data_5LXY
# 
_entry.id   5LXY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5LXY         
WWPDB D_1200001549 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5LXY 
_pdbx_database_status.recvd_initial_deposition_date   2016-09-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Falk, S.'       1 
'Finogenova, K.' 2 
'Benda, C.'      3 
'Conti, E.'      4 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nat Commun' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2041-1723 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            7 
_citation.language                  ? 
_citation.page_first                13573 
_citation.page_last                 13573 
_citation.title                     
'Structure of the RBM7-ZCCHC8 core of the NEXT complex reveals connections to splicing factors.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1038/ncomms13573 
_citation.pdbx_database_id_PubMed   27905398 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Falk, S.'           1 
primary 'Finogenova, K.'     2 
primary 'Melko, M.'          3 
primary 'Benda, C.'          4 
primary 'Lykke-Andersen, S.' 5 
primary 'Jensen, T.H.'       6 
primary 'Conti, E.'          7 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   126.570 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5LXY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     178.771 
_cell.length_a_esd                 ? 
_cell.length_b                     66.575 
_cell.length_b_esd                 ? 
_cell.length_c                     111.912 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        28 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5LXY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'RNA-binding protein 7'                        10032.661 7 ? ? ? ? 
2 polymer     man 'Zinc finger CCHC domain-containing protein 8' 5097.909  7 ? ? ? ? 
3 non-polymer syn 'BROMIDE ION'                                  79.904    9 ? ? ? ? 
4 water       nat water                                          18.015    3 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNA-binding motif protein 7'                  
2 'TRAMP-like complex RNA-binding factor ZCCHC8' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;GPDSMGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLY
GRPIKIQFRS
;
;GPDSMGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLY
GRPIKIQFRS
;
A,B,E,G,I,K,M ? 
2 'polypeptide(L)' no no GPDSMRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLK                                                 
GPDSMRFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLK                                                 D,C,F,H,J,L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  GLY n 
1 2  PRO n 
1 3  ASP n 
1 4  SER n 
1 5  MET n 
1 6  GLY n 
1 7  ALA n 
1 8  ALA n 
1 9  ALA n 
1 10 ALA n 
1 11 GLU n 
1 12 ALA n 
1 13 ASP n 
1 14 ARG n 
1 15 THR n 
1 16 LEU n 
1 17 PHE n 
1 18 VAL n 
1 19 GLY n 
1 20 ASN n 
1 21 LEU n 
1 22 GLU n 
1 23 THR n 
1 24 LYS n 
1 25 VAL n 
1 26 THR n 
1 27 GLU n 
1 28 GLU n 
1 29 LEU n 
1 30 LEU n 
1 31 PHE n 
1 32 GLU n 
1 33 LEU n 
1 34 PHE n 
1 35 HIS n 
1 36 GLN n 
1 37 ALA n 
1 38 GLY n 
1 39 PRO n 
1 40 VAL n 
1 41 ILE n 
1 42 LYS n 
1 43 VAL n 
1 44 LYS n 
1 45 ILE n 
1 46 PRO n 
1 47 LYS n 
1 48 ASP n 
1 49 LYS n 
1 50 ASP n 
1 51 GLY n 
1 52 LYS n 
1 53 PRO n 
1 54 LYS n 
1 55 GLN n 
1 56 PHE n 
1 57 ALA n 
1 58 PHE n 
1 59 VAL n 
1 60 ASN n 
1 61 PHE n 
1 62 LYS n 
1 63 HIS n 
1 64 GLU n 
1 65 VAL n 
1 66 SER n 
1 67 VAL n 
1 68 PRO n 
1 69 TYR n 
1 70 ALA n 
1 71 MET n 
1 72 ASN n 
1 73 LEU n 
1 74 LEU n 
1 75 ASN n 
1 76 GLY n 
1 77 ILE n 
1 78 LYS n 
1 79 LEU n 
1 80 TYR n 
1 81 GLY n 
1 82 ARG n 
1 83 PRO n 
1 84 ILE n 
1 85 LYS n 
1 86 ILE n 
1 87 GLN n 
1 88 PHE n 
1 89 ARG n 
1 90 SER n 
2 1  GLY n 
2 2  PRO n 
2 3  ASP n 
2 4  SER n 
2 5  MET n 
2 6  ARG n 
2 7  PHE n 
2 8  LYS n 
2 9  PRO n 
2 10 GLY n 
2 11 VAL n 
2 12 ILE n 
2 13 SER n 
2 14 GLU n 
2 15 GLU n 
2 16 LEU n 
2 17 GLN n 
2 18 ASP n 
2 19 ALA n 
2 20 LEU n 
2 21 GLY n 
2 22 VAL n 
2 23 THR n 
2 24 ASP n 
2 25 LYS n 
2 26 SER n 
2 27 LEU n 
2 28 PRO n 
2 29 PRO n 
2 30 PHE n 
2 31 ILE n 
2 32 TYR n 
2 33 ARG n 
2 34 MET n 
2 35 ARG n 
2 36 GLN n 
2 37 LEU n 
2 38 GLY n 
2 39 TYR n 
2 40 PRO n 
2 41 PRO n 
2 42 GLY n 
2 43 TRP n 
2 44 LEU n 
2 45 LYS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 90 Human ? RBM7   ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 45 Human ? ZCCHC8 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RBM7_HUMAN  Q9Y580 ? 1 
;MGAAAAEADRTLFVGNLETKVTEELLFELFHQAGPVIKVKIPKDKDGKPKQFAFVNFKHEVSVPYAMNLLNGIKLYGRPI
KIQFRS
;
1   
2 UNP ZCHC8_HUMAN Q6NZY4 ? 2 RFKPGVISEELQDALGVTDKSLPPFIYRMRQLGYPPGWLK                                                  285 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5LXY A 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
2  2 5LXY D 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
3  1 5LXY B 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
4  2 5LXY C 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
5  1 5LXY E 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
6  2 5LXY F 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
7  1 5LXY G 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
8  2 5LXY H 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
9  1 5LXY I 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
10 2 5LXY J 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
11 1 5LXY K 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
12 2 5LXY L 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
13 1 5LXY M 5 ? 90 ? Q9Y580 1   ? 86  ? 1   86  
14 2 5LXY N 6 ? 45 ? Q6NZY4 285 ? 324 ? 285 324 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1  5LXY GLY A 1 ? UNP Q9Y580 ? ? 'expression tag' -3  1  
1  5LXY PRO A 2 ? UNP Q9Y580 ? ? 'expression tag' -2  2  
1  5LXY ASP A 3 ? UNP Q9Y580 ? ? 'expression tag' -1  3  
1  5LXY SER A 4 ? UNP Q9Y580 ? ? 'expression tag' 0   4  
2  5LXY GLY D 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 5  
2  5LXY PRO D 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 6  
2  5LXY ASP D 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 7  
2  5LXY SER D 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 8  
2  5LXY MET D 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 9  
3  5LXY GLY B 1 ? UNP Q9Y580 ? ? 'expression tag' -3  10 
3  5LXY PRO B 2 ? UNP Q9Y580 ? ? 'expression tag' -2  11 
3  5LXY ASP B 3 ? UNP Q9Y580 ? ? 'expression tag' -1  12 
3  5LXY SER B 4 ? UNP Q9Y580 ? ? 'expression tag' 0   13 
4  5LXY GLY C 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 14 
4  5LXY PRO C 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 15 
4  5LXY ASP C 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 16 
4  5LXY SER C 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 17 
4  5LXY MET C 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 18 
5  5LXY GLY E 1 ? UNP Q9Y580 ? ? 'expression tag' -3  19 
5  5LXY PRO E 2 ? UNP Q9Y580 ? ? 'expression tag' -2  20 
5  5LXY ASP E 3 ? UNP Q9Y580 ? ? 'expression tag' -1  21 
5  5LXY SER E 4 ? UNP Q9Y580 ? ? 'expression tag' 0   22 
6  5LXY GLY F 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 23 
6  5LXY PRO F 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 24 
6  5LXY ASP F 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 25 
6  5LXY SER F 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 26 
6  5LXY MET F 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 27 
7  5LXY GLY G 1 ? UNP Q9Y580 ? ? 'expression tag' -3  28 
7  5LXY PRO G 2 ? UNP Q9Y580 ? ? 'expression tag' -2  29 
7  5LXY ASP G 3 ? UNP Q9Y580 ? ? 'expression tag' -1  30 
7  5LXY SER G 4 ? UNP Q9Y580 ? ? 'expression tag' 0   31 
8  5LXY GLY H 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 32 
8  5LXY PRO H 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 33 
8  5LXY ASP H 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 34 
8  5LXY SER H 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 35 
8  5LXY MET H 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 36 
9  5LXY GLY I 1 ? UNP Q9Y580 ? ? 'expression tag' -3  37 
9  5LXY PRO I 2 ? UNP Q9Y580 ? ? 'expression tag' -2  38 
9  5LXY ASP I 3 ? UNP Q9Y580 ? ? 'expression tag' -1  39 
9  5LXY SER I 4 ? UNP Q9Y580 ? ? 'expression tag' 0   40 
10 5LXY GLY J 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 41 
10 5LXY PRO J 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 42 
10 5LXY ASP J 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 43 
10 5LXY SER J 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 44 
10 5LXY MET J 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 45 
11 5LXY GLY K 1 ? UNP Q9Y580 ? ? 'expression tag' -3  46 
11 5LXY PRO K 2 ? UNP Q9Y580 ? ? 'expression tag' -2  47 
11 5LXY ASP K 3 ? UNP Q9Y580 ? ? 'expression tag' -1  48 
11 5LXY SER K 4 ? UNP Q9Y580 ? ? 'expression tag' 0   49 
12 5LXY GLY L 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 50 
12 5LXY PRO L 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 51 
12 5LXY ASP L 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 52 
12 5LXY SER L 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 53 
12 5LXY MET L 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 54 
13 5LXY GLY M 1 ? UNP Q9Y580 ? ? 'expression tag' -3  55 
13 5LXY PRO M 2 ? UNP Q9Y580 ? ? 'expression tag' -2  56 
13 5LXY ASP M 3 ? UNP Q9Y580 ? ? 'expression tag' -1  57 
13 5LXY SER M 4 ? UNP Q9Y580 ? ? 'expression tag' 0   58 
14 5LXY GLY N 1 ? UNP Q6NZY4 ? ? 'expression tag' 280 59 
14 5LXY PRO N 2 ? UNP Q6NZY4 ? ? 'expression tag' 281 60 
14 5LXY ASP N 3 ? UNP Q6NZY4 ? ? 'expression tag' 282 61 
14 5LXY SER N 4 ? UNP Q6NZY4 ? ? 'expression tag' 283 62 
14 5LXY MET N 5 ? UNP Q6NZY4 ? ? 'expression tag' 284 63 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
BR  non-polymer         . 'BROMIDE ION'   ? 'Br -1'          79.904  
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5LXY 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.9 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.3 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;0.1 M Bis-Tris-Propane
0.2 M NaBr
0.1 M Sodium malonate
20% (w/v) PEG3350
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-06-26 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
_diffrn_source.pdbx_synchrotron_site       SLS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5LXY 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.85 
_reflns.d_resolution_low                 71.79 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       24933 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.2 
_reflns.pdbx_Rmerge_I_obs                0.061 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            8.1 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.995 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.85 
_reflns_shell.d_res_low                   2.92 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        99.7 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.62 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                244.620 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                32.730 
_refine.correlation_coeff_Fo_to_Fc               0.8660 
_refine.correlation_coeff_Fo_to_Fc_free          0.8290 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5LXY 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.8500 
_refine.ls_d_res_low                             71.7900 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     24232 
_refine.ls_number_reflns_R_free                  1245 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7800 
_refine.ls_percent_reflns_R_free                 5.0000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       0.3000 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2618 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      5LXR 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5485 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         9 
_refine_hist.number_atoms_solvent             3 
_refine_hist.number_atoms_total               5497 
_refine_hist.d_res_high                       2.8500 
_refine_hist.d_res_low                        71.7900 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  0.019  5621  ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.000  0.020  5034  ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 1.147  1.970  7693  ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 3.767  3.000  11372 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 4.166  5.000  760   ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 23.805 22.529 174   ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 12.573 15.000 643   ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 13.952 15.000 18    ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.038  0.200  901   ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.005  0.021  6486  ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.004  0.020  1294  ? r_gen_planes_other     ? ? 
'X-RAY DIFFRACTION' ? 5.240  11.022 3112  ? r_mcbond_it            ? ? 
'X-RAY DIFFRACTION' ? 5.241  11.021 3111  ? r_mcbond_other         ? ? 
'X-RAY DIFFRACTION' ? 8.090  16.491 3848  ? r_mcangle_it           ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.8500 
_refine_ls_shell.d_res_low                        2.9240 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             ? 
_refine_ls_shell.number_reflns_R_work             1709 
_refine_ls_shell.percent_reflns_obs               99.7800 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  ? 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  ? 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   ? 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5LXY 
_struct.title                        'Structure of the minimal RBM7 - ZCCHC8 Complex' 
_struct.pdbx_descriptor              'RNA-binding protein 7, Zinc finger CCHC domain-containing protein 8' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5LXY 
_struct_keywords.text            'NEXT Complex RRM RBM7 ZCCHC8, RNA Binding Protein' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 1 ? 
F N N 2 ? 
G N N 1 ? 
H N N 2 ? 
I N N 1 ? 
J N N 2 ? 
K N N 1 ? 
L N N 2 ? 
M N N 1 ? 
N N N 2 ? 
O N N 3 ? 
P N N 3 ? 
Q N N 3 ? 
R N N 3 ? 
S N N 3 ? 
T N N 3 ? 
U N N 3 ? 
V N N 3 ? 
W N N 3 ? 
