22.902  1.00 43.70 ? 61   HIS A CD2  1 
ATOM   784   C CE1  . HIS A 1 72  ? -72.544 25.254  21.623  1.00 44.47 ? 61   HIS A CE1  1 
ATOM   785   N NE2  . HIS A 1 72  ? -72.435 24.146  22.338  1.00 45.37 ? 61   HIS A NE2  1 
ATOM   786   H H    . HIS A 1 72  ? -68.588 24.396  20.204  1.00 28.99 ? 61   HIS A H    1 
ATOM   787   H HA   . HIS A 1 72  ? -68.602 26.381  20.967  1.00 32.41 ? 61   HIS A HA   1 
ATOM   788   H HB2  . HIS A 1 72  ? -68.771 25.136  23.489  1.00 36.62 ? 61   HIS A HB2  1 
ATOM   789   H HB3  . HIS A 1 72  ? -69.238 26.619  23.169  1.00 36.62 ? 61   HIS A HB3  1 
ATOM   790   H HD2  . HIS A 1 72  ? -70.848 23.426  23.450  1.00 52.44 ? 61   HIS A HD2  1 
ATOM   791   H HE1  . HIS A 1 72  ? -73.294 25.519  21.142  1.00 53.36 ? 61   HIS A HE1  1 
ATOM   792   H HE2  . HIS A 1 72  ? -73.046 23.547  22.427  1.00 54.44 ? 61   HIS A HE2  1 
ATOM   793   N N    . SER A 1 73  ? -65.872 26.166  21.114  1.00 25.56 ? 62   SER A N    1 
ATOM   794   C CA   . SER A 1 73  ? -64.509 26.667  21.265  1.00 23.28 ? 62   SER A CA   1 
ATOM   795   C C    . SER A 1 73  ? -63.713 25.918  22.308  1.00 21.43 ? 62   SER A C    1 
ATOM   796   O O    . SER A 1 73  ? -62.596 26.337  22.637  1.00 23.61 ? 62   SER A O    1 
ATOM   797   C CB   . SER A 1 73  ? -64.454 28.166  21.542  1.00 27.60 ? 62   SER A CB   1 
ATOM   798   O OG   . SER A 1 73  ? -65.034 28.865  20.444  1.00 34.95 ? 62   SER A OG   1 
ATOM   799   H H    . SER A 1 73  ? -65.986 25.769  20.360  1.00 30.67 ? 62   SER A H    1 
ATOM   800   H HA   . SER A 1 73  ? -64.054 26.526  20.419  1.00 27.93 ? 62   SER A HA   1 
ATOM   801   H HB2  . SER A 1 73  ? -64.954 28.362  22.349  1.00 33.13 ? 62   SER A HB2  1 
ATOM   802   H HB3  . SER A 1 73  ? -63.529 28.439  21.644  1.00 33.13 ? 62   SER A HB3  1 
ATOM   803   H HG   . SER A 1 73  ? -65.834 28.630  20.344  1.00 41.94 ? 62   SER A HG   1 
ATOM   804   N N    . ARG A 1 74  ? -64.214 24.777  22.782  1.00 21.59 ? 63   ARG A N    1 
ATOM   805   C CA   . ARG A 1 74  ? -63.467 23.992  23.743  1.00 20.92 ? 63   ARG A CA   1 
ATOM   806   C C    . ARG A 1 74  ? -62.309 23.268  23.063  1.00 18.25 ? 63   ARG A C    1 
ATOM   807   O O    . ARG A 1 74  ? -62.309 23.034  21.854  1.00 18.85 ? 63   ARG A O    1 
ATOM   808   C CB   . ARG A 1 74  ? -64.389 22.965  24.387  1.00 22.77 ? 63   ARG A CB   1 
ATOM   809   C CG   . ARG A 1 74  ? -65.448 23.640  25.209  1.00 33.48 ? 63   ARG A CG   1 
ATOM   810   C CD   . ARG A 1 74  ? -66.535 22.660  25.634  1.00 42.12 ? 63   ARG A CD   1 
ATOM   811   N NE   . ARG A 1 74  ? -67.519 23.322  26.480  1.00 51.33 ? 63   ARG A NE   1 
ATOM   812   C CZ   . ARG A 1 74  ? -67.270 23.748  27.721  1.00 57.96 ? 63   ARG A CZ   1 
ATOM   813   N NH1  . ARG A 1 74  ? -66.057 23.588  28.259  1.00 51.67 ? 63   ARG A NH1  1 
ATOM   814   N NH2  . ARG A 1 74  ? -68.230 24.341  28.427  1.00 64.99 ? 63   ARG A NH2  1 
ATOM   815   H H    . ARG A 1 74  ? -64.976 24.445  22.563  1.00 25.91 ? 63   ARG A H    1 
ATOM   816   H HA   . ARG A 1 74  ? -63.111 24.571  24.435  1.00 25.11 ? 63   ARG A HA   1 
ATOM   817   H HB2  . ARG A 1 74  ? -64.825 22.444  23.694  1.00 27.32 ? 63   ARG A HB2  1 
ATOM   818   H HB3  . ARG A 1 74  ? -63.871 22.388  24.969  1.00 27.32 ? 63   ARG A HB3  1 
ATOM   819   H HG2  . ARG A 1 74  ? -65.044 24.012  26.008  1.00 40.18 ? 63   ARG A HG2  1 
ATOM   820   H HG3  . ARG A 1 74  ? -65.861 24.343  24.683  1.00 40.18 ? 63   ARG A HG3  1 
ATOM   821   H HD2  . ARG A 1 74  ? -66.988 22.318  24.847  1.00 50.54 ? 63   ARG A HD2  1 
ATOM   822   H HD3  . ARG A 1 74  ? -66.136 21.934  26.138  1.00 50.54 ? 63   ARG A HD3  1 
ATOM   823   H HE   . ARG A 1 74  ? -68.327 23.378  26.190  1.00 61.60 ? 63   ARG A HE   1 
ATOM   824   H HH11 . ARG A 1 74  ? -65.433 23.205  27.807  1.00 62.00 ? 63   ARG A HH11 1 
ATOM   825   H HH12 . ARG A 1 74  ? -65.901 23.866  29.058  1.00 62.00 ? 63   ARG A HH12 1 
ATOM   826   H HH21 . ARG A 1 74  ? -69.012 24.448  28.085  1.00 77.98 ? 63   ARG A HH21 1 
ATOM   827   H HH22 . ARG A 1 74  ? -68.069 24.618  29.225  1.00 77.98 ? 63   ARG A HH22 1 
ATOM   828   N N    . MET A 1 75  ? -61.303 22.937  23.874  1.00 17.52 ? 64   MET A N    1 
ATOM   829   C CA   . MET A 1 75  ? -60.138 22.182  23.422  1.00 17.57 ? 64   MET A CA   1 
ATOM   830   C C    . MET A 1 75  ? -60.553 20.812  22.904  1.00 15.12 ? 64   MET A C    1 
ATOM   831   O O    . MET A 1 75  ? -61.296 20.078  23.569  1.00 15.79 ? 64   MET A O    1 
ATOM   832   C CB   . MET A 1 75  ? -59.260 21.911  24.647  1.00 18.40 ? 64   MET A CB   1 
ATOM   833   C CG   . MET A 1 75  ? -58.577 23.107  25.254  1.00 19.12 ? 64   MET A CG   1 
ATOM   834   S SD   . MET A 1 75  ? -57.774 22.661  26.807  1.00 17.84 ? 64   MET A SD   1 
ATOM   835   C CE   . MET A 1 75  ? -56.579 21.490  26.255  1.00 17.64 ? 64   MET A CE   1 
ATOM   836   H H    . MET A 1 75  ? -61.273 23.144  24.708  1.00 21.03 ? 64   MET A H    1 
ATOM   837   H HA   . MET A 1 75  ? -59.637 22.674  22.753  1.00 21.08 ? 64   MET A HA   1 
ATOM   838   H HB2  . MET A 1 75  ? -59.814 21.514  25.337  1.00 22.08 ? 64   MET A HB2  1 
ATOM   839   H HB3  . MET A 1 75  ? -58.567 21.282  24.391  1.00 22.08 ? 64   MET A HB3  1 
ATOM   840   H HG2  . MET A 1 75  ? -57.900 23.437  24.643  1.00 22.94 ? 64   MET A HG2  1 
ATOM   841   H HG3  . MET A 1 75  ? -59.235 23.796  25.436  1.00 22.94 ? 64   MET A HG3  1 
ATOM   842   H HE1  . MET A 1 75  ? -56.073 21.171  27.019  1.00 21.16 ? 64   MET A HE1  1 
ATOM   843   H HE2  . MET A 1 75  ? -57.037 20.749  25.828  1.00 21.16 ? 64   MET A HE2  1 
ATOM   844   H HE3  . MET A 1 75  ? -55.984 21.921  25.621  1.00 21.16 ? 64   MET A HE3  1 
ATOM   845   N N    . VAL A 1 76  ? -59.988 20.434  21.763  1.00 14.57 ? 65   VAL A N    1 
ATOM   846   C CA   . VAL A 1 76  ? -60.098 19.089  21.215  1.00 14.26 ? 65   VAL A CA   1 
ATOM   847   C C    . VAL A 1 76  ? -58.668 18.576  21.104  1.00 13.46 ? 65   VAL A C    1 
ATOM   848   O O    . VAL A 1 76  ? -57.872 19.159  20.362  1.00 14.37 ? 65   VAL A O    1 
ATOM   849   C CB   . VAL A 1 76  ? -60.808 19.075  19.850  1.00 14.01 ? 65   VAL A CB   1 
ATOM   850   C CG1  . VAL A 1 76  ? -61.070 17.642  19.458  1.00 16.07 ? 65   VAL A CG1  1 
ATOM   851   C CG2  . VAL A 1 76  ? -62.105 19.866  19.928  1.00 17.20 ? 65   VAL A CG2  1 
ATOM   852   H H    . VAL A 1 76  ? -59.518 20.960  21.270  1.00 17.49 ? 65   VAL A H    1 
ATOM   853   H HA   . VAL A 1 76  ? -60.588 18.521  21.830  1.00 17.11 ? 65   VAL A HA   1 
ATOM   854   H HB   . VAL A 1 76  ? -60.236 19.481  19.180  1.00 16.81 ? 65   VAL A HB   1 
ATOM   855   H HG11 . VAL A 1 76  ? -61.518 17.627  18.598  1.00 19.29 ? 65   VAL A HG11 1 
ATOM   856   H HG12 . VAL A 1 76  ? -60.223 17.172  19.399  1.00 19.29 ? 65   VAL A HG12 1 
ATOM   857   H HG13 . VAL A 1 76  ? -61.632 17.228  20.131  1.00 19.29 ? 65   VAL A HG13 1 
ATOM   858   H HG21 . VAL A 1 76  ? -62.538 19.847  19.060  1.00 20.64 ? 65   VAL A HG21 1 
ATOM   859   H HG22 . VAL A 1 76  ? -62.681 19.462  20.595  1.00 20.64 ? 65   VAL A HG22 1 
ATOM   860   H HG23 . VAL A 1 76  ? -61.901 20.781  20.176  1.00 20.64 ? 65   VAL A HG23 1 
ATOM   861   N N    . ILE A 1 77  ? -58.343 17.516  21.831  1.00 14.19 ? 66   ILE A N    1 
ATOM   862   C CA   . ILE A 1 77  ? -56.988 16.985  21.866  1.00 13.09 ? 66   ILE A CA   1 
ATOM   863   C C    . ILE A 1 77  ? -56.988 15.576  21.285  1.00 12.80 ? 66   ILE A C    1 
ATOM   864   O O    . ILE A 1 77  ? -58.007 14.867  21.354  1.00 13.20 ? 66   ILE A O    1 
ATOM   865   C CB   . ILE A 1 77  ? -56.427 16.966  23.299  1.00 13.03 ? 66   ILE A CB   1 
ATOM   866   C CG1  . ILE A 1 77  ? -57.294 16.101  24.212  1.00 14.15 ? 66   ILE A CG1  1 
ATOM   867   C CG2  . ILE A 1 77  ? -56.187 18.366  23.830  1.00 16.20 ? 66   ILE A CG2  1 
ATOM   868   C CD1  . ILE A 1 77  ? -56.690 15.959  25.609  1.00 17.14 ? 66   ILE A CD1  1 
ATOM   869   H H    . ILE A 1 77  ? -58.899 17.080  22.321  1.00 17.03 ? 66   ILE A H    1 
ATOM   870   H HA   . ILE A 1 77  ? -56.410 17.540  21.320  1.00 15.70 ? 66   ILE A HA   1 
ATOM   871   H HB   . ILE A 1 77  ? -55.559 16.536  23.252  1.00 15.63 ? 66   ILE A HB   1 
ATOM   872   H HG12 . ILE A 1 77  ? -58.169 16.509  24.301  1.00 16.98 ? 66   ILE A HG12 1 
ATOM   873   H HG13 . ILE A 1 77  ? -57.376 15.215  23.827  1.00 16.98 ? 66   ILE A HG13 1 
ATOM   874   H HG21 . ILE A 1 77  ? -55.836 18.305  24.732  1.00 19.45 ? 66   ILE A HG21 1 
ATOM   875   H HG22 . ILE A 1 77  ? -55.549 18.817  23.256  1.00 19.45 ? 66   ILE A HG22 1 
ATOM   876   H HG23 . ILE A 1 77  ? -57.028 18.850  23.835  1.00 19.45 ? 66   ILE A HG23 1 
ATOM   877   H HD11 . ILE A 1 77  ? -57.273 15.404  26.150  1.00 20.57 ? 66   ILE A HD11 1 
ATOM   878   H HD12 . ILE A 1 77  ? -55.815 15.546  25.534  1.00 20.57 ? 66   ILE A HD12 1 
ATOM   879   H HD13 . ILE A 1 77  ? -56.607 16.839  26.008  1.00 20.57 ? 66   ILE A HD13 1 
ATOM   880   N N    . PRO A 1 78  ? -55.835 15.075  20.823  1.00 11.83 ? 67   PRO A N    1 
ATOM   881   C CA   . PRO A 1 78  ? -55.714 13.628  20.573  1.00 11.77 ? 67   PRO A CA   1 
ATOM   882   C C    . PRO A 1 78  ? -55.974 12.841  21.859  1.00 11.95 ? 67   PRO A C    1 
ATOM   883   O O    . PRO A 1 78  ? -55.623 13.285  22.949  1.00 12.04 ? 67   PRO A O    1 
ATOM   884   C CB   . PRO A 1 78  ? -54.255 13.468  20.118  1.00 11.34 ? 67   PRO A CB   1 
ATOM   885   C CG   . PRO A 1 78  ? -53.817 14.850  19.659  1.00 12.73 ? 67   PRO A CG   1 
ATOM   886   C CD   . PRO A 1 78  ? -54.553 15.767  20.625  1.00 13.17 ? 67   PRO A CD   1 
ATOM   887   H HA   . PRO A 1 78  ? -56.319 13.340  19.872  1.00 14.12 ? 67   PRO A HA   1 
ATOM   888   H HB2  . PRO A 1 78  ? -53.713 13.167  20.863  1.00 13.61 ? 67   PRO A HB2  1 
ATOM   889   H HB3  . PRO A 1 78  ? -54.211 12.835  19.384  1.00 13.61 ? 67   PRO A HB3  1 
ATOM   890   H HG2  . PRO A 1 78  ? -52.855 14.943  19.751  1.00 15.28 ? 67   PRO A HG2  1 
ATOM   891   H HG3  . PRO A 1 78  ? -54.100 15.004  18.744  1.00 15.28 ? 67   PRO A HG3  1 
ATOM   892   H HD2  . PRO A 1 78  ? -54.071 15.834  21.464  1.00 15.80 ? 67   PRO A HD2  1 
ATOM   893   H HD3  . PRO A 1 78  ? -54.696 16.638  20.224  1.00 15.80 ? 67   PRO A HD3  1 
ATOM   894   N N    . GLY A 1 79  ? -56.626 11.688  21.743  1.00 12.27 ? 68   GLY A N    1 
ATOM   895   C CA   . GLY A 1 79  ? -56.794 10.840  22.908  1.00 12.51 ? 68   GLY A CA   1 
ATOM   896   C C    . GLY A 1 79  ? -55.451 10.442  23.496  1.00 11.57 ? 68   GLY A C    1 
ATOM   897   O O    . GLY A 1 79  ? -54.450 10.261  22.807  1.00 12.34 ? 68   GLY A O    1 
ATOM   898   H H    . GLY A 1 79  ? -56.972 11.383  21.018  1.00 14.72 ? 68   GLY A H    1 
ATOM   899   H HA2  . GLY A 1 79  ? -57.303 11.312  23.585  1.00 15.02 ? 68   GLY A HA2  1 
ATOM   900   H HA3  . GLY A 1 79  ? -57.276 10.036  22.660  1.00 15.02 ? 68   GLY A HA3  1 
ATOM   901   N N    . GLY A 1 80  ? -55.412 10.276  24.816  1.00 12.47 ? 69   GLY A N    1 
ATOM   902   C CA   . GLY A 1 80  ? -54.186 9.862   25.458  1.00 11.77 ? 69   GLY A CA   1 
ATOM   903   C C    . GLY A 1 80  ? -53.786 8.456   25.042  1.00 10.30 ? 69   GLY A C    1 
ATOM   904   O O    . GLY A 1 80  ? -54.621 7.595   24.756  1.00 12.14 ? 69   GLY A O    1 
ATOM   905   H H    . GLY A 1 80  ? -56.076 10.397  25.349  1.00 14.96 ? 69   GLY A H    1 
ATOM   906   H HA2  . GLY A 1 80  ? -53.470 10.471  25.219  1.00 14.13 ? 69   GLY A HA2  1 
ATOM   907   H HA3  . GLY A 1 80  ? -54.300 9.880   26.421  1.00 14.13 ? 69   GLY A HA3  1 
ATOM   908   N N    . ILE A 1 81  ? -52.480 8.213   25.118  1.00 10.83 ? 70   ILE A N    1 
ATOM   909   C CA   . ILE A 1 81  ? -51.895 6.902   24.955  1.00 10.58 ? 70   ILE A CA   1 
ATOM   910   C C    . ILE A 1 81  ? -51.266 6.552   26.298  1.00 10.22 ? 70   ILE A C    1 
ATOM   911   O O    . ILE A 1 81  ? -50.255 7.144   26.690  1.00 11.06 ? 70   ILE A O    1 
ATOM   912   C CB   . ILE A 1 81  ? -50.844 6.843   23.845  1.00 11.02 ? 70   ILE A CB   1 
ATOM   913   C CG1  . ILE A 1 81  ? -51.398 7.351   22.526  1.00 12.02 ? 70   ILE A CG1  1 
ATOM   914   C CG2  . ILE A 1 81  ? -50.272 5.442   23.763  1.00 12.83 ? 70   ILE A CG2  1 
ATOM   915   C CD1  . ILE A 1 81  ? -50.384 7.460   21.413  1.00 13.29 ? 70   ILE A CD1  1 
ATOM   916   H H    . ILE A 1 81  ? -51.895 8.825   25.270  1.00 12.99 ? 70   ILE A H    1 
ATOM   917   H HA   . ILE A 1 81  ? -52.591 6.255   24.760  1.00 12.70 ? 70   ILE A HA   1 
ATOM   918   H HB   . ILE A 1 81  ? -50.120 7.435   24.100  1.00 13.22 ? 70   ILE A HB   1 
ATOM   919   H HG12 . ILE A 1 81  ? -52.095 6.745   22.229  1.00 14.43 ? 70   ILE A HG12 1 
ATOM   920   H HG13 . ILE A 1 81  ? -51.773 8.234   22.668  1.00 14.43 ? 70   ILE A HG13 1 
ATOM   921   H HG21 . ILE A 1 81  ? -49.608 5.414   23.057  1.00 15.40 ? 70   ILE A HG21 1 
ATOM   922   H HG22 . ILE A 1 81  ? -49.862 5.218   24.613  1.00 15.40 ? 70   ILE A HG22 1 
ATOM   923   H HG23 . ILE A 1 81  ? -50.990 4.819   23.567  1.00 15.40 ? 70   ILE A HG23 1 
ATOM   924   H HD11 . ILE A 1 81  ? -50.826 7.790   20.616  1.00 15.95 ? 70   ILE A HD11 1 
ATOM   925   H HD12 . ILE A 1 81  ? -49.685 8.075   21.684  1.00 15.95 ? 70   ILE A HD12 1 
ATOM   926   H HD13 . ILE A 1 81  ? -50.007 6.583   21.244  1.00 15.95 ? 70   ILE A HD13 1 
ATOM   927   N N    . ASP A 1 82  ? -51.824 5.572   27.001  1.00 11.15 ? 71   ASP A N    1 
ATOM   928   C CA   . ASP A 1 82  ? -51.241 5.101   28.240  1.00 10.26 ? 71   ASP A CA   1 
ATOM   929   C C    . ASP A 1 82  ? -50.246 4.037   27.846  1.00 10.62 ? 71   ASP A C    1 
ATOM   930   O O    . ASP A 1 82  ? -50.593 2.904   27.506  1.00 11.63 ? 71   ASP A O    1 
ATOM   931   C CB   . ASP A 1 82  ? -52.296 4.555   29.174  1.00 11.50 ? 71   ASP A CB   1 
ATOM   932   C CG   . ASP A 1 82  ? -51.758 4.208   30.534  1.00 11.28 ? 71   ASP A CG   1 
ATOM   933   O OD1  . ASP A 1 82  ? -50.502 4.044   30.656  1.00 11.64 ? 71   ASP A OD1  1 
ATOM   934   O OD2  . ASP A 1 82  ? -52.587 4.092   31.487  1.00 11.53 ? 71   ASP A OD2  1 
ATOM   935   H H    . ASP A 1 82  ? -52.546 5.163   26.775  1.00 13.38 ? 71   ASP A H    1 
ATOM   936   H HA   . ASP A 1 82  ? -50.771 5.826   28.682  1.00 12.32 ? 71   ASP A HA   1 
ATOM   937   H HB2  . ASP A 1 82  ? -52.991 5.222   29.289  1.00 13.80 ? 71   ASP A HB2  1 
ATOM   938   H HB3  . ASP A 1 82  ? -52.672 3.749   28.787  1.00 13.80 ? 71   ASP A HB3  1 
ATOM   939   N N    . VAL A 1 83  ? -48.972 4.407   27.887  1.00 10.93 ? 72   VAL A N    1 
ATOM   940   C CA   . VAL A 1 83  ? -47.869 3.554   27.499  1.00 10.41 ? 72   VAL A CA   1 
ATOM   941   C C    . VAL A 1 83  ? -47.625 2.393   28.444  1.00 10.00 ? 72   VAL A C    1 
ATOM   942   O O    . VAL A 1 83  ? -46.749 1.566   28.151  1.00 11.16 ? 72   VAL A O    1 
ATOM   943   C CB   . VAL A 1 83  ? -46.564 4.321   27.314  1.00 11.06 ? 72   VAL A CB   1 
ATOM   944   C CG1  . VAL A 1 83  ? -46.695 5.249   26.115  1.00 11.99 ? 72   VAL A CG1  1 
ATOM   945   C CG2  . VAL A 1 83  ? -46.190 5.084   28.574  1.00 11.25 ? 72   VAL A CG2  1 
ATOM   946   H H    . VAL A 1 83  ? -48.717 5.186   28.149  1.00 13.12 ? 72   VAL A H    1 
ATOM   947   H HA   . VAL A 1 83  ? -48.089 3.168   26.636  1.00 12.49 ? 72   VAL A HA   1 
ATOM   948   H HB   . VAL A 1 83  ? -45.852 3.689   27.126  1.00 13.27 ? 72   VAL A HB   1 
ATOM   949   H HG11 . VAL A 1 83  ? -45.864 5.735   26.000  1.00 14.39 ? 72   VAL A HG11 1 
ATOM   950   H HG12 . VAL A 1 83  ? -46.881 4.719   25.325  1.00 14.39 ? 72   VAL A HG12 1 
ATOM   951   H HG13 . VAL A 1 83  ? -47.423 5.870   26.276  1.00 14.39 ? 72   VAL A HG13 1 
ATOM   952   H HG21 . VAL A 1 83  ? -45.357 5.558   28.420  1.00 13.50 ? 72   VAL A HG21 1 
ATOM   953   H HG22 . VAL A 1 83  ? -46.896 5.715   28.782  1.00 13.50 ? 72   VAL A HG22 1 
ATOM   954   H HG23 . VAL A 1 83  ? -46.082 4.455   29.304  1.00 13.50 ? 72   VAL A HG23 1 
ATOM   955   N N    . HIS A 1 84  ? -48.319 2.330   29.572  1.00 10.75 ? 73   HIS A N    1 
ATOM   956   C CA   . HIS A 1 84  ? -48.048 1.277   30.542  1.00 10.43 ? 73   HIS A CA   1 
ATOM   957   C C    . HIS A 1 84  ? -49.342 0.869   31.260  1.00 10.65 ? 73   HIS A C    1 
ATOM   958   O O    . HIS A 1 84  ? -49.706 1.495   32.257  1.00 11.30 ? 73   HIS A O    1 
ATOM   959   C CB   . HIS A 1 84  ? -46.990 1.730   31.545  1.00 10.65 ? 73   HIS A CB   1 
ATOM   960   C CG   . HIS A 1 84  ? -46.429 0.620   32.381  1.00 10.76 ? 73   HIS A CG   1 
ATOM   961   N ND1  . HIS A 1 84  ? -45.171 0.690   32.923  1.00 11.91 ? 73   HIS A ND1  1 
ATOM   962   C CD2  . HIS A 1 84  ? -46.919 -0.607  32.712  1.00 11.47 ? 73   HIS A CD2  1 
ATOM   963   C CE1  . HIS A 1 84  ? -44.926 -0.436  33.584  1.00 11.38 ? 73   HIS A CE1  1 
ATOM   964   N NE2  . HIS A 1 84  ? -45.965 -1.240  33.480  1.00 11.84 ? 73   HIS A NE2  1 
ATOM   965   H H    . HIS A 1 84  ? -48.943 2.876   29.799  1.00 12.90 ? 73   HIS A H    1 
ATOM   966   H HA   . HIS A 1 84  ? -47.705 0.499   30.076  1.00 12.51 ? 73   HIS A HA   1 
ATOM   967   H HB2  . HIS A 1 84  ? -46.255 2.136   31.060  1.00 12.78 ? 73   HIS A HB2  1 
ATOM   968   H HB3  . HIS A 1 84  ? -47.387 2.381   32.144  1.00 12.78 ? 73   HIS A HB3  1 
ATOM   969   H HD1  . HIS A 1 84  ? -44.635 1.359   32.859  1.00 14.29 ? 73   HIS A HD1  1 
ATOM   970   H HD2  . HIS A 1 84  ? -47.754 -0.946  32.483  1.00 13.77 ? 73   HIS A HD2  1 
ATOM   971   H HE1  . HIS A 1 84  ? -44.143 -0.626  34.050  1.00 13.65 ? 73   HIS A HE1  1 
ATOM   972   N N    . THR A 1 85  ? -49.955 -0.222  30.831  1.00 10.81 ? 74   THR A N    1 
ATOM   973   C CA   . THR A 1 85  ? -51.043 -0.848  31.585  1.00 10.89 ? 74   THR A CA   1 
ATOM   974   C C    . THR A 1 85  ? -50.675 -2.293  31.850  1.00 11.44 ? 74   THR A C    1 
ATOM   975   O O    . THR A 1 85  ? -49.845 -2.872  31.133  1.00 11.56 ? 74   THR A O    1 
ATOM   976   C CB   . THR A 1 85  ? -52.386 -0.680  30.870  1.00 12.22 ? 74   THR A CB   1 
ATOM   977   O OG1  . THR A 1 85  ? -52.373 -1.333  29.602  1.00 12.18 ? 74   THR A OG1  1 
ATOM   978   C CG2  . THR A 1 85  ? -52.731 0.791   30.684  1.00 12.99 ? 74   THR A CG2  1 
ATOM   979   H H    . THR A 1 85  ? -49.760 -0.629  30.098  1.00 12.98 ? 74   THR A H    1 
ATOM   980   H HA   . THR A 1 85  ? -51.116 -0.404  32.445  1.00 13.06 ? 74   THR A HA   1 
ATOM   981   H HB   . THR A 1 85  ? -53.081 -1.078  31.417  1.00 14.66 ? 74   THR A HB   1 
ATOM   982   H HG1  . THR A 1 85  ? -52.226 -2.154  29.703  1.00 14.61 ? 74   THR A HG1  1 
ATOM   983   H HG21 . THR A 1 85  ? -53.584 0.876   30.229  1.00 15.59 ? 74   THR A HG21 1 
ATOM   984   H HG22 . THR A 1 85  ? -52.789 1.230   31.547  1.00 15.59 ? 74   THR A HG22 1 
ATOM   985   H HG23 . THR A 1 85  ? -52.046 1.227   30.153  1.00 15.59 ? 74   THR A HG23 1 
ATOM   986   N N    . ARG A 1 86  ? -51.300 -2.868  32.878  1.00 12.40 ? 75   ARG A N    1 
ATOM   987   C CA   . ARG A 1 86  ? -51.130 -4.271  33.242  1.00 12.76 ? 75   ARG A CA   1 
ATOM   988   C C    . ARG A 1 86  ? -52.512 -4.818  33.635  1.00 13.01 ? 75   ARG A C    1 
ATOM   989   O O    . ARG A 1 86  ? -52.739 -5.318  34.739  1.00 14.85 ? 75   ARG A O    1 
ATOM   990   C CB   . ARG A 1 86  ? -50.066 -4.455  34.311  1.00 13.82 ? 75   ARG A CB   1 
ATOM   991   C CG   . ARG A 1 86  ? -48.703 -3.997  33.842  1.00 13.21 ? 75   ARG A CG   1 
ATOM   992   C CD   . ARG A 1 86  ? -47.618 -4.294  34.870  1.00 14.23 ? 75   ARG A CD   1 
ATOM   993   N NE   . ARG A 1 86  ? -46.275 -4.036  34.351  1.00 12.77 ? 75   ARG A NE   1 
ATOM   994   C CZ   . ARG A 1 86  ? -45.539 -4.934  33.698  1.00 12.74 ? 75   ARG A CZ   1 
ATOM   995   N NH1  . ARG A 1 86  ? -45.957 -6.187  33.522  1.00 14.81 ? 75   ARG A NH1  1 
ATOM   996   N NH2  . ARG A 1 86  ? -44.331 -4.596  33.260  1.00 13.46 ? 75   ARG A NH2  1 
ATOM   997   H H    . ARG A 1 86  ? -51.846 -2.449  33.394  1.00 14.88 ? 75   ARG A H    1 
ATOM   998   H HA   . ARG A 1 86  ? -50.838 -4.759  32.456  1.00 15.32 ? 75   ARG A HA   1 
ATOM   999   H HB2  . ARG A 1 86  ? -50.307 -3.934  35.093  1.00 16.58 ? 75   ARG A HB2  1 
ATOM   1000  H HB3  . ARG A 1 86  ? -50.005 -5.395  34.541  1.00 16.58 ? 75   ARG A HB3  1 
ATOM   1001  H HG2  . ARG A 1 86  ? -48.476 -4.460  33.020  1.00 15.85 ? 75   ARG A HG2  1 
ATOM   1002  H HG3  . ARG A 1 86  ? -48.723 -3.039  33.691  1.00 15.85 ? 75   ARG A HG3  1 
ATOM   1003  H HD2  . ARG A 1 86  ? -47.754 -3.729  35.647  1.00 17.08 ? 75   ARG A HD2  1 
ATOM   1004  H HD3  . ARG A 1 86  ? -47.668 -5.228  35.124  1.00 17.08 ? 75   ARG A HD3  1 
ATOM   1005  H HE   . ARG A 1 86  ? -45.939 -3.254  34.475  1.00 15.32 ? 75   ARG A HE   1 
ATOM   1006  H HH11 . ARG A 1 86  ? -46.735 -6.424  33.801  1.00 17.77 ? 75   ARG A HH11 1 
ATOM   1007  H HH12 . ARG A 1 86  ? -45.459 -6.752  33.107  1.00 17.77 ? 75   ARG A HH12 1 
ATOM   1008  H HH21 . ARG A 1 86  ? -44.041 -3.795  33.376  1.00 16.15 ? 75   ARG A HH21 1 
ATOM   1009  H HH22 . ARG A 1 86  ? -43.844 -5.175  32.852  1.00 16.15 ? 75   ARG A HH22 1 
ATOM   1010  N N    . PHE A 1 87  ? -53.438 -4.733  32.697  1.00 13.11 ? 76   PHE A N    1 
ATOM   1011  C CA   . PHE A 1 87  ? -54.793 -5.187  32.941  1.00 13.80 ? 76   PHE A CA   1 
ATOM   1012  C C    . PHE A 1 87  ? -54.857 -6.702  32.963  1.00 14.54 ? 76   PHE A C    1 
ATOM   1013  O O    . PHE A 1 87  ? -54.159 -7.388  32.254  1.00 16.08 ? 76   PHE A O    1 
ATOM   1014  C CB   . PHE A 1 87  ? -55.727 -4.670  31.865  1.00 14.81 ? 76   PHE A CB   1 
ATOM   1015  C CG   . PHE A 1 87  ? -55.804 -3.171  31.769  1.00 13.99 ? 76   PHE A CG   1 
ATOM   1016  C CD1  . PHE A 1 87  ? -55.808 -2.373  32.895  1.00 13.69 ? 76   PHE A CD1  1 
ATOM   1017  C CD2  . PHE A 1 87  ? -55.838 -2.560  30.531  1.00 14.59 ? 76   PHE A CD2  1 
ATOM   1018  C CE1  . PHE A 1 87  ? -55.894 -0.985  32.765  1.00 14.15 ? 76   PHE A CE1  1 
ATOM   1019  C CE2  . PHE A 1 87  ? -55.950 -1.168  30.422  1.00 13.40 ? 76   PHE A CE2  1 
ATOM   1020  C CZ   . PHE A 1 87  ? -55.959 -0.399  31.532  1.00 13.43 ? 76   PHE A CZ   1 
ATOM   1021  H H    . PHE A 1 87  ? -53.307 -4.415  31.909  1.00 15.73 ? 76   PHE A H    1 
ATOM   1022  H HA   . PHE A 1 87  ? -55.098 -4.853  33.799  1.00 16.55 ? 76   PHE A HA   1 
ATOM   1023  H HB2  . PHE A 1 87  ? -55.424 -5.004  31.006  1.00 17.78 ? 76   PHE A HB2  1 
ATOM   1024  H HB3  . PHE A 1 87  ? -56.621 -4.999  32.046  1.00 17.78 ? 76   PHE A HB3  1 
ATOM   1025  H HD1  . PHE A 1 87  ? -55.779 -2.760  33.740  1.00 16.42 ? 76   PHE A HD1  1 
ATOM   1026  H HD2  . PHE A 1 87  ? -55.847 -3.082  29.761  1.00 17.51 ? 76   PHE A HD2  1 
ATOM   1027  H HE1  . PHE A 1 87  ? -55.906 -0.452  33.528  1.00 16.97 ? 76   PHE A HE1  1 
ATOM   1028  H HE2  . PHE A 1 87  ? -55.976 -0.770  29.582  1.00 16.08 ? 76   PHE A HE2  1 
ATOM   1029  H HZ   . PHE A 1 87  ? -56.006 0.527   31.458  1.00 16.11 ? 76   PHE A HZ   1 
ATOM   1030  N N    . GLN A 1 88  ? -55.752 -7.217  33.784  1.00 16.80 ? 77   GLN A N    1 
ATOM   1031  C CA   . GLN A 1 88  ? -56.008 -8.660  33.774  1.00 19.29 ? 77   GLN A CA   1 
ATOM   1032  C C    . GLN A 1 88  ? -54.749 -9.451  34.147  1.00 19.96 ? 77   GLN A C    1 
ATOM   1033  O O    . GLN A 1 88  ? -54.626 -10.623 33.792  1.00 22.12 ? 77   GLN A O    1 
ATOM   1034  C CB   . GLN A 1 88  ? -56.582 -9.119  32.393  1.00 20.13 ? 77   GLN A CB   1 
ATOM   1035  C CG   . GLN A 1 88  ? -57.494 -10.309 32.496  1.00 26.70 ? 77   GLN A CG   1 
ATOM   1036  C CD   . GLN A 1 88  ? -58.396 -10.462 31.305  1.00 22.06 ? 77   GLN A CD   1 
ATOM   1037  O OE1  . GLN A 1 88  ? -58.823 -9.491  30.673  1.00 19.07 ? 77   GLN A OE1  1 
ATOM   1038  N NE2  . GLN A 1 88  ? -58.750 -11.697 31.034  1.00 25.17 ? 77   GLN A NE2  1 
ATOM   1039  H H    . GLN A 1 88  ? -56.220 -6.770  34.349  1.00 20.16 ? 77   GLN A H    1 
ATOM   1040  H HA   . GLN A 1 88  ? -56.681 -8.854  34.445  1.00 23.15 ? 77   GLN A HA   1 
ATOM   1041  H HB2  . GLN A 1 88  ? -57.087 -8.388  32.003  1.00 24.16 ? 77   GLN A HB2  1 
ATOM   1042  H HB3  . GLN A 1 88  ? -55.844 -9.358  31.810  1.00 24.16 ? 77   GLN A HB3  1 
ATOM   1043  H HG2  . GLN A 1 88  ? -56.956 -11.113 32.569  1.00 32.04 ? 77   GLN A HG2  1 
ATOM   1044  H HG3  . GLN A 1 88  ? -58.052 -10.211 33.283  1.00 32.04 ? 77   GLN A HG3  1 
ATOM   1045  H HE21 . GLN A 1 88  ? -58.467 -12.344 31.525  1.00 30.21 ? 77   GLN A HE21 1 
ATOM   1046  H HE22 . GLN A 1 88  ? -59.266 -11.859 30.365  1.00 30.21 ? 77   GLN A HE22 1 
ATOM   1047  N N    . MET A 1 89  ? -53.804 -8.854  34.829  1.00 17.64 ? 78   MET A N    1 
ATOM   1048  C CA   . MET A 1 89  ? -52.496 -9.494  34.977  1.00 16.91 ? 78   MET A CA   1 
ATOM   1049  C C    . MET A 1 89  ? -52.540 -10.585 36.049  1.00 19.92 ? 78   MET A C    1 
ATOM   1050  O O    . MET A 1 89  ? -53.074 -10.359 37.131  1.00 21.75 ? 78   MET A O    1 
ATOM   1051  C CB   . MET A 1 89  ? -51.422 -8.486  35.321  1.00 22.01 ? 78   MET A CB   1 
ATOM   1052  C CG   . MET A 1 89  ? -49.994 -9.074  35.206  1.00 20.22 ? 78   MET A CG   1 
ATOM   1053  S SD   . MET A 1 89  ? -48.872 -8.000  36.021  1.00 22.84 ? 78   MET A SD   1 
ATOM   1054  C CE   . MET A 1 89  ? -49.483 -8.315  37.690  1.00 32.33 ? 78   MET A CE   1 
ATOM   1055  H H    . MET A 1 89  ? -53.879 -8.089  35.216  1.00 21.17 ? 78   MET A H    1 
ATOM   1056  H HA   . MET A 1 89  ? -52.254 -9.902  34.130  1.00 20.29 ? 78   MET A HA   1 
ATOM   1057  H HB2  . MET A 1 89  ? -51.488 -7.734  34.712  1.00 26.41 ? 78   MET A HB2  1 
ATOM   1058  H HB3  . MET A 1 89  ? -51.551 -8.187  36.234  1.00 26.41 ? 78   MET A HB3  1 
ATOM   1059  H HG2  . MET A 1 89  ? -49.961 -9.944  35.634  1.00 24.26 ? 78   MET A HG2  1 
ATOM   1060  H HG3  . MET A 1 89  ? -49.740 -9.140  34.272  1.00 24.26 ? 78   MET A HG3  1 
ATOM   1061  H HE1  . MET A 1 89  ? -50.418 -8.063  37.736  1.00 38.79 ? 78   MET A HE1  1 
ATOM   1062  H HE2  . MET A 1 89  ? -49.384 -9.259  37.889  1.00 38.79 ? 78   MET A HE2  1 
ATOM   1063  H HE3  . MET A 1 89  ? -48.966 -7.788  38.319  1.00 38.79 ? 78   MET A HE3  1 
ATOM   1064  N N    . PRO A 1 90  ? -51.997 -11.771 35.772  1.00 18.24 ? 79   PRO A N    1 
ATOM   1065  C CA   . PRO A 1 90  ? -51.891 -12.813 36.805  1.00 20.69 ? 79   PRO A CA   1 
ATOM   1066  C C    . PRO A 1 90  ? -50.818 -12.485 37.816  1.00 20.46 ? 79   PRO A C    1 
ATOM   1067  O O    . PRO A 1 90  ? -49.803 -11.890 37.482  1.00 20.99 ? 79   PRO A O    1 
ATOM   1068  C CB   . PRO A 1 90  ? -51.503 -14.059 35.994  1.00 24.42 ? 79   PRO A CB   1 
ATOM   1069  C CG   . PRO A 1 90  ? -51.735 -13.717 34.570  1.00 23.66 ? 79   PRO A CG   1 
ATOM   1070  C CD   . PRO A 1 90  ? -51.571 -12.258 34.455  1.00 19.53 ? 79   PRO A CD   1 
ATOM   1071  H HA   . PRO A 1 90  ? -52.741 -12.955 37.249  1.00 24.83 ? 79   PRO A HA   1 
ATOM   1072  H HB2  . PRO A 1 90  ? -50.567 -14.265 36.145  1.00 29.30 ? 79   PRO A HB2  1 
ATOM   1073  H HB3  . PRO A 1 90  ? -52.062 -14.805 36.260  1.00 29.30 ? 79   PRO A HB3  1 
ATOM   1074  H HG2  . PRO A 1 90  ? -51.083 -14.176 34.017  1.00 28.39 ? 79   PRO A HG2  1 
ATOM   1075  H HG3  . PRO A 1 90  ? -52.635 -13.977 34.319  1.00 28.39 ? 79   PRO A HG3  1 
ATOM   1076  H HD2  . PRO A 1 90  ? -50.641 -12.034 34.295  1.00 23.43 ? 79   PRO A HD2  1 
ATOM   1077  H HD3  . PRO A 1 90  ? -52.148 -11.906 33.760  1.00 23.43 ? 79   PRO A HD3  1 
ATOM   1078  N N    . ASP A 1 91  ? -51.052 -12.846 39.065  1.00 21.76 ? 80   ASP A N    1 
ATOM   1079  C CA   . ASP A 1 91  ? -50.041 -12.693 40.106  1.00 21.19 ? 80   ASP A CA   1 
ATOM   1080  C C    . ASP A 1 91  ? -50.345 -13.720 41.185  1.00 25.85 ? 80   ASP A C    1 
ATOM   1081  O O    . ASP A 1 91  ? -51.383 -13.645 41.848  1.00 25.18 ? 80   ASP A O    1 
ATOM   1082  C CB   . ASP A 1 91  ? -50.071 -11.273 40.665  1.00 22.66 ? 80   ASP A CB   1 
ATOM   1083  C CG   . ASP A 1 91  ? -48.939 -10.992 41.616  1.00 24.96 ? 80   ASP A CG   1 
ATOM   1084  O OD1  . ASP A 1 91  ? -48.677 -11.845 42.469  1.00 33.15 ? 80   ASP A OD1  1 
ATOM   1085  O OD2  . ASP A 1 91  ? -48.323 -9.915  41.549  1.00 26.64 ? 80   ASP A OD2  1 
ATOM   1086  H H    . ASP A 1 91  ? -51.793 -13.185 39.341  1.00 26.11 ? 80   ASP A H    1 
ATOM   1087  H HA   . ASP A 1 91  ? -49.160 -12.870 39.741  1.00 25.43 ? 80   ASP A HA   1 
ATOM   1088  H HB2  . ASP A 1 91  ? -50.006 -10.643 39.929  1.00 27.20 ? 80   ASP A HB2  1 
ATOM   1089  H HB3  . ASP A 1 91  ? -50.904 -11.139 41.143  1.00 27.20 ? 80   ASP A HB3  1 
ATOM   1090  N N    . GLN A 1 92  ? -49.473 -14.699 41.329  1.00 26.02 ? 81   GLN A N    1 
ATOM   1091  C CA   . GLN A 1 92  ? -49.602 -15.721 42.384  1.00 31.77 ? 81   GLN A CA   1 
ATOM   1092  C C    . GLN A 1 92  ? -50.977 -16.379 42.380  1.00 32.88 ? 81   GLN A C    1 
ATOM   1093  O O    . GLN A 1 92  ? -51.602 -16.602 43.435  1.00 36.86 ? 81   GLN A O    1 
ATOM   1094  C CB   . GLN A 1 92  ? -49.294 -15.140 43.769  1.00 39.36 ? 81   GLN A CB   1 
ATOM   1095  C CG   . GLN A 1 92  ? -47.878 -14.607 43.921  1.00 44.31 ? 81   GLN A CG   1 
ATOM   1096  C CD   . GLN A 1 92  ? -46.799 -15.683 43.734  1.00 57.35 ? 81   GLN A CD   1 
ATOM   1097  O OE1  . GLN A 1 92  ? -47.092 -16.883 43.648  1.00 60.88 ? 81   GLN A OE1  1 
ATOM   1098  N NE2  . GLN A 1 92  ? -45.541 -15.247 43.673  1.00 62.03 ? 81   GLN A NE2  1 
ATOM   1099  H H    . GLN A 1 92  ? -48.783 -14.806 40.827  1.00 31.22 ? 81   GLN A H    1 
ATOM   1100  H HA   . GLN A 1 92  ? -48.949 -16.418 42.212  1.00 38.13 ? 81   GLN A HA   1 
ATOM   1101  H HB2  . GLN A 1 92  ? -49.905 -14.407 43.942  1.00 47.23 ? 81   GLN A HB2  1 
ATOM   1102  H HB3  . GLN A 1 92  ? -49.420 -15.836 44.433  1.00 47.23 ? 81   GLN A HB3  1 
ATOM   1103  H HG2  . GLN A 1 92  ? -47.729 -13.916 43.256  1.00 53.18 ? 81   GLN A HG2  1 
ATOM   1104  H HG3  . GLN A 1 92  ? -47.777 -14.234 44.812  1.00 53.18 ? 81   GLN A HG3  1 
ATOM   1105  H HE21 . GLN A 1 92  ? -45.374 -14.406 43.738  1.00 74.44 ? 81   GLN A HE21 1 
ATOM   1106  H HE22 . GLN A 1 92  ? -44.897 -15.807 43.569  1.00 74.44 ? 81   GLN A HE22 1 
ATOM   1107  N N    . GLY A 1 93  ? -51.437 -16.743 41.185  1.00 31.49 ? 82   GLY A N    1 
ATOM   1108  C CA   . GLY A 1 93  ? -52.710 -17.426 41.080  1.00 33.00 ? 82   GLY A CA   1 
ATOM   1109  C C    . GLY A 1 93  ? -53.910 -16.516 41.186  1.00 31.12 ? 82   GLY A C    1 
ATOM   1110  O O    . GLY A 1 93  ? -55.038 -16.984 40.959  1.00 36.72 ? 82   GLY A O    1 
ATOM   1111  H H    . GLY A 1 93  ? -51.037 -16.606 40.436  1.00 37.78 ? 82   GLY A H    1 
ATOM   1112  H HA2  . GLY A 1 93  ? -52.754 -17.884 40.226  1.00 39.61 ? 82   GLY A HA2  1 
ATOM   1113  H HA3  . GLY A 1 93  ? -52.772 -18.090 41.784  1.00 39.61 ? 82   GLY A HA3  1 
ATOM   1114  N N    . MET A 1 94  ? -53.707 -15.232 41.496  1.00 26.00 ? 83   MET A N    1 
ATOM   1115  C CA   . MET A 1 94  ? -54.770 -14.245 41.421  1.00 23.01 ? 83   MET A CA   1 
ATOM   1116  C C    . MET A 1 94  ? -54.737 -13.604 40.053  1.00 21.98 ? 83   MET A C    1 
ATOM   1117  O O    . MET A 1 94  ? -53.807 -13.798 39.276  1.00 24.27 ? 83   MET A O    1 
ATOM   1118  C CB   . MET A 1 94  ? -54.556 -13.171 42.488  1.00 25.50 ? 83   MET A CB   1 
ATOM   1119  C CG   . MET A 1 94  ? -54.628 -13.786 43.898  1.00 26.83 ? 83   MET A CG   1 
ATOM   1120  S SD   . MET A 1 94  ? -54.580 -12.590 45.234  1.00 32.26 ? 83   MET A SD   1 
ATOM   1121  C CE   . MET A 1 94  ? -52.935 -12.014 45.093  1.00 35.39 ? 83   MET A CE   1 
ATOM   1122  H H    . MET A 1 94  ? -52.953 -14.911 41.756  1.00 31.20 ? 83   MET A H    1 
ATOM   1123  H HA   . MET A 1 94  ? -55.630 -14.670 41.568  1.00 27.62 ? 83   MET A HA   1 
ATOM   1124  H HB2  . MET A 1 94  ? -53.680 -12.770 42.373  1.00 30.60 ? 83   MET A HB2  1 
ATOM   1125  H HB3  . MET A 1 94  ? -55.249 -12.496 42.412  1.00 30.60 ? 83   MET A HB3  1 
ATOM   1126  H HG2  . MET A 1 94  ? -55.458 -14.282 43.977  1.00 32.19 ? 83   MET A HG2  1 
ATOM   1127  H HG3  . MET A 1 94  ? -53.876 -14.386 44.013  1.00 32.19 ? 83   MET A HG3  1 
ATOM   1128  H HE1  . MET A 1 94  ? -52.776 -11.345 45.777  1.00 42.46 ? 83   MET A HE1  1 
ATOM   1129  H HE2  . MET A 1 94  ? -52.328 -12.761 45.213  1.00 42.46 ? 83   MET A HE2  1 
ATOM   1130  H HE3  . MET A 1 94  ? -52.812 -11.625 44.213  1.00 42.46 ? 83   MET A HE3  1 
ATOM   1131  N N    A THR A 1 95  ? -55.793 -12.862 39.729  0.52 19.67 ? 84   THR A N    1 
ATOM   1132  N N    B THR A 1 95  ? -55.752 -12.813 39.766  0.48 24.41 ? 84   THR A N    1 
ATOM   1133  C CA   A THR A 1 95  ? -55.794 -11.999 38.559  0.52 21.01 ? 84   THR A CA   1 
ATOM   1134  C CA   B THR A 1 95  ? -55.746 -12.007 38.564  0.48 24.48 ? 84   THR A CA   1 
ATOM   1135  C C    A THR A 1 95  ? -56.248 -10.618 38.980  0.52 21.65 ? 84   THR A C    1 
ATOM   1136  C C    B THR A 1 95  ? -56.277 -10.639 38.940  0.48 25.50 ? 84   THR A C    1 
ATOM   1137  O O    A THR A 1 95  ? -57.080 -10.466 39.862  0.52 19.80 ? 84   THR A O    1 
ATOM   1138  O O    B THR A 1 95  ? -57.161 -10.526 39.790  0.48 28.90 ? 84   THR A O    1 
ATOM   1139  C CB   A THR A 1 95  ? -56.734 -12.523 37.466  0.52 24.98 ? 84   THR A CB   1 
ATOM   1140  C CB   B THR A 1 95  ? -56.573 -12.672 37.452  0.48 21.91 ? 84   THR A CB   1 
ATOM   1141  O OG1  A THR A 1 95  ? -56.277 -13.809 37.031  0.52 28.79 ? 84   THR A OG1  1 
ATOM   1142  O OG1  B THR A 1 95  ? -56.387 -11.962 36.233  0.48 22.71 ? 84   THR A OG1  1 
ATOM   1143  C CG2  A THR A 1 95  ? -56.774 -11.576 36.284  0.52 28.45 ? 84   THR A CG2  1 
ATOM   1144  C CG2  B THR A 1 95  ? -58.060 -12.739 37.796  0.48 20.75 ? 84   THR A CG2  1 
ATOM   1145  H H    A THR A 1 95  ? -56.527 -12.843 40.178  0.52 23.61 ? 84   THR A H    1 
ATOM   1146  H H    B THR A 1 95  ? -56.457 -12.725 40.251  0.48 29.29 ? 84   THR A H    1 
ATOM   1147  H HA   A THR A 1 95  ? -54.897 -11.936 38.196  0.52 25.21 ? 84   THR A HA   1 
ATOM   1148  H HA   B THR A 1 95  ? -54.835 -11.906 38.249  0.48 29.37 ? 84   THR A HA   1 
ATOM   1149  H HB   A THR A 1 95  ? -57.632 -12.605 37.824  0.52 29.98 ? 84   THR A HB   1 
ATOM   1150  H HB   B THR A 1 95  ? -56.258 -13.582 37.333  0.48 26.29 ? 84   THR A HB   1 
ATOM   1151  H HG1  A THR A 1 95  ? -55.498 -13.747 36.722  0.52 34.54 ? 84   THR A HG1  1 
ATOM   1152  H HG1  B THR A 1 95  ? -55.575 -11.970 36.016  0.48 27.25 ? 84   THR A HG1  1 
ATOM   1153  H HG21 A THR A 1 95  ? -57.372 -11.921 35.603  0.52 34.14 ? 84   THR A HG21 1 
ATOM   1154  H HG21 B THR A 1 95  ? -58.548 -13.164 37.073  0.48 24.89 ? 84   THR A HG21 1 
ATOM   1155  H HG22 A THR A 1 95  ? -57.090 -10.704 36.569  0.52 34.14 ? 84   THR A HG22 1 
ATOM   1156  H HG22 B THR A 1 95  ? -58.190 -13.253 38.608  0.48 24.89 ? 84   THR A HG22 1 
ATOM   1157  H HG23 A THR A 1 95  ? -55.886 -11.482 35.906  0.52 34.14 ? 84   THR A HG23 1 
ATOM   1158  H HG23 B THR A 1 95  ? -58.410 -11.844 37.929  0.48 24.89 ? 84   THR A HG23 1 
ATOM   1159  N N    . SER A 1 96  ? -55.704 -9.606  38.329  1.00 21.12 ? 85   SER A N    1 
ATOM   1160  C CA   . SER A 1 96  ? -56.077 -8.250  38.649  1.00 19.57 ? 85   SER A CA   1 
ATOM   1161  C C    . SER A 1 96  ? -57.584 -8.035  38.720  1.00 23.10 ? 85   SER A C    1 
ATOM   1162  O O    . SER A 1 96  ? -58.375 -8.580  37.937  1.00 22.73 ? 85   SER A O    1 
ATOM   1163  C CB   . SER A 1 96  ? -55.511 -7.332  37.581  1.00 20.91 ? 85   SER A CB   1 
ATOM   1164  O OG   . SER A 1 96  ? -55.993 -6.018  37.785  1.00 19.38 ? 85   SER A OG   1 
ATOM   1165  H H    . SER A 1 96  ? -55.107 -9.678  37.714  1.00 25.35 ? 85   SER A H    1 
ATOM   1166  H HA   . SER A 1 96  ? -55.691 -8.002  39.504  1.00 23.48 ? 85   SER A HA   1 
ATOM   1167  H HB2  . SER A 1 96  ? -54.543 -7.331  37.640  1.00 25.09 ? 85   SER A HB2  1 
ATOM   1168  H HB3  . SER A 1 96  ? -55.794 -7.644  36.707  1.00 25.09 ? 85   SER A HB3  1 
ATOM   1169  H HG   . SER A 1 96  ? -55.757 -5.740  38.542  1.00 23.25 ? 85   SER A HG   1 
ATOM   1170  N N    . ALA A 1 97  ? -57.965 -7.172  39.647  1.00 18.39 ? 86   ALA A N    1 
ATOM   1171  C CA   . ALA A 1 97  ? -59.360 -6.798  39.792  1.00 20.14 ? 86   ALA A CA   1 
ATOM   1172  C C    . ALA A 1 97  ? -59.897 -6.134  38.539  1.00 18.98 ? 86   ALA A C    1 
ATOM   1173  O O    . ALA A 1 97  ? -61.106 -6.176  38.315  1.00 21.96 ? 86   ALA A O    1 
ATOM   1174  C CB   . ALA A 1 97  ? -59.535 -5.869  40.998  1.00 24.69 ? 86   ALA A CB   1 
ATOM   1175  H H    . ALA A 1 97  ? -57.435 -6.788  40.205  1.00 22.07 ? 86   ALA A H    1 
ATOM   1176  H HA   . ALA A 1 97  ? -59.884 -7.598  39.954  1.00 24.17 ? 86   ALA A HA   1 
ATOM   1177  H HB1  . ALA A 1 97  ? -60.472 -5.630  41.078  1.00 29.62 ? 86   ALA A HB1  1 
ATOM   1178  H HB2  . ALA A 1 97  ? -59.241 -6.331  41.798  1.00 29.62 ? 86   ALA A HB2  1 
ATOM   1179  H HB3  . ALA A 1 97  ? -59.001 -5.071  40.861  1.00 29.62 ? 86   ALA A HB3  1 
ATOM   1180  N N    . ASP A 1 98  ? -59.049 -5.478  37.744  1.00 16.69 ? 87   ASP A N    1 
ATOM   1181  C CA   . ASP A 1 98  ? -59.477 -4.776  36.526  1.00 16.56 ? 87   ASP A CA   1 
ATOM   1182  C C    . ASP A 1 98  ? -58.989 -5.570  35.328  1.00 16.58 ? 87   ASP A C    1 
ATOM   1183  O O    . ASP A 1 98  ? -57.773 -5.663  35.080  1.00 17.51 ? 87   ASP A O    1 
ATOM   1184  C CB   . ASP A 1 98  ? -58.962 -3.349  36.460  1.00 16.54 ? 87   ASP A CB   1 
ATOM   1185  C CG   . ASP A 1 98  ? -59.577 -2.444  37.491  1.00 17.52 ? 87   ASP A CG   1 
ATOM   1186  O OD1  . ASP A 1 98  ? -60.752 -2.635  37.839  1.00 21.79 ? 87   ASP A OD1  1 
ATOM   1187  O OD2  . ASP A 1 98  ? -58.941 -1.496  37.942  1.00 17.53 ? 87   ASP A OD2  1 
ATOM   1188  H H    . ASP A 1 98  ? -58.203 -5.424  37.891  1.00 20.02 ? 87   ASP A H    1 
ATOM   1189  H HA   . ASP A 1 98  ? -60.446 -4.748  36.498  1.00 19.87 ? 87   ASP A HA   1 
ATOM   1190  H HB2  . ASP A 1 98  ? -58.002 -3.355  36.603  1.00 19.85 ? 87   ASP A HB2  1 
ATOM   1191  H HB3  . ASP A 1 98  ? -59.162 -2.984  35.584  1.00 19.85 ? 87   ASP A HB3  1 
ATOM   1192  N N    . ASP A 1 99  ? -59.928 -6.192  34.615  1.00 17.09 ? 88   ASP A N    1 
ATOM   1193  C CA   . ASP A 1 99  ? -59.587 -6.956  33.429  1.00 17.46 ? 88   ASP A CA   1 
ATOM   1194  C C    . ASP A 1 99  ? -59.458 -6.015  32.234  1.00 16.14 ? 88   ASP A C    1 
ATOM   1195  O O    . ASP A 1 99  ? -59.515 -4.787  32.364  1.00 15.33 ? 88   ASP A O    1 
ATOM   1196  C CB   . ASP A 1 99  ? -60.538 -8.133  33.236  1.00 18.76 ? 88   ASP A CB   1 
ATOM   1197  C CG   . ASP A 1 99  ? -61.937 -7.732  32.849  1.00 19.97 ? 88   ASP A CG   1 
ATOM   1198  O OD1  . ASP A 1 99  ? -62.183 -6.539  32.534  1.00 19.77 ? 88   ASP A OD1  1 
ATOM   1199  O OD2  . ASP A 1 99  ? -62.829 -8.625  32.895  1.00 24.83 ? 88   ASP A OD2  1 
ATOM   1200  H H    . ASP A 1 99  ? -60.768 -6.183  34.800  1.00 20.51 ? 88   ASP A H    1 
ATOM   1201  H HA   . ASP A 1 99  ? -58.707 -7.338  33.572  1.00 20.95 ? 88   ASP A HA   1 
ATOM   1202  H HB2  . ASP A 1 99  ? -60.189 -8.704  32.533  1.00 22.51 ? 88   ASP A HB2  1 
ATOM   1203  H HB3  . ASP A 1 99  ? -60.592 -8.631  34.067  1.00 22.51 ? 88   ASP A HB3  1 
ATOM   1204  N N    . PHE A 1 100 ? -59.271 -6.583  31.037  1.00 15.90 ? 89   PHE A N    1 
ATOM   1205  C CA   . PHE A 1 100 ? -59.101 -5.718  29.872  1.00 14.87 ? 89   PHE A CA   1 
ATOM   1206  C C    . PHE A 1 100 ? -60.349 -4.902  29.575  1.00 15.65 ? 89   PHE A C    1 
ATOM   1207  O O    . PHE A 1 100 ? -60.212 -3.810  29.001  1.00 16.74 ? 89   PHE A O    1 
ATOM   1208  C CB   . PHE A 1 100 ? -58.656 -6.497  28.633  1.00 16.04 ? 89   PHE A CB   1 
ATOM   1209  C CG   . PHE A 1 100 ? -57.164 -6.558  28.485  1.00 13.36 ? 89   PHE A CG   1 
ATOM   1210  C CD1  . PHE A 1 100 ? -56.468 -5.489  27.986  1.00 14.98 ? 89   PHE A CD1  1 
ATOM   1211  C CD2  . PHE A 1 100 ? -56.438 -7.673  28.903  1.00 14.32 ? 89   PHE A CD2  1 
ATOM   1212  C CE1  . PHE A 1 100 ? -55.113 -5.516  27.899  1.00 15.69 ? 89   PHE A CE1  1 
ATOM   1213  C CE2  . PHE A 1 100 ? -55.086 -7.701  28.824  1.00 15.44 ? 89   PHE A CE2  1 
ATOM   1214  C CZ   . PHE A 1 100 ? -54.420 -6.618  28.303  1.00 14.43 ? 89   PHE A CZ   1 
ATOM   1215  H H    . PHE A 1 100 ? -59.239 -7.428  30.880  1.00 19.08 ? 89   PHE A H    1 
ATOM   1216  H HA   . PHE A 1 100 ? -58.394 -5.085  30.074  1.00 17.84 ? 89   PHE A HA   1 
ATOM   1217  H HB2  . PHE A 1 100 ? -58.987 -7.407  28.697  1.00 19.25 ? 89   PHE A HB2  1 
ATOM   1218  H HB3  . PHE A 1 100 ? -59.018 -6.067  27.843  1.00 19.25 ? 89   PHE A HB3  1 
ATOM   1219  H HD1  . PHE A 1 100 ? -56.929 -4.729  27.713  1.00 17.98 ? 89   PHE A HD1  1 
ATOM   1220  H HD2  . PHE A 1 100 ? -56.889 -8.403  29.262  1.00 17.19 ? 89   PHE A HD2  1 
ATOM   1221  H HE1  . PHE A 1 100 ? -54.658 -4.785  27.546  1.00 18.83 ? 89   PHE A HE1  1 
ATOM   1222  H HE2  . PHE A 1 100 ? -54.615 -8.456  29.094  1.00 18.53 ? 89   PHE A HE2  1 
ATOM   1223  H HZ   . PHE A 1 100 ? -53.493 -6.636  28.229  1.00 17.32 ? 89   PHE A HZ   1 
ATOM   1224  N N    . PHE A 1 101 ? -61.538 -5.371  29.995  1.00 14.90 ? 90   PHE A N    1 
ATOM   1225  C CA   . PHE A 1 101 ? -62.724 -4.562  29.796  1.00 15.42 ? 90   PHE A CA   1 
ATOM   1226  C C    . PHE A 1 101 ? -62.741 -3.406  30.775  1.00 15.92 ? 90   PHE A C    1 
ATOM   1227  O O    . PHE A 1 101 ? -62.848 -2.234  30.390  1.00 14.72 ? 90   PHE A O    1 
ATOM   1228  C CB   . PHE A 1 101 ? -64.012 -5.357  29.958  1.00 14.75 ? 90   PHE A CB   1 
ATOM   1229  C CG   . PHE A 1 101 ? -65.224 -4.462  30.028  1.00 15.11 ? 90   PHE A CG   1 
ATOM   1230  C CD1  . PHE A 1 101 ? -65.670 -3.817  28.889  1.00 16.13 ? 90   PHE A CD1  1 
ATOM   1231  C CD2  . PHE A 1 101 ? -65.853 -4.175  31.249  1.00 17.29 ? 90   PHE A CD2  1 
ATOM   1232  C CE1  . PHE A 1 101 ? -66.720 -2.950  28.932  1.00 16.23 ? 90   PHE A CE1  1 
ATOM   1233  C CE2  . PHE A 1 101 ? -66.911 -3.317  31.272  1.00 19.71 ? 90   PHE A CE2  1 
ATOM   1234  C CZ   . PHE A 1 101 ? -67.322 -2.698  30.133  1.00 18.08 ? 90   PHE A CZ   1 
ATOM   1235  H H    . PHE A 1 101 ? -61.670 -6.127  30.382  1.00 17.88 ? 90   PHE A H    1 
ATOM   1236  H HA   . PHE A 1 101 ? -62.709 -4.195  28.898  1.00 18.51 ? 90   PHE A HA   1 
ATOM   1237  H HB2  . PHE A 1 101 ? -64.118 -5.950  29.198  1.00 17.71 ? 90   PHE A HB2  1 
ATOM   1238  H HB3  . PHE A 1 101 ? -63.967 -5.871  30.780  1.00 17.71 ? 90   PHE A HB3  1 
ATOM   1239  H HD1  . PHE A 1 101 ? -65.244 -3.978  28.078  1.00 19.36 ? 90   PHE A HD1  1 
ATOM   1240  H HD2  . PHE A 1 101 ? -65.563 -4.583  32.033  1.00 20.75 ? 90   PHE A HD2  1 
ATOM   1241  H HE1  . PHE A 1 101 ? -67.021 -2.534  28.157  1.00 19.48 ? 90   PHE A HE1  1 
ATOM   1242  H HE2  . PHE A 1 101 ? -67.339 -3.134  32.077  1.00 23.65 ? 90   PHE A HE2  1 
ATOM   1243  H HZ   . PHE A 1 101 ? -68.055 -2.126  30.164  1.00 21.69 ? 90   PHE A HZ   1 
ATOM   1244  N N    . GLN A 1 102 ? -62.628 -3.728  32.055  1.00 14.98 ? 91   GLN A N    1 
ATOM   1245  C CA   . GLN A 1 102 ? -62.845 -2.696  33.064  1.00 15.03 ? 91   GLN A CA   1 
ATOM   1246  C C    . GLN A 1 102 ? -61.724 -1.650  33.019  1.00 14.13 ? 91   GLN A C    1 
ATOM   1247  O O    . GLN A 1 102 ? -61.957 -0.439  33.197  1.00 14.72 ? 91   GLN A O    1 
ATOM   1248  C CB   . GLN A 1 102 ? -62.889 -3.317  34.455  1.00 17.61 ? 91   GLN A CB   1 
ATOM   1249  C CG   . GLN A 1 102 ? -63.384 -2.328  35.521  1.00 17.80 ? 91   GLN A CG   1 
ATOM   1250  C CD   . GLN A 1 102 ? -64.794 -1.814  35.236  1.00 20.85 ? 91   GLN A CD   1 
ATOM   1251  O OE1  . GLN A 1 102 ? -65.729 -2.582  34.952  1.00 25.44 ? 91   GLN A OE1  1 
ATOM   1252  N NE2  . GLN A 1 102 ? -64.940 -0.513  35.249  1.00 21.39 ? 91   GLN A NE2  1 
ATOM   1253  H H    . GLN A 1 102 ? -62.434 -4.508  32.361  1.00 17.97 ? 91   GLN A H    1 
ATOM   1254  H HA   . GLN A 1 102 ? -63.690 -2.251  32.897  1.00 18.03 ? 91   GLN A HA   1 
ATOM   1255  H HB2  . GLN A 1 102 ? -63.493 -4.076  34.445  1.00 21.13 ? 91   GLN A HB2  1 
ATOM   1256  H HB3  . GLN A 1 102 ? -61.996 -3.606  34.702  1.00 21.13 ? 91   GLN A HB3  1 
ATOM   1257  H HG2  . GLN A 1 102 ? -63.394 -2.771  36.384  1.00 21.35 ? 91   GLN A HG2  1 
ATOM   1258  H HG3  . GLN A 1 102 ? -62.785 -1.565  35.546  1.00 21.35 ? 91   GLN A HG3  1 
ATOM   1259  H HE21 . GLN A 1 102 ? -64.265 -0.006  35.410  1.00 25.67 ? 91   GLN A HE21 1 
ATOM   1260  H HE22 . GLN A 1 102 ? -65.712 -0.165  35.095  1.00 25.67 ? 91   GLN A HE22 1 
ATOM   1261  N N    . GLY A 1 103 ? -60.490 -2.099  32.802  1.00 13.55 ? 92   GLY A N    1 
ATOM   1262  C CA   . GLY A 1 103 ? -59.365 -1.173  32.748  1.00 14.28 ? 92   GLY A CA   1 
ATOM   1263  C C    . GLY A 1 103 ? -59.453 -0.230  31.571  1.00 12.45 ? 92   GLY A C    1 
ATOM   1264  O O    . GLY A 1 103 ? -59.141 0.957   31.701  1.00 13.62 ? 92   GLY A O    1 
ATOM   1265  H H    . GLY A 1 103 ? -60.280 -2.924  32.683  1.00 16.26 ? 92   GLY A H    1 
ATOM   1266  H HA2  . GLY A 1 103 ? -59.341 -0.646  33.563  1.00 17.13 ? 92   GLY A HA2  1 
ATOM   1267  H HA3  . GLY A 1 103 ? -58.537 -1.673  32.681  1.00 17.13 ? 92   GLY A HA3  1 
ATOM   1268  N N    . THR A 1 104 ? -59.862 -0.734  30.407  1.00 13.28 ? 93   THR A N    1 
ATOM   1269  C CA   . THR A 1 104 ? -59.992 0.124   29.221  1.00 14.75 ? 93   THR A CA   1 
ATOM   1270  C C    . THR A 1 104 ? -61.201 1.040   29.305  1.00 14.14 ? 93   THR A C    1 
ATOM   1271  O O    . THR A 1 104 ? -61.180 2.162   28.797  1.00 13.94 ? 93   THR A O    1 
ATOM   1272  C CB   . THR A 1 104 ? -59.920 -0.642  27.907  1.00 13.39 ? 93   THR A CB   1 
ATOM   1273  O OG1  . THR A 1 104 ? -61.012 -1.575  27.835  1.00 14.64 ? 93   THR A OG1  1 
ATOM   1274  C CG2  . THR A 1 104 ? -58.577 -1.356  27.760  1.00 14.60 ? 93   THR A CG2  1 
ATOM   1275  H H    . THR A 1 104 ? -60.070 -1.558  30.275  1.00 15.93 ? 93   THR A H    1 
ATOM   1276  H HA   . THR A 1 104 ? -59.220 0.712   29.221  1.00 17.70 ? 93   THR A HA   1 
ATOM   1277  H HB   . THR A 1 104 ? -60.000 -0.012  27.174  1.00 16.06 ? 93   THR A HB   1 
ATOM   1278  H HG1  . THR A 1 104 ? -60.969 -2.118  28.474  1.00 17.57 ? 93   THR A HG1  1 
ATOM   1279  H HG21 . THR A 1 104 ? -58.548 -1.839  26.919  1.00 17.52 ? 93   THR A HG21 1 
ATOM   1280  H HG22 . THR A 1 104 ? -57.854 -0.709  27.778  1.00 17.52 ? 93   THR A HG22 1 
ATOM   1281  H HG23 . THR A 1 104 ? -58.455 -1.985  28.489  1.00 17.52 ? 93   THR A HG23 1 
ATOM   1282  N N    . LYS A 1 105 ? -62.289 0.588   29.943  1.00 14.21 ? 94   LYS A N    1 
ATOM   1283  C CA   . LYS A 1 105 ? -63.395 1.484   30.227  1.00 13.14 ? 94   LYS A CA   1 
ATOM   1284  C C    . LYS A 1 105 ? -62.937 2.638   31.098  1.00 14.28 ? 94   LYS A C    1 
ATOM   1285  O O    . LYS A 1 105 ? -63.279 3.795   30.832  1.00 14.32 ? 94   LYS A O    1 
ATOM   1286  C CB   . LYS A 1 105 ? -64.524 0.684   30.874  1.00 14.34 ? 94   LYS A CB   1 
ATOM   1287  C CG   . LYS A 1 105 ? -65.737 1.524   31.224  1.00 14.84 ? 94   LYS A CG   1 
ATOM   1288  C CD   . LYS A 1 105 ? -66.842 0.694   31.870  1.00 16.25 ? 94   LYS A CD   1 
ATOM   1289  C CE   . LYS A 1 105 ? -68.016 1.541   32.228  1.00 16.58 ? 94   LYS A CE   1 
ATOM   1290  N NZ   . LYS A 1 105 ? -69.081 0.735   32.974  1.00 21.30 ? 94   LYS A NZ   1 
ATOM   1291  H H    . LYS A 1 105 ? -62.402 -0.221  30.213  1.00 17.06 ? 94   LYS A H    1 
ATOM   1292  H HA   . LYS A 1 105 ? -63.728 1.851   29.393  1.00 15.76 ? 94   LYS A HA   1 
ATOM   1293  H HB2  . LYS A 1 105 ? -64.809 -0.009  30.258  1.00 17.21 ? 94   LYS A HB2  1 
ATOM   1294  H HB3  . LYS A 1 105 ? -64.194 0.282   31.693  1.00 17.21 ? 94   LYS A HB3  1 
ATOM   1295  H HG2  . LYS A 1 105 ? -65.475 2.217   31.850  1.00 17.81 ? 94   LYS A HG2  1 
ATOM   1296  H HG3  . LYS A 1 105 ? -66.093 1.923   30.415  1.00 17.81 ? 94   LYS A HG3  1 
ATOM   1297  H HD2  . LYS A 1 105 ? -67.137 0.012   31.246  1.00 19.50 ? 94   LYS A HD2  1 
ATOM   1298  H HD3  . LYS A 1 105 ? -66.503 0.284   32.681  1.00 19.50 ? 94   LYS A HD3  1 
ATOM   1299  H HE2  . LYS A 1 105 ? -67.725 2.266   32.803  1.00 19.90 ? 94   LYS A HE2  1 
ATOM   1300  H HE3  . LYS A 1 105 ? -68.415 1.895   31.418  1.00 19.90 ? 94   LYS A HE3  1 
ATOM   1301  H HZ1  . LYS A 1 105 ? -68.739 0.402   33.725  1.00 25.56 ? 94   LYS A HZ1  1 
ATOM   1302  H HZ2  . LYS A 1 105 ? -69.771 1.259   33.178  1.00 25.56 ? 94   LYS A HZ2  1 
ATOM   1303  H HZ3  . LYS A 1 105 ? -69.367 0.064   32.464  1.00 25.56 ? 94   LYS A HZ3  1 
ATOM   1304  N N    . ALA A 1 106 ? -62.158 2.336   32.141  1.00 12.99 ? 95   ALA A N    1 
ATOM   1305  C CA   . ALA A 1 106 ? -61.612 3.367   33.008  1.00 13.69 ? 95   ALA A CA   1 
ATOM   1306  C C    . ALA A 1 106 ? -60.653 4.300   32.281  1.00 12.40 ? 95   ALA A C    1 
ATOM   1307  O O    . ALA A 1 106 ? -60.711 5.512   32.454  1.00 12.99 ? 95   ALA A O    1 
ATOM   1308  C CB   . ALA A 1 106 ? -60.914 2.708   34.206  1.00 14.22 ? 95   ALA A CB   1 
ATOM   1309  H H    . ALA A 1 106 ? -61.934 1.536   32.363  1.00 15.59 ? 95   ALA A H    1 
ATOM   1310  H HA   . ALA A 1 106 ? -62.343 3.905   33.351  1.00 16.43 ? 95   ALA A HA   1 
ATOM   1311  H HB1  . ALA A 1 106 ? -60.551 3.401   34.780  1.00 17.06 ? 95   ALA A HB1  1 
ATOM   1312  H HB2  . ALA A 1 106 ? -61.561 2.177   34.695  1.00 17.06 ? 95   ALA A HB2  1 
ATOM   1313  H HB3  . ALA A 1 106 ? -60.198 2.140   33.880  1.00 17.06 ? 95   ALA A HB3  1 
ATOM   1314  N N    . ALA A 1 107 ? -59.830 3.749   31.398  1.00 12.58 ? 96   ALA A N    1 
ATOM   1315  C CA   . ALA A 1 107 ? -58.942 4.585   30.584  1.00 11.59 ? 96   ALA A CA   1 
ATOM   1316  C C    . ALA A 1 107 ? -59.735 5.577   29.762  1.00 12.68 ? 96   ALA A C    1 
ATOM   1317  O O    . ALA A 1 107 ? -59.443 6.781   29.753  1.00 13.03 ? 96   ALA A O    1 
ATOM   1318  C CB   . ALA A 1 107 ? -58.052 3.686   29.734  1.00 13.57 ? 96   ALA A CB   1 
ATOM   1319  H H    . ALA A 1 107 ? -59.763 2.904   31.249  1.00 15.10 ? 96   ALA A H    1 
ATOM   1320  H HA   . ALA A 1 107 ? -58.365 5.091   31.177  1.00 13.91 ? 96   ALA A HA   1 
ATOM   1321  H HB1  . ALA A 1 107 ? -57.466 4.240   29.197  1.00 16.28 ? 96   ALA A HB1  1 
ATOM   1322  H HB2  . ALA A 1 107 ? -57.527 3.118   30.320  1.00 16.28 ? 96   ALA A HB2  1 
ATOM   1323  H HB3  . ALA A 1 107 ? -58.612 3.141   29.159  1.00 16.28 ? 96   ALA A HB3  1 
ATOM   1324  N N    . LEU A 1 108 ? -60.747 5.085   29.050  1.00 13.34 ? 97   LEU A N    1 
ATOM   1325  C CA   . LEU A 1 108 ? -61.547 5.961   28.207  1.00 13.12 ? 97   LEU A CA   1 
ATOM   1326  C C    . LEU A 1 108 ? -62.241 7.028   29.046  1.00 12.18 ? 97   LEU A C    1 
ATOM   1327  O O    . LEU A 1 108 ? -62.304 8.205   28.655  1.00 13.57 ? 97   LEU A O    1 
ATOM   1328  C CB   . LEU A 1 108 ? -62.580 5.132   27.439  1.00 13.43 ? 97   LEU A CB   1 
ATOM   1329  C CG   . LEU A 1 108 ? -62.030 4.271   26.304  1.00 13.24 ? 97   LEU A CG   1 
ATOM   1330  C CD1  . LEU A 1 108 ? -63.079 3.268   25.863  1.00 14.48 ? 97   LEU A CD1  1 
ATOM   1331  C CD2  . LEU A 1 108 ? -61.621 5.121   25.143  1.00 14.64 ? 97   LEU A CD2  1 
ATOM   1332  H H    . LEU A 1 108 ? -60.986 4.259   29.040  1.00 16.01 ? 97   LEU A H    1 
ATOM   1333  H HA   . LEU A 1 108 ? -60.971 6.404   27.564  1.00 15.74 ? 97   LEU A HA   1 
ATOM   1334  H HB2  . LEU A 1 108 ? -63.022 4.538   28.066  1.00 16.12 ? 97   LEU A HB2  1 
ATOM   1335  H HB3  . LEU A 1 108 ? -63.233 5.738   27.054  1.00 16.12 ? 97   LEU A HB3  1 
ATOM   1336  H HG   . LEU A 1 108 ? -61.252 3.784   26.616  1.00 15.88 ? 97   LEU A HG   1 
ATOM   1337  H HD11 . LEU A 1 108 ? -62.716 2.729   25.143  1.00 17.38 ? 97   LEU A HD11 1 
ATOM   1338  H HD12 . LEU A 1 108 ? -63.310 2.703   26.616  1.00 17.38 ? 97   LEU A HD12 1 
ATOM   1339  H HD13 . LEU A 1 108 ? -63.864 3.748   25.555  1.00 17.38 ? 97   LEU A HD13 1 
ATOM   1340  H HD21 . LEU A 1 108 ? -61.277 4.549   24.439  1.00 17.57 ? 97   LEU A HD21 1 
ATOM   1341  H HD22 . LEU A 1 108 ? -62.395 5.611   24.822  1.00 17.57 ? 97   LEU A HD22 1 
ATOM   1342  H HD23 . LEU A 1 108 ? -60.933 5.741   25.432  1.00 17.57 ? 97   LEU A HD23 1 
ATOM   1343  N N    . ALA A 1 109 ? -62.752 6.650   30.225  1.00 13.40 ? 98   ALA A N    1 
ATOM   1344  C CA   . ALA A 1 109 ? -63.411 7.619   31.077  1.00 13.34 ? 98   ALA A CA   1 
ATOM   1345  C C    . ALA A 1 109 ? -62.501 8.771   31.462  1.00 13.74 ? 98   ALA A C    1 
ATOM   1346  O O    . ALA A 1 109 ? -62.981 9.874   31.745  1.00 16.99 ? 98   ALA A O    1 
ATOM   1347  C CB   . ALA A 1 109 ? -63.915 6.954   32.345  1.00 15.72 ? 98   ALA A CB   1 
ATOM   1348  H H    . ALA A 1 109 ? -62.726 5.850   30.542  1.00 16.08 ? 98   ALA A H    1 
ATOM   1349  H HA   . ALA A 1 109 ? -64.176 7.985   30.606  1.00 16.01 ? 98   ALA A HA   1 
ATOM   1350  H HB1  . ALA A 1 109 ? -64.352 7.621   32.898  1.00 18.87 ? 98   ALA A HB1  1 
ATOM   1351  H HB2  . ALA A 1 109 ? -64.546 6.257   32.106  1.00 18.87 ? 98   ALA A HB2  1 
ATOM   1352  H HB3  . ALA A 1 109 ? -63.162 6.571   32.821  1.00 18.87 ? 98   ALA A HB3  1 
ATOM   1353  N N    . GLY A 1 110 ? -61.199 8.532   31.520  1.00 13.25 ? 99   GLY A N    1 
ATOM   1354  C CA   . GLY A 1 110 ? -60.223 9.570   31.807  1.00 13.42 ? 99   GLY A CA   1 
ATOM   1355  C C    . GLY A 1 110 ? -59.648 10.280  30.607  1.00 14.11 ? 99   GLY A C    1 
ATOM   1356  O O    . GLY A 1 110 ? -58.759 11.125  30.788  1.00 15.91 ? 99   GLY A O    1 
ATOM   1357  H H    . GLY A 1 110 ? -60.849 7.757   31.394  1.00 15.91 ? 99   GLY A H    1 
ATOM   1358  H HA2  . GLY A 1 110 ? -60.637 10.238  32.376  1.00 16.10 ? 99   GLY A HA2  1 
ATOM   1359  H HA3  . GLY A 1 110 ? -59.486 9.176   32.300  1.00 16.10 ? 99   GLY A HA3  1 
ATOM   1360  N N    . GLY A 1 111 ? -60.043 9.938   29.390  1.00 12.96 ? 100  GLY A N    1 
ATOM   1361  C CA   . GLY A 1 111 ? -59.499 10.603  28.220  1.00 12.63 ? 100  GLY A CA   1 
ATOM   1362  C C    . GLY A 1 111 ? -58.397 9.862   27.489  1.00 12.04 ? 100  GLY A C    1 
ATOM   1363  O O    . GLY A 1 111 ? -57.791 10.443  26.574  1.00 14.42 ? 100  GLY A O    1 
ATOM   1364  H H    . GLY A 1 111 ? -60.623 9.327   29.215  1.00 15.55 ? 100  GLY A H    1 
ATOM   1365  H HA2  . GLY A 1 111 ? -60.218 10.761  27.589  1.00 15.15 ? 100  GLY A HA2  1 
ATOM   1366  H HA3  . GLY A 1 111 ? -59.146 11.466  28.490  1.00 15.15 ? 100  GLY A HA3  1 
ATOM   1367  N N    . THR A 1 112 ? -58.163 8.610   27.818  1.00 12.61 ? 101  THR A N    1 
ATOM   1368  C CA   . THR A 1 112 ? -57.147 7.781   27.183  1.00 12.10 ? 101  THR A CA   1 
ATOM   1369  C C    . THR A 1 112 ? -57.822 6.834   26.205  1.00 11.89 ? 101  THR A C    1 
ATOM   1370  O O    . THR A 1 112 ? -58.741 6.079   26.589  1.00 13.37 ? 101  THR A O    1 
ATOM   1371  C CB   . THR A 1 112 ? -56.369 7.016   28.248  1.00 12.66 ? 101  THR A CB   1 
ATOM   1372  O OG1  . THR A 1 112 ? -55.554 7.940   28.972  1.00 13.04 ? 101  THR A OG1  1 
ATOM   1373  C CG2  . THR A 1 112 ? -55.502 5.922   27.688  1.00 13.22 ? 101  THR A CG2  1 
ATOM   1374  H H    . THR A 1 112 ? -58.597 8.195   28.434  1.00 15.14 ? 101  THR A H    1 
ATOM   1375  H HA   . THR A 1 112 ? -56.528 8.344   26.692  1.00 14.52 ? 101  THR A HA   1 
ATOM   1376  H HB   . THR A 1 112 ? -57.000 6.609   28.862  1.00 15.20 ? 101  THR A HB   1 
ATOM   1377  H HG1  . THR A 1 112 ? -56.036 8.522   29.339  1.00 15.65 ? 101  THR A HG1  1 
ATOM   1378  H HG21 . THR A 1 112 ? -55.032 5.471   28.407  1.00 15.86 ? 101  THR A HG21 1 
ATOM   1379  H HG22 . THR A 1 112 ? -56.048 5.276   27.213  1.00 15.86 ? 101  THR A HG22 1 
ATOM   1380  H HG23 . THR A 1 112 ? -54.851 6.296   27.073  1.00 15.86 ? 101  THR A HG23 1 
ATOM   1381  N N    . THR A 1 113 ? -57.409 6.900   24.936  1.00 11.30 ? 102  THR A N    1 
ATOM   1382  C CA   . THR A 1 113 ? -57.997 6.118   23.861  1.00 12.29 ? 102  THR A CA   1 
ATOM   1383  C C    . THR A 1 113 ? -57.109 4.987   23.345  1.00 11.39 ? 102  THR A C    1 
ATOM   1384  O O    . THR A 1 113 ? -57.546 4.229   22.489  1.00 12.02 ? 102  THR A O    1 
ATOM   1385  C CB   . THR A 1 113 ? -58.400 7.048   22.727  1.00 12.91 ? 102  THR A CB   1 
ATOM   1386  O OG1  . THR A 1 113 ? -57.306 7.881   22.365  1.00 12.61 ? 102  THR A OG1  1 
ATOM   1387  C CG2  . THR A 1 113 ? -59.550 7.980   23.096  1.00 13.33 ? 102  THR A CG2  1 
ATOM   1388  H H    . THR A 1 113 ? -56.769 7.409   24.671  1.00 13.56 ? 102  THR A H    1 
ATOM   1389  H HA   . THR A 1 113 ? -58.810 5.709   24.197  1.00 14.75 ? 102  THR A HA   1 
ATOM   1390  H HB   . THR A 1 113 ? -58.670 6.521   21.959  1.00 15.49 ? 102  THR A HB   1 
ATOM   1391  H HG1  . THR A 1 113 ? -56.657 7.410   22.112  1.00 15.13 ? 102  THR A HG1  1 
ATOM   1392  H HG21 . THR A 1 113 ? -59.768 8.551   22.343  1.00 16.00 ? 102  THR A HG21 1 
ATOM   1393  H HG22 . THR A 1 113 ? -60.333 7.460   23.336  1.00 16.00 ? 102  THR A HG22 1 
ATOM   1394  H HG23 . THR A 1 113 ? -59.297 8.535   23.850  1.00 16.00 ? 102  THR A HG23 1 
ATOM   1395  N N    . MET A 1 114 ? -55.890 4.853   23.841  1.00 11.48 ? 103  MET A N    1 
ATOM   1396  C CA   . MET A 1 114 ? -55.053 3.718   23.497  1.00 11.30 ? 103  MET A CA   1 
ATOM   1397  C C    . MET A 1 114 ? -54.277 3.312   24.733  1.00 11.77 ? 103  MET A C    1 
ATOM   1398  O O    . MET A 1 114 ? -53.799 4.181   25.478  1.00 11.89 ? 103  MET A O    1 
ATOM   1399  C CB   . MET A 1 114 ? -54.090 4.032   22.335  1.00 12.04 ? 103  MET A CB   1 
ATOM   1400  C CG   . MET A 1 114 ? -53.261 2.821   21.940  1.00 15.64 ? 103  MET A CG   1 
ATOM   1401  S SD   . MET A 1 114 ? -52.255 3.169   20.513  1.00 14.31 ? 103  MET A SD   1 
ATOM   1402  C CE   . MET A 1 114 ? -51.560 1.519   20.377  1.00 13.86 ? 103  MET A CE   1 
ATOM   1403  H H    . MET A 1 114 ? -55.522 5.409   24.384  1.00 13.77 ? 103  MET A H    1 
ATOM   1404  H HA   . MET A 1 114 ? -55.619 2.980   23.223  1.00 13.56 ? 103  MET A HA   1 
ATOM   1405  H HB2  . MET A 1 114 ? -54.605 4.312   21.562  1.00 14.44 ? 103  MET A HB2  1 
ATOM   1406  H HB3  . MET A 1 114 ? -53.483 4.739   22.607  1.00 14.44 ? 103  MET A HB3  1 
ATOM   1407  H HG2  . MET A 1 114 ? -52.676 2.579   22.674  1.00 18.76 ? 103  MET A HG2  1 
ATOM   1408  H HG3  . MET A 1 114 ? -53.853 2.083   21.723  1.00 18.76 ? 103  MET A HG3  1 
ATOM   1409  H HE1  . MET A 1 114 ? -50.953 1.494   19.622  1.00 16.63 ? 103  MET A HE1  1 
ATOM   1410  H HE2  . MET A 1 114 ? -51.081 1.311   21.195  1.00 16.63 ? 103  MET A HE2  1 
ATOM   1411  H HE3  . MET A 1 114 ? -52.281 0.884   20.245  1.00 16.63 ? 103  MET A HE3  1 
ATOM   1412  N N    . ILE A 1 115 ? -54.122 1.996   24.932  1.00 11.87 ? 104  ILE A N    1 
ATOM   1413  C CA   . ILE A 1 115 ? -53.320 1.451   26.008  1.00 11.04 ? 104  ILE A CA   1 
ATOM   1414  C C    . ILE A 1 115 ? -52.255 0.544   25.415  1.00 11.64 ? 104  ILE A C    1 
ATOM   1415  O O    . ILE A 1 115 ? -52.485 -0.103  24.394  1.00 12.30 ? 104  ILE A O    1 
ATOM   1416  C CB   . ILE A 1 115 ? -54.169 0.743   27.077  1.00 11.22 ? 104  ILE A CB   1 
ATOM   1417  C CG1  . ILE A 1 115 ? -54.942 -0.451  26.507  1.00 11.88 ? 104  ILE A CG1  1 
ATOM   1418  C CG2  . ILE A 1 115 ? -55.153 1.760   27.670  1.00 12.57 ? 104  ILE A CG2  1 
ATOM   1419  C CD1  . ILE A 1 115 ? -54.284 -1.727  26.808  1.00 12.97 ? 104  ILE A CD1  1 
ATOM   1420  H H    . ILE A 1 115 ? -54.486 1.393   24.439  1.00 14.25 ? 104  ILE A H    1 
ATOM   1421  H HA   . ILE A 1 115 ? -52.861 2.185   26.446  1.00 13.25 ? 104  ILE A HA   1 
ATOM   1422  H HB   . ILE A 1 115 ? -53.583 0.427   27.783  1.00 13.46 ? 104  ILE A HB   1 
ATOM   1423  H HG12 . ILE A 1 115 ? -55.831 -0.470  26.896  1.00 14.26 ? 104  ILE A HG12 1 
ATOM   1424  H HG13 . ILE A 1 115 ? -55.001 -0.361  25.543  1.00 14.26 ? 104  ILE A HG13 1 
ATOM   1425  H HG21 . ILE A 1 115 ? -55.693 1.320   28.346  1.00 15.09 ? 104  ILE A HG21 1 
ATOM   1426  H HG22 . ILE A 1 115 ? -54.652 2.488   28.069  1.00 15.09 ? 104  ILE A HG22 1 
ATOM   1427  H HG23 . ILE A 1 115 ? -55.722 2.099   26.961  1.00 15.09 ? 104  ILE A HG23 1 
ATOM   1428  H HD11 . ILE A 1 115 ? -54.809 -2.449  26.428  1.00 15.56 ? 104  ILE A HD11 1 
ATOM   1429  H HD12 . ILE A 1 115 ? -53.396 -1.723  26.419  1.00 15.56 ? 104  ILE A HD12 1 
ATOM   1430  H HD13 . ILE A 1 115 ? -54.224 -1.832  27.770  1.00 15.56 ? 104  ILE A HD13 1 
ATOM   1431  N N    . ILE A 1 116 ? -51.096 0.489   26.060  1.00 11.00 ? 105  ILE A N    1 
ATOM   1432  C CA   . ILE A 1 116 ? -50.047 -0.448  25.706  1.00 11.04 ? 105  ILE A CA   1 
ATOM   1433  C C    . ILE A 1 116 ? -49.758 -1.270  26.934  1.00 12.15 ? 105  ILE A C    1 
ATOM   1434  O O    . ILE A 1 116 ? -49.231 -0.771  27.936  1.00 11.72 ? 105  ILE A O    1 
ATOM   1435  C CB   . ILE A 1 116 ? -48.776 0.199   25.136  1.00 11.24 ? 105  ILE A CB   1 
ATOM   1436  C CG1  . ILE A 1 116 ? -49.138 1.315   24.142  1.00 12.69 ? 105  ILE A CG1  1 
ATOM   1437  C CG2  . ILE A 1 116 ? -47.924 -0.900  24.462  1.00 11.97 ? 105  ILE A CG2  1 
ATOM   1438  C CD1  . ILE A 1 116 ? -47.900 1.952   23.493  1.00 13.25 ? 105  ILE A CD1  1 
ATOM   1439  H H    . ILE A 1 116 ? -50.892 0.999   26.722  1.00 13.20 ? 105  ILE A H    1 
ATOM   1440  H HA   . ILE A 1 116 ? -50.392 -1.050  25.028  1.00 13.24 ? 105  ILE A HA   1 
ATOM   1441  H HB   . ILE A 1 116 ? -48.267 0.585   25.866  1.00 13.48 ? 105  ILE A HB   1 
ATOM   1442  H HG12 . ILE A 1 116 ? -49.689 0.943   23.436  1.00 15.22 ? 105  ILE A HG12 1 
ATOM   1443  H HG13 . ILE A 1 116 ? -49.623 2.011   24.611  1.00 15.22 ? 105  ILE A HG13 1 
ATOM   1444  H HG21 . ILE A 1 116 ? -47.119 -0.498  24.099  1.00 14.37 ? 105  ILE A HG21 1 
ATOM   1445  H HG22 . ILE A 1 116 ? -47.690 -1.569  25.124  1.00 14.37 ? 105  ILE A HG22 1 
ATOM   1446  H HG23 . ILE A 1 116 ? -48.441 -1.307  23.749  1.00 14.37 ? 105  ILE A HG23 1 
ATOM   1447  H HD11 . ILE A 1 116 ? -48.187 2.645   22.879  1.00 15.90 ? 105  ILE A HD11 1 
ATOM   1448  H HD12 . ILE A 1 116 ? -47.342 2.336   24.188  1.00 15.90 ? 105  ILE A HD12 1 
ATOM   1449  H HD13 . ILE A 1 116 ? -47.408 1.268   23.013  1.00 15.90 ? 105  ILE A HD13 1 
ATOM   1450  N N    . ASP A 1 117 ? -50.194 -2.526  26.880  1.00 11.52 ? 106  ASP A N    1 
ATOM   1451  C CA   . ASP A 1 117 ? -50.126 -3.444  28.010  1.00 11.57 ? 106  ASP A CA   1 
ATOM   1452  C C    . ASP A 1 117 ? -48.829 -4.249  27.937  1.00 12.40 ? 106  ASP A C    1 
ATOM   1453  O O    . ASP A 1 117 ? -47.943 -3.973  27.105  1.00 13.57 ? 106  ASP A O    1 
ATOM   1454  C CB   . ASP A 1 117 ? -51.406 -4.262  28.076  1.00 11.77 ? 106  ASP A CB   1 
ATOM   1455  C CG   . ASP A 1 117 ? -51.750 -4.683  29.488  1.00 12.47 ? 106  ASP A CG   1 
ATOM   1456  O OD1  . ASP A 1 117 ? -51.165 -5.687  29.966  1.00 13.59 ? 106  ASP A OD1  1 
ATOM   1457  O OD2  . ASP A 1 117 ? -52.643 -4.042  30.075  1.00 13.27 ? 106  ASP A OD2  1 
ATOM   1458  H H    . ASP A 1 117 ? -50.544 -2.878  26.178  1.00 13.83 ? 106  ASP A H    1 
ATOM   1459  H HA   . ASP A 1 117 ? -50.086 -2.917  28.823  1.00 13.89 ? 106  ASP A HA   1 
ATOM   1460  H HB2  . ASP A 1 117 ? -52.141 -3.729  27.734  1.00 14.13 ? 106  ASP A HB2  1 
ATOM   1461  H HB3  . ASP A 1 117 ? -51.299 -5.063  27.541  1.00 14.13 ? 106  ASP A HB3  1 
ATOM   1462  N N    . HIS A 1 118 ? -48.652 -5.188  28.861  1.00 12.66 ? 107  HIS A N    1 
ATOM   1463  C CA   . HIS A 1 118 ? -47.421 -5.946  29.027  1.00 11.57 ? 107  HIS A CA   1 
ATOM   1464  C C    . HIS A 1 118 ? -47.726 -7.438  29.082  1.00 12.28 ? 107  HIS A C    1 
ATOM   1465  O O    . HIS A 1 118 ? -48.367 -7.920  30.020  1.00 13.72 ? 107  HIS A O    1 
ATOM   1466  C CB   . HIS A 1 118 ? -46.725 -5.555  30.329  1.00 11.94 ? 107  HIS A CB   1 
ATOM   1467  C CG   . HIS A 1 118 ? -45.956 -4.265  30.244  1.00 11.55 ? 107  HIS A CG   1 
ATOM   1468  N ND1  . HIS A 1 118 ? -44.616 -4.243  29.932  1.00 11.48 ? 107  HIS A ND1  1 
ATOM   1469  C CD2  . HIS A 1 118 ? -46.322 -2.985  30.430  1.00 12.28 ? 107  HIS A CD2  1 
ATOM   1470  C CE1  . HIS A 1 118 ? -44.189 -2.985  29.896  1.00 11.80 ? 107  HIS A CE1  1 
ATOM   1471  N NE2  . HIS A 1 118 ? -45.207 -2.191  30.218  1.00 11.04 ? 107  HIS A NE2  1 
ATOM   1472  H H    . HIS A 1 118 ? -49.260 -5.412  29.427  1.00 15.19 ? 107  HIS A H    1 
ATOM   1473  H HA   . HIS A 1 118 ? -46.823 -5.772  28.284  1.00 13.88 ? 107  HIS A HA   1 
ATOM   1474  H HB2  . HIS A 1 118 ? -47.394 -5.455  31.024  1.00 14.33 ? 107  HIS A HB2  1 
ATOM   1475  H HB3  . HIS A 1 118 ? -46.101 -6.256  30.572  1.00 14.33 ? 107  HIS A HB3  1 
ATOM   1476  H HD1  . HIS A 1 118 ? -44.137 -4.934  29.754  1.00 13.78 ? 107  HIS A HD1  1 
ATOM   1477  H HD2  . HIS A 1 118 ? -47.173 -2.685  30.655  1.00 14.73 ? 107  HIS A HD2  1 
ATOM   1478  H HE1  . HIS A 1 118 ? -43.319 -2.710  29.717  1.00 14.16 ? 107  HIS A HE1  1 
ATOM   1479  N N    . VAL A 1 119 ? -47.287 -8.169  28.064  1.00 11.88 ? 108  VAL A N    1 
ATOM   1480  C CA   . VAL A 1 119 ? -47.341 -9.629  28.085  1.00 13.41 ? 108  VAL A CA   1 
ATOM   1481  C C    . VAL A 1 119 ? -46.317 -10.158 29.075  1.00 13.36 ? 108  VAL A C    1 
ATOM   1482  O O    . VAL A 1 119 ? -45.150 -9.781  29.003  1.00 13.51 ? 108  VAL A O    1 
ATOM   1483  C CB   . VAL A 1 119 ? -46.998 -10.146 26.678  1.00 13.60 ? 108  VAL A CB   1 
ATOM   1484  C CG1  . VAL A 1 119 ? -46.961 -11.682 26.664  1.00 15.80 ? 108  VAL A CG1  1 
ATOM   1485  C CG2  . VAL A 1 119 ? -47.983 -9.601  25.638  1.00 15.20 ? 108  VAL A CG2  1 
ATOM   1486  H H    . VAL A 1 119 ? -46.951 -7.843  27.342  1.00 14.26 ? 108  VAL A H    1 
ATOM   1487  H HA   . VAL A 1 119 ? -48.227 -9.934  28.338  1.00 16.09 ? 108  VAL A HA   1 
ATOM   1488  H HB   . VAL A 1 119 ? -46.113 -9.829  26.439  1.00 16.32 ? 108  VAL A HB   1 
ATOM   1489  H HG11 . VAL A 1 119 ? -46.743 -11.984 25.769  1.00 18.96 ? 108  VAL A HG11 1 
ATOM   1490  H HG12 . VAL A 1 119 ? -46.286 -11.987 27.290  1.00 18.96 ? 108  VAL A HG12 1 
ATOM   1491  H HG13 . VAL A 1 119 ? -47.832 -12.021 26.925  1.00 18.96 ? 108  VAL A HG13 1 
ATOM   1492  H HG21 . VAL A 1 119 ? -47.740 -9.944  24.764  1.00 18.24 ? 108  VAL A HG21 1 
ATOM   1493  H HG22 . VAL A 1 119 ? -48.879 -9.889  25.870  1.00 18.24 ? 108  VAL A HG22 1 
ATOM   1494  H HG23 . VAL A 1 119 ? -47.936 -8.632  25.638  1.00 18.24 ? 108  VAL A HG23 1 
ATOM   1495  N N    . VAL A 1 120 ? -46.725 -11.047 29.976  1.00 15.51 ? 109  VAL A N    1 
ATOM   1496  C CA   . VAL A 1 120 ? -45.835 -11.604 31.006  1.00 14.74 ? 109  VAL A CA   1 
ATOM   1497  C C    . VAL A 1 120 ? -45.812 -13.118 30.912  1.00 15.34 ? 109  VAL A C    1 
ATOM   1498  O O    . VAL A 1 120 ? -46.628 -13.794 31.549  1.00 17.32 ? 109  VAL A O    1 
ATOM   1499  C CB   . VAL A 1 120 ? -46.172 -11.159 32.434  1.00 15.63 ? 109  VAL A CB   1 
ATOM   1500  C CG1  . VAL A 1 120 ? -45.136 -11.642 33.398  1.00 18.37 ? 109  VAL A CG1  1 
ATOM   1501  C CG2  . VAL A 1 120 ? -46.293 -9.641  32.484  1.00 18.69 ? 109  VAL A CG2  1 
ATOM   1502  H H    . VAL A 1 120 ? -47.528 -11.353 30.017  1.00 18.61 ? 109  VAL A H    1 
ATOM   1503  H HA   . VAL A 1 120 ? -44.934 -11.295 30.820  1.00 17.69 ? 109  VAL A HA   1 
ATOM   1504  H HB   . VAL A 1 120 ? -47.026 -11.539 32.692  1.00 18.76 ? 109  VAL A HB   1 
ATOM   1505  H HG11 . VAL A 1 120 ? -45.374 -11.347 34.291  1.00 22.04 ? 109  VAL A HG11 1 
ATOM   1506  H HG12 . VAL A 1 120 ? -45.104 -12.611 33.367  1.00 22.04 ? 109  VAL A HG12 1 
ATOM   1507  H HG13 . VAL A 1 120 ? -44.275 -11.274 33.146  1.00 22.04 ? 109  VAL A HG13 1 
ATOM   1508  H HG21 . VAL A 1 120 ? -46.507 -9.372  33.391  1.00 22.43 ? 109  VAL A HG21 1 
ATOM   1509  H HG22 . VAL A 1 120 ? -45.449 -9.248  32.212  1.00 22.43 ? 109  VAL A HG22 1 
ATOM   1510  H HG23 . VAL A 1 120 ? -46.999 -9.361  31.881  1.00 22.43 ? 109  VAL A HG23 1 
ATOM   1511  N N    . PRO A 1 121 ? -44.892 -13.695 30.152  1.00 15.76 ? 110  PRO A N    1 
ATOM   1512  C CA   . PRO A 1 121 ? -44.762 -15.151 30.131  1.00 16.37 ? 110  PRO A CA   1 
ATOM   1513  C C    . PRO A 1 121 ? -44.201 -15.607 31.463  1.00 20.35 ? 110  PRO A C    1 
ATOM   1514  O O    . PRO A 1 121 ? -43.243 -15.039 31.969  1.00 23.19 ? 110  PRO A O    1 
ATOM   1515  C CB   . PRO A 1 121 ? -43.739 -15.401 29.005  1.00 20.12 ? 110  PRO A CB   1 
ATOM   1516  C CG   . PRO A 1 121 ? -43.261 -14.077 28.533  1.00 21.26 ? 110  PRO A CG   1 
ATOM   1517  C CD   . PRO A 1 121 ? -43.825 -13.012 29.399  1.00 22.01 ? 110  PRO A CD   1 
ATOM   1518  H HA   . PRO A 1 121 ? -45.606 -15.589 29.938  1.00 19.64 ? 110  PRO A HA   1 
ATOM   1519  H HB2  . PRO A 1 121 ? -42.998 -15.920 29.355  1.00 24.15 ? 110  PRO A HB2  1 
ATOM   1520  H HB3  . PRO A 1 121 ? -44.171 -15.880 28.280  1.00 24.15 ? 110  PRO A HB3  1 
ATOM   1521  H HG2  . PRO A 1 121 ? -42.292 -14.059 28.577  1.00 25.51 ? 110  PRO A HG2  1 
ATOM   1522  H HG3  . PRO A 1 121 ? -43.553 -13.946 27.617  1.00 25.51 ? 110  PRO A HG3  1 
ATOM   1523  H HD2  . PRO A 1 121 ? -43.146 -12.677 30.005  1.00 26.41 ? 110  PRO A HD2  1 
ATOM   1524  H HD3  . PRO A 1 121 ? -44.198 -12.300 28.856  1.00 26.41 ? 110  PRO A HD3  1 
ATOM   1525  N N    . GLU A 1 122 ? -44.788 -16.629 32.034  1.00 21.04 ? 111  GLU A N    1 
ATOM   1526  C CA   . GLU A 1 122 ? -44.133 -17.222 33.195  1.00 22.65 ? 111  GLU A CA   1 
ATOM   1527  C C    . GLU A 1 122 ? -42.764 -17.771 32.805  1.00 22.97 ? 111  GLU A C    1 
ATOM   1528  O O    . GLU A 1 122 ? -42.581 -18.222 31.668  1.00 23.30 ? 111  GLU A O    1 
ATOM   1529  C CB   . GLU A 1 122 ? -45.000 -18.328 33.756  1.00 25.20 ? 111  GLU A CB   1 
ATOM   1530  C CG   . GLU A 1 122 ? -46.229 -17.756 34.459  1.00 27.76 ? 111  GLU A CG   1 
ATOM   1531  C CD   . GLU A 1 122 ? -45.880 -16.950 35.715  1.00 27.07 ? 111  GLU A CD   1 
ATOM   1532  O OE1  . GLU A 1 122 ? -45.177 -17.482 36.610  1.00 27.32 ? 111  GLU A OE1  1 
ATOM   1533  O OE2  . GLU A 1 122 ? -46.289 -15.767 35.793  1.00 24.93 ? 111  GLU A OE2  1 
ATOM   1534  H H    . GLU A 1 122 ? -45.529 -16.992 31.792  1.00 25.25 ? 111  GLU A H    1 
ATOM   1535  H HA   . GLU A 1 122 ? -44.012 -16.546 33.880  1.00 27.17 ? 111  GLU A HA   1 
ATOM   1536  H HB2  . GLU A 1 122 ? -45.301 -18.900 33.032  1.00 30.24 ? 111  GLU A HB2  1 
ATOM   1537  H HB3  . GLU A 1 122 ? -44.489 -18.841 34.401  1.00 30.24 ? 111  GLU A HB3  1 
ATOM   1538  H HG2  . GLU A 1 122 ? -46.697 -17.168 33.847  1.00 33.31 ? 111  GLU A HG2  1 
ATOM   1539  H HG3  . GLU A 1 122 ? -46.808 -18.487 34.725  1.00 33.31 ? 111  GLU A HG3  1 
ATOM   1540  N N    . PRO A 1 123 ? -41.770 -17.727 33.708  1.00 22.68 ? 112  PRO A N    1 
ATOM   1541  C CA   . PRO A 1 123 ? -40.467 -18.293 33.343  1.00 28.08 ? 112  PRO A CA   1 
ATOM   1542  C C    . PRO A 1 123 ? -40.657 -19.720 32.855  1.00 29.17 ? 112  PRO A C    1 
ATOM   1543  O O    . PRO A 1 123 ? -41.388 -20.516 33.458  1.00 32.48 ? 112  PRO A O    1 
ATOM   1544  C CB   . PRO A 1 123 ? -39.652 -18.216 34.641  1.00 29.56 ? 112  PRO A CB   1 
ATOM   1545  C CG   . PRO A 1 123 ? -40.278 -17.056 35.405  1.00 31.68 ? 112  PRO A CG   1 
ATOM   1546  C CD   . PRO A 1 123 ? -41.749 -17.133 35.065  1.00 25.43 ? 112  PRO A CD   1 
ATOM   1547  H HA   . PRO A 1 123 ? -40.041 -17.761 32.654  1.00 33.69 ? 112  PRO A HA   1 
ATOM   1548  H HB2  . PRO A 1 123 ? -39.742 -19.046 35.136  1.00 35.47 ? 112  PRO A HB2  1 
ATOM   1549  H HB3  . PRO A 1 123 ? -38.722 -18.034 34.435  1.00 35.47 ? 112  PRO A HB3  1 
ATOM   1550  H HG2  . PRO A 1 123 ? -40.138 -17.175 36.357  1.00 38.02 ? 112  PRO A HG2  1 
ATOM   1551  H HG3  . PRO A 1 123 ? -39.897 -16.218 35.101  1.00 38.02 ? 112  PRO A HG3  1 
ATOM   1552  H HD2  . PRO A 1 123 ? -42.211 -17.711 35.692  1.00 30.52 ? 112  PRO A HD2  1 
ATOM   1553  H HD3  . PRO A 1 123 ? -42.138 -16.244 35.049  1.00 30.52 ? 112  PRO A HD3  1 
ATOM   1554  N N    . GLY A 1 124 ? -40.062 -20.006 31.695  1.00 34.58 ? 113  GLY A N    1 
ATOM   1555  C CA   . GLY A 1 124 ? -40.143 -21.305 31.069  1.00 36.60 ? 113  GLY A CA   1 
ATOM   1556  C C    . GLY A 1 124 ? -41.189 -21.419 29.990  1.00 37.32 ? 113  GLY A C    1 
ATOM   1557  O O    . GLY A 1 124 ? -41.235 -22.453 29.308  1.00 45.84 ? 113  GLY A O    1 
ATOM   1558  H H    . GLY A 1 124 ? -39.595 -19.440 31.246  1.00 41.50 ? 113  GLY A H    1 
ATOM   1559  H HA2  . GLY A 1 124 ? -39.283 -21.520 30.676  1.00 43.93 ? 113  GLY A HA2  1 
ATOM   1560  H HA3  . GLY A 1 124 ? -40.338 -21.970 31.748  1.00 43.93 ? 113  GLY A HA3  1 
ATOM   1561  N N    A THR A 1 125 ? -41.981 -20.404 29.761  0.61 31.33 ? 114  THR A N    1 
ATOM   1562  N N    B THR A 1 125 ? -42.071 -20.401 29.861  0.39 32.73 ? 114  THR A N    1 
ATOM   1563  C CA   A THR A 1 125 ? -42.961 -20.510 28.706  0.61 28.90 ? 114  THR A CA   1 
ATOM   1564  C CA   B THR A 1 125 ? -43.102 -20.299 28.821  0.39 27.67 ? 114  THR A CA   1 
ATOM   1565  C C    A THR A 1 125 ? -42.656 -19.501 27.612  0.61 24.61 ? 114  THR A C    1 
ATOM   1566  C C    B THR A 1 125 ? -42.541 -19.561 27.602  0.39 26.70 ? 114  THR A C    1 
ATOM   1567  O O    A THR A 1 125 ? -42.047 -18.440 27.836  0.61 23.95 ? 114  THR A O    1 
ATOM   1568  O O    B THR A 1 125 ? -41.632 -18.732 27.723  0.39 29.34 ? 114  THR A O    1 
ATOM   1569  C CB   A THR A 1 125 ? -44.344 -20.322 29.252  0.61 30.23 ? 114  THR A CB   1 
ATOM   1570  C CB   B THR A 1 125 ? -44.335 -19.515 29.336  0.39 18.33 ? 114  THR A CB   1 
ATOM   1571  O OG1  A THR A 1 125 ? -44.488 -18.955 29.641  0.61 29.03 ? 114  THR A OG1  1 
ATOM   1572  O OG1  B THR A 1 125 ? -44.984 -20.216 30.420  0.39 21.74 ? 114  THR A OG1  1 
ATOM   1573  C CG2  A THR A 1 125 ? -44.552 -21.237 30.474  0.61 29.40 ? 114  THR A CG2  1 
ATOM   1574  C CG2  B THR A 1 125 ? -45.384 -19.304 28.239  0.39 21.80 ? 114  THR A CG2  1 
ATOM   1575  H H    A THR A 1 125 ? -41.976 -19.657 30.187  0.61 37.60 ? 114  THR A H    1 
ATOM   1576  H H    B THR A 1 125 ? -42.082 -19.729 30.397  0.39 39.28 ? 114  THR A H    1 
ATOM   1577  H HA   A THR A 1 125 ? -42.911 -21.398 28.317  0.61 34.68 ? 114  THR A HA   1 
ATOM   1578  H HA   B THR A 1 125 ? -43.385 -21.186 28.549  0.39 33.20 ? 114  THR A HA   1 
ATOM   1579  H HB   A THR A 1 125 ? -45.001 -20.546 28.575  0.61 36.27 ? 114  THR A HB   1 
ATOM   1580  H HB   B THR A 1 125 ? -44.048 -18.642 29.649  0.39 21.99 ? 114  THR A HB   1 
ATOM   1581  H HG1  A THR A 1 125 ? -43.921 -18.763 30.230  0.61 34.83 ? 114  THR A HG1  1 
ATOM   1582  H HG1  B THR A 1 125 ? -44.448 -20.315 31.059  0.39 26.08 ? 114  THR A HG1  1 
ATOM   1583  H HG21 A THR A 1 125 ? -45.446 -21.117 30.829  0.61 35.28 ? 114  THR A HG21 1 
ATOM   1584  H HG21 B THR A 1 125 ? -44.998 -18.803 27.504  0.39 26.16 ? 114  THR A HG21 1 
ATOM   1585  H HG22 A THR A 1 125 ? -44.437 -22.165 30.217  0.61 35.28 ? 114  THR A HG22 1 
ATOM   1586  H HG22 B THR A 1 125 ? -46.140 -18.812 28.595  0.39 26.16 ? 114  THR A HG22 1 
ATOM   1587  H HG23 A THR A 1 125 ? -43.906 -21.019 31.164  0.61 35.28 ? 114  THR A HG23 1 
ATOM   1588  H HG23 B THR A 1 125 ? -45.694 -20.162 27.909  0.39 26.16 ? 114  THR A HG23 1 
ATOM   1589  N N    . SER A 1 126 ? -43.089 -19.860 26.418  1.00 21.93 ? 115  SER A N    1 
ATOM   1590  C CA   . SER A 1 126 ? -42.665 -19.129 25.245  1.00 21.94 ? 115  SER A CA   1 
ATOM   1591  C C    . SER A 1 126 ? -43.269 -17.734 25.206  1.00 20.58 ? 115  SER A C    1 
ATOM   1592  O O    . SER A 1 126 ? -44.413 -17.494 25.633  1.00 20.11 ? 115  SER A O    1 
ATOM   1593  C CB   . SER A 1 126 ? -42.959 -19.845 23.952  1.00 26.13 ? 115  SER A CB   1 
ATOM   1594  O OG   . SER A 1 126 ? -44.264 -19.705 23.554  1.00 26.02 ? 115  SER A OG   1 
ATOM   1595  H H    . SER A 1 126 ? -43.656 -20.490 26.275  1.00 26.31 ? 115  SER A H    1 
ATOM   1596  H HA   . SER A 1 126 ? -41.703 -19.019 25.295  1.00 26.33 ? 115  SER A HA   1 
ATOM   1597  H HB2  . SER A 1 126 ? -42.383 -19.482 23.260  1.00 31.36 ? 115  SER A HB2  1 
ATOM   1598  H HB3  . SER A 1 126 ? -42.770 -20.789 24.070  1.00 31.36 ? 115  SER A HB3  1 
ATOM   1599  H HG   . SER A 1 126 ? -44.390 -20.115 22.833  1.00 31.23 ? 115  SER A HG   1 
ATOM   1600  N N    . LEU A 1 127 ? -42.492 -16.809 24.659  1.00 19.35 ? 116  LEU A N    1 
ATOM   1601  C CA   . LEU A 1 127 ? -43.001 -15.463 24.462  1.00 18.80 ? 116  LEU A CA   1 
ATOM   1602  C C    . LEU A 1 127 ? -44.241 -15.490 23.592  1.00 16.52 ? 116  LEU A C    1 
ATOM   1603  O O    . LEU A 1 127 ? -45.184 -14.733 23.827  1.00 16.57 ? 116  LEU A O    1 
ATOM   1604  C CB   . LEU A 1 127 ? -41.948 -14.553 23.832  1.00 17.80 ? 116  LEU A CB   1 
ATOM   1605  C CG   . LEU A 1 127 ? -40.627 -14.323 24.555  1.00 19.43 ? 116  LEU A CG   1 
ATOM   1606  C CD1  . LEU A 1 127 ? -39.770 -13.297 23.860  1.00 22.14 ? 116  LEU A CD1  1 
ATOM   1607  C CD2  . LEU A 1 127 ? -40.857 -14.003 25.989  1.00 22.34 ? 116  LEU A CD2  1 
ATOM   1608  H H    . LEU A 1 127 ? -41.682 -16.932 24.399  1.00 23.22 ? 116  LEU A H    1 
ATOM   1609  H HA   . LEU A 1 127 ? -43.246 -15.088 25.322  1.00 22.56 ? 116  LEU A HA   1 
ATOM   1610  H HB2  . LEU A 1 127 ? -41.727 -14.921 22.962  1.00 21.36 ? 116  LEU A HB2  1 
ATOM   1611  H HB3  . LEU A 1 127 ? -42.352 -13.680 23.708  1.00 21.36 ? 116  LEU A HB3  1 
ATOM   1612  H HG   . LEU A 1 127 ? -40.132 -15.157 24.534  1.00 23.32 ? 116  LEU A HG   1 
ATOM   1613  H HD11 . LEU A 1 127 ? -38.944 -13.187 24.357  1.00 26.57 ? 116  LEU A HD11 1 
ATOM   1614  H HD12 . LEU A 1 127 ? -39.576 -13.605 22.961  1.00 26.57 ? 116  LEU A HD12 1 
ATOM   1615  H HD13 . LEU A 1 127 ? -40.250 -12.456 23.826  1.00 26.57 ? 116  LEU A HD13 1 
ATOM   1616  H HD21 . LEU A 1 127 ? -40.001 -13.862 26.422  1.00 26.81 ? 116  LEU A HD21 1 
ATOM   1617  H HD22 . LEU A 1 127 ? -41.396 -13.199 26.050  1.00 26.81 ? 116  LEU A HD22 1 
ATOM   1618  H HD23 . LEU A 1 127 ? -41.321 -14.745 26.407  1.00 26.81 ? 116  LEU A HD23 1 
ATOM   1619  N N    . LEU A 1 128 ? -44.226 -16.297 22.534  1.00 17.71 ? 117  LEU A N    1 
ATOM   1620  C CA   . LEU A 1 128 ? -45.341 -16.300 21.603  1.00 17.27 ? 117  LEU A CA   1 
ATOM   1621  C C    . LEU A 1 128 ? -46.612 -16.822 22.253  1.00 17.13 ? 117  LEU A C    1 
ATOM   1622  O O    . LEU A 1 128 ? -47.705 -16.308 21.979  1.00 16.53 ? 117  LEU A O    1 
ATOM   1623  C CB   . LEU A 1 128 ? -44.974 -17.097 20.337  1.00 18.99 ? 117  LEU A CB   1 
ATOM   1624  C CG   . LEU A 1 128 ? -46.099 -17.198 19.273  1.00 21.92 ? 117  LEU A CG   1 
ATOM   1625  C CD1  . LEU A 1 128 ? -46.758 -15.837 18.837  1.00 22.78 ? 117  LEU A CD1  1 
ATOM   1626  C CD2  . LEU A 1 128 ? -45.576 -17.953 18.041  1.00 28.33 ? 117  LEU A CD2  1 
ATOM   1627  H H    . LEU A 1 128 ? -43.591 -16.843 22.337  1.00 21.25 ? 117  LEU A H    1 
ATOM   1628  H HA   . LEU A 1 128 ? -45.512 -15.386 21.329  1.00 20.72 ? 117  LEU A HA   1 
ATOM   1629  H HB2  . LEU A 1 128 ? -44.211 -16.672 19.916  1.00 22.78 ? 117  LEU A HB2  1 
ATOM   1630  H HB3  . LEU A 1 128 ? -44.739 -18.001 20.599  1.00 22.78 ? 117  LEU A HB3  1 
ATOM   1631  H HG   . LEU A 1 128 ? -46.810 -17.740 19.650  1.00 26.30 ? 117  LEU A HG   1 
ATOM   1632  H HD11 . LEU A 1 128 ? -47.443 -16.017 18.173  1.00 27.33 ? 117  LEU A HD11 1 
ATOM   1633  H HD12 . LEU A 1 128 ? -47.154 -15.415 19.615  1.00 27.33 ? 117  LEU A HD12 1 
ATOM   1634  H HD13 . LEU A 1 128 ? -46.074 -15.262 18.459  1.00 27.33 ? 117  LEU A HD13 1 
ATOM   1635  H HD21 . LEU A 1 128 ? -46.285 -18.011 17.382  1.00 34.00 ? 117  LEU A HD21 1 
ATOM   1636  H HD22 . LEU A 1 128 ? -44.820 -17.470 17.673  1.00 34.00 ? 117  LEU A HD22 1 
ATOM   1637  H HD23 . LEU A 1 128 ? -45.300 -18.843 18.311  1.00 34.00 ? 117  LEU A HD23 1 
ATOM   1638  N N    . ALA A 1 129 ? -46.507 -17.913 23.031  1.00 16.70 ? 118  ALA A N    1 
ATOM   1639  C CA   . ALA A 1 129 ? -47.698 -18.439 23.674  1.00 19.06 ? 118  ALA A CA   1 
ATOM   1640  C C    . ALA A 1 129 ? -48.310 -17.387 24.577  1.00 16.80 ? 118  ALA A C    1 
ATOM   1641  O O    . ALA A 1 129 ? -49.529 -17.219 24.605  1.00 18.06 ? 118  ALA A O    1 
ATOM   1642  C CB   . ALA A 1 129 ? -47.352 -19.676 24.482  1.00 20.24 ? 118  ALA A CB   1 
ATOM   1643  H H    . ALA A 1 129 ? -45.782 -18.346 23.191  1.00 20.04 ? 118  ALA A H    1 
ATOM   1644  H HA   . ALA A 1 129 ? -48.350 -18.684 22.999  1.00 22.87 ? 118  ALA A HA   1 
ATOM   1645  H HB1  . ALA A 1 129 ? -48.159 -20.013 24.903  1.00 24.29 ? 118  ALA A HB1  1 
ATOM   1646  H HB2  . ALA A 1 129 ? -46.984 -20.348 23.887  1.00 24.29 ? 118  ALA A HB2  1 
ATOM   1647  H HB3  . ALA A 1 129 ? -46.699 -19.439 25.158  1.00 24.29 ? 118  ALA A HB3  1 
ATOM   1648  N N    . ALA A 1 130 ? -47.479 -16.646 25.300  1.00 17.56 ? 119  ALA A N    1 
ATOM   1649  C CA   . ALA A 1 130 ? -48.009 -15.623 26.180  1.00 16.26 ? 119  ALA A CA   1 
ATOM   1650  C C    . ALA A 1 130 ? -48.609 -14.486 25.363  1.00 15.34 ? 119  ALA A C    1 
ATOM   1651  O O    . ALA A 1 130 ? -49.657 -13.952 25.711  1.00 15.47 ? 119  ALA A O    1 
ATOM   1652  C CB   . ALA A 1 130 ? -46.907 -15.117 27.125  1.00 17.83 ? 119  ALA A CB   1 
ATOM   1653  H H    . ALA A 1 130 ? -46.622 -16.716 25.299  1.00 21.07 ? 119  ALA A H    1 
ATOM   1654  H HA   . ALA A 1 130 ? -48.716 -16.007 26.722  1.00 19.51 ? 119  ALA A HA   1 
ATOM   1655  H HB1  . ALA A 1 130 ? -47.278 -14.434 27.705  1.00 21.40 ? 119  ALA A HB1  1 
ATOM   1656  H HB2  . ALA A 1 130 ? -46.580 -15.860 27.655  1.00 21.40 ? 119  ALA A HB2  1 
ATOM   1657  H HB3  . ALA A 1 130 ? -46.184 -14.744 26.596  1.00 21.40 ? 119  ALA A HB3  1 
ATOM   1658  N N    . PHE A 1 131 ? -47.935 -14.079 24.291  1.00 14.93 ? 120  PHE A N    1 
ATOM   1659  C CA   . PHE A 1 131 ? -48.466 -13.037 23.432  1.00 14.35 ? 120  PHE A CA   1 
ATOM   1660  C C    . PHE A 1 131 ? -49.839 -13.443 22.938  1.00 14.58 ? 120  PHE A C    1 
ATOM   1661  O O    . PHE A 1 131 ? -50.776 -12.642 22.962  1.00 14.56 ? 120  PHE A O    1 
ATOM   1662  C CB   . PHE A 1 131 ? -47.510 -12.795 22.252  1.00 14.73 ? 120  PHE A CB   1 
ATOM   1663  C CG   . PHE A 1 131 ? -48.033 -11.824 21.260  1.00 15.08 ? 120  PHE A CG   1 
ATOM   1664  C CD1  . PHE A 1 131 ? -47.783 -10.469 21.401  1.00 14.76 ? 120  PHE A CD1  1 
ATOM   1665  C CD2  . PHE A 1 131 ? -48.747 -12.271 20.144  1.00 15.63 ? 120  PHE A CD2  1 
ATOM   1666  C CE1  . PHE A 1 131 ? -48.265 -9.577  20.455  1.00 16.28 ? 120  PHE A CE1  1 
ATOM   1667  C CE2  . PHE A 1 131 ? -49.214 -11.373 19.179  1.00 17.67 ? 120  PHE A CE2  1 
ATOM   1668  C CZ   . PHE A 1 131 ? -48.996 -10.025 19.356  1.00 15.29 ? 120  PHE A CZ   1 
ATOM   1669  H H    . PHE A 1 131 ? -47.173 -14.390 24.044  1.00 17.92 ? 120  PHE A H    1 
ATOM   1670  H HA   . PHE A 1 131 ? -48.550 -12.212 23.936  1.00 17.22 ? 120  PHE A HA   1 
ATOM   1671  H HB2  . PHE A 1 131 ? -46.671 -12.449 22.593  1.00 17.68 ? 120  PHE A HB2  1 
ATOM   1672  H HB3  . PHE A 1 131 ? -47.358 -13.636 21.794  1.00 17.68 ? 120  PHE A HB3  1 
ATOM   1673  H HD1  . PHE A 1 131 ? -47.310 -10.157 22.138  1.00 17.71 ? 120  PHE A HD1  1 
ATOM   1674  H HD2  . PHE A 1 131 ? -48.904 -13.181 20.035  1.00 18.75 ? 120  PHE A HD2  1 
ATOM   1675  H HE1  . PHE A 1 131 ? -48.108 -8.666  20.561  1.00 19.54 ? 120  PHE A HE1  1 
ATOM   1676  H HE2  . PHE A 1 131 ? -49.704 -11.679 18.450  1.00 21.20 ? 120  PHE A HE2  1 
ATOM   1677  H HZ   . PHE A 1 131 ? -49.304 -9.418  18.723  1.00 18.34 ? 120  PHE A HZ   1 
ATOM   1678  N N    . ASP A 1 132 ? -49.967 -14.684 22.476  1.00 15.39 ? 121  ASP A N    1 
ATOM   1679  C CA   . ASP A 1 132 ? -51.263 -15.141 21.990  1.00 14.82 ? 121  ASP A CA   1 
ATOM   1680  C C    . ASP A 1 132 ? -52.333 -15.082 23.077  1.00 15.32 ? 121  ASP A C    1 
ATOM   1681  O O    . ASP A 1 132 ? -53.509 -14.754 22.792  1.00 17.77 ? 121  ASP A O    1 
ATOM   1682  C CB   . ASP A 1 132 ? -51.164 -16.572 21.476  1.00 18.40 ? 121  ASP A CB   1 
ATOM   1683  C CG   . ASP A 1 132 ? -50.495 -16.689 20.137  1.00 21.46 ? 121  ASP A CG   1 
ATOM   1684  O OD1  . ASP A 1 132 ? -50.340 -15.683 19.409  1.00 20.90 ? 121  ASP A OD1  1 
ATOM   1685  O OD2  . ASP A 1 132 ? -50.145 -17.849 19.823  1.00 24.57 ? 121  ASP A OD2  1 
ATOM   1686  H H    . ASP A 1 132 ? -49.336 -15.267 22.434  1.00 18.47 ? 121  ASP A H    1 
ATOM   1687  H HA   . ASP A 1 132 ? -51.545 -14.574 21.256  1.00 17.79 ? 121  ASP A HA   1 
ATOM   1688  H HB2  . ASP A 1 132 ? -50.652 -17.098 22.110  1.00 22.08 ? 121  ASP A HB2  1 
ATOM   1689  H HB3  . ASP A 1 132 ? -52.059 -16.937 21.393  1.00 22.08 ? 121  ASP A HB3  1 
ATOM   1690  N N    A GLN A 1 133 ? -51.962 -15.424 24.311  0.61 16.20 ? 122  GLN A N    1 
ATOM   1691  N N    B GLN A 1 133 ? -51.958 -15.401 24.319  0.39 16.59 ? 122  GLN A N    1 
ATOM   1692  C CA   A GLN A 1 133 ? -52.923 -15.389 25.403  0.61 16.52 ? 122  GLN A CA   1 
ATOM   1693  C CA   B GLN A 1 133 ? -52.909 -15.395 25.425  0.39 19.50 ? 122  GLN A CA   1 
ATOM   1694  C C    A GLN A 1 133 ? -53.369 -13.962 25.687  0.61 14.81 ? 122  GLN A C    1 
ATOM   1695  C C    B GLN A 1 133 ? -53.359 -13.977 25.747  0.39 18.12 ? 122  GLN A C    1 
ATOM   1696  O O    A GLN A 1 133 ? -54.565 -13.690 25.856  0.61 15.70 ? 122  GLN A O    1 
ATOM   1697  O O    B GLN A 1 133 ? -54.548 -13.726 25.989  0.39 18.33 ? 122  GLN A O    1 
ATOM   1698  C CB   A GLN A 1 133 ? -52.324 -16.027 26.651  0.61 17.09 ? 122  GLN A CB   1 
ATOM   1699  C CB   B GLN A 1 133 ? -52.257 -16.043 26.648  0.39 21.72 ? 122  GLN A CB   1 
ATOM   1700  C CG   A GLN A 1 133 ? -53.284 -15.980 27.842  0.61 20.99 ? 122  GLN A CG   1 
ATOM   1701  C CG   B GLN A 1 133 ? -53.069 -15.919 27.930  0.39 24.01 ? 122  GLN A CG   1 
ATOM   1702  C CD   A GLN A 1 133 ? -54.567 -16.752 27.601  0.61 24.89 ? 122  GLN A CD   1 
ATOM   1703  C CD   B GLN A 1 133 ? -52.505 -16.749 29.071  0.39 26.41 ? 122  GLN A CD   1 
ATOM   1704  O OE1  A GLN A 1 133 ? -55.598 -16.210 27.140  0.61 24.71 ? 122  GLN A OE1  1 
ATOM   1705  O OE1  B GLN A 1 133 ? -51.414 -16.478 29.578  0.39 32.19 ? 122  GLN A OE1  1 
ATOM   1706  N NE2  A GLN A 1 133 ? -54.513 -18.020 27.913  0.61 27.23 ? 122  GLN A NE2  1 
ATOM   1707  N NE2  B GLN A 1 133 ? -53.251 -17.760 29.484  0.39 29.13 ? 122  GLN A NE2  1 
ATOM   1708  H H    A GLN A 1 133 ? -51.172 -15.675 24.536  0.61 19.44 ? 122  GLN A H    1 
ATOM   1709  H H    B GLN A 1 133 ? -51.159 -15.624 24.544  0.39 19.91 ? 122  GLN A H    1 
ATOM   1710  H HA   A GLN A 1 133 ? -53.706 -15.903 25.150  0.61 19.83 ? 122  GLN A HA   1 
ATOM   1711  H HA   B GLN A 1 133 ? -53.690 -15.916 25.182  0.39 23.40 ? 122  GLN A HA   1 
ATOM   1712  H HB2  A GLN A 1 133 ? -52.119 -16.956 26.465  0.61 20.50 ? 122  GLN A HB2  1 
ATOM   1713  H HB2  B GLN A 1 133 ? -52.131 -16.988 26.469  0.39 26.06 ? 122  GLN A HB2  1 
ATOM   1714  H HB3  A GLN A 1 133 ? -51.516 -15.549 26.895  0.61 20.50 ? 122  GLN A HB3  1 
ATOM   1715  H HB3  B GLN A 1 133 ? -51.397 -15.622 26.802  0.39 26.06 ? 122  GLN A HB3  1 
ATOM   1716  H HG2  A GLN A 1 133 ? -52.844 -16.365 28.616  0.61 25.19 ? 122  GLN A HG2  1 
ATOM   1717  H HG2  B GLN A 1 133 ? -53.077 -14.990 28.210  0.39 28.82 ? 122  GLN A HG2  1 
ATOM   1718  H HG3  A GLN A 1 133 ? -53.520 -15.056 28.021  0.61 25.19 ? 122  GLN A HG3  1 
ATOM   1719  H HG3  B GLN A 1 133 ? -53.975 -16.221 27.759  0.39 28.82 ? 122  GLN A HG3  1 
ATOM   1720  H HE21 A GLN A 1 133 ? -53.787 -18.355 28.229  0.61 32.68 ? 122  GLN A HE21 1 
ATOM   1721  H HE21 B GLN A 1 133 ? -54.009 -17.916 29.108  0.39 34.95 ? 122  GLN A HE21 1 
ATOM   1722  H HE22 A GLN A 1 133 ? -55.205 -18.520 27.803  0.61 32.68 ? 122  GLN A HE22 1 
ATOM   1723  H HE22 B GLN A 1 133 ? -52.978 -18.262 30.127  0.39 34.95 ? 122  GLN A HE22 1 
ATOM   1724  N N    . TRP A 1 134 ? -52.422 -13.038 25.764  1.00 16.04 ? 123  TRP A N    1 
ATOM   1725  C CA   . TRP A 1 134 ? -52.782 -11.638 26.001  1.00 14.71 ? 123  TRP A CA   1 
ATOM   1726  C C    . TRP A 1 134 ? -53.634 -11.105 24.859  1.00 15.10 ? 123  TRP A C    1 
ATOM   1727  O O    . TRP A 1 134 ? -54.587 -10.357 25.102  1.00 15.42 ? 123  TRP A O    1 
ATOM   1728  C CB   . TRP A 1 134 ? -51.527 -10.772 26.201  1.00 14.93 ? 123  TRP A CB   1 
ATOM   1729  C CG   . TRP A 1 134 ? -51.248 -10.453 27.623  1.00 15.24 ? 123  TRP A CG   1 
ATOM   1730  C CD1  . TRP A 1 134 ? -51.492 -9.273  28.222  1.00 15.74 ? 123  TRP A CD1  1 
ATOM   1731  C CD2  . TRP A 1 134 ? -50.719 -11.314 28.647  1.00 15.53 ? 123  TRP A CD2  1 
ATOM   1732  N NE1  . TRP A 1 134 ? -51.147 -9.314  29.554  1.00 15.79 ? 123  TRP A NE1  1 
ATOM   1733  C CE2  . TRP A 1 134 ? -50.656 -10.563 29.833  1.00 15.78 ? 123  TRP A CE2  1 
ATOM   1734  C CE3  . TRP A 1 134 ? -50.258 -12.625 28.672  1.00 16.28 ? 123  TRP A CE3  1 
ATOM   1735  C CZ2  . TRP A 1 134 ? -50.167 -11.084 31.039  1.00 15.87 ? 123  TRP A CZ2  1 
ATOM   1736  C CZ3  . TRP A 1 134 ? -49.759 -13.144 29.874  1.00 17.21 ? 123  TRP A CZ3  1 
ATOM   1737  C CH2  . TRP A 1 134 ? -49.728 -12.392 31.034  1.00 16.80 ? 123  TRP A CH2  1 
ATOM   1738  H H    A TRP A 1 134 ? -51.579 -13.186 25.686  0.61 19.25 ? 123  TRP A H    1 
ATOM   1739  H H    B TRP A 1 134 ? -51.582 -13.177 25.644  0.39 19.25 ? 123  TRP A H    1 
ATOM   1740  H HA   . TRP A 1 134 ? -53.309 -11.586 26.813  1.00 17.65 ? 123  TRP A HA   1 
ATOM   1741  H HB2  . TRP A 1 134 ? -50.758 -11.247 25.847  1.00 17.92 ? 123  TRP A HB2  1 
ATOM   1742  H HB3  . TRP A 1 134 ? -51.645 -9.935  25.726  1.00 17.92 ? 123  TRP A HB3  1 
ATOM   1743  H HD1  . TRP A 1 134 ? -51.863 -8.534  27.796  1.00 18.89 ? 123  TRP A HD1  1 
ATOM   1744  H HE1  . TRP A 1 134 ? -51.221 -8.665  30.114  1.00 18.95 ? 123  TRP A HE1  1 
ATOM   1745  H HE3  . TRP A 1 134 ? -50.276 -13.147 27.903  1.00 19.53 ? 123  TRP A HE3  1 
ATOM   1746  H HZ2  . TRP A 1 134 ? -50.139 -10.568 31.812  1.00 19.04 ? 123  TRP A HZ2  1 
ATOM   1747  H HZ3  . TRP A 1 134 ? -49.465 -14.026 29.898  1.00 20.66 ? 123  TRP A HZ3  1 
ATOM   1748  H HH2  . TRP A 1 134 ? -49.395 -12.768 31.817  1.00 20.17 ? 123  TRP A HH2  1 
ATOM   1749  N N    . ARG A 1 135 ? -53.292 -11.451 23.612  1.00 15.15 ? 124  ARG A N    1 
ATOM   1750  C CA   . ARG A 1 135 ? -54.120 -11.052 22.475  1.00 15.52 ? 124  ARG A CA   1 
ATOM   1751  C C    . ARG A 1 135 ? -55.542 -11.590 22.615  1.00 15.08 ? 124  ARG A C    1 
ATOM   1752  O O    . ARG A 1 135 ? -56.513 -10.885 22.274  1.00 15.80 ? 124  ARG A O    1 
ATOM   1753  C CB   . ARG A 1 135 ? -53.503 -11.562 21.166  1.00 15.63 ? 124  ARG A CB   1 
ATOM   1754  C CG   . ARG A 1 135 ? -52.340 -10.753 20.599  1.00 16.63 ? 124  ARG A CG   1 
ATOM   1755  C CD   . ARG A 1 135 ? -52.714 -9.383  20.091  1.00 18.12 ? 124  ARG A CD   1 
ATOM   1756  N NE   . ARG A 1 135 ? -53.864 -9.436  19.185  1.00 17.54 ? 124  ARG A NE   1 
ATOM   1757  C CZ   . ARG A 1 135 ? -53.819 -9.721  17.894  1.00 19.99 ? 124  ARG A CZ   1 
ATOM   1758  N NH1  . ARG A 1 135 ? -52.675 -9.909  17.239  1.00 22.27 ? 124  ARG A NH1  1 
ATOM   1759  N NH2  . ARG A 1 135 ? -54.977 -9.756  17.231  1.00 21.74 ? 124  ARG A NH2  1 
ATOM   1760  H H    . ARG A 1 135 ? -52.596 -11.911 23.403  1.00 18.18 ? 124  ARG A H    1 
ATOM   1761  H HA   . ARG A 1 135 ? -54.163 -10.084 22.434  1.00 18.62 ? 124  ARG A HA   1 
ATOM   1762  H HB2  . ARG A 1 135 ? -53.180 -12.464 21.315  1.00 18.75 ? 124  ARG A HB2  1 
ATOM   1763  H HB3  . ARG A 1 135 ? -54.198 -11.578 20.490  1.00 18.75 ? 124  ARG A HB3  1 
ATOM   1764  H HG2  . ARG A 1 135 ? -51.675 -10.637 21.296  1.00 19.96 ? 124  ARG A HG2  1 
ATOM   1765  H HG3  . ARG A 1 135 ? -51.953 -11.245 19.858  1.00 19.96 ? 124  ARG A HG3  1 
ATOM   1766  H HD2  . ARG A 1 135 ? -52.946 -8.816  20.843  1.00 21.75 ? 124  ARG A HD2  1 
ATOM   1767  H HD3  . ARG A 1 135 ? -51.963 -9.006  19.607  1.00 21.75 ? 124  ARG A HD3  1 
ATOM   1768  H HE   . ARG A 1 135 ? -54.637 -9.268  19.523  1.00 21.04 ? 124  ARG A HE   1 
ATOM   1769  H HH11 . ARG A 1 135 ? -51.928 -9.890  17.665  1.00 26.73 ? 124  ARG A HH11 1 
ATOM   1770  H HH12 . ARG A 1 135 ? -52.684 -10.077 16.396  1.00 26.73 ? 124  ARG A HH12 1 
ATOM   1771  H HH21 . ARG A 1 135 ? -55.716 -9.617  17.649  1.00 26.09 ? 124  ARG A HH21 1 
ATOM   1772  H HH22 . ARG A 1 135 ? -54.984 -9.912  16.385  1.00 26.09 ? 124  ARG A HH22 1 
ATOM   1773  N N    . GLU A 1 136 ? -55.693 -12.851 23.070  1.00 16.27 ? 125  GLU A N    1 
ATOM   1774  C CA   . GLU A 1 136 ? -57.039 -13.412 23.237  1.00 17.61 ? 125  GLU A CA   1 
ATOM   1775  C C    . GLU A 1 136 ? -57.829 -12.592 24.249  1.00 16.46 ? 125  GLU A C    1 
ATOM   1776  O O    . GLU A 1 136 ? -58.998 -12.247 24.007  1.00 17.99 ? 125  GLU A O    1 
ATOM   1777  C CB   . GLU A 1 136 ? -56.971 -14.886 23.644  1.00 21.61 ? 125  GLU A CB   1 
ATOM   1778  C CG   . GLU A 1 136 ? -58.319 -15.513 24.028  1.00 30.14 ? 125  GLU A CG   1 
ATOM   1779  C CD   . GLU A 1 136 ? -58.102 -16.944 24.468  1.00 42.27 ? 125  GLU A CD   1 
ATOM   1780  O OE1  . GLU A 1 136 ? -58.440 -17.301 25.632  1.00 51.95 ? 125  GLU A OE1  1 
ATOM   1781  O OE2  . GLU A 1 136 ? -57.566 -17.721 23.641  1.00 47.45 ? 125  GLU A OE2  1 
ATOM   1782  H H    . GLU A 1 136 ? -55.051 -13.382 23.280  1.00 19.52 ? 125  GLU A H    1 
ATOM   1783  H HA   . GLU A 1 136 ? -57.505 -13.362 22.388  1.00 21.14 ? 125  GLU A HA   1 
ATOM   1784  H HB2  . GLU A 1 136 ? -56.611 -15.395 22.901  1.00 25.93 ? 125  GLU A HB2  1 
ATOM   1785  H HB3  . GLU A 1 136 ? -56.381 -14.967 24.410  1.00 25.93 ? 125  GLU A HB3  1 
ATOM   1786  H HG2  . GLU A 1 136 ? -58.712 -15.018 24.764  1.00 36.17 ? 125  GLU A HG2  1 
ATOM   1787  H HG3  . GLU A 1 136 ? -58.911 -15.511 23.260  1.00 36.17 ? 125  GLU A HG3  1 
ATOM   1788  N N    . TRP A 1 137 ? -57.209 -12.274 25.385  1.00 16.25 ? 126  TRP A N    1 
ATOM   1789  C CA   . TRP A 1 137 ? -57.898 -11.526 26.422  1.00 16.98 ? 126  TRP A CA   1 
ATOM   1790  C C    . TRP A 1 137 ? -58.254 -10.132 25.922  1.00 14.96 ? 126  TRP A C    1 
ATOM   1791  O O    . TRP A 1 137 ? -59.384 -9.661  26.090  1.00 17.35 ? 126  TRP A O    1 
ATOM   1792  C CB   . TRP A 1 137 ? -56.967 -11.383 27.632  1.00 18.82 ? 126  TRP A CB   1 
ATOM   1793  C CG   . TRP A 1 137 ? -56.737 -12.634 28.418  1.00 18.30 ? 126  TRP A CG   1 
ATOM   1794  C CD1  . TRP A 1 137 ? -57.560 -13.692 28.515  1.00 19.88 ? 126  TRP A CD1  1 
ATOM   1795  C CD2  . TRP A 1 137 ? -55.635 -12.888 29.292  1.00 18.66 ? 126  TRP A CD2  1 
ATOM   1796  N NE1  . TRP A 1 137 ? -57.040 -14.608 29.406  1.00 22.57 ? 126  TRP A NE1  1 
ATOM   1797  C CE2  . TRP A 1 137 ? -55.844 -14.150 29.878  1.00 21.51 ? 126  TRP A CE2  1 
ATOM   1798  C CE3  . TRP A 1 137 ? -54.466 -12.177 29.604  1.00 21.86 ? 126  TRP A CE3  1 
ATOM   1799  C CZ2  . TRP A 1 137 ? -54.953 -14.724 30.770  1.00 24.05 ? 126  TRP A CZ2  1 
ATOM   1800  C CZ3  . TRP A 1 137 ? -53.585 -12.755 30.497  1.00 22.89 ? 126  TRP A CZ3  1 
ATOM   1801  C CH2  . TRP A 1 137 ? -53.821 -14.022 31.056  1.00 25.06 ? 126  TRP A CH2  1 
ATOM   1802  H H    . TRP A 1 137 ? -56.396 -12.480 25.575  1.00 19.49 ? 126  TRP A H    1 
ATOM   1803  H HA   . TRP A 1 137 ? -58.707 -11.988 26.691  1.00 20.38 ? 126  TRP A HA   1 
ATOM   1804  H HB2  . TRP A 1 137 ? -56.103 -11.073 27.319  1.00 22.58 ? 126  TRP A HB2  1 
ATOM   1805  H HB3  . TRP A 1 137 ? -57.347 -10.726 28.236  1.00 22.58 ? 126  TRP A HB3  1 
ATOM   1806  H HD1  . TRP A 1 137 ? -58.378 -13.775 28.081  1.00 23.86 ? 126  TRP A HD1  1 
ATOM   1807  H HE1  . TRP A 1 137 ? -57.395 -15.367 29.603  1.00 27.08 ? 126  TRP A HE1  1 
ATOM   1808  H HE3  . TRP A 1 137 ? -54.299 -11.340 29.235  1.00 26.23 ? 126  TRP A HE3  1 
ATOM   1809  H HZ2  . TRP A 1 137 ? -55.109 -15.563 31.140  1.00 28.86 ? 126  TRP A HZ2  1 
ATOM   1810  H HZ3  . TRP A 1 137 ? -52.804 -12.302 30.720  1.00 27.47 ? 126  TRP A HZ3  1 
ATOM   1811  H HH2  . TRP A 1 137 ? -53.204 -14.378 31.654  1.00 30.07 ? 126  TRP A HH2  1 
ATOM   1812  N N    . ALA A 1 138 ? -57.289 -9.434  25.320  1.00 14.49 ? 127  ALA A N    1 
ATOM   1813  C CA   . ALA A 1 138 ? -57.516 -8.042  24.921  1.00 14.28 ? 127  ALA A CA   1 
ATOM   1814  C C    . ALA A 1 138 ? -58.426 -7.930  23.694  1.00 13.92 ? 127  ALA A C    1 
ATOM   1815  O O    . ALA A 1 138 ? -59.296 -7.070  23.656  1.00 14.59 ? 127  ALA A O    1 
ATOM   1816  C CB   . ALA A 1 138 ? -56.180 -7.366  24.700  1.00 15.18 ? 127  ALA A CB   1 
ATOM   1817  H H    . ALA A 1 138 ? -56.506 -9.736  25.134  1.00 17.38 ? 127  ALA A H    1 
ATOM   1818  H HA   . ALA A 1 138 ? -57.957 -7.582  25.652  1.00 17.13 ? 127  ALA A HA   1 
ATOM   1819  H HB1  . ALA A 1 138 ? -56.333 -6.446  24.436  1.00 18.22 ? 127  ALA A HB1  1 
ATOM   1820  H HB2  . ALA A 1 138 ? -55.672 -7.394  25.526  1.00 18.22 ? 127  ALA A HB2  1 
ATOM   1821  H HB3  . ALA A 1 138 ? -55.700 -7.837  24.000  1.00 18.22 ? 127  ALA A HB3  1 
ATOM   1822  N N    . ASP A 1 139 ? -58.324 -8.841  22.738  1.00 14.32 ? 128  ASP A N    1 
ATOM   1823  C CA   . ASP A 1 139 ? -59.225 -8.807  21.578  1.00 15.62 ? 128  ASP A CA   1 
ATOM   1824  C C    . ASP A 1 139 ? -60.652 -9.039  22.020  1.00 17.04 ? 128  ASP A C    1 
ATOM   1825  O O    . ASP A 1 139 ? -61.583 -8.467  21.455  1.00 18.72 ? 128  ASP A O    1 
ATOM   1826  C CB   . ASP A 1 139 ? -58.849 -9.853  20.540  1.00 14.85 ? 128  ASP A CB   1 
ATOM   1827  C CG   . ASP A 1 139 ? -57.606 -9.511  19.748  1.00 17.07 ? 128  ASP A CG   1 
ATOM   1828  O OD1  . ASP A 1 139 ? -57.186 -8.362  19.754  1.00 20.84 ? 128  ASP A OD1  1 
ATOM   1829  O OD2  . ASP A 1 139 ? -57.139 -10.419 19.043  1.00 21.03 ? 128  ASP A OD2  1 
ATOM   1830  H H    . ASP A 1 139 ? -57.753 -9.484  22.730  1.00 17.18 ? 128  ASP A H    1 
ATOM   1831  H HA   . ASP A 1 139 ? -59.175 -7.933  21.160  1.00 18.75 ? 128  ASP A HA   1 
ATOM   1832  H HB2  . ASP A 1 139 ? -58.690 -10.697 20.990  1.00 17.82 ? 128  ASP A HB2  1 
ATOM   1833  H HB3  . ASP A 1 139 ? -59.582 -9.948  19.912  1.00 17.82 ? 128  ASP A HB3  1 
ATOM   1834  N N    A SER A 1 140 ? -60.852 -9.882  23.014  0.73 18.91 ? 129  SER A N    1 
ATOM   1835  N N    B SER A 1 140 ? -60.828 -9.894  23.038  0.27 16.02 ? 129  SER A N    1 
ATOM   1836  C CA   A SER A 1 140 ? -62.221 -10.175 23.412  0.73 19.46 ? 129  SER A CA   1 
ATOM   1837  C CA   B SER A 1 140 ? -62.153 -10.247 23.538  0.27 15.05 ? 129  SER A CA   1 
ATOM   1838  C C    A SER A 1 140 ? -62.785 -9.128  24.361  0.73 16.02 ? 129  SER A C    1 
ATOM   1839  C C    B SER A 1 140 ? -62.774 -9.094  24.305  0.27 15.52 ? 129  SER A C    1 
ATOM   1840  O O    A SER A 1 140 ? -64.009 -8.996  24.453  0.73 18.24 ? 129  SER A O    1 
ATOM   1841  O O    B SER A 1 140 ? -63.996 -8.884  24.237  0.27 15.71 ? 129  SER A O    1 
ATOM   1842  C CB   A SER A 1 140 ? -62.251 -11.552 24.038  0.73 24.64 ? 129  SER A CB   1 
ATOM   1843  C CB   B SER A 1 140 ? -62.052 -11.472 24.452  0.27 16.32 ? 129  SER A CB   1 
ATOM   1844  O OG   A SER A 1 140 ? -61.680 -11.489 25.318  0.73 24.63 ? 129  SER A OG   1 
ATOM   1845  O OG   B SER A 1 140 ? -63.324 -11.821 24.994  0.27 19.62 ? 129  SER A OG   1 
ATOM   1846  H H    A SER A 1 140 ? -60.240 -10.286 23.463  0.73 22.69 ? 129  SER A H    1 
ATOM   1847  H H    B SER A 1 140 ? -60.185 -10.284 23.455  0.27 19.22 ? 129  SER A H    1 
ATOM   1848  H HA   A SER A 1 140 ? -62.782 -10.193 22.620  0.73 23.35 ? 129  SER A HA   1 
ATOM   1849  H HA   B SER A 1 140 ? -62.732 -10.467 22.792  0.27 18.06 ? 129  SER A HA   1 
ATOM   1850  H HB2  A SER A 1 140 ? -63.171 -11.852 24.111  0.73 29.57 ? 129  SER A HB2  1 
ATOM   1851  H HB2  B SER A 1 140 ? -61.713 -12.221 23.938  0.27 19.58 ? 129  SER A HB2  1 
ATOM   1852  H HB3  A SER A 1 140 ? -61.740 -12.166 23.488  0.73 29.57 ? 129  SER A HB3  1 
ATOM   1853  H HB3  B SER A 1 140 ? -61.445 -11.270 25.182  0.27 19.58 ? 129  SER A HB3  1 
ATOM   1854  H HG   A SER A 1 140 ? -60.884 -11.224 25.264  0.73 29.56 ? 129  SER A HG   1 
ATOM   1855  H HG   B SER A 1 140 ? -63.630 -11.181 25.444  0.27 23.54 ? 129  SER A HG   1 
ATOM   1856  N N    . LYS A 1 141 ? -61.954 -8.336  25.049  1.00 15.67 ? 130  LYS A N    1 
ATOM   1857  C CA   . LYS A 1 141 ? -62.475 -7.411  26.060  1.00 15.06 ? 130  LYS A CA   1 
ATOM   1858  C C    . LYS A 1 141 ? -62.114 -5.941  25.924  1.00 14.44 ? 130  LYS A C    1 
ATOM   1859  O O    . LYS A 1 141 ? -62.835 -5.117  26.502  1.00 15.01 ? 130  LYS A O    1 
ATOM   1860  C CB   . LYS A 1 141 ? -62.067 -7.859  27.461  1.00 16.72 ? 130  LYS A CB   1 
ATOM   1861  C CG   . LYS A 1 141 ? -62.792 -9.168  27.881  1.00 21.18 ? 130  LYS A CG   1 
ATOM   1862  C CD   . LYS A 1 141 ? -62.846 -9.352  29.399  1.00 28.82 ? 130  LYS A CD   1 
ATOM   1863  C CE   . LYS A 1 141 ? -63.793 -10.508 29.836  1.00 31.61 ? 130  LYS A CE   1 
ATOM   1864  N NZ   . LYS A 1 141 ? -65.308 -10.243 29.703  1.00 40.35 ? 130  LYS A NZ   1 
ATOM   1865  H H    A LYS A 1 141 ? -61.100 -8.316  24.951  0.73 18.81 ? 130  LYS A H    1 
ATOM   1866  H H    B LYS A 1 141 ? -61.096 -8.342  24.986  0.27 18.81 ? 130  LYS A H    1 
ATOM   1867  H HA   . LYS A 1 141 ? -63.443 -7.460  26.024  1.00 18.07 ? 130  LYS A HA   1 
ATOM   1868  H HB2  . LYS A 1 141 ? -61.111 -8.023  27.479  1.00 20.07 ? 130  LYS A HB2  1 
ATOM   1869  H HB3  . LYS A 1 141 ? -62.300 -7.166  28.098  1.00 20.07 ? 130  LYS A HB3  1 
ATOM   1870  H HG2  . LYS A 1 141 ? -63.703 -9.145  27.549  1.00 25.42 ? 130  LYS A HG2  1 
ATOM   1871  H HG3  . LYS A 1 141 ? -62.319 -9.926  27.503  1.00 25.42 ? 130  LYS A HG3  1 
ATOM   1872  H HD2  . LYS A 1 141 ? -61.955 -9.556  29.724  1.00 34.58 ? 130  LYS A HD2  1 
ATOM   1873  H HD3  . LYS A 1 141 ? -63.167 -8.532  29.806  1.00 34.58 ? 130  LYS A HD3  1 
ATOM   1874  H HE2  . LYS A 1 141 ? -63.589 -11.287 29.296  1.00 37.93 ? 130  LYS A HE2  1 
ATOM   1875  H HE3  . LYS A 1 141 ? -63.617 -10.708 30.768  1.00 37.93 ? 130  LYS A HE3  1 
ATOM   1876  H HZ1  . LYS A 1 141 ? -65.513 -10.074 28.854  1.00 48.42 ? 130  LYS A HZ1  1 
ATOM   1877  H HZ2  . LYS A 1 141 ? -65.766 -10.957 29.975  1.00 48.42 ? 130  LYS A HZ2  1 
ATOM   1878  H HZ3  . LYS A 1 141 ? -65.539 -9.544  30.202  1.00 48.42 ? 130  LYS A HZ3  1 
ATOM   1879  N N    . SER A 1 142 ? -61.005 -5.571  25.260  1.00 13.94 ? 131  SER A N    1 
ATOM   1880  C CA   . SER A 1 142 ? -60.598 -4.174  25.289  1.00 13.21 ? 131  SER A CA   1 
ATOM   1881  C C    . SER A 1 142 ? -61.691 -3.295  24.667  1.00 13.93 ? 131  SER A C    1 
ATOM   1882  O O    . SER A 1 142 ? -62.208 -3.589  23.605  1.00 13.84 ? 131  SER A O    1 
ATOM   1883  C CB   . SER A 1 142 ? -59.301 -4.005  24.520  1.00 13.82 ? 131  SER A CB   1 
ATOM   1884  O OG   . SER A 1 142 ? -58.899 -2.654  24.683  1.00 13.66 ? 131  SER A OG   1 
ATOM   1885  H H    . SER A 1 142 ? -60.496 -6.094  24.805  1.00 16.73 ? 131  SER A H    1 
ATOM   1886  H HA   . SER A 1 142 ? -60.456 -3.892  26.207  1.00 15.85 ? 131  SER A HA   1 
ATOM   1887  H HB2  . SER A 1 142 ? -58.624 -4.595  24.885  1.00 16.58 ? 131  SER A HB2  1 
ATOM   1888  H HB3  . SER A 1 142 ? -59.450 -4.192  23.580  1.00 16.58 ? 131  SER A HB3  1 
ATOM   1889  H HG   . SER A 1 142 ? -59.490 -2.140  24.380  1.00 16.39 ? 131  SER A HG   1 
ATOM   1890  N N    . CYS A 1 143 ? -61.932 -2.150  25.279  1.00 13.87 ? 132  CYS A N    1 
ATOM   1891  C CA   . CYS A 1 143 ? -62.847 -1.142  24.768  1.00 14.25 ? 132  CYS A CA   1 
ATOM   1892  C C    . CYS A 1 143 ? -62.182 -0.149  23.838  1.00 13.33 ? 132  CYS A C    1 
ATOM   1893  O O    . CYS A 1 143 ? -62.884 0.670   23.241  1.00 14.89 ? 132  CYS A O    1 
ATOM   1894  C CB   . CYS A 1 143 ? -63.442 -0.340  25.932  1.00 14.03 ? 132  CYS A CB   1 
ATOM   1895  S SG   . CYS A 1 143 ? -64.454 -1.298  27.077  1.00 15.87 ? 132  CYS A SG   1 
ATOM   1896  H H    . CYS A 1 143 ? -61.562 -1.923  26.022  1.00 16.64 ? 132  CYS A H    1 
ATOM   1897  H HA   . CYS A 1 143 ? -63.572 -1.575  24.290  1.00 17.09 ? 132  CYS A HA   1 
ATOM   1898  H HB2  . CYS A 1 143 ? -62.715 0.050   26.441  1.00 16.84 ? 132  CYS A HB2  1 
ATOM   1899  H HB3  . CYS A 1 143 ? -64.000 0.365   25.568  1.00 16.84 ? 132  CYS A HB3  1 
ATOM   1900  H HG   . CYS A 1 143 ? -63.782 -2.168  27.559  1.00 19.04 ? 132  CYS A HG   1 
ATOM   1901  N N    . CYS A 1 144 ? -60.863 -0.211  23.693  1.00 13.28 ? 133  CYS A N    1 
ATOM   1902  C CA   . CYS A 1 144 ? -60.112 0.782   22.939  1.00 13.93 ? 133  CYS A CA   1 
ATOM   1903  C C    . CYS A 1 144 ? -58.956 0.100   22.219  1.00 13.10 ? 133  CYS A C    1 
ATOM   1904  O O    . CYS A 1 144 ? -58.566 -1.029  22.536  1.00 13.38 ? 133  CYS A O    1 
ATOM   1905  C CB   . CYS A 1 144 ? -59.588 1.927   23.838  1.00 14.31 ? 133  CYS A CB   1 
ATOM   1906  S SG   . CYS A 1 144 ? -58.375 1.415   25.078  1.00 14.39 ? 133  CYS A SG   1 
ATOM   1907  H H    . CYS A 1 144 ? -60.372 -0.832  24.029  1.00 15.93 ? 133  CYS A H    1 
ATOM   1908  H HA   . CYS A 1 144 ? -60.693 1.172   22.267  1.00 16.72 ? 133  CYS A HA   1 
ATOM   1909  H HB2  . CYS A 1 144 ? -59.167 2.595   23.274  1.00 17.17 ? 133  CYS A HB2  1 
ATOM   1910  H HB3  . CYS A 1 144 ? -60.339 2.322   24.307  1.00 17.17 ? 133  CYS A HB3  1 
ATOM   1911  H HG   . CYS A 1 144 ? -57.425 0.938   24.522  1.00 17.27 ? 133  CYS A HG   1 
ATOM   1912  N N    . ASP A 1 145 ? -58.422 0.801   21.222  1.00 12.08 ? 134  ASP A N    1 
ATOM   1913  C CA   . ASP A 1 145 ? -57.247 0.277   20.551  1.00 12.63 ? 134  ASP A CA   1 
ATOM   1914  C C    . ASP A 1 145 ? -56.121 0.043   21.551  1.00 11.92 ? 134  ASP A C    1 
ATOM   1915  O O    . ASP A 1 145 ? -56.015 0.726   22.572  1.00 12.31 ? 134  ASP A O    1 
ATOM   1916  C CB   . ASP A 1 145 ? -56.781 1.255   19.477  1.00 12.64 ? 134  ASP A CB   1 
ATOM   1917  C CG   . ASP A 1 145 ? -57.668 1.262   18.223  1.00 13.73 ? 134  ASP A CG   1 
ATOM   1918  O OD1  . ASP A 1 145 ? -58.500 0.325   18.043  1.00 13.86 ? 134  ASP A OD1  1 
ATOM   1919  O OD2  . ASP A 1 145 ? -57.478 2.199   17.416  1.00 13.46 ? 134  ASP A OD2  1 
ATOM   1920  H H    . ASP A 1 145 ? -58.712 1.555   20.927  1.00 14.50 ? 134  ASP A H    1 
ATOM   1921  H HA   . ASP A 1 145 ? -57.464 -0.568  20.127  1.00 15.15 ? 134  ASP A HA   1 
ATOM   1922  H HB2  . ASP A 1 145 ? -56.784 2.151   19.848  1.00 15.16 ? 134  ASP A HB2  1 
ATOM   1923  H HB3  . ASP A 1 145 ? -55.882 1.014   19.204  1.00 15.16 ? 134  ASP A HB3  1 
ATOM   1924  N N    . TYR A 1 146 ? -55.263 -0.924  21.243  1.00 12.00 ? 135  TYR A N    1 
ATOM   1925  C CA   . TYR A 1 146 ? -54.220 -1.264  22.188  1.00 12.36 ? 135  TYR A CA   1 
ATOM   1926  C C    . TYR A 1 146 ? -53.043 -1.873  21.443  1.00 11.85 ? 135  TYR A C    1 
ATOM   1927  O O    . TYR A 1 146 ? -53.150 -2.318  20.298  1.00 13.05 ? 135  TYR A O    1 
ATOM   1928  C CB   . TYR A 1 146 ? -54.760 -2.264  23.228  1.00 12.78 ? 135  TYR A CB   1 
ATOM   1929  C CG   . TYR A 1 146 ? -54.940 -3.670  22.728  1.00 12.63 ? 135  TYR A CG   1 
ATOM   1930  C CD1  . TYR A 1 146 ? -56.068 -4.054  22.023  1.00 13.31 ? 135  TYR A CD1  1 
ATOM   1931  C CD2  . TYR A 1 146 ? -53.957 -4.615  22.933  1.00 13.75 ? 135  TYR A CD2  1 
ATOM   1932  C CE1  . TYR A 1 146 ? -56.209 -5.366  21.529  1.00 14.67 ? 135  TYR A CE1  1 
ATOM   1933  C CE2  . TYR A 1 146 ? -54.080 -5.865  22.455  1.00 14.05 ? 135  TYR A CE2  1 
ATOM   1934  C CZ   . TYR A 1 146 ? -55.188 -6.255  21.753  1.00 16.53 ? 135  TYR A CZ   1 
ATOM   1935  O OH   . TYR A 1 146 ? -55.250 -7.556  21.341  1.00 17.06 ? 135  TYR A OH   1 
ATOM   1936  H H    . TYR A 1 146 ? -55.264 -1.383  20.516  1.00 14.39 ? 135  TYR A H    1 
ATOM   1937  H HA   . TYR A 1 146 ? -53.920 -0.465  22.648  1.00 14.84 ? 135  TYR A HA   1 
ATOM   1938  H HB2  . TYR A 1 146 ? -54.142 -2.296  23.974  1.00 15.34 ? 135  TYR A HB2  1 
ATOM   1939  H HB3  . TYR A 1 146 ? -55.625 -1.951  23.536  1.00 15.34 ? 135  TYR A HB3  1 
ATOM   1940  H HD1  . TYR A 1 146 ? -56.741 -3.432  21.866  1.00 15.98 ? 135  TYR A HD1  1 
ATOM   1941  H HD2  . TYR A 1 146 ? -53.183 -4.376  23.391  1.00 16.51 ? 135  TYR A HD2  1 
ATOM   1942  H HE1  . TYR A 1 146 ? -56.970 -5.621  21.060  1.00 17.60 ? 135  TYR A HE1  1 
ATOM   1943  H HE2  . TYR A 1 146 ? -53.402 -6.482  22.615  1.00 16.87 ? 135  TYR A HE2  1 
ATOM   1944  H HH   . TYR A 1 146 ? -55.980 -7.700  20.952  1.00 20.47 ? 135  TYR A HH   1 
ATOM   1945  N N    A SER A 1 147 ? -51.932 -1.951  22.152  0.54 13.58 ? 136  SER A N    1 
ATOM   1946  N N    B SER A 1 147 ? -51.875 -1.836  22.087  0.46 11.61 ? 136  SER A N    1 
ATOM   1947  C CA   A SER A 1 147 ? -50.817 -2.739  21.684  0.54 13.28 ? 136  SER A CA   1 
ATOM   1948  C CA   B SER A 1 147 ? -50.668 -2.541  21.638  0.46 11.57 ? 136  SER A CA   1 
ATOM   1949  C C    A SER A 1 147 ? -50.143 -3.368  22.883  0.54 11.35 ? 136  SER A C    1 
ATOM   1950  C C    B SER A 1 147 ? -50.132 -3.331  22.834  0.46 12.21 ? 136  SER A C    1 
ATOM   1951  O O    A SER A 1 147 ? -50.587 -3.222  24.027  0.54 12.48 ? 136  SER A O    1 
ATOM   1952  O O    B SER A 1 147 ? -50.663 -3.244  23.945  0.46 12.12 ? 136  SER A O    1 
ATOM   1953  C CB   A SER A 1 147 ? -49.874 -1.881  20.863  0.54 13.28 ? 136  SER A CB   1 
ATOM   1954  C CB   B SER A 1 147 ? -49.609 -1.561  21.092  0.46 14.43 ? 136  SER A CB   1 
ATOM   1955  O OG   A SER A 1 147 ? -49.186 -2.726  19.997  0.54 13.29 ? 136  SER A OG   1 
ATOM   1956  O OG   B SER A 1 147 ? -49.993 -0.982  19.847  0.46 12.41 ? 136  SER A OG   1 
ATOM   1957  H H    A SER A 1 147 ? -51.800 -1.558  22.906  0.54 16.30 ? 136  SER A H    1 
ATOM   1958  H H    B SER A 1 147 ? -51.752 -1.394  22.814  0.46 13.93 ? 136  SER A H    1 
ATOM   1959  H HA   A SER A 1 147 ? -51.147 -3.451  21.115  0.54 15.93 ? 136  SER A HA   1 
ATOM   1960  H HA   B SER A 1 147 ? -50.900 -3.167  20.934  0.46 13.88 ? 136  SER A HA   1 
ATOM   1961  H HB2  A SER A 1 147 ? -50.383 -1.234  20.351  0.54 15.94 ? 136  SER A HB2  1 
ATOM   1962  H HB2  B SER A 1 147 ? -49.480 -0.850  21.739  0.46 17.32 ? 136  SER A HB2  1 
ATOM   1963  H HB3  A SER A 1 147 ? -49.244 -1.434  21.450  0.54 15.94 ? 136  SER A HB3  1 
ATOM   1964  H HB3  B SER A 1 147 ? -48.776 -2.043  20.966  0.46 17.32 ? 136  SER A HB3  1 
ATOM   1965  H HG   A SER A 1 147 ? -49.728 -3.125  19.494  0.54 15.94 ? 136  SER A HG   1 
ATOM   1966  H HG   B SER A 1 147 ? -50.104 -1.584  19.272  0.46 14.89 ? 136  SER A HG   1 
ATOM   1967  N N    . LEU A 1 148 ? -49.063 -4.105  22.606  1.00 11.91 ? 137  LEU A N    1 
ATOM   1968  C CA   . LEU A 1 148 ? -48.467 -4.978  23.625  1.00 11.41 ? 137  LEU A CA   1 
ATOM   1969  C C    . LEU A 1 148 ? -46.962 -4.901  23.632  1.00 11.94 ? 137  LEU A C    1 
ATOM   1970  O O    . LEU A 1 148 ? -46.311 -5.271  22.648  1.00 14.09 ? 137  LEU A O    1 
ATOM   1971  C CB   . LEU A 1 148 ? -48.863 -6.455  23.397  1.00 12.02 ? 137  LEU A CB   1 
ATOM   1972  C CG   . LEU A 1 148 ? -50.331 -6.753  23.554  1.00 12.63 ? 137  LEU A CG   1 
ATOM   1973  C CD1  . LEU A 1 148 ? -50.637 -8.198  23.062  1.00 14.28 ? 137  LEU A CD1  1 
ATOM   1974  C CD2  . LEU A 1 148 ? -50.830 -6.568  24.977  1.00 14.31 ? 137  LEU A CD2  1 
ATOM   1975  H H    . LEU A 1 148 ? -48.659 -4.132  21.847  1.00 14.29 ? 137  LEU A H    1 
ATOM   1976  H HA   . LEU A 1 148 ? -48.788 -4.710  24.500  1.00 13.69 ? 137  LEU A HA   1 
ATOM   1977  H HB2  . LEU A 1 148 ? -48.609 -6.707  22.496  1.00 14.42 ? 137  LEU A HB2  1 
ATOM   1978  H HB3  . LEU A 1 148 ? -48.384 -7.005  24.036  1.00 14.42 ? 137  LEU A HB3  1 
ATOM   1979  H HG   . LEU A 1 148 ? -50.830 -6.142  22.990  1.00 15.16 ? 137  LEU A HG   1 
ATOM   1980  H HD11 . LEU A 1 148 ? -51.585 -8.373  23.169  1.00 17.14 ? 137  LEU A HD11 1 
ATOM   1981  H HD12 . LEU A 1 148 ? -50.391 -8.271  22.126  1.00 17.14 ? 137  LEU A HD12 1 
ATOM   1982  H HD13 . LEU A 1 148 ? -50.122 -8.827  23.590  1.00 17.14 ? 137  LEU A HD13 1 
ATOM   1983  H HD21 . LEU A 1 148 ? -51.778 -6.775  25.009  1.00 17.17 ? 137  LEU A HD21 1 
ATOM   1984  H HD22 . LEU A 1 148 ? -50.341 -7.166  25.564  1.00 17.17 ? 137  LEU A HD22 1 
ATOM   1985  H HD23 . LEU A 1 148 ? -50.684 -5.647  25.246  1.00 17.17 ? 137  LEU A HD23 1 
ATOM   1986  N N    . HIS A 1 149 ? -46.426 -4.495  24.769  1.00 11.84 ? 138  HIS A N    1 
ATOM   1987  C CA   . HIS A 1 149 ? -45.019 -4.736  25.074  1.00 11.17 ? 138  HIS A CA   1 
ATOM   1988  C C    . HIS A 1 149 ? -44.889 -6.201  25.514  1.00 11.15 ? 138  HIS A C    1 
ATOM   1989  O O    . HIS A 1 149 ? -45.834 -6.779  26.045  1.00 13.11 ? 138  HIS A O    1 
ATOM   1990  C CB   . HIS A 1 149 ? -44.590 -3.899  26.289  1.00 11.18 ? 138  HIS A CB   1 
ATOM   1991  C CG   . HIS A 1 149 ? -44.859 -2.447  26.210  1.00 11.15 ? 138  HIS A CG   1 
ATOM   1992  N ND1  . HIS A 1 149 ? -44.176 -1.595  25.361  1.00 11.22 ? 138  HIS A ND1  1 
ATOM   1993  C CD2  . HIS A 1 149 ? -45.698 -1.676  26.941  1.00 11.44 ? 138  HIS A CD2  1 
ATOM   1994  C CE1  . HIS A 1 149 ? -44.611 -0.365  25.574  1.00 12.09 ? 138  HIS A CE1  1 
ATOM   1995  N NE2  . HIS A 1 149 ? -45.545 -0.383  26.508  1.00 11.53 ? 138  HIS A NE2  1 
ATOM   1996  H H    . HIS A 1 149 ? -46.854 -4.076  25.387  1.00 14.21 ? 138  HIS A H    1 
ATOM   1997  H HA   . HIS A 1 149 ? -44.448 -4.554  24.312  1.00 13.40 ? 138  HIS A HA   1 
ATOM   1998  H HB2  . HIS A 1 149 ? -45.056 -4.236  27.070  1.00 13.42 ? 138  HIS A HB2  1 
ATOM   1999  H HB3  . HIS A 1 149 ? -43.635 -4.009  26.412  1.00 13.42 ? 138  HIS A HB3  1 
ATOM   2000  H HD2  . HIS A 1 149 ? -46.288 -1.972  27.596  1.00 13.73 ? 138  HIS A HD2  1 
ATOM   2001  H HE1  . HIS A 1 149 ? -44.326 0.392   25.115  1.00 14.51 ? 138  HIS A HE1  1 
ATOM   2002  H HE2  . HIS A 1 149 ? -45.971 0.301   26.806  1.00 13.83 ? 138  HIS A HE2  1 
ATOM   2003  N N    . VAL A 1 150 ? -43.714 -6.783  25.327  1.00 12.46 ? 139  VAL A N    1 
ATOM   2004  C CA   . VAL A 1 150 ? -43.494 -8.170  25.713  1.00 12.25 ? 139  VAL A CA   1 
ATOM   2005  C C    . VAL A 1 150 ? -42.406 -8.213  26.769  1.00 12.00 ? 139  VAL A C    1 
ATOM   2006  O O    . VAL A 1 150 ? -41.271 -7.771  26.537  1.00 12.03 ? 139  VAL A O    1 
ATOM   2007  C CB   . VAL A 1 150 ? -43.166 -9.077  24.530  1.00 12.92 ? 139  VAL A CB   1 
ATOM   2008  C CG1  . VAL A 1 150 ? -42.781 -10.467 25.003  1.00 14.96 ? 139  VAL A CG1  1 
ATOM   2009  C CG2  . VAL A 1 150 ? -44.356 -9.114  23.596  1.00 14.04 ? 139  VAL A CG2  1 
ATOM   2010  H H    . VAL A 1 150 ? -43.027 -6.398  24.980  1.00 14.96 ? 139  VAL A H    1 
ATOM   2011  H HA   . VAL A 1 150 ? -44.307 -8.508  26.120  1.00 14.70 ? 139  VAL A HA   1 
ATOM   2012  H HB   . VAL A 1 150 ? -42.413 -8.705  24.044  1.00 15.50 ? 139  VAL A HB   1 
ATOM   2013  H HG11 . VAL A 1 150 ? -42.579 -11.018 24.231  1.00 17.95 ? 139  VAL A HG11 1 
ATOM   2014  H HG12 . VAL A 1 150 ? -42.001 -10.400 25.576  1.00 17.95 ? 139  VAL A HG12 1 
ATOM   2015  H HG13 . VAL A 1 150 ? -43.524 -10.848 25.498  1.00 17.95 ? 139  VAL A HG13 1 
ATOM   2016  H HG21 . VAL A 1 150 ? -44.148 -9.691  22.844  1.00 16.85 ? 139  VAL A HG21 1 
ATOM   2017  H HG22 . VAL A 1 150 ? -45.123 -9.461  24.077  1.00 16.85 ? 139  VAL A HG22 1 
ATOM   2018  H HG23 . VAL A 1 150 ? -44.539 -8.215  23.284  1.00 16.85 ? 139  VAL A HG23 1 
ATOM   2019  N N    . ASP A 1 151 ? -42.747 -8.705  27.952  1.00 12.42 ? 140  ASP A N    1 
ATOM   2020  C CA   . ASP A 1 151 ? -41.802 -8.751  29.056  1.00 13.29 ? 140  ASP A CA   1 
ATOM   2021  C C    . ASP A 1 151 ? -41.031 -10.066 29.000  1.00 12.18 ? 140  ASP A C    1 
ATOM   2022  O O    . ASP A 1 151 ? -41.613 -11.144 28.817  1.00 14.52 ? 140  ASP A O    1 
ATOM   2023  C CB   . ASP A 1 151 ? -42.509 -8.630  30.394  1.00 13.00 ? 140  ASP A CB   1 
ATOM   2024  C CG   . ASP A 1 151 ? -43.168 -7.315  30.628  1.00 12.72 ? 140  ASP A CG   1 
ATOM   2025  O OD1  . ASP A 1 151 ? -43.280 -6.499  29.714  1.00 13.06 ? 140  ASP A OD1  1 
ATOM   2026  O OD2  . ASP A 1 151 ? -43.639 -7.142  31.785  1.00 17.37 ? 140  ASP A OD2  1 
ATOM   2027  H H    . ASP A 1 151 ? -43.524 -9.020  28.141  1.00 14.91 ? 140  ASP A H    1 
ATOM   2028  H HA   . ASP A 1 151 ? -41.170 -8.019  28.974  1.00 15.94 ? 140  ASP A HA   1 