X N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 26 ? GLN A 36 ? THR A 22  GLN A 32  1 ? 11 
HELX_P HELX_P2  AA2 VAL A 65 ? ASN A 75 ? VAL A 61  ASN A 71  1 ? 11 
HELX_P HELX_P3  AA3 SER B 13 ? GLY B 21 ? SER D 292 GLY D 300 1 ? 9  
HELX_P HELX_P4  AA4 PHE B 30 ? GLY B 38 ? PHE D 309 GLY D 317 1 ? 9  
HELX_P HELX_P5  AA5 PRO B 40 ? LYS B 45 ? PRO D 319 LYS D 324 1 ? 6  
HELX_P HELX_P6  AA6 GLU C 11 ? ARG C 14 ? GLU B 7   ARG B 10  1 ? 4  
HELX_P HELX_P7  AA7 THR C 26 ? HIS C 35 ? THR B 22  HIS B 31  1 ? 10 
HELX_P HELX_P8  AA8 VAL C 65 ? ASN C 75 ? VAL B 61  ASN B 71  1 ? 11 
HELX_P HELX_P9  AA9 SER D 13 ? GLY D 21 ? SER C 292 GLY C 300 1 ? 9  
HELX_P HELX_P10 AB1 PHE D 30 ? GLY D 38 ? PHE C 309 GLY C 317 1 ? 9  
HELX_P HELX_P11 AB2 PRO D 40 ? LYS D 45 ? PRO C 319 LYS C 324 1 ? 6  
HELX_P HELX_P12 AB3 THR E 26 ? HIS E 35 ? THR E 22  HIS E 31  1 ? 10 
HELX_P HELX_P13 AB4 VAL E 65 ? ASN E 75 ? VAL E 61  ASN E 71  1 ? 11 
HELX_P HELX_P14 AB5 SER F 13 ? GLY F 21 ? SER F 292 GLY F 300 1 ? 9  
HELX_P HELX_P15 AB6 PHE F 30 ? GLY F 38 ? PHE F 309 GLY F 317 1 ? 9  
HELX_P HELX_P16 AB7 PRO F 40 ? LYS F 45 ? PRO F 319 LYS F 324 1 ? 6  
HELX_P HELX_P17 AB8 THR G 26 ? HIS G 35 ? THR G 22  HIS G 31  1 ? 10 
HELX_P HELX_P18 AB9 VAL G 65 ? ASN G 75 ? VAL G 61  ASN G 71  1 ? 11 
HELX_P HELX_P19 AC1 SER H 13 ? GLY H 21 ? SER H 292 GLY H 300 1 ? 9  
HELX_P HELX_P20 AC2 PHE H 30 ? GLY H 38 ? PHE H 309 GLY H 317 1 ? 9  
HELX_P HELX_P21 AC3 GLU I 11 ? THR I 15 ? GLU I 7   THR I 11  5 ? 5  
HELX_P HELX_P22 AC4 THR I 26 ? HIS I 35 ? THR I 22  HIS I 31  1 ? 10 
HELX_P HELX_P23 AC5 VAL I 65 ? ASN I 75 ? VAL I 61  ASN I 71  1 ? 11 
HELX_P HELX_P24 AC6 SER J 13 ? GLY J 21 ? SER J 292 GLY J 300 1 ? 9  
HELX_P HELX_P25 AC7 PHE J 30 ? GLY J 38 ? PHE J 309 GLY J 317 1 ? 9  
HELX_P HELX_P26 AC8 PRO J 40 ? LEU J 44 ? PRO J 319 LEU J 323 5 ? 5  
HELX_P HELX_P27 AC9 THR K 26 ? HIS K 35 ? THR K 22  HIS K 31  1 ? 10 
HELX_P HELX_P28 AD1 VAL K 65 ? ASN K 75 ? VAL K 61  ASN K 71  1 ? 11 
HELX_P HELX_P29 AD2 SER L 13 ? GLY L 21 ? SER L 292 GLY L 300 1 ? 9  
HELX_P HELX_P30 AD3 PHE L 30 ? GLY L 38 ? PHE L 309 GLY L 317 1 ? 9  
HELX_P HELX_P31 AD4 PRO L 40 ? LEU L 44 ? PRO L 319 LEU L 323 5 ? 5  
HELX_P HELX_P32 AD5 LEU M 30 ? GLY M 38 ? LEU M 26  GLY M 34  1 ? 9  
HELX_P HELX_P33 AD6 VAL M 65 ? ASN M 75 ? VAL M 61  ASN M 71  1 ? 11 
HELX_P HELX_P34 AD7 SER N 13 ? GLY N 21 ? SER N 292 GLY N 300 1 ? 9  
HELX_P HELX_P35 AD8 PHE N 30 ? GLY N 38 ? PHE N 309 GLY N 317 1 ? 9  
HELX_P HELX_P36 AD9 PRO N 40 ? LEU N 44 ? PRO N 319 LEU N 323 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 2 ? 
AA3 ? 4 ? 
AA4 ? 2 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 2 ? 
AB5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 40 ? LYS A 44 ? VAL A 36 LYS A 40 
AA1 2 ALA A 57 ? PHE A 61 ? ALA A 53 PHE A 57 
AA1 3 THR A 15 ? GLY A 19 ? THR A 11 GLY A 15 
AA1 4 LYS A 85 ? ILE A 86 ? LYS A 81 ILE A 82 
AA2 1 LYS A 78 ? LEU A 79 ? LYS A 74 LEU A 75 
AA2 2 ARG A 82 ? PRO A 83 ? ARG A 78 PRO A 79 
AA3 1 VAL C 40 ? LYS C 44 ? VAL B 36 LYS B 40 
AA3 2 ALA C 57 ? PHE C 61 ? ALA B 53 PHE B 57 
AA3 3 THR C 15 ? GLY C 19 ? THR B 11 GLY B 15 
AA3 4 LYS C 85 ? PHE C 88 ? LYS B 81 PHE B 84 
AA4 1 LYS C 78 ? LEU C 79 ? LYS B 74 LEU B 75 
AA4 2 ARG C 82 ? PRO C 83 ? ARG B 78 PRO B 79 
AA5 1 VAL E 40 ? LYS E 44 ? VAL E 36 LYS E 40 
AA5 2 ALA E 57 ? PHE E 61 ? ALA E 53 PHE E 57 
AA5 3 THR E 15 ? GLY E 19 ? THR E 11 GLY E 15 
AA5 4 LYS E 85 ? PHE E 88 ? LYS E 81 PHE E 84 
AA6 1 LYS E 78 ? LEU E 79 ? LYS E 74 LEU E 75 
AA6 2 ARG E 82 ? PRO E 83 ? ARG E 78 PRO E 79 
AA7 1 VAL G 40 ? LYS G 44 ? VAL G 36 LYS G 40 
AA7 2 ALA G 57 ? PHE G 61 ? ALA G 53 PHE G 57 
AA7 3 THR G 15 ? GLY G 19 ? THR G 11 GLY G 15 
AA7 4 LYS G 85 ? PHE G 88 ? LYS G 81 PHE G 84 
AA8 1 LYS G 78 ? LEU G 79 ? LYS G 74 LEU G 75 
AA8 2 ARG G 82 ? PRO G 83 ? ARG G 78 PRO G 79 
AA9 1 VAL I 18 ? GLY I 19 ? VAL I 14 GLY I 15 
AA9 2 LYS I 85 ? ILE I 86 ? LYS I 81 ILE I 82 
AB1 1 VAL I 40 ? LYS I 44 ? VAL I 36 LYS I 40 
AB1 2 PHE I 58 ? PHE I 61 ? PHE I 54 PHE I 57 
AB2 1 LYS I 78 ? LEU I 79 ? LYS I 74 LEU I 75 
AB2 2 ARG I 82 ? PRO I 83 ? ARG I 78 PRO I 79 
AB3 1 VAL K 40 ? VAL K 43 ? VAL K 36 VAL K 39 
AB3 2 PHE K 56 ? PHE K 61 ? PHE K 52 PHE K 57 
AB3 3 THR K 15 ? GLY K 19 ? THR K 11 GLY K 15 
AB3 4 LYS K 85 ? PHE K 88 ? LYS K 81 PHE K 84 
AB4 1 LYS K 78 ? LEU K 79 ? LYS K 74 LEU K 75 
AB4 2 ARG K 82 ? PRO K 83 ? ARG K 78 PRO K 79 
AB5 1 VAL M 40 ? LYS M 42 ? VAL M 36 LYS M 38 
AB5 2 ALA M 57 ? PHE M 61 ? ALA M 53 PHE M 57 
AB5 3 THR M 15 ? GLY M 19 ? THR M 11 GLY M 15 
AB5 4 LYS M 85 ? PHE M 88 ? LYS M 81 PHE M 84 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 44 ? N LYS A 40 O PHE A 58 ? O PHE A 54 
AA1 2 3 O VAL A 59 ? O VAL A 55 N LEU A 16 ? N LEU A 12 
AA1 3 4 N GLY A 19 ? N GLY A 15 O LYS A 85 ? O LYS A 81 
AA2 1 2 N LEU A 79 ? N LEU A 75 O ARG A 82 ? O ARG A 78 
AA3 1 2 N ILE C 41 ? N ILE B 37 O ASN C 60 ? O ASN B 56 
AA3 2 3 O VAL C 59 ? O VAL B 55 N LEU C 16 ? N LEU B 12 
AA3 3 4 N GLY C 19 ? N GLY B 15 O LYS C 85 ? O LYS B 81 
AA4 1 2 N LEU C 79 ? N LEU B 75 O ARG C 82 ? O ARG B 78 
AA5 1 2 N ILE E 41 ? N ILE E 37 O ASN E 60 ? O ASN E 56 
AA5 2 3 O VAL E 59 ? O VAL E 55 N LEU E 16 ? N LEU E 12 
AA5 3 4 N GLY E 19 ? N GLY E 15 O LYS E 85 ? O LYS E 81 
AA6 1 2 N LEU E 79 ? N LEU E 75 O ARG E 82 ? O ARG E 78 
AA7 1 2 N ILE G 41 ? N ILE G 37 O ASN G 60 ? O ASN G 56 
AA7 2 3 O ALA G 57 ? O ALA G 53 N VAL G 18 ? N VAL G 14 
AA7 3 4 N GLY G 19 ? N GLY G 15 O LYS G 85 ? O LYS G 81 
AA8 1 2 N LEU G 79 ? N LEU G 75 O ARG G 82 ? O ARG G 78 
AA9 1 2 N GLY I 19 ? N GLY I 15 O LYS I 85 ? O LYS I 81 
AB1 1 2 N LYS I 44 ? N LYS I 40 O PHE I 58 ? O PHE I 54 
AB2 1 2 N LEU I 79 ? N LEU I 75 O ARG I 82 ? O ARG I 78 
AB3 1 2 N ILE K 41 ? N ILE K 37 O ASN K 60 ? O ASN K 56 
AB3 2 3 O VAL K 59 ? O VAL K 55 N LEU K 16 ? N LEU K 12 
AB3 3 4 N GLY K 19 ? N GLY K 15 O LYS K 85 ? O LYS K 81 
AB4 1 2 N LEU K 79 ? N LEU K 75 O ARG K 82 ? O ARG K 78 
AB5 1 2 N LYS M 42 ? N LYS M 38 O ASN M 60 ? O ASN M 56 
AB5 2 3 O VAL M 59 ? O VAL M 55 N LEU M 16 ? N LEU M 12 
AB5 3 4 N PHE M 17 ? N PHE M 13 O GLN M 87 ? O GLN M 83 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D BR 401 ? 2 'binding site for residue BR D 401' 
AC2 Software C BR 401 ? 2 'binding site for residue BR C 401' 
AC3 Software C BR 402 ? 2 'binding site for residue BR C 402' 
AC4 Software F BR 401 ? 1 'binding site for residue BR F 401' 
AC5 Software G BR 101 ? 1 'binding site for residue BR G 101' 
AC6 Software J BR 401 ? 2 'binding site for residue BR J 401' 
AC7 Software L BR 401 ? 1 'binding site for residue BR L 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 2 LEU D 44 ? LEU C 323 . ? 1_555 ? 