ATOM   2029  H HB2  . ASP A 1 151 ? -43.194 -9.315  30.446  1.00 15.61 ? 140  ASP A HB2  1 
ATOM   2030  H HB3  . ASP A 1 151 ? -41.859 -8.764  31.102  1.00 15.61 ? 140  ASP A HB3  1 
ATOM   2031  N N    A ILE A 1 152 ? -39.727 -9.966  29.107  0.60 13.28 ? 141  ILE A N    1 
ATOM   2032  N N    B ILE A 1 152 ? -39.716 -9.969  29.182  0.40 13.65 ? 141  ILE A N    1 
ATOM   2033  C CA   A ILE A 1 152 ? -38.852 -11.120 29.071  0.60 16.31 ? 141  ILE A CA   1 
ATOM   2034  C CA   B ILE A 1 152 ? -38.794 -11.096 29.068  0.40 14.25 ? 141  ILE A CA   1 
ATOM   2035  C C    A ILE A 1 152 ? -38.652 -11.596 30.499  0.60 15.57 ? 141  ILE A C    1 
ATOM   2036  C C    B ILE A 1 152 ? -38.511 -11.642 30.459  0.40 15.69 ? 141  ILE A C    1 
ATOM   2037  O O    A ILE A 1 152 ? -38.275 -10.829 31.384  0.60 14.66 ? 141  ILE A O    1 
ATOM   2038  O O    B ILE A 1 152 ? -37.795 -11.015 31.245  0.40 22.17 ? 141  ILE A O    1 
ATOM   2039  C CB   A ILE A 1 152 ? -37.521 -10.732 28.412  0.60 16.51 ? 141  ILE A CB   1 
ATOM   2040  C CB   B ILE A 1 152 ? -37.466 -10.659 28.435  0.40 15.51 ? 141  ILE A CB   1 
ATOM   2041  C CG1  A ILE A 1 152 ? -37.772 -10.556 26.906  0.60 19.66 ? 141  ILE A CG1  1 
ATOM   2042  C CG1  B ILE A 1 152 ? -37.681 -10.022 27.074  0.40 14.82 ? 141  ILE A CG1  1 
ATOM   2043  C CG2  A ILE A 1 152 ? -36.456 -11.776 28.707  0.60 21.08 ? 141  ILE A CG2  1 
ATOM   2044  C CG2  B ILE A 1 152 ? -36.524 -11.865 28.296  0.40 18.77 ? 141  ILE A CG2  1 
ATOM   2045  C CD1  A ILE A 1 152 ? -36.674 -9.834  26.125  0.60 21.13 ? 141  ILE A CD1  1 
ATOM   2046  C CD1  B ILE A 1 152 ? -38.165 -10.968 26.041  0.40 15.04 ? 141  ILE A CD1  1 
ATOM   2047  H H    A ILE A 1 152 ? -39.309 -9.221  29.204  0.60 15.94 ? 141  ILE A H    1 
ATOM   2048  H H    B ILE A 1 152 ? -39.321 -9.231  29.380  0.40 16.37 ? 141  ILE A H    1 
ATOM   2049  H HA   A ILE A 1 152 ? -39.263 -11.832 28.556  0.60 19.57 ? 141  ILE A HA   1 
ATOM   2050  H HA   B ILE A 1 152 ? -39.189 -11.796 28.526  0.40 17.10 ? 141  ILE A HA   1 
ATOM   2051  H HB   A ILE A 1 152 ? -37.231 -9.882  28.779  0.60 19.81 ? 141  ILE A HB   1 
ATOM   2052  H HB   B ILE A 1 152 ? -37.047 -10.007 29.017  0.40 18.62 ? 141  ILE A HB   1 
ATOM   2053  H HG12 A ILE A 1 152 ? -37.878 -11.435 26.510  0.60 23.59 ? 141  ILE A HG12 1 
ATOM   2054  H HG12 B ILE A 1 152 ? -38.339 -9.315  27.160  0.40 17.78 ? 141  ILE A HG12 1 
ATOM   2055  H HG13 A ILE A 1 152 ? -38.590 -10.048 26.790  0.60 23.59 ? 141  ILE A HG13 1 
ATOM   2056  H HG13 B ILE A 1 152 ? -36.839 -9.652  26.766  0.40 17.78 ? 141  ILE A HG13 1 
ATOM   2057  H HG21 A ILE A 1 152 ? -35.627 -11.509 28.282  0.60 25.30 ? 141  ILE A HG21 1 
ATOM   2058  H HG21 B ILE A 1 152 ? -35.691 -11.571 27.895  0.40 22.52 ? 141  ILE A HG21 1 
ATOM   2059  H HG22 A ILE A 1 152 ? -36.332 -11.837 29.667  0.60 25.30 ? 141  ILE A HG22 1 
ATOM   2060  H HG22 B ILE A 1 152 ? -36.355 -12.236 29.177  0.40 22.52 ? 141  ILE A HG22 1 
ATOM   2061  H HG23 A ILE A 1 152 ? -36.748 -12.632 28.356  0.60 25.30 ? 141  ILE A HG23 1 
ATOM   2062  H HG23 B ILE A 1 152 ? -36.946 -12.532 27.732  0.40 22.52 ? 141  ILE A HG23 1 
ATOM   2063  H HD11 A ILE A 1 152 ? -36.934 -9.779  25.193  0.60 25.36 ? 141  ILE A HD11 1 
ATOM   2064  H HD11 B ILE A 1 152 ? -38.278 -10.491 25.204  0.40 18.05 ? 141  ILE A HD11 1 
ATOM   2065  H HD12 A ILE A 1 152 ? -36.561 -8.943  26.491  0.60 25.36 ? 141  ILE A HD12 1 
ATOM   2066  H HD12 B ILE A 1 152 ? -37.512 -11.677 25.932  0.40 18.05 ? 141  ILE A HD12 1 
ATOM   2067  H HD13 A ILE A 1 152 ? -35.847 -10.334 26.210  0.60 25.36 ? 141  ILE A HD13 1 
ATOM   2068  H HD13 B ILE A 1 152 ? -39.014 -11.340 26.327  0.40 18.05 ? 141  ILE A HD13 1 
ATOM   2069  N N    . SER A 1 153 ? -39.004 -12.831 30.759  1.00 17.58 ? 142  SER A N    1 
ATOM   2070  C CA   . SER A 1 153 ? -38.875 -13.370 32.096  1.00 20.73 ? 142  SER A CA   1 
ATOM   2071  C C    . SER A 1 153 ? -37.605 -14.186 32.312  1.00 23.17 ? 142  SER A C    1 
ATOM   2072  O O    . SER A 1 153 ? -37.263 -14.440 33.475  1.00 26.89 ? 142  SER A O    1 
ATOM   2073  C CB   . SER A 1 153 ? -40.101 -14.190 32.451  1.00 25.77 ? 142  SER A CB   1 
ATOM   2074  O OG   . SER A 1 153 ? -40.235 -15.234 31.508  1.00 31.32 ? 142  SER A OG   1 
ATOM   2075  H H    . SER A 1 153 ? -39.370 -13.364 30.192  1.00 21.10 ? 142  SER A H    1 
ATOM   2076  H HA   . SER A 1 153 ? -38.842 -12.625 32.717  1.00 24.87 ? 142  SER A HA   1 
ATOM   2077  H HB2  . SER A 1 153 ? -39.992 -14.568 33.337  1.00 30.92 ? 142  SER A HB2  1 
ATOM   2078  H HB3  . SER A 1 153 ? -40.888 -13.624 32.419  1.00 30.92 ? 142  SER A HB3  1 
ATOM   2079  H HG   . SER A 1 153 ? -40.911 -15.699 31.689  1.00 37.58 ? 142  SER A HG   1 
ATOM   2080  N N    A GLU A 1 154 ? -36.917 -14.596 31.235  0.57 22.03 ? 143  GLU A N    1 
ATOM   2081  N N    B GLU A 1 154 ? -36.893 -14.568 31.252  0.43 24.86 ? 143  GLU A N    1 
ATOM   2082  C CA   A GLU A 1 154 ? -35.713 -15.420 31.321  0.57 19.61 ? 143  GLU A CA   1 
ATOM   2083  C CA   B GLU A 1 154 ? -35.681 -15.363 31.408  0.43 28.68 ? 143  GLU A CA   1 
ATOM   2084  C C    A GLU A 1 154 ? -34.906 -15.269 30.039  0.57 21.43 ? 143  GLU A C    1 
ATOM   2085  C C    B GLU A 1 154 ? -34.935 -15.376 30.073  0.43 24.18 ? 143  GLU A C    1 
ATOM   2086  O O    A GLU A 1 154 ? -35.443 -14.976 28.973  0.57 26.73 ? 143  GLU A O    1 
ATOM   2087  O O    B GLU A 1 154 ? -35.545 -15.240 29.013  0.43 25.45 ? 143  GLU A O    1 
ATOM   2088  C CB   A GLU A 1 154 ? -36.056 -16.896 31.514  0.57 23.00 ? 143  GLU A CB   1 
ATOM   2089  C CB   B GLU A 1 154 ? -36.035 -16.774 31.939  0.43 36.50 ? 143  GLU A CB   1 
ATOM   2090  C CG   A GLU A 1 154 ? -36.871 -17.375 30.416  0.57 24.68 ? 143  GLU A CG   1 
ATOM   2091  C CG   B GLU A 1 154 ? -35.610 -17.954 31.124  0.43 34.26 ? 143  GLU A CG   1 
ATOM   2092  C CD   A GLU A 1 154 ? -37.318 -18.800 30.611  0.57 30.91 ? 143  GLU A CD   1 
ATOM   2093  C CD   B GLU A 1 154 ? -36.306 -19.272 31.543  0.43 30.60 ? 143  GLU A CD   1 
ATOM   2094  O OE1  A GLU A 1 154 ? -36.650 -19.547 31.365  0.57 32.82 ? 143  GLU A OE1  1 
ATOM   2095  O OE1  B GLU A 1 154 ? -36.488 -19.557 32.754  0.43 31.17 ? 143  GLU A OE1  1 
ATOM   2096  O OE2  A GLU A 1 154 ? -38.341 -19.164 30.003  0.57 34.74 ? 143  GLU A OE2  1 
ATOM   2097  O OE2  B GLU A 1 154 ? -36.683 -20.031 30.631  0.43 27.68 ? 143  GLU A OE2  1 
ATOM   2098  H H    A GLU A 1 154 ? -37.138 -14.401 30.427  0.57 26.44 ? 143  GLU A H    1 
ATOM   2099  H H    B GLU A 1 154 ? -37.091 -14.380 30.436  0.43 29.83 ? 143  GLU A H    1 
ATOM   2100  H HA   A GLU A 1 154 ? -35.168 -15.127 32.069  0.57 23.53 ? 143  GLU A HA   1 
ATOM   2101  H HA   B GLU A 1 154 ? -35.108 -14.935 32.063  0.43 34.41 ? 143  GLU A HA   1 
ATOM   2102  H HB2  A GLU A 1 154 ? -35.238 -17.418 31.540  0.57 27.60 ? 143  GLU A HB2  1 
ATOM   2103  H HB2  B GLU A 1 154 ? -35.628 -16.874 32.814  0.43 43.80 ? 143  GLU A HB2  1 
ATOM   2104  H HB3  A GLU A 1 154 ? -36.555 -17.007 32.339  0.57 27.60 ? 143  GLU A HB3  1 
ATOM   2105  H HB3  B GLU A 1 154 ? -36.999 -16.825 32.030  0.43 43.80 ? 143  GLU A HB3  1 
ATOM   2106  H HG2  A GLU A 1 154 ? -37.662 -16.818 30.342  0.57 29.62 ? 143  GLU A HG2  1 
ATOM   2107  H HG2  B GLU A 1 154 ? -35.825 -17.787 30.193  0.43 41.11 ? 143  GLU A HG2  1 
ATOM   2108  H HG3  A GLU A 1 154 ? -36.355 -17.331 29.596  0.57 29.62 ? 143  GLU A HG3  1 
ATOM   2109  H HG3  B GLU A 1 154 ? -34.653 -18.078 31.225  0.43 41.11 ? 143  GLU A HG3  1 
ATOM   2110  N N    . TRP A 1 155 ? -33.612 -15.524 30.139  1.00 22.51 ? 144  TRP A N    1 
ATOM   2111  C CA   . TRP A 1 155 ? -32.727 -15.460 28.984  1.00 21.85 ? 144  TRP A CA   1 
ATOM   2112  C C    . TRP A 1 155 ? -32.050 -16.793 28.783  1.00 27.26 ? 144  TRP A C    1 
ATOM   2113  O O    . TRP A 1 155 ? -31.325 -17.280 29.646  1.00 33.27 ? 144  TRP A O    1 
ATOM   2114  C CB   . TRP A 1 155 ? -31.610 -14.428 29.191  1.00 25.34 ? 144  TRP A CB   1 
ATOM   2115  C CG   . TRP A 1 155 ? -30.699 -14.075 27.954  1.00 23.34 ? 144  TRP A CG   1 
ATOM   2116  C CD1  . TRP A 1 155 ? -29.352 -14.122 27.908  1.00 23.99 ? 144  TRP A CD1  1 
ATOM   2117  C CD2  . TRP A 1 155 ? -31.116 -13.589 26.672  1.00 23.74 ? 144  TRP A CD2  1 
ATOM   2118  N NE1  . TRP A 1 155 ? -28.888 -13.714 26.680  1.00 23.57 ? 144  TRP A NE1  1 
ATOM   2119  C CE2  . TRP A 1 155 ? -29.953 -13.366 25.908  1.00 22.69 ? 144  TRP A CE2  1 
ATOM   2120  C CE3  . TRP A 1 155 ? -32.357 -13.340 26.094  1.00 25.23 ? 144  TRP A CE3  1 
ATOM   2121  C CZ2  . TRP A 1 155 ? -29.981 -12.872 24.622  1.00 26.06 ? 144  TRP A CZ2  1 
ATOM   2122  C CZ3  . TRP A 1 155 ? -32.391 -12.838 24.787  1.00 28.11 ? 144  TRP A CZ3  1 
ATOM   2123  C CH2  . TRP A 1 155 ? -31.203 -12.634 24.062  1.00 29.10 ? 144  TRP A CH2  1 
ATOM   2124  H H    . TRP A 1 155 ? -33.200 -15.704 30.872  1.00 27.01 ? 144  TRP A H    1 
ATOM   2125  H HA   . TRP A 1 155 ? -33.231 -15.232 28.187  1.00 26.22 ? 144  TRP A HA   1 
ATOM   2126  H HB2  . TRP A 1 155 ? -32.019 -13.600 29.487  1.00 30.40 ? 144  TRP A HB2  1 
ATOM   2127  H HB3  . TRP A 1 155 ? -31.023 -14.759 29.889  1.00 30.40 ? 144  TRP A HB3  1 
ATOM   2128  H HD1  . TRP A 1 155 ? -28.809 -14.394 28.613  1.00 28.79 ? 144  TRP A HD1  1 
ATOM   2129  H HE1  . TRP A 1 155 ? -28.062 -13.656 26.450  1.00 28.28 ? 144  TRP A HE1  1 
ATOM   2130  H HE3  . TRP A 1 155 ? -33.141 -13.453 26.582  1.00 30.28 ? 144  TRP A HE3  1 
ATOM   2131  H HZ2  . TRP A 1 155 ? -29.198 -12.761 24.132  1.00 31.28 ? 144  TRP A HZ2  1 
ATOM   2132  H HZ3  . TRP A 1 155 ? -33.210 -12.656 24.387  1.00 33.73 ? 144  TRP A HZ3  1 
ATOM   2133  H HH2  . TRP A 1 155 ? -31.251 -12.320 23.188  1.00 34.92 ? 144  TRP A HH2  1 
ATOM   2134  N N    . HIS A 1 156 ? -32.203 -17.323 27.613  1.00 30.07 ? 145  HIS A N    1 
ATOM   2135  C CA   . HIS A 1 156 ? -31.502 -18.567 27.324  1.00 36.18 ? 145  HIS A CA   1 
ATOM   2136  C C    . HIS A 1 156 ? -31.596 -18.740 25.840  1.00 39.21 ? 145  HIS A C    1 
ATOM   2137  O O    . HIS A 1 156 ? -32.236 -17.943 25.144  1.00 35.90 ? 145  HIS A O    1 
ATOM   2138  C CB   . HIS A 1 156 ? -32.140 -19.761 28.035  1.00 40.78 ? 145  HIS A CB   1 
ATOM   2139  C CG   . HIS A 1 156 ? -33.597 -19.901 27.745  1.00 40.55 ? 145  HIS A CG   1 
ATOM   2140  N ND1  . HIS A 1 156 ? -34.085 -20.135 26.475  1.00 50.81 ? 145  HIS A ND1  1 
ATOM   2141  C CD2  . HIS A 1 156 ? -34.679 -19.755 28.541  1.00 44.24 ? 145  HIS A CD2  1 
ATOM   2142  C CE1  . HIS A 1 156 ? -35.406 -20.152 26.509  1.00 51.25 ? 145  HIS A CE1  1 
ATOM   2143  N NE2  . HIS A 1 156 ? -35.790 -19.917 27.750  1.00 45.01 ? 145  HIS A NE2  1 
ATOM   2144  H H    . HIS A 1 156 ? -32.687 -17.010 26.975  1.00 36.09 ? 145  HIS A H    1 
ATOM   2145  H HA   . HIS A 1 156 ? -30.569 -18.498 27.582  1.00 43.41 ? 145  HIS A HA   1 
ATOM   2146  H HB2  . HIS A 1 156 ? -31.697 -20.574 27.745  1.00 48.93 ? 145  HIS A HB2  1 
ATOM   2147  H HB3  . HIS A 1 156 ? -32.035 -19.650 28.993  1.00 48.93 ? 145  HIS A HB3  1 
ATOM   2148  H HD1  . HIS A 1 156 ? -33.604 -20.253 25.772  1.00 60.97 ? 145  HIS A HD1  1 
ATOM   2149  H HD2  . HIS A 1 156 ? -34.672 -19.576 29.454  1.00 53.09 ? 145  HIS A HD2  1 
ATOM   2150  H HE1  . HIS A 1 156 ? -35.967 -20.308 25.784  1.00 61.50 ? 145  HIS A HE1  1 
ATOM   2151  N N    . LYS A 1 157 ? -30.999 -19.845 25.387  1.00 42.75 ? 146  LYS A N    1 
ATOM   2152  C CA   . LYS A 1 157 ? -31.023 -20.260 24.003  1.00 43.11 ? 146  LYS A CA   1 
ATOM   2153  C C    . LYS A 1 157 ? -32.442 -20.181 23.461  1.00 36.77 ? 146  LYS A C    1 
ATOM   2154  O O    . LYS A 1 157 ? -33.398 -20.684 24.056  1.00 37.20 ? 146  LYS A O    1 
ATOM   2155  C CB   . LYS A 1 157 ? -30.479 -21.698 23.901  1.00 52.13 ? 146  LYS A CB   1 
ATOM   2156  C CG   . LYS A 1 157 ? -29.129 -21.894 24.583  1.00 63.74 ? 146  LYS A CG   1 
ATOM   2157  C CD   . LYS A 1 157 ? -28.689 -23.359 24.524  1.00 67.50 ? 146  LYS A CD   1 
ATOM   2158  C CE   . LYS A 1 157 ? -27.206 -23.532 24.848  1.00 70.65 ? 146  LYS A CE   1 
ATOM   2159  N NZ   . LYS A 1 157 ? -26.707 -24.903 24.501  1.00 72.77 ? 146  LYS A NZ   1 
ATOM   2160  H H    . LYS A 1 157 ? -30.560 -20.385 25.892  1.00 51.29 ? 146  LYS A H    1 
ATOM   2161  H HA   . LYS A 1 157 ? -30.456 -19.675 23.477  1.00 51.73 ? 146  LYS A HA   1 
ATOM   2162  H HB2  . LYS A 1 157 ? -31.113 -22.302 24.319  1.00 62.56 ? 146  LYS A HB2  1 
ATOM   2163  H HB3  . LYS A 1 157 ? -30.375 -21.927 22.964  1.00 62.56 ? 146  LYS A HB3  1 
ATOM   2164  H HG2  . LYS A 1 157 ? -28.459 -21.357 24.132  1.00 76.49 ? 146  LYS A HG2  1 
ATOM   2165  H HG3  . LYS A 1 157 ? -29.198 -21.634 25.515  1.00 76.49 ? 146  LYS A HG3  1 
ATOM   2166  H HD2  . LYS A 1 157 ? -29.201 -23.870 25.171  1.00 81.00 ? 146  LYS A HD2  1 
ATOM   2167  H HD3  . LYS A 1 157 ? -28.845 -23.701 23.630  1.00 81.00 ? 146  LYS A HD3  1 
ATOM   2168  H HE2  . LYS A 1 157 ? -26.692 -22.886 24.339  1.00 84.78 ? 146  LYS A HE2  1 
ATOM   2169  H HE3  . LYS A 1 157 ? -27.069 -23.393 25.798  1.00 84.78 ? 146  LYS A HE3  1 
ATOM   2170  H HZ1  . LYS A 1 157 ? -25.842 -24.972 24.701  1.00 87.32 ? 146  LYS A HZ1  1 
ATOM   2171  H HZ2  . LYS A 1 157 ? -27.159 -25.517 24.961  1.00 87.32 ? 146  LYS A HZ2  1 
ATOM   2172  H HZ3  . LYS A 1 157 ? -26.815 -25.055 23.631  1.00 87.32 ? 146  LYS A HZ3  1 
ATOM   2173  N N    . GLY A 1 158 ? -32.583 -19.497 22.374  1.00 31.66 ? 147  GLY A N    1 
ATOM   2174  C CA   . GLY A 1 158 ? -33.824 -19.469 21.684  1.00 32.43 ? 147  GLY A CA   1 
ATOM   2175  C C    . GLY A 1 158 ? -34.623 -18.218 21.927  1.00 27.26 ? 147  GLY A C    1 
ATOM   2176  O O    . GLY A 1 158 ? -35.453 -17.874 21.082  1.00 29.75 ? 147  GLY A O    1 
ATOM   2177  H H    . GLY A 1 158 ? -31.962 -19.030 22.007  1.00 37.99 ? 147  GLY A H    1 
ATOM   2178  H HA2  . GLY A 1 158 ? -33.660 -19.543 20.730  1.00 38.92 ? 147  GLY A HA2  1 
ATOM   2179  H HA3  . GLY A 1 158 ? -34.359 -20.229 21.959  1.00 38.92 ? 147  GLY A HA3  1 
ATOM   2180  N N    . ILE A 1 159 ? -34.383 -17.528 23.050  1.00 24.83 ? 148  ILE A N    1 
ATOM   2181  C CA   . ILE A 1 159 ? -35.165 -16.322 23.335  1.00 22.57 ? 148  ILE A CA   1 
ATOM   2182  C C    . ILE A 1 159 ? -34.958 -15.279 22.248  1.00 22.27 ? 148  ILE A C    1 
ATOM   2183  O O    . ILE A 1 159 ? -35.904 -14.582 21.853  1.00 20.71 ? 148  ILE A O    1 
ATOM   2184  C CB   . ILE A 1 159 ? -34.874 -15.751 24.748  1.00 21.98 ? 148  ILE A CB   1 
ATOM   2185  C CG1  . ILE A 1 159 ? -35.282 -16.763 25.826  1.00 28.95 ? 148  ILE A CG1  1 
ATOM   2186  C CG2  . ILE A 1 159 ? -35.681 -14.506 25.042  1.00 22.34 ? 148  ILE A CG2  1 
ATOM   2187  C CD1  . ILE A 1 159 ? -36.843 -17.004 26.041  1.00 30.03 ? 148  ILE A CD1  1 
ATOM   2188  H H    . ILE A 1 159 ? -33.793 -17.730 23.643  1.00 29.79 ? 148  ILE A H    1 
ATOM   2189  H HA   . ILE A 1 159 ? -36.104 -16.565 23.317  1.00 27.09 ? 148  ILE A HA   1 
ATOM   2190  H HB   . ILE A 1 159 ? -33.928 -15.553 24.830  1.00 26.37 ? 148  ILE A HB   1 
ATOM   2191  H HG12 . ILE A 1 159 ? -34.889 -17.620 25.599  1.00 34.74 ? 148  ILE A HG12 1 
ATOM   2192  H HG13 . ILE A 1 159 ? -34.920 -16.462 26.674  1.00 34.74 ? 148  ILE A HG13 1 
ATOM   2193  H HG21 . ILE A 1 159 ? -35.461 -14.192 25.934  1.00 26.81 ? 148  ILE A HG21 1 
ATOM   2194  H HG22 . ILE A 1 159 ? -35.460 -13.825 24.388  1.00 26.81 ? 148  ILE A HG22 1 
ATOM   2195  H HG23 . ILE A 1 159 ? -36.625 -14.722 24.990  1.00 26.81 ? 148  ILE A HG23 1 
ATOM   2196  H HD11 . ILE A 1 159 ? -36.967 -17.661 26.744  1.00 36.03 ? 148  ILE A HD11 1 
ATOM   2197  H HD12 . ILE A 1 159 ? -37.260 -16.165 26.293  1.00 36.03 ? 148  ILE A HD12 1 
ATOM   2198  H HD13 . ILE A 1 159 ? -37.229 -17.330 25.212  1.00 36.03 ? 148  ILE A HD13 1 
ATOM   2199  N N    . GLN A 1 160 ? -33.719 -15.143 21.752  1.00 23.04 ? 149  GLN A N    1 
ATOM   2200  C CA   . GLN A 1 160 ? -33.444 -14.168 20.701  1.00 21.81 ? 149  GLN A CA   1 
ATOM   2201  C C    . GLN A 1 160 ? -34.331 -14.442 19.489  1.00 21.84 ? 149  GLN A C    1 
ATOM   2202  O O    . GLN A 1 160 ? -34.903 -13.514 18.895  1.00 22.71 ? 149  GLN A O    1 
ATOM   2203  C CB   . GLN A 1 160 ? -31.951 -14.222 20.320  1.00 27.48 ? 149  GLN A CB   1 
ATOM   2204  C CG   . GLN A 1 160 ? -31.691 -13.677 18.985  1.00 37.57 ? 149  GLN A CG   1 
ATOM   2205  C CD   . GLN A 1 160 ? -30.247 -13.568 18.656  1.00 50.46 ? 149  GLN A CD   1 
ATOM   2206  O OE1  . GLN A 1 160 ? -29.375 -13.941 19.458  1.00 52.31 ? 149  GLN A OE1  1 
ATOM   2207  N NE2  . GLN A 1 160 ? -29.964 -13.052 17.459  1.00 54.65 ? 149  GLN A NE2  1 
ATOM   2208  H H    . GLN A 1 160 ? -33.035 -15.599 22.005  1.00 27.65 ? 149  GLN A H    1 
ATOM   2209  H HA   . GLN A 1 160 ? -33.643 -13.277 21.030  1.00 26.17 ? 149  GLN A HA   1 
ATOM   2210  H HB2  . GLN A 1 160 ? -31.441 -13.703 20.961  1.00 32.97 ? 149  GLN A HB2  1 
ATOM   2211  H HB3  . GLN A 1 160 ? -31.655 -15.146 20.330  1.00 32.97 ? 149  GLN A HB3  1 
ATOM   2212  H HG2  . GLN A 1 160 ? -32.103 -14.256 18.325  1.00 45.08 ? 149  GLN A HG2  1 
ATOM   2213  H HG3  . GLN A 1 160 ? -32.076 -12.788 18.930  1.00 45.08 ? 149  GLN A HG3  1 
ATOM   2214  H HE21 . GLN A 1 160 ? -30.601 -12.808 16.935  1.00 65.58 ? 149  GLN A HE21 1 
ATOM   2215  H HE22 . GLN A 1 160 ? -29.145 -12.963 17.212  1.00 65.58 ? 149  GLN A HE22 1 
ATOM   2216  N N    A GLU A 1 161 ? -34.473 -15.706 19.100  0.45 22.27 ? 150  GLU A N    1 
ATOM   2217  N N    B GLU A 1 161 ? -34.453 -15.716 19.123  0.55 21.79 ? 150  GLU A N    1 
ATOM   2218  C CA   A GLU A 1 161 ? -35.279 -16.014 17.924  0.45 22.61 ? 150  GLU A CA   1 
ATOM   2219  C CA   B GLU A 1 161 ? -35.248 -16.084 17.965  0.55 20.56 ? 150  GLU A CA   1 
ATOM   2220  C C    A GLU A 1 161 ? -36.753 -15.670 18.146  0.45 20.41 ? 150  GLU A C    1 
ATOM   2221  C C    B GLU A 1 161 ? -36.732 -15.820 18.226  0.55 18.25 ? 150  GLU A C    1 
ATOM   2222  O O    A GLU A 1 161 ? -37.410 -15.120 17.252  0.45 18.41 ? 150  GLU A O    1 
ATOM   2223  O O    B GLU A 1 161 ? -37.468 -15.427 17.312  0.55 19.65 ? 150  GLU A O    1 
ATOM   2224  C CB   A GLU A 1 161 ? -35.101 -17.485 17.564  0.45 26.09 ? 150  GLU A CB   1 
ATOM   2225  C CB   B GLU A 1 161 ? -34.988 -17.558 17.628  0.55 29.25 ? 150  GLU A CB   1 
ATOM   2226  C CG   A GLU A 1 161 ? -33.664 -17.796 17.153  0.45 27.90 ? 150  GLU A CG   1 
ATOM   2227  C CG   B GLU A 1 161 ? -35.695 -18.055 16.387  0.55 38.91 ? 150  GLU A CG   1 
ATOM   2228  C CD   A GLU A 1 161 ? -33.213 -19.218 17.460  0.45 37.62 ? 150  GLU A CD   1 
ATOM   2229  C CD   B GLU A 1 161 ? -35.414 -19.521 16.060  0.55 48.39 ? 150  GLU A CD   1 
ATOM   2230  O OE1  A GLU A 1 161 ? -34.037 -20.098 17.792  0.45 40.01 ? 150  GLU A OE1  1 
ATOM   2231  O OE1  B GLU A 1 161 ? -34.507 -20.122 16.682  0.55 53.86 ? 150  GLU A OE1  1 
ATOM   2232  O OE2  A GLU A 1 161 ? -31.997 -19.435 17.388  0.45 38.88 ? 150  GLU A OE2  1 
ATOM   2233  O OE2  B GLU A 1 161 ? -36.101 -20.066 15.169  0.55 50.20 ? 150  GLU A OE2  1 
ATOM   2234  H H    A GLU A 1 161 ? -34.122 -16.388 19.489  0.45 26.73 ? 150  GLU A H    1 
ATOM   2235  H H    B GLU A 1 161 ? -34.086 -16.380 19.529  0.55 26.15 ? 150  GLU A H    1 
ATOM   2236  H HA   A GLU A 1 161 ? -34.960 -15.484 17.177  0.45 27.13 ? 150  GLU A HA   1 
ATOM   2237  H HA   B GLU A 1 161 ? -34.974 -15.547 17.205  0.55 24.67 ? 150  GLU A HA   1 
ATOM   2238  H HB2  A GLU A 1 161 ? -35.320 -18.032 18.335  0.45 31.31 ? 150  GLU A HB2  1 
ATOM   2239  H HB2  B GLU A 1 161 ? -34.036 -17.681 17.493  0.55 35.10 ? 150  GLU A HB2  1 
ATOM   2240  H HB3  A GLU A 1 161 ? -35.684 -17.705 16.821  0.45 31.31 ? 150  GLU A HB3  1 
ATOM   2241  H HB3  B GLU A 1 161 ? -35.285 -18.103 18.374  0.55 35.10 ? 150  GLU A HB3  1 
ATOM   2242  H HG2  A GLU A 1 161 ? -33.580 -17.660 16.196  0.45 33.48 ? 150  GLU A HG2  1 
ATOM   2243  H HG2  B GLU A 1 161 ? -36.652 -17.957 16.512  0.55 46.69 ? 150  GLU A HG2  1 
ATOM   2244  H HG3  A GLU A 1 161 ? -33.070 -17.190 17.622  0.45 33.48 ? 150  GLU A HG3  1 
ATOM   2245  H HG3  B GLU A 1 161 ? -35.407 -17.522 15.629  0.55 46.69 ? 150  GLU A HG3  1 
ATOM   2246  N N    A GLU A 1 162 ? -37.297 -15.994 19.323  0.45 17.68 ? 151  GLU A N    1 
ATOM   2247  N N    B GLU A 1 162 ? -37.186 -16.017 19.468  0.55 19.59 ? 151  GLU A N    1 
ATOM   2248  C CA   A GLU A 1 162 ? -38.679 -15.639 19.619  0.45 19.31 ? 151  GLU A CA   1 
ATOM   2249  C CA   B GLU A 1 162 ? -38.566 -15.695 19.811  0.55 16.44 ? 151  GLU A CA   1 
ATOM   2250  C C    A GLU A 1 162 ? -38.875 -14.133 19.598  0.45 17.25 ? 151  GLU A C    1 
ATOM   2251  C C    B GLU A 1 162 ? -38.847 -14.205 19.676  0.55 16.77 ? 151  GLU A C    1 
ATOM   2252  O O    A GLU A 1 162 ? -39.920 -13.642 19.158  0.45 17.17 ? 151  GLU A O    1 
ATOM   2253  O O    B GLU A 1 162 ? -39.919 -13.803 19.217  0.55 16.65 ? 151  GLU A O    1 
ATOM   2254  C CB   A GLU A 1 162 ? -39.103 -16.194 20.977  0.45 22.22 ? 151  GLU A CB   1 
ATOM   2255  C CB   B GLU A 1 162 ? -38.847 -16.139 21.239  0.55 18.04 ? 151  GLU A CB   1 
ATOM   2256  C CG   A GLU A 1 162 ? -39.596 -17.631 20.937  0.45 22.65 ? 151  GLU A CG   1 
ATOM   2257  C CG   B GLU A 1 162 ? -38.613 -17.622 21.455  0.55 17.75 ? 151  GLU A CG   1 
ATOM   2258  C CD   A GLU A 1 162 ? -40.775 -17.818 21.856  0.45 26.59 ? 151  GLU A CD   1 
ATOM   2259  C CD   B GLU A 1 162 ? -38.972 -17.999 22.871  0.55 17.90 ? 151  GLU A CD   1 
ATOM   2260  O OE1  A GLU A 1 162 ? -41.911 -17.475 21.446  0.45 24.17 ? 151  GLU A OE1  1 
ATOM   2261  O OE1  B GLU A 1 162 ? -40.079 -17.631 23.283  0.55 18.67 ? 151  GLU A OE1  1 
ATOM   2262  O OE2  A GLU A 1 162 ? -40.550 -18.252 22.999  0.45 30.67 ? 151  GLU A OE2  1 
ATOM   2263  O OE2  B GLU A 1 162 ? -38.134 -18.561 23.573  0.55 26.29 ? 151  GLU A OE2  1 
ATOM   2264  H H    A GLU A 1 162 ? -36.891 -16.413 19.955  0.45 21.21 ? 151  GLU A H    1 
ATOM   2265  H H    B GLU A 1 162 ? -36.720 -16.330 20.119  0.55 23.51 ? 151  GLU A H    1 
ATOM   2266  H HA   A GLU A 1 162 ? -39.256 -16.027 18.942  0.45 23.17 ? 151  GLU A HA   1 
ATOM   2267  H HA   B GLU A 1 162 ? -39.165 -16.175 19.217  0.55 19.73 ? 151  GLU A HA   1 
ATOM   2268  H HB2  A GLU A 1 162 ? -38.342 -16.160 21.578  0.45 26.66 ? 151  GLU A HB2  1 
ATOM   2269  H HB2  B GLU A 1 162 ? -38.263 -15.653 21.841  0.55 21.65 ? 151  GLU A HB2  1 
ATOM   2270  H HB3  A GLU A 1 162 ? -39.821 -15.645 21.327  0.45 26.66 ? 151  GLU A HB3  1 
ATOM   2271  H HB3  B GLU A 1 162 ? -39.774 -15.949 21.451  0.55 21.65 ? 151  GLU A HB3  1 
ATOM   2272  H HG2  A GLU A 1 162 ? -39.874 -17.851 20.034  0.45 27.18 ? 151  GLU A HG2  1 
ATOM   2273  H HG2  B GLU A 1 162 ? -39.173 -18.131 20.848  0.55 21.29 ? 151  GLU A HG2  1 
ATOM   2274  H HG3  A GLU A 1 162 ? -38.885 -18.224 21.227  0.45 27.18 ? 151  GLU A HG3  1 
ATOM   2275  H HG3  B GLU A 1 162 ? -37.677 -17.827 21.308  0.55 21.29 ? 151  GLU A HG3  1 
ATOM   2276  N N    . MET A 1 163 ? -37.894 -13.375 20.085  1.00 15.77 ? 152  MET A N    1 
ATOM   2277  C CA   . MET A 1 163 ? -38.034 -11.920 20.025  1.00 14.23 ? 152  MET A CA   1 
ATOM   2278  C C    . MET A 1 163 ? -38.088 -11.439 18.597  1.00 14.43 ? 152  MET A C    1 
ATOM   2279  O O    . MET A 1 163 ? -38.935 -10.605 18.242  1.00 13.81 ? 152  MET A O    1 
ATOM   2280  C CB   . MET A 1 163 ? -36.872 -11.246 20.750  1.00 15.89 ? 152  MET A CB   1 
ATOM   2281  C CG   . MET A 1 163 ? -36.855 -11.478 22.255  1.00 15.78 ? 152  MET A CG   1 
ATOM   2282  S SD   . MET A 1 163 ? -35.342 -11.068 23.033  1.00 18.48 ? 152  MET A SD   1 
ATOM   2283  C CE   . MET A 1 163 ? -35.378 -9.304  22.856  1.00 18.90 ? 152  MET A CE   1 
ATOM   2284  H H    A MET A 1 163 ? -37.166 -13.663 20.442  0.45 18.93 ? 152  MET A H    1 
ATOM   2285  H H    B MET A 1 163 ? -37.140 -13.634 20.409  0.55 18.93 ? 152  MET A H    1 
ATOM   2286  H HA   . MET A 1 163 ? -38.855 -11.664 20.474  1.00 17.07 ? 152  MET A HA   1 
ATOM   2287  H HB2  . MET A 1 163 ? -36.040 -11.588 20.389  1.00 19.07 ? 152  MET A HB2  1 
ATOM   2288  H HB3  . MET A 1 163 ? -36.925 -10.289 20.600  1.00 19.07 ? 152  MET A HB3  1 
ATOM   2289  H HG2  . MET A 1 163 ? -37.551 -10.938 22.661  1.00 18.93 ? 152  MET A HG2  1 
ATOM   2290  H HG3  . MET A 1 163 ? -37.029 -12.417 22.426  1.00 18.93 ? 152  MET A HG3  1 
ATOM   2291  H HE1  . MET A 1 163 ? -34.576 -8.931  23.254  1.00 22.68 ? 152  MET A HE1  1 
ATOM   2292  H HE2  . MET A 1 163 ? -35.413 -9.082  21.912  1.00 22.68 ? 152  MET A HE2  1 
ATOM   2293  H HE3  . MET A 1 163 ? -36.163 -8.957  23.307  1.00 22.68 ? 152  MET A HE3  1 
ATOM   2294  N N    . GLU A 1 164 ? -37.183 -11.947 17.764  1.00 15.30 ? 153  GLU A N    1 
ATOM   2295  C CA   . GLU A 1 164 ? -37.152 -11.527 16.383  1.00 15.74 ? 153  GLU A CA   1 
ATOM   2296  C C    . GLU A 1 164 ? -38.471 -11.868 15.696  1.00 15.15 ? 153  GLU A C    1 
ATOM   2297  O O    . GLU A 1 164 ? -39.017 -11.063 14.930  1.00 15.59 ? 153  GLU A O    1 
ATOM   2298  C CB   . GLU A 1 164 ? -35.969 -12.199 15.675  1.00 19.59 ? 153  GLU A CB   1 
ATOM   2299  C CG   . GLU A 1 164 ? -35.901 -11.816 14.201  1.00 23.81 ? 153  GLU A CG   1 
ATOM   2300  C CD   . GLU A 1 164 ? -34.878 -12.660 13.442  1.00 32.38 ? 153  GLU A CD   1 
ATOM   2301  O OE1  . GLU A 1 164 ? -34.235 -13.531 14.074  1.00 36.32 ? 153  GLU A OE1  1 
ATOM   2302  O OE2  . GLU A 1 164 ? -34.773 -12.501 12.203  1.00 35.66 ? 153  GLU A OE2  1 
ATOM   2303  H H    . GLU A 1 164 ? -36.587 -12.528 17.978  1.00 18.37 ? 153  GLU A H    1 
ATOM   2304  H HA   . GLU A 1 164 ? -37.026 -10.566 16.342  1.00 18.89 ? 153  GLU A HA   1 
ATOM   2305  H HB2  . GLU A 1 164 ? -35.143 -11.920 16.099  1.00 23.50 ? 153  GLU A HB2  1 
ATOM   2306  H HB3  . GLU A 1 164 ? -36.068 -13.162 15.734  1.00 23.50 ? 153  GLU A HB3  1 
ATOM   2307  H HG2  . GLU A 1 164 ? -36.771 -11.956 13.795  1.00 28.58 ? 153  GLU A HG2  1 
ATOM   2308  H HG3  . GLU A 1 164 ? -35.642 -10.884 14.125  1.00 28.58 ? 153  GLU A HG3  1 
ATOM   2309  N N    . ALA A 1 165 ? -39.022 -13.051 15.972  1.00 16.32 ? 154  ALA A N    1 
ATOM   2310  C CA   . ALA A 1 165 ? -40.282 -13.422 15.357  1.00 15.90 ? 154  ALA A CA   1 
ATOM   2311  C C    . ALA A 1 165 ? -41.428 -12.529 15.826  1.00 14.42 ? 154  ALA A C    1 
ATOM   2312  O O    . ALA A 1 165 ? -42.306 -12.195 15.041  1.00 15.55 ? 154  ALA A O    1 
ATOM   2313  C CB   . ALA A 1 165 ? -40.585 -14.892 15.628  1.00 20.03 ? 154  ALA A CB   1 
ATOM   2314  H H    . ALA A 1 165 ? -38.690 -13.641 16.502  1.00 19.58 ? 154  ALA A H    1 
ATOM   2315  H HA   . ALA A 1 165 ? -40.200 -13.312 14.397  1.00 19.09 ? 154  ALA A HA   1 
ATOM   2316  H HB1  . ALA A 1 165 ? -41.430 -15.122 15.210  1.00 24.04 ? 154  ALA A HB1  1 
ATOM   2317  H HB2  . ALA A 1 165 ? -39.873 -15.435 15.256  1.00 24.04 ? 154  ALA A HB2  1 
ATOM   2318  H HB3  . ALA A 1 165 ? -40.642 -15.031 16.586  1.00 24.04 ? 154  ALA A HB3  1 
ATOM   2319  N N    . LEU A 1 166 ? -41.456 -12.156 17.107  1.00 13.73 ? 155  LEU A N    1 
ATOM   2320  C CA   . LEU A 1 166 ? -42.497 -11.234 17.582  1.00 13.77 ? 155  LEU A CA   1 
ATOM   2321  C C    . LEU A 1 166 ? -42.444 -9.885  16.881  1.00 12.41 ? 155  LEU A C    1 
ATOM   2322  O O    . LEU A 1 166 ? -43.487 -9.322  16.524  1.00 13.46 ? 155  LEU A O    1 
ATOM   2323  C CB   . LEU A 1 166 ? -42.471 -11.073 19.095  1.00 13.83 ? 155  LEU A CB   1 
ATOM   2324  C CG   . LEU A 1 166 ? -43.079 -12.247 19.852  1.00 13.59 ? 155  LEU A CG   1 
ATOM   2325  C CD1  . LEU A 1 166 ? -42.696 -12.199 21.301  1.00 17.38 ? 155  LEU A CD1  1 
ATOM   2326  C CD2  . LEU A 1 166 ? -44.608 -12.291 19.732  1.00 16.53 ? 155  LEU A CD2  1 
ATOM   2327  H H    . LEU A 1 166 ? -40.900 -12.413 17.711  1.00 16.48 ? 155  LEU A H    1 
ATOM   2328  H HA   . LEU A 1 166 ? -43.357 -11.626 17.360  1.00 16.52 ? 155  LEU A HA   1 
ATOM   2329  H HB2  . LEU A 1 166 ? -41.550 -10.980 19.383  1.00 16.59 ? 155  LEU A HB2  1 
ATOM   2330  H HB3  . LEU A 1 166 ? -42.972 -10.277 19.333  1.00 16.59 ? 155  LEU A HB3  1 
ATOM   2331  H HG   . LEU A 1 166 ? -42.729 -13.072 19.481  1.00 16.31 ? 155  LEU A HG   1 
ATOM   2332  H HD11 . LEU A 1 166 ? -43.095 -12.956 21.758  1.00 20.85 ? 155  LEU A HD11 1 
ATOM   2333  H HD12 . LEU A 1 166 ? -41.730 -12.241 21.373  1.00 20.85 ? 155  LEU A HD12 1 
ATOM   2334  H HD13 . LEU A 1 166 ? -43.021 -11.370 21.686  1.00 20.85 ? 155  LEU A HD13 1 
ATOM   2335  H HD21 . LEU A 1 166 ? -44.942 -13.054 20.230  1.00 19.83 ? 155  LEU A HD21 1 
ATOM   2336  H HD22 . LEU A 1 166 ? -44.977 -11.471 20.095  1.00 19.83 ? 155  LEU A HD22 1 
ATOM   2337  H HD23 . LEU A 1 166 ? -44.848 -12.376 18.796  1.00 19.83 ? 155  LEU A HD23 1 
ATOM   2338  N N    . VAL A 1 167 ? -41.249 -9.346  16.671  1.00 12.37 ? 156  VAL A N    1 
ATOM   2339  C CA   . VAL A 1 167 ? -41.121 -8.056  15.978  1.00 12.94 ? 156  VAL A CA   1 
ATOM   2340  C C    . VAL A 1 167 ? -41.598 -8.177  14.547  1.00 13.35 ? 156  VAL A C    1 
ATOM   2341  O O    . VAL A 1 167 ? -42.425 -7.393  14.073  1.00 14.69 ? 156  VAL A O    1 
ATOM   2342  C CB   . VAL A 1 167 ? -39.666 -7.588  16.012  1.00 13.38 ? 156  VAL A CB   1 
ATOM   2343  C CG1  . VAL A 1 167 ? -39.465 -6.394  15.078  1.00 13.19 ? 156  VAL A CG1  1 
ATOM   2344  C CG2  . VAL A 1 167 ? -39.253 -7.260  17.432  1.00 13.96 ? 156  VAL A CG2  1 
ATOM   2345  H H    . VAL A 1 167 ? -40.502 -9.697  16.914  1.00 14.84 ? 156  VAL A H    1 
ATOM   2346  H HA   . VAL A 1 167 ? -41.667 -7.392  16.428  1.00 15.52 ? 156  VAL A HA   1 
ATOM   2347  H HB   . VAL A 1 167 ? -39.099 -8.309  15.697  1.00 16.06 ? 156  VAL A HB   1 
ATOM   2348  H HG11 . VAL A 1 167 ? -38.536 -6.116  15.117  1.00 15.83 ? 156  VAL A HG11 1 
ATOM   2349  H HG12 . VAL A 1 167 ? -39.693 -6.659  14.173  1.00 15.83 ? 156  VAL A HG12 1 
ATOM   2350  H HG13 . VAL A 1 167 ? -40.040 -5.668  15.366  1.00 15.83 ? 156  VAL A HG13 1 
ATOM   2351  H HG21 . VAL A 1 167 ? -38.329 -6.966  17.432  1.00 16.75 ? 156  VAL A HG21 1 
ATOM   2352  H HG22 . VAL A 1 167 ? -39.826 -6.554  17.772  1.00 16.75 ? 156  VAL A HG22 1 
ATOM   2353  H HG23 . VAL A 1 167 ? -39.348 -8.055  17.980  1.00 16.75 ? 156  VAL A HG23 1 
ATOM   2354  N N    . LYS A 1 168 ? -41.118 -9.202  13.844  1.00 12.61 ? 157  LYS A N    1 
ATOM   2355  C CA   . LYS A 1 168 ? -41.358 -9.259  12.408  1.00 14.59 ? 157  LYS A CA   1 
ATOM   2356  C C    . LYS A 1 168 ? -42.727 -9.810  12.074  1.00 14.20 ? 157  LYS A C    1 
ATOM   2357  O O    . LYS A 1 168 ? -43.334 -9.391  11.068  1.00 15.64 ? 157  LYS A O    1 
ATOM   2358  C CB   . LYS A 1 168 ? -40.290 -10.109 11.750  1.00 15.07 ? 157  LYS A CB   1 
ATOM   2359  C CG   . LYS A 1 168 ? -38.922 -9.429  11.852  1.00 14.96 ? 157  LYS A CG   1 
ATOM   2360  C CD   . LYS A 1 168 ? -37.812 -10.262 11.241  1.00 15.64 ? 157  LYS A CD   1 
ATOM   2361  C CE   . LYS A 1 168 ? -36.470 -9.536  11.300  1.00 17.73 ? 157  LYS A CE   1 
ATOM   2362  N NZ   . LYS A 1 168 ? -35.461 -10.343 10.606  1.00 19.36 ? 157  LYS A NZ   1 
ATOM   2363  H H    . LYS A 1 168 ? -40.663 -9.858  14.164  1.00 15.13 ? 157  LYS A H    1 
ATOM   2364  H HA   . LYS A 1 168 ? -41.297 -8.363  12.041  1.00 17.51 ? 157  LYS A HA   1 
ATOM   2365  H HB2  . LYS A 1 168 ? -40.240 -10.968 12.199  1.00 18.08 ? 157  LYS A HB2  1 
ATOM   2366  H HB3  . LYS A 1 168 ? -40.505 -10.229 10.812  1.00 18.08 ? 157  LYS A HB3  1 
ATOM   2367  H HG2  . LYS A 1 168 ? -38.955 -8.581  11.382  1.00 17.95 ? 157  LYS A HG2  1 
ATOM   2368  H HG3  . LYS A 1 168 ? -38.709 -9.284  12.787  1.00 17.95 ? 157  LYS A HG3  1 
ATOM   2369  H HD2  . LYS A 1 168 ? -37.729 -11.094 11.732  1.00 18.77 ? 157  LYS A HD2  1 
ATOM   2370  H HD3  . LYS A 1 168 ? -38.020 -10.440 10.311  1.00 18.77 ? 157  LYS A HD3  1 
ATOM   2371  H HE2  . LYS A 1 168 ? -36.542 -8.676  10.856  1.00 21.28 ? 157  LYS A HE2  1 
ATOM   2372  H HE3  . LYS A 1 168 ? -36.199 -9.424  12.225  1.00 21.28 ? 157  LYS A HE3  1 
ATOM   2373  H HZ1  . LYS A 1 168 ? -34.672 -9.931  10.632  1.00 23.24 ? 157  LYS A HZ1  1 
ATOM   2374  H HZ2  . LYS A 1 168 ? -35.385 -11.138 10.998  1.00 23.24 ? 157  LYS A HZ2  1 
ATOM   2375  H HZ3  . LYS A 1 168 ? -35.697 -10.460 9.756   1.00 23.24 ? 157  LYS A HZ3  1 
ATOM   2376  N N    . ASP A 1 169 ? -43.230 -10.763 12.864  1.00 13.55 ? 158  ASP A N    1 
ATOM   2377  C CA   . ASP A 1 169 ? -44.462 -11.447 12.524  1.00 13.87 ? 158  ASP A CA   1 
ATOM   2378  C C    . ASP A 1 169 ? -45.669 -10.917 13.278  1.00 14.88 ? 158  ASP A C    1 
ATOM   2379  O O    . ASP A 1 169 ? -46.805 -11.165 12.872  1.00 16.71 ? 158  ASP A O    1 
ATOM   2380  C CB   . ASP A 1 169 ? -44.352 -12.948 12.831  1.00 14.90 ? 158  ASP A CB   1 
ATOM   2381  C CG   . ASP A 1 169 ? -43.217 -13.645 12.116  1.00 14.54 ? 158  ASP A CG   1 
ATOM   2382  O OD1  . ASP A 1 169 ? -42.736 -13.105 11.100  1.00 16.35 ? 158  ASP A OD1  1 
ATOM   2383  O OD2  . ASP A 1 169 ? -42.834 -14.743 12.582  1.00 16.46 ? 158  ASP A OD2  1 
ATOM   2384  H H    . ASP A 1 169 ? -42.871 -11.027 13.600  1.00 16.26 ? 158  ASP A H    1 
ATOM   2385  H HA   . ASP A 1 169 ? -44.631 -11.344 11.574  1.00 16.64 ? 158  ASP A HA   1 
ATOM   2386  H HB2  . ASP A 1 169 ? -44.214 -13.062 13.784  1.00 17.88 ? 158  ASP A HB2  1 
ATOM   2387  H HB3  . ASP A 1 169 ? -45.178 -13.382 12.565  1.00 17.88 ? 158  ASP A HB3  1 
ATOM   2388  N N    . HIS A 1 170 ? -45.482 -10.252 14.406  1.00 14.30 ? 159  HIS A N    1 
ATOM   2389  C CA   . HIS A 1 170 ? -46.593 -9.935  15.299  1.00 14.12 ? 159  HIS A CA   1 
ATOM   2390  C C    . HIS A 1 170 ? -46.672 -8.484  15.711  1.00 15.20 ? 159  HIS A C    1 
ATOM   2391  O O    . HIS A 1 170 ? -47.429 -8.159  16.633  1.00 17.02 ? 159  HIS A O    1 
ATOM   2392  C CB   . HIS A 1 170 ? -46.580 -10.827 16.531  1.00 15.63 ? 159  HIS A CB   1 
ATOM   2393  C CG   . HIS A 1 170 ? -46.872 -12.236 16.203  1.00 16.12 ? 159  HIS A CG   1 
ATOM   2394  N ND1  . HIS A 1 170 ? -48.139 -12.668 15.862  1.00 21.14 ? 159  HIS A ND1  1 
ATOM   2395  C CD2  . HIS A 1 170 ? -46.047 -13.288 16.024  1.00 20.48 ? 159  HIS A CD2  1 
ATOM   2396  C CE1  . HIS A 1 170 ? -48.085 -13.959 15.586  1.00 25.38 ? 159  HIS A CE1  1 
ATOM   2397  N NE2  . HIS A 1 170 ? -46.828 -14.355 15.666  1.00 25.13 ? 159  HIS A NE2  1 
ATOM   2398  H H    . HIS A 1 170 ? -44.718 -9.970  14.683  1.00 17.15 ? 159  HIS A H    1 
ATOM   2399  H HA   . HIS A 1 170 ? -47.415 -10.131 14.822  1.00 16.94 ? 159  HIS A HA   1 
ATOM   2400  H HB2  . HIS A 1 170 ? -45.702 -10.789 16.942  1.00 18.75 ? 159  HIS A HB2  1 
ATOM   2401  H HB3  . HIS A 1 170 ? -47.254 -10.517 17.155  1.00 18.75 ? 159  HIS A HB3  1 
ATOM   2402  H HD2  . HIS A 1 170 ? -45.128 -13.300 16.167  1.00 24.58 ? 159  HIS A HD2  1 
ATOM   2403  H HE1  . HIS A 1 170 ? -48.807 -14.493 15.344  1.00 30.46 ? 159  HIS A HE1  1 
ATOM   2404  H HE2  . HIS A 1 170 ? -46.546 -15.153 15.516  1.00 30.16 ? 159  HIS A HE2  1 
ATOM   2405  N N    . GLY A 1 171 ? -45.902 -7.612  15.097  1.00 14.26 ? 160  GLY A N    1 
ATOM   2406  C CA   . GLY A 1 171 ? -46.140 -6.209  15.346  1.00 14.89 ? 160  GLY A CA   1 
ATOM   2407  C C    . GLY A 1 171 ? -45.660 -5.704  16.696  1.00 12.93 ? 160  GLY A C    1 
ATOM   2408  O O    . GLY A 1 171 ? -46.160 -4.677  17.183  1.00 15.27 ? 160  GLY A O    1 
ATOM   2409  H H    . GLY A 1 171 ? -45.262 -7.794  14.552  1.00 17.11 ? 160  GLY A H    1 
ATOM   2410  H HA2  . GLY A 1 171 ? -45.696 -5.688  14.659  1.00 17.87 ? 160  GLY A HA2  1 
ATOM   2411  H HA3  . GLY A 1 171 ? -47.092 -6.036  15.285  1.00 17.87 ? 160  GLY A HA3  1 
ATOM   2412  N N    . VAL A 1 172 ? -44.716 -6.384  17.314  1.00 13.56 ? 161  VAL A N    1 
ATOM   2413  C CA   . VAL A 1 172 ? -44.152 -5.934  18.578  1.00 13.14 ? 161  VAL A CA   1 
ATOM   2414  C C    . VAL A 1 172 ? -42.906 -5.100  18.267  1.00 14.05 ? 161  VAL A C    1 
ATOM   2415  O O    . VAL A 1 172 ? -42.128 -5.426  17.368  1.00 16.82 ? 161  VAL A O    1 
ATOM   2416  C CB   . VAL A 1 172 ? -43.831 -7.175  19.429  1.00 13.33 ? 161  VAL A CB   1 
ATOM   2417  C CG1  . VAL A 1 172 ? -43.091 -6.815  20.680  1.00 15.34 ? 161  VAL A CG1  1 
ATOM   2418  C CG2  . VAL A 1 172 ? -45.125 -7.879  19.778  1.00 14.38 ? 161  VAL A CG2  1 
ATOM   2419  H H    . VAL A 1 172 ? -44.379 -7.119  17.023  1.00 16.28 ? 161  VAL A H    1 
ATOM   2420  H HA   . VAL A 1 172 ? -44.794 -5.382  19.051  1.00 15.77 ? 161  VAL A HA   1 
ATOM   2421  H HB   . VAL A 1 172 ? -43.280 -7.785  18.914  1.00 15.99 ? 161  VAL A HB   1 
ATOM   2422  H HG11 . VAL A 1 172 ? -42.910 -7.624  21.183  1.00 18.41 ? 161  VAL A HG11 1 
ATOM   2423  H HG12 . VAL A 1 172 ? -42.258 -6.381  20.440  1.00 18.41 ? 161  VAL A HG12 1 
ATOM   2424  H HG13 . VAL A 1 172 ? -43.638 -6.212  21.207  1.00 18.41 ? 161  VAL A HG13 1 
ATOM   2425  H HG21 . VAL A 1 172 ? -44.923 -8.662  20.315  1.00 17.26 ? 161  VAL A HG21 1 
ATOM   2426  H HG22 . VAL A 1 172 ? -45.690 -7.271  20.279  1.00 17.26 ? 161  VAL A HG22 1 
ATOM   2427  H HG23 . VAL A 1 172 ? -45.570 -8.146  18.959  1.00 17.26 ? 161  VAL A HG23 1 
ATOM   2428  N N    . ASN A 1 173 ? -42.695 -4.017  18.994  1.00 11.22 ? 162  ASN A N    1 
ATOM   2429  C CA   . ASN A 1 173 ? -41.438 -3.286  18.854  1.00 11.58 ? 162  ASN A CA   1 
ATOM   2430  C C    . ASN A 1 173 ? -40.883 -2.835  20.186  1.00 11.53 ? 162  ASN A C    1 
ATOM   2431  O O    . ASN A 1 173 ? -40.033 -1.933  20.221  1.00 11.03 ? 162  ASN A O    1 
ATOM   2432  C CB   . ASN A 1 173 ? -41.496 -2.112  17.855  1.00 10.85 ? 162  ASN A CB   1 
ATOM   2433  C CG   . ASN A 1 173 ? -42.345 -0.974  18.325  1.00 11.79 ? 162  ASN A CG   1 
ATOM   2434  O OD1  . ASN A 1 173 ? -42.909 -1.014  19.428  1.00 12.14 ? 162  ASN A OD1  1 
ATOM   2435  N ND2  . ASN A 1 173 ? -42.410 0.069   17.513  1.00 12.05 ? 162  ASN A ND2  1 
ATOM   2436  H H    . ASN A 1 173 ? -43.246 -3.685  19.564  1.00 13.46 ? 162  ASN A H    1 
ATOM   2437  H HA   . ASN A 1 173 ? -40.790 -3.910  18.493  1.00 13.90 ? 162  ASN A HA   1 
ATOM   2438  H HB2  . ASN A 1 173 ? -40.597 -1.775  17.715  1.00 13.02 ? 162  ASN A HB2  1 
ATOM   2439  H HB3  . ASN A 1 173 ? -41.863 -2.432  17.016  1.00 13.02 ? 162  ASN A HB3  1 
ATOM   2440  H HD21 . ASN A 1 173 ? -42.883 0.753   17.730  1.00 14.46 ? 162  ASN A HD21 1 
ATOM   2441  H HD22 . ASN A 1 173 ? -41.979 0.062   16.769  1.00 14.46 ? 162  ASN A HD22 1 
ATOM   2442  N N    . SER A 1 174 ? -41.250 -3.506  21.273  1.00 10.76 ? 163  SER A N    1 
ATOM   2443  C CA   . SER A 1 174 ? -40.727 -3.175  22.593  1.00 11.03 ? 163  SER A CA   1 
ATOM   2444  C C    . SER A 1 174 ? -40.773 -4.393  23.490  1.00 10.95 ? 163  SER A C    1 
ATOM   2445  O O    . SER A 1 174 ? -41.759 -5.147  23.493  1.00 12.35 ? 163  SER A O    1 
ATOM   2446  C CB   . SER A 1 174 ? -41.477 -2.006  23.220  1.00 11.51 ? 163  SER A CB   1 
ATOM   2447  O OG   . SER A 1 174 ? -42.865 -2.216  23.229  1.00 12.14 ? 163  SER A OG   1 
ATOM   2448  H H    . SER A 1 174 ? -41.805 -4.162  21.272  1.00 12.91 ? 163  SER A H    1 
ATOM   2449  H HA   . SER A 1 174 ? -39.797 -2.912  22.502  1.00 13.24 ? 163  SER A HA   1 
ATOM   2450  H HB2  . SER A 1 174 ? -41.173 -1.894  24.134  1.00 13.82 ? 163  SER A HB2  1 
ATOM   2451  H HB3  . SER A 1 174 ? -41.286 -1.204  22.710  1.00 13.82 ? 163  SER A HB3  1 
ATOM   2452  H HG   . SER A 1 174 ? -43.252 -1.558  23.579  1.00 14.57 ? 163  SER A HG   1 
ATOM   2453  N N    . PHE A 1 175 ? -39.709 -4.551  24.259  1.00 10.85 ? 164  PHE A N    1 
ATOM   2454  C CA   . PHE A 1 175 ? -39.511 -5.646  25.183  1.00 11.48 ? 164  PHE A CA   1 
ATOM   2455  C C    . PHE A 1 175 ? -39.009 -5.071  26.500  1.00 12.56 ? 164  PHE A C    1 
ATOM   2456  O O    . PHE A 1 175 ? -38.288 -4.065  26.502  1.00 14.62 ? 164  PHE A O    1 
ATOM   2457  C CB   . PHE A 1 175 ? -38.492 -6.676  24.697  1.00 11.61 ? 164  PHE A CB   1 
ATOM   2458  C CG   . PHE A 1 175 ? -38.874 -7.337  23.409  1.00 11.34 ? 164  PHE A CG   1 
ATOM   2459  C CD1  . PHE A 1 175 ? -38.491 -6.773  22.223  1.00 13.17 ? 164  PHE A CD1  1 
ATOM   2460  C CD2  . PHE A 1 175 ? -39.632 -8.493  23.372  1.00 12.53 ? 164  PHE A CD2  1 
ATOM   2461  C CE1  . PHE A 1 175 ? -38.873 -7.324  21.014  1.00 13.13 ? 164  PHE A CE1  1 
ATOM   2462  C CE2  . PHE A 1 175 ? -39.992 -9.056  22.148  1.00 13.03 ? 164  PHE A CE2  1 
ATOM   2463  C CZ   . PHE A 1 175 ? -39.603 -8.477  20.971  1.00 13.62 ? 164  PHE A CZ   1 
ATOM   2464  H H    . PHE A 1 175 ? -39.049 -4.000  24.259  1.00 13.02 ? 164  PHE A H    1 
ATOM   2465  H HA   . PHE A 1 175 ? -40.356 -6.096  25.342  1.00 13.77 ? 164  PHE A HA   1 
ATOM   2466  H HB2  . PHE A 1 175 ? -37.640 -6.233  24.562  1.00 13.93 ? 164  PHE A HB2  1 
ATOM   2467  H HB3  . PHE A 1 175 ? -38.401 -7.368  25.370  1.00 13.93 ? 164  PHE A HB3  1 
ATOM   2468  H HD1  . PHE A 1 175 ? -37.998 -5.985  22.230  1.00 15.80 ? 164  PHE A HD1  1 
ATOM   2469  H HD2  . PHE A 1 175 ? -39.906 -8.894  24.166  1.00 15.04 ? 164  PHE A HD2  1 
ATOM   2470  H HE1  . PHE A 1 175 ? -38.593 -6.929  20.220  1.00 15.75 ? 164  PHE A HE1  1 
ATOM   2471  H HE2  . PHE A 1 175 ? -40.498 -9.837  22.131  1.00 15.64 ? 164  PHE A HE2  1 
ATOM   2472  H HZ   . PHE A 1 175 ? -39.842 -8.855  20.155  1.00 16.34 ? 164  PHE A HZ   1 
ATOM   2473  N N    A LEU A 1 176 ? -39.348 -5.745  27.593  0.50 12.51 ? 165  LEU A N    1 
ATOM   2474  N N    B LEU A 1 176 ? -39.378 -5.727  27.607  0.50 11.82 ? 165  LEU A N    1 
ATOM   2475  C CA   A LEU A 1 176 ? -38.937 -5.307  28.915  0.50 13.81 ? 165  LEU A CA   1 
ATOM   2476  C CA   B LEU A 1 176 ? -38.967 -5.344  28.957  0.50 10.40 ? 165  LEU A CA   1 
ATOM   2477  C C    A LEU A 1 176 ? -38.082 -6.365  29.592  0.50 13.14 ? 165  LEU A C    1 
ATOM   2478  C C    B LEU A 1 176 ? -38.060 -6.388  29.575  0.50 10.88 ? 165  LEU A C    1 
ATOM   2479  O O    A LEU A 1 176 ? -38.411 -7.553  29.551  0.50 13.75 ? 165  LEU A O    1 
ATOM   2480  O O    B LEU A 1 176 ? -38.372 -7.579  29.528  0.50 12.86 ? 165  LEU A O    1 
ATOM   2481  C CB   A LEU A 1 176 ? -40.156 -4.957  29.753  0.50 13.35 ? 165  LEU A CB   1 
ATOM   2482  C CB   B LEU A 1 176 ? -40.211 -5.154  29.844  0.50 13.54 ? 165  LEU A CB   1 
ATOM   2483  C CG   A LEU A 1 176 ? -39.811 -4.429  31.130  0.50 10.28 ? 165  LEU A CG   1 
ATOM   2484  C CG   B LEU A 1 176 ? -40.024 -4.927  31.350  0.50 11.51 ? 165  LEU A CG   1 
ATOM   2485  C CD1  A LEU A 1 176 ? -40.803 -3.382  31.536  0.50 11.99 ? 165  LEU A CD1  1 
ATOM   2486  C CD1  B LEU A 1 176 ? -39.508 -3.540  31.598  0.50 12.13 ? 165  LEU A CD1  1 
ATOM   2487  C CD2  A LEU A 1 176 ? -39.739 -5.558  32.134  0.50 10.75 ? 165  LEU A CD2  1 
ATOM   2488  C CD2  B LEU A 1 176 ? -41.312 -5.138  32.164  0.50 12.75 ? 165  LEU A CD2  1 
ATOM   2489  H H    A LEU A 1 176 ? -39.819 -6.465  27.593  0.50 15.01 ? 165  LEU A H    1 
ATOM   2490  H H    B LEU A 1 176 ? -39.884 -6.422  27.597  0.50 14.18 ? 165  LEU A H    1 
ATOM   2491  H HA   A LEU A 1 176 ? -38.399 -4.505  28.825  0.50 16.58 ? 165  LEU A HA   1 
ATOM   2492  H HA   B LEU A 1 176 ? -38.485 -4.503  28.920  0.50 12.48 ? 165  LEU A HA   1 
ATOM   2493  H HB2  A LEU A 1 176 ? -40.667 -4.274  29.292  0.50 16.02 ? 165  LEU A HB2  1 
ATOM   2494  H HB2  B LEU A 1 176 ? -40.700 -4.387  29.506  0.50 16.24 ? 165  LEU A HB2  1 
ATOM   2495  H HB3  A LEU A 1 176 ? -40.697 -5.754  29.866  0.50 16.02 ? 165  LEU A HB3  1 
ATOM   2496  H HB3  B LEU A 1 176 ? -40.765 -5.945  29.749  0.50 16.24 ? 165  LEU A HB3  1 
ATOM   2497  H HG   A LEU A 1 176 ? -38.937 -4.010  31.093  0.50 12.33 ? 165  LEU A HG   1 
ATOM   2498  H HG   B LEU A 1 176 ? -39.360 -5.553  31.679  0.50 13.81 ? 165  LEU A HG   1 
ATOM   2499  H HD11 A LEU A 1 176 ? -40.571 -3.053  32.418  0.50 14.39 ? 165  LEU A HD11 1 
ATOM   2500  H HD11 B LEU A 1 176 ? -39.395 -3.412  32.553  0.50 14.55 ? 165  LEU A HD11 1 
ATOM   2501  H HD12 A LEU A 1 176 ? -40.775 -2.656  30.894  0.50 14.39 ? 165  LEU A HD12 1 
ATOM   2502  H HD12 B LEU A 1 176 ? -38.656 -3.435  31.146  0.50 14.55 ? 165  LEU A HD12 1 
ATOM   2503  H HD13 A LEU A 1 176 ? -41.689 -3.776  31.552  0.50 14.39 ? 165  LEU A HD13 1 
ATOM   2504  H HD13 B LEU A 1 176 ? -40.148 -2.899  31.251  0.50 14.55 ? 165  LEU A HD13 1 
ATOM   2505  H HD21 A LEU A 1 176 ? -39.517 -5.192  33.004  0.50 12.90 ? 165  LEU A HD21 1 
ATOM   2506  H HD21 B LEU A 1 176 ? -41.122 -4.979  33.102  0.50 15.30 ? 165  LEU A HD21 1 
ATOM   2507  H HD22 A LEU A 1 176 ? -40.600 -6.002  32.171  0.50 12.90 ? 165  LEU A HD22 1 
ATOM   2508  H HD22 B LEU A 1 176 ? -41.988 -4.516  31.853  0.50 15.30 ? 165  LEU A HD22 1 
ATOM   2509  H HD23 A LEU A 1 176 ? -39.054 -6.185  31.854  0.50 12.90 ? 165  LEU A HD23 1 
ATOM   2510  H HD23 B LEU A 1 176 ? -41.618 -6.050  32.038  0.50 15.30 ? 165  LEU A HD23 1 
ATOM   2511  N N    . VAL A 1 177 ? -36.988 -5.929  30.213  1.00 11.95 ? 166  VAL A N    1 
ATOM   2512  C CA   . VAL A 1 177 ? -36.173 -6.790  31.057  1.00 11.73 ? 166  VAL A CA   1 
ATOM   2513  C C    . VAL A 1 177 ? -36.154 -6.252  32.476  1.00 11.42 ? 166  VAL A C    1 
ATOM   2514  O O    . VAL A 1 177 ? -36.302 -5.042  32.707  1.00 12.56 ? 166  VAL A O    1 
ATOM   2515  C CB   . VAL A 1 177 ? -34.738 -6.968  30.528  1.00 14.46 ? 166  VAL A CB   1 
ATOM   2516  C CG1  . VAL A 1 177 ? -34.738 -7.658  29.195  1.00 18.64 ? 166  VAL A CG1  1 
ATOM   2517  C CG2  . VAL A 1 177 ? -33.957 -5.678  30.482  1.00 18.49 ? 166  VAL A CG2  1 
ATOM   2518  H H    . VAL A 1 177 ? -36.702 -5.120  30.165  1.00 14.34 ? 166  VAL A H    1 
ATOM   2519  H HA   . VAL A 1 177 ? -36.583 -7.668  31.085  1.00 14.08 ? 166  VAL A HA   1 
ATOM   2520  H HB   . VAL A 1 177 ? -34.269 -7.553  31.143  1.00 17.35 ? 166  VAL A HB   1 
ATOM   2521  H HG11 . VAL A 1 177 ? -33.823 -7.755  28.890  1.00 22.37 ? 166  VAL A HG11 1 
ATOM   2522  H HG12 . VAL A 1 177 ? -35.149 -8.531  29.293  1.00 22.37 ? 166  VAL A HG12 1 
ATOM   2523  H HG13 . VAL A 1 177 ? -35.243 -7.123  28.563  1.00 22.37 ? 166  VAL A HG13 1 
ATOM   2524  H HG21 . VAL A 1 177 ? -33.067 -5.860  30.142  1.00 22.19 ? 166  VAL A HG21 1 
ATOM   2525  H HG22 . VAL A 1 177 ? -34.414 -5.053  29.898  1.00 22.19 ? 166  VAL A HG22 1 
ATOM   2526  H HG23 . VAL A 1 177 ? -33.900 -5.312  31.379  1.00 22.19 ? 166  VAL A HG23 1 
ATOM   2527  N N    A TYR A 1 178 ? -35.940 -7.163  33.431  0.48 13.47 ? 167  TYR A N    1 
ATOM   2528  N N    B TYR A 1 178 ? -35.942 -7.149  33.429  0.52 14.70 ? 167  TYR A N    1 
ATOM   2529  C CA   A TYR A 1 178 ? -35.898 -6.834  34.846  0.48 13.50 ? 167  TYR A CA   1 
ATOM   2530  C CA   B TYR A 1 178 ? -36.023 -6.833  34.843  0.52 14.31 ? 167  TYR A CA   1 
ATOM   2531  C C    A TYR A 1 178 ? -34.505 -6.886  35.426  0.48 14.05 ? 167  TYR A C    1 
ATOM   2532  C C    B TYR A 1 178 ? -34.630 -6.828  35.462  0.52 14.38 ? 167  TYR A C    1 
ATOM   2533  O O    A TYR A 1 178 ? -33.775 -7.873  35.260  0.48 14.89 ? 167  TYR A O    1 
ATOM   2534  O O    B TYR A 1 178 ? -33.858 -7.777  35.269  0.52 16.47 ? 167  TYR A O    1 
ATOM   2535  C CB   A TYR A 1 178 ? -36.712 -7.807  35.676  0.48 13.80 ? 167  TYR A CB   1 
ATOM   2536  C CB   B TYR A 1 178 ? -36.913 -7.869  35.535  0.52 15.18 ? 167  TYR A CB   1 
ATOM   2537  C CG   A TYR A 1 178 ? -38.149 -7.583  35.540  0.48 13.68 ? 167  TYR A CG   1 
ATOM   2538  C CG   B TYR A 1 178 ? -38.379 -7.830  35.160  0.52 15.39 ? 167  TYR A CG   1 
ATOM   2539  C CD1  A TYR A 1 178 ? -38.836 -8.056  34.434  0.48 12.92 ? 167  TYR A CD1  1 
ATOM   2540  C CD1  B TYR A 1 178 ? -39.269 -7.020  35.868  0.52 14.54 ? 167  TYR A CD1  1 
ATOM   2541  C CD2  A TYR A 1 178 ? -38.834 -6.852  36.494  0.48 13.94 ? 167  TYR A CD2  1 
ATOM   2542  C CD2  B TYR A 1 178 ? -38.896 -8.620  34.130  0.52 13.56 ? 167  TYR A CD2  1 
ATOM   2543  C CE1  A TYR A 1 178 ? -40.183 -7.826  34.300  0.48 15.10 ? 167  TYR A CE1  1 
ATOM   2544  C CE1  B TYR A 1 178 ? -40.628 -6.991  35.567  0.52 13.60 ? 167  TYR A CE1  1 
ATOM   2545  C CE2  A TYR A 1 178 ? -40.162 -6.654  36.382  0.48 14.74 ? 167  TYR A CE2  1 
ATOM   2546  C CE2  B TYR A 1 178 ? -40.282 -8.595  33.822  0.52 12.72 ? 167  TYR A CE2  1 
ATOM   2547  C CZ   A TYR A 1 178 ? -40.835 -7.134  35.279  0.48 14.80 ? 167  TYR A CZ   1 
ATOM   2548  C CZ   B TYR A 1 178 ? -41.130 -7.756  34.555  0.52 12.51 ? 167  TYR A CZ   1 
ATOM   2549  O OH   A TYR A 1 178 ? -42.168 -6.896  35.159  0.48 16.76 ? 167  TYR A OH   1 
ATOM   2550  O OH   B TYR A 1 178 ? -42.494 -7.671  34.303  0.52 14.07 ? 167  TYR A OH   1 
ATOM   2551  H H    A TYR A 1 178 ? -35.813 -7.998  33.272  0.48 16.17 ? 167  TYR A H    1 
ATOM   2552  H H    B TYR A 1 178 ? -35.744 -7.972  33.274  0.52 17.64 ? 167  TYR A H    1 
ATOM   2553  H HA   A TYR A 1 178 ? -36.254 -5.941  34.981  0.48 16.20 ? 167  TYR A HA   1 
ATOM   2554  H HA   B TYR A 1 178 ? -36.418 -5.955  34.960  0.52 17.17 ? 167  TYR A HA   1 
ATOM   2555  H HB2  A TYR A 1 178 ? -36.518 -8.712  35.385  0.48 16.56 ? 167  TYR A HB2  1 
ATOM   2556  H HB2  B TYR A 1 178 ? -36.581 -8.753  35.316  0.52 18.22 ? 167  TYR A HB2  1 
ATOM   2557  H HB3  A TYR A 1 178 ? -36.477 -7.700  36.611  0.48 16.56 ? 167  TYR A HB3  1 
ATOM   2558  H HB3  B TYR A 1 178 ? -36.855 -7.730  36.494  0.52 18.22 ? 167  TYR A HB3  1 
ATOM   2559  H HD1  A TYR A 1 178 ? -38.382 -8.535  33.778  0.48 15.51 ? 167  TYR A HD1  1 
ATOM   2560  H HD1  B TYR A 1 178 ? -38.947 -6.493  36.563  0.52 17.44 ? 167  TYR A HD1  1 
ATOM   2561  H HD2  A TYR A 1 178 ? -38.383 -6.537  37.244  0.48 16.72 ? 167  TYR A HD2  1 
ATOM   2562  H HD2  B TYR A 1 178 ? -38.328 -9.178  33.649  0.52 16.27 ? 167  TYR A HD2  1 
ATOM   2563  H HE1  A TYR A 1 178 ? -40.648 -8.154  33.564  0.48 18.12 ? 167  TYR A HE1  1 
ATOM   2564  H HE1  B TYR A 1 178 ? -41.196 -6.436  36.051  0.52 16.32 ? 167  TYR A HE1  1 
ATOM   2565  H HE2  A TYR A 1 178 ? -40.617 -6.166  37.030  0.48 17.69 ? 167  TYR A HE2  1 
ATOM   2566  H HE2  B TYR A 1 178 ? -40.619 -9.117  33.130  0.52 15.27 ? 167  TYR A HE2  1 
ATOM   2567  H HH   A TYR A 1 178 ? -42.444 -6.464  35.825  0.48 20.12 ? 167  TYR A HH   1 
ATOM   2568  H HH   B TYR A 1 178 ? -42.700 -8.177  33.665  0.52 16.88 ? 167  TYR A HH   1 
ATOM   2569  N N    A MET A 1 179 ? -34.217 -5.882  36.231  0.48 15.25 ? 168  MET A N    1 
ATOM   2570  N N    B MET A 1 179 ? -34.302 -5.767  36.208  0.52 14.44 ? 168  MET A N    1 
ATOM   2571  C CA   A MET A 1 179 ? -33.041 -5.854  37.064  0.48 14.56 ? 168  MET A CA   1 
ATOM   2572  C CA   B MET A 1 179 ? -33.105 -5.786  37.049  0.52 11.98 ? 168  MET A CA   1 
ATOM   2573  C C    A MET A 1 179 ? -33.383 -6.157  38.511  0.48 12.11 ? 168  MET A C    1 
ATOM   2574  C C    B MET A 1 179 ? -33.405 -6.207  38.476  0.52 11.91 ? 168  MET A C    1 
ATOM   2575  O O    A MET A 1 179 ? -32.480 -6.262  39.351  0.48 11.71 ? 168  MET A O    1 
ATOM   2576  O O    B MET A 1 179 ? -32.485 -6.427  39.268  0.52 13.89 ? 168  MET A O    1 
ATOM   2577  C CB   A MET A 1 179 ? -32.398 -4.482  36.915  0.48 13.90 ? 168  MET A CB   1 
ATOM   2578  C CB   B MET A 1 179 ? -32.412 -4.422  37.060  0.52 13.64 ? 168  MET A CB   1 
ATOM   2579  C CG   A MET A 1 179 ? -32.412 -4.032  35.436  0.48 10.96 ? 168  MET A CG   1 
ATOM   2580  C CG   B MET A 1 179 ? -31.512 -4.227  35.824  0.52 16.78 ? 168  MET A CG   1 
ATOM   2581  S SD   A MET A 1 179 ? -31.755 -2.364  35.255  0.48 12.71 ? 168  MET A SD   1 
ATOM   2582  S SD   B MET A 1 179 ? -30.929 -2.543  35.622  0.52 17.92 ? 168  MET A SD   1 
ATOM   2583  C CE   A MET A 1 179 ? -30.112 -2.579  35.885  0.48 8.38  ? 168  MET A CE   1 
ATOM   2584  C CE   B MET A 1 179 ? -29.526 -2.744  34.540  0.52 20.70 ? 168  MET A CE   1 
ATOM   2585  H H    A MET A 1 179 ? -34.708 -5.181  36.312  0.48 18.29 ? 168  MET A H    1 
ATOM   2586  H H    B MET A 1 179 ? -34.751 -5.034  36.244  0.52 17.33 ? 168  MET A H    1 
ATOM   2587  H HA   A MET A 1 179 ? -32.410 -6.517  36.743  0.48 17.48 ? 168  MET A HA   1 
ATOM   2588  H HA   B MET A 1 179 ? -32.480 -6.423  36.670  0.52 14.37 ? 168  MET A HA   1 
ATOM   2589  H HB2  A MET A 1 179 ? -32.895 -3.834  37.438  0.48 16.68 ? 168  MET A HB2  1 
ATOM   2590  H HB2  B MET A 1 179 ? -33.084 -3.722  37.059  0.52 16.37 ? 168  MET A HB2  1 
ATOM   2591  H HB3  A MET A 1 179 ? -31.476 -4.523  37.214  0.48 16.68 ? 168  MET A HB3  1 
ATOM   2592  H HB3  B MET A 1 179 ? -31.857 -4.352  37.853  0.52 16.37 ? 168  MET A HB3  1 
ATOM   2593  H HG2  A MET A 1 179 ? -31.863 -4.635  34.912  0.48 13.15 ? 168  MET A HG2  1 
ATOM   2594  H HG2  B MET A 1 179 ? -30.735 -4.803  35.908  0.52 20.14 ? 168  MET A HG2  1 
ATOM   2595  H HG3  A MET A 1 179 ? -33.325 -4.038  35.108  0.48 13.15 ? 168  MET A HG3  1 
ATOM   2596  H HG3  B MET A 1 179 ? -32.015 -4.466  35.030  0.52 20.14 ? 168  MET A HG3  1 
ATOM   2597  H HE1  A MET A 1 179 ? -29.644 -1.730  35.840  0.48 10.06 ? 168  MET A HE1  1 
ATOM   2598  H HE1  B MET A 1 179 ? -29.133 -1.874  34.367  0.52 24.84 ? 168  MET A HE1  1 
ATOM   2599  H HE2  A MET A 1 179 ? -30.164 -2.879  36.806  0.48 10.06 ? 168  MET A HE2  1 
ATOM   2600  H HE2  B MET A 1 179 ? -28.876 -3.321  34.971  0.52 24.84 ? 168  MET A HE2  1 
ATOM   2601  H HE3  A MET A 1 179 ? -29.651 -3.240  35.346  0.48 10.06 ? 168  MET A HE3  1 
ATOM   2602  H HE3  B MET A 1 179 ? -29.824 -3.145  33.708  0.52 24.84 ? 168  MET A HE3  1 
ATOM   2603  N N    . ALA A 1 180 ? -34.676 -6.335  38.811  1.00 12.30 ? 169  ALA A N    1 
ATOM   2604  C CA   . ALA A 1 180 ? -35.137 -6.767  40.101  1.00 13.71 ? 169  ALA A CA   1 
ATOM   2605  C C    . ALA A 1 180 ? -35.953 -8.046  39.957  1.00 13.15 ? 169  ALA A C    1 
ATOM   2606  O O    . ALA A 1 180 ? -35.942 -8.691  38.907  1.00 14.33 ? 169  ALA A O    1 
ATOM   2607  C CB   . ALA A 1 180 ? -35.877 -5.635  40.767  1.00 16.52 ? 169  ALA A CB   1 
ATOM   2608  H H    . ALA A 1 180 ? -35.322 -6.185  38.264  1.00 14.76 ? 169  ALA A H    1 
ATOM   2609  H HA   . ALA A 1 180 ? -34.365 -6.974  40.651  1.00 16.45 ? 169  ALA A HA   1 
ATOM   2610  H HB1  . ALA A 1 180 ? -36.186 -5.929  41.638  1.00 19.83 ? 169  ALA A HB1  1 
ATOM   2611  H HB2  . ALA A 1 180 ? -35.275 -4.881  40.868  1.00 19.83 ? 169  ALA A HB2  1 
ATOM   2612  H HB3  . ALA A 1 180 ? -36.633 -5.384  40.214  1.00 19.83 ? 169  ALA A HB3  1 
ATOM   2613  N N    . PHE A 1 181 ? -36.642 -8.407  41.028  1.00 14.23 ? 170  PHE A N    1 
ATOM   2614  C CA   . PHE A 1 181 ? -37.358 -9.671  41.115  1.00 15.64 ? 170  PHE A CA   1 
ATOM   2615  C C    . PHE A 1 181 ? -36.391 -10.846 41.015  1.00 15.83 ? 170  PHE A C    1 
ATOM   2616  O O    . PHE A 1 181 ? -36.491 -11.722 40.152  1.00 15.74 ? 170  PHE A O    1 
ATOM   2617  C CB   . PHE A 1 181 ? -38.529 -9.768  40.133  1.00 16.35 ? 170  PHE A CB   1 
ATOM   2618  C CG   . PHE A 1 181 ? -39.499 -8.677  40.314  1.00 15.89 ? 170  PHE A CG   1 
ATOM   2619  C CD1  . PHE A 1 181 ? -40.364 -8.672  41.388  1.00 22.09 ? 170  PHE A CD1  1 
ATOM   2620  C CD2  . PHE A 1 181 ? -39.416 -7.579  39.571  1.00 19.80 ? 170  PHE A CD2  1 
ATOM   2621  C CE1  . PHE A 1 181 ? -41.205 -7.580  41.588  1.00 24.88 ? 170  PHE A CE1  1 
ATOM   2622  C CE2  . PHE A 1 181 ? -40.227 -6.526  39.765  1.00 20.64 ? 170  PHE A CE2  1 
ATOM   2623  C CZ   . PHE A 1 181 ? -41.108 -6.507  40.728  1.00 23.22 ? 170  PHE A CZ   1 
ATOM   2624  H H    . PHE A 1 181 ? -36.712 -7.924  41.736  1.00 17.08 ? 170  PHE A H    1 
ATOM   2625  H HA   . PHE A 1 181 ? -37.747 -9.718  42.002  1.00 18.77 ? 170  PHE A HA   1 
ATOM   2626  H HB2  . PHE A 1 181 ? -38.188 -9.721  39.226  1.00 19.62 ? 170  PHE A HB2  1 
ATOM   2627  H HB3  . PHE A 1 181 ? -38.992 -10.609 40.272  1.00 19.62 ? 170  PHE A HB3  1 
ATOM   2628  H HD1  . PHE A 1 181 ? -40.420 -9.413  41.947  1.00 26.51 ? 170  PHE A HD1  1 
ATOM   2629  H HD2  . PHE A 1 181 ? -38.810 -7.557  38.865  1.00 23.76 ? 170  PHE A HD2  1 
ATOM   2630  H HE1  . PHE A 1 181 ? -41.827 -7.580  42.279  1.00 29.86 ? 170  PHE A HE1  1 
ATOM   2631  H HE2  . PHE A 1 181 ? -40.168 -5.796  39.191  1.00 24.77 ? 170  PHE A HE2  1 
ATOM   2632  H HZ   . PHE A 1 181 ? -41.660 -5.767  40.840  1.00 27.86 ? 170  PHE A HZ   1 
ATOM   2633  N N    . LYS A 1 182 ? -35.475 -10.854 41.975  1.00 14.43 ? 171  LYS A N    1 
ATOM   2634  C CA   . LYS A 1 182 ? -34.442 -11.872 42.032  1.00 15.93 ? 171  LYS A CA   1 
ATOM   2635  C C    . LYS A 1 182 ? -35.084 -13.250 42.054  1.00 18.18 ? 171  LYS A C    1 
ATOM   2636  O O    . LYS A 1 182 ? -36.082 -13.476 42.746  1.00 21.10 ? 171  LYS A O    1 
ATOM   2637  C CB   . LYS A 1 182 ? -33.588 -11.669 43.265  1.00 16.96 ? 171  LYS A CB   1 
ATOM   2638  C CG   . LYS A 1 182 ? -32.312 -12.529 43.214  1.00 19.30 ? 171  LYS A CG   1 
ATOM   2639  C CD   . LYS A 1 182 ? -31.408 -12.289 44.403  1.00 22.91 ? 171  LYS A CD   1 
ATOM   2640  C CE   . LYS A 1 182 ? -30.201 -13.137 44.375  1.00 27.78 ? 171  LYS A CE   1 
ATOM   2641  N NZ   . LYS A 1 182 ? -29.298 -12.843 43.201  1.00 33.26 ? 171  LYS A NZ   1 
ATOM   2642  H H    . LYS A 1 182 ? -35.431 -10.275 42.609  1.00 17.31 ? 171  LYS A H    1 
ATOM   2643  H HA   . LYS A 1 182 ? -33.875 -11.807 41.247  1.00 19.12 ? 171  LYS A HA   1 
ATOM   2644  H HB2  . LYS A 1 182 ? -33.325 -10.737 43.322  1.00 20.35 ? 171  LYS A HB2  1 
ATOM   2645  H HB3  . LYS A 1 182 ? -34.096 -11.923 44.052  1.00 20.35 ? 171  LYS A HB3  1 
ATOM   2646  H HG2  . LYS A 1 182 ? -32.561 -13.467 43.210  1.00 23.16 ? 171  LYS A HG2  1 
ATOM   2647  H HG3  . LYS A 1 182 ? -31.815 -12.313 42.410  1.00 23.16 ? 171  LYS A HG3  1 
ATOM   2648  H HD2  . LYS A 1 182 ? -31.124 -11.362 44.404  1.00 27.49 ? 171  LYS A HD2  1 
ATOM   2649  H HD3  . LYS A 1 182 ? -31.896 -12.488 45.218  1.00 27.49 ? 171  LYS A HD3  1 
ATOM   2650  H HE2  . LYS A 1 182 ? -29.693 -12.989 45.188  1.00 33.33 ? 171  LYS A HE2  1 
ATOM   2651  H HE3  . LYS A 1 182 ? -30.471 -14.067 44.319  1.00 33.33 ? 171  LYS A HE3  1 
ATOM   2652  H HZ1  . LYS A 1 182 ? -29.736 -12.979 42.439  1.00 39.91 ? 171  LYS A HZ1  1 
ATOM   2653  H HZ2  . LYS A 1 182 ? -29.027 -11.996 43.231  1.00 39.91 ? 171  LYS A HZ2  1 
ATOM   2654  H HZ3  . LYS A 1 182 ? -28.585 -13.376 43.225  1.00 39.91 ? 171  LYS A HZ3  1 
ATOM   2655  N N    . ASP A 1 183 ? -34.509 -14.157 41.283  1.00 19.94 ? 172  ASP A N    1 
ATOM   2656  C CA   . ASP A 1 183 ? -34.961 -15.560 41.220  1.00 25.26 ? 172  ASP A CA   1 
ATOM   2657  C C    . ASP A 1 183 ? -36.368 -15.709 40.656  1.00 25.45 ? 172  ASP A C    1 
ATOM   2658  O O    . ASP A 1 183 ? -36.994 -16.764 40.802  1.00 30.25 ? 172  ASP A O    1 
ATOM   2659  C CB   . ASP A 1 183 ? -34.848 -16.263 42.585  1.00 29.95 ? 172  ASP A CB   1 
ATOM   2660  C CG   . ASP A 1 183 ? -33.418 -16.356 43.080  1.00 32.81 ? 172  ASP A CG   1 
ATOM   2661  O OD1  . ASP A 1 183 ? -32.522 -16.658 42.262  1.00 38.24 ? 172  ASP A OD1  1 
ATOM   2662  O OD2  . ASP A 1 183 ? -33.189 -16.150 44.295  1.00 37.89 ? 172  ASP A OD2  1 
ATOM   2663  H H    . ASP A 1 183 ? -33.838 -13.991 40.771  1.00 23.92 ? 172  ASP A H    1 
ATOM   2664  H HA   . ASP A 1 183 ? -34.368 -16.032 40.615  1.00 30.31 ? 172  ASP A HA   1 
ATOM   2665  H HB2  . ASP A 1 183 ? -35.361 -15.764 43.240  1.00 35.94 ? 172  ASP A HB2  1 
ATOM   2666  H HB3  . ASP A 1 183 ? -35.198 -17.164 42.506  1.00 35.94 ? 172  ASP A HB3  1 
ATOM   2667  N N    . ARG A 1 184 ? -36.875 -14.682 40.003  1.00 20.66 ? 173  ARG A N    1 
ATOM   2668  C CA   . ARG A 1 184 ? -38.109 -14.752 39.229  1.00 19.68 ? 173  ARG A CA   1 
ATOM   2669  C C    . ARG A 1 184 ? -37.871 -14.218 37.839  1.00 17.77 ? 173  ARG A C    1 
ATOM   2670  O O    . ARG A 1 184 ? -37.922 -14.990 36.876  1.00 19.66 ? 173  ARG A O    1 
ATOM   2671  C CB   . ARG A 1 184 ? -39.206 -13.970 39.914  1.00 23.29 ? 173  ARG A CB   1 
ATOM   2672  C CG   . ARG A 1 184 ? -40.435 -13.820 39.032  1.00 28.30 ? 173  ARG A CG   1 
ATOM   2673  C CD   . ARG A 1 184 ? -41.691 -13.931 39.779  1.00 28.43 ? 173  ARG A CD   1 
ATOM   2674  N NE   . ARG A 1 184 ? -42.863 -13.655 38.949  1.00 25.30 ? 173  ARG A NE   1 
ATOM   2675  C CZ   . ARG A 1 184 ? -43.535 -14.551 38.205  1.00 22.94 ? 173  ARG A CZ   1 
ATOM   2676  N NH1  . ARG A 1 184 ? -43.165 -15.840 38.142  1.00 28.42 ? 173  ARG A NH1  1 
ATOM   2677  N NH2  . ARG A 1 184 ? -44.611 -14.146 37.549  1.00 25.34 ? 173  ARG A NH2  1 
ATOM   2678  H H    . ARG A 1 184 ? -36.511 -13.903 39.989  1.00 24.79 ? 173  ARG A H    1 
ATOM   2679  H HA   . ARG A 1 184 ? -38.392 -15.677 39.157  1.00 23.62 ? 173  ARG A HA   1 
ATOM   2680  H HB2  . ARG A 1 184 ? -39.470 -14.434 40.724  1.00 27.94 ? 173  ARG A HB2  1 
ATOM   2681  H HB3  . ARG A 1 184 ? -38.878 -13.083 40.129  1.00 27.94 ? 173  ARG A HB3  1 
ATOM   2682  H HG2  . ARG A 1 184 ? -40.415 -12.948 38.608  1.00 33.96 ? 173  ARG A HG2  1 
ATOM   2683  H HG3  . ARG A 1 184 ? -40.426 -14.517 38.357  1.00 33.96 ? 173  ARG A HG3  1 
ATOM   2684  H HD2  . ARG A 1 184 ? -41.775 -14.833 40.127  1.00 34.11 ? 173  ARG A HD2  1 
ATOM   2685  H HD3  . ARG A 1 184 ? -41.683 -13.293 40.510  1.00 34.11 ? 173  ARG A HD3  1 
ATOM   2686  H HE   . ARG A 1 184 ? -43.148 -12.844 38.934  1.00 30.36 ? 173  ARG A HE   1 
ATOM   2687  H HH11 . ARG A 1 184 ? -42.476 -16.111 38.579  1.00 34.11 ? 173  ARG A HH11 1 
ATOM   2688  H HH12 . ARG A 1 184 ? -43.612 -16.392 37.657  1.00 34.11 ? 173  ARG A HH12 1 
ATOM   2689  H HH21 . ARG A 1 184 ? -44.849 -13.320 37.582  1.00 30.40 ? 173  ARG A HH21 1 
ATOM   2690  H HH22 . ARG A 1 184 ? -45.047 -14.699 37.055  1.00 30.40 ? 173  ARG A HH22 1 
ATOM   2691  N N    . PHE A 1 185 ? -37.557 -12.925 37.719  1.00 14.80 ? 174  PHE A N    1 
ATOM   2692  C CA   . PHE A 1 185 ? -37.275 -12.338 36.398  1.00 14.78 ? 174  PHE A CA   1 
ATOM   2693  C C    . PHE A 1 185 ? -35.884 -11.723 36.232  1.00 13.37 ? 174  PHE A C    1 
ATOM   2694  O O    . PHE A 1 185 ? -35.482 -11.477 35.090  1.00 14.33 ? 174  PHE A O    1 
ATOM   2695  C CB   . PHE A 1 185 ? -38.230 -11.179 36.091  1.00 14.09 ? 174  PHE A CB   1 
ATOM   2696  C CG   . PHE A 1 185 ? -39.700 -11.504 36.104  1.00 15.26 ? 174  PHE A CG   1 
ATOM   2697  C CD1  . PHE A 1 185 ? -40.182 -12.688 35.575  1.00 18.19 ? 174  PHE A CD1  1 
ATOM   2698  C CD2  . PHE A 1 185 ? -40.596 -10.605 36.632  1.00 18.28 ? 174  PHE A CD2  1 
ATOM   2699  C CE1  . PHE A 1 185 ? -41.545 -12.951 35.560  1.00 18.89 ? 174  PHE A CE1  1 
ATOM   2700  C CE2  . PHE A 1 185 ? -41.961 -10.834 36.616  1.00 19.62 ? 174  PHE A CE2  1 
ATOM   2701  C CZ   . PHE A 1 185 ? -42.435 -12.017 36.085  1.00 19.37 ? 174  PHE A CZ   1 
ATOM   2702  H H    . PHE A 1 185 ? -37.499 -12.371 38.375  1.00 17.76 ? 174  PHE A H    1 
ATOM   2703  H HA   . PHE A 1 185 ? -37.391 -13.017 35.716  1.00 17.74 ? 174  PHE A HA   1 
ATOM   2704  H HB2  . PHE A 1 185 ? -38.083 -10.481 36.749  1.00 16.90 ? 174  PHE A HB2  1 
ATOM   2705  H HB3  . PHE A 1 185 ? -38.019 -10.837 35.208  1.00 16.90 ? 174  PHE A HB3  1 
ATOM   2706  H HD1  . PHE A 1 185 ? -39.590 -13.305 35.209  1.00 21.83 ? 174  PHE A HD1  1 
ATOM   2707  H HD2  . PHE A 1 185 ? -40.278 -9.801  36.973  1.00 21.93 ? 174  PHE A HD2  1 
ATOM   2708  H HE1  . PHE A 1 185 ? -41.862 -13.749 35.203  1.00 22.67 ? 174  PHE A HE1  1 
ATOM   2709  H HE2  . PHE A 1 185 ? -42.549 -10.212 36.981  1.00 23.55 ? 174  PHE A HE2  1 
ATOM   2710  H HZ   . PHE A 1 185 ? -43.347 -12.197 36.091  1.00 23.24 ? 174  PHE A HZ   1 
ATOM   2711  N N    . GLN A 1 186 ? -35.181 -11.446 37.318  1.00 13.05 ? 175  GLN A N    1 
ATOM   2712  C CA   . GLN A 1 186 ? -33.945 -10.669 37.249  1.00 11.89 ? 175  GLN A CA   1 
ATOM   2713  C C    . GLN A 1 186 ? -32.956 -11.296 36.293  1.00 13.54 ? 175  GLN A C    1 
ATOM   2714  O O    . GLN A 1 186 ? -32.693 -12.512 36.324  1.00 14.92 ? 175  GLN A O    1 
ATOM   2715  C CB   . GLN A 1 186 ? -33.338 -10.636 38.638  1.00 12.03 ? 175  GLN A CB   1 
ATOM   2716  C CG   . GLN A 1 186 ? -32.116 -9.689  38.767  1.00 13.14 ? 175  GLN A CG   1 
ATOM   2717  C CD   . GLN A 1 186 ? -31.761 -9.443  40.197  1.00 15.31 ? 175  GLN A CD   1 
ATOM   2718  O OE1  . GLN A 1 186 ? -32.646 -9.315  41.039  1.00 14.50 ? 175  GLN A OE1  1 
ATOM   2719  N NE2  . GLN A 1 186 ? -30.480 -9.401  40.494  1.00 17.74 ? 175  GLN A NE2  1 
ATOM   2720  H H    . GLN A 1 186 ? -35.396 -11.695 38.113  1.00 15.66 ? 175  GLN A H    1 
ATOM   2721  H HA   . GLN A 1 186 ? -34.135 -9.762  36.962  1.00 14.27 ? 175  GLN A HA   1 
ATOM   2722  H HB2  . GLN A 1 186 ? -34.013 -10.336 39.267  1.00 14.44 ? 175  GLN A HB2  1 
ATOM   2723  H HB3  . GLN A 1 186 ? -33.046 -11.531 38.873  1.00 14.44 ? 175  GLN A HB3  1 
ATOM   2724  H HG2  . GLN A 1 186 ? -31.351 -10.094 38.329  1.00 15.77 ? 175  GLN A HG2  1 
ATOM   2725  H HG3  . GLN A 1 186 ? -32.327 -8.837  38.356  1.00 15.77 ? 175  GLN A HG3  1 
ATOM   2726  H HE21 . GLN A 1 186 ? -29.891 -9.512  39.876  1.00 21.29 ? 175  GLN A HE21 1 
ATOM   2727  H HE22 . GLN A 1 186 ? -30.230 -9.261  41.305  1.00 21.29 ? 175  GLN A HE22 1 
ATOM   2728  N N    . LEU A 1 187 ? -32.368 -10.432 35.490  1.00 12.89 ? 176  LEU A N    1 
ATOM   2729  C CA   . LEU A 1 187 ? -31.269 -10.784 34.611  1.00 12.44 ? 176  LEU A CA   1 
ATOM   2730  C C    . LEU A 1 187 ? -29.965 -10.181 35.119  1.00 11.56 ? 176  LEU A C    1 
ATOM   2731  O O    . LEU A 1 187 ? -29.970 -9.114  35.746  1.00 13.27 ? 176  LEU A O    1 
ATOM   2732  C CB   . LEU A 1 187 ? -31.524 -10.300 33.186  1.00 13.80 ? 176  LEU A CB   1 
ATOM   2733  C CG   . LEU A 1 187 ? -32.784 -10.769 32.487  1.00 14.85 ? 176  LEU A CG   1 
ATOM   2734  C CD1  . LEU A 1 187 ? -32.765 -10.273 31.042  1.00 16.54 ? 176  LEU A CD1  1 
ATOM   2735  C CD2  . LEU A 1 187 ? -32.882 -12.254 32.528  1.00 17.24 ? 176  LEU A CD2  1 
ATOM   2736  H H    . LEU A 1 187 ? -32.595 -9.605  35.433  1.00 15.47 ? 176  LEU A H    1 
ATOM   2737  H HA   . LEU A 1 187 ? -31.171 -11.748 34.592  1.00 14.93 ? 176  LEU A HA   1 
ATOM   2738  H HB2  . LEU A 1 187 ? -31.554 -9.331  33.202  1.00 16.56 ? 176  LEU A HB2  1 
ATOM   2739  H HB3  . LEU A 1 187 ? -30.775 -10.584 32.638  1.00 16.56 ? 176  LEU A HB3  1 
ATOM   2740  H HG   . LEU A 1 187 ? -33.561 -10.395 32.932  1.00 17.82 ? 176  LEU A HG   1 
ATOM   2741  H HD11 . LEU A 1 187 ? -33.571 -10.573 30.595  1.00 19.85 ? 176  LEU A HD11 1 
ATOM   2742  H HD12 . LEU A 1 187 ? -32.727 -9.304  31.042  1.00 19.85 ? 176  LEU A HD12 1 
ATOM   2743  H HD13 . LEU A 1 187 ? -31.984 -10.635 30.595  1.00 19.85 ? 176  LEU A HD13 1 
ATOM   2744  H HD21 . LEU A 1 187 ? -33.695 -12.529 32.075  1.00 20.69 ? 176  LEU A HD21 1 
ATOM   2745  H HD22 . LEU A 1 187 ? -32.110 -12.634 32.081  1.00 20.69 ? 176  LEU A HD22 1 
ATOM   2746  H HD23 . LEU A 1 187 ? -32.905 -12.544 33.454  1.00 20.69 ? 176  LEU A HD23 1 
ATOM   2747  N N    . THR A 1 188 ? -28.842 -10.874 34.849  1.00 13.17 ? 177  THR A N    1 
ATOM   2748  C CA   . THR A 1 188 ? -27.531 -10.334 35.178  1.00 12.23 ? 177  THR A CA   1 
ATOM   2749  C C    . THR A 1 188 ? -27.159 -9.224  34.188  1.00 12.27 ? 177  THR A C    1 
ATOM   2750  O O    . THR A 1 188 ? -27.775 -9.062  33.134  1.00 12.92 ? 177  THR A O    1 
ATOM   2751  C CB   . THR A 1 188 ? -26.458 -11.410 35.106  1.00 14.01 ? 177  THR A CB   1 
ATOM   2752  O OG1  . THR A 1 188 ? -26.315 -11.779 33.727  1.00 13.84 ? 177  THR A OG1  1 
ATOM   2753  C CG2  . THR A 1 188 ? -26.812 -12.628 35.951  1.00 15.64 ? 177  THR A CG2  1 
ATOM   2754  H H    . THR A 1 188 ? -28.823 -11.651 34.480  1.00 15.81 ? 177  THR A H    1 
ATOM   2755  H HA   . THR A 1 188 ? -27.543 -9.963  36.074  1.00 14.68 ? 177  THR A HA   1 
ATOM   2756  H HB   . THR A 1 188 ? -25.618 -11.048 35.429  1.00 16.81 ? 177  THR A HB   1 
ATOM   2757  H HG1  . THR A 1 188 ? -25.727 -12.374 33.648  1.00 16.61 ? 177  THR A HG1  1 
ATOM   2758  H HG21 . THR A 1 188 ? -26.110 -13.294 35.883  1.00 18.77 ? 177  THR A HG21 1 
ATOM   2759  H HG22 . THR A 1 188 ? -26.912 -12.369 36.880  1.00 18.77 ? 177  THR A HG22 1 
ATOM   2760  H HG23 . THR A 1 188 ? -27.645 -13.016 35.640  1.00 18.77 ? 177  THR A HG23 1 
ATOM   2761  N N    . ASP A 1 189 ? -26.124 -8.465  34.538  1.00 11.83 ? 178  ASP A N    1 
ATOM   2762  C CA   . ASP A 1 189 ? -25.646 -7.433  33.628  1.00 12.80 ? 178  ASP A CA   1 
ATOM   2763  C C    . ASP A 1 189 ? -25.227 -8.015  32.281  1.00 11.26 ? 178  ASP A C    1 
ATOM   2764  O O    . ASP A 1 189 ? -25.524 -7.427  31.235  1.00 12.17 ? 178  ASP A O    1 
ATOM   2765  C CB   . ASP A 1 189 ? -24.526 -6.638  34.269  1.00 12.19 ? 178  ASP A CB   1 
ATOM   2766  C CG   . ASP A 1 189 ? -24.958 -5.857  35.483  1.00 12.65 ? 178  ASP A CG   1 
ATOM   2767  O OD1  . ASP A 1 189 ? -26.172 -5.652  35.674  1.00 12.99 ? 178  ASP A OD1  1 
ATOM   2768  O OD2  . ASP A 1 189 ? -24.058 -5.479  36.287  1.00 12.53 ? 178  ASP A OD2  1 
ATOM   2769  H H    . ASP A 1 189 ? -25.692 -8.526  35.279  1.00 14.20 ? 178  ASP A H    1 
ATOM   2770  H HA   . ASP A 1 189 ? -26.375 -6.816  33.459  1.00 15.36 ? 178  ASP A HA   1 
ATOM   2771  H HB2  . ASP A 1 189 ? -23.825 -7.250  34.543  1.00 14.63 ? 178  ASP A HB2  1 
ATOM   2772  H HB3  . ASP A 1 189 ? -24.177 -6.008  33.619  1.00 14.63 ? 178  ASP A HB3  1 
ATOM   2773  N N    A CYS A 1 190 ? -24.517 -9.142  32.265  0.71 11.62 ? 179  CYS A N    1 
ATOM   2774  N N    B CYS A 1 190 ? -24.527 -9.149  32.302  0.29 14.41 ? 179  CYS A N    1 
ATOM   2775  C CA   A CYS A 1 190 ? -24.189 -9.773  30.989  0.71 13.95 ? 179  CYS A CA   1 
ATOM   2776  C CA   B CYS A 1 190 ? -24.163 -9.835  31.072  0.29 15.14 ? 179  CYS A CA   1 
ATOM   2777  C C    A CYS A 1 190 ? -25.453 -10.081 30.200  0.71 13.21 ? 179  CYS A C    1 
ATOM   2778  C C    B CYS A 1 190 ? -25.405 -10.141 30.232  0.29 11.01 ? 179  CYS A C    1 
ATOM   2779  O O    A CYS A 1 190 ? -25.541 -9.811  28.996  0.71 14.22 ? 179  CYS A O    1 
ATOM   2780  O O    B CYS A 1 190 ? -25.436 -9.885  29.024  0.29 11.30 ? 179  CYS A O    1 
ATOM   2781  C CB   A CYS A 1 190 ? -23.428 -11.103 31.195  0.71 16.40 ? 179  CYS A CB   1 
ATOM   2782  C CB   B CYS A 1 190 ? -23.400 -11.123 31.428  0.29 20.20 ? 179  CYS A CB   1 
ATOM   2783  S SG   A CYS A 1 190 ? -21.715 -10.922 31.589  0.71 15.47 ? 179  CYS A SG   1 
ATOM   2784  S SG   B CYS A 1 190 ? -23.102 -12.247 30.076  0.29 24.08 ? 179  CYS A SG   1 
ATOM   2785  H H    A CYS A 1 190 ? -24.220 -9.552  32.960  0.71 13.94 ? 179  CYS A H    1 
ATOM   2786  H H    B CYS A 1 190 ? -24.253 -9.539  33.018  0.29 17.29 ? 179  CYS A H    1 
ATOM   2787  H HA   A CYS A 1 190 ? -23.634 -9.176  30.463  0.71 16.74 ? 179  CYS A HA   1 
ATOM   2788  H HA   B CYS A 1 190 ? -23.575 -9.267  30.550  0.29 18.17 ? 179  CYS A HA   1 
ATOM   2789  H HB2  A CYS A 1 190 ? -23.847 -11.589 31.923  0.71 19.68 ? 179  CYS A HB2  1 
ATOM   2790  H HB2  B CYS A 1 190 ? -22.537 -10.876 31.795  0.29 24.24 ? 179  CYS A HB2  1 
ATOM   2791  H HB3  A CYS A 1 190 ? -23.488 -11.624 30.379  0.71 19.68 ? 179  CYS A HB3  1 
ATOM   2792  H HB3  B CYS A 1 190 ? -23.910 -11.605 32.098  0.29 24.24 ? 179  CYS A HB3  1 
ATOM   2793  H HG   A CYS A 1 190 ? -21.228 -12.010 31.726  0.71 18.57 ? 179  CYS A HG   1 
ATOM   2794  H HG   B CYS A 1 190 ? -24.155 -12.591 29.615  0.29 28.90 ? 179  CYS A HG   1 
ATOM   2795  N N    . GLN A 1 191 ? -26.454 -10.686 30.864  1.00 12.48 ? 180  GLN A N    1 
ATOM   2796  C CA   . GLN A 1 191 ? -27.683 -11.016 30.153  1.00 13.49 ? 180  GLN A CA   1 
ATOM   2797  C C    . GLN A 1 191 ? -28.350 -9.764  29.583  1.00 11.84 ? 180  GLN A C    1 
ATOM   2798  O O    . GLN A 1 191 ? -28.834 -9.770  28.450  1.00 13.39 ? 180  GLN A O    1 
ATOM   2799  C CB   . GLN A 1 191 ? -28.606 -11.795 31.068  1.00 13.62 ? 180  GLN A CB   1 
ATOM   2800  C CG   . GLN A 1 191 ? -28.105 -13.202 31.365  1.00 14.16 ? 180  GLN A CG   1 
ATOM   2801  C CD   . GLN A 1 191 ? -28.970 -13.901 32.341  1.00 15.38 ? 180  GLN A CD   1 
ATOM   2802  O OE1  . GLN A 1 191 ? -29.470 -13.327 33.297  1.00 15.10 ? 180  GLN A OE1  1 
ATOM   2803  N NE2  . GLN A 1 191 ? -29.172 -15.165 32.098  1.00 22.91 ? 180  GLN A NE2  1 
ATOM   2804  H H    . GLN A 1 191 ? -26.454 -10.887 31.700  1.00 14.98 ? 180  GLN A H    1 
ATOM   2805  H HA   . GLN A 1 191 ? -27.460 -11.592 29.406  1.00 16.18 ? 180  GLN A HA   1 
ATOM   2806  H HB2  . GLN A 1 191 ? -28.686 -11.322 31.911  1.00 16.34 ? 180  GLN A HB2  1 
ATOM   2807  H HB3  . GLN A 1 191 ? -29.477 -11.870 30.647  1.00 16.34 ? 180  GLN A HB3  1 
ATOM   2808  H HG2  . GLN A 1 191 ? -28.098 -13.718 30.543  1.00 16.99 ? 180  GLN A HG2  1 
ATOM   2809  H HG3  . GLN A 1 191 ? -27.210 -13.151 31.735  1.00 16.99 ? 180  GLN A HG3  1 
ATOM   2810  H HE21 . GLN A 1 191 ? -28.812 -15.534 31.410  1.00 27.49 ? 180  GLN A HE21 1 
ATOM   2811  H HE22 . GLN A 1 191 ? -29.666 -15.631 32.627  1.00 27.49 ? 180  GLN A HE22 1 
ATOM   2812  N N    . ILE A 1 192 ? -28.389 -8.687  30.360  1.00 11.77 ? 181  ILE A N    1 
ATOM   2813  C CA   . ILE A 1 192 ? -28.987 -7.436  29.887  1.00 12.13 ? 181  ILE A CA   1 
ATOM   2814  C C    . ILE A 1 192 ? -28.230 -6.921  28.665  1.00 11.87 ? 181  ILE A C    1 
ATOM   2815  O O    . ILE A 1 192 ? -28.828 -6.487  27.675  1.00 12.65 ? 181  ILE A O    1 
ATOM   2816  C CB   . ILE A 1 192 ? -29.075 -6.414  31.035  1.00 12.76 ? 181  ILE A CB   1 
ATOM   2817  C CG1  . ILE A 1 192 ? -30.086 -6.941  32.097  1.00 15.19 ? 181  ILE A CG1  1 
ATOM   2818  C CG2  . ILE A 1 192 ? -29.521 -5.052  30.518  1.00 13.45 ? 181  ILE A CG2  1 
ATOM   2819  C CD1  . ILE A 1 192 ? -30.102 -6.164  33.362  1.00 19.29 ? 181  ILE A CD1  1 
ATOM   2820  H H    . ILE A 1 192 ? -28.078 -8.651  31.161  1.00 14.12 ? 181  ILE A H    1 
ATOM   2821  H HA   . ILE A 1 192 ? -29.895 -7.623  29.602  1.00 14.56 ? 181  ILE A HA   1 
ATOM   2822  H HB   . ILE A 1 192 ? -28.201 -6.325  31.447  1.00 15.31 ? 181  ILE A HB   1 
ATOM   2823  H HG12 . ILE A 1 192 ? -30.979 -6.908  31.719  1.00 18.23 ? 181  ILE A HG12 1 
ATOM   2824  H HG13 . ILE A 1 192 ? -29.856 -7.858  32.316  1.00 18.23 ? 181  ILE A HG13 1 
ATOM   2825  H HG21 . ILE A 1 192 ? -29.566 -4.432  31.263  1.00 16.14 ? 181  ILE A HG21 1 
ATOM   2826  H HG22 . ILE A 1 192 ? -28.878 -4.738  29.864  1.00 16.14 ? 181  ILE A HG22 1 
ATOM   2827  H HG23 . ILE A 1 192 ? -30.395 -5.142  30.108  1.00 16.14 ? 181  ILE A HG23 1 
ATOM   2828  H HD11 . ILE A 1 192 ? -30.754 -6.555  33.964  1.00 23.14 ? 181  ILE A HD11 1 
ATOM   2829  H HD12 . ILE A 1 192 ? -29.219 -6.196  33.763  1.00 23.14 ? 181  ILE A HD12 1 
ATOM   2830  H HD13 . ILE A 1 192 ? -30.343 -5.245  33.165  1.00 23.14 ? 181  ILE A HD13 1 
ATOM   2831  N N    . TYR A 1 193 ? -26.906 -6.940  28.725  1.00 11.56 ? 182  TYR A N    1 
ATOM   2832  C CA   . TYR A 1 193 ? -26.087 -6.551  27.582  1.00 12.57 ? 182  TYR A CA   1 
ATOM   2833  C C    . TYR A 1 193 ? -26.483 -7.344  26.340  1.00 11.85 ? 182  TYR A C    1 
ATOM   2834  O O    . TYR A 1 193 ? -26.646 -6.775  25.249  1.00 12.76 ? 182  TYR A O    1 
ATOM   2835  C CB   . TYR A 1 193 ? -24.623 -6.763  27.938  1.00 13.04 ? 182  TYR A CB   1 
ATOM   2836  C CG   . TYR A 1 193 ? -23.673 -6.453  26.857  1.00 13.23 ? 182  TYR A CG   1 
ATOM   2837  C CD1  . TYR A 1 193 ? -23.534 -7.302  25.745  1.00 15.70 ? 182  TYR A CD1  1 
ATOM   2838  C CD2  . TYR A 1 193 ? -22.839 -5.359  26.949  1.00 13.59 ? 182  TYR A CD2  1 
ATOM   2839  C CE1  . TYR A 1 193 ? -22.603 -7.046  24.773  1.00 18.06 ? 182  TYR A CE1  1 
ATOM   2840  C CE2  . TYR A 1 193 ? -21.901 -5.082  25.936  1.00 18.59 ? 182  TYR A CE2  1 
ATOM   2841  C CZ   . TYR A 1 193 ? -21.808 -5.935  24.857  1.00 20.18 ? 182  TYR A CZ   1 
ATOM   2842  O OH   . TYR A 1 193 ? -20.877 -5.769  23.865  1.00 23.75 ? 182  TYR A OH   1 
ATOM   2843  H H    . TYR A 1 193 ? -26.454 -7.175  29.417  1.00 13.88 ? 182  TYR A H    1 
ATOM   2844  H HA   . TYR A 1 193 ? -26.222 -5.609  27.397  1.00 15.09 ? 182  TYR A HA   1 
ATOM   2845  H HB2  . TYR A 1 193 ? -24.404 -6.194  28.693  1.00 15.65 ? 182  TYR A HB2  1 
ATOM   2846  H HB3  . TYR A 1 193 ? -24.496 -7.693  28.183  1.00 15.65 ? 182  TYR A HB3  1 
ATOM   2847  H HD1  . TYR A 1 193 ? -24.070 -8.059  25.677  1.00 18.84 ? 182  TYR A HD1  1 
ATOM   2848  H HD2  . TYR A 1 193 ? -22.911 -4.786  27.679  1.00 16.31 ? 182  TYR A HD2  1 
ATOM   2849  H HE1  . TYR A 1 193 ? -22.527 -7.616  24.042  1.00 21.68 ? 182  TYR A HE1  1 
ATOM   2850  H HE2  . TYR A 1 193 ? -21.341 -4.343  26.002  1.00 22.31 ? 182  TYR A HE2  1 
ATOM   2851  H HH   . TYR A 1 193 ? -20.926 -6.403  23.316  1.00 28.50 ? 182  TYR A HH   1 
ATOM   2852  N N    . GLU A 1 194 ? -26.634 -8.668  26.498  1.00 12.16 ? 183  GLU A N    1 
ATOM   2853  C CA   . GLU A 1 194 ? -26.963 -9.520  25.363  1.00 13.32 ? 183  GLU A CA   1 
ATOM   2854  C C    . GLU A 1 194 ? -28.372 -9.248  24.839  1.00 12.28 ? 183  GLU A C    1 
ATOM   2855  O O    . GLU A 1 194 ? -28.578 -9.161  23.620  1.00 14.00 ? 183  GLU A O    1 
ATOM   2856  C CB   . GLU A 1 194 ? -26.776 -10.987 25.761  1.00 14.10 ? 183  GLU A CB   1 
ATOM   2857  C CG   . GLU A 1 194 ? -25.304 -11.286 26.058  1.00 15.51 ? 183  GLU A CG   1 
ATOM   2858  C CD   . GLU A 1 194 ? -25.023 -12.636 26.593  1.00 24.77 ? 183  GLU A CD   1 
ATOM   2859  O OE1  . GLU A 1 194 ? -25.871 -13.528 26.486  1.00 25.85 ? 183  GLU A OE1  1 
ATOM   2860  O OE2  . GLU A 1 194 ? -23.919 -12.825 27.136  1.00 30.30 ? 183  GLU A OE2  1 
ATOM   2861  H H    . GLU A 1 194 ? -26.550 -9.086  27.245  1.00 14.60 ? 183  GLU A H    1 
ATOM   2862  H HA   . GLU A 1 194 ? -26.341 -9.330  24.643  1.00 15.98 ? 183  GLU A HA   1 
ATOM   2863  H HB2  . GLU A 1 194 ? -27.293 -11.173 26.560  1.00 16.92 ? 183  GLU A HB2  1 
ATOM   2864  H HB3  . GLU A 1 194 ? -27.063 -11.559 25.031  1.00 16.92 ? 183  GLU A HB3  1 
ATOM   2865  H HG2  . GLU A 1 194 ? -24.799 -11.189 25.235  1.00 18.61 ? 183  GLU A HG2  1 
ATOM   2866  H HG3  . GLU A 1 194 ? -24.986 -10.642 26.710  1.00 18.61 ? 183  GLU A HG3  1 
ATOM   2867  N N    . VAL A 1 195 ? -29.340 -9.071  25.734  1.00 12.31 ? 184  VAL A N    1 
ATOM   2868  C CA   . VAL A 1 195 ? -30.716 -8.774  25.300  1.00 12.44 ? 184  VAL A CA   1 
ATOM   2869  C C    . VAL A 1 195 ? -30.769 -7.440  24.576  1.00 12.39 ? 184  VAL A C    1 
ATOM   2870  O O    . VAL A 1 195 ? -31.426 -7.317  23.547  1.00 13.16 ? 184  VAL A O    1 
ATOM   2871  C CB   . VAL A 1 195 ? -31.724 -8.814  26.467  1.00 14.53 ? 184  VAL A CB   1 
ATOM   2872  C CG1  . VAL A 1 195 ? -33.116 -8.490  25.934  1.00 16.56 ? 184  VAL A CG1  1 
ATOM   2873  C CG2  . VAL A 1 195 ? -31.770 -10.134 27.114  1.00 18.29 ? 184  VAL A CG2  1 
ATOM   2874  H H    . VAL A 1 195 ? -29.236 -9.116  26.586  1.00 14.77 ? 184  VAL A H    1 
ATOM   2875  H HA   . VAL A 1 195 ? -30.986 -9.455  24.665  1.00 14.93 ? 184  VAL A HA   1 
ATOM   2876  H HB   . VAL A 1 195 ? -31.483 -8.150  27.131  1.00 17.44 ? 184  VAL A HB   1 
ATOM   2877  H HG11 . VAL A 1 195 ? -33.749 -8.516  26.669  1.00 19.87 ? 184  VAL A HG11 1 
ATOM   2878  H HG12 . VAL A 1 195 ? -33.104 -7.605  25.538  1.00 19.87 ? 184  VAL A HG12 1 
ATOM   2879  H HG13 . VAL A 1 195 ? -33.359 -9.149  25.265  1.00 19.87 ? 184  VAL A HG13 1 
ATOM   2880  H HG21 . VAL A 1 195 ? -32.415 -10.109 27.837  1.00 21.95 ? 184  VAL A HG21 1 
ATOM   2881  H HG22 . VAL A 1 195 ? -32.034 -10.798 26.457  1.00 21.95 ? 184  VAL A HG22 1 
ATOM   2882  H HG23 . VAL A 1 195 ? -30.890 -10.345 27.462  1.00 21.95 ? 184  VAL A HG23 1 
ATOM   2883  N N    . LEU A 1 196 ? -30.120 -6.407  25.127  1.00 12.48 ? 185  LEU A N    1 
ATOM   2884  C CA   . LEU A 1 196 ? -30.135 -5.087  24.485  1.00 10.72 ? 185  LEU A CA   1 
ATOM   2885  C C    . LEU A 1 196 ? -29.444 -5.107  23.136  1.00 12.17 ? 185  LEU A C    1 
ATOM   2886  O O    . LEU A 1 196 ? -29.874 -4.451  22.199  1.00 12.27 ? 185  LEU A O    1 
ATOM   2887  C CB   . LEU A 1 196 ? -29.503 -4.057  25.411  1.00 11.77 ? 185  LEU A CB   1 
ATOM   2888  C CG   . LEU A 1 196 ? -30.539 -3.366  26.344  1.00 12.01 ? 185  LEU A CG   1 
ATOM   2889  C CD1  . LEU A 1 196 ? -31.385 -4.302  27.164  1.00 12.93 ? 185  LEU A CD1  1 
ATOM   2890  C CD2  . LEU A 1 196 ? -29.754 -2.399  27.232  1.00 13.76 ? 185  LEU A CD2  1 
ATOM   2891  H H    . LEU A 1 196 ? -29.671 -6.443  25.860  1.00 14.98 ? 185  LEU A H    1 
ATOM   2892  H HA   . LEU A 1 196 ? -31.057 -4.824  24.339  1.00 12.86 ? 185  LEU A HA   1 
ATOM   2893  H HB2  . LEU A 1 196 ? -28.844 -4.498  25.970  1.00 14.12 ? 185  LEU A HB2  1 
ATOM   2894  H HB3  . LEU A 1 196 ? -29.077 -3.370  24.875  1.00 14.12 ? 185  LEU A HB3  1 
ATOM   2895  H HG   . LEU A 1 196 ? -31.139 -2.836  25.796  1.00 14.42 ? 185  LEU A HG   1 
ATOM   2896  H HD11 . LEU A 1 196 ? -31.995 -3.780  27.708  1.00 15.52 ? 185  LEU A HD11 1 
ATOM   2897  H HD12 . LEU A 1 196 ? -31.885 -4.880  26.566  1.00 15.52 ? 185  LEU A HD12 1 
ATOM   2898  H HD13 . LEU A 1 196 ? -30.806 -4.834  27.732  1.00 15.52 ? 185  LEU A HD13 1 
ATOM   2899  H HD21 . LEU A 1 196 ? -30.372 -1.948  27.829  1.00 16.52 ? 185  LEU A HD21 1 
ATOM   2900  H HD22 . LEU A 1 196 ? -29.103 -2.901  27.746  1.00 16.52 ? 185  LEU A HD22 1 
ATOM   2901  H HD23 . LEU A 1 196 ? -29.303 -1.749  26.670  1.00 16.52 ? 185  LEU A HD23 1 
ATOM   2902  N N    . SER A 1 197 ? -28.418 -5.937  22.990  1.00 11.64 ? 186  SER A N    1 
ATOM   2903  C CA   . SER A 1 197 ? -27.780 -6.099  21.683  1.00 13.02 ? 186  SER A CA   1 
ATOM   2904  C C    . SER A 1 197 ? -28.777 -6.657  20.660  1.00 11.86 ? 186  SER A C    1 
ATOM   2905  O O    . SER A 1 197 ? -28.837 -6.189  19.518  1.00 12.85 ? 186  SER A O    1 
ATOM   2906  C CB   . SER A 1 197 ? -26.520 -6.954  21.794  1.00 13.80 ? 186  SER A CB   1 
ATOM   2907  O OG   . SER A 1 197 ? -25.562 -6.326  22.645  1.00 14.43 ? 186  SER A OG   1 
ATOM   2908  H H    . SER A 1 197 ? -28.074 -6.413  23.619  1.00 13.96 ? 186  SER A H    1 
ATOM   2909  H HA   . SER A 1 197 ? -27.506 -5.224  21.368  1.00 15.63 ? 186  SER A HA   1 
ATOM   2910  H HB2  . SER A 1 197 ? -26.755 -7.819  22.165  1.00 16.55 ? 186  SER A HB2  1 
ATOM   2911  H HB3  . SER A 1 197 ? -26.134 -7.066  20.911  1.00 16.55 ? 186  SER A HB3  1 
ATOM   2912  H HG   . SER A 1 197 ? -25.884 -6.223  23.413  1.00 17.32 ? 186  SER A HG   1 
ATOM   2913  N N    . VAL A 1 198 ? -29.535 -7.688  21.053  1.00 12.88 ? 187  VAL A N    1 
ATOM   2914  C CA   . VAL A 1 198 ? -30.553 -8.249  20.172  1.00 12.77 ? 187  VAL A CA   1 
ATOM   2915  C C    . VAL A 1 198 ? -31.630 -7.210  19.879  1.00 12.46 ? 187  VAL A C    1 
ATOM   2916  O O    . VAL A 1 198 ? -32.050 -7.063  18.740  1.00 13.50 ? 187  VAL A O    1 
ATOM   2917  C CB   . VAL A 1 198 ? -31.134 -9.524  20.784  1.00 14.96 ? 187  VAL A CB   1 
ATOM   2918  C CG1  . VAL A 1 198 ? -32.403 -9.975  20.035  1.00 16.34 ? 187  VAL A CG1  1 
ATOM   2919  C CG2  . VAL A 1 198 ? -30.070 -10.625 20.819  1.00 16.18 ? 187  VAL A CG2  1 
ATOM   2920  H H    . VAL A 1 198 ? -29.477 -8.074  21.819  1.00 15.45 ? 187  VAL A H    1 
ATOM   2921  H HA   . VAL A 1 198 ? -30.138 -8.490  19.329  1.00 15.32 ? 187  VAL A HA   1 
ATOM   2922  H HB   . VAL A 1 198 ? -31.389 -9.337  21.701  1.00 17.95 ? 187  VAL A HB   1 
ATOM   2923  H HG11 . VAL A 1 198 ? -32.743 -10.784 20.449  1.00 19.61 ? 187  VAL A HG11 1 
ATOM   2924  H HG12 . VAL A 1 198 ? -33.068 -9.271  20.089  1.00 19.61 ? 187  VAL A HG12 1 
ATOM   2925  H HG13 . VAL A 1 198 ? -32.177 -10.148 19.108  1.00 19.61 ? 187  VAL A HG13 1 
ATOM   2926  H HG21 . VAL A 1 198 ? -30.455 -11.424 21.209  1.00 19.42 ? 187  VAL A HG21 1 
ATOM   2927  H HG22 . VAL A 1 198 ? -29.775 -10.808 19.913  1.00 19.42 ? 187  VAL A HG22 1 
ATOM   2928  H HG23 . VAL A 1 198 ? -29.321 -10.322 21.356  1.00 19.42 ? 187  VAL A HG23 1 
ATOM   2929  N N    . ILE A 1 199 ? -32.129 -6.515  20.917  1.00 11.92 ? 188  ILE A N    1 
ATOM   2930  C CA   . ILE A 1 199 ? -33.178 -5.511  20.732  1.00 11.66 ? 188  ILE A CA   1 
ATOM   2931  C C    . ILE A 1 199 ? -32.759 -4.461  19.708  1.00 12.28 ? 188  ILE A C    1 
ATOM   2932  O O    . ILE A 1 199 ? -33.523 -4.122  18.808  1.00 12.45 ? 188  ILE A O    1 
ATOM   2933  C CB   . ILE A 1 199 ? -33.574 -4.925  22.091  1.00 11.29 ? 188  ILE A CB   1 
ATOM   2934  C CG1  . ILE A 1 199 ? -34.341 -5.980  22.882  1.00 11.90 ? 188  ILE A CG1  1 
ATOM   2935  C CG2  . ILE A 1 199 ? -34.391 -3.669  21.931  1.00 11.67 ? 188  ILE A CG2  1 
ATOM   2936  C CD1  . ILE A 1 199 ? -34.715 -5.544  24.311  1.00 14.07 ? 188  ILE A CD1  1 
ATOM   2937  H H    . ILE A 1 199 ? -31.874 -6.610  21.733  1.00 14.30 ? 188  ILE A H    1 
ATOM   2938  H HA   . ILE A 1 199 ? -33.963 -5.957  20.376  1.00 14.00 ? 188  ILE A HA   1 
ATOM   2939  H HB   . ILE A 1 199 ? -32.765 -4.704  22.577  1.00 13.55 ? 188  ILE A HB   1 
ATOM   2940  H HG12 . ILE A 1 199 ? -35.164 -6.185  22.412  1.00 14.28 ? 188  ILE A HG12 1 
ATOM   2941  H HG13 . ILE A 1 199 ? -33.794 -6.777  22.950  1.00 14.28 ? 188  ILE A HG13 1 
ATOM   2942  H HG21 . ILE A 1 199 ? -34.621 -3.328  22.810  1.00 14.01 ? 188  ILE A HG21 1 
ATOM   2943  H HG22 . ILE A 1 199 ? -33.866 -3.011  21.448  1.00 14.01 ? 188  ILE A HG22 1 
ATOM   2944  H HG23 . ILE A 1 199 ? -35.197 -3.878  21.435  1.00 14.01 ? 188  ILE A HG23 1 
ATOM   2945  H HD11 . ILE A 1 199 ? -35.197 -6.265  24.745  1.00 16.88 ? 188  ILE A HD11 1 
ATOM   2946  H HD12 . ILE A 1 199 ? -33.902 -5.346  24.803  1.00 16.88 ? 188  ILE A HD12 1 
ATOM   2947  H HD13 . ILE A 1 199 ? -35.274 -4.753  24.263  1.00 16.88 ? 188  ILE A HD13 1 
ATOM   2948  N N    . ARG A 1 200 ? -31.523 -3.982  19.802  1.00 11.69 ? 189  ARG A N    1 
ATOM   2949  C CA   . ARG A 1 200 ? -30.969 -3.033  18.850  1.00 12.32 ? 189  ARG A CA   1 
ATOM   2950  C C    . ARG A 1 200 ? -31.005 -3.607  17.452  1.00 12.77 ? 189  ARG A C    1 
ATOM   2951  O O    . ARG A 1 200 ? -31.429 -2.953  16.501  1.00 13.85 ? 189  ARG A O    1 
ATOM   2952  C CB   . ARG A 1 200 ? -29.512 -2.715  19.236  1.00 12.23 ? 189  ARG A CB   1 
ATOM   2953  C CG   . ARG A 1 200 ? -28.727 -1.852  18.283  1.00 14.38 ? 189  ARG A CG   1 
ATOM   2954  C CD   . ARG A 1 200 ? -27.252 -1.945  18.533  1.00 15.16 ? 189  ARG A CD   1 
ATOM   2955  N NE   . ARG A 1 200 ? -26.813 -3.275  18.105  1.00 14.75 ? 189  ARG A NE   1 
ATOM   2956  C CZ   . ARG A 1 200 ? -25.871 -4.014  18.675  1.00 14.94 ? 189  ARG A CZ   1 
ATOM   2957  N NH1  . ARG A 1 200 ? -25.173 -3.556  19.691  1.00 15.93 ? 189  ARG A NH1  1 
ATOM   2958  N NH2  . ARG A 1 200 ? -25.601 -5.248  18.213  1.00 18.12 ? 189  ARG A NH2  1 
ATOM   2959  H H    . ARG A 1 200 ? -30.974 -4.200  20.426  1.00 14.03 ? 189  ARG A H    1 
ATOM   2960  H HA   . ARG A 1 200 ? -31.485 -2.211  18.865  1.00 14.78 ? 189  ARG A HA   1 
ATOM   2961  H HB2  . ARG A 1 200 ? -29.519 -2.261  20.094  1.00 14.67 ? 189  ARG A HB2  1 
ATOM   2962  H HB3  . ARG A 1 200 ? -29.033 -3.554  19.323  1.00 14.67 ? 189  ARG A HB3  1 
ATOM   2963  H HG2  . ARG A 1 200 ? -28.899 -2.143  17.373  1.00 17.25 ? 189  ARG A HG2  1 
ATOM   2964  H HG3  . ARG A 1 200 ? -28.995 -0.927  18.395  1.00 17.25 ? 189  ARG A HG3  1 
ATOM   2965  H HD2  . ARG A 1 200 ? -26.784 -1.275  18.011  1.00 18.19 ? 189  ARG A HD2  1 
ATOM   2966  H HD3  . ARG A 1 200 ? -27.069 -1.841  19.479  1.00 18.19 ? 189  ARG A HD3  1 
ATOM   2967  H HE   . ARG A 1 200 ? -27.204 -3.609  17.416  1.00 17.70 ? 189  ARG A HE   1 
ATOM   2968  H HH11 . ARG A 1 200 ? -25.339 -2.775  20.010  1.00 19.11 ? 189  ARG A HH11 1 
ATOM   2969  H HH12 . ARG A 1 200 ? -24.558 -4.043  20.045  1.00 19.11 ? 189  ARG A HH12 1 
ATOM   2970  H HH21 . ARG A 1 200 ? -26.037 -5.559  17.540  1.00 21.74 ? 189  ARG A HH21 1 
ATOM   2971  H HH22 . ARG A 1 200 ? -24.971 -5.713  18.570  1.00 21.74 ? 189  ARG A HH22 1 
ATOM   2972  N N    . ASP A 1 201 ? -30.529 -4.846  17.299  1.00 13.18 ? 190  ASP A N    1 
ATOM   2973  C CA   . ASP A 1 201 ? -30.435 -5.452  15.967  1.00 14.00 ? 190  ASP A CA   1 
ATOM   2974  C C    . ASP A 1 201 ? -31.799 -5.636  15.325  1.00 13.32 ? 190  ASP A C    1 
ATOM   2975  O O    . ASP A 1 201 ? -31.901 -5.625  14.099  1.00 16.14 ? 190  ASP A O    1 
ATOM   2976  C CB   . ASP A 1 201 ? -29.753 -6.808  16.076  1.00 16.01 ? 190  ASP A CB   1 
ATOM   2977  C CG   . ASP A 1 201 ? -28.273 -6.717  16.347  1.00 23.03 ? 190  ASP A CG   1 
ATOM   2978  O OD1  . ASP A 1 201 ? -27.687 -5.620  16.198  1.00 25.45 ? 190  ASP A OD1  1 
ATOM   2979  O OD2  . ASP A 1 201 ? -27.700 -7.811  16.614  1.00 27.37 ? 190  ASP A OD2  1 
ATOM   2980  H H    . ASP A 1 201 ? -30.258 -5.351  17.941  1.00 15.82 ? 190  ASP A H    1 
ATOM   2981  H HA   . ASP A 1 201 ? -29.899 -4.884  15.392  1.00 16.80 ? 190  ASP A HA   1 
ATOM   2982  H HB2  . ASP A 1 201 ? -30.159 -7.305  16.804  1.00 19.21 ? 190  ASP A HB2  1 
ATOM   2983  H HB3  . ASP A 1 201 ? -29.874 -7.288  15.242  1.00 19.21 ? 190  ASP A HB3  1 
ATOM   2984  N N    . ILE A 1 202 ? -32.852 -5.848  16.121  1.00 12.60 ? 191  ILE A N    1 
ATOM   2985  C CA   . ILE A 1 202 ? -34.188 -6.079  15.599  1.00 12.81 ? 191  ILE A CA   1 
ATOM   2986  C C    . ILE A 1 202 ? -35.013 -4.797  15.540  1.00 11.83 ? 191  ILE A C    1 
ATOM   2987  O O    . ILE A 1 202 ? -36.168 -4.828  15.076  1.00 13.14 ? 191  ILE A O    1 
ATOM   2988  C CB   . ILE A 1 202 ? -34.928 -7.253  16.281  1.00 13.80 ? 191  ILE A CB   1 
ATOM   2989  C CG1  . ILE A 1 202 ? -35.252 -6.897  17.716  1.00 13.29 ? 191  ILE A CG1  1 
ATOM   2990  C CG2  . ILE A 1 202 ? -34.095 -8.517  16.141  1.00 18.35 ? 191  ILE A CG2  1 
ATOM   2991  C CD1  . ILE A 1 202 ? -35.865 -8.063  18.528  1.00 17.16 ? 191  ILE A CD1  1 
ATOM   2992  H H    . ILE A 1 202 ? -32.810 -5.861  16.980  1.00 15.13 ? 191  ILE A H    1 
ATOM   2993  H HA   . ILE A 1 202 ? -34.075 -6.352  14.675  1.00 15.37 ? 191  ILE A HA   1 
ATOM   2994  H HB   . ILE A 1 202 ? -35.765 -7.393  15.812  1.00 16.57 ? 191  ILE A HB   1 
ATOM   2995  H HG12 . ILE A 1 202 ? -34.435 -6.624  18.161  1.00 15.95 ? 191  ILE A HG12 1 
ATOM   2996  H HG13 . ILE A 1 202 ? -35.889 -6.166  17.720  1.00 15.95 ? 191  ILE A HG13 1 
ATOM   2997  H HG21 . ILE A 1 202 ? -34.562 -9.251  16.570  1.00 22.02 ? 191  ILE A HG21 1 
ATOM   2998  H HG22 . ILE A 1 202 ? -33.970 -8.710  15.199  1.00 22.02 ? 191  ILE A HG22 1 
ATOM   2999  H HG23 . ILE A 1 202 ? -33.236 -8.377  16.568  1.00 22.02 ? 191  ILE A HG23 1 
ATOM   3000  H HD11 . ILE A 1 202 ? -36.044 -7.759  19.431  1.00 20.59 ? 191  ILE A HD11 1 
ATOM   3001  H HD12 . ILE A 1 202 ? -36.691 -8.343  18.103  1.00 20.59 ? 191  ILE A HD12 1 
ATOM   3002  H HD13 . ILE A 1 202 ? -35.235 -8.801  18.545  1.00 20.59 ? 191  ILE A HD13 1 
ATOM   3003  N N    . GLY A 1 203 ? -34.463 -3.658  15.995  1.00 12.43 ? 192  GLY A N    1 
ATOM   3004  C CA   . GLY A 1 203 ? -35.170 -2.403  15.856  1.00 11.81 ? 192  GLY A CA   1 
ATOM   3005  C C    . GLY A 1 203 ? -36.230 -2.142  16.893  1.00 10.81 ? 192  GLY A C    1 
ATOM   3006  O O    . GLY A 1 203 ? -37.162 -1.365  16.634  1.00 12.20 ? 192  GLY A O    1 
ATOM   3007  H H    . GLY A 1 203 ? -33.695 -3.598  16.378  1.00 14.92 ? 192  GLY A H    1 
ATOM   3008  H HA2  . GLY A 1 203 ? -34.530 -1.676  15.896  1.00 14.17 ? 192  GLY A HA2  1 
ATOM   3009  H HA3  . GLY A 1 203 ? -35.595 -2.379  14.984  1.00 14.17 ? 192  GLY A HA3  1 
ATOM   3010  N N    . ALA A 1 204 ? -36.104 -2.753  18.060  1.00 11.54 ? 193  ALA A N    1 
ATOM   3011  C CA   . ALA A 1 204 ? -37.093 -2.569  19.118  1.00 11.40 ? 193  ALA A CA   1 
ATOM   3012  C C    . ALA A 1 204 ? -36.586 -1.604  20.202  1.00 11.95 ? 193  ALA A C    1 
ATOM   3013  O O    . ALA A 1 204 ? -35.452 -1.130  20.180  1.00 11.60 ? 193  ALA A O    1 
ATOM   3014  C CB   . ALA A 1 204 ? -37.504 -3.938  19.697  1.00 12.42 ? 193  ALA A CB   1 
ATOM   3015  H H    . ALA A 1 204 ? -35.456 -3.279  18.268  1.00 13.84 ? 193  ALA A H    1 
ATOM   3016  H HA   . ALA A 1 204 ? -37.887 -2.172  18.727  1.00 13.68 ? 193  ALA A HA   1 
ATOM   3017  H HB1  . ALA A 1 204 ? -38.160 -3.800  20.398  1.00 14.91 ? 193  ALA A HB1  1 
ATOM   3018  H HB2  . ALA A 1 204 ? -37.885 -4.479  18.988  1.00 14.91 ? 193  ALA A HB2  1 
ATOM   3019  H HB3  . ALA A 1 204 ? -36.718 -4.375  20.061  1.00 14.91 ? 193  ALA A HB3  1 
ATOM   3020  N N    . ILE A 1 205 ? -37.469 -1.296  21.140  1.00 11.16 ? 194  ILE A N    1 
ATOM   3021  C CA   . ILE A 1 205 ? -37.175 -0.440  22.293  1.00 11.36 ? 194  ILE A CA   1 
ATOM   3022  C C    . ILE A 1 205 ? -36.908 -1.354  23.477  1.00 10.91 ? 194  ILE A C    1 
ATOM   3023  O O    . ILE A 1 205 ? -37.712 -2.253  23.758  1.00 11.09 ? 194  ILE A O    1 
ATOM   3024  C CB   . ILE A 1 205 ? -38.367 0.476   22.642  1.00 12.14 ? 194  ILE A CB   1 
ATOM   3025  C CG1  . ILE A 1 205 ? -38.818 1.316   21.433  1.00 13.93 ? 194  ILE A CG1  1 
ATOM   3026  C CG2  . ILE A 1 205 ? -38.049 1.351   23.848  1.00 12.21 ? 194  ILE A CG2  1 
ATOM   3027  C CD1  . ILE A 1 205 ? -37.779 2.128   20.853  1.00 15.63 ? 194  ILE A CD1  1 
ATOM   3028  H H    . ILE A 1 205 ? -38.280 -1.580  21.134  1.00 13.40 ? 194  ILE A H    1 
ATOM   3029  H HA   . ILE A 1 205 ? -36.390 0.103   22.121  1.00 13.64 ? 194  ILE A HA   1 
ATOM   3030  H HB   . ILE A 1 205 ? -39.109 -0.098  22.889  1.00 14.56 ? 194  ILE A HB   1 
ATOM   3031  H HG12 . ILE A 1 205 ? -39.144 0.717   20.743  1.00 16.71 ? 194  ILE A HG12 1 
ATOM   3032  H HG13 . ILE A 1 205 ? -39.532 1.909   21.715  1.00 16.71 ? 194  ILE A HG13 1 
ATOM   3033  H HG21 . ILE A 1 205 ? -38.816 1.913   24.040  1.00 14.66 ? 194  ILE A HG21 1 
ATOM   3034  H HG22 . ILE A 1 205 ? -37.856 0.782   24.609  1.00 14.66 ? 194  ILE A HG22 1 
ATOM   3035  H HG23 . ILE A 1 205 ? -37.278 1.903   23.642  1.00 14.66 ? 194  ILE A HG23 1 
ATOM   3036  H HD11 . ILE A 1 205 ? -38.146 2.620   20.102  1.00 18.75 ? 194  ILE A HD11 1 
ATOM   3037  H HD12 . ILE A 1 205 ? -37.449 2.744   21.524  1.00 18.75 ? 194  ILE A HD12 1 
ATOM   3038  H HD13 . ILE A 1 205 ? -37.060 1.551   20.550  1.00 18.75 ? 194  ILE A HD13 1 
ATOM   3039  N N    . ALA A 1 206 ? -35.809 -1.123  24.175  1.00 10.21 ? 195  ALA A N    1 
ATOM   3040  C CA   . ALA A 1 206 ? -35.477 -1.880  25.386  1.00 10.41 ? 195  ALA A CA   1 
ATOM   3041  C C    . ALA A 1 206 ? -36.031 -1.168  26.606  1.00 10.11 ? 195  ALA A C    1 
ATOM   3042  O O    . ALA A 1 206 ? -35.477 -0.146  27.027  1.00 11.21 ? 195  ALA A O    1 
ATOM   3043  C CB   . ALA A 1 206 ? -33.961 -2.082  25.547  1.00 11.18 ? 195  ALA A CB   1 
ATOM   3044  H H    . ALA A 1 206 ? -35.226 -0.526  23.971  1.00 12.25 ? 195  ALA A H    1 
ATOM   3045  H HA   . ALA A 1 206 ? -35.892 -2.755  25.335  1.00 12.49 ? 195  ALA A HA   1 
ATOM   3046  H HB1  . ALA A 1 206 ? -33.794 -2.585  26.359  1.00 13.42 ? 195  ALA A HB1  1 
ATOM   3047  H HB2  . ALA A 1 206 ? -33.625 -2.570  24.779  1.00 13.42 ? 195  ALA A HB2  1 
ATOM   3048  H HB3  . ALA A 1 206 ? -33.531 -1.214  25.602  1.00 13.42 ? 195  ALA A HB3  1 
ATOM   3049  N N    . GLN A 1 207 ? -37.093 -1.701  27.193  1.00 10.32 ? 196  GLN A N    1 
ATOM   3050  C CA   . GLN A 1 207 ? -37.619 -1.188  28.429  1.00 9.86  ? 196  GLN A CA   1 
ATOM   3051  C C    . GLN A 1 207 ? -36.927 -1.934  29.576  1.00 11.12 ? 196  GLN A C    1 
ATOM   3052  O O    . GLN A 1 207 ? -36.580 -3.121  29.474  1.00 11.13 ? 196  GLN A O    1 
ATOM   3053  C CB   . GLN A 1 207 ? -39.110 -1.431  28.573  1.00 10.62 ? 196  GLN A CB   1 
ATOM   3054  C CG   . GLN A 1 207 ? -39.940 -0.895  27.454  1.00 10.94 ? 196  GLN A CG   1 
ATOM   3055  C CD   . GLN A 1 207 ? -41.408 -1.072  27.785  1.00 11.64 ? 196  GLN A CD   1 
ATOM   3056  O OE1  . GLN A 1 207 ? -41.860 -2.188  28.027  1.00 13.39 ? 196  GLN A OE1  1 
ATOM   3057  N NE2  . GLN A 1 207 ? -42.134 0.016   27.890  1.00 11.95 ? 196  GLN A NE2  1 
ATOM   3058  H H    . GLN A 1 207 ? -37.529 -2.374  26.882  1.00 12.38 ? 196  GLN A H    1 
ATOM   3059  H HA   . GLN A 1 207 ? -37.438 -0.238  28.506  1.00 11.83 ? 196  GLN A HA   1 
ATOM   3060  H HB2  . GLN A 1 207 ? -39.264 -2.387  28.622  1.00 12.74 ? 196  GLN A HB2  1 
ATOM   3061  H HB3  . GLN A 1 207 ? -39.414 -1.009  29.392  1.00 12.74 ? 196  GLN A HB3  1 
ATOM   3062  H HG2  . GLN A 1 207 ? -39.759 0.050   27.336  1.00 13.12 ? 196  GLN A HG2  1 
ATOM   3063  H HG3  . GLN A 1 207 ? -39.744 -1.385  26.639  1.00 13.12 ? 196  GLN A HG3  1 
ATOM   3064  H HE21 . GLN A 1 207 ? -41.772 0.787   27.772  1.00 14.34 ? 196  GLN A HE21 1 
ATOM   3065  H HE22 . GLN A 1 207 ? -42.971 -0.042  28.077  1.00 14.34 ? 196  GLN A HE22 1 
ATOM   3066  N N    A VAL A 1 208 ? -36.800 -1.248  30.704  0.46 11.03 ? 197  VAL A N    1 
ATOM   3067  N N    B VAL A 1 208 ? -36.744 -1.251  30.711  0.54 13.58 ? 197  VAL A N    1 
ATOM   3068  C CA   A VAL A 1 208 ? -36.266 -1.856  31.904  0.46 11.49 ? 197  VAL A CA   1 
ATOM   3069  C CA   B VAL A 1 208 ? -36.240 -1.912  31.907  0.54 13.62 ? 197  VAL A CA   1 
ATOM   3070  C C    A VAL A 1 208 ? -37.190 -1.602  33.092  0.46 11.44 ? 197  VAL A C    1 
ATOM   3071  C C    B VAL A 1 208 ? -37.091 -1.598  33.118  0.54 14.38 ? 197  VAL A C    1 
ATOM   3072  O O    A VAL A 1 208 ? -37.918 -0.595  33.143  0.46 14.61 ? 197  VAL A O    1 
ATOM   3073  O O    B VAL A 1 208 ? -37.512 -0.454  33.315  0.54 16.02 ? 197  VAL A O    1 
ATOM   3074  C CB   A VAL A 1 208 ? -34.812 -1.393  32.143  0.46 14.64 ? 197  VAL A CB   1 
ATOM   3075  C CB   B VAL A 1 208 ? -34.812 -1.484  32.265  0.54 15.48 ? 197  VAL A CB   1 
ATOM   3076  C CG1  A VAL A 1 208 ? -34.105 -2.192  33.202  0.46 12.03 ? 197  VAL A CG1  1 
ATOM   3077  C CG1  B VAL A 1 208 ? -33.821 -1.982  31.260  0.54 15.92 ? 197  VAL A CG1  1 
ATOM   3078  C CG2  A VAL A 1 208 ? -34.020 -1.529  30.869  0.46 24.31 ? 197  VAL A CG2  1 
ATOM   3079  C CG2  B VAL A 1 208 ? -34.778 0.040   32.446  0.54 10.61 ? 197  VAL A CG2  1 
ATOM   3080  H H    A VAL A 1 208 ? -37.018 -0.421  30.797  0.46 13.24 ? 197  VAL A H    1 
ATOM   3081  H H    B VAL A 1 208 ? -36.905 -0.412  30.810  0.54 16.30 ? 197  VAL A H    1 
ATOM   3082  H HA   A VAL A 1 208 ? -36.238 -2.816  31.767  0.46 13.78 ? 197  VAL A HA   1 
ATOM   3083  H HA   B VAL A 1 208 ? -36.246 -2.872  31.770  0.54 16.35 ? 197  VAL A HA   1 
ATOM   3084  H HB   A VAL A 1 208 ? -34.809 -0.460  32.409  0.46 17.56 ? 197  VAL A HB   1 
ATOM   3085  H HB   B VAL A 1 208 ? -34.580 -1.881  33.119  0.54 18.58 ? 197  VAL A HB   1 
ATOM   3086  H HG11 A VAL A 1 208 ? -33.202 -1.852  33.303  0.46 14.43 ? 197  VAL A HG11 1 
ATOM   3087  H HG11 B VAL A 1 208 ? -32.934 -1.691  31.521  0.54 19.10 ? 197  VAL A HG11 1 
ATOM   3088  H HG12 A VAL A 1 208 ? -34.587 -2.104  34.038  0.46 14.43 ? 197  VAL A HG12 1 
ATOM   3089  H HG12 B VAL A 1 208 ? -33.858 -2.950  31.234  0.54 19.10 ? 197  VAL A HG12 1 
ATOM   3090  H HG13 A VAL A 1 208 ? -34.080 -3.123  32.930  0.46 14.43 ? 197  VAL A HG13 1 
ATOM   3091  H HG13 B VAL A 1 208 ? -34.046 -1.618  30.389  0.54 19.10 ? 197  VAL A HG13 1 
ATOM   3092  H HG21 A VAL A 1 208 ? -33.110 -1.235  31.031  0.46 29.17 ? 197  VAL A HG21 1 
ATOM   3093  H HG21 B VAL A 1 208 ? -33.874 0.310   32.672  0.54 12.73 ? 197  VAL A HG21 1 
ATOM   3094  H HG22 A VAL A 1 208 ? -34.024 -2.459  30.593  0.46 29.17 ? 197  VAL A HG22 1 
ATOM   3095  H HG22 B VAL A 1 208 ? -35.051 0.462   31.616  0.54 12.73 ? 197  VAL A HG22 1 
ATOM   3096  H HG23 A VAL A 1 208 ? -34.429 -0.978  30.183  0.46 29.17 ? 197  VAL A HG23 1 
ATOM   3097  H HG23 B VAL A 1 208 ? -35.386 0.287   33.159  0.54 12.73 ? 197  VAL A HG23 1 
ATOM   3098  N N    . HIS A 1 209 ? -37.257 -2.595  33.968  1.00 12.24 ? 198  HIS A N    1 
ATOM   3099  C CA   . HIS A 1 209 ? -37.652 -2.407  35.355  1.00 11.98 ? 198  HIS A CA   1 
ATOM   3100  C C    . HIS A 1 209 ? -36.347 -2.285  36.133  1.00 11.97 ? 198  HIS A C    1 
ATOM   3101  O O    . HIS A 1 209 ? -35.638 -3.265  36.331  1.00 12.48 ? 198  HIS A O    1 
ATOM   3102  C CB   . HIS A 1 209 ? -38.477 -3.582  35.878  1.00 13.52 ? 198  HIS A CB   1 
ATOM   3103  C CG   . HIS A 1 209 ? -38.855 -3.386  37.308  1.00 12.29 ? 198  HIS A CG   1 
ATOM   3104  N ND1  . HIS A 1 209 ? -40.154 -3.168  37.716  1.00 13.16 ? 198  HIS A ND1  1 
ATOM   3105  C CD2  . HIS A 1 209 ? -38.075 -3.261  38.413  1.00 13.24 ? 198  HIS A CD2  1 
ATOM   3106  C CE1  . HIS A 1 209 ? -40.146 -2.923  39.025  1.00 13.50 ? 198  HIS A CE1  1 
ATOM   3107  N NE2  . HIS A 1 209 ? -38.903 -3.010  39.471  1.00 14.00 ? 198  HIS A NE2  1 
ATOM   3108  H H    . HIS A 1 209 ? -37.109 -3.419  33.770  1.00 14.69 ? 198  HIS A H    1 
ATOM   3109  H HA   . HIS A 1 209 ? -38.162 -1.587  35.453  1.00 14.37 ? 198  HIS A HA   1 
ATOM   3110  H HB2  . HIS A 1 209 ? -39.290 -3.660  35.356  1.00 16.23 ? 198  HIS A HB2  1 
ATOM   3111  H HB3  . HIS A 1 209 ? -37.953 -4.396  35.810  1.00 16.23 ? 198  HIS A HB3  1 
ATOM   3112  H HD2  . HIS A 1 209 ? -37.150 -3.354  38.448  1.00 15.88 ? 198  HIS A HD2  1 
ATOM   3113  H HE1  . HIS A 1 209 ? -40.900 -2.781  39.551  1.00 16.20 ? 198  HIS A HE1  1 
ATOM   3114  H HE2  . HIS A 1 209 ? -38.655 -2.907  40.288  1.00 16.80 ? 198  HIS A HE2  1 
ATOM   3115  N N    . ALA A 1 210 ? -36.010 -1.058  36.527  1.00 11.49 ? 199  ALA A N    1 
ATOM   3116  C CA   . ALA A 1 210 ? -34.712 -0.699  37.055  1.00 12.36 ? 199  ALA A CA   1 
ATOM   3117  C C    . ALA A 1 210 ? -34.777 -0.500  38.568  1.00 11.57 ? 199  ALA A C    1 
ATOM   3118  O O    . ALA A 1 210 ? -34.990 0.616   39.049  1.00 12.37 ? 199  ALA A O    1 
ATOM   3119  C CB   . ALA A 1 210 ? -34.244 0.553   36.340  1.00 14.74 ? 199  ALA A CB   1 
ATOM   3120  H H    . ALA A 1 210 ? -36.551 -0.391  36.493  1.00 13.79 ? 199  ALA A H    1 
ATOM   3121  H HA   . ALA A 1 210 ? -34.081 -1.411  36.868  1.00 14.83 ? 199  ALA A HA   1 
ATOM   3122  H HB1  . ALA A 1 210 ? -33.374 0.806   36.684  1.00 17.69 ? 199  ALA A HB1  1 
ATOM   3123  H HB2  . ALA A 1 210 ? -34.184 0.369   35.389  1.00 17.69 ? 199  ALA A HB2  1 
ATOM   3124  H HB3  . ALA A 1 210 ? -34.883 1.265   36.499  1.00 17.69 ? 199  ALA A HB3  1 
ATOM   3125  N N    . GLU A 1 211 ? -34.562 -1.593  39.318  1.00 11.65 ? 200  GLU A N    1 
ATOM   3126  C CA   . GLU A 1 211 ? -34.172 -1.521  40.719  1.00 11.18 ? 200  GLU A CA   1 
ATOM   3127  C C    . GLU A 1 211 ? -33.097 -2.581  40.913  1.00 11.07 ? 200  GLU A C    1 
ATOM   3128  O O    . GLU A 1 211 ? -33.136 -3.615  40.245  1.00 12.52 ? 200  GLU A O    1 
ATOM   3129  C CB   . GLU A 1 211 ? -35.312 -1.824  41.673  1.00 11.97 ? 200  GLU A CB   1 
ATOM   3130  C CG   . GLU A 1 211 ? -36.504 -0.853  41.613  1.00 11.27 ? 200  GLU A CG   1 
ATOM   3131  C CD   . GLU A 1 211 ? -37.632 -1.391  42.477  1.00 12.75 ? 200  GLU A CD   1 
ATOM   3132  O OE1  . GLU A 1 211 ? -38.255 -2.380  42.034  1.00 14.12 ? 200  GLU A OE1  1 
ATOM   3133  O OE2  . GLU A 1 211 ? -37.825 -0.875  43.613  1.00 12.92 ? 200  GLU A OE2  1 
ATOM   3134  H H    . GLU A 1 211 ? -34.640 -2.397  39.024  1.00 13.98 ? 200  GLU A H    1 
ATOM   3135  H HA   . GLU A 1 211 ? -33.804 -0.648  40.924  1.00 13.42 ? 200  GLU A HA   1 
ATOM   3136  H HB2  . GLU A 1 211 ? -35.650 -2.712  41.475  1.00 14.37 ? 200  GLU A HB2  1 
ATOM   3137  H HB3  . GLU A 1 211 ? -34.967 -1.805  42.579  1.00 14.37 ? 200  GLU A HB3  1 
ATOM   3138  H HG2  . GLU A 1 211 ? -36.237 0.015   41.955  1.00 13.53 ? 200  GLU A HG2  1 
ATOM   3139  H HG3  . GLU A 1 211 ? -36.821 -0.779  40.699  1.00 13.53 ? 200  GLU A HG3  1 
ATOM   3140  N N    . ASN A 1 212 ? -32.205 -2.375  41.881  1.00 11.52 ? 201  ASN A N    1 
ATOM   3141  C CA   . ASN A 1 212 ? -31.195 -3.395  42.152  1.00 12.16 ? 201  ASN A CA   1 
ATOM   3142  C C    . ASN A 1 212 ? -31.827 -4.547  42.950  1.00 11.92 ? 201  ASN A C    1 
ATOM   3143  O O    . ASN A 1 212 ? -32.016 -4.451  44.166  1.00 12.35 ? 201  ASN A O    1 
ATOM   3144  C CB   . ASN A 1 212 ? -30.004 -2.822  42.895  1.00 12.35 ? 201  ASN A CB   1 
ATOM   3145  C CG   . ASN A 1 212 ? -28.872 -3.813  42.962  1.00 10.93 ? 201  ASN A CG   1 
ATOM   3146  O OD1  . ASN A 1 212 ? -29.056 -4.932  43.453  1.00 12.87 ? 201  ASN A OD1  1 
ATOM   3147  N ND2  . ASN A 1 212 ? -27.727 -3.454  42.440  1.00 12.12 ? 201  ASN A ND2  1 
ATOM   3148  H H    . ASN A 1 212 ? -32.162 -1.676  42.381  1.00 13.83 ? 201  ASN A H    1 
ATOM   3149  H HA   . ASN A 1 212 ? -30.877 -3.754  41.309  1.00 14.59 ? 201  ASN A HA   1 
ATOM   3150  H HB2  . ASN A 1 212 ? -29.688 -2.030  42.433  1.00 14.82 ? 201  ASN A HB2  1 
ATOM   3151  H HB3  . ASN A 1 212 ? -30.267 -2.600  43.802  1.00 14.82 ? 201  ASN A HB3  1 
ATOM   3152  H HD21 . ASN A 1 212 ? -27.058 -3.994  42.459  1.00 14.55 ? 201  ASN A HD21 1 
ATOM   3153  H HD22 . ASN A 1 212 ? -27.644 -2.678  42.078  1.00 14.55 ? 201  ASN A HD22 1 
ATOM   3154  N N    . GLY A 1 213 ? -32.122 -5.651  42.257  1.00 12.06 ? 202  GLY A N    1 
ATOM   3155  C CA   . GLY A 1 213 ? -32.786 -6.789  42.866  1.00 12.29 ? 202  GLY A CA   1 
ATOM   3156  C C    . GLY A 1 213 ? -31.975 -7.489  43.911  1.00 12.05 ? 202  GLY A C    1 
ATOM   3157  O O    . GLY A 1 213 ? -32.538 -8.107  44.815  1.00 13.18 ? 202  GLY A O    1 
ATOM   3158  H H    . GLY A 1 213 ? -31.943 -5.759  41.422  1.00 14.47 ? 202  GLY A H    1 
ATOM   3159  H HA2  . GLY A 1 213 ? -33.612 -6.491  43.276  1.00 14.75 ? 202  GLY A HA2  1 
ATOM   3160  H HA3  . GLY A 1 213 ? -33.007 -7.433  42.175  1.00 14.75 ? 202  GLY A HA3  1 
ATOM   3161  N N    . ASP A 1 214 ? -30.660 -7.449  43.800  1.00 12.88 ? 203  ASP A N    1 
ATOM   3162  C CA   . ASP A 1 214 ? -29.822 -8.115  44.798  1.00 13.75 ? 203  ASP A CA   1 
ATOM   3163  C C    . ASP A 1 214 ? -29.887 -7.377  46.129  1.00 12.61 ? 203  ASP A C    1 
ATOM   3164  O O    . ASP A 1 214 ? -30.005 -8.003  47.191  1.00 13.91 ? 203  ASP A O    1 
ATOM   3165  C CB   . ASP A 1 214 ? -28.382 -8.166  44.293  1.00 12.84 ? 203  ASP A CB   1 
ATOM   3166  C CG   . ASP A 1 214 ? -28.070 -9.384  43.442  1.00 15.69 ? 203  ASP A CG   1 
ATOM   3167  O OD1  . ASP A 1 214 ? -29.007 -10.044 42.982  1.00 16.06 ? 203  ASP A OD1  1 
ATOM   3168  O OD2  . ASP A 1 214 ? -26.865 -9.708  43.249  1.00 14.89 ? 203  ASP A OD2  1 
ATOM   3169  H H    . ASP A 1 214 ? -30.227 -7.052  43.172  1.00 15.46 ? 203  ASP A H    1 
ATOM   3170  H HA   . ASP A 1 214 ? -30.136 -9.023  44.932  1.00 16.49 ? 203  ASP A HA   1 
ATOM   3171  H HB2  . ASP A 1 214 ? -28.212 -7.377  43.754  1.00 15.41 ? 203  ASP A HB2  1 
ATOM   3172  H HB3  . ASP A 1 214 ? -27.783 -8.177  45.056  1.00 15.41 ? 203  ASP A HB3  1 
ATOM   3173  N N    . ILE A 1 215 ? -29.735 -6.043  46.092  1.00 12.23 ? 204  ILE A N    1 
ATOM   3174  C CA   . ILE A 1 215 ? -29.857 -5.263  47.315  1.00 13.37 ? 204  ILE A CA   1 
ATOM   3175  C C    . ILE A 1 215 ? -31.239 -5.458  47.933  1.00 13.48 ? 204  ILE A C    1 
ATOM   3176  O O    . ILE A 1 215 ? -31.373 -5.660  49.149  1.00 13.92 ? 204  ILE A O    1 
ATOM   3177  C CB   . ILE A 1 215 ? -29.557 -3.771  47.065  1.00 12.52 ? 204  ILE A CB   1 
ATOM   3178  C CG1  . ILE A 1 215 ? -28.131 -3.572  46.536  1.00 13.98 ? 204  ILE A CG1  1 
ATOM   3179  C CG2  . ILE A 1 215 ? -29.758 -3.020  48.369  1.00 13.84 ? 204  ILE A CG2  1 
ATOM   3180  C CD1  . ILE A 1 215 ? -27.838 -2.123  46.139  1.00 14.80 ? 204  ILE A CD1  1 
ATOM   3181  H H    . ILE A 1 215 ? -29.566 -5.583  45.385  1.00 14.68 ? 204  ILE A H    1 
ATOM   3182  H HA   . ILE A 1 215 ? -29.204 -5.589  47.954  1.00 16.05 ? 204  ILE A HA   1 
ATOM   3183  H HB   . ILE A 1 215 ? -30.185 -3.431  46.409  1.00 15.02 ? 204  ILE A HB   1 
ATOM   3184  H HG12 . ILE A 1 215 ? -27.500 -3.827  47.227  1.00 16.77 ? 204  ILE A HG12 1 
ATOM   3185  H HG13 . ILE A 1 215 ? -28.006 -4.128  45.751  1.00 16.77 ? 204  ILE A HG13 1 
ATOM   3186  H HG21 . ILE A 1 215 ? -29.571 -2.079  48.223  1.00 16.61 ? 204  ILE A HG21 1 
ATOM   3187  H HG22 . ILE A 1 215 ? -30.676 -3.134  48.661  1.00 16.61 ? 204  ILE A HG22 1 
ATOM   3188  H HG23 . ILE A 1 215 ? -29.151 -3.378  49.036  1.00 16.61 ? 204  ILE A HG23 1 
ATOM   3189  H HD11 . ILE A 1 215 ? -26.926 -2.063  45.814  1.00 17.76 ? 204  ILE A HD11 1 
ATOM   3190  H HD12 . ILE A 1 215 ? -28.457 -1.856  45.441  1.00 17.76 ? 204  ILE A HD12 1 
ATOM   3191  H HD13 . ILE A 1 215 ? -27.951 -1.554  46.916  1.00 17.76 ? 204  ILE A HD13 1 
ATOM   3192  N N    . ILE A 1 216 ? -32.288 -5.388  47.106  1.00 12.23 ? 205  ILE A N    1 
ATOM   3193  C CA   . ILE A 1 216 ? -33.646 -5.585  47.601  1.00 14.46 ? 205  ILE A CA   1 
ATOM   3194  C C    . ILE A 1 216 ? -33.792 -6.945  48.275  1.00 13.19 ? 205  ILE A C    1 
ATOM   3195  O O    . ILE A 1 216 ? -34.397 -7.055  49.326  1.00 14.45 ? 205  ILE A O    1 
ATOM   3196  C CB   . ILE A 1 216 ? -34.662 -5.376  46.485  1.00 13.32 ? 205  ILE A CB   1 
ATOM   3197  C CG1  . ILE A 1 216 ? -34.693 -3.902  46.042  1.00 14.33 ? 205  ILE A CG1  1 
ATOM   3198  C CG2  . ILE A 1 216 ? -36.039 -5.849  46.918  1.00 15.50 ? 205  ILE A CG2  1 
ATOM   3199  C CD1  . ILE A 1 216 ? -35.430 -3.658  44.726  1.00 14.31 ? 205  ILE A CD1  1 
ATOM   3200  H H    . ILE A 1 216 ? -32.237 -5.228  46.262  1.00 14.67 ? 205  ILE A H    1 
ATOM   3201  H HA   . ILE A 1 216 ? -33.822 -4.912  48.277  1.00 17.35 ? 205  ILE A HA   1 
ATOM   3202  H HB   . ILE A 1 216 ? -34.386 -5.911  45.725  1.00 15.98 ? 205  ILE A HB   1 
ATOM   3203  H HG12 . ILE A 1 216 ? -35.136 -3.380  46.729  1.00 17.19 ? 205  ILE A HG12 1 
ATOM   3204  H HG13 . ILE A 1 216 ? -33.781 -3.591  45.932  1.00 17.19 ? 205  ILE A HG13 1 
ATOM   3205  H HG21 . ILE A 1 216 ? -36.665 -5.705  46.191  1.00 18.60 ? 205  ILE A HG21 1 
ATOM   3206  H HG22 . ILE A 1 216 ? -35.995 -6.794  47.134  1.00 18.60 ? 205  ILE A HG22 1 
ATOM   3207  H HG23 . ILE A 1 216 ? -36.316 -5.344  47.698  1.00 18.60 ? 205  ILE A HG23 1 
ATOM   3208  H HD11 . ILE A 1 216 ? -35.403 -2.710  44.520  1.00 17.18 ? 205  ILE A HD11 1 
ATOM   3209  H HD12 . ILE A 1 216 ? -34.993 -4.162  44.022  1.00 17.18 ? 205  ILE A HD12 1 
ATOM   3210  H HD13 . ILE A 1 216 ? -36.350 -3.951  44.820  1.00 17.18 ? 205  ILE A HD13 1 
ATOM   3211  N N    . ALA A 1 217 ? -33.284 -8.000  47.643  1.00 14.01 ? 206  ALA A N    1 
ATOM   3212  C CA   . ALA A 1 217 ? -33.450 -9.327  48.226  1.00 15.41 ? 206  ALA A CA   1 
ATOM   3213  C C    . ALA A 1 217 ? -32.832 -9.384  49.617  1.00 14.71 ? 206  ALA A C    1 
ATOM   3214  O O    . ALA A 1 217 ? -33.400 -9.996  50.528  1.00 17.97 ? 206  ALA A O    1 
ATOM   3215  C CB   . ALA A 1 217 ? -32.854 -10.389 47.295  1.00 17.26 ? 206  ALA A CB   1 
ATOM   3216  H H    . ALA A 1 217 ? -32.852 -7.978  46.899  1.00 16.82 ? 206  ALA A H    1 
ATOM   3217  H HA   . ALA A 1 217 ? -34.398 -9.512  48.316  1.00 18.49 ? 206  ALA A HA   1 
ATOM   3218  H HB1  . ALA A 1 217 ? -32.973 -11.263 47.697  1.00 20.71 ? 206  ALA A HB1  1 
ATOM   3219  H HB2  . ALA A 1 217 ? -33.312 -10.352 46.441  1.00 20.71 ? 206  ALA A HB2  1 
ATOM   3220  H HB3  . ALA A 1 217 ? -31.909 -10.206 47.172  1.00 20.71 ? 206  ALA A HB3  1 
ATOM   3221  N N    . GLU A 1 218 ? -31.654 -8.773  49.802  1.00 14.62 ? 207  GLU A N    1 
ATOM   3222  C CA   . GLU A 1 218 ? -31.007 -8.770  51.119  1.00 15.28 ? 207  GLU A CA   1 
ATOM   3223  C C    . GLU A 1 218 ? -31.808 -7.930  52.094  1.00 14.77 ? 207  GLU A C    1 
ATOM   3224  O O    . GLU A 1 218 ? -32.023 -8.327  53.236  1.00 17.51 ? 207  GLU A O    1 
ATOM   3225  C CB   . GLU A 1 218 ? -29.579 -8.224  50.987  1.00 17.33 ? 207  GLU A CB   1 
ATOM   3226  C CG   . GLU A 1 218 ? -28.685 -9.047  50.074  1.00 17.97 ? 207  GLU A CG   1 
ATOM   3227  C CD   . GLU A 1 218 ? -28.021 -10.227 50.721  1.00 18.95 ? 207  GLU A CD   1 
ATOM   3228  O OE1  . GLU A 1 218 ? -28.217 -10.501 51.913  1.00 21.37 ? 207  GLU A OE1  1 
ATOM   3229  O OE2  . GLU A 1 218 ? -27.254 -10.915 49.983  1.00 21.33 ? 207  GLU A OE2  1 
ATOM   3230  H H    . GLU A 1 218 ? -31.216 -8.358  49.190  1.00 17.54 ? 207  GLU A H    1 
ATOM   3231  H HA   . GLU A 1 218 ? -30.961 -9.677  51.459  1.00 18.34 ? 207  GLU A HA   1 
ATOM   3232  H HB2  . GLU A 1 218 ? -29.621 -7.324  50.627  1.00 20.80 ? 207  GLU A HB2  1 
ATOM   3233  H HB3  . GLU A 1 218 ? -29.169 -8.208  51.866  1.00 20.80 ? 207  GLU A HB3  1 
ATOM   3234  H HG2  . GLU A 1 218 ? -29.221 -9.381  49.338  1.00 21.57 ? 207  GLU A HG2  1 
ATOM   3235  H HG3  . GLU A 1 218 ? -27.985 -8.471  49.730  1.00 21.57 ? 207  GLU A HG3  1 
ATOM   3236  N N    . GLU A 1 219 ? -32.234 -6.750  51.666  1.00 15.99 ? 208  GLU A N    1 
ATOM   3237  C CA   . GLU A 1 219 ? -32.958 -5.844  52.544  1.00 15.58 ? 208  GLU A CA   1 
ATOM   3238  C C    . GLU A 1 219 ? -34.313 -6.401  52.967  1.00 15.81 ? 208  GLU A C    1 
ATOM   3239  O O    . GLU A 1 219 ? -34.723 -6.219  54.125  1.00 18.24 ? 208  GLU A O    1 
ATOM   3240  C CB   . GLU A 1 219 ? -33.088 -4.457  51.903  1.00 15.69 ? 208  GLU A CB   1 
ATOM   3241  C CG   . GLU A 1 219 ? -31.760 -3.688  51.914  1.00 18.35 ? 208  GLU A CG   1 
ATOM   3242  C CD   . GLU A 1 219 ? -31.388 -3.268  53.315  1.00 17.99 ? 208  GLU A CD   1 
ATOM   3243  O OE1  . GLU A 1 219 ? -32.034 -2.382  53.870  1.00 19.79 ? 208  GLU A OE1  1 
ATOM   3244  O OE2  . GLU A 1 219 ? -30.531 -3.941  53.957  1.00 20.13 ? 208  GLU A OE2  1 
ATOM   3245  H H    . GLU A 1 219 ? -32.115 -6.449  50.869  1.00 19.19 ? 208  GLU A H    1 
ATOM   3246  H HA   . GLU A 1 219 ? -32.435 -5.733  53.353  1.00 18.70 ? 208  GLU A HA   1 
ATOM   3247  H HB2  . GLU A 1 219 ? -33.370 -4.558  50.980  1.00 18.83 ? 208  GLU A HB2  1 
ATOM   3248  H HB3  . GLU A 1 219 ? -33.741 -3.938  52.397  1.00 18.83 ? 208  GLU A HB3  1 
ATOM   3249  H HG2  . GLU A 1 219 ? -31.055 -4.258  51.569  1.00 22.02 ? 208  GLU A HG2  1 
ATOM   3250  H HG3  . GLU A 1 219 ? -31.846 -2.890  51.369  1.00 22.02 ? 208  GLU A HG3  1 
ATOM   3251  N N    . GLN A 1 220 ? -35.022 -7.077  52.063  1.00 17.14 ? 209  GLN A N    1 
ATOM   3252  C CA   . GLN A 1 220 ? -36.303 -7.669  52.443  1.00 18.43 ? 209  GLN A CA   1 
ATOM   3253  C C    . GLN A 1 220 ? -36.107 -8.573  53.629  1.00 19.25 ? 209  GLN A C    1 
ATOM   3254  O O    . GLN A 1 220 ? -36.904 -8.565  54.570  1.00 20.60 ? 209  GLN A O    1 
ATOM   3255  C CB   . GLN A 1 220 ? -36.877 -8.507  51.292  1.00 19.10 ? 209  GLN A CB   1 
ATOM   3256  C CG   . GLN A 1 220 ? -37.452 -7.717  50.186  1.00 21.70 ? 209  GLN A CG   1 
ATOM   3257  C CD   . GLN A 1 220 ? -37.847 -8.599  48.988  1.00 21.76 ? 209  GLN A CD   1 
ATOM   3258  O OE1  . GLN A 1 220 ? -37.341 -9.706  48.802  1.00 26.79 ? 209  GLN A OE1  1 
ATOM   3259  N NE2  . GLN A 1 220 ? -38.713 -8.087  48.172  1.00 23.32 ? 209  GLN A NE2  1 
ATOM   3260  H H    . GLN A 1 220 ? -34.791 -7.204  51.245  1.00 20.56 ? 209  GLN A H    1 
ATOM   3261  H HA   . GLN A 1 220 ? -36.937 -6.972  52.676  1.00 22.11 ? 209  GLN A HA   1 
ATOM   3262  H HB2  . GLN A 1 220 ? -36.167 -9.056  50.924  1.00 22.92 ? 209  GLN A HB2  1 
ATOM   3263  H HB3  . GLN A 1 220 ? -37.581 -9.076  51.644  1.00 22.92 ? 209  GLN A HB3  1 
ATOM   3264  H HG2  . GLN A 1 220 ? -38.248 -7.261  50.500  1.00 26.04 ? 209  GLN A HG2  1 
ATOM   3265  H HG3  . GLN A 1 220 ? -36.795 -7.072  49.882  1.00 26.04 ? 209  GLN A HG3  1 
ATOM   3266  H HE21 . GLN A 1 220 ? -39.029 -7.300  48.318  1.00 27.99 ? 209  GLN A HE21 1 
ATOM   3267  H HE22 . GLN A 1 220 ? -38.972 -8.533  47.484  1.00 27.99 ? 209  GLN A HE22 1 
ATOM   3268  N N    . GLN A 1 221 ? -35.080 -9.420  53.565  1.00 19.86 ? 210  GLN A N    1 
ATOM   3269  C CA   . GLN A 1 221 ? -34.877 -10.381 54.623  1.00 22.94 ? 210  GLN A CA   1 
ATOM   3270  C C    . GLN A 1 221 ? -34.460 -9.706  55.923  1.00 22.25 ? 210  GLN A C    1 
ATOM   3271  O O    . GLN A 1 221 ? -34.969 -10.046 57.002  1.00 25.26 ? 210  GLN A O    1 
ATOM   3272  C CB   . GLN A 1 221 ? -33.879 -11.449 54.168  1.00 32.14 ? 210  GLN A CB   1 
ATOM   3273  C CG   . GLN A 1 221 ? -33.980 -12.711 55.043  1.00 40.44 ? 210  GLN A CG   1 