2  AC1 2 PHE B 30 ? PHE D 309 . ? 1_555 ? 
3  AC2 2 PHE D 30 ? PHE C 309 . ? 1_555 ? 
4  AC2 2 LEU F 44 ? LEU F 323 . ? 1_555 ? 
5  AC3 2 GLY D 10 ? GLY C 289 . ? 1_555 ? 
6  AC3 2 LYS D 25 ? LYS C 304 . ? 1_555 ? 
7  AC4 1 PHE F 30 ? PHE F 309 . ? 1_555 ? 
8  AC5 1 HIS G 63 ? HIS G 59  . ? 1_555 ? 
9  AC6 2 PHE J 30 ? PHE J 309 . ? 1_555 ? 
10 AC6 2 ARG J 33 ? ARG J 312 . ? 1_555 ? 
11 AC7 1 PHE L 30 ? PHE L 309 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5LXY 
_atom_sites.fract_transf_matrix[1][1]   0.005594 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004149 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.015021 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011125 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
BR 
C  
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 11 ? 4.865   1.995   2.507   1.00 144.73 ? 7   GLU A N   1 
ATOM   2    C  CA  . GLU A 1 11 ? 5.664   1.395   3.570   1.00 145.67 ? 7   GLU A CA  1 
ATOM   3    C  C   . GLU A 1 11 ? 4.798   0.688   4.612   1.00 141.45 ? 7   GLU A C   1 
ATOM   4    O  O   . GLU A 1 11 ? 5.321   0.066   5.534   1.00 141.87 ? 7   GLU A O   1 
ATOM   5    C  CB  . GLU A 1 11 ? 6.529   2.454   4.256   1.00 151.42 ? 7   GLU A CB  1 
ATOM   6    N  N   . ALA A 1 12 ? 3.480   0.797   4.472   1.00 138.64 ? 8   ALA A N   1 
ATOM   7    C  CA  . ALA A 1 12 ? 2.533   0.146   5.369   1.00 133.95 ? 8   ALA A CA  1 
ATOM   8    C  C   . ALA A 1 12 ? 1.914   -1.052  4.663   1.00 131.01 ? 8   ALA A C   1 
ATOM   9    O  O   . ALA A 1 12 ? 1.442   -0.929  3.529   1.00 133.02 ? 8   ALA A O   1 
ATOM   10   C  CB  . ALA A 1 12 ? 1.440   1.121   5.811   1.00 131.43 ? 8   ALA A CB  1 
ATOM   11   N  N   . ASP A 1 13 ? 1.906   -2.204  5.333   1.00 127.60 ? 9   ASP A N   1 
ATOM   12   C  CA  . ASP A 1 13 ? 1.392   -3.438  4.747   1.00 120.74 ? 9   ASP A CA  1 
ATOM   13   C  C   . ASP A 1 13 ? -0.032  -3.673  5.241   1.00 108.50 ? 9   ASP A C   1 
ATOM   14   O  O   . ASP A 1 13 ? -0.243  -4.036  6.402   1.00 109.32 ? 9   ASP A O   1 
ATOM   15   C  CB  . ASP A 1 13 ? 2.289   -4.628  5.079   1.00 126.76 ? 9   ASP A CB  1 
ATOM   16   C  CG  . ASP A 1 13 ? 2.007   -5.824  4.188   1.00 127.24 ? 9   ASP A CG  1 
ATOM   17   O  OD1 . ASP A 1 13 ? 1.579   -5.608  3.031   1.00 126.88 ? 9   ASP A OD1 1 
ATOM   18   O  OD2 . ASP A 1 13 ? 2.206   -6.971  4.641   1.00 126.05 ? 9   ASP A OD2 1 
ATOM   19   N  N   . ARG A 1 14 ? -1.003  -3.477  4.347   1.00 101.19 ? 10  ARG A N   1 
ATOM   20   C  CA  . ARG A 1 14 ? -2.426  -3.596  4.648   1.00 88.12  ? 10  ARG A CA  1 
ATOM   21   C  C   . ARG A 1 14 ? -3.037  -4.847  4.024   1.00 79.43  ? 10  ARG A C   1 
ATOM   22   O  O   . ARG A 1 14 ? -4.240  -4.893  3.754   1.00 75.00  ? 10  ARG A O   1 
ATOM   23   C  CB  . ARG A 1 14 ? -3.169  -2.350  4.168   1.00 88.68  ? 10  ARG A CB  1 
ATOM   24   C  CG  . ARG A 1 14 ? -2.627  -1.046  4.724   1.00 65.29  ? 10  ARG A CG  1 
ATOM   25   C  CD  . ARG A 1 14 ? -3.055  0.146   3.891   1.00 68.42  ? 10  ARG A CD  1 
ATOM   26   N  NE  . ARG A 1 14 ? -2.035  0.519   2.914   1.00 100.66 ? 10  ARG A NE  1 
ATOM   27   C  CZ  . ARG A 1 14 ? -2.190  0.446   1.597   1.00 96.97  ? 10  ARG A CZ  1 
ATOM   28   N  NH1 . ARG A 1 14 ? -3.340  0.022   1.086   1.00 91.77  ? 10  ARG A NH1 1 
ATOM   29   N  NH2 . ARG A 1 14 ? -1.202  0.810   0.792   1.00 97.54  ? 10  ARG A NH2 1 
ATOM   30   N  N   . THR A 1 15 ? -2.221  -5.868  3.787   1.00 80.12  ? 11  THR A N   1 
ATOM   31   C  CA  . THR A 1 15 ? -2.650  -7.076  3.097   1.00 81.81  ? 11  THR A CA  1 
ATOM   32   C  C   . THR A 1 15 ? -2.692  -8.241  4.073   1.00 83.04  ? 11  THR A C   1 
ATOM   33   O  O   . THR A 1 15 ? -1.734  -8.468  4.820   1.00 83.08  ? 11  THR A O   1 
ATOM   34   C  CB  . THR A 1 15 ? -1.711  -7.402  1.933   1.00 88.54  ? 11  THR A CB  1 
ATOM   35   O  OG1 . THR A 1 15 ? -1.659  -6.285  1.036   1.00 94.69  ? 11  THR A OG1 1 
ATOM   36   C  CG2 . THR A 1 15 ? -2.204  -8.629  1.177   1.00 85.79  ? 11  THR A CG2 1 
ATOM   37   N  N   . LEU A 1 16 ? -3.799  -8.975  4.056   1.00 89.02  ? 12  LEU A N   1 
ATOM   38   C  CA  . LEU A 1 16 ? -3.949  -10.201 4.821   1.00 87.83  ? 12  LEU A CA  1 
ATOM   39   C  C   . LEU A 1 16 ? -3.966  -11.397 3.882   1.00 83.81  ? 12  LEU A C   1 
ATOM   40   O  O   . LEU A 1 16 ? -4.555  -11.343 2.796   1.00 87.33  ? 12  LEU A O   1 
ATOM   41   C  CB  . LEU A 1 16 ? -5.235  -10.193 5.652   1.00 88.04  ? 12  LEU A CB  1 
ATOM   42   C  CG  . LEU A 1 16 ? -5.173  -9.699  7.096   1.00 91.15  ? 12  LEU A CG  1 
ATOM   43   C  CD1 . LEU A 1 16 ? -6.531  -9.858  7.751   1.00 87.16  ? 12  LEU A CD1 1 
ATOM   44   C  CD2 . LEU A 1 16 ? -4.119  -10.462 7.869   1.00 96.66  ? 12  LEU A CD2 1 
ATOM   45   N  N   . PHE A 1 17 ? -3.315  -12.471 4.308   1.00 75.10  ? 13  PHE A N   1 
ATOM   46   C  CA  . PHE A 1 17 ? -3.393  -13.754 3.629   1.00 69.94  ? 13  PHE A CA  1 
ATOM   47   C  C   . PHE A 1 17 ? -4.333  -14.646 4.431   1.00 66.54  ? 13  PHE A C   1 
ATOM   48   O  O   . PHE A 1 17 ? -4.126  -14.855 5.631   1.00 70.83  ? 13  PHE A O   1 
ATOM   49   C  CB  . PHE A 1 17 ? -1.999  -14.377 3.504   1.00 71.06  ? 13  PHE A CB  1 
ATOM   50   C  CG  . PHE A 1 17 ? -1.995  -15.778 2.963   1.00 71.03  ? 13  PHE A CG  1 
ATOM   51   C  CD1 . PHE A 1 17 ? -2.225  -16.857 3.797   1.00 76.49  ? 13  PHE A CD1 1 
ATOM   52   C  CD2 . PHE A 1 17 ? -1.734  -16.019 1.628   1.00 70.57  ? 13  PHE A CD2 1 
ATOM   53   C  CE1 . PHE A 1 17 ? -2.221  -18.147 3.310   1.00 78.59  ? 13  PHE A CE1 1 
ATOM   54   C  CE2 . PHE A 1 17 ? -1.725  -17.309 1.134   1.00 74.17  ? 13  PHE A CE2 1 
ATOM   55   C  CZ  . PHE A 1 17 ? -1.968  -18.375 1.973   1.00 76.65  ? 13  PHE A CZ  1 
ATOM   56   N  N   . VAL A 1 18 ? -5.349  -15.185 3.764   1.00 60.90  ? 14  VAL A N   1 
ATOM   57   C  CA  . VAL A 1 18 ? -6.336  -16.049 4.400   1.00 58.45  ? 14  VAL A CA  1 
ATOM   58   C  C   . VAL A 1 18 ? -6.419  -17.340 3.600   1.00 61.61  ? 14  VAL A C   1 
ATOM   59   O  O   . VAL A 1 18 ? -6.617  -17.309 2.384   1.00 68.03  ? 14  VAL A O   1 
ATOM   60   C  CB  . VAL A 1 18 ? -7.717  -15.368 4.513   1.00 54.33  ? 14  VAL A CB  1 
ATOM   61   C  CG1 . VAL A 1 18 ? -8.198  -14.826 3.165   1.00 53.05  ? 14  VAL A CG1 1 
ATOM   62   C  CG2 . VAL A 1 18 ? -8.732  -16.324 5.117   1.00 51.72  ? 14  VAL A CG2 1 
ATOM   63   N  N   . GLY A 1 19 ? -6.275  -18.476 4.282   1.00 65.37  ? 15  GLY A N   1 
ATOM   64   C  CA  . GLY A 1 19 ? -6.237  -19.766 3.636   1.00 75.15  ? 15  GLY A CA  1 
ATOM   65   C  C   . GLY A 1 19 ? -7.312  -20.716 4.137   1.00 80.52  ? 15  GLY A C   1 
ATOM   66   O  O   . GLY A 1 19 ? -8.181  -20.358 4.939   1.00 82.45  ? 15  GLY A O   1 
ATOM   67   N  N   . ASN A 1 20 ? -7.246  -21.943 3.608   1.00 86.62  ? 16  ASN A N   1 
ATOM   68   C  CA  . ASN A 1 20 ? -8.162  -23.030 3.960   1.00 89.61  ? 16  ASN A CA  1 
ATOM   69   C  C   . ASN A 1 20 ? -9.597  -22.686 3.566   1.00 83.08  ? 16  ASN A C   1 
ATOM   70   O  O   . ASN A 1 20 ? -10.551 -23.164 4.178   1.00 85.93  ? 16  ASN A O   1 
ATOM   71   C  CB  . ASN A 1 20 ? -8.075  -23.388 5.446   1.00 94.57  ? 16  ASN A CB  1 
ATOM   72   C  CG  . ASN A 1 20 ? -8.698  -24.731 5.761   1.00 99.85  ? 16  ASN A CG  1 
ATOM   73   O  OD1 . ASN A 1 20 ? -8.913  -25.561 4.876   1.00 103.67 ? 16  ASN A OD1 1 
ATOM   74   N  ND2 . ASN A 1 20 ? -8.986  -24.955 7.035   1.00 101.59 ? 16  ASN A ND2 1 
ATOM   75   N  N   . LEU A 1 21 ? -9.753  -21.861 2.537   1.00 76.29  ? 17  LEU A N   1 
ATOM   76   C  CA  . LEU A 1 21 ? -11.082 -21.443 2.119   1.00 71.08  ? 17  LEU A CA  1 
ATOM   77   C  C   . LEU A 1 21 ? -11.818 -22.607 1.472   1.00 74.58  ? 17  LEU A C   1 
ATOM   78   O  O   . LEU A 1 21 ? -11.229 -23.397 0.727   1.00 79.30  ? 17  LEU A O   1 
ATOM   79   C  CB  . LEU A 1 21 ? -10.984 -20.274 1.142   1.00 67.81  ? 17  LEU A CB  1 
ATOM   80   C  CG  . LEU A 1 21 ? -10.175 -19.089 1.666   1.00 66.26  ? 17  LEU A CG  1 
ATOM   81   C  CD1 . LEU A 1 21 ? -10.213 -17.941 0.679   1.00 66.55  ? 17  LEU A CD1 1 
ATOM   82   C  CD2 . LEU A 1 21 ? -10.662 -18.648 3.023   1.00 62.99  ? 17  LEU A CD2 1 
ATOM   83   N  N   . GLU A 1 22 ? -13.100 -22.739 1.787   1.00 75.77  ? 18  GLU A N   1 
ATOM   84   C  CA  . GLU A 1 22 ? -13.874 -23.772 1.124   1.00 80.70  ? 18  GLU A CA  1 
ATOM   85   C  C   . GLU A 1 22 ? -14.109 -23.330 -0.321  1.00 82.73  ? 18  GLU A C   1 
ATOM   86   O  O   . GLU A 1 22 ? -14.071 -22.139 -0.641  1.00 81.66  ? 18  GLU A O   1 
ATOM   87   C  CB  . GLU A 1 22 ? -15.182 -24.028 1.871   1.00 82.70  ? 18  GLU A CB  1 
ATOM   88   C  CG  . GLU A 1 22 ? -15.869 -25.346 1.512   1.00 91.97  ? 18  GLU A CG  1 
ATOM   89   C  CD  . GLU A 1 22 ? -16.842 -25.242 0.364   1.00 98.54  ? 18  GLU A CD  1 
ATOM   90   O  OE1 . GLU A 1 22 ? -17.274 -26.305 -0.127  1.00 104.46 ? 18  GLU A OE1 1 
ATOM   91   O  OE2 . GLU A 1 22 ? -17.179 -24.113 -0.045  1.00 99.74  ? 18  GLU A OE2 1 
ATOM   92   N  N   . THR A 1 23 ? -14.342 -24.307 -1.200  1.00 86.83  ? 19  THR A N   1 
ATOM   93   C  CA  . THR A 1 23 ? -14.373 -24.023 -2.633  1.00 89.26  ? 19  THR A CA  1 
ATOM   94   C  C   . THR A 1 23 ? -15.446 -23.001 -3.013  1.00 87.19  ? 19  THR A C   1 
ATOM   95   O  O   . THR A 1 23 ? -15.244 -22.217 -3.949  1.00 87.60  ? 19  THR A O   1 
ATOM   96   C  CB  . THR A 1 23 ? -14.557 -25.327 -3.418  1.00 95.40  ? 19  THR A CB  1 
ATOM   97   O  OG1 . THR A 1 23 ? -14.500 -25.061 -4.825  1.00 97.69  ? 19  THR A OG1 1 
ATOM   98   C  CG2 . THR A 1 23 ? -15.880 -25.998 -3.074  1.00 97.76  ? 19  THR A CG2 1 
ATOM   99   N  N   . LYS A 1 24 ? -16.570 -22.969 -2.294  1.00 85.70  ? 20  LYS A N   1 
ATOM   100  C  CA  . LYS A 1 24 ? -17.656 -22.052 -2.625  1.00 82.80  ? 20  LYS A CA  1 
ATOM   101  C  C   . LYS A 1 24 ? -17.375 -20.604 -2.228  1.00 75.99  ? 20  LYS A C   1 
ATOM   102  O  O   . LYS A 1 24 ? -18.101 -19.708 -2.677  1.00 74.62  ? 20  LYS A O   1 
ATOM   103  C  CB  . LYS A 1 24 ? -18.965 -22.516 -1.974  1.00 82.93  ? 20  LYS A CB  1 
ATOM   104  N  N   . VAL A 1 25 ? -16.381 -20.358 -1.370  1.00 71.77  ? 21  VAL A N   1 
ATOM   105  C  CA  . VAL A 1 25 ? -16.065 -18.996 -0.945  1.00 68.58  ? 21  VAL A CA  1 
ATOM   106  C  C   . VAL A 1 25 ? -15.720 -18.143 -2.162  1.00 70.99  ? 21  VAL A C   1 
ATOM   107  O  O   . VAL A 1 25 ? -14.985 -18.579 -3.057  1.00 77.81  ? 21  VAL A O   1 
ATOM   108  C  CB  . VAL A 1 25 ? -14.904 -19.008 0.064   1.00 67.63  ? 21  VAL A CB  1 
ATOM   109  C  CG1 . VAL A 1 25 ? -14.537 -17.590 0.483   1.00 64.42  ? 21  VAL A CG1 1 
ATOM   110  C  CG2 . VAL A 1 25 ? -15.230 -19.872 1.275   1.00 69.03  ? 21  VAL A CG2 1 
ATOM   111  N  N   . THR A 1 26 ? -16.257 -16.925 -2.209  1.00 69.64  ? 22  THR A N   1 
ATOM   112  C  CA  . THR A 1 26 ? -16.026 -16.016 -3.328  1.00 73.13  ? 22  THR A CA  1 
ATOM   113  C  C   . THR A 1 26 ? -15.336 -14.744 -2.846  1.00 75.82  ? 22  THR A C   1 
ATOM   114  O  O   . THR A 1 26 ? -15.223 -14.485 -1.645  1.00 75.02  ? 22  THR A O   1 
ATOM   115  C  CB  . THR A 1 26 ? -17.332 -15.651 -4.043  1.00 72.30  ? 22  THR A CB  1 
ATOM   116  O  OG1 . THR A 1 26 ? -18.229 -15.035 -3.114  1.00 70.07  ? 22  THR A OG1 1 
ATOM   117  C  CG2 . THR A 1 26 ? -17.988 -16.898 -4.615  1.00 74.50  ? 22  THR A CG2 1 
ATOM   118  N  N   . GLU A 1 27 ? -14.834 -13.966 -3.810  1.00 82.52  ? 23  GLU A N   1 
ATOM   119  C  CA  . GLU A 1 27 ? -14.206 -12.691 -3.477  1.00 83.18  ? 23  GLU A CA  1 
ATOM   120  C  C   . GLU A 1 27 ? -15.204 -11.734 -2.838  1.00 80.09  ? 23  GLU A C   1 
ATOM   121  O  O   . GLU A 1 27 ? -14.873 -11.038 -1.872  1.00 79.65  ? 23  GLU A O   1 
ATOM   122  C  CB  . GLU A 1 27 ? -13.598 -12.051 -4.724  1.00 91.83  ? 23  GLU A CB  1 
ATOM   123  C  CG  . GLU A 1 27 ? -12.420 -12.795 -5.319  1.00 98.13  ? 23  GLU A CG  1 
ATOM   124  C  CD  . GLU A 1 27 ? -11.846 -12.086 -6.542  1.00 106.79 ? 23  GLU A CD  1 
ATOM   125  O  OE1 . GLU A 1 27 ? -12.473 -11.110 -7.017  1.00 109.17 ? 23  GLU A OE1 1 
ATOM   126  O  OE2 . GLU A 1 27 ? -10.766 -12.502 -7.023  1.00 112.04 ? 23  GLU A OE2 1 
ATOM   127  N  N   . GLU A 1 28 ? -16.435 -11.687 -3.358  1.00 78.95  ? 24  GLU A N   1 
ATOM   128  C  CA  . GLU A 1 28 ? -17.445 -10.818 -2.761  1.00 75.94  ? 24  GLU A CA  1 
ATOM   129  C  C   . GLU A 1 28 ? -17.807 -11.274 -1.353  1.00 73.73  ? 24  GLU A C   1 
ATOM   130  O  O   . GLU A 1 28 ? -18.032 -10.443 -0.464  1.00 73.31  ? 24  GLU A O   1 
ATOM   131  C  CB  . GLU A 1 28 ? -18.690 -10.770 -3.644  1.00 78.05  ? 24  GLU A CB  1 
ATOM   132  N  N   . LEU A 1 29 ? -17.821 -12.588 -1.122  1.00 72.41  ? 25  LEU A N   1 
ATOM   133  C  CA  . LEU A 1 29 ? -18.131 -13.104 0.207   1.00 67.78  ? 25  LEU A CA  1 
ATOM   134  C  C   . LEU A 1 29 ? -17.092 -12.650 1.220   1.00 61.97  ? 25  LEU A C   1 
ATOM   135  O  O   . LEU A 1 29 ? -17.437 -12.155 2.298   1.00 59.27  ? 25  LEU A O   1 
ATOM   136  C  CB  . LEU A 1 29 ? -18.222 -14.627 0.175   1.00 70.17  ? 25  LEU A CB  1 
ATOM   137  C  CG  . LEU A 1 29 ? -18.788 -15.269 1.445   1.00 70.69  ? 25  LEU A CG  1 
ATOM   138  C  CD1 . LEU A 1 29 ? -20.278 -14.974 1.586   1.00 73.52  ? 25  LEU A CD1 1 
ATOM   139  C  CD2 . LEU A 1 29 ? -18.515 -16.773 1.489   1.00 71.88  ? 25  LEU A CD2 1 
ATOM   140  N  N   . LEU A 1 30 ? -15.809 -12.788 0.881   1.00 63.03  ? 26  LEU A N   1 
ATOM   141  C  CA  . LEU A 1 30 ? -14.762 -12.361 1.802   1.00 58.49  ? 26  LEU A CA  1 
ATOM   142  C  C   . LEU A 1 30 ? -14.780 -10.854 1.998   1.00 54.76  ? 26  LEU A C   1 
ATOM   143  O  O   . LEU A 1 30 ? -14.527 -10.366 3.106   1.00 50.87  ? 26  LEU A O   1 
ATOM   144  C  CB  . LEU A 1 30 ? -13.398 -12.820 1.300   1.00 59.29  ? 26  LEU A CB  1 
ATOM   145  C  CG  . LEU A 1 30 ? -13.231 -14.327 1.460   1.00 61.87  ? 26  LEU A CG  1 
ATOM   146  C  CD1 . LEU A 1 30 ? -11.970 -14.810 0.777   1.00 65.21  ? 26  LEU A CD1 1 
ATOM   147  C  CD2 . LEU A 1 30 ? -13.250 -14.692 2.933   1.00 60.86  ? 26  LEU A CD2 1 
ATOM   148  N  N   . PHE A 1 31 ? -15.074 -10.104 0.935   1.00 60.00  ? 27  PHE A N   1 
ATOM   149  C  CA  . PHE A 1 31 ? -15.213 -8.659  1.057   1.00 67.71  ? 27  PHE A CA  1 
ATOM   150  C  C   . PHE A 1 31 ? -16.196 -8.304  2.164   1.00 70.61  ? 27  PHE A C   1 
ATOM   151  O  O   . PHE A 1 31 ? -15.857 -7.579  3.105   1.00 70.21  ? 27  PHE A O   1 
ATOM   152  C  CB  . PHE A 1 31 ? -15.660 -8.061  -0.277  1.00 73.67  ? 27  PHE A CB  1 
ATOM   153  C  CG  . PHE A 1 31 ? -15.544 -6.565  -0.341  1.00 77.26  ? 27  PHE A CG  1 
ATOM   154  C  CD1 . PHE A 1 31 ? -16.512 -5.756  0.224   1.00 79.37  ? 27  PHE A CD1 1 
ATOM   155  C  CD2 . PHE A 1 31 ? -14.458 -5.968  -0.961  1.00 80.52  ? 27  PHE A CD2 1 
ATOM   156  C  CE1 . PHE A 1 31 ? -16.405 -4.381  0.169   1.00 82.54  ? 27  PHE A CE1 1 
ATOM   157  C  CE2 . PHE A 1 31 ? -14.345 -4.593  -1.019  1.00 84.13  ? 27  PHE A CE2 1 
ATOM   158  C  CZ  . PHE A 1 31 ? -15.322 -3.798  -0.452  1.00 84.02  ? 27  PHE A CZ  1 
ATOM   159  N  N   . GLU A 1 32 ? -17.425 -8.819  2.062   1.00 77.38  ? 28  GLU A N   1 
ATOM   160  C  CA  . GLU A 1 32 ? -18.436 -8.523  3.070   1.00 75.23  ? 28  GLU A CA  1 
ATOM   161  C  C   . GLU A 1 32 ? -18.004 -8.977  4.459   1.00 63.25  ? 28  GLU A C   1 
ATOM   162  O  O   . GLU A 1 32 ? -18.242 -8.278  5.451   1.00 61.65  ? 28  GLU A O   1 
ATOM   163  C  CB  . GLU A 1 32 ? -19.762 -9.183  2.699   1.00 81.19  ? 28  GLU A CB  1 
ATOM   164  C  CG  . GLU A 1 32 ? -20.863 -8.849  3.673   1.00 89.79  ? 28  GLU A CG  1 
ATOM   165  C  CD  . GLU A 1 32 ? -22.144 -9.604  3.394   1.00 97.89  ? 28  GLU A CD  1 
ATOM   166  O  OE1 . GLU A 1 32 ? -22.136 -10.499 2.520   1.00 102.32 ? 28  GLU A OE1 1 
ATOM   167  O  OE2 . GLU A 1 32 ? -23.158 -9.300  4.057   1.00 98.76  ? 28  GLU A OE2 1 
ATOM   168  N  N   . LEU A 1 33 ? -17.368 -10.145 4.552   1.00 58.08  ? 29  LEU A N   1 
ATOM   169  C  CA  . LEU A 1 33 ? -16.971 -10.671 5.855   1.00 54.24  ? 29  LEU A CA  1 
ATOM   170  C  C   . LEU A 1 33 ? -15.906 -9.802  6.507   1.00 59.31  ? 29  LEU A C   1 
ATOM   171  O  O   . LEU A 1 33 ? -16.055 -9.385  7.660   1.00 66.61  ? 29  LEU A O   1 
ATOM   172  C  CB  . LEU A 1 33 ? -16.481 -12.111 5.709   1.00 51.41  ? 29  LEU A CB  1 
ATOM   173  C  CG  . LEU A 1 33 ? -15.985 -12.745 7.001   1.00 32.73  ? 29  LEU A CG  1 
ATOM   174  C  CD1 . LEU A 1 33 ? -17.091 -12.744 8.038   1.00 65.49  ? 29  LEU A CD1 1 
ATOM   175  C  CD2 . LEU A 1 33 ? -15.520 -14.167 6.738   1.00 33.43  ? 29  LEU A CD2 1 
ATOM   176  N  N   . PHE A 1 34 ? -14.830 -9.504  5.781   1.00 57.50  ? 30  PHE A N   1 
ATOM   177  C  CA  . PHE A 1 34 ? -13.757 -8.707  6.360   1.00 53.37  ? 30  PHE A CA  1 
ATOM   178  C  C   . PHE A 1 34 ? -14.123 -7.232  6.445   1.00 52.27  ? 30  PHE A C   1 
ATOM   179  O  O   . PHE A 1 34 ? -13.467 -6.483  7.179   1.00 49.29  ? 30  PHE A O   1 
ATOM   180  C  CB  . PHE A 1 34 ? -12.469 -8.907  5.559   1.00 48.52  ? 30  PHE A CB  1 
ATOM   181  C  CG  . PHE A 1 34 ? -11.786 -10.204 5.856   1.00 40.89  ? 30  PHE A CG  1 
ATOM   182  C  CD1 . PHE A 1 34 ? -12.136 -11.357 5.167   1.00 37.17  ? 30  PHE A CD1 1 
ATOM   183  C  CD2 . PHE A 1 34 ? -10.817 -10.281 6.844   1.00 38.89  ? 30  PHE A CD2 1 
ATOM   184  C  CE1 . PHE A 1 34 ? -11.519 -12.562 5.447   1.00 36.53  ? 30  PHE A CE1 1 
ATOM   185  C  CE2 . PHE A 1 34 ? -10.201 -11.484 7.134   1.00 38.42  ? 30  PHE A CE2 1 
ATOM   186  C  CZ  . PHE A 1 34 ? -10.554 -12.627 6.431   1.00 37.47  ? 30  PHE A CZ  1 
ATOM   187  N  N   . HIS A 1 35 ? -15.161 -6.809  5.717   1.00 55.19  ? 31  HIS A N   1 
ATOM   188  C  CA  . HIS A 1 35 ? -15.679 -5.459  5.883   1.00 65.10  ? 31  HIS A CA  1 
ATOM   189  C  C   . HIS A 1 35 ? -16.143 -5.210  7.314   1.00 68.13  ? 31  HIS A C   1 
ATOM   190  O  O   . HIS A 1 35 ? -16.153 -4.058  7.758   1.00 67.81  ? 31  HIS A O   1 
ATOM   191  C  CB  . HIS A 1 35 ? -16.836 -5.219  4.911   1.00 71.41  ? 31  HIS A CB  1 
ATOM   192  C  CG  . HIS A 1 35 ? -16.919 -3.816  4.402   1.00 77.38  ? 31  HIS A CG  1 
ATOM   193  N  ND1 . HIS A 1 35 ? -15.844 -3.173  3.830   1.00 80.58  ? 31  HIS A ND1 1 
ATOM   194  C  CD2 . HIS A 1 35 ? -17.949 -2.937  4.366   1.00 82.35  ? 31  HIS A CD2 1 
ATOM   195  C  CE1 . HIS A 1 35 ? -16.202 -1.954  3.471   1.00 86.37  ? 31  HIS A CE1 1 
ATOM   196  N  NE2 . HIS A 1 35 ? -17.475 -1.785  3.784   1.00 87.65  ? 31  HIS A NE2 1 
ATOM   197  N  N   . GLN A 1 36 ? -16.488 -6.270  8.053   1.00 67.87  ? 32  GLN A N   1 
ATOM   198  C  CA  . GLN A 1 36 ? -16.859 -6.132  9.459   1.00 64.21  ? 32  GLN A CA  1 
ATOM   199  C  C   . GLN A 1 36 ? -15.680 -5.676  10.309  1.00 63.88  ? 32  GLN A C   1 
ATOM   200  O  O   . GLN A 1 36 ? -15.868 -4.934  11.281  1.00 65.97  ? 32  GLN A O   1 
ATOM   201  C  CB  . GLN A 1 36 ? -17.391 -7.460  9.991   1.00 61.42  ? 32  GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 36 ? -18.715 -7.894  9.390   1.00 63.93  ? 32  GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 36 ? -19.874 -7.069  9.895   1.00 68.74  ? 32  GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 36 ? -20.188 -7.088  11.089  1.00 66.97  ? 32  GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 36 ? -20.515 -6.331  8.994   1.00 73.88  ? 32  GLN A NE2 1 
ATOM   206  N  N   . ALA A 1 37 ? -14.465 -6.106  9.959   1.00 61.57  ? 33  ALA A N   1 
ATOM   207  C  CA  . ALA A 1 37 ? -13.274 -5.761  10.721  1.00 56.60  ? 33  ALA A CA  1 
ATOM   208  C  C   . ALA A 1 37 ? -12.712 -4.401  10.342  1.00 58.10  ? 33  ALA A C   1 
ATOM   209  O  O   . ALA A 1 37 ? -11.988 -3.801  11.143  1.00 64.93  ? 33  ALA A O   1 
ATOM   210  C  CB  . ALA A 1 37 ? -12.197 -6.827  10.520  1.00 54.72  ? 33  ALA A CB  1 
ATOM   211  N  N   . GLY A 1 38 ? -13.014 -3.917  9.142   1.00 56.22  ? 34  GLY A N   1 
ATOM   212  C  CA  . GLY A 1 38 ? -12.580 -2.612  8.711   1.00 58.86  ? 34  GLY A CA  1 