ATOM   3274  C CD   . GLN A 1 221 ? -35.424 -13.242 55.206  1.00 45.06 ? 210  GLN A CD   1 
ATOM   3275  O OE1  . GLN A 1 221 ? -36.076 -13.640 54.230  1.00 45.55 ? 210  GLN A OE1  1 
ATOM   3276  N NE2  . GLN A 1 221 ? -35.919 -13.249 56.452  1.00 49.73 ? 210  GLN A NE2  1 
ATOM   3277  H H    . GLN A 1 221 ? -34.502 -9.453  52.930  1.00 23.83 ? 210  GLN A H    1 
ATOM   3278  H HA   . GLN A 1 221 ? -35.720 -10.830 54.791  1.00 27.53 ? 210  GLN A HA   1 
ATOM   3279  H HB2  . GLN A 1 221 ? -34.071 -11.698 53.250  1.00 38.56 ? 210  GLN A HB2  1 
ATOM   3280  H HB3  . GLN A 1 221 ? -32.978 -11.099 54.241  1.00 38.56 ? 210  GLN A HB3  1 
ATOM   3281  H HG2  . GLN A 1 221 ? -33.449 -13.415 54.639  1.00 48.53 ? 210  GLN A HG2  1 
ATOM   3282  H HG3  . GLN A 1 221 ? -33.638 -12.506 55.927  1.00 48.53 ? 210  GLN A HG3  1 
ATOM   3283  H HE21 . GLN A 1 221 ? -35.438 -12.967 57.107  1.00 59.68 ? 210  GLN A HE21 1 
ATOM   3284  H HE22 . GLN A 1 221 ? -36.717 -13.534 56.596  1.00 59.68 ? 210  GLN A HE22 1 
ATOM   3285  N N    . ARG A 1 222 ? -33.613 -8.687  55.836  1.00 21.66 ? 211  ARG A N    1 
ATOM   3286  C CA   . ARG A 1 222 ? -33.207 -7.955  57.026  1.00 21.87 ? 211  ARG A CA   1 
ATOM   3287  C C    . ARG A 1 222 ? -34.396 -7.280  57.691  1.00 19.84 ? 211  ARG A C    1 
ATOM   3288  O O    . ARG A 1 222 ? -34.564 -7.350  58.919  1.00 23.14 ? 211  ARG A O    1 
ATOM   3289  C CB   . ARG A 1 222 ? -32.172 -6.916  56.619  1.00 20.90 ? 211  ARG A CB   1 
ATOM   3290  C CG   . ARG A 1 222 ? -31.577 -6.214  57.819  1.00 22.09 ? 211  ARG A CG   1 
ATOM   3291  C CD   . ARG A 1 222 ? -30.551 -5.160  57.415  1.00 22.48 ? 211  ARG A CD   1 
ATOM   3292  N NE   . ARG A 1 222 ? -31.199 -4.027  56.749  1.00 22.14 ? 211  ARG A NE   1 
ATOM   3293  C CZ   . ARG A 1 222 ? -31.914 -3.106  57.377  1.00 23.14 ? 211  ARG A CZ   1 
ATOM   3294  N NH1  . ARG A 1 222 ? -32.081 -3.146  58.710  1.00 26.31 ? 211  ARG A NH1  1 
ATOM   3295  N NH2  . ARG A 1 222 ? -32.451 -2.134  56.687  1.00 27.69 ? 211  ARG A NH2  1 
ATOM   3296  H H    . ARG A 1 222 ? -33.262 -8.402  55.105  1.00 25.99 ? 211  ARG A H    1 
ATOM   3297  H HA   . ARG A 1 222 ? -32.800 -8.565  57.662  1.00 26.25 ? 211  ARG A HA   1 
ATOM   3298  H HB2  . ARG A 1 222 ? -31.454 -7.353  56.136  1.00 25.08 ? 211  ARG A HB2  1 
ATOM   3299  H HB3  . ARG A 1 222 ? -32.596 -6.248  56.057  1.00 25.08 ? 211  ARG A HB3  1 
ATOM   3300  H HG2  . ARG A 1 222 ? -32.285 -5.773  58.314  1.00 26.51 ? 211  ARG A HG2  1 
ATOM   3301  H HG3  . ARG A 1 222 ? -31.133 -6.868  58.382  1.00 26.51 ? 211  ARG A HG3  1 
ATOM   3302  H HD2  . ARG A 1 222 ? -30.099 -4.831  58.207  1.00 26.97 ? 211  ARG A HD2  1 
ATOM   3303  H HD3  . ARG A 1 222 ? -29.912 -5.551  56.799  1.00 26.97 ? 211  ARG A HD3  1 
ATOM   3304  H HE   . ARG A 1 222 ? -31.071 -3.929  55.905  1.00 26.57 ? 211  ARG A HE   1 
ATOM   3305  H HH11 . ARG A 1 222 ? -31.729 -3.783  59.169  1.00 31.57 ? 211  ARG A HH11 1 
ATOM   3306  H HH12 . ARG A 1 222 ? -32.546 -2.539  59.104  1.00 31.57 ? 211  ARG A HH12 1 
ATOM   3307  H HH21 . ARG A 1 222 ? -32.344 -2.102  55.834  1.00 33.23 ? 211  ARG A HH21 1 
ATOM   3308  H HH22 . ARG A 1 222 ? -32.914 -1.528  57.085  1.00 33.23 ? 211  ARG A HH22 1 
ATOM   3309  N N    A ILE A 1 223 ? -35.255 -6.654  56.882  0.40 22.04 ? 212  ILE A N    1 
ATOM   3310  N N    B ILE A 1 223 ? -35.250 -6.650  56.896  0.60 18.07 ? 212  ILE A N    1 
ATOM   3311  C CA   A ILE A 1 223 ? -36.405 -5.907  57.385  0.40 23.09 ? 212  ILE A CA   1 
ATOM   3312  C CA   B ILE A 1 223 ? -36.378 -5.919  57.457  0.60 18.23 ? 212  ILE A CA   1 
ATOM   3313  C C    A ILE A 1 223 ? -37.449 -6.847  57.981  0.40 24.03 ? 212  ILE A C    1 
ATOM   3314  C C    B ILE A 1 223 ? -37.425 -6.880  58.021  0.60 19.36 ? 212  ILE A C    1 
ATOM   3315  O O    A ILE A 1 223 ? -38.025 -6.565  59.036  0.40 26.67 ? 212  ILE A O    1 
ATOM   3316  O O    B ILE A 1 223 ? -37.908 -6.695  59.141  0.60 19.68 ? 212  ILE A O    1 
ATOM   3317  C CB   A ILE A 1 223 ? -36.982 -5.057  56.234  0.40 20.47 ? 212  ILE A CB   1 
ATOM   3318  C CB   B ILE A 1 223 ? -36.920 -4.945  56.392  0.60 18.56 ? 212  ILE A CB   1 
ATOM   3319  C CG1  A ILE A 1 223 ? -36.013 -3.926  55.865  0.40 22.45 ? 212  ILE A CG1  1 
ATOM   3320  C CG1  B ILE A 1 223 ? -35.881 -3.845  56.156  0.60 20.14 ? 212  ILE A CG1  1 
ATOM   3321  C CG2  A ILE A 1 223 ? -38.367 -4.521  56.583  0.40 20.36 ? 212  ILE A CG2  1 
ATOM   3322  C CG2  B ILE A 1 223 ? -38.230 -4.338  56.823  0.60 21.45 ? 212  ILE A CG2  1 
ATOM   3323  C CD1  A ILE A 1 223 ? -35.916 -2.800  56.892  0.40 22.86 ? 212  ILE A CD1  1 
ATOM   3324  C CD1  B ILE A 1 223 ? -36.073 -3.068  54.853  0.60 19.85 ? 212  ILE A CD1  1 
ATOM   3325  H H    A ILE A 1 223 ? -35.189 -6.649  56.025  0.40 26.45 ? 212  ILE A H    1 
ATOM   3326  H H    B ILE A 1 223 ? -35.201 -6.630  56.038  0.60 21.68 ? 212  ILE A H    1 
ATOM   3327  H HA   A ILE A 1 223 ? -36.109 -5.304  58.085  0.40 27.70 ? 212  ILE A HA   1 
ATOM   3328  H HA   B ILE A 1 223 ? -36.054 -5.383  58.197  0.60 21.88 ? 212  ILE A HA   1 
ATOM   3329  H HB   A ILE A 1 223 ? -37.074 -5.632  55.459  0.40 24.56 ? 212  ILE A HB   1 
ATOM   3330  H HB   B ILE A 1 223 ? -37.057 -5.430  55.563  0.60 22.28 ? 212  ILE A HB   1 
ATOM   3331  H HG12 A ILE A 1 223 ? -35.126 -4.302  55.759  0.40 26.94 ? 212  ILE A HG12 1 
ATOM   3332  H HG12 B ILE A 1 223 ? -35.928 -3.209  56.887  0.60 24.17 ? 212  ILE A HG12 1 
ATOM   3333  H HG13 A ILE A 1 223 ? -36.303 -3.533  55.027  0.40 26.94 ? 212  ILE A HG13 1 
ATOM   3334  H HG13 B ILE A 1 223 ? -34.999 -4.249  56.130  0.60 24.17 ? 212  ILE A HG13 1 
ATOM   3335  H HG21 A ILE A 1 223 ? -38.698 -3.993  55.840  0.40 24.43 ? 212  ILE A HG21 1 
ATOM   3336  H HG21 B ILE A 1 223 ? -38.540 -3.732  56.132  0.60 25.74 ? 212  ILE A HG21 1 
ATOM   3337  H HG22 A ILE A 1 223 ? -38.962 -5.269  56.748  0.40 24.43 ? 212  ILE A HG22 1 
ATOM   3338  H HG22 B ILE A 1 223 ? -38.878 -5.047  56.957  0.60 25.74 ? 212  ILE A HG22 1 
ATOM   3339  H HG23 A ILE A 1 223 ? -38.301 -3.969  57.378  0.40 24.43 ? 212  ILE A HG23 1 
ATOM   3340  H HG23 B ILE A 1 223 ? -38.095 -3.852  57.652  0.60 25.74 ? 212  ILE A HG23 1 
ATOM   3341  H HD11 A ILE A 1 223 ? -35.284 -2.136  56.574  0.40 27.44 ? 212  ILE A HD11 1 
ATOM   3342  H HD11 B ILE A 1 223 ? -35.379 -2.395  54.781  0.60 23.82 ? 212  ILE A HD11 1 
ATOM   3343  H HD12 A ILE A 1 223 ? -36.792 -2.397  57.003  0.40 27.44 ? 212  ILE A HD12 1 
ATOM   3344  H HD12 B ILE A 1 223 ? -36.015 -3.686  54.107  0.60 23.82 ? 212  ILE A HD12 1 
ATOM   3345  H HD13 A ILE A 1 223 ? -35.612 -3.168  57.737  0.40 27.44 ? 212  ILE A HD13 1 
ATOM   3346  H HD13 B ILE A 1 223 ? -36.946 -2.644  54.865  0.60 23.82 ? 212  ILE A HD13 1 
ATOM   3347  N N    . LEU A 1 224 ? -37.738 -7.954  57.297  1.00 21.37 ? 213  LEU A N    1 
ATOM   3348  C CA   . LEU A 1 224 ? -38.645 -8.960  57.857  1.00 25.08 ? 213  LEU A CA   1 
ATOM   3349  C C    . LEU A 1 224 ? -38.110 -9.506  59.175  1.00 28.72 ? 213  LEU A C    1 
ATOM   3350  O O    . LEU A 1 224 ? -38.876 -9.713  60.131  1.00 27.16 ? 213  LEU A O    1 
ATOM   3351  C CB   . LEU A 1 224 ? -38.853 -10.095 56.850  1.00 22.88 ? 213  LEU A CB   1 
ATOM   3352  C CG   . LEU A 1 224 ? -39.788 -9.774  55.682  1.00 21.83 ? 213  LEU A CG   1 
ATOM   3353  C CD1  . LEU A 1 224 ? -39.696 -10.902 54.709  1.00 23.71 ? 213  LEU A CD1  1 
ATOM   3354  C CD2  . LEU A 1 224 ? -41.210 -9.586  56.193  1.00 25.14 ? 213  LEU A CD2  1 
ATOM   3355  H H    . LEU A 1 224 ? -37.437 -8.131  56.511  1.00 25.64 ? 213  LEU A H    1 
ATOM   3356  H HA   . LEU A 1 224 ? -39.506 -8.548  58.030  1.00 30.10 ? 213  LEU A HA   1 
ATOM   3357  H HB2  . LEU A 1 224 ? -37.991 -10.335 56.475  1.00 27.46 ? 213  LEU A HB2  1 
ATOM   3358  H HB3  . LEU A 1 224 ? -39.225 -10.858 57.320  1.00 27.46 ? 213  LEU A HB3  1 
ATOM   3359  H HG   . LEU A 1 224 ? -39.501 -8.958  55.244  1.00 26.20 ? 213  LEU A HG   1 
ATOM   3360  H HD11 . LEU A 1 224 ? -40.283 -10.719 53.958  1.00 28.45 ? 213  LEU A HD11 1 
ATOM   3361  H HD12 . LEU A 1 224 ? -38.779 -10.979 54.402  1.00 28.45 ? 213  LEU A HD12 1 
ATOM   3362  H HD13 . LEU A 1 224 ? -39.968 -11.722 55.150  1.00 28.45 ? 213  LEU A HD13 1 
ATOM   3363  H HD21 . LEU A 1 224 ? -41.790 -9.383  55.443  1.00 30.17 ? 213  LEU A HD21 1 
ATOM   3364  H HD22 . LEU A 1 224 ? -41.501 -10.404 56.626  1.00 30.17 ? 213  LEU A HD22 1 
ATOM   3365  H HD23 . LEU A 1 224 ? -41.222 -8.853  56.829  1.00 30.17 ? 213  LEU A HD23 1 
ATOM   3366  N N    . ASP A 1 225 ? -36.803 -9.751  59.242  1.00 25.43 ? 214  ASP A N    1 
ATOM   3367  C CA   . ASP A 1 225 ? -36.207 -10.320 60.443  1.00 27.36 ? 214  ASP A CA   1 
ATOM   3368  C C    . ASP A 1 225 ? -36.272 -9.366  61.623  1.00 29.73 ? 214  ASP A C    1 
ATOM   3369  O O    . ASP A 1 225 ? -36.255 -9.816  62.779  1.00 33.62 ? 214  ASP A O    1 
ATOM   3370  C CB   . ASP A 1 225 ? -34.749 -10.716 60.173  1.00 32.98 ? 214  ASP A CB   1 
ATOM   3371  C CG   . ASP A 1 225 ? -34.617 -11.981 59.322  1.00 35.90 ? 214  ASP A CG   1 
ATOM   3372  O OD1  . ASP A 1 225 ? -35.626 -12.674 59.065  1.00 37.28 ? 214  ASP A OD1  1 
ATOM   3373  O OD2  . ASP A 1 225 ? -33.483 -12.269 58.878  1.00 42.32 ? 214  ASP A OD2  1 
ATOM   3374  H H    . ASP A 1 225 ? -36.244 -9.597  58.608  1.00 30.51 ? 214  ASP A H    1 
ATOM   3375  H HA   . ASP A 1 225 ? -36.694 -11.124 60.684  1.00 32.83 ? 214  ASP A HA   1 
ATOM   3376  H HB2  . ASP A 1 225 ? -34.309 -9.991  59.702  1.00 39.58 ? 214  ASP A HB2  1 
ATOM   3377  H HB3  . ASP A 1 225 ? -34.305 -10.878 61.020  1.00 39.58 ? 214  ASP A HB3  1 
ATOM   3378  N N    . LEU A 1 226 ? -36.373 -8.066  61.369  1.00 27.94 ? 215  LEU A N    1 
ATOM   3379  C CA   . LEU A 1 226 ? -36.626 -7.103  62.440  1.00 28.23 ? 215  LEU A CA   1 
ATOM   3380  C C    . LEU A 1 226 ? -38.075 -7.079  62.893  1.00 30.83 ? 215  LEU A C    1 
ATOM   3381  O O    . LEU A 1 226 ? -38.395 -6.362  63.851  1.00 34.26 ? 215  LEU A O    1 
ATOM   3382  C CB   . LEU A 1 226 ? -36.218 -5.695  61.996  1.00 27.82 ? 215  LEU A CB   1 
ATOM   3383  C CG   . LEU A 1 226 ? -34.728 -5.459  61.811  1.00 31.12 ? 215  LEU A CG   1 
ATOM   3384  C CD1  . LEU A 1 226 ? -34.461 -4.095  61.205  1.00 32.48 ? 215  LEU A CD1  1 
ATOM   3385  C CD2  . LEU A 1 226 ? -33.991 -5.588  63.114  1.00 33.57 ? 215  LEU A CD2  1 
ATOM   3386  H H    . LEU A 1 226 ? -36.299 -7.715  60.588  1.00 33.53 ? 215  LEU A H    1 
ATOM   3387  H HA   . LEU A 1 226 ? -36.081 -7.340  63.207  1.00 33.88 ? 215  LEU A HA   1 
ATOM   3388  H HB2  . LEU A 1 226 ? -36.647 -5.507  61.147  1.00 33.38 ? 215  LEU A HB2  1 
ATOM   3389  H HB3  . LEU A 1 226 ? -36.530 -5.063  62.662  1.00 33.38 ? 215  LEU A HB3  1 
ATOM   3390  H HG   . LEU A 1 226 ? -34.377 -6.129  61.204  1.00 37.35 ? 215  LEU A HG   1 
ATOM   3391  H HD11 . LEU A 1 226 ? -33.503 -3.978  61.101  1.00 38.97 ? 215  LEU A HD11 1 
ATOM   3392  H HD12 . LEU A 1 226 ? -34.896 -4.044  60.340  1.00 38.97 ? 215  LEU A HD12 1 
ATOM   3393  H HD13 . LEU A 1 226 ? -34.816 -3.412  61.795  1.00 38.97 ? 215  LEU A HD13 1 
ATOM   3394  H HD21 . LEU A 1 226 ? -33.046 -5.431  62.958  1.00 40.28 ? 215  LEU A HD21 1 
ATOM   3395  H HD22 . LEU A 1 226 ? -34.337 -4.931  63.738  1.00 40.28 ? 215  LEU A HD22 1 
ATOM   3396  H HD23 . LEU A 1 226 ? -34.126 -6.482  63.465  1.00 40.28 ? 215  LEU A HD23 1 
ATOM   3397  N N    . GLY A 1 227 ? -38.944 -7.843  62.256  1.00 29.90 ? 216  GLY A N    1 
ATOM   3398  C CA   . GLY A 1 227 ? -40.341 -7.829  62.620  1.00 29.01 ? 216  GLY A CA   1 
ATOM   3399  C C    . GLY A 1 227 ? -41.147 -6.792  61.895  1.00 27.56 ? 216  GLY A C    1 
ATOM   3400  O O    . GLY A 1 227 ? -42.312 -6.567  62.253  1.00 30.01 ? 216  GLY A O    1 
ATOM   3401  H H    . GLY A 1 227 ? -38.749 -8.377  61.611  1.00 35.88 ? 216  GLY A H    1 
ATOM   3402  H HA2  . GLY A 1 227 ? -40.728 -8.698  62.433  1.00 34.81 ? 216  GLY A HA2  1 
ATOM   3403  H HA3  . GLY A 1 227 ? -40.420 -7.661  63.573  1.00 34.81 ? 216  GLY A HA3  1 
ATOM   3404  N N    . ILE A 1 228 ? -40.569 -6.150  60.884  1.00 26.18 ? 217  ILE A N    1 
ATOM   3405  C CA   . ILE A 1 228 ? -41.260 -5.104  60.125  1.00 26.55 ? 217  ILE A CA   1 
ATOM   3406  C C    . ILE A 1 228 ? -41.958 -5.825  58.979  1.00 26.59 ? 217  ILE A C    1 
ATOM   3407  O O    . ILE A 1 228 ? -41.426 -5.962  57.880  1.00 29.12 ? 217  ILE A O    1 
ATOM   3408  C CB   . ILE A 1 228 ? -40.305 -4.005  59.649  1.00 24.71 ? 217  ILE A CB   1 
ATOM   3409  C CG1  . ILE A 1 228 ? -39.561 -3.355  60.823  1.00 28.19 ? 217  ILE A CG1  1 
ATOM   3410  C CG2  . ILE A 1 228 ? -41.047 -2.968  58.851  1.00 26.25 ? 217  ILE A CG2  1 
ATOM   3411  C CD1  . ILE A 1 228 ? -38.404 -2.494  60.394  1.00 30.06 ? 217  ILE A CD1  1 
ATOM   3412  H H    . ILE A 1 228 ? -39.767 -6.303  60.612  1.00 31.42 ? 217  ILE A H    1 
ATOM   3413  H HA   . ILE A 1 228 ? -41.938 -4.696  60.686  1.00 31.86 ? 217  ILE A HA   1 
ATOM   3414  H HB   . ILE A 1 228 ? -39.645 -4.414  59.067  1.00 29.66 ? 217  ILE A HB   1 
ATOM   3415  H HG12 . ILE A 1 228 ? -40.181 -2.796  61.316  1.00 33.82 ? 217  ILE A HG12 1 
ATOM   3416  H HG13 . ILE A 1 228 ? -39.215 -4.053  61.400  1.00 33.82 ? 217  ILE A HG13 1 
ATOM   3417  H HG21 . ILE A 1 228 ? -40.421 -2.285  58.562  1.00 31.50 ? 217  ILE A HG21 1 
ATOM   3418  H HG22 . ILE A 1 228 ? -41.452 -3.395  58.079  1.00 31.50 ? 217  ILE A HG22 1 
ATOM   3419  H HG23 . ILE A 1 228 ? -41.734 -2.573  59.409  1.00 31.50 ? 217  ILE A HG23 1 
ATOM   3420  H HD11 . ILE A 1 228 ? -37.983 -2.117  61.182  1.00 36.07 ? 217  ILE A HD11 1 
ATOM   3421  H HD12 . ILE A 1 228 ? -37.768 -3.040  59.907  1.00 36.07 ? 217  ILE A HD12 1 
ATOM   3422  H HD13 . ILE A 1 228 ? -38.735 -1.783  59.823  1.00 36.07 ? 217  ILE A HD13 1 
ATOM   3423  N N    . THR A 1 229 ? -43.195 -6.275  59.244  1.00 23.88 ? 218  THR A N    1 
ATOM   3424  C CA   . THR A 1 229 ? -43.943 -7.035  58.248  1.00 24.45 ? 218  THR A CA   1 
ATOM   3425  C C    . THR A 1 229 ? -45.007 -6.217  57.528  1.00 22.15 ? 218  THR A C    1 
ATOM   3426  O O    . THR A 1 229 ? -45.580 -6.701  56.541  1.00 21.87 ? 218  THR A O    1 
ATOM   3427  C CB   . THR A 1 229 ? -44.616 -8.232  58.904  1.00 28.15 ? 218  THR A CB   1 
ATOM   3428  O OG1  . THR A 1 229 ? -45.477 -7.751  59.929  1.00 31.17 ? 218  THR A OG1  1 
ATOM   3429  C CG2  . THR A 1 229 ? -43.571 -9.173  59.486  1.00 31.01 ? 218  THR A CG2  1 
ATOM   3430  H H    . THR A 1 229 ? -43.613 -6.152  59.985  1.00 28.66 ? 218  THR A H    1 
ATOM   3431  H HA   . THR A 1 229 ? -43.325 -7.370  57.580  1.00 29.34 ? 218  THR A HA   1 
ATOM   3432  H HB   . THR A 1 229 ? -45.136 -8.716  58.243  1.00 33.78 ? 218  THR A HB   1 
ATOM   3433  H HG1  . THR A 1 229 ? -45.861 -8.395  60.307  1.00 37.40 ? 218  THR A HG1  1 
ATOM   3434  H HG21 . THR A 1 229 ? -44.005 -9.934  59.902  1.00 37.22 ? 218  THR A HG21 1 
ATOM   3435  H HG22 . THR A 1 229 ? -42.984 -9.492  58.782  1.00 37.22 ? 218  THR A HG22 1 
ATOM   3436  H HG23 . THR A 1 229 ? -43.041 -8.709  60.152  1.00 37.22 ? 218  THR A HG23 1 
ATOM   3437  N N    . GLY A 1 230 ? -45.305 -5.006  58.001  1.00 23.12 ? 219  GLY A N    1 
ATOM   3438  C CA   . GLY A 1 230 ? -46.346 -4.207  57.409  1.00 22.65 ? 219  GLY A CA   1 
ATOM   3439  C C    . GLY A 1 230 ? -45.906 -3.549  56.118  1.00 19.44 ? 219  GLY A C    1 
ATOM   3440  O O    . GLY A 1 230 ? -44.753 -3.676  55.671  1.00 20.27 ? 219  GLY A O    1 
ATOM   3441  H H    . GLY A 1 230 ? -44.910 -4.633  58.668  1.00 27.74 ? 219  GLY A H    1 
ATOM   3442  H HA2  . GLY A 1 230 ? -47.116 -4.766  57.222  1.00 27.18 ? 219  GLY A HA2  1 
ATOM   3443  H HA3  . GLY A 1 230 ? -46.614 -3.513  58.031  1.00 27.18 ? 219  GLY A HA3  1 
ATOM   3444  N N    . PRO A 1 231 ? -46.837 -2.820  55.491  1.00 20.53 ? 220  PRO A N    1 
ATOM   3445  C CA   . PRO A 1 231 ? -46.541 -2.243  54.168  1.00 20.03 ? 220  PRO A CA   1 
ATOM   3446  C C    . PRO A 1 231 ? -45.346 -1.301  54.138  1.00 19.54 ? 220  PRO A C    1 
ATOM   3447  O O    . PRO A 1 231 ? -44.717 -1.146  53.091  1.00 20.24 ? 220  PRO A O    1 
ATOM   3448  C CB   . PRO A 1 231 ? -47.852 -1.494  53.822  1.00 22.67 ? 220  PRO A CB   1 
ATOM   3449  C CG   . PRO A 1 231 ? -48.924 -2.246  54.569  1.00 23.94 ? 220  PRO A CG   1 
ATOM   3450  C CD   . PRO A 1 231 ? -48.244 -2.579  55.884  1.00 21.67 ? 220  PRO A CD   1 
ATOM   3451  H HA   . PRO A 1 231 ? -46.401 -2.951  53.521  1.00 24.03 ? 220  PRO A HA   1 
ATOM   3452  H HB2  . PRO A 1 231 ? -47.797 -0.575  54.130  1.00 27.20 ? 220  PRO A HB2  1 
ATOM   3453  H HB3  . PRO A 1 231 ? -48.008 -1.529  52.866  1.00 27.20 ? 220  PRO A HB3  1 
ATOM   3454  H HG2  . PRO A 1 231 ? -49.696 -1.676  54.709  1.00 28.73 ? 220  PRO A HG2  1 
ATOM   3455  H HG3  . PRO A 1 231 ? -49.164 -3.052  54.086  1.00 28.73 ? 220  PRO A HG3  1 
ATOM   3456  H HD2  . PRO A 1 231 ? -48.300 -1.826  56.494  1.00 26.00 ? 220  PRO A HD2  1 
ATOM   3457  H HD3  . PRO A 1 231 ? -48.629 -3.380  56.271  1.00 26.00 ? 220  PRO A HD3  1 
ATOM   3458  N N    . GLU A 1 232 ? -45.021 -0.640  55.243  1.00 19.52 ? 221  GLU A N    1 
ATOM   3459  C CA   . GLU A 1 232 ? -43.838 0.213   55.251  1.00 18.78 ? 221  GLU A CA   1 
ATOM   3460  C C    . GLU A 1 232 ? -42.568 -0.585  55.039  1.00 18.25 ? 221  GLU A C    1 
ATOM   3461  O O    . GLU A 1 232 ? -41.578 -0.019  54.575  1.00 17.90 ? 221  GLU A O    1 
ATOM   3462  C CB   . GLU A 1 232 ? -43.787 1.038   56.530  1.00 21.12 ? 221  GLU A CB   1 
ATOM   3463  C CG   . GLU A 1 232 ? -43.359 0.306   57.811  1.00 22.55 ? 221  GLU A CG   1 
ATOM   3464  C CD   . GLU A 1 232 ? -44.417 -0.554  58.470  1.00 23.99 ? 221  GLU A CD   1 
ATOM   3465  O OE1  . GLU A 1 232 ? -45.525 -0.807  57.924  1.00 22.52 ? 221  GLU A OE1  1 
ATOM   3466  O OE2  . GLU A 1 232 ? -44.112 -0.970  59.610  1.00 26.96 ? 221  GLU A OE2  1 
ATOM   3467  H H    . GLU A 1 232 ? -45.456 -0.666  55.985  1.00 23.43 ? 221  GLU A H    1 
ATOM   3468  H HA   . GLU A 1 232 ? -43.911 0.837   54.511  1.00 22.53 ? 221  GLU A HA   1 
ATOM   3469  H HB2  . GLU A 1 232 ? -43.162 1.767   56.394  1.00 25.34 ? 221  GLU A HB2  1 
ATOM   3470  H HB3  . GLU A 1 232 ? -44.672 1.402   56.690  1.00 25.34 ? 221  GLU A HB3  1 
ATOM   3471  H HG2  . GLU A 1 232 ? -42.610 -0.272  57.596  1.00 27.06 ? 221  GLU A HG2  1 
ATOM   3472  H HG3  . GLU A 1 232 ? -43.078 0.968   58.461  1.00 27.06 ? 221  GLU A HG3  1 
ATOM   3473  N N    . GLY A 1 233 ? -42.571 -1.889  55.332  1.00 17.89 ? 222  GLY A N    1 
ATOM   3474  C CA   . GLY A 1 233 ? -41.384 -2.685  55.056  1.00 19.13 ? 222  GLY A CA   1 
ATOM   3475  C C    . GLY A 1 233 ? -41.094 -2.754  53.579  1.00 17.14 ? 222  GLY A C    1 
ATOM   3476  O O    . GLY A 1 233 ? -39.930 -2.841  53.160  1.00 17.35 ? 222  GLY A O    1 
ATOM   3477  H H    . GLY A 1 233 ? -43.229 -2.321  55.679  1.00 21.46 ? 222  GLY A H    1 
ATOM   3478  H HA2  . GLY A 1 233 ? -40.618 -2.294  55.505  1.00 22.95 ? 222  GLY A HA2  1 
ATOM   3479  H HA3  . GLY A 1 233 ? -41.511 -3.587  55.389  1.00 22.95 ? 222  GLY A HA3  1 
ATOM   3480  N N    . HIS A 1 234 ? -42.141 -2.685  52.752  1.00 17.10 ? 223  HIS A N    1 
ATOM   3481  C CA   . HIS A 1 234 ? -41.953 -2.669  51.301  1.00 17.04 ? 223  HIS A CA   1 
ATOM   3482  C C    . HIS A 1 234 ? -41.116 -1.476  50.849  1.00 14.63 ? 223  HIS A C    1 
ATOM   3483  O O    . HIS A 1 234 ? -40.106 -1.647  50.155  1.00 16.43 ? 223  HIS A O    1 
ATOM   3484  C CB   . HIS A 1 234 ? -43.294 -2.668  50.624  1.00 17.23 ? 223  HIS A CB   1 
ATOM   3485  C CG   . HIS A 1 234 ? -43.208 -2.745  49.143  1.00 17.71 ? 223  HIS A CG   1 
ATOM   3486  N ND1  . HIS A 1 234 ? -42.923 -3.917  48.475  1.00 17.68 ? 223  HIS A ND1  1 
ATOM   3487  C CD2  . HIS A 1 234 ? -43.346 -1.784  48.193  1.00 18.89 ? 223  HIS A CD2  1 
ATOM   3488  C CE1  . HIS A 1 234 ? -42.898 -3.673  47.172  1.00 18.78 ? 223  HIS A CE1  1 
ATOM   3489  N NE2  . HIS A 1 234 ? -43.151 -2.387  46.975  1.00 20.24 ? 223  HIS A NE2  1 
ATOM   3490  H H    . HIS A 1 234 ? -42.962 -2.647  53.004  1.00 20.52 ? 223  HIS A H    1 
ATOM   3491  H HA   . HIS A 1 234 ? -41.486 -3.477  51.037  1.00 20.45 ? 223  HIS A HA   1 
ATOM   3492  H HB2  . HIS A 1 234 ? -43.802 -3.435  50.933  1.00 20.67 ? 223  HIS A HB2  1 
ATOM   3493  H HB3  . HIS A 1 234 ? -43.761 -1.849  50.853  1.00 20.67 ? 223  HIS A HB3  1 
ATOM   3494  H HD2  . HIS A 1 234 ? -43.539 -0.886  48.340  1.00 22.67 ? 223  HIS A HD2  1 
ATOM   3495  H HE1  . HIS A 1 234 ? -42.732 -4.301  46.506  1.00 22.53 ? 223  HIS A HE1  1 
ATOM   3496  H HE2  . HIS A 1 234 ? -43.190 -1.996  46.211  1.00 24.28 ? 223  HIS A HE2  1 
ATOM   3497  N N    . VAL A 1 235 ? -41.513 -0.259  51.233  1.00 15.63 ? 224  VAL A N    1 
ATOM   3498  C CA   . VAL A 1 235 ? -40.764 0.918   50.817  1.00 16.97 ? 224  VAL A CA   1 
ATOM   3499  C C    . VAL A 1 235 ? -39.391 0.971   51.485  1.00 15.46 ? 224  VAL A C    1 
ATOM   3500  O O    . VAL A 1 235 ? -38.426 1.414   50.865  1.00 16.52 ? 224  VAL A O    1 
ATOM   3501  C CB   . VAL A 1 235 ? -41.611 2.199   50.974  1.00 16.20 ? 224  VAL A CB   1 
ATOM   3502  C CG1  . VAL A 1 235 ? -41.969 2.474   52.437  1.00 19.65 ? 224  VAL A CG1  1 
ATOM   3503  C CG2  . VAL A 1 235 ? -40.930 3.381   50.339  1.00 16.98 ? 224  VAL A CG2  1 
ATOM   3504  H H    . VAL A 1 235 ? -42.199 -0.095  51.724  1.00 18.76 ? 224  VAL A H    1 
ATOM   3505  H HA   . VAL A 1 235 ? -40.594 0.826   49.866  1.00 20.36 ? 224  VAL A HA   1 
ATOM   3506  H HB   . VAL A 1 235 ? -42.446 2.065   50.499  1.00 19.44 ? 224  VAL A HB   1 
ATOM   3507  H HG11 . VAL A 1 235 ? -42.499 3.285   52.485  1.00 23.58 ? 224  VAL A HG11 1 
ATOM   3508  H HG12 . VAL A 1 235 ? -42.479 1.724   52.782  1.00 23.58 ? 224  VAL A HG12 1 
ATOM   3509  H HG13 . VAL A 1 235 ? -41.151 2.581   52.947  1.00 23.58 ? 224  VAL A HG13 1 
ATOM   3510  H HG21 . VAL A 1 235 ? -41.488 4.166   50.456  1.00 20.38 ? 224  VAL A HG21 1 
ATOM   3511  H HG22 . VAL A 1 235 ? -40.071 3.518   50.768  1.00 20.38 ? 224  VAL A HG22 1 
ATOM   3512  H HG23 . VAL A 1 235 ? -40.804 3.202   49.394  1.00 20.38 ? 224  VAL A HG23 1 
ATOM   3513  N N    . LEU A 1 236 ? -39.266 0.499   52.733  1.00 16.66 ? 225  LEU A N    1 
ATOM   3514  C CA   . LEU A 1 236 ? -37.971 0.496   53.415  1.00 17.74 ? 225  LEU A CA   1 
ATOM   3515  C C    . LEU A 1 236 ? -36.997 -0.445  52.751  1.00 15.77 ? 225  LEU A C    1 
ATOM   3516  O O    . LEU A 1 236 ? -35.788 -0.177  52.774  1.00 17.73 ? 225  LEU A O    1 
ATOM   3517  C CB   . LEU A 1 236 ? -38.139 0.111   54.889  1.00 19.08 ? 225  LEU A CB   1 
ATOM   3518  C CG   . LEU A 1 236 ? -38.841 1.159   55.744  1.00 21.85 ? 225  LEU A CG   1 
ATOM   3519  C CD1  . LEU A 1 236 ? -39.149 0.547   57.117  1.00 25.04 ? 225  LEU A CD1  1 
ATOM   3520  C CD2  . LEU A 1 236 ? -37.948 2.398   55.882  1.00 23.97 ? 225  LEU A CD2  1 
ATOM   3521  H H    . LEU A 1 236 ? -39.912 0.178   53.201  1.00 20.00 ? 225  LEU A H    1 
ATOM   3522  H HA   . LEU A 1 236 ? -37.595 1.389   53.380  1.00 21.29 ? 225  LEU A HA   1 
ATOM   3523  H HB2  . LEU A 1 236 ? -38.660 -0.706  54.938  1.00 22.89 ? 225  LEU A HB2  1 
ATOM   3524  H HB3  . LEU A 1 236 ? -37.260 -0.040  55.271  1.00 22.89 ? 225  LEU A HB3  1 
ATOM   3525  H HG   . LEU A 1 236 ? -39.676 1.420   55.324  1.00 26.23 ? 225  LEU A HG   1 
ATOM   3526  H HD11 . LEU A 1 236 ? -39.596 1.211   57.665  1.00 30.04 ? 225  LEU A HD11 1 
ATOM   3527  H HD12 . LEU A 1 236 ? -39.723 -0.225  56.997  1.00 30.04 ? 225  LEU A HD12 1 
ATOM   3528  H HD13 . LEU A 1 236 ? -38.316 0.279   57.536  1.00 30.04 ? 225  LEU A HD13 1 
ATOM   3529  H HD21 . LEU A 1 236 ? -38.405 3.057   56.428  1.00 28.77 ? 225  LEU A HD21 1 
ATOM   3530  H HD22 . LEU A 1 236 ? -37.114 2.140   56.305  1.00 28.77 ? 225  LEU A HD22 1 
ATOM   3531  H HD23 . LEU A 1 236 ? -37.774 2.762   55.000  1.00 28.77 ? 225  LEU A HD23 1 
ATOM   3532  N N    . SER A 1 237 ? -37.495 -1.524  52.130  1.00 15.38 ? 226  SER A N    1 
ATOM   3533  C CA   . SER A 1 237 ? -36.639 -2.477  51.445  1.00 16.04 ? 226  SER A CA   1 
ATOM   3534  C C    . SER A 1 237 ? -36.280 -2.086  50.012  1.00 15.84 ? 226  SER A C    1 
ATOM   3535  O O    . SER A 1 237 ? -35.428 -2.742  49.422  1.00 16.74 ? 226  SER A O    1 
ATOM   3536  C CB   . SER A 1 237 ? -37.283 -3.878  51.453  1.00 17.68 ? 226  SER A CB   1 
ATOM   3537  O OG   . SER A 1 237 ? -38.441 -3.927  50.643  1.00 21.88 ? 226  SER A OG   1 
ATOM   3538  H H    . SER A 1 237 ? -38.332 -1.719  52.096  1.00 18.46 ? 226  SER A H    1 
ATOM   3539  H HA   . SER A 1 237 ? -35.807 -2.543  51.939  1.00 19.24 ? 226  SER A HA   1 
ATOM   3540  H HB2  . SER A 1 237 ? -36.639 -4.521  51.117  1.00 21.21 ? 226  SER A HB2  1 
ATOM   3541  H HB3  . SER A 1 237 ? -37.529 -4.104  52.364  1.00 21.21 ? 226  SER A HB3  1 
ATOM   3542  H HG   . SER A 1 237 ? -39.011 -3.377  50.922  1.00 26.25 ? 226  SER A HG   1 
ATOM   3543  N N    . ARG A 1 238 ? -36.846 -0.999  49.492  1.00 16.11 ? 227  ARG A N    1 
ATOM   3544  C CA   . ARG A 1 238 ? -36.630 -0.569  48.112  1.00 15.32 ? 227  ARG A CA   1 
ATOM   3545  C C    . ARG A 1 238 ? -36.452 0.945   48.106  1.00 14.34 ? 227  ARG A C    1 
ATOM   3546  O O    . ARG A 1 238 ? -37.149 1.645   47.385  1.00 14.81 ? 227  ARG A O    1 
ATOM   3547  C CB   . ARG A 1 238 ? -37.837 -0.945  47.213  1.00 15.03 ? 227  ARG A CB   1 
ATOM   3548  C CG   . ARG A 1 238 ? -38.361 -2.338  47.365  1.00 18.48 ? 227  ARG A CG   1 
ATOM   3549  C CD   . ARG A 1 238 ? -39.477 -2.555  46.500  1.00 17.01 ? 227  ARG A CD   1 
ATOM   3550  N NE   . ARG A 1 238 ? -39.068 -3.032  45.186  1.00 16.57 ? 227  ARG A NE   1 
ATOM   3551  C CZ   . ARG A 1 238 ? -39.106 -4.308  44.809  1.00 16.83 ? 227  ARG A CZ   1 
ATOM   3552  N NH1  . ARG A 1 238 ? -38.796 -4.618  43.564  1.00 14.65 ? 227  ARG A NH1  1 
ATOM   3553  N NH2  . ARG A 1 238 ? -39.412 -5.277  45.681  1.00 18.21 ? 227  ARG A NH2  1 
ATOM   3554  H H    . ARG A 1 238 ? -37.373 -0.480  49.932  1.00 19.33 ? 227  ARG A H    1 
ATOM   3555  H HA   . ARG A 1 238 ? -35.829 -0.984  47.756  1.00 18.39 ? 227  ARG A HA   1 
ATOM   3556  H HB2  . ARG A 1 238 ? -38.566 -0.338  47.414  1.00 18.03 ? 227  ARG A HB2  1 
ATOM   3557  H HB3  . ARG A 1 238 ? -37.572 -0.835  46.287  1.00 18.03 ? 227  ARG A HB3  1 
ATOM   3558  H HG2  . ARG A 1 238 ? -37.665 -2.972  47.132  1.00 22.18 ? 227  ARG A HG2  1 
ATOM   3559  H HG3  . ARG A 1 238 ? -38.651 -2.475  48.280  1.00 22.18 ? 227  ARG A HG3  1 
ATOM   3560  H HD2  . ARG A 1 238 ? -40.061 -3.221  46.895  1.00 20.41 ? 227  ARG A HD2  1 
ATOM   3561  H HD3  . ARG A 1 238 ? -39.955 -1.719  46.382  1.00 20.41 ? 227  ARG A HD3  1 
ATOM   3562  H HE   . ARG A 1 238 ? -38.747 -2.458  44.631  1.00 19.88 ? 227  ARG A HE   1 
ATOM   3563  H HH11 . ARG A 1 238 ? -38.571 -3.999  43.011  1.00 17.58 ? 227  ARG A HH11 1 
ATOM   3564  H HH12 . ARG A 1 238 ? -38.770 -5.442  43.321  1.00 17.58 ? 227  ARG A HH12 1 
ATOM   3565  H HH21 . ARG A 1 238 ? -39.635 -5.075  46.487  1.00 21.85 ? 227  ARG A HH21 1 
ATOM   3566  H HH22 . ARG A 1 238 ? -39.414 -6.098  45.427  1.00 21.85 ? 227  ARG A HH22 1 
ATOM   3567  N N    . PRO A 1 239 ? -35.479 1.477   48.847  1.00 15.38 ? 228  PRO A N    1 
ATOM   3568  C CA   . PRO A 1 239 ? -35.280 2.930   48.831  1.00 15.24 ? 228  PRO A CA   1 
ATOM   3569  C C    . PRO A 1 239 ? -34.896 3.441   47.441  1.00 12.96 ? 228  PRO A C    1 
ATOM   3570  O O    . PRO A 1 239 ? -34.306 2.713   46.645  1.00 15.45 ? 228  PRO A O    1 
ATOM   3571  C CB   . PRO A 1 239 ? -34.132 3.144   49.828  1.00 18.14 ? 228  PRO A CB   1 
ATOM   3572  C CG   . PRO A 1 239 ? -33.375 1.832   49.735  1.00 19.99 ? 228  PRO A CG   1 
ATOM   3573  C CD   . PRO A 1 239 ? -34.456 0.796   49.643  1.00 19.90 ? 228  PRO A CD   1 
ATOM   3574  H HA   . PRO A 1 239 ? -36.075 3.389   49.143  1.00 18.28 ? 228  PRO A HA   1 
ATOM   3575  H HB2  . PRO A 1 239 ? -33.579 3.890   49.546  1.00 21.77 ? 228  PRO A HB2  1 
ATOM   3576  H HB3  . PRO A 1 239 ? -34.485 3.284   50.720  1.00 21.77 ? 228  PRO A HB3  1 
ATOM   3577  H HG2  . PRO A 1 239 ? -32.821 1.826   48.939  1.00 23.99 ? 228  PRO A HG2  1 
ATOM   3578  H HG3  . PRO A 1 239 ? -32.839 1.703   50.533  1.00 23.99 ? 228  PRO A HG3  1 
ATOM   3579  H HD2  . PRO A 1 239 ? -34.134 0.006   49.181  1.00 23.88 ? 228  PRO A HD2  1 
ATOM   3580  H HD3  . PRO A 1 239 ? -34.799 0.581   50.525  1.00 23.88 ? 228  PRO A HD3  1 
ATOM   3581  N N    . GLU A 1 240 ? -35.201 4.734   47.160  1.00 13.64 ? 229  GLU A N    1 
ATOM   3582  C CA   . GLU A 1 240 ? -35.039 5.227   45.792  1.00 13.53 ? 229  GLU A CA   1 
ATOM   3583  C C    . GLU A 1 240 ? -33.620 5.065   45.296  1.00 12.68 ? 229  GLU A C    1 
ATOM   3584  O O    . GLU A 1 240 ? -33.409 4.996   44.084  1.00 12.80 ? 229  GLU A O    1 
ATOM   3585  C CB   . GLU A 1 240 ? -35.466 6.673   45.637  1.00 16.52 ? 229  GLU A CB   1 
ATOM   3586  C CG   . GLU A 1 240 ? -34.649 7.744   46.390  1.00 16.27 ? 229  GLU A CG   1 
ATOM   3587  C CD   . GLU A 1 240 ? -35.085 9.188   46.029  1.00 15.63 ? 229  GLU A CD   1 
ATOM   3588  O OE1  . GLU A 1 240 ? -36.090 9.603   46.675  1.00 17.59 ? 229  GLU A OE1  1 
ATOM   3589  O OE2  . GLU A 1 240 ? -34.544 9.868   45.048  1.00 15.37 ? 229  GLU A OE2  1 
ATOM   3590  H H    . GLU A 1 240 ? -35.490 5.313   47.726  1.00 16.37 ? 229  GLU A H    1 
ATOM   3591  H HA   . GLU A 1 240 ? -35.607 4.697   45.212  1.00 16.23 ? 229  GLU A HA   1 
ATOM   3592  H HB2  . GLU A 1 240 ? -35.426 6.897   44.694  1.00 19.82 ? 229  GLU A HB2  1 
ATOM   3593  H HB3  . GLU A 1 240 ? -36.383 6.748   45.943  1.00 19.82 ? 229  GLU A HB3  1 
ATOM   3594  H HG2  . GLU A 1 240 ? -34.772 7.623   47.344  1.00 19.53 ? 229  GLU A HG2  1 
ATOM   3595  H HG3  . GLU A 1 240 ? -33.711 7.647   46.160  1.00 19.53 ? 229  GLU A HG3  1 
ATOM   3596  N N    . GLU A 1 241 ? -32.639 5.011   46.194  1.00 12.38 ? 230  GLU A N    1 
ATOM   3597  C CA   . GLU A 1 241 ? -31.275 4.853   45.752  1.00 11.98 ? 230  GLU A CA   1 
ATOM   3598  C C    . GLU A 1 241 ? -31.100 3.589   44.938  1.00 12.27 ? 230  GLU A C    1 
ATOM   3599  O O    . GLU A 1 241 ? -30.260 3.560   44.043  1.00 12.78 ? 230  GLU A O    1 
ATOM   3600  C CB   . GLU A 1 241 ? -30.316 4.803   46.974  1.00 16.83 ? 230  GLU A CB   1 
ATOM   3601  C CG   . GLU A 1 241 ? -30.128 6.089   47.678  1.00 18.51 ? 230  GLU A CG   1 
ATOM   3602  C CD   . GLU A 1 241 ? -31.267 6.538   48.656  1.00 22.58 ? 230  GLU A CD   1 
ATOM   3603  O OE1  . GLU A 1 241 ? -32.312 5.877   48.900  1.00 20.28 ? 230  GLU A OE1  1 
ATOM   3604  O OE2  . GLU A 1 241 ? -31.086 7.644   49.204  1.00 35.64 ? 230  GLU A OE2  1 
ATOM   3605  H H    . GLU A 1 241 ? -32.742 5.064   47.046  1.00 14.85 ? 230  GLU A H    1 
ATOM   3606  H HA   . GLU A 1 241 ? -31.026 5.610   45.199  1.00 14.38 ? 230  GLU A HA   1 
ATOM   3607  H HB2  . GLU A 1 241 ? -30.669 4.168   47.617  1.00 20.20 ? 230  GLU A HB2  1 
ATOM   3608  H HB3  . GLU A 1 241 ? -29.444 4.507   46.670  1.00 20.20 ? 230  GLU A HB3  1 
ATOM   3609  H HG2  . GLU A 1 241 ? -29.311 6.031   48.199  1.00 22.21 ? 230  GLU A HG2  1 
ATOM   3610  H HG3  . GLU A 1 241 ? -30.033 6.787   47.011  1.00 22.21 ? 230  GLU A HG3  1 
ATOM   3611  N N    . VAL A 1 242 ? -31.858 2.534   45.217  1.00 12.26 ? 231  VAL A N    1 
ATOM   3612  C CA   . VAL A 1 242 ? -31.725 1.303   44.431  1.00 12.39 ? 231  VAL A CA   1 
ATOM   3613  C C    . VAL A 1 242 ? -32.390 1.386   43.060  1.00 11.60 ? 231  VAL A C    1 
ATOM   3614  O O    . VAL A 1 242 ? -31.978 0.622   42.172  1.00 11.94 ? 231  VAL A O    1 
ATOM   3615  C CB   . VAL A 1 242 ? -32.144 0.022   45.159  1.00 13.34 ? 231  VAL A CB   1 
ATOM   3616  C CG1  . VAL A 1 242 ? -31.438 -0.087  46.489  1.00 17.37 ? 231  VAL A CG1  1 
ATOM   3617  C CG2  . VAL A 1 242 ? -33.683 -0.101  45.289  1.00 14.55 ? 231  VAL A CG2  1 
ATOM   3618  H H    . VAL A 1 242 ? -32.446 2.501   45.843  1.00 14.72 ? 231  VAL A H    1 
ATOM   3619  H HA   . VAL A 1 242 ? -30.778 1.198   44.252  1.00 14.86 ? 231  VAL A HA   1 
ATOM   3620  H HB   . VAL A 1 242 ? -31.849 -0.732  44.624  1.00 16.01 ? 231  VAL A HB   1 
ATOM   3621  H HG11 . VAL A 1 242 ? -31.718 -0.904  46.930  1.00 20.84 ? 231  VAL A HG11 1 
ATOM   3622  H HG12 . VAL A 1 242 ? -30.480 -0.105  46.337  1.00 20.84 ? 231  VAL A HG12 1 
ATOM   3623  H HG13 . VAL A 1 242 ? -31.672 0.681   47.034  1.00 20.84 ? 231  VAL A HG13 1 
ATOM   3624  H HG21 . VAL A 1 242 ? -33.896 -0.925  45.754  1.00 17.47 ? 231  VAL A HG21 1 
ATOM   3625  H HG22 . VAL A 1 242 ? -34.019 0.659   45.790  1.00 17.47 ? 231  VAL A HG22 1 
ATOM   3626  H HG23 . VAL A 1 242 ? -34.075 -0.111  44.401  1.00 17.47 ? 231  VAL A HG23 1 
ATOM   3627  N N    . GLU A 1 243 ? -33.353 2.311   42.877  1.00 10.83 ? 232  GLU A N    1 
ATOM   3628  C CA   . GLU A 1 243 ? -33.914 2.579   41.563  1.00 11.15 ? 232  GLU A CA   1 
ATOM   3629  C C    . GLU A 1 243 ? -32.909 3.384   40.765  1.00 11.73 ? 232  GLU A C    1 
ATOM   3630  O O    . GLU A 1 243 ? -32.546 3.001   39.644  1.00 11.64 ? 232  GLU A O    1 
ATOM   3631  C CB   . GLU A 1 243 ? -35.260 3.329   41.699  1.00 10.81 ? 232  GLU A CB   1 
ATOM   3632  C CG   . GLU A 1 243 ? -35.915 3.708   40.406  1.00 10.96 ? 232  GLU A CG   1 
ATOM   3633  C CD   . GLU A 1 243 ? -36.911 4.832   40.513  1.00 11.55 ? 232  GLU A CD   1 
ATOM   3634  O OE1  . GLU A 1 243 ? -37.149 5.349   41.605  1.00 13.14 ? 232  GLU A OE1  1 
ATOM   3635  O OE2  . GLU A 1 243 ? -37.457 5.188   39.438  1.00 11.96 ? 232  GLU A OE2  1 
ATOM   3636  H H    . GLU A 1 243 ? -33.691 2.790   43.506  1.00 13.00 ? 232  GLU A H    1 
ATOM   3637  H HA   . GLU A 1 243 ? -34.074 1.740   41.102  1.00 13.38 ? 232  GLU A HA   1 
ATOM   3638  H HB2  . GLU A 1 243 ? -35.880 2.763   42.184  1.00 12.97 ? 232  GLU A HB2  1 
ATOM   3639  H HB3  . GLU A 1 243 ? -35.107 4.146   42.199  1.00 12.97 ? 232  GLU A HB3  1 
ATOM   3640  H HG2  . GLU A 1 243 ? -35.227 3.983   39.780  1.00 13.16 ? 232  GLU A HG2  1 
ATOM   3641  H HG3  . GLU A 1 243 ? -36.382 2.933   40.057  1.00 13.16 ? 232  GLU A HG3  1 
ATOM   3642  N N    . ALA A 1 244 ? -32.422 4.500   41.333  1.00 11.08 ? 233  ALA A N    1 
ATOM   3643  C CA   . ALA A 1 244 ? -31.456 5.329   40.615  1.00 11.14 ? 233  ALA A CA   1 
ATOM   3644  C C    . ALA A 1 244 ? -30.234 4.534   40.209  1.00 10.10 ? 233  ALA A C    1 
ATOM   3645  O O    . ALA A 1 244 ? -29.735 4.707   39.111  1.00 11.38 ? 233  ALA A O    1 
ATOM   3646  C CB   . ALA A 1 244 ? -31.127 6.554   41.448  1.00 12.30 ? 233  ALA A CB   1 
ATOM   3647  H H    . ALA A 1 244 ? -32.634 4.788   42.115  1.00 13.29 ? 233  ALA A H    1 
ATOM   3648  H HA   . ALA A 1 244 ? -31.875 5.643   39.799  1.00 13.37 ? 233  ALA A HA   1 
ATOM   3649  H HB1  . ALA A 1 244 ? -30.486 7.100   40.967  1.00 14.75 ? 233  ALA A HB1  1 
ATOM   3650  H HB2  . ALA A 1 244 ? -31.941 7.058   41.602  1.00 14.75 ? 233  ALA A HB2  1 
ATOM   3651  H HB3  . ALA A 1 244 ? -30.750 6.268   42.295  1.00 14.75 ? 233  ALA A HB3  1 
ATOM   3652  N N    . GLU A 1 245 ? -29.757 3.656   41.095  1.00 10.48 ? 234  GLU A N    1 
ATOM   3653  C CA   . GLU A 1 245 ? -28.572 2.869   40.763  1.00 10.55 ? 234  GLU A CA   1 
ATOM   3654  C C    . GLU A 1 245 ? -28.828 2.020   39.528  1.00 11.43 ? 234  GLU A C    1 
ATOM   3655  O O    . GLU A 1 245 ? -28.023 2.006   38.575  1.00 11.58 ? 234  GLU A O    1 
ATOM   3656  C CB   . GLU A 1 245 ? -28.188 1.986   41.936  1.00 10.47 ? 234  GLU A CB   1 
ATOM   3657  C CG   . GLU A 1 245 ? -26.894 1.163   41.766  1.00 11.17 ? 234  GLU A CG   1 
ATOM   3658  C CD   . GLU A 1 245 ? -27.057 -0.015  40.854  1.00 11.55 ? 234  GLU A CD   1 
ATOM   3659  O OE1  . GLU A 1 245 ? -27.940 -0.866  41.185  1.00 12.70 ? 234  GLU A OE1  1 
ATOM   3660  O OE2  . GLU A 1 245 ? -26.319 -0.116  39.830  1.00 11.40 ? 234  GLU A OE2  1 
ATOM   3661  H H    . GLU A 1 245 ? -30.092 3.501   41.872  1.00 12.58 ? 234  GLU A H    1 
ATOM   3662  H HA   . GLU A 1 245 ? -27.831 3.467   40.575  1.00 12.66 ? 234  GLU A HA   1 
ATOM   3663  H HB2  . GLU A 1 245 ? -28.073 2.549   42.717  1.00 12.57 ? 234  GLU A HB2  1 
ATOM   3664  H HB3  . GLU A 1 245 ? -28.911 1.358   42.094  1.00 12.57 ? 234  GLU A HB3  1 
ATOM   3665  H HG2  . GLU A 1 245 ? -26.204 1.735   41.395  1.00 13.41 ? 234  GLU A HG2  1 
ATOM   3666  H HG3  . GLU A 1 245 ? -26.616 0.832   42.635  1.00 13.41 ? 234  GLU A HG3  1 
ATOM   3667  N N    . ALA A 1 246 ? -29.954 1.293   39.538  1.00 11.21 ? 235  ALA A N    1 
ATOM   3668  C CA   . ALA A 1 246 ? -30.250 0.400   38.417  1.00 10.82 ? 235  ALA A CA   1 
ATOM   3669  C C    . ALA A 1 246 ? -30.464 1.196   37.127  1.00 10.29 ? 235  ALA A C    1 
ATOM   3670  O O    . ALA A 1 246 ? -30.065 0.752   36.056  1.00 11.70 ? 235  ALA A O    1 
ATOM   3671  C CB   . ALA A 1 246 ? -31.451 -0.462  38.769  1.00 11.21 ? 235  ALA A CB   1 
ATOM   3672  H H    . ALA A 1 246 ? -30.545 1.300   40.164  1.00 13.45 ? 235  ALA A H    1 
ATOM   3673  H HA   . ALA A 1 246 ? -29.493 -0.190  38.279  1.00 12.99 ? 235  ALA A HA   1 
ATOM   3674  H HB1  . ALA A 1 246 ? -31.644 -1.052  38.024  1.00 13.45 ? 235  ALA A HB1  1 
ATOM   3675  H HB2  . ALA A 1 246 ? -31.244 -0.984  39.560  1.00 13.45 ? 235  ALA A HB2  1 
ATOM   3676  H HB3  . ALA A 1 246 ? -32.212 0.114   38.942  1.00 13.45 ? 235  ALA A HB3  1 
ATOM   3677  N N    . VAL A 1 247 ? -31.125 2.363   37.215  1.00 10.99 ? 236  VAL A N    1 
ATOM   3678  C CA   . VAL A 1 247 ? -31.304 3.203   36.044  1.00 9.92  ? 236  VAL A CA   1 
ATOM   3679  C C    . VAL A 1 247 ? -29.933 3.583   35.479  1.00 10.94 ? 236  VAL A C    1 
ATOM   3680  O O    . VAL A 1 247 ? -29.703 3.518   34.274  1.00 10.50 ? 236  VAL A O    1 
ATOM   3681  C CB   . VAL A 1 247 ? -32.178 4.428   36.398  1.00 10.10 ? 236  VAL A CB   1 
ATOM   3682  C CG1  . VAL A 1 247 ? -32.164 5.466   35.257  1.00 11.39 ? 236  VAL A CG1  1 
ATOM   3683  C CG2  . VAL A 1 247 ? -33.584 3.986   36.727  1.00 10.60 ? 236  VAL A CG2  1 
ATOM   3684  H H    . VAL A 1 247 ? -31.472 2.679   37.936  1.00 13.18 ? 236  VAL A H    1 
ATOM   3685  H HA   . VAL A 1 247 ? -31.772 2.694   35.364  1.00 11.90 ? 236  VAL A HA   1 
ATOM   3686  H HB   . VAL A 1 247 ? -31.810 4.854   37.188  1.00 12.12 ? 236  VAL A HB   1 
ATOM   3687  H HG11 . VAL A 1 247 ? -32.720 6.219   35.510  1.00 13.67 ? 236  VAL A HG11 1 
ATOM   3688  H HG12 . VAL A 1 247 ? -31.252 5.761   35.110  1.00 13.67 ? 236  VAL A HG12 1 
ATOM   3689  H HG13 . VAL A 1 247 ? -32.513 5.053   34.451  1.00 13.67 ? 236  VAL A HG13 1 
ATOM   3690  H HG21 . VAL A 1 247 ? -34.116 4.767   36.946  1.00 12.72 ? 236  VAL A HG21 1 
ATOM   3691  H HG22 . VAL A 1 247 ? -33.961 3.534   35.956  1.00 12.72 ? 236  VAL A HG22 1 
ATOM   3692  H HG23 . VAL A 1 247 ? -33.555 3.381   37.485  1.00 12.72 ? 236  VAL A HG23 1 
ATOM   3693  N N    . ASN A 1 248 ? -29.021 3.995   36.349  1.00 9.70  ? 237  ASN A N    1 
ATOM   3694  C CA   . ASN A 1 248 ? -27.669 4.356   35.947  1.00 9.76  ? 237  ASN A CA   1 
ATOM   3695  C C    . ASN A 1 248 ? -26.960 3.203   35.265  1.00 10.96 ? 237  ASN A C    1 
ATOM   3696  O O    . ASN A 1 248 ? -26.284 3.383   34.237  1.00 10.89 ? 237  ASN A O    1 
ATOM   3697  C CB   . ASN A 1 248 ? -26.892 4.791   37.183  1.00 10.80 ? 237  ASN A CB   1 
ATOM   3698  C CG   . ASN A 1 248 ? -25.582 5.365   36.853  1.00 12.23 ? 237  ASN A CG   1 
ATOM   3699  O OD1  . ASN A 1 248 ? -25.502 6.487   36.292  1.00 14.17 ? 237  ASN A OD1  1 
ATOM   3700  N ND2  . ASN A 1 248 ? -24.525 4.640   37.208  1.00 13.99 ? 237  ASN A ND2  1 
ATOM   3701  H H    . ASN A 1 248 ? -29.163 4.075   37.193  1.00 11.64 ? 237  ASN A H    1 
ATOM   3702  H HA   . ASN A 1 248 ? -27.705 5.103   35.329  1.00 11.71 ? 237  ASN A HA   1 
ATOM   3703  H HB2  . ASN A 1 248 ? -27.403 5.465   37.658  1.00 12.96 ? 237  ASN A HB2  1 
ATOM   3704  H HB3  . ASN A 1 248 ? -26.747 4.020   37.754  1.00 12.96 ? 237  ASN A HB3  1 
ATOM   3705  H HD21 . ASN A 1 248 ? -24.635 3.886   37.606  1.00 16.79 ? 237  ASN A HD21 1 
ATOM   3706  H HD22 . ASN A 1 248 ? -23.731 4.926   37.040  1.00 16.79 ? 237  ASN A HD22 1 
ATOM   3707  N N    . ARG A 1 249 ? -27.112 2.007   35.820  1.00 10.36 ? 238  ARG A N    1 
ATOM   3708  C CA   . ARG A 1 249 ? -26.455 0.830   35.262  1.00 10.42 ? 238  ARG A CA   1 
ATOM   3709  C C    . ARG A 1 249 ? -27.084 0.438   33.927  1.00 10.86 ? 238  ARG A C    1 
ATOM   3710  O O    . ARG A 1 249 ? -26.379 0.058   32.973  1.00 10.92 ? 238  ARG A O    1 
ATOM   3711  C CB   . ARG A 1 249 ? -26.520 -0.279  36.311  1.00 10.96 ? 238  ARG A CB   1 
ATOM   3712  C CG   . ARG A 1 249 ? -25.965 -1.655  35.884  1.00 12.07 ? 238  ARG A CG   1 
ATOM   3713  C CD   . ARG A 1 249 ? -25.566 -2.487  37.103  1.00 12.24 ? 238  ARG A CD   1 
ATOM   3714  N NE   . ARG A 1 249 ? -26.569 -2.401  38.145  1.00 11.65 ? 238  ARG A NE   1 
ATOM   3715  C CZ   . ARG A 1 249 ? -27.572 -3.241  38.344  1.00 10.88 ? 238  ARG A CZ   1 
ATOM   3716  N NH1  . ARG A 1 249 ? -27.680 -4.378  37.677  1.00 13.06 ? 238  ARG A NH1  1 
ATOM   3717  N NH2  . ARG A 1 249 ? -28.484 -2.915  39.246  1.00 11.83 ? 238  ARG A NH2  1 
ATOM   3718  H H    . ARG A 1 249 ? -27.590 1.849   36.518  1.00 12.43 ? 238  ARG A H    1 
ATOM   3719  H HA   . ARG A 1 249 ? -25.521 1.036   35.103  1.00 12.51 ? 238  ARG A HA   1 
ATOM   3720  H HB2  . ARG A 1 249 ? -26.014 0.007   37.088  1.00 13.16 ? 238  ARG A HB2  1 
ATOM   3721  H HB3  . ARG A 1 249 ? -27.448 -0.408  36.561  1.00 13.16 ? 238  ARG A HB3  1 
ATOM   3722  H HG2  . ARG A 1 249 ? -26.648 -2.139  35.394  1.00 14.48 ? 238  ARG A HG2  1 
ATOM   3723  H HG3  . ARG A 1 249 ? -25.179 -1.527  35.331  1.00 14.48 ? 238  ARG A HG3  1 
ATOM   3724  H HD2  . ARG A 1 249 ? -25.477 -3.417  36.842  1.00 14.69 ? 238  ARG A HD2  1 
ATOM   3725  H HD3  . ARG A 1 249 ? -24.727 -2.154  37.459  1.00 14.69 ? 238  ARG A HD3  1 
ATOM   3726  H HE   . ARG A 1 249 ? -26.506 -1.737  38.688  1.00 13.98 ? 238  ARG A HE   1 
ATOM   3727  H HH11 . ARG A 1 249 ? -27.109 -4.572  37.064  1.00 15.67 ? 238  ARG A HH11 1 
ATOM   3728  H HH12 . ARG A 1 249 ? -28.330 -4.915  37.845  1.00 15.67 ? 238  ARG A HH12 1 
ATOM   3729  H HH21 . ARG A 1 249 ? -28.395 -2.192  39.703  1.00 14.19 ? 238  ARG A HH21 1 
ATOM   3730  H HH22 . ARG A 1 249 ? -29.108 -3.473  39.444  1.00 14.19 ? 238  ARG A HH22 1 
ATOM   3731  N N    . ALA A 1 250 ? -28.414 0.517   33.826  1.00 10.71 ? 239  ALA A N    1 
ATOM   3732  C CA   . ALA A 1 250 ? -29.089 0.257   32.562  1.00 10.33 ? 239  ALA A CA   1 
ATOM   3733  C C    . ALA A 1 250 ? -28.599 1.210   31.482  1.00 10.08 ? 239  ALA A C    1 
ATOM   3734  O O    . ALA A 1 250 ? -28.369 0.806   30.332  1.00 10.62 ? 239  ALA A O    1 
ATOM   3735  C CB   . ALA A 1 250 ? -30.604 0.343   32.723  1.00 11.30 ? 239  ALA A CB   1 
ATOM   3736  H H    . ALA A 1 250 ? -28.942 0.720   34.474  1.00 12.85 ? 239  ALA A H    1 
ATOM   3737  H HA   . ALA A 1 250 ? -28.874 -0.645  32.277  1.00 12.40 ? 239  ALA A HA   1 
ATOM   3738  H HB1  . ALA A 1 250 ? -31.022 0.165   31.866  1.00 13.56 ? 239  ALA A HB1  1 
ATOM   3739  H HB2  . ALA A 1 250 ? -30.890 -0.316  33.374  1.00 13.56 ? 239  ALA A HB2  1 
ATOM   3740  H HB3  . ALA A 1 250 ? -30.838 1.234   33.027  1.00 13.56 ? 239  ALA A HB3  1 
ATOM   3741  N N    . ILE A 1 251 ? -28.505 2.506   31.802  1.00 10.34 ? 240  ILE A N    1 
ATOM   3742  C CA   . ILE A 1 251 ? -27.994 3.492   30.859  1.00 10.13 ? 240  ILE A CA   1 
ATOM   3743  C C    . ILE A 1 251 ? -26.576 3.148   30.434  1.00 11.14 ? 240  ILE A C    1 
ATOM   3744  O O    . ILE A 1 251 ? -26.218 3.286   29.265  1.00 10.68 ? 240  ILE A O    1 
ATOM   3745  C CB   . ILE A 1 251 ? -28.074 4.889   31.487  1.00 10.46 ? 240  ILE A CB   1 
ATOM   3746  C CG1  . ILE A 1 251 ? -29.533 5.367   31.482  1.00 11.69 ? 240  ILE A CG1  1 
ATOM   3747  C CG2  . ILE A 1 251 ? -27.166 5.900   30.799  1.00 11.21 ? 240  ILE A CG2  1 
ATOM   3748  C CD1  . ILE A 1 251 ? -29.831 6.540   32.400  1.00 11.93 ? 240  ILE A CD1  1 
ATOM   3749  H H    . ILE A 1 251 ? -28.732 2.836   32.563  1.00 12.41 ? 240  ILE A H    1 
ATOM   3750  H HA   . ILE A 1 251 ? -28.553 3.489   30.066  1.00 12.16 ? 240  ILE A HA   1 
ATOM   3751  H HB   . ILE A 1 251 ? -27.789 4.815   32.411  1.00 12.55 ? 240  ILE A HB   1 
ATOM   3752  H HG12 . ILE A 1 251 ? -29.766 5.635   30.580  1.00 14.02 ? 240  ILE A HG12 1 
ATOM   3753  H HG13 . ILE A 1 251 ? -30.099 4.629   31.758  1.00 14.02 ? 240  ILE A HG13 1 
ATOM   3754  H HG21 . ILE A 1 251 ? -27.260 6.759   31.239  1.00 13.46 ? 240  ILE A HG21 1 
ATOM   3755  H HG22 . ILE A 1 251 ? -26.248 5.594   30.863  1.00 13.46 ? 240  ILE A HG22 1 
ATOM   3756  H HG23 . ILE A 1 251 ? -27.426 5.974   29.867  1.00 13.46 ? 240  ILE A HG23 1 
ATOM   3757  H HD11 . ILE A 1 251 ? -30.771 6.766   32.327  1.00 14.31 ? 240  ILE A HD11 1 
ATOM   3758  H HD12 . ILE A 1 251 ? -29.620 6.288   33.312  1.00 14.31 ? 240  ILE A HD12 1 
ATOM   3759  H HD13 . ILE A 1 251 ? -29.286 7.296   32.131  1.00 14.31 ? 240  ILE A HD13 1 
ATOM   3760  N N    . THR A 1 252 ? -25.754 2.697   31.381  1.00 10.72 ? 241  THR A N    1 
ATOM   3761  C CA   . THR A 1 252 ? -24.376 2.351   31.069  1.00 10.43 ? 241  THR A CA   1 
ATOM   3762  C C    . THR A 1 252 ? -24.351 1.219   30.047  1.00 11.02 ? 241  THR A C    1 
ATOM   3763  O O    . THR A 1 252 ? -23.598 1.262   29.068  1.00 11.78 ? 241  THR A O    1 
ATOM   3764  C CB   . THR A 1 252 ? -23.642 1.968   32.350  1.00 11.72 ? 241  THR A CB   1 
ATOM   3765  O OG1  . THR A 1 252 ? -23.648 3.046   33.276  1.00 11.95 ? 241  THR A OG1  1 
ATOM   3766  C CG2  . THR A 1 252 ? -22.181 1.607   32.088  1.00 12.17 ? 241  THR A CG2  1 
ATOM   3767  H H    . THR A 1 252 ? -25.971 2.585   32.206  1.00 12.87 ? 241  THR A H    1 
ATOM   3768  H HA   . THR A 1 252 ? -23.932 3.121   30.682  1.00 12.52 ? 241  THR A HA   1 
ATOM   3769  H HB   . THR A 1 252 ? -24.078 1.200   32.751  1.00 14.06 ? 241  THR A HB   1 
ATOM   3770  H HG1  . THR A 1 252 ? -24.438 3.252   33.473  1.00 14.35 ? 241  THR A HG1  1 
ATOM   3771  H HG21 . THR A 1 252 ? -21.744 1.369   32.921  1.00 14.60 ? 241  THR A HG21 1 
ATOM   3772  H HG22 . THR A 1 252 ? -22.130 0.854   31.479  1.00 14.60 ? 241  THR A HG22 1 
ATOM   3773  H HG23 . THR A 1 252 ? -21.718 2.363   31.694  1.00 14.60 ? 241  THR A HG23 1 
ATOM   3774  N N    . ILE A 1 253 ? -25.181 0.189   30.262  1.00 10.50 ? 242  ILE A N    1 
ATOM   3775  C CA   . ILE A 1 253 ? -25.249 -0.925  29.327  1.00 10.83 ? 242  ILE A CA   1 
ATOM   3776  C C    . ILE A 1 253 ? -25.796 -0.476  27.997  1.00 11.38 ? 242  ILE A C    1 
ATOM   3777  O O    . ILE A 1 253 ? -25.274 -0.856  26.949  1.00 11.62 ? 242  ILE A O    1 
ATOM   3778  C CB   . ILE A 1 253 ? -26.059 -2.088  29.925  1.00 12.11 ? 242  ILE A CB   1 
ATOM   3779  C CG1  . ILE A 1 253 ? -25.460 -2.579  31.241  1.00 12.02 ? 242  ILE A CG1  1 
ATOM   3780  C CG2  . ILE A 1 253 ? -26.156 -3.215  28.906  1.00 12.62 ? 242  ILE A CG2  1 
ATOM   3781  C CD1  . ILE A 1 253 ? -26.298 -3.551  32.024  1.00 13.60 ? 242  ILE A CD1  1 
ATOM   3782  H H    . ILE A 1 253 ? -25.707 0.117   30.938  1.00 12.60 ? 242  ILE A H    1 
ATOM   3783  H HA   . ILE A 1 253 ? -24.348 -1.250  29.174  1.00 12.99 ? 242  ILE A HA   1 
ATOM   3784  H HB   . ILE A 1 253 ? -26.957 -1.768  30.105  1.00 14.54 ? 242  ILE A HB   1 
ATOM   3785  H HG12 . ILE A 1 253 ? -24.616 -3.015  31.047  1.00 14.43 ? 242  ILE A HG12 1 
ATOM   3786  H HG13 . ILE A 1 253 ? -25.302 -1.809  31.810  1.00 14.43 ? 242  ILE A HG13 1 
ATOM   3787  H HG21 . ILE A 1 253 ? -26.668 -3.944  29.290  1.00 15.14 ? 242  ILE A HG21 1 
ATOM   3788  H HG22 . ILE A 1 253 ? -26.599 -2.883  28.109  1.00 15.14 ? 242  ILE A HG22 1 
ATOM   3789  H HG23 . ILE A 1 253 ? -25.262 -3.519  28.685  1.00 15.14 ? 242  ILE A HG23 1 
ATOM   3790  H HD11 . ILE A 1 253 ? -25.823 -3.793  32.835  1.00 16.32 ? 242  ILE A HD11 1 
ATOM   3791  H HD12 . ILE A 1 253 ? -27.142 -3.130  32.248  1.00 16.32 ? 242  ILE A HD12 1 
ATOM   3792  H HD13 . ILE A 1 253 ? -26.454 -4.340  31.483  1.00 16.32 ? 242  ILE A HD13 1 
ATOM   3793  N N    . ALA A 1 254 ? -26.844 0.327   28.010  1.00 10.54 ? 243  ALA A N    1 
ATOM   3794  C CA   . ALA A 1 254 ? -27.456 0.788   26.768  1.00 10.92 ? 243  ALA A CA   1 
ATOM   3795  C C    . ALA A 1 254 ? -26.506 1.649   25.946  1.00 10.68 ? 243  ALA A C    1 
ATOM   3796  O O    . ALA A 1 254 ? -26.463 1.538   24.728  1.00 11.33 ? 243  ALA A O    1 
ATOM   3797  C CB   . ALA A 1 254 ? -28.747 1.553   27.095  1.00 11.99 ? 243  ALA A CB   1 
ATOM   3798  H H    . ALA A 1 254 ? -27.225 0.622   28.723  1.00 12.65 ? 243  ALA A H    1 
ATOM   3799  H HA   . ALA A 1 254 ? -27.696 0.017   26.232  1.00 13.11 ? 243  ALA A HA   1 
ATOM   3800  H HB1  . ALA A 1 254 ? -29.151 1.859   26.268  1.00 14.39 ? 243  ALA A HB1  1 
ATOM   3801  H HB2  . ALA A 1 254 ? -29.356 0.960   27.561  1.00 14.39 ? 243  ALA A HB2  1 
ATOM   3802  H HB3  . ALA A 1 254 ? -28.529 2.313   27.657  1.00 14.39 ? 243  ALA A HB3  1 
ATOM   3803  N N    . ASN A 1 255 ? -25.723 2.514   26.583  1.00 11.17 ? 244  ASN A N    1 
ATOM   3804  C CA   . ASN A 1 255 ? -24.746 3.292   25.835  1.00 12.05 ? 244  ASN A CA   1 
ATOM   3805  C C    . ASN A 1 255 ? -23.675 2.406   25.237  1.00 12.48 ? 244  ASN A C    1 
ATOM   3806  O O    . ASN A 1 255 ? -23.254 2.639   24.114  1.00 14.10 ? 244  ASN A O    1 
ATOM   3807  C CB   . ASN A 1 255 ? -24.142 4.348   26.724  1.00 13.25 ? 244  ASN A CB   1 
ATOM   3808  C CG   . ASN A 1 255 ? -25.020 5.580   26.821  1.00 15.74 ? 244  ASN A CG   1 
ATOM   3809  O OD1  . ASN A 1 255 ? -25.641 5.968   25.837  1.00 17.65 ? 244  ASN A OD1  1 
ATOM   3810  N ND2  . ASN A 1 255 ? -24.978 6.238   27.932  1.00 21.99 ? 244  ASN A ND2  1 
ATOM   3811  H H    . ASN A 1 255 ? -25.737 2.667   27.430  1.00 13.41 ? 244  ASN A H    1 
ATOM   3812  H HA   . ASN A 1 255 ? -25.199 3.743   25.105  1.00 14.46 ? 244  ASN A HA   1 
ATOM   3813  H HB2  . ASN A 1 255 ? -24.029 3.986   27.617  1.00 15.90 ? 244  ASN A HB2  1 
ATOM   3814  H HB3  . ASN A 1 255 ? -23.283 4.617   26.361  1.00 15.90 ? 244  ASN A HB3  1 
ATOM   3815  H HD21 . ASN A 1 255 ? -25.460 6.944   28.032  1.00 26.39 ? 244  ASN A HD21 1 
ATOM   3816  H HD22 . ASN A 1 255 ? -24.469 5.971   28.571  1.00 26.39 ? 244  ASN A HD22 1 
ATOM   3817  N N    A GLN A 1 256 ? -23.220 1.380   25.965  0.55 12.09 ? 245  GLN A N    1 
ATOM   3818  N N    B GLN A 1 256 ? -23.214 1.390   25.962  0.45 14.01 ? 245  GLN A N    1 
ATOM   3819  C CA   A GLN A 1 256 ? -22.160 0.519   25.442  0.55 12.51 ? 245  GLN A CA   1 
ATOM   3820  C CA   B GLN A 1 256 ? -22.152 0.564   25.405  0.45 14.25 ? 245  GLN A CA   1 
ATOM   3821  C C    A GLN A 1 256 ? -22.644 -0.375  24.335  0.55 14.85 ? 245  GLN A C    1 
ATOM   3822  C C    B GLN A 1 256 ? -22.669 -0.278  24.259  0.45 13.32 ? 245  GLN A C    1 
ATOM   3823  O O    A GLN A 1 256 ? -21.830 -0.828  23.519  0.55 21.85 ? 245  GLN A O    1 
ATOM   3824  O O    B GLN A 1 256 ? -21.927 -0.545  23.303  0.45 14.63 ? 245  GLN A O    1 
ATOM   3825  C CB   A GLN A 1 256 ? -21.538 -0.349  26.531  0.55 16.18 ? 245  GLN A CB   1 
ATOM   3826  C CB   B GLN A 1 256 ? -21.508 -0.263  26.510  0.45 15.08 ? 245  GLN A CB   1 
ATOM   3827  C CG   A GLN A 1 256 ? -20.731 0.395   27.587  0.55 16.98 ? 245  GLN A CG   1 
ATOM   3828  C CG   B GLN A 1 256 ? -20.101 -0.752  26.165  0.45 14.41 ? 245  GLN A CG   1 
ATOM   3829  C CD   A GLN A 1 256 ? -19.644 1.268   26.995  0.55 23.34 ? 245  GLN A CD   1 
ATOM   3830  C CD   B GLN A 1 256 ? -19.159 0.396   25.876  0.45 15.79 ? 245  GLN A CD   1 
ATOM   3831  O OE1  A GLN A 1 256 ? -18.834 0.785   26.214  0.55 31.14 ? 245  GLN A OE1  1 
ATOM   3832  O OE1  B GLN A 1 256 ? -19.379 1.555   26.285  0.45 18.63 ? 245  GLN A OE1  1 
ATOM   3833  N NE2  A GLN A 1 256 ? -19.640 2.558   27.330  0.55 28.36 ? 245  GLN A NE2  1 
ATOM   3834  N NE2  B GLN A 1 256 ? -18.098 0.095   25.175  0.45 17.56 ? 245  GLN A NE2  1 
ATOM   3835  H H    A GLN A 1 256 ? -23.504 1.166   26.748  0.55 14.51 ? 245  GLN A H    1 
ATOM   3836  H H    B GLN A 1 256 ? -23.487 1.166   26.746  0.45 16.81 ? 245  GLN A H    1 
ATOM   3837  H HA   A GLN A 1 256 ? -21.458 1.082   25.079  0.55 15.02 ? 245  GLN A HA   1 
ATOM   3838  H HA   B GLN A 1 256 ? -21.466 1.149   25.047  0.45 17.09 ? 245  GLN A HA   1 
ATOM   3839  H HB2  A GLN A 1 256 ? -22.250 -0.822  26.990  0.55 19.42 ? 245  GLN A HB2  1 
ATOM   3840  H HB2  B GLN A 1 256 ? -21.446 0.280   27.312  0.45 18.09 ? 245  GLN A HB2  1 
ATOM   3841  H HB3  A GLN A 1 256 ? -20.943 -0.989  26.110  0.55 19.42 ? 245  GLN A HB3  1 
ATOM   3842  H HB3  B GLN A 1 256 ? -22.061 -1.042  26.681  0.45 18.09 ? 245  GLN A HB3  1 
ATOM   3843  H HG2  A GLN A 1 256 ? -21.329 0.965   28.096  0.55 20.38 ? 245  GLN A HG2  1 
ATOM   3844  H HG2  B GLN A 1 256 ? -19.745 -1.254  26.915  0.45 17.29 ? 245  GLN A HG2  1 
ATOM   3845  H HG3  A GLN A 1 256 ? -20.309 -0.252  28.174  0.55 20.38 ? 245  GLN A HG3  1 
ATOM   3846  H HG3  B GLN A 1 256 ? -20.144 -1.315  25.376  0.45 17.29 ? 245  GLN A HG3  1 
ATOM   3847  H HE21 A GLN A 1 256 ? -20.240 2.865   27.863  0.55 34.04 ? 245  GLN A HE21 1 
ATOM   3848  H HE21 B GLN A 1 256 ? -17.525 0.705   24.978  0.45 21.07 ? 245  GLN A HE21 1 
ATOM   3849  H HE22 A GLN A 1 256 ? -19.037 3.083   27.012  0.55 34.04 ? 245  GLN A HE22 1 
ATOM   3850  H HE22 B GLN A 1 256 ? -17.973 -0.714  24.910  0.45 21.07 ? 245  GLN A HE22 1 
ATOM   3851  N N    . THR A 1 257 ? -23.937 -0.661  24.297  1.00 12.07 ? 246  THR A N    1 
ATOM   3852  C CA   . THR A 1 257 ? -24.524 -1.466  23.242  1.00 12.17 ? 246  THR A CA   1 
ATOM   3853  C C    . THR A 1 257 ? -25.183 -0.648  22.151  1.00 12.14 ? 246  THR A C    1 
ATOM   3854  O O    . THR A 1 257 ? -25.646 -1.223  21.164  1.00 13.31 ? 246  THR A O    1 
ATOM   3855  C CB   . THR A 1 257 ? -25.538 -2.482  23.794  1.00 13.58 ? 246  THR A CB   1 
ATOM   3856  O OG1  . THR A 1 257 ? -26.563 -1.791  24.504  1.00 12.64 ? 246  THR A OG1  1 
ATOM   3857  C CG2  . THR A 1 257 ? -24.879 -3.526  24.735  1.00 14.45 ? 246  THR A CG2  1 
ATOM   3858  H H    . THR A 1 257 ? -24.496 -0.429  24.908  1.00 14.49 ? 246  THR A H    1 
ATOM   3859  H HA   . THR A 1 257 ? -23.812 -1.974  22.824  1.00 14.60 ? 246  THR A HA   1 
ATOM   3860  H HB   . THR A 1 257 ? -25.939 -2.961  23.052  1.00 16.29 ? 246  THR A HB   1 
ATOM   3861  H HG1  . THR A 1 257 ? -27.121 -2.340  24.809  1.00 15.17 ? 246  THR A HG1  1 
ATOM   3862  H HG21 . THR A 1 257 ? -25.549 -4.148  25.061  1.00 17.33 ? 246  THR A HG21 1 
ATOM   3863  H HG22 . THR A 1 257 ? -24.197 -4.022  24.254  1.00 17.33 ? 246  THR A HG22 1 
ATOM   3864  H HG23 . THR A 1 257 ? -24.469 -3.079  25.491  1.00 17.33 ? 246  THR A HG23 1 
ATOM   3865  N N    . ASN A 1 258 ? -25.273 0.657   22.308  1.00 10.79 ? 247  ASN A N    1 
ATOM   3866  C CA   . ASN A 1 258 ? -25.996 1.491   21.342  1.00 11.63 ? 247  ASN A CA   1 
ATOM   3867  C C    . ASN A 1 258 ? -27.417 0.956   21.121  1.00 10.88 ? 247  ASN A C    1 
ATOM   3868  O O    . ASN A 1 258 ? -27.902 0.887   19.994  1.00 11.34 ? 247  ASN A O    1 
ATOM   3869  C CB   . ASN A 1 258 ? -25.221 1.635   20.018  1.00 12.39 ? 247  ASN A CB   1 
ATOM   3870  C CG   . ASN A 1 258 ? -25.850 2.630   19.064  1.00 11.65 ? 247  ASN A CG   1 
ATOM   3871  O OD1  . ASN A 1 258 ? -26.386 3.661   19.472  1.00 12.22 ? 247  ASN A OD1  1 
ATOM   3872  N ND2  . ASN A 1 258 ? -25.735 2.335   17.760  1.00 12.54 ? 247  ASN A ND2  1 
ATOM   3873  H H    . ASN A 1 258 ? -24.928 1.094   22.963  1.00 12.95 ? 247  ASN A H    1 
ATOM   3874  H HA   . ASN A 1 258 ? -26.083 2.381   21.719  1.00 13.95 ? 247  ASN A HA   1 
ATOM   3875  H HB2  . ASN A 1 258 ? -24.320 1.936   20.212  1.00 14.87 ? 247  ASN A HB2  1 
ATOM   3876  H HB3  . ASN A 1 258 ? -25.194 0.772   19.574  1.00 14.87 ? 247  ASN A HB3  1 
ATOM   3877  H HD21 . ASN A 1 258 ? -26.071 2.861   17.169  1.00 15.04 ? 247  ASN A HD21 1 
ATOM   3878  H HD22 . ASN A 1 258 ? -25.325 1.620   17.516  1.00 15.04 ? 247  ASN A HD22 1 
ATOM   3879  N N    . CYS A 1 259 ? -28.099 0.636   22.222  1.00 10.82 ? 248  CYS A N    1 
ATOM   3880  C CA   . CYS A 1 259 ? -29.486 0.199   22.192  1.00 10.96 ? 248  CYS A CA   1 
ATOM   3881  C C    . CYS A 1 259 ? -30.375 1.255   22.822  1.00 11.05 ? 248  CYS A C    1 
ATOM   3882  O O    . CYS A 1 259 ? -30.093 1.691   23.934  1.00 11.07 ? 248  CYS A O    1 
ATOM   3883  C CB   . CYS A 1 259 ? -29.658 -1.087  22.971  1.00 11.68 ? 248  CYS A CB   1 
ATOM   3884  S SG   . CYS A 1 259 ? -31.335 -1.768  22.923  1.00 11.64 ? 248  CYS A SG   1 
ATOM   3885  H H    . CYS A 1 259 ? -27.767 0.667   23.015  1.00 12.99 ? 248  CYS A H    1 
ATOM   3886  H HA   . CYS A 1 259 ? -29.769 0.053   21.275  1.00 13.15 ? 248  CYS A HA   1 
ATOM   3887  H HB2  . CYS A 1 259 ? -29.058 -1.755  22.605  1.00 14.02 ? 248  CYS A HB2  1 
ATOM   3888  H HB3  . CYS A 1 259 ? -29.434 -0.920  23.900  1.00 14.02 ? 248  CYS A HB3  1 
ATOM   3889  H HG   . CYS A 1 259 ? -31.365 -2.780  23.567  1.00 13.96 ? 248  CYS A HG   1 
ATOM   3890  N N    . PRO A 1 260 ? -31.451 1.677   22.165  1.00 10.20 ? 249  PRO A N    1 
ATOM   3891  C CA   . PRO A 1 260 ? -32.322 2.668   22.783  1.00 10.59 ? 249  PRO A CA   1 
ATOM   3892  C C    . PRO A 1 260 ? -32.993 2.098   24.021  1.00 9.56  ? 249  PRO A C    1 
ATOM   3893  O O    . PRO A 1 260 ? -33.431 0.947   24.047  1.00 11.02 ? 249  PRO A O    1 
ATOM   3894  C CB   . PRO A 1 260 ? -33.327 2.984   21.674  1.00 11.53 ? 249  PRO A CB   1 
ATOM   3895  C CG   . PRO A 1 260 ? -33.406 1.706   20.860  1.00 11.84 ? 249  PRO A CG   1 
ATOM   3896  C CD   . PRO A 1 260 ? -31.969 1.214   20.867  1.00 11.27 ? 249  PRO A CD   1 
ATOM   3897  H HA   . PRO A 1 260 ? -31.824 3.468   23.015  1.00 12.71 ? 249  PRO A HA   1 
ATOM   3898  H HB2  . PRO A 1 260 ? -34.189 3.199   22.064  1.00 13.84 ? 249  PRO A HB2  1 
ATOM   3899  H HB3  . PRO A 1 260 ? -32.999 3.719   21.133  1.00 13.84 ? 249  PRO A HB3  1 
ATOM   3900  H HG2  . PRO A 1 260 ? -33.996 1.070   21.295  1.00 14.21 ? 249  PRO A HG2  1 
ATOM   3901  H HG3  . PRO A 1 260 ? -33.704 1.903   19.959  1.00 14.21 ? 249  PRO A HG3  1 
ATOM   3902  H HD2  . PRO A 1 260 ? -31.943 0.245   20.819  1.00 13.52 ? 249  PRO A HD2  1 
ATOM   3903  H HD3  . PRO A 1 260 ? -31.470 1.618   20.140  1.00 13.52 ? 249  PRO A HD3  1 
ATOM   3904  N N    . LEU A 1 261 ? -33.096 2.933   25.045  1.00 10.06 ? 250  LEU A N    1 
ATOM   3905  C CA   . LEU A 1 261 ? -33.519 2.514   26.361  1.00 9.98  ? 250  LEU A CA   1 
ATOM   3906  C C    . LEU A 1 261 ? -34.731 3.289   26.841  1.00 9.75  ? 250  LEU A C    1 
ATOM   3907  O O    . LEU A 1 261 ? -34.896 4.473   26.543  1.00 10.71 ? 250  LEU A O    1 
ATOM   3908  C CB   . LEU A 1 261 ? -32.362 2.719   27.339  1.00 10.99 ? 250  LEU A CB   1 
ATOM   3909  C CG   . LEU A 1 261 ? -32.532 2.285   28.785  1.00 11.92 ? 250  LEU A CG   1 
ATOM   3910  C CD1  . LEU A 1 261 ? -32.705 0.763   28.904  1.00 13.40 ? 250  LEU A CD1  1 
ATOM   3911  C CD2  . LEU A 1 261 ? -31.367 2.767   29.661  1.00 12.64 ? 250  LEU A CD2  1 
ATOM   3912  H H    . LEU A 1 261 ? -32.920 3.773   24.994  1.00 12.07 ? 250  LEU A H    1 
ATOM   3913  H HA   . LEU A 1 261 ? -33.744 1.571   26.343  1.00 11.98 ? 250  LEU A HA   1 
ATOM   3914  H HB2  . LEU A 1 261 ? -31.595 2.237   26.992  1.00 13.19 ? 250  LEU A HB2  1 
ATOM   3915  H HB3  . LEU A 1 261 ? -32.155 3.666   27.355  1.00 13.19 ? 250  LEU A HB3  1 
ATOM   3916  H HG   . LEU A 1 261 ? -33.340 2.694   29.131  1.00 14.30 ? 250  LEU A HG   1 
ATOM   3917  H HD11 . LEU A 1 261 ? -32.809 0.530   29.840  1.00 16.08 ? 250  LEU A HD11 1 
ATOM   3918  H HD12 . LEU A 1 261 ? -33.492 0.495   28.406  1.00 16.08 ? 250  LEU A HD12 1 
ATOM   3919  H HD13 . LEU A 1 261 ? -31.918 0.327   28.540  1.00 16.08 ? 250  LEU A HD13 1 
ATOM   3920  H HD21 . LEU A 1 261 ? -31.515 2.470   30.573  1.00 15.17 ? 250  LEU A HD21 1 
ATOM   3921  H HD22 . LEU A 1 261 ? -30.540 2.392   29.321  1.00 15.17 ? 250  LEU A HD22 1 
ATOM   3922  H HD23 . LEU A 1 261 ? -31.330 3.736   29.631  1.00 15.17 ? 250  LEU A HD23 1 
ATOM   3923  N N    . TYR A 1 262 ? -35.544 2.623   27.648  1.00 10.05 ? 251  TYR A N    1 
ATOM   3924  C CA   . TYR A 1 262 ? -36.798 3.179   28.124  1.00 10.26 ? 251  TYR A CA   1 
ATOM   3925  C C    . TYR A 1 262 ? -36.957 2.724   29.567  1.00 10.00 ? 251  TYR A C    1 
ATOM   3926  O O    . TYR A 1 262 ? -36.976 1.528   29.848  1.00 10.37 ? 251  TYR A O    1 
ATOM   3927  C CB   . TYR A 1 262 ? -37.911 2.677   27.214  1.00 10.36 ? 251  TYR A CB   1 
ATOM   3928  C CG   . TYR A 1 262 ? -39.312 3.113   27.559  1.00 9.87  ? 251  TYR A CG   1 
ATOM   3929  C CD1  . TYR A 1 262 ? -39.975 2.672   28.706  1.00 10.73 ? 251  TYR A CD1  1 
ATOM   3930  C CD2  . TYR A 1 262 ? -39.984 3.954   26.688  1.00 11.12 ? 251  TYR A CD2  1 
ATOM   3931  C CE1  . TYR A 1 262 ? -41.294 3.049   28.929  1.00 10.82 ? 251  TYR A CE1  1 
ATOM   3932  C CE2  . TYR A 1 262 ? -41.289 4.327   26.920  1.00 10.65 ? 251  TYR A CE2  1 
ATOM   3933  C CZ   . TYR A 1 262 ? -41.949 3.859   28.028  1.00 9.93  ? 251  TYR A CZ   1 
ATOM   3934  O OH   . TYR A 1 262 ? -43.263 4.183   28.232  1.00 11.06 ? 251  TYR A OH   1 
ATOM   3935  H H    . TYR A 1 262 ? -35.387 1.829   27.939  1.00 12.06 ? 251  TYR A H    1 
ATOM   3936  H HA   . TYR A 1 262 ? -36.770 4.148   28.094  1.00 12.31 ? 251  TYR A HA   1 
ATOM   3937  H HB2  . TYR A 1 262 ? -37.729 2.986   26.312  1.00 12.44 ? 251  TYR A HB2  1 
ATOM   3938  H HB3  . TYR A 1 262 ? -37.901 1.707   27.228  1.00 12.44 ? 251  TYR A HB3  1 
ATOM   3939  H HD1  . TYR A 1 262 ? -39.549 2.093   29.296  1.00 12.87 ? 251  TYR A HD1  1 
ATOM   3940  H HD2  . TYR A 1 262 ? -39.558 4.242   25.913  1.00 13.35 ? 251  TYR A HD2  1 
ATOM   3941  H HE1  . TYR A 1 262 ? -41.745 2.732   29.678  1.00 12.98 ? 251  TYR A HE1  1 
ATOM   3942  H HE2  . TYR A 1 262 ? -41.734 4.867   26.307  1.00 12.78 ? 251  TYR A HE2  1 
ATOM   3943  H HH   . TYR A 1 262 ? -43.542 3.822   28.938  1.00 13.28 ? 251  TYR A HH   1 
ATOM   3944  N N    . ILE A 1 263 ? -37.055 3.665   30.487  1.00 10.41 ? 252  ILE A N    1 
ATOM   3945  C CA   . ILE A 1 263 ? -37.166 3.366   31.913  1.00 9.99  ? 252  ILE A CA   1 
ATOM   3946  C C    . ILE A 1 263 ? -38.635 3.362   32.297  1.00 10.28 ? 252  ILE A C    1 
ATOM   3947  O O    . ILE A 1 263 ? -39.268 4.433   32.312  1.00 10.97 ? 252  ILE A O    1 
ATOM   3948  C CB   . ILE A 1 263 ? -36.413 4.395   32.772  1.00 10.92 ? 252  ILE A CB   1 
ATOM   3949  C CG1  . ILE A 1 263 ? -34.968 4.578   32.305  1.00 12.81 ? 252  ILE A CG1  1 
ATOM   3950  C CG2  . ILE A 1 263 ? -36.468 3.998   34.251  1.00 12.42 ? 252  ILE A CG2  1 
ATOM   3951  C CD1  . ILE A 1 263 ? -34.116 3.326   32.324  1.00 14.73 ? 252  ILE A CD1  1 
ATOM   3952  H H    . ILE A 1 263 ? -37.060 4.507   30.312  1.00 12.49 ? 252  ILE A H    1 
ATOM   3953  H HA   . ILE A 1 263 ? -36.798 2.486   32.090  1.00 11.99 ? 252  ILE A HA   1 
ATOM   3954  H HB   . ILE A 1 263 ? -36.865 5.248   32.677  1.00 13.11 ? 252  ILE A HB   1 
ATOM   3955  H HG12 . ILE A 1 263 ? -34.980 4.909   31.393  1.00 15.37 ? 252  ILE A HG12 1 
ATOM   3956  H HG13 . ILE A 1 263 ? -34.540 5.230   32.881  1.00 15.37 ? 252  ILE A HG13 1 
ATOM   3957  H HG21 . ILE A 1 263 ? -35.988 4.660   34.773  1.00 14.91 ? 252  ILE A HG21 1 
ATOM   3958  H HG22 . ILE A 1 263 ? -37.395 3.962   34.534  1.00 14.91 ? 252  ILE A HG22 1 
ATOM   3959  H HG23 . ILE A 1 263 ? -36.055 3.127   34.359  1.00 14.91 ? 252  ILE A HG23 1 
ATOM   3960  H HD11 . ILE A 1 263 ? -33.224 3.546   32.012  1.00 17.68 ? 252  ILE A HD11 1 
ATOM   3961  H HD12 . ILE A 1 263 ? -34.075 2.986   33.231  1.00 17.68 ? 252  ILE A HD12 1 
ATOM   3962  H HD13 . ILE A 1 263 ? -34.516 2.663   31.739  1.00 17.68 ? 252  ILE A HD13 1 
ATOM   3963  N N    . THR A 1 264 ? -39.197 2.193   32.620  1.00 10.85 ? 253  THR A N    1 
ATOM   3964  C CA   . THR A 1 264 ? -40.580 2.170   33.072  1.00 10.71 ? 253  THR A CA   1 
ATOM   3965  C C    . THR A 1 264 ? -40.679 2.690   34.506  1.00 11.26 ? 253  THR A C    1 
ATOM   3966  O O    . THR A 1 264 ? -39.718 2.639   35.266  1.00 11.46 ? 253  THR A O    1 
ATOM   3967  C CB   . THR A 1 264 ? -41.178 0.783   33.014  1.00 11.90 ? 253  THR A CB   1 
ATOM   3968  O OG1  . THR A 1 264 ? -40.531 -0.122  33.909  1.00 13.22 ? 253  THR A OG1  1 
ATOM   3969  C CG2  . THR A 1 264 ? -41.237 0.239   31.616  1.00 13.32 ? 253  THR A CG2  1 
ATOM   3970  H H    . THR A 1 264 ? -38.809 1.426   32.587  1.00 13.02 ? 253  THR A H    1 
ATOM   3971  H HA   . THR A 1 264 ? -41.110 2.750   32.503  1.00 12.86 ? 253  THR A HA   1 
ATOM   3972  H HB   . THR A 1 264 ? -42.099 0.861   33.308  1.00 14.28 ? 253  THR A HB   1 
ATOM   3973  H HG1  . THR A 1 264 ? -39.716 -0.186  33.715  1.00 15.86 ? 253  THR A HG1  1 
ATOM   3974  H HG21 . THR A 1 264 ? -41.625 -0.650  31.622  1.00 15.99 ? 253  THR A HG21 1 
ATOM   3975  H HG22 . THR A 1 264 ? -41.780 0.817   31.058  1.00 15.99 ? 253  THR A HG22 1 
ATOM   3976  H HG23 . THR A 1 264 ? -40.343 0.190   31.242  1.00 15.99 ? 253  THR A HG23 1 
ATOM   3977  N N    . LYS A 1 265 ? -41.843 3.232   34.853  1.00 10.28 ? 254  LYS A N    1 
ATOM   3978  C CA   . LYS A 1 265 ? -42.160 3.508   36.268  1.00 11.34 ? 254  LYS A CA   1 
ATOM   3979  C C    . LYS A 1 265 ? -41.076 4.357   36.941  1.00 11.47 ? 254  LYS A C    1 
ATOM   3980  O O    . LYS A 1 265 ? -40.537 3.990   37.978  1.00 11.64 ? 254  LYS A O    1 
ATOM   3981  C CB   . LYS A 1 265 ? -42.351 2.201   37.052  1.00 13.27 ? 254  LYS A CB   1 
ATOM   3982  C CG   . LYS A 1 265 ? -43.465 1.321   36.625  1.00 13.86 ? 254  LYS A CG   1 
ATOM   3983  C CD   . LYS A 1 265 ? -43.395 0.046   37.436  1.00 15.31 ? 254  LYS A CD   1 
ATOM   3984  C CE   . LYS A 1 265 ? -44.594 -0.788  37.296  1.00 15.85 ? 254  LYS A CE   1 
ATOM   3985  N NZ   . LYS A 1 265 ? -44.488 -1.929  38.238  1.00 16.35 ? 254  LYS A NZ   1 
ATOM   3986  H H    . LYS A 1 265 ? -42.466 3.450   34.301  1.00 12.34 ? 254  LYS A H    1 
ATOM   3987  H HA   . LYS A 1 265 ? -42.993 4.004   36.310  1.00 13.61 ? 254  LYS A HA   1 
ATOM   3988  H HB2  . LYS A 1 265 ? -41.534 1.683   36.979  1.00 15.92 ? 254  LYS A HB2  1 
ATOM   3989  H HB3  . LYS A 1 265 ? -42.504 2.426   37.982  1.00 15.92 ? 254  LYS A HB3  1 
ATOM   3990  H HG2  . LYS A 1 265 ? -44.315 1.756   36.797  1.00 16.63 ? 254  LYS A HG2  1 
ATOM   3991  H HG3  . LYS A 1 265 ? -43.372 1.101   35.685  1.00 16.63 ? 254  LYS A HG3  1 
ATOM   3992  H HD2  . LYS A 1 265 ? -42.632 -0.475  37.140  1.00 18.38 ? 254  LYS A HD2  1 
ATOM   3993  H HD3  . LYS A 1 265 ? -43.297 0.274   38.374  1.00 18.38 ? 254  LYS A HD3  1 
ATOM   3994  H HE2  . LYS A 1 265 ? -45.383 -0.269  37.519  1.00 19.02 ? 254  LYS A HE2  1 
ATOM   3995  H HE3  . LYS A 1 265 ? -44.652 -1.132  36.391  1.00 19.02 ? 254  LYS A HE3  1 
ATOM   3996  H HZ1  . LYS A 1 265 ? -44.428 -1.629  39.073  1.00 19.62 ? 254  LYS A HZ1  1 
ATOM   3997  H HZ2  . LYS A 1 265 ? -45.208 -2.448  38.168  1.00 19.62 ? 254  LYS A HZ2  1 
ATOM   3998  H HZ3  . LYS A 1 265 ? -43.764 -2.412  38.050  1.00 19.62 ? 254  LYS A HZ3  1 
ATOM   3999  N N    . VAL A 1 266 ? -40.827 5.545   36.397  1.00 10.87 ? 255  VAL A N    1 
ATOM   4000  C CA   . VAL A 1 266 ? -39.910 6.474   37.054  1.00 11.07 ? 255  VAL A CA   1 
ATOM   4001  C C    . VAL A 1 266 ? -40.614 7.012   38.285  1.00 10.91 ? 255  VAL A C    1 
ATOM   4002  O O    . VAL A 1 266 ? -41.627 7.720   38.173  1.00 11.20 ? 255  VAL A O    1 
ATOM   4003  C CB   . VAL A 1 266 ? -39.480 7.599   36.102  1.00 11.13 ? 255  VAL A CB   1 
ATOM   4004  C CG1  . VAL A 1 266 ? -38.608 8.637   36.827  1.00 12.13 ? 255  VAL A CG1  1 
ATOM   4005  C CG2  . VAL A 1 266 ? -38.697 7.020   34.951  1.00 11.94 ? 255  VAL A CG2  1 
ATOM   4006  H H    . VAL A 1 266 ? -41.169 5.834   35.663  1.00 13.05 ? 255  VAL A H    1 
ATOM   4007  H HA   . VAL A 1 266 ? -39.117 5.995   37.340  1.00 13.29 ? 255  VAL A HA   1 
ATOM   4008  H HB   . VAL A 1 266 ? -40.265 8.046   35.749  1.00 13.36 ? 255  VAL A HB   1 
ATOM   4009  H HG11 . VAL A 1 266 ? -38.355 9.331   36.198  1.00 14.55 ? 255  VAL A HG11 1 
ATOM   4010  H HG12 . VAL A 1 266 ? -39.117 9.022   37.558  1.00 14.55 ? 255  VAL A HG12 1 
ATOM   4011  H HG13 . VAL A 1 266 ? -37.815 8.198   37.172  1.00 14.55 ? 255  VAL A HG13 1 
ATOM   4012  H HG21 . VAL A 1 266 ? -38.431 7.739   34.358  1.00 14.33 ? 255  VAL A HG21 1 
ATOM   4013  H HG22 . VAL A 1 266 ? -37.911 6.570   35.299  1.00 14.33 ? 255  VAL A HG22 1 
ATOM   4014  H HG23 . VAL A 1 266 ? -39.257 6.388   34.475  1.00 14.33 ? 255  VAL A HG23 1 
ATOM   4015  N N    . MET A 1 267 ? -40.067 6.705   39.466  1.00 10.83 ? 256  MET A N    1 
ATOM   4016  C CA   . MET A 1 267 ? -40.756 7.007   40.728  1.00 10.83 ? 256  MET A CA   1 
ATOM   4017  C C    . MET A 1 267 ? -40.074 8.031   41.588  1.00 11.09 ? 256  MET A C    1 
ATOM   4018  O O    . MET A 1 267 ? -40.703 8.552   42.509  1.00 13.19 ? 256  MET A O    1 
ATOM   4019  C CB   . MET A 1 267 ? -40.907 5.748   41.574  1.00 11.58 ? 256  MET A CB   1 
ATOM   4020  C CG   . MET A 1 267 ? -41.671 4.604   40.913  1.00 12.00 ? 256  MET A CG   1 
ATOM   4021  S SD   . MET A 1 267 ? -43.303 5.049   40.291  1.00 11.80 ? 256  MET A SD   1 
ATOM   4022  C CE   . MET A 1 267 ? -44.208 5.160   41.870  1.00 12.65 ? 256  MET A CE   1 
ATOM   4023  H H    . MET A 1 267 ? -39.303 6.324   39.564  1.00 12.99 ? 256  MET A H    1 
ATOM   4024  H HA   . MET A 1 267 ? -41.647 7.327   40.520  1.00 12.99 ? 256  MET A HA   1 
ATOM   4025  H HB2  . MET A 1 267 ? -40.022 5.418   41.794  1.00 13.89 ? 256  MET A HB2  1 
ATOM   4026  H HB3  . MET A 1 267 ? -41.378 5.981   42.389  1.00 13.89 ? 256  MET A HB3  1 
ATOM   4027  H HG2  . MET A 1 267 ? -41.151 4.277   40.163  1.00 14.39 ? 256  MET A HG2  1 
ATOM   4028  H HG3  . MET A 1 267 ? -41.788 3.894   41.563  1.00 14.39 ? 256  MET A HG3  1 
ATOM   4029  H HE1  . MET A 1 267 ? -45.131 5.399   41.689  1.00 15.18 ? 256  MET A HE1  1 
ATOM   4030  H HE2  . MET A 1 267 ? -44.171 4.299   42.316  1.00 15.18 ? 256  MET A HE2  1 
ATOM   4031  H HE3  . MET A 1 267 ? -43.793 5.838   42.425  1.00 15.18 ? 256  MET A HE3  1 
ATOM   4032  N N    . SER A 1 268 ? -38.815 8.350   41.347  1.00 11.67 ? 257  SER A N    1 
ATOM   4033  C CA   . SER A 1 268 ? -38.101 9.179   42.300  1.00 11.09 ? 257  SER A CA   1 
ATOM   4034  C C    . SER A 1 268 ? -37.327 10.303  41.632  1.00 11.01 ? 257  SER A C    1 
ATOM   4035  O O    . SER A 1 268 ? -36.988 10.245  40.435  1.00 11.23 ? 257  SER A O    1 
ATOM   4036  C CB   . SER A 1 268 ? -37.141 8.341   43.110  1.00 11.99 ? 257  SER A CB   1 
ATOM   4037  O OG   . SER A 1 268 ? -36.094 7.794   42.331  1.00 12.12 ? 257  SER A OG   1 
ATOM   4038  H H    . SER A 1 268 ? -38.361 8.107   40.658  1.00 14.00 ? 257  SER A H    1 
ATOM   4039  H HA   . SER A 1 268 ? -38.740 9.578   42.911  1.00 13.31 ? 257  SER A HA   1 
ATOM   4040  H HB2  . SER A 1 268 ? -36.753 8.898   43.802  1.00 14.39 ? 257  SER A HB2  1 
ATOM   4041  H HB3  . SER A 1 268 ? -37.636 7.613   43.518  1.00 14.39 ? 257  SER A HB3  1 
ATOM   4042  H HG   . SER A 1 268 ? -36.411 7.302   41.728  1.00 14.55 ? 257  SER A HG   1 
ATOM   4043  N N    . LYS A 1 269 ? -37.011 11.318  42.454  1.00 11.53 ? 258  LYS A N    1 
ATOM   4044  C CA   . LYS A 1 269 ? -36.201 12.420  41.958  1.00 11.90 ? 258  LYS A CA   1 
ATOM   4045  C C    . LYS A 1 269 ? -34.844 11.938  41.479  1.00 12.06 ? 258  LYS A C    1 
ATOM   4046  O O    . LYS A 1 269 ? -34.345 12.400  40.450  1.00 12.91 ? 258  LYS A O    1 
ATOM   4047  C CB   . LYS A 1 269 ? -36.023 13.469  43.029  1.00 12.02 ? 258  LYS A CB   1 
ATOM   4048  C CG   . LYS A 1 269 ? -37.355 14.091  43.486  1.00 13.09 ? 258  LYS A CG   1 
ATOM   4049  C CD   . LYS A 1 269 ? -37.216 15.380  44.295  1.00 18.15 ? 258  LYS A CD   1 
ATOM   4050  C CE   . LYS A 1 269 ? -36.356 15.239  45.450  1.00 23.27 ? 258  LYS A CE   1 
ATOM   4051  N NZ   . LYS A 1 269 ? -36.356 16.530  46.239  1.00 26.98 ? 258  LYS A NZ   1 
ATOM   4052  H H    . LYS A 1 269 ? -37.249 11.384  43.277  1.00 13.83 ? 258  LYS A H    1 
ATOM   4053  H HA   . LYS A 1 269 ? -36.655 12.833  41.207  1.00 14.28 ? 258  LYS A HA   1 
ATOM   4054  H HB2  . LYS A 1 269 ? -35.601 13.062  43.802  1.00 14.42 ? 258  LYS A HB2  1 
ATOM   4055  H HB3  . LYS A 1 269 ? -35.463 14.181  42.682  1.00 14.42 ? 258  LYS A HB3  1 
ATOM   4056  H HG2  . LYS A 1 269 ? -37.888 14.294  42.701  1.00 15.71 ? 258  LYS A HG2  1 
ATOM   4057  H HG3  . LYS A 1 269 ? -37.824 13.447  44.039  1.00 15.71 ? 258  LYS A HG3  1 
ATOM   4058  H HD2  . LYS A 1 269 ? -36.839 16.069  43.725  1.00 21.78 ? 258  LYS A HD2  1 
ATOM   4059  H HD3  . LYS A 1 269 ? -38.093 15.652  44.607  1.00 21.78 ? 258  LYS A HD3  1 
ATOM   4060  H HE2  . LYS A 1 269 ? -36.689 14.527  46.019  1.00 27.92 ? 258  LYS A HE2  1 
ATOM   4061  H HE3  . LYS A 1 269 ? -35.449 15.051  45.162  1.00 27.92 ? 258  LYS A HE3  1 
ATOM   4062  H HZ1  . LYS A 1 269 ? -36.057 17.197  45.730  1.00 32.37 ? 258  LYS A HZ1  1 
ATOM   4063  H HZ2  . LYS A 1 269 ? -37.183 16.721  46.509  1.00 32.37 ? 258  LYS A HZ2  1 
ATOM   4064  H HZ3  . LYS A 1 269 ? -35.830 16.451  46.952  1.00 32.37 ? 258  LYS A HZ3  1 
ATOM   4065  N N    . SER A 1 270 ? -34.213 11.053  42.229  1.00 11.68 ? 259  SER A N    1 
ATOM   4066  C CA   . SER A 1 270 ? -32.857 10.692  41.856  1.00 12.98 ? 259  SER A CA   1 
ATOM   4067  C C    . SER A 1 270 ? -32.830 9.864   40.569  1.00 11.82 ? 259  SER A C    1 
ATOM   4068  O O    . SER A 1 270 ? -31.912 10.006  39.764  1.00 12.54 ? 259  SER A O    1 
ATOM   4069  C CB   . SER A 1 270 ? -32.084 10.038  42.990  1.00 18.64 ? 259  SER A CB   1 
ATOM   4070  O OG   . SER A 1 270 ? -32.707 8.826   43.348  1.00 16.35 ? 259  SER A OG   1 
ATOM   4071  H H    . SER A 1 270 ? -34.528 10.661  42.927  1.00 14.01 ? 259  SER A H    1 
ATOM   4072  H HA   . SER A 1 270 ? -32.389 11.517  41.654  1.00 15.57 ? 259  SER A HA   1 
ATOM   4073  H HB2  . SER A 1 270 ? -31.178 9.857   42.696  1.00 22.37 ? 259  SER A HB2  1 
ATOM   4074  H HB3  . SER A 1 270 ? -32.077 10.632  43.756  1.00 22.37 ? 259  SER A HB3  1 
ATOM   4075  H HG   . SER A 1 270 ? -33.495 8.971   43.600  1.00 19.62 ? 259  SER A HG   1 
ATOM   4076  N N    A SER A 1 271 ? -33.808 9.000   40.392  0.62 11.19 ? 260  SER A N    1 
ATOM   4077  N N    B SER A 1 271 ? -33.822 9.023   40.325  0.38 12.61 ? 260  SER A N    1 
ATOM   4078  C CA   A SER A 1 271 ? -33.927 8.254   39.158  0.62 10.71 ? 260  SER A CA   1 
ATOM   4079  C CA   B SER A 1 271 ? -33.817 8.283   39.067  0.38 11.84 ? 260  SER A CA   1 
ATOM   4080  C C    A SER A 1 271 ? -34.116 9.184   37.974  0.62 10.24 ? 260  SER A C    1 
ATOM   4081  C C    B SER A 1 271 ? -34.137 9.202   37.898  0.38 11.74 ? 260  SER A C    1 
ATOM   4082  O O    A SER A 1 271 ? -33.433 9.030   36.948  0.62 10.07 ? 260  SER A O    1 
ATOM   4083  O O    B SER A 1 271 ? -33.540 9.087   36.816  0.38 13.92 ? 260  SER A O    1 
ATOM   4084  C CB   A SER A 1 271 ? -35.073 7.272   39.301  0.62 12.26 ? 260  SER A CB   1 
ATOM   4085  C CB   B SER A 1 271 ? -34.764 7.086   39.143  0.38 11.12 ? 260  SER A CB   1 
ATOM   4086  O OG   A SER A 1 271 ? -35.306 6.645   38.087  0.62 12.08 ? 260  SER A OG   1 
ATOM   4087  O OG   B SER A 1 271 ? -36.109 7.488   39.152  0.38 10.26 ? 260  SER A OG   1 
ATOM   4088  H H    A SER A 1 271 ? -34.419 8.826   40.972  0.62 13.43 ? 260  SER A H    1 
ATOM   4089  H H    B SER A 1 271 ? -34.487 8.863   40.846  0.38 15.13 ? 260  SER A H    1 
ATOM   4090  H HA   A SER A 1 271 ? -33.112 7.747   39.014  0.62 12.86 ? 260  SER A HA   1 
ATOM   4091  H HA   B SER A 1 271 ? -32.924 7.934   38.923  0.38 14.21 ? 260  SER A HA   1 
ATOM   4092  H HB2  A SER A 1 271 ? -34.841 6.605   39.966  0.62 14.71 ? 260  SER A HB2  1 
ATOM   4093  H HB2  B SER A 1 271 ? -34.613 6.517   38.371  0.38 13.34 ? 260  SER A HB2  1 
ATOM   4094  H HB3  A SER A 1 271 ? -35.872 7.751   39.571  0.62 14.71 ? 260  SER A HB3  1 
ATOM   4095  H HB3  B SER A 1 271 ? -34.580 6.592   39.957  0.38 13.34 ? 260  SER A HB3  1 
ATOM   4096  H HG   A SER A 1 271 ? -35.940 6.100   38.162  0.62 14.49 ? 260  SER A HG   1 
ATOM   4097  H HG   B SER A 1 271 ? -36.610 6.816   39.193  0.38 12.32 ? 260  SER A HG   1 
ATOM   4098  N N    . ALA A 1 272 ? -35.060 10.138  38.080  1.00 10.57 ? 261  ALA A N    1 
ATOM   4099  C CA   . ALA A 1 272 ? -35.309 11.057  36.993  1.00 10.67 ? 261  ALA A CA   1 
ATOM   4100  C C    . ALA A 1 272 ? -34.074 11.898  36.677  1.00 10.60 ? 261  ALA A C    1 
ATOM   4101  O O    . ALA A 1 272 ? -33.830 12.246  35.515  1.00 11.99 ? 261  ALA A O    1 
ATOM   4102  C CB   . ALA A 1 272 ? -36.487 11.950  37.352  1.00 11.61 ? 261  ALA A CB   1 
ATOM   4103  H H    . ALA A 1 272 ? -35.543 10.254  38.782  1.00 12.69 ? 261  ALA A H    1 
ATOM   4104  H HA   . ALA A 1 272 ? -35.543 10.553  36.198  1.00 12.81 ? 261  ALA A HA   1 
ATOM   4105  H HB1  . ALA A 1 272 ? -36.651 12.565  36.621  1.00 13.93 ? 261  ALA A HB1  1 
ATOM   4106  H HB2  . ALA A 1 272 ? -37.270 11.396  37.501  1.00 13.93 ? 261  ALA A HB2  1 
ATOM   4107  H HB3  . ALA A 1 272 ? -36.274 12.445  38.159  1.00 13.93 ? 261  ALA A HB3  1 
ATOM   4108  N N    . GLU A 1 273 ? -33.357 12.312  37.712  1.00 11.03 ? 262  GLU A N    1 
ATOM   4109  C CA   . GLU A 1 273 ? -32.130 13.094  37.517  1.00 11.51 ? 262  GLU A CA   1 
ATOM   4110  C C    . GLU A 1 273 ? -31.045 12.305  36.794  1.00 12.33 ? 262  GLU A C    1 
ATOM   4111  O O    . GLU A 1 273 ? -30.325 12.864  35.954  1.00 13.18 ? 262  GLU A O    1 
ATOM   4112  C CB   . GLU A 1 273 ? -31.629 13.557  38.891  1.00 14.28 ? 262  GLU A CB   1 
ATOM   4113  C CG   . GLU A 1 273 ? -30.322 14.366  38.868  1.00 16.65 ? 262  GLU A CG   1 
ATOM   4114  C CD   . GLU A 1 273 ? -30.369 15.691  38.151  1.00 20.31 ? 262  GLU A CD   1 
ATOM   4115  O OE1  . GLU A 1 273 ? -31.468 16.183  37.855  1.00 21.94 ? 262  GLU A OE1  1 
ATOM   4116  O OE2  . GLU A 1 273 ? -29.254 16.269  37.884  1.00 21.98 ? 262  GLU A OE2  1 
ATOM   4117  H H    . GLU A 1 273 ? -33.553 12.157  38.535  1.00 13.23 ? 262  GLU A H    1 
ATOM   4118  H HA   . GLU A 1 273 ? -32.334 13.881  36.989  1.00 13.81 ? 262  GLU A HA   1 
ATOM   4119  H HB2  . GLU A 1 273 ? -32.311 14.114  39.297  1.00 17.14 ? 262  GLU A HB2  1 
ATOM   4120  H HB3  . GLU A 1 273 ? -31.478 12.774  39.444  1.00 17.14 ? 262  GLU A HB3  1 
ATOM   4121  H HG2  . GLU A 1 273 ? -30.058 14.544  39.784  1.00 19.98 ? 262  GLU A HG2  1 
ATOM   4122  H HG3  . GLU A 1 273 ? -29.639 13.830  38.435  1.00 19.98 ? 262  GLU A HG3  1 
ATOM   4123  N N    . VAL A 1 274 ? -30.909 11.003  37.083  1.00 11.39 ? 263  VAL A N    1 
ATOM   4124  C CA   . VAL A 1 274 ? -30.000 10.175  36.299  1.00 11.16 ? 263  VAL A CA   1 
ATOM   4125  C C    . VAL A 1 274 ? -30.374 10.231  34.819  1.00 10.87 ? 263  VAL A C    1 
ATOM   4126  O O    . VAL A 1 274 ? -29.518 10.364  33.941  1.00 10.77 ? 263  VAL A O    1 
ATOM   4127  C CB   . VAL A 1 274 ? -29.975 8.720   36.819  1.00 11.49 ? 263  VAL A CB   1 
ATOM   4128  C CG1  . VAL A 1 274 ? -29.170 7.804   35.849  1.00 11.60 ? 263  VAL A CG1  1 
ATOM   4129  C CG2  . VAL A 1 274 ? -29.337 8.589   38.215  1.00 13.83 ? 263  VAL A CG2  1 
ATOM   4130  H H    . VAL A 1 274 ? -31.323 10.589  37.714  1.00 13.67 ? 263  VAL A H    1 
ATOM   4131  H HA   . VAL A 1 274 ? -29.103 10.533  36.388  1.00 13.39 ? 263  VAL A HA   1 
ATOM   4132  H HB   . VAL A 1 274 ? -30.884 8.383   36.869  1.00 13.79 ? 263  VAL A HB   1 
ATOM   4133  H HG11 . VAL A 1 274 ? -29.169 6.899   36.198  1.00 13.92 ? 263  VAL A HG11 1 
ATOM   4134  H HG12 . VAL A 1 274 ? -29.591 7.822   34.975  1.00 13.92 ? 263  VAL A HG12 1 
ATOM   4135  H HG13 . VAL A 1 274 ? -28.260 8.135   35.785  1.00 13.92 ? 263  VAL A HG13 1 
ATOM   4136  H HG21 . VAL A 1 274 ? -29.352 7.657   38.482  1.00 16.60 ? 263  VAL A HG21 1 
ATOM   4137  H HG22 . VAL A 1 274 ? -28.422 8.908   38.174  1.00 16.60 ? 263  VAL A HG22 1 
ATOM   4138  H HG23 . VAL A 1 274 ? -29.846 9.123   38.845  1.00 16.60 ? 263  VAL A HG23 1 
ATOM   4139  N N    . ILE A 1 275 ? -31.657 10.092  34.522  1.00 11.35 ? 264  ILE A N    1 
ATOM   4140  C CA   . ILE A 1 275 ? -32.129 10.137  33.143  1.00 11.04 ? 264  ILE A CA   1 
ATOM   4141  C C    . ILE A 1 275 ? -31.797 11.483  32.518  1.00 11.68 ? 264  ILE A C    1 
ATOM   4142  O O    . ILE A 1 275 ? -31.265 11.544  31.393  1.00 11.95 ? 264  ILE A O    1 
ATOM   4143  C CB   . ILE A 1 275 ? -33.623 9.823   33.064  1.00 10.18 ? 264  ILE A CB   1 
ATOM   4144  C CG1  . ILE A 1 275 ? -33.894 8.415   33.502  1.00 11.66 ? 264  ILE A CG1  1 
ATOM   4145  C CG2  . ILE A 1 275 ? -34.139 10.069  31.667  1.00 12.25 ? 264  ILE A CG2  1 
ATOM   4146  C CD1  . ILE A 1 275 ? -35.368 8.103   33.749  1.00 11.54 ? 264  ILE A CD1  1 
ATOM   4147  H H    . ILE A 1 275 ? -32.280 9.969   35.102  1.00 13.62 ? 264  ILE A H    1 
ATOM   4148  H HA   . ILE A 1 275 ? -31.661 9.456   32.635  1.00 13.25 ? 264  ILE A HA   1 
ATOM   4149  H HB   . ILE A 1 275 ? -34.090 10.422  33.668  1.00 12.21 ? 264  ILE A HB   1 
ATOM   4150  H HG12 . ILE A 1 275 ? -33.576 7.809   32.814  1.00 13.99 ? 264  ILE A HG12 1 
ATOM   4151  H HG13 . ILE A 1 275 ? -33.416 8.249   34.329  1.00 13.99 ? 264  ILE A HG13 1 
ATOM   4152  H HG21 . ILE A 1 275 ? -35.087 9.864   31.641  1.00 14.70 ? 264  ILE A HG21 1 
ATOM   4153  H HG22 . ILE A 1 275 ? -33.995 11.000  31.437  1.00 14.70 ? 264  ILE A HG22 1 
ATOM   4154  H HG23 . ILE A 1 275 ? -33.659 9.497   31.049  1.00 14.70 ? 264  ILE A HG23 1 
ATOM   4155  H HD11 . ILE A 1 275 ? -35.453 7.178   34.026  1.00 13.84 ? 264  ILE A HD11 1 
ATOM   4156  H HD12 . ILE A 1 275 ? -35.702 8.690   34.445  1.00 13.84 ? 264  ILE A HD12 1 
ATOM   4157  H HD13 . ILE A 1 275 ? -35.863 8.249   32.927  1.00 13.84 ? 264  ILE A HD13 1 
ATOM   4158  N N    . ALA A 1 276 ? -32.099 12.579  33.230  1.00 11.67 ? 265  ALA A N    1 
ATOM   4159  C CA   . ALA A 1 276 ? -31.838 13.915  32.707  1.00 12.54 ? 265  ALA A CA   1 
ATOM   4160  C C    . ALA A 1 276 ? -30.360 14.092  32.375  1.00 12.64 ? 265  ALA A C    1 
ATOM   4161  O O    . ALA A 1 276 ? -29.998 14.570  31.285  1.00 13.57 ? 265  ALA A O    1 
ATOM   4162  C CB   . ALA A 1 276 ? -32.278 14.938  33.747  1.00 13.17 ? 265  ALA A CB   1 
ATOM   4163  H H    . ALA A 1 276 ? -32.453 12.570  34.013  1.00 14.01 ? 265  ALA A H    1 
ATOM   4164  H HA   . ALA A 1 276 ? -32.355 14.054  31.898  1.00 15.05 ? 265  ALA A HA   1 
ATOM   4165  H HB1  . ALA A 1 276 ? -32.107 15.829  33.405  1.00 15.80 ? 265  ALA A HB1  1 
ATOM   4166  H HB2  . ALA A 1 276 ? -33.226 14.825  33.918  1.00 15.80 ? 265  ALA A HB2  1 
ATOM   4167  H HB3  . ALA A 1 276 ? -31.775 14.794  34.563  1.00 15.80 ? 265  ALA A HB3  1 
ATOM   4168  N N    . GLN A 1 277 ? -29.464 13.682  33.293  1.00 12.29 ? 266  GLN A N    1 
ATOM   4169  C CA   . GLN A 1 277 ? -28.042 13.861  33.027  1.00 14.03 ? 266  GLN A CA   1 
ATOM   4170  C C    . GLN A 1 277 ? -27.600 13.017  31.842  1.00 11.21 ? 266  GLN A C    1 
ATOM   4171  O O    . GLN A 1 277 ? -26.742 13.438  31.062  1.00 12.76 ? 266  GLN A O    1 
ATOM   4172  C CB   . GLN A 1 277 ? -27.257 13.568  34.299  1.00 15.50 ? 266  GLN A CB   1 
ATOM   4173  C CG   . GLN A 1 277 ? -27.463 14.613  35.402  1.00 17.56 ? 266  GLN A CG   1 
ATOM   4174  C CD   . GLN A 1 277 ? -27.069 16.093  35.027  1.00 26.99 ? 266  GLN A CD   1 
ATOM   4175  O OE1  . GLN A 1 277 ? -26.275 16.353  34.156  1.00 38.30 ? 266  GLN A OE1  1 
ATOM   4176  N NE2  . GLN A 1 277 ? -27.739 17.041  35.680  1.00 37.68 ? 266  GLN A NE2  1 
ATOM   4177  H H    . GLN A 1 277 ? -29.653 13.312  34.046  1.00 14.75 ? 266  GLN A H    1 
ATOM   4178  H HA   . GLN A 1 277 ? -27.887 14.791  32.796  1.00 16.84 ? 266  GLN A HA   1 
ATOM   4179  H HB2  . GLN A 1 277 ? -27.537 12.708  34.649  1.00 18.60 ? 266  GLN A HB2  1 
ATOM   4180  H HB3  . GLN A 1 277 ? -26.311 13.545  34.085  1.00 18.60 ? 266  GLN A HB3  1 
ATOM   4181  H HG2  . GLN A 1 277 ? -28.401 14.616  35.649  1.00 21.07 ? 266  GLN A HG2  1 
ATOM   4182  H HG3  . GLN A 1 277 ? -26.928 14.356  36.170  1.00 21.07 ? 266  GLN A HG3  1 
ATOM   4183  H HE21 . GLN A 1 277 ? -28.337 16.825  36.258  1.00 45.22 ? 266  GLN A HE21 1 
ATOM   4184  H HE22 . GLN A 1 277 ? -27.573 17.870  35.522  1.00 45.22 ? 266  GLN A HE22 1 
ATOM   4185  N N    . ALA A 1 278 ? -28.137 11.808  31.731  1.00 11.56 ? 267  ALA A N    1 
ATOM   4186  C CA   . ALA A 1 278 ? -27.733 10.935  30.643  1.00 11.52 ? 267  ALA A CA   1 
ATOM   4187  C C    . ALA A 1 278 ? -28.158 11.502  29.301  1.00 10.77 ? 267  ALA A C    1 
ATOM   4188  O O    . ALA A 1 278 ? -27.422 11.392  28.324  1.00 11.55 ? 267  ALA A O    1 
ATOM   4189  C CB   . ALA A 1 278 ? -28.306 9.549   30.861  1.00 12.25 ? 267  ALA A CB   1 
ATOM   4190  H H    . ALA A 1 278 ? -28.725 11.476  32.263  1.00 13.87 ? 267  ALA A H    1 
ATOM   4191  H HA   . ALA A 1 278 ? -26.766 10.861  30.643  1.00 13.83 ? 267  ALA A HA   1 
ATOM   4192  H HB1  . ALA A 1 278 ? -28.030 8.975   30.130  1.00 14.69 ? 267  ALA A HB1  1 
ATOM   4193  H HB2  . ALA A 1 278 ? -27.972 9.198   31.702  1.00 14.69 ? 267  ALA A HB2  1 
ATOM   4194  H HB3  . ALA A 1 278 ? -29.274 9.609   30.889  1.00 14.69 ? 267  ALA A HB3  1 
ATOM   4195  N N    . ARG A 1 279 ? -29.364 12.072  29.210  1.00 11.85 ? 268  ARG A N    1 
ATOM   4196  C CA   . ARG A 1 279 ? -29.796 12.668  27.955  1.00 13.08 ? 268  ARG A CA   1 
ATOM   4197  C C    . ARG A 1 279 ? -28.839 13.761  27.537  1.00 12.88 ? 268  ARG A C    1 
ATOM   4198  O O    . ARG A 1 279 ? -28.556 13.931  26.347  1.00 12.93 ? 268  ARG A O    1 
ATOM   4199  C CB   . ARG A 1 279 ? -31.197 13.241  28.107  1.00 14.16 ? 268  ARG A CB   1 
ATOM   4200  C CG   . ARG A 1 279 ? -32.265 12.222  28.225  1.00 15.39 ? 268  ARG A CG   1 
ATOM   4201  C CD   . ARG A 1 279 ? -33.635 12.892  28.379  1.00 16.73 ? 268  ARG A CD   1 
ATOM   4202  N NE   . ARG A 1 279 ? -34.015 13.504  27.115  1.00 14.78 ? 268  ARG A NE   1 
ATOM   4203  C CZ   . ARG A 1 279 ? -33.883 14.818  26.794  1.00 19.26 ? 268  ARG A CZ   1 
ATOM   4204  N NH1  . ARG A 1 279 ? -33.543 15.779  27.668  1.00 17.43 ? 268  ARG A NH1  1 
ATOM   4205  N NH2  . ARG A 1 279 ? -34.129 15.207  25.555  1.00 22.18 ? 268  ARG A NH2  1 
ATOM   4206  H H    . ARG A 1 279 ? -29.936 12.124  29.850  1.00 14.22 ? 268  ARG A H    1 
ATOM   4207  H HA   . ARG A 1 279 ? -29.813 11.990  27.261  1.00 15.69 ? 268  ARG A HA   1 
ATOM   4208  H HB2  . ARG A 1 279 ? -31.223 13.789  28.907  1.00 16.99 ? 268  ARG A HB2  1 
ATOM   4209  H HB3  . ARG A 1 279 ? -31.395 13.787  27.330  1.00 16.99 ? 268  ARG A HB3  1 
ATOM   4210  H HG2  . ARG A 1 279 ? -32.280 11.675  27.423  1.00 18.47 ? 268  ARG A HG2  1 
ATOM   4211  H HG3  . ARG A 1 279 ? -32.102 11.672  29.007  1.00 18.47 ? 268  ARG A HG3  1 
ATOM   4212  H HD2  . ARG A 1 279 ? -34.300 12.227  28.616  1.00 20.07 ? 268  ARG A HD2  1 
ATOM   4213  H HD3  . ARG A 1 279 ? -33.586 13.584  29.057  1.00 20.07 ? 268  ARG A HD3  1 
ATOM   4214  H HE   . ARG A 1 279 ? -34.354 12.987  26.517  1.00 17.74 ? 268  ARG A HE   1 
ATOM   4215  H HH11 . ARG A 1 279 ? -33.339 15.571  28.477  1.00 20.92 ? 268  ARG A HH11 1 
ATOM   4216  H HH12 . ARG A 1 279 ? -33.502 16.599  27.411  1.00 20.92 ? 268  ARG A HH12 1 
ATOM   4217  H HH21 . ARG A 1 279 ? -34.389 14.633  24.970  1.00 26.62 ? 268  ARG A HH21 1 
ATOM   4218  H HH22 . ARG A 1 279 ? -34.117 16.044  25.359  1.00 26.62 ? 268  ARG A HH22 1 
ATOM   4219  N N    . LYS A 1 280 ? -28.412 14.577  28.499  1.00 14.29 ? 269  LYS A N    1 
ATOM   4220  C CA   . LYS A 1 280 ? -27.505 15.672  28.201  1.00 14.95 ? 269  LYS A CA   1 
ATOM   4221  C C    . LYS A 1 280 ? -26.211 15.157  27.587  1.00 14.91 ? 269  LYS A C    1 
ATOM   4222  O O    . LYS A 1 280 ? -25.625 15.829  26.730  1.00 17.41 ? 269  LYS A O    1 
ATOM   4223  C CB   . LYS A 1 280 ? -27.262 16.491  29.475  1.00 19.25 ? 269  LYS A CB   1 
ATOM   4224  C CG   . LYS A 1 280 ? -26.709 17.832  29.124  1.00 23.31 ? 269  LYS A CG   1 
ATOM   4225  C CD   . LYS A 1 280 ? -26.694 18.909  30.239  1.00 30.23 ? 269  LYS A CD   1 
ATOM   4226  C CE   . LYS A 1 280 ? -27.240 18.515  31.542  1.00 36.08 ? 269  LYS A CE   1 
ATOM   4227  N NZ   . LYS A 1 280 ? -26.767 19.582  32.500  1.00 36.58 ? 269  LYS A NZ   1 
ATOM   4228  H H    . LYS A 1 280 ? -28.634 14.515  29.328  1.00 17.14 ? 269  LYS A H    1 
ATOM   4229  H HA   . LYS A 1 280 ? -27.926 16.256  27.551  1.00 17.95 ? 269  LYS A HA   1 
ATOM   4230  H HB2  . LYS A 1 280 ? -28.102 16.617  29.945  1.00 23.10 ? 269  LYS A HB2  1 
ATOM   4231  H HB3  . LYS A 1 280 ? -26.622 16.031  30.040  1.00 23.10 ? 269  LYS A HB3  1 
ATOM   4232  H HG2  . LYS A 1 280 ? -25.792 17.711  28.832  1.00 27.97 ? 269  LYS A HG2  1 
ATOM   4233  H HG3  . LYS A 1 280 ? -27.232 18.189  28.389  1.00 27.97 ? 269  LYS A HG3  1 
ATOM   4234  H HD2  . LYS A 1 280 ? -25.774 19.182  30.384  1.00 36.28 ? 269  LYS A HD2  1 
ATOM   4235  H HD3  . LYS A 1 280 ? -27.209 19.671  29.931  1.00 36.28 ? 269  LYS A HD3  1 
ATOM   4236  H HE2  . LYS A 1 280 ? -28.209 18.509  31.516  1.00 43.30 ? 269  LYS A HE2  1 
ATOM   4237  H HE3  . LYS A 1 280 ? -26.883 17.655  31.814  1.00 43.30 ? 269  LYS A HE3  1 
ATOM   4238  H HZ1  . LYS A 1 280 ? -25.877 19.606  32.513  1.00 43.90 ? 269  LYS A HZ1  1 
ATOM   4239  H HZ2  . LYS A 1 280 ? -27.075 20.377  32.244  1.00 43.90 ? 269  LYS A HZ2  1 
ATOM   4240  H HZ3  . LYS A 1 280 ? -27.064 19.407  33.320  1.00 43.90 ? 269  LYS A HZ3  1 
ATOM   4241  N N    . LYS A 1 281 ? -25.768 13.971  27.998  1.00 14.70 ? 270  LYS A N    1 
ATOM   4242  C CA   . LYS A 1 281 ? -24.564 13.354  27.460  1.00 15.17 ? 270  LYS A CA   1 
ATOM   4243  C C    . LYS A 1 281 ? -24.812 12.658  26.133  1.00 14.88 ? 270  LYS A C    1 
ATOM   4244  O O    . LYS A 1 281 ? -23.872 12.169  25.530  1.00 22.85 ? 270  LYS A O    1 
ATOM   4245  C CB   . LYS A 1 281 ? -24.001 12.381  28.499  1.00 19.33 ? 270  LYS A CB   1 
ATOM   4246  C CG   . LYS A 1 281 ? -23.292 13.150  29.648  1.00 24.93 ? 270  LYS A CG   1 
ATOM   4247  C CD   . LYS A 1 281 ? -22.563 12.243  30.650  1.00 30.98 ? 270  LYS A CD   1 
ATOM   4248  C CE   . LYS A 1 281 ? -21.709 13.072  31.614  1.00 37.95 ? 270  LYS A CE   1 
ATOM   4249  N NZ   . LYS A 1 281 ? -20.936 12.375  32.815  1.00 36.92 ? 270  LYS A NZ   1 
ATOM   4250  H H    . LYS A 1 281 ? -26.157 13.496  28.600  1.00 17.64 ? 270  LYS A H    1 
ATOM   4251  H HA   . LYS A 1 281 ? -23.899 14.045  27.312  1.00 18.21 ? 270  LYS A HA   1 
ATOM   4252  H HB2  . LYS A 1 281 ? -24.726 11.861  28.879  1.00 23.19 ? 270  LYS A HB2  1 
ATOM   4253  H HB3  . LYS A 1 281 ? -23.352 11.798  28.075  1.00 23.19 ? 270  LYS A HB3  1 
ATOM   4254  H HG2  . LYS A 1 281 ? -22.637 13.753  29.263  1.00 29.92 ? 270  LYS A HG2  1 
ATOM   4255  H HG3  . LYS A 1 281 ? -23.957 13.659  30.139  1.00 29.92 ? 270  LYS A HG3  1 
ATOM   4256  H HD2  . LYS A 1 281 ? -23.215 11.746  31.168  1.00 37.17 ? 270  LYS A HD2  1 
ATOM   4257  H HD3  . LYS A 1 281 ? -21.979 11.636  30.168  1.00 37.17 ? 270  LYS A HD3  1 
ATOM   4258  H HE2  . LYS A 1 281 ? -21.036 13.527  31.085  1.00 45.54 ? 270  LYS A HE2  1 
ATOM   4259  H HE3  . LYS A 1 281 ? -22.290 13.738  32.014  1.00 45.54 ? 270  LYS A HE3  1 
ATOM   4260  H HZ1  . LYS A 1 281 ? -20.362 11.774  32.498  1.00 44.31 ? 270  LYS A HZ1  1 
ATOM   4261  H HZ2  . LYS A 1 281 ? -20.487 12.985  33.282  1.00 44.31 ? 270  LYS A HZ2  1 
ATOM   4262  H HZ3  . LYS A 1 281 ? -21.515 11.967  33.353  1.00 44.31 ? 270  LYS A HZ3  1 
ATOM   4263  N N    . GLY A 1 282 ? -26.040 12.582  25.661  1.00 13.40 ? 271  GLY A N    1 
ATOM   4264  C CA   . GLY A 1 282 ? -26.351 12.011  24.362  1.00 13.48 ? 271  GLY A CA   1 
ATOM   4265  C C    . GLY A 1 282 ? -27.070 10.674  24.397  1.00 12.52 ? 271  GLY A C    1 
ATOM   4266  O O    . GLY A 1 282 ? -27.323 10.099  23.342  1.00 14.34 ? 271  GLY A O    1 
ATOM   4267  H H    . GLY A 1 282 ? -26.733 12.863  26.085  1.00 16.08 ? 271  GLY A H    1 
ATOM   4268  H HA2  . GLY A 1 282 ? -26.907 12.635  23.870  1.00 16.17 ? 271  GLY A HA2  1 
ATOM   4269  H HA3  . GLY A 1 282 ? -25.525 11.891  23.867  1.00 16.17 ? 271  GLY A HA3  1 
ATOM   4270  N N    . THR A 1 283 ? -27.366 10.139  25.573  1.00 11.11 ? 272  THR A N    1 
ATOM   4271  C CA   . THR A 1 283 ? -27.973 8.825   25.674  1.00 11.17 ? 272  THR A CA   1 
ATOM   4272  C C    . THR A 1 283 ? -29.355 8.857   25.041  1.00 11.30 ? 272  THR A C    1 
ATOM   4273  O O    . THR A 1 283 ? -30.162 9.751   25.319  1.00 11.87 ? 272  THR A O    1 
ATOM   4274  C CB   . THR A 1 283 ? -28.093 8.420   27.141  1.00 11.97 ? 272  THR A CB   1 
ATOM   4275  O OG1  . THR A 1 283 ? -26.815 8.468   27.761  1.00 14.14 ? 272  THR A OG1  1 
ATOM   4276  C CG2  . THR A 1 283 ? -28.655 7.014   27.273  1.00 11.73 ? 272  THR A CG2  1 
ATOM   4277  H H    . THR A 1 283 ? -27.225 10.520  26.330  1.00 13.33 ? 272  THR A H    1 
ATOM   4278  H HA   . THR A 1 283 ? -27.428 8.171   25.209  1.00 13.41 ? 272  THR A HA   1 
ATOM   4279  H HB   . THR A 1 283 ? -28.693 9.032   27.595  1.00 14.36 ? 272  THR A HB   1 
ATOM   4280  H HG1  . THR A 1 283 ? -26.503 9.247   27.716  1.00 16.97 ? 272  THR A HG1  1 
ATOM   4281  H HG21 . THR A 1 283 ? -28.725 6.772   28.209  1.00 14.08 ? 272  THR A HG21 1 
ATOM   4282  H HG22 . THR A 1 283 ? -29.536 6.970   26.869  1.00 14.08 ? 272  THR A HG22 1 
ATOM   4283  H HG23 . THR A 1 283 ? -28.072 6.381   26.826  1.00 14.08 ? 272  THR A HG23 1 
ATOM   4284  N N    . VAL A 1 284 ? -29.642 7.839   24.246  1.00 11.18 ? 273  VAL A N    1 
ATOM   4285  C CA   . VAL A 1 284 ? -30.989 7.645   23.717  1.00 11.22 ? 273  VAL A CA   1 
ATOM   4286  C C    . VAL A 1 284 ? -31.777 6.911   24.805  1.00 10.61 ? 273  VAL A C    1 
ATOM   4287  O O    . VAL A 1 284 ? -31.754 5.681   24.874  1.00 10.79 ? 273  VAL A O    1 
ATOM   4288  C CB   . VAL A 1 284 ? -30.987 6.878   22.377  1.00 11.67 ? 273  VAL A CB   1 
ATOM   4289  C CG1  . VAL A 1 284 ? -32.411 6.709   21.900  1.00 14.01 ? 273  VAL A CG1  1 
ATOM   4290  C CG2  . VAL A 1 284 ? -30.115 7.616   21.355  1.00 12.45 ? 273  VAL A CG2  1 
ATOM   4291  H H    . VAL A 1 284 ? -29.076 7.242   23.995  1.00 13.42 ? 273  VAL A H    1 
ATOM   4292  H HA   . VAL A 1 284 ? -31.404 8.510   23.572  1.00 13.46 ? 273  VAL A HA   1 
ATOM   4293  H HB   . VAL A 1 284 ? -30.609 5.996   22.516  1.00 14.01 ? 273  VAL A HB   1 
ATOM   4294  H HG11 . VAL A 1 284 ? -32.407 6.227   21.058  1.00 16.82 ? 273  VAL A HG11 1 
ATOM   4295  H HG12 . VAL A 1 284 ? -32.909 6.208   22.566  1.00 16.82 ? 273  VAL A HG12 1 
ATOM   4296  H HG13 . VAL A 1 284 ? -32.809 7.585   21.779  1.00 16.82 ? 273  VAL A HG13 1 
ATOM   4297  H HG21 . VAL A 1 284 ? -30.123 7.123   20.519  1.00 14.94 ? 273  VAL A HG21 1 
ATOM   4298  H HG22 . VAL A 1 284 ? -30.473 8.506   21.218  1.00 14.94 ? 273  VAL A HG22 1 
ATOM   4299  H HG23 . VAL A 1 284 ? -29.209 7.672   21.697  1.00 14.94 ? 273  VAL A HG23 1 
ATOM   4300  N N    . VAL A 1 285 ? -32.400 7.668   25.694  1.00 11.40 ? 274  VAL A N    1 
ATOM   4301  C CA   . VAL A 1 285 ? -33.140 7.112   26.825  1.00 10.92 ? 274  VAL A CA   1 
ATOM   4302  C C    . VAL A 1 285 ? -34.405 7.920   27.037  1.00 11.13 ? 274  VAL A C    1 
ATOM   4303  O O    . VAL A 1 285 ? -34.377 9.142   26.960  1.00 14.57 ? 274  VAL A O    1 
ATOM   4304  C CB   . VAL A 1 285 ? -32.287 7.033   28.124  1.00 11.20 ? 274  VAL A CB   1 
ATOM   4305  C CG1  . VAL A 1 285 ? -31.761 8.398   28.568  1.00 13.48 ? 274  VAL A CG1  1 
ATOM   4306  C CG2  . VAL A 1 285 ? -33.056 6.347   29.244  1.00 11.84 ? 274  VAL A CG2  1 
ATOM   4307  H H    . VAL A 1 285 ? -32.411 8.528   25.666  1.00 13.68 ? 274  VAL A H    1 
ATOM   4308  H HA   . VAL A 1 285 ? -33.408 6.207   26.599  1.00 13.10 ? 274  VAL A HA   1 
ATOM   4309  H HB   . VAL A 1 285 ? -31.512 6.481   27.937  1.00 13.44 ? 274  VAL A HB   1 
ATOM   4310  H HG11 . VAL A 1 285 ? -31.240 8.287   29.378  1.00 16.18 ? 274  VAL A HG11 1 
ATOM   4311  H HG12 . VAL A 1 285 ? -31.204 8.765   27.863  1.00 16.18 ? 274  VAL A HG12 1 
ATOM   4312  H HG13 . VAL A 1 285 ? -32.514 8.987   28.735  1.00 16.18 ? 274  VAL A HG13 1 
ATOM   4313  H HG21 . VAL A 1 285 ? -32.497 6.316   30.037  1.00 14.21 ? 274  VAL A HG21 1 
ATOM   4314  H HG22 . VAL A 1 285 ? -33.863 6.853   29.428  1.00 14.21 ? 274  VAL A HG22 1 
ATOM   4315  H HG23 . VAL A 1 285 ? -33.285 5.448   28.964  1.00 14.21 ? 274  VAL A HG23 1 
ATOM   4316  N N    . TYR A 1 286 ? -35.488 7.211   27.324  1.00 10.43 ? 275  TYR A N    1 
ATOM   4317  C CA   . TYR A 1 286 ? -36.812 7.761   27.586  1.00 10.80 ? 275  TYR A CA   1 
ATOM   4318  C C    . TYR A 1 286 ? -37.200 7.390   29.007  1.00 10.68 ? 275  TYR A C    1 
ATOM   4319  O O    . TYR A 1 286 ? -36.917 6.284   29.482  1.00 12.93 ? 275  TYR A O    1 
ATOM   4320  C CB   . TYR A 1 286 ? -37.831 7.203   26.582  1.00 12.68 ? 275  TYR A CB   1 
ATOM   4321  C CG   . TYR A 1 286 ? -37.471 7.703   25.205  1.00 13.20 ? 275  TYR A CG   1 
ATOM   4322  C CD1  . TYR A 1 286 ? -37.854 8.986   24.801  1.00 14.69 ? 275  TYR A CD1  1 
ATOM   4323  C CD2  . TYR A 1 286 ? -36.667 6.980   24.384  1.00 15.66 ? 275  TYR A CD2  1 
ATOM   4324  C CE1  . TYR A 1 286 ? -37.465 9.505   23.618  1.00 17.23 ? 275  TYR A CE1  1 
ATOM   4325  C CE2  . TYR A 1 286 ? -36.256 7.508   23.148  1.00 18.20 ? 275  TYR A CE2  1 
ATOM   4326  C CZ   . TYR A 1 286 ? -36.668 8.769   22.808  1.00 18.51 ? 275  TYR A CZ   1 
ATOM   4327  O OH   . TYR A 1 286 ? -36.246 9.300   21.610  1.00 24.84 ? 275  TYR A OH   1 
ATOM   4328  H H    . TYR A 1 286 ? -35.477 6.352   27.375  1.00 12.52 ? 275  TYR A H    1 
ATOM   4329  H HA   . TYR A 1 286 ? -36.790 8.728   27.508  1.00 12.96 ? 275  TYR A HA   1 
ATOM   4330  H HB2  . TYR A 1 286 ? -37.796 6.234   26.582  1.00 15.22 ? 275  TYR A HB2  1 
ATOM   4331  H HB3  . TYR A 1 286 ? -38.721 7.517   26.806  1.00 15.22 ? 275  TYR A HB3  1 
ATOM   4332  H HD1  . TYR A 1 286 ? -38.379 9.502   25.370  1.00 17.63 ? 275  TYR A HD1  1 
ATOM   4333  H HD2  . TYR A 1 286 ? -36.377 6.136   24.647  1.00 18.80 ? 275  TYR A HD2  1 
ATOM   4334  H HE1  . TYR A 1 286 ? -37.732 10.360  23.368  1.00 20.68 ? 275  TYR A HE1  1 
ATOM   4335  H HE2  . TYR A 1 286 ? -35.707 7.017   22.579  1.00 21.84 ? 275  TYR A HE2  1 
ATOM   4336  H HH   . TYR A 1 286 ? -36.555 10.076  21.515  1.00 29.80 ? 275  TYR A HH   1 
ATOM   4337  N N    . GLY A 1 287 ? -37.825 8.332   29.700  1.00 10.43 ? 276  GLY A N    1 
ATOM   4338  C CA   . GLY A 1 287 ? -38.368 8.054   31.027  1.00 10.62 ? 276  GLY A CA   1 
ATOM   4339  C C    . GLY A 1 287 ? -39.886 8.107   31.060  1.00 10.46 ? 276  GLY A C    1 
ATOM   4340  O O    . GLY A 1 287 ? -40.477 9.015   30.468  1.00 10.90 ? 276  GLY A O    1 
ATOM   4341  H H    . GLY A 1 287 ? -37.950 9.138   29.427  1.00 12.52 ? 276  GLY A H    1 
ATOM   4342  H HA2  . GLY A 1 287 ? -38.086 7.171   31.312  1.00 12.74 ? 276  GLY A HA2  1 
ATOM   4343  H HA3  . GLY A 1 287 ? -38.025 8.705   31.659  1.00 12.74 ? 276  GLY A HA3  1 
ATOM   4344  N N    . GLU A 1 288 ? -40.474 7.163   31.775  1.00 10.38 ? 277  GLU A N    1 
ATOM   4345  C CA   . GLU A 1 288 ? -41.916 6.992   31.939  1.00 9.77  ? 277  GLU A CA   1 
ATOM   4346  C C    . GLU A 1 288 ? -42.304 7.173   33.410  1.00 10.13 ? 277  GLU A C    1 
ATOM   4347  O O    . GLU A 1 288 ? -42.492 6.191   34.151  1.00 11.34 ? 277  GLU A O    1 
ATOM   4348  C CB   . GLU A 1 288 ? -42.271 5.580   31.493  1.00 10.17 ? 277  GLU A CB   1 
ATOM   4349  C CG   . GLU A 1 288 ? -43.769 5.223   31.603  1.00 10.62 ? 277  GLU A CG   1 
ATOM   4350  C CD   . GLU A 1 288 ? -43.910 3.702   31.621  1.00 10.60 ? 277  GLU A CD   1 
ATOM   4351  O OE1  . GLU A 1 288 ? -43.812 3.110   32.709  1.00 11.72 ? 277  GLU A OE1  1 
ATOM   4352  O OE2  . GLU A 1 288 ? -44.060 3.096   30.528  1.00 10.75 ? 277  GLU A OE2  1 
ATOM   4353  H H    . GLU A 1 288 ? -40.027 6.567   32.205  1.00 12.46 ? 277  GLU A H    1 
ATOM   4354  H HA   . GLU A 1 288 ? -42.398 7.634   31.395  1.00 11.72 ? 277  GLU A HA   1 
ATOM   4355  H HB2  . GLU A 1 288 ? -42.012 5.474   30.565  1.00 12.20 ? 277  GLU A HB2  1 
ATOM   4356  H HB3  . GLU A 1 288 ? -41.779 4.949   32.042  1.00 12.20 ? 277  GLU A HB3  1 
ATOM   4357  H HG2  . GLU A 1 288 ? -44.133 5.581   32.427  1.00 12.74 ? 277  GLU A HG2  1 
ATOM   4358  H HG3  . GLU A 1 288 ? -44.247 5.572   30.834  1.00 12.74 ? 277  GLU A HG3  1 
ATOM   4359  N N    . PRO A 1 289 ? -42.492 8.407   33.874  1.00 9.94  ? 278  PRO A N    1 
ATOM   4360  C CA   . PRO A 1 289 ? -43.234 8.577   35.121  1.00 11.33 ? 278  PRO A CA   1 
ATOM   4361  C C    . PRO A 1 289 ? -44.661 8.079   34.927  1.00 10.39 ? 278  PRO A C    1 
ATOM   4362  O O    . PRO A 1 289 ? -45.140 7.958   33.799  1.00 11.42 ? 278  PRO A O    1 
ATOM   4363  C CB   . PRO A 1 289 ? -43.169 10.075  35.352  1.00 11.15 ? 278  PRO A CB   1 
ATOM   4364  C CG   . PRO A 1 289 ? -43.110 10.661  33.966  1.00 12.04 ? 278  PRO A CG   1 
ATOM   4365  C CD   . PRO A 1 289 ? -42.217 9.686   33.205  1.00 11.38 ? 278  PRO A CD   1 
ATOM   4366  H HA   . PRO A 1 289 ? -42.806 8.104   35.852  1.00 13.60 ? 278  PRO A HA   1 
ATOM   4367  H HB2  . PRO A 1 289 ? -43.967 10.371  35.819  1.00 13.37 ? 278  PRO A HB2  1 
ATOM   4368  H HB3  . PRO A 1 289 ? -42.371 10.296  35.856  1.00 13.37 ? 278  PRO A HB3  1 
ATOM   4369  H HG2  . PRO A 1 289 ? -44.000 10.691  33.581  1.00 14.44 ? 278  PRO A HG2  1 
ATOM   4370  H HG3  . PRO A 1 289 ? -42.713 11.545  33.997  1.00 14.44 ? 278  PRO A HG3  1 
ATOM   4371  H HD2  . PRO A 1 289 ? -42.477 9.644   32.272  1.00 13.65 ? 278  PRO A HD2  1 
ATOM   4372  H HD3  . PRO A 1 289 ? -41.284 9.929   33.307  1.00 13.65 ? 278  PRO A HD3  1 
ATOM   4373  N N    . ILE A 1 290 ? -45.308 7.774   36.040  1.00 10.76 ? 279  ILE A N    1 
ATOM   4374  C CA   . ILE A 1 290 ? -46.655 7.222   36.016  1.00 10.97 ? 279  ILE A CA   1 
ATOM   4375  C C    . ILE A 1 290 ? -47.564 8.095   36.880  1.00 11.13 ? 279  ILE A C    1 
ATOM   4376  O O    . ILE A 1 290 ? -47.108 8.930   37.667  1.00 11.41 ? 279  ILE A O    1 
ATOM   4377  C CB   . ILE A 1 290 ? -46.688 5.721   36.406  1.00 11.54 ? 279  ILE A CB   1 
ATOM   4378  C CG1  . ILE A 1 290 ? -46.148 5.518   37.819  1.00 11.16 ? 279  ILE A CG1  1 
ATOM   4379  C CG2  . ILE A 1 290 ? -45.954 4.896   35.375  1.00 11.76 ? 279  ILE A CG2  1 
ATOM   4380  C CD1  . ILE A 1 290 ? -46.405 4.167   38.371  1.00 12.74 ? 279  ILE A CD1  1 
ATOM   4381  H H    . ILE A 1 290 ? -44.987 7.878   36.831  1.00 12.91 ? 279  ILE A H    1 
ATOM   4382  H HA   . ILE A 1 290 ? -46.986 7.283   35.106  1.00 13.16 ? 279  ILE A HA   1 
ATOM   4383  H HB   . ILE A 1 290 ? -47.616 5.437   36.403  1.00 13.85 ? 279  ILE A HB   1 
ATOM   4384  H HG12 . ILE A 1 290 ? -45.188 5.656   37.809  1.00 13.39 ? 279  ILE A HG12 1 
ATOM   4385  H HG13 . ILE A 1 290 ? -46.567 6.164   38.410  1.00 13.39 ? 279  ILE A HG13 1 
ATOM   4386  H HG21 . ILE A 1 290 ? -45.986 3.962   35.637  1.00 14.12 ? 279  ILE A HG21 1 
ATOM   4387  H HG22 . ILE A 1 290 ? -46.383 5.013   34.513  1.00 14.12 ? 279  ILE A HG22 1 
ATOM   4388  H HG23 . ILE A 1 290 ? -45.032 5.195   35.330  1.00 14.12 ? 279  ILE A HG23 1 
ATOM   4389  H HD11 . ILE A 1 290 ? -46.035 4.116   39.266  1.00 15.29 ? 279  ILE A HD11 1 
ATOM   4390  H HD12 . ILE A 1 290 ? -47.363 4.016   38.400  1.00 15.29 ? 279  ILE A HD12 1 
ATOM   4391  H HD13 . ILE A 1 290 ? -45.983 3.507   37.800  1.00 15.29 ? 279  ILE A HD13 1 
ATOM   4392  N N    . THR A 1 291 ? -48.880 7.906   36.723  1.00 10.72 ? 280  THR A N    1 
ATOM   4393  C CA   . THR A 1 291 ? -49.803 8.755   37.461  1.00 10.99 ? 280  THR A CA   1 
ATOM   4394  C C    . THR A 1 291 ? -49.456 8.762   38.943  1.00 11.95 ? 280  THR A C    1 
ATOM   4395  O O    . THR A 1 291 ? -49.485 9.811   39.583  1.00 12.53 ? 280  THR A O    1 
ATOM   4396  C CB   . THR A 1 291 ? -51.236 8.253   37.294  1.00 11.63 ? 280  THR A CB   1 
ATOM   4397  O OG1  . THR A 1 291 ? -51.433 7.899   35.909  1.00 12.02 ? 280  THR A OG1  1 
ATOM   4398  C CG2  . THR A 1 291 ? -52.220 9.367   37.675  1.00 13.32 ? 280  THR A CG2  1 
ATOM   4399  H H    . THR A 1 291 ? -49.246 7.316   36.215  1.00 12.87 ? 280  THR A H    1 
ATOM   4400  H HA   . THR A 1 291 ? -49.751 9.663   37.125  1.00 13.19 ? 280  THR A HA   1 
ATOM   4401  H HB   . THR A 1 291 ? -51.390 7.482   37.863  1.00 13.96 ? 280  THR A HB   1 
ATOM   4402  H HG1  . THR A 1 291 ? -52.216 7.619   35.792  1.00 14.43 ? 280  THR A HG1  1 
ATOM   4403  H HG21 . THR A 1 291 ? -53.132 9.052   37.570  1.00 15.98 ? 280  THR A HG21 1 
ATOM   4404  H HG22 . THR A 1 291 ? -52.081 9.631   38.598  1.00 15.98 ? 280  THR A HG22 1 
ATOM   4405  H HG23 . THR A 1 291 ? -52.085 10.138  37.102  1.00 15.98 ? 280  THR A HG23 1 
ATOM   4406  N N    . ALA A 1 292 ? -49.154 7.583   39.507  1.00 12.08 ? 281  ALA A N    1 
ATOM   4407  C CA   . ALA A 1 292 ? -48.840 7.502   40.927  1.00 12.35 ? 281  ALA A CA   1 
ATOM   4408  C C    . ALA A 1 292 ? -47.726 8.477   41.308  1.00 11.34 ? 281  ALA A C    1 
ATOM   4409  O O    . ALA A 1 292 ? -47.827 9.199   42.293  1.00 12.38 ? 281  ALA A O    1 
ATOM   4410  C CB   . ALA A 1 292 ? -48.449 6.070   41.261  1.00 12.60 ? 281  ALA A CB   1 
ATOM   4411  H H    . ALA A 1 292 ? -49.126 6.830   39.091  1.00 14.49 ? 281  ALA A H    1 
ATOM   4412  H HA   . ALA A 1 292 ? -49.630 7.729   41.442  1.00 14.82 ? 281  ALA A HA   1 
ATOM   4413  H HB1  . ALA A 1 292 ? -48.239 6.013   42.207  1.00 15.12 ? 281  ALA A HB1  1 
ATOM   4414  H HB2  . ALA A 1 292 ? -49.193 5.483   41.051  1.00 15.12 ? 281  ALA A HB2  1 
ATOM   4415  H HB3  . ALA A 1 292 ? -47.673 5.823   40.734  1.00 15.12 ? 281  ALA A HB3  1 
ATOM   4416  N N    . SER A 1 293 ? -46.600 8.440   40.590  1.00 11.22 ? 282  SER A N    1 
ATOM   4417  C CA   . SER A 1 293 ? -45.465 9.269   41.003  1.00 11.28 ? 282  SER A CA   1 
ATOM   4418  C C    . SER A 1 293 ? -45.650 10.748  40.637  1.00 11.26 ? 282  SER A C    1 
ATOM   4419  O O    . SER A 1 293 ? -45.025 11.612  41.262  1.00 12.50 ? 282  SER A O    1 
ATOM   4420  C CB   . SER A 1 293 ? -44.150 8.740   40.442  1.00 12.45 ? 282  SER A CB   1 
ATOM   4421  O OG   . SER A 1 293 ? -44.172 8.658   39.041  1.00 11.47 ? 282  SER A OG   1 
ATOM   4422  H H    . SER A 1 293 ? -46.470 7.962   39.887  1.00 13.47 ? 282  SER A H    1 
ATOM   4423  H HA   . SER A 1 293 ? -45.399 9.224   41.970  1.00 13.53 ? 282  SER A HA   1 
ATOM   4424  H HB2  . SER A 1 293 ? -43.434 9.338   40.708  1.00 14.94 ? 282  SER A HB2  1 
ATOM   4425  H HB3  . SER A 1 293 ? -43.990 7.855   40.804  1.00 14.94 ? 282  SER A HB3  1 
ATOM   4426  H HG   . SER A 1 293 ? -43.437 8.364   38.759  1.00 13.77 ? 282  SER A HG   1 
ATOM   4427  N N    . LEU A 1 294 ? -46.500 11.047  39.654  1.00 11.25 ? 283  LEU A N    1 
ATOM   4428  C CA   . LEU A 1 294 ? -46.842 12.404  39.289  1.00 12.01 ? 283  LEU A CA   1 
ATOM   4429  C C    . LEU A 1 294 ? -47.886 13.020  40.221  1.00 13.23 ? 283  LEU A C    1 
ATOM   4430  O O    . LEU A 1 294 ? -48.029 14.253  40.242  1.00 13.57 ? 283  LEU A O    1 
ATOM   4431  C CB   . LEU A 1 294 ? -47.375 12.449  37.857  1.00 12.76 ? 283  LEU A CB   1 
ATOM   4432  C CG   . LEU A 1 294 ? -46.308 12.087  36.796  1.00 12.13 ? 283  LEU A CG   1 
ATOM   4433  C CD1  . LEU A 1 294 ? -46.951 11.755  35.450  1.00 13.71 ? 283  LEU A CD1  1 
ATOM   4434  C CD2  . LEU A 1 294 ? -45.259 13.175  36.673  1.00 13.09 ? 283  LEU A CD2  1 
ATOM   4435  H H    . LEU A 1 294 ? -46.899 10.455  39.174  1.00 13.50 ? 283  LEU A H    1 
ATOM   4436  H HA   . LEU A 1 294 ? -46.043 12.953  39.330  1.00 14.41 ? 283  LEU A HA   1 
ATOM   4437  H HB2  . LEU A 1 294 ? -48.106 11.817  37.773  1.00 15.31 ? 283  LEU A HB2  1 
ATOM   4438  H HB3  . LEU A 1 294 ? -47.691 13.347  37.667  1.00 15.31 ? 283  LEU A HB3  1 
ATOM   4439  H HG   . LEU A 1 294 ? -45.851 11.285  37.095  1.00 14.56 ? 283  LEU A HG   1 
ATOM   4440  H HD11 . LEU A 1 294 ? -46.254 11.533  34.813  1.00 16.46 ? 283  LEU A HD11 1 
ATOM   4441  H HD12 . LEU A 1 294 ? -47.549 10.999  35.563  1.00 16.46 ? 283  LEU A HD12 1 
ATOM   4442  H HD13 . LEU A 1 294 ? -47.450 12.527  35.140  1.00 16.46 ? 283  LEU A HD13 1 
ATOM   4443  H HD21 . LEU A 1 294 ? -44.610 12.912  36.001  1.00 15.71 ? 283  LEU A HD21 1 
ATOM   4444  H HD22 . LEU A 1 294 ? -45.692 14.002  36.410  1.00 15.71 ? 283  LEU A HD22 1 
ATOM   4445  H HD23 . LEU A 1 294 ? -44.820 13.288  37.530  1.00 15.71 ? 283  LEU A HD23 1 
ATOM   4446  N N    . GLY A 1 295 ? -48.629 12.198  40.961  1.00 12.03 ? 284  GLY A N    1 
ATOM   4447  C CA   . GLY A 1 295 ? -49.794 12.710  41.655  1.00 12.95 ? 284  GLY A CA   1 
ATOM   4448  C C    . GLY A 1 295 ? -49.797 12.560  43.161  1.00 15.45 ? 284  GLY A C    1 
ATOM   4449  O O    . GLY A 1 295 ? -50.575 13.253  43.824  1.00 19.25 ? 284  GLY A O    1 
ATOM   4450  H H    . GLY A 1 295 ? -48.479 11.359  41.073  1.00 14.43 ? 284  GLY A H    1 
ATOM   4451  H HA2  . GLY A 1 295 ? -49.885 13.655  41.453  1.00 15.54 ? 284  GLY A HA2  1 
ATOM   4452  H HA3  . GLY A 1 295 ? -50.582 12.258  41.313  1.00 15.54 ? 284  GLY A HA3  1 
ATOM   4453  N N    . THR A 1 296 ? -49.018 11.642  43.732  1.00 13.16 ? 285  THR A N    1 
ATOM   4454  C CA   . THR A 1 296 ? -49.021 11.465  45.190  1.00 14.21 ? 285  THR A CA   1 
ATOM   4455  C C    . THR A 1 296 ? -47.646 10.975  45.643  1.00 13.71 ? 285  THR A C    1 
ATOM   4456  O O    . THR A 1 296 ? -46.668 11.022  44.889  1.00 14.99 ? 285  THR A O    1 
ATOM   4457  C CB   . THR A 1 296 ? -50.209 10.611  45.626  1.00 15.26 ? 285  THR A CB   1 
ATOM   4458  O OG1  . THR A 1 296 ? -50.288 10.685  47.049  1.00 19.92 ? 285  THR A OG1  1 
ATOM   4459  C CG2  . THR A 1 296 ? -50.089 9.174   45.217  1.00 18.15 ? 285  THR A CG2  1 
ATOM   4460  H H    . THR A 1 296 ? -48.486 11.116  43.308  1.00 15.79 ? 285  THR A H    1 
ATOM   4461  H HA   . THR A 1 296 ? -49.149 12.339  45.592  1.00 17.06 ? 285  THR A HA   1 
ATOM   4462  H HB   . THR A 1 296 ? -51.022 10.971  45.240  1.00 18.31 ? 285  THR A HB   1 
ATOM   4463  H HG1  . THR A 1 296 ? -50.933 10.225  47.326  1.00 23.90 ? 285  THR A HG1  1 
ATOM   4464  H HG21 . THR A 1 296 ? -50.867 8.678   45.518  1.00 21.78 ? 285  THR A HG21 1 
ATOM   4465  H HG22 . THR A 1 296 ? -50.028 9.109   44.251  1.00 21.78 ? 285  THR A HG22 1 
ATOM   4466  H HG23 . THR A 1 296 ? -49.294 8.783   45.611  1.00 21.78 ? 285  THR A HG23 1 
ATOM   4467  N N    . ASP A 1 297 ? -47.561 10.522  46.911  1.00 13.79 ? 286  ASP A N    1 
ATOM   4468  C CA   . ASP A 1 297 ? -46.285 10.101  47.455  1.00 13.71 ? 286  ASP A CA   1 
ATOM   4469  C C    . ASP A 1 297 ? -46.457 8.910   48.392  1.00 13.72 ? 286  ASP A C    1 
ATOM   4470  O O    . ASP A 1 297 ? -47.564 8.423   48.641  1.00 15.74 ? 286  ASP A O    1 
ATOM   4471  C CB   . ASP A 1 297 ? -45.582 11.281  48.127  1.00 14.65 ? 286  ASP A CB   1 
ATOM   4472  C CG   . ASP A 1 297 ? -46.332 11.803  49.341  1.00 17.52 ? 286  ASP A CG   1 
ATOM   4473  O OD1  . ASP A 1 297 ? -46.666 10.994  50.234  1.00 17.19 ? 286  ASP A OD1  1 
ATOM   4474  O OD2  . ASP A 1 297 ? -46.599 13.031  49.412  1.00 21.81 ? 286  ASP A OD2  1 
ATOM   4475  H H    . ASP A 1 297 ? -48.224 10.455  47.456  1.00 16.54 ? 286  ASP A H    1 
ATOM   4476  H HA   . ASP A 1 297 ? -45.722 9.810   46.721  1.00 16.45 ? 286  ASP A HA   1 
ATOM   4477  H HB2  . ASP A 1 297 ? -44.700 10.999  48.418  1.00 17.58 ? 286  ASP A HB2  1 
ATOM   4478  H HB3  . ASP A 1 297 ? -45.503 12.007  47.489  1.00 17.58 ? 286  ASP A HB3  1 
ATOM   4479  N N    . GLY A 1 298 ? -45.342 8.429   48.905  1.00 13.82 ? 287  GLY A N    1 
ATOM   4480  C CA   . GLY A 1 298 ? -45.256 7.255   49.738  1.00 14.28 ? 287  GLY A CA   1 
ATOM   4481  C C    . GLY A 1 298 ? -45.429 7.490   51.227  1.00 15.77 ? 287  GLY A C    1 
ATOM   4482  O O    . GLY A 1 298 ? -45.303 6.526   52.000  1.00 16.44 ? 287  GLY A O    1 
ATOM   4483  H H    . GLY A 1 298 ? -44.575 8.793   48.771  1.00 16.58 ? 287  GLY A H    1 
ATOM   4484  H HA2  . GLY A 1 298 ? -45.936 6.623   49.458  1.00 17.14 ? 287  GLY A HA2  1 
ATOM   4485  H HA3  . GLY A 1 298 ? -44.389 6.840   49.603  1.00 17.14 ? 287  GLY A HA3  1 
ATOM   4486  N N    . SER A 1 299 ? -45.807 8.710   51.636  1.00 16.10 ? 288  SER A N    1 
ATOM   4487  C CA   . SER A 1 299 ? -46.112 8.920   53.044  1.00 16.97 ? 288  SER A CA   1 
ATOM   4488  C C    . SER A 1 299 ? -47.194 7.946   53.497  1.00 16.73 ? 288  SER A C    1 
ATOM   4489  O O    . SER A 1 299 ? -47.232 7.523   54.670  1.00 18.32 ? 288  SER A O    1 
ATOM   4490  C CB   . SER A 1 299 ? -46.544 10.377  53.306  1.00 20.19 ? 288  SER A CB   1 
ATOM   4491  O OG   . SER A 1 299 ? -47.740 10.656  52.599  1.00 20.13 ? 288  SER A OG   1 
ATOM   4492  H H    . SER A 1 299 ? -45.890 9.403   51.135  1.00 19.32 ? 288  SER A H    1 
ATOM   4493  H HA   . SER A 1 299 ? -45.314 8.746   53.568  1.00 20.36 ? 288  SER A HA   1 
ATOM   4494  H HB2  . SER A 1 299 ? -46.699 10.497  54.256  1.00 24.23 ? 288  SER A HB2  1 
ATOM   4495  H HB3  . SER A 1 299 ? -45.845 10.977  53.002  1.00 24.23 ? 288  SER A HB3  1 
ATOM   4496  H HG   . SER A 1 299 ? -47.617 10.551  51.774  1.00 24.16 ? 288  SER A HG   1 
ATOM   4497  N N    . HIS A 1 300 ? -48.041 7.512   52.560  1.00 16.73 ? 289  HIS A N    1 
ATOM   4498  C CA   . HIS A 1 300 ? -49.176 6.669   52.877  1.00 17.00 ? 289  HIS A CA   1 
ATOM   4499  C C    . HIS A 1 300 ? -48.819 5.228   53.192  1.00 17.92 ? 289  HIS A C    1 
ATOM   4500  O O    . HIS A 1 300 ? -49.677 4.513   53.729  1.00 18.43 ? 289  HIS A O    1 
ATOM   4501  C CB   . HIS A 1 300 ? -50.177 6.767   51.731  1.00 17.91 ? 289  HIS A CB   1 
ATOM   4502  C CG   . HIS A 1 300 ? -50.568 8.179   51.457  1.00 18.34 ? 289  HIS A CG   1 
ATOM   4503  N ND1  . HIS A 1 300 ? -51.320 8.911   52.354  1.00 20.85 ? 289  HIS A ND1  1 
ATOM   4504  C CD2  . HIS A 1 300 ? -50.226 9.030   50.459  1.00 19.64 ? 289  HIS A CD2  1 
ATOM   4505  C CE1  . HIS A 1 300 ? -51.478 10.141  51.881  1.00 22.53 ? 289  HIS A CE1  1 
ATOM   4506  N NE2  . HIS A 1 300 ? -50.799 10.247  50.746  1.00 22.71 ? 289  HIS A NE2  1 
ATOM   4507  H H    . HIS A 1 300 ? -47.972 7.700   51.723  1.00 20.07 ? 289  HIS A H    1 
ATOM   4508  H HA   . HIS A 1 300 ? -49.609 7.032   53.666  1.00 20.40 ? 289  HIS A HA   1 
ATOM   4509  H HB2  . HIS A 1 300 ? -49.776 6.402   50.926  1.00 21.49 ? 289  HIS A HB2  1 
ATOM   4510  H HB3  . HIS A 1 300 ? -50.977 6.270   51.962  1.00 21.49 ? 289  HIS A HB3  1 
ATOM   4511  H HD1  . HIS A 1 300 ? -51.662 8.608   53.083  1.00 25.01 ? 289  HIS A HD1  1 
ATOM   4512  H HD2  . HIS A 1 300 ? -49.704 8.828   49.716  1.00 23.57 ? 289  HIS A HD2  1 
ATOM   4513  H HE1  . HIS A 1 300 ? -51.957 10.824  52.293  1.00 27.03 ? 289  HIS A HE1  1 
ATOM   4514  N N    . TYR A 1 301 ? -47.578 4.799   52.936  1.00 15.86 ? 290  TYR A N    1 
ATOM   4515  C CA   . TYR A 1 301 ? -47.155 3.484   53.396  1.00 16.43 ? 290  TYR A CA   1 
ATOM   4516  C C    . TYR A 1 301 ? -47.210 3.345   54.909  1.00 17.06 ? 290  TYR A C    1 
ATOM   4517  O O    . TYR A 1 301 ? -47.258 2.214   55.403  1.00 18.58 ? 290  TYR A O    1 
ATOM   4518  C CB   . TYR A 1 301 ? -45.749 3.173   52.920  1.00 15.51 ? 290  TYR A CB   1 