ATOM   213  C  C   . GLY A 1 38 ? -12.813 -2.423  7.228   1.00 59.47  ? 34  GLY A C   1 
ATOM   214  O  O   . GLY A 1 38 ? -13.069 -3.385  6.493   1.00 61.79  ? 34  GLY A O   1 
ATOM   215  N  N   . PRO A 1 39 ? -12.780 -1.172  6.769   1.00 58.18  ? 35  PRO A N   1 
ATOM   216  C  CA  . PRO A 1 39 ? -12.998 -0.907  5.344   1.00 61.23  ? 35  PRO A CA  1 
ATOM   217  C  C   . PRO A 1 39 ? -12.027 -1.716  4.501   1.00 61.42  ? 35  PRO A C   1 
ATOM   218  O  O   . PRO A 1 39 ? -10.812 -1.680  4.709   1.00 62.37  ? 35  PRO A O   1 
ATOM   219  C  CB  . PRO A 1 39 ? -12.745 0.601   5.218   1.00 53.53  ? 35  PRO A CB  1 
ATOM   220  C  CG  . PRO A 1 39 ? -13.102 1.130   6.552   1.00 62.88  ? 35  PRO A CG  1 
ATOM   221  C  CD  . PRO A 1 39 ? -12.667 0.073   7.548   1.00 58.00  ? 35  PRO A CD  1 
ATOM   222  N  N   . VAL A 1 40 ? -12.575 -2.474  3.565   1.00 47.23  ? 36  VAL A N   1 
ATOM   223  C  CA  . VAL A 1 40 ? -11.794 -3.309  2.665   1.00 90.90  ? 36  VAL A CA  1 
ATOM   224  C  C   . VAL A 1 40 ? -11.739 -2.636  1.304   1.00 95.75  ? 36  VAL A C   1 
ATOM   225  O  O   . VAL A 1 40 ? -12.750 -2.117  0.812   1.00 98.04  ? 36  VAL A O   1 
ATOM   226  C  CB  . VAL A 1 40 ? -12.397 -4.724  2.565   1.00 44.03  ? 36  VAL A CB  1 
ATOM   227  C  CG1 . VAL A 1 40 ? -11.719 -5.529  1.470   1.00 66.01  ? 36  VAL A CG1 1 
ATOM   228  C  CG2 . VAL A 1 40 ? -12.268 -5.438  3.910   1.00 56.52  ? 36  VAL A CG2 1 
ATOM   229  N  N   . ILE A 1 41 ? -10.562 -2.660  0.683   1.00 91.10  ? 37  ILE A N   1 
ATOM   230  C  CA  . ILE A 1 41 ? -10.412 -2.116  -0.661  1.00 97.40  ? 37  ILE A CA  1 
ATOM   231  C  C   . ILE A 1 41 ? -10.761 -3.160  -1.704  1.00 95.80  ? 37  ILE A C   1 
ATOM   232  O  O   . ILE A 1 41 ? -11.619 -2.936  -2.561  1.00 102.45 ? 37  ILE A O   1 
ATOM   233  C  CB  . ILE A 1 41 ? -8.977  -1.589  -0.876  1.00 100.10 ? 37  ILE A CB  1 
ATOM   234  C  CG1 . ILE A 1 41 ? -8.687  -0.398  0.036   1.00 107.37 ? 37  ILE A CG1 1 
ATOM   235  C  CG2 . ILE A 1 41 ? -8.762  -1.231  -2.342  1.00 105.25 ? 37  ILE A CG2 1 
ATOM   236  C  CD1 . ILE A 1 41 ? -7.258  0.090   -0.067  1.00 115.53 ? 37  ILE A CD1 1 
ATOM   237  N  N   . LYS A 1 42 ? -10.134 -4.327  -1.613  1.00 84.57  ? 38  LYS A N   1 
ATOM   238  C  CA  . LYS A 1 42 ? -10.361 -5.380  -2.587  1.00 82.79  ? 38  LYS A CA  1 
ATOM   239  C  C   . LYS A 1 42 ? -10.011 -6.713  -1.950  1.00 71.91  ? 38  LYS A C   1 
ATOM   240  O  O   . LYS A 1 42 ? -9.273  -6.780  -0.961  1.00 66.84  ? 38  LYS A O   1 
ATOM   241  C  CB  . LYS A 1 42 ? -9.539  -5.156  -3.862  1.00 94.65  ? 38  LYS A CB  1 
ATOM   242  N  N   . VAL A 1 43 ? -10.589 -7.769  -2.511  1.00 69.62  ? 39  VAL A N   1 
ATOM   243  C  CA  . VAL A 1 43 ? -10.237 -9.141  -2.178  1.00 66.29  ? 39  VAL A CA  1 
ATOM   244  C  C   . VAL A 1 43 ? -9.954  -9.864  -3.481  1.00 71.18  ? 39  VAL A C   1 
ATOM   245  O  O   . VAL A 1 43 ? -10.775 -9.832  -4.404  1.00 76.99  ? 39  VAL A O   1 
ATOM   246  C  CB  . VAL A 1 43 ? -11.352 -9.854  -1.387  1.00 62.08  ? 39  VAL A CB  1 
ATOM   247  C  CG1 . VAL A 1 43 ? -10.988 -11.314 -1.155  1.00 63.54  ? 39  VAL A CG1 1 
ATOM   248  C  CG2 . VAL A 1 43 ? -11.589 -9.146  -0.051  1.00 59.02  ? 39  VAL A CG2 1 
ATOM   249  N  N   . LYS A 1 44 ? -8.797  -10.511 -3.557  1.00 70.29  ? 40  LYS A N   1 
ATOM   250  C  CA  . LYS A 1 44 ? -8.380  -11.227 -4.751  1.00 73.57  ? 40  LYS A CA  1 
ATOM   251  C  C   . LYS A 1 44 ? -8.129  -12.676 -4.377  1.00 70.23  ? 40  LYS A C   1 
ATOM   252  O  O   . LYS A 1 44 ? -7.459  -12.960 -3.379  1.00 68.21  ? 40  LYS A O   1 
ATOM   253  C  CB  . LYS A 1 44 ? -7.118  -10.609 -5.362  1.00 76.98  ? 40  LYS A CB  1 
ATOM   254  N  N   . ILE A 1 45 ? -8.676  -13.583 -5.175  1.00 69.73  ? 41  ILE A N   1 
ATOM   255  C  CA  . ILE A 1 45 ? -8.398  -15.008 -5.060  1.00 70.54  ? 41  ILE A CA  1 
ATOM   256  C  C   . ILE A 1 45 ? -7.569  -15.403 -6.280  1.00 83.16  ? 41  ILE A C   1 
ATOM   257  O  O   . ILE A 1 45 ? -8.088  -15.402 -7.407  1.00 89.97  ? 41  ILE A O   1 
ATOM   258  C  CB  . ILE A 1 45 ? -9.691  -15.826 -4.958  1.00 63.94  ? 41  ILE A CB  1 
ATOM   259  C  CG1 . ILE A 1 45 ? -10.457 -15.426 -3.695  1.00 60.67  ? 41  ILE A CG1 1 
ATOM   260  C  CG2 . ILE A 1 45 ? -9.383  -17.316 -4.976  1.00 63.79  ? 41  ILE A CG2 1 
ATOM   261  C  CD1 . ILE A 1 45 ? -11.776 -16.136 -3.513  1.00 61.41  ? 41  ILE A CD1 1 
ATOM   262  N  N   . PRO A 1 46 ? -6.292  -15.733 -6.115  1.00 84.76  ? 42  PRO A N   1 
ATOM   263  C  CA  . PRO A 1 46 ? -5.433  -15.967 -7.277  1.00 90.65  ? 42  PRO A CA  1 
ATOM   264  C  C   . PRO A 1 46 ? -5.810  -17.247 -8.012  1.00 98.27  ? 42  PRO A C   1 
ATOM   265  O  O   . PRO A 1 46 ? -6.511  -18.118 -7.492  1.00 97.17  ? 42  PRO A O   1 
ATOM   266  C  CB  . PRO A 1 46 ? -4.031  -16.063 -6.667  1.00 89.23  ? 42  PRO A CB  1 
ATOM   267  C  CG  . PRO A 1 46 ? -4.148  -15.451 -5.300  1.00 84.09  ? 42  PRO A CG  1 
ATOM   268  C  CD  . PRO A 1 46 ? -5.534  -15.748 -4.854  1.00 81.89  ? 42  PRO A CD  1 
ATOM   269  N  N   . LYS A 1 47 ? -5.335  -17.337 -9.253  1.00 103.69 ? 43  LYS A N   1 
ATOM   270  C  CA  . LYS A 1 47 ? -5.680  -18.414 -10.168 1.00 104.74 ? 43  LYS A CA  1 
ATOM   271  C  C   . LYS A 1 47 ? -4.560  -19.445 -10.248 1.00 110.37 ? 43  LYS A C   1 
ATOM   272  O  O   . LYS A 1 47 ? -3.425  -19.204 -9.829  1.00 111.15 ? 43  LYS A O   1 
ATOM   273  C  CB  . LYS A 1 47 ? -5.968  -17.858 -11.564 1.00 108.69 ? 43  LYS A CB  1 
ATOM   274  N  N   . ASP A 1 48 ? -4.893  -20.599 -10.813 1.00 116.83 ? 44  ASP A N   1 
ATOM   275  C  CA  . ASP A 1 48 ? -3.937  -21.680 -10.983 1.00 123.84 ? 44  ASP A CA  1 
ATOM   276  C  C   . ASP A 1 48 ? -3.371  -21.643 -12.401 1.00 130.47 ? 44  ASP A C   1 
ATOM   277  O  O   . ASP A 1 48 ? -3.612  -20.706 -13.170 1.00 131.14 ? 44  ASP A O   1 
ATOM   278  C  CB  . ASP A 1 48 ? -4.595  -23.021 -10.666 1.00 124.78 ? 44  ASP A CB  1 
ATOM   279  N  N   . LYS A 1 49 ? -2.604  -22.674 -12.760 1.00 136.56 ? 45  LYS A N   1 
ATOM   280  C  CA  . LYS A 1 49 ? -2.048  -22.759 -14.104 1.00 144.93 ? 45  LYS A CA  1 
ATOM   281  C  C   . LYS A 1 49 ? -3.115  -23.027 -15.158 1.00 150.27 ? 45  LYS A C   1 
ATOM   282  O  O   . LYS A 1 49 ? -2.887  -22.742 -16.338 1.00 154.22 ? 45  LYS A O   1 
ATOM   283  C  CB  . LYS A 1 49 ? -0.973  -23.848 -14.166 1.00 148.10 ? 45  LYS A CB  1 
ATOM   284  N  N   . ASP A 1 50 ? -4.265  -23.573 -14.765 1.00 150.00 ? 46  ASP A N   1 
ATOM   285  C  CA  . ASP A 1 50 ? -5.382  -23.798 -15.674 1.00 149.97 ? 46  ASP A CA  1 
ATOM   286  C  C   . ASP A 1 50 ? -6.529  -22.833 -15.408 1.00 143.66 ? 46  ASP A C   1 
ATOM   287  O  O   . ASP A 1 50 ? -7.663  -23.088 -15.823 1.00 145.83 ? 46  ASP A O   1 
ATOM   288  C  CB  . ASP A 1 50 ? -5.868  -25.244 -15.570 1.00 151.57 ? 46  ASP A CB  1 
ATOM   289  N  N   . GLY A 1 51 ? -6.252  -21.727 -14.721 1.00 136.83 ? 47  GLY A N   1 
ATOM   290  C  CA  . GLY A 1 51 ? -7.279  -20.770 -14.375 1.00 131.16 ? 47  GLY A CA  1 
ATOM   291  C  C   . GLY A 1 51 ? -8.108  -21.136 -13.166 1.00 123.53 ? 47  GLY A C   1 
ATOM   292  O  O   . GLY A 1 51 ? -9.096  -20.449 -12.879 1.00 120.45 ? 47  GLY A O   1 
ATOM   293  N  N   . LYS A 1 52 ? -7.738  -22.193 -12.444 1.00 119.99 ? 48  LYS A N   1 
ATOM   294  C  CA  . LYS A 1 52 ? -8.512  -22.607 -11.284 1.00 109.67 ? 48  LYS A CA  1 
ATOM   295  C  C   . LYS A 1 52 ? -8.259  -21.662 -10.110 1.00 106.15 ? 48  LYS A C   1 
ATOM   296  O  O   . LYS A 1 52 ? -7.115  -21.278 -9.858  1.00 106.30 ? 48  LYS A O   1 
ATOM   297  C  CB  . LYS A 1 52 ? -8.148  -24.032 -10.879 1.00 106.62 ? 48  LYS A CB  1 
ATOM   298  N  N   . PRO A 1 53 ? -9.305  -21.265 -9.389  1.00 102.36 ? 49  PRO A N   1 
ATOM   299  C  CA  . PRO A 1 53 ? -9.104  -20.449 -8.187  1.00 94.32  ? 49  PRO A CA  1 
ATOM   300  C  C   . PRO A 1 53 ? -8.319  -21.218 -7.135  1.00 94.83  ? 49  PRO A C   1 
ATOM   301  O  O   . PRO A 1 53 ? -8.512  -22.422 -6.946  1.00 96.31  ? 49  PRO A O   1 
ATOM   302  C  CB  . PRO A 1 53 ? -10.533 -20.146 -7.717  1.00 89.43  ? 49  PRO A CB  1 
ATOM   303  C  CG  . PRO A 1 53 ? -11.419 -20.463 -8.894  1.00 93.15  ? 49  PRO A CG  1 
ATOM   304  C  CD  . PRO A 1 53 ? -10.726 -21.563 -9.623  1.00 101.36 ? 49  PRO A CD  1 
ATOM   305  N  N   . LYS A 1 54 ? -7.388  -20.528 -6.484  1.00 97.18  ? 50  LYS A N   1 
ATOM   306  C  CA  . LYS A 1 54 ? -6.656  -21.158 -5.401  1.00 98.90  ? 50  LYS A CA  1 
ATOM   307  C  C   . LYS A 1 54 ? -7.519  -21.216 -4.145  1.00 95.22  ? 50  LYS A C   1 
ATOM   308  O  O   . LYS A 1 54 ? -8.612  -20.648 -4.075  1.00 89.54  ? 50  LYS A O   1 
ATOM   309  C  CB  . LYS A 1 54 ? -5.361  -20.406 -5.102  1.00 99.36  ? 50  LYS A CB  1 
ATOM   310  C  CG  . LYS A 1 54 ? -4.279  -20.608 -6.136  1.00 106.06 ? 50  LYS A CG  1 
ATOM   311  C  CD  . LYS A 1 54 ? -3.788  -22.042 -6.181  1.00 112.30 ? 50  LYS A CD  1 
ATOM   312  C  CE  . LYS A 1 54 ? -2.630  -22.196 -7.158  1.00 120.61 ? 50  LYS A CE  1 
ATOM   313  N  NZ  . LYS A 1 54 ? -1.383  -21.530 -6.676  1.00 122.45 ? 50  LYS A NZ  1 
ATOM   314  N  N   . GLN A 1 55 ? -7.005  -21.918 -3.138  1.00 99.51  ? 51  GLN A N   1 
ATOM   315  C  CA  . GLN A 1 55 ? -7.718  -22.119 -1.888  1.00 95.06  ? 51  GLN A CA  1 
ATOM   316  C  C   . GLN A 1 55 ? -7.402  -21.033 -0.863  1.00 88.51  ? 51  GLN A C   1 
ATOM   317  O  O   . GLN A 1 55 ? -7.701  -21.210 0.322   1.00 86.27  ? 51  GLN A O   1 
ATOM   318  C  CB  . GLN A 1 55 ? -7.400  -23.506 -1.314  1.00 99.80  ? 51  GLN A CB  1 
ATOM   319  N  N   . PHE A 1 56 ? -6.780  -19.932 -1.288  1.00 79.78  ? 52  PHE A N   1 
ATOM   320  C  CA  . PHE A 1 56 ? -6.452  -18.816 -0.409  1.00 71.49  ? 52  PHE A CA  1 
ATOM   321  C  C   . PHE A 1 56 ? -6.786  -17.505 -1.113  1.00 70.44  ? 52  PHE A C   1 
ATOM   322  O  O   . PHE A 1 56 ? -7.063  -17.472 -2.314  1.00 76.19  ? 52  PHE A O   1 
ATOM   323  C  CB  . PHE A 1 56 ? -4.983  -18.850 0.030   1.00 73.19  ? 52  PHE A CB  1 
ATOM   324  C  CG  . PHE A 1 56 ? -4.008  -18.969 -1.105  1.00 77.66  ? 52  PHE A CG  1 
ATOM   325  C  CD1 . PHE A 1 56 ? -3.478  -17.835 -1.695  1.00 77.51  ? 52  PHE A CD1 1 
ATOM   326  C  CD2 . PHE A 1 56 ? -3.619  -20.213 -1.580  1.00 78.90  ? 52  PHE A CD2 1 
ATOM   327  C  CE1 . PHE A 1 56 ? -2.579  -17.933 -2.734  1.00 80.33  ? 52  PHE A CE1 1 
ATOM   328  C  CE2 . PHE A 1 56 ? -2.726  -20.320 -2.618  1.00 82.93  ? 52  PHE A CE2 1 
ATOM   329  C  CZ  . PHE A 1 56 ? -2.202  -19.177 -3.198  1.00 84.48  ? 52  PHE A CZ  1 
ATOM   330  N  N   . ALA A 1 57 ? -6.768  -16.414 -0.347  1.00 68.41  ? 53  ALA A N   1 
ATOM   331  C  CA  . ALA A 1 57 ? -7.129  -15.104 -0.876  1.00 63.50  ? 53  ALA A CA  1 
ATOM   332  C  C   . ALA A 1 57 ? -6.291  -14.023 -0.207  1.00 60.54  ? 53  ALA A C   1 
ATOM   333  O  O   . ALA A 1 57 ? -5.768  -14.205 0.897   1.00 62.09  ? 53  ALA A O   1 
ATOM   334  C  CB  . ALA A 1 57 ? -8.624  -14.815 -0.673  1.00 59.37  ? 53  ALA A CB  1 
ATOM   335  N  N   . PHE A 1 58 ? -6.168  -12.886 -0.892  1.00 59.62  ? 54  PHE A N   1 
ATOM   336  C  CA  . PHE A 1 58 ? -5.520  -11.702 -0.343  1.00 61.13  ? 54  PHE A CA  1 
ATOM   337  C  C   . PHE A 1 58 ? -6.594  -10.664 -0.048  1.00 60.24  ? 54  PHE A C   1 
ATOM   338  O  O   . PHE A 1 58 ? -7.341  -10.267 -0.949  1.00 64.96  ? 54  PHE A O   1 
ATOM   339  C  CB  . PHE A 1 58 ? -4.490  -11.133 -1.317  1.00 65.08  ? 54  PHE A CB  1 
ATOM   340  C  CG  . PHE A 1 58 ? -3.358  -12.063 -1.611  1.00 72.14  ? 54  PHE A CG  1 
ATOM   341  C  CD1 . PHE A 1 58 ? -2.380  -12.312 -0.663  1.00 72.90  ? 54  PHE A CD1 1 
ATOM   342  C  CD2 . PHE A 1 58 ? -3.257  -12.676 -2.851  1.00 79.24  ? 54  PHE A CD2 1 
ATOM   343  C  CE1 . PHE A 1 58 ? -1.342  -13.176 -0.937  1.00 78.64  ? 54  PHE A CE1 1 
ATOM   344  C  CE2 . PHE A 1 58 ? -2.212  -13.537 -3.134  1.00 83.06  ? 54  PHE A CE2 1 
ATOM   345  C  CZ  . PHE A 1 58 ? -1.257  -13.790 -2.175  1.00 84.00  ? 54  PHE A CZ  1 
ATOM   346  N  N   . VAL A 1 59 ? -6.659  -10.218 1.204   1.00 55.52  ? 55  VAL A N   1 
ATOM   347  C  CA  . VAL A 1 59 ? -7.577  -9.166  1.622   1.00 55.98  ? 55  VAL A CA  1 
ATOM   348  C  C   . VAL A 1 59 ? -6.753  -7.919  1.882   1.00 55.11  ? 55  VAL A C   1 
ATOM   349  O  O   . VAL A 1 59 ? -5.894  -7.908  2.773   1.00 54.15  ? 55  VAL A O   1 
ATOM   350  C  CB  . VAL A 1 59 ? -8.373  -9.564  2.873   1.00 55.52  ? 55  VAL A CB  1 
ATOM   351  C  CG1 . VAL A 1 59 ? -9.144  -8.368  3.421   1.00 56.86  ? 55  VAL A CG1 1 
ATOM   352  C  CG2 . VAL A 1 59 ? -9.327  -10.704 2.545   1.00 53.57  ? 55  VAL A CG2 1 
ATOM   353  N  N   . ASN A 1 60 ? -7.042  -6.862  1.137   1.00 57.69  ? 56  ASN A N   1 
ATOM   354  C  CA  . ASN A 1 60 ? -6.304  -5.611  1.226   1.00 63.77  ? 56  ASN A CA  1 
ATOM   355  C  C   . ASN A 1 60 ? -7.185  -4.589  1.926   1.00 61.05  ? 56  ASN A C   1 
ATOM   356  O  O   . ASN A 1 60 ? -8.280  -4.278  1.445   1.00 60.80  ? 56  ASN A O   1 
ATOM   357  C  CB  . ASN A 1 60 ? -5.881  -5.114  -0.158  1.00 70.50  ? 56  ASN A CB  1 
ATOM   358  N  N   . PHE A 1 61 ? -6.719  -4.095  3.065   1.00 60.42  ? 57  PHE A N   1 
ATOM   359  C  CA  . PHE A 1 61 ? -7.465  -3.127  3.849   1.00 64.90  ? 57  PHE A CA  1 
ATOM   360  C  C   . PHE A 1 61 ? -7.051  -1.709  3.480   1.00 71.37  ? 57  PHE A C   1 
ATOM   361  O  O   . PHE A 1 61 ? -5.982  -1.473  2.916   1.00 78.65  ? 57  PHE A O   1 
ATOM   362  C  CB  . PHE A 1 61 ? -7.259  -3.364  5.343   1.00 66.45  ? 57  PHE A CB  1 
ATOM   363  C  CG  . PHE A 1 61 ? -8.049  -4.512  5.885   1.00 67.87  ? 57  PHE A CG  1 
ATOM   364  C  CD1 . PHE A 1 61 ? -9.406  -4.380  6.128   1.00 71.45  ? 57  PHE A CD1 1 
ATOM   365  C  CD2 . PHE A 1 61 ? -7.436  -5.721  6.162   1.00 67.53  ? 57  PHE A CD2 1 
ATOM   366  C  CE1 . PHE A 1 61 ? -10.138 -5.436  6.636   1.00 71.68  ? 57  PHE A CE1 1 
ATOM   367  C  CE2 . PHE A 1 61 ? -8.157  -6.779  6.667   1.00 68.48  ? 57  PHE A CE2 1 
ATOM   368  C  CZ  . PHE A 1 61 ? -9.515  -6.639  6.904   1.00 70.04  ? 57  PHE A CZ  1 
ATOM   369  N  N   . LYS A 1 62 ? -7.933  -0.761  3.795   1.00 73.72  ? 58  LYS A N   1 
ATOM   370  C  CA  . LYS A 1 62 ? -7.623  0.648   3.584   1.00 76.52  ? 58  LYS A CA  1 
ATOM   371  C  C   . LYS A 1 62 ? -6.539  1.136   4.541   1.00 81.08  ? 58  LYS A C   1 
ATOM   372  O  O   . LYS A 1 62 ? -5.739  2.008   4.179   1.00 92.37  ? 58  LYS A O   1 
ATOM   373  C  CB  . LYS A 1 62 ? -8.899  1.480   3.736   1.00 78.06  ? 58  LYS A CB  1 
ATOM   374  C  CG  . LYS A 1 62 ? -8.767  2.948   3.367   1.00 84.21  ? 58  LYS A CG  1 
ATOM   375  C  CD  . LYS A 1 62 ? -10.113 3.641   3.481   1.00 87.69  ? 58  LYS A CD  1 
ATOM   376  C  CE  . LYS A 1 62 ? -9.989  5.136   3.243   1.00 96.29  ? 58  LYS A CE  1 
ATOM   377  N  NZ  . LYS A 1 62 ? -11.256 5.840   3.596   1.00 97.59  ? 58  LYS A NZ  1 
ATOM   378  N  N   . HIS A 1 63 ? -6.512  0.611   5.765   1.00 77.78  ? 59  HIS A N   1 
ATOM   379  C  CA  . HIS A 1 63 ? -5.570  1.031   6.791   1.00 88.43  ? 59  HIS A CA  1 
ATOM   380  C  C   . HIS A 1 63 ? -4.904  -0.187  7.416   1.00 92.59  ? 59  HIS A C   1 
ATOM   381  O  O   . HIS A 1 63 ? -5.512  -1.253  7.539   1.00 86.42  ? 59  HIS A O   1 
ATOM   382  C  CB  . HIS A 1 63 ? -6.250  1.871   7.872   1.00 95.94  ? 59  HIS A CB  1 
ATOM   383  C  CG  . HIS A 1 63 ? -6.990  3.055   7.333   1.00 101.75 ? 59  HIS A CG  1 
ATOM   384  N  ND1 . HIS A 1 63 ? -6.406  3.974   6.489   1.00 104.45 ? 59  HIS A ND1 1 
ATOM   385  C  CD2 . HIS A 1 63 ? -8.269  3.464   7.512   1.00 101.89 ? 59  HIS A CD2 1 
ATOM   386  C  CE1 . HIS A 1 63 ? -7.292  4.902   6.174   1.00 106.84 ? 59  HIS A CE1 1 
ATOM   387  N  NE2 . HIS A 1 63 ? -8.429  4.615   6.782   1.00 105.19 ? 59  HIS A NE2 1 
ATOM   388  N  N   . GLU A 1 64 ? -3.620  -0.030  7.756   1.00 102.45 ? 60  GLU A N   1 
ATOM   389  C  CA  . GLU A 1 64 ? -2.859  -1.116  8.370   1.00 103.04 ? 60  GLU A CA  1 
ATOM   390  C  C   . GLU A 1 64 ? -3.517  -1.627  9.651   1.00 98.63  ? 60  GLU A C   1 
ATOM   391  O  O   . GLU A 1 64 ? -3.525  -2.837  9.910   1.00 96.73  ? 60  GLU A O   1 
ATOM   392  C  CB  . GLU A 1 64 ? -1.428  -0.656  8.654   1.00 107.00 ? 60  GLU A CB  1 
ATOM   393  N  N   . VAL A 1 65 ? -4.084  -0.722  10.459  1.00 93.32  ? 61  VAL A N   1 
ATOM   394  C  CA  . VAL A 1 65 ? -4.601  -1.109  11.774  1.00 85.10  ? 61  VAL A CA  1 
ATOM   395  C  C   . VAL A 1 65 ? -5.707  -2.150  11.650  1.00 75.92  ? 61  VAL A C   1 
ATOM   396  O  O   . VAL A 1 65 ? -5.944  -2.923  12.586  1.00 74.12  ? 61  VAL A O   1 
ATOM   397  C  CB  . VAL A 1 65 ? -5.090  0.130   12.554  1.00 83.62  ? 61  VAL A CB  1 
ATOM   398  C  CG1 . VAL A 1 65 ? -3.933  1.092   12.833  1.00 90.96  ? 61  VAL A CG1 1 
ATOM   399  C  CG2 . VAL A 1 65 ? -6.200  0.838   11.790  1.00 78.95  ? 61  VAL A CG2 1 
ATOM   400  N  N   . SER A 1 66 ? -6.383  -2.203  10.499  1.00 71.05  ? 62  SER A N   1 
ATOM   401  C  CA  . SER A 1 66 ? -7.431  -3.194  10.287  1.00 65.79  ? 62  SER A CA  1 
ATOM   402  C  C   . SER A 1 66 ? -6.886  -4.617  10.278  1.00 66.41  ? 62  SER A C   1 
ATOM   403  O  O   . SER A 1 66 ? -7.650  -5.562  10.509  1.00 65.41  ? 62  SER A O   1 
ATOM   404  C  CB  . SER A 1 66 ? -8.169  -2.919  8.973   1.00 63.51  ? 62  SER A CB  1 
ATOM   405  O  OG  . SER A 1 66 ? -8.945  -1.736  9.045   1.00 65.58  ? 62  SER A OG  1 
ATOM   406  N  N   . VAL A 1 67 ? -5.598  -4.797  9.996   1.00 69.81  ? 63  VAL A N   1 
ATOM   407  C  CA  . VAL A 1 67 ? -5.032  -6.136  9.835   1.00 70.73  ? 63  VAL A CA  1 
ATOM   408  C  C   . VAL A 1 67 ? -4.972  -6.874  11.171  1.00 71.45  ? 63  VAL A C   1 
ATOM   409  O  O   . VAL A 1 67 ? -5.498  -7.992  11.258  1.00 70.15  ? 63  VAL A O   1 
ATOM   410  C  CB  . VAL A 1 67 ? -3.653  -6.088  9.158   1.00 72.74  ? 63  VAL A CB  1 
ATOM   411  C  CG1 . VAL A 1 67 ? -2.958  -7.432  9.299   1.00 69.47  ? 63  VAL A CG1 1 
ATOM   412  C  CG2 . VAL A 1 67 ? -3.796  -5.692  7.696   1.00 76.41  ? 63  VAL A CG2 1 
ATOM   413  N  N   . PRO A 1 68 ? -4.368  -6.323  12.237  1.00 72.99  ? 64  PRO A N   1 
ATOM   414  C  CA  . PRO A 1 68 ? -4.356  -7.089  13.500  1.00 75.94  ? 64  PRO A CA  1 
ATOM   415  C  C   . PRO A 1 68 ? -5.747  -7.317  14.065  1.00 76.84  ? 64  PRO A C   1 
ATOM   416  O  O   . PRO A 1 68 ? -6.016  -8.383  14.635  1.00 77.96  ? 64  PRO A O   1 
ATOM   417  C  CB  . PRO A 1 68 ? -3.497  -6.224  14.433  1.00 78.01  ? 64  PRO A CB  1 
ATOM   418  C  CG  . PRO A 1 68 ? -2.724  -5.331  13.530  1.00 79.17  ? 64  PRO A CG  1 
ATOM   419  C  CD  . PRO A 1 68 ? -3.645  -5.049  12.390  1.00 74.70  ? 64  PRO A CD  1 
ATOM   420  N  N   . TYR A 1 69 ? -6.654  -6.353  13.886  1.00 76.12  ? 65  TYR A N   1 
ATOM   421  C  CA  . TYR A 1 69 ? -8.012  -6.503  14.401  1.00 74.13  ? 65  TYR A CA  1 
ATOM   422  C  C   . TYR A 1 69 ? -8.718  -7.665  13.718  1.00 68.83  ? 65  TYR A C   1 
ATOM   423  O  O   . TYR A 1 69 ? -9.286  -8.539  14.384  1.00 72.90  ? 65  TYR A O   1 
ATOM   424  C  CB  . TYR A 1 69 ? -8.781  -5.194  14.206  1.00 77.71  ? 65  TYR A CB  1 
ATOM   425  C  CG  . TYR A 1 69 ? -10.139 -5.144  14.863  1.00 80.17  ? 65  TYR A CG  1 
ATOM   426  C  CD1 . TYR A 1 69 ? -10.292 -4.625  16.139  1.00 86.33  ? 65  TYR A CD1 1 
ATOM   427  C  CD2 . TYR A 1 69 ? -11.270 -5.600  14.200  1.00 79.41  ? 65  TYR A CD2 1 
ATOM   428  C  CE1 . TYR A 1 69 ? -11.537 -4.570  16.747  1.00 89.98  ? 65  TYR A CE1 1 
ATOM   429  C  CE2 . TYR A 1 69 ? -12.515 -5.550  14.796  1.00 84.59  ? 65  TYR A CE2 1 
ATOM   430  C  CZ  . TYR A 1 69 ? -12.643 -5.034  16.069  1.00 90.17  ? 65  TYR A CZ  1 
ATOM   431  O  OH  . TYR A 1 69 ? -13.881 -4.982  16.664  1.00 92.58  ? 65  TYR A OH  1 
ATOM   432  N  N   . ALA A 1 70 ? -8.650  -7.713  12.385  1.00 64.85  ? 66  ALA A N   1 
ATOM   433  C  CA  . ALA A 1 70 ? -9.284  -8.798  11.644  1.00 64.61  ? 66  ALA A CA  1 
ATOM   434  C  C   . ALA A 1 70 ? -8.724  -10.146 12.062  1.00 71.18  ? 66  ALA A C   1 