ATOM   4519  C CG   . TYR A 1 301 ? -45.645 2.930   51.444  1.00 15.62 ? 290  TYR A CG   1 
ATOM   4520  C CD1  . TYR A 1 301 ? -46.364 1.897   50.843  1.00 17.16 ? 290  TYR A CD1  1 
ATOM   4521  C CD2  . TYR A 1 301 ? -44.831 3.714   50.639  1.00 14.32 ? 290  TYR A CD2  1 
ATOM   4522  C CE1  . TYR A 1 301 ? -46.297 1.684   49.528  1.00 15.82 ? 290  TYR A CE1  1 
ATOM   4523  C CE2  . TYR A 1 301 ? -44.736 3.483   49.312  1.00 14.38 ? 290  TYR A CE2  1 
ATOM   4524  C CZ   . TYR A 1 301 ? -45.458 2.488   48.741  1.00 14.59 ? 290  TYR A CZ   1 
ATOM   4525  O OH   . TYR A 1 301 ? -45.376 2.299   47.351  1.00 13.96 ? 290  TYR A OH   1 
ATOM   4526  H H    . TYR A 1 301 ? -46.979 5.243   52.507  1.00 19.03 ? 290  TYR A H    1 
ATOM   4527  H HA   . TYR A 1 301 ? -47.749 2.817   53.017  1.00 19.71 ? 290  TYR A HA   1 
ATOM   4528  H HB2  . TYR A 1 301 ? -45.173 3.922   53.138  1.00 18.62 ? 290  TYR A HB2  1 
ATOM   4529  H HB3  . TYR A 1 301 ? -45.436 2.375   53.374  1.00 18.62 ? 290  TYR A HB3  1 
ATOM   4530  H HD1  . TYR A 1 301 ? -46.924 1.367   51.364  1.00 20.59 ? 290  TYR A HD1  1 
ATOM   4531  H HD2  . TYR A 1 301 ? -44.334 4.401   51.021  1.00 17.18 ? 290  TYR A HD2  1 
ATOM   4532  H HE1  . TYR A 1 301 ? -46.788 0.997   49.138  1.00 18.99 ? 290  TYR A HE1  1 
ATOM   4533  H HE2  . TYR A 1 301 ? -44.197 4.027   48.785  1.00 17.25 ? 290  TYR A HE2  1 
ATOM   4534  H HH   . TYR A 1 301 ? -45.881 1.670   47.116  1.00 16.75 ? 290  TYR A HH   1 
ATOM   4535  N N    . TRP A 1 302 ? -47.235 4.458   55.638  1.00 17.39 ? 291  TRP A N    1 
ATOM   4536  C CA   . TRP A 1 302 ? -47.312 4.471   57.091  1.00 18.93 ? 291  TRP A CA   1 
ATOM   4537  C C    . TRP A 1 302 ? -48.718 4.745   57.600  1.00 22.80 ? 291  TRP A C    1 
ATOM   4538  O O    . TRP A 1 302 ? -48.903 4.989   58.793  1.00 25.14 ? 291  TRP A O    1 
ATOM   4539  C CB   . TRP A 1 302 ? -46.329 5.493   57.646  1.00 20.08 ? 291  TRP A CB   1 
ATOM   4540  C CG   . TRP A 1 302 ? -44.887 5.027   57.584  1.00 20.43 ? 291  TRP A CG   1 
ATOM   4541  C CD1  . TRP A 1 302 ? -44.199 4.358   58.547  1.00 22.75 ? 291  TRP A CD1  1 
ATOM   4542  C CD2  . TRP A 1 302 ? -43.989 5.171   56.484  1.00 18.96 ? 291  TRP A CD2  1 
ATOM   4543  N NE1  . TRP A 1 302 ? -42.921 4.097   58.128  1.00 20.74 ? 291  TRP A NE1  1 
ATOM   4544  C CE2  . TRP A 1 302 ? -42.763 4.603   56.866  1.00 18.89 ? 291  TRP A CE2  1 
ATOM   4545  C CE3  . TRP A 1 302 ? -44.078 5.785   55.225  1.00 19.22 ? 291  TRP A CE3  1 
ATOM   4546  C CZ2  . TRP A 1 302 ? -41.663 4.586   56.021  1.00 19.24 ? 291  TRP A CZ2  1 
ATOM   4547  C CZ3  . TRP A 1 302 ? -42.982 5.756   54.406  1.00 19.42 ? 291  TRP A CZ3  1 
ATOM   4548  C CH2  . TRP A 1 302 ? -41.793 5.168   54.807  1.00 19.85 ? 291  TRP A CH2  1 
ATOM   4549  H H    . TRP A 1 302 ? -47.206 5.247   55.296  1.00 20.87 ? 291  TRP A H    1 
ATOM   4550  H HA   . TRP A 1 302 ? -47.046 3.599   57.421  1.00 22.72 ? 291  TRP A HA   1 
ATOM   4551  H HB2  . TRP A 1 302 ? -46.402 6.312   57.131  1.00 24.09 ? 291  TRP A HB2  1 
ATOM   4552  H HB3  . TRP A 1 302 ? -46.548 5.666   58.575  1.00 24.09 ? 291  TRP A HB3  1 
ATOM   4553  H HD1  . TRP A 1 302 ? -44.547 4.112   59.373  1.00 27.29 ? 291  TRP A HD1  1 
ATOM   4554  H HE1  . TRP A 1 302 ? -42.318 3.685   58.582  1.00 24.89 ? 291  TRP A HE1  1 
ATOM   4555  H HE3  . TRP A 1 302 ? -44.871 6.183   54.945  1.00 23.06 ? 291  TRP A HE3  1 
ATOM   4556  H HZ2  . TRP A 1 302 ? -40.861 4.194   56.283  1.00 23.08 ? 291  TRP A HZ2  1 
ATOM   4557  H HZ3  . TRP A 1 302 ? -43.033 6.149   53.564  1.00 23.30 ? 291  TRP A HZ3  1 
ATOM   4558  H HH2  . TRP A 1 302 ? -41.067 5.171   54.226  1.00 23.82 ? 291  TRP A HH2  1 
ATOM   4559  N N    . SER A 1 303 ? -49.720 4.682   56.737  1.00 22.05 ? 292  SER A N    1 
ATOM   4560  C CA   . SER A 1 303 ? -51.097 4.808   57.204  1.00 20.75 ? 292  SER A CA   1 
ATOM   4561  C C    . SER A 1 303 ? -51.391 3.811   58.321  1.00 22.36 ? 292  SER A C    1 
ATOM   4562  O O    . SER A 1 303 ? -50.953 2.654   58.281  1.00 23.30 ? 292  SER A O    1 
ATOM   4563  C CB   . SER A 1 303 ? -52.094 4.530   56.068  1.00 21.70 ? 292  SER A CB   1 
ATOM   4564  O OG   . SER A 1 303 ? -53.437 4.686   56.558  1.00 23.84 ? 292  SER A OG   1 
ATOM   4565  H H    . SER A 1 303 ? -49.635 4.569   55.889  1.00 26.46 ? 292  SER A H    1 
ATOM   4566  H HA   . SER A 1 303 ? -51.248 5.705   57.539  1.00 24.90 ? 292  SER A HA   1 
ATOM   4567  H HB2  . SER A 1 303 ? -51.941 5.161   55.347  1.00 26.04 ? 292  SER A HB2  1 
ATOM   4568  H HB3  . SER A 1 303 ? -51.972 3.622   55.750  1.00 26.04 ? 292  SER A HB3  1 
ATOM   4569  H HG   . SER A 1 303 ? -53.987 4.535   55.942  1.00 28.61 ? 292  SER A HG   1 
ATOM   4570  N N    . LYS A 1 304 ? -52.211 4.239   59.280  1.00 25.04 ? 293  LYS A N    1 
ATOM   4571  C CA   . LYS A 1 304 ? -52.687 3.332   60.321  1.00 28.65 ? 293  LYS A CA   1 
ATOM   4572  C C    . LYS A 1 304 ? -53.677 2.317   59.782  1.00 26.15 ? 293  LYS A C    1 
ATOM   4573  O O    . LYS A 1 304 ? -53.943 1.303   60.442  1.00 29.66 ? 293  LYS A O    1 
ATOM   4574  C CB   . LYS A 1 304 ? -53.338 4.143   61.440  1.00 36.29 ? 293  LYS A CB   1 
ATOM   4575  C CG   . LYS A 1 304 ? -52.321 4.980   62.168  1.00 48.92 ? 293  LYS A CG   1 
ATOM   4576  C CD   . LYS A 1 304 ? -51.394 4.101   63.020  1.00 62.12 ? 293  LYS A CD   1 
ATOM   4577  C CE   . LYS A 1 304 ? -51.140 4.711   64.401  1.00 72.16 ? 293  LYS A CE   1 
ATOM   4578  N NZ   . LYS A 1 304 ? -52.395 5.072   65.164  1.00 77.28 ? 293  LYS A NZ   1 
ATOM   4579  H H    . LYS A 1 304 ? -52.503 5.045   59.350  1.00 30.05 ? 293  LYS A H    1 
ATOM   4580  H HA   . LYS A 1 304 ? -51.932 2.851   60.694  1.00 34.37 ? 293  LYS A HA   1 
ATOM   4581  H HB2  . LYS A 1 304 ? -54.005 4.735   61.060  1.00 43.55 ? 293  LYS A HB2  1 
ATOM   4582  H HB3  . LYS A 1 304 ? -53.748 3.538   62.077  1.00 43.55 ? 293  LYS A HB3  1 
ATOM   4583  H HG2  . LYS A 1 304 ? -51.778 5.460   61.523  1.00 58.71 ? 293  LYS A HG2  1 
ATOM   4584  H HG3  . LYS A 1 304 ? -52.778 5.602   62.755  1.00 58.71 ? 293  LYS A HG3  1 
ATOM   4585  H HD2  . LYS A 1 304 ? -51.805 3.232   63.145  1.00 74.54 ? 293  LYS A HD2  1 
ATOM   4586  H HD3  . LYS A 1 304 ? -50.541 4.007   62.569  1.00 74.54 ? 293  LYS A HD3  1 
ATOM   4587  H HE2  . LYS A 1 304 ? -50.643 4.072   64.936  1.00 86.59 ? 293  LYS A HE2  1 
ATOM   4588  H HE3  . LYS A 1 304 ? -50.618 5.521   64.292  1.00 86.59 ? 293  LYS A HE3  1 
ATOM   4589  H HZ1  . LYS A 1 304 ? -52.892 4.345   65.293  1.00 92.74 ? 293  LYS A HZ1  1 
ATOM   4590  H HZ2  . LYS A 1 304 ? -52.180 5.420   65.955  1.00 92.74 ? 293  LYS A HZ2  1 
ATOM   4591  H HZ3  . LYS A 1 304 ? -52.869 5.669   64.705  1.00 92.74 ? 293  LYS A HZ3  1 
ATOM   4592  N N    . ASN A 1 305 ? -54.230 2.586   58.605  1.00 22.46 ? 294  ASN A N    1 
ATOM   4593  C CA   . ASN A 1 305 ? -55.158 1.709   57.906  1.00 22.67 ? 294  ASN A CA   1 
ATOM   4594  C C    . ASN A 1 305 ? -54.326 0.817   56.991  1.00 21.78 ? 294  ASN A C    1 
ATOM   4595  O O    . ASN A 1 305 ? -53.823 1.269   55.961  1.00 21.69 ? 294  ASN A O    1 
ATOM   4596  C CB   . ASN A 1 305 ? -56.125 2.582   57.133  1.00 23.72 ? 294  ASN A CB   1 
ATOM   4597  C CG   . ASN A 1 305 ? -57.125 1.796   56.347  1.00 27.29 ? 294  ASN A CG   1 
ATOM   4598  O OD1  . ASN A 1 305 ? -57.013 0.562   56.172  1.00 26.77 ? 294  ASN A OD1  1 
ATOM   4599  N ND2  . ASN A 1 305 ? -58.126 2.509   55.841  1.00 26.78 ? 294  ASN A ND2  1 
ATOM   4600  H H    . ASN A 1 305 ? -54.072 3.311   58.171  1.00 26.95 ? 294  ASN A H    1 
ATOM   4601  H HA   . ASN A 1 305 ? -55.649 1.160   58.538  1.00 27.20 ? 294  ASN A HA   1 
ATOM   4602  H HB2  . ASN A 1 305 ? -56.610 3.144   57.757  1.00 28.47 ? 294  ASN A HB2  1 
ATOM   4603  H HB3  . ASN A 1 305 ? -55.623 3.133   56.512  1.00 28.47 ? 294  ASN A HB3  1 
ATOM   4604  H HD21 . ASN A 1 305 ? -58.739 2.122   55.378  1.00 32.14 ? 294  ASN A HD21 1 
ATOM   4605  H HD22 . ASN A 1 305 ? -58.161 3.358   55.977  1.00 32.14 ? 294  ASN A HD22 1 
ATOM   4606  N N    . TRP A 1 306 ? -54.141 -0.437  57.417  1.00 21.10 ? 295  TRP A N    1 
ATOM   4607  C CA   . TRP A 1 306 ? -53.324 -1.395  56.681  1.00 21.87 ? 295  TRP A CA   1 
ATOM   4608  C C    . TRP A 1 306 ? -53.756 -1.449  55.224  1.00 20.74 ? 295  TRP A C    1 
ATOM   4609  O O    . TRP A 1 306 ? -52.920 -1.466  54.313  1.00 19.62 ? 295  TRP A O    1 
ATOM   4610  C CB   . TRP A 1 306 ? -53.407 -2.797  57.328  1.00 21.86 ? 295  TRP A CB   1 
ATOM   4611  C CG   . TRP A 1 306 ? -52.519 -3.772  56.626  1.00 21.72 ? 295  TRP A CG   1 
ATOM   4612  C CD1  . TRP A 1 306 ? -51.228 -4.089  56.955  1.00 25.93 ? 295  TRP A CD1  1 
ATOM   4613  C CD2  . TRP A 1 306 ? -52.810 -4.490  55.413  1.00 20.61 ? 295  TRP A CD2  1 
ATOM   4614  N NE1  . TRP A 1 306 ? -50.707 -4.959  56.023  1.00 21.89 ? 295  TRP A NE1  1 
ATOM   4615  C CE2  . TRP A 1 306 ? -51.645 -5.199  55.057  1.00 20.16 ? 295  TRP A CE2  1 
ATOM   4616  C CE3  . TRP A 1 306 ? -53.933 -4.593  54.595  1.00 20.43 ? 295  TRP A CE3  1 
ATOM   4617  C CZ2  . TRP A 1 306 ? -51.573 -6.003  53.903  1.00 21.81 ? 295  TRP A CZ2  1 
ATOM   4618  C CZ3  . TRP A 1 306 ? -53.864 -5.382  53.455  1.00 20.92 ? 295  TRP A CZ3  1 
ATOM   4619  C CH2  . TRP A 1 306 ? -52.676 -6.062  53.113  1.00 22.01 ? 295  TRP A CH2  1 
ATOM   4620  H H    . TRP A 1 306 ? -54.484 -0.756  58.138  1.00 25.32 ? 295  TRP A H    1 
ATOM   4621  H HA   . TRP A 1 306 ? -52.398 -1.107  56.708  1.00 26.25 ? 295  TRP A HA   1 
ATOM   4622  H HB2  . TRP A 1 306 ? -53.125 -2.741  58.255  1.00 26.24 ? 295  TRP A HB2  1 
ATOM   4623  H HB3  . TRP A 1 306 ? -54.319 -3.122  57.274  1.00 26.24 ? 295  TRP A HB3  1 
ATOM   4624  H HD1  . TRP A 1 306 ? -50.766 -3.753  57.689  1.00 31.11 ? 295  TRP A HD1  1 
ATOM   4625  H HE1  . TRP A 1 306 ? -49.907 -5.275  56.029  1.00 26.27 ? 295  TRP A HE1  1 
ATOM   4626  H HE3  . TRP A 1 306 ? -54.698 -4.096  54.779  1.00 24.51 ? 295  TRP A HE3  1 
ATOM   4627  H HZ2  . TRP A 1 306 ? -50.809 -6.494  53.703  1.00 26.17 ? 295  TRP A HZ2  1 
ATOM   4628  H HZ3  . TRP A 1 306 ? -54.603 -5.440  52.893  1.00 25.10 ? 295  TRP A HZ3  1 
ATOM   4629  H HH2  . TRP A 1 306 ? -52.672 -6.620  52.369  1.00 26.41 ? 295  TRP A HH2  1 
ATOM   4630  N N    . ALA A 1 307 ? -55.065 -1.509  54.976  1.00 21.68 ? 296  ALA A N    1 
ATOM   4631  C CA   . ALA A 1 307 ? -55.557 -1.688  53.603  1.00 20.51 ? 296  ALA A CA   1 
ATOM   4632  C C    . ALA A 1 307 ? -55.244 -0.481  52.739  1.00 19.32 ? 296  ALA A C    1 
ATOM   4633  O O    . ALA A 1 307 ? -54.974 -0.612  51.533  1.00 19.80 ? 296  ALA A O    1 
ATOM   4634  C CB   . ALA A 1 307 ? -57.066 -1.904  53.628  1.00 21.53 ? 296  ALA A CB   1 
ATOM   4635  H H    . ALA A 1 307 ? -55.682 -1.451  55.573  1.00 26.01 ? 296  ALA A H    1 
ATOM   4636  H HA   . ALA A 1 307 ? -55.139 -2.469  53.207  1.00 24.61 ? 296  ALA A HA   1 
ATOM   4637  H HB1  . ALA A 1 307 ? -57.383 -2.021  52.719  1.00 25.84 ? 296  ALA A HB1  1 
ATOM   4638  H HB2  . ALA A 1 307 ? -57.263 -2.696  54.152  1.00 25.84 ? 296  ALA A HB2  1 
ATOM   4639  H HB3  . ALA A 1 307 ? -57.489 -1.128  54.029  1.00 25.84 ? 296  ALA A HB3  1 
ATOM   4640  N N    . LYS A 1 308 ? -55.295 0.710   53.333  1.00 18.75 ? 297  LYS A N    1 
ATOM   4641  C CA   . LYS A 1 308 ? -54.906 1.912   52.593  1.00 18.37 ? 297  LYS A CA   1 
ATOM   4642  C C    . LYS A 1 308 ? -53.430 1.876   52.241  1.00 16.95 ? 297  LYS A C    1 
ATOM   4643  O O    . LYS A 1 308 ? -53.032 2.130   51.089  1.00 18.31 ? 297  LYS A O    1 
ATOM   4644  C CB   . LYS A 1 308 ? -55.205 3.158   53.419  1.00 19.17 ? 297  LYS A CB   1 
ATOM   4645  C CG   . LYS A 1 308 ? -54.896 4.452   52.696  1.00 19.78 ? 297  LYS A CG   1 
ATOM   4646  C CD   . LYS A 1 308 ? -55.336 5.665   53.515  1.00 21.45 ? 297  LYS A CD   1 
ATOM   4647  C CE   . LYS A 1 308 ? -54.945 6.995   52.912  1.00 22.90 ? 297  LYS A CE   1 
ATOM   4648  N NZ   . LYS A 1 308 ? -55.485 8.168   53.774  1.00 28.44 ? 297  LYS A NZ   1 
ATOM   4649  H H    . LYS A 1 308 ? -55.544 0.849   54.144  1.00 22.50 ? 297  LYS A H    1 
ATOM   4650  H HA   . LYS A 1 308 ? -55.415 1.962   51.770  1.00 22.05 ? 297  LYS A HA   1 
ATOM   4651  H HB2  . LYS A 1 308 ? -56.148 3.163   53.647  1.00 23.01 ? 297  LYS A HB2  1 
ATOM   4652  H HB3  . LYS A 1 308 ? -54.671 3.134   54.228  1.00 23.01 ? 297  LYS A HB3  1 
ATOM   4653  H HG2  . LYS A 1 308 ? -53.939 4.516   52.547  1.00 23.73 ? 297  LYS A HG2  1 
ATOM   4654  H HG3  . LYS A 1 308 ? -55.369 4.468   51.850  1.00 23.73 ? 297  LYS A HG3  1 
ATOM   4655  H HD2  . LYS A 1 308 ? -56.302 5.650   53.597  1.00 25.74 ? 297  LYS A HD2  1 
ATOM   4656  H HD3  . LYS A 1 308 ? -54.931 5.609   54.395  1.00 25.74 ? 297  LYS A HD3  1 
ATOM   4657  H HE2  . LYS A 1 308 ? -53.977 7.062   52.876  1.00 27.48 ? 297  LYS A HE2  1 
ATOM   4658  H HE3  . LYS A 1 308 ? -55.322 7.070   52.022  1.00 27.48 ? 297  LYS A HE3  1 
ATOM   4659  H HZ1  . LYS A 1 308 ? -55.249 8.945   53.411  1.00 34.12 ? 297  LYS A HZ1  1 
ATOM   4660  H HZ2  . LYS A 1 308 ? -56.372 8.127   53.820  1.00 34.12 ? 297  LYS A HZ2  1 
ATOM   4661  H HZ3  . LYS A 1 308 ? -55.149 8.119   54.597  1.00 34.12 ? 297  LYS A HZ3  1 
ATOM   4662  N N    . ALA A 1 309 ? -52.589 1.570   53.225  1.00 17.98 ? 298  ALA A N    1 
ATOM   4663  C CA   . ALA A 1 309 ? -51.152 1.474   52.964  1.00 17.73 ? 298  ALA A CA   1 
ATOM   4664  C C    . ALA A 1 309 ? -50.865 0.413   51.915  1.00 17.25 ? 298  ALA A C    1 
ATOM   4665  O O    . ALA A 1 309 ? -50.064 0.645   51.020  1.00 16.07 ? 298  ALA A O    1 
ATOM   4666  C CB   . ALA A 1 309 ? -50.442 1.138   54.267  1.00 19.30 ? 298  ALA A CB   1 
ATOM   4667  H H    . ALA A 1 309 ? -52.817 1.415   54.039  1.00 21.58 ? 298  ALA A H    1 
ATOM   4668  H HA   . ALA A 1 309 ? -50.821 2.327   52.642  1.00 21.28 ? 298  ALA A HA   1 
ATOM   4669  H HB1  . ALA A 1 309 ? -49.489 1.074   54.100  1.00 23.17 ? 298  ALA A HB1  1 
ATOM   4670  H HB2  . ALA A 1 309 ? -50.618 1.841   54.913  1.00 23.17 ? 298  ALA A HB2  1 
ATOM   4671  H HB3  . ALA A 1 309 ? -50.778 0.291   54.600  1.00 23.17 ? 298  ALA A HB3  1 
ATOM   4672  N N    . ALA A 1 310 ? -51.517 -0.752  51.998  1.00 17.65 ? 299  ALA A N    1 
ATOM   4673  C CA   . ALA A 1 310 ? -51.296 -1.807  51.023  1.00 17.62 ? 299  ALA A CA   1 
ATOM   4674  C C    . ALA A 1 310 ? -51.726 -1.407  49.623  1.00 15.24 ? 299  ALA A C    1 
ATOM   4675  O O    . ALA A 1 310 ? -51.148 -1.884  48.634  1.00 15.44 ? 299  ALA A O    1 
ATOM   4676  C CB   . ALA A 1 310 ? -52.025 -3.065  51.471  1.00 18.78 ? 299  ALA A CB   1 
ATOM   4677  H H    . ALA A 1 310 ? -52.089 -0.949  52.609  1.00 21.18 ? 299  ALA A H    1 
ATOM   4678  H HA   . ALA A 1 310 ? -50.348 -2.009  50.993  1.00 21.15 ? 299  ALA A HA   1 
ATOM   4679  H HB1  . ALA A 1 310 ? -51.875 -3.766  50.818  1.00 22.54 ? 299  ALA A HB1  1 
ATOM   4680  H HB2  . ALA A 1 310 ? -51.680 -3.338  52.336  1.00 22.54 ? 299  ALA A HB2  1 
ATOM   4681  H HB3  . ALA A 1 310 ? -52.973 -2.873  51.539  1.00 22.54 ? 299  ALA A HB3  1 
ATOM   4682  N N    . ALA A 1 311 ? -52.693 -0.501  49.503  1.00 16.50 ? 300  ALA A N    1 
ATOM   4683  C CA   . ALA A 1 311 ? -53.125 -0.054  48.185  1.00 15.68 ? 300  ALA A CA   1 
ATOM   4684  C C    . ALA A 1 311 ? -52.017 0.653   47.430  1.00 15.17 ? 300  ALA A C    1 
ATOM   4685  O O    . ALA A 1 311 ? -52.069 0.683   46.192  1.00 15.53 ? 300  ALA A O    1 
ATOM   4686  C CB   . ALA A 1 311 ? -54.325 0.895   48.317  1.00 15.98 ? 300  ALA A CB   1 
ATOM   4687  H H    . ALA A 1 311 ? -53.109 -0.134  50.161  1.00 19.80 ? 300  ALA A H    1 
ATOM   4688  H HA   . ALA A 1 311 ? -53.403 -0.823  47.663  1.00 18.81 ? 300  ALA A HA   1 
ATOM   4689  H HB1  . ALA A 1 311 ? -54.599 1.182   47.432  1.00 19.17 ? 300  ALA A HB1  1 
ATOM   4690  H HB2  . ALA A 1 311 ? -55.053 0.424   48.752  1.00 19.17 ? 300  ALA A HB2  1 
ATOM   4691  H HB3  . ALA A 1 311 ? -54.063 1.663   48.848  1.00 19.17 ? 300  ALA A HB3  1 
ATOM   4692  N N    . PHE A 1 312 ? -51.040 1.216   48.145  1.00 13.53 ? 301  PHE A N    1 
ATOM   4693  C CA   . PHE A 1 312 ? -49.892 1.893   47.551  1.00 13.69 ? 301  PHE A CA   1 
ATOM   4694  C C    . PHE A 1 312 ? -48.730 0.960   47.224  1.00 14.25 ? 301  PHE A C    1 
ATOM   4695  O O    . PHE A 1 312 ? -47.802 1.388   46.541  1.00 13.69 ? 301  PHE A O    1 
ATOM   4696  C CB   . PHE A 1 312 ? -49.377 2.992   48.507  1.00 14.69 ? 301  PHE A CB   1 
ATOM   4697  C CG   . PHE A 1 312 ? -50.286 4.199   48.581  1.00 14.67 ? 301  PHE A CG   1 
ATOM   4698  C CD1  . PHE A 1 312 ? -51.448 4.153   49.298  1.00 15.02 ? 301  PHE A CD1  1 
ATOM   4699  C CD2  . PHE A 1 312 ? -49.983 5.367   47.920  1.00 15.83 ? 301  PHE A CD2  1 
ATOM   4700  C CE1  . PHE A 1 312 ? -52.302 5.238   49.360  1.00 16.15 ? 301  PHE A CE1  1 
ATOM   4701  C CE2  . PHE A 1 312 ? -50.813 6.465   47.968  1.00 16.85 ? 301  PHE A CE2  1 
ATOM   4702  C CZ   . PHE A 1 312 ? -51.996 6.395   48.697  1.00 16.99 ? 301  PHE A CZ   1 
ATOM   4703  H H    . PHE A 1 312 ? -51.024 1.217   49.005  1.00 16.23 ? 301  PHE A H    1 
ATOM   4704  H HA   . PHE A 1 312 ? -50.172 2.321   46.727  1.00 16.43 ? 301  PHE A HA   1 
ATOM   4705  H HB2  . PHE A 1 312 ? -49.302 2.621   49.400  1.00 17.62 ? 301  PHE A HB2  1 
ATOM   4706  H HB3  . PHE A 1 312 ? -48.508 3.292   48.200  1.00 17.62 ? 301  PHE A HB3  1 
ATOM   4707  H HD1  . PHE A 1 312 ? -51.674 3.370   49.746  1.00 18.02 ? 301  PHE A HD1  1 
ATOM   4708  H HD2  . PHE A 1 312 ? -49.198 5.415   47.424  1.00 18.99 ? 301  PHE A HD2  1 
ATOM   4709  H HE1  . PHE A 1 312 ? -53.087 5.182   49.856  1.00 19.38 ? 301  PHE A HE1  1 
ATOM   4710  H HE2  . PHE A 1 312 ? -50.587 7.244   47.513  1.00 20.22 ? 301  PHE A HE2  1 
ATOM   4711  H HZ   . PHE A 1 312 ? -52.564 7.131   48.746  1.00 20.39 ? 301  PHE A HZ   1 
ATOM   4712  N N    . VAL A 1 313 ? -48.782 -0.300  47.646  1.00 14.29 ? 302  VAL A N    1 
ATOM   4713  C CA   . VAL A 1 313 ? -47.657 -1.189  47.457  1.00 14.39 ? 302  VAL A CA   1 
ATOM   4714  C C    . VAL A 1 313 ? -47.538 -1.560  45.999  1.00 13.41 ? 302  VAL A C    1 
ATOM   4715  O O    . VAL A 1 313 ? -48.437 -2.184  45.419  1.00 13.67 ? 302  VAL A O    1 
ATOM   4716  C CB   . VAL A 1 313 ? -47.780 -2.422  48.351  1.00 14.83 ? 302  VAL A CB   1 
ATOM   4717  C CG1  . VAL A 1 313 ? -46.776 -3.528  47.957  1.00 15.19 ? 302  VAL A CG1  1 
ATOM   4718  C CG2  . VAL A 1 313 ? -47.576 -2.002  49.813  1.00 15.84 ? 302  VAL A CG2  1 
ATOM   4719  H H    . VAL A 1 313 ? -49.457 -0.658  48.041  1.00 17.15 ? 302  VAL A H    1 
ATOM   4720  H HA   . VAL A 1 313 ? -46.845 -0.722  47.710  1.00 17.26 ? 302  VAL A HA   1 
ATOM   4721  H HB   . VAL A 1 313 ? -48.675 -2.786  48.266  1.00 17.80 ? 302  VAL A HB   1 
ATOM   4722  H HG11 . VAL A 1 313 ? -46.893 -4.286  48.550  1.00 18.22 ? 302  VAL A HG11 1 
ATOM   4723  H HG12 . VAL A 1 313 ? -46.945 -3.796  47.040  1.00 18.22 ? 302  VAL A HG12 1 
ATOM   4724  H HG13 . VAL A 1 313 ? -45.874 -3.179  48.039  1.00 18.22 ? 302  VAL A HG13 1 
ATOM   4725  H HG21 . VAL A 1 313 ? -47.654 -2.785  50.380  1.00 19.01 ? 302  VAL A HG21 1 
ATOM   4726  H HG22 . VAL A 1 313 ? -46.693 -1.611  49.908  1.00 19.01 ? 302  VAL A HG22 1 
ATOM   4727  H HG23 . VAL A 1 313 ? -48.254 -1.351  50.051  1.00 19.01 ? 302  VAL A HG23 1 
ATOM   4728  N N    . THR A 1 314 ? -46.397 -1.204  45.421  1.00 13.53 ? 303  THR A N    1 
ATOM   4729  C CA   . THR A 1 314 ? -46.024 -1.478  44.045  1.00 12.89 ? 303  THR A CA   1 
ATOM   4730  C C    . THR A 1 314 ? -44.524 -1.244  43.965  1.00 12.83 ? 303  THR A C    1 
ATOM   4731  O O    . THR A 1 314 ? -43.933 -0.717  44.895  1.00 12.72 ? 303  THR A O    1 
ATOM   4732  C CB   . THR A 1 314 ? -46.770 -0.564  43.091  1.00 14.12 ? 303  THR A CB   1 
ATOM   4733  O OG1  . THR A 1 314 ? -46.554 -1.078  41.776  1.00 16.71 ? 303  THR A OG1  1 
ATOM   4734  C CG2  . THR A 1 314 ? -46.332 0.897   43.206  1.00 15.37 ? 303  THR A CG2  1 
ATOM   4735  H H    . THR A 1 314 ? -45.784 -0.772  45.841  1.00 16.24 ? 303  THR A H    1 
ATOM   4736  H HA   . THR A 1 314 ? -46.217 -2.402  43.821  1.00 15.47 ? 303  THR A HA   1 
ATOM   4737  H HB   . THR A 1 314 ? -47.718 -0.607  43.292  1.00 16.94 ? 303  THR A HB   1 
ATOM   4738  H HG1  . THR A 1 314 ? -46.951 -0.599  41.212  1.00 20.05 ? 303  THR A HG1  1 
ATOM   4739  H HG21 . THR A 1 314 ? -46.833 1.444   42.580  1.00 18.44 ? 303  THR A HG21 1 
ATOM   4740  H HG22 . THR A 1 314 ? -46.493 1.221   44.106  1.00 18.44 ? 303  THR A HG22 1 
ATOM   4741  H HG23 . THR A 1 314 ? -45.386 0.976   43.007  1.00 18.44 ? 303  THR A HG23 1 
ATOM   4742  N N    . SER A 1 315 ? -43.899 -1.657  42.868  1.00 12.60 ? 304  SER A N    1 
ATOM   4743  C CA   . SER A 1 315 ? -42.453 -1.548  42.742  1.00 12.53 ? 304  SER A CA   1 
ATOM   4744  C C    . SER A 1 315 ? -42.125 -0.928  41.395  1.00 12.60 ? 304  SER A C    1 
ATOM   4745  O O    . SER A 1 315 ? -42.698 -1.347  40.377  1.00 13.09 ? 304  SER A O    1 
ATOM   4746  C CB   . SER A 1 315 ? -41.820 -2.934  42.794  1.00 14.68 ? 304  SER A CB   1 
ATOM   4747  O OG   . SER A 1 315 ? -42.094 -3.465  44.061  1.00 16.57 ? 304  SER A OG   1 
ATOM   4748  H H    . SER A 1 315 ? -44.289 -2.003  42.184  1.00 15.12 ? 304  SER A H    1 
ATOM   4749  H HA   . SER A 1 315 ? -42.089 -0.997  43.452  1.00 15.04 ? 304  SER A HA   1 
ATOM   4750  H HB2  . SER A 1 315 ? -42.213 -3.499  42.111  1.00 17.61 ? 304  SER A HB2  1 
ATOM   4751  H HB3  . SER A 1 315 ? -40.861 -2.860  42.670  1.00 17.61 ? 304  SER A HB3  1 
ATOM   4752  H HG   . SER A 1 315 ? -41.759 -4.232  44.129  1.00 19.88 ? 304  SER A HG   1 
ATOM   4753  N N    . PRO A 1 316 ? -41.196 0.034   41.342  1.00 11.22 ? 305  PRO A N    1 
ATOM   4754  C CA   . PRO A 1 316 ? -40.622 0.702   42.512  1.00 11.20 ? 305  PRO A CA   1 
ATOM   4755  C C    . PRO A 1 316 ? -41.716 1.409   43.312  1.00 11.83 ? 305  PRO A C    1 
ATOM   4756  O O    . PRO A 1 316 ? -42.797 1.711   42.798  1.00 12.05 ? 305  PRO A O    1 
ATOM   4757  C CB   . PRO A 1 316 ? -39.603 1.699   41.928  1.00 13.02 ? 305  PRO A CB   1 
ATOM   4758  C CG   . PRO A 1 316 ? -39.386 1.270   40.469  1.00 12.27 ? 305  PRO A CG   1 
ATOM   4759  C CD   . PRO A 1 316 ? -40.751 0.657   40.102  1.00 12.13 ? 305  PRO A CD   1 
ATOM   4760  H HA   . PRO A 1 316 ? -40.164 0.062   43.079  1.00 13.44 ? 305  PRO A HA   1 
ATOM   4761  H HB2  . PRO A 1 316 ? -39.967 2.597   41.969  1.00 15.63 ? 305  PRO A HB2  1 
ATOM   4762  H HB3  . PRO A 1 316 ? -38.773 1.644   42.427  1.00 15.63 ? 305  PRO A HB3  1 
ATOM   4763  H HG2  . PRO A 1 316 ? -39.189 2.044   39.918  1.00 14.73 ? 305  PRO A HG2  1 
ATOM   4764  H HG3  . PRO A 1 316 ? -38.678 0.609   40.416  1.00 14.73 ? 305  PRO A HG3  1 
ATOM   4765  H HD2  . PRO A 1 316 ? -41.371 1.352   39.832  1.00 14.55 ? 305  PRO A HD2  1 
ATOM   4766  H HD3  . PRO A 1 316 ? -40.644 -0.012  39.408  1.00 14.55 ? 305  PRO A HD3  1 
ATOM   4767  N N    . PRO A 1 317 ? -41.491 1.621   44.604  1.00 11.74 ? 306  PRO A N    1 
ATOM   4768  C CA   . PRO A 1 317 ? -42.535 2.233   45.433  1.00 12.07 ? 306  PRO A CA   1 
ATOM   4769  C C    . PRO A 1 317 ? -42.743 3.706   45.119  1.00 11.90 ? 306  PRO A C    1 
ATOM   4770  O O    . PRO A 1 317 ? -41.880 4.354   44.526  1.00 12.71 ? 306  PRO A O    1 
ATOM   4771  C CB   . PRO A 1 317 ? -41.979 2.096   46.855  1.00 14.38 ? 306  PRO A CB   1 
ATOM   4772  C CG   . PRO A 1 317 ? -40.736 1.273   46.753  1.00 17.55 ? 306  PRO A CG   1 
ATOM   4773  C CD   . PRO A 1 317 ? -40.265 1.362   45.351  1.00 12.49 ? 306  PRO A CD   1 
ATOM   4774  H HA   . PRO A 1 317 ? -43.373 1.750   45.355  1.00 14.48 ? 306  PRO A HA   1 
ATOM   4775  H HB2  . PRO A 1 317 ? -41.774 2.976   47.206  1.00 17.25 ? 306  PRO A HB2  1 
ATOM   4776  H HB3  . PRO A 1 317 ? -42.634 1.651   47.415  1.00 17.25 ? 306  PRO A HB3  1 
ATOM   4777  H HG2  . PRO A 1 317 ? -40.066 1.629   47.358  1.00 21.06 ? 306  PRO A HG2  1 
ATOM   4778  H HG3  . PRO A 1 317 ? -40.941 0.353   46.982  1.00 21.06 ? 306  PRO A HG3  1 
ATOM   4779  H HD2  . PRO A 1 317 ? -39.643 2.100   45.249  1.00 14.98 ? 306  PRO A HD2  1 
ATOM   4780  H HD3  . PRO A 1 317 ? -39.869 0.522   45.072  1.00 14.98 ? 306  PRO A HD3  1 
ATOM   4781  N N    A LEU A 1 318 ? -43.857 4.237   45.619  0.46 14.49 ? 307  LEU A N    1 
ATOM   4782  N N    B LEU A 1 318 ? -43.892 4.243   45.537  0.54 10.80 ? 307  LEU A N    1 
ATOM   4783  C CA   A LEU A 1 318 ? -44.009 5.684   45.744  0.46 15.83 ? 307  LEU A CA   1 
ATOM   4784  C CA   B LEU A 1 318 ? -43.978 5.704   45.611  0.54 10.50 ? 307  LEU A CA   1 
ATOM   4785  C C    A LEU A 1 318 ? -42.934 6.240   46.670  0.46 14.80 ? 307  LEU A C    1 
ATOM   4786  C C    B LEU A 1 318 ? -42.931 6.224   46.604  0.54 11.11 ? 307  LEU A C    1 
ATOM   4787  O O    A LEU A 1 318 ? -42.753 5.754   47.797  0.46 15.57 ? 307  LEU A O    1 
ATOM   4788  O O    B LEU A 1 318 ? -42.700 5.642   47.668  0.54 13.62 ? 307  LEU A O    1 
ATOM   4789  C CB   A LEU A 1 318 ? -45.370 6.012   46.366  0.46 16.64 ? 307  LEU A CB   1 
ATOM   4790  C CB   B LEU A 1 318 ? -45.387 6.191   46.007  0.54 13.23 ? 307  LEU A CB   1 
ATOM   4791  C CG   A LEU A 1 318 ? -46.629 6.097   45.502  0.46 15.11 ? 307  LEU A CG   1 
ATOM   4792  C CG   B LEU A 1 318 ? -46.437 6.046   44.897  0.54 12.21 ? 307  LEU A CG   1 
ATOM   4793  C CD1  A LEU A 1 318 ? -46.487 7.173   44.425  0.46 16.75 ? 307  LEU A CD1  1 
ATOM   4794  C CD1  B LEU A 1 318 ? -46.960 4.638   44.876  0.54 16.10 ? 307  LEU A CD1  1 
ATOM   4795  C CD2  A LEU A 1 318 ? -46.944 4.755   44.871  0.46 14.32 ? 307  LEU A CD2  1 
ATOM   4796  C CD2  B LEU A 1 318 ? -47.566 6.993   45.144  0.54 14.06 ? 307  LEU A CD2  1 
ATOM   4797  H H    A LEU A 1 318 ? -44.535 3.784   45.890  0.46 17.39 ? 307  LEU A H    1 
ATOM   4798  H H    B LEU A 1 318 ? -44.598 3.812   45.772  0.54 12.96 ? 307  LEU A H    1 
ATOM   4799  H HA   A LEU A 1 318 ? -43.940 6.110   44.875  0.46 19.00 ? 307  LEU A HA   1 
ATOM   4800  H HA   B LEU A 1 318 ? -43.771 6.074   44.739  0.54 12.60 ? 307  LEU A HA   1 
ATOM   4801  H HB2  A LEU A 1 318 ? -45.548 5.336   47.039  0.46 19.97 ? 307  LEU A HB2  1 
ATOM   4802  H HB2  B LEU A 1 318 ? -45.691 5.676   46.770  0.54 15.87 ? 307  LEU A HB2  1 
ATOM   4803  H HB3  A LEU A 1 318 ? -45.285 6.871   46.807  0.46 19.97 ? 307  LEU A HB3  1 
ATOM   4804  H HB3  B LEU A 1 318 ? -45.336 7.130   46.244  0.54 15.87 ? 307  LEU A HB3  1 
ATOM   4805  H HG   A LEU A 1 318 ? -47.378 6.341   46.067  0.46 18.13 ? 307  LEU A HG   1 
ATOM   4806  H HG   B LEU A 1 318 ? -46.039 6.248   44.036  0.54 14.65 ? 307  LEU A HG   1 
ATOM   4807  H HD11 A LEU A 1 318 ? -47.300 7.200   43.897  0.46 20.10 ? 307  LEU A HD11 1 
ATOM   4808  H HD11 B LEU A 1 318 ? -47.622 4.558   44.172  0.54 19.32 ? 307  LEU A HD11 1 
ATOM   4809  H HD12 A LEU A 1 318 ? -46.342 8.031   44.853  0.46 20.10 ? 307  LEU A HD12 1 
ATOM   4810  H HD12 B LEU A 1 318 ? -46.223 4.030   44.708  0.54 19.32 ? 307  LEU A HD12 1 
ATOM   4811  H HD13 A LEU A 1 318 ? -45.731 6.954   43.857  0.46 20.10 ? 307  LEU A HD13 1 
ATOM   4812  H HD13 B LEU A 1 318 ? -47.364 4.439   45.735  0.54 19.32 ? 307  LEU A HD13 1 
ATOM   4813  H HD21 A LEU A 1 318 ? -47.745 4.841   44.331  0.46 17.18 ? 307  LEU A HD21 1 
ATOM   4814  H HD21 B LEU A 1 318 ? -48.222 6.892   44.437  0.54 16.87 ? 307  LEU A HD21 1 
ATOM   4815  H HD22 A LEU A 1 318 ? -46.197 4.485   44.314  0.46 17.18 ? 307  LEU A HD22 1 
ATOM   4816  H HD22 B LEU A 1 318 ? -47.969 6.786   46.002  0.54 16.87 ? 307  LEU A HD22 1 
ATOM   4817  H HD23 A LEU A 1 318 ? -47.087 4.101   45.573  0.46 17.18 ? 307  LEU A HD23 1 
ATOM   4818  H HD23 B LEU A 1 318 ? -47.222 7.900   45.149  0.54 16.87 ? 307  LEU A HD23 1 
ATOM   4819  N N    . SER A 1 319 ? -42.245 7.289   46.227  1.00 13.49 ? 308  SER A N    1 
ATOM   4820  C CA   . SER A 1 319 ? -41.241 7.883   47.086  1.00 13.41 ? 308  SER A CA   1 
ATOM   4821  C C    . SER A 1 319 ? -41.902 8.536   48.289  1.00 12.38 ? 308  SER A C    1 
ATOM   4822  O O    . SER A 1 319 ? -42.826 9.329   48.120  1.00 13.87 ? 308  SER A O    1 
ATOM   4823  C CB   . SER A 1 319 ? -40.498 8.969   46.360  1.00 13.24 ? 308  SER A CB   1 
ATOM   4824  O OG   . SER A 1 319 ? -39.666 9.688   47.271  1.00 14.72 ? 308  SER A OG   1 
ATOM   4825  H H    . SER A 1 319 ? -42.344 7.674   45.464  1.00 16.19 ? 308  SER A H    1 
ATOM   4826  H HA   . SER A 1 319 ? -40.612 7.209   47.389  1.00 16.09 ? 308  SER A HA   1 
ATOM   4827  H HB2  . SER A 1 319 ? -39.944 8.569   45.671  1.00 15.89 ? 308  SER A HB2  1 
ATOM   4828  H HB3  . SER A 1 319 ? -41.137 9.580   45.962  1.00 15.89 ? 308  SER A HB3  1 
ATOM   4829  H HG   . SER A 1 319 ? -39.252 10.295  46.864  1.00 17.66 ? 308  SER A HG   1 
ATOM   4830  N N    . PRO A 1 320 ? -41.404 8.300   49.502  1.00 13.16 ? 309  PRO A N    1 
ATOM   4831  C CA   . PRO A 1 320 ? -41.896 9.037   50.669  1.00 15.56 ? 309  PRO A CA   1 
ATOM   4832  C C    . PRO A 1 320 ? -41.595 10.513  50.649  1.00 15.27 ? 309  PRO A C    1 
ATOM   4833  O O    . PRO A 1 320 ? -42.173 11.240  51.454  1.00 19.30 ? 309  PRO A O    1 
ATOM   4834  C CB   . PRO A 1 320 ? -41.217 8.322   51.849  1.00 16.97 ? 309  PRO A CB   1 
ATOM   4835  C CG   . PRO A 1 320 ? -40.962 6.907   51.345  1.00 17.17 ? 309  PRO A CG   1 
ATOM   4836  C CD   . PRO A 1 320 ? -40.552 7.178   49.907  1.00 14.68 ? 309  PRO A CD   1 
ATOM   4837  H HA   . PRO A 1 320 ? -42.856 8.919   50.746  1.00 18.67 ? 309  PRO A HA   1 
ATOM   4838  H HB2  . PRO A 1 320 ? -40.383 8.766   52.066  1.00 20.37 ? 309  PRO A HB2  1 
ATOM   4839  H HB3  . PRO A 1 320 ? -41.813 8.313   52.614  1.00 20.37 ? 309  PRO A HB3  1 
ATOM   4840  H HG2  . PRO A 1 320 ? -40.242 6.493   51.847  1.00 20.61 ? 309  PRO A HG2  1 
ATOM   4841  H HG3  . PRO A 1 320 ? -41.776 6.380   51.388  1.00 20.61 ? 309  PRO A HG3  1 
ATOM   4842  H HD2  . PRO A 1 320 ? -39.617 7.433   49.866  1.00 17.62 ? 309  PRO A HD2  1 
ATOM   4843  H HD3  . PRO A 1 320 ? -40.732 6.402   49.354  1.00 17.62 ? 309  PRO A HD3  1 
ATOM   4844  N N    . ASP A 1 321 ? -40.718 10.977  49.768  1.00 15.04 ? 310  ASP A N    1 
ATOM   4845  C CA   . ASP A 1 321 ? -40.369 12.395  49.730  1.00 15.51 ? 310  ASP A CA   1 
ATOM   4846  C C    . ASP A 1 321 ? -41.495 13.165  49.060  1.00 15.24 ? 310  ASP A C    1 
ATOM   4847  O O    . ASP A 1 321 ? -41.767 12.975  47.863  1.00 15.56 ? 310  ASP A O    1 
ATOM   4848  C CB   . ASP A 1 321 ? -39.052 12.546  48.990  1.00 15.08 ? 310  ASP A CB   1 
ATOM   4849  C CG   . ASP A 1 321 ? -38.585 13.959  48.865  1.00 17.78 ? 310  ASP A CG   1 
ATOM   4850  O OD1  . ASP A 1 321 ? -39.376 14.899  49.132  1.00 19.43 ? 310  ASP A OD1  1 
ATOM   4851  O OD2  . ASP A 1 321 ? -37.404 14.114  48.470  1.00 19.95 ? 310  ASP A OD2  1 
ATOM   4852  H H    . ASP A 1 321 ? -40.311 10.496  49.183  1.00 18.05 ? 310  ASP A H    1 
ATOM   4853  H HA   . ASP A 1 321 ? -40.258 12.729  50.633  1.00 18.61 ? 310  ASP A HA   1 
ATOM   4854  H HB2  . ASP A 1 321 ? -38.368 12.050  49.466  1.00 18.09 ? 310  ASP A HB2  1 
ATOM   4855  H HB3  . ASP A 1 321 ? -39.154 12.188  48.095  1.00 18.09 ? 310  ASP A HB3  1 
ATOM   4856  N N    . PRO A 1 322 ? -42.206 14.011  49.807  1.00 17.10 ? 311  PRO A N    1 
ATOM   4857  C CA   . PRO A 1 322 ? -43.395 14.672  49.262  1.00 18.02 ? 311  PRO A CA   1 
ATOM   4858  C C    . PRO A 1 322 ? -43.093 15.660  48.161  1.00 16.14 ? 311  PRO A C    1 
ATOM   4859  O O    . PRO A 1 322 ? -44.026 16.096  47.486  1.00 18.51 ? 311  PRO A O    1 
ATOM   4860  C CB   . PRO A 1 322 ? -44.026 15.334  50.507  1.00 20.47 ? 311  PRO A CB   1 
ATOM   4861  C CG   . PRO A 1 322 ? -42.826 15.602  51.379  1.00 24.51 ? 311  PRO A CG   1 
ATOM   4862  C CD   . PRO A 1 322 ? -41.943 14.406  51.194  1.00 18.96 ? 311  PRO A CD   1 
ATOM   4863  H HA   . PRO A 1 322 ? -44.010 14.005  48.919  1.00 21.62 ? 311  PRO A HA   1 
ATOM   4864  H HB2  . PRO A 1 322 ? -44.469 16.160  50.258  1.00 24.56 ? 311  PRO A HB2  1 
ATOM   4865  H HB3  . PRO A 1 322 ? -44.641 14.720  50.937  1.00 24.56 ? 311  PRO A HB3  1 
ATOM   4866  H HG2  . PRO A 1 322 ? -42.379 16.410  51.082  1.00 29.41 ? 311  PRO A HG2  1 
ATOM   4867  H HG3  . PRO A 1 322 ? -43.105 15.683  52.305  1.00 29.41 ? 311  PRO A HG3  1 
ATOM   4868  H HD2  . PRO A 1 322 ? -41.011 14.652  51.305  1.00 22.75 ? 311  PRO A HD2  1 
ATOM   4869  H HD3  . PRO A 1 322 ? -42.200 13.697  51.803  1.00 22.75 ? 311  PRO A HD3  1 
ATOM   4870  N N    . THR A 1 323 ? -41.820 16.028  47.971  1.00 16.32 ? 312  THR A N    1 
ATOM   4871  C CA   . THR A 1 323 ? -41.421 16.944  46.916  1.00 17.43 ? 312  THR A CA   1 
ATOM   4872  C C    . THR A 1 323 ? -41.328 16.210  45.567  1.00 15.29 ? 312  THR A C    1 
ATOM   4873  O O    . THR A 1 323 ? -41.092 16.839  44.530  1.00 15.90 ? 312  THR A O    1 
ATOM   4874  C CB   . THR A 1 323 ? -40.061 17.635  47.241  1.00 17.30 ? 312  THR A CB   1 
ATOM   4875  O OG1  . THR A 1 323 ? -38.981 16.699  47.173  1.00 20.24 ? 312  THR A OG1  1 
ATOM   4876  C CG2  . THR A 1 323 ? -40.070 18.334  48.584  1.00 23.43 ? 312  THR A CG2  1 
ATOM   4877  H H    . THR A 1 323 ? -41.163 15.751  48.452  1.00 19.58 ? 312  THR A H    1 
ATOM   4878  H HA   . THR A 1 323 ? -42.094 17.637  46.832  1.00 20.92 ? 312  THR A HA   1 
ATOM   4879  H HB   . THR A 1 323 ? -39.906 18.318  46.570  1.00 20.76 ? 312  THR A HB   1 
ATOM   4880  H HG1  . THR A 1 323 ? -39.103 16.079  47.726  1.00 24.28 ? 312  THR A HG1  1 
ATOM   4881  H HG21 . THR A 1 323 ? -39.208 18.749  48.748  1.00 28.11 ? 312  THR A HG21 1 
ATOM   4882  H HG22 . THR A 1 323 ? -40.757 19.018  48.598  1.00 28.11 ? 312  THR A HG22 1 
ATOM   4883  H HG23 . THR A 1 323 ? -40.249 17.693  49.290  1.00 28.11 ? 312  THR A HG23 1 
ATOM   4884  N N    . THR A 1 324 ? -41.520 14.893  45.557  1.00 14.16 ? 313  THR A N    1 
ATOM   4885  C CA   . THR A 1 324 ? -41.282 14.125  44.340  1.00 14.00 ? 313  THR A CA   1 
ATOM   4886  C C    . THR A 1 324 ? -42.241 14.495  43.231  1.00 13.15 ? 313  THR A C    1 
ATOM   4887  O O    . THR A 1 324 ? -41.778 14.713  42.102  1.00 13.15 ? 313  THR A O    1 
ATOM   4888  C CB   . THR A 1 324 ? -41.276 12.624  44.637  1.00 12.65 ? 313  THR A CB   1 
ATOM   4889  O OG1  . THR A 1 324 ? -40.301 12.327  45.639  1.00 13.57 ? 313  THR A OG1  1 
ATOM   4890  C CG2  . THR A 1 324 ? -40.964 11.832  43.404  1.00 12.10 ? 313  THR A CG2  1 
ATOM   4891  H H    . THR A 1 324 ? -41.783 14.427  46.231  1.00 17.00 ? 313  THR A H    1 
ATOM   4892  H HA   . THR A 1 324 ? -40.393 14.347  44.022  1.00 16.79 ? 313  THR A HA   1 
ATOM   4893  H HB   . THR A 1 324 ? -42.153 12.358  44.956  1.00 15.18 ? 313  THR A HB   1 
ATOM   4894  H HG1  . THR A 1 324 ? -40.479 12.744  46.347  1.00 16.28 ? 313  THR A HG1  1 
ATOM   4895  H HG21 . THR A 1 324 ? -40.965 10.885  43.611  1.00 14.52 ? 313  THR A HG21 1 
ATOM   4896  H HG22 . THR A 1 324 ? -41.630 12.007  42.721  1.00 14.52 ? 313  THR A HG22 1 
ATOM   4897  H HG23 . THR A 1 324 ? -40.091 12.081  43.064  1.00 14.52 ? 313  THR A HG23 1 
ATOM   4898  N N    . PRO A 1 325 ? -43.562 14.532  43.434  1.00 14.90 ? 314  PRO A N    1 
ATOM   4899  C CA   . PRO A 1 325 ? -44.414 14.840  42.283  1.00 14.96 ? 314  PRO A CA   1 
ATOM   4900  C C    . PRO A 1 325 ? -44.080 16.167  41.614  1.00 13.41 ? 314  PRO A C    1 
ATOM   4901  O O    . PRO A 1 325 ? -44.099 16.243  40.383  1.00 14.63 ? 314  PRO A O    1 
ATOM   4902  C CB   . PRO A 1 325 ? -45.830 14.840  42.863  1.00 17.33 ? 314  PRO A CB   1 
ATOM   4903  C CG   . PRO A 1 325 ? -45.767 14.127  44.105  1.00 20.48 ? 314  PRO A CG   1 
ATOM   4904  C CD   . PRO A 1 325 ? -44.365 14.201  44.628  1.00 14.80 ? 314  PRO A CD   1 
ATOM   4905  H HA   . PRO A 1 325 ? -44.346 14.132  41.623  1.00 17.95 ? 314  PRO A HA   1 
ATOM   4906  H HB2  . PRO A 1 325 ? -46.118 15.754  43.012  1.00 20.79 ? 314  PRO A HB2  1 
ATOM   4907  H HB3  . PRO A 1 325 ? -46.431 14.392  42.247  1.00 20.79 ? 314  PRO A HB3  1 
ATOM   4908  H HG2  . PRO A 1 325 ? -46.379 14.536  44.737  1.00 24.57 ? 314  PRO A HG2  1 
ATOM   4909  H HG3  . PRO A 1 325 ? -46.016 13.202  43.953  1.00 24.57 ? 314  PRO A HG3  1 
ATOM   4910  H HD2  . PRO A 1 325 ? -44.289 14.906  45.291  1.00 17.76 ? 314  PRO A HD2  1 
ATOM   4911  H HD3  . PRO A 1 325 ? -44.094 13.343  44.990  1.00 17.76 ? 314  PRO A HD3  1 
ATOM   4912  N N    A ASP A 1 326 ? -43.806 17.223  42.392  0.45 15.44 ? 315  ASP A N    1 
ATOM   4913  N N    B ASP A 1 326 ? -43.770 17.198  42.369  0.55 12.45 ? 315  ASP A N    1 
ATOM   4914  C CA   A ASP A 1 326 ? -43.469 18.527  41.811  0.45 15.07 ? 315  ASP A CA   1 
ATOM   4915  C CA   B ASP A 1 326 ? -43.543 18.475  41.722  0.55 14.03 ? 315  ASP A CA   1 
ATOM   4916  C C    A ASP A 1 326 ? -42.272 18.407  40.879  0.45 16.04 ? 315  ASP A C    1 
ATOM   4917  C C    B ASP A 1 326 ? -42.274 18.430  40.872  0.55 12.88 ? 315  ASP A C    1 
ATOM   4918  O O    A ASP A 1 326 ? -42.253 18.958  39.773  0.45 18.64 ? 315  ASP A O    1 
ATOM   4919  O O    B ASP A 1 326 ? -42.233 19.013  39.783  0.55 12.05 ? 315  ASP A O    1 
ATOM   4920  C CB   A ASP A 1 326 ? -43.132 19.518  42.929  0.45 17.89 ? 315  ASP A CB   1 
ATOM   4921  C CB   B ASP A 1 326 ? -43.513 19.565  42.777  0.55 17.70 ? 315  ASP A CB   1 
ATOM   4922  C CG   A ASP A 1 326 ? -42.469 20.826  42.409  0.45 18.98 ? 315  ASP A CG   1 
ATOM   4923  C CG   B ASP A 1 326 ? -44.898 19.886  43.340  0.55 21.64 ? 315  ASP A CG   1 
ATOM   4924  O OD1  A ASP A 1 326 ? -43.175 21.723  41.918  0.45 23.36 ? 315  ASP A OD1  1 
ATOM   4925  O OD1  B ASP A 1 326 ? -45.922 19.412  42.808  0.55 25.57 ? 315  ASP A OD1  1 
ATOM   4926  O OD2  A ASP A 1 326 ? -41.222 20.967  42.507  0.45 23.51 ? 315  ASP A OD2  1 
ATOM   4927  O OD2  B ASP A 1 326 ? -44.955 20.639  44.309  0.55 22.68 ? 315  ASP A OD2  1 
ATOM   4928  H H    A ASP A 1 326 ? -43.808 17.210  43.251  0.45 18.53 ? 315  ASP A H    1 
ATOM   4929  H H    B ASP A 1 326 ? -43.685 17.192  43.225  0.55 14.94 ? 315  ASP A H    1 
ATOM   4930  H HA   A ASP A 1 326 ? -44.224 18.868  41.307  0.45 18.08 ? 315  ASP A HA   1 
ATOM   4931  H HA   B ASP A 1 326 ? -44.288 18.660  41.129  0.55 16.84 ? 315  ASP A HA   1 
ATOM   4932  H HB2  A ASP A 1 326 ? -43.950 19.760  43.391  0.45 21.47 ? 315  ASP A HB2  1 
ATOM   4933  H HB2  B ASP A 1 326 ? -42.951 19.277  43.513  0.55 21.24 ? 315  ASP A HB2  1 
ATOM   4934  H HB3  A ASP A 1 326 ? -42.516 19.096  43.548  0.45 21.47 ? 315  ASP A HB3  1 
ATOM   4935  H HB3  B ASP A 1 326 ? -43.155 20.376  42.384  0.55 21.24 ? 315  ASP A HB3  1 
ATOM   4936  N N    . PHE A 1 327 ? -41.258 17.701  41.332  1.00 13.14 ? 316  PHE A N    1 
ATOM   4937  C CA   . PHE A 1 327 ? -40.029 17.554  40.566  1.00 13.48 ? 316  PHE A CA   1 
ATOM   4938  C C    . PHE A 1 327 ? -40.283 16.765  39.305  1.00 12.71 ? 316  PHE A C    1 
ATOM   4939  O O    . PHE A 1 327 ? -39.803 17.135  38.238  1.00 12.70 ? 316  PHE A O    1 
ATOM   4940  C CB   . PHE A 1 327 ? -38.970 16.883  41.428  1.00 14.62 ? 316  PHE A CB   1 
ATOM   4941  C CG   . PHE A 1 327 ? -37.600 16.766  40.761  1.00 13.56 ? 316  PHE A CG   1 
ATOM   4942  C CD1  . PHE A 1 327 ? -36.750 17.836  40.711  1.00 17.66 ? 316  PHE A CD1  1 
ATOM   4943  C CD2  . PHE A 1 327 ? -37.170 15.603  40.208  1.00 13.94 ? 316  PHE A CD2  1 
ATOM   4944  C CE1  . PHE A 1 327 ? -35.498 17.744  40.114  1.00 19.61 ? 316  PHE A CE1  1 
ATOM   4945  C CE2  . PHE A 1 327 ? -35.915 15.499  39.629  1.00 14.75 ? 316  PHE A CE2  1 
ATOM   4946  C CZ   . PHE A 1 327 ? -35.082 16.568  39.599  1.00 16.69 ? 316  PHE A CZ   1 
ATOM   4947  H H    . PHE A 1 327 ? -41.255 17.286  42.086  1.00 15.77 ? 316  PHE A H    1 
ATOM   4948  H HA   . PHE A 1 327 ? -39.703 18.432  40.314  1.00 16.18 ? 316  PHE A HA   1 
ATOM   4949  H HB2  . PHE A 1 327 ? -38.858 17.400  42.241  1.00 17.54 ? 316  PHE A HB2  1 
ATOM   4950  H HB3  . PHE A 1 327 ? -39.269 15.987  41.648  1.00 17.54 ? 316  PHE A HB3  1 
ATOM   4951  H HD1  . PHE A 1 327 ? -37.019 18.646  41.080  1.00 21.20 ? 316  PHE A HD1  1 
ATOM   4952  H HD2  . PHE A 1 327 ? -37.721 14.855  40.237  1.00 16.73 ? 316  PHE A HD2  1 
ATOM   4953  H HE1  . PHE A 1 327 ? -34.935 18.483  40.098  1.00 23.53 ? 316  PHE A HE1  1 
ATOM   4954  H HE2  . PHE A 1 327 ? -35.643 14.691  39.259  1.00 17.69 ? 316  PHE A HE2  1 
ATOM   4955  H HZ   . PHE A 1 327 ? -34.250 16.503  39.189  1.00 20.03 ? 316  PHE A HZ   1 
ATOM   4956  N N    . LEU A 1 328 ? -40.997 15.643  39.402  1.00 11.78 ? 317  LEU A N    1 
ATOM   4957  C CA   . LEU A 1 328 ? -41.261 14.862  38.200  1.00 11.91 ? 317  LEU A CA   1 
ATOM   4958  C C    . LEU A 1 328 ? -42.097 15.632  37.176  1.00 11.50 ? 317  LEU A C    1 
ATOM   4959  O O    . LEU A 1 328 ? -41.836 15.553  35.976  1.00 12.27 ? 317  LEU A O    1 
ATOM   4960  C CB   . LEU A 1 328 ? -41.837 13.493  38.549  1.00 12.28 ? 317  LEU A CB   1 
ATOM   4961  C CG   . LEU A 1 328 ? -41.033 12.564  39.462  1.00 11.65 ? 317  LEU A CG   1 
ATOM   4962  C CD1  . LEU A 1 328 ? -41.791 11.303  39.689  1.00 12.90 ? 317  LEU A CD1  1 
ATOM   4963  C CD2  . LEU A 1 328 ? -39.684 12.257  38.822  1.00 12.96 ? 317  LEU A CD2  1 
ATOM   4964  H H    . LEU A 1 328 ? -41.329 15.322  40.128  1.00 14.13 ? 317  LEU A H    1 
ATOM   4965  H HA   . LEU A 1 328 ? -40.405 14.693  37.775  1.00 14.29 ? 317  LEU A HA   1 
ATOM   4966  H HB2  . LEU A 1 328 ? -42.694 13.635  38.980  1.00 14.73 ? 317  LEU A HB2  1 
ATOM   4967  H HB3  . LEU A 1 328 ? -41.979 13.012  37.718  1.00 14.73 ? 317  LEU A HB3  1 
ATOM   4968  H HG   . LEU A 1 328 ? -40.882 12.996  40.318  1.00 13.98 ? 317  LEU A HG   1 
ATOM   4969  H HD11 . LEU A 1 328 ? -41.272 10.724  40.269  1.00 15.48 ? 317  LEU A HD11 1 
ATOM   4970  H HD12 . LEU A 1 328 ? -42.640 11.516  40.108  1.00 15.48 ? 317  LEU A HD12 1 
ATOM   4971  H HD13 . LEU A 1 328 ? -41.942 10.869  38.836  1.00 15.48 ? 317  LEU A HD13 1 
ATOM   4972  H HD21 . LEU A 1 328 ? -39.183 11.669  39.409  1.00 15.55 ? 317  LEU A HD21 1 
ATOM   4973  H HD22 . LEU A 1 328 ? -39.832 11.824  37.967  1.00 15.55 ? 317  LEU A HD22 1 
ATOM   4974  H HD23 . LEU A 1 328 ? -39.199 13.087  38.694  1.00 15.55 ? 317  LEU A HD23 1 
ATOM   4975  N N    . ASN A 1 329 ? -43.106 16.403  37.623  1.00 11.97 ? 318  ASN A N    1 
ATOM   4976  C CA   . ASN A 1 329 ? -43.832 17.247  36.699  1.00 11.98 ? 318  ASN A CA   1 
ATOM   4977  C C    . ASN A 1 329 ? -42.942 18.329  36.083  1.00 12.12 ? 318  ASN A C    1 
ATOM   4978  O O    . ASN A 1 329 ? -43.124 18.686  34.916  1.00 12.59 ? 318  ASN A O    1 
ATOM   4979  C CB   . ASN A 1 329 ? -45.037 17.857  37.415  1.00 12.32 ? 318  ASN A CB   1 
ATOM   4980  C CG   . ASN A 1 329 ? -46.189 16.872  37.495  1.00 13.11 ? 318  ASN A CG   1 
ATOM   4981  O OD1  . ASN A 1 329 ? -46.865 16.623  36.510  1.00 14.28 ? 318  ASN A OD1  1 
ATOM   4982  N ND2  . ASN A 1 329 ? -46.406 16.307  38.671  1.00 13.76 ? 318  ASN A ND2  1 
ATOM   4983  H H    . ASN A 1 329 ? -43.374 16.445  38.439  1.00 14.36 ? 318  ASN A H    1 
ATOM   4984  H HA   . ASN A 1 329 ? -44.168 16.696  35.975  1.00 14.37 ? 318  ASN A HA   1 
ATOM   4985  H HB2  . ASN A 1 329 ? -44.783 18.103  38.319  1.00 14.79 ? 318  ASN A HB2  1 
ATOM   4986  H HB3  . ASN A 1 329 ? -45.339 18.639  36.927  1.00 14.79 ? 318  ASN A HB3  1 
ATOM   4987  H HD21 . ASN A 1 329 ? -47.048 15.742  38.765  1.00 16.52 ? 318  ASN A HD21 1 
ATOM   4988  H HD22 . ASN A 1 329 ? -45.905 16.504  39.342  1.00 16.52 ? 318  ASN A HD22 1 
ATOM   4989  N N    . SER A 1 330 ? -41.975 18.860  36.840  1.00 11.67 ? 319  SER A N    1 
ATOM   4990  C CA   . SER A 1 330 ? -41.006 19.798  36.282  1.00 12.12 ? 319  SER A CA   1 
ATOM   4991  C C    . SER A 1 330 ? -40.180 19.142  35.175  1.00 11.63 ? 319  SER A C    1 
ATOM   4992  O O    . SER A 1 330 ? -39.957 19.751  34.121  1.00 12.65 ? 319  SER A O    1 
ATOM   4993  C CB   . SER A 1 330 ? -40.130 20.370  37.391  1.00 13.09 ? 319  SER A CB   1 
ATOM   4994  O OG   . SER A 1 330 ? -40.855 21.244  38.235  1.00 17.17 ? 319  SER A OG   1 
ATOM   4995  H H    . SER A 1 330 ? -41.861 18.691  37.676  1.00 14.01 ? 319  SER A H    1 
ATOM   4996  H HA   . SER A 1 330 ? -41.490 20.538  35.883  1.00 14.54 ? 319  SER A HA   1 
ATOM   4997  H HB2  . SER A 1 330 ? -39.781 19.638  37.923  1.00 15.71 ? 319  SER A HB2  1 
ATOM   4998  H HB3  . SER A 1 330 ? -39.397 20.862  36.988  1.00 15.71 ? 319  SER A HB3  1 
ATOM   4999  H HG   . SER A 1 330 ? -41.162 21.886  37.788  1.00 20.61 ? 319  SER A HG   1 
ATOM   5000  N N    . LEU A 1 331 ? -39.717 17.919  35.379  1.00 11.86 ? 320  LEU A N    1 
ATOM   5001  C CA   . LEU A 1 331 ? -38.900 17.281  34.340  1.00 12.53 ? 320  LEU A CA   1 
ATOM   5002  C C    . LEU A 1 331 ? -39.731 16.798  33.161  1.00 13.32 ? 320  LEU A C    1 
ATOM   5003  O O    . LEU A 1 331 ? -39.212 16.709  32.050  1.00 14.84 ? 320  LEU A O    1 
ATOM   5004  C CB   . LEU A 1 331 ? -38.062 16.141  34.918  1.00 13.69 ? 320  LEU A CB   1 
ATOM   5005  C CG   . LEU A 1 331 ? -36.700 16.640  35.425  1.00 14.44 ? 320  LEU A CG   1 
ATOM   5006  C CD1  . LEU A 1 331 ? -36.732 17.726  36.487  1.00 16.24 ? 320  LEU A CD1  1 
ATOM   5007  C CD2  . LEU A 1 331 ? -35.865 15.486  35.889  1.00 16.52 ? 320  LEU A CD2  1 
ATOM   5008  H H    . LEU A 1 331 ? -39.851 17.445  36.083  1.00 14.23 ? 320  LEU A H    1 
ATOM   5009  H HA   . LEU A 1 331 ? -38.280 17.944  33.998  1.00 15.03 ? 320  LEU A HA   1 
ATOM   5010  H HB2  . LEU A 1 331 ? -38.536 15.742  35.664  1.00 16.43 ? 320  LEU A HB2  1 
ATOM   5011  H HB3  . LEU A 1 331 ? -37.904 15.478  34.228  1.00 16.43 ? 320  LEU A HB3  1 
ATOM   5012  H HG   . LEU A 1 331 ? -36.236 17.022  34.664  1.00 17.33 ? 320  LEU A HG   1 
ATOM   5013  H HD11 . LEU A 1 331 ? -35.821 17.959  36.727  1.00 19.48 ? 320  LEU A HD11 1 
ATOM   5014  H HD12 . LEU A 1 331 ? -37.189 18.504  36.130  1.00 19.48 ? 320  LEU A HD12 1 
ATOM   5015  H HD13 . LEU A 1 331 ? -37.205 17.393  37.265  1.00 19.48 ? 320  LEU A HD13 1 
ATOM   5016  H HD21 . LEU A 1 331 ? -35.011 15.821  36.205  1.00 19.83 ? 320  LEU A HD21 1 
ATOM   5017  H HD22 . LEU A 1 331 ? -36.329 15.030  36.609  1.00 19.83 ? 320  LEU A HD22 1 
ATOM   5018  H HD23 . LEU A 1 331 ? -35.728 14.877  35.146  1.00 19.83 ? 320  LEU A HD23 1 
ATOM   5019  N N    . LEU A 1 332 ? -41.014 16.494  33.370  1.00 13.19 ? 321  LEU A N    1 
ATOM   5020  C CA   . LEU A 1 332 ? -41.873 16.230  32.242  1.00 15.15 ? 321  LEU A CA   1 
ATOM   5021  C C    . LEU A 1 332 ? -42.034 17.492  31.410  1.00 13.12 ? 321  LEU A C    1 
ATOM   5022  O O    . LEU A 1 332 ? -42.158 17.450  30.176  1.00 17.10 ? 321  LEU A O    1 
ATOM   5023  C CB   . LEU A 1 332 ? -43.216 15.823  32.851  1.00 20.62 ? 321  LEU A CB   1 
ATOM   5024  C CG   . LEU A 1 332 ? -44.239 15.104  32.065  1.00 23.01 ? 321  LEU A CG   1 
ATOM   5025  C CD1  . LEU A 1 332 ? -43.717 13.825  31.488  1.00 17.49 ? 321  LEU A CD1  1 
ATOM   5026  C CD2  . LEU A 1 332 ? -45.473 14.902  32.955  1.00 19.93 ? 321  LEU A CD2  1 
ATOM   5027  H H    . LEU A 1 332 ? -41.394 16.438  34.140  1.00 15.83 ? 321  LEU A H    1 
ATOM   5028  H HA   . LEU A 1 332 ? -41.522 15.510  31.695  1.00 18.18 ? 321  LEU A HA   1 
ATOM   5029  H HB2  . LEU A 1 332 ? -43.022 15.261  33.617  1.00 24.75 ? 321  LEU A HB2  1 
ATOM   5030  H HB3  . LEU A 1 332 ? -43.642 16.635  33.167  1.00 24.75 ? 321  LEU A HB3  1 
ATOM   5031  H HG   . LEU A 1 332 ? -44.507 15.667  31.322  1.00 27.62 ? 321  LEU A HG   1 
ATOM   5032  H HD11 . LEU A 1 332 ? -44.425 13.395  30.984  1.00 20.99 ? 321  LEU A HD11 1 
ATOM   5033  H HD12 . LEU A 1 332 ? -42.969 14.025  30.904  1.00 20.99 ? 321  LEU A HD12 1 
ATOM   5034  H HD13 . LEU A 1 332 ? -43.428 13.248  32.212  1.00 20.99 ? 321  LEU A HD13 1 
ATOM   5035  H HD21 . LEU A 1 332 ? -46.153 14.430  32.450  1.00 23.92 ? 321  LEU A HD21 1 
ATOM   5036  H HD22 . LEU A 1 332 ? -45.218 14.382  33.734  1.00 23.92 ? 321  LEU A HD22 1 
ATOM   5037  H HD23 . LEU A 1 332 ? -45.808 15.769  33.231  1.00 23.92 ? 321  LEU A HD23 1 
ATOM   5038  N N    . SER A 1 333 ? -42.007 18.636  32.069  1.00 11.94 ? 322  SER A N    1 
ATOM   5039  C CA   . SER A 1 333 ? -42.237 19.918  31.413  1.00 14.93 ? 322  SER A CA   1 
ATOM   5040  C C    . SER A 1 333 ? -41.038 20.425  30.628  1.00 16.75 ? 322  SER A C    1 
ATOM   5041  O O    . SER A 1 333 ? -41.242 21.150  29.647  1.00 25.84 ? 322  SER A O    1 
ATOM   5042  C CB   . SER A 1 333 ? -42.667 20.962  32.430  1.00 15.13 ? 322  SER A CB   1 
ATOM   5043  O OG   . SER A 1 333 ? -43.921 20.563  32.992  1.00 13.93 ? 322  SER A OG   1 
ATOM   5044  H H    . SER A 1 333 ? -41.857 18.701  32.913  1.00 14.33 ? 322  SER A H    1 
ATOM   5045  H HA   . SER A 1 333 ? -42.967 19.810  30.784  1.00 17.91 ? 322  SER A HA   1 
ATOM   5046  H HB2  . SER A 1 333 ? -42.002 21.022  33.133  1.00 18.16 ? 322  SER A HB2  1 
ATOM   5047  H HB3  . SER A 1 333 ? -42.770 21.820  31.988  1.00 18.16 ? 322  SER A HB3  1 
ATOM   5048  H HG   . SER A 1 333 ? -43.842 19.817  33.370  1.00 16.72 ? 322  SER A HG   1 
ATOM   5049  N N    . CYS A 1 334 ? -39.823 20.065  31.000  1.00 14.27 ? 323  CYS A N    1 
ATOM   5050  C CA   . CYS A 1 334 ? -38.612 20.519  30.312  1.00 15.18 ? 323  CYS A CA   1 
ATOM   5051  C C    . CYS A 1 334 ? -38.072 19.498  29.343  1.00 15.03 ? 323  CYS A C    1 
ATOM   5052  O O    . CYS A 1 334 ? -37.075 19.781  28.693  1.00 17.46 ? 323  CYS A O    1 
ATOM   5053  C CB   . CYS A 1 334 ? -37.517 20.909  31.320  1.00 17.78 ? 323  CYS A CB   1 
ATOM   5054  S SG   . CYS A 1 334 ? -36.847 19.636  32.284  1.00 17.30 ? 323  CYS A SG   1 
ATOM   5055  H H    . CYS A 1 334 ? -39.663 19.543  31.664  1.00 17.12 ? 323  CYS A H    1 
ATOM   5056  H HA   . CYS A 1 334 ? -38.832 21.314  29.801  1.00 18.22 ? 323  CYS A HA   1 
ATOM   5057  H HB2  . CYS A 1 334 ? -36.784 21.312  30.828  1.00 21.33 ? 323  CYS A HB2  1 
ATOM   5058  H HB3  . CYS A 1 334 ? -37.889 21.564  31.931  1.00 21.33 ? 323  CYS A HB3  1 
ATOM   5059  H HG   . CYS A 1 334 ? -36.350 18.818  31.559  1.00 20.76 ? 323  CYS A HG   1 
ATOM   5060  N N    . GLY A 1 335 ? -38.721 18.347  29.205  1.00 15.24 ? 324  GLY A N    1 
ATOM   5061  C CA   . GLY A 1 335 ? -38.337 17.360  28.222  1.00 14.66 ? 324  GLY A CA   1 
ATOM   5062  C C    . GLY A 1 335 ? -37.452 16.238  28.693  1.00 13.70 ? 324  GLY A C    1 
ATOM   5063  O O    . GLY A 1 335 ? -37.081 15.394  27.854  1.00 15.60 ? 324  GLY A O    1 
ATOM   5064  H H    . GLY A 1 335 ? -39.398 18.117  29.681  1.00 18.29 ? 324  GLY A H    1 
ATOM   5065  H HA2  . GLY A 1 335 ? -39.142 16.962  27.856  1.00 17.59 ? 324  GLY A HA2  1 
ATOM   5066  H HA3  . GLY A 1 335 ? -37.875 17.811  27.498  1.00 17.59 ? 324  GLY A HA3  1 
ATOM   5067  N N    . ASP A 1 336 ? -37.120 16.188  29.984  1.00 14.47 ? 325  ASP A N    1 
ATOM   5068  C CA   . ASP A 1 336 ? -36.284 15.099  30.478  1.00 15.79 ? 325  ASP A CA   1 
ATOM   5069  C C    . ASP A 1 336 ? -37.054 13.824  30.694  1.00 14.99 ? 325  ASP A C    1 
ATOM   5070  O O    . ASP A 1 336 ? -36.467 12.746  30.642  1.00 19.90 ? 325  ASP A O    1 
ATOM   5071  C CB   . ASP A 1 336 ? -35.551 15.485  31.758  1.00 16.08 ? 325  ASP A CB   1 
ATOM   5072  C CG   . ASP A 1 336 ? -34.442 16.413  31.510  1.00 18.16 ? 325  ASP A CG   1 
ATOM   5073  O OD1  . ASP A 1 336 ? -33.657 16.077  30.575  1.00 22.62 ? 325  ASP A OD1  1 
ATOM   5074  O OD2  . ASP A 1 336 ? -34.320 17.408  32.300  1.00 24.19 ? 325  ASP A OD2  1 
ATOM   5075  H H    . ASP A 1 336 ? -37.359 16.760  30.580  1.00 17.36 ? 325  ASP A H    1 
ATOM   5076  H HA   . ASP A 1 336 ? -35.608 14.912  29.808  1.00 18.95 ? 325  ASP A HA   1 
ATOM   5077  H HB2  . ASP A 1 336 ? -36.175 15.916  32.363  1.00 19.30 ? 325  ASP A HB2  1 
ATOM   5078  H HB3  . ASP A 1 336 ? -35.188 14.685  32.169  1.00 19.30 ? 325  ASP A HB3  1 
ATOM   5079  N N    . LEU A 1 337 ? -38.343 13.917  30.942  1.00 12.66 ? 326  LEU A N    1 
ATOM   5080  C CA   . LEU A 1 337 ? -39.244 12.788  30.967  1.00 12.27 ? 326  LEU A CA   1 
ATOM   5081  C C    . LEU A 1 337 ? -40.225 13.084  29.853  1.00 13.84 ? 326  LEU A C    1 
ATOM   5082  O O    . LEU A 1 337 ? -40.754 14.170  29.786  1.00 23.27 ? 326  LEU A O    1 
ATOM   5083  C CB   . LEU A 1 337 ? -39.884 12.665  32.348  1.00 11.90 ? 326  LEU A CB   1 
ATOM   5084  C CG   . LEU A 1 337 ? -38.931 12.497  33.533  1.00 11.38 ? 326  LEU A CG   1 
ATOM   5085  C CD1  . LEU A 1 337 ? -39.718 12.568  34.820  1.00 11.79 ? 326  LEU A CD1  1 
ATOM   5086  C CD2  . LEU A 1 337 ? -38.161 11.202  33.420  1.00 12.88 ? 326  LEU A CD2  1 
ATOM   5087  H H    . LEU A 1 337 ? -38.738 14.663  31.107  1.00 15.19 ? 326  LEU A H    1 
ATOM   5088  H HA   . LEU A 1 337 ? -38.764 11.971  30.762  1.00 14.72 ? 326  LEU A HA   1 
ATOM   5089  H HB2  . LEU A 1 337 ? -40.407 13.465  32.511  1.00 14.28 ? 326  LEU A HB2  1 
ATOM   5090  H HB3  . LEU A 1 337 ? -40.472 11.893  32.341  1.00 14.28 ? 326  LEU A HB3  1 
ATOM   5091  H HG   . LEU A 1 337 ? -38.292 13.227  33.532  1.00 13.65 ? 326  LEU A HG   1 
ATOM   5092  H HD11 . LEU A 1 337 ? -39.110 12.461  35.568  1.00 14.15 ? 326  LEU A HD11 1 
ATOM   5093  H HD12 . LEU A 1 337 ? -40.159 13.430  34.873  1.00 14.15 ? 326  LEU A HD12 1 
ATOM   5094  H HD13 . LEU A 1 337 ? -40.378 11.857  34.826  1.00 14.15 ? 326  LEU A HD13 1 
ATOM   5095  H HD21 . LEU A 1 337 ? -37.566 11.121  34.182  1.00 15.45 ? 326  LEU A HD21 1 
ATOM   5096  H HD22 . LEU A 1 337 ? -38.788 10.462  33.409  1.00 15.45 ? 326  LEU A HD22 1 
ATOM   5097  H HD23 . LEU A 1 337 ? -37.646 11.212  32.598  1.00 15.45 ? 326  LEU A HD23 1 
ATOM   5098  N N    A GLN A 1 338 ? -40.475 12.116  29.007  0.49 11.07 ? 327  GLN A N    1 
ATOM   5099  N N    B GLN A 1 338 ? -40.465 12.161  28.945  0.51 11.87 ? 327  GLN A N    1 
ATOM   5100  C CA   A GLN A 1 338 ? -41.128 12.383  27.746  0.49 10.06 ? 327  GLN A CA   1 
ATOM   5101  C CA   B GLN A 1 338 ? -41.217 12.491  27.738  0.51 11.79 ? 327  GLN A CA   1 
ATOM   5102  C C    A GLN A 1 338 ? -42.513 11.783  27.613  0.49 11.20 ? 327  GLN A C    1 
ATOM   5103  C C    B GLN A 1 338 ? -42.551 11.777  27.586  0.51 11.21 ? 327  GLN A C    1 
ATOM   5104  O O    A GLN A 1 338 ? -43.330 12.314  26.860  0.49 12.54 ? 327  GLN A O    1 
ATOM   5105  O O    B GLN A 1 338 ? -43.375 12.224  26.778  0.51 12.30 ? 327  GLN A O    1 
ATOM   5106  C CB   A GLN A 1 338 ? -40.255 11.833  26.617  0.49 11.48 ? 327  GLN A CB   1 
ATOM   5107  C CB   B GLN A 1 338 ? -40.387 12.202  26.469  0.51 11.93 ? 327  GLN A CB   1 
ATOM   5108  C CG   A GLN A 1 338 ? -38.834 12.396  26.667  0.49 10.83 ? 327  GLN A CG   1 
ATOM   5109  C CG   B GLN A 1 338 ? -39.236 13.203  26.232  0.51 16.56 ? 327  GLN A CG   1 
ATOM   5110  C CD   A GLN A 1 338 ? -37.943 11.778  27.720  0.49 12.85 ? 327  GLN A CD   1 
ATOM   5111  C CD   B GLN A 1 338 ? -38.061 12.597  25.438  0.51 22.84 ? 327  GLN A CD   1 
ATOM   5112  O OE1  A GLN A 1 338 ? -38.129 10.649  28.142  0.49 11.88 ? 327  GLN A OE1  1 
ATOM   5113  O OE1  B GLN A 1 338 ? -37.292 11.773  25.960  0.51 27.27 ? 327  GLN A OE1  1 
ATOM   5114  N NE2  A GLN A 1 338 ? -36.999 12.554  28.204  0.49 12.55 ? 327  GLN A NE2  1 
ATOM   5115  N NE2  B GLN A 1 338 ? -37.931 12.992  24.180  0.51 22.56 ? 327  GLN A NE2  1 
ATOM   5116  H H    B GLN A 1 338 ? -40.210 11.341  28.995  0.51 14.25 ? 327  GLN A H    1 
ATOM   5117  H HA   A GLN A 1 338 ? -41.205 13.343  27.626  0.49 12.07 ? 327  GLN A HA   1 
ATOM   5118  H HA   B GLN A 1 338 ? -41.402 13.444  27.749  0.51 14.14 ? 327  GLN A HA   1 
ATOM   5119  H HB2  A GLN A 1 338 ? -40.201 10.867  26.697  0.49 13.78 ? 327  GLN A HB2  1 
ATOM   5120  H HB2  B GLN A 1 338 ? -39.999 11.316  26.545  0.51 14.31 ? 327  GLN A HB2  1 
ATOM   5121  H HB3  A GLN A 1 338 ? -40.647 12.075  25.763  0.49 13.78 ? 327  GLN A HB3  1 
ATOM   5122  H HB3  B GLN A 1 338 ? -40.974 12.237  25.697  0.51 14.31 ? 327  GLN A HB3  1 
ATOM   5123  H HG2  A GLN A 1 338 ? -38.413 12.250  25.805  0.49 13.00 ? 327  GLN A HG2  1 
ATOM   5124  H HG2  B GLN A 1 338 ? -39.576 13.961  25.732  0.51 19.87 ? 327  GLN A HG2  1 
ATOM   5125  H HG3  A GLN A 1 338 ? -38.885 13.348  26.847  0.49 13.00 ? 327  GLN A HG3  1 
ATOM   5126  H HG3  B GLN A 1 338 ? -38.895 13.500  27.091  0.51 19.87 ? 327  GLN A HG3  1 
ATOM   5127  H HE21 A GLN A 1 338 ? -36.918 13.361  27.918  0.49 15.06 ? 327  GLN A HE21 1 
ATOM   5128  H HE21 B GLN A 1 338 ? -38.487 13.559  23.848  0.51 27.08 ? 327  GLN A HE21 1 
ATOM   5129  H HE22 A GLN A 1 338 ? -36.463 12.254  28.806  0.49 15.06 ? 327  GLN A HE22 1 
ATOM   5130  H HE22 B GLN A 1 338 ? -37.292 12.683  23.695  0.51 27.08 ? 327  GLN A HE22 1 
ATOM   5131  N N    . VAL A 1 339 ? -42.763 10.658  28.275  1.00 10.86 ? 328  VAL A N    1 
ATOM   5132  C CA   . VAL A 1 339 ? -44.004 9.920   28.124  1.00 10.89 ? 328  VAL A CA   1 
ATOM   5133  C C    . VAL A 1 339 ? -44.575 9.672   29.494  1.00 11.14 ? 328  VAL A C    1 
ATOM   5134  O O    . VAL A 1 339 ? -43.884 9.655   30.507  1.00 12.43 ? 328  VAL A O    1 
ATOM   5135  C CB   . VAL A 1 339 ? -43.807 8.606   27.365  1.00 11.82 ? 328  VAL A CB   1 
ATOM   5136  C CG1  . VAL A 1 339 ? -43.282 8.848   25.955  1.00 12.92 ? 328  VAL A CG1  1 
ATOM   5137  C CG2  . VAL A 1 339 ? -42.947 7.619   28.120  1.00 11.89 ? 328  VAL A CG2  1 
ATOM   5138  H H    A VAL A 1 339 ? -42.214 10.297  28.829  0.49 13.03 ? 328  VAL A H    1 
ATOM   5139  H H    B VAL A 1 339 ? -42.206 10.311  28.831  0.51 13.03 ? 328  VAL A H    1 
ATOM   5140  H HA   . VAL A 1 339 ? -44.636 10.462  27.628  1.00 13.07 ? 328  VAL A HA   1 
ATOM   5141  H HB   . VAL A 1 339 ? -44.679 8.193   27.267  1.00 14.19 ? 328  VAL A HB   1 
ATOM   5142  H HG11 . VAL A 1 339 ? -43.171 7.994   25.509  1.00 15.51 ? 328  VAL A HG11 1 
ATOM   5143  H HG12 . VAL A 1 339 ? -43.920 9.395   25.471  1.00 15.51 ? 328  VAL A HG12 1 
ATOM   5144  H HG13 . VAL A 1 339 ? -42.428 9.306   26.011  1.00 15.51 ? 328  VAL A HG13 1 
ATOM   5145  H HG21 . VAL A 1 339 ? -42.859 6.810   27.592  1.00 14.26 ? 328  VAL A HG21 1 
ATOM   5146  H HG22 . VAL A 1 339 ? -42.074 8.013   28.271  1.00 14.26 ? 328  VAL A HG22 1 
ATOM   5147  H HG23 . VAL A 1 339 ? -43.371 7.416   28.968  1.00 14.26 ? 328  VAL A HG23 1 
ATOM   5148  N N    . THR A 1 340 ? -45.899 9.399   29.527  1.00 10.61 ? 329  THR A N    1 
ATOM   5149  C CA   . THR A 1 340 ? -46.572 9.135   30.781  1.00 10.67 ? 329  THR A CA   1 
ATOM   5150  C C    . THR A 1 340 ? -47.423 7.873   30.628  1.00 10.07 ? 329  THR A C    1 
ATOM   5151  O O    . THR A 1 340 ? -48.121 7.668   29.623  1.00 10.95 ? 329  THR A O    1 
ATOM   5152  C CB   . THR A 1 340 ? -47.441 10.342  31.243  1.00 11.58 ? 329  THR A CB   1 
ATOM   5153  O OG1  . THR A 1 340 ? -48.452 10.603  30.265  1.00 11.59 ? 329  THR A OG1  1 
ATOM   5154  C CG2  . THR A 1 340 ? -46.563 11.545  31.491  1.00 11.72 ? 329  THR A CG2  1 
ATOM   5155  H H    . THR A 1 340 ? -46.410 9.366   28.836  1.00 12.74 ? 329  THR A H    1 
ATOM   5156  H HA   . THR A 1 340 ? -45.906 8.966   31.466  1.00 12.80 ? 329  THR A HA   1 
ATOM   5157  H HB   . THR A 1 340 ? -47.871 10.113  32.082  1.00 13.89 ? 329  THR A HB   1 
ATOM   5158  H HG1  . THR A 1 340 ? -48.925 11.254  30.508  1.00 13.91 ? 329  THR A HG1  1 
ATOM   5159  H HG21 . THR A 1 340 ? -47.104 12.297  31.779  1.00 14.06 ? 329  THR A HG21 1 
ATOM   5160  H HG22 . THR A 1 340 ? -45.911 11.344  32.181  1.00 14.06 ? 329  THR A HG22 1 
ATOM   5161  H HG23 . THR A 1 340 ? -46.095 11.787  30.677  1.00 14.06 ? 329  THR A HG23 1 
ATOM   5162  N N    . GLY A 1 341 ? -47.401 7.067   31.665  1.00 10.68 ? 330  GLY A N    1 
ATOM   5163  C CA   . GLY A 1 341 ? -48.253 5.892   31.768  1.00 11.04 ? 330  GLY A CA   1 
ATOM   5164  C C    . GLY A 1 341 ? -48.883 5.824   33.139  1.00 9.99  ? 330  GLY A C    1 
ATOM   5165  O O    . GLY A 1 341 ? -48.734 6.738   33.953  1.00 10.92 ? 330  GLY A O    1 
ATOM   5166  H H    . GLY A 1 341 ? -46.888 7.179   32.346  1.00 12.81 ? 330  GLY A H    1 
ATOM   5167  H HA2  . GLY A 1 341 ? -48.955 5.933   31.101  1.00 13.25 ? 330  GLY A HA2  1 
ATOM   5168  H HA3  . GLY A 1 341 ? -47.728 5.089   31.623  1.00 13.25 ? 330  GLY A HA3  1 
ATOM   5169  N N    . SER A 1 342 ? -49.605 4.738   33.392  1.00 10.34 ? 331  SER A N    1 
ATOM   5170  C CA   . SER A 1 342 ? -50.152 4.493   34.725  1.00 12.08 ? 331  SER A CA   1 
ATOM   5171  C C    . SER A 1 342 ? -49.547 3.316   35.440  1.00 11.27 ? 331  SER A C    1 
ATOM   5172  O O    . SER A 1 342 ? -49.602 3.256   36.679  1.00 11.96 ? 331  SER A O    1 
ATOM   5173  C CB   . SER A 1 342 ? -51.666 4.262   34.663  1.00 11.69 ? 331  SER A CB   1 
ATOM   5174  O OG   . SER A 1 342 ? -51.949 3.122   33.875  1.00 11.80 ? 331  SER A OG   1 
ATOM   5175  H H    . SER A 1 342 ? -49.792 4.129   32.814  1.00 12.41 ? 331  SER A H    1 
ATOM   5176  H HA   . SER A 1 342 ? -49.997 5.279   35.271  1.00 14.49 ? 331  SER A HA   1 
ATOM   5177  H HB2  . SER A 1 342 ? -52.003 4.121   35.562  1.00 14.02 ? 331  SER A HB2  1 
ATOM   5178  H HB3  . SER A 1 342 ? -52.090 5.038   34.265  1.00 14.02 ? 331  SER A HB3  1 
ATOM   5179  H HG   . SER A 1 342 ? -51.658 3.232   33.095  1.00 14.16 ? 331  SER A HG   1 
ATOM   5180  N N    . ALA A 1 343 ? -49.017 2.353   34.708  1.00 10.72 ? 332  ALA A N    1 
ATOM   5181  C CA   . ALA A 1 343 ? -48.715 1.043   35.264  1.00 11.28 ? 332  ALA A CA   1 
ATOM   5182  C C    . ALA A 1 343 ? -49.903 0.492   36.048  1.00 12.20 ? 332  ALA A C    1 
ATOM   5183  O O    . ALA A 1 343 ? -49.753 -0.152  37.093  1.00 13.78 ? 332  ALA A O    1 
ATOM   5184  C CB   . ALA A 1 343 ? -47.435 1.048   36.093  1.00 11.54 ? 332  ALA A CB   1 
ATOM   5185  H H    . ALA A 1 343 ? -48.819 2.432   33.874  1.00 12.87 ? 332  ALA A H    1 
ATOM   5186  H HA   . ALA A 1 343 ? -48.564 0.436   34.523  1.00 13.54 ? 332  ALA A HA   1 
ATOM   5187  H HB1  . ALA A 1 343 ? -47.281 0.155   36.440  1.00 13.85 ? 332  ALA A HB1  1 
ATOM   5188  H HB2  . ALA A 1 343 ? -46.694 1.317   35.528  1.00 13.85 ? 332  ALA A HB2  1 
ATOM   5189  H HB3  . ALA A 1 343 ? -47.537 1.675   36.827  1.00 13.85 ? 332  ALA A HB3  1 
ATOM   5190  N N    . HIS A 1 344 ? -51.107 0.735   35.538  1.00 11.37 ? 333  HIS A N    1 
ATOM   5191  C CA   . HIS A 1 344 ? -52.331 0.306   36.218  1.00 11.56 ? 333  HIS A CA   1 
ATOM   5192  C C    . HIS A 1 344 ? -52.299 -1.198  36.379  1.00 12.46 ? 333  HIS A C    1 
ATOM   5193  O O    . HIS A 1 344 ? -52.256 -1.933  35.404  1.00 12.42 ? 333  HIS A O    1 
ATOM   5194  C CB   . HIS A 1 344 ? -53.497 0.731   35.367  1.00 12.94 ? 333  HIS A CB   1 
ATOM   5195  C CG   . HIS A 1 344 ? -54.827 0.595   36.023  1.00 11.96 ? 333  HIS A CG   1 
ATOM   5196  N ND1  . HIS A 1 344 ? -55.538 1.677   36.520  1.00 13.06 ? 333  HIS A ND1  1 
ATOM   5197  C CD2  . HIS A 1 344 ? -55.554 -0.516  36.290  1.00 12.16 ? 333  HIS A CD2  1 
ATOM   5198  C CE1  . HIS A 1 344 ? -56.686 1.224   37.009  1.00 13.76 ? 333  HIS A CE1  1 
ATOM   5199  N NE2  . HIS A 1 344 ? -56.721 -0.095  36.878  1.00 13.12 ? 333  HIS A NE2  1 
ATOM   5200  H H    . HIS A 1 344 ? -51.245 1.148   34.797  1.00 13.65 ? 333  HIS A H    1 
ATOM   5201  H HA   . HIS A 1 344 ? -52.398 0.724   37.091  1.00 13.87 ? 333  HIS A HA   1 
ATOM   5202  H HB2  . HIS A 1 344 ? -53.382 1.664   35.128  1.00 15.53 ? 333  HIS A HB2  1 
ATOM   5203  H HB3  . HIS A 1 344 ? -53.509 0.188   34.564  1.00 15.53 ? 333  HIS A HB3  1 
ATOM   5204  H HD2  . HIS A 1 344 ? -55.331 -1.390  36.063  1.00 14.59 ? 333  HIS A HD2  1 
ATOM   5205  H HE1  . HIS A 1 344 ? -57.347 1.745   37.405  1.00 16.51 ? 333  HIS A HE1  1 
ATOM   5206  H HE2  . HIS A 1 344 ? -57.355 -0.608  37.152  1.00 15.74 ? 333  HIS A HE2  1 
ATOM   5207  N N    . CYS A 1 345 ? -52.367 -1.649  37.625  1.00 12.41 ? 334  CYS A N    1 
ATOM   5208  C CA   . CYS A 1 345 ? -52.165 -3.066  37.948  1.00 12.37 ? 334  CYS A CA   1 
ATOM   5209  C C    . CYS A 1 345 ? -52.862 -3.268  39.283  1.00 13.08 ? 334  CYS A C    1 
ATOM   5210  O O    . CYS A 1 345 ? -52.251 -3.200  40.343  1.00 14.73 ? 334  CYS A O    1 
ATOM   5211  C CB   . CYS A 1 345 ? -50.663 -3.373  38.041  1.00 14.41 ? 334  CYS A CB   1 
ATOM   5212  S SG   . CYS A 1 345 ? -50.292 -5.099  38.218  1.00 20.37 ? 334  CYS A SG   1 
ATOM   5213  H H    . CYS A 1 345 ? -52.529 -1.155  38.311  1.00 14.89 ? 334  CYS A H    1 
ATOM   5214  H HA   . CYS A 1 345 ? -52.575 -3.633  37.276  1.00 14.84 ? 334  CYS A HA   1 
ATOM   5215  H HB2  . CYS A 1 345 ? -50.230 -3.058  37.232  1.00 17.29 ? 334  CYS A HB2  1 
ATOM   5216  H HB3  . CYS A 1 345 ? -50.296 -2.910  38.811  1.00 17.29 ? 334  CYS A HB3  1 
ATOM   5217  H HG   . CYS A 1 345 ? -49.102 -5.239  38.281  1.00 24.45 ? 334  CYS A HG   1 
ATOM   5218  N N    . THR A 1 346 ? -54.158 -3.499  39.268  1.00 14.14 ? 335  THR A N    1 
ATOM   5219  C CA   . THR A 1 346 ? -54.928 -3.319  40.486  1.00 15.08 ? 335  THR A CA   1 
ATOM   5220  C C    . THR A 1 346 ? -55.346 -4.634  41.145  1.00 16.37 ? 335  THR A C    1 
ATOM   5221  O O    . THR A 1 346 ? -55.684 -5.628  40.481  1.00 16.80 ? 335  THR A O    1 
ATOM   5222  C CB   . THR A 1 346 ? -56.169 -2.464  40.232  1.00 15.92 ? 335  THR A CB   1 
ATOM   5223  O OG1  . THR A 1 346 ? -56.857 -3.035  39.103  1.00 16.55 ? 335  THR A OG1  1 
ATOM   5224  C CG2  . THR A 1 346 ? -55.787 -1.005  39.968  1.00 16.34 ? 335  THR A CG2  1 
ATOM   5225  H H    . THR A 1 346 ? -54.611 -3.755  38.583  1.00 16.97 ? 335  THR A H    1 
ATOM   5226  H HA   . THR A 1 346 ? -54.376 -2.842  41.124  1.00 18.10 ? 335  THR A HA   1 
ATOM   5227  H HB   . THR A 1 346 ? -56.747 -2.494  41.011  1.00 19.10 ? 335  THR A HB   1 
ATOM   5228  H HG1  . THR A 1 346 ? -57.549 -2.589  38.932  1.00 19.87 ? 335  THR A HG1  1 
ATOM   5229  H HG21 . THR A 1 346 ? -56.585 -0.477  39.809  1.00 19.60 ? 335  THR A HG21 1 
ATOM   5230  H HG22 . THR A 1 346 ? -55.316 -0.642  40.734  1.00 19.60 ? 335  THR A HG22 1 
ATOM   5231  H HG23 . THR A 1 346 ? -55.212 -0.950  39.189  1.00 19.60 ? 335  THR A HG23 1 
ATOM   5232  N N    . PHE A 1 347 ? -55.334 -4.609  42.469  1.00 16.31 ? 336  PHE A N    1 
ATOM   5233  C CA   . PHE A 1 347 ? -55.764 -5.738  43.272  1.00 17.03 ? 336  PHE A CA   1 
ATOM   5234  C C    . PHE A 1 347 ? -56.615 -5.164  44.392  1.00 16.40 ? 336  PHE A C    1 
ATOM   5235  O O    . PHE A 1 347 ? -56.268 -4.131  44.962  1.00 17.69 ? 336  PHE A O    1 
ATOM   5236  C CB   . PHE A 1 347 ? -54.569 -6.546  43.812  1.00 17.18 ? 336  PHE A CB   1 
ATOM   5237  C CG   . PHE A 1 347 ? -53.795 -7.229  42.733  1.00 17.80 ? 336  PHE A CG   1 
ATOM   5238  C CD1  . PHE A 1 347 ? -52.761 -6.578  42.071  1.00 19.81 ? 336  PHE A CD1  1 
ATOM   5239  C CD2  . PHE A 1 347 ? -54.175 -8.488  42.314  1.00 18.64 ? 336  PHE A CD2  1 
ATOM   5240  C CE1  . PHE A 1 347 ? -52.120 -7.211  41.033  1.00 22.51 ? 336  PHE A CE1  1 
ATOM   5241  C CE2  . PHE A 1 347 ? -53.548 -9.116  41.290  1.00 22.38 ? 336  PHE A CE2  1 
ATOM   5242  C CZ   . PHE A 1 347 ? -52.513 -8.474  40.640  1.00 22.43 ? 336  PHE A CZ   1 
ATOM   5243  H H    . PHE A 1 347 ? -55.075 -3.934  42.934  1.00 19.57 ? 336  PHE A H    1 
ATOM   5244  H HA   . PHE A 1 347 ? -56.317 -6.327  42.735  1.00 20.43 ? 336  PHE A HA   1 
ATOM   5245  H HB2  . PHE A 1 347 ? -53.967 -5.945  44.278  1.00 20.61 ? 336  PHE A HB2  1 
ATOM   5246  H HB3  . PHE A 1 347 ? -54.897 -7.225  44.422  1.00 20.61 ? 336  PHE A HB3  1 
ATOM   5247  H HD1  . PHE A 1 347 ? -52.507 -5.720  42.326  1.00 23.77 ? 336  PHE A HD1  1 
ATOM   5248  H HD2  . PHE A 1 347 ? -54.883 -8.914  42.741  1.00 22.36 ? 336  PHE A HD2  1 
ATOM   5249  H HE1  . PHE A 1 347 ? -51.416 -6.788  40.596  1.00 27.01 ? 336  PHE A HE1  1 
ATOM   5250  H HE2  . PHE A 1 347 ? -53.807 -9.971  41.032  1.00 26.86 ? 336  PHE A HE2  1 
ATOM   5251  H HZ   . PHE A 1 347 ? -52.062 -8.905  39.951  1.00 26.91 ? 336  PHE A HZ   1 
ATOM   5252  N N    . ASN A 1 348 ? -57.749 -5.822  44.668  1.00 17.24 ? 337  ASN A N    1 
ATOM   5253  C CA   . ASN A 1 348 ? -58.669 -5.328  45.678  1.00 18.90 ? 337  ASN A CA   1 
ATOM   5254  C C    . ASN A 1 348 ? -58.130 -5.642  47.069  1.00 17.78 ? 337  ASN A C    1 
ATOM   5255  O O    . ASN A 1 348 ? -57.055 -6.232  47.236  1.00 17.99 ? 337  ASN A O    1 
ATOM   5256  C CB   . ASN A 1 348 ? -60.097 -5.842  45.441  1.00 19.60 ? 337  ASN A CB   1 
ATOM   5257  C CG   . ASN A 1 348 ? -60.228 -7.319  45.634  1.00 20.73 ? 337  ASN A CG   1 
ATOM   5258  O OD1  . ASN A 1 348 ? -59.524 -7.913  46.419  1.00 21.05 ? 337  ASN A OD1  1 
ATOM   5259  N ND2  . ASN A 1 348 ? -61.106 -7.921  44.881  1.00 28.19 ? 337  ASN A ND2  1 
ATOM   5260  H H    . ASN A 1 348 ? -57.999 -6.550  44.284  1.00 20.69 ? 337  ASN A H    1 
ATOM   5261  H HA   . ASN A 1 348 ? -58.703 -4.362  45.602  1.00 22.68 ? 337  ASN A HA   1 
ATOM   5262  H HB2  . ASN A 1 348 ? -60.697 -5.404  46.064  1.00 23.52 ? 337  ASN A HB2  1 
ATOM   5263  H HB3  . ASN A 1 348 ? -60.359 -5.636  44.529  1.00 23.52 ? 337  ASN A HB3  1 
ATOM   5264  H HD21 . ASN A 1 348 ? -61.222 -8.771  44.951  1.00 33.83 ? 337  ASN A HD21 1 
ATOM   5265  H HD22 . ASN A 1 348 ? -61.568 -7.469  44.314  1.00 33.83 ? 337  ASN A HD22 1 
ATOM   5266  N N    . THR A 1 349 ? -58.831 -5.135  48.093  1.00 19.39 ? 338  THR A N    1 
ATOM   5267  C CA   . THR A 1 349 ? -58.287 -5.260  49.445  1.00 20.00 ? 338  THR A CA   1 
ATOM   5268  C C    . THR A 1 349 ? -58.130 -6.715  49.860  1.00 19.60 ? 338  THR A C    1 
ATOM   5269  O O    . THR A 1 349 ? -57.128 -7.085  50.487  1.00 20.22 ? 338  THR A O    1 
ATOM   5270  C CB   . THR A 1 349 ? -59.124 -4.454  50.431  1.00 24.27 ? 338  THR A CB   1 
ATOM   5271  O OG1  . THR A 1 349 ? -58.998 -3.070  50.098  1.00 22.39 ? 338  THR A OG1  1 
ATOM   5272  C CG2  . THR A 1 349 ? -58.640 -4.661  51.863  1.00 25.33 ? 338  THR A CG2  1 
ATOM   5273  H H    . THR A 1 349 ? -59.589 -4.734  48.034  1.00 23.26 ? 338  THR A H    1 
ATOM   5274  H HA   . THR A 1 349 ? -57.398 -4.870  49.445  1.00 24.00 ? 338  THR A HA   1 
ATOM   5275  H HB   . THR A 1 349 ? -60.054 -4.723  50.372  1.00 29.13 ? 338  THR A HB   1 
ATOM   5276  H HG1  . THR A 1 349 ? -59.452 -2.604  50.629  1.00 26.87 ? 338  THR A HG1  1 
ATOM   5277  H HG21 . THR A 1 349 ? -58.704 -5.599  52.102  1.00 30.40 ? 338  THR A HG21 1 
ATOM   5278  H HG22 . THR A 1 349 ? -57.715 -4.378  51.944  1.00 30.40 ? 338  THR A HG22 1 
ATOM   5279  H HG23 . THR A 1 349 ? -59.184 -4.141  52.475  1.00 30.40 ? 338  THR A HG23 1 
ATOM   5280  N N    . ALA A 1 350 ? -59.096 -7.568  49.510  1.00 21.09 ? 339  ALA A N    1 
ATOM   5281  C CA   . ALA A 1 350 ? -58.960 -8.976  49.894  1.00 21.50 ? 339  ALA A CA   1 
ATOM   5282  C C    . ALA A 1 350 ? -57.761 -9.633  49.210  1.00 20.96 ? 339  ALA A C    1 
ATOM   5283  O O    . ALA A 1 350 ? -57.082 -10.475 49.812  1.00 22.95 ? 339  ALA A O    1 
ATOM   5284  C CB   . ALA A 1 350 ? -60.234 -9.741  49.550  1.00 23.54 ? 339  ALA A CB   1 
ATOM   5285  H H    . ALA A 1 350 ? -59.808 -7.370  49.071  1.00 25.31 ? 339  ALA A H    1 
ATOM   5286  H HA   . ALA A 1 350 ? -58.827 -9.031  50.853  1.00 25.80 ? 339  ALA A HA   1 
ATOM   5287  H HB1  . ALA A 1 350 ? -60.125 -10.669 49.811  1.00 28.25 ? 339  ALA A HB1  1 
ATOM   5288  H HB2  . ALA A 1 350 ? -60.978 -9.347  50.032  1.00 28.25 ? 339  ALA A HB2  1 
ATOM   5289  H HB3  . ALA A 1 350 ? -60.389 -9.682  48.595  1.00 28.25 ? 339  ALA A HB3  1 
ATOM   5290  N N    . GLN A 1 351 ? -57.440 -9.212  47.986  1.00 19.28 ? 340  GLN A N    1 
ATOM   5291  C CA   . GLN A 1 351 ? -56.260 -9.734  47.307  1.00 19.07 ? 340  GLN A CA   1 
ATOM   5292  C C    . GLN A 1 351 ? -54.991 -9.173  47.931  1.00 19.37 ? 340  GLN A C    1 
ATOM   5293  O O    . GLN A 1 351 ? -54.060 -9.922  48.227  1.00 20.20 ? 340  GLN A O    1 
ATOM   5294  C CB   . GLN A 1 351 ? -56.337 -9.355  45.835  1.00 19.44 ? 340  GLN A CB   1 
ATOM   5295  C CG   . GLN A 1 351 ? -57.490 -10.038 45.095  1.00 19.59 ? 340  GLN A CG   1 
ATOM   5296  C CD   . GLN A 1 351 ? -57.602 -9.555  43.657  1.00 20.22 ? 340  GLN A CD   1 
ATOM   5297  O OE1  . GLN A 1 351 ? -57.741 -8.339  43.392  1.00 19.96 ? 340  GLN A OE1  1 
ATOM   5298  N NE2  . GLN A 1 351 ? -57.521 -10.487 42.703  1.00 22.88 ? 340  GLN A NE2  1 
ATOM   5299  H H    . GLN A 1 351 ? -57.885 -8.631  47.534  1.00 23.13 ? 340  GLN A H    1 
ATOM   5300  H HA   . GLN A 1 351 ? -56.242 -10.701 47.379  1.00 22.88 ? 340  GLN A HA   1 
ATOM   5301  H HB2  . GLN A 1 351 ? -56.463 -8.396  45.764  1.00 23.33 ? 340  GLN A HB2  1 
ATOM   5302  H HB3  . GLN A 1 351 ? -55.509 -9.613  45.400  1.00 23.33 ? 340  GLN A HB3  1 
ATOM   5303  H HG2  . GLN A 1 351 ? -57.338 -10.996 45.082  1.00 23.51 ? 340  GLN A HG2  1 
ATOM   5304  H HG3  . GLN A 1 351 ? -58.324 -9.837  45.548  1.00 23.51 ? 340  GLN A HG3  1 
ATOM   5305  H HE21 . GLN A 1 351 ? -57.410 -11.313 42.917  1.00 27.46 ? 340  GLN A HE21 1 
ATOM   5306  H HE22 . GLN A 1 351 ? -57.578 -10.261 41.875  1.00 27.46 ? 340  GLN A HE22 1 
ATOM   5307  N N    . LYS A 1 352 ? -54.962 -7.866  48.179  1.00 17.95 ? 341  LYS A N    1 
ATOM   5308  C CA   . LYS A 1 352 ? -53.828 -7.268  48.875  1.00 17.10 ? 341  LYS A CA   1 
ATOM   5309  C C    . LYS A 1 352 ? -53.563 -7.982  50.202  1.00 16.83 ? 341  LYS A C    1 
ATOM   5310  O O    . LYS A 1 352 ? -52.406 -8.257  50.568  1.00 18.99 ? 341  LYS A O    1 
ATOM   5311  C CB   . LYS A 1 352 ? -54.085 -5.775  49.105  1.00 18.07 ? 341  LYS A CB   1 
ATOM   5312  C CG   . LYS A 1 352 ? -54.028 -4.866  47.869  1.00 16.67 ? 341  LYS A CG   1 
ATOM   5313  C CD   . LYS A 1 352 ? -52.620 -4.673  47.329  1.00 16.03 ? 341  LYS A CD   1 
ATOM   5314  C CE   . LYS A 1 352 ? -52.588 -3.655  46.168  1.00 15.61 ? 341  LYS A CE   1 
ATOM   5315  N NZ   . LYS A 1 352 ? -51.195 -3.330  45.827  1.00 15.09 ? 341  LYS A NZ   1 
ATOM   5316  H H    . LYS A 1 352 ? -55.579 -7.310  47.958  1.00 21.54 ? 341  LYS A H    1 
ATOM   5317  H HA   . LYS A 1 352 ? -53.036 -7.355  48.324  1.00 20.52 ? 341  LYS A HA   1 
ATOM   5318  H HB2  . LYS A 1 352 ? -54.969 -5.676  49.492  1.00 21.69 ? 341  LYS A HB2  1 
ATOM   5319  H HB3  . LYS A 1 352 ? -53.422 -5.447  49.732  1.00 21.69 ? 341  LYS A HB3  1 
ATOM   5320  H HG2  . LYS A 1 352 ? -54.566 -5.259  47.164  1.00 20.01 ? 341  LYS A HG2  1 
ATOM   5321  H HG3  . LYS A 1 352 ? -54.380 -3.993  48.104  1.00 20.01 ? 341  LYS A HG3  1 
ATOM   5322  H HD2  . LYS A 1 352 ? -52.049 -4.341  48.040  1.00 19.23 ? 341  LYS A HD2  1 
ATOM   5323  H HD3  . LYS A 1 352 ? -52.286 -5.521  46.999  1.00 19.23 ? 341  LYS A HD3  1 
ATOM   5324  H HE2  . LYS A 1 352 ? -53.016 -4.039  45.387  1.00 18.73 ? 341  LYS A HE2  1 
ATOM   5325  H HE3  . LYS A 1 352 ? -53.038 -2.839  46.438  1.00 18.73 ? 341  LYS A HE3  1 
ATOM   5326  H HZ1  . LYS A 1 352 ? -51.175 -2.744  45.158  1.00 18.11 ? 341  LYS A HZ1  1 
ATOM   5327  H HZ2  . LYS A 1 352 ? -50.783 -2.978  46.533  1.00 18.11 ? 341  LYS A HZ2  1 
ATOM   5328  H HZ3  . LYS A 1 352 ? -50.763 -4.068  45.578  1.00 18.11 ? 341  LYS A HZ3  1 
ATOM   5329  N N    . ALA A 1 353 ? -54.637 -8.358  50.921  1.00 20.42 ? 342  ALA A N    1 
ATOM   5330  C CA   . ALA A 1 353 ? -54.548 -8.916  52.274  1.00 21.59 ? 342  ALA A CA   1 
ATOM   5331  C C    . ALA A 1 353 ? -53.911 -10.298 52.344  1.00 21.88 ? 342  ALA A C    1 
ATOM   5332  O O    . ALA A 1 353 ? -53.610 -10.766 53.447  1.00 23.31 ? 342  ALA A O    1 
ATOM   5333  C CB   . ALA A 1 353 ? -55.938 -8.987  52.862  1.00 23.38 ? 342  ALA A CB   1 
ATOM   5334  H H    . ALA A 1 353 ? -55.446 -8.295  50.634  1.00 24.50 ? 342  ALA A H    1 
ATOM   5335  H HA   . ALA A 1 353 ? -54.021 -8.318  52.826  1.00 25.91 ? 342  ALA A HA   1 
ATOM   5336  H HB1  . ALA A 1 353 ? -55.883 -9.356  53.757  1.00 28.06 ? 342  ALA A HB1  1 
ATOM   5337  H HB2  . ALA A 1 353 ? -56.312 -8.092  52.894  1.00 28.06 ? 342  ALA A HB2  1 
ATOM   5338  H HB3  . ALA A 1 353 ? -56.488 -9.556  52.302  1.00 28.06 ? 342  ALA A HB3  1 
ATOM   5339  N N    . VAL A 1 354 ? -53.649 -10.936 51.205  1.00 21.84 ? 343  VAL A N    1 
ATOM   5340  C CA   . VAL A 1 354 ? -52.772 -12.107 51.178  1.00 24.99 ? 343  VAL A CA   1 
ATOM   5341  C C    . VAL A 1 354 ? -51.449 -11.797 51.862  1.00 23.79 ? 343  VAL A C    1 
ATOM   5342  O O    . VAL A 1 354 ? -50.832 -12.685 52.469  1.00 28.01 ? 343  VAL A O    1 
ATOM   5343  C CB   . VAL A 1 354 ? -52.586 -12.584 49.719  1.00 28.24 ? 343  VAL A CB   1 
ATOM   5344  C CG1  . VAL A 1 354 ? -51.515 -13.657 49.602  1.00 36.20 ? 343  VAL A CG1  1 
ATOM   5345  C CG2  . VAL A 1 354 ? -53.906 -13.111 49.209  1.00 27.34 ? 343  VAL A CG2  1 
ATOM   5346  H H    . VAL A 1 354 ? -53.965 -10.712 50.436  1.00 26.21 ? 343  VAL A H    1 
ATOM   5347  H HA   . VAL A 1 354 ? -53.197 -12.826 51.671  1.00 29.99 ? 343  VAL A HA   1 
ATOM   5348  H HB   . VAL A 1 354 ? -52.325 -11.831 49.166  1.00 33.89 ? 343  VAL A HB   1 
ATOM   5349  H HG11 . VAL A 1 354 ? -51.435 -13.923 48.673  1.00 43.43 ? 343  VAL A HG11 1 
ATOM   5350  H HG12 . VAL A 1 354 ? -50.672 -13.296 49.917  1.00 43.43 ? 343  VAL A HG12 1 
ATOM   5351  H HG13 . VAL A 1 354 ? -51.773 -14.419 50.144  1.00 43.43 ? 343  VAL A HG13 1 
ATOM   5352  H HG21 . VAL A 1 354 ? -53.793 -13.411 48.293  1.00 32.81 ? 343  VAL A HG21 1 
ATOM   5353  H HG22 . VAL A 1 354 ? -54.186 -13.852 49.768  1.00 32.81 ? 343  VAL A HG22 1 
ATOM   5354  H HG23 . VAL A 1 354 ? -54.565 -12.400 49.246  1.00 32.81 ? 343  VAL A HG23 1 
ATOM   5355  N N    . GLY A 1 355 ? -51.002 -10.538 51.799  1.00 21.15 ? 344  GLY A N    1 
ATOM   5356  C CA   . GLY A 1 355 ? -49.777 -10.096 52.447  1.00 20.54 ? 344  GLY A CA   1 
ATOM   5357  C C    . GLY A 1 355 ? -49.960 -9.403  53.788  1.00 20.71 ? 344  GLY A C    1 
ATOM   5358  O O    . GLY A 1 355 ? -49.060 -8.683  54.235  1.00 22.38 ? 344  GLY A O    1 
ATOM   5359  H H    . GLY A 1 355 ? -51.407 -9.910  51.374  1.00 25.38 ? 344  GLY A H    1 
ATOM   5360  H HA2  . GLY A 1 355 ? -49.202 -10.864 52.586  1.00 24.65 ? 344  GLY A HA2  1 
ATOM   5361  H HA3  . GLY A 1 355 ? -49.316 -9.480  51.856  1.00 24.65 ? 344  GLY A HA3  1 
ATOM   5362  N N    . LYS A 1 356 ? -51.078 -9.645  54.476  1.00 22.50 ? 345  LYS A N    1 
ATOM   5363  C CA   . LYS A 1 356 ? -51.330 -8.906  55.702  1.00 24.40 ? 345  LYS A CA   1 
ATOM   5364  C C    . LYS A 1 356 ? -50.265 -9.150  56.753  1.00 25.59 ? 345  LYS A C    1 
ATOM   5365  O O    . LYS A 1 356 ? -50.041 -8.284  57.603  1.00 28.70 ? 345  LYS A O    1 
ATOM   5366  C CB   . LYS A 1 356 ? -52.697 -9.248  56.287  1.00 28.00 ? 345  LYS A CB   1 
ATOM   5367  C CG   . LYS A 1 356 ? -52.847 -10.656 56.776  1.00 35.46 ? 345  LYS A CG   1 
ATOM   5368  C CD   . LYS A 1 356 ? -54.278 -10.896 57.267  1.00 44.56 ? 345  LYS A CD   1 
ATOM   5369  C CE   . LYS A 1 356 ? -54.371 -12.181 58.089  1.00 54.19 ? 345  LYS A CE   1 
ATOM   5370  N NZ   . LYS A 1 356 ? -53.901 -13.347 57.289  1.00 60.95 ? 345  LYS A NZ   1 
ATOM   5371  H H    . LYS A 1 356 ? -51.685 -10.215 54.259  1.00 27.00 ? 345  LYS A H    1 
ATOM   5372  H HA   . LYS A 1 356 ? -51.328 -7.958  55.497  1.00 29.28 ? 345  LYS A HA   1 
ATOM   5373  H HB2  . LYS A 1 356 ? -52.867 -8.659  57.038  1.00 33.60 ? 345  LYS A HB2  1 
ATOM   5374  H HB3  . LYS A 1 356 ? -53.369 -9.104  55.603  1.00 33.60 ? 345  LYS A HB3  1 
ATOM   5375  H HG2  . LYS A 1 356 ? -52.663 -11.273 56.050  1.00 42.55 ? 345  LYS A HG2  1 
ATOM   5376  H HG3  . LYS A 1 356 ? -52.238 -10.809 57.515  1.00 42.55 ? 345  LYS A HG3  1 
ATOM   5377  H HD2  . LYS A 1 356 ? -54.554 -10.155 57.828  1.00 53.48 ? 345  LYS A HD2  1 
ATOM   5378  H HD3  . LYS A 1 356 ? -54.870 -10.979 56.504  1.00 53.48 ? 345  LYS A HD3  1 
ATOM   5379  H HE2  . LYS A 1 356 ? -53.809 -12.103 58.876  1.00 65.03 ? 345  LYS A HE2  1 
ATOM   5380  H HE3  . LYS A 1 356 ? -55.294 -12.336 58.345  1.00 65.03 ? 345  LYS A HE3  1 
ATOM   5381  H HZ1  . LYS A 1 356 ? -53.958 -14.091 57.773  1.00 73.13 ? 345  LYS A HZ1  1 
ATOM   5382  H HZ2  . LYS A 1 356 ? -54.404 -13.438 56.560  1.00 73.13 ? 345  LYS A HZ2  1 
ATOM   5383  H HZ3  . LYS A 1 356 ? -53.054 -13.226 57.043  1.00 73.13 ? 345  LYS A HZ3  1 
ATOM   5384  N N    . ASP A 1 357 ? -49.611 -10.307 56.723  1.00 26.26 ? 346  ASP A N    1 
ATOM   5385  C CA   . ASP A 1 357 ? -48.591 -10.646 57.708  1.00 26.56 ? 346  ASP A CA   1 
ATOM   5386  C C    . ASP A 1 357 ? -47.182 -10.628 57.141  1.00 23.82 ? 346  ASP A C    1 
ATOM   5387  O O    . ASP A 1 357 ? -46.234 -10.966 57.859  1.00 25.07 ? 346  ASP A O    1 
ATOM   5388  C CB   . ASP A 1 357 ? -48.879 -12.019 58.317  1.00 29.42 ? 346  ASP A CB   1 
ATOM   5389  C CG   . ASP A 1 357 ? -50.162 -12.037 59.074  1.00 30.45 ? 346  ASP A CG   1 
ATOM   5390  O OD1  . ASP A 1 357 ? -50.392 -11.085 59.840  1.00 35.03 ? 346  ASP A OD1  1 
ATOM   5391  O OD2  . ASP A 1 357 ? -50.940 -12.989 58.893  1.00 38.95 ? 346  ASP A OD2  1 
ATOM   5392  H H    . ASP A 1 357 ? -49.742 -10.920 56.134  1.00 31.51 ? 346  ASP A H    1 
ATOM   5393  H HA   . ASP A 1 357 ? -48.626 -9.994  58.425  1.00 31.87 ? 346  ASP A HA   1 
ATOM   5394  H HB2  . ASP A 1 357 ? -48.938 -12.676 57.606  1.00 35.30 ? 346  ASP A HB2  1 
ATOM   5395  H HB3  . ASP A 1 357 ? -48.164 -12.252 58.929  1.00 35.30 ? 346  ASP A HB3  1 
ATOM   5396  N N    . ASN A 1 358 ? -47.033 -10.239 55.879  1.00 22.83 ? 347  ASN A N    1 
ATOM   5397  C CA   . ASN A 1 358 ? -45.729 -10.264 55.237  1.00 22.41 ? 347  ASN A CA   1 
ATOM   5398  C C    . ASN A 1 358 ? -45.832 -9.399  53.993  1.00 19.82 ? 347  ASN A C    1 
ATOM   5399  O O    . ASN A 1 358 ? -46.433 -9.816  53.003  1.00 20.60 ? 347  ASN A O    1 
ATOM   5400  C CB   . ASN A 1 358 ? -45.403 -11.700 54.879  1.00 23.24 ? 347  ASN A CB   1 
ATOM   5401  C CG   . ASN A 1 358 ? -44.049 -11.834 54.195  1.00 22.08 ? 347  ASN A CG   1 
ATOM   5402  O OD1  . ASN A 1 358 ? -43.516 -10.878 53.615  1.00 21.98 ? 347  ASN A OD1  1 
ATOM   5403  N ND2  . ASN A 1 358 ? -43.475 -13.011 54.278  1.00 27.16 ? 347  ASN A ND2  1 
ATOM   5404  H H    . ASN A 1 358 ? -47.670 -9.956  55.375  1.00 27.39 ? 347  ASN A H    1 
ATOM   5405  H HA   . ASN A 1 358 ? -45.047 -9.910  55.829  1.00 26.89 ? 347  ASN A HA   1 
ATOM   5406  H HB2  . ASN A 1 358 ? -45.386 -12.233 55.689  1.00 27.89 ? 347  ASN A HB2  1 
ATOM   5407  H HB3  . ASN A 1 358 ? -46.082 -12.037 54.273  1.00 27.89 ? 347  ASN A HB3  1 
ATOM   5408  H HD21 . ASN A 1 358 ? -43.866 -13.650 54.701  1.00 32.59 ? 347  ASN A HD21 1 
ATOM   5409  H HD22 . ASN A 1 358 ? -42.710 -13.144 53.910  1.00 32.59 ? 347  ASN A HD22 1 
ATOM   5410  N N    . PHE A 1 359 ? -45.210 -8.219  54.016  1.00 20.15 ? 348  PHE A N    1 
ATOM   5411  C CA   . PHE A 1 359 ? -45.388 -7.283  52.928  1.00 20.33 ? 348  PHE A CA   1 
ATOM   5412  C C    . PHE A 1 359 ? -44.900 -7.842  51.593  1.00 19.51 ? 348  PHE A C    1 
ATOM   5413  O O    . PHE A 1 359 ? -45.354 -7.377  50.543  1.00 19.01 ? 348  PHE A O    1 
ATOM   5414  C CB   . PHE A 1 359 ? -44.676 -5.951  53.253  1.00 18.64 ? 348  PHE A CB   1 
ATOM   5415  C CG   . PHE A 1 359 ? -43.176 -6.059  53.365  1.00 19.72 ? 348  PHE A CG   1 
ATOM   5416  C CD1  . PHE A 1 359 ? -42.359 -6.029  52.244  1.00 18.33 ? 348  PHE A CD1  1 
ATOM   5417  C CD2  . PHE A 1 359 ? -42.579 -6.200  54.596  1.00 20.04 ? 348  PHE A CD2  1 
ATOM   5418  C CE1  . PHE A 1 359 ? -41.008 -6.115  52.358  1.00 19.77 ? 348  PHE A CE1  1 
ATOM   5419  C CE2  . PHE A 1 359 ? -41.188 -6.317  54.708  1.00 19.90 ? 348  PHE A CE2  1 
ATOM   5420  C CZ   . PHE A 1 359 ? -40.416 -6.289  53.601  1.00 18.96 ? 348  PHE A CZ   1 
ATOM   5421  H H    . PHE A 1 359 ? -44.689 -7.948  54.644  1.00 24.18 ? 348  PHE A H    1 
ATOM   5422  H HA   . PHE A 1 359 ? -46.335 -7.094  52.837  1.00 24.39 ? 348  PHE A HA   1 
ATOM   5423  H HB2  . PHE A 1 359 ? -44.874 -5.313  52.549  1.00 22.37 ? 348  PHE A HB2  1 
ATOM   5424  H HB3  . PHE A 1 359 ? -45.011 -5.618  54.100  1.00 22.37 ? 348  PHE A HB3  1 
ATOM   5425  H HD1  . PHE A 1 359 ? -42.741 -5.926  51.403  1.00 22.00 ? 348  PHE A HD1  1 
ATOM   5426  H HD2  . PHE A 1 359 ? -43.106 -6.235  55.361  1.00 24.05 ? 348  PHE A HD2  1 
ATOM   5427  H HE1  . PHE A 1 359 ? -40.479 -6.101  51.594  1.00 23.72 ? 348  PHE A HE1  1 
ATOM   5428  H HE2  . PHE A 1 359 ? -40.796 -6.414  55.545  1.00 23.88 ? 348  PHE A HE2  1 
ATOM   5429  H HZ   . PHE A 1 359 ? -39.491 -6.347  53.675  1.00 22.75 ? 348  PHE A HZ   1 
ATOM   5430  N N    . THR A 1 360 ? -43.975 -8.799  51.598  1.00 18.65 ? 349  THR A N    1 
ATOM   5431  C CA   . THR A 1 360 ? -43.505 -9.364  50.323  1.00 19.14 ? 349  THR A CA   1 
ATOM   5432  C C    . THR A 1 360 ? -44.560 -10.203 49.608  1.00 18.72 ? 349  THR A C    1 
ATOM   5433  O O    . THR A 1 360 ? -44.385 -10.508 48.413  1.00 20.66 ? 349  THR A O    1 
ATOM   5434  C CB   . THR A 1 360 ? -42.232 -10.199 50.495  1.00 21.42 ? 349  THR A CB   1 
ATOM   5435  O OG1  . THR A 1 360 ? -42.512 -11.430 51.162  1.00 24.15 ? 349  THR A OG1  1 
ATOM   5436  C CG2  . THR A 1 360 ? -41.120 -9.443  51.279  1.00 23.54 ? 349  THR A CG2  1 
ATOM   5437  H H    . THR A 1 360 ? -43.609 -9.133  52.301  1.00 22.37 ? 349  THR A H    1 
ATOM   5438  H HA   . THR A 1 360 ? -43.283 -8.627  49.733  1.00 22.97 ? 349  THR A HA   1 
ATOM   5439  H HB   . THR A 1 360 ? -41.878 -10.402 49.615  1.00 25.70 ? 349  THR A HB   1 
ATOM   5440  H HG1  . THR A 1 360 ? -42.834 -11.278 51.923  1.00 28.98 ? 349  THR A HG1  1 
ATOM   5441  H HG21 . THR A 1 360 ? -40.334 -10.005 51.365  1.00 28.25 ? 349  THR A HG21 1 
ATOM   5442  H HG22 . THR A 1 360 ? -40.877 -8.630  50.808  1.00 28.25 ? 349  THR A HG22 1 
ATOM   5443  H HG23 . THR A 1 360 ? -41.440 -9.210  52.165  1.00 28.25 ? 349  THR A HG23 1 
ATOM   5444  N N    . LEU A 1 361 ? -45.650 -10.566 50.297  1.00 19.08 ? 350  LEU A N    1 
ATOM   5445  C CA   . LEU A 1 361 ? -46.760 -11.305 49.717  1.00 19.64 ? 350  LEU A CA   1 
ATOM   5446  C C    . LEU A 1 361 ? -47.910 -10.409 49.271  1.00 19.43 ? 350  LEU A C    1 
ATOM   5447  O O    . LEU A 1 361 ? -48.886 -10.905 48.705  1.00 21.46 ? 350  LEU A O    1 
ATOM   5448  C CB   . LEU A 1 361 ? -47.290 -12.348 50.704  1.00 22.72 ? 350  LEU A CB   1 
ATOM   5449  C CG   . LEU A 1 361 ? -46.232 -13.353 51.085  1.00 24.80 ? 350  LEU A CG   1 
ATOM   5450  C CD1  . LEU A 1 361 ? -46.824 -14.279 52.134  1.00 28.51 ? 350  LEU A CD1  1 
ATOM   5451  C CD2  . LEU A 1 361 ? -45.693 -14.111 49.892  1.00 31.64 ? 350  LEU A CD2  1 
ATOM   5452  H H    . LEU A 1 361 ? -45.764 -10.385 51.130  1.00 22.90 ? 350  LEU A H    1 
ATOM   5453  H HA   . LEU A 1 361 ? -46.438 -11.780 48.935  1.00 23.57 ? 350  LEU A HA   1 
ATOM   5454  H HB2  . LEU A 1 361 ? -47.587 -11.900 51.511  1.00 27.26 ? 350  LEU A HB2  1 
ATOM   5455  H HB3  . LEU A 1 361 ? -48.028 -12.826 50.295  1.00 27.26 ? 350  LEU A HB3  1 
ATOM   5456  H HG   . LEU A 1 361 ? -45.489 -12.881 51.494  1.00 29.76 ? 350  LEU A HG   1 
ATOM   5457  H HD11 . LEU A 1 361 ? -46.155 -14.933 52.390  1.00 34.22 ? 350  LEU A HD11 1 
ATOM   5458  H HD12 . LEU A 1 361 ? -47.088 -13.754 52.905  1.00 34.22 ? 350  LEU A HD12 1 
ATOM   5459  H HD13 . LEU A 1 361 ? -47.598 -14.727 51.757  1.00 34.22 ? 350  LEU A HD13 1 
ATOM   5460  H HD21 . LEU A 1 361 ? -45.019 -14.740 50.196  1.00 37.97 ? 350  LEU A HD21 1 
ATOM   5461  H HD22 . LEU A 1 361 ? -46.422 -14.588 49.466  1.00 37.97 ? 350  LEU A HD22 1 
ATOM   5462  H HD23 . LEU A 1 361 ? -45.300 -13.480 49.269  1.00 37.97 ? 350  LEU A HD23 1 
ATOM   5463  N N    . ILE A 1 362 ? -47.826 -9.102  49.484  1.00 19.60 ? 351  ILE A N    1 
ATOM   5464  C CA   . ILE A 1 362 ? -48.865 -8.213  48.982  1.00 18.51 ? 351  ILE A CA   1 
ATOM   5465  C C    . ILE A 1 362 ? -48.753 -8.142  47.459  1.00 17.60 ? 351  ILE A C    1 
ATOM   5466  O O    . ILE A 1 362 ? -47.693 -7.716  46.972  1.00 17.73 ? 351  ILE A O    1 
ATOM   5467  C CB   . ILE A 1 362 ? -48.702 -6.815  49.587  1.00 17.82 ? 351  ILE A CB   1 
ATOM   5468  C CG1  . ILE A 1 362 ? -48.829 -6.832  51.097  1.00 18.87 ? 351  ILE A CG1  1 
ATOM   5469  C CG2  . ILE A 1 362 ? -49.691 -5.831  48.933  1.00 19.02 ? 351  ILE A CG2  1 
ATOM   5470  C CD1  . ILE A 1 362 ? -48.437 -5.525  51.717  1.00 20.13 ? 351  ILE A CD1  1 
ATOM   5471  H H    . ILE A 1 362 ? -47.189 -8.709  49.909  1.00 23.52 ? 351  ILE A H    1 
ATOM   5472  H HA   . ILE A 1 362 ? -49.739 -8.559  49.219  1.00 22.21 ? 351  ILE A HA   1 
ATOM   5473  H HB   . ILE A 1 362 ? -47.806 -6.509  49.375  1.00 21.39 ? 351  ILE A HB   1 
ATOM   5474  H HG12 . ILE A 1 362 ? -49.752 -7.014  51.336  1.00 22.64 ? 351  ILE A HG12 1 
ATOM   5475  H HG13 . ILE A 1 362 ? -48.250 -7.522  51.457  1.00 22.64 ? 351  ILE A HG13 1 
ATOM   5476  H HG21 . ILE A 1 362 ? -49.572 -4.954  49.329  1.00 22.82 ? 351  ILE A HG21 1 
ATOM   5477  H HG22 . ILE A 1 362 ? -49.513 -5.791  47.980  1.00 22.82 ? 351  ILE A HG22 1 
ATOM   5478  H HG23 . ILE A 1 362 ? -50.596 -6.144  49.088  1.00 22.82 ? 351  ILE A HG23 1 
ATOM   5479  H HD11 . ILE A 1 362 ? -48.537 -5.590  52.679  1.00 24.16 ? 351  ILE A HD11 1 
ATOM   5480  H HD12 . ILE A 1 362 ? -47.514 -5.334  51.491  1.00 24.16 ? 351  ILE A HD12 1 
ATOM   5481  H HD13 . ILE A 1 362 ? -49.014 -4.827  51.370  1.00 24.16 ? 351  ILE A HD13 1 
ATOM   5482  N N    . PRO A 1 363 ? -49.794 -8.454  46.676  1.00 16.67 ? 352  PRO A N    1 
ATOM   5483  C CA   . PRO A 1 363 ? -49.688 -8.270  45.221  1.00 17.38 ? 352  PRO A CA   1 
ATOM   5484  C C    . PRO A 1 363 ? -49.450 -6.805  44.889  1.00 16.06 ? 352  PRO A C    1 
ATOM   5485  O O    . PRO A 1 363 ? -50.142 -5.898  45.371  1.00 17.09 ? 352  PRO A O    1 
ATOM   5486  C CB   . PRO A 1 363 ? -51.036 -8.790  44.690  1.00 19.19 ? 352  PRO A CB   1 
ATOM   5487  C CG   . PRO A 1 363 ? -51.969 -8.659  45.840  1.00 18.46 ? 352  PRO A CG   1 
ATOM   5488  C CD   . PRO A 1 363 ? -51.111 -9.017  47.046  1.00 18.64 ? 352  PRO A CD   1 
ATOM   5489  H HA   . PRO A 1 363 ? -48.966 -8.809  44.860  1.00 20.85 ? 352  PRO A HA   1 
ATOM   5490  H HB2  . PRO A 1 363 ? -51.329 -8.241  43.945  1.00 23.03 ? 352  PRO A HB2  1 
ATOM   5491  H HB3  . PRO A 1 363 ? -50.948 -9.717  44.422  1.00 23.03 ? 352  PRO A HB3  1 
ATOM   5492  H HG2  . PRO A 1 363 ? -52.291 -7.747  45.902  1.00 22.16 ? 352  PRO A HG2  1 
ATOM   5493  H HG3  . PRO A 1 363 ? -52.705 -9.283  45.741  1.00 22.16 ? 352  PRO A HG3  1 
ATOM   5494  H HD2  . PRO A 1 363 ? -51.452 -8.589  47.846  1.00 22.37 ? 352  PRO A HD2  1 
ATOM   5495  H HD3  . PRO A 1 363 ? -51.053 -9.980  47.150  1.00 22.37 ? 352  PRO A HD3  1 
ATOM   5496  N N    . GLU A 1 364 ? -48.445 -6.581  44.068  1.00 15.89 ? 353  GLU A N    1 
ATOM   5497  C CA   . GLU A 1 364 ? -47.994 -5.233  43.747  1.00 14.62 ? 353  GLU A CA   1 
ATOM   5498  C C    . GLU A 1 364 ? -48.839 -4.567  42.679  1.00 15.09 ? 353  GLU A C    1 
ATOM   5499  O O    . GLU A 1 364 ? -49.256 -5.191  41.698  1.00 17.76 ? 353  GLU A O    1 
ATOM   5500  C CB   . GLU A 1 364 ? -46.558 -5.303  43.237  1.00 15.52 ? 353  GLU A CB   1 
ATOM   5501  C CG   . GLU A 1 364 ? -45.537 -5.699  44.242  1.00 18.94 ? 353  GLU A CG   1 
ATOM   5502  C CD   . GLU A 1 364 ? -44.141 -5.730  43.602  1.00 27.35 ? 353  GLU A CD   1 
ATOM   5503  O OE1  . GLU A 1 364 ? -44.026 -5.432  42.394  1.00 43.14 ? 353  GLU A OE1  1 
ATOM   5504  O OE2  . GLU A 1 364 ? -43.154 -6.011  44.279  1.00 23.35 ? 353  GLU A OE2  1 
ATOM   5505  H H    . GLU A 1 364 ? -47.996 -7.200  43.675  1.00 19.07 ? 353  GLU A H    1 
ATOM   5506  H HA   . GLU A 1 364 ? -48.014 -4.683  44.546  1.00 17.54 ? 353  GLU A HA   1 
ATOM   5507  H HB2  . GLU A 1 364 ? -46.521 -5.950  42.516  1.00 18.63 ? 353  GLU A HB2  1 
ATOM   5508  H HB3  . GLU A 1 364 ? -46.310 -4.428  42.900  1.00 18.63 ? 353  GLU A HB3  1 
ATOM   5509  H HG2  . GLU A 1 364 ? -45.529 -5.054  44.967  1.00 22.73 ? 353  GLU A HG2  1 
ATOM   5510  H HG3  . GLU A 1 364 ? -45.741 -6.585  44.579  1.00 22.73 ? 353  GLU A HG3  1 
ATOM   5511  N N    . GLY A 1 365 ? -49.084 -3.285  42.871  1.00 13.53 ? 354  GLY A N    1 
ATOM   5512  C CA   . GLY A 1 365 ? -49.657 -2.436  41.851  1.00 14.14 ? 354  GLY A CA   1 
ATOM   5513  C C    . GLY A 1 365 ? -50.674 -1.481  42.420  1.00 13.69 ? 354  GLY A C    1 
ATOM   5514  O O    . GLY A 1 365 ? -51.265 -1.706  43.483  1.00 14.67 ? 354  GLY A O    1 
ATOM   5515  H H    . GLY A 1 365 ? -48.922 -2.873  43.609  1.00 16.23 ? 354  GLY A H    1 
ATOM   5516  H HA2  . GLY A 1 365 ? -48.954 -1.921  41.425  1.00 16.96 ? 354  GLY A HA2  1 
ATOM   5517  H HA3  . GLY A 1 365 ? -50.090 -2.984  41.178  1.00 16.96 ? 354  GLY A HA3  1 
ATOM   5518  N N    . THR A 1 366 ? -50.920 -0.407  41.679  1.00 13.47 ? 355  THR A N    1 
ATOM   5519  C CA   . THR A 1 366 ? -51.883 0.612   42.038  1.00 13.47 ? 355  THR A CA   1 
ATOM   5520  C C    . THR A 1 366 ? -52.741 0.953   40.828  1.00 14.47 ? 355  THR A C    1 
ATOM   5521  O O    . THR A 1 366 ? -52.499 0.506   39.703  1.00 13.50 ? 355  THR A O    1 
ATOM   5522  C CB   . THR A 1 366 ? -51.221 1.924   42.517  1.00 13.70 ? 355  THR A CB   1 
ATOM   5523  O OG1  . THR A 1 366 ? -50.707 2.668   41.405  1.00 13.99 ? 355  THR A OG1  1 
ATOM   5524  C CG2  . THR A 1 366 ? -50.128 1.715   43.498  1.00 14.69 ? 355  THR A CG2  1 
ATOM   5525  H H    . THR A 1 366 ? -50.522 -0.245  40.934  1.00 16.16 ? 355  THR A H    1 
ATOM   5526  H HA   . THR A 1 366 ? -52.460 0.280   42.743  1.00 16.16 ? 355  THR A HA   1 
ATOM   5527  H HB   . THR A 1 366 ? -51.899 2.463   42.955  1.00 16.43 ? 355  THR A HB   1 
ATOM   5528  H HG1  . THR A 1 366 ? -51.331 2.860   40.875  1.00 16.79 ? 355  THR A HG1  1 
ATOM   5529  H HG21 . THR A 1 366 ? -49.429 1.171   43.102  1.00 17.63 ? 355  THR A HG21 1 
ATOM   5530  H HG22 . THR A 1 366 ? -49.752 2.569   43.762  1.00 17.63 ? 355  THR A HG22 1 
ATOM   5531  H HG23 . THR A 1 366 ? -50.471 1.264   44.285  1.00 17.63 ? 355  THR A HG23 1 
ATOM   5532  N N    . ASN A 1 367 ? -53.773 1.777   41.073  1.00 13.25 ? 356  ASN A N    1 
ATOM   5533  C CA   . ASN A 1 367 ? -54.541 2.363   39.983  1.00 12.28 ? 356  ASN A CA   1 
ATOM   5534  C C    . ASN A 1 367 ? -53.794 3.532   39.339  1.00 11.93 ? 356  ASN A C    1 
ATOM   5535  O O    . ASN A 1 367 ? -52.709 3.945   39.769  1.00 13.07 ? 356  ASN A O    1 
ATOM   5536  C CB   . ASN A 1 367 ? -55.920 2.798   40.502  1.00 12.98 ? 356  ASN A CB   1 
ATOM   5537  C CG   . ASN A 1 367 ? -55.824 3.900   41.514  1.00 13.82 ? 356  ASN A CG   1 
ATOM   5538  O OD1  . ASN A 1 367 ? -55.438 3.684   42.643  1.00 14.34 ? 356  ASN A OD1  1 
ATOM   5539  N ND2  . ASN A 1 367 ? -56.171 5.117   41.097  1.00 14.43 ? 356  ASN A ND2  1 
ATOM   5540  H H    . ASN A 1 367 ? -54.040 2.006   41.857  1.00 15.90 ? 356  ASN A H    1 
ATOM   5541  H HA   . ASN A 1 367 ? -54.680 1.688   39.300  1.00 14.74 ? 356  ASN A HA   1 
ATOM   5542  H HB2  . ASN A 1 367 ? -56.453 3.118   39.758  1.00 15.58 ? 356  ASN A HB2  1 
ATOM   5543  H HB3  . ASN A 1 367 ? -56.355 2.040   40.923  1.00 15.58 ? 356  ASN A HB3  1 
ATOM   5544  H HD21 . ASN A 1 367 ? -56.135 5.784   41.639  1.00 17.32 ? 356  ASN A HD21 1 
ATOM   5545  H HD22 . ASN A 1 367 ? -56.432 5.236   40.286  1.00 17.32 ? 356  ASN A HD22 1 
ATOM   5546  N N    . GLY A 1 368 ? -54.365 4.069   38.270  1.00 12.03 ? 357  GLY A N    1 
ATOM   5547  C CA   . GLY A 1 368 ? -53.866 5.273   37.643  1.00 12.45 ? 357  GLY A CA   1 
ATOM   5548  C C    . GLY A 1 368 ? -54.247 5.462   36.203  1.00 12.55 ? 357  GLY A C    1 
ATOM   5549  O O    . GLY A 1 368 ? -53.989 6.545   35.674  1.00 12.21 ? 357  GLY A O    1 
ATOM   5550  H H    . GLY A 1 368 ? -55.061 3.744   37.884  1.00 14.43 ? 357  GLY A H    1 
ATOM   5551  H HA2  . GLY A 1 368 ? -54.191 6.041   38.138  1.00 14.95 ? 357  GLY A HA2  1 
ATOM   5552  H HA3  . GLY A 1 368 ? -52.897 5.273   37.695  1.00 14.95 ? 357  GLY A HA3  1 
ATOM   5553  N N    . THR A 1 369 ? -54.830 4.468   35.528  1.00 12.01 ? 358  THR A N    1 
ATOM   5554  C CA   . THR A 1 369 ? -55.137 4.685   34.116  1.00 12.32 ? 358  THR A CA   1 
ATOM   5555  C C    . THR A 1 369 ? -56.199 5.759   33.951  1.00 12.74 ? 358  THR A C    1 
ATOM   5556  O O    . THR A 1 369 ? -56.198 6.530   32.985  1.00 12.53 ? 358  THR A O    1 
ATOM   5557  C CB   . THR A 1 369 ? -55.529 3.379   33.376  1.00 11.99 ? 358  THR A CB   1 
ATOM   5558  O OG1  . THR A 1 369 ? -55.402 3.544   31.958  1.00 12.31 ? 358  THR A OG1  1 
ATOM   5559  C CG2  . THR A 1 369 ? -56.972 2.946   33.642  1.00 12.47 ? 358  THR A CG2  1 
ATOM   5560  H H    . THR A 1 369 ? -55.047 3.699   35.845  1.00 14.41 ? 358  THR A H    1 
ATOM   5561  H HA   . THR A 1 369 ? -54.333 5.018   33.687  1.00 14.79 ? 358  THR A HA   1 
ATOM   5562  H HB   . THR A 1 369 ? -54.942 2.663   33.665  1.00 14.39 ? 358  THR A HB   1 
ATOM   5563  H HG1  . THR A 1 369 ? -54.608 3.735   31.762  1.00 14.77 ? 358  THR A HG1  1 
ATOM   5564  H HG21 . THR A 1 369 ? -57.167 2.128   33.159  1.00 14.96 ? 358  THR A HG21 1 
ATOM   5565  H HG22 . THR A 1 369 ? -57.102 2.790   34.591  1.00 14.96 ? 358  THR A HG22 1 
ATOM   5566  H HG23 . THR A 1 369 ? -57.585 3.639   33.350  1.00 14.96 ? 358  THR A HG23 1 
ATOM   5567  N N    . GLU A 1 370 ? -57.170 5.788   34.873  1.00 12.42 ? 359  GLU A N    1 
ATOM   5568  C CA   . GLU A 1 370 ? -58.286 6.702   34.750  1.00 12.79 ? 359  GLU A CA   1 
ATOM   5569  C C    . GLU A 1 370 ? -57.878 8.142   35.038  1.00 12.87 ? 359  GLU A C    1 
ATOM   5570  O O    . GLU A 1 370 ? -58.442 9.068   34.465  1.00 14.09 ? 359  GLU A O    1 
ATOM   5571  C CB   . GLU A 1 370 ? -59.417 6.258   35.691  1.00 12.72 ? 359  GLU A CB   1 
ATOM   5572  C CG   . GLU A 1 370 ? -60.720 6.977   35.526  1.00 13.19 ? 359  GLU A CG   1 
ATOM   5573  C CD   . GLU A 1 370 ? -61.915 6.336   36.221  1.00 14.80 ? 359  GLU A CD   1 
ATOM   5574  O OE1  . GLU A 1 370 ? -61.737 5.266   36.867  1.00 16.47 ? 359  GLU A OE1  1 
ATOM   5575  O OE2  . GLU A 1 370 ? -63.038 6.907   36.043  1.00 18.25 ? 359  GLU A OE2  1 
ATOM   5576  H H    . GLU A 1 370 ? -57.197 5.288   35.572  1.00 14.91 ? 359  GLU A H    1 
ATOM   5577  H HA   . GLU A 1 370 ? -58.623 6.664   33.841  1.00 15.35 ? 359  GLU A HA   1 
ATOM   5578  H HB2  . GLU A 1 370 ? -59.586 5.315   35.543  1.00 15.27 ? 359  GLU A HB2  1 
ATOM   5579  H HB3  . GLU A 1 370 ? -59.125 6.394   36.606  1.00 15.27 ? 359  GLU A HB3  1 
ATOM   5580  H HG2  . GLU A 1 370 ? -60.623 7.874   35.884  1.00 15.82 ? 359  GLU A HG2  1 
ATOM   5581  H HG3  . GLU A 1 370 ? -60.926 7.027   34.580  1.00 15.82 ? 359  GLU A HG3  1 
ATOM   5582  N N    . GLU A 1 371 ? -56.947 8.348   35.956  1.00 12.62 ? 360  GLU A N    1 
ATOM   5583  C CA   . GLU A 1 371 ? -56.637 9.682   36.467  1.00 12.96 ? 360  GLU A CA   1 
ATOM   5584  C C    . GLU A 1 371 ? -55.477 10.359  35.748  1.00 11.89 ? 360  GLU A C    1 
ATOM   5585  O O    . GLU A 1 371 ? -55.266 11.548  35.977  1.00 13.43 ? 360  GLU A O    1 
ATOM   5586  C CB   . GLU A 1 371 ? -56.300 9.581   37.962  1.00 13.63 ? 360  GLU A CB   1 
ATOM   5587  C CG   . GLU A 1 371 ? -57.439 9.003   38.810  1.00 13.45 ? 360  GLU A CG   1 
ATOM   5588  C CD   . GLU A 1 371 ? -57.510 7.490   38.916  1.00 13.61 ? 360  GLU A CD   1 
ATOM   5589  O OE1  . GLU A 1 371 ? -56.605 6.777   38.415  1.00 14.18 ? 360  GLU A OE1  1 
ATOM   5590  O OE2  . GLU A 1 371 ? -58.538 7.032   39.520  1.00 15.84 ? 360  GLU A OE2  1 
ATOM   5591  H H    . GLU A 1 371 ? -56.471 7.723   36.307  1.00 15.15 ? 360  GLU A H    1 
ATOM   5592  H HA   . GLU A 1 371 ? -57.420 10.246  36.372  1.00 15.55 ? 360  GLU A HA   1 
ATOM   5593  H HB2  . GLU A 1 371 ? -55.527 9.005   38.070  1.00 16.36 ? 360  GLU A HB2  1 
ATOM   5594  H HB3  . GLU A 1 371 ? -56.099 10.469  38.298  1.00 16.36 ? 360  GLU A HB3  1 
ATOM   5595  H HG2  . GLU A 1 371 ? -57.351 9.350   39.712  1.00 16.14 ? 360  GLU A HG2  1 
ATOM   5596  H HG3  . GLU A 1 371 ? -58.281 9.304   38.432  1.00 16.14 ? 360  GLU A HG3  1 
ATOM   5597  N N    . ARG A 1 372 ? -54.752 9.631   34.888  1.00 12.16 ? 361  ARG A N    1 
ATOM   5598  C CA   . ARG A 1 372 ? -53.501 10.133  34.318  1.00 10.81 ? 361  ARG A CA   1 
ATOM   5599  C C    . ARG A 1 372 ? -53.640 11.528  33.704  1.00 11.64 ? 361  ARG A C    1 
ATOM   5600  O O    . ARG A 1 372 ? -52.826 12.419  33.995  1.00 13.05 ? 361  ARG A O    1 
ATOM   5601  C CB   . ARG A 1 372 ? -52.994 9.131   33.282  1.00 11.20 ? 361  ARG A CB   1 
ATOM   5602  C CG   . ARG A 1 372 ? -51.657 9.546   32.678  1.00 11.61 ? 361  ARG A CG   1 
ATOM   5603  C CD   . ARG A 1 372 ? -51.101 8.518   31.749  1.00 12.42 ? 361  ARG A CD   1 
ATOM   5604  N NE   . ARG A 1 372 ? -51.974 8.289   30.613  1.00 11.52 ? 361  ARG A NE   1 
ATOM   5605  C CZ   . ARG A 1 372 ? -51.837 8.732   29.367  1.00 11.06 ? 361  ARG A CZ   1 
ATOM   5606  N NH1  . ARG A 1 372 ? -50.779 9.424   28.971  1.00 11.84 ? 361  ARG A NH1  1 
ATOM   5607  N NH2  . ARG A 1 372 ? -52.784 8.472   28.478  1.00 12.27 ? 361  ARG A NH2  1 
ATOM   5608  H H    . ARG A 1 372 ? -54.966 8.842   34.621  1.00 14.60 ? 361  ARG A H    1 
ATOM   5609  H HA   . ARG A 1 372 ? -52.838 10.188  35.024  1.00 12.97 ? 361  ARG A HA   1 
ATOM   5610  H HB2  . ARG A 1 372 ? -52.877 8.267   33.707  1.00 13.45 ? 361  ARG A HB2  1 
ATOM   5611  H HB3  . ARG A 1 372 ? -53.641 9.064   32.562  1.00 13.45 ? 361  ARG A HB3  1 
ATOM   5612  H HG2  . ARG A 1 372 ? -51.777 10.368  32.178  1.00 13.94 ? 361  ARG A HG2  1 
ATOM   5613  H HG3  . ARG A 1 372 ? -51.016 9.682   33.393  1.00 13.94 ? 361  ARG A HG3  1 
ATOM   5614  H HD2  . ARG A 1 372 ? -50.242 8.820   31.415  1.00 14.91 ? 361  ARG A HD2  1 
ATOM   5615  H HD3  . ARG A 1 372 ? -50.998 7.679   32.226  1.00 14.91 ? 361  ARG A HD3  1 
ATOM   5616  H HE   . ARG A 1 372 ? -52.668 7.805   30.765  1.00 13.83 ? 361  ARG A HE   1 
ATOM   5617  H HH11 . ARG A 1 372 ? -50.158 9.620   29.533  1.00 14.21 ? 361  ARG A HH11 1 
ATOM   5618  H HH12 . ARG A 1 372 ? -50.717 9.686   28.154  1.00 14.21 ? 361  ARG A HH12 1 
ATOM   5619  H HH21 . ARG A 1 372 ? -53.473 8.011   28.706  1.00 14.72 ? 361  ARG A HH21 1 
ATOM   5620  H HH22 . ARG A 1 372 ? -52.690 8.729   27.662  1.00 14.72 ? 361  ARG A HH22 1 
ATOM   5621  N N    A MET A 1 373 ? -54.581 11.694  32.765  0.50 11.80 ? 362  MET A N    1 
ATOM   5622  N N    B MET A 1 373 ? -54.580 11.713  32.790  0.50 14.05 ? 362  MET A N    1 
ATOM   5623  C CA   A MET A 1 373 ? -54.718 12.970  32.042  0.50 11.87 ? 362  MET A CA   1 
ATOM   5624  C CA   B MET A 1 373 ? -54.575 12.986  32.065  0.50 14.63 ? 362  MET A CA   1 
ATOM   5625  C C    A MET A 1 373 ? -55.009 14.101  33.006  0.50 11.12 ? 362  MET A C    1 
ATOM   5626  C C    B MET A 1 373 ? -55.043 14.138  32.950  0.50 15.27 ? 362  MET A C    1 
ATOM   5627  O O    A MET A 1 373 ? -54.381 15.165  32.972  0.50 10.49 ? 362  MET A O    1 
ATOM   5628  O O    B MET A 1 373 ? -54.499 15.246  32.850  0.50 15.53 ? 362  MET A O    1 
ATOM   5629  C CB   A MET A 1 373 ? -55.860 12.856  31.018  0.50 12.50 ? 362  MET A CB   1 
ATOM   5630  C CB   B MET A 1 373 ? -55.316 12.835  30.735  0.50 16.27 ? 362  MET A CB   1 
ATOM   5631  C CG   A MET A 1 373 ? -55.704 11.713  30.009  0.50 12.82 ? 362  MET A CG   1 
ATOM   5632  C CG   B MET A 1 373 ? -54.583 11.869  29.762  0.50 13.10 ? 362  MET A CG   1 
ATOM   5633  S SD   A MET A 1 373 ? -54.330 11.952  28.863  0.50 11.75 ? 362  MET A SD   1 
ATOM   5634  S SD   B MET A 1 373 ? -55.590 11.533  28.320  0.50 14.39 ? 362  MET A SD   1 
ATOM   5635  C CE   A MET A 1 373 ? -54.980 13.166  27.737  0.50 12.68 ? 362  MET A CE   1 
ATOM   5636  C CE   B MET A 1 373 ? -55.559 13.119  27.472  0.50 14.79 ? 362  MET A CE   1 
ATOM   5637  H H    A MET A 1 373 ? -55.147 11.092  32.529  0.50 14.16 ? 362  MET A H    1 
ATOM   5638  H H    B MET A 1 373 ? -55.201 11.158  32.575  0.50 16.86 ? 362  MET A H    1 
ATOM   5639  H HA   A MET A 1 373 ? -53.895 13.158  31.563  0.50 14.25 ? 362  MET A HA   1 
ATOM   5640  H HA   B MET A 1 373 ? -53.652 13.173  31.832  0.50 17.55 ? 362  MET A HA   1 
ATOM   5641  H HB2  A MET A 1 373 ? -56.692 12.714  31.497  0.50 15.00 ? 362  MET A HB2  1 
ATOM   5642  H HB2  B MET A 1 373 ? -56.203 12.479  30.903  0.50 19.53 ? 362  MET A HB2  1 
ATOM   5643  H HB3  A MET A 1 373 ? -55.911 13.685  30.517  0.50 15.00 ? 362  MET A HB3  1 
ATOM   5644  H HB3  B MET A 1 373 ? -55.381 13.703  30.306  0.50 19.53 ? 362  MET A HB3  1 
ATOM   5645  H HG2  A MET A 1 373 ? -55.548 10.887  30.493  0.50 15.38 ? 362  MET A HG2  1 
ATOM   5646  H HG2  B MET A 1 373 ? -53.753 12.276  29.468  0.50 15.72 ? 362  MET A HG2  1 
ATOM   5647  H HG3  A MET A 1 373 ? -56.518 11.642  29.487  0.50 15.38 ? 362  MET A HG3  1 
ATOM   5648  H HG3  B MET A 1 373 ? -54.405 11.030  30.215  0.50 15.72 ? 362  MET A HG3  1 
ATOM   5649  H HE1  A MET A 1 373 ? -54.307 13.369  27.069  0.50 15.21 ? 362  MET A HE1  1 
ATOM   5650  H HE1  B MET A 1 373 ? -56.084 13.052  26.659  0.50 17.74 ? 362  MET A HE1  1 
ATOM   5651  H HE2  A MET A 1 373 ? -55.774 12.808  27.311  0.50 15.21 ? 362  MET A HE2  1 
ATOM   5652  H HE2  B MET A 1 373 ? -55.937 13.796  28.055  0.50 17.74 ? 362  MET A HE2  1 
ATOM   5653  H HE3  A MET A 1 373 ? -55.205 13.969  28.234  0.50 15.21 ? 362  MET A HE3  1 
ATOM   5654  H HE3  B MET A 1 373 ? -54.641 13.344  27.255  0.50 17.74 ? 362  MET A HE3  1 
ATOM   5655  N N    . SER A 1 374 ? -55.984 13.878  33.877  1.00 13.47 ? 363  SER A N    1 
ATOM   5656  C CA   . SER A 1 374 ? -56.392 14.890  34.838  1.00 13.00 ? 363  SER A CA   1 
ATOM   5657  C C    . SER A 1 374 ? -55.272 15.288  35.774  1.00 13.23 ? 363  SER A C    1 
ATOM   5658  O O    . SER A 1 374 ? -55.088 16.470  36.067  1.00 13.72 ? 363  SER A O    1 
ATOM   5659  C CB   . SER A 1 374 ? -57.603 14.405  35.626  1.00 15.97 ? 363  SER A CB   1 
ATOM   5660  O OG   . SER A 1 374 ? -58.702 14.209  34.756  1.00 18.66 ? 363  SER A OG   1 
ATOM   5661  H H    . SER A 1 374 ? -56.410 13.134  33.946  1.00 16.16 ? 363  SER A H    1 
ATOM   5662  H HA   . SER A 1 374 ? -56.660 15.685  34.351  1.00 15.60 ? 363  SER A HA   1 
ATOM   5663  H HB2  . SER A 1 374 ? -57.385 13.564  36.058  1.00 19.17 ? 363  SER A HB2  1 
ATOM   5664  H HB3  . SER A 1 374 ? -57.838 15.071  36.291  1.00 19.17 ? 363  SER A HB3  1 
ATOM   5665  H HG   . SER A 1 374 ? -58.898 14.931  34.373  1.00 22.40 ? 363  SER A HG   1 
ATOM   5666  N N    . VAL A 1 375 ? -54.552 14.309  36.303  1.00 12.62 ? 364  VAL A N    1 
ATOM   5667  C CA   . VAL A 1 375 ? -53.472 14.604  37.255  1.00 12.82 ? 364  VAL A CA   1 
ATOM   5668  C C    . VAL A 1 375 ? -52.404 15.454  36.590  1.00 12.20 ? 364  VAL A C    1 
ATOM   5669  O O    . VAL A 1 375 ? -51.913 16.437  37.154  1.00 13.04 ? 364  VAL A O    1 
ATOM   5670  C CB   . VAL A 1 375 ? -52.906 13.279  37.810  1.00 14.04 ? 364  VAL A CB   1 
ATOM   5671  C CG1  . VAL A 1 375 ? -51.539 13.491  38.443  1.00 13.91 ? 364  VAL A CG1  1 
ATOM   5672  C CG2  . VAL A 1 375 ? -53.904 12.664  38.787  1.00 15.03 ? 364  VAL A CG2  1 
ATOM   5673  H H    . VAL A 1 375 ? -54.661 13.472  36.134  1.00 15.15 ? 364  VAL A H    1 
ATOM   5674  H HA   . VAL A 1 375 ? -53.836 15.109  37.999  1.00 15.38 ? 364  VAL A HA   1 
ATOM   5675  H HB   . VAL A 1 375 ? -52.796 12.658  37.073  1.00 16.84 ? 364  VAL A HB   1 
ATOM   5676  H HG11 . VAL A 1 375 ? -51.213 12.642  38.780  1.00 16.69 ? 364  VAL A HG11 1 
ATOM   5677  H HG12 . VAL A 1 375 ? -50.930 13.836  37.771  1.00 16.69 ? 364  VAL A HG12 1 
ATOM   5678  H HG13 . VAL A 1 375 ? -51.623 14.126  39.171  1.00 16.69 ? 364  VAL A HG13 1 
ATOM   5679  H HG21 . VAL A 1 375 ? -53.539 11.833  39.129  1.00 18.04 ? 364  VAL A HG21 1 
ATOM   5680  H HG22 . VAL A 1 375 ? -54.054 13.285  39.517  1.00 18.04 ? 364  VAL A HG22 1 
ATOM   5681  H HG23 . VAL A 1 375 ? -54.737 12.493  38.321  1.00 18.04 ? 364  VAL A HG23 1 
ATOM   5682  N N    . ILE A 1 376 ? -52.035 15.113  35.352  1.00 12.26 ? 365  ILE A N    1 
ATOM   5683  C CA   . ILE A 1 376 ? -51.014 15.908  34.649  1.00 11.91 ? 365  ILE A CA   1 
ATOM   5684  C C    . ILE A 1 376 ? -51.522 17.320  34.376  1.00 11.57 ? 365  ILE A C    1 
ATOM   5685  O O    . ILE A 1 376 ? -50.775 18.304  34.514  1.00 13.01 ? 365  ILE A O    1 
ATOM   5686  C CB   . ILE A 1 376 ? -50.545 15.196  33.379  1.00 11.07 ? 365  ILE A CB   1 
ATOM   5687  C CG1  . ILE A 1 376 ? -49.891 13.878  33.700  1.00 11.81 ? 365  ILE A CG1  1 
ATOM   5688  C CG2  . ILE A 1 376 ? -49.589 16.092  32.583  1.00 12.54 ? 365  ILE A CG2  1 
ATOM   5689  C CD1  . ILE A 1 376 ? -49.792 12.942  32.561  1.00 13.61 ? 365  ILE A CD1  1 
ATOM   5690  H H    . ILE A 1 376 ? -52.347 14.447  34.907  1.00 14.71 ? 365  ILE A H    1 
ATOM   5691  H HA   . ILE A 1 376 ? -50.242 15.990  35.231  1.00 14.29 ? 365  ILE A HA   1 
ATOM   5692  H HB   . ILE A 1 376 ? -51.324 15.020  32.827  1.00 13.29 ? 365  ILE A HB   1 
ATOM   5693  H HG12 . ILE A 1 376 ? -48.991 14.049  34.019  1.00 14.17 ? 365  ILE A HG12 1 
ATOM   5694  H HG13 . ILE A 1 376 ? -50.405 13.439  34.396  1.00 14.17 ? 365  ILE A HG13 1 
ATOM   5695  H HG21 . ILE A 1 376 ? -49.306 15.620  31.784  1.00 15.05 ? 365  ILE A HG21 1 
ATOM   5696  H HG22 . ILE A 1 376 ? -50.052 16.909  32.340  1.00 15.05 ? 365  ILE A HG22 1 
ATOM   5697  H HG23 . ILE A 1 376 ? -48.819 16.300  33.136  1.00 15.05 ? 365  ILE A HG23 1 
ATOM   5698  H HD11 . ILE A 1 376 ? -49.360 12.127  32.859  1.00 16.33 ? 365  ILE A HD11 1 
ATOM   5699  H HD12 . ILE A 1 376 ? -50.684 12.745  32.236  1.00 16.33 ? 365  ILE A HD12 1 
ATOM   5700  H HD13 . ILE A 1 376 ? -49.267 13.357  31.858  1.00 16.33 ? 365  ILE A HD13 1 
ATOM   5701  N N    . TRP A 1 377 ? -52.774 17.449  33.931  1.00 11.92 ? 366  TRP A N    1 
ATOM   5702  C CA   . TRP A 1 377 ? -53.314 18.786  33.690  1.00 12.40 ? 366  TRP A CA   1 
ATOM   5703  C C    . TRP A 1 377 ? -53.197 19.616  34.958  1.00 13.69 ? 366  TRP A C    1 
ATOM   5704  O O    . TRP A 1 377 ? -52.739 20.755  34.943  1.00 12.97 ? 366  TRP A O    1 
ATOM   5705  C CB   . TRP A 1 377 ? -54.779 18.688  33.248  1.00 12.57 ? 366  TRP A CB   1 
ATOM   5706  C CG   . TRP A 1 377 ? -55.312 20.011  32.799  1.00 12.60 ? 366  TRP A CG   1 
ATOM   5707  C CD1  . TRP A 1 377 ? -56.034 20.886  33.532  1.00 14.49 ? 366  TRP A CD1  1 
ATOM   5708  C CD2  . TRP A 1 377 ? -55.065 20.649  31.554  1.00 12.73 ? 366  TRP A CD2  1 
ATOM   5709  N NE1  . TRP A 1 377 ? -56.235 22.033  32.832  1.00 15.08 ? 366  TRP A NE1  1 
ATOM   5710  C CE2  . TRP A 1 377 ? -55.686 21.906  31.592  1.00 13.61 ? 366  TRP A CE2  1 
ATOM   5711  C CE3  . TRP A 1 377 ? -54.427 20.259  30.379  1.00 13.26 ? 366  TRP A CE3  1 
ATOM   5712  C CZ2  . TRP A 1 377 ? -55.676 22.786  30.511  1.00 15.25 ? 366  TRP A CZ2  1 
ATOM   5713  C CZ3  . TRP A 1 377 ? -54.429 21.127  29.309  1.00 13.88 ? 366  TRP A CZ3  1 
ATOM   5714  C CH2  . TRP A 1 377 ? -55.011 22.390  29.383  1.00 15.36 ? 366  TRP A CH2  1 
ATOM   5715  H H    . TRP A 1 377 ? -53.315 16.801  33.767  1.00 14.30 ? 366  TRP A H    1 
ATOM   5716  H HA   . TRP A 1 377 ? -52.806 19.220  32.987  1.00 14.88 ? 366  TRP A HA   1 
ATOM   5717  H HB2  . TRP A 1 377 ? -54.849 18.065  32.508  1.00 15.08 ? 366  TRP A HB2  1 
ATOM   5718  H HB3  . TRP A 1 377 ? -55.318 18.382  33.995  1.00 15.08 ? 366  TRP A HB3  1 
ATOM   5719  H HD1  . TRP A 1 377 ? -56.284 20.756  34.418  1.00 17.39 ? 366  TRP A HD1  1 
ATOM   5720  H HE1  . TRP A 1 377 ? -56.686 22.711  33.108  1.00 18.09 ? 366  TRP A HE1  1 
ATOM   5721  H HE3  . TRP A 1 377 ? -54.006 19.432  30.319  1.00 15.91 ? 366  TRP A HE3  1 
ATOM   5722  H HZ2  . TRP A 1 377 ? -56.093 23.615  30.559  1.00 18.31 ? 366  TRP A HZ2  1 
ATOM   5723  H HZ3  . TRP A 1 377 ? -53.978 20.884  28.533  1.00 16.66 ? 366  TRP A HZ3  1 
ATOM   5724  H HH2  . TRP A 1 377 ? -55.000 22.946  28.638  1.00 18.43 ? 366  TRP A HH2  1 
ATOM   5725  N N    . ASP A 1 378 ? -53.632 19.051  36.068  1.00 12.03 ? 367  ASP A N    1 
ATOM   5726  C CA   . ASP A 1 378 ? -53.669 19.778  37.328  1.00 13.35 ? 367  ASP A CA   1 
ATOM   5727  C C    . ASP A 1 378 ? -52.257 20.104  37.820  1.00 13.79 ? 367  ASP A C    1 
ATOM   5728  O O    . ASP A 1 378 ? -51.995 21.230  38.240  1.00 14.92 ? 367  ASP A O    1 
ATOM   5729  C CB   . ASP A 1 378 ? -54.403 18.930  38.359  1.00 14.20 ? 367  ASP A CB   1 
ATOM   5730  C CG   . ASP A 1 378 ? -54.543 19.620  39.688  1.00 17.03 ? 367  ASP A CG   1 
ATOM   5731  O OD1  . ASP A 1 378 ? -53.652 19.477  40.549  1.00 20.67 ? 367  ASP A OD1  1 
ATOM   5732  O OD2  . ASP A 1 378 ? -55.553 20.305  39.870  1.00 18.59 ? 367  ASP A OD2  1 
ATOM   5733  H H    . ASP A 1 378 ? -53.916 18.241  36.122  1.00 14.44 ? 367  ASP A H    1 
ATOM   5734  H HA   . ASP A 1 378 ? -54.154 20.610  37.210  1.00 16.02 ? 367  ASP A HA   1 
ATOM   5735  H HB2  . ASP A 1 378 ? -55.293 18.732  38.029  1.00 17.04 ? 367  ASP A HB2  1 
ATOM   5736  H HB3  . ASP A 1 378 ? -53.910 18.107  38.500  1.00 17.04 ? 367  ASP A HB3  1 
ATOM   5737  N N    . LYS A 1 379 ? -51.334 19.138  37.765  1.00 13.08 ? 368  LYS A N    1 
ATOM   5738  C CA   . LYS A 1 379 ? -50.022 19.289  38.397  1.00 12.43 ? 368  LYS A CA   1 
ATOM   5739  C C    . LYS A 1 379 ? -48.996 19.974  37.504  1.00 12.16 ? 368  LYS A C    1 
ATOM   5740  O O    . LYS A 1 379 ? -48.016 20.522  38.018  1.00 13.76 ? 368  LYS A O    1 
ATOM   5741  C CB   . LYS A 1 379 ? -49.503 17.900  38.800  1.00 14.96 ? 368  LYS A CB   1 
ATOM   5742  C CG   . LYS A 1 379 ? -50.397 17.199  39.849  1.00 17.78 ? 368  LYS A CG   1 
ATOM   5743  C CD   . LYS A 1 379 ? -50.302 17.842  41.153  1.00 25.78 ? 368  LYS A CD   1 
ATOM   5744  C CE   . LYS A 1 379 ? -48.975 17.383  41.870  1.00 38.48 ? 368  LYS A CE   1 
ATOM   5745  N NZ   . LYS A 1 379 ? -48.803 18.126  43.131  1.00 41.85 ? 368  LYS A NZ   1 
ATOM   5746  H H    . LYS A 1 379 ? -51.445 18.384  37.366  1.00 15.70 ? 368  LYS A H    1 
ATOM   5747  H HA   . LYS A 1 379 ? -50.119 19.820  39.203  1.00 14.92 ? 368  LYS A HA   1 
ATOM   5748  H HB2  . LYS A 1 379 ? -49.468 17.336  38.012  1.00 17.95 ? 368  LYS A HB2  1 
ATOM   5749  H HB3  . LYS A 1 379 ? -48.615 17.994  39.179  1.00 17.95 ? 368  LYS A HB3  1 
ATOM   5750  H HG2  . LYS A 1 379 ? -51.322 17.238  39.558  1.00 21.33 ? 368  LYS A HG2  1 
ATOM   5751  H HG3  . LYS A 1 379 ? -50.114 16.276  39.945  1.00 21.33 ? 368  LYS A HG3  1 
ATOM   5752  H HD2  . LYS A 1 379 ? -50.278 18.805  41.041  1.00 30.93 ? 368  LYS A HD2  1 
ATOM   5753  H HD3  . LYS A 1 379 ? -51.058 17.580  41.702  1.00 30.93 ? 368  LYS A HD3  1 
ATOM   5754  H HE2  . LYS A 1 379 ? -49.026 16.436  42.074  1.00 46.17 ? 368  LYS A HE2  1 
ATOM   5755  H HE3  . LYS A 1 379 ? -48.215 17.569  41.297  1.00 46.17 ? 368  LYS A HE3  1 
ATOM   5756  H HZ1  . LYS A 1 379 ? -48.756 18.999  42.965  1.00 50.22 ? 368  LYS A HZ1  1 
ATOM   5757  H HZ2  . LYS A 1 379 ? -49.493 17.970  43.672  1.00 50.22 ? 368  LYS A HZ2  1 
ATOM   5758  H HZ3  . LYS A 1 379 ? -48.054 17.867  43.536  1.00 50.22 ? 368  LYS A HZ3  1 
ATOM   5759  N N    . ALA A 1 380 ? -49.199 19.951  36.189  1.00 12.36 ? 369  ALA A N    1 
ATOM   5760  C CA   . ALA A 1 380 ? -48.219 20.492  35.243  1.00 12.49 ? 369  ALA A CA   1 
ATOM   5761  C C    . ALA A 1 380 ? -48.739 21.663  34.432  1.00 12.15 ? 369  ALA A C    1 
ATOM   5762  O O    . ALA A 1 380 ? -47.943 22.526  34.094  1.00 13.32 ? 369  ALA A O    1 
ATOM   5763  C CB   . ALA A 1 380 ? -47.670 19.416  34.292  1.00 13.66 ? 369  ALA A CB   1 
ATOM   5764  H H    . ALA A 1 380 ? -49.902 19.626  35.814  1.00 14.83 ? 369  ALA A H    1 
ATOM   5765  H HA   . ALA A 1 380 ? -47.466 20.822  35.757  1.00 14.98 ? 369  ALA A HA   1 
ATOM   5766  H HB1  . ALA A 1 380 ? -47.028 19.824  33.690  1.00 16.39 ? 369  ALA A HB1  1 
ATOM   5767  H HB2  . ALA A 1 380 ? -47.238 18.723  34.816  1.00 16.39 ? 369  ALA A HB2  1 
ATOM   5768  H HB3  . ALA A 1 380 ? -48.405 19.038  33.785  1.00 16.39 ? 369  ALA A HB3  1 
ATOM   5769  N N    . VAL A 1 381 ? -50.025 21.687  34.080  1.00 12.78 ? 370  VAL A N    1 
ATOM   5770  C CA   . VAL A 1 381 ? -50.545 22.767  33.244  1.00 12.08 ? 370  VAL A CA   1 
ATOM   5771  C C    . VAL A 1 381 ? -51.071 23.917  34.098  1.00 13.54 ? 370  VAL A C    1 
ATOM   5772  O O    . VAL A 1 381 ? -50.687 25.078  33.924  1.00 14.93 ? 370  VAL A O    1 
ATOM   5773  C CB   . VAL A 1 381 ? -51.579 22.261  32.213  1.00 12.86 ? 370  VAL A CB   1 
ATOM   5774  C CG1  . VAL A 1 381 ? -52.042 23.447  31.379  1.00 14.52 ? 370  VAL A CG1  1 
ATOM   5775  C CG2  . VAL A 1 381 ? -50.982 21.194  31.343  1.00 14.09 ? 370  VAL A CG2  1 
ATOM   5776  H H    . VAL A 1 381 ? -50.608 21.098  34.308  1.00 15.33 ? 370  VAL A H    1 
ATOM   5777  H HA   . VAL A 1 381 ? -49.801 23.122  32.733  1.00 14.50 ? 370  VAL A HA   1 
ATOM   5778  H HB   . VAL A 1 381 ? -52.346 21.889  32.676  1.00 15.43 ? 370  VAL A HB   1 
ATOM   5779  H HG11 . VAL A 1 381 ? -52.692 23.140  30.728  1.00 17.43 ? 370  VAL A HG11 1 
ATOM   5780  H HG12 . VAL A 1 381 ? -52.446 24.105  31.966  1.00 17.43 ? 370  VAL A HG12 1 
ATOM   5781  H HG13 . VAL A 1 381 ? -51.276 23.832  30.926  1.00 17.43 ? 370  VAL A HG13 1 
ATOM   5782  H HG21 . VAL A 1 381 ? -51.651 20.895  30.707  1.00 16.91 ? 370  VAL A HG21 1 
ATOM   5783  H HG22 . VAL A 1 381 ? -50.218 21.562  30.872  1.00 16.91 ? 370  VAL A HG22 1 
ATOM   5784  H HG23 . VAL A 1 381 ? -50.701 20.452  31.901  1.00 16.91 ? 370  VAL A HG23 1 
ATOM   5785  N N    . VAL A 1 382 ? -51.978 23.622  35.037  1.00 14.24 ? 371  VAL A N    1 
ATOM   5786  C CA   . VAL A 1 382 ? -52.522 24.690  35.876  1.00 15.40 ? 371  VAL A CA   1 
ATOM   5787  C C    . VAL A 1 382 ? -51.405 25.370  36.651  1.00 14.76 ? 371  VAL A C    1 
ATOM   5788  O O    . VAL A 1 382 ? -51.465 26.577  36.917  1.00 17.27 ? 371  VAL A O    1 
ATOM   5789  C CB   . VAL A 1 382 ? -53.630 24.136  36.775  1.00 17.30 ? 371  VAL A CB   1 
ATOM   5790  C CG1  . VAL A 1 382 ? -54.159 25.232  37.688  1.00 19.90 ? 371  VAL A CG1  1 
ATOM   5791  C CG2  . VAL A 1 382 ? -54.750 23.538  35.913  1.00 18.22 ? 371  VAL A CG2  1 
ATOM   5792  H H    . VAL A 1 382 ? -52.285 22.836  35.204  1.00 17.09 ? 371  VAL A H    1 
ATOM   5793  H HA   . VAL A 1 382 ? -52.923 25.359  35.299  1.00 18.48 ? 371  VAL A HA   1 
ATOM   5794  H HB   . VAL A 1 382 ? -53.266 23.429  37.330  1.00 20.76 ? 371  VAL A HB   1 
ATOM   5795  H HG11 . VAL A 1 382 ? -54.859 24.864  38.249  1.00 23.88 ? 371  VAL A HG11 1 
ATOM   5796  H HG12 . VAL A 1 382 ? -53.432 25.562  38.238  1.00 23.88 ? 371  VAL A HG12 1 
ATOM   5797  H HG13 . VAL A 1 382 ? -54.515 25.952  37.143  1.00 23.88 ? 371  VAL A HG13 1 
ATOM   5798  H HG21 . VAL A 1 382 ? -55.445 23.191  36.494  1.00 21.86 ? 371  VAL A HG21 1 
ATOM   5799  H HG22 . VAL A 1 382 ? -55.113 24.233  35.341  1.00 21.86 ? 371  VAL A HG22 1 
ATOM   5800  H HG23 . VAL A 1 382 ? -54.383 22.822  35.371  1.00 21.86 ? 371  VAL A HG23 1 
ATOM   5801  N N    . THR A 1 383 ? -50.385 24.625  37.047  1.00 14.60 ? 372  THR A N    1 
ATOM   5802  C CA   . THR A 1 383 ? -49.271 25.188  37.786  1.00 14.45 ? 372  THR A CA   1 
ATOM   5803  C C    . THR A 1 383 ? -48.323 26.019  36.917  1.00 13.95 ? 372  THR A C    1 
ATOM   5804  O O    . THR A 1 383 ? -47.367 26.587  37.451  1.00 15.76 ? 372  THR A O    1 
ATOM   5805  C CB   . THR A 1 383 ? -48.444 24.039  38.373  1.00 14.65 ? 372  THR A CB   1 
ATOM   5806  O OG1  . THR A 1 383 ? -48.091 23.182  37.287  1.00 14.39 ? 372  THR A OG1  1 
ATOM   5807  C CG2  . THR A 1 383 ? -49.224 23.256  39.424  1.00 15.47 ? 372  THR A CG2  1 
ATOM   5808  H H    . THR A 1 383 ? -50.315 23.781  36.898  1.00 17.53 ? 372  THR A H    1 
ATOM   5809  H HA   . THR A 1 383 ? -49.600 25.741  38.511  1.00 17.33 ? 372  THR A HA   1 
ATOM   5810  H HB   . THR A 1 383 ? -47.640 24.393  38.783  1.00 17.58 ? 372  THR A HB   1 
ATOM   5811  H HG1  . THR A 1 383 ? -47.634 22.536  37.568  1.00 17.26 ? 372  THR A HG1  1 
ATOM   5812  H HG21 . THR A 1 383 ? -48.676 22.538  39.776  1.00 18.56 ? 372  THR A HG21 1 
ATOM   5813  H HG22 . THR A 1 383 ? -49.479 23.844  40.153  1.00 18.56 ? 372  THR A HG22 1 
ATOM   5814  H HG23 . THR A 1 383 ? -50.025 22.878  39.029  1.00 18.56 ? 372  THR A HG23 1 
ATOM   5815  N N    . GLY A 1 384 ? -48.518 26.039  35.610  1.00 14.20 ? 373  GLY A N    1 
ATOM   5816  C CA   . GLY A 1 384 ? -47.702 26.826  34.702  1.00 13.49 ? 373  GLY A CA   1 
ATOM   5817  C C    . GLY A 1 384 ? -46.428 26.174  34.242  1.00 12.99 ? 373  GLY A C    1 
ATOM   5818  O O    . GLY A 1 384 ? -45.616 26.849  33.582  1.00 14.06 ? 373  GLY A O    1 
ATOM   5819  H H    . GLY A 1 384 ? -49.136 25.592  35.213  1.00 17.04 ? 373  GLY A H    1 
ATOM   5820  H HA2  . GLY A 1 384 ? -48.227 27.038  33.915  1.00 16.19 ? 373  GLY A HA2  1 
ATOM   5821  H HA3  . GLY A 1 384 ? -47.467 27.660  35.138  1.00 16.19 ? 373  GLY A HA3  1 
ATOM   5822  N N    A LYS A 1 385 ? -46.227 24.898  34.563  0.52 12.79 ? 374  LYS A N    1 
ATOM   5823  N N    B LYS A 1 385 ? -46.208 24.897  34.568  0.48 12.84 ? 374  LYS A N    1 
ATOM   5824  C CA   A LYS A 1 385 ? -44.983 24.239  34.192  0.52 12.34 ? 374  LYS A CA   1 
ATOM   5825  C CA   B LYS A 1 385 ? -44.951 24.257  34.189  0.48 13.27 ? 374  LYS A CA   1 
ATOM   5826  C C    A LYS A 1 385 ? -44.918 23.972  32.702  0.52 12.15 ? 374  LYS A C    1 
ATOM   5827  C C    B LYS A 1 385 ? -44.903 23.940  32.702  0.48 14.82 ? 374  LYS A C    1 
ATOM   5828  O O    A LYS A 1 385 ? -43.843 24.107  32.088  0.52 11.98 ? 374  LYS A O    1 
ATOM   5829  O O    B LYS A 1 385 ? -43.821 23.990  32.090  0.48 17.41 ? 374  LYS A O    1 
ATOM   5830  C CB   A LYS A 1 385 ? -44.827 22.980  35.021  0.52 14.15 ? 374  LYS A CB   1 
ATOM   5831  C CB   B LYS A 1 385 ? -44.727 22.996  35.012  0.48 13.03 ? 374  LYS A CB   1 
ATOM   5832  C CG   A LYS A 1 385 ? -44.719 23.303  36.482  0.52 14.64 ? 374  LYS A CG   1 
ATOM   5833  C CG   B LYS A 1 385 ? -44.577 23.213  36.495  0.48 12.74 ? 374  LYS A CG   1 
ATOM   5834  C CD   A LYS A 1 385 ? -44.323 22.112  37.312  0.52 16.41 ? 374  LYS A CD   1 
ATOM   5835  C CD   B LYS A 1 385 ? -44.461 21.856  37.198  0.48 15.33 ? 374  LYS A CD   1 
ATOM   5836  C CE   A LYS A 1 385 ? -43.889 22.546  38.692  0.52 15.70 ? 374  LYS A CE   1 
ATOM   5837  C CE   B LYS A 1 385 ? -44.422 21.949  38.717  0.48 17.76 ? 374  LYS A CE   1 
ATOM   5838  N NZ   A LYS A 1 385 ? -43.679 21.405  39.567  0.52 14.03 ? 374  LYS A NZ   1 
ATOM   5839  N NZ   B LYS A 1 385 ? -43.147 22.502  39.220  0.48 15.66 ? 374  LYS A NZ   1 
ATOM   5840  H H    A LYS A 1 385 ? -46.786 24.402  34.988  0.52 15.35 ? 374  LYS A H    1 
ATOM   5841  H H    B LYS A 1 385 ? -46.756 24.393  34.998  0.48 15.41 ? 374  LYS A H    1 
ATOM   5842  H HA   A LYS A 1 385 ? -44.245 24.828  34.414  0.52 14.81 ? 374  LYS A HA   1 
ATOM   5843  H HA   B LYS A 1 385 ? -44.222 24.867  34.382  0.48 15.93 ? 374  LYS A HA   1 
ATOM   5844  H HB2  A LYS A 1 385 ? -45.602 22.411  34.891  0.52 16.98 ? 374  LYS A HB2  1 
ATOM   5845  H HB2  B LYS A 1 385 ? -45.485 22.404  34.879  0.48 15.63 ? 374  LYS A HB2  1 
ATOM   5846  H HB3  A LYS A 1 385 ? -44.020 22.515  34.751  0.52 16.98 ? 374  LYS A HB3  1 
ATOM   5847  H HB3  B LYS A 1 385 ? -43.919 22.563  34.697  0.48 15.63 ? 374  LYS A HB3  1 
ATOM   5848  H HG2  A LYS A 1 385 ? -44.047 23.991  36.604  0.52 17.56 ? 374  LYS A HG2  1 
ATOM   5849  H HG2  B LYS A 1 385 ? -43.771 23.723  36.671  0.48 15.29 ? 374  LYS A HG2  1 
ATOM   5850  H HG3  A LYS A 1 385 ? -45.580 23.618  36.800  0.52 17.56 ? 374  LYS A HG3  1 
ATOM   5851  H HG3  B LYS A 1 385 ? -45.357 23.675  36.839  0.48 15.29 ? 374  LYS A HG3  1 
ATOM   5852  H HD2  A LYS A 1 385 ? -45.082 21.515  37.403  0.52 19.70 ? 374  LYS A HD2  1 
ATOM   5853  H HD2  B LYS A 1 385 ? -45.226 21.312  36.954  0.48 18.40 ? 374  LYS A HD2  1 
ATOM   5854  H HD3  A LYS A 1 385 ? -43.582 21.654  36.887  0.52 19.70 ? 374  LYS A HD3  1 
ATOM   5855  H HD3  B LYS A 1 385 ? -43.644 21.423  36.907  0.48 18.40 ? 374  LYS A HD3  1 
ATOM   5856  H HE2  A LYS A 1 385 ? -43.054 23.035  38.625  0.52 18.84 ? 374  LYS A HE2  1 
ATOM   5857  H HE2  B LYS A 1 385 ? -45.140 22.527  39.017  0.48 21.31 ? 374  LYS A HE2  1 
ATOM   5858  H HE3  A LYS A 1 385 ? -44.577 23.107  39.083  0.52 18.84 ? 374  LYS A HE3  1 
ATOM   5859  H HE3  B LYS A 1 385 ? -44.532 21.060  39.091  0.48 21.31 ? 374  LYS A HE3  1 
ATOM   5860  H HZ1  A LYS A 1 385 ? -43.048 20.875  39.230  0.52 16.84 ? 374  LYS A HZ1  1 
ATOM   5861  H HZ1  B LYS A 1 385 ? -42.470 21.985  38.964  0.48 18.79 ? 374  LYS A HZ1  1 
ATOM   5862  H HZ2  A LYS A 1 385 ? -43.424 21.683  40.373  0.52 16.84 ? 374  LYS A HZ2  1 
ATOM   5863  H HZ2  B LYS A 1 385 ? -43.024 23.322  38.897  0.48 18.79 ? 374  LYS A HZ2  1 
ATOM   5864  H HZ3  A LYS A 1 385 ? -44.434 20.940  39.647  0.52 16.84 ? 374  LYS A HZ3  1 
ATOM   5865  H HZ3  B LYS A 1 385 ? -43.163 22.540  40.109  0.48 18.79 ? 374  LYS A HZ3  1 
ATOM   5866  N N    . MET A 1 386 ? -46.042 23.576  32.110  1.00 13.26 ? 375  MET A N    1 
ATOM   5867  C CA   . MET A 1 386 ? -46.106 23.288  30.686  1.00 12.68 ? 375  MET A CA   1 
ATOM   5868  C C    . MET A 1 386 ? -47.426 23.826  30.159  1.00 13.35 ? 375  MET A C    1 
ATOM   5869  O O    . MET A 1 386 ? -48.371 24.033  30.915  1.00 13.61 ? 375  MET A O    1 
ATOM   5870  C CB   . MET A 1 386 ? -45.993 21.776  30.353  1.00 12.54 ? 375  MET A CB   1 
ATOM   5871  C CG   . MET A 1 386 ? -47.201 21.000  30.736  1.00 12.71 ? 375  MET A CG   1 
ATOM   5872  S SD   . MET A 1 386 ? -47.273 19.276  30.185  1.00 13.75 ? 375  MET A SD   1 
ATOM   5873  C CE   . MET A 1 386 ? -45.975 18.511  31.137  1.00 15.71 ? 375  MET A CE   1 
ATOM   5874  H H    . MET A 1 386 ? -46.793 23.478  32.518  1.00 15.91 ? 375  MET A H    1 
ATOM   5875  H HA   . MET A 1 386 ? -45.377 23.746  30.239  1.00 15.21 ? 375  MET A HA   1 
ATOM   5876  H HB2  . MET A 1 386 ? -45.863 21.673  29.397  1.00 15.05 ? 375  MET A HB2  1 
ATOM   5877  H HB3  . MET A 1 386 ? -45.235 21.404  30.831  1.00 15.05 ? 375  MET A HB3  1 
ATOM   5878  H HG2  . MET A 1 386 ? -47.262 20.993  31.704  1.00 15.25 ? 375  MET A HG2  1 
ATOM   5879  H HG3  . MET A 1 386 ? -47.978 21.450  30.370  1.00 15.25 ? 375  MET A HG3  1 
ATOM   5880  H HE1  . MET A 1 386 ? -45.133 18.943  30.924  1.00 18.85 ? 375  MET A HE1  1 
ATOM   5881  H HE2  . MET A 1 386 ? -46.173 18.616  32.080  1.00 18.85 ? 375  MET A HE2  1 
ATOM   5882  H HE3  . MET A 1 386 ? -45.931 17.569  30.910  1.00 18.85 ? 375  MET A HE3  1 
ATOM   5883  N N    . ASP A 1 387 ? -47.513 24.000  28.844  1.00 12.16 ? 376  ASP A N    1 
ATOM   5884  C CA   . ASP A 1 387 ? -48.736 24.466  28.210  1.00 12.54 ? 376  ASP A CA   1 
ATOM   5885  C C    . ASP A 1 387 ? -49.558 23.309  27.647  1.00 13.20 ? 376  ASP A C    1 
ATOM   5886  O O    . ASP A 1 387 ? -49.156 22.139  27.709  1.00 12.26 ? 376  ASP A O    1 
ATOM   5887  C CB   . ASP A 1 387 ? -48.449 25.603  27.230  1.00 12.43 ? 376  ASP A CB   1 
ATOM   5888  C CG   . ASP A 1 387 ? -47.637 25.190  26.023  1.00 14.24 ? 376  ASP A CG   1 
ATOM   5889  O OD1  . ASP A 1 387 ? -47.772 24.040  25.562  1.00 12.15 ? 376  ASP A OD1  1 
ATOM   5890  O OD2  . ASP A 1 387 ? -46.901 26.076  25.517  1.00 14.56 ? 376  ASP A OD2  1 
ATOM   5891  H H    . ASP A 1 387 ? -46.869 23.852  28.294  1.00 14.60 ? 376  ASP A H    1 
ATOM   5892  H HA   . ASP A 1 387 ? -49.282 24.856  28.910  1.00 15.05 ? 376  ASP A HA   1 
ATOM   5893  H HB2  . ASP A 1 387 ? -49.293 25.959  26.910  1.00 14.91 ? 376  ASP A HB2  1 
ATOM   5894  H HB3  . ASP A 1 387 ? -47.956 26.297  27.694  1.00 14.91 ? 376  ASP A HB3  1 
ATOM   5895  N N    . GLU A 1 388 ? -50.717 23.650  27.084  1.00 12.16 ? 377  GLU A N    1 
ATOM   5896  C CA   . GLU A 1 388 ? -51.631 22.606  26.619  1.00 12.68 ? 377  GLU A CA   1 
ATOM   5897  C C    . GLU A 1 388 ? -51.038 21.798  25.480  1.00 12.89 ? 377  GLU A C    1 
ATOM   5898  O O    . GLU A 1 388 ? -51.404 20.632  25.292  1.00 12.46 ? 377  GLU A O    1 
ATOM   5899  C CB   . GLU A 1 388 ? -52.962 23.248  26.204  1.00 14.08 ? 377  GLU A CB   1 
ATOM   5900  C CG   . GLU A 1 388 ? -52.843 24.200  25.014  1.00 14.10 ? 377  GLU A CG   1 
ATOM   5901  C CD   . GLU A 1 388 ? -54.130 24.817  24.527  1.00 17.47 ? 377  GLU A CD   1 
ATOM   5902  O OE1  . GLU A 1 388 ? -55.209 24.564  25.093  1.00 18.29 ? 377  GLU A OE1  1 
ATOM   5903  O OE2  . GLU A 1 388 ? -54.091 25.513  23.480  1.00 17.34 ? 377  GLU A OE2  1 
ATOM   5904  H H    . GLU A 1 388 ? -50.993 24.456  26.961  1.00 14.60 ? 377  GLU A H    1 
ATOM   5905  H HA   . GLU A 1 388 ? -51.811 21.998  27.353  1.00 15.21 ? 377  GLU A HA   1 
ATOM   5906  H HB2  . GLU A 1 388 ? -53.585 22.545  25.960  1.00 16.90 ? 377  GLU A HB2  1 
ATOM   5907  H HB3  . GLU A 1 388 ? -53.313 23.753  26.954  1.00 16.90 ? 377  GLU A HB3  1 
ATOM   5908  H HG2  . GLU A 1 388 ? -52.250 24.927  25.263  1.00 16.92 ? 377  GLU A HG2  1 
ATOM   5909  H HG3  . GLU A 1 388 ? -52.458 23.712  24.269  1.00 16.92 ? 377  GLU A HG3  1 
ATOM   5910  N N    . ASN A 1 389 ? -50.140 22.402  24.688  1.00 12.05 ? 378  ASN A N    1 
ATOM   5911  C CA   . ASN A 1 389 ? -49.535 21.669  23.586  1.00 13.03 ? 378  ASN A CA   1 
ATOM   5912  C C    . ASN A 1 389 ? -48.513 20.655  24.103  1.00 11.14 ? 378  ASN A C    1 
ATOM   5913  O O    . ASN A 1 389 ? -48.470 19.520  23.637  1.00 12.43 ? 378  ASN A O    1 
ATOM   5914  C CB   . ASN A 1 389 ? -48.927 22.671  22.599  1.00 12.42 ? 378  ASN A CB   1 
ATOM   5915  C CG   . ASN A 1 389 ? -49.951 23.712  22.151  1.00 12.56 ? 378  ASN A CG   1 
ATOM   5916  O OD1  . ASN A 1 389 ? -49.972 24.837  22.639  1.00 15.02 ? 378  ASN A OD1  1 
ATOM   5917  N ND2  . ASN A 1 389 ? -50.851 23.289  21.259  1.00 13.61 ? 378  ASN A ND2  1 
ATOM   5918  H H    . ASN A 1 389 ? -49.875 23.216  24.770  1.00 14.46 ? 378  ASN A H    1 
ATOM   5919  H HA   . ASN A 1 389 ? -50.229 21.178  23.119  1.00 15.64 ? 378  ASN A HA   1 
ATOM   5920  H HB2  . ASN A 1 389 ? -48.190 23.135  23.028  1.00 14.90 ? 378  ASN A HB2  1 
ATOM   5921  H HB3  . ASN A 1 389 ? -48.613 22.196  21.814  1.00 14.90 ? 378  ASN A HB3  1 
ATOM   5922  H HD21 . ASN A 1 389 ? -51.454 23.828  20.968  1.00 16.34 ? 378  ASN A HD21 1 
ATOM   5923  H HD22 . ASN A 1 389 ? -50.827 22.477  20.976  1.00 16.34 ? 378  ASN A HD22 1 
ATOM   5924  N N    A GLN A 1 390 ? -47.718 21.044  25.095  0.48 12.00 ? 379  GLN A N    1 
ATOM   5925  N N    B GLN A 1 390 ? -47.713 21.024  25.096  0.52 11.90 ? 379  GLN A N    1 
ATOM   5926  C CA   A GLN A 1 390 ? -46.832 20.097  25.750  0.48 11.49 ? 379  GLN A CA   1 
ATOM   5927  C CA   B GLN A 1 390 ? -46.817 20.048  25.699  0.52 12.40 ? 379  GLN A CA   1 
ATOM   5928  C C    A GLN A 1 390 ? -47.634 18.992  26.423  0.48 11.21 ? 379  GLN A C    1 
ATOM   5929  C C    B GLN A 1 390 ? -47.589 19.002  26.508  0.52 11.26 ? 379  GLN A C    1 
ATOM   5930  O O    A GLN A 1 390 ? -47.221 17.826  26.424  0.48 11.44 ? 379  GLN A O    1 
ATOM   5931  O O    B GLN A 1 390 ? -47.107 17.870  26.667  0.52 12.70 ? 379  GLN A O    1 
ATOM   5932  C CB   A GLN A 1 390 ? -46.003 20.827  26.786  0.48 12.66 ? 379  GLN A CB   1 
ATOM   5933  C CB   B GLN A 1 390 ? -45.777 20.757  26.556  0.52 14.21 ? 379  GLN A CB   1 
ATOM   5934  C CG   A GLN A 1 390 ? -44.944 21.720  26.204  0.48 16.80 ? 379  GLN A CG   1 
ATOM   5935  C CG   B GLN A 1 390 ? -44.807 19.842  27.326  0.52 18.83 ? 379  GLN A CG   1 
ATOM   5936  C CD   A GLN A 1 390 ? -44.416 22.627  27.276  0.48 17.58 ? 379  GLN A CD   1 
ATOM   5937  C CD   B GLN A 1 390 ? -43.761 19.133  26.507  0.52 20.62 ? 379  GLN A CD   1 
ATOM   5938  O OE1  A GLN A 1 390 ? -44.959 23.729  27.519  0.48 15.59 ? 379  GLN A OE1  1 
ATOM   5939  O OE1  B GLN A 1 390 ? -43.650 19.309  25.312  0.52 18.60 ? 379  GLN A OE1  1 
ATOM   5940  N NE2  A GLN A 1 390 ? -43.390 22.140  27.981  0.48 17.94 ? 379  GLN A NE2  1 
ATOM   5941  N NE2  B GLN A 1 390 ? -42.958 18.325  27.193  0.52 22.44 ? 379  GLN A NE2  1 
ATOM   5942  H H    A GLN A 1 390 ? -47.675 21.845  25.404  0.48 14.40 ? 379  GLN A H    1 
ATOM   5943  H H    B GLN A 1 390 ? -47.670 21.814  25.433  0.52 14.28 ? 379  GLN A H    1 
ATOM   5944  H HA   A GLN A 1 390 ? -46.237 19.698  25.096  0.48 13.79 ? 379  GLN A HA   1 
ATOM   5945  H HA   B GLN A 1 390 ? -46.345 19.581  24.991  0.52 14.89 ? 379  GLN A HA   1 
ATOM   5946  H HB2  A GLN A 1 390 ? -46.591 21.379  27.325  0.48 15.19 ? 379  GLN A HB2  1 
ATOM   5947  H HB2  B GLN A 1 390 ? -45.243 21.326  25.981  0.52 17.05 ? 379  GLN A HB2  1 
ATOM   5948  H HB3  A GLN A 1 390 ? -45.561 20.173  27.350  0.48 15.19 ? 379  GLN A HB3  1 
ATOM   5949  H HB3  B GLN A 1 390 ? -46.241 21.303  27.210  0.52 17.05 ? 379  GLN A HB3  1 
ATOM   5950  H HG2  A GLN A 1 390 ? -44.212 21.181  25.864  0.48 20.16 ? 379  GLN A HG2  1 
ATOM   5951  H HG2  B GLN A 1 390 ? -44.340 20.381  27.985  0.52 22.60 ? 379  GLN A HG2  1 
ATOM   5952  H HG3  A GLN A 1 390 ? -45.327 22.263  25.497  0.48 20.16 ? 379  GLN A HG3  1 
ATOM   5953  H HG3  B GLN A 1 390 ? -45.328 19.161  27.780  0.52 22.60 ? 379  GLN A HG3  1 
ATOM   5954  H HE21 A GLN A 1 390 ? -43.081 21.357  27.804  0.48 21.53 ? 379  GLN A HE21 1 
ATOM   5955  H HE21 B GLN A 1 390 ? -43.058 18.239  28.043  0.52 26.92 ? 379  GLN A HE21 1 
ATOM   5956  H HE22 A GLN A 1 390 ? -43.040 22.609  28.610  0.48 21.53 ? 379  GLN A HE22 1 
ATOM   5957  H HE22 B GLN A 1 390 ? -42.338 17.889  26.787  0.52 26.92 ? 379  GLN A HE22 1 
ATOM   5958  N N    . PHE A 1 391 ? -48.793 19.337  26.985  1.00 11.34 ? 380  PHE A N    1 
ATOM   5959  C CA   . PHE A 1 391 ? -49.651 18.346  27.611  1.00 11.36 ? 380  PHE A CA   1 
ATOM   5960  C C    . PHE A 1 391 ? -50.014 17.262  26.626  1.00 12.59 ? 380  PHE A C    1 
ATOM   5961  O O    . PHE A 1 391 ? -49.968 16.072  26.955  1.00 11.95 ? 380  PHE A O    1 
ATOM   5962  C CB   . PHE A 1 391 ? -50.903 19.045  28.161  1.00 12.20 ? 380  PHE A CB   1 
ATOM   5963  C CG   . PHE A 1 391 ? -51.986 18.126  28.666  1.00 11.83 ? 380  PHE A CG   1 
ATOM   5964  C CD1  . PHE A 1 391 ? -51.861 17.559  29.931  1.00 12.46 ? 380  PHE A CD1  1 
ATOM   5965  C CD2  . PHE A 1 391 ? -53.084 17.861  27.905  1.00 12.92 ? 380  PHE A CD2  1 
ATOM   5966  C CE1  . PHE A 1 391 ? -52.868 16.722  30.406  1.00 13.24 ? 380  PHE A CE1  1 
ATOM   5967  C CE2  . PHE A 1 391 ? -54.117 17.028  28.403  1.00 14.14 ? 380  PHE A CE2  1 
ATOM   5968  C CZ   . PHE A 1 391 ? -54.002 16.505  29.667  1.00 15.80 ? 380  PHE A CZ   1 
ATOM   5969  H H    . PHE A 1 391 ? -49.113 20.135  26.984  1.00 13.61 ? 380  PHE A H    1 
ATOM   5970  H HA   . PHE A 1 391 ? -49.180 17.937  28.354  1.00 13.64 ? 380  PHE A HA   1 
ATOM   5971  H HB2  . PHE A 1 391 ? -50.638 19.616  28.899  1.00 14.64 ? 380  PHE A HB2  1 
ATOM   5972  H HB3  . PHE A 1 391 ? -51.287 19.587  27.454  1.00 14.64 ? 380  PHE A HB3  1 
ATOM   5973  H HD1  . PHE A 1 391 ? -51.113 17.737  30.453  1.00 14.96 ? 380  PHE A HD1  1 
ATOM   5974  H HD2  . PHE A 1 391 ? -53.172 18.255  27.067  1.00 15.50 ? 380  PHE A HD2  1 
ATOM   5975  H HE1  . PHE A 1 391 ? -52.796 16.354  31.257  1.00 15.89 ? 380  PHE A HE1  1 
ATOM   5976  H HE2  . PHE A 1 391 ? -54.873 16.856  27.889  1.00 16.96 ? 380  PHE A HE2  1 
ATOM   5977  H HZ   . PHE A 1 391 ? -54.655 15.925  29.986  1.00 18.96 ? 380  PHE A HZ   1 
ATOM   5978  N N    . VAL A 1 392 ? -50.355 17.649  25.398  1.00 11.87 ? 381  VAL A N    1 
ATOM   5979  C CA   . VAL A 1 392 ? -50.604 16.663  24.348  1.00 11.29 ? 381  VAL A CA   1 
ATOM   5980  C C    . VAL A 1 392 ? -49.354 15.828  24.086  1.00 10.98 ? 381  VAL A C    1 
ATOM   5981  O O    . VAL A 1 392 ? -49.409 14.596  23.984  1.00 11.72 ? 381  VAL A O    1 
ATOM   5982  C CB   . VAL A 1 392 ? -51.175 17.339  23.081  1.00 11.60 ? 381  VAL A CB   1 
ATOM   5983  C CG1  . VAL A 1 392 ? -51.219 16.371  21.909  1.00 12.25 ? 381  VAL A CG1  1 
ATOM   5984  C CG2  . VAL A 1 392 ? -52.537 17.906  23.389  1.00 13.66 ? 381  VAL A CG2  1 
ATOM   5985  H H    . VAL A 1 392 ? -50.448 18.466  25.149  1.00 14.25 ? 381  VAL A H    1 
ATOM   5986  H HA   . VAL A 1 392 ? -51.286 16.052  24.671  1.00 13.54 ? 381  VAL A HA   1 
ATOM   5987  H HB   . VAL A 1 392 ? -50.597 18.077  22.834  1.00 13.92 ? 381  VAL A HB   1 
ATOM   5988  H HG11 . VAL A 1 392 ? -51.582 16.829  21.135  1.00 14.70 ? 381  VAL A HG11 1 
ATOM   5989  H HG12 . VAL A 1 392 ? -50.319 16.063  21.720  1.00 14.70 ? 381  VAL A HG12 1 
ATOM   5990  H HG13 . VAL A 1 392 ? -51.784 15.618  22.143  1.00 14.70 ? 381  VAL A HG13 1 
ATOM   5991  H HG21 . VAL A 1 392 ? -52.890 18.329  22.590  1.00 16.39 ? 381  VAL A HG21 1 
ATOM   5992  H HG22 . VAL A 1 392 ? -53.123 17.185  23.668  1.00 16.39 ? 381  VAL A HG22 1 
ATOM   5993  H HG23 . VAL A 1 392 ? -52.453 18.560  24.100  1.00 16.39 ? 381  VAL A HG23 1 
ATOM   5994  N N    . ALA A 1 393 ? -48.179 16.481  23.970  1.00 11.38 ? 382  ALA A N    1 
ATOM   5995  C CA   . ALA A 1 393 ? -46.967 15.715  23.757  1.00 10.58 ? 382  ALA A CA   1 
ATOM   5996  C C    . ALA A 1 393 ? -46.767 14.626  24.803  1.00 10.57 ? 382  ALA A C    1 
ATOM   5997  O O    . ALA A 1 393 ? -46.407 13.497  24.471  1.00 11.54 ? 382  ALA A O    1 
ATOM   5998  C CB   . ALA A 1 393 ? -45.743 16.632  23.698  1.00 11.61 ? 382  ALA A CB   1 
ATOM   5999  H H    . ALA A 1 393 ? -48.073 17.334  24.011  1.00 13.65 ? 382  ALA A H    1 
ATOM   6000  H HA   . ALA A 1 393 ? -47.037 15.274  22.896  1.00 12.70 ? 382  ALA A HA   1 
ATOM   6001  H HB1  . ALA A 1 393 ? -44.950 16.091  23.555  1.00 13.93 ? 382  ALA A HB1  1 
ATOM   6002  H HB2  . ALA A 1 393 ? -45.853 17.258  22.965  1.00 13.93 ? 382  ALA A HB2  1 
ATOM   6003  H HB3  . ALA A 1 393 ? -45.668 17.114  24.536  1.00 13.93 ? 382  ALA A HB3  1 
ATOM   6004  N N    . VAL A 1 394 ? -46.909 14.961  26.081  1.00 11.24 ? 383  VAL A N    1 
ATOM   6005  C CA   . VAL A 1 394 ? -46.543 14.030  27.143  1.00 11.35 ? 383  VAL A CA   1 
ATOM   6006  C C    . VAL A 1 394 ? -47.656 13.046  27.451  1.00 10.52 ? 383  VAL A C    1 
ATOM   6007  O O    . VAL A 1 394 ? -47.393 12.075  28.148  1.00 11.60 ? 383  VAL A O    1 
ATOM   6008  C CB   . VAL A 1 394 ? -46.047 14.708  28.441  1.00 11.50 ? 383  VAL A CB   1 
ATOM   6009  C CG1  . VAL A 1 394 ? -44.849 15.597  28.151  1.00 11.57 ? 383  VAL A CG1  1 
ATOM   6010  C CG2  . VAL A 1 394 ? -47.168 15.458  29.154  1.00 12.07 ? 383  VAL A CG2  1 
ATOM   6011  H H    . VAL A 1 394 ? -47.214 15.715  26.359  1.00 13.49 ? 383  VAL A H    1 
ATOM   6012  H HA   . VAL A 1 394 ? -45.798 13.502  26.814  1.00 13.62 ? 383  VAL A HA   1 
ATOM   6013  H HB   . VAL A 1 394 ? -45.743 14.012  29.045  1.00 13.80 ? 383  VAL A HB   1 
ATOM   6014  H HG11 . VAL A 1 394 ? -44.555 16.011  28.978  1.00 13.88 ? 383  VAL A HG11 1 
ATOM   6015  H HG12 . VAL A 1 394 ? -44.135 15.054  27.781  1.00 13.88 ? 383  VAL A HG12 1 
ATOM   6016  H HG13 . VAL A 1 394 ? -45.110 16.280  27.513  1.00 13.88 ? 383  VAL A HG13 1 
ATOM   6017  H HG21 . VAL A 1 394 ? -46.812 15.865  29.959  1.00 14.48 ? 383  VAL A HG21 1 
ATOM   6018  H HG22 . VAL A 1 394 ? -47.515 16.143  28.562  1.00 14.48 ? 383  VAL A HG22 1 
ATOM   6019  H HG23 . VAL A 1 394 ? -47.871 14.830  29.383  1.00 14.48 ? 383  VAL A HG23 1 
ATOM   6020  N N    . THR A 1 395 ? -48.865 13.243  26.898  1.00 10.86 ? 384  THR A N    1 
ATOM   6021  C CA   . THR A 1 395 ? -49.969 12.293  27.087  1.00 10.45 ? 384  THR A CA   1 
ATOM   6022  C C    . THR A 1 395 ? -50.228 11.416  25.874  1.00 10.86 ? 384  THR A C    1 
ATOM   6023  O O    . THR A 1 395 ? -50.822 10.337  26.028  1.00 11.11 ? 384  THR A O    1 
ATOM   6024  C CB   . THR A 1 395 ? -51.268 12.978  27.530  1.00 11.81 ? 384  THR A CB   1 
ATOM   6025  O OG1  . THR A 1 395 ? -51.714 13.913  26.548  1.00 11.93 ? 384  THR A OG1  1 
ATOM   6026  C CG2  . THR A 1 395 ? -51.107 13.596  28.887  1.00 13.53 ? 384  THR A CG2  1 
ATOM   6027  H H    . THR A 1 395 ? -49.069 13.921  26.409  1.00 13.03 ? 384  THR A H    1 
ATOM   6028  H HA   . THR A 1 395 ? -49.714 11.696  27.808  1.00 12.54 ? 384  THR A HA   1 
ATOM   6029  H HB   . THR A 1 395 ? -51.949 12.293  27.615  1.00 14.17 ? 384  THR A HB   1 
ATOM   6030  H HG1  . THR A 1 395 ? -51.129 14.504  26.428  1.00 14.32 ? 384  THR A HG1  1 
ATOM   6031  H HG21 . THR A 1 395 ? -51.934 14.025  29.156  1.00 16.24 ? 384  THR A HG21 1 
ATOM   6032  H HG22 . THR A 1 395 ? -50.881 12.912  29.537  1.00 16.24 ? 384  THR A HG22 1 
ATOM   6033  H HG23 . THR A 1 395 ? -50.400 14.259  28.867  1.00 16.24 ? 384  THR A HG23 1 
ATOM   6034  N N    . SER A 1 396 ? -49.784 11.819  24.676  1.00 11.43 ? 385  SER A N    1 
ATOM   6035  C CA   . SER A 1 396 ? -49.925 10.966  23.496  1.00 10.32 ? 385  SER A CA   1 
ATOM   6036  C C    . SER A 1 396 ? -48.776 11.094  22.494  1.00 10.70 ? 385  SER A C    1 
ATOM   6037  O O    . SER A 1 396 ? -48.246 10.094  22.037  1.00 11.12 ? 385  SER A O    1 
ATOM   6038  C CB   . SER A 1 396 ? -51.238 11.197  22.751  1.00 11.39 ? 385  SER A CB   1 
ATOM   6039  O OG   . SER A 1 396 ? -51.362 12.508  22.219  1.00 11.21 ? 385  SER A OG   1 
ATOM   6040  H H    . SER A 1 396 ? -49.402 12.575  24.524  1.00 13.71 ? 385  SER A H    1 
ATOM   6041  H HA   . SER A 1 396 ? -49.933 10.044  23.798  1.00 12.39 ? 385  SER A HA   1 
ATOM   6042  H HB2  . SER A 1 396 ? -51.293 10.563  22.019  1.00 13.67 ? 385  SER A HB2  1 
ATOM   6043  H HB3  . SER A 1 396 ? -51.972 11.045  23.367  1.00 13.67 ? 385  SER A HB3  1 
ATOM   6044  H HG   . SER A 1 396 ? -51.325 13.074  22.838  1.00 13.45 ? 385  SER A HG   1 
ATOM   6045  N N    . THR A 1 397 ? -48.430 12.309  22.061  1.00 10.60 ? 386  THR A N    1 
ATOM   6046  C CA   . THR A 1 397 ? -47.650 12.409  20.840  1.00 10.36 ? 386  THR A CA   1 
ATOM   6047  C C    . THR A 1 397 ? -46.237 11.863  20.989  1.00 11.00 ? 386  THR A C    1 
ATOM   6048  O O    . THR A 1 397 ? -45.743 11.167  20.098  1.00 11.09 ? 386  THR A O    1 
ATOM   6049  C CB   . THR A 1 397 ? -47.583 13.845  20.318  1.00 10.45 ? 386  THR A CB   1 
ATOM   6050  O OG1  . THR A 1 397 ? -48.826 14.496  20.486  1.00 11.58 ? 386  THR A OG1  1 
ATOM   6051  C CG2  . THR A 1 397 ? -47.146 13.849  18.868  1.00 11.96 ? 386  THR A CG2  1 
ATOM   6052  H H    . THR A 1 397 ? -48.626 13.056  22.440  1.00 12.72 ? 386  THR A H    1 
ATOM   6053  H HA   . THR A 1 397 ? -48.090 11.877  20.158  1.00 12.43 ? 386  THR A HA   1 
ATOM   6054  H HB   . THR A 1 397 ? -46.912 14.326  20.827  1.00 12.54 ? 386  THR A HB   1 
ATOM   6055  H HG1  . THR A 1 397 ? -49.424 14.085  20.063  1.00 13.89 ? 386  THR A HG1  1 
ATOM   6056  H HG21 . THR A 1 397 ? -47.104 14.760  18.538  1.00 14.35 ? 386  THR A HG21 1 
ATOM   6057  H HG22 . THR A 1 397 ? -46.269 13.442  18.785  1.00 14.35 ? 386  THR A HG22 1 
ATOM   6058  H HG23 . THR A 1 397 ? -47.779 13.348  18.330  1.00 14.35 ? 386  THR A HG23 1 
ATOM   6059  N N    . ASN A 1 398 ? -45.581 12.143  22.107  1.00 10.58 ? 387  ASN A N    1 
ATOM   6060  C CA   . ASN A 1 398 ? -44.236 11.584  22.277  1.00 11.04 ? 387  ASN A CA   1 
ATOM   6061  C C    . ASN A 1 398 ? -44.265 10.060  22.307  1.00 11.87 ? 387  ASN A C    1 
ATOM   6062  O O    . ASN A 1 398 ? -43.409 9.405   21.678  1.00 11.69 ? 387  ASN A O    1 
ATOM   6063  C CB   . ASN A 1 398 ? -43.615 12.080  23.573  1.00 11.09 ? 387  ASN A CB   1 
ATOM   6064  C CG   . ASN A 1 398 ? -43.244 13.531  23.533  1.00 11.19 ? 387  ASN A CG   1 
ATOM   6065  O OD1  . ASN A 1 398 ? -43.133 14.134  22.457  1.00 13.38 ? 387  ASN A OD1  1 
ATOM   6066  N ND2  . ASN A 1 398 ? -43.065 14.101  24.690  1.00 11.47 ? 387  ASN A ND2  1 
ATOM   6067  H H    . ASN A 1 398 ? -45.869 12.628  22.756  1.00 12.70 ? 387  ASN A H    1 
ATOM   6068  H HA   . ASN A 1 398 ? -43.674 11.866  21.539  1.00 13.25 ? 387  ASN A HA   1 
ATOM   6069  H HB2  . ASN A 1 398 ? -44.251 11.954  24.295  1.00 13.31 ? 387  ASN A HB2  1 
ATOM   6070  H HB3  . ASN A 1 398 ? -42.809 11.571  23.750  1.00 13.31 ? 387  ASN A HB3  1 
ATOM   6071  H HD21 . ASN A 1 398 ? -42.850 14.933  24.732  1.00 13.76 ? 387  ASN A HD21 1 
ATOM   6072  H HD22 . ASN A 1 398 ? -43.161 13.645  25.413  1.00 13.76 ? 387  ASN A HD22 1 
ATOM   6073  N N    . ALA A 1 399 ? -45.257 9.479   22.994  1.00 10.87 ? 388  ALA A N    1 
ATOM   6074  C CA   . ALA A 1 399 ? -45.390 8.030   23.005  1.00 11.29 ? 388  ALA A CA   1 
ATOM   6075  C C    . ALA A 1 399 ? -45.586 7.500   21.592  1.00 11.49 ? 388  ALA A C    1 
ATOM   6076  O O    . ALA A 1 399 ? -45.019 6.454   21.226  1.00 12.14 ? 388  ALA A O    1 
ATOM   6077  C CB   . ALA A 1 399 ? -46.591 7.653   23.886  1.00 13.23 ? 388  ALA A CB   1 
ATOM   6078  H H    . ALA A 1 399 ? -45.852 9.898   23.451  1.00 13.05 ? 388  ALA A H    1 
ATOM   6079  H HA   . ALA A 1 399 ? -44.590 7.630   23.381  1.00 13.55 ? 388  ALA A HA   1 
ATOM   6080  H HB1  . ALA A 1 399 ? -46.684 6.688   23.896  1.00 15.87 ? 388  ALA A HB1  1 
ATOM   6081  H HB2  . ALA A 1 399 ? -46.437 7.981   24.785  1.00 15.87 ? 388  ALA A HB2  1 
ATOM   6082  H HB3  . ALA A 1 399 ? -47.391 8.059   23.517  1.00 15.87 ? 388  ALA A HB3  1 
ATOM   6083  N N    . ALA A 1 400 ? -46.403 8.186   20.803  1.00 10.87 ? 389  ALA A N    1 
ATOM   6084  C CA   . ALA A 1 400 ? -46.645 7.749   19.435  1.00 11.48 ? 389  ALA A CA   1 
ATOM   6085  C C    . ALA A 1 400 ? -45.335 7.739   18.641  1.00 11.60 ? 389  ALA A C    1 
ATOM   6086  O O    . ALA A 1 400 ? -45.071 6.809   17.848  1.00 12.04 ? 389  ALA A O    1 
ATOM   6087  C CB   . ALA A 1 400 ? -47.689 8.620   18.765  1.00 11.48 ? 389  ALA A CB   1 
ATOM   6088  H H    . ALA A 1 400 ? -46.825 8.899   21.031  1.00 13.04 ? 389  ALA A H    1 
ATOM   6089  H HA   . ALA A 1 400 ? -46.986 6.841   19.453  1.00 13.77 ? 389  ALA A HA   1 
ATOM   6090  H HB1  . ALA A 1 400 ? -47.828 8.305   17.858  1.00 13.77 ? 389  ALA A HB1  1 
ATOM   6091  H HB2  . ALA A 1 400 ? -48.518 8.561   19.266  1.00 13.77 ? 389  ALA A HB2  1 
ATOM   6092  H HB3  . ALA A 1 400 ? -47.374 9.537   18.753  1.00 13.77 ? 389  ALA A HB3  1 
ATOM   6093  N N    . LYS A 1 401 ? -44.522 8.780   18.798  1.00 10.69 ? 390  LYS A N    1 
ATOM   6094  C CA   . LYS A 1 401 ? -43.249 8.836   18.079  1.00 10.99 ? 390  LYS A CA   1 
ATOM   6095  C C    . LYS A 1 401 ? -42.281 7.731   18.539  1.00 11.07 ? 390  LYS A C    1 
ATOM   6096  O O    . LYS A 1 401 ? -41.618 7.108   17.720  1.00 11.62 ? 390  LYS A O    1 
ATOM   6097  C CB   . LYS A 1 401 ? -42.647 10.216  18.237  1.00 11.99 ? 390  LYS A CB   1 
ATOM   6098  C CG   . LYS A 1 401 ? -43.410 11.292  17.445  1.00 11.60 ? 390  LYS A CG   1 
ATOM   6099  C CD   . LYS A 1 401 ? -42.961 12.681  17.767  1.00 12.31 ? 390  LYS A CD   1 
ATOM   6100  C CE   . LYS A 1 401 ? -43.705 13.694  16.953  1.00 12.46 ? 390  LYS A CE   1 
ATOM   6101  N NZ   . LYS A 1 401 ? -43.515 15.116  17.457  1.00 13.15 ? 390  LYS A NZ   1 
ATOM   6102  H H    . LYS A 1 401 ? -44.678 9.457   19.306  1.00 12.83 ? 390  LYS A H    1 
ATOM   6103  H HA   . LYS A 1 401 ? -43.422 8.698   17.134  1.00 13.19 ? 390  LYS A HA   1 
ATOM   6104  H HB2  . LYS A 1 401 ? -42.665 10.463  19.175  1.00 14.38 ? 390  LYS A HB2  1 
ATOM   6105  H HB3  . LYS A 1 401 ? -41.731 10.200  17.916  1.00 14.38 ? 390  LYS A HB3  1 
ATOM   6106  H HG2  . LYS A 1 401 ? -43.270 11.144  16.497  1.00 13.91 ? 390  LYS A HG2  1 
ATOM   6107  H HG3  . LYS A 1 401 ? -44.355 11.227  17.655  1.00 13.91 ? 390  LYS A HG3  1 
ATOM   6108  H HD2  . LYS A 1 401 ? -43.126 12.862  18.705  1.00 14.78 ? 390  LYS A HD2  1 
ATOM   6109  H HD3  . LYS A 1 401 ? -42.015 12.766  17.569  1.00 14.78 ? 390  LYS A HD3  1 
ATOM   6110  H HE2  . LYS A 1 401 ? -43.388 13.657  16.037  1.00 14.95 ? 390  LYS A HE2  1 
ATOM   6111  H HE3  . LYS A 1 401 ? -44.653 13.490  16.985  1.00 14.95 ? 390  LYS A HE3  1 
ATOM   6112  H HZ1  . LYS A 1 401 ? -43.806 15.182  18.295  1.00 15.78 ? 390  LYS A HZ1  1 
ATOM   6113  H HZ2  . LYS A 1 401 ? -42.653 15.335  17.431  1.00 15.78 ? 390  LYS A HZ2  1 
ATOM   6114  H HZ3  . LYS A 1 401 ? -43.973 15.683  16.946  1.00 15.78 ? 390  LYS A HZ3  1 
ATOM   6115  N N    . VAL A 1 402 ? -42.191 7.476   19.845  1.00 10.91 ? 391  VAL A N    1 
ATOM   6116  C CA   . VAL A 1 402 ? -41.283 6.474   20.375  1.00 10.69 ? 391  VAL A CA   1 
ATOM   6117  C C    . VAL A 1 402 ? -41.665 5.110   19.848  1.00 11.19 ? 391  VAL A C    1 
ATOM   6118  O O    . VAL A 1 402 ? -40.805 4.298   19.540  1.00 12.27 ? 391  VAL A O    1 
ATOM   6119  C CB   . VAL A 1 402 ? -41.288 6.533   21.908  1.00 11.73 ? 391  VAL A CB   1 
ATOM   6120  C CG1  . VAL A 1 402 ? -40.622 5.282   22.526  1.00 12.34 ? 391  VAL A CG1  1 
ATOM   6121  C CG2  . VAL A 1 402 ? -40.629 7.791   22.411  1.00 12.12 ? 391  VAL A CG2  1 
ATOM   6122  H H    . VAL A 1 402 ? -42.655 7.878   20.447  1.00 13.10 ? 391  VAL A H    1 
ATOM   6123  H HA   . VAL A 1 402 ? -40.383 6.671   20.071  1.00 12.83 ? 391  VAL A HA   1 
ATOM   6124  H HB   . VAL A 1 402 ? -42.210 6.549   22.210  1.00 14.07 ? 391  VAL A HB   1 
ATOM   6125  H HG11 . VAL A 1 402 ? -40.646 5.358   23.493  1.00 14.81 ? 391  VAL A HG11 1 
ATOM   6126  H HG12 . VAL A 1 402 ? -41.110 4.493   22.244  1.00 14.81 ? 391  VAL A HG12 1 
ATOM   6127  H HG13 . VAL A 1 402 ? -39.703 5.231   22.220  1.00 14.81 ? 391  VAL A HG13 1 
ATOM   6128  H HG21 . VAL A 1 402 ? -40.652 7.793   23.381  1.00 14.55 ? 391  VAL A HG21 1 
ATOM   6129  H HG22 . VAL A 1 402 ? -39.710 7.811   22.101  1.00 14.55 ? 391  VAL A HG22 1 
ATOM   6130  H HG23 . VAL A 1 402 ? -41.112 8.559   22.067  1.00 14.55 ? 391  VAL A HG23 1 
ATOM   6131  N N    . PHE A 1 403 ? -42.982 4.824   19.785  1.00 11.26 ? 392  PHE A N    1 
ATOM   6132  C CA   . PHE A 1 403 ? -43.449 3.477   19.463  1.00 10.91 ? 392  PHE A CA   1 
ATOM   6133  C C    . PHE A 1 403 ? -43.918 3.285   18.032  1.00 11.37 ? 392  PHE A C    1 
ATOM   6134  O O    . PHE A 1 403 ? -44.490 2.238   17.721  1.00 12.03 ? 392  PHE A O    1 
ATOM   6135  C CB   . PHE A 1 403 ? -44.476 3.029   20.495  1.00 12.50 ? 392  PHE A CB   1 
ATOM   6136  C CG   . PHE A 1 403 ? -43.867 2.824   21.876  1.00 11.53 ? 392  PHE A CG   1 
ATOM   6137  C CD1  . PHE A 1 403 ? -42.910 1.869   22.097  1.00 13.15 ? 392  PHE A CD1  1 
ATOM   6138  C CD2  . PHE A 1 403 ? -44.270 3.608   22.944  1.00 12.44 ? 392  PHE A CD2  1 
ATOM   6139  C CE1  . PHE A 1 403 ? -42.362 1.705   23.353  1.00 12.76 ? 392  PHE A CE1  1 
ATOM   6140  C CE2  . PHE A 1 403 ? -43.735 3.452   24.207  1.00 12.44 ? 392  PHE A CE2  1 
ATOM   6141  C CZ   . PHE A 1 403 ? -42.800 2.515   24.438  1.00 13.36 ? 392  PHE A CZ   1 
ATOM   6142  H H    . PHE A 1 403 ? -43.612 5.392   19.924  1.00 13.51 ? 392  PHE A H    1 
ATOM   6143  H HA   . PHE A 1 403 ? -42.689 2.884   19.571  1.00 13.09 ? 392  PHE A HA   1 
ATOM   6144  H HB2  . PHE A 1 403 ? -45.166 3.707   20.569  1.00 15.00 ? 392  PHE A HB2  1 
ATOM   6145  H HB3  . PHE A 1 403 ? -44.865 2.188   20.211  1.00 15.00 ? 392  PHE A HB3  1 
ATOM   6146  H HD1  . PHE A 1 403 ? -42.621 1.333   21.394  1.00 15.77 ? 392  PHE A HD1  1 
ATOM   6147  H HD2  . PHE A 1 403 ? -44.919 4.259   22.807  1.00 14.93 ? 392  PHE A HD2  1 
ATOM   6148  H HE1  . PHE A 1 403 ? -41.716 1.051   23.494  1.00 15.32 ? 392  PHE A HE1  1 
ATOM   6149  H HE2  . PHE A 1 403 ? -44.030 3.993   24.904  1.00 14.93 ? 392  PHE A HE2  1 
ATOM   6150  H HZ   . PHE A 1 403 ? -42.435 2.408   25.287  1.00 16.03 ? 392  PHE A HZ   1 
ATOM   6151  N N    . ASN A 1 404 ? -43.655 4.250   17.144  1.00 11.36 ? 393  ASN A N    1 
ATOM   6152  C CA   . ASN A 1 404 ? -43.908 4.115   15.710  1.00 12.06 ? 393  ASN A CA   1 
ATOM   6153  C C    . ASN A 1 404 ? -45.408 4.132   15.420  1.00 12.13 ? 393  ASN A C    1 
ATOM   6154  O O    . ASN A 1 404 ? -45.877 3.466   14.493  1.00 14.32 ? 393  ASN A O    1 
ATOM   6155  C CB   . ASN A 1 404 ? -43.202 2.910   15.104  1.00 12.45 ? 393  ASN A CB   1 
ATOM   6156  C CG   . ASN A 1 404 ? -42.562 3.235   13.778  1.00 12.16 ? 393  ASN A CG   1 
ATOM   6157  O OD1  . ASN A 1 404 ? -42.679 4.346   13.282  1.00 14.57 ? 393  ASN A OD1  1 
ATOM   6158  N ND2  . ASN A 1 404 ? -41.821 2.289   13.245  1.00 12.95 ? 393  ASN A ND2  1 
ATOM   6159  H H    . ASN A 1 404 ? -43.319 5.012   17.358  1.00 13.63 ? 393  ASN A H    1 
ATOM   6160  H HA   . ASN A 1 404 ? -43.536 4.898   15.275  1.00 14.47 ? 393  ASN A HA   1 
ATOM   6161  H HB2  . ASN A 1 404 ? -42.507 2.611   15.710  1.00 14.94 ? 393  ASN A HB2  1 
ATOM   6162  H HB3  . ASN A 1 404 ? -43.849 2.201   14.962  1.00 14.94 ? 393  ASN A HB3  1 
ATOM   6163  H HD21 . ASN A 1 404 ? -41.433 2.421   12.489  1.00 15.54 ? 393  ASN A HD21 1 
ATOM   6164  H HD22 . ASN A 1 404 ? -41.725 1.537   13.652  1.00 15.54 ? 393  ASN A HD22 1 
ATOM   6165  N N    . LEU A 1 405 ? -46.128 4.994   16.144  1.00 12.02 ? 394  LEU A N    1 
ATOM   6166  C CA   . LEU A 1 405 ? -47.564 5.182   15.997  1.00 12.79 ? 394  LEU A CA   1 
ATOM   6167  C C    . LEU A 1 405 ? -47.933 6.591   15.559  1.00 11.84 ? 394  LEU A C    1 
ATOM   6168  O O    . LEU A 1 405 ? -49.109 6.931   15.586  1.00 13.62 ? 394  LEU A O    1 
ATOM   6169  C CB   . LEU A 1 405 ? -48.280 4.861   17.323  1.00 14.87 ? 394  LEU A CB   1 
ATOM   6170  C CG   . LEU A 1 405 ? -48.186 3.444   17.889  1.00 18.23 ? 394  LEU A CG   1 
ATOM   6171  C CD1  . LEU A 1 405 ? -48.464 3.396   19.390  1.00 20.09 ? 394  LEU A CD1  1 
ATOM   6172  C CD2  . LEU A 1 405 ? -49.147 2.566   17.218  1.00 23.77 ? 394  LEU A CD2  1 
ATOM   6173  H H    . LEU A 1 405 ? -45.786 5.498   16.751  1.00 14.42 ? 394  LEU A H    1 
ATOM   6174  H HA   . LEU A 1 405 ? -47.894 4.566   15.324  1.00 15.35 ? 394  LEU A HA   1 
ATOM   6175  H HB2  . LEU A 1 405 ? -47.924 5.457   18.001  1.00 17.84 ? 394  LEU A HB2  1 
ATOM   6176  H HB3  . LEU A 1 405 ? -49.223 5.051   17.202  1.00 17.84 ? 394  LEU A HB3  1 
ATOM   6177  H HG   . LEU A 1 405 ? -47.294 3.095   17.734  1.00 21.87 ? 394  LEU A HG   1 
ATOM   6178  H HD11 . LEU A 1 405 ? -48.391 2.478   19.695  1.00 24.11 ? 394  LEU A HD11 1 
ATOM   6179  H HD12 . LEU A 1 405 ? -47.813 3.950   19.849  1.00 24.11 ? 394  LEU A HD12 1 
ATOM   6180  H HD13 . LEU A 1 405 ? -49.359 3.730   19.556  1.00 24.11 ? 394  LEU A HD13 1 
ATOM   6181  H HD21 . LEU A 1 405 ? -49.072 1.673   17.591  1.00 28.52 ? 394  LEU A HD21 1 
ATOM   6182  H HD22 . LEU A 1 405 ? -50.042 2.910   17.361  1.00 28.52 ? 394  LEU A HD22 1 
ATOM   6183  H HD23 . LEU A 1 405 ? -48.947 2.546   16.269  1.00 28.52 ? 394  LEU A HD23 1 
ATOM   6184  N N    . TYR A 1 406 ? -46.973 7.393   15.129  1.00 12.76 ? 395  TYR A N    1 
ATOM   6185  C CA   . TYR A 1 406 ? -47.217 8.784   14.755  1.00 12.51 ? 395  TYR A CA   1 
ATOM   6186  C C    . TYR A 1 406 ? -47.159 8.951   13.229  1.00 12.78 ? 395  TYR A C    1 
ATOM   6187  O O    . TYR A 1 406 ? -46.224 8.455   12.608  1.00 14.17 ? 395  TYR A O    1 
ATOM   6188  C CB   . TYR A 1 406 ? -46.133 9.697   15.361  1.00 11.60 ? 395  TYR A CB   1 
ATOM   6189  C CG   . TYR A 1 406 ? -46.272 11.148  15.010  1.00 11.90 ? 395  TYR A CG   1 
ATOM   6190  C CD1  . TYR A 1 406 ? -47.166 11.950  15.715  1.00 12.28 ? 395  TYR A CD1  1 
ATOM   6191  C CD2  . TYR A 1 406 ? -45.516 11.719  14.012  1.00 12.58 ? 395  TYR A CD2  1 
ATOM   6192  C CE1  . TYR A 1 406 ? -47.309 13.257  15.434  1.00 12.92 ? 395  TYR A CE1  1 
ATOM   6193  C CE2  . TYR A 1 406 ? -45.636 13.042  13.707  1.00 13.17 ? 395  TYR A CE2  1 
ATOM   6194  C CZ   . TYR A 1 406 ? -46.540 13.804  14.411  1.00 12.22 ? 395  TYR A CZ   1 
ATOM   6195  O OH   . TYR A 1 406 ? -46.697 15.152  14.160  1.00 13.10 ? 395  TYR A OH   1 
ATOM   6196  H H    . TYR A 1 406 ? -46.152 7.153   15.043  1.00 15.32 ? 395  TYR A H    1 
ATOM   6197  H HA   . TYR A 1 406 ? -48.087 9.069   15.073  1.00 15.01 ? 395  TYR A HA   1 
ATOM   6198  H HB2  . TYR A 1 406 ? -46.171 9.624   16.328  1.00 13.92 ? 395  TYR A HB2  1 
ATOM   6199  H HB3  . TYR A 1 406 ? -45.265 9.400   15.046  1.00 13.92 ? 395  TYR A HB3  1 
ATOM   6200  H HD1  . TYR A 1 406 ? -47.679 11.572  16.393  1.00 14.74 ? 395  TYR A HD1  1 
ATOM   6201  H HD2  . TYR A 1 406 ? -44.913 11.193  13.539  1.00 15.10 ? 395  TYR A HD2  1 
ATOM   6202  H HE1  . TYR A 1 406 ? -47.911 13.783  15.909  1.00 15.51 ? 395  TYR A HE1  1 
ATOM   6203  H HE2  . TYR A 1 406 ? -45.125 13.421  13.029  1.00 15.80 ? 395  TYR A HE2  1 
ATOM   6204  H HH   . TYR A 1 406 ? -46.194 15.388  13.530  1.00 15.72 ? 395  TYR A HH   1 
ATOM   6205  N N    . PRO A 1 407 ? -48.101 9.686   12.606  1.00 12.83 ? 396  PRO A N    1 
ATOM   6206  C CA   . PRO A 1 407 ? -49.198 10.482  13.163  1.00 12.39 ? 396  PRO A CA   1 
ATOM   6207  C C    . PRO A 1 407 ? -50.531 9.737   13.250  1.00 11.89 ? 396  PRO A C    1 
ATOM   6208  O O    . PRO A 1 407 ? -51.538 10.358  13.495  1.00 12.79 ? 396  PRO A O    1 
ATOM   6209  C CB   . PRO A 1 407 ? -49.264 11.638  12.202  1.00 15.08 ? 396  PRO A CB   1 
ATOM   6210  C CG   . PRO A 1 407 ? -49.012 10.973  10.889  1.00 15.89 ? 396  PRO A CG   1 
ATOM   6211  C CD   . PRO A 1 407 ? -47.911 9.994   11.168  1.00 14.05 ? 396  PRO A CD   1 
ATOM   6212  H HA   . PRO A 1 407 ? -48.959 10.812  14.043  1.00 14.87 ? 396  PRO A HA   1 
ATOM   6213  H HB2  . PRO A 1 407 ? -50.144 12.045  12.227  1.00 18.09 ? 396  PRO A HB2  1 
ATOM   6214  H HB3  . PRO A 1 407 ? -48.570 12.285  12.408  1.00 18.09 ? 396  PRO A HB3  1 
ATOM   6215  H HG2  . PRO A 1 407 ? -49.814 10.515  10.594  1.00 19.07 ? 396  PRO A HG2  1 
ATOM   6216  H HG3  . PRO A 1 407 ? -48.730 11.632  10.236  1.00 19.07 ? 396  PRO A HG3  1 
ATOM   6217  H HD2  . PRO A 1 407 ? -48.024 9.194   10.631  1.00 16.86 ? 396  PRO A HD2  1 
ATOM   6218  H HD3  . PRO A 1 407 ? -47.045 10.405  11.020  1.00 16.86 ? 396  PRO A HD3  1 
ATOM   6219  N N    . ARG A 1 408 ? -50.531 8.403   13.102  1.00 12.70 ? 397  ARG A N    1 
ATOM   6220  C CA   . ARG A 1 408 ? -51.792 7.666   13.236  1.00 12.42 ? 397  ARG A CA   1 
ATOM   6221  C C    . ARG A 1 408 ? -52.470 8.005   14.565  1.00 12.43 ? 397  ARG A C    1 
ATOM   6222  O O    . ARG A 1 408 ? -53.689 8.236   14.626  1.00 12.53 ? 397  ARG A O    1 
ATOM   6223  C CB   . ARG A 1 408 ? -51.508 6.172   13.140  1.00 13.61 ? 397  ARG A CB   1 
ATOM   6224  C CG   . ARG A 1 408 ? -52.712 5.327   13.421  1.00 13.54 ? 397  ARG A CG   1 
ATOM   6225  C CD   . ARG A 1 408 ? -52.407 3.872   13.183  1.00 15.25 ? 397  ARG A CD   1 
ATOM   6226  N NE   . ARG A 1 408 ? -53.600 3.072   13.348  1.00 15.46 ? 397  ARG A NE   1 
ATOM   6227  C CZ   . ARG A 1 408 ? -53.672 1.790   13.006  1.00 15.89 ? 397  ARG A CZ   1 
ATOM   6228  N NH1  . ARG A 1 408 ? -52.588 1.168   12.544  1.00 16.94 ? 397  ARG A NH1  1 
ATOM   6229  N NH2  . ARG A 1 408 ? -54.819 1.140   13.098  1.00 19.42 ? 397  ARG A NH2  1 
ATOM   6230  H H    . ARG A 1 408 ? -49.841 7.919   12.930  1.00 15.24 ? 397  ARG A H    1 
ATOM   6231  H HA   . ARG A 1 408 ? -52.390 7.913   12.514  1.00 14.90 ? 397  ARG A HA   1 
ATOM   6232  H HB2  . ARG A 1 408 ? -51.201 5.967   12.243  1.00 16.34 ? 397  ARG A HB2  1 
ATOM   6233  H HB3  . ARG A 1 408 ? -50.822 5.940   13.786  1.00 16.34 ? 397  ARG A HB3  1 
ATOM   6234  H HG2  . ARG A 1 408 ? -52.975 5.437   14.348  1.00 16.25 ? 397  ARG A HG2  1 
ATOM   6235  H HG3  . ARG A 1 408 ? -53.435 5.589   12.831  1.00 16.25 ? 397  ARG A HG3  1 
ATOM   6236  H HD2  . ARG A 1 408 ? -52.081 3.754   12.277  1.00 18.30 ? 397  ARG A HD2  1 
ATOM   6237  H HD3  . ARG A 1 408 ? -51.744 3.571   13.824  1.00 18.30 ? 397  ARG A HD3  1 
ATOM   6238  H HE   . ARG A 1 408 ? -54.332 3.477   13.547  1.00 18.55 ? 397  ARG A HE   1 
ATOM   6239  H HH11 . ARG A 1 408 ? -51.849 1.600   12.459  1.00 20.33 ? 397  ARG A HH11 1 
ATOM   6240  H HH12 . ARG A 1 408 ? -52.627 0.337   12.329  1.00 20.33 ? 397  ARG A HH12 1 
ATOM   6241  H HH21 . ARG A 1 408 ? -55.514 1.538   13.412  1.00 23.30 ? 397  ARG A HH21 1 
ATOM   6242  H HH22 . ARG A 1 408 ? -54.853 0.302   12.908  1.00 23.30 ? 397  ARG A HH22 1 
ATOM   6243  N N    . LYS A 1 409 ? -51.682 8.006   15.624  1.00 11.66 ? 398  LYS A N    1 
ATOM   6244  C CA   . LYS A 1 409 ? -52.069 8.362   16.997  1.00 11.97 ? 398  LYS A CA   1 
ATOM   6245  C C    . LYS A 1 409 ? -51.342 9.653   17.391  1.00 11.53 ? 398  LYS A C    1 
ATOM   6246  O O    . LYS A 1 409 ? -50.324 10.019  16.815  1.00 12.63 ? 398  LYS A O    1 
ATOM   6247  C CB   . LYS A 1 409 ? -51.733 7.248   17.985  1.00 11.68 ? 398  LYS A CB   1 
ATOM   6248  C CG   . LYS A 1 409 ? -52.262 5.893   17.622  1.00 12.53 ? 398  LYS A CG   1 
ATOM   6249  C CD   . LYS A 1 409 ? -53.770 5.869   17.475  1.00 11.76 ? 398  LYS A CD   1 
ATOM   6250  C CE   . LYS A 1 409 ? -54.305 4.442   17.509  1.00 13.06 ? 398  LYS A CE   1 
ATOM   6251  N NZ   . LYS A 1 409 ? -55.782 4.402   17.206  1.00 13.09 ? 398  LYS A NZ   1 
ATOM   6252  H H    . LYS A 1 409 ? -50.851 7.789   15.575  1.00 13.99 ? 398  LYS A H    1 
ATOM   6253  H HA   . LYS A 1 409 ? -53.024 8.525   17.032  1.00 14.37 ? 398  LYS A HA   1 
ATOM   6254  H HB2  . LYS A 1 409 ? -50.768 7.177   18.052  1.00 14.01 ? 398  LYS A HB2  1 
ATOM   6255  H HB3  . LYS A 1 409 ? -52.101 7.483   18.851  1.00 14.01 ? 398  LYS A HB3  1 
ATOM   6256  H HG2  . LYS A 1 409 ? -51.874 5.620   16.775  1.00 15.03 ? 398  LYS A HG2  1 
ATOM   6257  H HG3  . LYS A 1 409 ? -52.018 5.262   18.317  1.00 15.03 ? 398  LYS A HG3  1 
ATOM   6258  H HD2  . LYS A 1 409 ? -54.172 6.363   18.208  1.00 14.11 ? 398  LYS A HD2  1 
ATOM   6259  H HD3  . LYS A 1 409 ? -54.017 6.267   16.626  1.00 14.11 ? 398  LYS A HD3  1 
ATOM   6260  H HE2  . LYS A 1 409 ? -53.842 3.910   16.843  1.00 15.67 ? 398  LYS A HE2  1 
ATOM   6261  H HE3  . LYS A 1 409 ? -54.166 4.068   18.394  1.00 15.67 ? 398  LYS A HE3  1 
ATOM   6262  H HZ1  . LYS A 1 409 ? -56.229 4.882   17.807  1.00 15.71 ? 398  LYS A HZ1  1 
ATOM   6263  H HZ2  . LYS A 1 409 ? -55.935 4.738   16.396  1.00 15.71 ? 398  LYS A HZ2  1 
ATOM   6264  H HZ3  . LYS A 1 409 ? -56.075 3.562   17.230  1.00 15.71 ? 398  LYS A HZ3  1 
ATOM   6265  N N    . GLY A 1 410 ? -51.855 10.323  18.430  1.00 11.38 ? 399  GLY A N    1 
ATOM   6266  C CA   . GLY A 1 410 ? -51.201 11.490  18.963  1.00 11.11 ? 399  GLY A CA   1 
ATOM   6267  C C    . GLY A 1 410 ? -51.324 12.755  18.144  1.00 11.66 ? 399  GLY A C    1 
ATOM   6268  O O    . GLY A 1 410 ? -50.616 13.747  18.428  1.00 12.23 ? 399  GLY A O    1 
ATOM   6269  H H    . GLY A 1 410 ? -52.583 10.111  18.836  1.00 13.65 ? 399  GLY A H    1 
ATOM   6270  H HA2  . GLY A 1 410 ? -51.563 11.673  19.844  1.00 13.33 ? 399  GLY A HA2  1 
ATOM   6271  H HA3  . GLY A 1 410 ? -50.256 11.296  19.065  1.00 13.33 ? 399  GLY A HA3  1 
ATOM   6272  N N    . ARG A 1 411 ? -52.225 12.786  17.156  1.00 12.56 ? 400  ARG A N    1 
ATOM   6273  C CA   . ARG A 1 411 ? -52.354 13.972  16.316  1.00 12.98 ? 400  ARG A CA   1 
ATOM   6274  C C    . ARG A 1 411 ? -53.718 14.072  15.663  1.00 12.90 ? 400  ARG A C    1 
ATOM   6275  O O    . ARG A 1 411 ? -54.207 13.119  15.037  1.00 13.63 ? 400  ARG A O    1 
ATOM   6276  C CB   . ARG A 1 411 ? -51.285 13.982  15.229  1.00 13.58 ? 400  ARG A CB   1 
ATOM   6277  C CG   . ARG A 1 411 ? -51.233 15.303  14.467  1.00 13.58 ? 400  ARG A CG   1 
ATOM   6278  C CD   . ARG A 1 411 ? -49.964 15.401  13.649  1.00 13.67 ? 400  ARG A CD   1 
ATOM   6279  N NE   . ARG A 1 411 ? -49.772 16.703  13.014  1.00 13.97 ? 400  ARG A NE   1 
ATOM   6280  C CZ   . ARG A 1 411 ? -49.303 17.788  13.612  1.00 16.08 ? 400  ARG A CZ   1 
ATOM   6281  N NH1  . ARG A 1 411 ? -49.037 17.766  14.909  1.00 15.28 ? 400  ARG A NH1  1 
ATOM   6282  N NH2  . ARG A 1 411 ? -49.100 18.890  12.897  1.00 16.03 ? 400  ARG A NH2  1 
ATOM   6283  H H    . ARG A 1 411 ? -52.761 12.144  16.957  1.00 15.07 ? 400  ARG A H    1 
ATOM   6284  H HA   . ARG A 1 411 ? -52.228 14.761  16.866  1.00 15.58 ? 400  ARG A HA   1 
ATOM   6285  H HB2  . ARG A 1 411 ? -50.417 13.837  15.637  1.00 16.30 ? 400  ARG A HB2  1 
ATOM   6286  H HB3  . ARG A 1 411 ? -51.475 13.275  14.592  1.00 16.30 ? 400  ARG A HB3  1 
ATOM   6287  H HG2  . ARG A 1 411 ? -51.991 15.357  13.864  1.00 16.29 ? 400  ARG A HG2  1 
ATOM   6288  H HG3  . ARG A 1 411 ? -51.249 16.039  15.097  1.00 16.29 ? 400  ARG A HG3  1 
ATOM   6289  H HD2  . ARG A 1 411 ? -49.205 15.240  14.230  1.00 16.40 ? 400  ARG A HD2  1 
ATOM   6290  H HD3  . ARG A 1 411 ? -49.991 14.731  12.949  1.00 16.40 ? 400  ARG A HD3  1 
ATOM   6291  H HE   . ARG A 1 411 ? -49.981 16.770  12.182  1.00 16.77 ? 400  ARG A HE   1 
ATOM   6292  H HH11 . ARG A 1 411 ? -49.151 17.042  15.359  1.00 18.34 ? 400  ARG A HH11 1 
ATOM   6293  H HH12 . ARG A 1 411 ? -48.742 18.473  15.300  1.00 18.34 ? 400  ARG A HH12 1 
ATOM   6294  H HH21 . ARG A 1 411 ? -49.292 18.899  12.059  1.00 19.23 ? 400  ARG A HH21 1 
ATOM   6295  H HH22 . ARG A 1 411 ? -48.828 19.608  13.283  1.00 19.23 ? 400  ARG A HH22 1 
ATOM   6296  N N    . ILE A 1 412 ? -54.307 15.262  15.751  1.00 13.08 ? 401  ILE A N    1 
ATOM   6297  C CA   . ILE A 1 412 ? -55.536 15.558  15.019  1.00 13.07 ? 401  ILE A CA   1 
ATOM   6298  C C    . ILE A 1 412 ? -55.090 16.084  13.663  1.00 13.71 ? 401  ILE A C    1 
ATOM   6299  O O    . ILE A 1 412 ? -54.733 17.263  13.514  1.00 15.44 ? 401  ILE A O    1 
ATOM   6300  C CB   . ILE A 1 412 ? -56.437 16.541  15.772  1.00 14.52 ? 401  ILE A CB   1 
ATOM   6301  C CG1  . ILE A 1 412 ? -56.810 15.978  17.161  1.00 14.87 ? 401  ILE A CG1  1 
ATOM   6302  C CG2  . ILE A 1 412 ? -57.663 16.890  14.917  1.00 15.22 ? 401  ILE A CG2  1 
ATOM   6303  C CD1  . ILE A 1 412 ? -57.583 16.855  18.013  1.00 16.18 ? 401  ILE A CD1  1 
ATOM   6304  H H    . ILE A 1 412 ? -54.014 15.915  16.228  1.00 15.69 ? 401  ILE A H    1 
ATOM   6305  H HA   . ILE A 1 412 ? -56.032 14.737  14.879  1.00 15.68 ? 401  ILE A HA   1 
ATOM   6306  H HB   . ILE A 1 412 ? -55.933 17.357  15.911  1.00 17.43 ? 401  ILE A HB   1 
ATOM   6307  H HG12 . ILE A 1 412 ? -57.329 15.168  17.033  1.00 17.85 ? 401  ILE A HG12 1 
ATOM   6308  H HG13 . ILE A 1 412 ? -55.990 15.764  17.634  1.00 17.85 ? 401  ILE A HG13 1 
ATOM   6309  H HG21 . ILE A 1 412 ? -58.223 17.512  15.407  1.00 18.26 ? 401  ILE A HG21 1 
ATOM   6310  H HG22 . ILE A 1 412 ? -57.363 17.296  14.088  1.00 18.26 ? 401  ILE A HG22 1 
ATOM   6311  H HG23 . ILE A 1 412 ? -58.157 16.077  14.728  1.00 18.26 ? 401  ILE A HG23 1 
ATOM   6312  H HD11 . ILE A 1 412 ? -57.759 16.403  18.854  1.00 19.42 ? 401  ILE A HD11 1 
ATOM   6313  H HD12 . ILE A 1 412 ? -57.077 17.666  18.173  1.00 19.42 ? 401  ILE A HD12 1 
ATOM   6314  H HD13 . ILE A 1 412 ? -58.419 17.068  17.570  1.00 19.42 ? 401  ILE A HD13 1 
ATOM   6315  N N    . ALA A 1 413 ? -55.136 15.206  12.677  1.00 14.22 ? 402  ALA A N    1 
ATOM   6316  C CA   . ALA A 1 413 ? -54.697 15.513  11.321  1.00 15.55 ? 402  ALA A CA   1 
ATOM   6317  C C    . ALA A 1 413 ? -55.434 14.608  10.351  1.00 15.16 ? 402  ALA A C    1 
ATOM   6318  O O    . ALA A 1 413 ? -55.853 13.485  10.699  1.00 15.13 ? 402  ALA A O    1 
ATOM   6319  C CB   . ALA A 1 413 ? -53.203 15.282  11.170  1.00 15.67 ? 402  ALA A CB   1 
ATOM   6320  H H    . ALA A 1 413 ? -55.427 14.402  12.768  1.00 17.06 ? 402  ALA A H    1 
ATOM   6321  H HA   . ALA A 1 413 ? -54.898 16.438  11.107  1.00 18.67 ? 402  ALA A HA   1 
ATOM   6322  H HB1  . ALA A 1 413 ? -52.942 15.494  10.260  1.00 18.81 ? 402  ALA A HB1  1 
ATOM   6323  H HB2  . ALA A 1 413 ? -52.730 15.857  11.792  1.00 18.81 ? 402  ALA A HB2  1 
ATOM   6324  H HB3  . ALA A 1 413 ? -53.006 14.352  11.363  1.00 18.81 ? 402  ALA A HB3  1 
ATOM   6325  N N    . VAL A 1 414 ? -55.620 15.107  9.134   1.00 15.72 ? 403  VAL A N    1 
ATOM   6326  C CA   . VAL A 1 414 ? -56.323 14.314  8.138   1.00 16.31 ? 403  VAL A CA   1 
ATOM   6327  C C    . VAL A 1 414 ? -55.570 13.005  7.918   1.00 16.21 ? 403  VAL A C    1 
ATOM   6328  O O    . VAL A 1 414 ? -54.354 12.996  7.746   1.00 16.35 ? 403  VAL A O    1 
ATOM   6329  C CB   . VAL A 1 414 ? -56.475 15.102  6.835   1.00 18.26 ? 403  VAL A CB   1 
ATOM   6330  C CG1  . VAL A 1 414 ? -56.947 14.188  5.701   1.00 21.25 ? 403  VAL A CG1  1 
ATOM   6331  C CG2  . VAL A 1 414 ? -57.410 16.280  7.037   1.00 20.04 ? 403  VAL A CG2  1 
ATOM   6332  H H    . VAL A 1 414 ? -55.357 15.881  8.867   1.00 18.87 ? 403  VAL A H    1 
ATOM   6333  H HA   . VAL A 1 414 ? -57.210 14.101  8.468   1.00 19.58 ? 403  VAL A HA   1 
ATOM   6334  H HB   . VAL A 1 414 ? -55.608 15.456  6.584   1.00 21.92 ? 403  VAL A HB   1 
ATOM   6335  H HG11 . VAL A 1 414 ? -57.035 14.712  4.889   1.00 25.50 ? 403  VAL A HG11 1 
ATOM   6336  H HG12 . VAL A 1 414 ? -56.293 13.483  5.571   1.00 25.50 ? 403  VAL A HG12 1 
ATOM   6337  H HG13 . VAL A 1 414 ? -57.805 13.804  5.942   1.00 25.50 ? 403  VAL A HG13 1 
ATOM   6338  H HG21 . VAL A 1 414 ? -57.493 16.764  6.201   1.00 24.05 ? 403  VAL A HG21 1 
ATOM   6339  H HG22 . VAL A 1 414 ? -58.279 15.949  7.315   1.00 24.05 ? 403  VAL A HG22 1 
ATOM   6340  H HG23 . VAL A 1 414 ? -57.042 16.860  7.722   1.00 24.05 ? 403  VAL A HG23 1 
ATOM   6341  N N    . GLY A 1 415 ? -56.305 11.899  7.920   1.00 16.00 ? 404  GLY A N    1 
ATOM   6342  C CA   . GLY A 1 415 ? -55.780 10.574  7.751   1.00 15.96 ? 404  GLY A CA   1 
ATOM   6343  C C    . GLY A 1 415 ? -55.445 9.871   9.044   1.00 15.57 ? 404  GLY A C    1 
ATOM   6344  O O    . GLY A 1 415 ? -55.184 8.639   9.030   1.00 16.58 ? 404  GLY A O    1 
ATOM   6345  H H    . GLY A 1 415 ? -57.159 11.906  8.024   1.00 19.20 ? 404  GLY A H    1 
ATOM   6346  H HA2  . GLY A 1 415 ? -56.430 10.034  7.274   1.00 19.15 ? 404  GLY A HA2  1 
ATOM   6347  H HA3  . GLY A 1 415 ? -54.973 10.619  7.215   1.00 19.15 ? 404  GLY A HA3  1 
ATOM   6348  N N    . SER A 1 416 ? -55.359 10.605  10.158  1.00 14.54 ? 405  SER A N    1 
ATOM   6349  C CA   . SER A 1 416 ? -55.081 9.988   11.441  1.00 13.60 ? 405  SER A CA   1 
ATOM   6350  C C    . SER A 1 416 ? -56.321 9.287   11.978  1.00 13.70 ? 405  SER A C    1 
ATOM   6351  O O    . SER A 1 416 ? -57.450 9.502   11.525  1.00 15.19 ? 405  SER A O    1 
ATOM   6352  C CB   . SER A 1 416 ? -54.602 11.040  12.421  1.00 14.25 ? 405  SER A CB   1 
ATOM   6353  O OG   . SER A 1 416 ? -53.385 11.641  11.984  1.00 14.91 ? 405  SER A OG   1 
ATOM   6354  H H    . SER A 1 416 ? -55.459 11.458  10.190  1.00 17.45 ? 405  SER A H    1 
ATOM   6355  H HA   . SER A 1 416 ? -54.378 9.328   11.334  1.00 16.32 ? 405  SER A HA   1 
ATOM   6356  H HB2  . SER A 1 416 ? -55.281 11.728  12.500  1.00 17.10 ? 405  SER A HB2  1 
ATOM   6357  H HB3  . SER A 1 416 ? -54.454 10.621  13.283  1.00 17.10 ? 405  SER A HB3  1 
ATOM   6358  H HG   . SER A 1 416 ? -52.786 11.057  11.912  1.00 17.89 ? 405  SER A HG   1 
ATOM   6359  N N    . ASP A 1 417 ? -56.099 8.444   12.976  1.00 12.66 ? 406  ASP A N    1 
ATOM   6360  C CA   . ASP A 1 417 ? -57.219 7.751   13.606  1.00 13.27 ? 406  ASP A CA   1 
ATOM   6361  C C    . ASP A 1 417 ? -58.080 8.717   14.399  1.00 12.90 ? 406  ASP A C    1 
ATOM   6362  O O    . ASP A 1 417 ? -57.586 9.647   15.033  1.00 13.59 ? 406  ASP A O    1 
ATOM   6363  C CB   . ASP A 1 417 ? -56.749 6.626   14.527  1.00 13.41 ? 406  ASP A CB   1 
ATOM   6364  C CG   . ASP A 1 417 ? -56.234 5.396   13.775  1.00 13.47 ? 406  ASP A CG   1 
ATOM   6365  O OD1  . ASP A 1 417 ? -56.309 5.371   12.528  1.00 14.73 ? 406  ASP A OD1  1 
ATOM   6366  O OD2  . ASP A 1 417 ? -55.807 4.448   14.469  1.00 14.00 ? 406  ASP A OD2  1 
ATOM   6367  H H    . ASP A 1 417 ? -55.326 8.256   13.303  1.00 15.19 ? 406  ASP A H    1 
ATOM   6368  H HA   . ASP A 1 417 ? -57.773 7.357   12.914  1.00 15.92 ? 406  ASP A HA   1 
ATOM   6369  H HB2  . ASP A 1 417 ? -56.027 6.957   15.084  1.00 16.09 ? 406  ASP A HB2  1 
ATOM   6370  H HB3  . ASP A 1 417 ? -57.492 6.345   15.084  1.00 16.09 ? 406  ASP A HB3  1 
ATOM   6371  N N    . ALA A 1 418 ? -59.386 8.446   14.386  1.00 14.15 ? 407  ALA A N    1 
ATOM   6372  C CA   . ALA A 1 418 ? -60.378 9.310   15.033  1.00 13.75 ? 407  ALA A CA   1 
ATOM   6373  C C    . ALA A 1 418 ? -60.497 8.970   16.526  1.00 13.40 ? 407  ALA A C    1 
ATOM   6374  O O    . ALA A 1 418 ? -61.532 8.473   16.996  1.00 15.34 ? 407  ALA A O    1 
ATOM   6375  C CB   . ALA A 1 418 ? -61.701 9.247   14.293  1.00 15.00 ? 407  ALA A CB   1 
ATOM   6376  H H    . ALA A 1 418 ? -59.729 7.757   14.002  1.00 16.98 ? 407  ALA A H    1 
ATOM   6377  H HA   . ALA A 1 418 ? -60.063 10.225  14.975  1.00 16.50 ? 407  ALA A HA   1 
ATOM   6378  H HB1  . ALA A 1 418 ? -62.340 9.825   14.739  1.00 18.00 ? 407  ALA A HB1  1 
ATOM   6379  H HB2  . ALA A 1 418 ? -61.566 9.545   13.379  1.00 18.00 ? 407  ALA A HB2  1 
ATOM   6380  H HB3  . ALA A 1 418 ? -62.023 8.332   14.298  1.00 18.00 ? 407  ALA A HB3  1 
ATOM   6381  N N    . ASP A 1 419 ? -59.434 9.278   17.260  1.00 13.00 ? 408  ASP A N    1 
ATOM   6382  C CA   . ASP A 1 419 ? -59.325 9.149   18.722  1.00 12.95 ? 408  ASP A CA   1 
ATOM   6383  C C    . ASP A 1 419 ? -59.130 10.563  19.240  1.00 12.86 ? 408  ASP A C    1 
ATOM   6384  O O    . ASP A 1 419 ? -58.060 11.156  19.079  1.00 13.96 ? 408  ASP A O    1 
ATOM   6385  C CB   . ASP A 1 419 ? -58.146 8.267   19.108  1.00 12.39 ? 408  ASP A CB   1 
ATOM   6386  C CG   . ASP A 1 419 ? -58.279 6.826   18.697  1.00 13.51 ? 408  ASP A CG   1 
ATOM   6387  O OD1  . ASP A 1 419 ? -59.376 6.365   18.310  1.00 16.26 ? 408  ASP A OD1  1 
ATOM   6388  O OD2  . ASP A 1 419 ? -57.239 6.116   18.794  1.00 14.76 ? 408  ASP A OD2  1 
ATOM   6389  H H    . ASP A 1 419 ? -58.710 9.586   16.912  1.00 15.60 ? 408  ASP A H    1 
ATOM   6390  H HA   . ASP A 1 419 ? -60.142 8.779   19.092  1.00 15.54 ? 408  ASP A HA   1 
ATOM   6391  H HB2  . ASP A 1 419 ? -57.345 8.619   18.690  1.00 14.87 ? 408  ASP A HB2  1 
ATOM   6392  H HB3  . ASP A 1 419 ? -58.046 8.288   20.073  1.00 14.87 ? 408  ASP A HB3  1 
ATOM   6393  N N    A LEU A 1 420 ? -60.163 11.083  19.896  0.49 13.04 ? 409  LEU A N    1 
ATOM   6394  N N    B LEU A 1 420 ? -60.164 11.167  19.803  0.51 15.71 ? 409  LEU A N    1 
ATOM   6395  C CA   A LEU A 1 420 ? -60.247 12.494  20.236  0.49 13.33 ? 409  LEU A CA   1 
ATOM   6396  C CA   B LEU A 1 420 ? -60.044 12.554  20.221  0.51 16.50 ? 409  LEU A CA   1 
ATOM   6397  C C    A LEU A 1 420 ? -60.860 12.675  21.611  0.49 14.10 ? 409  LEU A C    1 
ATOM   6398  C C    B LEU A 1 420 ? -60.887 12.775  21.467  0.51 12.57 ? 409  LEU A C    1 
ATOM   6399  O O    A LEU A 1 420 ? -61.658 11.850  22.074  0.49 15.21 ? 409  LEU A O    1 
ATOM   6400  O O    B LEU A 1 420 ? -61.863 12.061  21.697  0.51 12.94 ? 409  LEU A O    1 
ATOM   6401  C CB   A LEU A 1 420 ? -61.185 13.257  19.281  0.49 16.47 ? 409  LEU A CB   1 
ATOM   6402  C CB   B LEU A 1 420 ? -60.527 13.523  19.127  0.51 19.78 ? 409  LEU A CB   1 
ATOM   6403  C CG   A LEU A 1 420 ? -60.838 13.293  17.810  0.49 15.34 ? 409  LEU A CG   1 
ATOM   6404  C CG   B LEU A 1 420 ? -60.561 13.182  17.644  0.51 20.34 ? 409  LEU A CG   1 
ATOM   6405  C CD1  A LEU A 1 420 ? -61.836 14.027  16.959  0.49 21.91 ? 409  LEU A CD1  1 
ATOM   6406  C CD1  B LEU A 1 420 ? -61.587 12.137  17.250  0.51 22.48 ? 409  LEU A CD1  1 
ATOM   6407  C CD2  A LEU A 1 420 ? -59.434 13.889  17.625  0.49 23.49 ? 409  LEU A CD2  1 
ATOM   6408  C CD2  B LEU A 1 420 ? -60.800 14.449  16.874  0.51 16.27 ? 409  LEU A CD2  1 
ATOM   6409  H H    A LEU A 1 420 ? -60.842 10.626  20.159  0.49 15.64 ? 409  LEU A H    1 
ATOM   6410  H H    B LEU A 1 420 ? -60.930 10.806  19.952  0.51 18.85 ? 409  LEU A H    1 
ATOM   6411  H HA   A LEU A 1 420 ? -59.367 12.901  20.218  0.49 15.99 ? 409  LEU A HA   1 
ATOM   6412  H HA   B LEU A 1 420 ? -59.118 12.756  20.430  0.51 19.81 ? 409  LEU A HA   1 
ATOM   6413  H HB2  A LEU A 1 420 ? -62.067 12.859  19.351  0.49 19.77 ? 409  LEU A HB2  1 
ATOM   6414  H HB2  B LEU A 1 420 ? -61.437 13.768  19.358  0.51 23.74 ? 409  LEU A HB2  1 
ATOM   6415  H HB3  A LEU A 1 420 ? -61.230 14.178  19.581  0.49 19.77 ? 409  LEU A HB3  1 
ATOM   6416  H HB3  B LEU A 1 420 ? -59.975 14.317  19.199  0.51 23.74 ? 409  LEU A HB3  1 
ATOM   6417  H HG   A LEU A 1 420 ? -60.806 12.379  17.487  0.49 18.40 ? 409  LEU A HG   1 
ATOM   6418  H HG   B LEU A 1 420 ? -59.688 12.845  17.387  0.51 24.41 ? 409  LEU A HG   1 
ATOM   6419  H HD11 A LEU A 1 420 ? -61.541 14.003  16.035  0.49 26.29 ? 409  LEU A HD11 1 
ATOM   6420  H HD11 B LEU A 1 420 ? -61.533 11.988  16.293  0.51 26.98 ? 409  LEU A HD11 1 
ATOM   6421  H HD12 A LEU A 1 420 ? -62.700 13.593  17.041  0.49 26.29 ? 409  LEU A HD12 1 
ATOM   6422  H HD12 B LEU A 1 420 ? -61.397 11.313  17.725  0.51 26.98 ? 409  LEU A HD12 1 
ATOM   6423  H HD13 A LEU A 1 420 ? -61.897 14.945  17.264  0.49 26.29 ? 409  LEU A HD13 1 
ATOM   6424  H HD13 B LEU A 1 420 ? -62.471 12.459  17.486  0.51 26.98 ? 409  LEU A HD13 1 
ATOM   6425  H HD21 A LEU A 1 420 ? -59.221 13.907  16.678  0.49 28.19 ? 409  LEU A HD21 1 
ATOM   6426  H HD21 B LEU A 1 420 ? -60.823 14.243  15.927  0.51 19.52 ? 409  LEU A HD21 1 
ATOM   6427  H HD22 A LEU A 1 420 ? -59.423 14.790  17.984  0.49 28.19 ? 409  LEU A HD22 1 
ATOM   6428  H HD22 B LEU A 1 420 ? -61.648 14.831  17.151  0.51 19.52 ? 409  LEU A HD22 1 
ATOM   6429  H HD23 A LEU A 1 420 ? -58.792 13.336  18.097  0.49 28.19 ? 409  LEU A HD23 1 
ATOM   6430  H HD23 B LEU A 1 420 ? -60.080 15.072  17.060  0.51 19.52 ? 409  LEU A HD23 1 
ATOM   6431  N N    . VAL A 1 421 ? -60.536 13.795  22.238  1.00 13.47 ? 410  VAL A N    1 
ATOM   6432  C CA   . VAL A 1 421 ? -61.181 14.141  23.483  1.00 14.42 ? 410  VAL A CA   1 
ATOM   6433  C C    . VAL A 1 421 ? -61.513 15.621  23.455  1.00 14.08 ? 410  VAL A C    1 
ATOM   6434  O O    . VAL A 1 421 ? -60.640 16.445  23.184  1.00 14.31 ? 410  VAL A O    1 
ATOM   6435  C CB   . VAL A 1 421 ? -60.264 13.854  24.681  1.00 14.51 ? 410  VAL A CB   1 
ATOM   6436  C CG1  . VAL A 1 421 ? -60.860 14.342  25.996  1.00 15.85 ? 410  VAL A CG1  1 
ATOM   6437  C CG2  . VAL A 1 421 ? -59.951 12.369  24.748  1.00 15.54 ? 410  VAL A CG2  1 
ATOM   6438  H H    . VAL A 1 421 ? -59.920 14.347  22.005  1.00 16.16 ? 410  VAL A H    1 
ATOM   6439  H HA   . VAL A 1 421 ? -62.002 13.634  23.584  1.00 17.30 ? 410  VAL A HA   1 
ATOM   6440  H HB   . VAL A 1 421 ? -59.426 14.324  24.548  1.00 17.41 ? 410  VAL A HB   1 
ATOM   6441  H HG11 . VAL A 1 421 ? -60.244 14.138  26.717  1.00 19.02 ? 410  VAL A HG11 1 
ATOM   6442  H HG12 . VAL A 1 421 ? -61.001 15.301  25.942  1.00 19.02 ? 410  VAL A HG12 1 
ATOM   6443  H HG13 . VAL A 1 421 ? -61.706 13.892  26.145  1.00 19.02 ? 410  VAL A HG13 1 
ATOM   6444  H HG21 . VAL A 1 421 ? -59.372 12.202  25.509  1.00 18.65 ? 410  VAL A HG21 1 
ATOM   6445  H HG22 . VAL A 1 421 ? -60.781 11.876  24.850  1.00 18.65 ? 410  VAL A HG22 1 
ATOM   6446  H HG23 . VAL A 1 421 ? -59.506 12.103  23.929  1.00 18.65 ? 410  VAL A HG23 1 
ATOM   6447  N N    . ILE A 1 422 ? -62.745 15.973  23.794  1.00 15.49 ? 411  ILE A N    1 
ATOM   6448  C CA   . ILE A 1 422 ? -63.057 17.372  24.101  1.00 15.78 ? 411  ILE A CA   1 
ATOM   6449  C C    . ILE A 1 422 ? -62.805 17.548  25.580  1.00 15.94 ? 411  ILE A C    1 
ATOM   6450  O O    . ILE A 1 422 ? -63.415 16.861  26.391  1.00 16.02 ? 411  ILE A O    1 
ATOM   6451  C CB   . ILE A 1 422 ? -64.507 17.743  23.749  1.00 16.83 ? 411  ILE A CB   1 
ATOM   6452  C CG1  . ILE A 1 422 ? -64.746 17.460  22.274  1.00 17.99 ? 411  ILE A CG1  1 
ATOM   6453  C CG2  . ILE A 1 422 ? -64.754 19.223  24.130  1.00 19.80 ? 411  ILE A CG2  1 
ATOM   6454  C CD1  . ILE A 1 422 ? -66.129 17.770  21.792  1.00 18.66 ? 411  ILE A CD1  1 
ATOM   6455  H H    . ILE A 1 422 ? -63.412 15.434  23.854  1.00 18.59 ? 411  ILE A H    1 
ATOM   6456  H HA   . ILE A 1 422 ? -62.459 17.956  23.611  1.00 18.93 ? 411  ILE A HA   1 
ATOM   6457  H HB   . ILE A 1 422 ? -65.105 17.186  24.271  1.00 20.20 ? 411  ILE A HB   1 
ATOM   6458  H HG12 . ILE A 1 422 ? -64.127 17.994  21.752  1.00 21.59 ? 411  ILE A HG12 1 
ATOM   6459  H HG13 . ILE A 1 422 ? -64.583 16.518  22.109  1.00 21.59 ? 411  ILE A HG13 1 
ATOM   6460  H HG21 . ILE A 1 422 ? -65.668 19.458  23.908  1.00 23.77 ? 411  ILE A HG21 1 
ATOM   6461  H HG22 . ILE A 1 422 ? -64.606 19.333  25.083  1.00 23.77 ? 411  ILE A HG22 1 
ATOM   6462  H HG23 . ILE A 1 422 ? -64.138 19.784  23.633  1.00 23.77 ? 411  ILE A HG23 1 
ATOM   6463  H HD11 . ILE A 1 422 ? -66.188 17.559  20.847  1.00 22.40 ? 411  ILE A HD11 1 
ATOM   6464  H HD12 . ILE A 1 422 ? -66.765 17.233  22.291  1.00 22.40 ? 411  ILE A HD12 1 
ATOM   6465  H HD13 . ILE A 1 422 ? -66.309 18.713  21.933  1.00 22.40 ? 411  ILE A HD13 1 
ATOM   6466  N N    . TRP A 1 423 ? -61.859 18.425  25.916  1.00 15.76 ? 412  TRP A N    1 
ATOM   6467  C CA   . TRP A 1 423 ? -61.295 18.524  27.253  1.00 14.88 ? 412  TRP A CA   1 
ATOM   6468  C C    . TRP A 1 423 ? -61.837 19.764  27.934  1.00 15.58 ? 412  TRP A C    1 
ATOM   6469  O O    . TRP A 1 423 ? -61.905 20.841  27.325  1.00 17.99 ? 412  TRP A O    1 
ATOM   6470  C CB   . TRP A 1 423 ? -59.774 18.622  27.157  1.00 17.21 ? 412  TRP A CB   1 
ATOM   6471  C CG   . TRP A 1 423 ? -59.052 18.585  28.476  1.00 16.42 ? 412  TRP A CG   1 
ATOM   6472  C CD1  . TRP A 1 423 ? -58.438 19.632  29.108  1.00 16.67 ? 412  TRP A CD1  1 
ATOM   6473  C CD2  . TRP A 1 423 ? -58.824 17.435  29.318  1.00 13.89 ? 412  TRP A CD2  1 
ATOM   6474  N NE1  . TRP A 1 423 ? -57.844 19.199  30.272  1.00 16.17 ? 412  TRP A NE1  1 
ATOM   6475  C CE2  . TRP A 1 423 ? -58.085 17.859  30.426  1.00 14.74 ? 412  TRP A CE2  1 
ATOM   6476  C CE3  . TRP A 1 423 ? -59.155 16.080  29.211  1.00 15.72 ? 412  TRP A CE3  1 
ATOM   6477  C CZ2  . TRP A 1 423 ? -57.683 16.999  31.412  1.00 15.42 ? 412  TRP A CZ2  1 
ATOM   6478  C CZ3  . TRP A 1 423 ? -58.757 15.206  30.233  1.00 17.23 ? 412  TRP A CZ3  1 
ATOM   6479  C CH2  . TRP A 1 423 ? -58.017 15.674  31.298  1.00 15.22 ? 412  TRP A CH2  1 
ATOM   6480  H H    . TRP A 1 423 ? -61.521 18.992  25.364  1.00 18.91 ? 412  TRP A H    1 
ATOM   6481  H HA   . TRP A 1 423 ? -61.533 17.742  27.776  1.00 17.86 ? 412  TRP A HA   1 
ATOM   6482  H HB2  . TRP A 1 423 ? -59.449 17.879  26.625  1.00 20.65 ? 412  TRP A HB2  1 
ATOM   6483  H HB3  . TRP A 1 423 ? -59.545 19.458  26.721  1.00 20.65 ? 412  TRP A HB3  1 
ATOM   6484  H HD1  . TRP A 1 423 ? -58.425 20.509  28.798  1.00 20.00 ? 412  TRP A HD1  1 
ATOM   6485  H HE1  . TRP A 1 423 ? -57.423 19.697  30.832  1.00 19.41 ? 412  TRP A HE1  1 
ATOM   6486  H HE3  . TRP A 1 423 ? -59.645 15.768  28.484  1.00 18.86 ? 412  TRP A HE3  1 
ATOM   6487  H HZ2  . TRP A 1 423 ? -57.191 17.305  32.139  1.00 18.51 ? 412  TRP A HZ2  1 
ATOM   6488  H HZ3  . TRP A 1 423 ? -58.980 14.305  30.184  1.00 20.67 ? 412  TRP A HZ3  1 
ATOM   6489  H HH2  . TRP A 1 423 ? -57.771 15.085  31.974  1.00 18.26 ? 412  TRP A HH2  1 
ATOM   6490  N N    . ASP A 1 424 ? -62.183 19.615  29.221  1.00 16.08 ? 413  ASP A N    1 
ATOM   6491  C CA   . ASP A 1 424 ? -62.624 20.727  30.034  1.00 16.43 ? 413  ASP A CA   1 
ATOM   6492  C C    . ASP A 1 424 ? -61.453 21.109  30.937  1.00 17.53 ? 413  ASP A C    1 
ATOM   6493  O O    . ASP A 1 424 ? -61.170 20.392  31.906  1.00 18.75 ? 413  ASP A O    1 
ATOM   6494  C CB   . ASP A 1 424 ? -63.858 20.352  30.857  1.00 19.41 ? 413  ASP A CB   1 
ATOM   6495  C CG   . ASP A 1 424 ? -64.314 21.483  31.722  1.00 23.35 ? 413  ASP A CG   1 
ATOM   6496  O OD1  . ASP A 1 424 ? -63.640 22.515  31.882  1.00 27.43 ? 413  ASP A OD1  1 
ATOM   6497  O OD2  . ASP A 1 424 ? -65.462 21.382  32.273  1.00 29.04 ? 413  ASP A OD2  1 
ATOM   6498  H H    . ASP A 1 424 ? -62.165 18.864  29.640  1.00 19.30 ? 413  ASP A H    1 
ATOM   6499  H HA   . ASP A 1 424 ? -62.843 21.483  29.467  1.00 19.72 ? 413  ASP A HA   1 
ATOM   6500  H HB2  . ASP A 1 424 ? -64.583 20.119  30.257  1.00 23.30 ? 413  ASP A HB2  1 
ATOM   6501  H HB3  . ASP A 1 424 ? -63.643 19.600  31.431  1.00 23.30 ? 413  ASP A HB3  1 
ATOM   6502  N N    . PRO A 1 425 ? -60.762 22.216  30.676  1.00 17.09 ? 414  PRO A N    1 
ATOM   6503  C CA   . PRO A 1 425 ? -59.594 22.581  31.490  1.00 17.91 ? 414  PRO A CA   1 
ATOM   6504  C C    . PRO A 1 425 ? -59.935 23.198  32.824  1.00 18.95 ? 414  PRO A C    1 
ATOM   6505  O O    . PRO A 1 425 ? -59.029 23.406  33.644  1.00 19.59 ? 414  PRO A O    1 
ATOM   6506  C CB   . PRO A 1 425 ? -58.886 23.632  30.614  1.00 17.87 ? 414  PRO A CB   1 
ATOM   6507  C CG   . PRO A 1 425 ? -60.053 24.301  29.900  1.00 19.72 ? 414  PRO A CG   1 
ATOM   6508  C CD   . PRO A 1 425 ? -60.987 23.153  29.570  1.00 18.48 ? 414  PRO A CD   1 
ATOM   6509  H HA   . PRO A 1 425 ? -59.011 21.816  31.620  1.00 21.49 ? 414  PRO A HA   1 
ATOM   6510  H HB2  . PRO A 1 425 ? -58.407 24.264  31.172  1.00 21.45 ? 414  PRO A HB2  1 
ATOM   6511  H HB3  . PRO A 1 425 ? -58.292 23.196  29.984  1.00 21.45 ? 414  PRO A HB3  1 
ATOM   6512  H HG2  . PRO A 1 425 ? -60.482 24.938  30.492  1.00 23.67 ? 414  PRO A HG2  1 
ATOM   6513  H HG3  . PRO A 1 425 ? -59.739 24.736  29.091  1.00 23.67 ? 414  PRO A HG3  1 
ATOM   6514  H HD2  . PRO A 1 425 ? -61.908 23.457  29.565  1.00 22.17 ? 414  PRO A HD2  1 
ATOM   6515  H HD3  . PRO A 1 425 ? -60.740 22.747  28.725  1.00 22.17 ? 414  PRO A HD3  1 
ATOM   6516  N N    . ASP A 1 426 ? -61.211 23.487  33.076  1.00 18.06 ? 415  ASP A N    1 
ATOM   6517  C CA   . ASP A 1 426 ? -61.592 24.290  34.213  1.00 19.38 ? 415  ASP A CA   1 
ATOM   6518  C C    . ASP A 1 426 ? -62.365 23.541  35.286  1.00 21.13 ? 415  ASP A C    1 
ATOM   6519  O O    . ASP A 1 426 ? -62.418 24.026  36.415  1.00 31.00 ? 415  ASP A O    1 
ATOM   6520  C CB   . ASP A 1 426 ? -62.440 25.462  33.741  1.00 21.85 ? 415  ASP A CB   1 
ATOM   6521  C CG   . ASP A 1 426 ? -61.657 26.422  32.864  1.00 25.38 ? 415  ASP A CG   1 
ATOM   6522  O OD1  . ASP A 1 426 ? -60.411 26.462  32.968  1.00 23.53 ? 415  ASP A OD1  1 
ATOM   6523  O OD2  . ASP A 1 426 ? -62.286 27.131  32.081  1.00 31.51 ? 415  ASP A OD2  1 
ATOM   6524  H H    . ASP A 1 426 ? -61.873 23.223  32.595  1.00 21.68 ? 415  ASP A H    1 
ATOM   6525  H HA   . ASP A 1 426 ? -60.790 24.650  34.623  1.00 23.25 ? 415  ASP A HA   1 
ATOM   6526  H HB2  . ASP A 1 426 ? -63.189 25.125  33.225  1.00 26.22 ? 415  ASP A HB2  1 
ATOM   6527  H HB3  . ASP A 1 426 ? -62.761 25.953  34.513  1.00 26.22 ? 415  ASP A HB3  1 
ATOM   6528  N N    A SER A 1 427 ? -62.954 22.383  34.941  0.60 21.51 ? 416  SER A N    1 
ATOM   6529  N N    B SER A 1 427 ? -62.957 22.408  35.008  0.40 20.90 ? 416  SER A N    1 
ATOM   6530  C CA   A SER A 1 427 ? -63.654 21.511  35.887  0.60 23.11 ? 416  SER A CA   1 
ATOM   6531  C CA   B SER A 1 427 ? -63.761 21.821  36.057  0.40 23.46 ? 416  SER A CA   1 
ATOM   6532  C C    A SER A 1 427 ? -62.743 21.173  37.056  0.60 17.25 ? 416  SER A C    1 
ATOM   6533  C C    B SER A 1 427 ? -62.922 20.984  37.008  0.40 23.59 ? 416  SER A C    1 
ATOM   6534  O O    A SER A 1 427 ? -61.560 20.993  36.857  0.60 16.11 ? 416  SER A O    1 
ATOM   6535  O O    B SER A 1 427 ? -61.989 20.290  36.608  0.40 22.96 ? 416  SER A O    1 
ATOM   6536  C CB   A SER A 1 427 ? -64.019 20.198  35.171  0.60 23.40 ? 416  SER A CB   1 
ATOM   6537  C CB   B SER A 1 427 ? -64.902 21.034  35.476  0.40 20.04 ? 416  SER A CB   1 
ATOM   6538  O OG   A SER A 1 427 ? -62.865 19.494  34.645  0.60 23.06 ? 416  SER A OG   1 
ATOM   6539  O OG   B SER A 1 427 ? -65.830 21.949  34.914  0.40 21.28 ? 416  SER A OG   1 
ATOM   6540  H H    A SER A 1 427 ? -62.958 22.078  34.137  0.60 25.81 ? 416  SER A H    1 
ATOM   6541  H H    B SER A 1 427 ? -62.920 21.975  34.265  0.40 25.08 ? 416  SER A H    1 
ATOM   6542  H HA   A SER A 1 427 ? -64.460 21.939  36.215  0.60 27.73 ? 416  SER A HA   1 
ATOM   6543  H HA   B SER A 1 427 ? -64.148 22.542  36.579  0.40 28.15 ? 416  SER A HA   1 
ATOM   6544  H HB2  A SER A 1 427 ? -64.471 19.618  35.803  0.60 28.08 ? 416  SER A HB2  1 
ATOM   6545  H HB2  B SER A 1 427 ? -64.568 20.444  34.782  0.40 24.05 ? 416  SER A HB2  1 
ATOM   6546  H HB3  A SER A 1 427 ? -64.616 20.404  34.435  0.60 28.08 ? 416  SER A HB3  1 
ATOM   6547  H HB3  B SER A 1 427 ? -65.334 20.523  36.178  0.40 24.05 ? 416  SER A HB3  1 
ATOM   6548  H HG   A SER A 1 427 ? -63.109 18.787  34.264  0.60 27.67 ? 416  SER A HG   1 
ATOM   6549  H HG   B SER A 1 427 ? -65.459 22.402  34.312  0.40 25.53 ? 416  SER A HG   1 
ATOM   6550  N N    . VAL A 1 428 ? -63.280 21.079  38.279  1.00 23.39 ? 417  VAL A N    1 
ATOM   6551  C CA   . VAL A 1 428 ? -62.575 20.469  39.398  1.00 21.76 ? 417  VAL A CA   1 
ATOM   6552  C C    . VAL A 1 428 ? -63.420 19.304  39.863  1.00 22.31 ? 417  VAL A C    1 
ATOM   6553  O O    . VAL A 1 428 ? -64.636 19.459  40.077  1.00 25.77 ? 417  VAL A O    1 
ATOM   6554  C CB   . VAL A 1 428 ? -62.348 21.456  40.554  1.00 24.11 ? 417  VAL A CB   1 
ATOM   6555  C CG1  . VAL A 1 428 ? -61.624 20.790  41.719  1.00 29.49 ? 417  VAL A CG1  1 
ATOM   6556  C CG2  . VAL A 1 428 ? -61.558 22.680  40.080  1.00 25.02 ? 417  VAL A CG2  1 
ATOM   6557  H H    A VAL A 1 428 ? -64.064 21.368  38.482  0.60 28.07 ? 417  VAL A H    1 
ATOM   6558  H H    B VAL A 1 428 ? -63.972 21.521  38.532  0.40 28.07 ? 417  VAL A H    1 
ATOM   6559  H HA   . VAL A 1 428 ? -61.715 20.133  39.101  1.00 26.11 ? 417  VAL A HA   1 
ATOM   6560  H HB   . VAL A 1 428 ? -63.209 21.764  40.876  1.00 28.93 ? 417  VAL A HB   1 
ATOM   6561  H HG11 . VAL A 1 428 ? -61.500 21.442  42.426  1.00 35.39 ? 417  VAL A HG11 1 
ATOM   6562  H HG12 . VAL A 1 428 ? -62.161 20.049  42.042  1.00 35.39 ? 417  VAL A HG12 1 
ATOM   6563  H HG13 . VAL A 1 428 ? -60.763 20.466  41.411  1.00 35.39 ? 417  VAL A HG13 1 
ATOM   6564  H HG21 . VAL A 1 428 ? -61.431 23.283  40.829  1.00 30.03 ? 417  VAL A HG21 1 
ATOM   6565  H HG22 . VAL A 1 428 ? -60.698 22.389  39.739  1.00 30.03 ? 417  VAL A HG22 1 
ATOM   6566  H HG23 . VAL A 1 428 ? -62.058 23.126  39.378  1.00 30.03 ? 417  VAL A HG23 1 
ATOM   6567  N N    . LYS A 1 429 ? -62.793 18.156  40.049  1.00 21.01 ? 418  LYS A N    1 
ATOM   6568  C CA   . LYS A 1 429 ? -63.465 16.981  40.565  1.00 21.46 ? 418  LYS A CA   1 
ATOM   6569  C C    . LYS A 1 429 ? -62.578 16.350  41.620  1.00 20.34 ? 418  LYS A C    1 
ATOM   6570  O O    . LYS A 1 429 ? -61.357 16.317  41.480  1.00 21.94 ? 418  LYS A O    1 
ATOM   6571  C CB   . LYS A 1 429 ? -63.692 16.006  39.428  1.00 25.70 ? 418  LYS A CB   1 
ATOM   6572  C CG   . LYS A 1 429 ? -64.552 16.581  38.304  1.00 31.59 ? 418  LYS A CG   1 
ATOM   6573  C CD   . LYS A 1 429 ? -64.858 15.522  37.270  1.00 34.13 ? 418  LYS A CD   1 
ATOM   6574  C CE   . LYS A 1 429 ? -65.690 16.075  36.129  1.00 34.79 ? 418  LYS A CE   1 
ATOM   6575  N NZ   . LYS A 1 429 ? -65.890 15.025  35.058  1.00 42.35 ? 418  LYS A NZ   1 
ATOM   6576  H H    . LYS A 1 429 ? -61.959 18.031  39.881  1.00 25.21 ? 418  LYS A H    1 
ATOM   6577  H HA   . LYS A 1 429 ? -64.317 17.223  40.960  1.00 25.76 ? 418  LYS A HA   1 
ATOM   6578  H HB2  . LYS A 1 429 ? -62.834 15.758  39.050  1.00 30.85 ? 418  LYS A HB2  1 
ATOM   6579  H HB3  . LYS A 1 429 ? -64.141 15.219  39.774  1.00 30.85 ? 418  LYS A HB3  1 
ATOM   6580  H HG2  . LYS A 1 429 ? -65.390 16.903  38.671  1.00 37.91 ? 418  LYS A HG2  1 
ATOM   6581  H HG3  . LYS A 1 429 ? -64.073 17.304  37.869  1.00 37.91 ? 418  LYS A HG3  1 
ATOM   6582  H HD2  . LYS A 1 429 ? -64.026 15.185  36.903  1.00 40.96 ? 418  LYS A HD2  1 
ATOM   6583  H HD3  . LYS A 1 429 ? -65.356 14.803  37.688  1.00 40.96 ? 418  LYS A HD3  1 
ATOM   6584  H HE2  . LYS A 1 429 ? -66.560 16.342  36.464  1.00 41.75 ? 418  LYS A HE2  1 
ATOM   6585  H HE3  . LYS A 1 429 ? -65.232 16.834  35.734  1.00 41.75 ? 418  LYS A HE3  1 
ATOM   6586  H HZ1  . LYS A 1 429 ? -66.379 15.358  34.393  1.00 50.82 ? 418  LYS A HZ1  1 
ATOM   6587  H HZ2  . LYS A 1 429 ? -65.102 14.766  34.736  1.00 50.82 ? 418  LYS A HZ2  1 
ATOM   6588  H HZ3  . LYS A 1 429 ? -66.309 14.319  35.400  1.00 50.82 ? 418  LYS A HZ3  1 
ATOM   6589  N N    . THR A 1 430 ? -63.208 15.782  42.638  1.00 20.70 ? 419  THR A N    1 
ATOM   6590  C CA   . THR A 1 430 ? -62.504 15.024  43.645  1.00 22.03 ? 419  THR A CA   1 
ATOM   6591  C C    . THR A 1 430 ? -62.330 13.615  43.125  1.00 22.11 ? 419  THR A C    1 
ATOM   6592  O O    . THR A 1 430 ? -63.294 12.977  42.683  1.00 27.30 ? 419  THR A O    1 
ATOM   6593  C CB   . THR A 1 430 ? -63.353 14.950  44.908  1.00 25.87 ? 419  THR A CB   1 
ATOM   6594  O OG1  . THR A 1 430 ? -63.768 16.259  45.255  1.00 31.57 ? 419  THR A OG1  1 
ATOM   6595  C CG2  . THR A 1 430 ? -62.548 14.355  46.034  1.00 25.53 ? 419  THR A CG2  1 
ATOM   6596  H H    . THR A 1 430 ? -64.057 15.826  42.765  1.00 24.84 ? 419  THR A H    1 
ATOM   6597  H HA   . THR A 1 430 ? -61.640 15.418  43.843  1.00 26.44 ? 419  THR A HA   1 
ATOM   6598  H HB   . THR A 1 430 ? -64.130 14.390  44.750  1.00 31.04 ? 419  THR A HB   1 
ATOM   6599  H HG1  . THR A 1 430 ? -63.098 16.746  45.395  1.00 37.88 ? 419  THR A HG1  1 
ATOM   6600  H HG21 . THR A 1 430 ? -63.088 14.308  46.839  1.00 30.63 ? 419  THR A HG21 1 
ATOM   6601  H HG22 . THR A 1 430 ? -62.256 13.461  45.797  1.00 30.63 ? 419  THR A HG22 1 
ATOM   6602  H HG23 . THR A 1 430 ? -61.768 14.905  46.210  1.00 30.63 ? 419  THR A HG23 1 
ATOM   6603  N N    . ILE A 1 431 ? -61.104 13.119  43.161  1.00 19.00 ? 420  ILE A N    1 
ATOM   6604  C CA   . ILE A 1 431 ? -60.845 11.739  42.792  1.00 16.23 ? 420  ILE A CA   1 
ATOM   6605  C C    . ILE A 1 431 ? -61.198 10.863  43.992  1.00 17.95 ? 420  ILE A C    1 
ATOM   6606  O O    . ILE A 1 431 ? -60.800 11.152  45.129  1.00 18.63 ? 420  ILE A O    1 
ATOM   6607  C CB   . ILE A 1 431 ? -59.383 11.551  42.357  1.00 17.40 ? 420  ILE A CB   1 
ATOM   6608  C CG1  . ILE A 1 431 ? -59.099 12.393  41.118  1.00 19.91 ? 420  ILE A CG1  1 
ATOM   6609  C CG2  . ILE A 1 431 ? -59.138 10.062  42.110  1.00 19.22 ? 420  ILE A CG2  1 
ATOM   6610  C CD1  . ILE A 1 431 ? -57.599 12.437  40.736  1.00 19.94 ? 420  ILE A CD1  1 
ATOM   6611  H H    . ILE A 1 431 ? -60.404 13.561  43.396  1.00 22.80 ? 420  ILE A H    1 
ATOM   6612  H HA   . ILE A 1 431 ? -61.420 11.490  42.051  1.00 19.47 ? 420  ILE A HA   1 
ATOM   6613  H HB   . ILE A 1 431 ? -58.803 11.848  43.075  1.00 20.88 ? 420  ILE A HB   1 
ATOM   6614  H HG12 . ILE A 1 431 ? -59.587 12.021  40.367  1.00 23.90 ? 420  ILE A HG12 1 
ATOM   6615  H HG13 . ILE A 1 431 ? -59.391 13.303  41.284  1.00 23.90 ? 420  ILE A HG13 1 
ATOM   6616  H HG21 . ILE A 1 431 ? -58.216 9.935   41.835  1.00 23.06 ? 420  ILE A HG21 1 
ATOM   6617  H HG22 . ILE A 1 431 ? -59.308 9.574   42.931  1.00 23.06 ? 420  ILE A HG22 1 
ATOM   6618  H HG23 . ILE A 1 431 ? -59.737 9.755   41.412  1.00 23.06 ? 420  ILE A HG23 1 
ATOM   6619  H HD11 . ILE A 1 431 ? -57.492 12.987  39.944  1.00 23.93 ? 420  ILE A HD11 1 
ATOM   6620  H HD12 . ILE A 1 431 ? -57.097 12.817  41.473  1.00 23.93 ? 420  ILE A HD12 1 
ATOM   6621  H HD13 . ILE A 1 431 ? -57.293 11.535  40.556  1.00 23.93 ? 420  ILE A HD13 1 
ATOM   6622  N N    . SER A 1 432 ? -61.974 9.803   43.757  1.00 18.15 ? 421  SER A N    1 
ATOM   6623  C CA   . SER A 1 432 ? -62.399 8.971   44.873  1.00 16.96 ? 421  SER A CA   1 
ATOM   6624  C C    . SER A 1 432 ? -62.731 7.564   44.405  1.00 17.26 ? 421  SER A C    1 
ATOM   6625  O O    . SER A 1 432 ? -63.246 7.375   43.295  1.00 19.52 ? 421  SER A O    1 
ATOM   6626  C CB   . SER A 1 432 ? -63.668 9.580   45.484  1.00 19.62 ? 421  SER A CB   1 
ATOM   6627  O OG   . SER A 1 432 ? -64.139 8.770   46.552  1.00 19.77 ? 421  SER A OG   1 
ATOM   6628  H H    . SER A 1 432 ? -62.258 9.552   42.984  1.00 21.78 ? 421  SER A H    1 
ATOM   6629  H HA   . SER A 1 432 ? -61.705 8.931   45.549  1.00 20.35 ? 421  SER A HA   1 
ATOM   6630  H HB2  . SER A 1 432 ? -63.463 10.466  45.823  1.00 23.55 ? 421  SER A HB2  1 
ATOM   6631  H HB3  . SER A 1 432 ? -64.354 9.636   44.800  1.00 23.55 ? 421  SER A HB3  1 
ATOM   6632  H HG   . SER A 1 432 ? -63.552 8.713   47.150  1.00 23.73 ? 421  SER A HG   1 
ATOM   6633  N N    . ALA A 1 433 ? -62.483 6.589   45.281  1.00 18.75 ? 422  ALA A N    1 
ATOM   6634  C CA   . ALA A 1 433 ? -62.987 5.231   45.053  1.00 18.77 ? 422  ALA A CA   1 
ATOM   6635  C C    . ALA A 1 433 ? -64.511 5.181   45.009  1.00 20.58 ? 422  ALA A C    1 
ATOM   6636  O O    . ALA A 1 433 ? -65.067 4.222   44.474  1.00 23.62 ? 422  ALA A O    1 
ATOM   6637  C CB   . ALA A 1 433 ? -62.493 4.294   46.162  1.00 20.13 ? 422  ALA A CB   1 
ATOM   6638  H H    . ALA A 1 433 ? -62.030 6.684   46.006  1.00 22.50 ? 422  ALA A H    1 
ATOM   6639  H HA   . ALA A 1 433 ? -62.648 4.903   44.206  1.00 22.53 ? 422  ALA A HA   1 
ATOM   6640  H HB1  . ALA A 1 433 ? -62.836 3.401   45.996  1.00 24.16 ? 422  ALA A HB1  1 
ATOM   6641  H HB2  . ALA A 1 433 ? -61.523 4.283   46.157  1.00 24.16 ? 422  ALA A HB2  1 
ATOM   6642  H HB3  . ALA A 1 433 ? -62.816 4.619   47.017  1.00 24.16 ? 422  ALA A HB3  1 
ATOM   6643  N N    . LYS A 1 434 ? -65.175 6.220   45.486  1.00 19.67 ? 423  LYS A N    1 
ATOM   6644  C CA   . LYS A 1 434 ? -66.636 6.263   45.408  1.00 22.28 ? 423  LYS A CA   1 
ATOM   6645  C C    . LYS A 1 434 ? -67.122 6.433   43.984  1.00 23.28 ? 423  LYS A C    1 
ATOM   6646  O O    . LYS A 1 434 ? -68.268 6.069   43.684  1.00 27.93 ? 423  LYS A O    1 
ATOM   6647  C CB   . LYS A 1 434 ? -67.194 7.408   46.273  1.00 27.58 ? 423  LYS A CB   1 
ATOM   6648  C CG   . LYS A 1 434 ? -66.935 7.191   47.763  1.00 32.08 ? 423  LYS A CG   1 
ATOM   6649  C CD   . LYS A 1 434 ? -67.464 8.339   48.622  1.00 45.36 ? 423  LYS A CD   1 
ATOM   6650  C CE   . LYS A 1 434 ? -66.444 9.496   48.721  1.00 54.10 ? 423  LYS A CE   1 
ATOM   6651  N NZ   . LYS A 1 434 ? -66.578 10.244  50.019  1.00 57.81 ? 423  LYS A NZ   1 
ATOM   6652  H H    . LYS A 1 434 ? -64.814 6.908   45.856  1.00 23.60 ? 423  LYS A H    1 
ATOM   6653  H HA   . LYS A 1 434 ? -66.994 5.429   45.750  1.00 26.74 ? 423  LYS A HA   1 
ATOM   6654  H HB2  . LYS A 1 434 ? -66.769 8.240   46.011  1.00 33.09 ? 423  LYS A HB2  1 
ATOM   6655  H HB3  . LYS A 1 434 ? -68.153 7.468   46.139  1.00 33.09 ? 423  LYS A HB3  1 
ATOM   6656  H HG2  . LYS A 1 434 ? -67.377 6.376   48.046  1.00 38.49 ? 423  LYS A HG2  1 
ATOM   6657  H HG3  . LYS A 1 434 ? -65.979 7.120   47.912  1.00 38.49 ? 423  LYS A HG3  1 
ATOM   6658  H HD2  . LYS A 1 434 ? -68.278 8.686   48.225  1.00 54.43 ? 423  LYS A HD2  1 
ATOM   6659  H HD3  . LYS A 1 434 ? -67.640 8.013   49.518  1.00 54.43 ? 423  LYS A HD3  1 
ATOM   6660  H HE2  . LYS A 1 434 ? -65.545 9.135   48.670  1.00 64.92 ? 423  LYS A HE2  1 
ATOM   6661  H HE3  . LYS A 1 434 ? -66.597 10.119  47.993  1.00 64.92 ? 423  LYS A HE3  1 
ATOM   6662  H HZ1  . LYS A 1 434 ? -67.395 10.589  50.088  1.00 69.38 ? 423  LYS A HZ1  1 
ATOM   6663  H HZ2  . LYS A 1 434 ? -66.438 9.693   50.703  1.00 69.38 ? 423  LYS A HZ2  1 
ATOM   6664  H HZ3  . LYS A 1 434 ? -65.981 10.904  50.052  1.00 69.38 ? 423  LYS A HZ3  1 
ATOM   6665  N N    . THR A 1 435 ? -66.297 6.999   43.104  1.00 21.16 ? 424  THR A N    1 
ATOM   6666  C CA   . THR A 1 435 ? -66.708 7.316   41.749  1.00 19.21 ? 424  THR A CA   1 
ATOM   6667  C C    . THR A 1 435 ? -65.793 6.733   40.658  1.00 20.91 ? 424  THR A C    1 
ATOM   6668  O O    . THR A 1 435 ? -66.153 6.804   39.465  1.00 21.83 ? 424  THR A O    1 
ATOM   6669  C CB   . THR A 1 435 ? -66.778 8.829   41.576  1.00 20.37 ? 424  THR A CB   1 
ATOM   6670  O OG1  . THR A 1 435 ? -65.498 9.387   41.878  1.00 22.93 ? 424  THR A OG1  1 
ATOM   6671  C CG2  . THR A 1 435 ? -67.812 9.453   42.477  1.00 23.22 ? 424  THR A CG2  1 
ATOM   6672  H H    . THR A 1 435 ? -65.482 7.212   43.277  1.00 25.39 ? 424  THR A H    1 
ATOM   6673  H HA   . THR A 1 435 ? -67.599 6.961   41.605  1.00 23.05 ? 424  THR A HA   1 
ATOM   6674  H HB   . THR A 1 435 ? -67.010 9.037   40.657  1.00 24.45 ? 424  THR A HB   1 
ATOM   6675  H HG1  . THR A 1 435 ? -65.520 10.222  41.788  1.00 27.51 ? 424  THR A HG1  1 
ATOM   6676  H HG21 . THR A 1 435 ? -67.832 10.413  42.344  1.00 27.86 ? 424  THR A HG21 1 
ATOM   6677  H HG22 . THR A 1 435 ? -68.688 9.088   42.278  1.00 27.86 ? 424  THR A HG22 1 
ATOM   6678  H HG23 . THR A 1 435 ? -67.597 9.268   43.405  1.00 27.86 ? 424  THR A HG23 1 
ATOM   6679  N N    . HIS A 1 436 ? -64.653 6.130   41.012  1.00 18.35 ? 425  HIS A N    1 
ATOM   6680  C CA   . HIS A 1 436 ? -63.785 5.554   40.002  1.00 16.79 ? 425  HIS A CA   1 
ATOM   6681  C C    . HIS A 1 436 ? -64.425 4.376   39.317  1.00 17.10 ? 425  HIS A C    1 
ATOM   6682  O O    . HIS A 1 436 ? -65.333 3.711   39.845  1.00 18.73 ? 425  HIS A O    1 
ATOM   6683  C CB   . HIS A 1 436 ? -62.385 5.257   40.539  1.00 16.99 ? 425  HIS A CB   1 
ATOM   6684  C CG   . HIS A 1 436 ? -62.249 4.166   41.561  1.00 17.28 ? 425  HIS A CG   1 
ATOM   6685  N ND1  . HIS A 1 436 ? -61.064 3.971   42.241  1.00 16.78 ? 425  HIS A ND1  1 
ATOM   6686  C CD2  . HIS A 1 436 ? -63.097 3.207   42.010  1.00 17.73 ? 425  HIS A CD2  1 
ATOM   6687  C CE1  . HIS A 1 436 ? -61.195 2.955   43.072  1.00 15.92 ? 425  HIS A CE1  1 
ATOM   6688  N NE2  . HIS A 1 436 ? -62.421 2.477   42.952  1.00 18.58 ? 425  HIS A NE2  1 
ATOM   6689  H H    . HIS A 1 436 ? -64.369 6.047   41.819  1.00 22.03 ? 425  HIS A H    1 
ATOM   6690  H HA   . HIS A 1 436 ? -63.667 6.228   39.314  1.00 20.15 ? 425  HIS A HA   1 
ATOM   6691  H HB2  . HIS A 1 436 ? -61.822 5.013   39.788  1.00 20.39 ? 425  HIS A HB2  1 
ATOM   6692  H HB3  . HIS A 1 436 ? -62.041 6.069   40.943  1.00 20.39 ? 425  HIS A HB3  1 
ATOM   6693  H HD2  . HIS A 1 436 ? -63.978 3.078   41.740  1.00 21.28 ? 425  HIS A HD2  1 
ATOM   6694  H HE1  . HIS A 1 436 ? -60.537 2.630   43.644  1.00 19.10 ? 425  HIS A HE1  1 
ATOM   6695  H HE2  . HIS A 1 436 ? -62.741 1.809   43.390  1.00 22.29 ? 425  HIS A HE2  1 
ATOM   6696  N N    . ASN A 1 437 ? -63.958 4.113   38.102  1.00 16.19 ? 426  ASN A N    1 
ATOM   6697  C CA   . ASN A 1 437 ? -64.464 3.004   37.286  1.00 16.06 ? 426  ASN A CA   1 
ATOM   6698  C C    . ASN A 1 437 ? -63.709 1.727   37.600  1.00 19.65 ? 426  ASN A C    1 
ATOM   6699  O O    . ASN A 1 437 ? -63.057 1.149   36.753  1.00 18.30 ? 426  ASN A O    1 
ATOM   6700  C CB   . ASN A 1 437 ? -64.466 3.357   35.806  1.00 16.99 ? 426  ASN A CB   1 
ATOM   6701  C CG   . ASN A 1 437 ? -65.650 4.233   35.448  1.00 17.68 ? 426  ASN A CG   1 
ATOM   6702  O OD1  . ASN A 1 437 ? -66.756 3.733   35.277  1.00 20.73 ? 426  ASN A OD1  1 
ATOM   6703  N ND2  . ASN A 1 437 ? -65.454 5.541   35.406  1.00 17.66 ? 426  ASN A ND2  1 
ATOM   6704  H H    . ASN A 1 437 ? -63.337 4.568   37.718  1.00 19.42 ? 426  ASN A H    1 
ATOM   6705  H HA   . ASN A 1 437 ? -65.389 2.850   37.537  1.00 19.27 ? 426  ASN A HA   1 
ATOM   6706  H HB2  . ASN A 1 437 ? -63.653 3.841   35.591  1.00 20.39 ? 426  ASN A HB2  1 
ATOM   6707  H HB3  . ASN A 1 437 ? -64.521 2.543   35.282  1.00 20.39 ? 426  ASN A HB3  1 
ATOM   6708  H HD21 . ASN A 1 437 ? -64.677 5.866   35.578  1.00 21.20 ? 426  ASN A HD21 1 
ATOM   6709  H HD22 . ASN A 1 437 ? -66.105 6.067   35.206  1.00 21.20 ? 426  ASN A HD22 1 
ATOM   6710  N N    . SER A 1 438 ? -63.918 1.254   38.844  1.00 20.64 ? 427  SER A N    1 
ATOM   6711  C CA   . SER A 1 438 ? -63.223 0.081   39.369  1.00 20.98 ? 427  SER A CA   1 
ATOM   6712  C C    . SER A 1 438 ? -63.956 -0.439  40.579  1.00 20.09 ? 427  SER A C    1 
ATOM   6713  O O    . SER A 1 438 ? -64.627 0.327   41.285  1.00 22.36 ? 427  SER A O    1 
ATOM   6714  C CB   . SER A 1 438 ? -61.810 0.442   39.781  1.00 23.57 ? 427  SER A CB   1 
ATOM   6715  O OG   . SER A 1 438 ? -61.171 -0.689  40.363  1.00 24.69 ? 427  SER A OG   1 
ATOM   6716  H H    . SER A 1 438 ? -64.468 1.606   39.404  1.00 24.77 ? 427  SER A H    1 
ATOM   6717  H HA   . SER A 1 438 ? -63.189 -0.616  38.695  1.00 25.18 ? 427  SER A HA   1 
ATOM   6718  H HB2  . SER A 1 438 ? -61.311 0.722   38.998  1.00 28.28 ? 427  SER A HB2  1 
ATOM   6719  H HB3  . SER A 1 438 ? -61.842 1.160   40.432  1.00 28.28 ? 427  SER A HB3  1 
ATOM   6720  H HG   . SER A 1 438 ? -61.141 -1.319  39.808  1.00 29.62 ? 427  SER A HG   1 
ATOM   6721  N N    . SER A 1 439 ? -63.826 -1.769  40.818  1.00 22.13 ? 428  SER A N    1 
ATOM   6722  C CA   . SER A 1 439 ? -64.339 -2.373  42.041  1.00 22.83 ? 428  SER A CA   1 
ATOM   6723  C C    . SER A 1 439 ? -63.434 -2.147  43.223  1.00 20.70 ? 428  SER A C    1 
ATOM   6724  O O    . SER A 1 439 ? -63.844 -2.453  44.363  1.00 24.25 ? 428  SER A O    1 
ATOM   6725  C CB   . SER A 1 439 ? -64.477 -3.873  41.851  1.00 23.09 ? 428  SER A CB   1 
ATOM   6726  O OG   . SER A 1 439 ? -63.190 -4.463  41.756  1.00 26.57 ? 428  SER A OG   1 
ATOM   6727  H H    . SER A 1 439 ? -63.445 -2.325  40.284  1.00 26.56 ? 428  SER A H    1 
ATOM   6728  H HA   . SER A 1 439 ? -65.213 -2.005  42.245  1.00 27.40 ? 428  SER A HA   1 
ATOM   6729  H HB2  . SER A 1 439 ? -64.946 -4.249  42.612  1.00 27.71 ? 428  SER A HB2  1 
ATOM   6730  H HB3  . SER A 1 439 ? -64.969 -4.047  41.034  1.00 27.71 ? 428  SER A HB3  1 
ATOM   6731  H HG   . SER A 1 439 ? -62.774 -4.141  41.102  1.00 31.88 ? 428  SER A HG   1 
ATOM   6732  N N    . LEU A 1 440 ? -62.256 -1.539  43.017  1.00 20.10 ? 429  LEU A N    1 
ATOM   6733  C CA   . LEU A 1 440 ? -61.376 -1.359  44.148  1.00 19.86 ? 429  LEU A CA   1 
ATOM   6734  C C    . LEU A 1 440 ? -62.022 -0.508  45.227  1.00 18.68 ? 429  LEU A C    1 
ATOM   6735  O O    . LEU A 1 440 ? -62.704 0.486   44.957  1.00 22.15 ? 429  LEU A O    1 
ATOM   6736  C CB   . LEU A 1 440 ? -60.027 -0.771  43.738  1.00 19.38 ? 429  LEU A CB   1 
ATOM   6737  C CG   . LEU A 1 440 ? -58.901 -1.774  43.689  1.00 17.96 ? 429  LEU A CG   1 
ATOM   6738  C CD1  . LEU A 1 440 ? -59.113 -2.841  42.610  1.00 18.73 ? 429  LEU A CD1  1 
ATOM   6739  C CD2  . LEU A 1 440 ? -57.572 -1.063  43.449  1.00 18.32 ? 429  LEU A CD2  1 
ATOM   6740  H H    . LEU A 1 440 ? -61.966 -1.238  42.265  1.00 24.12 ? 429  LEU A H    1 
ATOM   6741  H HA   . LEU A 1 440 ? -61.202 -2.231  44.537  1.00 23.83 ? 429  LEU A HA   1 
ATOM   6742  H HB2  . LEU A 1 440 ? -60.114 -0.383  42.853  1.00 23.26 ? 429  LEU A HB2  1 
ATOM   6743  H HB3  . LEU A 1 440 ? -59.781 -0.083  44.375  1.00 23.26 ? 429  LEU A HB3  1 
ATOM   6744  H HG   . LEU A 1 440 ? -58.847 -2.225  44.546  1.00 21.55 ? 429  LEU A HG   1 
ATOM   6745  H HD11 . LEU A 1 440 ? -58.363 -3.456  42.624  1.00 22.47 ? 429  LEU A HD11 1 
ATOM   6746  H HD12 . LEU A 1 440 ? -59.936 -3.319  42.797  1.00 22.47 ? 429  LEU A HD12 1 
ATOM   6747  H HD13 . LEU A 1 440 ? -59.170 -2.407  41.745  1.00 22.47 ? 429  LEU A HD13 1 
ATOM   6748  H HD21 . LEU A 1 440 ? -56.862 -1.724  43.422  1.00 21.99 ? 429  LEU A HD21 1 
ATOM   6749  H HD22 . LEU A 1 440 ? -57.616 -0.588  42.605  1.00 21.99 ? 429  LEU A HD22 1 
ATOM   6750  H HD23 . LEU A 1 440 ? -57.414 -0.437  44.173  1.00 21.99 ? 429  LEU A HD23 1 
ATOM   6751  N N    . GLU A 1 441 ? -61.729 -0.882  46.464  1.00 20.60 ? 430  GLU A N    1 
ATOM   6752  C CA   . GLU A 1 441 ? -62.178 -0.139  47.633  1.00 20.94 ? 430  GLU A CA   1 
ATOM   6753  C C    . GLU A 1 441 ? -61.371 1.136   47.869  1.00 20.57 ? 430  GLU A C    1 
ATOM   6754  O O    . GLU A 1 441 ? -61.888 2.098   48.459  1.00 23.68 ? 430  GLU A O    1 
ATOM   6755  C CB   . GLU A 1 441 ? -62.063 -1.033  48.853  1.00 21.96 ? 430  GLU A CB   1 
ATOM   6756  C CG   . GLU A 1 441 ? -62.946 -2.286  48.791  1.00 22.56 ? 430  GLU A CG   1 
ATOM   6757  C CD   . GLU A 1 441 ? -62.314 -3.480  48.071  1.00 21.26 ? 430  GLU A CD   1 
ATOM   6758  O OE1  . GLU A 1 441 ? -61.159 -3.387  47.630  1.00 21.79 ? 430  GLU A OE1  1 
ATOM   6759  O OE2  . GLU A 1 441 ? -62.998 -4.550  48.008  1.00 27.10 ? 430  GLU A OE2  1 
ATOM   6760  H H    . GLU A 1 441 ? -61.261 -1.577  46.657  1.00 24.71 ? 430  GLU A H    1 
ATOM   6761  H HA   . GLU A 1 441 ? -63.110 0.106   47.520  1.00 25.13 ? 430  GLU A HA   1 
ATOM   6762  H HB2  . GLU A 1 441 ? -61.142 -1.323  48.941  1.00 26.36 ? 430  GLU A HB2  1 
ATOM   6763  H HB3  . GLU A 1 441 ? -62.324 -0.525  49.637  1.00 26.36 ? 430  GLU A HB3  1 
ATOM   6764  H HG2  . GLU A 1 441 ? -63.151 -2.565  49.697  1.00 27.07 ? 430  GLU A HG2  1 
ATOM   6765  H HG3  . GLU A 1 441 ? -63.767 -2.063  48.325  1.00 27.07 ? 430  GLU A HG3  1 
ATOM   6766  N N    . TYR A 1 442 ? -60.089 1.166   47.446  1.00 19.18 ? 431  TYR A N    1 
ATOM   6767  C CA   . TYR A 1 442 ? -59.198 2.295   47.652  1.00 17.75 ? 431  TYR A CA   1 
ATOM   6768  C C    . TYR A 1 442 ? -58.716 2.853   46.316  1.00 17.23 ? 431  TYR A C    1 
ATOM   6769  O O    . TYR A 1 442 ? -58.623 2.134   45.323  1.00 18.10 ? 431  TYR A O    1 
ATOM   6770  C CB   . TYR A 1 442 ? -57.986 1.858   48.495  1.00 18.24 ? 431  TYR A CB   1 
ATOM   6771  C CG   . TYR A 1 442 ? -58.378 1.636   49.918  1.00 19.74 ? 431  TYR A CG   1 
ATOM   6772  C CD1  . TYR A 1 442 ? -58.435 2.691   50.813  1.00 22.36 ? 431  TYR A CD1  1 
ATOM   6773  C CD2  . TYR A 1 442 ? -58.782 0.367   50.359  1.00 19.29 ? 431  TYR A CD2  1 
ATOM   6774  C CE1  . TYR A 1 442 ? -58.867 2.479   52.116  1.00 23.56 ? 431  TYR A CE1  1 
ATOM   6775  C CE2  . TYR A 1 442 ? -59.228 0.169   51.642  1.00 23.34 ? 431  TYR A CE2  1 
ATOM   6776  C CZ   . TYR A 1 442 ? -59.252 1.220   52.515  1.00 24.94 ? 431  TYR A CZ   1 
ATOM   6777  O OH   . TYR A 1 442 ? -59.725 0.990   53.799  1.00 28.68 ? 431  TYR A OH   1 
ATOM   6778  H H    . TYR A 1 442 ? -59.716 0.516   47.025  1.00 23.01 ? 431  TYR A H    1 
ATOM   6779  H HA   . TYR A 1 442 ? -59.669 2.997   48.128  1.00 21.30 ? 431  TYR A HA   1 
ATOM   6780  H HB2  . TYR A 1 442 ? -57.632 1.026   48.143  1.00 21.89 ? 431  TYR A HB2  1 
ATOM   6781  H HB3  . TYR A 1 442 ? -57.309 2.551   48.469  1.00 21.89 ? 431  TYR A HB3  1 
ATOM   6782  H HD1  . TYR A 1 442 ? -58.184 3.544   50.541  1.00 26.83 ? 431  TYR A HD1  1 
ATOM   6783  H HD2  . TYR A 1 442 ? -58.777 -0.346  49.762  1.00 23.15 ? 431  TYR A HD2  1 
ATOM   6784  H HE1  . TYR A 1 442 ? -58.904 3.188   52.716  1.00 28.27 ? 431  TYR A HE1  1 
ATOM   6785  H HE2  . TYR A 1 442 ? -59.489 -0.679  51.922  1.00 28.00 ? 431  TYR A HE2  1 
ATOM   6786  H HH   . TYR A 1 442 ? -59.920 0.178   53.893  1.00 34.41 ? 431  TYR A HH   1 
ATOM   6787  N N    . ASN A 1 443 ? -58.461 4.162   46.321  1.00 16.59 ? 432  ASN A N    1 
ATOM   6788  C CA   . ASN A 1 443 ? -57.826 4.866   45.203  1.00 14.37 ? 432  ASN A CA   1 
ATOM   6789  C C    . ASN A 1 443 ? -56.645 5.633   45.783  1.00 15.15 ? 432  ASN A C    1 
ATOM   6790  O O    . ASN A 1 443 ? -56.789 6.310   46.805  1.00 15.78 ? 432  ASN A O    1 
ATOM   6791  C CB   . ASN A 1 443 ? -58.868 5.821   44.600  1.00 16.10 ? 432  ASN A CB   1 
ATOM   6792  C CG   . ASN A 1 443 ? -58.383 6.451   43.335  1.00 16.05 ? 432  ASN A CG   1 
ATOM   6793  O OD1  . ASN A 1 443 ? -57.316 7.052   43.303  1.00 14.67 ? 432  ASN A OD1  1 
ATOM   6794  N ND2  . ASN A 1 443 ? -59.128 6.263   42.269  1.00 16.25 ? 432  ASN A ND2  1 
ATOM   6795  H H    . ASN A 1 443 ? -58.653 4.679   46.980  1.00 19.91 ? 432  ASN A H    1 
ATOM   6796  H HA   . ASN A 1 443 ? -57.517 4.241   44.528  1.00 17.25 ? 432  ASN A HA   1 
ATOM   6797  H HB2  . ASN A 1 443 ? -59.676 5.324   44.400  1.00 19.32 ? 432  ASN A HB2  1 
ATOM   6798  H HB3  . ASN A 1 443 ? -59.058 6.528   45.236  1.00 19.32 ? 432  ASN A HB3  1 
ATOM   6799  H HD21 . ASN A 1 443 ? -59.849 5.798   42.325  1.00 19.49 ? 432  ASN A HD21 1 
ATOM   6800  H HD22 . ASN A 1 443 ? -58.893 6.604   41.515  1.00 19.49 ? 432  ASN A HD22 1 
ATOM   6801  N N    . ILE A 1 444 ? -55.460 5.497   45.178  1.00 13.85 ? 433  ILE A N    1 
ATOM   6802  C CA   . ILE A 1 444 ? -54.286 6.155   45.734  1.00 14.33 ? 433  ILE A CA   1 
ATOM   6803  C C    . ILE A 1 444 ? -54.294 7.669   45.619  1.00 14.57 ? 433  ILE A C    1 
ATOM   6804  O O    . ILE A 1 444 ? -53.443 8.312   46.226  1.00 15.63 ? 433  ILE A O    1 
ATOM   6805  C CB   . ILE A 1 444 ? -52.971 5.594   45.175  1.00 13.91 ? 433  ILE A CB   1 
ATOM   6806  C CG1  . ILE A 1 444 ? -52.838 5.852   43.679  1.00 14.74 ? 433  ILE A CG1  1 
ATOM   6807  C CG2  . ILE A 1 444 ? -52.831 4.144   45.535  1.00 15.66 ? 433  ILE A CG2  1 
ATOM   6808  C CD1  . ILE A 1 444 ? -51.410 5.679   43.133  1.00 14.23 ? 433  ILE A CD1  1 
ATOM   6809  H H    . ILE A 1 444 ? -55.316 5.040   44.463  1.00 16.62 ? 433  ILE A H    1 
ATOM   6810  H HA   . ILE A 1 444 ? -54.278 5.959   46.684  1.00 17.20 ? 433  ILE A HA   1 
ATOM   6811  H HB   . ILE A 1 444 ? -52.247 6.069   45.612  1.00 16.69 ? 433  ILE A HB   1 
ATOM   6812  H HG12 . ILE A 1 444 ? -53.413 5.232   43.204  1.00 17.69 ? 433  ILE A HG12 1 
ATOM   6813  H HG13 . ILE A 1 444 ? -53.116 6.763   43.494  1.00 17.69 ? 433  ILE A HG13 1 
ATOM   6814  H HG21 . ILE A 1 444 ? -51.996 3.808   45.174  1.00 18.79 ? 433  ILE A HG21 1 
ATOM   6815  H HG22 . ILE A 1 444 ? -52.833 4.058   46.502  1.00 18.79 ? 433  ILE A HG22 1 
ATOM   6816  H HG23 . ILE A 1 444 ? -53.578 3.653   45.158  1.00 18.79 ? 433  ILE A HG23 1 
ATOM   6817  H HD11 . ILE A 1 444 ? -51.413 5.860   42.180  1.00 17.08 ? 433  ILE A HD11 1 
ATOM   6818  H HD12 . ILE A 1 444 ? -50.821 6.301   43.587  1.00 17.08 ? 433  ILE A HD12 1 
ATOM   6819  H HD13 . ILE A 1 444 ? -51.119 4.768   43.296  1.00 17.08 ? 433  ILE A HD13 1 
ATOM   6820  N N    . PHE A 1 445 ? -55.270 8.246   44.920  1.00 13.86 ? 434  PHE A N    1 
ATOM   6821  C CA   . PHE A 1 445 ? -55.449 9.690   44.829  1.00 14.55 ? 434  PHE A CA   1 
ATOM   6822  C C    . PHE A 1 445 ? -56.671 10.165  45.586  1.00 15.41 ? 434  PHE A C    1 
ATOM   6823  O O    . PHE A 1 445 ? -57.099 11.305  45.389  1.00 16.35 ? 434  PHE A O    1 
ATOM   6824  C CB   . PHE A 1 445 ? -55.552 10.127  43.372  1.00 15.31 ? 434  PHE A CB   1 
ATOM   6825  C CG   . PHE A 1 445 ? -54.471 9.529   42.494  1.00 13.84 ? 434  PHE A CG   1 
ATOM   6826  C CD1  . PHE A 1 445 ? -53.134 9.926   42.641  1.00 14.10 ? 434  PHE A CD1  1 
ATOM   6827  C CD2  . PHE A 1 445 ? -54.775 8.567   41.585  1.00 14.36 ? 434  PHE A CD2  1 
ATOM   6828  C CE1  . PHE A 1 445 ? -52.116 9.337   41.866  1.00 13.09 ? 434  PHE A CE1  1 
ATOM   6829  C CE2  . PHE A 1 445 ? -53.787 7.933   40.828  1.00 13.42 ? 434  PHE A CE2  1 
ATOM   6830  C CZ   . PHE A 1 445 ? -52.463 8.338   40.950  1.00 14.69 ? 434  PHE A CZ   1 
ATOM   6831  H H    . PHE A 1 445 ? -55.859 7.804   44.476  1.00 16.63 ? 434  PHE A H    1 
ATOM   6832  H HA   . PHE A 1 445 ? -54.673 10.126  45.215  1.00 17.47 ? 434  PHE A HA   1 
ATOM   6833  H HB2  . PHE A 1 445 ? -56.412 9.848   43.020  1.00 18.37 ? 434  PHE A HB2  1 
ATOM   6834  H HB3  . PHE A 1 445 ? -55.473 11.093  43.327  1.00 18.37 ? 434  PHE A HB3  1 
ATOM   6835  H HD1  . PHE A 1 445 ? -52.915 10.582  43.263  1.00 16.92 ? 434  PHE A HD1  1 
ATOM   6836  H HD2  . PHE A 1 445 ? -55.657 8.279   41.509  1.00 17.23 ? 434  PHE A HD2  1 
ATOM   6837  H HE1  . PHE A 1 445 ? -51.231 9.607   41.960  1.00 15.70 ? 434  PHE A HE1  1 
ATOM   6838  H HE2  . PHE A 1 445 ? -54.022 7.286   40.203  1.00 16.10 ? 434  PHE A HE2  1 
ATOM   6839  H HZ   . PHE A 1 445 ? -51.807 7.945   40.421  1.00 17.63 ? 434  PHE A HZ   1 
ATOM   6840  N N    . GLU A 1 446 ? -57.211 9.331   46.479  1.00 16.31 ? 435  GLU A N    1 
ATOM   6841  C CA   . GLU A 1 446 ? -58.404 9.679   47.233  1.00 16.77 ? 435  GLU A CA   1 
ATOM   6842  C C    . GLU A 1 446 ? -58.319 11.099  47.769  1.00 18.06 ? 435  GLU A C    1 
ATOM   6843  O O    . GLU A 1 446 ? -57.400 11.446  48.501  1.00 18.75 ? 435  GLU A O    1 
ATOM   6844  C CB   . GLU A 1 446 ? -58.551 8.710   48.395  1.00 16.80 ? 435  GLU A CB   1 
ATOM   6845  C CG   . GLU A 1 446 ? -59.912 8.884   49.130  1.00 18.89 ? 435  GLU A CG   1 
ATOM   6846  C CD   . GLU A 1 446 ? -61.077 8.448   48.278  1.00 18.97 ? 435  GLU A CD   1 
ATOM   6847  O OE1  . GLU A 1 446 ? -60.977 7.456   47.534  1.00 20.20 ? 435  GLU A OE1  1 
ATOM   6848  O OE2  . GLU A 1 446 ? -62.150 9.096   48.325  1.00 19.65 ? 435  GLU A OE2  1 
ATOM   6849  H H    . GLU A 1 446 ? -56.898 8.552   46.664  1.00 19.58 ? 435  GLU A H    1 
ATOM   6850  H HA   . GLU A 1 446 ? -59.186 9.606   46.664  1.00 20.13 ? 435  GLU A HA   1 
ATOM   6851  H HB2  . GLU A 1 446 ? -58.503 7.801   48.060  1.00 20.16 ? 435  GLU A HB2  1 
ATOM   6852  H HB3  . GLU A 1 446 ? -57.840 8.869   49.035  1.00 20.16 ? 435  GLU A HB3  1 
ATOM   6853  H HG2  . GLU A 1 446 ? -59.909 8.345   49.936  1.00 22.67 ? 435  GLU A HG2  1 
ATOM   6854  H HG3  . GLU A 1 446 ? -60.035 9.820   49.353  1.00 22.67 ? 435  GLU A HG3  1 
ATOM   6855  N N    . GLY A 1 447 ? -59.363 11.879  47.519  1.00 18.13 ? 436  GLY A N    1 
ATOM   6856  C CA   . GLY A 1 447 ? -59.479 13.209  48.072  1.00 19.81 ? 436  GLY A CA   1 
ATOM   6857  C C    . GLY A 1 447 ? -58.809 14.299  47.271  1.00 20.18 ? 436  GLY A C    1 
ATOM   6858  O O    . GLY A 1 447 ? -58.980 15.481  47.606  1.00 22.78 ? 436  GLY A O    1 
ATOM   6859  H H    . GLY A 1 447 ? -60.026 11.651  47.021  1.00 21.76 ? 436  GLY A H    1 
ATOM   6860  H HA2  . GLY A 1 447 ? -60.420 13.434  48.151  1.00 23.77 ? 436  GLY A HA2  1 
ATOM   6861  H HA3  . GLY A 1 447 ? -59.094 13.214  48.962  1.00 23.77 ? 436  GLY A HA3  1 
ATOM   6862  N N    A MET A 1 448 ? -58.045 13.948  46.234  0.77 16.85 ? 437  MET A N    1 
ATOM   6863  N N    B MET A 1 448 ? -58.051 13.965  46.237  0.23 19.99 ? 437  MET A N    1 
ATOM   6864  C CA   A MET A 1 448 ? -57.417 14.977  45.412  0.77 17.48 ? 437  MET A CA   1 
ATOM   6865  C CA   B MET A 1 448 ? -57.365 14.998  45.474  0.23 20.60 ? 437  MET A CA   1 
ATOM   6866  C C    A MET A 1 448 ? -58.481 15.767  44.666  0.77 18.66 ? 437  MET A C    1 
ATOM   6867  C C    B MET A 1 448 ? -58.375 15.761  44.619  0.23 18.90 ? 437  MET A C    1 
ATOM   6868  O O    A MET A 1 448 ? -59.333 15.187  43.976  0.77 24.01 ? 437  MET A O    1 
ATOM   6869  O O    B MET A 1 448 ? -59.109 15.159  43.829  0.23 17.51 ? 437  MET A O    1 
ATOM   6870  C CB   A MET A 1 448 ? -56.476 14.361  44.401  0.77 19.24 ? 437  MET A CB   1 
ATOM   6871  C CB   B MET A 1 448 ? -56.265 14.363  44.627  0.23 22.57 ? 437  MET A CB   1 
ATOM   6872  C CG   A MET A 1 448 ? -55.687 15.420  43.612  0.77 20.67 ? 437  MET A CG   1 
ATOM   6873  C CG   B MET A 1 448 ? -55.072 13.870  45.470  0.23 21.60 ? 437  MET A CG   1 
ATOM   6874  S SD   A MET A 1 448 ? -54.854 14.708  42.211  0.77 23.29 ? 437  MET A SD   1 
ATOM   6875  S SD   B MET A 1 448 ? -53.669 13.159  44.555  0.23 19.85 ? 437  MET A SD   1 
ATOM   6876  C CE   A MET A 1 448 ? -53.781 13.555  43.053  0.77 30.75 ? 437  MET A CE   1 
ATOM   6877  C CE   B MET A 1 448 ? -53.476 14.381  43.263  0.23 17.38 ? 437  MET A CE   1 
ATOM   6878  H H    A MET A 1 448 ? -57.880 13.140  45.991  0.77 20.23 ? 437  MET A H    1 
ATOM   6879  H H    B MET A 1 448 ? -57.919 13.162  45.959  0.23 23.99 ? 437  MET A H    1 
ATOM   6880  H HA   A MET A 1 448 ? -56.908 15.577  45.979  0.77 20.98 ? 437  MET A HA   1 
ATOM   6881  H HA   B MET A 1 448 ? -56.945 15.618  46.091  0.23 24.72 ? 437  MET A HA   1 
ATOM   6882  H HB2  A MET A 1 448 ? -55.839 13.795  44.865  0.77 23.09 ? 437  MET A HB2  1 
ATOM   6883  H HB2  B MET A 1 448 ? -56.632 13.601  44.153  0.23 27.08 ? 437  MET A HB2  1 
ATOM   6884  H HB3  A MET A 1 448 ? -56.990 13.834  43.769  0.77 23.09 ? 437  MET A HB3  1 
ATOM   6885  H HB3  B MET A 1 448 ? -55.934 15.020  43.995  0.23 27.08 ? 437  MET A HB3  1 
ATOM   6886  H HG2  A MET A 1 448 ? -56.299 16.099  43.288  0.77 24.80 ? 437  MET A HG2  1 
ATOM   6887  H HG2  B MET A 1 448 ? -54.731 14.620  45.981  0.23 25.92 ? 437  MET A HG2  1 
ATOM   6888  H HG3  A MET A 1 448 ? -55.019 15.819  44.191  0.77 24.80 ? 437  MET A HG3  1 
ATOM   6889  H HG3  B MET A 1 448 ? -55.393 13.187  46.079  0.23 25.92 ? 437  MET A HG3  1 
ATOM   6890  H HE1  A MET A 1 448 ? -53.249 13.080  42.395  0.77 36.90 ? 437  MET A HE1  1 
ATOM   6891  H HE1  B MET A 1 448 ? -52.740 14.118  42.688  0.23 20.85 ? 437  MET A HE1  1 
ATOM   6892  H HE2  A MET A 1 448 ? -53.200 14.047  43.655  0.77 36.90 ? 437  MET A HE2  1 
ATOM   6893  H HE2  B MET A 1 448 ? -54.297 14.430  42.750  0.23 20.85 ? 437  MET A HE2  1 
ATOM   6894  H HE3  A MET A 1 448 ? -54.324 12.928  43.555  0.77 36.90 ? 437  MET A HE3  1 
ATOM   6895  H HE3  B MET A 1 448 ? -53.287 15.242  43.669  0.23 20.85 ? 437  MET A HE3  1 
ATOM   6896  N N    . GLU A 1 449 ? -58.429 17.081  44.805  1.00 18.79 ? 438  GLU A N    1 
ATOM   6897  C CA   . GLU A 1 449 ? -59.283 17.978  44.019  1.00 21.84 ? 438  GLU A CA   1 
ATOM   6898  C C    . GLU A 1 449 ? -58.485 18.315  42.774  1.00 20.08 ? 438  GLU A C    1 
ATOM   6899  O O    . GLU A 1 449 ? -57.515 19.074  42.821  1.00 25.99 ? 438  GLU A O    1 
ATOM   6900  C CB   . GLU A 1 449 ? -59.666 19.231  44.804  1.00 25.06 ? 438  GLU A CB   1 
ATOM   6901  C CG   . GLU A 1 449 ? -60.407 18.947  46.098  1.00 30.13 ? 438  GLU A CG   1 
ATOM   6902  C CD   . GLU A 1 449 ? -61.836 18.651  45.852  1.00 45.50 ? 438  GLU A CD   1 
ATOM   6903  O OE1  . GLU A 1 449 ? -62.429 19.328  44.975  1.00 51.31 ? 438  GLU A OE1  1 
ATOM   6904  O OE2  . GLU A 1 449 ? -62.364 17.736  46.524  1.00 52.13 ? 438  GLU A OE2  1 
ATOM   6905  H H    . GLU A 1 449 ? -57.936 17.495  45.374  1.00 22.55 ? 438  GLU A H    1 
ATOM   6906  H HA   . GLU A 1 449 ? -60.094 17.514  43.755  1.00 26.20 ? 438  GLU A HA   1 
ATOM   6907  H HB2  . GLU A 1 449 ? -58.857 19.718  45.027  1.00 30.07 ? 438  GLU A HB2  1 
ATOM   6908  H HB3  . GLU A 1 449 ? -60.239 19.783  44.250  1.00 30.07 ? 438  GLU A HB3  1 
ATOM   6909  H HG2  . GLU A 1 449 ? -60.007 18.178  46.533  1.00 36.16 ? 438  GLU A HG2  1 
ATOM   6910  H HG3  . GLU A 1 449 ? -60.352 19.725  46.675  1.00 36.16 ? 438  GLU A HG3  1 
ATOM   6911  N N    A CYS A 1 450 ? -58.927 17.793  41.650  0.76 20.16 ? 439  CYS A N    1 
ATOM   6912  N N    B CYS A 1 450 ? -58.834 17.688  41.664  0.24 13.92 ? 439  CYS A N    1 
ATOM   6913  C CA   A CYS A 1 450 ? -58.121 17.755  40.458  0.76 19.67 ? 439  CYS A CA   1 
ATOM   6914  C CA   B CYS A 1 450 ? -58.039 17.792  40.459  0.24 15.77 ? 439  CYS A CA   1 
ATOM   6915  C C    A CYS A 1 450 ? -58.798 18.564  39.361  0.76 17.28 ? 439  CYS A C    1 
ATOM   6916  C C    B CYS A 1 450 ? -58.783 18.588  39.407  0.24 15.64 ? 439  CYS A C    1 
ATOM   6917  O O    A CYS A 1 450 ? -59.947 18.291  38.989  0.76 19.97 ? 439  CYS A O    1 
ATOM   6918  O O    B CYS A 1 450 ? -59.955 18.322  39.118  0.24 14.88 ? 439  CYS A O    1 
ATOM   6919  C CB   A CYS A 1 450 ? -57.970 16.295  40.035  0.76 21.42 ? 439  CYS A CB   1 
ATOM   6920  C CB   B CYS A 1 450 ? -57.700 16.413  39.905  0.24 16.87 ? 439  CYS A CB   1 
ATOM   6921  S SG   A CYS A 1 450 ? -56.694 16.081  38.844  0.76 18.23 ? 439  CYS A SG   1 
ATOM   6922  S SG   B CYS A 1 450 ? -56.123 15.822  40.488  0.24 17.50 ? 439  CYS A SG   1 
ATOM   6923  H H    A CYS A 1 450 ? -59.709 17.448  41.553  0.76 24.20 ? 439  CYS A H    1 
ATOM   6924  H H    B CYS A 1 450 ? -59.532 17.192  41.584  0.24 16.70 ? 439  CYS A H    1 
ATOM   6925  H HA   A CYS A 1 450 ? -57.243 18.128  40.635  0.76 23.60 ? 439  CYS A HA   1 
ATOM   6926  H HA   B CYS A 1 450 ? -57.210 18.253  40.660  0.24 18.92 ? 439  CYS A HA   1 
ATOM   6927  H HB2  A CYS A 1 450 ? -57.750 15.759  40.814  0.76 25.71 ? 439  CYS A HB2  1 
ATOM   6928  H HB2  B CYS A 1 450 ? -58.381 15.781  40.184  0.24 20.24 ? 439  CYS A HB2  1 
ATOM   6929  H HB3  A CYS A 1 450 ? -58.803 15.989  39.644  0.76 25.71 ? 439  CYS A HB3  1 
ATOM   6930  H HB3  B CYS A 1 450 ? -57.665 16.459  38.936  0.24 20.24 ? 439  CYS A HB3  1 
ATOM   6931  H HG   A CYS A 1 450 ? -56.623 14.919  38.552  0.76 21.88 ? 439  CYS A HG   1 
ATOM   6932  H HG   B CYS A 1 450 ? -55.915 14.737  40.018  0.24 21.01 ? 439  CYS A HG   1 
ATOM   6933  N N    . ARG A 1 451 ? -58.088 19.552  38.832  1.00 17.57 ? 440  ARG A N    1 
ATOM   6934  C CA   . ARG A 1 451 ? -58.620 20.331  37.730  1.00 19.63 ? 440  ARG A CA   1 
ATOM   6935  C C    . ARG A 1 451 ? -58.363 19.611  36.395  1.00 19.62 ? 440  ARG A C    1 
ATOM   6936  O O    . ARG A 1 451 ? -57.286 19.061  36.171  1.00 23.37 ? 440  ARG A O    1 
ATOM   6937  C CB   . ARG A 1 451 ? -57.961 21.703  37.793  1.00 26.25 ? 440  ARG A CB   1 
ATOM   6938  C CG   . ARG A 1 451 ? -58.512 22.556  36.824  1.00 31.00 ? 440  ARG A CG   1 
ATOM   6939  C CD   . ARG A 1 451 ? -58.431 23.917  37.253  1.00 30.18 ? 440  ARG A CD   1 
ATOM   6940  N NE   . ARG A 1 451 ? -58.463 24.755  36.102  1.00 26.85 ? 440  ARG A NE   1 
ATOM   6941  C CZ   . ARG A 1 451 ? -58.119 26.017  36.138  1.00 32.32 ? 440  ARG A CZ   1 
ATOM   6942  N NH1  . ARG A 1 451 ? -57.735 26.542  37.298  1.00 31.03 ? 440  ARG A NH1  1 
ATOM   6943  N NH2  . ARG A 1 451 ? -58.173 26.735  35.023  1.00 36.43 ? 440  ARG A NH2  1 
ATOM   6944  H H    A ARG A 1 451 ? -57.303 19.789  39.092  0.76 21.08 ? 440  ARG A H    1 
ATOM   6945  H H    B ARG A 1 451 ? -57.292 19.779  39.066  0.24 21.08 ? 440  ARG A H    1 
ATOM   6946  H HA   . ARG A 1 451 ? -59.577 20.442  37.842  1.00 23.56 ? 440  ARG A HA   1 
ATOM   6947  H HB2  . ARG A 1 451 ? -58.111 22.095  38.668  1.00 31.50 ? 440  ARG A HB2  1 
ATOM   6948  H HB3  . ARG A 1 451 ? -57.010 21.614  37.620  1.00 31.50 ? 440  ARG A HB3  1 
ATOM   6949  H HG2  . ARG A 1 451 ? -58.017 22.466  35.994  1.00 37.20 ? 440  ARG A HG2  1 
ATOM   6950  H HG3  . ARG A 1 451 ? -59.446 22.331  36.688  1.00 37.20 ? 440  ARG A HG3  1 
ATOM   6951  H HD2  . ARG A 1 451 ? -59.190 24.131  37.818  1.00 36.22 ? 440  ARG A HD2  1 
ATOM   6952  H HD3  . ARG A 1 451 ? -57.596 24.065  37.726  1.00 36.22 ? 440  ARG A HD3  1 
ATOM   6953  H HE   . ARG A 1 451 ? -58.532 24.379  35.332  1.00 32.22 ? 440  ARG A HE   1 
ATOM   6954  H HH11 . ARG A 1 451 ? -57.710 26.052  38.005  1.00 37.24 ? 440  ARG A HH11 1 
ATOM   6955  H HH12 . ARG A 1 451 ? -57.507 27.370  37.341  1.00 37.24 ? 440  ARG A HH12 1 
ATOM   6956  H HH21 . ARG A 1 451 ? -58.427 26.369  34.288  1.00 43.71 ? 440  ARG A HH21 1 
ATOM   6957  H HH22 . ARG A 1 451 ? -57.952 27.566  35.036  1.00 43.71 ? 440  ARG A HH22 1 
ATOM   6958  N N    . GLY A 1 452 ? -59.373 19.576  35.524  1.00 18.25 ? 441  GLY A N    1 
ATOM   6959  C CA   . GLY A 1 452 ? -59.279 19.041  34.183  1.00 17.88 ? 441  GLY A CA   1 
ATOM   6960  C C    . GLY A 1 452 ? -59.966 17.705  34.056  1.00 18.75 ? 441  GLY A C    1 
ATOM   6961  O O    . GLY A 1 452 ? -59.687 16.798  34.852  1.00 19.98 ? 441  GLY A O    1 
ATOM   6962  H H    . GLY A 1 452 ? -60.158 19.875  35.707  1.00 21.89 ? 441  GLY A H    1 
ATOM   6963  H HA2  . GLY A 1 452 ? -59.689 19.659  33.558  1.00 21.45 ? 441  GLY A HA2  1 
ATOM   6964  H HA3  . GLY A 1 452 ? -58.346 18.931  33.942  1.00 21.45 ? 441  GLY A HA3  1 
ATOM   6965  N N    . SER A 1 453 ? -60.821 17.547  33.045  1.00 19.30 ? 442  SER A N    1 
ATOM   6966  C CA   . SER A 1 453 ? -61.518 16.278  32.845  1.00 18.76 ? 442  SER A CA   1 
ATOM   6967  C C    . SER A 1 453 ? -62.052 16.220  31.425  1.00 17.00 ? 442  SER A C    1 
ATOM   6968  O O    . SER A 1 453 ? -62.265 17.257  30.789  1.00 18.95 ? 442  SER A O    1 
ATOM   6969  C CB   . SER A 1 453 ? -62.685 16.135  33.814  1.00 22.95 ? 442  SER A CB   1 
ATOM   6970  O OG   . SER A 1 453 ? -63.575 17.197  33.599  1.00 29.23 ? 442  SER A OG   1 
ATOM   6971  H H    . SER A 1 453 ? -61.014 18.153  32.466  1.00 23.16 ? 442  SER A H    1 
ATOM   6972  H HA   . SER A 1 453 ? -60.904 15.539  32.981  1.00 22.51 ? 442  SER A HA   1 
ATOM   6973  H HB2  . SER A 1 453 ? -63.140 15.294  33.650  1.00 27.54 ? 442  SER A HB2  1 
ATOM   6974  H HB3  . SER A 1 453 ? -62.355 16.169  34.725  1.00 27.54 ? 442  SER A HB3  1 
ATOM   6975  H HG   . SER A 1 453 ? -64.227 17.136  34.125  1.00 35.08 ? 442  SER A HG   1 
ATOM   6976  N N    . PRO A 1 454 ? -62.276 15.020  30.897  1.00 17.99 ? 443  PRO A N    1 
ATOM   6977  C CA   . PRO A 1 454 ? -62.884 14.910  29.565  1.00 18.06 ? 443  PRO A CA   1 
ATOM   6978  C C    . PRO A 1 454 ? -64.376 15.210  29.631  1.00 18.48 ? 443  PRO A C    1 
ATOM   6979  O O    . PRO A 1 454 ? -65.085 14.810  30.570  1.00 22.43 ? 443  PRO A O    1 
ATOM   6980  C CB   . PRO A 1 454 ? -62.634 13.443  29.180  1.00 20.42 ? 443  PRO A CB   1 
ATOM   6981  C CG   . PRO A 1 454 ? -62.331 12.752  30.429  1.00 22.69 ? 443  PRO A CG   1 
ATOM   6982  C CD   . PRO A 1 454 ? -61.925 13.708  31.457  1.00 18.98 ? 443  PRO A CD   1 
ATOM   6983  H HA   . PRO A 1 454 ? -62.449 15.502  28.931  1.00 21.67 ? 443  PRO A HA   1 
ATOM   6984  H HB2  . PRO A 1 454 ? -63.432 13.074  28.771  1.00 24.51 ? 443  PRO A HB2  1 
ATOM   6985  H HB3  . PRO A 1 454 ? -61.882 13.391  28.570  1.00 24.51 ? 443  PRO A HB3  1 
ATOM   6986  H HG2  . PRO A 1 454 ? -63.124 12.276  30.721  1.00 27.23 ? 443  PRO A HG2  1 
ATOM   6987  H HG3  . PRO A 1 454 ? -61.612 12.121  30.268  1.00 27.23 ? 443  PRO A HG3  1 
ATOM   6988  H HD2  . PRO A 1 454 ? -62.420 13.550  32.276  1.00 22.78 ? 443  PRO A HD2  1 
ATOM   6989  H HD3  . PRO A 1 454 ? -60.968 13.653  31.607  1.00 22.78 ? 443  PRO A HD3  1 
ATOM   6990  N N    . LEU A 1 455 ? -64.841 15.937  28.633  1.00 16.90 ? 444  LEU A N    1 
ATOM   6991  C CA   . LEU A 1 455 ? -66.271 16.124  28.380  1.00 19.68 ? 444  LEU A CA   1 
ATOM   6992  C C    . LEU A 1 455 ? -66.817 15.131  27.379  1.00 18.01 ? 444  LEU A C    1 
ATOM   6993  O O    . LEU A 1 455 ? -67.938 14.624  27.561  1.00 22.11 ? 444  LEU A O    1 
ATOM   6994  C CB   . LEU A 1 455 ? -66.529 17.521  27.817  1.00 22.03 ? 444  LEU A CB   1 
ATOM   6995  C CG   . LEU A 1 455 ? -66.328 18.651  28.808  1.00 24.25 ? 444  LEU A CG   1 
ATOM   6996  C CD1  . LEU A 1 455 ? -66.463 19.983  28.072  1.00 29.30 ? 444  LEU A CD1  1 
ATOM   6997  C CD2  . LEU A 1 455 ? -67.305 18.555  29.951  1.00 31.11 ? 444  LEU A CD2  1 
ATOM   6998  H H    . LEU A 1 455 ? -64.338 16.345  28.067  1.00 20.28 ? 444  LEU A H    1 
ATOM   6999  H HA   . LEU A 1 455 ? -66.763 16.030  29.211  1.00 23.61 ? 444  LEU A HA   1 
ATOM   7000  H HB2  . LEU A 1 455 ? -65.923 17.671  27.074  1.00 26.44 ? 444  LEU A HB2  1 
ATOM   7001  H HB3  . LEU A 1 455 ? -67.446 17.564  27.504  1.00 26.44 ? 444  LEU A HB3  1 
ATOM   7002  H HG   . LEU A 1 455 ? -65.431 18.597  29.173  1.00 29.09 ? 444  LEU A HG   1 
ATOM   7003  H HD11 . LEU A 1 455 ? -66.336 20.707  28.704  1.00 35.16 ? 444  LEU A HD11 1 
ATOM   7004  H HD12 . LEU A 1 455 ? -65.789 20.028  27.376  1.00 35.16 ? 444  LEU A HD12 1 
ATOM   7005  H HD13 . LEU A 1 455 ? -67.349 20.038  27.679  1.00 35.16 ? 444  LEU A HD13 1 
ATOM   7006  H HD21 . LEU A 1 455 ? -67.148 19.292  30.562  1.00 37.33 ? 444  LEU A HD21 1 
ATOM   7007  H HD22 . LEU A 1 455 ? -68.208 18.604  29.599  1.00 37.33 ? 444  LEU A HD22 1 
ATOM   7008  H HD23 . LEU A 1 455 ? -67.173 17.710  30.409  1.00 37.33 ? 444  LEU A HD23 1 