ATOM   435  O  O   . ALA A 1 70 ? -9.448  -11.146 12.070  1.00 73.04  ? 66  ALA A O   1 
ATOM   436  C  CB  . ALA A 1 70 ? -9.112  -8.582  10.140  1.00 63.18  ? 66  ALA A CB  1 
ATOM   437  N  N   . MET A 1 71 ? -7.439  -10.190 12.418  1.00 79.60  ? 67  MET A N   1 
ATOM   438  C  CA  . MET A 1 71 ? -6.848  -11.436 12.881  1.00 86.88  ? 67  MET A CA  1 
ATOM   439  C  C   . MET A 1 71 ? -7.587  -11.965 14.100  1.00 80.58  ? 67  MET A C   1 
ATOM   440  O  O   . MET A 1 71 ? -7.968  -13.138 14.144  1.00 78.61  ? 67  MET A O   1 
ATOM   441  C  CB  . MET A 1 71 ? -5.372  -11.225 13.211  1.00 98.95  ? 67  MET A CB  1 
ATOM   442  C  CG  . MET A 1 71 ? -4.749  -12.370 13.991  1.00 106.65 ? 67  MET A CG  1 
ATOM   443  S  SD  . MET A 1 71 ? -4.535  -13.826 12.955  1.00 109.60 ? 67  MET A SD  1 
ATOM   444  C  CE  . MET A 1 71 ? -2.977  -13.415 12.166  1.00 115.48 ? 67  MET A CE  1 
ATOM   445  N  N   . ASN A 1 72 ? -7.820  -11.110 15.094  1.00 79.06  ? 68  ASN A N   1 
ATOM   446  C  CA  . ASN A 1 72 ? -8.481  -11.587 16.302  1.00 77.18  ? 68  ASN A CA  1 
ATOM   447  C  C   . ASN A 1 72 ? -9.960  -11.848 16.051  1.00 71.52  ? 68  ASN A C   1 
ATOM   448  O  O   . ASN A 1 72 ? -10.508 -12.851 16.525  1.00 73.88  ? 68  ASN A O   1 
ATOM   449  C  CB  . ASN A 1 72 ? -8.302  -10.589 17.445  1.00 79.98  ? 68  ASN A CB  1 
ATOM   450  C  CG  . ASN A 1 72 ? -6.853  -10.386 17.824  1.00 86.43  ? 68  ASN A CG  1 
ATOM   451  O  OD1 . ASN A 1 72 ? -6.456  -9.296  18.241  1.00 88.23  ? 68  ASN A OD1 1 
ATOM   452  N  ND2 . ASN A 1 72 ? -6.049  -11.436 17.679  1.00 89.77  ? 68  ASN A ND2 1 
ATOM   453  N  N   . LEU A 1 73 ? -10.613 -10.980 15.279  1.00 64.41  ? 69  LEU A N   1 
ATOM   454  C  CA  . LEU A 1 73 ? -12.058 -11.089 15.113  1.00 59.19  ? 69  LEU A CA  1 
ATOM   455  C  C   . LEU A 1 73 ? -12.440 -12.287 14.254  1.00 55.97  ? 69  LEU A C   1 
ATOM   456  O  O   . LEU A 1 73 ? -13.414 -12.988 14.553  1.00 55.61  ? 69  LEU A O   1 
ATOM   457  C  CB  . LEU A 1 73 ? -12.607 -9.802  14.498  1.00 57.36  ? 69  LEU A CB  1 
ATOM   458  C  CG  . LEU A 1 73 ? -14.128 -9.785  14.342  1.00 55.58  ? 69  LEU A CG  1 
ATOM   459  C  CD1 . LEU A 1 73 ? -14.796 -9.549  15.696  1.00 61.52  ? 69  LEU A CD1 1 
ATOM   460  C  CD2 . LEU A 1 73 ? -14.587 -8.763  13.302  1.00 52.61  ? 69  LEU A CD2 1 
ATOM   461  N  N   . LEU A 1 74 ? -11.678 -12.557 13.193  1.00 52.26  ? 70  LEU A N   1 
ATOM   462  C  CA  . LEU A 1 74 ? -12.157 -13.455 12.152  1.00 46.45  ? 70  LEU A CA  1 
ATOM   463  C  C   . LEU A 1 74 ? -11.385 -14.761 12.011  1.00 42.50  ? 70  LEU A C   1 
ATOM   464  O  O   . LEU A 1 74 ? -11.879 -15.668 11.328  1.00 39.57  ? 70  LEU A O   1 
ATOM   465  C  CB  . LEU A 1 74 ? -12.178 -12.738 10.796  1.00 45.03  ? 70  LEU A CB  1 
ATOM   466  C  CG  . LEU A 1 74 ? -13.092 -11.513 10.791  1.00 50.09  ? 70  LEU A CG  1 
ATOM   467  C  CD1 . LEU A 1 74 ? -12.956 -10.728 9.494   1.00 49.15  ? 70  LEU A CD1 1 
ATOM   468  C  CD2 . LEU A 1 74 ? -14.533 -11.932 11.012  1.00 55.06  ? 70  LEU A CD2 1 
ATOM   469  N  N   . ASN A 1 75 ? -10.231 -14.916 12.658  1.00 41.23  ? 71  ASN A N   1 
ATOM   470  C  CA  . ASN A 1 75 ? -9.475  -16.153 12.494  1.00 45.21  ? 71  ASN A CA  1 
ATOM   471  C  C   . ASN A 1 75 ? -10.267 -17.344 13.011  1.00 44.19  ? 71  ASN A C   1 
ATOM   472  O  O   . ASN A 1 75 ? -10.879 -17.283 14.080  1.00 53.85  ? 71  ASN A O   1 
ATOM   473  C  CB  . ASN A 1 75 ? -8.125  -16.082 13.200  1.00 52.91  ? 71  ASN A CB  1 
ATOM   474  C  CG  . ASN A 1 75 ? -7.184  -17.192 12.752  1.00 57.51  ? 71  ASN A CG  1 
ATOM   475  O  OD1 . ASN A 1 75 ? -7.313  -17.720 11.644  1.00 56.43  ? 71  ASN A OD1 1 
ATOM   476  N  ND2 . ASN A 1 75 ? -6.257  -17.577 13.624  1.00 63.28  ? 71  ASN A ND2 1 
ATOM   477  N  N   . GLY A 1 76 ? -10.273 -18.417 12.228  1.00 46.97  ? 72  GLY A N   1 
ATOM   478  C  CA  . GLY A 1 76 ? -10.910 -19.652 12.622  1.00 53.00  ? 72  GLY A CA  1 
ATOM   479  C  C   . GLY A 1 76 ? -12.396 -19.726 12.347  1.00 51.59  ? 72  GLY A C   1 
ATOM   480  O  O   . GLY A 1 76 ? -13.000 -20.790 12.557  1.00 51.59  ? 72  GLY A O   1 
ATOM   481  N  N   . ILE A 1 77 ? -13.001 -18.630 11.887  1.00 48.68  ? 73  ILE A N   1 
ATOM   482  C  CA  . ILE A 1 77 ? -14.419 -18.651 11.557  1.00 51.40  ? 73  ILE A CA  1 
ATOM   483  C  C   . ILE A 1 77 ? -14.678 -19.637 10.444  1.00 58.38  ? 73  ILE A C   1 
ATOM   484  O  O   . ILE A 1 77 ? -13.949 -19.686 9.448   1.00 67.95  ? 73  ILE A O   1 
ATOM   485  C  CB  . ILE A 1 77 ? -14.900 -17.237 11.216  1.00 49.09  ? 73  ILE A CB  1 
ATOM   486  C  CG1 . ILE A 1 77 ? -15.044 -16.465 12.525  1.00 53.46  ? 73  ILE A CG1 1 
ATOM   487  C  CG2 . ILE A 1 77 ? -16.160 -17.250 10.337  1.00 46.12  ? 73  ILE A CG2 1 
ATOM   488  C  CD1 . ILE A 1 77 ? -15.296 -15.040 12.352  1.00 53.63  ? 73  ILE A CD1 1 
ATOM   489  N  N   . LYS A 1 78 ? -15.712 -20.450 10.629  1.00 59.03  ? 74  LYS A N   1 
ATOM   490  C  CA  . LYS A 1 78 ? -16.043 -21.470 9.653   1.00 64.00  ? 74  LYS A CA  1 
ATOM   491  C  C   . LYS A 1 78 ? -16.901 -20.868 8.551   1.00 70.42  ? 74  LYS A C   1 
ATOM   492  O  O   . LYS A 1 78 ? -17.939 -20.252 8.820   1.00 71.44  ? 74  LYS A O   1 
ATOM   493  C  CB  . LYS A 1 78 ? -16.765 -22.638 10.322  1.00 63.21  ? 74  LYS A CB  1 
ATOM   494  C  CG  . LYS A 1 78 ? -15.900 -23.390 11.321  1.00 68.47  ? 74  LYS A CG  1 
ATOM   495  C  CD  . LYS A 1 78 ? -16.575 -24.658 11.823  1.00 75.72  ? 74  LYS A CD  1 
ATOM   496  C  CE  . LYS A 1 78 ? -15.607 -25.490 12.650  1.00 81.22  ? 74  LYS A CE  1 
ATOM   497  N  NZ  . LYS A 1 78 ? -16.146 -26.845 12.956  1.00 87.27  ? 74  LYS A NZ  1 
ATOM   498  N  N   . LEU A 1 79 ? -16.449 -21.039 7.313   1.00 69.68  ? 75  LEU A N   1 
ATOM   499  C  CA  . LEU A 1 79 ? -17.196 -20.669 6.122   1.00 64.68  ? 75  LEU A CA  1 
ATOM   500  C  C   . LEU A 1 79 ? -17.522 -21.955 5.378   1.00 68.33  ? 75  LEU A C   1 
ATOM   501  O  O   . LEU A 1 79 ? -16.611 -22.662 4.930   1.00 72.26  ? 75  LEU A O   1 
ATOM   502  C  CB  . LEU A 1 79 ? -16.394 -19.714 5.235   1.00 61.82  ? 75  LEU A CB  1 
ATOM   503  C  CG  . LEU A 1 79 ? -16.248 -18.262 5.694   1.00 59.55  ? 75  LEU A CG  1 
ATOM   504  C  CD1 . LEU A 1 79 ? -15.484 -17.459 4.644   1.00 62.22  ? 75  LEU A CD1 1 
ATOM   505  C  CD2 . LEU A 1 79 ? -17.606 -17.648 5.963   1.00 55.66  ? 75  LEU A CD2 1 
ATOM   506  N  N   . TYR A 1 80 ? -18.810 -22.277 5.291   1.00 70.86  ? 76  TYR A N   1 
ATOM   507  C  CA  . TYR A 1 80 ? -19.269 -23.510 4.654   1.00 77.59  ? 76  TYR A CA  1 
ATOM   508  C  C   . TYR A 1 80 ? -18.617 -24.727 5.304   1.00 81.38  ? 76  TYR A C   1 
ATOM   509  O  O   . TYR A 1 80 ? -18.250 -25.694 4.633   1.00 87.58  ? 76  TYR A O   1 
ATOM   510  C  CB  . TYR A 1 80 ? -19.003 -23.492 3.146   1.00 79.94  ? 76  TYR A CB  1 
ATOM   511  C  CG  . TYR A 1 80 ? -19.698 -22.367 2.409   1.00 80.98  ? 76  TYR A CG  1 
ATOM   512  C  CD1 . TYR A 1 80 ? -21.082 -22.302 2.347   1.00 83.92  ? 76  TYR A CD1 1 
ATOM   513  C  CD2 . TYR A 1 80 ? -18.968 -21.372 1.770   1.00 81.29  ? 76  TYR A CD2 1 
ATOM   514  C  CE1 . TYR A 1 80 ? -21.720 -21.276 1.674   1.00 83.28  ? 76  TYR A CE1 1 
ATOM   515  C  CE2 . TYR A 1 80 ? -19.599 -20.342 1.091   1.00 80.17  ? 76  TYR A CE2 1 
ATOM   516  C  CZ  . TYR A 1 80 ? -20.974 -20.301 1.049   1.00 80.40  ? 76  TYR A CZ  1 
ATOM   517  O  OH  . TYR A 1 80 ? -21.611 -19.281 0.381   1.00 79.61  ? 76  TYR A OH  1 
ATOM   518  N  N   . GLY A 1 81 ? -18.466 -24.672 6.625   1.00 80.29  ? 77  GLY A N   1 
ATOM   519  C  CA  . GLY A 1 81 ? -17.911 -25.771 7.384   1.00 83.89  ? 77  GLY A CA  1 
ATOM   520  C  C   . GLY A 1 81 ? -16.401 -25.792 7.488   1.00 83.52  ? 77  GLY A C   1 
ATOM   521  O  O   . GLY A 1 81 ? -15.858 -26.650 8.199   1.00 86.31  ? 77  GLY A O   1 
ATOM   522  N  N   . ARG A 1 82 ? -15.702 -24.868 6.826   1.00 77.91  ? 78  ARG A N   1 
ATOM   523  C  CA  . ARG A 1 82 ? -14.244 -24.870 6.826   1.00 75.56  ? 78  ARG A CA  1 
ATOM   524  C  C   . ARG A 1 82 ? -13.721 -23.656 7.578   1.00 66.09  ? 78  ARG A C   1 
ATOM   525  O  O   . ARG A 1 82 ? -14.017 -22.512 7.198   1.00 61.66  ? 78  ARG A O   1 
ATOM   526  C  CB  . ARG A 1 82 ? -13.699 -24.888 5.397   1.00 76.98  ? 78  ARG A CB  1 
ATOM   527  N  N   . PRO A 1 83 ? -12.963 -23.857 8.655   1.00 63.49  ? 79  PRO A N   1 
ATOM   528  C  CA  . PRO A 1 83 ? -12.421 -22.721 9.419   1.00 61.78  ? 79  PRO A CA  1 
ATOM   529  C  C   . PRO A 1 83 ? -11.322 -22.030 8.631   1.00 63.11  ? 79  PRO A C   1 
ATOM   530  O  O   . PRO A 1 83 ? -10.338 -22.661 8.241   1.00 70.05  ? 79  PRO A O   1 
ATOM   531  C  CB  . PRO A 1 83 ? -11.874 -23.374 10.691  1.00 67.12  ? 79  PRO A CB  1 
ATOM   532  C  CG  . PRO A 1 83 ? -11.654 -24.810 10.323  1.00 71.91  ? 79  PRO A CG  1 
ATOM   533  C  CD  . PRO A 1 83 ? -12.675 -25.153 9.287   1.00 69.72  ? 79  PRO A CD  1 
ATOM   534  N  N   . ILE A 1 84 ? -11.482 -20.722 8.415   1.00 58.07  ? 80  ILE A N   1 
ATOM   535  C  CA  . ILE A 1 84 ? -10.464 -19.977 7.693   1.00 58.45  ? 80  ILE A CA  1 
ATOM   536  C  C   . ILE A 1 84 ? -9.228  -19.845 8.572   1.00 66.74  ? 80  ILE A C   1 
ATOM   537  O  O   . ILE A 1 84 ? -9.311  -19.835 9.809   1.00 69.44  ? 80  ILE A O   1 
ATOM   538  C  CB  . ILE A 1 84 ? -10.980 -18.595 7.259   1.00 50.95  ? 80  ILE A CB  1 
ATOM   539  C  CG1 . ILE A 1 84 ? -11.125 -17.677 8.468   1.00 38.61  ? 80  ILE A CG1 1 
ATOM   540  C  CG2 . ILE A 1 84 ? -12.315 -18.733 6.558   1.00 48.34  ? 80  ILE A CG2 1 
ATOM   541  C  CD1 . ILE A 1 84 ? -11.573 -16.268 8.107   1.00 36.42  ? 80  ILE A CD1 1 
ATOM   542  N  N   . LYS A 1 85 ? -8.066  -19.781 7.933   1.00 68.86  ? 81  LYS A N   1 
ATOM   543  C  CA  . LYS A 1 85 ? -6.790  -19.649 8.627   1.00 68.53  ? 81  LYS A CA  1 
ATOM   544  C  C   . LYS A 1 85 ? -6.080  -18.393 8.157   1.00 69.63  ? 81  LYS A C   1 
ATOM   545  O  O   . LYS A 1 85 ? -5.645  -18.309 7.003   1.00 73.02  ? 81  LYS A O   1 