ATOM   7009  N N    . VAL A 1 456 ? -66.097 14.883  26.293  1.00 18.47 ? 445  VAL A N    1 
ATOM   7010  C CA   . VAL A 1 456 ? -66.488 13.925  25.275  1.00 16.98 ? 445  VAL A CA   1 
ATOM   7011  C C    . VAL A 1 456 ? -65.252 13.117  24.923  1.00 16.53 ? 445  VAL A C    1 
ATOM   7012  O O    . VAL A 1 456 ? -64.158 13.687  24.787  1.00 16.37 ? 445  VAL A O    1 
ATOM   7013  C CB   . VAL A 1 456 ? -67.024 14.653  24.026  1.00 17.83 ? 445  VAL A CB   1 
ATOM   7014  C CG1  . VAL A 1 456 ? -67.340 13.674  22.899  1.00 19.99 ? 445  VAL A CG1  1 
ATOM   7015  C CG2  . VAL A 1 456 ? -68.264 15.403  24.344  1.00 19.89 ? 445  VAL A CG2  1 
ATOM   7016  H H    . VAL A 1 456 ? -65.351 15.274  26.121  1.00 22.17 ? 445  VAL A H    1 
ATOM   7017  H HA   . VAL A 1 456 ? -67.173 13.329  25.618  1.00 20.37 ? 445  VAL A HA   1 
ATOM   7018  H HB   . VAL A 1 456 ? -66.358 15.282  23.708  1.00 21.39 ? 445  VAL A HB   1 
ATOM   7019  H HG11 . VAL A 1 456 ? -67.673 14.170  22.135  1.00 23.99 ? 445  VAL A HG11 1 
ATOM   7020  H HG12 . VAL A 1 456 ? -66.530 13.199  22.658  1.00 23.99 ? 445  VAL A HG12 1 
ATOM   7021  H HG13 . VAL A 1 456 ? -68.013 13.046  23.206  1.00 23.99 ? 445  VAL A HG13 1 
ATOM   7022  H HG21 . VAL A 1 456 ? -68.577 15.850  23.542  1.00 23.86 ? 445  VAL A HG21 1 
ATOM   7023  H HG22 . VAL A 1 456 ? -68.937 14.781  24.661  1.00 23.86 ? 445  VAL A HG22 1 
ATOM   7024  H HG23 . VAL A 1 456 ? -68.068 16.058  25.033  1.00 23.86 ? 445  VAL A HG23 1 
ATOM   7025  N N    . VAL A 1 457 ? -65.407 11.795  24.763  1.00 15.27 ? 446  VAL A N    1 
ATOM   7026  C CA   . VAL A 1 457 ? -64.306 10.939  24.300  1.00 14.94 ? 446  VAL A CA   1 
ATOM   7027  C C    . VAL A 1 457 ? -64.792 10.195  23.089  1.00 13.92 ? 446  VAL A C    1 
ATOM   7028  O O    . VAL A 1 457 ? -65.897 9.629   23.102  1.00 15.76 ? 446  VAL A O    1 
ATOM   7029  C CB   . VAL A 1 457 ? -63.833 9.957   25.384  1.00 15.51 ? 446  VAL A CB   1 
ATOM   7030  C CG1  . VAL A 1 457 ? -62.719 9.056   24.849  1.00 15.64 ? 446  VAL A CG1  1 
ATOM   7031  C CG2  . VAL A 1 457 ? -63.385 10.702  26.645  1.00 14.88 ? 446  VAL A CG2  1 
ATOM   7032  H H    . VAL A 1 457 ? -66.139 11.371  24.916  1.00 18.32 ? 446  VAL A H    1 
ATOM   7033  H HA   . VAL A 1 457 ? -63.554 11.493  24.039  1.00 17.93 ? 446  VAL A HA   1 
ATOM   7034  H HB   . VAL A 1 457 ? -64.578 9.386   25.630  1.00 18.61 ? 446  VAL A HB   1 
ATOM   7035  H HG11 . VAL A 1 457 ? -62.440 8.448   25.552  1.00 18.76 ? 446  VAL A HG11 1 
ATOM   7036  H HG12 . VAL A 1 457 ? -63.056 8.554   24.091  1.00 18.76 ? 446  VAL A HG12 1 
ATOM   7037  H HG13 . VAL A 1 457 ? -61.971 9.609   24.574  1.00 18.76 ? 446  VAL A HG13 1 
ATOM   7038  H HG21 . VAL A 1 457 ? -63.094 10.055  27.307  1.00 17.85 ? 446  VAL A HG21 1 
ATOM   7039  H HG22 . VAL A 1 457 ? -62.653 11.296  26.417  1.00 17.85 ? 446  VAL A HG22 1 
ATOM   7040  H HG23 . VAL A 1 457 ? -64.133 11.216  26.990  1.00 17.85 ? 446  VAL A HG23 1 
ATOM   7041  N N    A ILE A 1 458 ? -63.999 10.234  22.032  0.60 14.97 ? 447  ILE A N    1 
ATOM   7042  N N    B ILE A 1 458 ? -63.981 10.214  22.050  0.40 15.36 ? 447  ILE A N    1 
ATOM   7043  C CA   A ILE A 1 458 ? -64.281 9.562   20.775  0.60 16.27 ? 447  ILE A CA   1 
ATOM   7044  C CA   B ILE A 1 458 ? -64.251 9.570   20.782  0.40 15.29 ? 447  ILE A CA   1 
ATOM   7045  C C    A ILE A 1 458 ? -63.162 8.564   20.528  0.60 14.97 ? 447  ILE A C    1 
ATOM   7046  C C    B ILE A 1 458 ? -63.144 8.548   20.580  0.40 13.19 ? 447  ILE A C    1 
ATOM   7047  O O    A ILE A 1 458 ? -61.974 8.942   20.542  0.60 15.36 ? 447  ILE A O    1 
ATOM   7048  O O    B ILE A 1 458 ? -61.955 8.898   20.668  0.40 13.81 ? 447  ILE A O    1 
ATOM   7049  C CB   A ILE A 1 458 ? -64.372 10.572  19.621  0.60 17.82 ? 447  ILE A CB   1 
ATOM   7050  C CB   B ILE A 1 458 ? -64.211 10.601  19.640  0.40 15.40 ? 447  ILE A CB   1 
ATOM   7051  C CG1  A ILE A 1 458 ? -65.658 11.368  19.770  0.60 17.20 ? 447  ILE A CG1  1 
ATOM   7052  C CG1  B ILE A 1 458 ? -65.161 11.795  19.904  0.40 17.43 ? 447  ILE A CG1  1 
ATOM   7053  C CG2  A ILE A 1 458 ? -64.300 9.893   18.244  0.60 18.04 ? 447  ILE A CG2  1 
ATOM   7054  C CG2  B ILE A 1 458 ? -64.511 9.921   18.321  0.40 15.81 ? 447  ILE A CG2  1 
ATOM   7055  C CD1  A ILE A 1 458 ? -65.566 12.728  19.222  0.60 17.47 ? 447  ILE A CD1  1 
ATOM   7056  C CD1  B ILE A 1 458 ? -66.596 11.450  20.059  0.40 20.84 ? 447  ILE A CD1  1 
ATOM   7057  H H    A ILE A 1 458 ? -63.256 10.666  22.020  0.60 17.97 ? 447  ILE A H    1 
ATOM   7058  H H    B ILE A 1 458 ? -63.222 10.619  22.058  0.40 18.43 ? 447  ILE A H    1 
ATOM   7059  H HA   A ILE A 1 458 ? -65.121 9.082   20.838  0.60 19.53 ? 447  ILE A HA   1 
ATOM   7060  H HA   B ILE A 1 458 ? -65.113 9.125   20.796  0.40 18.34 ? 447  ILE A HA   1 
ATOM   7061  H HB   A ILE A 1 458 ? -63.625 11.186  19.696  0.60 21.38 ? 447  ILE A HB   1 
ATOM   7062  H HB   B ILE A 1 458 ? -63.307 10.951  19.592  0.40 18.47 ? 447  ILE A HB   1 
ATOM   7063  H HG12 A ILE A 1 458 ? -66.370 10.905  19.301  0.60 20.64 ? 447  ILE A HG12 1 
ATOM   7064  H HG12 B ILE A 1 458 ? -64.878 12.237  20.719  0.40 20.92 ? 447  ILE A HG12 1 
ATOM   7065  H HG13 A ILE A 1 458 ? -65.876 11.441  20.712  0.60 20.64 ? 447  ILE A HG13 1 
ATOM   7066  H HG13 B ILE A 1 458 ? -65.089 12.413  19.159  0.40 20.92 ? 447  ILE A HG13 1 
ATOM   7067  H HG21 A ILE A 1 458 ? -64.362 10.572  17.554  0.60 21.65 ? 447  ILE A HG21 1 
ATOM   7068  H HG21 B ILE A 1 458 ? -64.483 10.582  17.612  0.40 18.98 ? 447  ILE A HG21 1 
ATOM   7069  H HG22 A ILE A 1 458 ? -63.457 9.420   18.169  0.60 21.65 ? 447  ILE A HG22 1 
ATOM   7070  H HG22 B ILE A 1 458 ? -63.845 9.234   18.161  0.40 18.98 ? 447  ILE A HG22 1 
ATOM   7071  H HG23 A ILE A 1 458 ? -65.038 9.269   18.162  0.60 21.65 ? 447  ILE A HG23 1 
ATOM   7072  H HG23 B ILE A 1 458 ? -65.394 9.522   18.366  0.40 18.98 ? 447  ILE A HG23 1 
ATOM   7073  H HD11 A ILE A 1 458 ? -66.416 13.177  19.349  0.60 20.96 ? 447  ILE A HD11 1 
ATOM   7074  H HD11 B ILE A 1 458 ? -67.100 12.263  20.219  0.40 25.01 ? 447  ILE A HD11 1 
ATOM   7075  H HD12 A ILE A 1 458 ? -64.864 13.208  19.688  0.60 20.96 ? 447  ILE A HD12 1 
ATOM   7076  H HD12 B ILE A 1 458 ? -66.907 11.022  19.246  0.40 25.01 ? 447  ILE A HD12 1 
ATOM   7077  H HD13 A ILE A 1 458 ? -65.358 12.673  18.276  0.60 20.96 ? 447  ILE A HD13 1 
ATOM   7078  H HD13 B ILE A 1 458 ? -66.695 10.846  20.811  0.40 25.01 ? 447  ILE A HD13 1 
ATOM   7079  N N    . SER A 1 459 ? -63.517 7.292   20.327  1.00 15.28 ? 448  SER A N    1 
ATOM   7080  C CA   . SER A 1 459 ? -62.562 6.228   20.054  1.00 14.35 ? 448  SER A CA   1 
ATOM   7081  C C    . SER A 1 459 ? -62.980 5.519   18.789  1.00 14.32 ? 448  SER A C    1 
ATOM   7082  O O    . SER A 1 459 ? -64.130 5.093   18.660  1.00 15.00 ? 448  SER A O    1 
ATOM   7083  C CB   . SER A 1 459 ? -62.517 5.260   21.220  1.00 16.37 ? 448  SER A CB   1 
ATOM   7084  O OG   . SER A 1 459 ? -61.752 4.102   20.913  1.00 17.52 ? 448  SER A OG   1 
ATOM   7085  H H    . SER A 1 459 ? -64.333 7.022   20.327  1.00 18.33 ? 448  SER A H    1 
ATOM   7086  H HA   . SER A 1 459 ? -61.677 6.604   19.925  1.00 17.22 ? 448  SER A HA   1 
ATOM   7087  H HB2  . SER A 1 459 ? -62.116 5.706   21.982  1.00 19.65 ? 448  SER A HB2  1 
ATOM   7088  H HB3  . SER A 1 459 ? -63.423 4.988   21.436  1.00 19.65 ? 448  SER A HB3  1 
ATOM   7089  H HG   . SER A 1 459 ? -61.742 3.581   21.572  1.00 21.03 ? 448  SER A HG   1 
ATOM   7090  N N    . GLN A 1 460 ? -62.065 5.388   17.857  1.00 15.09 ? 449  GLN A N    1 
ATOM   7091  C CA   . GLN A 1 460 ? -62.377 4.804   16.555  1.00 14.76 ? 449  GLN A CA   1 
ATOM   7092  C C    . GLN A 1 460 ? -63.550 5.528   15.890  1.00 14.54 ? 449  GLN A C    1 
ATOM   7093  O O    . GLN A 1 460 ? -64.347 4.922   15.160  1.00 16.73 ? 449  GLN A O    1 
ATOM   7094  C CB   . GLN A 1 460 ? -62.659 3.303   16.625  1.00 15.90 ? 449  GLN A CB   1 
ATOM   7095  C CG   . GLN A 1 460 ? -61.514 2.512   17.253  1.00 17.30 ? 449  GLN A CG   1 
ATOM   7096  C CD   . GLN A 1 460 ? -61.712 1.019   17.050  1.00 17.04 ? 449  GLN A CD   1 
ATOM   7097  O OE1  . GLN A 1 460 ? -61.571 0.521   15.948  1.00 18.36 ? 449  GLN A OE1  1 
ATOM   7098  N NE2  . GLN A 1 460 ? -61.995 0.315   18.104  1.00 16.56 ? 449  GLN A NE2  1 
ATOM   7099  H H    . GLN A 1 460 ? -61.244 5.629   17.945  1.00 18.11 ? 449  GLN A H    1 
ATOM   7100  H HA   . GLN A 1 460 ? -61.605 4.922   15.979  1.00 17.71 ? 449  GLN A HA   1 
ATOM   7101  H HB2  . GLN A 1 460 ? -63.454 3.157   17.162  1.00 19.08 ? 449  GLN A HB2  1 
ATOM   7102  H HB3  . GLN A 1 460 ? -62.799 2.966   15.727  1.00 19.08 ? 449  GLN A HB3  1 
ATOM   7103  H HG2  . GLN A 1 460 ? -60.677 2.769   16.835  1.00 20.76 ? 449  GLN A HG2  1 
ATOM   7104  H HG3  . GLN A 1 460 ? -61.484 2.690   18.206  1.00 20.76 ? 449  GLN A HG3  1 
ATOM   7105  H HE21 . GLN A 1 460 ? -62.062 0.697   18.871  1.00 19.87 ? 449  GLN A HE21 1 
ATOM   7106  H HE22 . GLN A 1 460 ? -62.116 -0.534  18.034  1.00 19.87 ? 449  GLN A HE22 1 
ATOM   7107  N N    . GLY A 1 461 ? -63.668 6.847   16.101  1.00 14.93 ? 450  GLY A N    1 
ATOM   7108  C CA   . GLY A 1 461 ? -64.739 7.603   15.476  1.00 15.32 ? 450  GLY A CA   1 
ATOM   7109  C C    . GLY A 1 461 ? -66.105 7.448   16.093  1.00 15.39 ? 450  GLY A C    1 
ATOM   7110  O O    . GLY A 1 461 ? -67.066 7.978   15.525  1.00 18.08 ? 450  GLY A O    1 
ATOM   7111  H H    . GLY A 1 461 ? -63.143 7.314   16.597  1.00 17.91 ? 450  GLY A H    1 
ATOM   7112  H HA2  . GLY A 1 461 ? -64.509 8.545   15.500  1.00 18.38 ? 450  GLY A HA2  1 
ATOM   7113  H HA3  . GLY A 1 461 ? -64.804 7.337   14.545  1.00 18.38 ? 450  GLY A HA3  1 
ATOM   7114  N N    . LYS A 1 462 ? -66.200 6.793   17.260  1.00 15.45 ? 451  LYS A N    1 
ATOM   7115  C CA   . LYS A 1 462 ? -67.461 6.573   17.951  1.00 16.41 ? 451  LYS A CA   1 
ATOM   7116  C C    . LYS A 1 462 ? -67.426 7.296   19.290  1.00 16.44 ? 451  LYS A C    1 
ATOM   7117  O O    . LYS A 1 462 ? -66.391 7.328   19.974  1.00 16.05 ? 451  LYS A O    1 
ATOM   7118  C CB   . LYS A 1 462 ? -67.644 5.089   18.225  1.00 16.62 ? 451  LYS A CB   1 
ATOM   7119  C CG   . LYS A 1 462 ? -67.788 4.296   16.918  1.00 18.37 ? 451  LYS A CG   1 
ATOM   7120  C CD   . LYS A 1 462 ? -68.140 2.810   17.112  1.00 18.94 ? 451  LYS A CD   1 
ATOM   7121  C CE   . LYS A 1 462 ? -68.201 2.068   15.809  1.00 22.72 ? 451  LYS A CE   1 
ATOM   7122  N NZ   . LYS A 1 462 ? -68.359 0.616   16.017  1.00 27.24 ? 451  LYS A NZ   1 
ATOM   7123  H H    . LYS A 1 462 ? -65.524 6.461   17.675  1.00 18.54 ? 451  LYS A H    1 
ATOM   7124  H HA   . LYS A 1 462 ? -68.204 6.902   17.422  1.00 19.70 ? 451  LYS A HA   1 
ATOM   7125  H HB2  . LYS A 1 462 ? -66.870 4.752   18.702  1.00 19.94 ? 451  LYS A HB2  1 
ATOM   7126  H HB3  . LYS A 1 462 ? -68.448 4.956   18.752  1.00 19.94 ? 451  LYS A HB3  1 
ATOM   7127  H HG2  . LYS A 1 462 ? -68.492 4.699   16.387  1.00 22.04 ? 451  LYS A HG2  1 
ATOM   7128  H HG3  . LYS A 1 462 ? -66.948 4.339   16.435  1.00 22.04 ? 451  LYS A HG3  1 
ATOM   7129  H HD2  . LYS A 1 462 ? -67.462 2.392   17.665  1.00 22.72 ? 451  LYS A HD2  1 
ATOM   7130  H HD3  . LYS A 1 462 ? -69.008 2.742   17.539  1.00 22.72 ? 451  LYS A HD3  1 
ATOM   7131  H HE2  . LYS A 1 462 ? -68.961 2.385   15.296  1.00 27.26 ? 451  LYS A HE2  1 
ATOM   7132  H HE3  . LYS A 1 462 ? -67.378 2.217   15.317  1.00 27.26 ? 451  LYS A HE3  1 
ATOM   7133  H HZ1  . LYS A 1 462 ? -67.671 0.300   16.484  1.00 32.68 ? 451  LYS A HZ1  1 
ATOM   7134  H HZ2  . LYS A 1 462 ? -69.111 0.453   16.464  1.00 32.68 ? 451  LYS A HZ2  1 
ATOM   7135  H HZ3  . LYS A 1 462 ? -68.393 0.198   15.232  1.00 32.68 ? 451  LYS A HZ3  1 
ATOM   7136  N N    . ILE A 1 463 ? -68.563 7.882   19.656  1.00 16.73 ? 452  ILE A N    1 
ATOM   7137  C CA   . ILE A 1 463 ? -68.686 8.553   20.946  1.00 16.92 ? 452  ILE A CA   1 
ATOM   7138  C C    . ILE A 1 463 ? -68.782 7.508   22.050  1.00 16.73 ? 452  ILE A C    1 
ATOM   7139  O O    . ILE A 1 463 ? -69.738 6.731   22.114  1.00 18.37 ? 452  ILE A O    1 
ATOM   7140  C CB   . ILE A 1 463 ? -69.894 9.496   20.957  1.00 17.43 ? 452  ILE A CB   1 
ATOM   7141  C CG1  . ILE A 1 463 ? -69.764 10.554  19.864  1.00 19.69 ? 452  ILE A CG1  1 
ATOM   7142  C CG2  . ILE A 1 463 ? -70.072 10.096  22.334  1.00 20.51 ? 452  ILE A CG2  1 
ATOM   7143  C CD1  . ILE A 1 463 ? -71.070 11.306  19.627  1.00 23.15 ? 452  ILE A CD1  1 
ATOM   7144  H H    . ILE A 1 463 ? -69.276 7.905   19.177  1.00 20.08 ? 452  ILE A H    1 
ATOM   7145  H HA   . ILE A 1 463 ? -67.890 9.084   21.104  1.00 20.30 ? 452  ILE A HA   1 
ATOM   7146  H HB   . ILE A 1 463 ? -70.684 8.966   20.762  1.00 20.92 ? 452  ILE A HB   1 
ATOM   7147  H HG12 . ILE A 1 463 ? -69.088 11.198  20.125  1.00 23.63 ? 452  ILE A HG12 1 
ATOM   7148  H HG13 . ILE A 1 463 ? -69.510 10.122  19.033  1.00 23.63 ? 452  ILE A HG13 1 
ATOM   7149  H HG21 . ILE A 1 463 ? -70.840 10.689  22.323  1.00 24.61 ? 452  ILE A HG21 1 
ATOM   7150  H HG22 . ILE A 1 463 ? -70.215 9.381   22.974  1.00 24.61 ? 452  ILE A HG22 1 
ATOM   7151  H HG23 . ILE A 1 463 ? -69.273 10.594  22.567  1.00 24.61 ? 452  ILE A HG23 1 
ATOM   7152  H HD11 . ILE A 1 463 ? -70.933 11.963  18.926  1.00 27.77 ? 452  ILE A HD11 1 
ATOM   7153  H HD12 . ILE A 1 463 ? -71.754 10.673  19.358  1.00 27.77 ? 452  ILE A HD12 1 
ATOM   7154  H HD13 . ILE A 1 463 ? -71.333 11.749  20.449  1.00 27.77 ? 452  ILE A HD13 1 
ATOM   7155  N N    . VAL A 1 464 ? -67.810 7.495   22.950  1.00 16.05 ? 453  VAL A N    1 
ATOM   7156  C CA   . VAL A 1 464 ? -67.796 6.563   24.077  1.00 17.21 ? 453  VAL A CA   1 
ATOM   7157  C C    . VAL A 1 464 ? -67.958 7.234   25.426  1.00 18.00 ? 453  VAL A C    1 
ATOM   7158  O O    . VAL A 1 464 ? -68.151 6.523   26.434  1.00 18.54 ? 453  VAL A O    1 
ATOM   7159  C CB   . VAL A 1 464 ? -66.575 5.616   24.064  1.00 18.00 ? 453  VAL A CB   1 
ATOM   7160  C CG1  . VAL A 1 464 ? -66.564 4.800   22.762  1.00 19.35 ? 453  VAL A CG1  1 
ATOM   7161  C CG2  . VAL A 1 464 ? -65.248 6.368   24.157  1.00 19.05 ? 453  VAL A CG2  1 
ATOM   7162  H H    . VAL A 1 464 ? -67.132 8.025   22.933  1.00 19.26 ? 453  VAL A H    1 
ATOM   7163  H HA   . VAL A 1 464 ? -68.573 5.992   23.973  1.00 20.65 ? 453  VAL A HA   1 
ATOM   7164  H HB   . VAL A 1 464 ? -66.634 5.001   24.812  1.00 21.60 ? 453  VAL A HB   1 
ATOM   7165  H HG11 . VAL A 1 464 ? -65.794 4.211   22.766  1.00 23.21 ? 453  VAL A HG11 1 
ATOM   7166  H HG12 . VAL A 1 464 ? -67.380 4.279   22.709  1.00 23.21 ? 453  VAL A HG12 1 
ATOM   7167  H HG13 . VAL A 1 464 ? -66.510 5.410   22.009  1.00 23.21 ? 453  VAL A HG13 1 
ATOM   7168  H HG21 . VAL A 1 464 ? -64.520 5.726   24.145  1.00 22.86 ? 453  VAL A HG21 1 
ATOM   7169  H HG22 . VAL A 1 464 ? -65.172 6.969   23.399  1.00 22.86 ? 453  VAL A HG22 1 
ATOM   7170  H HG23 . VAL A 1 464 ? -65.229 6.874   24.984  1.00 22.86 ? 453  VAL A HG23 1 
ATOM   7171  N N    . LEU A 1 465 ? -67.881 8.563   25.496  1.00 17.08 ? 454  LEU A N    1 
ATOM   7172  C CA   . LEU A 1 465 ? -68.242 9.319   26.697  1.00 16.24 ? 454  LEU A CA   1 
ATOM   7173  C C    . LEU A 1 465 ? -68.902 10.609  26.236  1.00 17.07 ? 454  LEU A C    1 
ATOM   7174  O O    . LEU A 1 465 ? -68.327 11.342  25.407  1.00 18.29 ? 454  LEU A O    1 
ATOM   7175  C CB   . LEU A 1 465 ? -67.013 9.652   27.547  1.00 19.21 ? 454  LEU A CB   1 
ATOM   7176  C CG   . LEU A 1 465 ? -67.272 10.576  28.747  1.00 20.05 ? 454  LEU A CG   1 
ATOM   7177  C CD1  . LEU A 1 465 ? -68.042 9.885   29.825  1.00 22.96 ? 454  LEU A CD1  1 
ATOM   7178  C CD2  . LEU A 1 465 ? -66.007 11.135  29.339  1.00 23.03 ? 454  LEU A CD2  1 
ATOM   7179  H H    . LEU A 1 465 ? -67.617 9.060   24.846  1.00 20.49 ? 454  LEU A H    1 
ATOM   7180  H HA   . LEU A 1 465 ? -68.872 8.813   27.233  1.00 19.49 ? 454  LEU A HA   1 
ATOM   7181  H HB2  . LEU A 1 465 ? -66.644 8.824   27.892  1.00 23.05 ? 454  LEU A HB2  1 
ATOM   7182  H HB3  . LEU A 1 465 ? -66.357 10.088  26.981  1.00 23.05 ? 454  LEU A HB3  1 
ATOM   7183  H HG   . LEU A 1 465 ? -67.807 11.326  28.445  1.00 24.06 ? 454  LEU A HG   1 
ATOM   7184  H HD11 . LEU A 1 465 ? -68.181 10.504  30.559  1.00 27.55 ? 454  LEU A HD11 1 
ATOM   7185  H HD12 . LEU A 1 465 ? -68.896 9.597   29.467  1.00 27.55 ? 454  LEU A HD12 1 
ATOM   7186  H HD13 . LEU A 1 465 ? -67.535 9.117   30.131  1.00 27.55 ? 454  LEU A HD13 1 
ATOM   7187  H HD21 . LEU A 1 465 ? -66.235 11.707  30.089  1.00 27.64 ? 454  LEU A HD21 1 
ATOM   7188  H HD22 . LEU A 1 465 ? -65.448 10.402  29.640  1.00 27.64 ? 454  LEU A HD22 1 
ATOM   7189  H HD23 . LEU A 1 465 ? -65.542 11.649  28.660  1.00 27.64 ? 454  LEU A HD23 1 
ATOM   7190  N N    A GLU A 1 466 ? -70.100 10.898  26.750  0.30 20.56 ? 455  GLU A N    1 
ATOM   7191  N N    B GLU A 1 466 ? -70.102 10.887  26.757  0.70 20.70 ? 455  GLU A N    1 
ATOM   7192  C CA   A GLU A 1 466 ? -70.717 12.202  26.531  0.30 21.17 ? 455  GLU A CA   1 
ATOM   7193  C CA   B GLU A 1 466 ? -70.782 12.151  26.514  0.70 22.16 ? 455  GLU A CA   1 
ATOM   7194  C C    A GLU A 1 466 ? -71.827 12.420  27.550  0.30 22.23 ? 455  GLU A C    1 
ATOM   7195  C C    B GLU A 1 466 ? -71.777 12.394  27.643  0.70 26.55 ? 455  GLU A C    1 
ATOM   7196  O O    A GLU A 1 466 ? -72.561 11.489  27.893  0.30 20.38 ? 455  GLU A O    1 
ATOM   7197  O O    B GLU A 1 466 ? -72.359 11.450  28.180  0.70 25.92 ? 455  GLU A O    1 
ATOM   7198  C CB   A GLU A 1 466 ? -71.266 12.364  25.106  0.30 26.05 ? 455  GLU A CB   1 
ATOM   7199  C CB   B GLU A 1 466 ? -71.495 12.147  25.151  0.70 24.22 ? 455  GLU A CB   1 
ATOM   7200  C CG   A GLU A 1 466 ? -72.284 11.316  24.689  0.30 29.79 ? 455  GLU A CG   1 
ATOM   7201  C CG   B GLU A 1 466 ? -72.042 13.493  24.703  0.70 24.55 ? 455  GLU A CG   1 
ATOM   7202  C CD   A GLU A 1 466 ? -73.026 11.692  23.422  0.30 33.50 ? 455  GLU A CD   1 
ATOM   7203  C CD   B GLU A 1 466 ? -72.644 13.465  23.293  0.70 33.88 ? 455  GLU A CD   1 
ATOM   7204  O OE1  A GLU A 1 466 ? -72.728 12.761  22.840  0.30 31.57 ? 455  GLU A OE1  1 
ATOM   7205  O OE1  B GLU A 1 466 ? -73.151 12.406  22.862  0.70 35.11 ? 455  GLU A OE1  1 
ATOM   7206  O OE2  A GLU A 1 466 ? -73.913 10.919  23.012  0.30 37.80 ? 455  GLU A OE2  1 
ATOM   7207  O OE2  B GLU A 1 466 ? -72.611 14.516  22.612  0.70 40.99 ? 455  GLU A OE2  1 
ATOM   7208  H H    A GLU A 1 466 ? -70.571 10.358  27.226  0.30 24.67 ? 455  GLU A H    1 
ATOM   7209  H H    B GLU A 1 466 ? -70.544 10.347  27.261  0.70 24.85 ? 455  GLU A H    1 
ATOM   7210  H HA   A GLU A 1 466 ? -70.048 12.890  26.671  0.30 25.40 ? 455  GLU A HA   1 
ATOM   7211  H HA   B GLU A 1 466 ? -70.133 12.872  26.518  0.70 26.59 ? 455  GLU A HA   1 
ATOM   7212  H HB2  A GLU A 1 466 ? -71.694 13.232  25.037  0.30 31.26 ? 455  GLU A HB2  1 
ATOM   7213  H HB2  B GLU A 1 466 ? -70.866 11.847  24.476  0.70 29.06 ? 455  GLU A HB2  1 
ATOM   7214  H HB3  A GLU A 1 466 ? -70.525 12.317  24.482  0.30 31.26 ? 455  GLU A HB3  1 
ATOM   7215  H HB3  B GLU A 1 466 ? -72.241 11.529  25.197  0.70 29.06 ? 455  GLU A HB3  1 
ATOM   7216  H HG2  A GLU A 1 466 ? -71.826 10.476  24.531  0.30 35.75 ? 455  GLU A HG2  1 
ATOM   7217  H HG2  B GLU A 1 466 ? -72.738 13.770  25.318  0.70 29.46 ? 455  GLU A HG2  1 
ATOM   7218  H HG3  A GLU A 1 466 ? -72.937 11.210  25.399  0.30 35.75 ? 455  GLU A HG3  1 
ATOM   7219  H HG3  B GLU A 1 466 ? -71.321 14.142  24.706  0.70 29.46 ? 455  GLU A HG3  1 
ATOM   7220  N N    . ASP A 1 467 ? -71.942 13.653  28.024  1.00 26.71 ? 456  ASP A N    1 
ATOM   7221  C CA   . ASP A 1 467 ? -72.982 13.993  29.018  1.00 28.19 ? 456  ASP A CA   1 
ATOM   7222  C C    . ASP A 1 467 ? -72.813 13.155  30.277  1.00 28.15 ? 456  ASP A C    1 
ATOM   7223  O O    . ASP A 1 467 ? -73.786 12.767  30.934  1.00 29.69 ? 456  ASP A O    1 
ATOM   7224  C CB   . ASP A 1 467 ? -74.391 13.831  28.447  1.00 35.41 ? 456  ASP A CB   1 
ATOM   7225  C CG   . ASP A 1 467 ? -74.661 14.786  27.301  1.00 42.20 ? 456  ASP A CG   1 
ATOM   7226  O OD1  . ASP A 1 467 ? -74.137 15.923  27.338  1.00 47.26 ? 456  ASP A OD1  1 
ATOM   7227  O OD2  . ASP A 1 467 ? -75.380 14.399  26.355  1.00 52.38 ? 456  ASP A OD2  1 
ATOM   7228  H H    A ASP A 1 467 ? -71.440 14.313  27.796  0.30 32.06 ? 456  ASP A H    1 
ATOM   7229  H H    B ASP A 1 467 ? -71.483 14.322  27.737  0.70 32.06 ? 456  ASP A H    1 
ATOM   7230  H HA   . ASP A 1 467 ? -72.875 14.924  29.270  1.00 33.83 ? 456  ASP A HA   1 
ATOM   7231  H HB2  . ASP A 1 467 ? -74.498 12.926  28.117  1.00 42.50 ? 456  ASP A HB2  1 
ATOM   7232  H HB3  . ASP A 1 467 ? -75.039 14.009  29.147  1.00 42.50 ? 456  ASP A HB3  1 
ATOM   7233  N N    . GLY A 1 468 ? -71.575 12.845  30.621  1.00 24.25 ? 457  GLY A N    1 
ATOM   7234  C CA   . GLY A 1 468 ? -71.287 12.114  31.837  1.00 27.08 ? 457  GLY A CA   1 
ATOM   7235  C C    . GLY A 1 468 ? -71.589 10.640  31.804  1.00 27.10 ? 457  GLY A C    1 
ATOM   7236  O O    . GLY A 1 468 ? -71.537 9.996   32.865  1.00 27.82 ? 457  GLY A O    1 
ATOM   7237  H H    . GLY A 1 468 ? -70.877 13.049  30.161  1.00 29.10 ? 457  GLY A H    1 
ATOM   7238  H HA2  . GLY A 1 468 ? -70.346 12.219  32.047  1.00 32.50 ? 457  GLY A HA2  1 
ATOM   7239  H HA3  . GLY A 1 468 ? -71.799 12.505  32.562  1.00 32.50 ? 457  GLY A HA3  1 
ATOM   7240  N N    . THR A 1 469 ? -71.902 10.082  30.639  1.00 22.97 ? 458  THR A N    1 
ATOM   7241  C CA   . THR A 1 469 ? -72.276 8.680   30.514  1.00 22.64 ? 458  THR A CA   1 
ATOM   7242  C C    . THR A 1 469 ? -71.322 7.986   29.551  1.00 21.22 ? 458  THR A C    1 
ATOM   7243  O O    . THR A 1 469 ? -71.037 8.514   28.464  1.00 21.40 ? 458  THR A O    1 
ATOM   7244  C CB   . THR A 1 469 ? -73.722 8.573   30.012  1.00 24.49 ? 458  THR A CB   1 
ATOM   7245  O OG1  . THR A 1 469 ? -74.603 9.238   30.941  1.00 32.05 ? 458  THR A OG1  1 
ATOM   7246  C CG2  . THR A 1 469 ? -74.162 7.126   29.835  1.00 28.79 ? 458  THR A CG2  1 
ATOM   7247  H H    . THR A 1 469 ? -71.905 10.506  29.891  1.00 27.57 ? 458  THR A H    1 
ATOM   7248  H HA   . THR A 1 469 ? -72.214 8.246   31.380  1.00 27.17 ? 458  THR A HA   1 
ATOM   7249  H HB   . THR A 1 469 ? -73.788 9.012   29.149  1.00 29.39 ? 458  THR A HB   1 
ATOM   7250  H HG1  . THR A 1 469 ? -74.392 10.048  31.008  1.00 38.46 ? 458  THR A HG1  1 
ATOM   7251  H HG21 . THR A 1 469 ? -75.078 7.095   29.517  1.00 34.55 ? 458  THR A HG21 1 
ATOM   7252  H HG22 . THR A 1 469 ? -73.590 6.682   29.190  1.00 34.55 ? 458  THR A HG22 1 
ATOM   7253  H HG23 . THR A 1 469 ? -74.106 6.657   30.682  1.00 34.55 ? 458  THR A HG23 1 
ATOM   7254  N N    . LEU A 1 470 ? -70.818 6.831   29.976  1.00 20.37 ? 459  LEU A N    1 
ATOM   7255  C CA   . LEU A 1 470 ? -69.974 5.985   29.136  1.00 16.51 ? 459  LEU A CA   1 
ATOM   7256  C C    . LEU A 1 470 ? -70.823 5.112   28.232  1.00 17.79 ? 459  LEU A C    1 
ATOM   7257  O O    . LEU A 1 470 ? -71.890 4.624   28.639  1.00 20.72 ? 459  LEU A O    1 
ATOM   7258  C CB   . LEU A 1 470 ? -69.076 5.099   29.997  1.00 18.94 ? 459  LEU A CB   1 
ATOM   7259  C CG   . LEU A 1 470 ? -67.980 5.861   30.721  1.00 19.25 ? 459  LEU A CG   1 
ATOM   7260  C CD1  . LEU A 1 470 ? -67.511 5.101   31.917  1.00 19.86 ? 459  LEU A CD1  1 
ATOM   7261  C CD2  . LEU A 1 470 ? -66.811 6.130   29.760  1.00 21.18 ? 459  LEU A CD2  1 
ATOM   7262  H H    . LEU A 1 470 ? -70.953 6.509   30.762  1.00 24.45 ? 459  LEU A H    1 
ATOM   7263  H HA   . LEU A 1 470 ? -69.409 6.544   28.579  1.00 19.82 ? 459  LEU A HA   1 
ATOM   7264  H HB2  . LEU A 1 470 ? -69.622 4.657   30.667  1.00 22.73 ? 459  LEU A HB2  1 
ATOM   7265  H HB3  . LEU A 1 470 ? -68.652 4.437   29.429  1.00 22.73 ? 459  LEU A HB3  1 
ATOM   7266  H HG   . LEU A 1 470 ? -68.329 6.715   31.021  1.00 23.10 ? 459  LEU A HG   1 
ATOM   7267  H HD11 . LEU A 1 470 ? -66.813 5.609   32.359  1.00 23.83 ? 459  LEU A HD11 1 
ATOM   7268  H HD12 . LEU A 1 470 ? -68.258 4.970   32.521  1.00 23.83 ? 459  LEU A HD12 1 
ATOM   7269  H HD13 . LEU A 1 470 ? -67.163 4.243   31.628  1.00 23.83 ? 459  LEU A HD13 1 
ATOM   7270  H HD21 . LEU A 1 470 ? -66.119 6.617   30.233  1.00 25.41 ? 459  LEU A HD21 1 
ATOM   7271  H HD22 . LEU A 1 470 ? -66.462 5.282   29.443  1.00 25.41 ? 459  LEU A HD22 1 
ATOM   7272  H HD23 . LEU A 1 470 ? -67.133 6.656   29.011  1.00 25.41 ? 459  LEU A HD23 1 
ATOM   7273  N N    . HIS A 1 471 ? -70.364 4.930   26.993  1.00 17.52 ? 460  HIS A N    1 
ATOM   7274  C CA   . HIS A 1 471 ? -70.987 4.085   25.979  1.00 15.40 ? 460  HIS A CA   1 
ATOM   7275  C C    . HIS A 1 471 ? -69.881 3.239   25.340  1.00 15.04 ? 460  HIS A C    1 
ATOM   7276  O O    . HIS A 1 471 ? -69.441 3.562   24.257  1.00 22.18 ? 460  HIS A O    1 
ATOM   7277  C CB   . HIS A 1 471 ? -71.680 4.917   24.935  1.00 18.62 ? 460  HIS A CB   1 
ATOM   7278  C CG   . HIS A 1 471 ? -72.712 5.853   25.482  1.00 21.83 ? 460  HIS A CG   1 
ATOM   7279  N ND1  . HIS A 1 471 ? -73.957 5.426   25.861  1.00 26.49 ? 460  HIS A ND1  1 
ATOM   7280  C CD2  . HIS A 1 471 ? -72.675 7.185   25.747  1.00 24.03 ? 460  HIS A CD2  1 
ATOM   7281  C CE1  . HIS A 1 471 ? -74.661 6.445   26.322  1.00 27.39 ? 460  HIS A CE1  1 
ATOM   7282  N NE2  . HIS A 1 471 ? -73.910 7.529   26.263  1.00 25.43 ? 460  HIS A NE2  1 
ATOM   7283  H H    . HIS A 1 471 ? -69.650 5.312   26.704  1.00 21.03 ? 460  HIS A H    1 
ATOM   7284  H HA   . HIS A 1 471 ? -71.636 3.494   26.393  1.00 18.48 ? 460  HIS A HA   1 
ATOM   7285  H HB2  . HIS A 1 471 ? -71.015 5.450   24.471  1.00 22.34 ? 460  HIS A HB2  1 
ATOM   7286  H HB3  . HIS A 1 471 ? -72.122 4.324   24.307  1.00 22.34 ? 460  HIS A HB3  1 
ATOM   7287  H HD1  . HIS A 1 471 ? -74.241 4.616   25.802  1.00 31.79 ? 460  HIS A HD1  1 
ATOM   7288  H HD2  . HIS A 1 471 ? -71.958 7.758   25.598  1.00 28.83 ? 460  HIS A HD2  1 
ATOM   7289  H HE1  . HIS A 1 471 ? -75.537 6.406   26.632  1.00 32.87 ? 460  HIS A HE1  1 
ATOM   7290  N N    . VAL A 1 472 ? -69.407 2.223   26.037  1.00 15.59 ? 461  VAL A N    1 
ATOM   7291  C CA   . VAL A 1 472 ? -68.304 1.408   25.572  1.00 15.85 ? 461  VAL A CA   1 
ATOM   7292  C C    . VAL A 1 472 ? -68.830 0.077   25.059  1.00 15.24 ? 461  VAL A C    1 
ATOM   7293  O O    . VAL A 1 472 ? -69.913 -0.400  25.418  1.00 15.56 ? 461  VAL A O    1 
ATOM   7294  C CB   . VAL A 1 472 ? -67.248 1.179   26.666  1.00 16.79 ? 461  VAL A CB   1 
ATOM   7295  C CG1  . VAL A 1 472 ? -66.611 2.477   27.114  1.00 16.56 ? 461  VAL A CG1  1 
ATOM   7296  C CG2  . VAL A 1 472 ? -67.853 0.455   27.886  1.00 16.50 ? 461  VAL A CG2  1 
ATOM   7297  H H    . VAL A 1 472 ? -69.717 1.980   26.802  1.00 18.71 ? 461  VAL A H    1 
ATOM   7298  H HA   . VAL A 1 472 ? -67.871 1.862   24.832  1.00 19.02 ? 461  VAL A HA   1 
ATOM   7299  H HB   . VAL A 1 472 ? -66.546 0.615   26.307  1.00 20.15 ? 461  VAL A HB   1 
ATOM   7300  H HG11 . VAL A 1 472 ? -65.955 2.285   27.802  1.00 19.87 ? 461  VAL A HG11 1 
ATOM   7301  H HG12 . VAL A 1 472 ? -66.181 2.897   26.353  1.00 19.87 ? 461  VAL A HG12 1 
ATOM   7302  H HG13 . VAL A 1 472 ? -67.301 3.061   27.468  1.00 19.87 ? 461  VAL A HG13 1 
ATOM   7303  H HG21 . VAL A 1 472 ? -67.160 0.329   28.553  1.00 19.80 ? 461  VAL A HG21 1 
ATOM   7304  H HG22 . VAL A 1 472 ? -68.570 0.998   28.252  1.00 19.80 ? 461  VAL A HG22 1 
ATOM   7305  H HG23 . VAL A 1 472 ? -68.200 -0.405  27.602  1.00 19.80 ? 461  VAL A HG23 1 
ATOM   7306  N N    . THR A 1 473 ? -68.035 -0.547  24.204  1.00 16.26 ? 462  THR A N    1 
ATOM   7307  C CA   . THR A 1 473 ? -68.290 -1.875  23.703  1.00 15.42 ? 462  THR A CA   1 
ATOM   7308  C C    . THR A 1 473 ? -67.121 -2.767  24.040  1.00 14.00 ? 462  THR A C    1 
ATOM   7309  O O    . THR A 1 473 ? -65.984 -2.521  23.591  1.00 15.28 ? 462  THR A O    1 
ATOM   7310  C CB   . THR A 1 473 ? -68.546 -1.849  22.204  1.00 15.89 ? 462  THR A CB   1 
ATOM   7311  O OG1  . THR A 1 473 ? -69.736 -1.109  21.936  1.00 17.03 ? 462  THR A OG1  1 
ATOM   7312  C CG2  . THR A 1 473 ? -68.648 -3.243  21.617  1.00 16.31 ? 462  THR A CG2  1 
ATOM   7313  H H    . THR A 1 473 ? -67.313 -0.201  23.889  1.00 19.51 ? 462  THR A H    1 
ATOM   7314  H HA   . THR A 1 473 ? -69.079 -2.233  24.139  1.00 18.51 ? 462  THR A HA   1 
ATOM   7315  H HB   . THR A 1 473 ? -67.801 -1.403  21.771  1.00 19.06 ? 462  THR A HB   1 
ATOM   7316  H HG1  . THR A 1 473 ? -69.883 -1.091  21.109  1.00 20.44 ? 462  THR A HG1  1 
ATOM   7317  H HG21 . THR A 1 473 ? -68.811 -3.189  20.662  1.00 19.57 ? 462  THR A HG21 1 
ATOM   7318  H HG22 . THR A 1 473 ? -67.821 -3.727  21.768  1.00 19.57 ? 462  THR A HG22 1 
ATOM   7319  H HG23 . THR A 1 473 ? -69.378 -3.726  22.034  1.00 19.57 ? 462  THR A HG23 1 
ATOM   7320  N N    . GLU A 1 474 ? -67.374 -3.810  24.793  1.00 14.97 ? 463  GLU A N    1 
ATOM   7321  C CA   . GLU A 1 474 ? -66.359 -4.781  25.151  1.00 14.36 ? 463  GLU A CA   1 
ATOM   7322  C C    . GLU A 1 474 ? -65.858 -5.471  23.895  1.00 14.19 ? 463  GLU A C    1 
ATOM   7323  O O    . GLU A 1 474 ? -66.631 -5.946  23.064  1.00 16.77 ? 463  GLU A O    1 
ATOM   7324  C CB   . GLU A 1 474 ? -67.008 -5.809  26.108  1.00 16.63 ? 463  GLU A CB   1 
ATOM   7325  C CG   . GLU A 1 474 ? -66.037 -6.888  26.534  1.00 16.22 ? 463  GLU A CG   1 
ATOM   7326  C CD   . GLU A 1 474 ? -66.637 -7.838  27.522  1.00 20.50 ? 463  GLU A CD   1 
ATOM   7327  O OE1  . GLU A 1 474 ? -67.554 -8.546  27.125  1.00 24.20 ? 463  GLU A OE1  1 
ATOM   7328  O OE2  . GLU A 1 474 ? -66.182 -7.863  28.679  1.00 21.09 ? 463  GLU A OE2  1 
ATOM   7329  H H    . GLU A 1 474 ? -68.149 -3.987  25.121  1.00 17.96 ? 463  GLU A H    1 
ATOM   7330  H HA   . GLU A 1 474 ? -65.617 -4.347  25.599  1.00 17.23 ? 463  GLU A HA   1 
ATOM   7331  H HB2  . GLU A 1 474 ? -67.317 -5.350  26.905  1.00 19.95 ? 463  GLU A HB2  1 
ATOM   7332  H HB3  . GLU A 1 474 ? -67.754 -6.236  25.658  1.00 19.95 ? 463  GLU A HB3  1 
ATOM   7333  H HG2  . GLU A 1 474 ? -65.766 -7.397  25.753  1.00 19.47 ? 463  GLU A HG2  1 
ATOM   7334  H HG3  . GLU A 1 474 ? -65.263 -6.474  26.946  1.00 19.47 ? 463  GLU A HG3  1 
ATOM   7335  N N    . GLY A 1 475 ? -64.548 -5.468  23.723  1.00 15.10 ? 464  GLY A N    1 
ATOM   7336  C CA   . GLY A 1 475 ? -63.912 -6.162  22.621  1.00 15.68 ? 464  GLY A CA   1 
ATOM   7337  C C    . GLY A 1 475 ? -63.899 -5.385  21.320  1.00 15.62 ? 464  GLY A C    1 
ATOM   7338  O O    . GLY A 1 475 ? -63.556 -5.942  20.275  1.00 18.30 ? 464  GLY A O    1 
ATOM   7339  H H    . GLY A 1 475 ? -63.995 -5.063  24.242  1.00 18.12 ? 464  GLY A H    1 
ATOM   7340  H HA2  . GLY A 1 475 ? -62.994 -6.363  22.862  1.00 18.82 ? 464  GLY A HA2  1 
ATOM   7341  H HA3  . GLY A 1 475 ? -64.374 -7.001  22.466  1.00 18.82 ? 464  GLY A HA3  1 
ATOM   7342  N N    . SER A 1 476 ? -64.291 -4.117  21.349  1.00 13.47 ? 465  SER A N    1 
ATOM   7343  C CA   . SER A 1 476 ? -64.256 -3.282  20.154  1.00 13.54 ? 465  SER A CA   1 
ATOM   7344  C C    . SER A 1 476 ? -62.835 -2.848  19.782  1.00 13.57 ? 465  SER A C    1 
ATOM   7345  O O    . SER A 1 476 ? -62.599 -2.463  18.627  1.00 14.89 ? 465  SER A O    1 
ATOM   7346  C CB   . SER A 1 476 ? -65.134 -2.034  20.355  1.00 15.82 ? 465  SER A CB   1 
ATOM   7347  O OG   . SER A 1 476 ? -64.693 -1.244  21.438  1.00 16.87 ? 465  SER A OG   1 
ATOM   7348  H H    . SER A 1 476 ? -64.583 -3.715  22.051  1.00 16.16 ? 465  SER A H    1 
ATOM   7349  H HA   . SER A 1 476 ? -64.618 -3.786  19.409  1.00 16.25 ? 465  SER A HA   1 
ATOM   7350  H HB2  . SER A 1 476 ? -65.104 -1.499  19.546  1.00 18.98 ? 465  SER A HB2  1 
ATOM   7351  H HB3  . SER A 1 476 ? -66.045 -2.318  20.527  1.00 18.98 ? 465  SER A HB3  1 
ATOM   7352  H HG   . SER A 1 476 ? -64.715 -1.691  22.148  1.00 20.24 ? 465  SER A HG   1 
ATOM   7353  N N    . GLY A 1 477 ? -61.931 -2.825  20.740  1.00 13.92 ? 466  GLY A N    1 
ATOM   7354  C CA   . GLY A 1 477 ? -60.586 -2.292  20.502  1.00 15.05 ? 466  GLY A CA   1 
ATOM   7355  C C    . GLY A 1 477 ? -59.806 -3.184  19.562  1.00 14.39 ? 466  GLY A C    1 
ATOM   7356  O O    . GLY A 1 477 ? -59.919 -4.408  19.590  1.00 17.60 ? 466  GLY A O    1 
ATOM   7357  H H    . GLY A 1 477 ? -62.061 -3.111  21.541  1.00 16.70 ? 466  GLY A H    1 
ATOM   7358  H HA2  . GLY A 1 477 ? -60.649 -1.407  20.110  1.00 18.06 ? 466  GLY A HA2  1 
ATOM   7359  H HA3  . GLY A 1 477 ? -60.105 -2.228  21.341  1.00 18.06 ? 466  GLY A HA3  1 
ATOM   7360  N N    . ARG A 1 478 ? -58.936 -2.568  18.754  1.00 13.93 ? 467  ARG A N    1 
ATOM   7361  C CA   . ARG A 1 478 ? -58.104 -3.304  17.825  1.00 14.13 ? 467  ARG A CA   1 
ATOM   7362  C C    . ARG A 1 478 ? -56.676 -3.381  18.347  1.00 12.42 ? 467  ARG A C    1 
ATOM   7363  O O    . ARG A 1 478 ? -56.162 -2.411  18.912  1.00 13.66 ? 467  ARG A O    1 
ATOM   7364  C CB   . ARG A 1 478 ? -58.047 -2.557  16.469  1.00 14.72 ? 467  ARG A CB   1 
ATOM   7365  C CG   . ARG A 1 478 ? -59.388 -2.306  15.807  1.00 15.62 ? 467  ARG A CG   1 
ATOM   7366  C CD   . ARG A 1 478 ? -59.178 -1.384  14.600  1.00 17.53 ? 467  ARG A CD   1 
ATOM   7367  N NE   . ARG A 1 478 ? -58.631 -0.092  15.005  1.00 14.83 ? 467  ARG A NE   1 
ATOM   7368  C CZ   . ARG A 1 478 ? -58.183 0.830   14.160  1.00 15.24 ? 467  ARG A CZ   1 
ATOM   7369  N NH1  . ARG A 1 478 ? -58.280 0.631   12.874  1.00 18.00 ? 467  ARG A NH1  1 
ATOM   7370  N NH2  . ARG A 1 478 ? -57.621 1.941   14.626  1.00 16.17 ? 467  ARG A NH2  1 
ATOM   7371  H H    . ARG A 1 478 ? -58.814 -1.717  18.733  1.00 16.71 ? 467  ARG A H    1 
ATOM   7372  H HA   . ARG A 1 478 ? -58.451 -4.199  17.689  1.00 16.95 ? 467  ARG A HA   1 
ATOM   7373  H HB2  . ARG A 1 478 ? -57.627 -1.694  16.611  1.00 17.67 ? 467  ARG A HB2  1 
ATOM   7374  H HB3  . ARG A 1 478 ? -57.511 -3.080  15.852  1.00 17.67 ? 467  ARG A HB3  1 
ATOM   7375  H HG2  . ARG A 1 478 ? -59.764 -3.146  15.497  1.00 18.74 ? 467  ARG A HG2  1 
ATOM   7376  H HG3  . ARG A 1 478 ? -59.987 -1.871  16.433  1.00 18.74 ? 467  ARG A HG3  1 
ATOM   7377  H HD2  . ARG A 1 478 ? -58.554 -1.799  13.984  1.00 21.04 ? 467  ARG A HD2  1 
ATOM   7378  H HD3  . ARG A 1 478 ? -60.030 -1.230  14.162  1.00 21.04 ? 467  ARG A HD3  1 
ATOM   7379  H HE   . ARG A 1 478 ? -58.597 0.083   15.846  1.00 17.80 ? 467  ARG A HE   1 
ATOM   7380  H HH11 . ARG A 1 478 ? -58.621 -0.100  12.577  1.00 21.60 ? 467  ARG A HH11 1 
ATOM   7381  H HH12 . ARG A 1 478 ? -57.999 1.229   12.324  1.00 21.60 ? 467  ARG A HH12 1 
ATOM   7382  H HH21 . ARG A 1 478 ? -57.574 2.076   15.474  1.00 19.40 ? 467  ARG A HH21 1 
ATOM   7383  H HH22 . ARG A 1 478 ? -57.362 2.553   14.080  1.00 19.40 ? 467  ARG A HH22 1 
ATOM   7384  N N    . TYR A 1 479 ? -56.012 -4.502  18.088  1.00 13.16 ? 468  TYR A N    1 
ATOM   7385  C CA   . TYR A 1 479 ? -54.569 -4.582  18.231  1.00 13.32 ? 468  TYR A CA   1 
ATOM   7386  C C    . TYR A 1 479 ? -53.918 -3.747  17.150  1.00 13.15 ? 468  TYR A C    1 
ATOM   7387  O O    . TYR A 1 479 ? -54.168 -3.945  15.947  1.00 15.42 ? 468  TYR A O    1 
ATOM   7388  C CB   . TYR A 1 479 ? -54.113 -6.032  18.121  1.00 14.70 ? 468  TYR A CB   1 
ATOM   7389  C CG   . TYR A 1 479 ? -52.616 -6.166  18.248  1.00 13.69 ? 468  TYR A CG   1 
ATOM   7390  C CD1  . TYR A 1 479 ? -51.983 -5.970  19.458  1.00 12.67 ? 468  TYR A CD1  1 
ATOM   7391  C CD2  . TYR A 1 479 ? -51.836 -6.540  17.163  1.00 16.36 ? 468  TYR A CD2  1 
ATOM   7392  C CE1  . TYR A 1 479 ? -50.612 -6.086  19.571  1.00 13.41 ? 468  TYR A CE1  1 
ATOM   7393  C CE2  . TYR A 1 479 ? -50.470 -6.658  17.260  1.00 16.35 ? 468  TYR A CE2  1 
ATOM   7394  C CZ   . TYR A 1 479 ? -49.852 -6.436  18.478  1.00 13.76 ? 468  TYR A CZ   1 
ATOM   7395  O OH   . TYR A 1 479 ? -48.481 -6.583  18.601  1.00 15.66 ? 468  TYR A OH   1 
ATOM   7396  H H    . TYR A 1 479 ? -56.379 -5.234  17.827  1.00 15.80 ? 468  TYR A H    1 
ATOM   7397  H HA   . TYR A 1 479 ? -54.304 -4.235  19.097  1.00 15.98 ? 468  TYR A HA   1 
ATOM   7398  H HB2  . TYR A 1 479 ? -54.524 -6.550  18.830  1.00 17.63 ? 468  TYR A HB2  1 
ATOM   7399  H HB3  . TYR A 1 479 ? -54.376 -6.383  17.255  1.00 17.63 ? 468  TYR A HB3  1 
ATOM   7400  H HD1  . TYR A 1 479 ? -52.484 -5.722  20.201  1.00 15.21 ? 468  TYR A HD1  1 
ATOM   7401  H HD2  . TYR A 1 479 ? -52.244 -6.678  16.339  1.00 19.63 ? 468  TYR A HD2  1 
ATOM   7402  H HE1  . TYR A 1 479 ? -50.202 -5.943  20.393  1.00 16.09 ? 468  TYR A HE1  1 
ATOM   7403  H HE2  . TYR A 1 479 ? -49.966 -6.903  16.517  1.00 19.62 ? 468  TYR A HE2  1 
ATOM   7404  H HH   . TYR A 1 479 ? -48.147 -6.797  17.861  1.00 18.80 ? 468  TYR A HH   1 
ATOM   7405  N N    . ILE A 1 480 ? -53.005 -2.865  17.545  1.00 13.22 ? 469  ILE A N    1 
ATOM   7406  C CA   . ILE A 1 480 ? -52.274 -2.005  16.625  1.00 14.36 ? 469  ILE A CA   1 
ATOM   7407  C C    . ILE A 1 480 ? -50.845 -2.537  16.541  1.00 13.57 ? 469  ILE A C    1 
ATOM   7408  O O    . ILE A 1 480 ? -50.086 -2.421  17.522  1.00 13.44 ? 469  ILE A O    1 
ATOM   7409  C CB   . ILE A 1 480 ? -52.274 -0.542  17.090  1.00 14.10 ? 469  ILE A CB   1 
ATOM   7410  C CG1  . ILE A 1 480 ? -53.681 -0.095  17.461  1.00 19.45 ? 469  ILE A CG1  1 
ATOM   7411  C CG2  . ILE A 1 480 ? -51.591 0.311   16.048  1.00 18.27 ? 469  ILE A CG2  1 
ATOM   7412  C CD1  . ILE A 1 480 ? -54.633 -0.114  16.376  1.00 24.13 ? 469  ILE A CD1  1 
ATOM   7413  H H    . ILE A 1 480 ? -52.786 -2.744  18.368  1.00 15.86 ? 469  ILE A H    1 
ATOM   7414  H HA   . ILE A 1 480 ? -52.676 -2.052  15.744  1.00 17.23 ? 469  ILE A HA   1 
ATOM   7415  H HB   . ILE A 1 480 ? -51.736 -0.495  17.896  1.00 16.92 ? 469  ILE A HB   1 
ATOM   7416  H HG12 . ILE A 1 480 ? -54.017 -0.683  18.156  1.00 23.34 ? 469  ILE A HG12 1 
ATOM   7417  H HG13 . ILE A 1 480 ? -53.637 0.814   17.797  1.00 23.34 ? 469  ILE A HG13 1 
ATOM   7418  H HG21 . ILE A 1 480 ? -51.593 1.234   16.346  1.00 21.93 ? 469  ILE A HG21 1 
ATOM   7419  H HG22 . ILE A 1 480 ? -50.679 0.001   15.936  1.00 21.93 ? 469  ILE A HG22 1 
ATOM   7420  H HG23 . ILE A 1 480 ? -52.073 0.231   15.210  1.00 21.93 ? 469  ILE A HG23 1 
ATOM   7421  H HD11 . ILE A 1 480 ? -55.494 0.184   16.708  1.00 28.95 ? 469  ILE A HD11 1 
ATOM   7422  H HD12 . ILE A 1 480 ? -54.324 0.480   15.675  1.00 28.95 ? 469  ILE A HD12 1 
ATOM   7423  H HD13 . ILE A 1 480 ? -54.704 -1.020  16.035  1.00 28.95 ? 469  ILE A HD13 1 
ATOM   7424  N N    . PRO A 1 481 ? -50.435 -3.107  15.404  1.00 15.26 ? 470  PRO A N    1 
ATOM   7425  C CA   . PRO A 1 481 ? -49.040 -3.503  15.277  1.00 14.62 ? 470  PRO A CA   1 
ATOM   7426  C C    . PRO A 1 481 ? -48.158 -2.261  15.242  1.00 14.47 ? 470  PRO A C    1 
ATOM   7427  O O    . PRO A 1 481 ? -48.559 -1.180  14.801  1.00 16.37 ? 470  PRO A O    1 
ATOM   7428  C CB   . PRO A 1 481 ? -48.998 -4.244  13.938  1.00 19.48 ? 470  PRO A CB   1 
ATOM   7429  C CG   . PRO A 1 481 ? -50.168 -3.750  13.188  1.00 23.70 ? 470  PRO A CG   1 
ATOM   7430  C CD   . PRO A 1 481 ? -51.208 -3.321  14.182  1.00 19.65 ? 470  PRO A CD   1 
ATOM   7431  H HA   . PRO A 1 481 ? -48.771 -4.092  16.000  1.00 17.55 ? 470  PRO A HA   1 
ATOM   7432  H HB2  . PRO A 1 481 ? -48.176 -4.029  13.470  1.00 23.37 ? 470  PRO A HB2  1 
ATOM   7433  H HB3  . PRO A 1 481 ? -49.067 -5.199  14.090  1.00 23.37 ? 470  PRO A HB3  1 
ATOM   7434  H HG2  . PRO A 1 481 ? -49.900 -2.996  12.640  1.00 28.44 ? 470  PRO A HG2  1 
ATOM   7435  H HG3  . PRO A 1 481 ? -50.513 -4.464  12.630  1.00 28.44 ? 470  PRO A HG3  1 
ATOM   7436  H HD2  . PRO A 1 481 ? -51.628 -2.494  13.898  1.00 23.57 ? 470  PRO A HD2  1 
ATOM   7437  H HD3  . PRO A 1 481 ? -51.861 -4.026  14.314  1.00 23.57 ? 470  PRO A HD3  1 
ATOM   7438  N N    . ARG A 1 482 ? -46.908 -2.437  15.662  1.00 13.32 ? 471  ARG A N    1 
ATOM   7439  C CA   . ARG A 1 482 ? -45.936 -1.356  15.777  1.00 14.02 ? 471  ARG A CA   1 
ATOM   7440  C C    . ARG A 1 482 ? -44.649 -1.804  15.083  1.00 12.56 ? 471  ARG A C    1 
ATOM   7441  O O    . ARG A 1 482 ? -43.997 -2.746  15.540  1.00 14.93 ? 471  ARG A O    1 
ATOM   7442  C CB   . ARG A 1 482 ? -45.705 -1.037  17.241  1.00 13.42 ? 471  ARG A CB   1 
ATOM   7443  C CG   . ARG A 1 482 ? -46.916 -0.580  18.020  1.00 14.39 ? 471  ARG A CG   1 
ATOM   7444  C CD   . ARG A 1 482 ? -46.592 -0.344  19.497  1.00 14.94 ? 471  ARG A CD   1 
ATOM   7445  N NE   . ARG A 1 482 ? -46.157 -1.611  20.010  1.00 19.52 ? 471  ARG A NE   1 
ATOM   7446  C CZ   . ARG A 1 482 ? -45.303 -1.839  20.962  1.00 20.69 ? 471  ARG A CZ   1 
ATOM   7447  N NH1  . ARG A 1 482 ? -44.802 -0.833  21.642  1.00 18.26 ? 471  ARG A NH1  1 
ATOM   7448  N NH2  . ARG A 1 482 ? -44.975 -3.102  21.282  1.00 16.51 ? 471  ARG A NH2  1 
ATOM   7449  H H    . ARG A 1 482 ? -46.590 -3.202  15.893  1.00 15.99 ? 471  ARG A H    1 
ATOM   7450  H HA   . ARG A 1 482 ? -46.271 -0.562  15.332  1.00 16.83 ? 471  ARG A HA   1 
ATOM   7451  H HB2  . ARG A 1 482 ? -45.365 -1.834  17.677  1.00 16.10 ? 471  ARG A HB2  1 
ATOM   7452  H HB3  . ARG A 1 482 ? -45.042 -0.331  17.299  1.00 16.10 ? 471  ARG A HB3  1 
ATOM   7453  H HG2  . ARG A 1 482 ? -47.241 0.253   17.644  1.00 17.26 ? 471  ARG A HG2  1 
ATOM   7454  H HG3  . ARG A 1 482 ? -47.605 -1.261  17.966  1.00 17.26 ? 471  ARG A HG3  1 
ATOM   7455  H HD2  . ARG A 1 482 ? -45.874 0.302   19.585  1.00 17.92 ? 471  ARG A HD2  1 
ATOM   7456  H HD3  . ARG A 1 482 ? -47.386 -0.059  19.975  1.00 17.92 ? 471  ARG A HD3  1 
ATOM   7457  H HE   . ARG A 1 482 ? -46.505 -2.306  19.642  1.00 23.43 ? 471  ARG A HE   1 
ATOM   7458  H HH11 . ARG A 1 482 ? -45.008 -0.025  21.430  1.00 21.91 ? 471  ARG A HH11 1 
ATOM   7459  H HH12 . ARG A 1 482 ? -44.248 -0.981  22.283  1.00 21.91 ? 471  ARG A HH12 1 
ATOM   7460  H HH21 . ARG A 1 482 ? -45.319 -3.759  20.847  1.00 19.81 ? 471  ARG A HH21 1 
ATOM   7461  H HH22 . ARG A 1 482 ? -44.433 -3.254  21.933  1.00 19.81 ? 471  ARG A HH22 1 
ATOM   7462  N N    . LYS A 1 483 ? -44.333 -1.148  13.968  1.00 13.54 ? 472  LYS A N    1 
ATOM   7463  C CA   . LYS A 1 483 ? -43.180 -1.554  13.165  1.00 13.65 ? 472  LYS A CA   1 
ATOM   7464  C C    . LYS A 1 483 ? -41.869 -1.227  13.882  1.00 12.48 ? 472  LYS A C    1 
ATOM   7465  O O    . LYS A 1 483 ? -41.798 -0.264  14.656  1.00 12.59 ? 472  LYS A O    1 
ATOM   7466  C CB   . LYS A 1 483 ? -43.217 -0.903  11.771  1.00 15.13 ? 472  LYS A CB   1 
ATOM   7467  C CG   . LYS A 1 483 ? -44.337 -1.422  10.880  1.00 16.72 ? 472  LYS A CG   1 
ATOM   7468  C CD   . LYS A 1 483 ? -44.339 -0.766  9.524   1.00 21.43 ? 472  LYS A CD   1 
ATOM   7469  C CE   . LYS A 1 483 ? -45.343 -1.407  8.584   1.00 33.84 ? 472  LYS A CE   1 
ATOM   7470  N NZ   . LYS A 1 483 ? -45.150 -0.917  7.203   1.00 45.77 ? 472  LYS A NZ   1 
ATOM   7471  H H    . LYS A 1 483 ? -44.764 -0.471  13.657  1.00 16.25 ? 472  LYS A H    1 
ATOM   7472  H HA   . LYS A 1 483 ? -43.214 -2.515  13.040  1.00 16.38 ? 472  LYS A HA   1 
ATOM   7473  H HB2  . LYS A 1 483 ? -43.342 0.054   11.876  1.00 18.16 ? 472  LYS A HB2  1 
ATOM   7474  H HB3  . LYS A 1 483 ? -42.375 -1.077  11.322  1.00 18.16 ? 472  LYS A HB3  1 
ATOM   7475  H HG2  . LYS A 1 483 ? -44.224 -2.377  10.752  1.00 20.06 ? 472  LYS A HG2  1 
ATOM   7476  H HG3  . LYS A 1 483 ? -45.190 -1.241  11.304  1.00 20.06 ? 472  LYS A HG3  1 
ATOM   7477  H HD2  . LYS A 1 483 ? -44.573 0.170   9.624   1.00 25.72 ? 472  LYS A HD2  1 
ATOM   7478  H HD3  . LYS A 1 483 ? -43.458 -0.850  9.128   1.00 25.72 ? 472  LYS A HD3  1 
ATOM   7479  H HE2  . LYS A 1 483 ? -45.221 -2.370  8.588   1.00 40.60 ? 472  LYS A HE2  1 
ATOM   7480  H HE3  . LYS A 1 483 ? -46.243 -1.179  8.868   1.00 40.60 ? 472  LYS A HE3  1 
ATOM   7481  H HZ1  . LYS A 1 483 ? -44.329 -1.116  6.922   1.00 54.93 ? 472  LYS A HZ1  1 
ATOM   7482  H HZ2  . LYS A 1 483 ? -45.742 -1.298  6.659   1.00 54.93 ? 472  LYS A HZ2  1 
ATOM   7483  H HZ3  . LYS A 1 483 ? -45.258 -0.034  7.176   1.00 54.93 ? 472  LYS A HZ3  1 
ATOM   7484  N N    . PRO A 1 484 ? -40.820 -1.999  13.625  1.00 13.21 ? 473  PRO A N    1 
ATOM   7485  C CA   . PRO A 1 484 ? -39.530 -1.723  14.242  1.00 11.63 ? 473  PRO A CA   1 
ATOM   7486  C C    . PRO A 1 484 ? -38.871 -0.484  13.643  1.00 13.28 ? 473  PRO A C    1 
ATOM   7487  O O    . PRO A 1 484 ? -39.338 0.109   12.652  1.00 12.70 ? 473  PRO A O    1 
ATOM   7488  C CB   . PRO A 1 484 ? -38.737 -3.002  13.950  1.00 13.16 ? 473  PRO A CB   1 
ATOM   7489  C CG   . PRO A 1 484 ? -39.307 -3.475  12.645  1.00 14.05 ? 473  PRO A CG   1 
ATOM   7490  C CD   . PRO A 1 484 ? -40.776 -3.219  12.791  1.00 13.67 ? 473  PRO A CD   1 
ATOM   7491  H HA   . PRO A 1 484 ? -39.627 -1.611  15.201  1.00 13.96 ? 473  PRO A HA   1 
ATOM   7492  H HB2  . PRO A 1 484 ? -37.794 -2.795  13.863  1.00 15.79 ? 473  PRO A HB2  1 
ATOM   7493  H HB3  . PRO A 1 484 ? -38.889 -3.654  14.653  1.00 15.79 ? 473  PRO A HB3  1 
ATOM   7494  H HG2  . PRO A 1 484 ? -38.935 -2.958  11.914  1.00 16.85 ? 473  PRO A HG2  1 
ATOM   7495  H HG3  . PRO A 1 484 ? -39.129 -4.422  12.529  1.00 16.85 ? 473  PRO A HG3  1 
ATOM   7496  H HD2  . PRO A 1 484 ? -41.179 -3.052  11.925  1.00 16.41 ? 473  PRO A HD2  1 
ATOM   7497  H HD3  . PRO A 1 484 ? -41.205 -3.958  13.248  1.00 16.41 ? 473  PRO A HD3  1 
ATOM   7498  N N    . PHE A 1 485 ? -37.765 -0.107  14.266  1.00 11.48 ? 474  PHE A N    1 
ATOM   7499  C CA   . PHE A 1 485 ? -36.966 1.033   13.824  1.00 11.69 ? 474  PHE A CA   1 
ATOM   7500  C C    . PHE A 1 485 ? -37.729 2.351   13.737  1.00 12.35 ? 474  PHE A C    1 
ATOM   7501  O O    . PHE A 1 485 ? -37.629 3.085   12.731  1.00 13.98 ? 474  PHE A O    1 
ATOM   7502  C CB   . PHE A 1 485 ? -36.271 0.771   12.495  1.00 12.86 ? 474  PHE A CB   1 
ATOM   7503  C CG   . PHE A 1 485 ? -35.431 -0.495  12.523  1.00 12.64 ? 474  PHE A CG   1 
ATOM   7504  C CD1  . PHE A 1 485 ? -34.158 -0.511  13.091  1.00 13.30 ? 474  PHE A CD1  1 
ATOM   7505  C CD2  . PHE A 1 485 ? -35.907 -1.685  11.998  1.00 14.10 ? 474  PHE A CD2  1 
ATOM   7506  C CE1  . PHE A 1 485 ? -33.395 -1.678  13.115  1.00 15.32 ? 474  PHE A CE1  1 
ATOM   7507  C CE2  . PHE A 1 485 ? -35.159 -2.824  12.056  1.00 16.31 ? 474  PHE A CE2  1 
ATOM   7508  C CZ   . PHE A 1 485 ? -33.914 -2.815  12.614  1.00 16.14 ? 474  PHE A CZ   1 
ATOM   7509  H H    . PHE A 1 485 ? -37.448 -0.502  14.961  1.00 13.78 ? 474  PHE A H    1 
ATOM   7510  H HA   . PHE A 1 485 ? -36.264 1.165   14.480  1.00 14.03 ? 474  PHE A HA   1 
ATOM   7511  H HB2  . PHE A 1 485 ? -36.940 0.673   11.801  1.00 15.43 ? 474  PHE A HB2  1 
ATOM   7512  H HB3  . PHE A 1 485 ? -35.685 1.517   12.291  1.00 15.43 ? 474  PHE A HB3  1 
ATOM   7513  H HD1  . PHE A 1 485 ? -33.806 0.273   13.448  1.00 15.96 ? 474  PHE A HD1  1 
ATOM   7514  H HD2  . PHE A 1 485 ? -36.759 -1.713  11.626  1.00 16.92 ? 474  PHE A HD2  1 
ATOM   7515  H HE1  . PHE A 1 485 ? -32.549 -1.678  13.500  1.00 18.38 ? 474  PHE A HE1  1 
ATOM   7516  H HE2  . PHE A 1 485 ? -35.496 -3.613  11.696  1.00 19.58 ? 474  PHE A HE2  1 
ATOM   7517  H HZ   . PHE A 1 485 ? -33.408 -3.596  12.625  1.00 19.37 ? 474  PHE A HZ   1 
ATOM   7518  N N    . PRO A 1 486 ? -38.486 2.750   14.764  1.00 11.20 ? 475  PRO A N    1 
ATOM   7519  C CA   . PRO A 1 486 ? -39.116 4.075   14.725  1.00 11.15 ? 475  PRO A CA   1 
ATOM   7520  C C    . PRO A 1 486 ? -38.065 5.143   14.520  1.00 12.72 ? 475  PRO A C    1 
ATOM   7521  O O    . PRO A 1 486 ? -37.089 5.220   15.261  1.00 12.40 ? 475  PRO A O    1 
ATOM   7522  C CB   . PRO A 1 486 ? -39.767 4.205   16.105  1.00 12.35 ? 475  PRO A CB   1 
ATOM   7523  C CG   . PRO A 1 486 ? -39.066 3.174   16.964  1.00 12.61 ? 475  PRO A CG   1 
ATOM   7524  C CD   . PRO A 1 486 ? -38.752 2.066   16.023  1.00 12.58 ? 475  PRO A CD   1 
ATOM   7525  H HA   . PRO A 1 486 ? -39.790 4.124   14.029  1.00 13.38 ? 475  PRO A HA   1 
ATOM   7526  H HB2  . PRO A 1 486 ? -39.621 5.099   16.453  1.00 14.82 ? 475  PRO A HB2  1 
ATOM   7527  H HB3  . PRO A 1 486 ? -40.715 4.011   16.040  1.00 14.82 ? 475  PRO A HB3  1 
ATOM   7528  H HG2  . PRO A 1 486 ? -38.254 3.552   17.336  1.00 15.13 ? 475  PRO A HG2  1 
ATOM   7529  H HG3  . PRO A 1 486 ? -39.661 2.871   17.668  1.00 15.13 ? 475  PRO A HG3  1 
ATOM   7530  H HD2  . PRO A 1 486 ? -37.964 1.585   16.319  1.00 15.09 ? 475  PRO A HD2  1 
ATOM   7531  H HD3  . PRO A 1 486 ? -39.516 1.475   15.931  1.00 15.09 ? 475  PRO A HD3  1 
ATOM   7532  N N    . ASP A 1 487 ? -38.309 6.026   13.562  1.00 13.00 ? 476  ASP A N    1 
ATOM   7533  C CA   . ASP A 1 487 ? -37.313 7.039   13.205  1.00 12.85 ? 476  ASP A CA   1 
ATOM   7534  C C    . ASP A 1 487 ? -36.906 7.886   14.406  1.00 12.76 ? 476  ASP A C    1 
ATOM   7535  O O    . ASP A 1 487 ? -35.729 8.239   14.554  1.00 13.22 ? 476  ASP A O    1 
ATOM   7536  C CB   . ASP A 1 487 ? -37.869 7.986   12.133  1.00 15.53 ? 476  ASP A CB   1 
ATOM   7537  C CG   . ASP A 1 487 ? -37.922 7.397   10.754  1.00 18.81 ? 476  ASP A CG   1 
ATOM   7538  O OD1  . ASP A 1 487 ? -37.291 6.375   10.482  1.00 19.21 ? 476  ASP A OD1  1 
ATOM   7539  O OD2  . ASP A 1 487 ? -38.582 8.034   9.908   1.00 26.04 ? 476  ASP A OD2  1 
ATOM   7540  H H    . ASP A 1 487 ? -39.036 6.064   13.104  1.00 15.60 ? 476  ASP A H    1 
ATOM   7541  H HA   . ASP A 1 487 ? -36.521 6.605   12.852  1.00 15.42 ? 476  ASP A HA   1 
ATOM   7542  H HB2  . ASP A 1 487 ? -38.772 8.239   12.380  1.00 18.63 ? 476  ASP A HB2  1 
ATOM   7543  H HB3  . ASP A 1 487 ? -37.307 8.776   12.094  1.00 18.63 ? 476  ASP A HB3  1 
ATOM   7544  N N    . PHE A 1 488 ? -37.884 8.287   15.221  1.00 12.26 ? 477  PHE A N    1 
ATOM   7545  C CA   . PHE A 1 488 ? -37.620 9.208   16.318  1.00 12.42 ? 477  PHE A CA   1 
ATOM   7546  C C    . PHE A 1 488 ? -36.534 8.673   17.212  1.00 10.79 ? 477  PHE A C    1 
ATOM   7547  O O    . PHE A 1 488 ? -35.805 9.452   17.837  1.00 12.25 ? 477  PHE A O    1 
ATOM   7548  C CB   . PHE A 1 488 ? -38.941 9.389   17.086  1.00 12.38 ? 477  PHE A CB   1 
ATOM   7549  C CG   . PHE A 1 488 ? -38.915 10.417  18.169  1.00 12.18 ? 477  PHE A CG   1 
ATOM   7550  C CD1  . PHE A 1 488 ? -38.882 11.768  17.891  1.00 14.65 ? 477  PHE A CD1  1 
ATOM   7551  C CD2  . PHE A 1 488 ? -39.090 10.017  19.494  1.00 14.97 ? 477  PHE A CD2  1 
ATOM   7552  C CE1  . PHE A 1 488 ? -38.937 12.705  18.913  1.00 17.06 ? 477  PHE A CE1  1 
ATOM   7553  C CE2  . PHE A 1 488 ? -39.164 10.941  20.523  1.00 17.18 ? 477  PHE A CE2  1 
ATOM   7554  C CZ   . PHE A 1 488 ? -39.096 12.292  20.235  1.00 17.81 ? 477  PHE A CZ   1 
ATOM   7555  H H    . PHE A 1 488 ? -38.705 8.039   15.157  1.00 14.71 ? 477  PHE A H    1 
ATOM   7556  H HA   . PHE A 1 488 ? -37.341 10.068  15.966  1.00 14.90 ? 477  PHE A HA   1 
ATOM   7557  H HB2  . PHE A 1 488 ? -39.630 9.647   16.455  1.00 14.85 ? 477  PHE A HB2  1 
ATOM   7558  H HB3  . PHE A 1 488 ? -39.177 8.541   17.494  1.00 14.85 ? 477  PHE A HB3  1 
ATOM   7559  H HD1  . PHE A 1 488 ? -38.789 12.054  17.011  1.00 17.58 ? 477  PHE A HD1  1 
ATOM   7560  H HD2  . PHE A 1 488 ? -39.151 9.111   19.691  1.00 17.96 ? 477  PHE A HD2  1 
ATOM   7561  H HE1  . PHE A 1 488 ? -38.889 13.612  18.714  1.00 20.47 ? 477  PHE A HE1  1 
ATOM   7562  H HE2  . PHE A 1 488 ? -39.253 10.655  21.404  1.00 20.61 ? 477  PHE A HE2  1 
ATOM   7563  H HZ   . PHE A 1 488 ? -39.119 12.919  20.922  1.00 21.37 ? 477  PHE A HZ   1 
ATOM   7564  N N    . VAL A 1 489 ? -36.472 7.361   17.354  1.00 11.67 ? 478  VAL A N    1 
ATOM   7565  C CA   . VAL A 1 489 ? -35.503 6.694   18.198  1.00 11.65 ? 478  VAL A CA   1 
ATOM   7566  C C    . VAL A 1 489 ? -34.277 6.262   17.402  1.00 11.51 ? 478  VAL A C    1 
ATOM   7567  O O    . VAL A 1 489 ? -33.148 6.501   17.813  1.00 12.59 ? 478  VAL A O    1 
ATOM   7568  C CB   . VAL A 1 489 ? -36.209 5.476   18.840  1.00 11.77 ? 478  VAL A CB   1 
ATOM   7569  C CG1  . VAL A 1 489 ? -35.224 4.687   19.668  1.00 12.85 ? 478  VAL A CG1  1 
ATOM   7570  C CG2  . VAL A 1 489 ? -37.411 5.892   19.673  1.00 14.04 ? 478  VAL A CG2  1 
ATOM   7571  H H    . VAL A 1 489 ? -37.004 6.815   16.955  1.00 14.00 ? 478  VAL A H    1 
ATOM   7572  H HA   . VAL A 1 489 ? -35.218 7.295   18.904  1.00 13.98 ? 478  VAL A HA   1 
ATOM   7573  H HB   . VAL A 1 489 ? -36.530 4.895   18.132  1.00 14.13 ? 478  VAL A HB   1 
ATOM   7574  H HG11 . VAL A 1 489 ? -35.680 3.928   20.063  1.00 15.43 ? 478  VAL A HG11 1 
ATOM   7575  H HG12 . VAL A 1 489 ? -34.505 4.379   19.094  1.00 15.43 ? 478  VAL A HG12 1 
ATOM   7576  H HG13 . VAL A 1 489 ? -34.868 5.260   20.366  1.00 15.43 ? 478  VAL A HG13 1 
ATOM   7577  H HG21 . VAL A 1 489 ? -37.820 5.099   20.054  1.00 16.85 ? 478  VAL A HG21 1 
ATOM   7578  H HG22 . VAL A 1 489 ? -37.114 6.484   20.381  1.00 16.85 ? 478  VAL A HG22 1 
ATOM   7579  H HG23 . VAL A 1 489 ? -38.047 6.351   19.102  1.00 16.85 ? 478  VAL A HG23 1 
ATOM   7580  N N    . TYR A 1 490 ? -34.494 5.604   16.253  1.00 11.90 ? 479  TYR A N    1 
ATOM   7581  C CA   . TYR A 1 490 ? -33.441 4.852   15.586  1.00 11.72 ? 479  TYR A CA   1 
ATOM   7582  C C    . TYR A 1 490 ? -32.584 5.627   14.599  1.00 12.35 ? 479  TYR A C    1 
ATOM   7583  O O    . TYR A 1 490 ? -31.511 5.138   14.270  1.00 12.76 ? 479  TYR A O    1 
ATOM   7584  C CB   . TYR A 1 490 ? -34.005 3.600   14.912  1.00 11.75 ? 479  TYR A CB   1 
ATOM   7585  C CG   . TYR A 1 490 ? -33.922 2.392   15.824  1.00 11.05 ? 479  TYR A CG   1 
ATOM   7586  C CD1  . TYR A 1 490 ? -32.783 1.585   15.826  1.00 11.96 ? 479  TYR A CD1  1 
ATOM   7587  C CD2  . TYR A 1 490 ? -34.940 2.076   16.727  1.00 11.85 ? 479  TYR A CD2  1 
ATOM   7588  C CE1  . TYR A 1 490 ? -32.628 0.542   16.711  1.00 12.31 ? 479  TYR A CE1  1 
ATOM   7589  C CE2  . TYR A 1 490 ? -34.801 1.009   17.604  1.00 11.31 ? 479  TYR A CE2  1 
ATOM   7590  C CZ   . TYR A 1 490 ? -33.665 0.263   17.585  1.00 11.11 ? 479  TYR A CZ   1 
ATOM   7591  O OH   . TYR A 1 490 ? -33.477 -0.776  18.451  1.00 11.58 ? 479  TYR A OH   1 
ATOM   7592  H H    . TYR A 1 490 ? -35.250 5.582   15.844  1.00 14.28 ? 479  TYR A H    1 
ATOM   7593  H HA   . TYR A 1 490 ? -32.837 4.539   16.277  1.00 14.06 ? 479  TYR A HA   1 
ATOM   7594  H HB2  . TYR A 1 490 ? -34.937 3.749   14.690  1.00 14.11 ? 479  TYR A HB2  1 
ATOM   7595  H HB3  . TYR A 1 490 ? -33.494 3.411   14.110  1.00 14.11 ? 479  TYR A HB3  1 
ATOM   7596  H HD1  . TYR A 1 490 ? -32.081 1.797   15.254  1.00 14.35 ? 479  TYR A HD1  1 
ATOM   7597  H HD2  . TYR A 1 490 ? -35.708 2.601   16.758  1.00 14.22 ? 479  TYR A HD2  1 
ATOM   7598  H HE1  . TYR A 1 490 ? -31.858 0.019   16.701  1.00 14.77 ? 479  TYR A HE1  1 
ATOM   7599  H HE2  . TYR A 1 490 ? -35.479 0.811   18.209  1.00 13.58 ? 479  TYR A HE2  1 
ATOM   7600  H HH   . TYR A 1 490 ? -34.154 -0.869  18.939  1.00 13.90 ? 479  TYR A HH   1 
ATOM   7601  N N    A LYS A 1 491 ? -32.980 6.813   14.146  0.57 13.53 ? 480  LYS A N    1 
ATOM   7602  N N    B LYS A 1 491 ? -32.981 6.804   14.129  0.43 12.03 ? 480  LYS A N    1 
ATOM   7603  C CA   A LYS A 1 491 ? -32.072 7.509   13.234  0.57 13.21 ? 480  LYS A CA   1 
ATOM   7604  C CA   B LYS A 1 491 ? -32.074 7.506   13.222  0.43 11.04 ? 480  LYS A CA   1 
ATOM   7605  C C    A LYS A 1 491 ? -30.746 7.796   13.918  0.57 14.77 ? 480  LYS A C    1 
ATOM   7606  C C    B LYS A 1 491 ? -30.745 7.780   13.909  0.43 10.14 ? 480  LYS A C    1 
ATOM   7607  O O    A LYS A 1 491 ? -29.675 7.578   13.339  0.57 13.74 ? 480  LYS A O    1 
ATOM   7608  O O    B LYS A 1 491 ? -29.673 7.603   13.309  0.43 12.38 ? 480  LYS A O    1 
ATOM   7609  C CB   A LYS A 1 491 ? -32.724 8.751   12.634  0.57 14.29 ? 480  LYS A CB   1 
ATOM   7610  C CB   B LYS A 1 491 ? -32.727 8.774   12.691  0.43 12.38 ? 480  LYS A CB   1 
ATOM   7611  C CG   A LYS A 1 491 ? -33.716 8.392   11.509  0.57 15.23 ? 480  LYS A CG   1 
ATOM   7612  C CG   B LYS A 1 491 ? -33.765 8.484   11.610  0.43 15.48 ? 480  LYS A CG   1 
ATOM   7613  C CD   A LYS A 1 491 ? -34.482 9.632   11.016  0.57 18.89 ? 480  LYS A CD   1 
ATOM   7614  C CD   B LYS A 1 491 ? -33.139 8.152   10.272  0.43 18.77 ? 480  LYS A CD   1 
ATOM   7615  C CE   A LYS A 1 491 ? -35.329 9.450   9.783   0.57 22.67 ? 480  LYS A CE   1 
ATOM   7616  C CE   B LYS A 1 491 ? -34.191 8.123   9.154   0.43 23.51 ? 480  LYS A CE   1 
ATOM   7617  N NZ   A LYS A 1 491 ? -36.274 10.656  9.705   0.57 17.58 ? 480  LYS A NZ   1 
ATOM   7618  N NZ   B LYS A 1 491 ? -33.572 7.770   7.853   0.43 27.32 ? 480  LYS A NZ   1 
ATOM   7619  H H    A LYS A 1 491 ? -33.717 7.215   14.333  0.57 16.24 ? 480  LYS A H    1 
ATOM   7620  H H    B LYS A 1 491 ? -33.724 7.201   14.304  0.43 14.44 ? 480  LYS A H    1 
ATOM   7621  H HA   A LYS A 1 491 ? -31.881 6.911   12.495  0.57 15.86 ? 480  LYS A HA   1 
ATOM   7622  H HA   B LYS A 1 491 ? -31.895 6.931   12.462  0.43 13.25 ? 480  LYS A HA   1 
ATOM   7623  H HB2  A LYS A 1 491 ? -33.210 9.222   13.328  0.57 17.15 ? 480  LYS A HB2  1 
ATOM   7624  H HB2  B LYS A 1 491 ? -33.173 9.231   13.421  0.43 14.85 ? 480  LYS A HB2  1 
ATOM   7625  H HB3  A LYS A 1 491 ? -32.036 9.323   12.260  0.57 17.15 ? 480  LYS A HB3  1 
ATOM   7626  H HB3  B LYS A 1 491 ? -32.044 9.346   12.307  0.43 14.85 ? 480  LYS A HB3  1 
ATOM   7627  H HG2  A LYS A 1 491 ? -33.228 8.018   10.759  0.57 18.28 ? 480  LYS A HG2  1 
ATOM   7628  H HG2  B LYS A 1 491 ? -34.304 7.726   11.885  0.43 18.57 ? 480  LYS A HG2  1 
ATOM   7629  H HG3  A LYS A 1 491 ? -34.361 7.750   11.844  0.57 18.28 ? 480  LYS A HG3  1 
ATOM   7630  H HG3  B LYS A 1 491 ? -34.327 9.266   11.493  0.43 18.57 ? 480  LYS A HG3  1 
ATOM   7631  H HD2  A LYS A 1 491 ? -35.070 9.928   11.728  0.57 22.66 ? 480  LYS A HD2  1 
ATOM   7632  H HD2  B LYS A 1 491 ? -32.478 8.827   10.050  0.43 22.52 ? 480  LYS A HD2  1 
ATOM   7633  H HD3  A LYS A 1 491 ? -33.836 10.330  10.822  0.57 22.66 ? 480  LYS A HD3  1 
ATOM   7634  H HD3  B LYS A 1 491 ? -32.722 7.277   10.320  0.43 22.52 ? 480  LYS A HD3  1 
ATOM   7635  H HE2  A LYS A 1 491 ? -34.767 9.434   8.991   0.57 27.20 ? 480  LYS A HE2  1 
ATOM   7636  H HE2  B LYS A 1 491 ? -34.864 7.456   9.363   0.43 28.21 ? 480  LYS A HE2  1 
ATOM   7637  H HE3  A LYS A 1 491 ? -35.855 8.638   9.855   0.57 27.20 ? 480  LYS A HE3  1 
ATOM   7638  H HE3  B LYS A 1 491 ? -34.597 8.999   9.072   0.43 28.21 ? 480  LYS A HE3  1 
ATOM   7639  H HZ1  A LYS A 1 491 ? -35.802 11.409  9.650   0.57 21.10 ? 480  LYS A HZ1  1 
ATOM   7640  H HZ1  B LYS A 1 491 ? -32.951 8.370   7.639   0.43 32.79 ? 480  LYS A HZ1  1 
ATOM   7641  H HZ2  A LYS A 1 491 ? -36.795 10.588  8.986   0.57 21.10 ? 480  LYS A HZ2  1 
ATOM   7642  H HZ2  B LYS A 1 491 ? -33.193 6.967   7.904   0.43 32.79 ? 480  LYS A HZ2  1 
ATOM   7643  H HZ3  A LYS A 1 491 ? -36.786 10.688  10.432  0.57 21.10 ? 480  LYS A HZ3  1 
ATOM   7644  H HZ3  B LYS A 1 491 ? -34.193 7.757   7.215   0.43 32.79 ? 480  LYS A HZ3  1 
ATOM   7645  N N    . ARG A 1 492 ? -30.785 8.211   15.182  1.00 11.47 ? 481  ARG A N    1 
ATOM   7646  C CA   . ARG A 1 492 ? -29.554 8.420   15.942  1.00 12.59 ? 481  ARG A CA   1 
ATOM   7647  C C    . ARG A 1 492 ? -28.800 7.114   16.134  1.00 11.61 ? 481  ARG A C    1 
ATOM   7648  O O    . ARG A 1 492 ? -27.573 7.090   16.025  1.00 12.18 ? 481  ARG A O    1 
ATOM   7649  C CB   . ARG A 1 492 ? -29.861 9.073   17.306  1.00 11.71 ? 481  ARG A CB   1 
ATOM   7650  C CG   . ARG A 1 492 ? -30.175 10.544  17.231  1.00 12.26 ? 481  ARG A CG   1 
ATOM   7651  C CD   . ARG A 1 492 ? -30.734 11.064  18.581  1.00 13.69 ? 481  ARG A CD   1 
ATOM   7652  N NE   . ARG A 1 492 ? -32.075 10.477  18.797  1.00 14.71 ? 481  ARG A NE   1 
ATOM   7653  C CZ   . ARG A 1 492 ? -32.683 10.417  19.981  1.00 13.30 ? 481  ARG A CZ   1 
ATOM   7654  N NH1  . ARG A 1 492 ? -32.090 10.865  21.056  1.00 14.26 ? 481  ARG A NH1  1 
ATOM   7655  N NH2  . ARG A 1 492 ? -33.888 9.855   20.088  1.00 15.03 ? 481  ARG A NH2  1 
ATOM   7656  H H    . ARG A 1 492 ? -31.507 8.381   15.617  1.00 13.77 ? 481  ARG A H    1 
ATOM   7657  H HA   . ARG A 1 492 ? -28.979 9.024   15.446  1.00 15.11 ? 481  ARG A HA   1 
ATOM   7658  H HB2  . ARG A 1 492 ? -30.627 8.627   17.698  1.00 14.05 ? 481  ARG A HB2  1 
ATOM   7659  H HB3  . ARG A 1 492 ? -29.088 8.965   17.883  1.00 14.05 ? 481  ARG A HB3  1 
ATOM   7660  H HG2  . ARG A 1 492 ? -29.365 11.036  17.026  1.00 14.71 ? 481  ARG A HG2  1 
ATOM   7661  H HG3  . ARG A 1 492 ? -30.844 10.695  16.545  1.00 14.71 ? 481  ARG A HG3  1 
ATOM   7662  H HD2  . ARG A 1 492 ? -30.152 10.788  19.306  1.00 16.42 ? 481  ARG A HD2  1 
ATOM   7663  H HD3  . ARG A 1 492 ? -30.816 12.030  18.553  1.00 16.42 ? 481  ARG A HD3  1 
ATOM   7664  H HE   . ARG A 1 492 ? -32.509 10.199  18.108  1.00 17.65 ? 481  ARG A HE   1 
ATOM   7665  H HH11 . ARG A 1 492 ? -31.310 11.222  20.999  1.00 17.11 ? 481  ARG A HH11 1 
ATOM   7666  H HH12 . ARG A 1 492 ? -32.487 10.817  21.817  1.00 17.11 ? 481  ARG A HH12 1 
ATOM   7667  H HH21 . ARG A 1 492 ? -34.285 9.553   19.388  1.00 18.03 ? 481  ARG A HH21 1 
ATOM   7668  H HH22 . ARG A 1 492 ? -34.277 9.815   20.854  1.00 18.03 ? 481  ARG A HH22 1 
ATOM   7669  N N    . ILE A 1 493 ? -29.514 6.033   16.492  1.00 12.14 ? 482  ILE A N    1 
ATOM   7670  C CA   . ILE A 1 493 ? -28.866 4.733   16.703  1.00 11.66 ? 482  ILE A CA   1 
ATOM   7671  C C    . ILE A 1 493 ? -28.127 4.305   15.446  1.00 11.56 ? 482  ILE A C    1 
ATOM   7672  O O    . ILE A 1 493 ? -26.957 3.899   15.494  1.00 12.12 ? 482  ILE A O    1 
ATOM   7673  C CB   . ILE A 1 493 ? -29.910 3.670   17.129  1.00 10.93 ? 482  ILE A CB   1 
ATOM   7674  C CG1  . ILE A 1 493 ? -30.645 4.053   18.433  1.00 12.80 ? 482  ILE A CG1  1 
ATOM   7675  C CG2  . ILE A 1 493 ? -29.289 2.269   17.209  1.00 12.77 ? 482  ILE A CG2  1 
ATOM   7676  C CD1  . ILE A 1 493 ? -29.767 4.058   19.662  1.00 12.28 ? 482  ILE A CD1  1 
ATOM   7677  H H    . ILE A 1 493 ? -30.364 6.029   16.618  1.00 14.57 ? 482  ILE A H    1 
ATOM   7678  H HA   . ILE A 1 493 ? -28.216 4.817   17.418  1.00 13.99 ? 482  ILE A HA   1 
ATOM   7679  H HB   . ILE A 1 493 ? -30.581 3.639   16.429  1.00 13.12 ? 482  ILE A HB   1 
ATOM   7680  H HG12 . ILE A 1 493 ? -31.015 4.944   18.331  1.00 15.36 ? 482  ILE A HG12 1 
ATOM   7681  H HG13 . ILE A 1 493 ? -31.361 3.417   18.584  1.00 15.36 ? 482  ILE A HG13 1 
ATOM   7682  H HG21 . ILE A 1 493 ? -29.973 1.636   17.478  1.00 15.33 ? 482  ILE A HG21 1 
ATOM   7683  H HG22 . ILE A 1 493 ? -28.940 2.028   16.337  1.00 15.33 ? 482  ILE A HG22 1 
ATOM   7684  H HG23 . ILE A 1 493 ? -28.572 2.279   17.862  1.00 15.33 ? 482  ILE A HG23 1 
ATOM   7685  H HD11 . ILE A 1 493 ? -30.303 4.307   20.431  1.00 14.74 ? 482  ILE A HD11 1 
ATOM   7686  H HD12 . ILE A 1 493 ? -29.398 3.170   19.789  1.00 14.74 ? 482  ILE A HD12 1 
ATOM   7687  H HD13 . ILE A 1 493 ? -29.051 4.699   19.536  1.00 14.74 ? 482  ILE A HD13 1 
ATOM   7688  N N    A LYS A 1 494 ? -28.789 4.421   14.289  0.63 12.78 ? 483  LYS A N    1 
ATOM   7689  N N    B LYS A 1 494 ? -28.776 4.436   14.294  0.37 11.11 ? 483  LYS A N    1 
ATOM   7690  C CA   A LYS A 1 494 ? -28.168 4.028   13.030  0.63 13.58 ? 483  LYS A CA   1 
ATOM   7691  C CA   B LYS A 1 494 ? -28.153 4.017   13.049  0.37 12.99 ? 483  LYS A CA   1 
ATOM   7692  C C    A LYS A 1 494 ? -26.931 4.859   12.740  0.63 13.60 ? 483  LYS A C    1 
ATOM   7693  C C    B LYS A 1 494 ? -26.926 4.866   12.738  0.37 12.79 ? 483  LYS A C    1 
ATOM   7694  O O    A LYS A 1 494 ? -25.888 4.319   12.340  0.63 16.57 ? 483  LYS A O    1 
ATOM   7695  O O    B LYS A 1 494 ? -25.882 4.347   12.327  0.37 12.46 ? 483  LYS A O    1 
ATOM   7696  C CB   A LYS A 1 494 ? -29.184 4.146   11.887  0.63 16.86 ? 483  LYS A CB   1 
ATOM   7697  C CB   B LYS A 1 494 ? -29.192 4.080   11.927  0.37 13.96 ? 483  LYS A CB   1 
ATOM   7698  C CG   A LYS A 1 494 ? -28.625 3.754   10.516  0.63 17.59 ? 483  LYS A CG   1 
ATOM   7699  C CG   B LYS A 1 494 ? -30.336 3.068   12.058  0.37 13.86 ? 483  LYS A CG   1 
ATOM   7700  C CD   A LYS A 1 494 ? -29.739 3.904   9.496   0.63 26.66 ? 483  LYS A CD   1 
ATOM   7701  C CD   B LYS A 1 494 ? -31.372 3.413   10.991  0.37 19.03 ? 483  LYS A CD   1 
ATOM   7702  C CE   A LYS A 1 494 ? -29.638 2.979   8.328   0.63 38.74 ? 483  LYS A CE   1 
ATOM   7703  C CE   B LYS A 1 494 ? -32.555 2.476   10.978  0.37 18.92 ? 483  LYS A CE   1 
ATOM   7704  N NZ   A LYS A 1 494 ? -30.586 3.436   7.281   0.63 42.17 ? 483  LYS A NZ   1 
ATOM   7705  N NZ   B LYS A 1 494 ? -33.585 2.972   10.004  0.37 21.83 ? 483  LYS A NZ   1 
ATOM   7706  H H    A LYS A 1 494 ? -29.590 4.722   14.211  0.63 15.33 ? 483  LYS A H    1 
ATOM   7707  H H    B LYS A 1 494 ? -29.567 4.761   14.208  0.37 13.33 ? 483  LYS A H    1 
ATOM   7708  H HA   A LYS A 1 494 ? -27.895 3.099   13.091  0.63 16.30 ? 483  LYS A HA   1 
ATOM   7709  H HA   B LYS A 1 494 ? -27.863 3.095   13.137  0.37 15.59 ? 483  LYS A HA   1 
ATOM   7710  H HB2  A LYS A 1 494 ? -29.937 3.564   12.077  0.63 20.24 ? 483  LYS A HB2  1 
ATOM   7711  H HB2  B LYS A 1 494 ? -29.584 4.967   11.917  0.37 16.75 ? 483  LYS A HB2  1 
ATOM   7712  H HB3  A LYS A 1 494 ? -29.486 5.066   11.831  0.63 20.24 ? 483  LYS A HB3  1 
ATOM   7713  H HB3  B LYS A 1 494 ? -28.747 3.911   11.082  0.37 16.75 ? 483  LYS A HB3  1 
ATOM   7714  H HG2  A LYS A 1 494 ? -27.895 4.345   10.274  0.63 21.11 ? 483  LYS A HG2  1 
ATOM   7715  H HG2  B LYS A 1 494 ? -30.007 2.170   11.901  0.37 16.63 ? 483  LYS A HG2  1 
ATOM   7716  H HG3  A LYS A 1 494 ? -28.333 2.829   10.529  0.63 21.11 ? 483  LYS A HG3  1 
ATOM   7717  H HG3  B LYS A 1 494 ? -30.747 3.141   12.934  0.37 16.63 ? 483  LYS A HG3  1 
ATOM   7718  H HD2  A LYS A 1 494 ? -30.587 3.732   9.935   0.63 32.00 ? 483  LYS A HD2  1 
ATOM   7719  H HD2  B LYS A 1 494 ? -31.704 4.310   11.155  0.37 22.84 ? 483  LYS A HD2  1 
ATOM   7720  H HD3  A LYS A 1 494 ? -29.727 4.812   9.154   0.63 32.00 ? 483  LYS A HD3  1 
ATOM   7721  H HD3  B LYS A 1 494 ? -30.949 3.371   10.119  0.37 22.84 ? 483  LYS A HD3  1 
ATOM   7722  H HE2  A LYS A 1 494 ? -28.738 3.001   7.967   0.63 46.49 ? 483  LYS A HE2  1 
ATOM   7723  H HE2  B LYS A 1 494 ? -32.268 1.592   10.701  0.37 22.71 ? 483  LYS A HE2  1 
ATOM   7724  H HE3  A LYS A 1 494 ? -29.880 2.080   8.598   0.63 46.49 ? 483  LYS A HE3  1 
ATOM   7725  H HE3  B LYS A 1 494 ? -32.955 2.444   11.861  0.37 22.71 ? 483  LYS A HE3  1 
ATOM   7726  H HZ1  A LYS A 1 494 ? -30.541 2.897   6.574   0.63 50.60 ? 483  LYS A HZ1  1 
ATOM   7727  H HZ1  B LYS A 1 494 ? -33.860 3.784   10.240  0.37 26.20 ? 483  LYS A HZ1  1 
ATOM   7728  H HZ2  A LYS A 1 494 ? -31.417 3.428   7.598   0.63 50.60 ? 483  LYS A HZ2  1 
ATOM   7729  H HZ2  B LYS A 1 494 ? -33.236 3.011   9.186   0.37 26.20 ? 483  LYS A HZ2  1 
ATOM   7730  H HZ3  A LYS A 1 494 ? -30.381 4.264   7.026   0.63 50.60 ? 483  LYS A HZ3  1 
ATOM   7731  H HZ3  B LYS A 1 494 ? -34.284 2.421   9.994   0.37 26.20 ? 483  LYS A HZ3  1 
ATOM   7732  N N    . ALA A 1 495 ? -26.999 6.173   12.975  1.00 12.44 ? 484  ALA A N    1 
ATOM   7733  C CA   . ALA A 1 495 ? -25.838 7.010   12.714  1.00 12.88 ? 484  ALA A CA   1 
ATOM   7734  C C    . ALA A 1 495 ? -24.673 6.628   13.617  1.00 13.80 ? 484  ALA A C    1 
ATOM   7735  O O    . ALA A 1 495 ? -23.501 6.633   13.193  1.00 14.30 ? 484  ALA A O    1 
ATOM   7736  C CB   . ALA A 1 495 ? -26.232 8.475   12.925  1.00 13.52 ? 484  ALA A CB   1 
ATOM   7737  H H    . ALA A 1 495 ? -27.691 6.584   13.278  1.00 14.92 ? 484  ALA A H    1 
ATOM   7738  H HA   . ALA A 1 495 ? -25.560 6.898   11.792  1.00 15.46 ? 484  ALA A HA   1 
ATOM   7739  H HB1  . ALA A 1 495 ? -25.461 9.038   12.752  1.00 16.22 ? 484  ALA A HB1  1 
ATOM   7740  H HB2  . ALA A 1 495 ? -26.950 8.700   12.313  1.00 16.22 ? 484  ALA A HB2  1 
ATOM   7741  H HB3  . ALA A 1 495 ? -26.529 8.593   13.841  1.00 16.22 ? 484  ALA A HB3  1 
ATOM   7742  N N    . ARG A 1 496 ? -24.956 6.281   14.857  1.00 11.95 ? 485  ARG A N    1 
ATOM   7743  C CA   . ARG A 1 496 ? -23.918 5.878   15.794  1.00 13.00 ? 485  ARG A CA   1 
ATOM   7744  C C    . ARG A 1 496 ? -23.299 4.547   15.403  1.00 13.75 ? 485  ARG A C    1 
ATOM   7745  O O    . ARG A 1 496 ? -22.094 4.347   15.581  1.00 15.47 ? 485  ARG A O    1 
ATOM   7746  C CB   . ARG A 1 496 ? -24.462 5.861   17.231  1.00 11.90 ? 485  ARG A CB   1 
ATOM   7747  C CG   . ARG A 1 496 ? -24.873 7.227   17.694  1.00 12.26 ? 485  ARG A CG   1 
ATOM   7748  C CD   . ARG A 1 496 ? -25.641 7.163   18.973  1.00 12.36 ? 485  ARG A CD   1 
ATOM   7749  N NE   . ARG A 1 496 ? -26.238 8.454   19.207  1.00 11.76 ? 485  ARG A NE   1 
ATOM   7750  C CZ   . ARG A 1 496 ? -26.608 8.892   20.400  1.00 11.50 ? 485  ARG A CZ   1 
ATOM   7751  N NH1  . ARG A 1 496 ? -26.493 8.146   21.493  1.00 12.72 ? 485  ARG A NH1  1 
ATOM   7752  N NH2  . ARG A 1 496 ? -27.094 10.128  20.520  1.00 13.16 ? 485  ARG A NH2  1 
ATOM   7753  H H    . ARG A 1 496 ? -25.750 6.268   15.188  1.00 14.34 ? 485  ARG A H    1 
ATOM   7754  H HA   . ARG A 1 496 ? -23.211 6.542   15.764  1.00 15.61 ? 485  ARG A HA   1 
ATOM   7755  H HB2  . ARG A 1 496 ? -25.239 5.282   17.270  1.00 14.28 ? 485  ARG A HB2  1 
ATOM   7756  H HB3  . ARG A 1 496 ? -23.771 5.534   17.829  1.00 14.28 ? 485  ARG A HB3  1 
ATOM   7757  H HG2  . ARG A 1 496 ? -24.080 7.767   17.842  1.00 14.72 ? 485  ARG A HG2  1 
ATOM   7758  H HG3  . ARG A 1 496 ? -25.437 7.637   17.020  1.00 14.72 ? 485  ARG A HG3  1 
ATOM   7759  H HD2  . ARG A 1 496 ? -26.346 6.500   18.902  1.00 14.83 ? 485  ARG A HD2  1 
ATOM   7760  H HD3  . ARG A 1 496 ? -25.043 6.956   19.707  1.00 14.83 ? 485  ARG A HD3  1 
ATOM   7761  H HE   . ARG A 1 496 ? -26.434 8.937   18.523  1.00 14.11 ? 485  ARG A HE   1 
ATOM   7762  H HH11 . ARG A 1 496 ? -26.165 7.353   21.440  1.00 15.27 ? 485  ARG A HH11 1 
ATOM   7763  H HH12 . ARG A 1 496 ? -26.747 8.456   22.254  1.00 15.27 ? 485  ARG A HH12 1 
ATOM   7764  H HH21 . ARG A 1 496 ? -27.187 10.623  19.823  1.00 15.79 ? 485  ARG A HH21 1 
ATOM   7765  H HH22 . ARG A 1 496 ? -27.358 10.414  21.288  1.00 15.79 ? 485  ARG A HH22 1 
ATOM   7766  N N    A SER A 1 497 ? -24.096 3.637   14.828  0.48 17.71 ? 486  SER A N    1 
ATOM   7767  N N    B SER A 1 497 ? -24.071 3.635   14.822  0.52 12.75 ? 486  SER A N    1 
ATOM   7768  C CA   A SER A 1 497 ? -23.583 2.343   14.399  0.48 20.50 ? 486  SER A CA   1 
ATOM   7769  C CA   B SER A 1 497 ? -23.507 2.352   14.423  0.52 11.71 ? 486  SER A CA   1 
ATOM   7770  C C    A SER A 1 497 ? -22.571 2.472   13.265  0.48 20.49 ? 486  SER A C    1 
ATOM   7771  C C    B SER A 1 497 ? -22.459 2.530   13.339  0.52 17.21 ? 486  SER A C    1 
ATOM   7772  O O    A SER A 1 497 ? -21.816 1.524   13.021  0.48 20.03 ? 486  SER A O    1 
ATOM   7773  O O    B SER A 1 497 ? -21.537 1.718   13.234  0.52 21.63 ? 486  SER A O    1 
ATOM   7774  C CB   A SER A 1 497 ? -24.740 1.430   13.976  0.48 23.26 ? 486  SER A CB   1 
ATOM   7775  C CB   B SER A 1 497 ? -24.631 1.446   13.951  0.52 12.79 ? 486  SER A CB   1 
ATOM   7776  O OG   A SER A 1 497 ? -25.512 0.984   15.083  0.48 18.64 ? 486  SER A OG   1 
ATOM   7777  O OG   B SER A 1 497 ? -25.138 1.876   12.695  0.52 17.01 ? 486  SER A OG   1 
ATOM   7778  H H    A SER A 1 497 ? -24.936 3.751   14.678  0.48 21.25 ? 486  SER A H    1 
ATOM   7779  H H    B SER A 1 497 ? -24.908 3.731   14.650  0.52 15.30 ? 486  SER A H    1 
ATOM   7780  H HA   A SER A 1 497 ? -23.134 1.922   15.149  0.48 24.60 ? 486  SER A HA   1 
ATOM   7781  H HA   B SER A 1 497 ? -23.083 1.936   15.190  0.52 14.06 ? 486  SER A HA   1 
ATOM   7782  H HB2  A SER A 1 497 ? -25.318 1.921   13.372  0.48 27.91 ? 486  SER A HB2  1 
ATOM   7783  H HB2  B SER A 1 497 ? -24.290 0.542   13.861  0.52 15.34 ? 486  SER A HB2  1 
ATOM   7784  H HB3  A SER A 1 497 ? -24.374 0.655   13.521  0.48 27.91 ? 486  SER A HB3  1 
ATOM   7785  H HB3  B SER A 1 497 ? -25.347 1.467   14.604  0.52 15.34 ? 486  SER A HB3  1 
ATOM   7786  H HG   A SER A 1 497 ? -25.027 0.552   15.616  0.48 22.37 ? 486  SER A HG   1 
ATOM   7787  H HG   B SER A 1 497 ? -25.437 2.658   12.758  0.52 20.42 ? 486  SER A HG   1 
ATOM   7788  N N    . ARG A 1 498 ? -22.553 3.608   12.572  1.00 18.91 ? 487  ARG A N    1 
ATOM   7789  C CA   . ARG A 1 498 ? -21.587 3.880   11.513  1.00 21.33 ? 487  ARG A CA   1 
ATOM   7790  C C    . ARG A 1 498 ? -20.261 4.452   12.003  1.00 21.63 ? 487  ARG A C    1 
ATOM   7791  O O    . ARG A 1 498 ? -19.277 4.482   11.222  1.00 26.41 ? 487  ARG A O    1 
ATOM   7792  C CB   . ARG A 1 498 ? -22.191 4.822   10.476  1.00 24.69 ? 487  ARG A CB   1 
ATOM   7793  C CG   . ARG A 1 498 ? -23.415 4.301   9.770   1.00 29.43 ? 487  ARG A CG   1 
ATOM   7794  C CD   . ARG A 1 498 ? -23.879 5.316   8.739   1.00 40.58 ? 487  ARG A CD   1 
ATOM   7795  N NE   . ARG A 1 498 ? -25.233 5.051   8.264   1.00 52.82 ? 487  ARG A NE   1 
ATOM   7796  C CZ   . ARG A 1 498 ? -25.530 4.173   7.311   1.00 66.48 ? 487  ARG A CZ   1 
ATOM   7797  N NH1  . ARG A 1 498 ? -24.569 3.453   6.729   1.00 69.14 ? 487  ARG A NH1  1 
ATOM   7798  N NH2  . ARG A 1 498 ? -26.794 4.015   6.942   1.00 71.81 ? 487  ARG A NH2  1 
ATOM   7799  H H    . ARG A 1 498 ? -23.138 4.230   12.671  1.00 22.69 ? 487  ARG A H    1 
ATOM   7800  H HA   . ARG A 1 498 ? -21.390 3.045   11.062  1.00 25.59 ? 487  ARG A HA   1 
ATOM   7801  H HB2  . ARG A 1 498 ? -22.439 5.649   10.919  1.00 29.63 ? 487  ARG A HB2  1 
ATOM   7802  H HB3  . ARG A 1 498 ? -21.520 5.006   9.800   1.00 29.63 ? 487  ARG A HB3  1 
ATOM   7803  H HG2  . ARG A 1 498 ? -23.200 3.472   9.314   1.00 35.31 ? 487  ARG A HG2  1 
ATOM   7804  H HG3  . ARG A 1 498 ? -24.128 4.163   10.412  1.00 35.31 ? 487  ARG A HG3  1 
ATOM   7805  H HD2  . ARG A 1 498 ? -23.868 6.200   9.138   1.00 48.69 ? 487  ARG A HD2  1 
ATOM   7806  H HD3  . ARG A 1 498 ? -23.281 5.288   7.976   1.00 48.69 ? 487  ARG A HD3  1 
ATOM   7807  H HE   . ARG A 1 498 ? -25.874 5.516   8.597   1.00 63.38 ? 487  ARG A HE   1 
ATOM   7808  H HH11 . ARG A 1 498 ? -23.749 3.559   6.966   1.00 82.97 ? 487  ARG A HH11 1 
ATOM   7809  H HH12 . ARG A 1 498 ? -24.769 2.886   6.114   1.00 82.97 ? 487  ARG A HH12 1 
ATOM   7810  H HH21 . ARG A 1 498 ? -27.413 4.477   7.320   1.00 86.17 ? 487  ARG A HH21 1 
ATOM   7811  H HH22 . ARG A 1 498 ? -26.996 3.445   6.330   1.00 86.17 ? 487  ARG A HH22 1 
ATOM   7812  N N    . LEU A 1 499 ? -20.162 4.831   13.277  1.00 20.83 ? 488  LEU A N    1 
ATOM   7813  C CA   . LEU A 1 499 ? -18.959 5.526   13.746  1.00 21.00 ? 488  LEU A CA   1 
ATOM   7814  C C    . LEU A 1 499 ? -17.835 4.555   14.140  1.00 23.54 ? 488  LEU A C    1 
ATOM   7815  O O    . LEU A 1 499 ? -18.068 3.408   14.518  1.00 24.51 ? 488  LEU A O    1 
ATOM   7816  C CB   . LEU A 1 499 ? -19.316 6.359   14.971  1.00 21.04 ? 488  LEU A CB   1 
ATOM   7817  C CG   . LEU A 1 499 ? -20.419 7.389   14.855  1.00 23.19 ? 488  LEU A CG   1 
ATOM   7818  C CD1  . LEU A 1 499 ? -20.727 8.008   16.230  1.00 27.26 ? 488  LEU A CD1  1 
ATOM   7819  C CD2  . LEU A 1 499 ? -20.003 8.484   13.914  1.00 28.49 ? 488  LEU A CD2  1 
ATOM   7820  H H    . LEU A 1 499 ? -20.762 4.703   13.879  1.00 24.99 ? 488  LEU A H    1 
ATOM   7821  H HA   . LEU A 1 499 ? -18.630 6.118   13.052  1.00 25.21 ? 488  LEU A HA   1 
ATOM   7822  H HB2  . LEU A 1 499 ? -19.577 5.748   15.678  1.00 25.24 ? 488  LEU A HB2  1 
ATOM   7823  H HB3  . LEU A 1 499 ? -18.517 6.835   15.248  1.00 25.24 ? 488  LEU A HB3  1 
ATOM   7824  H HG   . LEU A 1 499 ? -21.225 6.971   14.512  1.00 27.83 ? 488  LEU A HG   1 
ATOM   7825  H HD11 . LEU A 1 499 ? -21.436 8.663   16.130  1.00 32.71 ? 488  LEU A HD11 1 
ATOM   7826  H HD12 . LEU A 1 499 ? -21.010 7.305   16.836  1.00 32.71 ? 488  LEU A HD12 1 
ATOM   7827  H HD13 . LEU A 1 499 ? -19.926 8.436   16.570  1.00 32.71 ? 488  LEU A HD13 1 
ATOM   7828  H HD21 . LEU A 1 499 ? -20.720 9.135   13.851  1.00 34.19 ? 488  LEU A HD21 1 
ATOM   7829  H HD22 . LEU A 1 499 ? -19.201 8.907   14.258  1.00 34.19 ? 488  LEU A HD22 1 
ATOM   7830  H HD23 . LEU A 1 499 ? -19.827 8.100   13.041  1.00 34.19 ? 488  LEU A HD23 1 
ATOM   7831  N N    . ALA A 1 500 ? -16.606 5.064   14.091  1.00 25.31 ? 489  ALA A N    1 
ATOM   7832  C CA   . ALA A 1 500 ? -15.430 4.313   14.541  1.00 29.66 ? 489  ALA A CA   1 
ATOM   7833  C C    . ALA A 1 500 ? -15.493 4.005   16.041  1.00 29.49 ? 489  ALA A C    1 
ATOM   7834  O O    . ALA A 1 500 ? -16.146 4.703   16.826  1.00 31.36 ? 489  ALA A O    1 
ATOM   7835  C CB   . ALA A 1 500 ? -14.155 5.116   14.262  1.00 37.31 ? 489  ALA A CB   1 
ATOM   7836  H H    . ALA A 1 500 ? -16.423 5.852   13.798  1.00 30.37 ? 489  ALA A H    1 
ATOM   7837  H HA   . ALA A 1 500 ? -15.377 3.475   14.057  1.00 35.60 ? 489  ALA A HA   1 
ATOM   7838  H HB1  . ALA A 1 500 ? -13.388 4.605   14.566  1.00 44.77 ? 489  ALA A HB1  1 
ATOM   7839  H HB2  . ALA A 1 500 ? -14.088 5.279   13.308  1.00 44.77 ? 489  ALA A HB2  1 
ATOM   7840  H HB3  . ALA A 1 500 ? -14.202 5.958   14.740  1.00 44.77 ? 489  ALA A HB3  1 
ATOM   7841  N N    . GLU A 1 501 ? -14.774 2.956   16.449  1.00 29.37 ? 490  GLU A N    1 
ATOM   7842  C CA   . GLU A 1 501 ? -14.711 2.584   17.878  1.00 33.60 ? 490  GLU A CA   1 
ATOM   7843  C C    . GLU A 1 501 ? -14.115 3.669   18.750  1.00 36.41 ? 490  GLU A C    1 
ATOM   7844  O O    . GLU A 1 501 ? -13.181 4.336   18.298  1.00 34.71 ? 490  GLU A O    1 
ATOM   7845  C CB   . GLU A 1 501 ? -13.863 1.332   18.097  1.00 35.73 ? 490  GLU A CB   1 
ATOM   7846  C CG   . GLU A 1 501 ? -14.493 0.116   17.581  1.00 35.98 ? 490  GLU A CG   1 
ATOM   7847  C CD   . GLU A 1 501 ? -15.655 -0.334  18.432  1.00 36.14 ? 490  GLU A CD   1 
ATOM   7848  O OE1  . GLU A 1 501 ? -15.642 -0.129  19.670  1.00 38.56 ? 490  GLU A OE1  1 
ATOM   7849  O OE2  . GLU A 1 501 ? -16.586 -0.892  17.847  1.00 35.73 ? 490  GLU A OE2  1 
ATOM   7850  O OXT  . GLU A 1 501 ? -14.518 3.836   19.921  1.00 37.41 ? 490  GLU A OXT  1 
ATOM   7851  H H    . GLU A 1 501 ? -14.316 2.445   15.930  1.00 35.25 ? 490  GLU A H    1 
ATOM   7852  H HA   . GLU A 1 501 ? -15.609 2.400   18.197  1.00 40.33 ? 490  GLU A HA   1 
ATOM   7853  H HB2  . GLU A 1 501 ? -13.013 1.445   17.643  1.00 42.88 ? 490  GLU A HB2  1 
ATOM   7854  H HB3  . GLU A 1 501 ? -13.717 1.213   19.049  1.00 42.88 ? 490  GLU A HB3  1 
ATOM   7855  H HG2  . GLU A 1 501 ? -14.824 0.286   16.685  1.00 43.18 ? 490  GLU A HG2  1 
ATOM   7856  H HG3  . GLU A 1 501 ? -13.837 -0.598  17.564  1.00 43.18 ? 490  GLU A HG3  1 
ATOM   7857  N N    . ASP B 1 26  ? -46.489 32.462  -10.342 1.00 58.48 ? 15   ASP B N    1 
ATOM   7858  C CA   . ASP B 1 26  ? -45.433 31.508  -10.665 1.00 52.27 ? 15   ASP B CA   1 
ATOM   7859  C C    . ASP B 1 26  ? -45.571 30.251  -9.818  1.00 46.04 ? 15   ASP B C    1 
ATOM   7860  O O    . ASP B 1 26  ? -46.029 30.322  -8.670  1.00 46.92 ? 15   ASP B O    1 
ATOM   7861  C CB   . ASP B 1 26  ? -44.064 32.112  -10.435 1.00 55.39 ? 15   ASP B CB   1 
ATOM   7862  C CG   . ASP B 1 26  ? -43.748 32.298  -8.975  1.00 63.48 ? 15   ASP B CG   1 
ATOM   7863  O OD1  . ASP B 1 26  ? -44.654 32.663  -8.195  1.00 67.88 ? 15   ASP B OD1  1 
ATOM   7864  O OD2  . ASP B 1 26  ? -42.581 32.082  -8.613  1.00 68.07 ? 15   ASP B OD2  1 
ATOM   7865  H HA   . ASP B 1 26  ? -45.502 31.257  -11.599 1.00 62.72 ? 15   ASP B HA   1 
ATOM   7866  H HB2  . ASP B 1 26  ? -43.392 31.525  -10.815 1.00 66.47 ? 15   ASP B HB2  1 
ATOM   7867  H HB3  . ASP B 1 26  ? -44.026 32.982  -10.863 1.00 66.47 ? 15   ASP B HB3  1 
ATOM   7868  N N    . ARG B 1 27  ? -45.102 29.140  -10.393 1.00 37.51 ? 16   ARG B N    1 
ATOM   7869  C CA   . ARG B 1 27  ? -45.508 27.788  -10.038 1.00 32.99 ? 16   ARG B CA   1 
ATOM   7870  C C    . ARG B 1 27  ? -44.301 26.876  -10.077 1.00 28.91 ? 16   ARG B C    1 
ATOM   7871  O O    . ARG B 1 27  ? -43.452 27.013  -10.965 1.00 33.83 ? 16   ARG B O    1 
ATOM   7872  C CB   . ARG B 1 27  ? -46.508 27.281  -11.083 1.00 35.07 ? 16   ARG B CB   1 
ATOM   7873  C CG   . ARG B 1 27  ? -47.790 28.069  -11.097 1.00 40.41 ? 16   ARG B CG   1 
ATOM   7874  C CD   . ARG B 1 27  ? -48.672 27.668  -12.264 1.00 46.87 ? 16   ARG B CD   1 
ATOM   7875  N NE   . ARG B 1 27  ? -50.046 28.128  -12.047 1.00 52.81 ? 16   ARG B NE   1 
ATOM   7876  C CZ   . ARG B 1 27  ? -50.964 28.237  -12.999 1.00 59.51 ? 16   ARG B CZ   1 
ATOM   7877  N NH1  . ARG B 1 27  ? -50.657 27.929  -14.252 1.00 60.91 ? 16   ARG B NH1  1 
ATOM   7878  N NH2  . ARG B 1 27  ? -52.187 28.661  -12.700 1.00 62.60 ? 16   ARG B NH2  1 
ATOM   7879  H H    . ARG B 1 27  ? -44.517 29.152  -11.024 1.00 45.01 ? 16   ARG B H    1 
ATOM   7880  H HA   . ARG B 1 27  ? -45.911 27.766  -9.156  1.00 39.59 ? 16   ARG B HA   1 
ATOM   7881  H HB2  . ARG B 1 27  ? -46.106 27.349  -11.963 1.00 42.09 ? 16   ARG B HB2  1 
ATOM   7882  H HB3  . ARG B 1 27  ? -46.727 26.357  -10.888 1.00 42.09 ? 16   ARG B HB3  1 
ATOM   7883  H HG2  . ARG B 1 27  ? -48.279 27.901  -10.276 1.00 48.49 ? 16   ARG B HG2  1 
ATOM   7884  H HG3  . ARG B 1 27  ? -47.586 29.013  -11.180 1.00 48.49 ? 16   ARG B HG3  1 
ATOM   7885  H HD2  . ARG B 1 27  ? -48.336 28.076  -13.078 1.00 56.24 ? 16   ARG B HD2  1 
ATOM   7886  H HD3  . ARG B 1 27  ? -48.680 26.702  -12.347 1.00 56.24 ? 16   ARG B HD3  1 
ATOM   7887  H HE   . ARG B 1 27  ? -50.274 28.343  -11.246 1.00 63.37 ? 16   ARG B HE   1 
ATOM   7888  H HH11 . ARG B 1 27  ? -49.865 27.654  -14.445 1.00 73.09 ? 16   ARG B HH11 1 
ATOM   7889  H HH12 . ARG B 1 27  ? -51.250 28.000  -14.870 1.00 73.09 ? 16   ARG B HH12 1 
ATOM   7890  H HH21 . ARG B 1 27  ? -52.386 28.863  -11.888 1.00 75.12 ? 16   ARG B HH21 1 
ATOM   7891  H HH22 . ARG B 1 27  ? -52.780 28.734  -13.318 1.00 75.12 ? 16   ARG B HH22 1 
ATOM   7892  N N    . LEU B 1 28  ? -44.257 25.906  -9.165  1.00 26.16 ? 17   LEU B N    1 
ATOM   7893  C CA   . LEU B 1 28  ? -43.087 25.044  -9.081  1.00 22.68 ? 17   LEU B CA   1 
ATOM   7894  C C    . LEU B 1 28  ? -43.503 23.726  -8.462  1.00 22.75 ? 17   LEU B C    1 
ATOM   7895  O O    . LEU B 1 28  ? -44.215 23.696  -7.456  1.00 22.60 ? 17   LEU B O    1 
ATOM   7896  C CB   . LEU B 1 28  ? -41.978 25.713  -8.244  1.00 22.71 ? 17   LEU B CB   1 
ATOM   7897  C CG   . LEU B 1 28  ? -40.697 24.908  -8.044  1.00 23.54 ? 17   LEU B CG   1 
ATOM   7898  C CD1  . LEU B 1 28  ? -39.993 24.714  -9.342  1.00 25.36 ? 17   LEU B CD1  1 
ATOM   7899  C CD2  . LEU B 1 28  ? -39.791 25.666  -7.071  1.00 27.48 ? 17   LEU B CD2  1 
ATOM   7900  H H    . LEU B 1 28  ? -44.877 25.731  -8.596  1.00 31.39 ? 17   LEU B H    1 
ATOM   7901  H HA   . LEU B 1 28  ? -42.744 24.873  -9.972  1.00 27.22 ? 17   LEU B HA   1 
ATOM   7902  H HB2  . LEU B 1 28  ? -41.730 26.544  -8.679  1.00 27.25 ? 17   LEU B HB2  1 
ATOM   7903  H HB3  . LEU B 1 28  ? -42.337 25.906  -7.364  1.00 27.25 ? 17   LEU B HB3  1 
ATOM   7904  H HG   . LEU B 1 28  ? -40.907 24.040  -7.666  1.00 28.25 ? 17   LEU B HG   1 
ATOM   7905  H HD11 . LEU B 1 28  ? -39.185 24.201  -9.189  1.00 30.43 ? 17   LEU B HD11 1 
ATOM   7906  H HD12 . LEU B 1 28  ? -40.579 24.235  -9.949  1.00 30.43 ? 17   LEU B HD12 1 
ATOM   7907  H HD13 . LEU B 1 28  ? -39.770 25.582  -9.713  1.00 30.43 ? 17   LEU B HD13 1 
ATOM   7908  H HD21 . LEU B 1 28  ? -38.975 25.158  -6.940  1.00 32.98 ? 17   LEU B HD21 1 
ATOM   7909  H HD22 . LEU B 1 28  ? -39.583 26.536  -7.446  1.00 32.98 ? 17   LEU B HD22 1 
ATOM   7910  H HD23 . LEU B 1 28  ? -40.255 25.771  -6.226  1.00 32.98 ? 17   LEU B HD23 1 
ATOM   7911  N N    . LEU B 1 29  ? -43.001 22.641  -9.033  1.00 22.22 ? 18   LEU B N    1 
ATOM   7912  C CA   . LEU B 1 29  ? -43.301 21.296  -8.565  1.00 22.87 ? 18   LEU B CA   1 
ATOM   7913  C C    . LEU B 1 29  ? -41.996 20.608  -8.211  1.00 22.60 ? 18   LEU B C    1 
ATOM   7914  O O    . LEU B 1 29  ? -41.078 20.559  -9.034  1.00 24.76 ? 18   LEU B O    1 
ATOM   7915  C CB   . LEU B 1 29  ? -44.020 20.479  -9.654  1.00 24.69 ? 18   LEU B CB   1 
ATOM   7916  C CG   . LEU B 1 29  ? -44.281 19.017  -9.282  1.00 27.23 ? 18   LEU B CG   1 
ATOM   7917  C CD1  . LEU B 1 29  ? -45.247 18.931  -8.115  1.00 29.10 ? 18   LEU B CD1  1 
ATOM   7918  C CD2  . LEU B 1 29  ? -44.845 18.268  -10.467 1.00 30.81 ? 18   LEU B CD2  1 
ATOM   7919  H H    . LEU B 1 29  ? -42.471 22.658  -9.710  1.00 26.66 ? 18   LEU B H    1 
ATOM   7920  H HA   . LEU B 1 29  ? -43.863 21.335  -7.776  1.00 27.44 ? 18   LEU B HA   1 
ATOM   7921  H HB2  . LEU B 1 29  ? -44.878 20.893  -9.838  1.00 29.63 ? 18   LEU B HB2  1 
ATOM   7922  H HB3  . LEU B 1 29  ? -43.476 20.485  -10.457 1.00 29.63 ? 18   LEU B HB3  1 
ATOM   7923  H HG   . LEU B 1 29  ? -43.447 18.596  -9.021  1.00 32.67 ? 18   LEU B HG   1 
ATOM   7924  H HD11 . LEU B 1 29  ? -45.397 17.998  -7.897  1.00 34.92 ? 18   LEU B HD11 1 
ATOM   7925  H HD12 . LEU B 1 29  ? -44.863 19.392  -7.353  1.00 34.92 ? 18   LEU B HD12 1 
ATOM   7926  H HD13 . LEU B 1 29  ? -46.085 19.351  -8.368  1.00 34.92 ? 18   LEU B HD13 1 
ATOM   7927  H HD21 . LEU B 1 29  ? -45.003 17.346  -10.211 1.00 36.98 ? 18   LEU B HD21 1 
ATOM   7928  H HD22 . LEU B 1 29  ? -45.678 18.685  -10.736 1.00 36.98 ? 18   LEU B HD22 1 
ATOM   7929  H HD23 . LEU B 1 29  ? -44.206 18.305  -11.196 1.00 36.98 ? 18   LEU B HD23 1 
ATOM   7930  N N    . ILE B 1 30  ? -41.918 20.047  -7.015  1.00 21.92 ? 19   ILE B N    1 
ATOM   7931  C CA   . ILE B 1 30  ? -40.787 19.206  -6.638  1.00 21.06 ? 19   ILE B CA   1 
ATOM   7932  C C    . ILE B 1 30  ? -41.284 17.780  -6.539  1.00 21.31 ? 19   ILE B C    1 
ATOM   7933  O O    . ILE B 1 30  ? -42.113 17.464  -5.669  1.00 23.97 ? 19   ILE B O    1 
ATOM   7934  C CB   . ILE B 1 30  ? -40.127 19.616  -5.313  1.00 20.52 ? 19   ILE B CB   1 
ATOM   7935  C CG1  . ILE B 1 30  ? -39.656 21.067  -5.342  1.00 22.66 ? 19   ILE B CG1  1 
ATOM   7936  C CG2  . ILE B 1 30  ? -38.933 18.697  -5.016  1.00 21.96 ? 19   ILE B CG2  1 
ATOM   7937  C CD1  . ILE B 1 30  ? -39.292 21.581  -4.023  1.00 26.18 ? 19   ILE B CD1  1 
ATOM   7938  H H    . ILE B 1 30  ? -42.510 20.136  -6.397  1.00 26.31 ? 19   ILE B H    1 
ATOM   7939  H HA   . ILE B 1 30  ? -40.115 19.246  -7.336  1.00 25.27 ? 19   ILE B HA   1 
ATOM   7940  H HB   . ILE B 1 30  ? -40.778 19.517  -4.601  1.00 24.63 ? 19   ILE B HB   1 
ATOM   7941  H HG12 . ILE B 1 30  ? -38.875 21.133  -5.914  1.00 27.19 ? 19   ILE B HG12 1 
ATOM   7942  H HG13 . ILE B 1 30  ? -40.370 21.623  -5.692  1.00 27.19 ? 19   ILE B HG13 1 
ATOM   7943  H HG21 . ILE B 1 30  ? -38.528 18.968  -4.177  1.00 26.35 ? 19   ILE B HG21 1 
ATOM   7944  H HG22 . ILE B 1 30  ? -39.248 17.782  -4.950  1.00 26.35 ? 19   ILE B HG22 1 
ATOM   7945  H HG23 . ILE B 1 30  ? -38.288 18.775  -5.736  1.00 26.35 ? 19   ILE B HG23 1 
ATOM   7946  H HD11 . ILE B 1 30  ? -39.003 22.503  -4.113  1.00 31.41 ? 19   ILE B HD11 1 
ATOM   7947  H HD12 . ILE B 1 30  ? -40.066 21.532  -3.441  1.00 31.41 ? 19   ILE B HD12 1 
ATOM   7948  H HD13 . ILE B 1 30  ? -38.571 21.042  -3.663  1.00 31.41 ? 19   ILE B HD13 1 
ATOM   7949  N N    . LYS B 1 31  ? -40.778 16.924  -7.421  1.00 23.87 ? 20   LYS B N    1 
ATOM   7950  C CA   . LYS B 1 31  ? -41.229 15.534  -7.464  1.00 25.03 ? 20   LYS B CA   1 
ATOM   7951  C C    . LYS B 1 31  ? -40.211 14.627  -6.788  1.00 25.20 ? 20   LYS B C    1 
ATOM   7952  O O    . LYS B 1 31  ? -39.008 14.792  -6.966  1.00 28.34 ? 20   LYS B O    1 
ATOM   7953  C CB   . LYS B 1 31  ? -41.445 15.047  -8.904  1.00 29.86 ? 20   LYS B CB   1 
ATOM   7954  C CG   . LYS B 1 31  ? -42.648 15.669  -9.568  1.00 35.51 ? 20   LYS B CG   1 
ATOM   7955  C CD   . LYS B 1 31  ? -42.886 15.088  -10.919 1.00 40.65 ? 20   LYS B CD   1 
ATOM   7956  C CE   . LYS B 1 31  ? -43.573 13.751  -10.805 1.00 46.27 ? 20   LYS B CE   1 
ATOM   7957  N NZ   . LYS B 1 31  ? -43.727 13.109  -12.154 1.00 48.23 ? 20   LYS B NZ   1 
ATOM   7958  H H    . LYS B 1 31  ? -40.176 17.119  -8.004  1.00 28.64 ? 20   LYS B H    1 
ATOM   7959  H HA   . LYS B 1 31  ? -42.070 15.456  -6.987  1.00 30.04 ? 20   LYS B HA   1 
ATOM   7960  H HB2  . LYS B 1 31  ? -40.663 15.271  -9.433  1.00 35.83 ? 20   LYS B HB2  1 
ATOM   7961  H HB3  . LYS B 1 31  ? -41.573 14.085  -8.895  1.00 35.83 ? 20   LYS B HB3  1 
ATOM   7962  H HG2  . LYS B 1 31  ? -43.434 15.506  -9.024  1.00 42.61 ? 20   LYS B HG2  1 
ATOM   7963  H HG3  . LYS B 1 31  ? -42.501 16.623  -9.669  1.00 42.61 ? 20   LYS B HG3  1 
ATOM   7964  H HD2  . LYS B 1 31  ? -43.456 15.684  -11.431 1.00 48.78 ? 20   LYS B HD2  1 
ATOM   7965  H HD3  . LYS B 1 31  ? -42.037 14.960  -11.370 1.00 48.78 ? 20   LYS B HD3  1 
ATOM   7966  H HE2  . LYS B 1 31  ? -43.043 13.163  -10.246 1.00 55.52 ? 20   LYS B HE2  1 
ATOM   7967  H HE3  . LYS B 1 31  ? -44.456 13.875  -10.423 1.00 55.52 ? 20   LYS B HE3  1 
ATOM   7968  H HZ1  . LYS B 1 31  ? -42.927 12.984  -12.524 1.00 57.88 ? 20   LYS B HZ1  1 
ATOM   7969  H HZ2  . LYS B 1 31  ? -44.134 12.322  -12.072 1.00 57.88 ? 20   LYS B HZ2  1 
ATOM   7970  H HZ3  . LYS B 1 31  ? -44.213 13.631  -12.686 1.00 57.88 ? 20   LYS B HZ3  1 
ATOM   7971  N N    . GLY B 1 32  ? -40.703 13.644  -6.053  1.00 25.81 ? 21   GLY B N    1 
ATOM   7972  C CA   . GLY B 1 32  ? -39.854 12.544  -5.658  1.00 28.58 ? 21   GLY B CA   1 
ATOM   7973  C C    . GLY B 1 32  ? -38.987 12.767  -4.438  1.00 27.08 ? 21   GLY B C    1 
ATOM   7974  O O    . GLY B 1 32  ? -38.095 11.945  -4.183  1.00 29.24 ? 21   GLY B O    1 
ATOM   7975  H H    . GLY B 1 32  ? -41.515 13.593  -5.774  1.00 30.97 ? 21   GLY B H    1 
ATOM   7976  H HA2  . GLY B 1 32  ? -40.412 11.770  -5.483  1.00 34.30 ? 21   GLY B HA2  1 
ATOM   7977  H HA3  . GLY B 1 32  ? -39.267 12.324  -6.398  1.00 34.30 ? 21   GLY B HA3  1 
ATOM   7978  N N    . GLY B 1 33  ? -39.235 13.827  -3.657  1.00 25.29 ? 22   GLY B N    1 
ATOM   7979  C CA   . GLY B 1 33  ? -38.429 14.121  -2.492  1.00 23.85 ? 22   GLY B CA   1 
ATOM   7980  C C    . GLY B 1 33  ? -38.923 13.420  -1.240  1.00 19.46 ? 22   GLY B C    1 
ATOM   7981  O O    . GLY B 1 33  ? -40.046 12.890  -1.162  1.00 20.83 ? 22   GLY B O    1 
ATOM   7982  H H    . GLY B 1 33  ? -39.873 14.388  -3.791  1.00 30.34 ? 22   GLY B H    1 
ATOM   7983  H HA2  . GLY B 1 33  ? -37.514 13.844  -2.656  1.00 28.62 ? 22   GLY B HA2  1 
ATOM   7984  H HA3  . GLY B 1 33  ? -38.435 15.077  -2.330  1.00 28.62 ? 22   GLY B HA3  1 
ATOM   7985  N N    . LYS B 1 34  ? -38.037 13.397  -0.267  1.00 17.87 ? 23   LYS B N    1 
ATOM   7986  C CA   . LYS B 1 34  ? -38.344 12.977  1.102   1.00 16.42 ? 23   LYS B CA   1 
ATOM   7987  C C    . LYS B 1 34  ? -38.480 14.247  1.930   1.00 14.56 ? 23   LYS B C    1 
ATOM   7988  O O    . LYS B 1 34  ? -37.480 14.906  2.258   1.00 16.49 ? 23   LYS B O    1 
ATOM   7989  C CB   . LYS B 1 34  ? -37.265 12.062  1.676   1.00 17.56 ? 23   LYS B CB   1 
ATOM   7990  C CG   . LYS B 1 34  ? -37.612 11.455  3.024   1.00 18.29 ? 23   LYS B CG   1 
ATOM   7991  C CD   . LYS B 1 34  ? -36.437 10.700  3.647   1.00 20.65 ? 23   LYS B CD   1 
ATOM   7992  C CE   . LYS B 1 34  ? -35.438 11.684  4.264   1.00 22.32 ? 23   LYS B CE   1 
ATOM   7993  N NZ   . LYS B 1 34  ? -34.223 11.039  4.893   1.00 26.16 ? 23   LYS B NZ   1 
ATOM   7994  H H    . LYS B 1 34  ? -37.215 13.628  -0.371  1.00 21.44 ? 23   LYS B H    1 
ATOM   7995  H HA   . LYS B 1 34  ? -39.191 12.505  1.116   1.00 19.70 ? 23   LYS B HA   1 
ATOM   7996  H HB2  . LYS B 1 34  ? -37.113 11.333  1.054   1.00 21.08 ? 23   LYS B HB2  1 
ATOM   7997  H HB3  . LYS B 1 34  ? -36.449 12.575  1.784   1.00 21.08 ? 23   LYS B HB3  1 
ATOM   7998  H HG2  . LYS B 1 34  ? -37.871 12.164  3.633   1.00 21.95 ? 23   LYS B HG2  1 
ATOM   7999  H HG3  . LYS B 1 34  ? -38.345 10.830  2.911   1.00 21.95 ? 23   LYS B HG3  1 
ATOM   8000  H HD2  . LYS B 1 34  ? -36.764 10.114  4.347   1.00 24.78 ? 23   LYS B HD2  1 
ATOM   8001  H HD3  . LYS B 1 34  ? -35.981 10.188  2.961   1.00 24.78 ? 23   LYS B HD3  1 
ATOM   8002  H HE2  . LYS B 1 34  ? -35.125 12.284  3.568   1.00 26.78 ? 23   LYS B HE2  1 
ATOM   8003  H HE3  . LYS B 1 34  ? -35.891 12.193  4.954   1.00 26.78 ? 23   LYS B HE3  1 
ATOM   8004  H HZ1  . LYS B 1 34  ? -34.475 10.491  5.547   1.00 31.39 ? 23   LYS B HZ1  1 
ATOM   8005  H HZ2  . LYS B 1 34  ? -33.775 10.574  4.281   1.00 31.39 ? 23   LYS B HZ2  1 
ATOM   8006  H HZ3  . LYS B 1 34  ? -33.687 11.665  5.230   1.00 31.39 ? 23   LYS B HZ3  1 
ATOM   8007  N N    . ILE B 1 35  ? -39.726 14.596  2.250   1.00 16.45 ? 24   ILE B N    1 
ATOM   8008  C CA   . ILE B 1 35  ? -39.996 15.740  3.099   1.00 15.21 ? 24   ILE B CA   1 
ATOM   8009  C C    . ILE B 1 35  ? -39.497 15.424  4.492   1.00 14.72 ? 24   ILE B C    1 
ATOM   8010  O O    . ILE B 1 35  ? -39.831 14.377  5.066   1.00 16.47 ? 24   ILE B O    1 
ATOM   8011  C CB   . ILE B 1 35  ? -41.491 16.069  3.102   1.00 16.15 ? 24   ILE B CB   1 
ATOM   8012  C CG1  . ILE B 1 35  ? -41.931 16.531  1.703   1.00 19.50 ? 24   ILE B CG1  1 
ATOM   8013  C CG2  . ILE B 1 35  ? -41.791 17.135  4.145   1.00 18.23 ? 24   ILE B CG2  1 
ATOM   8014  C CD1  . ILE B 1 35  ? -43.413 16.704  1.537   1.00 24.27 ? 24   ILE B CD1  1 
ATOM   8015  H H    . ILE B 1 35  ? -40.431 14.181  1.983   1.00 19.74 ? 24   ILE B H    1 
ATOM   8016  H HA   . ILE B 1 35  ? -39.513 16.512  2.766   1.00 18.25 ? 24   ILE B HA   1 
ATOM   8017  H HB   . ILE B 1 35  ? -41.984 15.265  3.331   1.00 19.38 ? 24   ILE B HB   1 
ATOM   8018  H HG12 . ILE B 1 35  ? -41.512 17.385  1.513   1.00 23.39 ? 24   ILE B HG12 1 
ATOM   8019  H HG13 . ILE B 1 35  ? -41.637 15.873  1.053   1.00 23.39 ? 24   ILE B HG13 1 
ATOM   8020  H HG21 . ILE B 1 35  ? -42.741 17.330  4.133   1.00 21.88 ? 24   ILE B HG21 1 
ATOM   8021  H HG22 . ILE B 1 35  ? -41.532 16.802  5.019   1.00 21.88 ? 24   ILE B HG22 1 
ATOM   8022  H HG23 . ILE B 1 35  ? -41.285 17.935  3.932   1.00 21.88 ? 24   ILE B HG23 1 
ATOM   8023  H HD11 . ILE B 1 35  ? -43.597 16.996  0.630   1.00 29.12 ? 24   ILE B HD11 1 
ATOM   8024  H HD12 . ILE B 1 35  ? -43.851 15.856  1.708   1.00 29.12 ? 24   ILE B HD12 1 
ATOM   8025  H HD13 . ILE B 1 35  ? -43.725 17.371  2.169   1.00 29.12 ? 24   ILE B HD13 1 
ATOM   8026  N N    . VAL B 1 36  ? -38.730 16.340  5.051   1.00 14.34 ? 25   VAL B N    1 
ATOM   8027  C CA   . VAL B 1 36  ? -38.196 16.219  6.397   1.00 13.91 ? 25   VAL B CA   1 
ATOM   8028  C C    . VAL B 1 36  ? -38.648 17.446  7.180   1.00 12.54 ? 25   VAL B C    1 
ATOM   8029  O O    . VAL B 1 36  ? -38.111 18.543  7.020   1.00 13.45 ? 25   VAL B O    1 
ATOM   8030  C CB   . VAL B 1 36  ? -36.668 16.119  6.364   1.00 14.15 ? 25   VAL B CB   1 
ATOM   8031  C CG1  . VAL B 1 36  ? -36.079 16.024  7.770   1.00 15.44 ? 25   VAL B CG1  1 
ATOM   8032  C CG2  . VAL B 1 36  ? -36.195 14.941  5.537   1.00 17.00 ? 25   VAL B CG2  1 
ATOM   8033  H H    . VAL B 1 36  ? -38.495 17.068  4.657   1.00 17.21 ? 25   VAL B H    1 
ATOM   8034  H HA   . VAL B 1 36  ? -38.554 15.424  6.823   1.00 16.69 ? 25   VAL B HA   1 
ATOM   8035  H HB   . VAL B 1 36  ? -36.316 16.924  5.954   1.00 16.98 ? 25   VAL B HB   1 
ATOM   8036  H HG11 . VAL B 1 36  ? -35.113 15.962  7.704   1.00 18.53 ? 25   VAL B HG11 1 
ATOM   8037  H HG12 . VAL B 1 36  ? -36.327 16.817  8.271   1.00 18.53 ? 25   VAL B HG12 1 
ATOM   8038  H HG13 . VAL B 1 36  ? -36.432 15.233  8.207   1.00 18.53 ? 25   VAL B HG13 1 
ATOM   8039  H HG21 . VAL B 1 36  ? -35.225 14.919  5.545   1.00 20.40 ? 25   VAL B HG21 1 
ATOM   8040  H HG22 . VAL B 1 36  ? -36.548 14.123  5.921   1.00 20.40 ? 25   VAL B HG22 1 
ATOM   8041  H HG23 . VAL B 1 36  ? -36.516 15.045  4.627   1.00 20.40 ? 25   VAL B HG23 1 
ATOM   8042  N N    . ASN B 1 37  ? -39.668 17.262  8.013   1.00 13.24 ? 26   ASN B N    1 
ATOM   8043  C CA   . ASN B 1 37  ? -40.108 18.291  8.954   1.00 12.67 ? 26   ASN B CA   1 
ATOM   8044  C C    . ASN B 1 37  ? -39.502 17.979  10.313  1.00 11.94 ? 26   ASN B C    1 
ATOM   8045  O O    . ASN B 1 37  ? -38.786 16.989  10.490  1.00 14.02 ? 26   ASN B O    1 
ATOM   8046  C CB   . ASN B 1 37  ? -41.626 18.369  8.977   1.00 13.68 ? 26   ASN B CB   1 
ATOM   8047  C CG   . ASN B 1 37  ? -42.168 19.160  7.801   1.00 14.14 ? 26   ASN B CG   1 
ATOM   8048  O OD1  . ASN B 1 37  ? -41.558 20.121  7.347   1.00 13.83 ? 26   ASN B OD1  1 
ATOM   8049  N ND2  . ASN B 1 37  ? -43.323 18.746  7.302   1.00 14.52 ? 26   ASN B ND2  1 
ATOM   8050  H H    . ASN B 1 37  ? -40.130 16.537  8.054   1.00 15.89 ? 26   ASN B H    1 
ATOM   8051  H HA   . ASN B 1 37  ? -39.767 19.152  8.664   1.00 15.21 ? 26   ASN B HA   1 
ATOM   8052  H HB2  . ASN B 1 37  ? -41.993 17.472  8.933   1.00 16.42 ? 26   ASN B HB2  1 
ATOM   8053  H HB3  . ASN B 1 37  ? -41.911 18.807  9.794   1.00 16.42 ? 26   ASN B HB3  1 
ATOM   8054  H HD21 . ASN B 1 37  ? -43.676 19.158  6.635   1.00 17.42 ? 26   ASN B HD21 1 
ATOM   8055  H HD22 . ASN B 1 37  ? -43.720 18.065  7.646   1.00 17.42 ? 26   ASN B HD22 1 
ATOM   8056  N N    . ASP B 1 38  ? -39.823 18.807  11.310  1.00 12.38 ? 27   ASP B N    1 
ATOM   8057  C CA   . ASP B 1 38  ? -39.254 18.529  12.624  1.00 12.46 ? 27   ASP B CA   1 
ATOM   8058  C C    . ASP B 1 38  ? -39.932 17.359  13.314  1.00 12.20 ? 27   ASP B C    1 
ATOM   8059  O O    . ASP B 1 38  ? -39.308 16.732  14.191  1.00 14.02 ? 27   ASP B O    1 
ATOM   8060  C CB   . ASP B 1 38  ? -39.234 19.784  13.526  1.00 13.04 ? 27   ASP B CB   1 
ATOM   8061  C CG   . ASP B 1 38  ? -40.573 20.134  14.100  1.00 14.45 ? 27   ASP B CG   1 
ATOM   8062  O OD1  . ASP B 1 38  ? -41.540 20.248  13.328  1.00 14.00 ? 27   ASP B OD1  1 
ATOM   8063  O OD2  . ASP B 1 38  ? -40.608 20.289  15.333  1.00 19.15 ? 27   ASP B OD2  1 
ATOM   8064  H H    . ASP B 1 38  ? -40.337 19.495  11.258  1.00 14.86 ? 27   ASP B H    1 
ATOM   8065  H HA   . ASP B 1 38  ? -38.328 18.271  12.491  1.00 14.95 ? 27   ASP B HA   1 
ATOM   8066  H HB2  . ASP B 1 38  ? -38.626 19.629  14.266  1.00 15.64 ? 27   ASP B HB2  1 
ATOM   8067  H HB3  . ASP B 1 38  ? -38.929 20.541  13.002  1.00 15.64 ? 27   ASP B HB3  1 
ATOM   8068  N N    . ASP B 1 39  ? -41.146 16.999  12.895  1.00 12.31 ? 28   ASP B N    1 
ATOM   8069  C CA   . ASP B 1 39  ? -41.905 15.943  13.537  1.00 11.14 ? 28   ASP B CA   1 
ATOM   8070  C C    . ASP B 1 39  ? -41.826 14.570  12.883  1.00 13.37 ? 28   ASP B C    1 
ATOM   8071  O O    . ASP B 1 39  ? -42.169 13.569  13.550  1.00 14.33 ? 28   ASP B O    1 
ATOM   8072  C CB   . ASP B 1 39  ? -43.375 16.329  13.679  1.00 13.04 ? 28   ASP B CB   1 
ATOM   8073  C CG   . ASP B 1 39  ? -44.087 16.588  12.346  1.00 14.29 ? 28   ASP B CG   1 
ATOM   8074  O OD1  . ASP B 1 39  ? -43.484 17.162  11.444  1.00 13.61 ? 28   ASP B OD1  1 
ATOM   8075  O OD2  . ASP B 1 39  ? -45.305 16.254  12.224  1.00 13.97 ? 28   ASP B OD2  1 
ATOM   8076  H H    . ASP B 1 39  ? -41.552 17.362  12.229  1.00 14.78 ? 28   ASP B H    1 
ATOM   8077  H HA   . ASP B 1 39  ? -41.556 15.840  14.436  1.00 13.37 ? 28   ASP B HA   1 
ATOM   8078  H HB2  . ASP B 1 39  ? -43.844 15.609  14.130  1.00 15.65 ? 28   ASP B HB2  1 
ATOM   8079  H HB3  . ASP B 1 39  ? -43.434 17.140  14.208  1.00 15.65 ? 28   ASP B HB3  1 
ATOM   8080  N N    A GLN B 1 40  ? -41.521 14.506  11.595  0.76 14.14 ? 29   GLN B N    1 
ATOM   8081  N N    B GLN B 1 40  ? -41.453 14.506  11.608  0.24 13.13 ? 29   GLN B N    1 
ATOM   8082  C CA   A GLN B 1 40  ? -41.451 13.248  10.863  0.76 15.14 ? 29   GLN B CA   1 
ATOM   8083  C CA   B GLN B 1 40  ? -41.551 13.294  10.807  0.24 15.37 ? 29   GLN B CA   1 
ATOM   8084  C C    A GLN B 1 40  ? -40.873 13.552  9.489   0.76 14.82 ? 29   GLN B C    1 
ATOM   8085  C C    B GLN B 1 40  ? -40.921 13.566  9.450   0.24 15.26 ? 29   GLN B C    1 
ATOM   8086  O O    A GLN B 1 40  ? -40.799 14.712  9.072   0.76 14.23 ? 29   GLN B O    1 
ATOM   8087  O O    B GLN B 1 40  ? -40.842 14.718  9.007   0.24 15.66 ? 29   GLN B O    1 
ATOM   8088  C CB   A GLN B 1 40  ? -42.843 12.650  10.665  0.76 15.77 ? 29   GLN B CB   1 
ATOM   8089  C CB   B GLN B 1 40  ? -43.010 12.887  10.597  0.24 20.25 ? 29   GLN B CB   1 
ATOM   8090  C CG   A GLN B 1 40  ? -43.809 13.595  9.923   0.76 16.43 ? 29   GLN B CG   1 
ATOM   8091  C CG   B GLN B 1 40  ? -43.162 11.647  9.732   0.24 23.61 ? 29   GLN B CG   1 
ATOM   8092  C CD   A GLN B 1 40  ? -45.189 13.051  9.715   0.76 21.88 ? 29   GLN B CD   1 
ATOM   8093  C CD   B GLN B 1 40  ? -44.551 11.421  9.180   0.24 20.27 ? 29   GLN B CD   1 
ATOM   8094  O OE1  A GLN B 1 40  ? -45.381 11.858  9.472   0.76 28.18 ? 29   GLN B OE1  1 
ATOM   8095  O OE1  B GLN B 1 40  ? -44.751 10.457  8.448   0.24 22.95 ? 29   GLN B OE1  1 
ATOM   8096  N NE2  A GLN B 1 40  ? -46.181 13.921  9.870   0.76 29.49 ? 29   GLN B NE2  1 
ATOM   8097  N NE2  B GLN B 1 40  ? -45.499 12.322  9.476   0.24 21.74 ? 29   GLN B NE2  1 
ATOM   8098  H H    A GLN B 1 40  ? -41.345 15.194  11.110  0.76 16.97 ? 29   GLN B H    1 
ATOM   8099  H H    B GLN B 1 40  ? -41.129 15.174  11.174  0.24 15.75 ? 29   GLN B H    1 
ATOM   8100  H HA   A GLN B 1 40  ? -40.883 12.612  11.324  0.76 18.16 ? 29   GLN B HA   1 
ATOM   8101  H HA   B GLN B 1 40  ? -41.076 12.568  11.240  0.24 18.44 ? 29   GLN B HA   1 
ATOM   8102  H HB2  A GLN B 1 40  ? -42.764 11.835  10.144  0.76 18.92 ? 29   GLN B HB2  1 
ATOM   8103  H HB2  B GLN B 1 40  ? -43.413 12.702  11.460  0.24 24.29 ? 29   GLN B HB2  1 
ATOM   8104  H HB3  A GLN B 1 40  ? -43.227 12.452  11.533  0.76 18.92 ? 29   GLN B HB3  1 
ATOM   8105  H HB3  B GLN B 1 40  ? -43.481 13.615  10.162  0.24 24.29 ? 29   GLN B HB3  1 
ATOM   8106  H HG2  A GLN B 1 40  ? -43.891 14.415  10.434  0.76 19.72 ? 29   GLN B HG2  1 
ATOM   8107  H HG2  B GLN B 1 40  ? -42.556 11.720  8.978   0.24 28.33 ? 29   GLN B HG2  1 
ATOM   8108  H HG3  A GLN B 1 40  ? -43.437 13.793  9.049   0.76 19.72 ? 29   GLN B HG3  1 
ATOM   8109  H HG3  B GLN B 1 40  ? -42.928 10.870  10.263  0.24 28.33 ? 29   GLN B HG3  1 
ATOM   8110  H HE21 A GLN B 1 40  ? -46.008 14.737  10.076  0.76 35.39 ? 29   GLN B HE21 1 
ATOM   8111  H HE21 B GLN B 1 40  ? -45.308 13.002  9.966   0.24 26.09 ? 29   GLN B HE21 1 
ATOM   8112  H HE22 A GLN B 1 40  ? -46.996 13.667  9.763   0.76 35.39 ? 29   GLN B HE22 1 
ATOM   8113  H HE22 B GLN B 1 40  ? -46.298 12.220  9.176   0.24 26.09 ? 29   GLN B HE22 1 
ATOM   8114  N N    . SER B 1 41  ? -40.493 12.485  8.789   1.00 14.80 ? 30   SER B N    1 
ATOM   8115  C CA   . SER B 1 41  ? -40.104 12.509  7.392   1.00 15.99 ? 30   SER B CA   1 
ATOM   8116  C C    . SER B 1 41  ? -41.065 11.616  6.606   1.00 17.66 ? 30   SER B C    1 
ATOM   8117  O O    . SER B 1 41  ? -41.504 10.578  7.108   1.00 20.52 ? 30   SER B O    1 
ATOM   8118  C CB   . SER B 1 41  ? -38.680 11.989  7.236   1.00 16.98 ? 30   SER B CB   1 
ATOM   8119  O OG   . SER B 1 41  ? -37.785 12.824  7.972   1.00 16.41 ? 30   SER B OG   1 
ATOM   8120  H H    A SER B 1 41  ? -40.453 11.695  9.128   0.76 17.76 ? 30   SER B H    1 
ATOM   8121  H H    B SER B 1 41  ? -40.420 11.706  9.147   0.24 17.76 ? 30   SER B H    1 
ATOM   8122  H HA   . SER B 1 41  ? -40.153 13.414  7.046   1.00 19.18 ? 30   SER B HA   1 
ATOM   8123  H HB2  . SER B 1 41  ? -38.631 11.083  7.581   1.00 20.37 ? 30   SER B HB2  1 
ATOM   8124  H HB3  . SER B 1 41  ? -38.435 12.004  6.298   1.00 20.37 ? 30   SER B HB3  1 
ATOM   8125  H HG   . SER B 1 41  ? -37.825 13.612  7.684   1.00 19.69 ? 30   SER B HG   1 
ATOM   8126  N N    . PHE B 1 42  ? -41.336 11.962  5.348   1.00 17.90 ? 31   PHE B N    1 
ATOM   8127  C CA   . PHE B 1 42  ? -42.216 11.148  4.511   1.00 19.23 ? 31   PHE B CA   1 
ATOM   8128  C C    . PHE B 1 42  ? -42.021 11.525  3.059   1.00 18.51 ? 31   PHE B C    1 
ATOM   8129  O O    . PHE B 1 42  ? -41.582 12.622  2.754   1.00 18.42 ? 31   PHE B O    1 
ATOM   8130  C CB   . PHE B 1 42  ? -43.683 11.304  4.876   1.00 17.52 ? 31   PHE B CB   1 
ATOM   8131  C CG   . PHE B 1 42  ? -44.191 12.710  4.785   1.00 18.73 ? 31   PHE B CG   1 
ATOM   8132  C CD1  . PHE B 1 42  ? -44.038 13.584  5.830   1.00 19.93 ? 31   PHE B CD1  1 
ATOM   8133  C CD2  . PHE B 1 42  ? -44.887 13.134  3.661   1.00 20.39 ? 31   PHE B CD2  1 
ATOM   8134  C CE1  . PHE B 1 42  ? -44.534 14.874  5.740   1.00 20.62 ? 31   PHE B CE1  1 
ATOM   8135  C CE2  . PHE B 1 42  ? -45.382 14.424  3.579   1.00 23.56 ? 31   PHE B CE2  1 
ATOM   8136  C CZ   . PHE B 1 42  ? -45.178 15.305  4.605   1.00 20.61 ? 31   PHE B CZ   1 
ATOM   8137  H H    . PHE B 1 42  ? -41.023 12.661  4.956   1.00 21.48 ? 31   PHE B H    1 
ATOM   8138  H HA   . PHE B 1 42  ? -41.977 10.213  4.615   1.00 23.07 ? 31   PHE B HA   1 
ATOM   8139  H HB2  . PHE B 1 42  ? -44.213 10.759  4.274   1.00 21.03 ? 31   PHE B HB2  1 
ATOM   8140  H HB3  . PHE B 1 42  ? -43.811 11.003  5.789   1.00 21.03 ? 31   PHE B HB3  1 
ATOM   8141  H HD1  . PHE B 1 42  ? -43.581 13.316  6.595   1.00 23.91 ? 31   PHE B HD1  1 
ATOM   8142  H HD2  . PHE B 1 42  ? -45.008 12.549  2.948   1.00 24.47 ? 31   PHE B HD2  1 
ATOM   8143  H HE1  . PHE B 1 42  ? -44.403 15.466  6.446   1.00 24.75 ? 31   PHE B HE1  1 
ATOM   8144  H HE2  . PHE B 1 42  ? -45.826 14.703  2.810   1.00 28.27 ? 31   PHE B HE2  1 
ATOM   8145  H HZ   . PHE B 1 42  ? -45.521 16.168  4.558   1.00 24.73 ? 31   PHE B HZ   1 
ATOM   8146  N N    . TYR B 1 43  ? -42.341 10.605  2.161   1.00 20.44 ? 32   TYR B N    1 
ATOM   8147  C CA   . TYR B 1 43  ? -42.154 10.830  0.726   1.00 20.61 ? 32   TYR B CA   1 
ATOM   8148  C C    . TYR B 1 43  ? -43.410 11.433  0.123   1.00 21.72 ? 32   TYR B C    1 
ATOM   8149  O O    . TYR B 1 43  ? -44.510 10.914  0.311   1.00 24.24 ? 32   TYR B O    1 
ATOM   8150  C CB   . TYR B 1 43  ? -41.805 9.528   0.015   1.00 23.42 ? 32   TYR B CB   1 
ATOM   8151  C CG   . TYR B 1 43  ? -40.461 9.028   0.415   1.00 25.27 ? 32   TYR B CG   1 
ATOM   8152  C CD1  . TYR B 1 43  ? -39.314 9.410   -0.269  1.00 26.17 ? 32   TYR B CD1  1 
ATOM   8153  C CD2  . TYR B 1 43  ? -40.321 8.218   1.538   1.00 29.31 ? 32   TYR B CD2  1 
ATOM   8154  C CE1  . TYR B 1 43  ? -38.084 8.959   0.103   1.00 25.63 ? 32   TYR B CE1  1 
ATOM   8155  C CE2  . TYR B 1 43  ? -39.071 7.777   1.946   1.00 30.63 ? 32   TYR B CE2  1 
ATOM   8156  C CZ   . TYR B 1 43  ? -37.955 8.149   1.211   1.00 30.00 ? 32   TYR B CZ   1 
ATOM   8157  O OH   . TYR B 1 43  ? -36.694 7.721   1.580   1.00 32.04 ? 32   TYR B OH   1 
ATOM   8158  H H    . TYR B 1 43  ? -42.672 9.835   2.354   1.00 24.53 ? 32   TYR B H    1 
ATOM   8159  H HA   . TYR B 1 43  ? -41.424 11.453  0.593   1.00 24.74 ? 32   TYR B HA   1 
ATOM   8160  H HB2  . TYR B 1 43  ? -42.461 8.851   0.246   1.00 28.11 ? 32   TYR B HB2  1 
ATOM   8161  H HB3  . TYR B 1 43  ? -41.801 9.678   -0.943  1.00 28.11 ? 32   TYR B HB3  1 
ATOM   8162  H HD1  . TYR B 1 43  ? -39.392 9.950   -1.022  1.00 31.41 ? 32   TYR B HD1  1 
ATOM   8163  H HD2  . TYR B 1 43  ? -41.075 7.970   2.022   1.00 35.17 ? 32   TYR B HD2  1 
ATOM   8164  H HE1  . TYR B 1 43  ? -37.329 9.216   -0.376  1.00 30.76 ? 32   TYR B HE1  1 
ATOM   8165  H HE2  . TYR B 1 43  ? -38.985 7.221   2.687   1.00 36.76 ? 32   TYR B HE2  1 
ATOM   8166  H HH   . TYR B 1 43  ? -36.744 7.237   2.265   1.00 38.45 ? 32   TYR B HH   1 
ATOM   8167  N N    . ALA B 1 44  ? -43.247 12.545  -0.589  1.00 21.58 ? 33   ALA B N    1 
ATOM   8168  C CA   . ALA B 1 44  ? -44.369 13.189  -1.262  1.00 23.44 ? 33   ALA B CA   1 
ATOM   8169  C C    . ALA B 1 44  ? -43.828 14.213  -2.232  1.00 22.08 ? 33   ALA B C    1 
ATOM   8170  O O    . ALA B 1 44  ? -42.707 14.713  -2.074  1.00 23.72 ? 33   ALA B O    1 
ATOM   8171  C CB   . ALA B 1 44  ? -45.298 13.880  -0.270  1.00 23.98 ? 33   ALA B CB   1 
ATOM   8172  H H    . ALA B 1 44  ? -42.494 12.946  -0.699  1.00 25.90 ? 33   ALA B H    1 
ATOM   8173  H HA   . ALA B 1 44  ? -44.878 12.528  -1.757  1.00 28.13 ? 33   ALA B HA   1 
ATOM   8174  H HB1  . ALA B 1 44  ? -46.027 14.294  -0.757  1.00 28.78 ? 33   ALA B HB1  1 
ATOM   8175  H HB2  . ALA B 1 44  ? -45.645 13.219  0.349   1.00 28.78 ? 33   ALA B HB2  1 
ATOM   8176  H HB3  . ALA B 1 44  ? -44.797 14.556  0.213   1.00 28.78 ? 33   ALA B HB3  1 
ATOM   8177  N N    . ASP B 1 45  ? -44.646 14.514  -3.240  1.00 21.86 ? 34   ASP B N    1 
ATOM   8178  C CA   . ASP B 1 45  ? -44.406 15.641  -4.129  1.00 23.82 ? 34   ASP B CA   1 
ATOM   8179  C C    . ASP B 1 45  ? -44.926 16.930  -3.483  1.00 21.96 ? 34   ASP B C    1 
ATOM   8180  O O    . ASP B 1 45  ? -45.820 16.912  -2.638  1.00 22.67 ? 34   ASP B O    1 
ATOM   8181  C CB   . ASP B 1 45  ? -45.135 15.429  -5.476  1.00 26.66 ? 34   ASP B CB   1 
ATOM   8182  C CG   . ASP B 1 45  ? -44.648 14.233  -6.244  1.00 29.15 ? 34   ASP B CG   1 
ATOM   8183  O OD1  . ASP B 1 45  ? -43.593 13.646  -5.927  1.00 28.26 ? 34   ASP B OD1  1 
ATOM   8184  O OD2  . ASP B 1 45  ? -45.371 13.868  -7.193  1.00 33.31 ? 34   ASP B OD2  1 
ATOM   8185  H H    . ASP B 1 45  ? -45.358 14.070  -3.429  1.00 26.24 ? 34   ASP B H    1 
ATOM   8186  H HA   . ASP B 1 45  ? -43.455 15.733  -4.297  1.00 28.58 ? 34   ASP B HA   1 
ATOM   8187  H HB2  . ASP B 1 45  ? -46.082 15.305  -5.303  1.00 32.00 ? 34   ASP B HB2  1 
ATOM   8188  H HB3  . ASP B 1 45  ? -45.002 16.213  -6.031  1.00 32.00 ? 34   ASP B HB3  1 
ATOM   8189  N N    . ILE B 1 46  ? -44.366 18.058  -3.910  1.00 21.42 ? 35   ILE B N    1 
ATOM   8190  C CA   . ILE B 1 46  ? -44.704 19.369  -3.362  1.00 19.70 ? 35   ILE B CA   1 
ATOM   8191  C C    . ILE B 1 46  ? -44.987 20.314  -4.515  1.00 22.16 ? 35   ILE B C    1 
ATOM   8192  O O    . ILE B 1 46  ? -44.111 20.547  -5.352  1.00 22.23 ? 35   ILE B O    1 
ATOM   8193  C CB   . ILE B 1 46  ? -43.553 19.960  -2.540  1.00 19.50 ? 35   ILE B CB   1 
ATOM   8194  C CG1  . ILE B 1 46  ? -43.068 19.003  -1.466  1.00 19.76 ? 35   ILE B CG1  1 
ATOM   8195  C CG2  . ILE B 1 46  ? -44.010 21.268  -1.897  1.00 19.45 ? 35   ILE B CG2  1 
ATOM   8196  C CD1  . ILE B 1 46  ? -41.667 19.360  -0.962  1.00 21.08 ? 35   ILE B CD1  1 
ATOM   8197  H H    . ILE B 1 46  ? -43.773 18.090  -4.532  1.00 25.71 ? 35   ILE B H    1 
ATOM   8198  H HA   . ILE B 1 46  ? -45.494 19.304  -2.802  1.00 23.64 ? 35   ILE B HA   1 
ATOM   8199  H HB   . ILE B 1 46  ? -42.814 20.152  -3.138  1.00 23.40 ? 35   ILE B HB   1 
ATOM   8200  H HG12 . ILE B 1 46  ? -43.677 19.036  -0.712  1.00 23.71 ? 35   ILE B HG12 1 
ATOM   8201  H HG13 . ILE B 1 46  ? -43.037 18.105  -1.832  1.00 23.71 ? 35   ILE B HG13 1 
ATOM   8202  H HG21 . ILE B 1 46  ? -43.277 21.637  -1.378  1.00 23.34 ? 35   ILE B HG21 1 
ATOM   8203  H HG22 . ILE B 1 46  ? -44.267 21.890  -2.595  1.00 23.34 ? 35   ILE B HG22 1 
ATOM   8204  H HG23 . ILE B 1 46  ? -44.767 21.088  -1.318  1.00 23.34 ? 35   ILE B HG23 1 
ATOM   8205  H HD11 . ILE B 1 46  ? -41.405 18.721  -0.280  1.00 25.30 ? 35   ILE B HD11 1 
ATOM   8206  H HD12 . ILE B 1 46  ? -41.046 19.325  -1.705  1.00 25.30 ? 35   ILE B HD12 1 
ATOM   8207  H HD13 . ILE B 1 46  ? -41.686 20.255  -0.587  1.00 25.30 ? 35   ILE B HD13 1 
ATOM   8208  N N    . TYR B 1 47  ? -46.163 20.930  -4.507  1.00 21.97 ? 36   TYR B N    1 
ATOM   8209  C CA   . TYR B 1 47  ? -46.529 21.919  -5.521  1.00 22.31 ? 36   TYR B CA   1 
ATOM   8210  C C    . TYR B 1 47  ? -46.709 23.282  -4.871  1.00 23.28 ? 36   TYR B C    1 
ATOM   8211  O O    . TYR B 1 47  ? -47.407 23.407  -3.862  1.00 22.18 ? 36   TYR B O    1 
ATOM   8212  C CB   . TYR B 1 47  ? -47.834 21.509  -6.231  1.00 24.28 ? 36   TYR B CB   1 
ATOM   8213  C CG   . TYR B 1 47  ? -48.324 22.526  -7.225  1.00 26.24 ? 36   TYR B CG   1 
ATOM   8214  C CD1  . TYR B 1 47  ? -47.519 22.914  -8.292  1.00 27.88 ? 36   TYR B CD1  1 
ATOM   8215  C CD2  . TYR B 1 47  ? -49.565 23.121  -7.082  1.00 30.99 ? 36   TYR B CD2  1 
ATOM   8216  C CE1  . TYR B 1 47  ? -47.941 23.864  -9.188  1.00 32.51 ? 36   TYR B CE1  1 
ATOM   8217  C CE2  . TYR B 1 47  ? -50.005 24.079  -7.982  1.00 35.00 ? 36   TYR B CE2  1 
ATOM   8218  C CZ   . TYR B 1 47  ? -49.185 24.442  -9.034  1.00 36.31 ? 36   TYR B CZ   1 
ATOM   8219  O OH   . TYR B 1 47  ? -49.576 25.395  -9.952  1.00 44.43 ? 36   TYR B OH   1 
ATOM   8220  H H    . TYR B 1 47  ? -46.776 20.793  -3.919  1.00 26.36 ? 36   TYR B H    1 
ATOM   8221  H HA   . TYR B 1 47  ? -45.823 21.982  -6.183  1.00 26.77 ? 36   TYR B HA   1 
ATOM   8222  H HB2  . TYR B 1 47  ? -47.684 20.677  -6.707  1.00 29.13 ? 36   TYR B HB2  1 
ATOM   8223  H HB3  . TYR B 1 47  ? -48.528 21.386  -5.565  1.00 29.13 ? 36   TYR B HB3  1 
ATOM   8224  H HD1  . TYR B 1 47  ? -46.678 22.530  -8.395  1.00 33.46 ? 36   TYR B HD1  1 
ATOM   8225  H HD2  . TYR B 1 47  ? -50.111 22.876  -6.370  1.00 37.19 ? 36   TYR B HD2  1 
ATOM   8226  H HE1  . TYR B 1 47  ? -47.394 24.112  -9.898  1.00 39.01 ? 36   TYR B HE1  1 
ATOM   8227  H HE2  . TYR B 1 47  ? -50.841 24.471  -7.879  1.00 42.00 ? 36   TYR B HE2  1 
ATOM   8228  H HH   . TYR B 1 47  ? -50.344 25.677  -9.763  1.00 53.32 ? 36   TYR B HH   1 
ATOM   8229  N N    A MET B 1 48  ? -46.120 24.291  -5.502  0.67 21.86 ? 37   MET B N    1 
ATOM   8230  N N    B MET B 1 48  ? -46.071 24.310  -5.437  0.33 21.15 ? 37   MET B N    1 
ATOM   8231  C CA   A MET B 1 48  ? -46.080 25.649  -4.995  0.67 20.72 ? 37   MET B CA   1 
ATOM   8232  C CA   B MET B 1 48  ? -46.108 25.655  -4.868  0.33 17.98 ? 37   MET B CA   1 
ATOM   8233  C C    A MET B 1 48  ? -46.607 26.621  -6.044  0.67 23.12 ? 37   MET B C    1 
ATOM   8234  C C    B MET B 1 48  ? -46.418 26.689  -5.946  0.33 17.61 ? 37   MET B C    1 
ATOM   8235  O O    A MET B 1 48  ? -46.511 26.386  -7.257  0.67 21.77 ? 37   MET B O    1 
ATOM   8236  O O    B MET B 1 48  ? -45.967 26.565  -7.088  0.33 19.36 ? 37   MET B O    1 
ATOM   8237  C CB   A MET B 1 48  ? -44.647 26.028  -4.631  0.67 19.77 ? 37   MET B CB   1 
ATOM   8238  C CB   B MET B 1 48  ? -44.779 26.012  -4.187  0.33 18.62 ? 37   MET B CB   1 
ATOM   8239  C CG   A MET B 1 48  ? -44.173 25.258  -3.429  0.67 18.48 ? 37   MET B CG   1 
ATOM   8240  C CG   B MET B 1 48  ? -43.594 26.070  -5.111  0.33 20.29 ? 37   MET B CG   1 
ATOM   8241  S SD   A MET B 1 48  ? -42.373 25.093  -3.322  0.67 20.60 ? 37   MET B SD   1 
ATOM   8242  S SD   B MET B 1 48  ? -42.093 25.641  -4.219  0.33 21.53 ? 37   MET B SD   1 
ATOM   8243  C CE   A MET B 1 48  ? -42.101 23.909  -4.648  0.67 22.92 ? 37   MET B CE   1 
ATOM   8244  C CE   B MET B 1 48  ? -42.213 23.846  -4.219  0.33 22.62 ? 37   MET B CE   1 
ATOM   8245  H H    A MET B 1 48  ? -45.722 24.204  -6.260  0.67 26.24 ? 37   MET B H    1 
ATOM   8246  H H    B MET B 1 48  ? -45.607 24.250  -6.158  0.33 25.38 ? 37   MET B H    1 
ATOM   8247  H HA   A MET B 1 48  ? -46.625 25.711  -4.195  0.67 24.86 ? 37   MET B HA   1 
ATOM   8248  H HA   B MET B 1 48  ? -46.804 25.689  -4.193  0.33 21.57 ? 37   MET B HA   1 
ATOM   8249  H HB2  A MET B 1 48  ? -44.061 25.822  -5.376  0.67 23.72 ? 37   MET B HB2  1 
ATOM   8250  H HB2  B MET B 1 48  ? -44.870 26.884  -3.771  0.33 22.35 ? 37   MET B HB2  1 
ATOM   8251  H HB3  A MET B 1 48  ? -44.608 26.974  -4.422  0.67 23.72 ? 37   MET B HB3  1 
ATOM   8252  H HB3  B MET B 1 48  ? -44.590 25.345  -3.509  0.33 22.35 ? 37   MET B HB3  1 
ATOM   8253  H HG2  A MET B 1 48  ? -44.477 25.712  -2.628  0.67 22.18 ? 37   MET B HG2  1 
ATOM   8254  H HG2  B MET B 1 48  ? -43.715 25.435  -5.835  0.33 24.34 ? 37   MET B HG2  1 
ATOM   8255  H HG3  A MET B 1 48  ? -44.550 24.364  -3.463  0.67 22.18 ? 37   MET B HG3  1 
ATOM   8256  H HG3  B MET B 1 48  ? -43.499 26.970  -5.461  0.33 24.34 ? 37   MET B HG3  1 
ATOM   8257  H HE1  A MET B 1 48  ? -41.152 23.719  -4.711  0.67 27.51 ? 37   MET B HE1  1 
ATOM   8258  H HE1  B MET B 1 48  ? -41.444 23.478  -3.756  0.33 27.14 ? 37   MET B HE1  1 
ATOM   8259  H HE2  A MET B 1 48  ? -42.589 23.095  -4.449  0.67 27.51 ? 37   MET B HE2  1 
ATOM   8260  H HE2  B MET B 1 48  ? -43.029 23.584  -3.765  0.33 27.14 ? 37   MET B HE2  1 
ATOM   8261  H HE3  A MET B 1 48  ? -42.419 24.291  -5.482  0.67 27.51 ? 37   MET B HE3  1 
ATOM   8262  H HE3  B MET B 1 48  ? -42.229 23.531  -5.137  0.33 27.14 ? 37   MET B HE3  1 
ATOM   8263  N N    . GLU B 1 49  ? -47.174 27.724  -5.561  1.00 22.80 ? 38   GLU B N    1 
ATOM   8264  C CA   . GLU B 1 49  ? -47.606 28.803  -6.430  1.00 24.94 ? 38   GLU B CA   1 
ATOM   8265  C C    . GLU B 1 49  ? -47.747 30.046  -5.569  1.00 25.20 ? 38   GLU B C    1 
ATOM   8266  O O    . GLU B 1 49  ? -48.148 29.958  -4.408  1.00 24.17 ? 38   GLU B O    1 
ATOM   8267  C CB   . GLU B 1 49  ? -48.971 28.469  -7.048  1.00 29.55 ? 38   GLU B CB   1 
ATOM   8268  C CG   . GLU B 1 49  ? -49.515 29.458  -8.045  1.00 38.39 ? 38   GLU B CG   1 
ATOM   8269  C CD   . GLU B 1 49  ? -50.776 28.943  -8.738  1.00 43.31 ? 38   GLU B CD   1 
ATOM   8270  O OE1  . GLU B 1 49  ? -51.417 28.000  -8.206  1.00 47.71 ? 38   GLU B OE1  1 
ATOM   8271  O OE2  . GLU B 1 49  ? -51.111 29.485  -9.828  1.00 45.87 ? 38   GLU B OE2  1 
ATOM   8272  H H    A GLU B 1 49  ? -47.319 27.868  -4.725  0.67 27.36 ? 38   GLU B H    1 
ATOM   8273  H H    B GLU B 1 49  ? -47.458 27.817  -4.754  0.33 27.36 ? 38   GLU B H    1 
ATOM   8274  H HA   . GLU B 1 49  ? -46.957 28.961  -7.133  1.00 29.93 ? 38   GLU B HA   1 
ATOM   8275  H HB2  . GLU B 1 49  ? -48.899 27.614  -7.501  1.00 35.46 ? 38   GLU B HB2  1 
ATOM   8276  H HB3  . GLU B 1 49  ? -49.620 28.398  -6.331  1.00 35.46 ? 38   GLU B HB3  1 
ATOM   8277  H HG2  . GLU B 1 49  ? -49.738 30.282  -7.586  1.00 46.06 ? 38   GLU B HG2  1 
ATOM   8278  H HG3  . GLU B 1 49  ? -48.844 29.625  -8.725  1.00 46.06 ? 38   GLU B HG3  1 
ATOM   8279  N N    . ASP B 1 50  ? -47.389 31.194  -6.127  1.00 25.26 ? 39   ASP B N    1 
ATOM   8280  C CA   . ASP B 1 50  ? -47.606 32.479  -5.463  1.00 26.71 ? 39   ASP B CA   1 
ATOM   8281  C C    . ASP B 1 50  ? -46.959 32.525  -4.085  1.00 23.87 ? 39   ASP B C    1 
ATOM   8282  O O    . ASP B 1 50  ? -47.490 33.141  -3.155  1.00 27.64 ? 39   ASP B O    1 
ATOM   8283  C CB   . ASP B 1 50  ? -49.096 32.812  -5.380  1.00 32.20 ? 39   ASP B CB   1 
ATOM   8284  C CG   . ASP B 1 50  ? -49.702 32.999  -6.734  1.00 41.55 ? 39   ASP B CG   1 
ATOM   8285  O OD1  . ASP B 1 50  ? -48.956 33.480  -7.611  1.00 42.59 ? 39   ASP B OD1  1 
ATOM   8286  O OD2  . ASP B 1 50  ? -50.891 32.650  -6.933  1.00 48.47 ? 39   ASP B OD2  1 
ATOM   8287  H H    . ASP B 1 50  ? -47.014 31.260  -6.898  1.00 30.32 ? 39   ASP B H    1 
ATOM   8288  H HA   . ASP B 1 50  ? -47.188 33.170  -5.998  1.00 32.06 ? 39   ASP B HA   1 
ATOM   8289  H HB2  . ASP B 1 50  ? -49.561 32.085  -4.938  1.00 38.64 ? 39   ASP B HB2  1 
ATOM   8290  H HB3  . ASP B 1 50  ? -49.211 33.635  -4.880  1.00 38.64 ? 39   ASP B HB3  1 
ATOM   8291  N N    . GLY B 1 51  ? -45.806 31.863  -3.967  1.00 22.09 ? 40   GLY B N    1 
ATOM   8292  C CA   . GLY B 1 51  ? -45.003 31.860  -2.757  1.00 22.38 ? 40   GLY B CA   1 
ATOM   8293  C C    . GLY B 1 51  ? -45.479 30.935  -1.667  1.00 19.38 ? 40   GLY B C    1 
ATOM   8294  O O    . GLY B 1 51  ? -44.927 30.972  -0.567  1.00 18.26 ? 40   GLY B O    1 
ATOM   8295  H H    . GLY B 1 51  ? -45.462 31.395  -4.601  1.00 26.50 ? 40   GLY B H    1 
ATOM   8296  H HA2  . GLY B 1 51  ? -44.095 31.608  -2.985  1.00 26.86 ? 40   GLY B HA2  1 
ATOM   8297  H HA3  . GLY B 1 51  ? -44.982 32.760  -2.394  1.00 26.86 ? 40   GLY B HA3  1 
ATOM   8298  N N    . LEU B 1 52  ? -46.486 30.100  -1.943  1.00 19.17 ? 41   LEU B N    1 
ATOM   8299  C CA   . LEU B 1 52  ? -47.098 29.237  -0.959  1.00 18.17 ? 41   LEU B CA   1 
ATOM   8300  C C    . LEU B 1 52  ? -47.041 27.802  -1.425  1.00 19.23 ? 41   LEU B C    1 
ATOM   8301  O O    . LEU B 1 52  ? -47.049 27.505  -2.627  1.00 20.26 ? 41   LEU B O    1 
ATOM   8302  C CB   . LEU B 1 52  ? -48.564 29.603  -0.741  1.00 19.89 ? 41   LEU B CB   1 
ATOM   8303  C CG   . LEU B 1 52  ? -48.801 31.015  -0.234  1.00 24.78 ? 41   LEU B CG   1 
ATOM   8304  C CD1  . LEU B 1 52  ? -50.304 31.321  -0.202  1.00 32.83 ? 41   LEU B CD1  1 
ATOM   8305  C CD2  . LEU B 1 52  ? -48.240 31.207  1.135   1.00 23.76 ? 41   LEU B CD2  1 
ATOM   8306  H H    . LEU B 1 52  ? -46.835 30.022  -2.725  1.00 23.00 ? 41   LEU B H    1 
ATOM   8307  H HA   . LEU B 1 52  ? -46.626 29.312  -0.115  1.00 21.80 ? 41   LEU B HA   1 
ATOM   8308  H HB2  . LEU B 1 52  ? -49.034 29.512  -1.584  1.00 23.87 ? 41   LEU B HB2  1 
ATOM   8309  H HB3  . LEU B 1 52  ? -48.942 28.990  -0.090  1.00 23.87 ? 41   LEU B HB3  1 
ATOM   8310  H HG   . LEU B 1 52  ? -48.372 31.647  -0.831  1.00 29.73 ? 41   LEU B HG   1 
ATOM   8311  H HD11 . LEU B 1 52  ? -50.435 32.225  0.124   1.00 39.40 ? 41   LEU B HD11 1 
ATOM   8312  H HD12 . LEU B 1 52  ? -50.662 31.238  -1.100  1.00 39.40 ? 41   LEU B HD12 1 
ATOM   8313  H HD13 . LEU B 1 52  ? -50.743 30.689  0.389   1.00 39.40 ? 41   LEU B HD13 1 
ATOM   8314  H HD21 . LEU B 1 52  ? -48.412 32.117  1.421   1.00 28.51 ? 41   LEU B HD21 1 
ATOM   8315  H HD22 . LEU B 1 52  ? -48.669 30.583  1.741   1.00 28.51 ? 41   LEU B HD22 1 
ATOM   8316  H HD23 . LEU B 1 52  ? -47.285 31.041  1.110   1.00 28.51 ? 41   LEU B HD23 1 
ATOM   8317  N N    . ILE B 1 53  ? -46.935 26.913  -0.454  1.00 17.40 ? 42   ILE B N    1 
ATOM   8318  C CA   . ILE B 1 53  ? -47.086 25.488  -0.678  1.00 17.73 ? 42   ILE B CA   1 
ATOM   8319  C C    . ILE B 1 53  ? -48.577 25.206  -0.808  1.00 19.69 ? 42   ILE B C    1 
ATOM   8320  O O    . ILE B 1 53  ? -49.351 25.446  0.132   1.00 21.27 ? 42   ILE B O    1 
ATOM   8321  C CB   . ILE B 1 53  ? -46.430 24.680  0.450   1.00 16.46 ? 42   ILE B CB   1 
ATOM   8322  C CG1  . ILE B 1 53  ? -44.919 24.940  0.496   1.00 17.52 ? 42   ILE B CG1  1 
ATOM   8323  C CG2  . ILE B 1 53  ? -46.676 23.200  0.232   1.00 20.10 ? 42   ILE B CG2  1 
ATOM   8324  C CD1  . ILE B 1 53  ? -44.223 24.450  1.774   1.00 17.62 ? 42   ILE B CD1  1 
ATOM   8325  H H    . ILE B 1 53  ? -46.772 27.117  0.366   1.00 20.88 ? 42   ILE B H    1 
ATOM   8326  H HA   . ILE B 1 53  ? -46.656 25.248  -1.513  1.00 21.28 ? 42   ILE B HA   1 
ATOM   8327  H HB   . ILE B 1 53  ? -46.822 24.944  1.297   1.00 19.75 ? 42   ILE B HB   1 
ATOM   8328  H HG12 . ILE B 1 53  ? -44.505 24.488  -0.256  1.00 21.02 ? 42   ILE B HG12 1 
ATOM   8329  H HG13 . ILE B 1 53  ? -44.767 25.895  0.426   1.00 21.02 ? 42   ILE B HG13 1 
ATOM   8330  H HG21 . ILE B 1 53  ? -46.257 22.702  0.951   1.00 24.11 ? 42   ILE B HG21 1 
ATOM   8331  H HG22 . ILE B 1 53  ? -47.632 23.037  0.229   1.00 24.11 ? 42   ILE B HG22 1 
ATOM   8332  H HG23 . ILE B 1 53  ? -46.292 22.939  -0.620  1.00 24.11 ? 42   ILE B HG23 1 
ATOM   8333  H HD11 . ILE B 1 53  ? -43.276 24.655  1.716   1.00 21.14 ? 42   ILE B HD11 1 
ATOM   8334  H HD12 . ILE B 1 53  ? -44.613 24.902  2.539   1.00 21.14 ? 42   ILE B HD12 1 
ATOM   8335  H HD13 . ILE B 1 53  ? -44.350 23.492  1.856   1.00 21.14 ? 42   ILE B HD13 1 
ATOM   8336  N N    . LYS B 1 54  ? -48.980 24.705  -1.972  1.00 21.33 ? 43   LYS B N    1 
ATOM   8337  C CA   . LYS B 1 54  ? -50.391 24.508  -2.276  1.00 22.36 ? 43   LYS B CA   1 
ATOM   8338  C C    . LYS B 1 54  ? -50.862 23.076  -2.121  1.00 25.06 ? 43   LYS B C    1 
ATOM   8339  O O    . LYS B 1 54  ? -52.010 22.837  -1.713  1.00 24.80 ? 43   LYS B O    1 
ATOM   8340  C CB   . LYS B 1 54  ? -50.696 24.973  -3.706  1.00 22.77 ? 43   LYS B CB   1 
ATOM   8341  C CG   . LYS B 1 54  ? -50.482 26.439  -3.928  1.00 28.63 ? 43   LYS B CG   1 
ATOM   8342  C CD   . LYS B 1 54  ? -51.411 27.229  -3.030  1.00 34.05 ? 43   LYS B CD   1 
ATOM   8343  C CE   . LYS B 1 54  ? -51.357 28.699  -3.304  1.00 37.95 ? 43   LYS B CE   1 
ATOM   8344  N NZ   . LYS B 1 54  ? -52.465 29.376  -2.584  1.00 46.54 ? 43   LYS B NZ   1 
ATOM   8345  H H    . LYS B 1 54  ? -48.450 24.470  -2.607  1.00 25.60 ? 43   LYS B H    1 
ATOM   8346  H HA   . LYS B 1 54  ? -50.916 25.055  -1.671  1.00 26.83 ? 43   LYS B HA   1 
ATOM   8347  H HB2  . LYS B 1 54  ? -50.119 24.493  -4.320  1.00 27.33 ? 43   LYS B HB2  1 
ATOM   8348  H HB3  . LYS B 1 54  ? -51.625 24.776  -3.907  1.00 27.33 ? 43   LYS B HB3  1 
ATOM   8349  H HG2  . LYS B 1 54  ? -49.566 26.671  -3.709  1.00 34.35 ? 43   LYS B HG2  1 
ATOM   8350  H HG3  . LYS B 1 54  ? -50.679 26.661  -4.852  1.00 34.35 ? 43   LYS B HG3  1 
ATOM   8351  H HD2  . LYS B 1 54  ? -52.322 26.930  -3.174  1.00 40.86 ? 43   LYS B HD2  1 
ATOM   8352  H HD3  . LYS B 1 54  ? -51.155 27.086  -2.106  1.00 40.86 ? 43   LYS B HD3  1 
ATOM   8353  H HE2  . LYS B 1 54  ? -50.515 29.060  -2.986  1.00 45.54 ? 43   LYS B HE2  1 
ATOM   8354  H HE3  . LYS B 1 54  ? -51.462 28.858  -4.255  1.00 45.54 ? 43   LYS B HE3  1 
ATOM   8355  H HZ1  . LYS B 1 54  ? -52.440 30.252  -2.742  1.00 55.85 ? 43   LYS B HZ1  1 
ATOM   8356  H HZ2  . LYS B 1 54  ? -53.248 29.055  -2.860  1.00 55.85 ? 43   LYS B HZ2  1 
ATOM   8357  H HZ3  . LYS B 1 54  ? -52.388 29.238  -1.708  1.00 55.85 ? 43   LYS B HZ3  1 
ATOM   8358  N N    . GLN B 1 55  ? -50.024 22.114  -2.490  1.00 23.39 ? 44   GLN B N    1 
ATOM   8359  C CA   . GLN B 1 55  ? -50.394 20.707  -2.415  1.00 24.44 ? 44   GLN B CA   1 
ATOM   8360  C C    . GLN B 1 55  ? -49.164 19.906  -2.020  1.00 21.56 ? 44   GLN B C    1 
ATOM   8361  O O    . GLN B 1 55  ? -48.035 20.221  -2.436  1.00 22.74 ? 44   GLN B O    1 
ATOM   8362  C CB   . GLN B 1 55  ? -50.861 20.156  -3.747  1.00 26.04 ? 44   GLN B CB   1 
ATOM   8363  C CG   . GLN B 1 55  ? -52.098 20.736  -4.283  1.00 28.17 ? 44   GLN B CG   1 
ATOM   8364  C CD   . GLN B 1 55  ? -52.457 20.085  -5.617  1.00 31.39 ? 44   GLN B CD   1 
ATOM   8365  O OE1  . GLN B 1 55  ? -52.587 18.861  -5.706  1.00 35.27 ? 44   GLN B OE1  1 
ATOM   8366  N NE2  . GLN B 1 55  ? -52.613 20.907  -6.662  1.00 34.27 ? 44   GLN B NE2  1 
ATOM   8367  H H    . GLN B 1 55  ? -49.229 22.252  -2.789  1.00 28.07 ? 44   GLN B H    1 
ATOM   8368  H HA   . GLN B 1 55  ? -51.089 20.577  -1.751  1.00 29.33 ? 44   GLN B HA   1 
ATOM   8369  H HB2  . GLN B 1 55  ? -50.163 20.308  -4.402  1.00 31.25 ? 44   GLN B HB2  1 
ATOM   8370  H HB3  . GLN B 1 55  ? -51.008 19.203  -3.648  1.00 31.25 ? 44   GLN B HB3  1 
ATOM   8371  H HG2  . GLN B 1 55  ? -52.825 20.581  -3.660  1.00 33.80 ? 44   GLN B HG2  1 
ATOM   8372  H HG3  . GLN B 1 55  ? -51.973 21.687  -4.429  1.00 33.80 ? 44   GLN B HG3  1 
ATOM   8373  H HE21 . GLN B 1 55  ? -52.510 21.755  -6.561  1.00 41.12 ? 44   GLN B HE21 1 
ATOM   8374  H HE22 . GLN B 1 55  ? -52.815 20.587  -7.434  1.00 41.12 ? 44   GLN B HE22 1 
ATOM   8375  N N    . ILE B 1 56  ? -49.400 18.868  -1.227  1.00 22.95 ? 45   ILE B N    1 
ATOM   8376  C CA   . ILE B 1 56  ? -48.393 17.881  -0.868  1.00 21.56 ? 45   ILE B CA   1 
ATOM   8377  C C    . ILE B 1 56  ? -49.029 16.499  -1.032  1.00 22.79 ? 45   ILE B C    1 
ATOM   8378  O O    . ILE B 1 56  ? -50.118 16.245  -0.501  1.00 26.78 ? 45   ILE B O    1 
ATOM   8379  C CB   . ILE B 1 56  ? -47.899 18.069  0.579   1.00 21.68 ? 45   ILE B CB   1 
ATOM   8380  C CG1  . ILE B 1 56  ? -47.195 19.429  0.723   1.00 20.97 ? 45   ILE B CG1  1 
ATOM   8381  C CG2  . ILE B 1 56  ? -46.957 16.909  0.967   1.00 23.62 ? 45   ILE B CG2  1 
ATOM   8382  C CD1  . ILE B 1 56  ? -46.913 19.766  2.187   1.00 18.75 ? 45   ILE B CD1  1 
ATOM   8383  H H    . ILE B 1 56  ? -50.167 18.710  -0.873  1.00 27.54 ? 45   ILE B H    1 
ATOM   8384  H HA   . ILE B 1 56  ? -47.635 17.951  -1.469  1.00 25.87 ? 45   ILE B HA   1 
ATOM   8385  H HB   . ILE B 1 56  ? -48.667 18.054  1.172   1.00 26.02 ? 45   ILE B HB   1 
ATOM   8386  H HG12 . ILE B 1 56  ? -46.349 19.403  0.249   1.00 25.16 ? 45   ILE B HG12 1 
ATOM   8387  H HG13 . ILE B 1 56  ? -47.764 20.124  0.357   1.00 25.16 ? 45   ILE B HG13 1 
ATOM   8388  H HG21 . ILE B 1 56  ? -46.655 17.041  1.879   1.00 28.34 ? 45   ILE B HG21 1 
ATOM   8389  H HG22 . ILE B 1 56  ? -47.442 16.072  0.896   1.00 28.34 ? 45   ILE B HG22 1 
ATOM   8390  H HG23 . ILE B 1 56  ? -46.198 16.904  0.364   1.00 28.34 ? 45   ILE B HG23 1 
ATOM   8391  H HD11 . ILE B 1 56  ? -46.471 20.628  2.233   1.00 22.50 ? 45   ILE B HD11 1 
ATOM   8392  H HD12 . ILE B 1 56  ? -47.753 19.798  2.671   1.00 22.50 ? 45   ILE B HD12 1 
ATOM   8393  H HD13 . ILE B 1 56  ? -46.341 19.079  2.564   1.00 22.50 ? 45   ILE B HD13 1 
ATOM   8394  N N    . GLY B 1 57  ? -48.366 15.611  -1.762  1.00 22.94 ? 46   GLY B N    1 
ATOM   8395  C CA   . GLY B 1 57  ? -48.854 14.236  -1.870  1.00 25.83 ? 46   GLY B CA   1 
ATOM   8396  C C    . GLY B 1 57  ? -48.351 13.588  -3.153  1.00 27.95 ? 46   GLY B C    1 
ATOM   8397  O O    . GLY B 1 57  ? -47.316 13.979  -3.694  1.00 27.90 ? 46   GLY B O    1 
ATOM   8398  H H    . GLY B 1 57  ? -47.643 15.772  -2.199  1.00 27.53 ? 46   GLY B H    1 
ATOM   8399  H HA2  . GLY B 1 57  ? -48.542 13.716  -1.114  1.00 30.99 ? 46   GLY B HA2  1 
ATOM   8400  H HA3  . GLY B 1 57  ? -49.824 14.230  -1.876  1.00 30.99 ? 46   GLY B HA3  1 
ATOM   8401  N N    . GLU B 1 58  ? -49.110 12.599  -3.629  1.00 37.84 ? 47   GLU B N    1 
ATOM   8402  C CA   . GLU B 1 58  ? -48.742 11.844  -4.816  1.00 39.29 ? 47   GLU B CA   1 
ATOM   8403  C C    . GLU B 1 58  ? -49.680 12.169  -5.970  1.00 44.75 ? 47   GLU B C    1 
ATOM   8404  O O    . GLU B 1 58  ? -50.847 12.510  -5.766  1.00 45.05 ? 47   GLU B O    1 
ATOM   8405  C CB   . GLU B 1 58  ? -48.823 10.343  -4.525  1.00 43.21 ? 47   GLU B CB   1 
ATOM   8406  C CG   . GLU B 1 58  ? -47.729 9.865   -3.602  1.00 46.75 ? 47   GLU B CG   1 
ATOM   8407  C CD   . GLU B 1 58  ? -46.357 10.027  -4.225  1.00 54.66 ? 47   GLU B CD   1 
ATOM   8408  O OE1  . GLU B 1 58  ? -46.264 10.036  -5.478  1.00 57.85 ? 47   GLU B OE1  1 
ATOM   8409  O OE2  . GLU B 1 58  ? -45.376 10.153  -3.467  1.00 57.69 ? 47   GLU B OE2  1 
ATOM   8410  H H    . GLU B 1 58  ? -49.851 12.347  -3.273  1.00 45.41 ? 47   GLU B H    1 
ATOM   8411  H HA   . GLU B 1 58  ? -47.835 12.064  -5.078  1.00 47.15 ? 47   GLU B HA   1 
ATOM   8412  H HB2  . GLU B 1 58  ? -49.676 10.149  -4.106  1.00 51.86 ? 47   GLU B HB2  1 
ATOM   8413  H HB3  . GLU B 1 58  ? -48.746 9.855   -5.360  1.00 51.86 ? 47   GLU B HB3  1 
ATOM   8414  H HG2  . GLU B 1 58  ? -47.753 10.384  -2.783  1.00 56.10 ? 47   GLU B HG2  1 
ATOM   8415  H HG3  . GLU B 1 58  ? -47.864 8.925   -3.406  1.00 56.10 ? 47   GLU B HG3  1 
ATOM   8416  N N    . ASN B 1 59  ? -49.159 12.060  -7.193  1.00 46.41 ? 48   ASN B N    1 
ATOM   8417  C CA   . ASN B 1 59  ? -49.972 12.217  -8.391  1.00 50.16 ? 48   ASN B CA   1 
ATOM   8418  C C    . ASN B 1 59  ? -50.729 13.536  -8.352  1.00 51.29 ? 48   ASN B C    1 
ATOM   8419  O O    . ASN B 1 59  ? -51.939 13.602  -8.592  1.00 52.51 ? 48   ASN B O    1 
ATOM   8420  C CB   . ASN B 1 59  ? -50.950 11.043  -8.559  1.00 58.11 ? 48   ASN B CB   1 
ATOM   8421  C CG   . ASN B 1 59  ? -50.254 9.701   -8.586  1.00 64.52 ? 48   ASN B CG   1 
ATOM   8422  O OD1  . ASN B 1 59  ? -49.312 9.498   -9.349  1.00 64.68 ? 48   ASN B OD1  1 
ATOM   8423  N ND2  . ASN B 1 59  ? -50.703 8.780   -7.740  1.00 71.47 ? 48   ASN B ND2  1 
ATOM   8424  H H    . ASN B 1 59  ? -48.330 11.893  -7.353  1.00 55.70 ? 48   ASN B H    1 
ATOM   8425  H HA   . ASN B 1 59  ? -49.389 12.232  -9.167  1.00 60.19 ? 48   ASN B HA   1 
ATOM   8426  H HB2  . ASN B 1 59  ? -51.573 11.042  -7.815  1.00 69.73 ? 48   ASN B HB2  1 
ATOM   8427  H HB3  . ASN B 1 59  ? -51.431 11.149  -9.394  1.00 69.73 ? 48   ASN B HB3  1 
ATOM   8428  H HD21 . ASN B 1 59  ? -50.338 8.001   -7.719  1.00 85.76 ? 48   ASN B HD21 1 
ATOM   8429  H HD22 . ASN B 1 59  ? -51.358 8.962   -7.214  1.00 85.76 ? 48   ASN B HD22 1 
ATOM   8430  N N    . LEU B 1 60  ? -50.015 14.599  -8.013  1.00 47.18 ? 49   LEU B N    1 
ATOM   8431  C CA   . LEU B 1 60  ? -50.679 15.871  -7.835  1.00 41.20 ? 49   LEU B CA   1 
ATOM   8432  C C    . LEU B 1 60  ? -51.193 16.378  -9.173  1.00 47.84 ? 49   LEU B C    1 
ATOM   8433  O O    . LEU B 1 60  ? -50.531 16.257  -10.209 1.00 51.51 ? 49   LEU B O    1 
ATOM   8434  C CB   . LEU B 1 60  ? -49.727 16.879  -7.200  1.00 36.67 ? 49   LEU B CB   1 
ATOM   8435  C CG   . LEU B 1 60  ? -49.144 16.443  -5.856  1.00 30.31 ? 49   LEU B CG   1 
ATOM   8436  C CD1  . LEU B 1 60  ? -48.228 17.520  -5.354  1.00 30.28 ? 49   LEU B CD1  1 
ATOM   8437  C CD2  . LEU B 1 60  ? -50.228 16.180  -4.837  1.00 32.86 ? 49   LEU B CD2  1 
ATOM   8438  H H    . LEU B 1 60  ? -49.164 14.609  -7.884  1.00 56.61 ? 49   LEU B H    1 
ATOM   8439  H HA   . LEU B 1 60  ? -51.438 15.755  -7.242  1.00 49.44 ? 49   LEU B HA   1 
ATOM   8440  H HB2  . LEU B 1 60  ? -48.986 17.031  -7.807  1.00 44.01 ? 49   LEU B HB2  1 
ATOM   8441  H HB3  . LEU B 1 60  ? -50.206 17.710  -7.056  1.00 44.01 ? 49   LEU B HB3  1 
ATOM   8442  H HG   . LEU B 1 60  ? -48.628 15.631  -5.975  1.00 36.37 ? 49   LEU B HG   1 
ATOM   8443  H HD11 . LEU B 1 60  ? -47.857 17.245  -4.501  1.00 36.34 ? 49   LEU B HD11 1 
ATOM   8444  H HD12 . LEU B 1 60  ? -47.515 17.653  -5.998  1.00 36.34 ? 49   LEU B HD12 1 
ATOM   8445  H HD13 . LEU B 1 60  ? -48.735 18.340  -5.246  1.00 36.34 ? 49   LEU B HD13 1 
ATOM   8446  H HD21 . LEU B 1 60  ? -49.816 15.907  -4.003  1.00 39.44 ? 49   LEU B HD21 1 
ATOM   8447  H HD22 . LEU B 1 60  ? -50.739 16.993  -4.704  1.00 39.44 ? 49   LEU B HD22 1 
ATOM   8448  H HD23 . LEU B 1 60  ? -50.806 15.475  -5.168  1.00 39.44 ? 49   LEU B HD23 1 
ATOM   8449  N N    . ILE B 1 61  ? -52.391 16.935  -9.147  1.00 51.45 ? 50   ILE B N    1 
ATOM   8450  C CA   . ILE B 1 61  ? -52.971 17.542  -10.333 1.00 51.16 ? 50   ILE B CA   1 
ATOM   8451  C C    . ILE B 1 61  ? -52.470 18.973  -10.381 1.00 49.65 ? 50   ILE B C    1 
ATOM   8452  O O    . ILE B 1 61  ? -52.819 19.794  -9.525  1.00 49.34 ? 50   ILE B O    1 
ATOM   8453  C CB   . ILE B 1 61  ? -54.502 17.465  -10.321 1.00 56.23 ? 50   ILE B CB   1 
ATOM   8454  C CG1  . ILE B 1 61  ? -54.964 16.001  -10.270 1.00 61.33 ? 50   ILE B CG1  1 
ATOM   8455  C CG2  . ILE B 1 61  ? -55.083 18.194  -11.531 1.00 59.15 ? 50   ILE B CG2  1 
ATOM   8456  C CD1  . ILE B 1 61  ? -54.159 15.034  -11.151 1.00 65.23 ? 50   ILE B CD1  1 
ATOM   8457  H H    . ILE B 1 61  ? -52.893 16.976  -8.450  1.00 61.74 ? 50   ILE B H    1 
ATOM   8458  H HA   . ILE B 1 61  ? -52.648 17.078  -11.122 1.00 61.39 ? 50   ILE B HA   1 
ATOM   8459  H HB   . ILE B 1 61  ? -54.820 17.910  -9.520  1.00 67.47 ? 50   ILE B HB   1 
ATOM   8460  H HG12 . ILE B 1 61  ? -54.895 15.688  -9.355  1.00 73.60 ? 50   ILE B HG12 1 
ATOM   8461  H HG13 . ILE B 1 61  ? -55.888 15.959  -10.560 1.00 73.60 ? 50   ILE B HG13 1 
ATOM   8462  H HG21 . ILE B 1 61  ? -56.050 18.132  -11.502 1.00 70.98 ? 50   ILE B HG21 1 
ATOM   8463  H HG22 . ILE B 1 61  ? -54.809 19.124  -11.500 1.00 70.98 ? 50   ILE B HG22 1 
ATOM   8464  H HG23 . ILE B 1 61  ? -54.748 17.777  -12.341 1.00 70.98 ? 50   ILE B HG23 1 
ATOM   8465  H HD11 . ILE B 1 61  ? -54.523 14.141  -11.052 1.00 78.28 ? 50   ILE B HD11 1 
ATOM   8466  H HD12 . ILE B 1 61  ? -54.227 15.320  -12.076 1.00 78.28 ? 50   ILE B HD12 1 
ATOM   8467  H HD13 . ILE B 1 61  ? -53.231 15.048  -10.868 1.00 78.28 ? 50   ILE B HD13 1 
ATOM   8468  N N    . VAL B 1 62  ? -51.618 19.256  -11.361 1.00 49.53 ? 51   VAL B N    1 
ATOM   8469  C CA   . VAL B 1 62  ? -51.034 20.588  -11.501 1.00 47.69 ? 51   VAL B CA   1 
ATOM   8470  C C    . VAL B 1 62  ? -51.224 21.067  -12.935 1.00 50.41 ? 51   VAL B C    1 
ATOM   8471  O O    . VAL B 1 62  ? -51.439 20.266  -13.860 1.00 51.10 ? 51   VAL B O    1 
ATOM   8472  C CB   . VAL B 1 62  ? -49.544 20.600  -11.092 1.00 47.60 ? 51   VAL B CB   1 
ATOM   8473  C CG1  . VAL B 1 62  ? -49.403 20.075  -9.679  1.00 45.93 ? 51   VAL B CG1  1 
ATOM   8474  C CG2  . VAL B 1 62  ? -48.700 19.792  -12.070 1.00 47.69 ? 51   VAL B CG2  1 
ATOM   8475  H H    . VAL B 1 62  ? -51.362 18.695  -11.960 1.00 59.43 ? 51   VAL B H    1 
ATOM   8476  H HA   . VAL B 1 62  ? -51.508 21.201  -10.917 1.00 57.23 ? 51   VAL B HA   1 
ATOM   8477  H HB   . VAL B 1 62  ? -49.221 21.515  -11.105 1.00 57.12 ? 51   VAL B HB   1 
ATOM   8478  H HG11 . VAL B 1 62  ? -50.282 19.846  -9.339  1.00 55.12 ? 51   VAL B HG11 1 
ATOM   8479  H HG12 . VAL B 1 62  ? -48.836 19.288  -9.690  1.00 55.12 ? 51   VAL B HG12 1 
ATOM   8480  H HG13 . VAL B 1 62  ? -49.003 20.764  -9.125  1.00 55.12 ? 51   VAL B HG13 1 
ATOM   8481  H HG21 . VAL B 1 62  ? -49.278 19.429  -12.759 1.00 57.22 ? 51   VAL B HG21 1 
ATOM   8482  H HG22 . VAL B 1 62  ? -48.035 20.374  -12.469 1.00 57.22 ? 51   VAL B HG22 1 
ATOM   8483  H HG23 . VAL B 1 62  ? -48.265 19.071  -11.589 1.00 57.22 ? 51   VAL B HG23 1 
ATOM   8484  N N    . PRO B 1 63  ? -51.159 22.379  -13.152 1.00 50.53 ? 52   PRO B N    1 
ATOM   8485  C CA   . PRO B 1 63  ? -51.250 22.908  -14.518 1.00 53.27 ? 52   PRO B CA   1 
ATOM   8486  C C    . PRO B 1 63  ? -50.149 22.340  -15.406 1.00 52.57 ? 52   PRO B C    1 
ATOM   8487  O O    . PRO B 1 63  ? -49.090 21.912  -14.941 1.00 53.19 ? 52   PRO B O    1 
ATOM   8488  C CB   . PRO B 1 63  ? -51.086 24.426  -14.328 1.00 51.83 ? 52   PRO B CB   1 
ATOM   8489  C CG   . PRO B 1 63  ? -51.380 24.681  -12.871 1.00 52.68 ? 52   PRO B CG   1 
ATOM   8490  C CD   . PRO B 1 63  ? -50.982 23.442  -12.143 1.00 51.73 ? 52   PRO B CD   1 
ATOM   8491  H HA   . PRO B 1 63  ? -52.119 22.716  -14.905 1.00 63.93 ? 52   PRO B HA   1 
ATOM   8492  H HB2  . PRO B 1 63  ? -50.176 24.686  -14.544 1.00 62.20 ? 52   PRO B HB2  1 
ATOM   8493  H HB3  . PRO B 1 63  ? -51.720 24.896  -14.892 1.00 62.20 ? 52   PRO B HB3  1 
ATOM   8494  H HG2  . PRO B 1 63  ? -50.858 25.438  -12.563 1.00 63.22 ? 52   PRO B HG2  1 
ATOM   8495  H HG3  . PRO B 1 63  ? -52.328 24.852  -12.757 1.00 63.22 ? 52   PRO B HG3  1 
ATOM   8496  H HD2  . PRO B 1 63  ? -50.054 23.495  -11.867 1.00 62.08 ? 52   PRO B HD2  1 
ATOM   8497  H HD3  . PRO B 1 63  ? -51.570 23.291  -11.386 1.00 62.08 ? 52   PRO B HD3  1 
ATOM   8498  N N    . GLY B 1 64  ? -50.410 22.324  -16.706 1.00 55.16 ? 53   GLY B N    1 
ATOM   8499  C CA   . GLY B 1 64  ? -49.371 21.968  -17.641 1.00 55.22 ? 53   GLY B CA   1 
ATOM   8500  C C    . GLY B 1 64  ? -48.270 23.010  -17.677 1.00 56.20 ? 53   GLY B C    1 
ATOM   8501  O O    . GLY B 1 64  ? -48.463 24.183  -17.346 1.00 59.65 ? 53   GLY B O    1 
ATOM   8502  H H    . GLY B 1 64  ? -51.170 22.514  -17.062 1.00 66.19 ? 53   GLY B H    1 
ATOM   8503  H HA2  . GLY B 1 64  ? -48.983 21.116  -17.387 1.00 66.27 ? 53   GLY B HA2  1 
ATOM   8504  H HA3  . GLY B 1 64  ? -49.748 21.884  -18.531 1.00 66.27 ? 53   GLY B HA3  1 
ATOM   8505  N N    . GLY B 1 65  ? -47.081 22.565  -18.072 1.00 53.84 ? 54   GLY B N    1 
ATOM   8506  C CA   . GLY B 1 65  ? -45.972 23.488  -18.224 1.00 51.46 ? 54   GLY B CA   1 
ATOM   8507  C C    . GLY B 1 65  ? -45.377 23.994  -16.931 1.00 49.78 ? 54   GLY B C    1 
ATOM   8508  O O    . GLY B 1 65  ? -44.635 24.978  -16.945 1.00 50.25 ? 54   GLY B O    1 
ATOM   8509  H H    . GLY B 1 65  ? -46.895 21.746  -18.255 1.00 64.61 ? 54   GLY B H    1 
ATOM   8510  H HA2  . GLY B 1 65  ? -45.267 23.050  -18.726 1.00 61.75 ? 54   GLY B HA2  1 
ATOM   8511  H HA3  . GLY B 1 65  ? -46.271 24.256  -18.736 1.00 61.75 ? 54   GLY B HA3  1 
ATOM   8512  N N    . VAL B 1 66  ? -45.669 23.348  -15.810 1.00 47.73 ? 55   VAL B N    1 
ATOM   8513  C CA   . VAL B 1 66  ? -45.118 23.776  -14.532 1.00 41.90 ? 55   VAL B CA   1 
ATOM   8514  C C    . VAL B 1 66  ? -43.662 23.331  -14.454 1.00 39.58 ? 55   VAL B C    1 
ATOM   8515  O O    . VAL B 1 66  ? -43.351 22.147  -14.632 1.00 38.51 ? 55   VAL B O    1 
ATOM   8516  C CB   . VAL B 1 66  ? -45.951 23.200  -13.374 1.00 40.45 ? 55   VAL B CB   1 
ATOM   8517  C CG1  . VAL B 1 66  ? -45.221 23.348  -12.049 1.00 40.36 ? 55   VAL B CG1  1 
ATOM   8518  C CG2  . VAL B 1 66  ? -47.315 23.875  -13.330 1.00 43.50 ? 55   VAL B CG2  1 
ATOM   8519  H H    . VAL B 1 66  ? -46.183 22.660  -15.762 1.00 57.27 ? 55   VAL B H    1 
ATOM   8520  H HA   . VAL B 1 66  ? -45.146 24.744  -14.477 1.00 50.27 ? 55   VAL B HA   1 
ATOM   8521  H HB   . VAL B 1 66  ? -46.093 22.253  -13.531 1.00 48.54 ? 55   VAL B HB   1 
ATOM   8522  H HG11 . VAL B 1 66  ? -45.772 22.976  -11.343 1.00 48.43 ? 55   VAL B HG11 1 
ATOM   8523  H HG12 . VAL B 1 66  ? -44.378 22.871  -12.099 1.00 48.43 ? 55   VAL B HG12 1 
ATOM   8524  H HG13 . VAL B 1 66  ? -45.059 24.290  -11.882 1.00 48.43 ? 55   VAL B HG13 1 
ATOM   8525  H HG21 . VAL B 1 66  ? -47.828 23.502  -12.596 1.00 52.20 ? 55   VAL B HG21 1 
ATOM   8526  H HG22 . VAL B 1 66  ? -47.191 24.828  -13.197 1.00 52.20 ? 55   VAL B HG22 1 
ATOM   8527  H HG23 . VAL B 1 66  ? -47.773 23.715  -14.170 1.00 52.20 ? 55   VAL B HG23 1 
ATOM   8528  N N    . LYS B 1 67  ? -42.770 24.275  -14.165 1.00 35.87 ? 56   LYS B N    1 
ATOM   8529  C CA   . LYS B 1 67  ? -41.383 23.953  -13.842 1.00 32.31 ? 56   LYS B CA   1 
ATOM   8530  C C    . LYS B 1 67  ? -41.319 22.864  -12.790 1.00 29.23 ? 56   LYS B C    1 
ATOM   8531  O O    . LYS B 1 67  ? -41.934 22.978  -11.728 1.00 27.70 ? 56   LYS B O    1 
ATOM   8532  C CB   . LYS B 1 67  ? -40.720 25.208  -13.278 1.00 34.75 ? 56   LYS B CB   1 
ATOM   8533  C CG   . LYS B 1 67  ? -39.267 25.082  -12.886 1.00 40.66 ? 56   LYS B CG   1 
ATOM   8534  C CD   . LYS B 1 67  ? -38.390 24.705  -14.043 1.00 49.51 ? 56   LYS B CD   1 
ATOM   8535  C CE   . LYS B 1 67  ? -36.937 25.018  -13.753 1.00 56.13 ? 56   LYS B CE   1 
ATOM   8536  N NZ   . LYS B 1 67  ? -36.088 23.779  -13.755 1.00 64.10 ? 56   LYS B NZ   1 
ATOM   8537  H H    . LYS B 1 67  ? -42.945 25.117  -14.149 1.00 43.04 ? 56   LYS B H    1 
ATOM   8538  H HA   . LYS B 1 67  ? -40.907 23.665  -14.636 1.00 38.77 ? 56   LYS B HA   1 
ATOM   8539  H HB2  . LYS B 1 67  ? -40.778 25.909  -13.947 1.00 41.70 ? 56   LYS B HB2  1 
ATOM   8540  H HB3  . LYS B 1 67  ? -41.209 25.480  -12.486 1.00 41.70 ? 56   LYS B HB3  1 
ATOM   8541  H HG2  . LYS B 1 67  ? -38.958 25.933  -12.539 1.00 48.79 ? 56   LYS B HG2  1 
ATOM   8542  H HG3  . LYS B 1 67  ? -39.181 24.395  -12.207 1.00 48.79 ? 56   LYS B HG3  1 
ATOM   8543  H HD2  . LYS B 1 67  ? -38.469 23.752  -14.209 1.00 59.41 ? 56   LYS B HD2  1 
ATOM   8544  H HD3  . LYS B 1 67  ? -38.659 25.207  -14.828 1.00 59.41 ? 56   LYS B HD3  1 
ATOM   8545  H HE2  . LYS B 1 67  ? -36.597 25.619  -14.435 1.00 67.36 ? 56   LYS B HE2  1 
ATOM   8546  H HE3  . LYS B 1 67  ? -36.867 25.431  -12.878 1.00 67.36 ? 56   LYS B HE3  1 
ATOM   8547  H HZ1  . LYS B 1 67  ? -36.131 23.383  -14.551 1.00 76.92 ? 56   LYS B HZ1  1 
ATOM   8548  H HZ2  . LYS B 1 67  ? -36.377 23.212  -13.133 1.00 76.92 ? 56   LYS B HZ2  1 
ATOM   8549  H HZ3  . LYS B 1 67  ? -35.241 23.991  -13.583 1.00 76.92 ? 56   LYS B HZ3  1 
ATOM   8550  N N    . THR B 1 68  ? -40.537 21.831  -13.074 1.00 29.12 ? 57   THR B N    1 
ATOM   8551  C CA   . THR B 1 68  ? -40.491 20.652  -12.218 1.00 28.89 ? 57   THR B CA   1 
ATOM   8552  C C    . THR B 1 68  ? -39.047 20.258  -11.922 1.00 26.13 ? 57   THR B C    1 
ATOM   8553  O O    . THR B 1 68  ? -38.245 20.072  -12.851 1.00 30.31 ? 57   THR B O    1 
ATOM   8554  C CB   . THR B 1 68  ? -41.201 19.483  -12.896 1.00 28.43 ? 57   THR B CB   1 
ATOM   8555  O OG1  . THR B 1 68  ? -42.584 19.811  -13.137 1.00 31.52 ? 57   THR B OG1  1 
ATOM   8556  C CG2  . THR B 1 68  ? -41.137 18.269  -12.034 1.00 29.52 ? 57   THR B CG2  1 
ATOM   8557  H H    . THR B 1 68  ? -40.020 21.788  -13.760 1.00 34.94 ? 57   THR B H    1 
ATOM   8558  H HA   . THR B 1 68  ? -40.938 20.841  -11.378 1.00 34.67 ? 57   THR B HA   1 
ATOM   8559  H HB   . THR B 1 68  ? -40.764 19.284  -13.740 1.00 34.12 ? 57   THR B HB   1 
ATOM   8560  H HG1  . THR B 1 68  ? -42.637 20.485  -13.634 1.00 37.82 ? 57   THR B HG1  1 
ATOM   8561  H HG21 . THR B 1 68  ? -41.589 17.529  -12.469 1.00 35.43 ? 57   THR B HG21 1 
ATOM   8562  H HG22 . THR B 1 68  ? -40.212 18.024  -11.875 1.00 35.43 ? 57   THR B HG22 1 
ATOM   8563  H HG23 . THR B 1 68  ? -41.567 18.444  -11.182 1.00 35.43 ? 57   THR B HG23 1 
ATOM   8564  N N    . ILE B 1 69  ? -38.747 20.085  -10.641 1.00 25.01 ? 58   ILE B N    1 
ATOM   8565  C CA   . ILE B 1 69  ? -37.468 19.609  -10.138 1.00 26.00 ? 58   ILE B CA   1 
ATOM   8566  C C    . ILE B 1 69  ? -37.633 18.156  -9.727  1.00 25.70 ? 58   ILE B C    1 
ATOM   8567  O O    . ILE B 1 69  ? -38.569 17.816  -8.992  1.00 27.05 ? 58   ILE B O    1 
ATOM   8568  C CB   . ILE B 1 69  ? -37.069 20.409  -8.881  1.00 27.11 ? 58   ILE B CB   1 
ATOM   8569  C CG1  . ILE B 1 69  ? -36.817 21.885  -9.193  1.00 31.41 ? 58   ILE B CG1  1 
ATOM   8570  C CG2  . ILE B 1 69  ? -35.857 19.781  -8.222  1.00 28.90 ? 58   ILE B CG2  1 
ATOM   8571  C CD1  . ILE B 1 69  ? -36.655 22.744  -7.958  1.00 35.40 ? 58   ILE B CD1  1 
ATOM   8572  H H    . ILE B 1 69  ? -39.307 20.248  -10.009 1.00 30.02 ? 58   ILE B H    1 
ATOM   8573  H HA   . ILE B 1 69  ? -36.777 19.686  -10.814 1.00 31.20 ? 58   ILE B HA   1 
ATOM   8574  H HB   . ILE B 1 69  ? -37.806 20.360  -8.253  1.00 32.53 ? 58   ILE B HB   1 
ATOM   8575  H HG12 . ILE B 1 69  ? -36.004 21.961  -9.716  1.00 37.69 ? 58   ILE B HG12 1 
ATOM   8576  H HG13 . ILE B 1 69  ? -37.569 22.231  -9.699  1.00 37.69 ? 58   ILE B HG13 1 
ATOM   8577  H HG21 . ILE B 1 69  ? -35.623 20.298  -7.435  1.00 34.68 ? 58   ILE B HG21 1 
ATOM   8578  H HG22 . ILE B 1 69  ? -36.073 18.870  -7.968  1.00 34.68 ? 58   ILE B HG22 1 
ATOM   8579  H HG23 . ILE B 1 69  ? -35.119 19.784  -8.852  1.00 34.68 ? 58   ILE B HG23 1 
ATOM   8580  H HD11 . ILE B 1 69  ? -36.500 23.662  -8.231  1.00 42.49 ? 58   ILE B HD11 1 
ATOM   8581  H HD12 . ILE B 1 69  ? -37.465 22.689  -7.427  1.00 42.49 ? 58   ILE B HD12 1 
ATOM   8582  H HD13 . ILE B 1 69  ? -35.899 22.419  -7.444  1.00 42.49 ? 58   ILE B HD13 1 
ATOM   8583  N N    . GLU B 1 70  ? -36.683 17.309  -10.102 1.00 26.14 ? 59   GLU B N    1 
ATOM   8584  C CA   . GLU B 1 70  ? -36.689 15.922  -9.654  1.00 28.71 ? 59   GLU B CA   1 
ATOM   8585  C C    . GLU B 1 70  ? -35.764 15.827  -8.443  1.00 30.01 ? 59   GLU B C    1 
ATOM   8586  O O    . GLU B 1 70  ? -34.570 16.135  -8.546  1.00 33.42 ? 59   GLU B O    1 
ATOM   8587  C CB   . GLU B 1 70  ? -36.253 15.001  -10.787 1.00 33.59 ? 59   GLU B CB   1 
ATOM   8588  C CG   . GLU B 1 70  ? -37.278 14.935  -11.910 1.00 38.11 ? 59   GLU B CG   1 
ATOM   8589  C CD   . GLU B 1 70  ? -38.546 14.167  -11.518 1.00 44.23 ? 59   GLU B CD   1 
ATOM   8590  O OE1  . GLU B 1 70  ? -38.550 13.495  -10.459 1.00 50.66 ? 59   GLU B OE1  1 
ATOM   8591  O OE2  . GLU B 1 70  ? -39.539 14.242  -12.266 1.00 51.04 ? 59   GLU B OE2  1 
ATOM   8592  H H    . GLU B 1 70  ? -36.023 17.512  -10.615 1.00 31.37 ? 59   GLU B H    1 
ATOM   8593  H HA   . GLU B 1 70  ? -37.585 15.673  -9.380  1.00 34.46 ? 59   GLU B HA   1 
ATOM   8594  H HB2  . GLU B 1 70  ? -35.420 15.328  -11.159 1.00 40.30 ? 59   GLU B HB2  1 
ATOM   8595  H HB3  . GLU B 1 70  ? -36.133 14.104  -10.437 1.00 40.30 ? 59   GLU B HB3  1 
ATOM   8596  H HG2  . GLU B 1 70  ? -37.538 15.838  -12.153 1.00 45.74 ? 59   GLU B HG2  1 
ATOM   8597  H HG3  . GLU B 1 70  ? -36.881 14.488  -12.674 1.00 45.74 ? 59   GLU B HG3  1 
ATOM   8598  N N    . ALA B 1 71  ? -36.324 15.459  -7.286  1.00 27.45 ? 60   ALA B N    1 
ATOM   8599  C CA   . ALA B 1 71  ? -35.537 15.393  -6.070  1.00 27.47 ? 60   ALA B CA   1 
ATOM   8600  C C    . ALA B 1 71  ? -34.810 14.073  -5.858  1.00 31.05 ? 60   ALA B C    1 
ATOM   8601  O O    . ALA B 1 71  ? -33.925 14.018  -5.007  1.00 31.07 ? 60   ALA B O    1 
ATOM   8602  C CB   . ALA B 1 71  ? -36.436 15.656  -4.872  1.00 26.67 ? 60   ALA B CB   1 
ATOM   8603  H H    . ALA B 1 71  ? -37.152 15.246  -7.187  1.00 32.94 ? 60   ALA B H    1 
ATOM   8604  H HA   . ALA B 1 71  ? -34.868 16.095  -6.097  1.00 32.97 ? 60   ALA B HA   1 
ATOM   8605  H HB1  . ALA B 1 71  ? -35.903 15.610  -4.062  1.00 32.00 ? 60   ALA B HB1  1 
ATOM   8606  H HB2  . ALA B 1 71  ? -36.829 16.538  -4.960  1.00 32.00 ? 60   ALA B HB2  1 
ATOM   8607  H HB3  . ALA B 1 71  ? -37.134 14.983  -4.848  1.00 32.00 ? 60   ALA B HB3  1 
ATOM   8608  N N    . HIS B 1 72  ? -35.145 13.031  -6.610  1.00 33.40 ? 61   HIS B N    1 
ATOM   8609  C CA   . HIS B 1 72  ? -34.442 11.745  -6.526  1.00 34.05 ? 61   HIS B CA   1 
ATOM   8610  C C    . HIS B 1 72  ? -34.354 11.215  -5.111  1.00 29.76 ? 61   HIS B C    1 
ATOM   8611  O O    . HIS B 1 72  ? -33.307 10.732  -4.687  1.00 33.10 ? 61   HIS B O    1 
ATOM   8612  C CB   . HIS B 1 72  ? -33.031 11.804  -7.141  1.00 38.28 ? 61   HIS B CB   1 
ATOM   8613  C CG   . HIS B 1 72  ? -32.997 12.346  -8.525  1.00 42.75 ? 61   HIS B CG   1 
ATOM   8614  N ND1  . HIS B 1 72  ? -32.593 13.631  -8.808  1.00 43.87 ? 61   HIS B ND1  1 
ATOM   8615  C CD2  . HIS B 1 72  ? -33.293 11.771  -9.710  1.00 44.66 ? 61   HIS B CD2  1 
ATOM   8616  C CE1  . HIS B 1 72  ? -32.657 13.834  -10.114 1.00 47.09 ? 61   HIS B CE1  1 
ATOM   8617  N NE2  . HIS B 1 72  ? -33.084 12.720  -10.686 1.00 49.23 ? 61   HIS B NE2  1 
ATOM   8618  H H    . HIS B 1 72  ? -35.784 13.039  -7.185  1.00 40.08 ? 61   HIS B H    1 
ATOM   8619  H HA   . HIS B 1 72  ? -34.948 11.096  -7.040  1.00 40.86 ? 61   HIS B HA   1 
ATOM   8620  H HB2  . HIS B 1 72  ? -32.473 12.371  -6.586  1.00 45.93 ? 61   HIS B HB2  1 
ATOM   8621  H HB3  . HIS B 1 72  ? -32.664 10.906  -7.165  1.00 45.93 ? 61   HIS B HB3  1 
ATOM   8622  H HD2  . HIS B 1 72  ? -33.596 10.902  -9.842  1.00 53.59 ? 61   HIS B HD2  1 
ATOM   8623  H HE1  . HIS B 1 72  ? -32.440 14.624  -10.554 1.00 56.51 ? 61   HIS B HE1  1 
ATOM   8624  H HE2  . HIS B 1 72  ? -33.202 12.605  -11.530 1.00 59.08 ? 61   HIS B HE2  1 
ATOM   8625  N N    . SER B 1 73  ? -35.445 11.351  -4.353  1.00 27.86 ? 62   SER B N    1 
ATOM   8626  C CA   . SER B 1 73  ? -35.573 10.841  -2.982  1.00 26.59 ? 62   SER B CA   1 
ATOM   8627  C C    . SER B 1 73  ? -34.657 11.563  -2.003  1.00 23.10 ? 62   SER B C    1 
ATOM   8628  O O    . SER B 1 73  ? -34.484 11.090  -0.863  1.00 25.15 ? 62   SER B O    1 
ATOM   8629  C CB   . SER B 1 73  ? -35.392 9.328   -2.926  1.00 29.85 ? 62   SER B CB   1 
ATOM   8630  O OG   . SER B 1 73  ? -36.453 8.686   -3.626  1.00 36.45 ? 62   SER B OG   1 
ATOM   8631  H H    . SER B 1 73  ? -36.156 11.752  -4.624  1.00 33.43 ? 62   SER B H    1 
ATOM   8632  H HA   . SER B 1 73  ? -36.480 11.019  -2.690  1.00 31.91 ? 62   SER B HA   1 
ATOM   8633  H HB2  . SER B 1 73  ? -34.548 9.092   -3.342  1.00 35.81 ? 62   SER B HB2  1 
ATOM   8634  H HB3  . SER B 1 73  ? -35.401 9.039   -2.000  1.00 35.81 ? 62   SER B HB3  1 
ATOM   8635  H HG   . SER B 1 73  ? -36.457 8.932   -4.430  1.00 43.75 ? 62   SER B HG   1 
ATOM   8636  N N    . ARG B 1 74  ? -34.085 12.712  -2.398  1.00 24.27 ? 63   ARG B N    1 
ATOM   8637  C CA   . ARG B 1 74  ? -33.293 13.515  -1.474  1.00 24.53 ? 63   ARG B CA   1 
ATOM   8638  C C    . ARG B 1 74  ? -34.176 14.226  -0.464  1.00 20.29 ? 63   ARG B C    1 
ATOM   8639  O O    . ARG B 1 74  ? -35.356 14.489  -0.701  1.00 21.20 ? 63   ARG B O    1 
ATOM   8640  C CB   . ARG B 1 74  ? -32.453 14.538  -2.244  1.00 26.36 ? 63   ARG B CB   1 
ATOM   8641  C CG   . ARG B 1 74  ? -31.447 13.820  -3.158  1.00 34.62 ? 63   ARG B CG   1 
ATOM   8642  C CD   . ARG B 1 74  ? -30.774 14.809  -4.089  1.00 47.22 ? 63   ARG B CD   1 
ATOM   8643  N NE   . ARG B 1 74  ? -29.723 14.187  -4.897  1.00 53.23 ? 63   ARG B NE   1 
ATOM   8644  C CZ   . ARG B 1 74  ? -28.551 13.766  -4.416  1.00 59.71 ? 63   ARG B CZ   1 
ATOM   8645  N NH1  . ARG B 1 74  ? -28.267 13.870  -3.116  1.00 57.07 ? 63   ARG B NH1  1 
ATOM   8646  N NH2  . ARG B 1 74  ? -27.660 13.230  -5.235  1.00 65.05 ? 63   ARG B NH2  1 
ATOM   8647  H H    . ARG B 1 74  ? -34.143 13.039  -3.191  1.00 29.13 ? 63   ARG B H    1 
ATOM   8648  H HA   . ARG B 1 74  ? -32.688 12.934  -0.988  1.00 29.43 ? 63   ARG B HA   1 
ATOM   8649  H HB2  . ARG B 1 74  ? -33.033 15.085  -2.796  1.00 31.63 ? 63   ARG B HB2  1 
ATOM   8650  H HB3  . ARG B 1 74  ? -31.960 15.090  -1.617  1.00 31.63 ? 63   ARG B HB3  1 
ATOM   8651  H HG2  . ARG B 1 74  ? -30.764 13.395  -2.615  1.00 41.54 ? 63   ARG B HG2  1 
ATOM   8652  H HG3  . ARG B 1 74  ? -31.912 13.160  -3.695  1.00 41.54 ? 63   ARG B HG3  1 
ATOM   8653  H HD2  . ARG B 1 74  ? -31.437 15.180  -4.692  1.00 56.66 ? 63   ARG B HD2  1 
ATOM   8654  H HD3  . ARG B 1 74  ? -30.370 15.517  -3.563  1.00 56.66 ? 63   ARG B HD3  1 
ATOM   8655  H HE   . ARG B 1 74  ? -29.870 14.087  -5.739  1.00 63.88 ? 63   ARG B HE   1 
ATOM   8656  H HH11 . ARG B 1 74  ? -28.839 14.221  -2.578  1.00 68.48 ? 63   ARG B HH11 1 
ATOM   8657  H HH12 . ARG B 1 74  ? -27.510 13.592  -2.818  1.00 68.48 ? 63   ARG B HH12 1 
ATOM   8658  H HH21 . ARG B 1 74  ? -27.837 13.155  -6.073  1.00 78.06 ? 63   ARG B HH21 1 
ATOM   8659  H HH22 . ARG B 1 74  ? -26.907 12.949  -4.928  1.00 78.06 ? 63   ARG B HH22 1 
ATOM   8660  N N    . MET B 1 75  ? -33.546 14.588  0.650   1.00 19.05 ? 64   MET B N    1 
ATOM   8661  C CA   . MET B 1 75  ? -34.180 15.349  1.716   1.00 19.00 ? 64   MET B CA   1 
ATOM   8662  C C    . MET B 1 75  ? -34.629 16.698  1.197   1.00 14.99 ? 64   MET B C    1 
ATOM   8663  O O    . MET B 1 75  ? -33.843 17.427  0.580   1.00 16.01 ? 64   MET B O    1 
ATOM   8664  C CB   . MET B 1 75  ? -33.129 15.634  2.791   1.00 19.61 ? 64   MET B CB   1 
ATOM   8665  C CG   . MET B 1 75  ? -32.618 14.441  3.559   1.00 21.26 ? 64   MET B CG   1 
ATOM   8666  S SD   . MET B 1 75  ? -31.237 14.953  4.579   1.00 19.67 ? 64   MET B SD   1 
ATOM   8667  C CE   . MET B 1 75  ? -32.023 16.125  5.640   1.00 18.33 ? 64   MET B CE   1 
ATOM   8668  H H    . MET B 1 75  ? -32.724 14.396  0.814   1.00 22.86 ? 64   MET B H    1 
ATOM   8669  H HA   . MET B 1 75  ? -34.923 14.858  2.100   1.00 22.80 ? 64   MET B HA   1 
ATOM   8670  H HB2  . MET B 1 75  ? -32.365 16.053  2.366   1.00 23.54 ? 64   MET B HB2  1 
ATOM   8671  H HB3  . MET B 1 75  ? -33.514 16.248  3.437   1.00 23.54 ? 64   MET B HB3  1 
ATOM   8672  H HG2  . MET B 1 75  ? -33.319 14.095  4.133   1.00 25.51 ? 64   MET B HG2  1 
ATOM   8673  H HG3  . MET B 1 75  ? -32.312 13.759  2.940   1.00 25.51 ? 64   MET B HG3  1 
ATOM   8674  H HE1  . MET B 1 75  ? -31.365 16.485  6.256   1.00 22.00 ? 64   MET B HE1  1 
ATOM   8675  H HE2  . MET B 1 75  ? -32.397 16.839  5.100   1.00 22.00 ? 64   MET B HE2  1 
ATOM   8676  H HE3  . MET B 1 75  ? -32.730 15.680  6.134   1.00 22.00 ? 64   MET B HE3  1 
ATOM   8677  N N    . VAL B 1 76  ? -35.854 17.061  1.524   1.00 14.88 ? 65   VAL B N    1 
ATOM   8678  C CA   . VAL B 1 76  ? -36.381 18.389  1.304   1.00 14.11 ? 65   VAL B CA   1 
ATOM   8679  C C    . VAL B 1 76  ? -36.771 18.924  2.685   1.00 14.41 ? 65   VAL B C    1 
ATOM   8680  O O    . VAL B 1 76  ? -37.633 18.344  3.349   1.00 14.76 ? 65   VAL B O    1 
ATOM   8681  C CB   . VAL B 1 76  ? -37.598 18.386  0.380   1.00 15.78 ? 65   VAL B CB   1 
ATOM   8682  C CG1  . VAL B 1 76  ? -37.940 19.841  0.058   1.00 16.46 ? 65   VAL B CG1  1 
ATOM   8683  C CG2  . VAL B 1 76  ? -37.364 17.551  -0.892  1.00 16.92 ? 65   VAL B CG2  1 
ATOM   8684  H H    . VAL B 1 76  ? -36.423 16.529  1.890   1.00 17.85 ? 65   VAL B H    1 
ATOM   8685  H HA   . VAL B 1 76  ? -35.696 18.961  0.924   1.00 16.93 ? 65   VAL B HA   1 
ATOM   8686  H HB   . VAL B 1 76  ? -38.351 18.000  0.855   1.00 18.94 ? 65   VAL B HB   1 
ATOM   8687  H HG11 . VAL B 1 76  ? -38.713 19.861  -0.528  1.00 19.75 ? 65   VAL B HG11 1 
ATOM   8688  H HG12 . VAL B 1 76  ? -38.140 20.309  0.885   1.00 19.75 ? 65   VAL B HG12 1 
ATOM   8689  H HG13 . VAL B 1 76  ? -37.180 20.254  -0.380  1.00 19.75 ? 65   VAL B HG13 1 
ATOM   8690  H HG21 . VAL B 1 76  ? -38.163 17.582  -1.440  1.00 20.31 ? 65   VAL B HG21 1 
ATOM   8691  H HG22 . VAL B 1 76  ? -36.613 17.924  -1.379  1.00 20.31 ? 65   VAL B HG22 1 
ATOM   8692  H HG23 . VAL B 1 76  ? -37.172 16.635  -0.637  1.00 20.31 ? 65   VAL B HG23 1 
ATOM   8693  N N    . ILE B 1 77  ? -36.111 19.982  3.125   1.00 13.67 ? 66   ILE B N    1 
ATOM   8694  C CA   . ILE B 1 77  ? -36.296 20.540  4.462   1.00 12.53 ? 66   ILE B CA   1 
ATOM   8695  C C    . ILE B 1 77  ? -36.862 21.953  4.343   1.00 12.54 ? 66   ILE B C    1 
ATOM   8696  O O    . ILE B 1 77  ? -36.662 22.646  3.334   1.00 13.01 ? 66   ILE B O    1 
ATOM   8697  C CB   . ILE B 1 77  ? -34.981 20.567  5.264   1.00 12.86 ? 66   ILE B CB   1 
ATOM   8698  C CG1  . ILE B 1 77  ? -33.891 21.388  4.572   1.00 14.34 ? 66   ILE B CG1  1 
ATOM   8699  C CG2  . ILE B 1 77  ? -34.503 19.147  5.574   1.00 14.73 ? 66   ILE B CG2  1 
ATOM   8700  C CD1  . ILE B 1 77  ? -32.633 21.606  5.425   1.00 16.10 ? 66   ILE B CD1  1 
ATOM   8701  H H    . ILE B 1 77  ? -35.530 20.409  2.655   1.00 16.40 ? 66   ILE B H    1 
ATOM   8702  H HA   . ILE B 1 77  ? -36.936 19.997  4.948   1.00 15.04 ? 66   ILE B HA   1 
ATOM   8703  H HB   . ILE B 1 77  ? -35.171 20.998  6.112   1.00 15.43 ? 66   ILE B HB   1 
ATOM   8704  H HG12 . ILE B 1 77  ? -33.623 20.929  3.761   1.00 17.21 ? 66   ILE B HG12 1 
ATOM   8705  H HG13 . ILE B 1 77  ? -34.252 22.261  4.350   1.00 17.21 ? 66   ILE B HG13 1 
ATOM   8706  H HG21 . ILE B 1 77  ? -33.675 19.196  6.078   1.00 17.68 ? 66   ILE B HG21 1 
ATOM   8707  H HG22 . ILE B 1 77  ? -35.182 18.692  6.096   1.00 17.68 ? 66   ILE B HG22 1 
ATOM   8708  H HG23 . ILE B 1 77  ? -34.355 18.675  4.740   1.00 17.68 ? 66   ILE B HG23 1 
ATOM   8709  H HD11 . ILE B 1 77  ? -31.995 22.132  4.917   1.00 19.32 ? 66   ILE B HD11 1 
ATOM   8710  H HD12 . ILE B 1 77  ? -32.880 22.076  6.236   1.00 19.32 ? 66   ILE B HD12 1 
ATOM   8711  H HD13 . ILE B 1 77  ? -32.249 20.743  5.646   1.00 19.32 ? 66   ILE B HD13 1 
ATOM   8712  N N    . PRO B 1 78  ? -37.504 22.453  5.393   1.00 13.09 ? 67   PRO B N    1 
ATOM   8713  C CA   . PRO B 1 78  ? -37.776 23.892  5.449   1.00 12.19 ? 67   PRO B CA   1 
ATOM   8714  C C    . PRO B 1 78  ? -36.479 24.672  5.390   1.00 12.77 ? 67   PRO B C    1 
ATOM   8715  O O    . PRO B 1 78  ? -35.463 24.265  5.943   1.00 12.73 ? 67   PRO B O    1 
ATOM   8716  C CB   . PRO B 1 78  ? -38.456 24.071  6.814   1.00 13.43 ? 67   PRO B CB   1 
ATOM   8717  C CG   . PRO B 1 78  ? -38.979 22.712  7.208   1.00 12.76 ? 67   PRO B CG   1 
ATOM   8718  C CD   . PRO B 1 78  ? -37.889 21.787  6.638   1.00 12.73 ? 67   PRO B CD   1 
ATOM   8719  H HA   . PRO B 1 78  ? -38.372 24.168  4.735   1.00 14.63 ? 67   PRO B HA   1 
ATOM   8720  H HB2  . PRO B 1 78  ? -37.806 24.386  7.461   1.00 16.11 ? 67   PRO B HB2  1 
ATOM   8721  H HB3  . PRO B 1 78  ? -39.186 24.704  6.731   1.00 16.11 ? 67   PRO B HB3  1 
ATOM   8722  H HG2  . PRO B 1 78  ? -39.034 22.640  8.174   1.00 15.32 ? 67   PRO B HG2  1 
ATOM   8723  H HG3  . PRO B 1 78  ? -39.838 22.547  6.790   1.00 15.32 ? 67   PRO B HG3  1 
ATOM   8724  H HD2  . PRO B 1 78  ? -37.134 21.739  7.244   1.00 15.28 ? 67   PRO B HD2  1 
ATOM   8725  H HD3  . PRO B 1 78  ? -38.255 20.907  6.453   1.00 15.28 ? 67   PRO B HD3  1 
ATOM   8726  N N    . GLY B 1 79  ? -36.505 25.809  4.713   1.00 12.60 ? 68   GLY B N    1 
ATOM   8727  C CA   . GLY B 1 79  ? -35.326 26.675  4.738   1.00 12.69 ? 68   GLY B CA   1 
ATOM   8728  C C    . GLY B 1 79  ? -34.966 27.099  6.147   1.00 12.42 ? 68   GLY B C    1 
ATOM   8729  O O    . GLY B 1 79  ? -35.813 27.283  7.017   1.00 13.13 ? 68   GLY B O    1 
ATOM   8730  H H    . GLY B 1 79  ? -37.165 26.099  4.245   1.00 15.12 ? 68   GLY B H    1 
ATOM   8731  H HA2  . GLY B 1 79  ? -34.569 26.204  4.354   1.00 15.23 ? 68   GLY B HA2  1 
ATOM   8732  H HA3  . GLY B 1 79  ? -35.495 27.470  4.210   1.00 15.23 ? 68   GLY B HA3  1 
ATOM   8733  N N    . GLY B 1 80  ? -33.672 27.268  6.381   1.00 12.92 ? 69   GLY B N    1 
ATOM   8734  C CA   . GLY B 1 80  ? -33.231 27.688  7.687   1.00 13.47 ? 69   GLY B CA   1 
ATOM   8735  C C    . GLY B 1 80  ? -33.696 29.089  8.022   1.00 11.64 ? 69   GLY B C    1 
ATOM   8736  O O    . GLY B 1 80  ? -33.836 29.946  7.155   1.00 12.87 ? 69   GLY B O    1 
ATOM   8737  H H    . GLY B 1 80  ? -33.044 27.147  5.806   1.00 15.51 ? 69   GLY B H    1 
ATOM   8738  H HA2  . GLY B 1 80  ? -33.578 27.079  8.358   1.00 16.17 ? 69   GLY B HA2  1 
ATOM   8739  H HA3  . GLY B 1 80  ? -32.262 27.667  7.724   1.00 16.17 ? 69   GLY B HA3  1 
ATOM   8740  N N    . ILE B 1 81  ? -33.855 29.336  9.320   1.00 11.60 ? 70   ILE B N    1 
ATOM   8741  C CA   . ILE B 1 81  ? -34.104 30.668  9.872   1.00 10.92 ? 70   ILE B CA   1 
ATOM   8742  C C    . ILE B 1 81  ? -32.912 31.031  10.721  1.00 11.45 ? 70   ILE B C    1 
ATOM   8743  O O    . ILE B 1 81  ? -32.696 30.442  11.786  1.00 11.76 ? 70   ILE B O    1 
ATOM   8744  C CB   . ILE B 1 81  ? -35.379 30.722  10.717  1.00 12.40 ? 70   ILE B CB   1 
ATOM   8745  C CG1  . ILE B 1 81  ? -36.611 30.270  9.906   1.00 12.73 ? 70   ILE B CG1  1 
ATOM   8746  C CG2  . ILE B 1 81  ? -35.595 32.112  11.239  1.00 13.51 ? 70   ILE B CG2  1 
ATOM   8747  C CD1  . ILE B 1 81  ? -37.890 30.116  10.762  1.00 13.97 ? 70   ILE B CD1  1 
ATOM   8748  H H    . ILE B 1 81  ? -33.822 28.724  9.923   1.00 13.92 ? 70   ILE B H    1 
ATOM   8749  H HA   . ILE B 1 81  ? -34.181 31.313  9.151   1.00 13.10 ? 70   ILE B HA   1 
ATOM   8750  H HB   . ILE B 1 81  ? -35.272 30.123  11.472  1.00 14.88 ? 70   ILE B HB   1 
ATOM   8751  H HG12 . ILE B 1 81  ? -36.792 30.929  9.217   1.00 15.27 ? 70   ILE B HG12 1 
ATOM   8752  H HG13 . ILE B 1 81  ? -36.421 29.411  9.499   1.00 15.27 ? 70   ILE B HG13 1 
ATOM   8753  H HG21 . ILE B 1 81  ? -36.406 32.126  11.771  1.00 16.22 ? 70   ILE B HG21 1 
ATOM   8754  H HG22 . ILE B 1 81  ? -34.835 32.364  11.786  1.00 16.22 ? 70   ILE B HG22 1 
ATOM   8755  H HG23 . ILE B 1 81  ? -35.679 32.721  10.489  1.00 16.22 ? 70   ILE B HG23 1 
ATOM   8756  H HD11 . ILE B 1 81  ? -38.620 29.831  10.190  1.00 16.76 ? 70   ILE B HD11 1 
ATOM   8757  H HD12 . ILE B 1 81  ? -37.730 29.451  11.451  1.00 16.76 ? 70   ILE B HD12 1 
ATOM   8758  H HD13 . ILE B 1 81  ? -38.102 30.970  11.169  1.00 16.76 ? 70   ILE B HD13 1 
ATOM   8759  N N    . ASP B 1 82  ? -32.125 32.014  10.282  1.00 11.19 ? 71   ASP B N    1 
ATOM   8760  C CA   . ASP B 1 82  ? -30.988 32.482  11.060  1.00 11.90 ? 71   ASP B CA   1 
ATOM   8761  C C    . ASP B 1 82  ? -31.530 33.566  11.973  1.00 10.84 ? 71   ASP B C    1 
ATOM   8762  O O    . ASP B 1 82  ? -31.803 34.695  11.553  1.00 12.18 ? 71   ASP B O    1 
ATOM   8763  C CB   . ASP B 1 82  ? -29.870 33.002  10.174  1.00 12.12 ? 71   ASP B CB   1 
ATOM   8764  C CG   . ASP B 1 82  ? -28.658 33.416  10.939  1.00 11.77 ? 71   ASP B CG   1 
ATOM   8765  O OD1  . ASP B 1 82  ? -28.731 33.568  12.170  1.00 11.75 ? 71   ASP B OD1  1 
ATOM   8766  O OD2  . ASP B 1 82  ? -27.576 33.502  10.283  1.00 11.62 ? 71   ASP B OD2  1 
ATOM   8767  H H    . ASP B 1 82  ? -32.232 32.424  9.534   1.00 13.43 ? 71   ASP B H    1 
ATOM   8768  H HA   . ASP B 1 82  ? -30.643 31.757  11.605  1.00 14.28 ? 71   ASP B HA   1 
ATOM   8769  H HB2  . ASP B 1 82  ? -29.608 32.303  9.555   1.00 14.54 ? 71   ASP B HB2  1 
ATOM   8770  H HB3  . ASP B 1 82  ? -30.191 33.774  9.683   1.00 14.54 ? 71   ASP B HB3  1 
ATOM   8771  N N    . VAL B 1 83  ? -31.720 33.218  13.232  1.00 10.33 ? 72   VAL B N    1 
ATOM   8772  C CA   . VAL B 1 83  ? -32.307 34.077  14.240  1.00 10.61 ? 72   VAL B CA   1 
ATOM   8773  C C    . VAL B 1 83  ? -31.399 35.233  14.646  1.00 11.46 ? 72   VAL B C    1 
ATOM   8774  O O    . VAL B 1 83  ? -31.851 36.080  15.433  1.00 11.61 ? 72   VAL B O    1 
ATOM   8775  C CB   . VAL B 1 83  ? -32.703 33.321  15.515  1.00 10.87 ? 72   VAL B CB   1 
ATOM   8776  C CG1  . VAL B 1 83  ? -33.875 32.345  15.232  1.00 12.83 ? 72   VAL B CG1  1 
ATOM   8777  C CG2  . VAL B 1 83  ? -31.543 32.579  16.129  1.00 11.79 ? 72   VAL B CG2  1 
ATOM   8778  H H    . VAL B 1 83  ? -31.504 32.445  13.541  1.00 12.40 ? 72   VAL B H    1 
ATOM   8779  H HA   . VAL B 1 83  ? -33.116 34.464  13.871  1.00 12.73 ? 72   VAL B HA   1 
ATOM   8780  H HB   . VAL B 1 83  ? -33.014 33.966  16.170  1.00 13.04 ? 72   VAL B HB   1 
ATOM   8781  H HG11 . VAL B 1 83  ? -34.105 31.881  16.053  1.00 15.40 ? 72   VAL B HG11 1 
ATOM   8782  H HG12 . VAL B 1 83  ? -34.638 32.852  14.913  1.00 15.40 ? 72   VAL B HG12 1 
ATOM   8783  H HG13 . VAL B 1 83  ? -33.597 31.705  14.558  1.00 15.40 ? 72   VAL B HG13 1 
ATOM   8784  H HG21 . VAL B 1 83  ? -31.848 32.121  16.928  1.00 14.14 ? 72   VAL B HG21 1 
ATOM   8785  H HG22 . VAL B 1 83  ? -31.206 31.934  15.487  1.00 14.14 ? 72   VAL B HG22 1 
ATOM   8786  H HG23 . VAL B 1 83  ? -30.847 33.214  16.357  1.00 14.14 ? 72   VAL B HG23 1 
ATOM   8787  N N    . HIS B 1 84  ? -30.159 35.304  14.145  1.00 11.10 ? 73   HIS B N    1 
ATOM   8788  C CA   . HIS B 1 84  ? -29.254 36.379  14.566  1.00 11.59 ? 73   HIS B CA   1 
ATOM   8789  C C    . HIS B 1 84  ? -28.336 36.763  13.405  1.00 11.81 ? 73   HIS B C    1 
ATOM   8790  O O    . HIS B 1 84  ? -27.293 36.122  13.215  1.00 11.64 ? 73   HIS B O    1 
ATOM   8791  C CB   . HIS B 1 84  ? -28.435 35.945  15.783  1.00 11.40 ? 73   HIS B CB   1 
ATOM   8792  C CG   . HIS B 1 84  ? -27.735 37.066  16.471  1.00 11.13 ? 73   HIS B CG   1 
ATOM   8793  N ND1  . HIS B 1 84  ? -27.412 37.009  17.789  1.00 11.78 ? 73   HIS B ND1  1 
ATOM   8794  C CD2  . HIS B 1 84  ? -27.320 38.287  16.040  1.00 11.06 ? 73   HIS B CD2  1 
ATOM   8795  C CE1  . HIS B 1 84  ? -26.793 38.122  18.161  1.00 12.06 ? 73   HIS B CE1  1 
ATOM   8796  N NE2  . HIS B 1 84  ? -26.741 38.948  17.117  1.00 12.49 ? 73   HIS B NE2  1 
ATOM   8797  H H    . HIS B 1 84  ? -29.825 34.755  13.574  1.00 13.32 ? 73   HIS B H    1 
ATOM   8798  H HA   . HIS B 1 84  ? -29.776 37.159  14.812  1.00 13.90 ? 73   HIS B HA   1 
ATOM   8799  H HB2  . HIS B 1 84  ? -29.030 35.528  16.427  1.00 13.68 ? 73   HIS B HB2  1 
ATOM   8800  H HB3  . HIS B 1 84  ? -27.763 35.308  15.496  1.00 13.68 ? 73   HIS B HB3  1 
ATOM   8801  H HD1  . HIS B 1 84  ? -27.560 36.335  18.302  1.00 14.13 ? 73   HIS B HD1  1 
ATOM   8802  H HD2  . HIS B 1 84  ? -27.413 38.623  15.178  1.00 13.27 ? 73   HIS B HD2  1 
ATOM   8803  H HE1  . HIS B 1 84  ? -26.483 38.311  19.017  1.00 14.47 ? 73   HIS B HE1  1 
ATOM   8804  N N    . THR B 1 85  ? -28.671 37.836  12.693  1.00 11.50 ? 74   THR B N    1 
ATOM   8805  C CA   . THR B 1 85  ? -27.737 38.430  11.737  1.00 12.21 ? 74   THR B CA   1 
ATOM   8806  C C    . THR B 1 85  ? -27.555 39.897  12.116  1.00 12.88 ? 74   THR B C    1 
ATOM   8807  O O    . THR B 1 85  ? -28.415 40.504  12.780  1.00 12.39 ? 74   THR B O    1 
ATOM   8808  C CB   . THR B 1 85  ? -28.219 38.256  10.284  1.00 12.24 ? 74   THR B CB   1 
ATOM   8809  O OG1  . THR B 1 85  ? -29.470 38.896  10.093  1.00 13.19 ? 74   THR B OG1  1 
ATOM   8810  C CG2  . THR B 1 85  ? -28.367 36.795  9.914   1.00 13.67 ? 74   THR B CG2  1 
ATOM   8811  H H    . THR B 1 85  ? -29.429 38.238  12.743  1.00 13.80 ? 74   THR B H    1 
ATOM   8812  H HA   . THR B 1 85  ? -26.877 37.990  11.821  1.00 14.65 ? 74   THR B HA   1 
ATOM   8813  H HB   . THR B 1 85  ? -27.566 38.653  9.686   1.00 14.69 ? 74   THR B HB   1 
ATOM   8814  H HG1  . THR B 1 85  ? -29.401 39.717  10.257  1.00 15.83 ? 74   THR B HG1  1 
ATOM   8815  H HG21 . THR B 1 85  ? -28.670 36.715  8.996   1.00 16.41 ? 74   THR B HG21 1 
ATOM   8816  H HG22 . THR B 1 85  ? -27.514 36.342  10.004  1.00 16.41 ? 74   THR B HG22 1 
ATOM   8817  H HG23 . THR B 1 85  ? -29.013 36.369  10.498  1.00 16.41 ? 74   THR B HG23 1 
ATOM   8818  N N    . ARG B 1 86  ? -26.432 40.486  11.658  1.00 12.69 ? 75   ARG B N    1 
ATOM   8819  C CA   . ARG B 1 86  ? -26.115 41.891  11.846  1.00 13.25 ? 75   ARG B CA   1 
ATOM   8820  C C    . ARG B 1 86  ? -25.487 42.412  10.555  1.00 14.28 ? 75   ARG B C    1 
ATOM   8821  O O    . ARG B 1 86  ? -24.376 42.912  10.518  1.00 15.52 ? 75   ARG B O    1 
ATOM   8822  C CB   . ARG B 1 86  ? -25.222 42.083  13.065  1.00 13.86 ? 75   ARG B CB   1 
ATOM   8823  C CG   . ARG B 1 86  ? -25.919 41.651  14.367  1.00 13.83 ? 75   ARG B CG   1 
ATOM   8824  C CD   . ARG B 1 86  ? -25.071 41.995  15.613  1.00 14.18 ? 75   ARG B CD   1 
ATOM   8825  N NE   . ARG B 1 86  ? -25.823 41.753  16.835  1.00 13.24 ? 75   ARG B NE   1 
ATOM   8826  C CZ   . ARG B 1 86  ? -26.612 42.633  17.435  1.00 13.87 ? 75   ARG B CZ   1 
ATOM   8827  N NH1  . ARG B 1 86  ? -26.746 43.860  16.955  1.00 15.48 ? 75   ARG B NH1  1 
ATOM   8828  N NH2  . ARG B 1 86  ? -27.221 42.293  18.597  1.00 14.11 ? 75   ARG B NH2  1 
ATOM   8829  H H    . ARG B 1 86  ? -25.825 40.063  11.221  1.00 15.23 ? 75   ARG B H    1 
ATOM   8830  H HA   . ARG B 1 86  ? -26.937 42.382  11.998  1.00 15.89 ? 75   ARG B HA   1 
ATOM   8831  H HB2  . ARG B 1 86  ? -24.420 41.547  12.959  1.00 16.63 ? 75   ARG B HB2  1 
ATOM   8832  H HB3  . ARG B 1 86  ? -24.989 43.021  13.143  1.00 16.63 ? 75   ARG B HB3  1 
ATOM   8833  H HG2  . ARG B 1 86  ? -26.769 42.113  14.443  1.00 16.60 ? 75   ARG B HG2  1 
ATOM   8834  H HG3  . ARG B 1 86  ? -26.060 40.692  14.351  1.00 16.60 ? 75   ARG B HG3  1 
ATOM   8835  H HD2  . ARG B 1 86  ? -24.278 41.436  15.627  1.00 17.01 ? 75   ARG B HD2  1 
ATOM   8836  H HD3  . ARG B 1 86  ? -24.824 42.932  15.587  1.00 17.01 ? 75   ARG B HD3  1 
ATOM   8837  H HE   . ARG B 1 86  ? -25.750 40.977  17.197  1.00 15.89 ? 75   ARG B HE   1 
ATOM   8838  H HH11 . ARG B 1 86  ? -26.346 44.083  16.227  1.00 18.57 ? 75   ARG B HH11 1 
ATOM   8839  H HH12 . ARG B 1 86  ? -27.255 44.425  17.356  1.00 18.57 ? 75   ARG B HH12 1 
ATOM   8840  H HH21 . ARG B 1 86  ? -27.132 41.498  18.913  1.00 16.94 ? 75   ARG B HH21 1 
ATOM   8841  H HH22 . ARG B 1 86  ? -27.736 42.857  18.993  1.00 16.94 ? 75   ARG B HH22 1 
ATOM   8842  N N    . PHE B 1 87  ? -26.244 42.304  9.473   1.00 14.81 ? 76   PHE B N    1 
ATOM   8843  C CA   . PHE B 1 87  ? -25.783 42.782  8.179   1.00 14.90 ? 76   PHE B CA   1 
ATOM   8844  C C    . PHE B 1 87  ? -25.796 44.304  8.115   1.00 15.70 ? 76   PHE B C    1 
ATOM   8845  O O    . PHE B 1 87  ? -26.645 44.975  8.694   1.00 16.85 ? 76   PHE B O    1 
ATOM   8846  C CB   . PHE B 1 87  ? -26.705 42.236  7.082   1.00 15.54 ? 76   PHE B CB   1 
ATOM   8847  C CG   . PHE B 1 87  ? -26.806 40.719  7.030   1.00 14.66 ? 76   PHE B CG   1 
ATOM   8848  C CD1  . PHE B 1 87  ? -25.681 39.910  7.185   1.00 14.07 ? 76   PHE B CD1  1 
ATOM   8849  C CD2  . PHE B 1 87  ? -28.034 40.085  6.774   1.00 14.74 ? 76   PHE B CD2  1 
ATOM   8850  C CE1  . PHE B 1 87  ? -25.756 38.548  7.084   1.00 14.73 ? 76   PHE B CE1  1 
ATOM   8851  C CE2  . PHE B 1 87  ? -28.108 38.706  6.693   1.00 13.68 ? 76   PHE B CE2  1 
ATOM   8852  C CZ   . PHE B 1 87  ? -26.965 37.953  6.843   1.00 13.68 ? 76   PHE B CZ   1 
ATOM   8853  H H    . PHE B 1 87  ? -27.031 41.958  9.461   1.00 17.77 ? 76   PHE B H    1 
ATOM   8854  H HA   . PHE B 1 87  ? -24.879 42.468  8.015   1.00 17.88 ? 76   PHE B HA   1 
ATOM   8855  H HB2  . PHE B 1 87  ? -27.598 42.584  7.228   1.00 18.64 ? 76   PHE B HB2  1 
ATOM   8856  H HB3  . PHE B 1 87  ? -26.374 42.537  6.222   1.00 18.64 ? 76   PHE B HB3  1 
ATOM   8857  H HD1  . PHE B 1 87  ? -24.854 40.309  7.336   1.00 16.88 ? 76   PHE B HD1  1 
ATOM   8858  H HD2  . PHE B 1 87  ? -28.802 40.596  6.660   1.00 17.69 ? 76   PHE B HD2  1 
ATOM   8859  H HE1  . PHE B 1 87  ? -24.994 38.029  7.200   1.00 17.68 ? 76   PHE B HE1  1 
ATOM   8860  H HE2  . PHE B 1 87  ? -28.923 38.291  6.527   1.00 16.42 ? 76   PHE B HE2  1 
ATOM   8861  H HZ   . PHE B 1 87  ? -27.017 37.026  6.797   1.00 16.42 ? 76   PHE B HZ   1 
ATOM   8862  N N    . GLN B 1 88  ? -24.845 44.861  7.371   1.00 16.06 ? 77   GLN B N    1 
ATOM   8863  C CA   . GLN B 1 88  ? -24.797 46.297  7.117   1.00 18.44 ? 77   GLN B CA   1 
ATOM   8864  C C    . GLN B 1 88  ? -24.722 47.082  8.405   1.00 18.03 ? 77   GLN B C    1 
ATOM   8865  O O    . GLN B 1 88  ? -25.132 48.233  8.459   1.00 21.23 ? 77   GLN B O    1 
ATOM   8866  C CB   . GLN B 1 88  ? -26.036 46.741  6.305   1.00 20.76 ? 77   GLN B CB   1 
ATOM   8867  C CG   . GLN B 1 88  ? -25.800 47.916  5.408   1.00 21.91 ? 77   GLN B CG   1 
ATOM   8868  C CD   . GLN B 1 88  ? -26.831 48.040  4.304   1.00 22.89 ? 77   GLN B CD   1 
ATOM   8869  O OE1  . GLN B 1 88  ? -27.379 47.036  3.786   1.00 19.02 ? 77   GLN B OE1  1 
ATOM   8870  N NE2  . GLN B 1 88  ? -27.059 49.257  3.894   1.00 24.12 ? 77   GLN B NE2  1 
ATOM   8871  H H    . GLN B 1 88  ? -24.207 44.422  6.998   1.00 19.27 ? 77   GLN B H    1 
ATOM   8872  H HA   . GLN B 1 88  ? -24.006 46.500  6.594   1.00 22.13 ? 77   GLN B HA   1 
ATOM   8873  H HB2  . GLN B 1 88  ? -26.324 46.000  5.749   1.00 24.91 ? 77   GLN B HB2  1 
ATOM   8874  H HB3  . GLN B 1 88  ? -26.743 46.980  6.924   1.00 24.91 ? 77   GLN B HB3  1 
ATOM   8875  H HG2  . GLN B 1 88  ? -25.831 48.727  5.938   1.00 26.29 ? 77   GLN B HG2  1 
ATOM   8876  H HG3  . GLN B 1 88  ? -24.928 47.825  4.993   1.00 26.29 ? 77   GLN B HG3  1 
ATOM   8877  H HE21 . GLN B 1 88  ? -26.635 49.916  4.248   1.00 28.94 ? 77   GLN B HE21 1 
ATOM   8878  H HE22 . GLN B 1 88  ? -27.632 49.400  3.269   1.00 28.94 ? 77   GLN B HE22 1 
ATOM   8879  N N    . MET B 1 89  ? -24.194 46.479  9.486   1.00 18.36 ? 78   MET B N    1 
ATOM   8880  C CA   . MET B 1 89  ? -24.300 47.166  10.768  1.00 18.24 ? 78   MET B CA   1 
ATOM   8881  C C    . MET B 1 89  ? -23.206 48.225  10.891  1.00 19.25 ? 78   MET B C    1 
ATOM   8882  O O    . MET B 1 89  ? -22.041 47.964  10.561  1.00 19.03 ? 78   MET B O    1 
ATOM   8883  C CB   . MET B 1 89  ? -24.133 46.164  11.892  1.00 18.71 ? 78   MET B CB   1 
ATOM   8884  C CG   . MET B 1 89  ? -24.366 46.729  13.301  1.00 19.09 ? 78   MET B CG   1 
ATOM   8885  S SD   . MET B 1 89  ? -23.712 45.636  14.486  1.00 18.83 ? 78   MET B SD   1 
ATOM   8886  C CE   . MET B 1 89  ? -21.928 45.938  14.131  1.00 25.42 ? 78   MET B CE   1 
ATOM   8887  H H    . MET B 1 89  ? -23.793 45.718  9.499   1.00 22.04 ? 78   MET B H    1 
ATOM   8888  H HA   . MET B 1 89  ? -25.173 47.583  10.847  1.00 21.89 ? 78   MET B HA   1 
ATOM   8889  H HB2  . MET B 1 89  ? -24.766 45.441  11.758  1.00 22.46 ? 78   MET B HB2  1 
ATOM   8890  H HB3  . MET B 1 89  ? -23.229 45.814  11.862  1.00 22.46 ? 78   MET B HB3  1 
ATOM   8891  H HG2  . MET B 1 89  ? -23.916 47.584  13.388  1.00 22.91 ? 78   MET B HG2  1 
ATOM   8892  H HG3  . MET B 1 89  ? -25.318 46.825  13.460  1.00 22.91 ? 78   MET B HG3  1 
ATOM   8893  H HE1  . MET B 1 89  ? -21.392 45.388  14.724  1.00 30.51 ? 78   MET B HE1  1 
ATOM   8894  H HE2  . MET B 1 89  ? -21.746 45.704  13.208  1.00 30.51 ? 78   MET B HE2  1 
ATOM   8895  H HE3  . MET B 1 89  ? -21.732 46.876  14.281  1.00 30.51 ? 78   MET B HE3  1 
ATOM   8896  N N    . PRO B 1 90  ? -23.549 49.419  11.413  1.00 18.75 ? 79   PRO B N    1 
ATOM   8897  C CA   . PRO B 1 90  ? -22.534 50.441  11.683  1.00 20.07 ? 79   PRO B CA   1 
ATOM   8898  C C    . PRO B 1 90  ? -21.698 50.062  12.897  1.00 17.94 ? 79   PRO B C    1 
ATOM   8899  O O    . PRO B 1 90  ? -22.206 49.508  13.855  1.00 20.51 ? 79   PRO B O    1 
ATOM   8900  C CB   . PRO B 1 90  ? -23.383 51.689  12.008  1.00 22.13 ? 79   PRO B CB   1 
ATOM   8901  C CG   . PRO B 1 90  ? -24.746 51.418  11.572  1.00 23.78 ? 79   PRO B CG   1 
ATOM   8902  C CD   . PRO B 1 90  ? -24.913 49.930  11.611  1.00 20.81 ? 79   PRO B CD   1 
ATOM   8903  H HA   . PRO B 1 90  ? -21.969 50.600  10.911  1.00 24.08 ? 79   PRO B HA   1 
ATOM   8904  H HB2  . PRO B 1 90  ? -23.362 51.851  12.964  1.00 26.55 ? 79   PRO B HB2  1 
ATOM   8905  H HB3  . PRO B 1 90  ? -23.023 52.453  11.530  1.00 26.55 ? 79   PRO B HB3  1 
ATOM   8906  H HG2  . PRO B 1 90  ? -25.371 51.846  12.178  1.00 28.54 ? 79   PRO B HG2  1 
ATOM   8907  H HG3  . PRO B 1 90  ? -24.869 51.750  10.668  1.00 28.54 ? 79   PRO B HG3  1 
ATOM   8908  H HD2  . PRO B 1 90  ? -25.255 49.651  12.475  1.00 24.97 ? 79   PRO B HD2  1 
ATOM   8909  H HD3  . PRO B 1 90  ? -25.491 49.636  10.889  1.00 24.97 ? 79   PRO B HD3  1 
ATOM   8910  N N    . ASP B 1 91  ? -20.422 50.463  12.897  1.00 19.04 ? 80   ASP B N    1 
ATOM   8911  C CA   . ASP B 1 91  ? -19.563 50.362  14.081  1.00 20.08 ? 80   ASP B CA   1 
ATOM   8912  C C    . ASP B 1 91  ? -18.475 51.420  13.966  1.00 21.92 ? 80   ASP B C    1 
ATOM   8913  O O    . ASP B 1 91  ? -17.659 51.370  13.044  1.00 21.86 ? 80   ASP B O    1 
ATOM   8914  C CB   . ASP B 1 91  ? -18.941 48.955  14.171  1.00 20.93 ? 80   ASP B CB   1 
ATOM   8915  C CG   . ASP B 1 91  ? -18.188 48.706  15.461  1.00 24.83 ? 80   ASP B CG   1 
ATOM   8916  O OD1  . ASP B 1 91  ? -17.362 49.539  15.821  1.00 30.75 ? 80   ASP B OD1  1 
ATOM   8917  O OD2  . ASP B 1 91  ? -18.394 47.654  16.108  1.00 23.05 ? 80   ASP B OD2  1 
ATOM   8918  H H    . ASP B 1 91  ? -20.026 50.802  12.212  1.00 22.85 ? 80   ASP B H    1 
ATOM   8919  H HA   . ASP B 1 91  ? -20.082 50.530  14.882  1.00 24.10 ? 80   ASP B HA   1 
ATOM   8920  H HB2  . ASP B 1 91  ? -19.649 48.295  14.108  1.00 25.11 ? 80   ASP B HB2  1 
ATOM   8921  H HB3  . ASP B 1 91  ? -18.317 48.840  13.436  1.00 25.11 ? 80   ASP B HB3  1 
ATOM   8922  N N    A GLN B 1 92  ? -18.457 52.370  14.903  0.44 23.88 ? 81   GLN B N    1 
ATOM   8923  N N    B GLN B 1 92  ? -18.480 52.389  14.875  0.56 23.84 ? 81   GLN B N    1 
ATOM   8924  C CA   A GLN B 1 92  ? -17.468 53.465  14.910  0.44 26.01 ? 81   GLN B CA   1 
ATOM   8925  C CA   B GLN B 1 92  ? -17.437 53.418  14.901  0.56 29.75 ? 81   GLN B CA   1 
ATOM   8926  C C    A GLN B 1 92  ? -17.307 54.098  13.534  0.44 28.36 ? 81   GLN B C    1 
ATOM   8927  C C    B GLN B 1 92  ? -17.291 54.078  13.529  0.56 31.77 ? 81   GLN B C    1 
ATOM   8928  O O    A GLN B 1 92  ? -16.194 54.379  13.076  0.44 29.84 ? 81   GLN B O    1 
ATOM   8929  O O    B GLN B 1 92  ? -16.182 54.344  13.057  0.56 35.14 ? 81   GLN B O    1 
ATOM   8930  C CB   A GLN B 1 92  ? -16.115 52.994  15.424  0.44 28.06 ? 81   GLN B CB   1 
ATOM   8931  C CB   B GLN B 1 92  ? -16.112 52.814  15.387  0.56 37.23 ? 81   GLN B CB   1 
ATOM   8932  C CG   A GLN B 1 92  ? -16.134 52.470  16.818  0.44 25.57 ? 81   GLN B CG   1 
ATOM   8933  C CG   B GLN B 1 92  ? -16.161 52.269  16.837  0.56 43.45 ? 81   GLN B CG   1 
ATOM   8934  C CD   A GLN B 1 92  ? -16.571 53.492  17.857  0.44 30.32 ? 81   GLN B CD   1 
ATOM   8935  C CD   B GLN B 1 92  ? -14.921 51.446  17.272  0.56 49.10 ? 81   GLN B CD   1 
ATOM   8936  O OE1  A GLN B 1 92  ? -16.738 54.676  17.573  0.44 29.16 ? 81   GLN B OE1  1 
ATOM   8937  O OE1  B GLN B 1 92  ? -14.807 51.046  18.444  0.56 48.37 ? 81   GLN B OE1  1 
ATOM   8938  N NE2  A GLN B 1 92  ? -16.741 53.027  19.078  0.44 33.33 ? 81   GLN B NE2  1 
ATOM   8939  N NE2  B GLN B 1 92  ? -14.011 51.182  16.338  0.56 52.20 ? 81   GLN B NE2  1 
ATOM   8940  H H    A GLN B 1 92  ? -19.014 52.407  15.557  0.44 28.66 ? 81   GLN B H    1 
ATOM   8941  H H    B GLN B 1 92  ? -19.075 52.477  15.489  0.56 28.61 ? 81   GLN B H    1 
ATOM   8942  H HA   A GLN B 1 92  ? -17.783 54.157  15.513  0.44 31.22 ? 81   GLN B HA   1 
ATOM   8943  H HA   B GLN B 1 92  ? -17.696 54.107  15.533  0.56 35.70 ? 81   GLN B HA   1 
ATOM   8944  H HB2  A GLN B 1 92  ? -15.795 52.284  14.846  0.44 33.68 ? 81   GLN B HB2  1 
ATOM   8945  H HB2  B GLN B 1 92  ? -15.871 52.079  14.803  0.56 44.67 ? 81   GLN B HB2  1 
ATOM   8946  H HB3  A GLN B 1 92  ? -15.497 53.740  15.398  0.44 33.68 ? 81   GLN B HB3  1 
ATOM   8947  H HB3  B GLN B 1 92  ? -15.426 53.499  15.352  0.56 44.67 ? 81   GLN B HB3  1 
ATOM   8948  H HG2  A GLN B 1 92  ? -16.749 51.721  16.862  0.44 30.68 ? 81   GLN B HG2  1 
ATOM   8949  H HG2  B GLN B 1 92  ? -16.242 53.020  17.446  0.56 52.14 ? 81   GLN B HG2  1 
ATOM   8950  H HG3  A GLN B 1 92  ? -15.240 52.174  17.052  0.44 30.68 ? 81   GLN B HG3  1 
ATOM   8951  H HG3  B GLN B 1 92  ? -16.938 51.695  16.924  0.56 52.14 ? 81   GLN B HG3  1 
ATOM   8952  H HE21 A GLN B 1 92  ? -16.988 53.556  19.710  0.44 40.00 ? 81   GLN B HE21 1 
ATOM   8953  H HE21 B GLN B 1 92  ? -14.125 51.465  15.534  0.56 62.64 ? 81   GLN B HE21 1 
ATOM   8954  H HE22 A GLN B 1 92  ? -16.605 52.194  19.244  0.44 40.00 ? 81   GLN B HE22 1 
ATOM   8955  H HE22 B GLN B 1 92  ? -13.308 50.728  16.538  0.56 62.64 ? 81   GLN B HE22 1 
ATOM   8956  N N    . GLY B 1 93  ? -18.422 54.329  12.863  1.00 25.90 ? 82   GLY B N    1 
ATOM   8957  C CA   . GLY B 1 93  ? -18.396 55.014  11.584  1.00 28.23 ? 82   GLY B CA   1 
ATOM   8958  C C    . GLY B 1 93  ? -18.091 54.123  10.412  1.00 28.97 ? 82   GLY B C    1 
ATOM   8959  O O    . GLY B 1 93  ? -18.186 54.576  9.269   1.00 30.11 ? 82   GLY B O    1 
ATOM   8960  H H    . GLY B 1 93  ? -19.208 54.104  13.131  1.00 31.08 ? 82   GLY B H    1 
ATOM   8961  H HA2  . GLY B 1 93  ? -19.259 55.430  11.430  1.00 33.87 ? 82   GLY B HA2  1 
ATOM   8962  H HA3  . GLY B 1 93  ? -17.725 55.714  11.614  1.00 33.87 ? 82   GLY B HA3  1 
ATOM   8963  N N    . MET B 1 94  ? -17.722 52.877  10.664  1.00 23.20 ? 83   MET B N    1 
ATOM   8964  C CA   . MET B 1 94  ? -17.585 51.893  9.621   1.00 23.02 ? 83   MET B CA   1 
ATOM   8965  C C    . MET B 1 94  ? -18.941 51.249  9.421   1.00 22.12 ? 83   MET B C    1 
ATOM   8966  O O    . MET B 1 94  ? -19.892 51.475  10.185  1.00 25.96 ? 83   MET B O    1 
ATOM   8967  C CB   . MET B 1 94  ? -16.502 50.866  9.997   1.00 22.27 ? 83   MET B CB   1 
ATOM   8968  C CG   . MET B 1 94  ? -15.089 51.493  10.088  1.00 23.67 ? 83   MET B CG   1 
ATOM   8969  S SD   . MET B 1 94  ? -13.772 50.304  10.527  1.00 32.05 ? 83   MET B SD   1 
ATOM   8970  C CE   . MET B 1 94  ? -14.145 50.087  12.235  1.00 37.18 ? 83   MET B CE   1 
ATOM   8971  H H    . MET B 1 94  ? -17.544 52.576  11.450  1.00 27.83 ? 83   MET B H    1 
ATOM   8972  H HA   . MET B 1 94  ? -17.315 52.333  8.799   1.00 27.62 ? 83   MET B HA   1 
ATOM   8973  H HB2  . MET B 1 94  ? -16.716 50.483  10.862  1.00 26.72 ? 83   MET B HB2  1 
ATOM   8974  H HB3  . MET B 1 94  ? -16.478 50.170  9.323   1.00 26.72 ? 83   MET B HB3  1 
ATOM   8975  H HG2  . MET B 1 94  ? -14.864 51.879  9.228   1.00 28.41 ? 83   MET B HG2  1 
ATOM   8976  H HG3  . MET B 1 94  ? -15.099 52.186  10.767  1.00 28.41 ? 83   MET B HG3  1 
ATOM   8977  H HE1  . MET B 1 94  ? -13.510 49.462  12.619  1.00 44.62 ? 83   MET B HE1  1 
ATOM   8978  H HE2  . MET B 1 94  ? -14.078 50.944  12.684  1.00 44.62 ? 83   MET B HE2  1 
ATOM   8979  H HE3  . MET B 1 94  ? -15.046 49.738  12.319  1.00 44.62 ? 83   MET B HE3  1 
ATOM   8980  N N    A THR B 1 95  ? -19.048 50.473  8.354   0.45 22.63 ? 84   THR B N    1 
ATOM   8981  N N    B THR B 1 95  ? -19.053 50.494  8.347   0.55 21.12 ? 84   THR B N    1 
ATOM   8982  C CA   A THR B 1 95  ? -20.212 49.646  8.080   0.45 22.42 ? 84   THR B CA   1 
ATOM   8983  C CA   B THR B 1 95  ? -20.203 49.639  8.130   0.55 20.89 ? 84   THR B CA   1 
ATOM   8984  C C    A THR B 1 95  ? -19.723 48.266  7.693   0.45 20.16 ? 84   THR B C    1 
ATOM   8985  C C    B THR B 1 95  ? -19.677 48.267  7.762   0.55 19.09 ? 84   THR B C    1 
ATOM   8986  O O    A THR B 1 95  ? -18.751 48.125  6.949   0.45 20.57 ? 84   THR B O    1 
ATOM   8987  O O    B THR B 1 95  ? -18.611 48.132  7.155   0.55 21.36 ? 84   THR B O    1 
ATOM   8988  C CB   A THR B 1 95  ? -21.035 50.205  6.927   0.45 23.78 ? 84   THR B CB   1 
ATOM   8989  C CB   B THR B 1 95  ? -21.131 50.214  7.050   0.55 22.95 ? 84   THR B CB   1 
ATOM   8990  O OG1  A THR B 1 95  ? -21.579 51.477  7.303   0.45 27.30 ? 84   THR B OG1  1 
ATOM   8991  O OG1  B THR B 1 95  ? -22.372 49.502  7.044   0.55 25.84 ? 84   THR B OG1  1 
ATOM   8992  C CG2  A THR B 1 95  ? -22.163 49.263  6.564   0.45 23.40 ? 84   THR B CG2  1 
ATOM   8993  C CG2  B THR B 1 95  ? -20.482 50.176  5.664   0.55 23.02 ? 84   THR B CG2  1 
ATOM   8994  H H    A THR B 1 95  ? -18.437 50.407  7.753   0.45 27.16 ? 84   THR B H    1 
ATOM   8995  H H    B THR B 1 95  ? -18.467 50.457  7.719   0.55 25.35 ? 84   THR B H    1 
ATOM   8996  H HA   A THR B 1 95  ? -20.771 49.579  8.870   0.45 26.90 ? 84   THR B HA   1 
ATOM   8997  H HA   B THR B 1 95  ? -20.707 49.562  8.955   0.55 25.07 ? 84   THR B HA   1 
ATOM   8998  H HB   A THR B 1 95  ? -20.466 50.316  6.150   0.45 28.54 ? 84   THR B HB   1 
ATOM   8999  H HB   B THR B 1 95  ? -21.311 51.143  7.262   0.55 27.54 ? 84   THR B HB   1 
ATOM   9000  H HG1  A THR B 1 95  ? -22.072 51.390  7.979   0.45 32.76 ? 84   THR B HG1  1 
ATOM   9001  H HG1  B THR B 1 95  ? -22.747 49.572  7.792   0.55 31.01 ? 84   THR B HG1  1 
ATOM   9002  H HG21 A THR B 1 95  ? -22.678 49.631  5.829   0.45 28.08 ? 84   THR B HG21 1 
ATOM   9003  H HG21 B THR B 1 95  ? -21.089 50.545  5.004   0.55 27.62 ? 84   THR B HG21 1 
ATOM   9004  H HG22 A THR B 1 95  ? -21.803 48.403  6.296   0.45 28.08 ? 84   THR B HG22 1 
ATOM   9005  H HG22 B THR B 1 95  ? -19.664 50.698  5.667   0.55 27.62 ? 84   THR B HG22 1 
ATOM   9006  H HG23 A THR B 1 95  ? -22.748 49.136  7.327   0.45 28.08 ? 84   THR B HG23 1 
ATOM   9007  H HG23 B THR B 1 95  ? -20.270 49.261  5.422   0.55 27.62 ? 84   THR B HG23 1 
ATOM   9008  N N    . SER B 1 96  ? -20.404 47.246  8.182   1.00 19.16 ? 85   SER B N    1 
ATOM   9009  C CA   . SER B 1 96  ? -20.001 45.880  7.893   1.00 17.62 ? 85   SER B CA   1 
ATOM   9010  C C    . SER B 1 96  ? -19.668 45.662  6.420   1.00 19.06 ? 85   SER B C    1 
ATOM   9011  O O    . SER B 1 96  ? -20.310 46.175  5.493   1.00 20.26 ? 85   SER B O    1 
ATOM   9012  C CB   . SER B 1 96  ? -21.137 44.943  8.298   1.00 17.40 ? 85   SER B CB   1 
ATOM   9013  O OG   . SER B 1 96  ? -20.842 43.607  7.867   1.00 16.98 ? 85   SER B OG   1 
ATOM   9014  H H    A SER B 1 96  ? -21.101 47.314  8.681   0.45 22.99 ? 85   SER B H    1 
ATOM   9015  H H    B SER B 1 96  ? -21.133 47.315  8.634   0.55 22.99 ? 85   SER B H    1 
ATOM   9016  H HA   . SER B 1 96  ? -19.218 45.657  8.420   1.00 21.15 ? 85   SER B HA   1 
ATOM   9017  H HB2  . SER B 1 96  ? -21.231 44.953  9.264   1.00 20.88 ? 85   SER B HB2  1 
ATOM   9018  H HB3  . SER B 1 96  ? -21.960 45.239  7.879   1.00 20.88 ? 85   SER B HB3  1 
ATOM   9019  H HG   . SER B 1 96  ? -20.128 43.342  8.222   1.00 20.38 ? 85   SER B HG   1 
ATOM   9020  N N    . ALA B 1 97  ? -18.684 44.802  6.224   1.00 17.91 ? 86   ALA B N    1 
ATOM   9021  C CA   . ALA B 1 97  ? -18.298 44.395  4.883   1.00 18.49 ? 86   ALA B CA   1 
ATOM   9022  C C    . ALA B 1 97  ? -19.433 43.706  4.124   1.00 19.30 ? 86   ALA B C    1 
ATOM   9023  O O    . ALA B 1 97  ? -19.447 43.745  2.890   1.00 19.87 ? 86   ALA B O    1 
ATOM   9024  C CB   . ALA B 1 97  ? -17.081 43.484  4.967   1.00 21.82 ? 86   ALA B CB   1 
ATOM   9025  H H    . ALA B 1 97  ? -18.222 44.438  6.851   1.00 21.49 ? 86   ALA B H    1 
ATOM   9026  H HA   . ALA B 1 97  ? -18.043 45.184  4.380   1.00 22.19 ? 86   ALA B HA   1 
ATOM   9027  H HB1  . ALA B 1 97  ? -16.827 43.214  4.070   1.00 26.18 ? 86   ALA B HB1  1 
ATOM   9028  H HB2  . ALA B 1 97  ? -16.353 43.968  5.386   1.00 26.18 ? 86   ALA B HB2  1 
ATOM   9029  H HB3  . ALA B 1 97  ? -17.308 42.703  5.496   1.00 26.18 ? 86   ALA B HB3  1 
ATOM   9030  N N    . ASP B 1 98  ? -20.378 43.050  4.816   1.00 16.08 ? 87   ASP B N    1 
ATOM   9031  C CA   . ASP B 1 98  ? -21.498 42.362  4.184   1.00 15.34 ? 87   ASP B CA   1 
ATOM   9032  C C    . ASP B 1 98  ? -22.755 43.186  4.462   1.00 16.62 ? 87   ASP B C    1 
ATOM   9033  O O    . ASP B 1 98  ? -23.200 43.262  5.611   1.00 16.75 ? 87   ASP B O    1 
ATOM   9034  C CB   . ASP B 1 98  ? -21.638 40.962  4.744   1.00 15.93 ? 87   ASP B CB   1 
ATOM   9035  C CG   . ASP B 1 98  ? -20.509 40.027  4.297   1.00 16.37 ? 87   ASP B CG   1 
ATOM   9036  O OD1  . ASP B 1 98  ? -19.986 40.206  3.180   1.00 19.75 ? 87   ASP B OD1  1 
ATOM   9037  O OD2  . ASP B 1 98  ? -20.164 39.113  5.085   1.00 15.80 ? 87   ASP B OD2  1 
ATOM   9038  H H    . ASP B 1 98  ? -20.384 42.992  5.674   1.00 19.30 ? 87   ASP B H    1 
ATOM   9039  H HA   . ASP B 1 98  ? -21.358 42.309  3.226   1.00 18.41 ? 87   ASP B HA   1 
ATOM   9040  H HB2  . ASP B 1 98  ? -21.624 41.007  5.713   1.00 19.12 ? 87   ASP B HB2  1 
ATOM   9041  H HB3  . ASP B 1 98  ? -22.478 40.584  4.441   1.00 19.12 ? 87   ASP B HB3  1 
ATOM   9042  N N    . ASP B 1 99  ? -23.312 43.809  3.411   1.00 16.86 ? 88   ASP B N    1 
ATOM   9043  C CA   . ASP B 1 99  ? -24.556 44.555  3.532   1.00 15.88 ? 88   ASP B CA   1 
ATOM   9044  C C    . ASP B 1 99  ? -25.746 43.595  3.474   1.00 15.01 ? 88   ASP B C    1 
ATOM   9045  O O    . ASP B 1 99  ? -25.582 42.375  3.466   1.00 15.58 ? 88   ASP B O    1 
ATOM   9046  C CB   . ASP B 1 99  ? -24.617 45.703  2.513   1.00 16.87 ? 88   ASP B CB   1 
ATOM   9047  C CG   . ASP B 1 99  ? -24.681 45.231  1.055   1.00 19.01 ? 88   ASP B CG   1 
ATOM   9048  O OD1  . ASP B 1 99  ? -24.966 44.040  0.799   1.00 17.45 ? 88   ASP B OD1  1 
ATOM   9049  O OD2  . ASP B 1 99  ? -24.455 46.105  0.167   1.00 22.16 ? 88   ASP B OD2  1 
ATOM   9050  H H    . ASP B 1 99  ? -22.980 43.810  2.618   1.00 20.23 ? 88   ASP B H    1 
ATOM   9051  H HA   . ASP B 1 99  ? -24.571 44.964  4.412   1.00 19.06 ? 88   ASP B HA   1 
ATOM   9052  H HB2  . ASP B 1 99  ? -25.409 46.234  2.688   1.00 20.25 ? 88   ASP B HB2  1 
ATOM   9053  H HB3  . ASP B 1 99  ? -23.824 46.252  2.613   1.00 20.25 ? 88   ASP B HB3  1 
ATOM   9054  N N    . PHE B 1 100 ? -26.964 44.137  3.422   1.00 16.27 ? 89   PHE B N    1 
ATOM   9055  C CA   . PHE B 1 100 ? -28.132 43.255  3.404   1.00 15.30 ? 89   PHE B CA   1 
ATOM   9056  C C    . PHE B 1 100 ? -28.205 42.415  2.150   1.00 15.42 ? 89   PHE B C    1 
ATOM   9057  O O    . PHE B 1 100 ? -28.827 41.347  2.170   1.00 17.28 ? 89   PHE B O    1 
ATOM   9058  C CB   . PHE B 1 100 ? -29.442 44.011  3.639   1.00 15.29 ? 89   PHE B CB   1 
ATOM   9059  C CG   . PHE B 1 100 ? -29.797 44.097  5.090   1.00 14.29 ? 89   PHE B CG   1 
ATOM   9060  C CD1  . PHE B 1 100 ? -30.430 43.044  5.720   1.00 15.76 ? 89   PHE B CD1  1 
ATOM   9061  C CD2  . PHE B 1 100 ? -29.478 45.215  5.838   1.00 16.95 ? 89   PHE B CD2  1 
ATOM   9062  C CE1  . PHE B 1 100 ? -30.733 43.104  7.045   1.00 16.29 ? 89   PHE B CE1  1 
ATOM   9063  C CE2  . PHE B 1 100 ? -29.784 45.278  7.189   1.00 17.36 ? 89   PHE B CE2  1 
ATOM   9064  C CZ   . PHE B 1 100 ? -30.421 44.235  7.799   1.00 15.58 ? 89   PHE B CZ   1 
ATOM   9065  H H    . PHE B 1 100 ? -27.138 44.979  3.398   1.00 19.52 ? 89   PHE B H    1 
ATOM   9066  H HA   . PHE B 1 100 ? -28.038 42.635  4.144   1.00 18.36 ? 89   PHE B HA   1 
ATOM   9067  H HB2  . PHE B 1 100 ? -29.353 44.914  3.296   1.00 18.34 ? 89   PHE B HB2  1 
ATOM   9068  H HB3  . PHE B 1 100 ? -30.161 43.550  3.179   1.00 18.34 ? 89   PHE B HB3  1 
ATOM   9069  H HD1  . PHE B 1 100 ? -30.647 42.282  5.234   1.00 18.92 ? 89   PHE B HD1  1 
ATOM   9070  H HD2  . PHE B 1 100 ? -29.044 45.930  5.432   1.00 20.34 ? 89   PHE B HD2  1 
ATOM   9071  H HE1  . PHE B 1 100 ? -31.166 42.388  7.450   1.00 19.55 ? 89   PHE B HE1  1 
ATOM   9072  H HE2  . PHE B 1 100 ? -29.570 46.040  7.678   1.00 20.83 ? 89   PHE B HE2  1 
ATOM   9073  H HZ   . PHE B 1 100 ? -30.634 44.274  8.704   1.00 18.69 ? 89   PHE B HZ   1 
ATOM   9074  N N    . PHE B 1 101 ? -27.625 42.871  1.047   1.00 16.44 ? 90   PHE B N    1 
ATOM   9075  C CA   . PHE B 1 101 ? -27.620 42.063  -0.167  1.00 17.80 ? 90   PHE B CA   1 
ATOM   9076  C C    . PHE B 1 101 ? -26.631 40.906  -0.031  1.00 15.35 ? 90   PHE B C    1 
ATOM   9077  O O    . PHE B 1 101 ? -26.987 39.727  -0.204  1.00 16.50 ? 90   PHE B O    1 
ATOM   9078  C CB   . PHE B 1 101 ? -27.246 42.905  -1.386  1.00 17.16 ? 90   PHE B CB   1 
ATOM   9079  C CG   . PHE B 1 101 ? -27.022 42.057  -2.601  1.00 16.56 ? 90   PHE B CG   1 
ATOM   9080  C CD1  . PHE B 1 101 ? -28.084 41.408  -3.209  1.00 18.00 ? 90   PHE B CD1  1 
ATOM   9081  C CD2  . PHE B 1 101 ? -25.746 41.853  -3.120  1.00 19.37 ? 90   PHE B CD2  1 
ATOM   9082  C CE1  . PHE B 1 101 ? -27.872 40.567  -4.313  1.00 20.24 ? 90   PHE B CE1  1 
ATOM   9083  C CE2  . PHE B 1 101 ? -25.545 41.040  -4.216  1.00 23.33 ? 90   PHE B CE2  1 
ATOM   9084  C CZ   . PHE B 1 101 ? -26.614 40.413  -4.820  1.00 21.36 ? 90   PHE B CZ   1 
ATOM   9085  H H    . PHE B 1 101 ? -27.232 43.633  0.974   1.00 19.72 ? 90   PHE B H    1 
ATOM   9086  H HA   . PHE B 1 101 ? -28.505 41.693  -0.310  1.00 21.36 ? 90   PHE B HA   1 
ATOM   9087  H HB2  . PHE B 1 101 ? -27.966 43.525  -1.578  1.00 20.60 ? 90   PHE B HB2  1 
ATOM   9088  H HB3  . PHE B 1 101 ? -26.427 43.390  -1.200  1.00 20.60 ? 90   PHE B HB3  1 
ATOM   9089  H HD1  . PHE B 1 101 ? -28.943 41.513  -2.869  1.00 21.60 ? 90   PHE B HD1  1 
ATOM   9090  H HD2  . PHE B 1 101 ? -25.018 42.275  -2.723  1.00 23.24 ? 90   PHE B HD2  1 
ATOM   9091  H HE1  . PHE B 1 101 ? -28.593 40.149  -4.725  1.00 24.29 ? 90   PHE B HE1  1 
ATOM   9092  H HE2  . PHE B 1 101 ? -24.688 40.926  -4.557  1.00 27.99 ? 90   PHE B HE2  1 
ATOM   9093  H HZ   . PHE B 1 101 ? -26.474 39.865  -5.558  1.00 25.63 ? 90   PHE B HZ   1 
ATOM   9094  N N    . GLN B 1 102 ? -25.366 41.237  0.260   1.00 15.67 ? 91   GLN B N    1 
ATOM   9095  C CA   . GLN B 1 102 ? -24.326 40.233  0.263   1.00 16.37 ? 91   GLN B CA   1 
ATOM   9096  C C    . GLN B 1 102 ? -24.579 39.218  1.375   1.00 14.63 ? 91   GLN B C    1 
ATOM   9097  O O    . GLN B 1 102 ? -24.348 38.004  1.208   1.00 15.31 ? 91   GLN B O    1 
ATOM   9098  C CB   . GLN B 1 102 ? -22.959 40.883  0.437   1.00 17.90 ? 91   GLN B CB   1 
ATOM   9099  C CG   . GLN B 1 102 ? -21.833 39.898  0.128   1.00 20.61 ? 91   GLN B CG   1 
ATOM   9100  C CD   . GLN B 1 102 ? -21.922 39.364  -1.300  1.00 22.01 ? 91   GLN B CD   1 
ATOM   9101  O OE1  . GLN B 1 102 ? -22.122 40.120  -2.264  1.00 25.84 ? 91   GLN B OE1  1 
ATOM   9102  N NE2  . GLN B 1 102 ? -21.778 38.046  -1.441  1.00 22.42 ? 91   GLN B NE2  1 
ATOM   9103  H H    . GLN B 1 102 ? -25.098 42.030  0.456   1.00 18.80 ? 91   GLN B H    1 
ATOM   9104  H HA   . GLN B 1 102 ? -24.333 39.763  -0.586  1.00 19.65 ? 91   GLN B HA   1 
ATOM   9105  H HB2  . GLN B 1 102 ? -22.882 41.634  -0.171  1.00 21.48 ? 91   GLN B HB2  1 
ATOM   9106  H HB3  . GLN B 1 102 ? -22.861 41.180  1.354   1.00 21.48 ? 91   GLN B HB3  1 
ATOM   9107  H HG2  . GLN B 1 102 ? -20.979 40.347  0.231   1.00 24.73 ? 91   GLN B HG2  1 
ATOM   9108  H HG3  . GLN B 1 102 ? -21.891 39.145  0.737   1.00 24.73 ? 91   GLN B HG3  1 
ATOM   9109  H HE21 . GLN B 1 102 ? -21.644 37.552  -0.750  1.00 26.90 ? 91   GLN B HE21 1 
ATOM   9110  H HE22 . GLN B 1 102 ? -21.819 37.691  -2.223  1.00 26.90 ? 91   GLN B HE22 1 
ATOM   9111  N N    . GLY B 1 103 ? -25.012 39.700  2.542   1.00 14.95 ? 92   GLY B N    1 
ATOM   9112  C CA   . GLY B 1 103 ? -25.219 38.812  3.670   1.00 15.02 ? 92   GLY B CA   1 
ATOM   9113  C C    . GLY B 1 103 ? -26.349 37.828  3.437   1.00 14.14 ? 92   GLY B C    1 
ATOM   9114  O O    . GLY B 1 103 ? -26.239 36.655  3.785   1.00 14.13 ? 92   GLY B O    1 
ATOM   9115  H H    . GLY B 1 103 ? -25.190 40.527  2.699   1.00 17.93 ? 92   GLY B H    1 
ATOM   9116  H HA2  . GLY B 1 103 ? -24.406 38.310  3.839   1.00 18.02 ? 92   GLY B HA2  1 
ATOM   9117  H HA3  . GLY B 1 103 ? -25.426 39.336  4.460   1.00 18.02 ? 92   GLY B HA3  1 
ATOM   9118  N N    . THR B 1 104 ? -27.430 38.274  2.777   1.00 13.99 ? 93   THR B N    1 
ATOM   9119  C CA   . THR B 1 104 ? -28.550 37.389  2.496   1.00 14.31 ? 93   THR B CA   1 
ATOM   9120  C C    . THR B 1 104 ? -28.278 36.479  1.311   1.00 14.55 ? 93   THR B C    1 
ATOM   9121  O O    . THR B 1 104 ? -28.772 35.348  1.283   1.00 14.43 ? 93   THR B O    1 
ATOM   9122  C CB   . THR B 1 104 ? -29.858 38.156  2.299   1.00 14.38 ? 93   THR B CB   1 
ATOM   9123  O OG1  . THR B 1 104 ? -29.773 39.056  1.210   1.00 15.19 ? 93   THR B OG1  1 
ATOM   9124  C CG2  . THR B 1 104 ? -30.254 38.858  3.565   1.00 14.78 ? 93   THR B CG2  1 
ATOM   9125  H H    . THR B 1 104 ? -27.530 39.077  2.488   1.00 16.78 ? 93   THR B H    1 
ATOM   9126  H HA   . THR B 1 104 ? -28.675 36.815  3.267   1.00 17.17 ? 93   THR B HA   1 
ATOM   9127  H HB   . THR B 1 104 ? -30.556 37.512  2.102   1.00 17.26 ? 93   THR B HB   1 
ATOM   9128  H HG1  . THR B 1 104 ? -29.160 39.614  1.346   1.00 18.23 ? 93   THR B HG1  1 
ATOM   9129  H HG21 . THR B 1 104 ? -31.084 39.341  3.430   1.00 17.73 ? 93   THR B HG21 1 
ATOM   9130  H HG22 . THR B 1 104 ? -30.377 38.211  4.278   1.00 17.73 ? 93   THR B HG22 1 
ATOM   9131  H HG23 . THR B 1 104 ? -29.562 39.486  3.826   1.00 17.73 ? 93   THR B HG23 1 
ATOM   9132  N N    . LYS B 1 105 ? -27.443 36.926  0.360   1.00 14.68 ? 94   LYS B N    1 
ATOM   9133  C CA   . LYS B 1 105 ? -26.962 36.030  -0.690  1.00 13.41 ? 94   LYS B CA   1 
ATOM   9134  C C    . LYS B 1 105 ? -26.194 34.876  -0.054  1.00 14.67 ? 94   LYS B C    1 
ATOM   9135  O O    . LYS B 1 105 ? -26.384 33.708  -0.400  1.00 14.30 ? 94   LYS B O    1 
ATOM   9136  C CB   . LYS B 1 105 ? -26.087 36.835  -1.677  1.00 16.12 ? 94   LYS B CB   1 
ATOM   9137  C CG   . LYS B 1 105 ? -25.566 36.011  -2.817  1.00 18.65 ? 94   LYS B CG   1 
ATOM   9138  C CD   . LYS B 1 105 ? -24.862 36.918  -3.841  1.00 19.43 ? 94   LYS B CD   1 
ATOM   9139  C CE   . LYS B 1 105 ? -24.246 36.107  -4.957  1.00 20.29 ? 94   LYS B CE   1 
ATOM   9140  N NZ   . LYS B 1 105 ? -23.563 37.005  -5.937  1.00 23.23 ? 94   LYS B NZ   1 
ATOM   9141  H H    . LYS B 1 105 ? -27.148 37.731  0.305   1.00 17.61 ? 94   LYS B H    1 
ATOM   9142  H HA   . LYS B 1 105 ? -27.718 35.666  -1.177  1.00 16.09 ? 94   LYS B HA   1 
ATOM   9143  H HB2  . LYS B 1 105 ? -26.617 37.558  -2.049  1.00 19.35 ? 94   LYS B HB2  1 
ATOM   9144  H HB3  . LYS B 1 105 ? -25.326 37.197  -1.197  1.00 19.35 ? 94   LYS B HB3  1 
ATOM   9145  H HG2  . LYS B 1 105 ? -24.923 35.365  -2.484  1.00 22.38 ? 94   LYS B HG2  1 
ATOM   9146  H HG3  . LYS B 1 105 ? -26.304 35.562  -3.257  1.00 22.38 ? 94   LYS B HG3  1 
ATOM   9147  H HD2  . LYS B 1 105 ? -25.510 37.527  -4.229  1.00 23.32 ? 94   LYS B HD2  1 
ATOM   9148  H HD3  . LYS B 1 105 ? -24.156 37.415  -3.399  1.00 23.32 ? 94   LYS B HD3  1 
ATOM   9149  H HE2  . LYS B 1 105 ? -23.588 35.497  -4.589  1.00 24.34 ? 94   LYS B HE2  1 
ATOM   9150  H HE3  . LYS B 1 105 ? -24.941 35.616  -5.423  1.00 24.34 ? 94   LYS B HE3  1 
ATOM   9151  H HZ1  . LYS B 1 105 ? -23.202 36.523  -6.591  1.00 27.87 ? 94   LYS B HZ1  1 
ATOM   9152  H HZ2  . LYS B 1 105 ? -24.150 37.575  -6.287  1.00 27.87 ? 94   LYS B HZ2  1 
ATOM   9153  H HZ3  . LYS B 1 105 ? -22.920 37.467  -5.529  1.00 27.87 ? 94   LYS B HZ3  1 
ATOM   9154  N N    . ALA B 1 106 ? -25.305 35.205  0.883   1.00 14.29 ? 95   ALA B N    1 
ATOM   9155  C CA   . ALA B 1 106 ? -24.537 34.189  1.608   1.00 13.75 ? 95   ALA B CA   1 
ATOM   9156  C C    . ALA B 1 106 ? -25.440 33.277  2.423   1.00 12.24 ? 95   ALA B C    1 
ATOM   9157  O O    . ALA B 1 106 ? -25.201 32.069  2.504   1.00 14.50 ? 95   ALA B O    1 
ATOM   9158  C CB   . ALA B 1 106 ? -23.482 34.871  2.495   1.00 15.07 ? 95   ALA B CB   1 
ATOM   9159  H H    . ALA B 1 106 ? -25.126 36.012  1.119   1.00 17.15 ? 95   ALA B H    1 
ATOM   9160  H HA   . ALA B 1 106 ? -24.067 33.637  0.964   1.00 16.50 ? 95   ALA B HA   1 
ATOM   9161  H HB1  . ALA B 1 106 ? -22.981 34.190  2.970   1.00 18.08 ? 95   ALA B HB1  1 
ATOM   9162  H HB2  . ALA B 1 106 ? -22.886 35.390  1.933   1.00 18.08 ? 95   ALA B HB2  1 
ATOM   9163  H HB3  . ALA B 1 106 ? -23.931 35.454  3.128   1.00 18.08 ? 95   ALA B HB3  1 
ATOM   9164  N N    . ALA B 1 107 ? -26.442 33.842  3.087   1.00 12.94 ? 96   ALA B N    1 
ATOM   9165  C CA   . ALA B 1 107 ? -27.351 33.004  3.858   1.00 12.73 ? 96   ALA B CA   1 
ATOM   9166  C C    . ALA B 1 107 ? -28.054 31.990  2.958   1.00 12.84 ? 96   ALA B C    1 
ATOM   9167  O O    . ALA B 1 107 ? -28.085 30.783  3.262   1.00 12.93 ? 96   ALA B O    1 
ATOM   9168  C CB   . ALA B 1 107 ? -28.371 33.878  4.581   1.00 13.30 ? 96   ALA B CB   1 
ATOM   9169  H H    . ALA B 1 107 ? -26.614 34.685  3.109   1.00 15.53 ? 96   ALA B H    1 
ATOM   9170  H HA   . ALA B 1 107 ? -26.844 32.515  4.526   1.00 15.27 ? 96   ALA B HA   1 
ATOM   9171  H HB1  . ALA B 1 107 ? -28.970 33.309  5.090   1.00 15.97 ? 96   ALA B HB1  1 
ATOM   9172  H HB2  . ALA B 1 107 ? -27.902 34.483  5.177   1.00 15.97 ? 96   ALA B HB2  1 
ATOM   9173  H HB3  . ALA B 1 107 ? -28.874 34.384  3.924   1.00 15.97 ? 96   ALA B HB3  1 
ATOM   9174  N N    . LEU B 1 108 ? -28.583 32.452  1.803   1.00 14.72 ? 97   LEU B N    1 
ATOM   9175  C CA   . LEU B 1 108 ? -29.252 31.531  0.883   1.00 13.56 ? 97   LEU B CA   1 
ATOM   9176  C C    . LEU B 1 108 ? -28.286 30.455  0.389   1.00 13.97 ? 97   LEU B C    1 
ATOM   9177  O O    . LEU B 1 108 ? -28.650 29.280  0.270   1.00 14.18 ? 97   LEU B O    1 
ATOM   9178  C CB   . LEU B 1 108 ? -29.795 32.328  -0.315  1.00 14.27 ? 97   LEU B CB   1 
ATOM   9179  C CG   . LEU B 1 108 ? -31.022 33.169  0.028   1.00 14.73 ? 97   LEU B CG   1 
ATOM   9180  C CD1  . LEU B 1 108 ? -31.318 34.138  -1.113  1.00 15.27 ? 97   LEU B CD1  1 
ATOM   9181  C CD2  . LEU B 1 108 ? -32.250 32.314  0.305   1.00 14.03 ? 97   LEU B CD2  1 
ATOM   9182  H H    . LEU B 1 108 ? -28.565 33.272  1.544   1.00 17.66 ? 97   LEU B H    1 
ATOM   9183  H HA   . LEU B 1 108 ? -29.995 31.100  1.333   1.00 16.27 ? 97   LEU B HA   1 
ATOM   9184  H HB2  . LEU B 1 108 ? -29.102 32.927  -0.634  1.00 17.12 ? 97   LEU B HB2  1 
ATOM   9185  H HB3  . LEU B 1 108 ? -30.046 31.708  -1.018  1.00 17.12 ? 97   LEU B HB3  1 
ATOM   9186  H HG   . LEU B 1 108 ? -30.834 33.692  0.824   1.00 17.68 ? 97   LEU B HG   1 
ATOM   9187  H HD11 . LEU B 1 108 ? -32.098 34.666  -0.884  1.00 18.32 ? 97   LEU B HD11 1 
ATOM   9188  H HD12 . LEU B 1 108 ? -30.551 34.718  -1.241  1.00 18.32 ? 97   LEU B HD12 1 
ATOM   9189  H HD13 . LEU B 1 108 ? -31.487 33.630  -1.922  1.00 18.32 ? 97   LEU B HD13 1 
ATOM   9190  H HD21 . LEU B 1 108 ? -32.998 32.895  0.517   1.00 16.84 ? 97   LEU B HD21 1 
ATOM   9191  H HD22 . LEU B 1 108 ? -32.453 31.788  -0.484  1.00 16.84 ? 97   LEU B HD22 1 
ATOM   9192  H HD23 . LEU B 1 108 ? -32.064 31.728  1.055   1.00 16.84 ? 97   LEU B HD23 1 
ATOM   9193  N N    . ALA B 1 109 ? -27.034 30.847  0.095   1.00 13.35 ? 98   ALA B N    1 
ATOM   9194  C CA   . ALA B 1 109 ? -26.019 29.894  -0.363  1.00 14.83 ? 98   ALA B CA   1 
ATOM   9195  C C    . ALA B 1 109 ? -25.836 28.733  0.615   1.00 14.77 ? 98   ALA B C    1 
ATOM   9196  O O    . ALA B 1 109 ? -25.475 27.617  0.196   1.00 17.48 ? 98   ALA B O    1 
ATOM   9197  C CB   . ALA B 1 109 ? -24.694 30.610  -0.620  1.00 14.76 ? 98   ALA B CB   1 
ATOM   9198  H H    . ALA B 1 109 ? -26.752 31.657  0.154   1.00 16.02 ? 98   ALA B H    1 
ATOM   9199  H HA   . ALA B 1 109 ? -26.313 29.517  -1.208  1.00 17.79 ? 98   ALA B HA   1 
ATOM   9200  H HB1  . ALA B 1 109 ? -24.039 29.962  -0.921  1.00 17.72 ? 98   ALA B HB1  1 
ATOM   9201  H HB2  . ALA B 1 109 ? -24.828 31.287  -1.301  1.00 17.72 ? 98   ALA B HB2  1 
ATOM   9202  H HB3  . ALA B 1 109 ? -24.395 31.024  0.205   1.00 17.72 ? 98   ALA B HB3  1 
ATOM   9203  N N    . GLY B 1 110 ? -26.034 28.988  1.899   1.00 13.96 ? 99   GLY B N    1 
ATOM   9204  C CA   . GLY B 1 110 ? -25.932 27.969  2.913   1.00 13.65 ? 99   GLY B CA   1 
ATOM   9205  C C    . GLY B 1 110 ? -27.216 27.303  3.318   1.00 14.89 ? 99   GLY B C    1 
ATOM   9206  O O    . GLY B 1 110 ? -27.175 26.446  4.206   1.00 15.45 ? 99   GLY B O    1 
ATOM   9207  H H    . GLY B 1 110 ? -26.233 29.765  2.209   1.00 16.75 ? 99   GLY B H    1 
ATOM   9208  H HA2  . GLY B 1 110 ? -25.329 27.277  2.598   1.00 16.37 ? 99   GLY B HA2  1 
ATOM   9209  H HA3  . GLY B 1 110 ? -25.541 28.362  3.709   1.00 16.37 ? 99   GLY B HA3  1 
ATOM   9210  N N    . GLY B 1 111 ? -28.329 27.592  2.651   1.00 14.00 ? 100  GLY B N    1 
ATOM   9211  C CA   . GLY B 1 111 ? -29.589 26.939  2.979   1.00 13.41 ? 100  GLY B CA   1 
ATOM   9212  C C    . GLY B 1 111 ? -30.515 27.690  3.928   1.00 12.73 ? 100  GLY B C    1 
ATOM   9213  O O    . GLY B 1 111 ? -31.503 27.118  4.378   1.00 15.68 ? 100  GLY B O    1 
ATOM   9214  H H    . GLY B 1 111 ? -28.380 28.160  2.007   1.00 16.81 ? 100  GLY B H    1 
ATOM   9215  H HA2  . GLY B 1 111 ? -30.078 26.780  2.157   1.00 16.09 ? 100  GLY B HA2  1 
ATOM   9216  H HA3  . GLY B 1 111 ? -29.395 26.077  3.379   1.00 16.09 ? 100  GLY B HA3  1 
ATOM   9217  N N    . THR B 1 112 ? -30.223 28.938  4.231   1.00 12.67 ? 101  THR B N    1 
ATOM   9218  C CA   . THR B 1 112 ? -31.022 29.797  5.097   1.00 12.22 ? 101  THR B CA   1 
ATOM   9219  C C    . THR B 1 112 ? -31.870 30.732  4.239   1.00 11.85 ? 101  THR B C    1 
ATOM   9220  O O    . THR B 1 112 ? -31.337 31.456  3.390   1.00 13.97 ? 101  THR B O    1 
ATOM   9221  C CB   . THR B 1 112 ? -30.101 30.574  6.035   1.00 13.63 ? 101  THR B CB   1 
ATOM   9222  O OG1  . THR B 1 112 ? -29.539 29.679  6.995   1.00 14.17 ? 101  THR B OG1  1 
ATOM   9223  C CG2  . THR B 1 112 ? -30.823 31.702  6.768   1.00 13.60 ? 101  THR B CG2  1 
ATOM   9224  H H    . THR B 1 112 ? -29.523 29.337  3.930   1.00 15.20 ? 101  THR B H    1 
ATOM   9225  H HA   . THR B 1 112 ? -31.617 29.250  5.635   1.00 14.67 ? 101  THR B HA   1 
ATOM   9226  H HB   . THR B 1 112 ? -29.383 30.968  5.515   1.00 16.36 ? 101  THR B HB   1 
ATOM   9227  H HG1  . THR B 1 112 ? -29.097 29.080  6.605   1.00 17.00 ? 101  THR B HG1  1 
ATOM   9228  H HG21 . THR B 1 112 ? -30.203 32.169  7.351   1.00 16.32 ? 101  THR B HG21 1 
ATOM   9229  H HG22 . THR B 1 112 ? -31.188 32.333  6.128   1.00 16.32 ? 101  THR B HG22 1 
ATOM   9230  H HG23 . THR B 1 112 ? -31.547 31.340  7.303   1.00 16.32 ? 101  THR B HG23 1 
ATOM   9231  N N    . THR B 1 113 ? -33.182 30.656  4.441   1.00 12.19 ? 102  THR B N    1 
ATOM   9232  C CA   . THR B 1 113 ? -34.153 31.409  3.663   1.00 12.64 ? 102  THR B CA   1 
ATOM   9233  C C    . THR B 1 113 ? -34.823 32.535  4.439   1.00 11.97 ? 102  THR B C    1 
ATOM   9234  O O    . THR B 1 113 ? -35.598 33.292  3.853   1.00 13.27 ? 102  THR B O    1 
ATOM   9235  C CB   . THR B 1 113 ? -35.188 30.449  3.066   1.00 13.66 ? 102  THR B CB   1 
ATOM   9236  O OG1  . THR B 1 113 ? -35.766 29.647  4.111   1.00 13.39 ? 102  THR B OG1  1 
ATOM   9237  C CG2  . THR B 1 113 ? -34.571 29.508  2.044   1.00 13.32 ? 102  THR B CG2  1 
ATOM   9238  H H    . THR B 1 113 ? -33.542 30.159  5.043   1.00 14.63 ? 102  THR B H    1 
ATOM   9239  H HA   . THR B 1 113 ? -33.685 31.820  2.919   1.00 15.16 ? 102  THR B HA   1 
ATOM   9240  H HB   . THR B 1 113 ? -35.887 30.960  2.628   1.00 16.40 ? 102  THR B HB   1 
ATOM   9241  H HG1  . THR B 1 113 ? -36.144 30.140  4.676   1.00 16.06 ? 102  THR B HG1  1 
ATOM   9242  H HG21 . THR B 1 113 ? -35.250 28.915  1.686   1.00 15.98 ? 102  THR B HG21 1 
ATOM   9243  H HG22 . THR B 1 113 ? -34.182 30.018  1.316   1.00 15.98 ? 102  THR B HG22 1 
ATOM   9244  H HG23 . THR B 1 113 ? -33.876 28.975  2.462   1.00 15.98 ? 102  THR B HG23 1 
ATOM   9245  N N    . MET B 1 114 ? -34.537 32.679  5.722   1.00 12.43 ? 103  MET B N    1 
ATOM   9246  C CA   . MET B 1 114 ? -35.010 33.811  6.487   1.00 12.19 ? 103  MET B CA   1 
ATOM   9247  C C    . MET B 1 114 ? -33.941 34.205  7.481   1.00 12.51 ? 103  MET B C    1 
ATOM   9248  O O    . MET B 1 114 ? -33.311 33.347  8.088   1.00 12.94 ? 103  MET B O    1 
ATOM   9249  C CB   . MET B 1 114 ? -36.311 33.495  7.224   1.00 13.28 ? 103  MET B CB   1 
ATOM   9250  C CG   . MET B 1 114 ? -36.895 34.733  7.906   1.00 15.39 ? 103  MET B CG   1 
ATOM   9251  S SD   . MET B 1 114 ? -38.428 34.392  8.727   1.00 15.23 ? 103  MET B SD   1 
ATOM   9252  C CE   . MET B 1 114 ? -38.672 36.051  9.419   1.00 14.59 ? 103  MET B CE   1 
ATOM   9253  H H    . MET B 1 114 ? -34.063 32.124  6.177   1.00 14.92 ? 103  MET B H    1 
ATOM   9254  H HA   . MET B 1 114 ? -35.176 34.555  5.886   1.00 14.62 ? 103  MET B HA   1 
ATOM   9255  H HB2  . MET B 1 114 ? -36.965 33.163  6.590   1.00 15.94 ? 103  MET B HB2  1 
ATOM   9256  H HB3  . MET B 1 114 ? -36.137 32.828  7.906   1.00 15.94 ? 103  MET B HB3  1 
ATOM   9257  H HG2  . MET B 1 114 ? -36.264 35.057  8.568   1.00 18.47 ? 103  MET B HG2  1 
ATOM   9258  H HG3  . MET B 1 114 ? -37.057 35.416  7.237   1.00 18.47 ? 103  MET B HG3  1 
ATOM   9259  H HE1  . MET B 1 114 ? -39.499 36.063  9.926   1.00 17.51 ? 103  MET B HE1  1 
ATOM   9260  H HE2  . MET B 1 114 ? -37.924 36.263  10.000  1.00 17.51 ? 103  MET B HE2  1 
ATOM   9261  H HE3  . MET B 1 114 ? -38.719 36.692  8.693   1.00 17.51 ? 103  MET B HE3  1 
ATOM   9262  N N    . ILE B 1 115 ? -33.745 35.523  7.622   1.00 11.37 ? 104  ILE B N    1 
ATOM   9263  C CA   . ILE B 1 115 ? -32.828 36.091  8.586   1.00 12.00 ? 104  ILE B CA   1 
ATOM   9264  C C    . ILE B 1 115 ? -33.588 37.031  9.509   1.00 11.20 ? 104  ILE B C    1 
ATOM   9265  O O    . ILE B 1 115 ? -34.540 37.701  9.078   1.00 13.30 ? 104  ILE B O    1 
ATOM   9266  C CB   . ILE B 1 115 ? -31.643 36.801  7.914   1.00 13.02 ? 104  ILE B CB   1 
ATOM   9267  C CG1  . ILE B 1 115 ? -32.083 37.986  7.037   1.00 14.31 ? 104  ILE B CG1  1 
ATOM   9268  C CG2  . ILE B 1 115 ? -30.897 35.770  7.058   1.00 14.13 ? 104  ILE B CG2  1 
ATOM   9269  C CD1  . ILE B 1 115 ? -31.942 39.310  7.689   1.00 14.65 ? 104  ILE B CD1  1 
ATOM   9270  H H    . ILE B 1 115 ? -34.150 36.117  7.150   1.00 13.64 ? 104  ILE B H    1 
ATOM   9271  H HA   . ILE B 1 115 ? -32.468 35.373  9.130   1.00 14.40 ? 104  ILE B HA   1 
ATOM   9272  H HB   . ILE B 1 115 ? -31.044 37.128  8.603   1.00 15.62 ? 104  ILE B HB   1 
ATOM   9273  H HG12 . ILE B 1 115 ? -31.543 37.995  6.231   1.00 17.17 ? 104  ILE B HG12 1 
ATOM   9274  H HG13 . ILE B 1 115 ? -33.018 37.871  6.803   1.00 17.17 ? 104  ILE B HG13 1 
ATOM   9275  H HG21 . ILE B 1 115 ? -30.144 36.205  6.626   1.00 16.96 ? 104  ILE B HG21 1 
ATOM   9276  H HG22 . ILE B 1 115 ? -30.581 35.054  7.630   1.00 16.96 ? 104  ILE B HG22 1 
ATOM   9277  H HG23 . ILE B 1 115 ? -31.504 35.417  6.389   1.00 16.96 ? 104  ILE B HG23 1 
ATOM   9278  H HD11 . ILE B 1 115 ? -32.238 39.998  7.073   1.00 17.58 ? 104  ILE B HD11 1 
ATOM   9279  H HD12 . ILE B 1 115 ? -32.487 39.326  8.492   1.00 17.58 ? 104  ILE B HD12 1 
ATOM   9280  H HD13 . ILE B 1 115 ? -31.010 39.451  7.919   1.00 17.58 ? 104  ILE B HD13 1 
ATOM   9281  N N    . ILE B 1 116 ? -33.174 37.083  10.777  1.00 11.57 ? 105  ILE B N    1 
ATOM   9282  C CA   . ILE B 1 116 ? -33.721 38.028  11.729  1.00 11.34 ? 105  ILE B CA   1 
ATOM   9283  C C    . ILE B 1 116 ? -32.535 38.856  12.193  1.00 12.01 ? 105  ILE B C    1 
ATOM   9284  O O    . ILE B 1 116 ? -31.655 38.372  12.930  1.00 11.99 ? 105  ILE B O    1 
ATOM   9285  C CB   . ILE B 1 116 ? -34.501 37.395  12.883  1.00 11.54 ? 105  ILE B CB   1 
ATOM   9286  C CG1  . ILE B 1 116 ? -35.427 36.283  12.378  1.00 12.97 ? 105  ILE B CG1  1 
ATOM   9287  C CG2  . ILE B 1 116 ? -35.315 38.473  13.604  1.00 12.81 ? 105  ILE B CG2  1 
ATOM   9288  C CD1  . ILE B 1 116 ? -36.265 35.603  13.453  1.00 15.17 ? 105  ILE B CD1  1 
ATOM   9289  H H    . ILE B 1 116 ? -32.568 36.570  11.107  1.00 13.89 ? 105  ILE B H    1 
ATOM   9290  H HA   . ILE B 1 116 ? -34.328 38.622  11.260  1.00 13.60 ? 105  ILE B HA   1 
ATOM   9291  H HB   . ILE B 1 116 ? -33.869 37.012  13.512  1.00 13.85 ? 105  ILE B HB   1 
ATOM   9292  H HG12 . ILE B 1 116 ? -36.038 36.662  11.727  1.00 15.56 ? 105  ILE B HG12 1 
ATOM   9293  H HG13 . ILE B 1 116 ? -34.885 35.599  11.955  1.00 15.56 ? 105  ILE B HG13 1 
ATOM   9294  H HG21 . ILE B 1 116 ? -35.806 38.063  14.333  1.00 15.37 ? 105  ILE B HG21 1 
ATOM   9295  H HG22 . ILE B 1 116 ? -34.709 39.147  13.949  1.00 15.37 ? 105  ILE B HG22 1 
ATOM   9296  H HG23 . ILE B 1 116 ? -35.933 38.875  12.973  1.00 15.37 ? 105  ILE B HG23 1 
ATOM   9297  H HD11 . ILE B 1 116 ? -36.814 34.919  13.039  1.00 18.21 ? 105  ILE B HD11 1 
ATOM   9298  H HD12 . ILE B 1 116 ? -35.673 35.202  14.107  1.00 18.21 ? 105  ILE B HD12 1 
ATOM   9299  H HD13 . ILE B 1 116 ? -36.829 36.267  13.879  1.00 18.21 ? 105  ILE B HD13 1 
ATOM   9300  N N    . ASP B 1 117 ? -32.536 40.117  11.777  1.00 12.22 ? 106  ASP B N    1 
ATOM   9301  C CA   . ASP B 1 117 ? -31.439 41.039  12.035  1.00 12.88 ? 106  ASP B CA   1 
ATOM   9302  C C    . ASP B 1 117 ? -31.743 41.859  13.300  1.00 12.69 ? 106  ASP B C    1 
ATOM   9303  O O    . ASP B 1 117 ? -32.718 41.582  14.025  1.00 13.85 ? 106  ASP B O    1 
ATOM   9304  C CB   . ASP B 1 117 ? -31.153 41.819  10.753  1.00 13.08 ? 106  ASP B CB   1 
ATOM   9305  C CG   . ASP B 1 117 ? -29.706 42.234  10.624  1.00 13.45 ? 106  ASP B CG   1 
ATOM   9306  O OD1  . ASP B 1 117 ? -29.340 43.250  11.292  1.00 14.70 ? 106  ASP B OD1  1 
ATOM   9307  O OD2  . ASP B 1 117 ? -28.963 41.584  9.853   1.00 13.61 ? 106  ASP B OD2  1 
ATOM   9308  H H    . ASP B 1 117 ? -33.180 40.471  11.330  1.00 14.66 ? 106  ASP B H    1 
ATOM   9309  H HA   . ASP B 1 117 ? -30.646 40.514  12.226  1.00 15.46 ? 106  ASP B HA   1 
ATOM   9310  H HB2  . ASP B 1 117 ? -31.374 41.263  9.990   1.00 15.69 ? 106  ASP B HB2  1 
ATOM   9311  H HB3  . ASP B 1 117 ? -31.697 42.623  10.746  1.00 15.69 ? 106  ASP B HB3  1 
ATOM   9312  N N    . HIS B 1 118 ? -30.883 42.835  13.574  1.00 13.43 ? 107  HIS B N    1 
ATOM   9313  C CA   . HIS B 1 118 ? -30.902 43.602  14.815  1.00 12.68 ? 107  HIS B CA   1 
ATOM   9314  C C    . HIS B 1 118 ? -30.808 45.083  14.498  1.00 12.96 ? 107  HIS B C    1 
ATOM   9315  O O    . HIS B 1 118 ? -29.759 45.559  14.037  1.00 14.86 ? 107  HIS B O    1 
ATOM   9316  C CB   . HIS B 1 118 ? -29.737 43.211  15.756  1.00 13.34 ? 107  HIS B CB   1 
ATOM   9317  C CG   . HIS B 1 118 ? -29.953 41.927  16.481  1.00 12.87 ? 107  HIS B CG   1 
ATOM   9318  N ND1  . HIS B 1 118 ? -30.504 41.878  17.745  1.00 12.84 ? 107  HIS B ND1  1 
ATOM   9319  C CD2  . HIS B 1 118 ? -29.721 40.642  16.116  1.00 13.26 ? 107  HIS B CD2  1 
ATOM   9320  C CE1  . HIS B 1 118 ? -30.594 40.610  18.128  1.00 12.94 ? 107  HIS B CE1  1 
ATOM   9321  N NE2  . HIS B 1 118 ? -30.079 39.845  17.180  1.00 12.77 ? 107  HIS B NE2  1 
ATOM   9322  H H    . HIS B 1 118 ? -30.257 43.078  13.037  1.00 16.12 ? 107  HIS B H    1 
ATOM   9323  H HA   . HIS B 1 118 ? -31.738 43.440  15.280  1.00 15.21 ? 107  HIS B HA   1 
ATOM   9324  H HB2  . HIS B 1 118 ? -28.927 43.122  15.229  1.00 16.01 ? 107  HIS B HB2  1 
ATOM   9325  H HB3  . HIS B 1 118 ? -29.623 43.910  16.419  1.00 16.01 ? 107  HIS B HB3  1 
ATOM   9326  H HD1  . HIS B 1 118 ? -30.757 42.559  18.205  1.00 15.41 ? 107  HIS B HD1  1 
ATOM   9327  H HD2  . HIS B 1 118 ? -29.335 40.357  15.319  1.00 15.91 ? 107  HIS B HD2  1 
ATOM   9328  H HE1  . HIS B 1 118 ? -30.916 40.314  18.949  1.00 15.53 ? 107  HIS B HE1  1 
ATOM   9329  N N    . VAL B 1 119 ? -31.869 45.816  14.820  1.00 14.03 ? 108  VAL B N    1 
ATOM   9330  C CA   . VAL B 1 119 ? -31.853 47.272  14.752  1.00 14.22 ? 108  VAL B CA   1 
ATOM   9331  C C    . VAL B 1 119 ? -31.040 47.809  15.918  1.00 14.96 ? 108  VAL B C    1 
ATOM   9332  O O    . VAL B 1 119 ? -31.299 47.460  17.065  1.00 15.17 ? 108  VAL B O    1 
ATOM   9333  C CB   . VAL B 1 119 ? -33.290 47.801  14.833  1.00 15.52 ? 108  VAL B CB   1 
ATOM   9334  C CG1  . VAL B 1 119 ? -33.297 49.327  14.825  1.00 16.16 ? 108  VAL B CG1  1 
ATOM   9335  C CG2  . VAL B 1 119 ? -34.098 47.213  13.693  1.00 15.58 ? 108  VAL B CG2  1 
ATOM   9336  H H    . VAL B 1 119 ? -32.619 45.489  15.084  1.00 16.83 ? 108  VAL B H    1 
ATOM   9337  H HA   . VAL B 1 119 ? -31.451 47.565  13.919  1.00 17.06 ? 108  VAL B HA   1 
ATOM   9338  H HB   . VAL B 1 119 ? -33.688 47.504  15.666  1.00 18.63 ? 108  VAL B HB   1 
ATOM   9339  H HG11 . VAL B 1 119 ? -34.214 49.639  14.877  1.00 19.39 ? 108  VAL B HG11 1 
ATOM   9340  H HG12 . VAL B 1 119 ? -32.794 49.649  15.590  1.00 19.39 ? 108  VAL B HG12 1 
ATOM   9341  H HG13 . VAL B 1 119 ? -32.887 49.640  14.003  1.00 19.39 ? 108  VAL B HG13 1 
ATOM   9342  H HG21 . VAL B 1 119 ? -35.007 47.548  13.745  1.00 18.70 ? 108  VAL B HG21 1 
ATOM   9343  H HG22 . VAL B 1 119 ? -33.695 47.478  12.851  1.00 18.70 ? 108  VAL B HG22 1 
ATOM   9344  H HG23 . VAL B 1 119 ? -34.097 46.246  13.771  1.00 18.70 ? 108  VAL B HG23 1 
ATOM   9345  N N    . VAL B 1 120 ? -30.074 48.677  15.634  1.00 15.15 ? 109  VAL B N    1 
ATOM   9346  C CA   . VAL B 1 120 ? -29.238 49.264  16.679  1.00 15.14 ? 109  VAL B CA   1 
ATOM   9347  C C    . VAL B 1 120 ? -29.334 50.782  16.678  1.00 17.02 ? 109  VAL B C    1 
ATOM   9348  O O    . VAL B 1 120 ? -28.521 51.440  16.016  1.00 18.60 ? 109  VAL B O    1 
ATOM   9349  C CB   . VAL B 1 120 ? -27.771 48.812  16.533  1.00 16.62 ? 109  VAL B CB   1 
ATOM   9350  C CG1  . VAL B 1 120 ? -26.934 49.319  17.727  1.00 18.79 ? 109  VAL B CG1  1 
ATOM   9351  C CG2  . VAL B 1 120 ? -27.676 47.285  16.416  1.00 20.62 ? 109  VAL B CG2  1 
ATOM   9352  H H    . VAL B 1 120 ? -29.881 48.944  14.840  1.00 18.18 ? 109  VAL B H    1 
ATOM   9353  H HA   . VAL B 1 120 ? -29.556 48.951  17.541  1.00 18.17 ? 109  VAL B HA   1 
ATOM   9354  H HB   . VAL B 1 120 ? -27.401 49.198  15.724  1.00 19.95 ? 109  VAL B HB   1 
ATOM   9355  H HG11 . VAL B 1 120 ? -26.017 49.025  17.617  1.00 22.55 ? 109  VAL B HG11 1 
ATOM   9356  H HG12 . VAL B 1 120 ? -26.971 50.288  17.750  1.00 22.55 ? 109  VAL B HG12 1 
ATOM   9357  H HG13 . VAL B 1 120 ? -27.303 48.955  18.548  1.00 22.55 ? 109  VAL B HG13 1 
ATOM   9358  H HG21 . VAL B 1 120 ? -26.744 47.033  16.326  1.00 24.75 ? 109  VAL B HG21 1 
ATOM   9359  H HG22 . VAL B 1 120 ? -28.052 46.884  17.215  1.00 24.75 ? 109  VAL B HG22 1 
ATOM   9360  H HG23 . VAL B 1 120 ? -28.174 46.998  15.635  1.00 24.75 ? 109  VAL B HG23 1 
ATOM   9361  N N    . PRO B 1 121 ? -30.252 51.377  17.425  1.00 18.11 ? 110  PRO B N    1 
ATOM   9362  C CA   . PRO B 1 121 ? -30.253 52.844  17.554  1.00 18.71 ? 110  PRO B CA   1 
ATOM   9363  C C    . PRO B 1 121 ? -29.023 53.292  18.342  1.00 19.52 ? 110  PRO B C    1 
ATOM   9364  O O    . PRO B 1 121 ? -28.667 52.699  19.354  1.00 20.66 ? 110  PRO B O    1 
ATOM   9365  C CB   . PRO B 1 121 ? -31.544 53.124  18.341  1.00 20.52 ? 110  PRO B CB   1 
ATOM   9366  C CG   . PRO B 1 121 ? -31.981 51.792  18.930  1.00 21.89 ? 110  PRO B CG   1 
ATOM   9367  C CD   . PRO B 1 121 ? -31.309 50.721  18.217  1.00 20.85 ? 110  PRO B CD   1 
ATOM   9368  H HA   . PRO B 1 121 ? -30.281 53.277  16.687  1.00 22.46 ? 110  PRO B HA   1 
ATOM   9369  H HB2  . PRO B 1 121 ? -31.361 53.764  19.047  1.00 24.63 ? 110  PRO B HB2  1 
ATOM   9370  H HB3  . PRO B 1 121 ? -32.222 53.468  17.738  1.00 24.63 ? 110  PRO B HB3  1 
ATOM   9371  H HG2  . PRO B 1 121 ? -31.740 51.768  19.869  1.00 26.26 ? 110  PRO B HG2  1 
ATOM   9372  H HG3  . PRO B 1 121 ? -32.942 51.703  18.832  1.00 26.26 ? 110  PRO B HG3  1 
ATOM   9373  H HD2  . PRO B 1 121 ? -30.913 50.099  18.848  1.00 25.02 ? 110  PRO B HD2  1 
ATOM   9374  H HD3  . PRO B 1 121 ? -31.934 50.271  17.628  1.00 25.02 ? 110  PRO B HD3  1 
ATOM   9375  N N    . GLU B 1 122 ? -28.358 54.341  17.896  1.00 21.70 ? 111  GLU B N    1 
ATOM   9376  C CA   . GLU B 1 122 ? -27.295 54.853  18.735  1.00 23.81 ? 111  GLU B CA   1 
ATOM   9377  C C    . GLU B 1 122 ? -27.932 55.422  19.998  1.00 22.29 ? 111  GLU B C    1 
ATOM   9378  O O    . GLU B 1 122 ? -29.080 55.874  19.955  1.00 24.07 ? 111  GLU B O    1 
ATOM   9379  C CB   . GLU B 1 122 ? -26.544 55.955  18.014  1.00 24.67 ? 111  GLU B CB   1 
ATOM   9380  C CG   . GLU B 1 122 ? -25.607 55.426  16.942  1.00 27.15 ? 111  GLU B CG   1 
ATOM   9381  C CD   . GLU B 1 122 ? -24.493 54.554  17.540  1.00 25.42 ? 111  GLU B CD   1 
ATOM   9382  O OE1  . GLU B 1 122 ? -23.705 55.088  18.350  1.00 27.28 ? 111  GLU B OE1  1 
ATOM   9383  O OE2  . GLU B 1 122 ? -24.404 53.372  17.185  1.00 24.91 ? 111  GLU B OE2  1 
ATOM   9384  H H    . GLU B 1 122 ? -28.491 54.755  17.154  1.00 26.04 ? 111  GLU B H    1 
ATOM   9385  H HA   . GLU B 1 122 ? -26.678 54.143  18.974  1.00 28.57 ? 111  GLU B HA   1 
ATOM   9386  H HB2  . GLU B 1 122 ? -27.184 56.547  17.588  1.00 29.60 ? 111  GLU B HB2  1 
ATOM   9387  H HB3  . GLU B 1 122 ? -26.014 56.449  18.659  1.00 29.60 ? 111  GLU B HB3  1 
ATOM   9388  H HG2  . GLU B 1 122 ? -26.112 54.885  16.315  1.00 32.58 ? 111  GLU B HG2  1 
ATOM   9389  H HG3  . GLU B 1 122 ? -25.193 56.173  16.482  1.00 32.58 ? 111  GLU B HG3  1 
ATOM   9390  N N    A PRO B 1 123 ? -27.220 55.486  21.123  0.50 30.31 ? 112  PRO B N    1 
ATOM   9391  N N    B PRO B 1 123 ? -27.235 55.327  21.142  0.50 20.82 ? 112  PRO B N    1 
ATOM   9392  C CA   A PRO B 1 123 ? -27.815 56.175  22.271  0.50 34.58 ? 112  PRO B CA   1 
ATOM   9393  C CA   B PRO B 1 123 ? -27.814 55.809  22.394  0.50 25.66 ? 112  PRO B CA   1 
ATOM   9394  C C    A PRO B 1 123 ? -28.247 57.578  21.859  0.50 38.27 ? 112  PRO B C    1 
ATOM   9395  C C    B PRO B 1 123 ? -28.310 57.228  22.209  0.50 27.20 ? 112  PRO B C    1 
ATOM   9396  O O    A PRO B 1 123 ? -27.672 58.191  20.951  0.50 35.23 ? 112  PRO B O    1 
ATOM   9397  O O    B PRO B 1 123 ? -27.572 58.117  21.764  0.50 26.70 ? 112  PRO B O    1 
ATOM   9398  C CB   A PRO B 1 123 ? -26.693 56.179  23.319  0.50 35.00 ? 112  PRO B CB   1 
ATOM   9399  C CB   B PRO B 1 123 ? -26.646 55.725  23.388  0.50 26.70 ? 112  PRO B CB   1 
ATOM   9400  C CG   A PRO B 1 123 ? -25.886 54.957  22.983  0.50 34.68 ? 112  PRO B CG   1 
ATOM   9401  C CG   B PRO B 1 123 ? -25.790 54.626  22.865  0.50 27.73 ? 112  PRO B CG   1 
ATOM   9402  C CD   A PRO B 1 123 ? -25.908 54.901  21.464  0.50 31.63 ? 112  PRO B CD   1 
ATOM   9403  C CD   B PRO B 1 123 ? -25.900 54.728  21.356  0.50 22.44 ? 112  PRO B CD   1 
ATOM   9404  H HA   A PRO B 1 123 ? -28.579 55.682  22.610  0.50 41.49 ? 112  PRO B HA   1 
ATOM   9405  H HA   B PRO B 1 123 ? -28.541 55.236  22.685  0.50 30.80 ? 112  PRO B HA   1 
ATOM   9406  H HB2  A PRO B 1 123 ? -26.158 56.983  23.228  0.50 41.99 ? 112  PRO B HB2  1 
ATOM   9407  H HB2  B PRO B 1 123 ? -26.161 56.565  23.397  0.50 32.03 ? 112  PRO B HB2  1 
ATOM   9408  H HB3  A PRO B 1 123 ? -27.071 56.111  24.209  0.50 41.99 ? 112  PRO B HB3  1 
ATOM   9409  H HB3  B PRO B 1 123 ? -26.982 55.509  24.272  0.50 32.03 ? 112  PRO B HB3  1 
ATOM   9410  H HG2  A PRO B 1 123 ? -24.980 55.059  23.312  0.50 41.62 ? 112  PRO B HG2  1 
ATOM   9411  H HG2  B PRO B 1 123 ? -24.874 54.760  23.153  0.50 33.28 ? 112  PRO B HG2  1 
ATOM   9412  H HG3  A PRO B 1 123 ? -26.307 54.170  23.364  0.50 41.62 ? 112  PRO B HG3  1 
ATOM   9413  H HG3  B PRO B 1 123 ? -26.127 53.772  23.177  0.50 33.28 ? 112  PRO B HG3  1 
ATOM   9414  H HD2  A PRO B 1 123 ? -25.191 55.440  21.095  0.50 37.96 ? 112  PRO B HD2  1 
ATOM   9415  H HD2  B PRO B 1 123 ? -25.209 55.311  21.006  0.50 26.93 ? 112  PRO B HD2  1 
ATOM   9416  H HD3  A PRO B 1 123 ? -25.857 53.982  21.158  0.50 37.96 ? 112  PRO B HD3  1 
ATOM   9417  H HD3  B PRO B 1 123 ? -25.858 53.846  20.955  0.50 26.93 ? 112  PRO B HD3  1 
ATOM   9418  N N    A GLY B 1 124 ? -29.310 58.061  22.500  0.50 41.13 ? 113  GLY B N    1 
ATOM   9419  N N    B GLY B 1 124 ? -29.584 57.426  22.542  0.50 28.56 ? 113  GLY B N    1 
ATOM   9420  C CA   A GLY B 1 124 ? -29.843 59.372  22.193  0.50 44.95 ? 113  GLY B CA   1 
ATOM   9421  C CA   B GLY B 1 124 ? -30.264 58.690  22.381  0.50 28.63 ? 113  GLY B CA   1 
ATOM   9422  C C    A GLY B 1 124 ? -30.701 59.429  20.953  0.50 41.97 ? 113  GLY B C    1 
ATOM   9423  C C    B GLY B 1 124 ? -31.091 58.815  21.120  0.50 32.70 ? 113  GLY B C    1 
ATOM   9424  O O    A GLY B 1 124 ? -30.951 60.521  20.437  0.50 43.35 ? 113  GLY B O    1 
ATOM   9425  O O    B GLY B 1 124 ? -31.881 59.763  21.014  0.50 38.46 ? 113  GLY B O    1 
ATOM   9426  H H    A GLY B 1 124 ? -29.738 57.642  23.117  0.50 49.36 ? 113  GLY B H    1 
ATOM   9427  H H    B GLY B 1 124 ? -30.087 56.813  22.875  0.50 34.27 ? 113  GLY B H    1 
ATOM   9428  H HA2  A GLY B 1 124 ? -30.378 59.678  22.942  0.50 53.94 ? 113  GLY B HA2  1 
ATOM   9429  H HA2  B GLY B 1 124 ? -30.853 58.828  23.139  0.50 34.36 ? 113  GLY B HA2  1 
ATOM   9430  H HA3  A GLY B 1 124 ? -29.106 59.992  22.077  0.50 53.94 ? 113  GLY B HA3  1 
ATOM   9431  H HA3  B GLY B 1 124 ? -29.606 59.402  22.379  0.50 34.36 ? 113  GLY B HA3  1 
ATOM   9432  N N    A THR B 1 125 ? -31.164 58.287  20.452  0.50 39.16 ? 114  THR B N    1 
ATOM   9433  N N    B THR B 1 125 ? -30.920 57.902  20.163  0.50 29.42 ? 114  THR B N    1 
ATOM   9434  C CA   A THR B 1 125 ? -31.939 58.267  19.223  0.50 32.30 ? 114  THR B CA   1 
ATOM   9435  C CA   B THR B 1 125 ? -31.729 57.862  18.955  0.50 27.70 ? 114  THR B CA   1 
ATOM   9436  C C    A THR B 1 125 ? -33.015 57.195  19.316  0.50 29.74 ? 114  THR B C    1 
ATOM   9437  C C    B THR B 1 125 ? -32.999 57.056  19.241  0.50 30.85 ? 114  THR B C    1 
ATOM   9438  O O    A THR B 1 125 ? -32.842 56.146  19.954  0.50 27.78 ? 114  THR B O    1 
ATOM   9439  O O    B THR B 1 125 ? -32.974 56.079  19.999  0.50 32.44 ? 114  THR B O    1 
ATOM   9440  C CB   A THR B 1 125 ? -31.074 57.980  18.003  0.50 34.61 ? 114  THR B CB   1 
ATOM   9441  C CB   B THR B 1 125 ? -30.924 57.190  17.828  0.50 22.86 ? 114  THR B CB   1 
ATOM   9442  O OG1  A THR B 1 125 ? -30.669 56.610  18.040  0.50 29.08 ? 114  THR B OG1  1 
ATOM   9443  O OG1  B THR B 1 125 ? -29.812 58.027  17.434  0.50 27.65 ? 114  THR B OG1  1 
ATOM   9444  C CG2  A THR B 1 125 ? -29.837 58.903  17.966  0.50 37.15 ? 114  THR B CG2  1 
ATOM   9445  C CG2  B THR B 1 125 ? -31.791 56.915  16.614  0.50 23.25 ? 114  THR B CG2  1 
ATOM   9446  H H    A THR B 1 125 ? -31.041 57.512  20.805  0.50 46.99 ? 114  THR B H    1 
ATOM   9447  H H    B THR B 1 125 ? -30.326 57.281  20.196  0.50 35.31 ? 114  THR B H    1 
ATOM   9448  H HA   A THR B 1 125 ? -32.371 59.126  19.099  0.50 38.76 ? 114  THR B HA   1 
ATOM   9449  H HA   B THR B 1 125 ? -31.974 58.760  18.683  0.50 33.24 ? 114  THR B HA   1 
ATOM   9450  H HB   A THR B 1 125 ? -31.594 58.137  17.199  0.50 41.53 ? 114  THR B HB   1 
ATOM   9451  H HB   B THR B 1 125 ? -30.581 56.342  18.149  0.50 27.43 ? 114  THR B HB   1 
ATOM   9452  H HG1  A THR B 1 125 ? -30.229 56.460  18.740  0.50 34.89 ? 114  THR B HG1  1 
ATOM   9453  H HG1  B THR B 1 125 ? -29.303 58.155  18.090  0.50 33.18 ? 114  THR B HG1  1 
ATOM   9454  H HG21 A THR B 1 125 ? -29.300 58.706  17.183  0.50 44.58 ? 114  THR B HG21 1 
ATOM   9455  H HG21 B THR B 1 125 ? -32.522 56.325  16.857  0.50 27.90 ? 114  THR B HG21 1 
ATOM   9456  H HG22 A THR B 1 125 ? -30.118 59.831  17.931  0.50 44.58 ? 114  THR B HG22 1 
ATOM   9457  H HG22 B THR B 1 125 ? -31.262 56.492  15.919  0.50 27.90 ? 114  THR B HG22 1 
ATOM   9458  H HG23 A THR B 1 125 ? -29.299 58.767  18.761  0.50 44.58 ? 114  THR B HG23 1 
ATOM   9459  H HG23 B THR B 1 125 ? -32.155 57.746  16.272  0.50 27.90 ? 114  THR B HG23 1 
ATOM   9460  N N    . SER B 1 126 ? -34.115 57.456  18.625  1.00 26.92 ? 115  SER B N    1 
ATOM   9461  C CA   . SER B 1 126 ? -35.349 56.716  18.860  1.00 24.39 ? 115  SER B CA   1 
ATOM   9462  C C    . SER B 1 126 ? -35.305 55.323  18.237  1.00 22.54 ? 115  SER B C    1 
ATOM   9463  O O    . SER B 1 126 ? -34.689 55.099  17.194  1.00 23.57 ? 115  SER B O    1 
ATOM   9464  C CB   . SER B 1 126 ? -36.573 57.471  18.351  1.00 29.03 ? 115  SER B CB   1 
ATOM   9465  O OG   . SER B 1 126 ? -36.721 57.350  16.968  1.00 29.51 ? 115  SER B OG   1 
ATOM   9466  H H    . SER B 1 126 ? -34.174 58.092  18.050  1.00 32.30 ? 115  SER B H    1 
ATOM   9467  H HA   . SER B 1 126 ? -35.457 56.601  19.817  1.00 29.27 ? 115  SER B HA   1 
ATOM   9468  H HB2  . SER B 1 126 ? -37.364 57.112  18.783  1.00 34.84 ? 115  SER B HB2  1 
ATOM   9469  H HB3  . SER B 1 126 ? -36.475 58.410  18.574  1.00 34.84 ? 115  SER B HB3  1 
ATOM   9470  H HG   . SER B 1 126 ? -37.400 57.773  16.714  1.00 35.41 ? 115  SER B HG   1 
ATOM   9471  N N    . LEU B 1 127 ? -36.048 54.412  18.849  1.00 21.11 ? 116  LEU B N    1 
ATOM   9472  C CA   . LEU B 1 127 ? -36.132 53.055  18.333  1.00 19.25 ? 116  LEU B CA   1 
ATOM   9473  C C    . LEU B 1 127 ? -36.772 53.046  16.949  1.00 18.83 ? 116  LEU B C    1 
ATOM   9474  O O    . LEU B 1 127 ? -36.336 52.308  16.063  1.00 19.20 ? 116  LEU B O    1 
ATOM   9475  C CB   . LEU B 1 127 ? -36.950 52.186  19.305  1.00 19.17 ? 116  LEU B CB   1 
ATOM   9476  C CG   . LEU B 1 127 ? -36.490 52.010  20.762  1.00 19.73 ? 116  LEU B CG   1 
ATOM   9477  C CD1  . LEU B 1 127 ? -37.307 50.952  21.460  1.00 20.15 ? 116  LEU B CD1  1 
ATOM   9478  C CD2  . LEU B 1 127 ? -34.988 51.693  20.870  1.00 22.35 ? 116  LEU B CD2  1 
ATOM   9479  H H    . LEU B 1 127 ? -36.510 54.553  19.560  1.00 25.33 ? 116  LEU B H    1 
ATOM   9480  H HA   . LEU B 1 127 ? -35.240 52.681  18.262  1.00 23.10 ? 116  LEU B HA   1 
ATOM   9481  H HB2  . LEU B 1 127 ? -37.845 52.558  19.344  1.00 23.01 ? 116  LEU B HB2  1 
ATOM   9482  H HB3  . LEU B 1 127 ? -37.000 51.295  18.925  1.00 23.01 ? 116  LEU B HB3  1 
ATOM   9483  H HG   . LEU B 1 127 ? -36.642 52.846  21.231  1.00 23.67 ? 116  LEU B HG   1 
ATOM   9484  H HD11 . LEU B 1 127 ? -36.995 50.864  22.374  1.00 24.18 ? 116  LEU B HD11 1 
ATOM   9485  H HD12 . LEU B 1 127 ? -38.240 51.218  21.453  1.00 24.18 ? 116  LEU B HD12 1 
ATOM   9486  H HD13 . LEU B 1 127 ? -37.199 50.110  20.991  1.00 24.18 ? 116  LEU B HD13 1 
ATOM   9487  H HD21 . LEU B 1 127 ? -34.754 51.593  21.806  1.00 26.82 ? 116  LEU B HD21 1 
ATOM   9488  H HD22 . LEU B 1 127 ? -34.805 50.869  20.393  1.00 26.82 ? 116  LEU B HD22 1 
ATOM   9489  H HD23 . LEU B 1 127 ? -34.483 52.423  20.478  1.00 26.82 ? 116  LEU B HD23 1 
ATOM   9490  N N    . LEU B 1 128 ? -37.822 53.856  16.738  1.00 19.15 ? 117  LEU B N    1 
ATOM   9491  C CA   . LEU B 1 128 ? -38.539 53.842  15.466  1.00 19.01 ? 117  LEU B CA   1 
ATOM   9492  C C    . LEU B 1 128 ? -37.699 54.432  14.333  1.00 19.50 ? 117  LEU B C    1 
ATOM   9493  O O    . LEU B 1 128 ? -37.710 53.917  13.214  1.00 21.80 ? 117  LEU B O    1 
ATOM   9494  C CB   . LEU B 1 128 ? -39.878 54.591  15.614  1.00 23.43 ? 117  LEU B CB   1 
ATOM   9495  C CG   . LEU B 1 128 ? -40.675 54.684  14.304  1.00 26.05 ? 117  LEU B CG   1 
ATOM   9496  C CD1  . LEU B 1 128 ? -40.980 53.307  13.685  1.00 26.94 ? 117  LEU B CD1  1 
ATOM   9497  C CD2  . LEU B 1 128 ? -41.947 55.476  14.486  1.00 32.82 ? 117  LEU B CD2  1 
ATOM   9498  H H    . LEU B 1 128 ? -38.132 54.415  17.314  1.00 22.98 ? 117  LEU B H    1 
ATOM   9499  H HA   . LEU B 1 128 ? -38.741 52.922  15.234  1.00 22.81 ? 117  LEU B HA   1 
ATOM   9500  H HB2  . LEU B 1 128 ? -40.427 54.126  16.264  1.00 28.11 ? 117  LEU B HB2  1 
ATOM   9501  H HB3  . LEU B 1 128 ? -39.700 55.495  15.919  1.00 28.11 ? 117  LEU B HB3  1 
ATOM   9502  H HG   . LEU B 1 128 ? -40.133 55.168  13.661  1.00 31.27 ? 117  LEU B HG   1 
ATOM   9503  H HD11 . LEU B 1 128 ? -41.482 53.434  12.865  1.00 32.33 ? 117  LEU B HD11 1 
ATOM   9504  H HD12 . LEU B 1 128 ? -40.143 52.855  13.494  1.00 32.33 ? 117  LEU B HD12 1 
ATOM   9505  H HD13 . LEU B 1 128 ? -41.501 52.786  14.316  1.00 32.33 ? 117  LEU B HD13 1 
ATOM   9506  H HD21 . LEU B 1 128 ? -42.420 55.512  13.639  1.00 39.38 ? 117  LEU B HD21 1 
ATOM   9507  H HD22 . LEU B 1 128 ? -42.498 55.039  15.154  1.00 39.38 ? 117  LEU B HD22 1 
ATOM   9508  H HD23 . LEU B 1 128 ? -41.722 56.373  14.777  1.00 39.38 ? 117  LEU B HD23 1 
ATOM   9509  N N    . ALA B 1 129 ? -36.967 55.511  14.594  1.00 21.19 ? 118  ALA B N    1 
ATOM   9510  C CA   . ALA B 1 129 ? -36.114 56.048  13.553  1.00 24.76 ? 118  ALA B CA   1 
ATOM   9511  C C    . ALA B 1 129 ? -35.117 55.009  13.087  1.00 21.34 ? 118  ALA B C    1 
ATOM   9512  O O    . ALA B 1 129 ? -34.877 54.856  11.876  1.00 23.09 ? 118  ALA B O    1 
ATOM   9513  C CB   . ALA B 1 129 ? -35.392 57.270  14.108  1.00 27.45 ? 118  ALA B CB   1 
ATOM   9514  H H    . ALA B 1 129 ? -36.949 55.935  15.342  1.00 25.43 ? 118  ALA B H    1 
ATOM   9515  H HA   . ALA B 1 129 ? -36.654 56.322  12.796  1.00 29.71 ? 118  ALA B HA   1 
ATOM   9516  H HB1  . ALA B 1 129 ? -34.818 57.637  13.418  1.00 32.94 ? 118  ALA B HB1  1 
ATOM   9517  H HB2  . ALA B 1 129 ? -36.050 57.930  14.376  1.00 32.94 ? 118  ALA B HB2  1 
ATOM   9518  H HB3  . ALA B 1 129 ? -34.860 57.002  14.873  1.00 32.94 ? 118  ALA B HB3  1 
ATOM   9519  N N    . ALA B 1 130 ? -34.541 54.256  14.035  1.00 20.08 ? 119  ALA B N    1 
ATOM   9520  C CA   . ALA B 1 130 ? -33.581 53.220  13.665  1.00 18.95 ? 119  ALA B CA   1 
ATOM   9521  C C    . ALA B 1 130 ? -34.266 52.059  12.949  1.00 17.46 ? 119  ALA B C    1 
ATOM   9522  O O    . ALA B 1 130 ? -33.736 51.528  11.965  1.00 19.23 ? 119  ALA B O    1 
ATOM   9523  C CB   . ALA B 1 130 ? -32.827 52.745  14.891  1.00 22.06 ? 119  ALA B CB   1 
ATOM   9524  H H    . ALA B 1 130 ? -34.688 54.326  14.879  1.00 24.10 ? 119  ALA B H    1 
ATOM   9525  H HA   . ALA B 1 130 ? -32.934 53.602  13.052  1.00 22.74 ? 119  ALA B HA   1 
ATOM   9526  H HB1  . ALA B 1 130 ? -32.195 52.058  14.626  1.00 26.48 ? 119  ALA B HB1  1 
ATOM   9527  H HB2  . ALA B 1 130 ? -32.355 53.497  15.281  1.00 26.48 ? 119  ALA B HB2  1 
ATOM   9528  H HB3  . ALA B 1 130 ? -33.461 52.384  15.530  1.00 26.48 ? 119  ALA B HB3  1 
ATOM   9529  N N    . PHE B 1 131 ? -35.443 51.667  13.431  1.00 17.87 ? 120  PHE B N    1 
ATOM   9530  C CA   . PHE B 1 131 ? -36.202 50.610  12.770  1.00 17.06 ? 120  PHE B CA   1 
ATOM   9531  C C    . PHE B 1 131 ? -36.473 50.995  11.319  1.00 17.17 ? 120  PHE B C    1 
ATOM   9532  O O    . PHE B 1 131 ? -36.284 50.189  10.405  1.00 18.70 ? 120  PHE B O    1 
ATOM   9533  C CB   . PHE B 1 131 ? -37.501 50.387  13.549  1.00 17.89 ? 120  PHE B CB   1 
ATOM   9534  C CG   . PHE B 1 131 ? -38.372 49.322  12.961  1.00 17.32 ? 120  PHE B CG   1 
ATOM   9535  C CD1  . PHE B 1 131 ? -38.218 47.992  13.315  1.00 18.36 ? 120  PHE B CD1  1 
ATOM   9536  C CD2  . PHE B 1 131 ? -39.326 49.664  12.018  1.00 18.94 ? 120  PHE B CD2  1 
ATOM   9537  C CE1  . PHE B 1 131 ? -39.018 47.005  12.734  1.00 22.29 ? 120  PHE B CE1  1 
ATOM   9538  C CE2  . PHE B 1 131 ? -40.118 48.671  11.415  1.00 19.51 ? 120  PHE B CE2  1 
ATOM   9539  C CZ   . PHE B 1 131 ? -39.964 47.337  11.795  1.00 20.05 ? 120  PHE B CZ   1 
ATOM   9540  H H    . PHE B 1 131 ? -35.820 51.993  14.132  1.00 21.44 ? 120  PHE B H    1 
ATOM   9541  H HA   . PHE B 1 131 ? -35.689 49.787  12.780  1.00 20.47 ? 120  PHE B HA   1 
ATOM   9542  H HB2  . PHE B 1 131 ? -37.281 50.124  14.457  1.00 21.47 ? 120  PHE B HB2  1 
ATOM   9543  H HB3  . PHE B 1 131 ? -38.007 51.214  13.559  1.00 21.47 ? 120  PHE B HB3  1 
ATOM   9544  H HD1  . PHE B 1 131 ? -37.578 47.753  13.946  1.00 22.04 ? 120  PHE B HD1  1 
ATOM   9545  H HD2  . PHE B 1 131 ? -39.423 50.552  11.760  1.00 22.73 ? 120  PHE B HD2  1 
ATOM   9546  H HE1  . PHE B 1 131 ? -38.909 46.116  12.985  1.00 26.75 ? 120  PHE B HE1  1 
ATOM   9547  H HE2  . PHE B 1 131 ? -40.765 48.906  10.789  1.00 23.41 ? 120  PHE B HE2  1 
ATOM   9548  H HZ   . PHE B 1 131 ? -40.498 46.678  11.414  1.00 24.06 ? 120  PHE B HZ   1 
ATOM   9549  N N    . ASP B 1 132 ? -36.869 52.251  11.084  1.00 19.95 ? 121  ASP B N    1 
ATOM   9550  C CA   . ASP B 1 132 ? -37.168 52.681  9.733   1.00 20.92 ? 121  ASP B CA   1 
ATOM   9551  C C    . ASP B 1 132 ? -35.923 52.615  8.854   1.00 18.45 ? 121  ASP B C    1 
ATOM   9552  O O    . ASP B 1 132 ? -36.004 52.263  7.663   1.00 19.95 ? 121  ASP B O    1 
ATOM   9553  C CB   . ASP B 1 132 ? -37.691 54.101  9.746   1.00 22.04 ? 121  ASP B CB   1 
ATOM   9554  C CG   . ASP B 1 132 ? -39.155 54.201  10.164  1.00 22.69 ? 121  ASP B CG   1 
ATOM   9555  O OD1  . ASP B 1 132 ? -39.859 53.171  10.220  1.00 26.24 ? 121  ASP B OD1  1 
ATOM   9556  O OD2  . ASP B 1 132 ? -39.623 55.338  10.394  1.00 27.24 ? 121  ASP B OD2  1 
ATOM   9557  H H    . ASP B 1 132 ? -36.969 52.857  11.685  1.00 23.94 ? 121  ASP B H    1 
ATOM   9558  H HA   . ASP B 1 132 ? -37.847 52.104  9.351   1.00 25.11 ? 121  ASP B HA   1 
ATOM   9559  H HB2  . ASP B 1 132 ? -37.165 54.623  10.372  1.00 26.45 ? 121  ASP B HB2  1 
ATOM   9560  H HB3  . ASP B 1 132 ? -37.609 54.474  8.854   1.00 26.45 ? 121  ASP B HB3  1 
ATOM   9561  N N    . GLN B 1 133 ? -34.759 52.957  9.426   1.00 20.87 ? 122  GLN B N    1 
ATOM   9562  C CA   . GLN B 1 133 ? -33.512 52.927  8.670   1.00 19.48 ? 122  GLN B CA   1 
ATOM   9563  C C    . GLN B 1 133 ? -33.150 51.508  8.277   1.00 18.96 ? 122  GLN B C    1 
ATOM   9564  O O    . GLN B 1 133 ? -32.758 51.248  7.127   1.00 20.00 ? 122  GLN B O    1 
ATOM   9565  C CB   . GLN B 1 133 ? -32.405 53.535  9.519   1.00 24.63 ? 122  GLN B CB   1 
ATOM   9566  C CG   . GLN B 1 133 ? -31.034 53.521  8.828   1.00 27.64 ? 122  GLN B CG   1 
ATOM   9567  C CD   . GLN B 1 133 ? -31.043 54.279  7.511   1.00 32.26 ? 122  GLN B CD   1 
ATOM   9568  O OE1  . GLN B 1 133 ? -31.386 53.722  6.419   1.00 35.17 ? 122  GLN B OE1  1 
ATOM   9569  N NE2  . GLN B 1 133 ? -30.671 55.554  7.581   1.00 36.18 ? 122  GLN B NE2  1 
ATOM   9570  H H    . GLN B 1 133 ? -34.672 53.207  10.245  1.00 25.04 ? 122  GLN B H    1 
ATOM   9571  H HA   . GLN B 1 133 ? -33.609 53.456  7.863   1.00 23.37 ? 122  GLN B HA   1 
ATOM   9572  H HB2  . GLN B 1 133 ? -32.630 54.457  9.716   1.00 29.55 ? 122  GLN B HB2  1 
ATOM   9573  H HB3  . GLN B 1 133 ? -32.328 53.030  10.344  1.00 29.55 ? 122  GLN B HB3  1 
ATOM   9574  H HG2  . GLN B 1 133 ? -30.380 53.937  9.411   1.00 33.17 ? 122  GLN B HG2  1 
ATOM   9575  H HG3  . GLN B 1 133 ? -30.780 52.603  8.645   1.00 33.17 ? 122  GLN B HG3  1 
ATOM   9576  H HE21 . GLN B 1 133 ? -30.446 55.896  8.337   1.00 43.42 ? 122  GLN B HE21 1 
ATOM   9577  H HE22 . GLN B 1 133 ? -30.655 56.037  6.869   1.00 43.42 ? 122  GLN B HE22 1 
ATOM   9578  N N    . TRP B 1 134 ? -33.243 50.574  9.234   1.00 17.09 ? 123  TRP B N    1 
ATOM   9579  C CA   . TRP B 1 134 ? -32.928 49.188  8.936   1.00 17.85 ? 123  TRP B CA   1 
ATOM   9580  C C    . TRP B 1 134 ? -33.905 48.645  7.902   1.00 18.70 ? 123  TRP B C    1 
ATOM   9581  O O    . TRP B 1 134 ? -33.506 47.885  7.020   1.00 18.29 ? 123  TRP B O    1 
ATOM   9582  C CB   . TRP B 1 134 ? -32.945 48.337  10.217  1.00 16.73 ? 123  TRP B CB   1 
ATOM   9583  C CG   . TRP B 1 134 ? -31.585 48.026  10.753  1.00 17.35 ? 123  TRP B CG   1 
ATOM   9584  C CD1  . TRP B 1 134 ? -30.943 46.839  10.666  1.00 17.63 ? 123  TRP B CD1  1 
ATOM   9585  C CD2  . TRP B 1 134 ? -30.697 48.902  11.475  1.00 16.30 ? 123  TRP B CD2  1 
ATOM   9586  N NE1  . TRP B 1 134 ? -29.689 46.917  11.234  1.00 17.76 ? 123  TRP B NE1  1 
ATOM   9587  C CE2  . TRP B 1 134 ? -29.523 48.165  11.762  1.00 16.32 ? 123  TRP B CE2  1 
ATOM   9588  C CE3  . TRP B 1 134 ? -30.770 50.237  11.898  1.00 17.04 ? 123  TRP B CE3  1 
ATOM   9589  C CZ2  . TRP B 1 134 ? -28.418 48.733  12.438  1.00 17.58 ? 123  TRP B CZ2  1 
ATOM   9590  C CZ3  . TRP B 1 134 ? -29.672 50.791  12.575  1.00 18.15 ? 123  TRP B CZ3  1 
ATOM   9591  C CH2  . TRP B 1 134 ? -28.536 50.035  12.850  1.00 17.73 ? 123  TRP B CH2  1 
ATOM   9592  H H    . TRP B 1 134 ? -33.482 50.723  10.046  1.00 20.50 ? 123  TRP B H    1 
ATOM   9593  H HA   . TRP B 1 134 ? -32.036 49.141  8.558   1.00 21.42 ? 123  TRP B HA   1 
ATOM   9594  H HB2  . TRP B 1 134 ? -33.432 48.818  10.905  1.00 20.07 ? 123  TRP B HB2  1 
ATOM   9595  H HB3  . TRP B 1 134 ? -33.389 47.496  10.028  1.00 20.07 ? 123  TRP B HB3  1 
ATOM   9596  H HD1  . TRP B 1 134 ? -31.281 46.087  10.235  1.00 21.16 ? 123  TRP B HD1  1 
ATOM   9597  H HE1  . TRP B 1 134 ? -29.123 46.272  11.288  1.00 21.32 ? 123  TRP B HE1  1 
ATOM   9598  H HE3  . TRP B 1 134 ? -31.523 50.752  11.716  1.00 20.45 ? 123  TRP B HE3  1 
ATOM   9599  H HZ2  . TRP B 1 134 ? -27.658 48.232  12.631  1.00 21.10 ? 123  TRP B HZ2  1 
ATOM   9600  H HZ3  . TRP B 1 134 ? -29.712 51.674  12.864  1.00 21.78 ? 123  TRP B HZ3  1 
ATOM   9601  H HH2  . TRP B 1 134 ? -27.829 50.432  13.305  1.00 21.27 ? 123  TRP B HH2  1 
ATOM   9602  N N    . ARG B 1 135 ? -35.195 48.969  8.027   1.00 18.45 ? 124  ARG B N    1 
ATOM   9603  C CA   . ARG B 1 135 ? -36.168 48.537  7.026   1.00 18.18 ? 124  ARG B CA   1 
ATOM   9604  C C    . ARG B 1 135 ? -35.808 49.071  5.640   1.00 19.27 ? 124  ARG B C    1 
ATOM   9605  O O    . ARG B 1 135 ? -35.931 48.357  4.629   1.00 18.65 ? 124  ARG B O    1 
ATOM   9606  C CB   . ARG B 1 135 ? -37.576 49.027  7.401   1.00 19.02 ? 124  ARG B CB   1 
ATOM   9607  C CG   . ARG B 1 135 ? -38.319 48.260  8.502   1.00 21.88 ? 124  ARG B CG   1 
ATOM   9608  C CD   . ARG B 1 135 ? -38.788 46.919  8.063   1.00 22.97 ? 124  ARG B CD   1 
ATOM   9609  N NE   . ARG B 1 135 ? -39.472 46.907  6.754   1.00 21.14 ? 124  ARG B NE   1 
ATOM   9610  C CZ   . ARG B 1 135 ? -40.767 47.094  6.554   1.00 21.58 ? 124  ARG B CZ   1 
ATOM   9611  N NH1  . ARG B 1 135 ? -41.610 47.317  7.580   1.00 24.56 ? 124  ARG B NH1  1 
ATOM   9612  N NH2  . ARG B 1 135 ? -41.219 47.104  5.309   1.00 25.72 ? 124  ARG B NH2  1 
ATOM   9613  H H    . ARG B 1 135 ? -35.526 49.431  8.672   1.00 22.14 ? 124  ARG B H    1 
ATOM   9614  H HA   . ARG B 1 135 ? -36.181 47.568  6.987   1.00 21.82 ? 124  ARG B HA   1 
ATOM   9615  H HB2  . ARG B 1 135 ? -37.505 49.949  7.694   1.00 22.82 ? 124  ARG B HB2  1 
ATOM   9616  H HB3  . ARG B 1 135 ? -38.129 48.988  6.605   1.00 22.82 ? 124  ARG B HB3  1 
ATOM   9617  H HG2  . ARG B 1 135 ? -37.723 48.137  9.257   1.00 26.25 ? 124  ARG B HG2  1 
ATOM   9618  H HG3  . ARG B 1 135 ? -39.096 48.774  8.774   1.00 26.25 ? 124  ARG B HG3  1 
ATOM   9619  H HD2  . ARG B 1 135 ? -38.021 46.328  7.999   1.00 27.57 ? 124  ARG B HD2  1 
ATOM   9620  H HD3  . ARG B 1 135 ? -39.410 46.576  8.723   1.00 27.57 ? 124  ARG B HD3  1 
ATOM   9621  H HE   . ARG B 1 135 ? -38.985 46.765  6.060   1.00 25.37 ? 124  ARG B HE   1 
ATOM   9622  H HH11 . ARG B 1 135 ? -41.313 47.327  8.386   1.00 29.47 ? 124  ARG B HH11 1 
ATOM   9623  H HH12 . ARG B 1 135 ? -42.449 47.437  7.429   1.00 29.47 ? 124  ARG B HH12 1 
ATOM   9624  H HH21 . ARG B 1 135 ? -40.680 46.958  4.655   1.00 30.86 ? 124  ARG B HH21 1 
ATOM   9625  H HH22 . ARG B 1 135 ? -42.059 47.212  5.157   1.00 30.86 ? 124  ARG B HH22 1 
ATOM   9626  N N    A GLU B 1 136 ? -35.413 50.345  5.554   0.59 21.37 ? 125  GLU B N    1 
ATOM   9627  N N    B GLU B 1 136 ? -35.369 50.325  5.570   0.41 18.84 ? 125  GLU B N    1 
ATOM   9628  C CA   A GLU B 1 136 ? -35.007 50.887  4.259   0.59 20.39 ? 125  GLU B CA   1 
ATOM   9629  C CA   B GLU B 1 136 ? -35.005 50.889  4.277   0.41 21.02 ? 125  GLU B CA   1 
ATOM   9630  C C    A GLU B 1 136 ? -33.877 50.054  3.668   0.59 18.87 ? 125  GLU B C    1 
ATOM   9631  C C    B GLU B 1 136 ? -33.847 50.124  3.654   0.41 20.36 ? 125  GLU B C    1 
ATOM   9632  O O    A GLU B 1 136 ? -33.937 49.640  2.501   0.59 20.54 ? 125  GLU B O    1 
ATOM   9633  O O    B GLU B 1 136 ? -33.856 49.840  2.447   0.41 22.00 ? 125  GLU B O    1 
ATOM   9634  C CB   A GLU B 1 136 ? -34.572 52.342  4.406   0.59 22.19 ? 125  GLU B CB   1 
ATOM   9635  C CB   B GLU B 1 136 ? -34.651 52.353  4.458   0.41 21.59 ? 125  GLU B CB   1 
ATOM   9636  C CG   A GLU B 1 136 ? -33.888 52.928  3.154   0.59 27.65 ? 125  GLU B CG   1 
ATOM   9637  C CG   B GLU B 1 136 ? -35.872 53.216  4.602   0.41 25.68 ? 125  GLU B CG   1 
ATOM   9638  C CD   A GLU B 1 136 ? -33.623 54.414  3.288   0.59 35.13 ? 125  GLU B CD   1 
ATOM   9639  C CD   B GLU B 1 136 ? -35.536 54.631  4.972   0.41 36.27 ? 125  GLU B CD   1 
ATOM   9640  O OE1  A GLU B 1 136 ? -34.597 55.154  3.127   0.59 36.60 ? 125  GLU B OE1  1 
ATOM   9641  O OE1  B GLU B 1 136 ? -34.337 54.977  4.927   0.41 41.39 ? 125  GLU B OE1  1 
ATOM   9642  O OE2  A GLU B 1 136 ? -32.471 54.852  3.559   0.59 36.12 ? 125  GLU B OE2  1 
ATOM   9643  O OE2  B GLU B 1 136 ? -36.468 55.383  5.329   0.41 38.44 ? 125  GLU B OE2  1 
ATOM   9644  H H    A GLU B 1 136 ? -35.372 50.900  6.210   0.59 25.64 ? 125  GLU B H    1 
ATOM   9645  H H    B GLU B 1 136 ? -35.276 50.858  6.239   0.41 22.61 ? 125  GLU B H    1 
ATOM   9646  H HA   A GLU B 1 136 ? -35.759 50.855  3.649   0.59 24.47 ? 125  GLU B HA   1 
ATOM   9647  H HA   B GLU B 1 136 ? -35.765 50.831  3.677   0.41 25.22 ? 125  GLU B HA   1 
ATOM   9648  H HB2  A GLU B 1 136 ? -35.355 52.883  4.594   0.59 26.63 ? 125  GLU B HB2  1 
ATOM   9649  H HB2  B GLU B 1 136 ? -34.113 52.454  5.259   0.41 25.91 ? 125  GLU B HB2  1 
ATOM   9650  H HB3  A GLU B 1 136 ? -33.944 52.407  5.142   0.59 26.63 ? 125  GLU B HB3  1 
ATOM   9651  H HB3  B GLU B 1 136 ? -34.154 52.659  3.682   0.41 25.91 ? 125  GLU B HB3  1 
ATOM   9652  H HG2  A GLU B 1 136 ? -33.038 52.481  3.018   0.59 33.18 ? 125  GLU B HG2  1 
ATOM   9653  H HG2  B GLU B 1 136 ? -36.350 53.231  3.758   0.41 30.82 ? 125  GLU B HG2  1 
ATOM   9654  H HG3  A GLU B 1 136 ? -34.463 52.792  2.385   0.59 33.18 ? 125  GLU B HG3  1 
ATOM   9655  H HG3  B GLU B 1 136 ? -36.439 52.849  5.299   0.41 30.82 ? 125  GLU B HG3  1 
ATOM   9656  N N    . TRP B 1 137 ? -32.831 49.797  4.459   1.00 19.37 ? 126  TRP B N    1 
ATOM   9657  C CA   . TRP B 1 137 ? -31.705 49.004  3.954   1.00 19.15 ? 126  TRP B CA   1 
ATOM   9658  C C    . TRP B 1 137 ? -32.149 47.612  3.507   1.00 18.54 ? 126  TRP B C    1 
ATOM   9659  O O    . TRP B 1 137 ? -31.829 47.168  2.401   1.00 18.34 ? 126  TRP B O    1 
ATOM   9660  C CB   . TRP B 1 137 ? -30.643 48.856  5.033   1.00 19.85 ? 126  TRP B CB   1 
ATOM   9661  C CG   . TRP B 1 137 ? -29.934 50.096  5.416   1.00 20.31 ? 126  TRP B CG   1 
ATOM   9662  C CD1  . TRP B 1 137 ? -29.742 51.202  4.647   1.00 22.13 ? 126  TRP B CD1  1 
ATOM   9663  C CD2  . TRP B 1 137 ? -29.284 50.346  6.659   1.00 23.51 ? 126  TRP B CD2  1 
ATOM   9664  N NE1  . TRP B 1 137 ? -28.991 52.118  5.344   1.00 24.03 ? 126  TRP B NE1  1 
ATOM   9665  C CE2  . TRP B 1 137 ? -28.701 51.616  6.581   1.00 24.43 ? 126  TRP B CE2  1 
ATOM   9666  C CE3  . TRP B 1 137 ? -29.115 49.600  7.826   1.00 28.16 ? 126  TRP B CE3  1 
ATOM   9667  C CZ2  . TRP B 1 137 ? -27.993 52.171  7.637   1.00 26.94 ? 126  TRP B CZ2  1 
ATOM   9668  C CZ3  . TRP B 1 137 ? -28.410 50.156  8.873   1.00 28.88 ? 126  TRP B CZ3  1 
ATOM   9669  C CH2  . TRP B 1 137 ? -27.843 51.417  8.766   1.00 26.75 ? 126  TRP B CH2  1 
ATOM   9670  H H    . TRP B 1 137 ? -32.762 50.042  5.280   1.00 23.24 ? 126  TRP B H    1 
ATOM   9671  H HA   . TRP B 1 137 ? -31.308 49.457  3.194   1.00 22.98 ? 126  TRP B HA   1 
ATOM   9672  H HB2  . TRP B 1 137 ? -31.067 48.507  5.832   1.00 23.82 ? 126  TRP B HB2  1 
ATOM   9673  H HB3  . TRP B 1 137 ? -29.976 48.226  4.721   1.00 23.82 ? 126  TRP B HB3  1 
ATOM   9674  H HD1  . TRP B 1 137 ? -30.052 51.312  3.777   1.00 26.56 ? 126  TRP B HD1  1 
ATOM   9675  H HE1  . TRP B 1 137 ? -28.760 52.894  5.055   1.00 28.84 ? 126  TRP B HE1  1 
ATOM   9676  H HE3  . TRP B 1 137 ? -29.481 48.749  7.901   1.00 33.79 ? 126  TRP B HE3  1 
ATOM   9677  H HZ2  . TRP B 1 137 ? -27.618 53.020  7.571   1.00 32.33 ? 126  TRP B HZ2  1 
ATOM   9678  H HZ3  . TRP B 1 137 ? -28.294 49.669  9.656   1.00 34.66 ? 126  TRP B HZ3  1 
ATOM   9679  H HH2  . TRP B 1 137 ? -27.379 51.770  9.490   1.00 32.10 ? 126  TRP B HH2  1 
ATOM   9680  N N    . ALA B 1 138 ? -32.836 46.885  4.391   1.00 17.32 ? 127  ALA B N    1 
ATOM   9681  C CA   . ALA B 1 138 ? -33.182 45.496  4.103   1.00 16.85 ? 127  ALA B CA   1 
ATOM   9682  C C    . ALA B 1 138 ? -34.221 45.407  2.994   1.00 17.12 ? 127  ALA B C    1 
ATOM   9683  O O    . ALA B 1 138 ? -34.129 44.534  2.121   1.00 17.02 ? 127  ALA B O    1 
ATOM   9684  C CB   . ALA B 1 138 ? -33.699 44.853  5.380   1.00 17.84 ? 127  ALA B CB   1 
ATOM   9685  H H    . ALA B 1 138 ? -33.109 47.171  5.154   1.00 20.78 ? 127  ALA B H    1 
ATOM   9686  H HA   . ALA B 1 138 ? -32.387 45.017  3.819   1.00 20.22 ? 127  ALA B HA   1 
ATOM   9687  H HB1  . ALA B 1 138 ? -33.931 43.929  5.197   1.00 21.41 ? 127  ALA B HB1  1 
ATOM   9688  H HB2  . ALA B 1 138 ? -33.004 44.892  6.056   1.00 21.41 ? 127  ALA B HB2  1 
ATOM   9689  H HB3  . ALA B 1 138 ? -34.483 45.338  5.682   1.00 21.41 ? 127  ALA B HB3  1 
ATOM   9690  N N    . ASP B 1 139 ? -35.195 46.324  2.978   1.00 18.28 ? 128  ASP B N    1 
ATOM   9691  C CA   . ASP B 1 139 ? -36.201 46.295  1.912   1.00 18.30 ? 128  ASP B CA   1 
ATOM   9692  C C    . ASP B 1 139 ? -35.551 46.472  0.543   1.00 18.70 ? 128  ASP B C    1 
ATOM   9693  O O    . ASP B 1 139 ? -35.982 45.858  -0.438  1.00 19.81 ? 128  ASP B O    1 
ATOM   9694  C CB   . ASP B 1 139 ? -37.310 47.330  2.104   1.00 18.13 ? 128  ASP B CB   1 
ATOM   9695  C CG   . ASP B 1 139 ? -38.322 46.951  3.165   1.00 20.84 ? 128  ASP B CG   1 
ATOM   9696  O OD1  . ASP B 1 139 ? -38.411 45.781  3.564   1.00 24.07 ? 128  ASP B OD1  1 
ATOM   9697  O OD2  . ASP B 1 139 ? -39.099 47.850  3.539   1.00 24.31 ? 128  ASP B OD2  1 
ATOM   9698  H H    . ASP B 1 139 ? -35.294 46.955  3.554   1.00 21.94 ? 128  ASP B H    1 
ATOM   9699  H HA   . ASP B 1 139 ? -36.621 45.421  1.919   1.00 21.96 ? 128  ASP B HA   1 
ATOM   9700  H HB2  . ASP B 1 139 ? -36.908 48.174  2.366   1.00 21.76 ? 128  ASP B HB2  1 
ATOM   9701  H HB3  . ASP B 1 139 ? -37.785 47.439  1.265   1.00 21.76 ? 128  ASP B HB3  1 
ATOM   9702  N N    A SER B 1 140 ? -34.509 47.295  0.453   0.50 21.00 ? 129  SER B N    1 
ATOM   9703  N N    B SER B 1 140 ? -34.494 47.303  0.469   0.50 17.68 ? 129  SER B N    1 
ATOM   9704  C CA   A SER B 1 140 ? -33.932 47.559  -0.858  0.50 19.22 ? 129  SER B CA   1 
ATOM   9705  C CA   B SER B 1 140 ? -33.837 47.628  -0.796  0.50 19.35 ? 129  SER B CA   1 
ATOM   9706  C C    A SER B 1 140 ? -32.996 46.442  -1.297  0.50 19.61 ? 129  SER B C    1 
ATOM   9707  C C    B SER B 1 140 ? -32.902 46.521  -1.259  0.50 21.00 ? 129  SER B C    1 
ATOM   9708  O O    A SER B 1 140 ? -32.872 46.187  -2.500  0.50 22.77 ? 129  SER B O    1 
ATOM   9709  O O    B SER B 1 140 ? -32.658 46.375  -2.455  0.50 20.20 ? 129  SER B O    1 
ATOM   9710  C CB   A SER B 1 140 ? -33.211 48.910  -0.844  0.50 28.04 ? 129  SER B CB   1 
ATOM   9711  C CB   B SER B 1 140 ? -33.019 48.919  -0.630  0.50 19.66 ? 129  SER B CB   1 
ATOM   9712  O OG   A SER B 1 140 ? -32.114 48.897  0.049   0.50 29.59 ? 129  SER B OG   1 
ATOM   9713  O OG   B SER B 1 140 ? -32.268 49.227  -1.812  0.50 20.89 ? 129  SER B OG   1 
ATOM   9714  H H    A SER B 1 140 ? -34.130 47.698  1.111   0.50 25.20 ? 129  SER B H    1 
ATOM   9715  H H    B SER B 1 140 ? -34.141 47.691  1.150   0.50 21.22 ? 129  SER B H    1 
ATOM   9716  H HA   A SER B 1 140 ? -34.650 47.614  -1.508  0.50 23.06 ? 129  SER B HA   1 
ATOM   9717  H HA   B SER B 1 140 ? -34.507 47.773  -1.482  0.50 23.22 ? 129  SER B HA   1 
ATOM   9718  H HB2  A SER B 1 140 ? -32.887 49.103  -1.737  0.50 33.65 ? 129  SER B HB2  1 
ATOM   9719  H HB2  B SER B 1 140 ? -33.627 49.652  -0.445  0.50 23.59 ? 129  SER B HB2  1 
ATOM   9720  H HB3  A SER B 1 140 ? -33.836 49.597  -0.563  0.50 33.65 ? 129  SER B HB3  1 
ATOM   9721  H HB3  B SER B 1 140 ? -32.404 48.807  0.112   0.50 23.59 ? 129  SER B HB3  1 
ATOM   9722  H HG   A SER B 1 140 ? -32.379 48.732  0.829   0.50 35.51 ? 129  SER B HG   1 
ATOM   9723  H HG   B SER B 1 140 ? -31.734 48.602  -1.984  0.50 25.07 ? 129  SER B HG   1 
ATOM   9724  N N    . LYS B 1 141 ? -32.368 45.742  -0.344  1.00 17.15 ? 130  LYS B N    1 
ATOM   9725  C CA   . LYS B 1 141 ? -31.258 44.856  -0.652  1.00 17.08 ? 130  LYS B CA   1 
ATOM   9726  C C    . LYS B 1 141 ? -31.477 43.394  -0.323  1.00 16.21 ? 130  LYS B C    1 
ATOM   9727  O O    . LYS B 1 141 ? -30.871 42.563  -0.967  1.00 17.54 ? 130  LYS B O    1 
ATOM   9728  C CB   . LYS B 1 141 ? -29.995 45.328  0.078   1.00 20.12 ? 130  LYS B CB   1 
ATOM   9729  C CG   . LYS B 1 141 ? -29.319 46.520  -0.559  1.00 25.18 ? 130  LYS B CG   1 
ATOM   9730  C CD   . LYS B 1 141 ? -28.041 46.877  0.192   1.00 29.74 ? 130  LYS B CD   1 
ATOM   9731  C CE   . LYS B 1 141 ? -27.168 47.950  -0.513  1.00 38.77 ? 130  LYS B CE   1 
ATOM   9732  N NZ   . LYS B 1 141 ? -27.958 49.087  -0.962  1.00 42.25 ? 130  LYS B NZ   1 
ATOM   9733  H H    A LYS B 1 141 ? -32.574 45.767  0.490   0.50 20.59 ? 130  LYS B H    1 
ATOM   9734  H H    B LYS B 1 141 ? -32.631 45.703  0.474   0.50 20.59 ? 130  LYS B H    1 
ATOM   9735  H HA   . LYS B 1 141 ? -31.081 44.912  -1.604  1.00 20.50 ? 130  LYS B HA   1 
ATOM   9736  H HB2  . LYS B 1 141 ? -30.233 45.574  0.985   1.00 24.15 ? 130  LYS B HB2  1 
ATOM   9737  H HB3  . LYS B 1 141 ? -29.354 44.599  0.094   1.00 24.15 ? 130  LYS B HB3  1 
ATOM   9738  H HG2  . LYS B 1 141 ? -29.087 46.307  -1.476  1.00 30.21 ? 130  LYS B HG2  1 
ATOM   9739  H HG3  . LYS B 1 141 ? -29.917 47.283  -0.529  1.00 30.21 ? 130  LYS B HG3  1 
ATOM   9740  H HD2  . LYS B 1 141 ? -28.280 47.220  1.067   1.00 35.68 ? 130  LYS B HD2  1 
ATOM   9741  H HD3  . LYS B 1 141 ? -27.503 46.076  0.289   1.00 35.68 ? 130  LYS B HD3  1 
ATOM   9742  H HE2  . LYS B 1 141 ? -26.498 48.273  0.109   1.00 46.53 ? 130  LYS B HE2  1 
ATOM   9743  H HE3  . LYS B 1 141 ? -26.741 47.553  -1.288  1.00 46.53 ? 130  LYS B HE3  1 
ATOM   9744  H HZ1  . LYS B 1 141 ? -27.432 49.684  -1.361  1.00 50.70 ? 130  LYS B HZ1  1 
ATOM   9745  H HZ2  . LYS B 1 141 ? -28.358 49.473  -0.267  1.00 50.70 ? 130  LYS B HZ2  1 
ATOM   9746  H HZ3  . LYS B 1 141 ? -28.579 48.817  -1.540  1.00 50.70 ? 130  LYS B HZ3  1 
ATOM   9747  N N    . SER B 1 142 ? -32.317 43.039  0.650   1.00 16.23 ? 131  SER B N    1 
ATOM   9748  C CA   . SER B 1 142 ? -32.389 41.643  1.074   1.00 15.37 ? 131  SER B CA   1 
ATOM   9749  C C    . SER B 1 142 ? -32.823 40.721  -0.054  1.00 14.67 ? 131  SER B C    1 
ATOM   9750  O O    . SER B 1 142 ? -33.798 40.990  -0.756  1.00 17.01 ? 131  SER B O    1 
ATOM   9751  C CB   . SER B 1 142 ? -33.333 41.502  2.243   1.00 16.76 ? 131  SER B CB   1 
ATOM   9752  O OG   . SER B 1 142 ? -33.245 40.160  2.707   1.00 15.60 ? 131  SER B OG   1 
ATOM   9753  H H    . SER B 1 142 ? -32.844 43.573  1.071   1.00 19.48 ? 131  SER B H    1 
ATOM   9754  H HA   . SER B 1 142 ? -31.508 41.360  1.366   1.00 18.44 ? 131  SER B HA   1 
ATOM   9755  H HB2  . SER B 1 142 ? -33.068 42.109  2.951   1.00 20.12 ? 131  SER B HB2  1 
ATOM   9756  H HB3  . SER B 1 142 ? -34.240 41.688  1.954   1.00 20.12 ? 131  SER B HB3  1 
ATOM   9757  H HG   . SER B 1 142 ? -33.463 39.629  2.094   1.00 18.73 ? 131  SER B HG   1 
ATOM   9758  N N    . CYS B 1 143 ? -32.149 39.590  -0.156  1.00 15.39 ? 132  CYS B N    1 
ATOM   9759  C CA   . CYS B 1 143 ? -32.471 38.536  -1.110  1.00 15.32 ? 132  CYS B CA   1 
ATOM   9760  C C    . CYS B 1 143 ? -33.496 37.530  -0.574  1.00 14.27 ? 132  CYS B C    1 
ATOM   9761  O O    . CYS B 1 143 ? -33.945 36.640  -1.321  1.00 15.20 ? 132  CYS B O    1 
ATOM   9762  C CB   . CYS B 1 143 ? -31.203 37.749  -1.492  1.00 15.46 ? 132  CYS B CB   1 
ATOM   9763  S SG   . CYS B 1 143 ? -29.958 38.713  -2.349  1.00 16.55 ? 132  CYS B SG   1 
ATOM   9764  H H    . CYS B 1 143 ? -31.471 39.399  0.337   1.00 18.47 ? 132  CYS B H    1 
ATOM   9765  H HA   . CYS B 1 143 ? -32.834 38.936  -1.916  1.00 18.39 ? 132  CYS B HA   1 
ATOM   9766  H HB2  . CYS B 1 143 ? -30.798 37.401  -0.682  1.00 18.55 ? 132  CYS B HB2  1 
ATOM   9767  H HB3  . CYS B 1 143 ? -31.457 37.014  -2.072  1.00 18.55 ? 132  CYS B HB3  1 
ATOM   9768  H HG   . CYS B 1 143 ? -29.613 39.620  -1.644  1.00 19.85 ? 132  CYS B HG   1 
ATOM   9769  N N    . CYS B 1 144 ? -33.824 37.599  0.719   1.00 14.50 ? 133  CYS B N    1 
ATOM   9770  C CA   . CYS B 1 144 ? -34.705 36.631  1.347   1.00 14.61 ? 133  CYS B CA   1 
ATOM   9771  C C    . CYS B 1 144 ? -35.624 37.334  2.336   1.00 13.79 ? 133  CYS B C    1 
ATOM   9772  O O    . CYS B 1 144 ? -35.391 38.476  2.755   1.00 14.34 ? 133  CYS B O    1 
ATOM   9773  C CB   . CYS B 1 144 ? -33.891 35.523  2.022   1.00 15.04 ? 133  CYS B CB   1 
ATOM   9774  S SG   . CYS B 1 144 ? -32.882 36.077  3.429   1.00 14.88 ? 133  CYS B SG   1 
ATOM   9775  H H    . CYS B 1 144 ? -33.541 38.209  1.255   1.00 17.40 ? 133  CYS B H    1 
ATOM   9776  H HA   . CYS B 1 144 ? -35.259 36.221  0.665   1.00 17.53 ? 133  CYS B HA   1 
ATOM   9777  H HB2  . CYS B 1 144 ? -34.502 34.844  2.348   1.00 18.04 ? 133  CYS B HB2  1 
ATOM   9778  H HB3  . CYS B 1 144 ? -33.292 35.135  1.366   1.00 18.04 ? 133  CYS B HB3  1 
ATOM   9779  H HG   . CYS B 1 144 ? -33.602 36.546  4.266   1.00 17.85 ? 133  CYS B HG   1 
ATOM   9780  N N    . ASP B 1 145 ? -36.683 36.634  2.702   1.00 13.04 ? 134  ASP B N    1 
ATOM   9781  C CA   . ASP B 1 145 ? -37.558 37.156  3.737   1.00 13.51 ? 134  ASP B CA   1 
ATOM   9782  C C    . ASP B 1 145 ? -36.769 37.406  5.013   1.00 13.73 ? 134  ASP B C    1 
ATOM   9783  O O    . ASP B 1 145 ? -35.775 36.730  5.304   1.00 13.13 ? 134  ASP B O    1 
ATOM   9784  C CB   . ASP B 1 145 ? -38.723 36.216  4.004   1.00 13.44 ? 134  ASP B CB   1 
ATOM   9785  C CG   . ASP B 1 145 ? -39.763 36.197  2.914   1.00 13.61 ? 134  ASP B CG   1 
ATOM   9786  O OD1  . ASP B 1 145 ? -39.832 37.110  2.063   1.00 15.03 ? 134  ASP B OD1  1 
ATOM   9787  O OD2  . ASP B 1 145 ? -40.606 35.259  3.007   1.00 14.58 ? 134  ASP B OD2  1 
ATOM   9788  H H    . ASP B 1 145 ? -36.914 35.872  2.377   1.00 15.65 ? 134  ASP B H    1 
ATOM   9789  H HA   . ASP B 1 145 ? -37.922 38.005  3.441   1.00 16.21 ? 134  ASP B HA   1 
ATOM   9790  H HB2  . ASP B 1 145 ? -38.380 35.314  4.100   1.00 16.12 ? 134  ASP B HB2  1 
ATOM   9791  H HB3  . ASP B 1 145 ? -39.162 36.489  4.825   1.00 16.12 ? 134  ASP B HB3  1 
ATOM   9792  N N    . TYR B 1 146 ? -37.198 38.403  5.766   1.00 13.36 ? 135  TYR B N    1 
ATOM   9793  C CA   . TYR B 1 146 ? -36.446 38.790  6.942   1.00 14.64 ? 135  TYR B CA   1 
ATOM   9794  C C    . TYR B 1 146 ? -37.359 39.409  7.981   1.00 13.56 ? 135  TYR B C    1 
ATOM   9795  O O    . TYR B 1 146 ? -38.477 39.801  7.685   1.00 14.18 ? 135  TYR B O    1 
ATOM   9796  C CB   . TYR B 1 146 ? -35.317 39.795  6.611   1.00 14.23 ? 135  TYR B CB   1 
ATOM   9797  C CG   . TYR B 1 146 ? -35.806 41.178  6.349   1.00 14.15 ? 135  TYR B CG   1 
ATOM   9798  C CD1  . TYR B 1 146 ? -36.356 41.523  5.131   1.00 14.94 ? 135  TYR B CD1  1 
ATOM   9799  C CD2  . TYR B 1 146 ? -35.727 42.155  7.345   1.00 15.07 ? 135  TYR B CD2  1 
ATOM   9800  C CE1  . TYR B 1 146 ? -36.829 42.825  4.897   1.00 18.07 ? 135  TYR B CE1  1 
ATOM   9801  C CE2  . TYR B 1 146 ? -36.178 43.413  7.128   1.00 16.42 ? 135  TYR B CE2  1 
ATOM   9802  C CZ   . TYR B 1 146 ? -36.742 43.741  5.924   1.00 15.95 ? 135  TYR B CZ   1 
ATOM   9803  O OH   . TYR B 1 146 ? -37.181 45.018  5.757   1.00 19.20 ? 135  TYR B OH   1 
ATOM   9804  H H    . TYR B 1 146 ? -37.910 38.863  5.622   1.00 16.04 ? 135  TYR B H    1 
ATOM   9805  H HA   . TYR B 1 146 ? -36.040 38.000  7.331   1.00 17.56 ? 135  TYR B HA   1 
ATOM   9806  H HB2  . TYR B 1 146 ? -34.703 39.834  7.360   1.00 17.08 ? 135  TYR B HB2  1 
ATOM   9807  H HB3  . TYR B 1 146 ? -34.850 39.491  5.817   1.00 17.08 ? 135  TYR B HB3  1 
ATOM   9808  H HD1  . TYR B 1 146 ? -36.421 40.884  4.459   1.00 17.92 ? 135  TYR B HD1  1 
ATOM   9809  H HD2  . TYR B 1 146 ? -35.362 41.937  8.172   1.00 18.09 ? 135  TYR B HD2  1 
ATOM   9810  H HE1  . TYR B 1 146 ? -37.208 43.057  4.079   1.00 21.68 ? 135  TYR B HE1  1 
ATOM   9811  H HE2  . TYR B 1 146 ? -36.125 44.049  7.805   1.00 19.71 ? 135  TYR B HE2  1 
ATOM   9812  H HH   . TYR B 1 146 ? -37.483 45.119  4.980   1.00 23.04 ? 135  TYR B HH   1 
ATOM   9813  N N    A SER B 1 147 ? -36.846 39.511  9.199   0.63 15.01 ? 136  SER B N    1 
ATOM   9814  N N    B SER B 1 147 ? -36.870 39.444  9.232   0.37 13.09 ? 136  SER B N    1 
ATOM   9815  C CA   A SER B 1 147 ? -37.507 40.342  10.188  0.63 14.26 ? 136  SER B CA   1 
ATOM   9816  C CA   B SER B 1 147 ? -37.527 40.115  10.357  0.37 12.67 ? 136  SER B CA   1 
ATOM   9817  C C    A SER B 1 147 ? -36.454 40.974  11.086  0.63 16.26 ? 136  SER B C    1 
ATOM   9818  C C    B SER B 1 147 ? -36.476 40.931  11.103  0.37 12.28 ? 136  SER B C    1 
ATOM   9819  O O    A SER B 1 147 ? -35.252 40.822  10.859  0.63 16.79 ? 136  SER B O    1 
ATOM   9820  O O    B SER B 1 147 ? -35.289 40.850  10.796  0.37 8.58  ? 136  SER B O    1 
ATOM   9821  C CB   A SER B 1 147 ? -38.579 39.540  10.903  0.63 13.36 ? 136  SER B CB   1 
ATOM   9822  C CB   B SER B 1 147 ? -38.210 39.117  11.321  0.37 17.60 ? 136  SER B CB   1 
ATOM   9823  O OG   A SER B 1 147 ? -39.497 40.384  11.519  0.63 12.37 ? 136  SER B OG   1 
ATOM   9824  O OG   B SER B 1 147 ? -39.403 38.563  10.780  0.37 16.15 ? 136  SER B OG   1 
ATOM   9825  H H    A SER B 1 147 ? -36.132 39.118  9.473   0.63 18.01 ? 136  SER B H    1 
ATOM   9826  H H    B SER B 1 147 ? -36.129 39.069  9.456   0.37 15.70 ? 136  SER B H    1 
ATOM   9827  H HA   A SER B 1 147 ? -37.956 41.066  9.723   0.63 17.11 ? 136  SER B HA   1 
ATOM   9828  H HA   B SER B 1 147 ? -38.202 40.723  10.019  0.37 15.21 ? 136  SER B HA   1 
ATOM   9829  H HB2  A SER B 1 147 ? -39.044 38.987  10.255  0.63 16.03 ? 136  SER B HB2  1 
ATOM   9830  H HB2  B SER B 1 147 ? -37.591 38.395  11.510  0.37 21.12 ? 136  SER B HB2  1 
ATOM   9831  H HB3  A SER B 1 147 ? -38.161 38.982  11.577  0.63 16.03 ? 136  SER B HB3  1 
ATOM   9832  H HB3  B SER B 1 147 ? -38.430 39.582  12.144  0.37 21.12 ? 136  SER B HB3  1 
ATOM   9833  H HG   A SER B 1 147 ? -40.086 39.931  11.911  0.63 14.84 ? 136  SER B HG   1 
ATOM   9834  H HG   B SER B 1 147 ? -39.746 38.027  11.329  0.37 19.38 ? 136  SER B HG   1 
ATOM   9835  N N    . LEU B 1 148 ? -36.912 41.708  12.105  1.00 13.22 ? 137  LEU B N    1 
ATOM   9836  C CA   . LEU B 1 148 ? -36.010 42.577  12.882  1.00 12.81 ? 137  LEU B CA   1 
ATOM   9837  C C    . LEU B 1 148 ? -36.264 42.510  14.380  1.00 13.09 ? 137  LEU B C    1 
ATOM   9838  O O    . LEU B 1 148 ? -37.360 42.868  14.839  1.00 14.67 ? 137  LEU B O    1 
ATOM   9839  C CB   . LEU B 1 148 ? -36.146 44.042  12.448  1.00 14.64 ? 137  LEU B CB   1 
ATOM   9840  C CG   . LEU B 1 148 ? -35.736 44.325  11.008  1.00 13.63 ? 137  LEU B CG   1 
ATOM   9841  C CD1  . LEU B 1 148 ? -36.178 45.733  10.626  1.00 15.94 ? 137  LEU B CD1  1 
ATOM   9842  C CD2  . LEU B 1 148 ? -34.230 44.176  10.807  1.00 15.18 ? 137  LEU B CD2  1 
ATOM   9843  H H    . LEU B 1 148 ? -37.733 41.738  12.362  1.00 15.86 ? 137  LEU B H    1 
ATOM   9844  H HA   . LEU B 1 148 ? -35.094 42.301  12.722  1.00 15.37 ? 137  LEU B HA   1 
ATOM   9845  H HB2  . LEU B 1 148 ? -37.074 44.308  12.546  1.00 17.56 ? 137  LEU B HB2  1 
ATOM   9846  H HB3  . LEU B 1 148 ? -35.589 44.588  13.024  1.00 17.56 ? 137  LEU B HB3  1 
ATOM   9847  H HG   . LEU B 1 148 ? -36.183 43.698  10.420  1.00 16.35 ? 137  LEU B HG   1 
ATOM   9848  H HD11 . LEU B 1 148 ? -35.914 45.908  9.709   1.00 19.12 ? 137  LEU B HD11 1 
ATOM   9849  H HD12 . LEU B 1 148 ? -37.142 45.794  10.710  1.00 19.12 ? 137  LEU B HD12 1 
ATOM   9850  H HD13 . LEU B 1 148 ? -35.751 46.369  11.220  1.00 19.12 ? 137  LEU B HD13 1 
ATOM   9851  H HD21 . LEU B 1 148 ? -34.016 44.365  9.880   1.00 18.21 ? 137  LEU B HD21 1 
ATOM   9852  H HD22 . LEU B 1 148 ? -33.771 44.802  11.388  1.00 18.21 ? 137  LEU B HD22 1 
ATOM   9853  H HD23 . LEU B 1 148 ? -33.971 43.268  11.029  1.00 18.21 ? 137  LEU B HD23 1 
ATOM   9854  N N    . HIS B 1 149 ? -35.242 42.098  15.124  1.00 12.66 ? 138  HIS B N    1 
ATOM   9855  C CA   . HIS B 1 149 ? -35.174 42.365  16.545  1.00 12.86 ? 138  HIS B CA   1 
ATOM   9856  C C    . HIS B 1 149 ? -34.801 43.837  16.728  1.00 13.64 ? 138  HIS B C    1 
ATOM   9857  O O    . HIS B 1 149 ? -34.134 44.418  15.872  1.00 14.13 ? 138  HIS B O    1 
ATOM   9858  C CB   . HIS B 1 149 ? -34.060 41.539  17.210  1.00 12.62 ? 138  HIS B CB   1 
ATOM   9859  C CG   . HIS B 1 149 ? -34.126 40.068  16.944  1.00 12.40 ? 138  HIS B CG   1 
ATOM   9860  N ND1  . HIS B 1 149 ? -35.105 39.235  17.464  1.00 12.76 ? 138  HIS B ND1  1 
ATOM   9861  C CD2  . HIS B 1 149 ? -33.271 39.272  16.243  1.00 12.94 ? 138  HIS B CD2  1 
ATOM   9862  C CE1  . HIS B 1 149 ? -34.840 37.991  17.101  1.00 13.72 ? 138  HIS B CE1  1 
ATOM   9863  N NE2  . HIS B 1 149 ? -33.736 37.983  16.361  1.00 11.37 ? 138  HIS B NE2  1 
ATOM   9864  H H    . HIS B 1 149 ? -34.570 41.656  14.820  1.00 15.19 ? 138  HIS B H    1 
ATOM   9865  H HA   . HIS B 1 149 ? -36.025 42.183  16.975  1.00 15.43 ? 138  HIS B HA   1 
ATOM   9866  H HB2  . HIS B 1 149 ? -33.203 41.858  16.885  1.00 15.15 ? 138  HIS B HB2  1 
ATOM   9867  H HB3  . HIS B 1 149 ? -34.112 41.666  18.171  1.00 15.15 ? 138  HIS B HB3  1 
ATOM   9868  H HD2  . HIS B 1 149 ? -32.506 39.545  15.791  1.00 15.53 ? 138  HIS B HD2  1 
ATOM   9869  H HE1  . HIS B 1 149 ? -35.357 37.247  17.308  1.00 16.46 ? 138  HIS B HE1  1 
ATOM   9870  H HE2  . HIS B 1 149 ? -33.385 37.289  15.993  1.00 13.64 ? 138  HIS B HE2  1 
ATOM   9871  N N    . VAL B 1 150 ? -35.206 44.432  17.851  1.00 12.84 ? 139  VAL B N    1 
ATOM   9872  C CA   . VAL B 1 150 ? -34.837 45.816  18.147  1.00 13.36 ? 139  VAL B CA   1 
ATOM   9873  C C    . VAL B 1 150 ? -33.968 45.859  19.407  1.00 13.13 ? 139  VAL B C    1 
ATOM   9874  O O    . VAL B 1 150 ? -34.397 45.429  20.486  1.00 14.01 ? 139  VAL B O    1 
ATOM   9875  C CB   . VAL B 1 150 ? -36.064 46.726  18.277  1.00 14.25 ? 139  VAL B CB   1 
ATOM   9876  C CG1  . VAL B 1 150 ? -35.650 48.137  18.691  1.00 14.94 ? 139  VAL B CG1  1 
ATOM   9877  C CG2  . VAL B 1 150 ? -36.794 46.720  16.946  1.00 15.58 ? 139  VAL B CG2  1 
ATOM   9878  H H    . VAL B 1 150 ? -35.693 44.059  18.453  1.00 15.41 ? 139  VAL B H    1 
ATOM   9879  H HA   . VAL B 1 150 ? -34.302 46.155  17.413  1.00 16.03 ? 139  VAL B HA   1 
ATOM   9880  H HB   . VAL B 1 150 ? -36.659 46.370  18.955  1.00 17.11 ? 139  VAL B HB   1 
ATOM   9881  H HG11 . VAL B 1 150 ? -36.444 48.689  18.766  1.00 17.92 ? 139  VAL B HG11 1 
ATOM   9882  H HG12 . VAL B 1 150 ? -35.195 48.094  19.546  1.00 17.92 ? 139  VAL B HG12 1 
ATOM   9883  H HG13 . VAL B 1 150 ? -35.055 48.501  18.017  1.00 17.92 ? 139  VAL B HG13 1 
ATOM   9884  H HG21 . VAL B 1 150 ? -37.574 47.293  17.012  1.00 18.69 ? 139  VAL B HG21 1 
ATOM   9885  H HG22 . VAL B 1 150 ? -36.196 47.053  16.257  1.00 18.69 ? 139  VAL B HG22 1 
ATOM   9886  H HG23 . VAL B 1 150 ? -37.065 45.812  16.739  1.00 18.69 ? 139  VAL B HG23 1 
ATOM   9887  N N    . ASP B 1 151 ? -32.765 46.397  19.280  1.00 13.24 ? 140  ASP B N    1 
ATOM   9888  C CA   . ASP B 1 151 ? -31.818 46.441  20.389  1.00 13.21 ? 140  ASP B CA   1 
ATOM   9889  C C    . ASP B 1 151 ? -32.018 47.750  21.129  1.00 13.89 ? 140  ASP B C    1 
ATOM   9890  O O    . ASP B 1 151 ? -32.096 48.828  20.506  1.00 16.16 ? 140  ASP B O    1 
ATOM   9891  C CB   . ASP B 1 151 ? -30.375 46.362  19.902  1.00 13.09 ? 140  ASP B CB   1 
ATOM   9892  C CG   . ASP B 1 151 ? -30.050 45.035  19.217  1.00 14.52 ? 140  ASP B CG   1 
ATOM   9893  O OD1  . ASP B 1 151 ? -30.952 44.190  19.027  1.00 13.93 ? 140  ASP B OD1  1 
ATOM   9894  O OD2  . ASP B 1 151 ? -28.855 44.864  18.855  1.00 18.93 ? 140  ASP B OD2  1 
ATOM   9895  H H    . ASP B 1 151 ? -32.467 46.747  18.553  1.00 15.89 ? 140  ASP B H    1 
ATOM   9896  H HA   . ASP B 1 151 ? -31.986 45.705  20.998  1.00 15.85 ? 140  ASP B HA   1 
ATOM   9897  H HB2  . ASP B 1 151 ? -30.219 47.075  19.263  1.00 15.71 ? 140  ASP B HB2  1 
ATOM   9898  H HB3  . ASP B 1 151 ? -29.780 46.461  20.661  1.00 15.71 ? 140  ASP B HB3  1 
ATOM   9899  N N    A ILE B 1 152 ? -32.112 47.687  22.445  0.56 15.14 ? 141  ILE B N    1 
ATOM   9900  N N    B ILE B 1 152 ? -32.066 47.662  22.439  0.44 13.56 ? 141  ILE B N    1 
ATOM   9901  C CA   A ILE B 1 152 ? -32.395 48.845  23.284  0.56 13.82 ? 141  ILE B CA   1 
ATOM   9902  C CA   B ILE B 1 152 ? -32.231 48.812  23.310  0.44 17.23 ? 141  ILE B CA   1 
ATOM   9903  C C    A ILE B 1 152 ? -31.060 49.343  23.825  0.56 13.09 ? 141  ILE B C    1 
ATOM   9904  C C    B ILE B 1 152 ? -30.843 49.305  23.670  0.44 16.94 ? 141  ILE B C    1 
ATOM   9905  O O    A ILE B 1 152 ? -30.472 48.732  24.714  0.56 15.73 ? 141  ILE B O    1 
ATOM   9906  O O    B ILE B 1 152 ? -29.996 48.542  24.147  0.44 16.25 ? 141  ILE B O    1 
ATOM   9907  C CB   A ILE B 1 152 ? -33.342 48.455  24.424  0.56 14.98 ? 141  ILE B CB   1 
ATOM   9908  C CB   B ILE B 1 152 ? -33.016 48.416  24.568  0.44 19.24 ? 141  ILE B CB   1 
ATOM   9909  C CG1  A ILE B 1 152 ? -34.701 48.090  23.845  0.56 17.05 ? 141  ILE B CG1  1 
ATOM   9910  C CG1  B ILE B 1 152 ? -34.353 47.794  24.166  0.44 18.75 ? 141  ILE B CG1  1 
ATOM   9911  C CG2  A ILE B 1 152 ? -33.465 49.593  25.459  0.56 18.25 ? 141  ILE B CG2  1 
ATOM   9912  C CG2  B ILE B 1 152 ? -33.220 49.638  25.468  0.44 21.63 ? 141  ILE B CG2  1 
ATOM   9913  C CD1  A ILE B 1 152 ? -35.616 47.527  24.879  0.56 20.86 ? 141  ILE B CD1  1 
ATOM   9914  C CD1  B ILE B 1 152 ? -35.231 48.729  23.356  0.44 18.97 ? 141  ILE B CD1  1 
ATOM   9915  H H    A ILE B 1 152 ? -32.014 46.959  22.893  0.56 18.17 ? 141  ILE B H    1 
ATOM   9916  H H    B ILE B 1 152 ? -32.003 46.919  22.867  0.44 16.27 ? 141  ILE B H    1 
ATOM   9917  H HA   A ILE B 1 152 ? -32.805 49.547  22.756  0.56 16.58 ? 141  ILE B HA   1 
ATOM   9918  H HA   B ILE B 1 152 ? -32.709 49.517  22.846  0.44 20.68 ? 141  ILE B HA   1 
ATOM   9919  H HB   A ILE B 1 152 ? -32.979 47.674  24.870  0.56 17.97 ? 141  ILE B HB   1 
ATOM   9920  H HB   B ILE B 1 152 ? -32.502 47.755  25.057  0.44 23.09 ? 141  ILE B HB   1 
ATOM   9921  H HG12 A ILE B 1 152 ? -35.115 48.886  23.477  0.56 20.46 ? 141  ILE B HG12 1 
ATOM   9922  H HG12 B ILE B 1 152 ? -34.184 47.004  23.630  0.44 22.50 ? 141  ILE B HG12 1 
ATOM   9923  H HG13 A ILE B 1 152 ? -34.583 47.422  23.151  0.56 20.46 ? 141  ILE B HG13 1 
ATOM   9924  H HG13 B ILE B 1 152 ? -34.840 47.549  24.969  0.44 22.50 ? 141  ILE B HG13 1 
ATOM   9925  H HG21 A ILE B 1 152 ? -34.070 49.313  26.164  0.56 21.90 ? 141  ILE B HG21 1 
ATOM   9926  H HG21 B ILE B 1 152 ? -33.717 49.370  26.257  0.44 25.96 ? 141  ILE B HG21 1 
ATOM   9927  H HG22 A ILE B 1 152 ? -32.588 49.779  25.829  0.56 21.90 ? 141  ILE B HG22 1 
ATOM   9928  H HG22 B ILE B 1 152 ? -32.352 49.987  25.726  0.44 25.96 ? 141  ILE B HG22 1 
ATOM   9929  H HG23 A ILE B 1 152 ? -33.813 50.384  25.018  0.56 21.90 ? 141  ILE B HG23 1 
ATOM   9930  H HG23 B ILE B 1 152 ? -33.715 50.312  24.977  0.44 25.96 ? 141  ILE B HG23 1 
ATOM   9931  H HD11 A ILE B 1 152 ? -36.465 47.310  24.464  0.56 25.03 ? 141  ILE B HD11 1 
ATOM   9932  H HD11 B ILE B 1 152 ? -36.059 48.273  23.136  0.44 22.77 ? 141  ILE B HD11 1 
ATOM   9933  H HD12 A ILE B 1 152 ? -35.216 46.726  25.252  0.56 25.03 ? 141  ILE B HD12 1 
ATOM   9934  H HD12 B ILE B 1 152 ? -35.419 49.521  23.883  0.44 22.77 ? 141  ILE B HD12 1 
ATOM   9935  H HD13 A ILE B 1 152 ? -35.747 48.188  25.577  0.56 25.03 ? 141  ILE B HD13 1 
ATOM   9936  H HD13 B ILE B 1 152 ? -34.763 48.975  22.543  0.44 22.77 ? 141  ILE B HD13 1 
ATOM   9937  N N    A SER B 1 153 ? -30.581 50.472  23.305  0.56 13.74 ? 142  SER B N    1 
ATOM   9938  N N    B SER B 1 153 ? -30.599 50.579  23.413  0.44 19.95 ? 142  SER B N    1 
ATOM   9939  C CA   A SER B 1 153 ? -29.256 50.969  23.689  0.56 16.66 ? 142  SER B CA   1 
ATOM   9940  C CA   B SER B 1 153 ? -29.283 51.156  23.623  0.44 20.85 ? 142  SER B CA   1 
ATOM   9941  C C    A SER B 1 153 ? -29.271 51.729  25.008  0.56 16.60 ? 142  SER B C    1 
ATOM   9942  C C    B SER B 1 153 ? -29.234 52.023  24.873  0.44 20.84 ? 142  SER B C    1 
ATOM   9943  O O    A SER B 1 153 ? -28.212 51.880  25.632  0.56 21.79 ? 142  SER B O    1 
ATOM   9944  O O    B SER B 1 153 ? -28.133 52.344  25.346  0.44 19.99 ? 142  SER B O    1 
ATOM   9945  C CB   A SER B 1 153 ? -28.696 51.899  22.615  0.56 19.54 ? 142  SER B CB   1 
ATOM   9946  C CB   B SER B 1 153 ? -28.870 51.951  22.372  0.44 21.57 ? 142  SER B CB   1 
ATOM   9947  O OG   A SER B 1 153 ? -29.609 52.935  22.270  0.56 22.12 ? 142  SER B OG   1 
ATOM   9948  O OG   B SER B 1 153 ? -28.809 51.096  21.222  0.44 24.12 ? 142  SER B OG   1 
ATOM   9949  H H    A SER B 1 153 ? -30.995 50.965  22.735  0.56 16.48 ? 142  SER B H    1 
ATOM   9950  H H    B SER B 1 153 ? -31.183 51.135  23.114  0.44 23.94 ? 142  SER B H    1 
ATOM   9951  H HA   A SER B 1 153 ? -28.651 50.217  23.782  0.56 19.99 ? 142  SER B HA   1 
ATOM   9952  H HA   B SER B 1 153 ? -28.643 50.436  23.739  0.44 25.02 ? 142  SER B HA   1 
ATOM   9953  H HB2  A SER B 1 153 ? -27.879 52.302  22.947  0.56 23.45 ? 142  SER B HB2  1 
ATOM   9954  H HB2  B SER B 1 153 ? -29.524 52.649  22.212  0.44 25.88 ? 142  SER B HB2  1 
ATOM   9955  H HB3  A SER B 1 153 ? -28.504 51.376  21.821  0.56 23.45 ? 142  SER B HB3  1 
ATOM   9956  H HB3  B SER B 1 153 ? -27.996 52.343  22.521  0.44 25.88 ? 142  SER B HB3  1 
ATOM   9957  H HG   A SER B 1 153 ? -29.273 53.428  21.678  0.56 26.55 ? 142  SER B HG   1 
ATOM   9958  H HG   B SER B 1 153 ? -28.583 51.540  20.545  0.44 28.94 ? 142  SER B HG   1 
ATOM   9959  N N    A GLU B 1 154 ? -30.422 52.260  25.413  0.56 20.22 ? 143  GLU B N    1 
ATOM   9960  N N    B GLU B 1 154 ? -30.405 52.372  25.425  0.44 22.27 ? 143  GLU B N    1 
ATOM   9961  C CA   A GLU B 1 154 ? -30.518 53.038  26.636  0.56 22.57 ? 143  GLU B CA   1 
ATOM   9962  C CA   B GLU B 1 154 ? -30.539 53.317  26.524  0.44 22.08 ? 143  GLU B CA   1 
ATOM   9963  C C    A GLU B 1 154 ? -31.926 52.912  27.172  0.56 19.45 ? 143  GLU B C    1 
ATOM   9964  C C    B GLU B 1 154 ? -31.938 53.216  27.126  0.44 19.96 ? 143  GLU B C    1 
ATOM   9965  O O    A GLU B 1 154 ? -32.867 52.592  26.445  0.56 21.54 ? 143  GLU B O    1 
ATOM   9966  O O    B GLU B 1 154 ? -32.922 53.249  26.379  0.44 19.03 ? 143  GLU B O    1 
ATOM   9967  C CB   A GLU B 1 154 ? -30.242 54.513  26.370  0.56 29.94 ? 143  GLU B CB   1 
ATOM   9968  C CB   B GLU B 1 154 ? -30.332 54.727  25.969  0.44 24.99 ? 143  GLU B CB   1 
ATOM   9969  C CG   A GLU B 1 154 ? -31.179 55.072  25.333  0.56 30.61 ? 143  GLU B CG   1 
ATOM   9970  C CG   B GLU B 1 154 ? -30.146 55.784  27.007  0.44 25.96 ? 143  GLU B CG   1 
ATOM   9971  C CD   A GLU B 1 154 ? -30.771 56.450  24.874  0.56 33.08 ? 143  GLU B CD   1 
ATOM   9972  C CD   B GLU B 1 154 ? -29.887 57.129  26.386  0.44 25.54 ? 143  GLU B CD   1 
ATOM   9973  O OE1  A GLU B 1 154 ? -29.927 57.095  25.552  0.56 35.81 ? 143  GLU B OE1  1 
ATOM   9974  O OE1  B GLU B 1 154 ? -30.828 57.687  25.776  0.44 24.24 ? 143  GLU B OE1  1 
ATOM   9975  O OE2  A GLU B 1 154 ? -31.307 56.879  23.833  0.56 34.41 ? 143  GLU B OE2  1 
ATOM   9976  O OE2  B GLU B 1 154 ? -28.742 57.614  26.500  0.44 27.33 ? 143  GLU B OE2  1 
ATOM   9977  H H    A GLU B 1 154 ? -31.166 52.181  24.990  0.56 24.26 ? 143  GLU B H    1 
ATOM   9978  H H    B GLU B 1 154 ? -31.161 52.056  25.163  0.44 26.73 ? 143  GLU B H    1 
ATOM   9979  H HA   A GLU B 1 154 ? -29.891 52.707  27.298  0.56 27.08 ? 143  GLU B HA   1 
ATOM   9980  H HA   B GLU B 1 154 ? -29.877 53.138  27.210  0.44 26.50 ? 143  GLU B HA   1 
ATOM   9981  H HB2  A GLU B 1 154 ? -30.363 55.015  27.191  0.56 35.93 ? 143  GLU B HB2  1 
ATOM   9982  H HB2  B GLU B 1 154 ? -29.542 54.726  25.407  0.44 29.99 ? 143  GLU B HB2  1 
ATOM   9983  H HB3  A GLU B 1 154 ? -29.334 54.615  26.045  0.56 35.93 ? 143  GLU B HB3  1 
ATOM   9984  H HB3  B GLU B 1 154 ? -31.109 54.969  25.441  0.44 29.99 ? 143  GLU B HB3  1 
ATOM   9985  H HG2  A GLU B 1 154 ? -31.184 54.486  24.560  0.56 36.73 ? 143  GLU B HG2  1 
ATOM   9986  H HG2  B GLU B 1 154 ? -30.950 55.848  27.547  0.44 31.15 ? 143  GLU B HG2  1 
ATOM   9987  H HG3  A GLU B 1 154 ? -32.071 55.133  25.711  0.56 36.73 ? 143  GLU B HG3  1 
ATOM   9988  H HG3  B GLU B 1 154 ? -29.385 55.555  27.564  0.44 31.15 ? 143  GLU B HG3  1 
ATOM   9989  N N    . TRP B 1 155 ? -32.045 53.157  28.459  1.00 19.86 ? 144  TRP B N    1 
ATOM   9990  C CA   . TRP B 1 155 ? -33.325 53.077  29.149  1.00 21.55 ? 144  TRP B CA   1 
ATOM   9991  C C    . TRP B 1 155 ? -33.608 54.401  29.817  1.00 26.62 ? 144  TRP B C    1 
ATOM   9992  O O    . TRP B 1 155 ? -32.857 54.860  30.677  1.00 29.38 ? 144  TRP B O    1 
ATOM   9993  C CB   . TRP B 1 155 ? -33.288 51.976  30.196  1.00 24.71 ? 144  TRP B CB   1 
ATOM   9994  C CG   . TRP B 1 155 ? -34.614 51.654  30.847  1.00 22.50 ? 144  TRP B CG   1 
ATOM   9995  C CD1  . TRP B 1 155 ? -34.901 51.752  32.165  1.00 24.46 ? 144  TRP B CD1  1 
ATOM   9996  C CD2  . TRP B 1 155 ? -35.806 51.158  30.213  1.00 23.51 ? 144  TRP B CD2  1 
ATOM   9997  N NE1  . TRP B 1 155 ? -36.200 51.346  32.406  1.00 23.77 ? 144  TRP B NE1  1 
ATOM   9998  C CE2  . TRP B 1 155 ? -36.764 50.945  31.230  1.00 21.26 ? 144  TRP B CE2  1 
ATOM   9999  C CE3  . TRP B 1 155 ? -36.153 50.867  28.897  1.00 27.60 ? 144  TRP B CE3  1 
ATOM   10000 C CZ2  . TRP B 1 155 ? -38.065 50.498  30.965  1.00 27.24 ? 144  TRP B CZ2  1 
ATOM   10001 C CZ3  . TRP B 1 155 ? -37.444 50.379  28.632  1.00 32.27 ? 144  TRP B CZ3  1 
ATOM   10002 C CH2  . TRP B 1 155 ? -38.381 50.210  29.657  1.00 29.46 ? 144  TRP B CH2  1 
ATOM   10003 H H    . TRP B 1 155 ? -31.380 53.270  28.990  1.00 23.83 ? 144  TRP B H    1 
ATOM   10004 H HA   . TRP B 1 155 ? -34.033 52.886  28.514  1.00 25.86 ? 144  TRP B HA   1 
ATOM   10005 H HB2  . TRP B 1 155 ? -32.966 51.164  29.775  1.00 29.65 ? 144  TRP B HB2  1 
ATOM   10006 H HB3  . TRP B 1 155 ? -32.675 52.242  30.899  1.00 29.65 ? 144  TRP B HB3  1 
ATOM   10007 H HD1  . TRP B 1 155 ? -34.302 52.031  32.820  1.00 29.35 ? 144  TRP B HD1  1 
ATOM   10008 H HE1  . TRP B 1 155 ? -36.580 51.318  33.178  1.00 28.52 ? 144  TRP B HE1  1 
ATOM   10009 H HE3  . TRP B 1 155 ? -35.533 50.964  28.211  1.00 33.12 ? 144  TRP B HE3  1 
ATOM   10010 H HZ2  . TRP B 1 155 ? -38.687 50.388  31.648  1.00 32.69 ? 144  TRP B HZ2  1 
ATOM   10011 H HZ3  . TRP B 1 155 ? -37.683 50.175  27.757  1.00 38.73 ? 144  TRP B HZ3  1 
ATOM   10012 H HH2  . TRP B 1 155 ? -39.231 49.894  29.452  1.00 35.35 ? 144  TRP B HH2  1 
ATOM   10013 N N    . HIS B 1 156 ? -34.687 55.023  29.427  1.00 30.62 ? 145  HIS B N    1 
ATOM   10014 C CA   . HIS B 1 156 ? -35.060 56.262  30.075  1.00 38.63 ? 145  HIS B CA   1 
ATOM   10015 C C    . HIS B 1 156 ? -36.510 56.474  29.749  1.00 38.68 ? 145  HIS B C    1 
ATOM   10016 O O    . HIS B 1 156 ? -37.111 55.713  28.984  1.00 34.37 ? 145  HIS B O    1 
ATOM   10017 C CB   . HIS B 1 156 ? -34.221 57.419  29.552  1.00 41.91 ? 145  HIS B CB   1 
ATOM   10018 C CG   . HIS B 1 156 ? -34.232 57.508  28.067  1.00 39.19 ? 145  HIS B CG   1 
ATOM   10019 N ND1  . HIS B 1 156 ? -35.398 57.631  27.338  1.00 52.44 ? 145  HIS B ND1  1 
ATOM   10020 C CD2  . HIS B 1 156 ? -33.235 57.406  27.164  1.00 42.85 ? 145  HIS B CD2  1 
ATOM   10021 C CE1  . HIS B 1 156 ? -35.111 57.629  26.049  1.00 53.09 ? 145  HIS B CE1  1 
ATOM   10022 N NE2  . HIS B 1 156 ? -33.805 57.487  25.917  1.00 48.33 ? 145  HIS B NE2  1 
ATOM   10023 H H    . HIS B 1 156 ? -35.217 54.762  28.802  1.00 36.74 ? 145  HIS B H    1 
ATOM   10024 H HA   . HIS B 1 156 ? -34.951 56.189  31.036  1.00 46.36 ? 145  HIS B HA   1 
ATOM   10025 H HB2  . HIS B 1 156 ? -34.573 58.251  29.906  1.00 50.29 ? 145  HIS B HB2  1 
ATOM   10026 H HB3  . HIS B 1 156 ? -33.302 57.298  29.839  1.00 50.29 ? 145  HIS B HB3  1 
ATOM   10027 H HD1  . HIS B 1 156 ? -36.188 57.703  27.671  1.00 62.93 ? 145  HIS B HD1  1 
ATOM   10028 H HD2  . HIS B 1 156 ? -32.330 57.301  27.351  1.00 51.42 ? 145  HIS B HD2  1 
ATOM   10029 H HE1  . HIS B 1 156 ? -35.723 57.717  25.355  1.00 63.71 ? 145  HIS B HE1  1 
ATOM   10030 N N    . LYS B 1 157 ? -37.044 57.556  30.298  1.00 40.22 ? 146  LYS B N    1 
ATOM   10031 C CA   . LYS B 1 157 ? -38.443 57.885  30.130  1.00 40.92 ? 146  LYS B CA   1 
ATOM   10032 C C    . LYS B 1 157 ? -38.818 57.883  28.665  1.00 37.99 ? 146  LYS B C    1 
ATOM   10033 O O    . LYS B 1 157 ? -38.140 58.468  27.816  1.00 36.21 ? 146  LYS B O    1 
ATOM   10034 C CB   . LYS B 1 157 ? -38.736 59.255  30.739  1.00 50.01 ? 146  LYS B CB   1 
ATOM   10035 C CG   . LYS B 1 157 ? -39.454 59.159  32.055  1.00 61.78 ? 146  LYS B CG   1 
ATOM   10036 C CD   . LYS B 1 157 ? -39.754 60.541  32.605  1.00 68.45 ? 146  LYS B CD   1 
ATOM   10037 C CE   . LYS B 1 157 ? -39.033 60.787  33.940  1.00 75.85 ? 146  LYS B CE   1 
ATOM   10038 N NZ   . LYS B 1 157 ? -39.512 59.874  35.031  1.00 79.23 ? 146  LYS B NZ   1 
ATOM   10039 H H    . LYS B 1 157 ? -36.608 58.121  30.779  1.00 48.26 ? 146  LYS B H    1 
ATOM   10040 H HA   . LYS B 1 157 ? -38.987 57.223  30.586  1.00 49.10 ? 146  LYS B HA   1 
ATOM   10041 H HB2  . LYS B 1 157 ? -37.899 59.721  30.887  1.00 60.01 ? 146  LYS B HB2  1 
ATOM   10042 H HB3  . LYS B 1 157 ? -39.295 59.760  30.128  1.00 60.01 ? 146  LYS B HB3  1 
ATOM   10043 H HG2  . LYS B 1 157 ? -40.293 58.689  31.931  1.00 74.14 ? 146  LYS B HG2  1 
ATOM   10044 H HG3  . LYS B 1 157 ? -38.894 58.690  32.694  1.00 74.14 ? 146  LYS B HG3  1 
ATOM   10045 H HD2  . LYS B 1 157 ? -39.454 61.210  31.970  1.00 82.14 ? 146  LYS B HD2  1 
ATOM   10046 H HD3  . LYS B 1 157 ? -40.709 60.625  32.755  1.00 82.14 ? 146  LYS B HD3  1 
ATOM   10047 H HE2  . LYS B 1 157 ? -38.082 60.638  33.819  1.00 91.02 ? 146  LYS B HE2  1 
ATOM   10048 H HE3  . LYS B 1 157 ? -39.192 61.702  34.222  1.00 91.02 ? 146  LYS B HE3  1 
ATOM   10049 H HZ1  . LYS B 1 157 ? -40.383 59.995  35.169  1.00 95.08 ? 146  LYS B HZ1  1 
ATOM   10050 H HZ2  . LYS B 1 157 ? -39.371 59.026  34.801  1.00 95.08 ? 146  LYS B HZ2  1 
ATOM   10051 H HZ3  . LYS B 1 157 ? -39.073 60.046  35.786  1.00 95.08 ? 146  LYS B HZ3  1 
ATOM   10052 N N    . GLY B 1 158 ? -39.913 57.240  28.384  1.00 33.15 ? 147  GLY B N    1 
ATOM   10053 C CA   . GLY B 1 158 ? -40.440 57.206  27.062  1.00 29.23 ? 147  GLY B CA   1 
ATOM   10054 C C    . GLY B 1 158 ? -40.074 55.969  26.283  1.00 25.47 ? 147  GLY B C    1 
ATOM   10055 O O    . GLY B 1 158 ? -40.731 55.688  25.278  1.00 26.24 ? 147  GLY B O    1 
ATOM   10056 H H    . GLY B 1 158 ? -40.381 56.804  28.959  1.00 39.78 ? 147  GLY B H    1 
ATOM   10057 H HA2  . GLY B 1 158 ? -41.408 57.260  27.105  1.00 35.07 ? 147  GLY B HA2  1 
ATOM   10058 H HA3  . GLY B 1 158 ? -40.116 57.978  26.571  1.00 35.07 ? 147  GLY B HA3  1 
ATOM   10059 N N    . ILE B 1 159 ? -39.032 55.228  26.705  1.00 25.44 ? 148  ILE B N    1 
ATOM   10060 C CA   . ILE B 1 159 ? -38.623 54.046  25.956  1.00 24.30 ? 148  ILE B CA   1 
ATOM   10061 C C    . ILE B 1 159 ? -39.742 53.013  25.952  1.00 24.10 ? 148  ILE B C    1 
ATOM   10062 O O    . ILE B 1 159 ? -39.970 52.323  24.944  1.00 23.05 ? 148  ILE B O    1 
ATOM   10063 C CB   . ILE B 1 159 ? -37.278 53.467  26.477  1.00 28.50 ? 148  ILE B CB   1 
ATOM   10064 C CG1  . ILE B 1 159 ? -36.089 54.423  26.260  1.00 32.13 ? 148  ILE B CG1  1 
ATOM   10065 C CG2  . ILE B 1 159 ? -36.882 52.199  25.715  1.00 27.51 ? 148  ILE B CG2  1 
ATOM   10066 C CD1  . ILE B 1 159 ? -35.715 54.703  24.759  1.00 36.20 ? 148  ILE B CD1  1 
ATOM   10067 H H    . ILE B 1 159 ? -38.562 55.390  27.407  1.00 30.53 ? 148  ILE B H    1 
ATOM   10068 H HA   . ILE B 1 159 ? -38.479 54.311  25.034  1.00 29.16 ? 148  ILE B HA   1 
ATOM   10069 H HB   . ILE B 1 159 ? -37.360 53.263  27.422  1.00 34.20 ? 148  ILE B HB   1 
ATOM   10070 H HG12 . ILE B 1 159 ? -36.301 55.275  26.671  1.00 38.56 ? 148  ILE B HG12 1 
ATOM   10071 H HG13 . ILE B 1 159 ? -35.307 54.042  26.689  1.00 38.56 ? 148  ILE B HG13 1 
ATOM   10072 H HG21 . ILE B 1 159 ? -36.041 51.868  26.068  1.00 33.01 ? 148  ILE B HG21 1 
ATOM   10073 H HG22 . ILE B 1 159 ? -37.576 51.531  25.832  1.00 33.01 ? 148  ILE B HG22 1 
ATOM   10074 H HG23 . ILE B 1 159 ? -36.785 52.413  24.774  1.00 33.01 ? 148  ILE B HG23 1 
ATOM   10075 H HD11 . ILE B 1 159 ? -34.960 55.311  24.731  1.00 43.44 ? 148  ILE B HD11 1 
ATOM   10076 H HD12 . ILE B 1 159 ? -35.482 53.864  24.331  1.00 43.44 ? 148  ILE B HD12 1 
ATOM   10077 H HD13 . ILE B 1 159 ? -36.479 55.101  24.313  1.00 43.44 ? 148  ILE B HD13 1 
ATOM   10078 N N    . GLN B 1 160 ? -40.433 52.863  27.088  1.00 23.40 ? 149  GLN B N    1 
ATOM   10079 C CA   . GLN B 1 160 ? -41.558 51.936  27.159  1.00 24.35 ? 149  GLN B CA   1 
ATOM   10080 C C    . GLN B 1 160 ? -42.555 52.213  26.040  1.00 21.20 ? 149  GLN B C    1 
ATOM   10081 O O    . GLN B 1 160 ? -43.005 51.298  25.350  1.00 20.92 ? 149  GLN B O    1 
ATOM   10082 C CB   . GLN B 1 160 ? -42.232 52.008  28.541  1.00 23.39 ? 149  GLN B CB   1 
ATOM   10083 C CG   . GLN B 1 160 ? -43.480 51.182  28.614  1.00 25.69 ? 149  GLN B CG   1 
ATOM   10084 C CD   . GLN B 1 160 ? -44.164 51.235  29.947  1.00 26.85 ? 149  GLN B CD   1 
ATOM   10085 O OE1  . GLN B 1 160 ? -43.547 51.500  30.978  1.00 30.24 ? 149  GLN B OE1  1 
ATOM   10086 N NE2  . GLN B 1 160 ? -45.467 51.008  29.934  1.00 33.55 ? 149  GLN B NE2  1 
ATOM   10087 H H    . GLN B 1 160 ? -40.270 53.283  27.820  1.00 28.08 ? 149  GLN B H    1 
ATOM   10088 H HA   . GLN B 1 160 ? -41.224 51.033  27.041  1.00 29.22 ? 149  GLN B HA   1 
ATOM   10089 H HB2  . GLN B 1 160 ? -41.614 51.679  29.213  1.00 28.07 ? 149  GLN B HB2  1 
ATOM   10090 H HB3  . GLN B 1 160 ? -42.469 52.929  28.730  1.00 28.07 ? 149  GLN B HB3  1 
ATOM   10091 H HG2  . GLN B 1 160 ? -44.107 51.503  27.946  1.00 30.83 ? 149  GLN B HG2  1 
ATOM   10092 H HG3  . GLN B 1 160 ? -43.254 50.256  28.434  1.00 30.83 ? 149  GLN B HG3  1 
ATOM   10093 H HE21 . GLN B 1 160 ? -45.867 50.843  29.191  1.00 40.25 ? 149  GLN B HE21 1 
ATOM   10094 H HE22 . GLN B 1 160 ? -45.913 51.026  30.669  1.00 40.25 ? 149  GLN B HE22 1 
ATOM   10095 N N    . GLU B 1 161 ? -42.920 53.478  25.851  1.00 22.23 ? 150  GLU B N    1 
ATOM   10096 C CA   . GLU B 1 161 ? -43.910 53.798  24.842  1.00 21.05 ? 150  GLU B CA   1 
ATOM   10097 C C    . GLU B 1 161 ? -43.384 53.513  23.438  1.00 20.05 ? 150  GLU B C    1 
ATOM   10098 O O    . GLU B 1 161 ? -44.128 53.040  22.565  1.00 19.81 ? 150  GLU B O    1 
ATOM   10099 C CB   . GLU B 1 161 ? -44.340 55.265  24.990  1.00 25.45 ? 150  GLU B CB   1 
ATOM   10100 C CG   . GLU B 1 161 ? -45.204 55.504  26.219  1.00 34.16 ? 150  GLU B CG   1 
ATOM   10101 C CD   . GLU B 1 161 ? -44.445 55.373  27.593  1.00 45.54 ? 150  GLU B CD   1 
ATOM   10102 O OE1  . GLU B 1 161 ? -43.204 55.624  27.688  1.00 33.96 ? 150  GLU B OE1  1 
ATOM   10103 O OE2  . GLU B 1 161 ? -45.122 55.026  28.598  1.00 55.70 ? 150  GLU B OE2  1 
ATOM   10104 H H    . GLU B 1 161 ? -42.613 54.154  26.286  1.00 26.68 ? 150  GLU B H    1 
ATOM   10105 H HA   . GLU B 1 161 ? -44.692 53.242  24.984  1.00 25.26 ? 150  GLU B HA   1 
ATOM   10106 H HB2  . GLU B 1 161 ? -43.549 55.820  25.066  1.00 30.54 ? 150  GLU B HB2  1 
ATOM   10107 H HB3  . GLU B 1 161 ? -44.853 55.524  24.208  1.00 30.54 ? 150  GLU B HB3  1 
ATOM   10108 H HG2  . GLU B 1 161 ? -45.570 56.401  26.170  1.00 41.00 ? 150  GLU B HG2  1 
ATOM   10109 H HG3  . GLU B 1 161 ? -45.926 54.856  26.220  1.00 41.00 ? 150  GLU B HG3  1 
ATOM   10110 N N    . GLU B 1 162 ? -42.099 53.766  23.191  1.00 22.14 ? 151  GLU B N    1 
ATOM   10111 C CA   . GLU B 1 162 ? -41.524 53.395  21.904  1.00 20.64 ? 151  GLU B CA   1 
ATOM   10112 C C    . GLU B 1 162 ? -41.611 51.894  21.662  1.00 20.26 ? 151  GLU B C    1 
ATOM   10113 O O    . GLU B 1 162 ? -41.870 51.445  20.535  1.00 19.12 ? 151  GLU B O    1 
ATOM   10114 C CB   . GLU B 1 162 ? -40.051 53.802  21.875  1.00 21.85 ? 151  GLU B CB   1 
ATOM   10115 C CG   . GLU B 1 162 ? -39.842 55.313  22.053  1.00 25.86 ? 151  GLU B CG   1 
ATOM   10116 C CD   . GLU B 1 162 ? -38.372 55.647  21.993  1.00 26.71 ? 151  GLU B CD   1 
ATOM   10117 O OE1  . GLU B 1 162 ? -37.741 55.331  20.958  1.00 28.00 ? 151  GLU B OE1  1 
ATOM   10118 O OE2  . GLU B 1 162 ? -37.850 56.210  22.979  1.00 31.49 ? 151  GLU B OE2  1 
ATOM   10119 H H    . GLU B 1 162 ? -41.553 54.143  23.738  1.00 26.57 ? 151  GLU B H    1 
ATOM   10120 H HA   . GLU B 1 162 ? -41.991 53.855  21.189  1.00 24.77 ? 151  GLU B HA   1 
ATOM   10121 H HB2  . GLU B 1 162 ? -39.584 53.349  22.594  1.00 26.22 ? 151  GLU B HB2  1 
ATOM   10122 H HB3  . GLU B 1 162 ? -39.670 53.546  21.020  1.00 26.22 ? 151  GLU B HB3  1 
ATOM   10123 H HG2  . GLU B 1 162 ? -40.295 55.790  21.340  1.00 31.04 ? 151  GLU B HG2  1 
ATOM   10124 H HG3  . GLU B 1 162 ? -40.185 55.588  22.918  1.00 31.04 ? 151  GLU B HG3  1 
ATOM   10125 N N    . MET B 1 163 ? -41.319 51.094  22.685  1.00 18.36 ? 152  MET B N    1 
ATOM   10126 C CA   . MET B 1 163 ? -41.402 49.640  22.530  1.00 17.71 ? 152  MET B CA   1 
ATOM   10127 C C    . MET B 1 163 ? -42.829 49.203  22.256  1.00 17.61 ? 152  MET B C    1 
ATOM   10128 O O    . MET B 1 163 ? -43.075 48.355  21.394  1.00 16.67 ? 152  MET B O    1 
ATOM   10129 C CB   . MET B 1 163 ? -40.884 48.960  23.785  1.00 17.32 ? 152  MET B CB   1 
ATOM   10130 C CG   . MET B 1 163 ? -39.431 49.216  24.081  1.00 17.31 ? 152  MET B CG   1 
ATOM   10131 S SD   . MET B 1 163 ? -38.897 48.726  25.699  1.00 19.97 ? 152  MET B SD   1 
ATOM   10132 C CE   . MET B 1 163 ? -39.133 46.978  25.641  1.00 19.62 ? 152  MET B CE   1 
ATOM   10133 H H    . MET B 1 163 ? -41.073 51.359  23.465  1.00 22.03 ? 152  MET B H    1 
ATOM   10134 H HA   . MET B 1 163 ? -40.841 49.369  21.787  1.00 21.25 ? 152  MET B HA   1 
ATOM   10135 H HB2  . MET B 1 163 ? -41.398 49.276  24.544  1.00 20.78 ? 152  MET B HB2  1 
ATOM   10136 H HB3  . MET B 1 163 ? -41.000 48.002  23.688  1.00 20.78 ? 152  MET B HB3  1 
ATOM   10137 H HG2  . MET B 1 163 ? -38.894 48.728  23.436  1.00 20.77 ? 152  MET B HG2  1 
ATOM   10138 H HG3  . MET B 1 163 ? -39.261 50.166  23.992  1.00 20.77 ? 152  MET B HG3  1 
ATOM   10139 H HE1  . MET B 1 163 ? -38.868 46.596  26.493  1.00 23.55 ? 152  MET B HE1  1 
ATOM   10140 H HE2  . MET B 1 163 ? -40.070 46.792  25.473  1.00 23.55 ? 152  MET B HE2  1 
ATOM   10141 H HE3  . MET B 1 163 ? -38.589 46.609  24.929  1.00 23.55 ? 152  MET B HE3  1 
ATOM   10142 N N    . GLU B 1 164 ? -43.781 49.744  23.024  1.00 18.47 ? 153  GLU B N    1 
ATOM   10143 C CA   . GLU B 1 164 ? -45.196 49.425  22.831  1.00 19.78 ? 153  GLU B CA   1 
ATOM   10144 C C    . GLU B 1 164 ? -45.611 49.688  21.392  1.00 19.00 ? 153  GLU B C    1 
ATOM   10145 O O    . GLU B 1 164 ? -46.325 48.876  20.779  1.00 19.57 ? 153  GLU B O    1 
ATOM   10146 C CB   . GLU B 1 164 ? -46.058 50.236  23.812  1.00 20.64 ? 153  GLU B CB   1 
ATOM   10147 C CG   . GLU B 1 164 ? -45.923 49.760  25.259  1.00 22.08 ? 153  GLU B CG   1 
ATOM   10148 C CD   . GLU B 1 164 ? -46.528 50.701  26.308  1.00 28.28 ? 153  GLU B CD   1 
ATOM   10149 O OE1  . GLU B 1 164 ? -46.834 51.870  25.989  1.00 30.75 ? 153  GLU B OE1  1 
ATOM   10150 O OE2  . GLU B 1 164 ? -46.681 50.256  27.466  1.00 35.84 ? 153  GLU B OE2  1 
ATOM   10151 H H    . GLU B 1 164 ? -43.632 50.298  23.664  1.00 22.17 ? 153  GLU B H    1 
ATOM   10152 H HA   . GLU B 1 164 ? -45.336 48.483  23.017  1.00 23.74 ? 153  GLU B HA   1 
ATOM   10153 H HB2  . GLU B 1 164 ? -45.785 51.167  23.776  1.00 24.77 ? 153  GLU B HB2  1 
ATOM   10154 H HB3  . GLU B 1 164 ? -46.990 50.154  23.555  1.00 24.77 ? 153  GLU B HB3  1 
ATOM   10155 H HG2  . GLU B 1 164 ? -46.367 48.902  25.344  1.00 26.50 ? 153  GLU B HG2  1 
ATOM   10156 H HG3  . GLU B 1 164 ? -44.980 49.659  25.464  1.00 26.50 ? 153  GLU B HG3  1 
ATOM   10157 N N    . ALA B 1 165 ? -45.190 50.828  20.841  1.00 18.86 ? 154  ALA B N    1 
ATOM   10158 C CA   . ALA B 1 165 ? -45.598 51.216  19.490  1.00 18.86 ? 154  ALA B CA   1 
ATOM   10159 C C    . ALA B 1 165 ? -44.991 50.282  18.446  1.00 19.61 ? 154  ALA B C    1 
ATOM   10160 O O    . ALA B 1 165 ? -45.648 49.964  17.437  1.00 19.70 ? 154  ALA B O    1 
ATOM   10161 C CB   . ALA B 1 165 ? -45.244 52.693  19.216  1.00 22.08 ? 154  ALA B CB   1 
ATOM   10162 H H    . ALA B 1 165 ? -44.669 51.392  21.228  1.00 22.63 ? 154  ALA B H    1 
ATOM   10163 H HA   . ALA B 1 165 ? -46.562 51.133  19.427  1.00 22.63 ? 154  ALA B HA   1 
ATOM   10164 H HB1  . ALA B 1 165 ? -45.525 52.922  18.316  1.00 26.50 ? 154  ALA B HB1  1 
ATOM   10165 H HB2  . ALA B 1 165 ? -45.706 53.253  19.860  1.00 26.50 ? 154  ALA B HB2  1 
ATOM   10166 H HB3  . ALA B 1 165 ? -44.285 52.809  19.304  1.00 26.50 ? 154  ALA B HB3  1 
ATOM   10167 N N    . LEU B 1 166 ? -43.729 49.852  18.645  1.00 17.08 ? 155  LEU B N    1 
ATOM   10168 C CA   . LEU B 1 166 ? -43.128 48.929  17.690  1.00 17.21 ? 155  LEU B CA   1 
ATOM   10169 C C    . LEU B 1 166 ? -43.871 47.604  17.679  1.00 15.96 ? 155  LEU B C    1 
ATOM   10170 O O    . LEU B 1 166 ? -44.067 47.015  16.619  1.00 16.45 ? 155  LEU B O    1 
ATOM   10171 C CB   . LEU B 1 166 ? -41.649 48.719  17.996  1.00 16.11 ? 155  LEU B CB   1 
ATOM   10172 C CG   . LEU B 1 166 ? -40.726 49.863  17.587  1.00 16.51 ? 155  LEU B CG   1 
ATOM   10173 C CD1  . LEU B 1 166 ? -39.412 49.675  18.201  1.00 19.51 ? 155  LEU B CD1  1 
ATOM   10174 C CD2  . LEU B 1 166 ? -40.592 49.868  16.055  1.00 18.61 ? 155  LEU B CD2  1 
ATOM   10175 H H    . LEU B 1 166 ? -43.224 50.076  19.304  1.00 20.50 ? 155  LEU B H    1 
ATOM   10176 H HA   . LEU B 1 166 ? -43.195 49.312  16.802  1.00 20.65 ? 155  LEU B HA   1 
ATOM   10177 H HB2  . LEU B 1 166 ? -41.548 48.592  18.952  1.00 19.34 ? 155  LEU B HB2  1 
ATOM   10178 H HB3  . LEU B 1 166 ? -41.349 47.923  17.530  1.00 19.34 ? 155  LEU B HB3  1 
ATOM   10179 H HG   . LEU B 1 166 ? -41.096 50.711  17.877  1.00 19.81 ? 155  LEU B HG   1 
ATOM   10180 H HD11 . LEU B 1 166 ? -38.832 50.407  17.936  1.00 23.42 ? 155  LEU B HD11 1 
ATOM   10181 H HD12 . LEU B 1 166 ? -39.513 49.666  19.166  1.00 23.42 ? 155  LEU B HD12 1 
ATOM   10182 H HD13 . LEU B 1 166 ? -39.040 48.832  17.899  1.00 23.42 ? 155  LEU B HD13 1 
ATOM   10183 H HD21 . LEU B 1 166 ? -40.006 50.595  15.792  1.00 22.33 ? 155  LEU B HD21 1 
ATOM   10184 H HD22 . LEU B 1 166 ? -40.218 49.020  15.769  1.00 22.33 ? 155  LEU B HD22 1 
ATOM   10185 H HD23 . LEU B 1 166 ? -41.470 49.992  15.662  1.00 22.33 ? 155  LEU B HD23 1 
ATOM   10186 N N    . VAL B 1 167 ? -44.258 47.093  18.852  1.00 15.83 ? 156  VAL B N    1 
ATOM   10187 C CA   . VAL B 1 167 ? -45.009 45.834  18.912  1.00 15.25 ? 156  VAL B CA   1 
ATOM   10188 C C    . VAL B 1 167 ? -46.388 46.000  18.275  1.00 16.08 ? 156  VAL B C    1 
ATOM   10189 O O    . VAL B 1 167 ? -46.835 45.152  17.496  1.00 18.36 ? 156  VAL B O    1 
ATOM   10190 C CB   . VAL B 1 167 ? -45.106 45.331  20.359  1.00 15.54 ? 156  VAL B CB   1 
ATOM   10191 C CG1  . VAL B 1 167 ? -45.973 44.117  20.410  1.00 17.30 ? 156  VAL B CG1  1 
ATOM   10192 C CG2  . VAL B 1 167 ? -43.727 45.038  20.916  1.00 16.03 ? 156  VAL B CG2  1 
ATOM   10193 H H    . VAL B 1 167 ? -44.100 47.450  19.618  1.00 19.00 ? 156  VAL B H    1 
ATOM   10194 H HA   . VAL B 1 167 ? -44.530 45.164  18.400  1.00 18.31 ? 156  VAL B HA   1 
ATOM   10195 H HB   . VAL B 1 167 ? -45.515 46.017  20.908  1.00 18.64 ? 156  VAL B HB   1 
ATOM   10196 H HG11 . VAL B 1 167 ? -46.027 43.807  21.327  1.00 20.76 ? 156  VAL B HG11 1 
ATOM   10197 H HG12 . VAL B 1 167 ? -46.857 44.347  20.085  1.00 20.76 ? 156  VAL B HG12 1 
ATOM   10198 H HG13 . VAL B 1 167 ? -45.583 43.428  19.850  1.00 20.76 ? 156  VAL B HG13 1 
ATOM   10199 H HG21 . VAL B 1 167 ? -43.816 44.722  21.828  1.00 19.24 ? 156  VAL B HG21 1 
ATOM   10200 H HG22 . VAL B 1 167 ? -43.304 44.357  20.369  1.00 19.24 ? 156  VAL B HG22 1 
ATOM   10201 H HG23 . VAL B 1 167 ? -43.200 45.852  20.897  1.00 19.24 ? 156  VAL B HG23 1 
ATOM   10202 N N    . LYS B 1 168 ? -47.072 47.102  18.574  1.00 18.10 ? 157  LYS B N    1 
ATOM   10203 C CA   . LYS B 1 168 ? -48.427 47.269  18.092  1.00 20.29 ? 157  LYS B CA   1 
ATOM   10204 C C    . LYS B 1 168 ? -48.455 47.534  16.598  1.00 20.04 ? 157  LYS B C    1 
ATOM   10205 O O    . LYS B 1 168 ? -49.302 46.975  15.880  1.00 23.48 ? 157  LYS B O    1 
ATOM   10206 C CB   . LYS B 1 168 ? -49.051 48.460  18.807  1.00 22.78 ? 157  LYS B CB   1 
ATOM   10207 C CG   . LYS B 1 168 ? -50.466 48.747  18.340  1.00 27.73 ? 157  LYS B CG   1 
ATOM   10208 C CD   . LYS B 1 168 ? -51.064 49.974  19.031  1.00 36.27 ? 157  LYS B CD   1 
ATOM   10209 C CE   . LYS B 1 168 ? -52.410 50.351  18.408  1.00 47.99 ? 157  LYS B CE   1 
ATOM   10210 N NZ   . LYS B 1 168 ? -52.214 50.852  16.990  1.00 57.21 ? 157  LYS B NZ   1 
ATOM   10211 H H    . LYS B 1 168 ? -46.774 47.756  19.047  1.00 21.72 ? 157  LYS B H    1 
ATOM   10212 H HA   . LYS B 1 168 ? -48.949 46.474  18.284  1.00 24.34 ? 157  LYS B HA   1 
ATOM   10213 H HB2  . LYS B 1 168 ? -49.081 48.276  19.760  1.00 27.33 ? 157  LYS B HB2  1 
ATOM   10214 H HB3  . LYS B 1 168 ? -48.513 49.248  18.638  1.00 27.33 ? 157  LYS B HB3  1 
ATOM   10215 H HG2  . LYS B 1 168 ? -50.457 48.913  17.384  1.00 33.28 ? 157  LYS B HG2  1 
ATOM   10216 H HG3  . LYS B 1 168 ? -51.028 47.983  18.541  1.00 33.28 ? 157  LYS B HG3  1 
ATOM   10217 H HD2  . LYS B 1 168 ? -51.207 49.776  19.970  1.00 43.52 ? 157  LYS B HD2  1 
ATOM   10218 H HD3  . LYS B 1 168 ? -50.460 50.726  18.933  1.00 43.52 ? 157  LYS B HD3  1 
ATOM   10219 H HE2  . LYS B 1 168 ? -52.985 49.571  18.381  1.00 57.59 ? 157  LYS B HE2  1 
ATOM   10220 H HE3  . LYS B 1 168 ? -52.822 51.058  18.929  1.00 57.59 ? 157  LYS B HE3  1 
ATOM   10221 H HZ1  . LYS B 1 168 ? -51.687 51.570  16.992  1.00 68.66 ? 157  LYS B HZ1  1 
ATOM   10222 H HZ2  . LYS B 1 168 ? -51.836 50.218  16.493  1.00 68.66 ? 157  LYS B HZ2  1 
ATOM   10223 H HZ3  . LYS B 1 168 ? -52.999 51.070  16.633  1.00 68.66 ? 157  LYS B HZ3  1 
ATOM   10224 N N    . ASP B 1 169 ? -47.561 48.410  16.116  1.00 19.13 ? 158  ASP B N    1 
ATOM   10225 C CA   . ASP B 1 169 ? -47.683 49.004  14.788  1.00 21.01 ? 158  ASP B CA   1 
ATOM   10226 C C    . ASP B 1 169 ? -46.619 48.576  13.787  1.00 21.03 ? 158  ASP B C    1 
ATOM   10227 O O    . ASP B 1 169 ? -46.759 48.893  12.600  1.00 22.31 ? 158  ASP B O    1 
ATOM   10228 C CB   . ASP B 1 169 ? -47.622 50.533  14.908  1.00 24.81 ? 158  ASP B CB   1 
ATOM   10229 C CG   . ASP B 1 169 ? -48.762 51.106  15.683  1.00 29.88 ? 158  ASP B CG   1 
ATOM   10230 O OD1  . ASP B 1 169 ? -49.869 50.517  15.665  1.00 32.35 ? 158  ASP B OD1  1 
ATOM   10231 O OD2  . ASP B 1 169 ? -48.546 52.178  16.303  1.00 37.42 ? 158  ASP B OD2  1 
ATOM   10232 H H    . ASP B 1 169 ? -46.868 48.676  16.551  1.00 22.96 ? 158  ASP B H    1 
ATOM   10233 H HA   . ASP B 1 169 ? -48.548 48.768  14.420  1.00 25.21 ? 158  ASP B HA   1 
ATOM   10234 H HB2  . ASP B 1 169 ? -46.800 50.781  15.359  1.00 29.77 ? 158  ASP B HB2  1 
ATOM   10235 H HB3  . ASP B 1 169 ? -47.642 50.920  14.019  1.00 29.77 ? 158  ASP B HB3  1 
ATOM   10236 N N    . HIS B 1 170 ? -45.589 47.851  14.212  1.00 18.33 ? 159  HIS B N    1 
ATOM   10237 C CA   . HIS B 1 170 ? -44.465 47.583  13.335  1.00 17.20 ? 159  HIS B CA   1 
ATOM   10238 C C    . HIS B 1 170 ? -44.033 46.128  13.323  1.00 17.44 ? 159  HIS B C    1 
ATOM   10239 O O    . HIS B 1 170 ? -42.967 45.812  12.797  1.00 16.93 ? 159  HIS B O    1 
ATOM   10240 C CB   . HIS B 1 170 ? -43.297 48.538  13.635  1.00 18.86 ? 159  HIS B CB   1 
ATOM   10241 C CG   . HIS B 1 170 ? -43.689 49.977  13.472  1.00 23.53 ? 159  HIS B CG   1 
ATOM   10242 N ND1  . HIS B 1 170 ? -43.750 50.597  12.247  1.00 30.32 ? 159  HIS B ND1  1 
ATOM   10243 C CD2  . HIS B 1 170 ? -44.150 50.874  14.375  1.00 25.38 ? 159  HIS B CD2  1 
ATOM   10244 C CE1  . HIS B 1 170 ? -44.154 51.848  12.412  1.00 30.57 ? 159  HIS B CE1  1 
ATOM   10245 N NE2  . HIS B 1 170 ? -44.429 52.034  13.692  1.00 28.50 ? 159  HIS B NE2  1 
ATOM   10246 H H    . HIS B 1 170 ? -45.520 47.507  14.997  1.00 21.99 ? 159  HIS B H    1 
ATOM   10247 H HA   . HIS B 1 170 ? -44.754 47.785  12.431  1.00 20.64 ? 159  HIS B HA   1 
ATOM   10248 H HB2  . HIS B 1 170 ? -43.006 48.407  14.551  1.00 22.63 ? 159  HIS B HB2  1 
ATOM   10249 H HB3  . HIS B 1 170 ? -42.569 48.352  13.023  1.00 22.63 ? 159  HIS B HB3  1 
ATOM   10250 H HD1  . HIS B 1 170 ? -43.512 50.246  11.499  1.00 36.38 ? 159  HIS B HD1  1 
ATOM   10251 H HD2  . HIS B 1 170 ? -44.239 50.739  15.290  1.00 30.45 ? 159  HIS B HD2  1 
ATOM   10252 H HE1  . HIS B 1 170 ? -44.266 52.476  11.735  1.00 36.68 ? 159  HIS B HE1  1 
ATOM   10253 N N    . GLY B 1 171 ? -44.850 45.221  13.832  1.00 16.76 ? 160  GLY B N    1 
ATOM   10254 C CA   . GLY B 1 171 ? -44.548 43.809  13.619  1.00 15.64 ? 160  GLY B CA   1 
ATOM   10255 C C    . GLY B 1 171 ? -43.311 43.336  14.338  1.00 14.40 ? 160  GLY B C    1 
ATOM   10256 O O    . GLY B 1 171 ? -42.688 42.367  13.909  1.00 16.42 ? 160  GLY B O    1 
ATOM   10257 H H    . GLY B 1 171 ? -45.561 45.383  14.288  1.00 20.11 ? 160  GLY B H    1 
ATOM   10258 H HA2  . GLY B 1 171 ? -45.298 43.273  13.923  1.00 18.77 ? 160  GLY B HA2  1 
ATOM   10259 H HA3  . GLY B 1 171 ? -44.426 43.648  12.670  1.00 18.77 ? 160  GLY B HA3  1 
ATOM   10260 N N    . VAL B 1 172 ? -42.980 43.952  15.447  1.00 14.79 ? 161  VAL B N    1 
ATOM   10261 C CA   . VAL B 1 172 ? -41.835 43.546  16.293  1.00 15.02 ? 161  VAL B CA   1 
ATOM   10262 C C    . VAL B 1 172 ? -42.340 42.767  17.504  1.00 13.74 ? 161  VAL B C    1 
ATOM   10263 O O    . VAL B 1 172 ? -43.362 43.108  18.093  1.00 15.16 ? 161  VAL B O    1 
ATOM   10264 C CB   . VAL B 1 172 ? -41.078 44.812  16.744  1.00 14.85 ? 161  VAL B CB   1 
ATOM   10265 C CG1  . VAL B 1 172 ? -40.012 44.464  17.776  1.00 15.28 ? 161  VAL B CG1  1 
ATOM   10266 C CG2  . VAL B 1 172 ? -40.451 45.492  15.561  1.00 16.67 ? 161  VAL B CG2  1 
ATOM   10267 H H    . VAL B 1 172 ? -43.404 44.633  15.756  1.00 17.74 ? 161  VAL B H    1 
ATOM   10268 H HA   . VAL B 1 172 ? -41.231 42.982  15.785  1.00 18.02 ? 161  VAL B HA   1 
ATOM   10269 H HB   . VAL B 1 172 ? -41.704 45.430  17.152  1.00 17.82 ? 161  VAL B HB   1 
ATOM   10270 H HG11 . VAL B 1 172 ? -39.552 45.276  18.041  1.00 18.33 ? 161  VAL B HG11 1 
ATOM   10271 H HG12 . VAL B 1 172 ? -40.440 44.058  18.546  1.00 18.33 ? 161  VAL B HG12 1 
ATOM   10272 H HG13 . VAL B 1 172 ? -39.382 43.841  17.381  1.00 18.33 ? 161  VAL B HG13 1 
ATOM   10273 H HG21 . VAL B 1 172 ? -39.980 46.284  15.865  1.00 20.00 ? 161  VAL B HG21 1 
ATOM   10274 H HG22 . VAL B 1 172 ? -39.829 44.880  15.137  1.00 20.00 ? 161  VAL B HG22 1 
ATOM   10275 H HG23 . VAL B 1 172 ? -41.148 45.742  14.934  1.00 20.00 ? 161  VAL B HG23 1 
ATOM   10276 N N    . ASN B 1 173 ? -41.620 41.722  17.891  1.00 11.80 ? 162  ASN B N    1 
ATOM   10277 C CA   . ASN B 1 173 ? -41.944 40.993  19.113  1.00 12.27 ? 162  ASN B CA   1 
ATOM   10278 C C    . ASN B 1 173 ? -40.730 40.553  19.904  1.00 13.17 ? 162  ASN B C    1 
ATOM   10279 O O    . ASN B 1 173 ? -40.849 39.657  20.746  1.00 13.05 ? 162  ASN B O    1 
ATOM   10280 C CB   . ASN B 1 173 ? -42.908 39.817  18.852  1.00 12.35 ? 162  ASN B CB   1 
ATOM   10281 C CG   . ASN B 1 173 ? -42.257 38.689  18.135  1.00 13.14 ? 162  ASN B CG   1 
ATOM   10282 O OD1  . ASN B 1 173 ? -41.056 38.729  17.825  1.00 12.56 ? 162  ASN B OD1  1 
ATOM   10283 N ND2  . ASN B 1 173 ? -43.025 37.620  17.908  1.00 13.44 ? 162  ASN B ND2  1 
ATOM   10284 H H    . ASN B 1 173 ? -40.940 41.414  17.466  1.00 14.16 ? 162  ASN B H    1 
ATOM   10285 H HA   . ASN B 1 173 ? -42.426 41.608  19.688  1.00 14.72 ? 162  ASN B HA   1 
ATOM   10286 H HB2  . ASN B 1 173 ? -43.237 39.482  19.701  1.00 14.83 ? 162  ASN B HB2  1 
ATOM   10287 H HB3  . ASN B 1 173 ? -43.649 40.130  18.309  1.00 14.83 ? 162  ASN B HB3  1 
ATOM   10288 H HD21 . ASN B 1 173 ? -42.701 36.937  17.496  1.00 16.13 ? 162  ASN B HD21 1 
ATOM   10289 H HD22 . ASN B 1 173 ? -43.843 37.613  18.173  1.00 16.13 ? 162  ASN B HD22 1 
ATOM   10290 N N    . SER B 1 174 ? -39.603 41.222  19.722  1.00 12.36 ? 163  SER B N    1 
ATOM   10291 C CA   . SER B 1 174 ? -38.392 40.851  20.440  1.00 12.00 ? 163  SER B CA   1 
ATOM   10292 C C    . SER B 1 174 ? -37.467 42.050  20.518  1.00 11.96 ? 163  SER B C    1 
ATOM   10293 O O    . SER B 1 174 ? -37.360 42.834  19.565  1.00 12.92 ? 163  SER B O    1 
ATOM   10294 C CB   . SER B 1 174 ? -37.682 39.672  19.779  1.00 12.89 ? 163  SER B CB   1 
ATOM   10295 O OG   . SER B 1 174 ? -37.467 39.885  18.396  1.00 12.85 ? 163  SER B OG   1 
ATOM   10296 H H    . SER B 1 174 ? -39.511 41.893  19.192  1.00 14.83 ? 163  SER B H    1 
ATOM   10297 H HA   . SER B 1 174 ? -38.627 40.592  21.345  1.00 14.40 ? 163  SER B HA   1 
ATOM   10298 H HB2  . SER B 1 174 ? -36.823 39.544  20.212  1.00 15.47 ? 163  SER B HB2  1 
ATOM   10299 H HB3  . SER B 1 174 ? -38.226 38.877  19.891  1.00 15.47 ? 163  SER B HB3  1 
ATOM   10300 H HG   . SER B 1 174 ? -36.993 40.569  18.280  1.00 15.42 ? 163  SER B HG   1 
ATOM   10301 N N    . PHE B 1 175 ? -36.875 42.226  21.694  1.00 12.31 ? 164  PHE B N    1 
ATOM   10302 C CA   . PHE B 1 175 ? -35.987 43.338  21.990  1.00 12.23 ? 164  PHE B CA   1 
ATOM   10303 C C    . PHE B 1 175 ? -34.776 42.766  22.702  1.00 12.22 ? 164  PHE B C    1 
ATOM   10304 O O    . PHE B 1 175 ? -34.868 41.759  23.401  1.00 14.74 ? 164  PHE B O    1 
ATOM   10305 C CB   . PHE B 1 175 ? -36.652 44.325  22.934  1.00 13.55 ? 164  PHE B CB   1 
ATOM   10306 C CG   . PHE B 1 175 ? -37.860 45.008  22.362  1.00 12.63 ? 164  PHE B CG   1 
ATOM   10307 C CD1  . PHE B 1 175 ? -39.110 44.451  22.517  1.00 14.72 ? 164  PHE B CD1  1 
ATOM   10308 C CD2  . PHE B 1 175 ? -37.727 46.136  21.620  1.00 14.39 ? 164  PHE B CD2  1 
ATOM   10309 C CE1  . PHE B 1 175 ? -40.217 45.039  21.957  1.00 14.91 ? 164  PHE B CE1  1 
ATOM   10310 C CE2  . PHE B 1 175 ? -38.809 46.746  21.064  1.00 13.84 ? 164  PHE B CE2  1 
ATOM   10311 C CZ   . PHE B 1 175 ? -40.080 46.210  21.256  1.00 15.25 ? 164  PHE B CZ   1 
ATOM   10312 H H    . PHE B 1 175 ? -36.979 41.691  22.360  1.00 14.78 ? 164  PHE B H    1 
ATOM   10313 H HA   . PHE B 1 175 ? -35.711 43.789  21.177  1.00 14.67 ? 164  PHE B HA   1 
ATOM   10314 H HB2  . PHE B 1 175 ? -36.932 43.851  23.733  1.00 16.26 ? 164  PHE B HB2  1 
ATOM   10315 H HB3  . PHE B 1 175 ? -36.009 45.011  23.169  1.00 16.26 ? 164  PHE B HB3  1 
ATOM   10316 H HD1  . PHE B 1 175 ? -39.206 43.667  23.009  1.00 17.66 ? 164  PHE B HD1  1 
ATOM   10317 H HD2  . PHE B 1 175 ? -36.884 46.509  21.505  1.00 17.26 ? 164  PHE B HD2  1 
ATOM   10318 H HE1  . PHE B 1 175 ? -41.060 44.669  22.090  1.00 17.89 ? 164  PHE B HE1  1 
ATOM   10319 H HE2  . PHE B 1 175 ? -38.703 47.532  20.579  1.00 16.60 ? 164  PHE B HE2  1 
ATOM   10320 H HZ   . PHE B 1 175 ? -40.822 46.615  20.870  1.00 18.30 ? 164  PHE B HZ   1 
ATOM   10321 N N    A LEU B 1 176 ? -33.664 43.463  22.568  0.48 12.35 ? 165  LEU B N    1 
ATOM   10322 N N    B LEU B 1 176 ? -33.641 43.432  22.530  0.52 12.99 ? 165  LEU B N    1 
ATOM   10323 C CA   A LEU B 1 176 ? -32.430 43.034  23.200  0.48 13.54 ? 165  LEU B CA   1 
ATOM   10324 C CA   B LEU B 1 176 ? -32.380 43.026  23.159  0.52 13.27 ? 165  LEU B CA   1 
ATOM   10325 C C    A LEU B 1 176 ? -31.910 44.090  24.161  0.48 13.55 ? 165  LEU B C    1 
ATOM   10326 C C    B LEU B 1 176 ? -31.892 44.083  24.141  0.52 14.77 ? 165  LEU B C    1 
ATOM   10327 O O    A LEU B 1 176 ? -31.893 45.277  23.844  0.48 12.55 ? 165  LEU B O    1 
ATOM   10328 O O    B LEU B 1 176 ? -31.881 45.265  23.807  0.52 16.60 ? 165  LEU B O    1 
ATOM   10329 C CB   A LEU B 1 176 ? -31.361 42.685  22.162  0.48 16.49 ? 165  LEU B CB   1 
ATOM   10330 C CB   B LEU B 1 176 ? -31.282 42.800  22.084  0.52 12.26 ? 165  LEU B CB   1 
ATOM   10331 C CG   A LEU B 1 176 ? -30.078 42.176  22.800  0.48 16.26 ? 165  LEU B CG   1 
ATOM   10332 C CG   B LEU B 1 176 ? -29.829 42.593  22.541  0.52 10.74 ? 165  LEU B CG   1 
ATOM   10333 C CD1  A LEU B 1 176 ? -29.495 41.117  21.899  0.48 17.26 ? 165  LEU B CD1  1 
ATOM   10334 C CD1  B LEU B 1 176 ? -29.736 41.245  23.176  0.52 10.47 ? 165  LEU B CD1  1 
ATOM   10335 C CD2  A LEU B 1 176 ? -29.120 43.290  22.983  0.48 15.55 ? 165  LEU B CD2  1 
ATOM   10336 C CD2  B LEU B 1 176 ? -28.787 42.697  21.380  0.52 11.70 ? 165  LEU B CD2  1 
ATOM   10337 H H    A LEU B 1 176 ? -33.595 44.191  22.115  0.48 14.83 ? 165  LEU B H    1 
ATOM   10338 H H    B LEU B 1 176 ? -33.570 44.138  22.043  0.52 15.59 ? 165  LEU B H    1 
ATOM   10339 H HA   A LEU B 1 176 ? -32.610 42.232  23.715  0.48 16.25 ? 165  LEU B HA   1 
ATOM   10340 H HA   B LEU B 1 176 ? -32.512 42.196  23.642  0.52 15.93 ? 165  LEU B HA   1 
ATOM   10341 H HB2  A LEU B 1 176 ? -31.702 41.991  21.576  0.48 19.79 ? 165  LEU B HB2  1 
ATOM   10342 H HB2  B LEU B 1 176 ? -31.528 42.014  21.572  0.52 14.71 ? 165  LEU B HB2  1 
ATOM   10343 H HB3  A LEU B 1 176 ? -31.147 43.479  21.648  0.48 19.79 ? 165  LEU B HB3  1 
ATOM   10344 H HB3  B LEU B 1 176 ? -31.283 43.571  21.496  0.52 14.71 ? 165  LEU B HB3  1 
ATOM   10345 H HG   A LEU B 1 176 ? -30.272 41.781  23.665  0.48 19.51 ? 165  LEU B HG   1 
ATOM   10346 H HG   B LEU B 1 176 ? -29.606 43.260  23.209  0.52 12.89 ? 165  LEU B HG   1 
ATOM   10347 H HD11 A LEU B 1 176 ? -28.675 40.783  22.294  0.48 20.71 ? 165  LEU B HD11 1 
ATOM   10348 H HD11 B LEU B 1 176 ? -28.823 41.098  23.470  0.52 12.57 ? 165  LEU B HD11 1 
ATOM   10349 H HD12 A LEU B 1 176 ? -30.136 40.395  21.805  0.48 20.71 ? 165  LEU B HD12 1 
ATOM   10350 H HD12 B LEU B 1 176 ? -30.338 41.212  23.935  0.52 12.57 ? 165  LEU B HD12 1 
ATOM   10351 H HD13 A LEU B 1 176 ? -29.309 41.509  21.031  0.48 20.71 ? 165  LEU B HD13 1 
ATOM   10352 H HD13 B LEU B 1 176 ? -29.986 40.572  22.524  0.52 12.57 ? 165  LEU B HD13 1 
ATOM   10353 H HD21 A LEU B 1 176 ? -28.310 42.946  23.391  0.48 18.66 ? 165  LEU B HD21 1 
ATOM   10354 H HD21 B LEU B 1 176 ? -27.898 42.557  21.740  0.52 14.04 ? 165  LEU B HD21 1 
ATOM   10355 H HD22 A LEU B 1 176 ? -28.916 43.677  22.117  0.48 18.66 ? 165  LEU B HD22 1 
ATOM   10356 H HD22 B LEU B 1 176 ? -28.986 42.018  20.716  0.52 14.04 ? 165  LEU B HD22 1 
ATOM   10357 H HD23 A LEU B 1 176 ? -29.521 43.960  23.559  0.48 18.66 ? 165  LEU B HD23 1 
ATOM   10358 H HD23 B LEU B 1 176 ? -28.847 43.579  20.980  0.52 14.04 ? 165  LEU B HD23 1 
ATOM   10359 N N    . VAL B 1 177 ? -31.481 43.648  25.334  1.00 12.41 ? 166  VAL B N    1 
ATOM   10360 C CA   . VAL B 1 177 ? -30.819 44.534  26.286  1.00 12.36 ? 166  VAL B CA   1 
ATOM   10361 C C    . VAL B 1 177 ? -29.434 43.989  26.609  1.00 10.89 ? 166  VAL B C    1 
ATOM   10362 O O    . VAL B 1 177 ? -29.159 42.795  26.474  1.00 12.35 ? 166  VAL B O    1 
ATOM   10363 C CB   . VAL B 1 177 ? -31.602 44.777  27.561  1.00 14.89 ? 166  VAL B CB   1 
ATOM   10364 C CG1  . VAL B 1 177 ? -32.916 45.485  27.251  1.00 18.59 ? 166  VAL B CG1  1 
ATOM   10365 C CG2  . VAL B 1 177 ? -31.817 43.483  28.311  1.00 16.31 ? 166  VAL B CG2  1 
ATOM   10366 H H    . VAL B 1 177 ? -31.569 42.839  25.611  1.00 14.89 ? 166  VAL B H    1 
ATOM   10367 H HA   . VAL B 1 177 ? -30.695 45.396  25.859  1.00 14.83 ? 166  VAL B HA   1 
ATOM   10368 H HB   . VAL B 1 177 ? -31.083 45.363  28.134  1.00 17.87 ? 166  VAL B HB   1 
ATOM   10369 H HG11 . VAL B 1 177 ? -33.399 45.631  28.079  1.00 22.31 ? 166  VAL B HG11 1 
ATOM   10370 H HG12 . VAL B 1 177 ? -32.723 46.336  26.826  1.00 22.31 ? 166  VAL B HG12 1 
ATOM   10371 H HG13 . VAL B 1 177 ? -33.441 44.929  26.654  1.00 22.31 ? 166  VAL B HG13 1 
ATOM   10372 H HG21 . VAL B 1 177 ? -32.318 43.667  29.120  1.00 19.58 ? 166  VAL B HG21 1 
ATOM   10373 H HG22 . VAL B 1 177 ? -32.312 42.870  27.746  1.00 19.58 ? 166  VAL B HG22 1 
ATOM   10374 H HG23 . VAL B 1 177 ? -30.953 43.101  28.536  1.00 19.58 ? 166  VAL B HG23 1 
ATOM   10375 N N    . TYR B 1 178 ? -28.576 44.884  27.072  1.00 12.81 ? 167  TYR B N    1 
ATOM   10376 C CA   . TYR B 1 178 ? -27.176 44.567  27.304  1.00 13.40 ? 167  TYR B CA   1 
ATOM   10377 C C    . TYR B 1 178 ? -26.798 44.604  28.768  1.00 13.63 ? 167  TYR B C    1 
ATOM   10378 O O    . TYR B 1 178 ? -27.124 45.566  29.485  1.00 14.45 ? 167  TYR B O    1 
ATOM   10379 C CB   . TYR B 1 178 ? -26.282 45.566  26.594  1.00 14.90 ? 167  TYR B CB   1 
ATOM   10380 C CG   . TYR B 1 178 ? -26.239 45.386  25.112  1.00 15.61 ? 167  TYR B CG   1 
ATOM   10381 C CD1  . TYR B 1 178 ? -27.204 45.935  24.285  1.00 15.13 ? 167  TYR B CD1  1 
ATOM   10382 C CD2  . TYR B 1 178 ? -25.224 44.667  24.536  1.00 19.00 ? 167  TYR B CD2  1 
ATOM   10383 C CE1  . TYR B 1 178 ? -27.145 45.745  22.904  1.00 19.66 ? 167  TYR B CE1  1 
ATOM   10384 C CE2  . TYR B 1 178 ? -25.171 44.490  23.232  1.00 20.02 ? 167  TYR B CE2  1 
ATOM   10385 C CZ   . TYR B 1 178 ? -26.096 45.016  22.401  1.00 21.14 ? 167  TYR B CZ   1 
ATOM   10386 O OH   . TYR B 1 178 ? -25.929 44.751  21.070  1.00 27.23 ? 167  TYR B OH   1 
ATOM   10387 H H    . TYR B 1 178 ? -28.783 45.696  27.263  1.00 15.38 ? 167  TYR B H    1 
ATOM   10388 H HA   . TYR B 1 178 ? -26.983 43.681  26.958  1.00 16.08 ? 167  TYR B HA   1 
ATOM   10389 H HB2  . TYR B 1 178 ? -26.609 46.462  26.774  1.00 17.89 ? 167  TYR B HB2  1 
ATOM   10390 H HB3  . TYR B 1 178 ? -25.378 45.472  26.931  1.00 17.89 ? 167  TYR B HB3  1 
ATOM   10391 H HD1  . TYR B 1 178 ? -27.902 46.426  24.654  1.00 18.16 ? 167  TYR B HD1  1 
ATOM   10392 H HD2  . TYR B 1 178 ? -24.567 44.290  25.076  1.00 22.81 ? 167  TYR B HD2  1 
ATOM   10393 H HE1  . TYR B 1 178 ? -27.790 46.110  22.341  1.00 23.59 ? 167  TYR B HE1  1 
ATOM   10394 H HE2  . TYR B 1 178 ? -24.471 43.995  22.872  1.00 24.02 ? 167  TYR B HE2  1 
ATOM   10395 H HH   . TYR B 1 178 ? -26.553 45.097  20.627  1.00 32.68 ? 167  TYR B HH   1 
ATOM   10396 N N    A MET B 1 179 ? -26.012 43.619  29.169  0.31 15.91 ? 168  MET B N    1 
ATOM   10397 N N    B MET B 1 179 ? -26.067 43.573  29.205  0.69 11.71 ? 168  MET B N    1 
ATOM   10398 C CA   A MET B 1 179 ? -25.405 43.578  30.483  0.31 15.23 ? 168  MET B CA   1 
ATOM   10399 C CA   B MET B 1 179 ? -25.421 43.575  30.508  0.69 11.87 ? 168  MET B CA   1 
ATOM   10400 C C    A MET B 1 179 ? -23.925 43.903  30.413  0.31 14.04 ? 168  MET B C    1 
ATOM   10401 C C    B MET B 1 179 ? -23.949 43.954  30.424  0.69 10.37 ? 168  MET B C    1 
ATOM   10402 O O    A MET B 1 179 ? -23.254 43.992  31.452  0.31 16.56 ? 168  MET B O    1 
ATOM   10403 O O    B MET B 1 179 ? -23.312 44.126  31.477  0.69 11.34 ? 168  MET B O    1 
ATOM   10404 C CB   A MET B 1 179 ? -25.612 42.180  31.041  0.31 14.17 ? 168  MET B CB   1 
ATOM   10405 C CB   B MET B 1 179 ? -25.534 42.192  31.152  0.69 12.79 ? 168  MET B CB   1 
ATOM   10406 C CG   A MET B 1 179 ? -27.082 41.756  30.863  0.31 13.08 ? 168  MET B CG   1 
ATOM   10407 C CG   B MET B 1 179 ? -26.994 41.917  31.596  0.69 17.46 ? 168  MET B CG   1 
ATOM   10408 S SD   A MET B 1 179 ? -27.386 40.102  31.448  0.31 13.33 ? 168  MET B SD   1 
ATOM   10409 S SD   B MET B 1 179 ? -27.247 40.234  32.176  0.69 17.50 ? 168  MET B SD   1 
ATOM   10410 C CE   A MET B 1 179 ? -26.945 40.317  33.117  0.31 1.63  ? 168  MET B CE   1 
ATOM   10411 C CE   B MET B 1 179 ? -26.972 40.383  33.873  0.69 24.29 ? 168  MET B CE   1 
ATOM   10412 H H    A MET B 1 179 ? -25.810 42.941  28.680  0.31 19.09 ? 168  MET B H    1 
ATOM   10413 H H    B MET B 1 179 ? -25.933 42.853  28.754  0.69 14.06 ? 168  MET B H    1 
ATOM   10414 H HA   A MET B 1 179 ? -25.849 44.213  31.066  0.31 18.27 ? 168  MET B HA   1 
ATOM   10415 H HA   B MET B 1 179 ? -25.876 44.210  31.083  0.69 14.25 ? 168  MET B HA   1 
ATOM   10416 H HB2  A MET B 1 179 ? -25.049 41.552  30.562  0.31 17.00 ? 168  MET B HB2  1 
ATOM   10417 H HB2  B MET B 1 179 ? -25.276 41.514  30.509  0.69 15.35 ? 168  MET B HB2  1 
ATOM   10418 H HB3  A MET B 1 179 ? -25.401 42.173  31.988  0.31 17.00 ? 168  MET B HB3  1 
ATOM   10419 H HB3  B MET B 1 179 ? -24.962 42.152  31.935  0.69 15.35 ? 168  MET B HB3  1 
ATOM   10420 H HG2  A MET B 1 179 ? -27.650 42.362  31.365  0.31 15.70 ? 168  MET B HG2  1 
ATOM   10421 H HG2  B MET B 1 179 ? -27.222 42.521  32.320  0.69 20.95 ? 168  MET B HG2  1 
ATOM   10422 H HG3  A MET B 1 179 ? -27.310 41.789  29.921  0.31 15.70 ? 168  MET B HG3  1 
ATOM   10423 H HG3  B MET B 1 179 ? -27.586 42.066  30.842  0.69 20.95 ? 168  MET B HG3  1 
ATOM   10424 H HE1  A MET B 1 179 ? -27.061 39.476  33.585  0.31 1.95  ? 168  MET B HE1  1 
ATOM   10425 H HE1  B MET B 1 179 ? -27.086 39.513  34.288  0.69 29.15 ? 168  MET B HE1  1 
ATOM   10426 H HE2  A MET B 1 179 ? -26.018 40.598  33.164  0.31 1.95  ? 168  MET B HE2  1 
ATOM   10427 H HE2  B MET B 1 179 ? -26.068 40.703  34.019  0.69 29.15 ? 168  MET B HE2  1 
ATOM   10428 H HE3  A MET B 1 179 ? -27.517 40.996  33.509  0.31 1.95  ? 168  MET B HE3  1 
ATOM   10429 H HE3  B MET B 1 179 ? -27.611 41.013  34.242  0.69 29.15 ? 168  MET B HE3  1 
ATOM   10430 N N    . ALA B 1 180 ? -23.410 44.077  29.209  1.00 12.53 ? 169  ALA B N    1 
ATOM   10431 C CA   . ALA B 1 180 ? -22.045 44.480  28.955  1.00 12.53 ? 169  ALA B CA   1 
ATOM   10432 C C    . ALA B 1 180 ? -22.043 45.756  28.100  1.00 13.80 ? 169  ALA B C    1 
ATOM   10433 O O    . ALA B 1 180 ? -23.072 46.415  27.949  1.00 13.52 ? 169  ALA B O    1 
ATOM   10434 C CB   . ALA B 1 180 ? -21.261 43.334  28.347  1.00 16.62 ? 169  ALA B CB   1 
ATOM   10435 H H    . ALA B 1 180 ? -23.849 43.942  28.482  1.00 15.03 ? 169  ALA B H    1 
ATOM   10436 H HA   . ALA B 1 180 ? -21.627 44.698  29.803  1.00 15.04 ? 169  ALA B HA   1 
ATOM   10437 H HB1  . ALA B 1 180 ? -20.351 43.626  28.185  1.00 19.95 ? 169  ALA B HB1  1 
ATOM   10438 H HB2  . ALA B 1 180 ? -21.265 42.586  28.964  1.00 19.95 ? 169  ALA B HB2  1 
ATOM   10439 H HB3  . ALA B 1 180 ? -21.680 43.075  27.511  1.00 19.95 ? 169  ALA B HB3  1 
ATOM   10440 N N    . PHE B 1 181 ? -20.868 46.118  27.568  1.00 13.77 ? 170  PHE B N    1 
ATOM   10441 C CA   . PHE B 1 181 ? -20.645 47.385  26.885  1.00 14.38 ? 170  PHE B CA   1 
ATOM   10442 C C    . PHE B 1 181 ? -20.917 48.536  27.843  1.00 14.08 ? 170  PHE B C    1 
ATOM   10443 O O    . PHE B 1 181 ? -21.761 49.415  27.603  1.00 14.66 ? 170  PHE B O    1 
ATOM   10444 C CB   . PHE B 1 181 ? -21.406 47.458  25.565  1.00 16.25 ? 170  PHE B CB   1 
ATOM   10445 C CG   . PHE B 1 181 ? -21.040 46.352  24.650  1.00 15.98 ? 170  PHE B CG   1 
ATOM   10446 C CD1  . PHE B 1 181 ? -19.819 46.345  24.017  1.00 20.73 ? 170  PHE B CD1  1 
ATOM   10447 C CD2  . PHE B 1 181 ? -21.809 45.254  24.561  1.00 20.40 ? 170  PHE B CD2  1 
ATOM   10448 C CE1  . PHE B 1 181 ? -19.456 45.293  23.200  1.00 25.35 ? 170  PHE B CE1  1 
ATOM   10449 C CE2  . PHE B 1 181 ? -21.469 44.211  23.741  1.00 23.43 ? 170  PHE B CE2  1 
ATOM   10450 C CZ   . PHE B 1 181 ? -20.291 44.208  23.093  1.00 26.41 ? 170  PHE B CZ   1 
ATOM   10451 H H    . PHE B 1 181 ? -20.165 45.624  27.595  1.00 16.53 ? 170  PHE B H    1 
ATOM   10452 H HA   . PHE B 1 181 ? -19.702 47.433  26.660  1.00 17.26 ? 170  PHE B HA   1 
ATOM   10453 H HB2  . PHE B 1 181 ? -22.358 47.401  25.743  1.00 19.50 ? 170  PHE B HB2  1 
ATOM   10454 H HB3  . PHE B 1 181 ? -21.198 48.297  25.124  1.00 19.50 ? 170  PHE B HB3  1 
ATOM   10455 H HD1  . PHE B 1 181 ? -19.259 47.084  24.091  1.00 24.88 ? 170  PHE B HD1  1 
ATOM   10456 H HD2  . PHE B 1 181 ? -22.629 45.238  24.999  1.00 24.48 ? 170  PHE B HD2  1 
ATOM   10457 H HE1  . PHE B 1 181 ? -18.644 45.307  22.749  1.00 30.42 ? 170  PHE B HE1  1 
ATOM   10458 H HE2  . PHE B 1 181 ? -22.033 43.475  23.674  1.00 28.11 ? 170  PHE B HE2  1 
ATOM   10459 H HZ   . PHE B 1 181 ? -20.061 43.493  22.545  1.00 31.69 ? 170  PHE B HZ   1 
ATOM   10460 N N    A LYS B 1 182 ? -20.146 48.522  28.934  0.61 17.19 ? 171  LYS B N    1 
ATOM   10461 N N    B LYS B 1 182 ? -20.155 48.526  28.928  0.39 12.21 ? 171  LYS B N    1 
ATOM   10462 C CA   A LYS B 1 182 ? -20.242 49.550  29.955  0.61 16.56 ? 171  LYS B CA   1 
ATOM   10463 C CA   B LYS B 1 182 ? -20.254 49.549  29.955  0.39 15.74 ? 171  LYS B CA   1 
ATOM   10464 C C    A LYS B 1 182 ? -20.098 50.922  29.320  0.61 18.99 ? 171  LYS B C    1 
ATOM   10465 C C    B LYS B 1 182 ? -20.081 50.930  29.342  0.39 18.38 ? 171  LYS B C    1 
ATOM   10466 O O    A LYS B 1 182 ? -19.276 51.121  28.424  0.61 21.45 ? 171  LYS B O    1 
ATOM   10467 O O    B LYS B 1 182 ? -19.209 51.151  28.495  0.39 22.52 ? 171  LYS B O    1 
ATOM   10468 C CB   A LYS B 1 182 ? -19.157 49.369  31.034  0.61 16.08 ? 171  LYS B CB   1 
ATOM   10469 C CB   B LYS B 1 182 ? -19.172 49.333  31.024  0.39 17.53 ? 171  LYS B CB   1 
ATOM   10470 C CG   A LYS B 1 182 ? -19.467 50.166  32.292  0.61 18.21 ? 171  LYS B CG   1 
ATOM   10471 C CG   B LYS B 1 182 ? -19.283 50.267  32.232  0.39 18.56 ? 171  LYS B CG   1 
ATOM   10472 C CD   A LYS B 1 182 ? -18.522 49.922  33.437  0.61 20.52 ? 171  LYS B CD   1 
ATOM   10473 C CD   B LYS B 1 182 ? -18.133 50.085  33.225  0.39 16.58 ? 171  LYS B CD   1 
ATOM   10474 C CE   A LYS B 1 182 ? -18.954 50.713  34.656  0.61 23.81 ? 171  LYS B CE   1 
ATOM   10475 C CE   B LYS B 1 182 ? -18.268 51.013  34.423  0.39 17.97 ? 171  LYS B CE   1 
ATOM   10476 N NZ   A LYS B 1 182 ? -20.363 50.497  35.085  0.61 26.43 ? 171  LYS B NZ   1 
ATOM   10477 N NZ   B LYS B 1 182 ? -17.208 50.818  35.447  0.39 20.13 ? 171  LYS B NZ   1 
ATOM   10478 H H    A LYS B 1 182 ? -19.557 47.919  29.102  0.61 20.62 ? 171  LYS B H    1 
ATOM   10479 H H    B LYS B 1 182 ? -19.562 47.925  29.095  0.39 14.65 ? 171  LYS B H    1 
ATOM   10480 H HA   A LYS B 1 182 ? -21.111 49.500  30.383  0.61 19.87 ? 171  LYS B HA   1 
ATOM   10481 H HA   B LYS B 1 182 ? -21.125 49.504  30.380  0.39 18.88 ? 171  LYS B HA   1 
ATOM   10482 H HB2  A LYS B 1 182 ? -19.102 48.431  31.276  0.61 19.30 ? 171  LYS B HB2  1 
ATOM   10483 H HB2  B LYS B 1 182 ? -19.235 48.422  31.350  0.39 21.04 ? 171  LYS B HB2  1 
ATOM   10484 H HB3  A LYS B 1 182 ? -18.305 49.675  30.684  0.61 19.30 ? 171  LYS B HB3  1 
ATOM   10485 H HB3  B LYS B 1 182 ? -18.302 49.476  30.620  0.39 21.04 ? 171  LYS B HB3  1 
ATOM   10486 H HG2  A LYS B 1 182 ? -19.431 51.112  32.077  0.61 21.85 ? 171  LYS B HG2  1 
ATOM   10487 H HG2  B LYS B 1 182 ? -19.270 51.187  31.923  0.39 22.27 ? 171  LYS B HG2  1 
ATOM   10488 H HG3  A LYS B 1 182 ? -20.360 49.935  32.594  0.61 21.85 ? 171  LYS B HG3  1 
ATOM   10489 H HG3  B LYS B 1 182 ? -20.114 50.084  32.698  0.39 22.27 ? 171  LYS B HG3  1 
ATOM   10490 H HD2  A LYS B 1 182 ? -18.526 48.979  33.665  0.61 24.63 ? 171  LYS B HD2  1 
ATOM   10491 H HD2  B LYS B 1 182 ? -18.132 49.171  33.548  0.39 19.90 ? 171  LYS B HD2  1 
ATOM   10492 H HD3  A LYS B 1 182 ? -17.629 50.207  33.186  0.61 24.63 ? 171  LYS B HD3  1 
ATOM   10493 H HD3  B LYS B 1 182 ? -17.293 50.284  32.781  0.39 19.90 ? 171  LYS B HD3  1 
ATOM   10494 H HE2  A LYS B 1 182 ? -18.382 50.470  35.400  0.61 28.57 ? 171  LYS B HE2  1 
ATOM   10495 H HE2  B LYS B 1 182 ? -18.218 51.931  34.115  0.39 21.56 ? 171  LYS B HE2  1 
ATOM   10496 H HE3  A LYS B 1 182 ? -18.850 51.658  34.462  0.61 28.57 ? 171  LYS B HE3  1 
ATOM   10497 H HE3  B LYS B 1 182 ? -19.125 50.853  34.848  0.39 21.56 ? 171  LYS B HE3  1 
ATOM   10498 H HZ1  A LYS B 1 182 ? -20.542 50.993  35.802  0.61 31.71 ? 171  LYS B HZ1  1 
ATOM   10499 H HZ1  B LYS B 1 182 ? -17.332 51.382  36.124  0.39 24.16 ? 171  LYS B HZ1  1 
ATOM   10500 H HZ2  A LYS B 1 182 ? -20.919 50.726  34.429  0.61 31.71 ? 171  LYS B HZ2  1 
ATOM   10501 H HZ2  B LYS B 1 182 ? -17.234 49.984  35.757  0.39 24.16 ? 171  LYS B HZ2  1 
ATOM   10502 H HZ3  A LYS B 1 182 ? -20.491 49.640  35.286  0.61 31.71 ? 171  LYS B HZ3  1 
ATOM   10503 H HZ3  B LYS B 1 182 ? -16.407 50.968  35.088  0.39 24.16 ? 171  LYS B HZ3  1 
ATOM   10504 N N    . ASP B 1 183 ? -20.939 51.848  29.752  1.00 20.16 ? 172  ASP B N    1 
ATOM   10505 C CA   . ASP B 1 183 ? -20.918 53.231  29.249  1.00 23.78 ? 172  ASP B CA   1 
ATOM   10506 C C    . ASP B 1 183 ? -21.280 53.347  27.770  1.00 24.23 ? 172  ASP B C    1 
ATOM   10507 O O    . ASP B 1 183 ? -21.048 54.381  27.146  1.00 25.41 ? 172  ASP B O    1 
ATOM   10508 C CB   . ASP B 1 183 ? -19.581 53.926  29.539  1.00 30.26 ? 172  ASP B CB   1 
ATOM   10509 C CG   . ASP B 1 183 ? -19.308 54.070  31.035  1.00 37.16 ? 172  ASP B CG   1 
ATOM   10510 O OD1  . ASP B 1 183 ? -20.260 54.385  31.785  1.00 39.76 ? 172  ASP B OD1  1 
ATOM   10511 O OD2  . ASP B 1 183 ? -18.153 53.849  31.460  1.00 44.50 ? 172  ASP B OD2  1 
ATOM   10512 H H    . ASP B 1 183 ? -21.552 51.706  30.339  1.00 24.19 ? 172  ASP B H    1 
ATOM   10513 H HA   . ASP B 1 183 ? -21.596 53.725  29.736  1.00 28.54 ? 172  ASP B HA   1 
ATOM   10514 H HB2  . ASP B 1 183 ? -18.861 53.404  29.151  1.00 36.31 ? 172  ASP B HB2  1 
ATOM   10515 H HB3  . ASP B 1 183 ? -19.595 54.814  29.149  1.00 36.31 ? 172  ASP B HB3  1 
ATOM   10516 N N    . ARG B 1 184 ? -21.869 52.320  27.199  1.00 19.08 ? 173  ARG B N    1 
ATOM   10517 C CA   . ARG B 1 184 ? -22.387 52.388  25.849  1.00 18.57 ? 173  ARG B CA   1 
ATOM   10518 C C    . ARG B 1 184 ? -23.824 51.898  25.879  1.00 15.36 ? 173  ARG B C    1 
ATOM   10519 O O    . ARG B 1 184 ? -24.743 52.679  25.618  1.00 18.83 ? 173  ARG B O    1 
ATOM   10520 C CB   . ARG B 1 184 ? -21.531 51.579  24.880  1.00 23.43 ? 173  ARG B CB   1 
ATOM   10521 C CG   . ARG B 1 184 ? -22.229 51.450  23.533  1.00 24.95 ? 173  ARG B CG   1 
ATOM   10522 C CD   . ARG B 1 184 ? -21.342 51.683  22.448  1.00 28.57 ? 173  ARG B CD   1 
ATOM   10523 N NE   . ARG B 1 184 ? -21.908 51.379  21.144  1.00 24.05 ? 173  ARG B NE   1 
ATOM   10524 C CZ   . ARG B 1 184 ? -22.489 52.231  20.305  1.00 24.62 ? 173  ARG B CZ   1 
ATOM   10525 N NH1  . ARG B 1 184 ? -22.693 53.501  20.606  1.00 26.01 ? 173  ARG B NH1  1 
ATOM   10526 N NH2  . ARG B 1 184 ? -22.928 51.755  19.141  1.00 21.67 ? 173  ARG B NH2  1 
ATOM   10527 H H    . ARG B 1 184 ? -21.984 51.557  27.578  1.00 22.90 ? 173  ARG B H    1 
ATOM   10528 H HA   . ARG B 1 184 ? -22.387 53.312  25.554  1.00 22.28 ? 173  ARG B HA   1 
ATOM   10529 H HB2  . ARG B 1 184 ? -20.682 52.029  24.745  1.00 28.11 ? 173  ARG B HB2  1 
ATOM   10530 H HB3  . ARG B 1 184 ? -21.389 50.689  25.239  1.00 28.11 ? 173  ARG B HB3  1 
ATOM   10531 H HG2  . ARG B 1 184 ? -22.586 50.552  23.444  1.00 29.94 ? 173  ARG B HG2  1 
ATOM   10532 H HG3  . ARG B 1 184 ? -22.946 52.101  23.482  1.00 29.94 ? 173  ARG B HG3  1 
ATOM   10533 H HD2  . ARG B 1 184 ? -21.087 52.619  22.449  1.00 34.28 ? 173  ARG B HD2  1 
ATOM   10534 H HD3  . ARG B 1 184 ? -20.554 51.128  22.564  1.00 34.28 ? 173  ARG B HD3  1 
ATOM   10535 H HE   . ARG B 1 184 ? -21.863 50.559  20.888  1.00 28.86 ? 173  ARG B HE   1 
ATOM   10536 H HH11 . ARG B 1 184 ? -22.411 53.814  21.356  1.00 31.21 ? 173  ARG B HH11 1 
ATOM   10537 H HH12 . ARG B 1 184 ? -23.083 54.019  20.043  1.00 31.21 ? 173  ARG B HH12 1 
ATOM   10538 H HH21 . ARG B 1 184 ? -22.812 50.926  18.944  1.00 26.01 ? 173  ARG B HH21 1 
ATOM   10539 H HH22 . ARG B 1 184 ? -23.326 52.277  18.585  1.00 26.01 ? 173  ARG B HH22 1 
ATOM   10540 N N    . PHE B 1 185 ? -24.024 50.608  26.168  1.00 13.51 ? 174  PHE B N    1 
ATOM   10541 C CA   . PHE B 1 185 ? -25.347 50.011  26.221  1.00 13.31 ? 174  PHE B CA   1 
ATOM   10542 C C    . PHE B 1 185 ? -25.725 49.444  27.577  1.00 13.26 ? 174  PHE B C    1 
ATOM   10543 O O    . PHE B 1 185 ? -26.904 49.139  27.789  1.00 13.93 ? 174  PHE B O    1 
ATOM   10544 C CB   . PHE B 1 185 ? -25.442 48.837  25.247  1.00 13.89 ? 174  PHE B CB   1 
ATOM   10545 C CG   . PHE B 1 185 ? -25.200 49.157  23.811  1.00 15.04 ? 174  PHE B CG   1 
ATOM   10546 C CD1  . PHE B 1 185 ? -25.625 50.347  23.245  1.00 16.20 ? 174  PHE B CD1  1 
ATOM   10547 C CD2  . PHE B 1 185 ? -24.554 48.233  22.998  1.00 16.48 ? 174  PHE B CD2  1 
ATOM   10548 C CE1  . PHE B 1 185 ? -25.443 50.604  21.906  1.00 17.97 ? 174  PHE B CE1  1 
ATOM   10549 C CE2  . PHE B 1 185 ? -24.366 48.484  21.641  1.00 17.75 ? 174  PHE B CE2  1 
ATOM   10550 C CZ   . PHE B 1 185 ? -24.801 49.678  21.110  1.00 16.78 ? 174  PHE B CZ   1 
ATOM   10551 H H    . PHE B 1 185 ? -23.390 50.053  26.339  1.00 16.21 ? 174  PHE B H    1 
ATOM   10552 H HA   . PHE B 1 185 ? -26.009 50.673  25.969  1.00 15.97 ? 174  PHE B HA   1 
ATOM   10553 H HB2  . PHE B 1 185 ? -24.789 48.170  25.509  1.00 16.67 ? 174  PHE B HB2  1 
ATOM   10554 H HB3  . PHE B 1 185 ? -26.333 48.458  25.313  1.00 16.67 ? 174  PHE B HB3  1 
ATOM   10555 H HD1  . PHE B 1 185 ? -26.069 50.971  23.773  1.00 19.44 ? 174  PHE B HD1  1 
ATOM   10556 H HD2  . PHE B 1 185 ? -24.274 47.423  23.358  1.00 19.78 ? 174  PHE B HD2  1 
ATOM   10557 H HE1  . PHE B 1 185 ? -25.729 51.411  21.543  1.00 21.56 ? 174  PHE B HE1  1 
ATOM   10558 H HE2  . PHE B 1 185 ? -23.928 47.863  21.104  1.00 21.30 ? 174  PHE B HE2  1 
ATOM   10559 H HZ   . PHE B 1 185 ? -24.662 49.862  20.208  1.00 20.13 ? 174  PHE B HZ   1 
ATOM   10560 N N    . GLN B 1 186 ? -24.773 49.200  28.456  1.00 13.58 ? 175  GLN B N    1 
ATOM   10561 C CA   . GLN B 1 186 ? -25.046 48.407  29.633  1.00 13.41 ? 175  GLN B CA   1 
ATOM   10562 C C    . GLN B 1 186 ? -26.143 49.015  30.485  1.00 12.90 ? 175  GLN B C    1 
ATOM   10563 O O    . GLN B 1 186 ? -26.152 50.217  30.778  1.00 14.35 ? 175  GLN B O    1 
ATOM   10564 C CB   . GLN B 1 186 ? -23.773 48.364  30.485  1.00 13.78 ? 175  GLN B CB   1 
ATOM   10565 C CG   . GLN B 1 186 ? -23.862 47.451  31.703  1.00 12.70 ? 175  GLN B CG   1 
ATOM   10566 C CD   . GLN B 1 186 ? -22.478 47.197  32.301  1.00 13.85 ? 175  GLN B CD   1 
ATOM   10567 O OE1  . GLN B 1 186 ? -21.492 47.029  31.588  1.00 14.00 ? 175  GLN B OE1  1 
ATOM   10568 N NE2  . GLN B 1 186 ? -22.402 47.126  33.626  1.00 16.40 ? 175  GLN B NE2  1 
ATOM   10569 H H    . GLN B 1 186 ? -23.962 49.481  28.394  1.00 16.29 ? 175  GLN B H    1 
ATOM   10570 H HA   . GLN B 1 186 ? -25.296 47.504  29.382  1.00 16.09 ? 175  GLN B HA   1 
ATOM   10571 H HB2  . GLN B 1 186 ? -23.040 48.048  29.933  1.00 16.54 ? 175  GLN B HB2  1 
ATOM   10572 H HB3  . GLN B 1 186 ? -23.580 49.260  30.802  1.00 16.54 ? 175  GLN B HB3  1 
ATOM   10573 H HG2  . GLN B 1 186 ? -24.414 47.871  32.380  1.00 15.24 ? 175  GLN B HG2  1 
ATOM   10574 H HG3  . GLN B 1 186 ? -24.242 46.598  31.439  1.00 15.24 ? 175  GLN B HG3  1 
ATOM   10575 H HE21 . GLN B 1 186 ? -23.111 47.222  34.103  1.00 19.68 ? 175  GLN B HE21 1 
ATOM   10576 H HE22 . GLN B 1 186 ? -21.643 46.984  34.006  1.00 19.68 ? 175  GLN B HE22 1 
ATOM   10577 N N    . LEU B 1 187 ? -27.042 48.151  30.919  1.00 11.88 ? 176  LEU B N    1 
ATOM   10578 C CA   . LEU B 1 187 ? -28.120 48.481  31.838  1.00 11.60 ? 176  LEU B CA   1 
ATOM   10579 C C    . LEU B 1 187 ? -27.828 47.907  33.227  1.00 12.22 ? 176  LEU B C    1 
ATOM   10580 O O    . LEU B 1 187 ? -27.202 46.843  33.349  1.00 12.79 ? 176  LEU B O    1 
ATOM   10581 C CB   . LEU B 1 187 ? -29.472 47.934  31.373  1.00 13.96 ? 176  LEU B CB   1 
ATOM   10582 C CG   . LEU B 1 187 ? -29.917 48.431  30.019  1.00 14.04 ? 176  LEU B CG   1 
ATOM   10583 C CD1  . LEU B 1 187 ? -31.353 47.934  29.757  1.00 15.60 ? 176  LEU B CD1  1 
ATOM   10584 C CD2  . LEU B 1 187 ? -29.848 49.949  29.901  1.00 17.00 ? 176  LEU B CD2  1 
ATOM   10585 H H    . LEU B 1 187 ? -27.049 47.324  30.682  1.00 14.25 ? 176  LEU B H    1 
ATOM   10586 H HA   . LEU B 1 187 ? -28.191 49.445  31.915  1.00 13.92 ? 176  LEU B HA   1 
ATOM   10587 H HB2  . LEU B 1 187 ? -29.416 46.967  31.328  1.00 16.75 ? 176  LEU B HB2  1 
ATOM   10588 H HB3  . LEU B 1 187 ? -30.149 48.192  32.018  1.00 16.75 ? 176  LEU B HB3  1 
ATOM   10589 H HG   . LEU B 1 187 ? -29.340 48.051  29.338  1.00 16.85 ? 176  LEU B HG   1 
ATOM   10590 H HD11 . LEU B 1 187 ? -31.643 48.251  28.888  1.00 18.72 ? 176  LEU B HD11 1 
ATOM   10591 H HD12 . LEU B 1 187 ? -31.359 46.964  29.775  1.00 18.72 ? 176  LEU B HD12 1 
ATOM   10592 H HD13 . LEU B 1 187 ? -31.938 48.281  30.449  1.00 18.72 ? 176  LEU B HD13 1 
ATOM   10593 H HD21 . LEU B 1 187 ? -30.144 50.211  29.015  1.00 20.40 ? 176  LEU B HD21 1 
ATOM   10594 H HD22 . LEU B 1 187 ? -30.426 50.344  30.573  1.00 20.40 ? 176  LEU B HD22 1 
ATOM   10595 H HD23 . LEU B 1 187 ? -28.932 50.236  30.042  1.00 20.40 ? 176  LEU B HD23 1 
ATOM   10596 N N    . THR B 1 188 ? -28.293 48.582  34.288  1.00 12.52 ? 177  THR B N    1 
ATOM   10597 C CA   . THR B 1 188 ? -28.185 48.058  35.641  1.00 12.52 ? 177  THR B CA   1 
ATOM   10598 C C    . THR B 1 188 ? -29.206 46.949  35.838  1.00 11.50 ? 177  THR B C    1 
ATOM   10599 O O    . THR B 1 188 ? -30.128 46.769  35.057  1.00 11.97 ? 177  THR B O    1 
ATOM   10600 C CB   . THR B 1 188 ? -28.464 49.124  36.674  1.00 13.06 ? 177  THR B CB   1 
ATOM   10601 O OG1  . THR B 1 188 ? -29.822 49.507  36.547  1.00 13.82 ? 177  THR B OG1  1 
ATOM   10602 C CG2  . THR B 1 188 ? -27.560 50.363  36.505  1.00 14.27 ? 177  THR B CG2  1 
ATOM   10603 H H    . THR B 1 188 ? -28.677 49.350  34.242  1.00 15.03 ? 177  THR B H    1 
ATOM   10604 H HA   . THR B 1 188 ? -27.296 47.699  35.789  1.00 15.03 ? 177  THR B HA   1 
ATOM   10605 H HB   . THR B 1 188 ? -28.316 48.759  37.560  1.00 15.68 ? 177  THR B HB   1 
ATOM   10606 H HG1  . THR B 1 188 ? -30.007 50.101  37.111  1.00 16.58 ? 177  THR B HG1  1 
ATOM   10607 H HG21 . THR B 1 188 ? -27.770 51.022  37.185  1.00 17.12 ? 177  THR B HG21 1 
ATOM   10608 H HG22 . THR B 1 188 ? -26.628 50.108  36.590  1.00 17.12 ? 177  THR B HG22 1 
ATOM   10609 H HG23 . THR B 1 188 ? -27.700 50.758  35.630  1.00 17.12 ? 177  THR B HG23 1 
ATOM   10610 N N    . ASP B 1 189 ? -29.027 46.180  36.909  1.00 11.53 ? 178  ASP B N    1 
ATOM   10611 C CA   . ASP B 1 189 ? -29.995 45.139  37.248  1.00 11.36 ? 178  ASP B CA   1 
ATOM   10612 C C    . ASP B 1 189 ? -31.401 45.712  37.434  1.00 12.87 ? 178  ASP B C    1 
ATOM   10613 O O    . ASP B 1 189 ? -32.366 45.117  36.964  1.00 12.09 ? 178  ASP B O    1 
ATOM   10614 C CB   . ASP B 1 189 ? -29.512 44.375  38.470  1.00 11.53 ? 178  ASP B CB   1 
ATOM   10615 C CG   . ASP B 1 189 ? -28.221 43.602  38.253  1.00 12.00 ? 178  ASP B CG   1 
ATOM   10616 O OD1  . ASP B 1 189 ? -27.858 43.359  37.080  1.00 12.66 ? 178  ASP B OD1  1 
ATOM   10617 O OD2  . ASP B 1 189 ? -27.622 43.193  39.272  1.00 12.35 ? 178  ASP B OD2  1 
ATOM   10618 H H    . ASP B 1 189 ? -28.361 46.238  37.450  1.00 13.84 ? 178  ASP B H    1 
ATOM   10619 H HA   . ASP B 1 189 ? -30.036 44.510  36.512  1.00 13.64 ? 178  ASP B HA   1 
ATOM   10620 H HB2  . ASP B 1 189 ? -29.361 45.006  39.191  1.00 13.83 ? 178  ASP B HB2  1 
ATOM   10621 H HB3  . ASP B 1 189 ? -30.197 43.739  38.729  1.00 13.83 ? 178  ASP B HB3  1 
ATOM   10622 N N    A CYS B 1 190 ? -31.538 46.877  38.075  0.53 10.22 ? 179  CYS B N    1 
ATOM   10623 N N    B CYS B 1 190 ? -31.523 46.833  38.154  0.47 15.50 ? 179  CYS B N    1 
ATOM   10624 C CA   A CYS B 1 190 ? -32.860 47.470  38.218  0.53 10.61 ? 179  CYS B CA   1 
ATOM   10625 C CA   B CYS B 1 190 ? -32.776 47.564  38.271  0.47 17.51 ? 179  CYS B CA   1 
ATOM   10626 C C    A CYS B 1 190 ? -33.435 47.785  36.859  0.53 10.55 ? 179  CYS B C    1 
ATOM   10627 C C    B CYS B 1 190 ? -33.400 47.810  36.904  0.47 15.60 ? 179  CYS B C    1 
ATOM   10628 O O    A CYS B 1 190 ? -34.620 47.537  36.596  0.53 11.18 ? 179  CYS B O    1 
ATOM   10629 O O    B CYS B 1 190 ? -34.591 47.550  36.690  0.47 15.88 ? 179  CYS B O    1 
ATOM   10630 C CB   A CYS B 1 190 ? -32.792 48.791  39.016  0.53 14.56 ? 179  CYS B CB   1 
ATOM   10631 C CB   B CYS B 1 190 ? -32.488 48.910  38.961  0.47 19.12 ? 179  CYS B CB   1 
ATOM   10632 S SG   A CYS B 1 190 ? -32.640 48.658  40.787  0.53 15.12 ? 179  CYS B SG   1 
ATOM   10633 S SG   B CYS B 1 190 ? -33.879 49.988  38.983  0.47 21.32 ? 179  CYS B SG   1 
ATOM   10634 H H    A CYS B 1 190 ? -30.897 47.330  38.426  0.53 12.27 ? 179  CYS B H    1 
ATOM   10635 H H    B CYS B 1 190 ? -30.875 47.192  38.591  0.47 18.60 ? 179  CYS B H    1 
ATOM   10636 H HA   A CYS B 1 190 ? -33.453 46.854  38.677  0.53 12.74 ? 179  CYS B HA   1 
ATOM   10637 H HA   B CYS B 1 190 ? -33.402 47.060  38.814  0.47 21.02 ? 179  CYS B HA   1 
ATOM   10638 H HB2  A CYS B 1 190 ? -32.026 49.295  38.700  0.53 17.47 ? 179  CYS B HB2  1 
ATOM   10639 H HB2  B CYS B 1 190 ? -32.226 48.742  39.880  0.47 22.94 ? 179  CYS B HB2  1 
ATOM   10640 H HB3  A CYS B 1 190 ? -33.602 49.294  38.836  0.53 17.47 ? 179  CYS B HB3  1 
ATOM   10641 H HB3  B CYS B 1 190 ? -31.769 49.359  38.489  0.47 22.94 ? 179  CYS B HB3  1 
ATOM   10642 H HG   A CYS B 1 190 ? -32.599 49.760  41.259  0.53 18.15 ? 179  CYS B HG   1 
ATOM   10643 H HG   B CYS B 1 190 ? -33.574 51.009  39.535  0.47 25.58 ? 179  CYS B HG   1 
ATOM   10644 N N    . GLN B 1 191 ? -32.608 48.362  35.977  1.00 12.06 ? 180  GLN B N    1 
ATOM   10645 C CA   . GLN B 1 191 ? -33.101 48.706  34.645  1.00 12.47 ? 180  GLN B CA   1 
ATOM   10646 C C    . GLN B 1 191 ? -33.533 47.447  33.894  1.00 12.90 ? 180  GLN B C    1 
ATOM   10647 O O    . GLN B 1 191 ? -34.568 47.446  33.215  1.00 13.39 ? 180  GLN B O    1 
ATOM   10648 C CB   . GLN B 1 191 ? -32.069 49.517  33.868  1.00 13.32 ? 180  GLN B CB   1 
ATOM   10649 C CG   . GLN B 1 191 ? -31.848 50.884  34.438  1.00 13.95 ? 180  GLN B CG   1 
ATOM   10650 C CD   . GLN B 1 191 ? -30.749 51.607  33.744  1.00 14.93 ? 180  GLN B CD   1 
ATOM   10651 O OE1  . GLN B 1 191 ? -29.721 51.034  33.443  1.00 14.28 ? 180  GLN B OE1  1 
ATOM   10652 N NE2  . GLN B 1 191 ? -30.973 52.864  33.452  1.00 22.32 ? 180  GLN B NE2  1 
ATOM   10653 H H    . GLN B 1 191 ? -31.781 48.551  36.112  1.00 14.47 ? 180  GLN B H    1 
ATOM   10654 H HA   . GLN B 1 191 ? -33.888 49.264  34.747  1.00 14.96 ? 180  GLN B HA   1 
ATOM   10655 H HB2  . GLN B 1 191 ? -31.222 49.046  33.884  1.00 15.98 ? 180  GLN B HB2  1 
ATOM   10656 H HB3  . GLN B 1 191 ? -32.374 49.620  32.953  1.00 15.98 ? 180  GLN B HB3  1 
ATOM   10657 H HG2  . GLN B 1 191 ? -32.661 51.405  34.341  1.00 16.74 ? 180  GLN B HG2  1 
ATOM   10658 H HG3  . GLN B 1 191 ? -31.613 50.804  35.376  1.00 16.74 ? 180  GLN B HG3  1 
ATOM   10659 H HE21 . GLN B 1 191 ? -31.725 53.226  33.662  1.00 26.78 ? 180  GLN B HE21 1 
ATOM   10660 H HE22 . GLN B 1 191 ? -30.370 53.326  33.051  1.00 26.78 ? 180  GLN B HE22 1 
ATOM   10661 N N    . ILE B 1 192 ? -32.765 46.373  33.999  1.00 12.48 ? 181  ILE B N    1 
ATOM   10662 C CA   . ILE B 1 192 ? -33.129 45.143  33.305  1.00 11.98 ? 181  ILE B CA   1 
ATOM   10663 C C    . ILE B 1 192 ? -34.450 44.616  33.837  1.00 12.39 ? 181  ILE B C    1 
ATOM   10664 O O    . ILE B 1 192 ? -35.301 44.162  33.075  1.00 12.50 ? 181  ILE B O    1 
ATOM   10665 C CB   . ILE B 1 192 ? -31.999 44.109  33.431  1.00 12.35 ? 181  ILE B CB   1 
ATOM   10666 C CG1  . ILE B 1 192 ? -30.778 44.619  32.716  1.00 15.55 ? 181  ILE B CG1  1 
ATOM   10667 C CG2  . ILE B 1 192 ? -32.460 42.755  32.894  1.00 13.69 ? 181  ILE B CG2  1 
ATOM   10668 C CD1  . ILE B 1 192 ? -29.570 43.872  32.931  1.00 19.24 ? 181  ILE B CD1  1 
ATOM   10669 H H    . ILE B 1 192 ? -32.038 46.328  34.457  1.00 14.97 ? 181  ILE B H    1 
ATOM   10670 H HA   . ILE B 1 192 ? -33.247 45.340  32.363  1.00 14.38 ? 181  ILE B HA   1 
ATOM   10671 H HB   . ILE B 1 192 ? -31.782 44.007  34.371  1.00 14.82 ? 181  ILE B HB   1 
ATOM   10672 H HG12 . ILE B 1 192 ? -30.957 44.612  31.763  1.00 18.66 ? 181  ILE B HG12 1 
ATOM   10673 H HG13 . ILE B 1 192 ? -30.612 45.529  33.007  1.00 18.66 ? 181  ILE B HG13 1 
ATOM   10674 H HG21 . ILE B 1 192 ? -31.735 42.118  32.982  1.00 16.42 ? 181  ILE B HG21 1 
ATOM   10675 H HG22 . ILE B 1 192 ? -33.227 42.457  33.407  1.00 16.42 ? 181  ILE B HG22 1 
ATOM   10676 H HG23 . ILE B 1 192 ? -32.704 42.853  31.960  1.00 16.42 ? 181  ILE B HG23 1 
ATOM   10677 H HD11 . ILE B 1 192 ? -28.851 44.284  32.428  1.00 23.09 ? 181  ILE B HD11 1 
ATOM   10678 H HD12 . ILE B 1 192 ? -29.359 43.880  33.878  1.00 23.09 ? 181  ILE B HD12 1 
ATOM   10679 H HD13 . ILE B 1 192 ? -29.706 42.960  32.630  1.00 23.09 ? 181  ILE B HD13 1 
ATOM   10680 N N    . TYR B 1 193 ? -34.630 44.660  35.156  1.00 11.59 ? 182  TYR B N    1 
ATOM   10681 C CA   . TYR B 1 193 ? -35.904 44.274  35.766  1.00 11.82 ? 182  TYR B CA   1 
ATOM   10682 C C    . TYR B 1 193 ? -37.058 45.077  35.172  1.00 12.10 ? 182  TYR B C    1 
ATOM   10683 O O    . TYR B 1 193 ? -38.104 44.525  34.817  1.00 12.73 ? 182  TYR B O    1 
ATOM   10684 C CB   . TYR B 1 193 ? -35.784 44.460  37.268  1.00 11.97 ? 182  TYR B CB   1 
ATOM   10685 C CG   . TYR B 1 193 ? -37.024 44.083  38.076  1.00 12.18 ? 182  TYR B CG   1 
ATOM   10686 C CD1  . TYR B 1 193 ? -38.134 44.875  38.051  1.00 14.18 ? 182  TYR B CD1  1 
ATOM   10687 C CD2  . TYR B 1 193 ? -37.027 42.977  38.923  1.00 13.39 ? 182  TYR B CD2  1 
ATOM   10688 C CE1  . TYR B 1 193 ? -39.245 44.590  38.782  1.00 19.25 ? 182  TYR B CE1  1 
ATOM   10689 C CE2  . TYR B 1 193 ? -38.133 42.678  39.694  1.00 17.54 ? 182  TYR B CE2  1 
ATOM   10690 C CZ   . TYR B 1 193 ? -39.215 43.507  39.597  1.00 19.60 ? 182  TYR B CZ   1 
ATOM   10691 O OH   . TYR B 1 193 ? -40.334 43.242  40.372  1.00 28.48 ? 182  TYR B OH   1 
ATOM   10692 H H    . TYR B 1 193 ? -34.031 44.909  35.720  1.00 13.91 ? 182  TYR B H    1 
ATOM   10693 H HA   . TYR B 1 193 ? -36.069 43.335  35.591  1.00 14.18 ? 182  TYR B HA   1 
ATOM   10694 H HB2  . TYR B 1 193 ? -35.050 43.913  37.587  1.00 14.37 ? 182  TYR B HB2  1 
ATOM   10695 H HB3  . TYR B 1 193 ? -35.593 45.394  37.447  1.00 14.37 ? 182  TYR B HB3  1 
ATOM   10696 H HD1  . TYR B 1 193 ? -38.141 45.621  37.495  1.00 17.01 ? 182  TYR B HD1  1 
ATOM   10697 H HD2  . TYR B 1 193 ? -36.272 42.436  38.975  1.00 16.07 ? 182  TYR B HD2  1 
ATOM   10698 H HE1  . TYR B 1 193 ? -39.992 45.143  38.751  1.00 23.10 ? 182  TYR B HE1  1 
ATOM   10699 H HE2  . TYR B 1 193 ? -38.142 41.937  40.257  1.00 21.05 ? 182  TYR B HE2  1 
ATOM   10700 H HH   . TYR B 1 193 ? -40.925 43.822  40.231  1.00 34.18 ? 182  TYR B HH   1 
ATOM   10701 N N    . GLU B 1 194 ? -36.870 46.387  35.044  1.00 12.94 ? 183  GLU B N    1 
ATOM   10702 C CA   . GLU B 1 194 ? -37.927 47.235  34.509  1.00 12.78 ? 183  GLU B CA   1 
ATOM   10703 C C    . GLU B 1 194 ? -38.218 46.930  33.052  1.00 12.44 ? 183  GLU B C    1 
ATOM   10704 O O    . GLU B 1 194 ? -39.386 46.869  32.645  1.00 14.04 ? 183  GLU B O    1 
ATOM   10705 C CB   . GLU B 1 194 ? -37.547 48.707  34.699  1.00 15.54 ? 183  GLU B CB   1 
ATOM   10706 C CG   . GLU B 1 194 ? -37.474 49.128  36.159  1.00 16.83 ? 183  GLU B CG   1 
ATOM   10707 C CD   . GLU B 1 194 ? -37.087 50.564  36.342  1.00 28.74 ? 183  GLU B CD   1 
ATOM   10708 O OE1  . GLU B 1 194 ? -36.706 51.243  35.362  1.00 31.14 ? 183  GLU B OE1  1 
ATOM   10709 O OE2  . GLU B 1 194 ? -37.105 50.980  37.509  1.00 39.81 ? 183  GLU B OE2  1 
ATOM   10710 H H    . GLU B 1 194 ? -36.149 46.804  35.257  1.00 15.53 ? 183  GLU B H    1 
ATOM   10711 H HA   . GLU B 1 194 ? -38.740 47.072  35.012  1.00 15.33 ? 183  GLU B HA   1 
ATOM   10712 H HB2  . GLU B 1 194 ? -36.676 48.861  34.301  1.00 18.65 ? 183  GLU B HB2  1 
ATOM   10713 H HB3  . GLU B 1 194 ? -38.212 49.262  34.262  1.00 18.65 ? 183  GLU B HB3  1 
ATOM   10714 H HG2  . GLU B 1 194 ? -38.344 49.000  36.567  1.00 20.20 ? 183  GLU B HG2  1 
ATOM   10715 H HG3  . GLU B 1 194 ? -36.813 48.581  36.612  1.00 20.20 ? 183  GLU B HG3  1 
ATOM   10716 N N    A VAL B 1 195 ? -37.169 46.760  32.246  0.48 11.55 ? 184  VAL B N    1 
ATOM   10717 N N    B VAL B 1 195 ? -37.182 46.707  32.243  0.52 14.24 ? 184  VAL B N    1 
ATOM   10718 C CA   A VAL B 1 195 ? -37.351 46.458  30.835  0.48 12.12 ? 184  VAL B CA   1 
ATOM   10719 C CA   B VAL B 1 195 ? -37.436 46.481  30.826  0.52 14.14 ? 184  VAL B CA   1 
ATOM   10720 C C    A VAL B 1 195 ? -38.078 45.140  30.667  0.48 11.21 ? 184  VAL B C    1 
ATOM   10721 C C    B VAL B 1 195 ? -38.042 45.106  30.595  0.52 12.59 ? 184  VAL B C    1 
ATOM   10722 O O    A VAL B 1 195 ? -39.030 45.043  29.887  0.48 10.11 ? 184  VAL B O    1 
ATOM   10723 O O    B VAL B 1 195 ? -38.885 44.936  29.705  0.52 16.37 ? 184  VAL B O    1 
ATOM   10724 C CB   A VAL B 1 195 ? -36.001 46.456  30.092  0.48 11.40 ? 184  VAL B CB   1 
ATOM   10725 C CB   B VAL B 1 195 ? -36.184 46.740  29.962  0.52 15.53 ? 184  VAL B CB   1 
ATOM   10726 C CG1  A VAL B 1 195 ? -36.219 46.055  28.627  0.48 16.79 ? 184  VAL B CG1  1 
ATOM   10727 C CG1  B VAL B 1 195 ? -35.076 45.822  30.324  0.52 17.29 ? 184  VAL B CG1  1 
ATOM   10728 C CG2  A VAL B 1 195 ? -35.343 47.833  30.119  0.48 12.78 ? 184  VAL B CG2  1 
ATOM   10729 C CG2  B VAL B 1 195 ? -36.542 46.622  28.479  0.52 15.24 ? 184  VAL B CG2  1 
ATOM   10730 H H    A VAL B 1 195 ? -36.347 46.816  32.494  0.48 13.86 ? 184  VAL B H    1 
ATOM   10731 H H    B VAL B 1 195 ? -36.355 46.683  32.479  0.52 17.09 ? 184  VAL B H    1 
ATOM   10732 H HA   A VAL B 1 195 ? -37.903 47.150  30.439  0.48 14.55 ? 184  VAL B HA   1 
ATOM   10733 H HA   B VAL B 1 195 ? -38.102 47.126  30.543  0.52 16.97 ? 184  VAL B HA   1 
ATOM   10734 H HB   A VAL B 1 195 ? -35.400 45.816  30.504  0.48 13.68 ? 184  VAL B HB   1 
ATOM   10735 H HB   B VAL B 1 195 ? -35.879 47.647  30.121  0.52 18.63 ? 184  VAL B HB   1 
ATOM   10736 H HG11 A VAL B 1 195 ? -35.364 46.057  28.169  0.48 20.14 ? 184  VAL B HG11 1 
ATOM   10737 H HG11 B VAL B 1 195 ? -34.310 46.016  29.762  0.52 20.75 ? 184  VAL B HG11 1 
ATOM   10738 H HG12 A VAL B 1 195 ? -36.608 45.167  28.598  0.48 20.14 ? 184  VAL B HG12 1 
ATOM   10739 H HG12 B VAL B 1 195 ? -34.845 45.959  31.256  0.52 20.75 ? 184  VAL B HG12 1 
ATOM   10740 H HG13 A VAL B 1 195 ? -36.819 46.693  28.211  0.48 20.14 ? 184  VAL B HG13 1 
ATOM   10741 H HG13 B VAL B 1 195 ? -35.366 44.907  30.186  0.52 20.75 ? 184  VAL B HG13 1 
ATOM   10742 H HG21 A VAL B 1 195 ? -34.500 47.788  29.642  0.48 15.34 ? 184  VAL B HG21 1 
ATOM   10743 H HG21 B VAL B 1 195 ? -35.747 46.787  27.948  0.52 18.28 ? 184