ATOM   546  C  CB  . LYS A 1 85 ? -5.906  -20.879 8.423   1.00 72.59  ? 81  LYS A CB  1 
ATOM   547  C  CG  . LYS A 1 85 ? -6.498  -22.168 8.930   1.00 79.61  ? 81  LYS A CG  1 
ATOM   548  C  CD  . LYS A 1 85 ? -6.744  -22.018 10.419  1.00 86.11  ? 81  LYS A CD  1 
ATOM   549  C  CE  . LYS A 1 85 ? -7.919  -22.833 10.884  1.00 90.60  ? 81  LYS A CE  1 
ATOM   550  N  NZ  . LYS A 1 85 ? -8.310  -22.404 12.253  1.00 91.49  ? 81  LYS A NZ  1 
ATOM   551  N  N   . ILE A 1 86 ? -5.985  -17.414 9.046   1.00 75.08  ? 82  ILE A N   1 
ATOM   552  C  CA  . ILE A 1 86 ? -5.427  -16.113 8.712   1.00 86.59  ? 82  ILE A CA  1 
ATOM   553  C  C   . ILE A 1 86 ? -4.003  -16.223 9.233   1.00 104.13 ? 82  ILE A C   1 
ATOM   554  O  O   . ILE A 1 86 ? -3.731  -15.994 10.409  1.00 110.24 ? 82  ILE A O   1 
ATOM   555  C  CB  . ILE A 1 86 ? -6.207  -14.973 9.363   1.00 85.69  ? 82  ILE A CB  1 
ATOM   556  C  CG1 . ILE A 1 86 ? -7.685  -15.067 8.988   1.00 81.16  ? 82  ILE A CG1 1 
ATOM   557  C  CG2 . ILE A 1 86 ? -5.673  -13.635 8.893   1.00 86.45  ? 82  ILE A CG2 1 
ATOM   558  C  CD1 . ILE A 1 86 ? -8.527  -13.971 9.604   1.00 75.71  ? 82  ILE A CD1 1 
ATOM   559  N  N   . GLN A 1 87 ? -3.059  -16.453 8.327   1.00 116.57 ? 83  GLN A N   1 
ATOM   560  C  CA  . GLN A 1 87 ? -1.689  -16.589 8.786   1.00 130.61 ? 83  GLN A CA  1 
ATOM   561  C  C   . GLN A 1 87 ? -0.995  -15.245 8.858   1.00 140.13 ? 83  GLN A C   1 
ATOM   562  O  O   . GLN A 1 87 ? -0.195  -15.011 9.772   1.00 150.74 ? 83  GLN A O   1 
ATOM   563  C  CB  . GLN A 1 87 ? -0.910  -17.525 7.860   1.00 130.80 ? 83  GLN A CB  1 
ATOM   564  C  CG  . GLN A 1 87 ? 0.585   -17.405 8.041   1.00 134.81 ? 83  GLN A CG  1 
ATOM   565  C  CD  . GLN A 1 87 ? 1.338   -18.549 7.441   1.00 139.86 ? 83  GLN A CD  1 
ATOM   566  O  OE1 . GLN A 1 87 ? 0.795   -19.325 6.656   1.00 140.88 ? 83  GLN A OE1 1 
ATOM   567  N  NE2 . GLN A 1 87 ? 2.601   -18.672 7.815   1.00 147.29 ? 83  GLN A NE2 1 
ATOM   568  N  N   . PHE A 1 88 ? -1.344  -14.335 7.963   1.00 133.24 ? 84  PHE A N   1 
ATOM   569  C  CA  . PHE A 1 88 ? -0.775  -13.000 7.985   1.00 131.74 ? 84  PHE A CA  1 
ATOM   570  C  C   . PHE A 1 88 ? -1.194  -12.195 9.212   1.00 134.03 ? 84  PHE A C   1 
ATOM   571  O  O   . PHE A 1 88 ? -0.509  -11.242 9.591   1.00 139.00 ? 84  PHE A O   1 
ATOM   572  C  CB  . PHE A 1 88 ? -1.170  -12.245 6.717   1.00 124.74 ? 84  PHE A CB  1 
ATOM   573  N  N   . PHE B 2 7  ? -21.053 1.978   8.428   1.00 88.58  ? 286 PHE D N   1 
ATOM   574  C  CA  . PHE B 2 7  ? -20.642 0.760   9.123   1.00 85.32  ? 286 PHE D CA  1 
ATOM   575  C  C   . PHE B 2 7  ? -21.672 0.299   10.146  1.00 88.88  ? 286 PHE D C   1 
ATOM   576  O  O   . PHE B 2 7  ? -21.856 0.936   11.187  1.00 92.47  ? 286 PHE D O   1 
ATOM   577  C  CB  . PHE B 2 7  ? -19.284 0.921   9.804   1.00 78.75  ? 286 PHE D CB  1 
ATOM   578  C  CG  . PHE B 2 7  ? -18.935 -0.227  10.715  1.00 69.73  ? 286 PHE D CG  1 
ATOM   579  C  CD1 . PHE B 2 7  ? -18.791 -1.509  10.206  1.00 66.94  ? 286 PHE D CD1 1 
ATOM   580  C  CD2 . PHE B 2 7  ? -18.709 -0.020  12.070  1.00 64.28  ? 286 PHE D CD2 1 
ATOM   581  C  CE1 . PHE B 2 7  ? -18.467 -2.570  11.037  1.00 62.19  ? 286 PHE D CE1 1 
ATOM   582  C  CE2 . PHE B 2 7  ? -18.376 -1.071  12.901  1.00 58.75  ? 286 PHE D CE2 1 
ATOM   583  C  CZ  . PHE B 2 7  ? -18.253 -2.348  12.384  1.00 57.30  ? 286 PHE D CZ  1 
ATOM   584  N  N   . LYS B 2 8  ? -22.413 -0.752  9.803   1.00 85.42  ? 287 LYS D N   1 
ATOM   585  C  CA  . LYS B 2 8  ? -23.353 -1.357  10.740  1.00 81.51  ? 287 LYS D CA  1 
ATOM   586  C  C   . LYS B 2 8  ? -22.840 -2.718  11.210  1.00 72.07  ? 287 LYS D C   1 
ATOM   587  O  O   . LYS B 2 8  ? -22.922 -3.706  10.459  1.00 70.28  ? 287 LYS D O   1 
ATOM   588  C  CB  . LYS B 2 8  ? -24.727 -1.496  10.078  1.00 83.65  ? 287 LYS D CB  1 
ATOM   589  N  N   . PRO B 2 9  ? -22.278 -2.822  12.418  1.00 62.49  ? 288 PRO D N   1 
ATOM   590  C  CA  . PRO B 2 9  ? -21.710 -4.107  12.853  1.00 56.43  ? 288 PRO D CA  1 
ATOM   591  C  C   . PRO B 2 9  ? -22.784 -5.183  12.939  1.00 57.86  ? 288 PRO D C   1 
ATOM   592  O  O   . PRO B 2 9  ? -23.965 -4.904  13.152  1.00 64.56  ? 288 PRO D O   1 
ATOM   593  C  CB  . PRO B 2 9  ? -21.108 -3.793  14.234  1.00 55.25  ? 288 PRO D CB  1 
ATOM   594  C  CG  . PRO B 2 9  ? -21.622 -2.422  14.604  1.00 60.22  ? 288 PRO D CG  1 
ATOM   595  C  CD  . PRO B 2 9  ? -21.907 -1.717  13.318  1.00 62.64  ? 288 PRO D CD  1 
ATOM   596  N  N   . GLY B 2 10 ? -22.358 -6.429  12.760  1.00 56.04  ? 289 GLY D N   1 
ATOM   597  C  CA  . GLY B 2 10 ? -23.245 -7.578  12.823  1.00 58.48  ? 289 GLY D CA  1 
ATOM   598  C  C   . GLY B 2 10 ? -24.419 -7.634  11.859  1.00 65.92  ? 289 GLY D C   1 
ATOM   599  O  O   . GLY B 2 10 ? -25.220 -8.572  11.925  1.00 71.27  ? 289 GLY D O   1 
ATOM   600  N  N   . VAL B 2 11 ? -24.549 -6.658  10.968  1.00 71.72  ? 290 VAL D N   1 
ATOM   601  C  CA  . VAL B 2 11 ? -25.548 -6.705  9.906   1.00 73.52  ? 290 VAL D CA  1 
ATOM   602  C  C   . VAL B 2 11 ? -24.898 -7.338  8.683   1.00 73.22  ? 290 VAL D C   1 
ATOM   603  O  O   . VAL B 2 11 ? -23.919 -6.805  8.144   1.00 77.18  ? 290 VAL D O   1 
ATOM   604  C  CB  . VAL B 2 11 ? -26.097 -5.310  9.583   1.00 76.09  ? 290 VAL D CB  1 
ATOM   605  C  CG1 . VAL B 2 11 ? -27.299 -5.412  8.659   1.00 81.78  ? 290 VAL D CG1 1 
ATOM   606  C  CG2 . VAL B 2 11 ? -26.465 -4.584  10.869  1.00 76.03  ? 290 VAL D CG2 1 
ATOM   607  N  N   . ILE B 2 12 ? -25.435 -8.476  8.236   1.00 69.31  ? 291 ILE D N   1 
ATOM   608  C  CA  . ILE B 2 12 ? -24.859 -9.217  7.119   1.00 68.73  ? 291 ILE D CA  1 
ATOM   609  C  C   . ILE B 2 12 ? -25.946 -9.693  6.159   1.00 74.23  ? 291 ILE D C   1 
ATOM   610  O  O   . ILE B 2 12 ? -27.111 -9.870  6.528   1.00 79.54  ? 291 ILE D O   1 
ATOM   611  C  CB  . ILE B 2 12 ? -24.037 -10.423 7.609   1.00 64.79  ? 291 ILE D CB  1 
ATOM   612  C  CG1 . ILE B 2 12 ? -24.927 -11.374 8.405   1.00 63.35  ? 291 ILE D CG1 1 
ATOM   613  C  CG2 . ILE B 2 12 ? -22.867 -9.969  8.453   1.00 61.77  ? 291 ILE D CG2 1 
ATOM   614  C  CD1 . ILE B 2 12 ? -24.214 -12.601 8.891   1.00 61.57  ? 291 ILE D CD1 1 
ATOM   615  N  N   . SER B 2 13 ? -25.529 -9.938  4.919   1.00 74.58  ? 292 SER D N   1 
ATOM   616  C  CA  . SER B 2 13 ? -26.422 -10.385 3.860   1.00 78.17  ? 292 SER D CA  1 
ATOM   617  C  C   . SER B 2 13 ? -26.874 -11.822 4.102   1.00 79.46  ? 292 SER D C   1 
ATOM   618  O  O   . SER B 2 13 ? -26.347 -12.537 4.958   1.00 75.90  ? 292 SER D O   1 
ATOM   619  C  CB  . SER B 2 13 ? -25.733 -10.299 2.500   1.00 80.55  ? 292 SER D CB  1 
ATOM   620  O  OG  . SER B 2 13 ? -24.731 -11.299 2.377   1.00 78.95  ? 292 SER D OG  1 
ATOM   621  N  N   . GLU B 2 14 ? -27.870 -12.244 3.320   1.00 86.97  ? 293 GLU D N   1 
ATOM   622  C  CA  . GLU B 2 14 ? -28.342 -13.621 3.399   1.00 96.47  ? 293 GLU D CA  1 
ATOM   623  C  C   . GLU B 2 14 ? -27.294 -14.596 2.882   1.00 100.38 ? 293 GLU D C   1 
ATOM   624  O  O   . GLU B 2 14 ? -27.188 -15.719 3.391   1.00 99.98  ? 293 GLU D O   1 
ATOM   625  C  CB  . GLU B 2 14 ? -29.645 -13.780 2.615   1.00 104.04 ? 293 GLU D CB  1 
ATOM   626  N  N   . GLU B 2 15 ? -26.521 -14.195 1.869   1.00 103.63 ? 294 GLU D N   1 
ATOM   627  C  CA  . GLU B 2 15 ? -25.477 -15.075 1.354   1.00 100.09 ? 294 GLU D CA  1 
ATOM   628  C  C   . GLU B 2 15 ? -24.429 -15.353 2.423   1.00 94.61  ? 294 GLU D C   1 
ATOM   629  O  O   . GLU B 2 15 ? -23.970 -16.491 2.575   1.00 94.48  ? 294 GLU D O   1 
ATOM   630  C  CB  . GLU B 2 15 ? -24.827 -14.461 0.112   1.00 95.51  ? 294 GLU D CB  1 
ATOM   631  N  N   . LEU B 2 16 ? -24.044 -14.324 3.179   1.00 87.86  ? 295 LEU D N   1 
ATOM   632  C  CA  . LEU B 2 16 ? -23.063 -14.524 4.239   1.00 82.26  ? 295 LEU D CA  1 
ATOM   633  C  C   . LEU B 2 16 ? -23.643 -15.333 5.395   1.00 82.12  ? 295 LEU D C   1 
ATOM   634  O  O   . LEU B 2 16 ? -22.943 -16.164 5.988   1.00 82.64  ? 295 LEU D O   1 
ATOM   635  C  CB  . LEU B 2 16 ? -22.539 -13.174 4.726   1.00 77.52  ? 295 LEU D CB  1 
ATOM   636  C  CG  . LEU B 2 16 ? -21.437 -13.247 5.782   1.00 71.55  ? 295 LEU D CG  1 
ATOM   637  C  CD1 . LEU B 2 16 ? -20.303 -14.128 5.281   1.00 68.73  ? 295 LEU D CD1 1 
ATOM   638  C  CD2 . LEU B 2 16 ? -20.930 -11.857 6.119   1.00 71.09  ? 295 LEU D CD2 1 
ATOM   639  N  N   . GLN B 2 17 ? -24.920 -15.113 5.725   1.00 82.30  ? 296 GLN D N   1 
ATOM   640  C  CA  . GLN B 2 17 ? -25.559 -15.891 6.782   1.00 79.62  ? 296 GLN D CA  1 
ATOM   641  C  C   . GLN B 2 17 ? -25.498 -17.378 6.466   1.00 80.10  ? 296 GLN D C   1 
ATOM   642  O  O   . GLN B 2 17 ? -25.131 -18.194 7.320   1.00 79.56  ? 296 GLN D O   1 
ATOM   643  C  CB  . GLN B 2 17 ? -27.011 -15.444 6.964   1.00 83.17  ? 296 GLN D CB  1 
ATOM   644  C  CG  . GLN B 2 17 ? -27.185 -14.061 7.556   1.00 86.76  ? 296 GLN D CG  1 
ATOM   645  C  CD  . GLN B 2 17 ? -28.638 -13.611 7.570   1.00 95.47  ? 296 GLN D CD  1 
ATOM   646  O  OE1 . GLN B 2 17 ? -29.490 -14.215 6.920   1.00 101.52 ? 296 GLN D OE1 1 
ATOM   647  N  NE2 . GLN B 2 17 ? -28.924 -12.549 8.318   1.00 97.99  ? 296 GLN D NE2 1 
ATOM   648  N  N   . ASP B 2 18 ? -25.832 -17.747 5.227   1.00 83.86  ? 297 ASP D N   1 
ATOM   649  C  CA  . ASP B 2 18 ? -25.755 -19.149 4.838   1.00 89.01  ? 297 ASP D CA  1 
ATOM   650  C  C   . ASP B 2 18 ? -24.320 -19.650 4.918   1.00 93.98  ? 297 ASP D C   1 
ATOM   651  O  O   . ASP B 2 18 ? -24.073 -20.791 5.324   1.00 96.31  ? 297 ASP D O   1 
ATOM   652  C  CB  . ASP B 2 18 ? -26.319 -19.334 3.427   1.00 88.58  ? 297 ASP D CB  1 
ATOM   653  N  N   . ALA B 2 19 ? -23.355 -18.802 4.549   1.00 94.01  ? 298 ALA D N   1 
ATOM   654  C  CA  . ALA B 2 19 ? -21.956 -19.199 4.656   1.00 90.87  ? 298 ALA D CA  1 
ATOM   655  C  C   . ALA B 2 19 ? -21.546 -19.382 6.112   1.00 90.06  ? 298 ALA D C   1 
ATOM   656  O  O   . ALA B 2 19 ? -20.826 -20.328 6.448   1.00 92.83  ? 298 ALA D O   1 
ATOM   657  C  CB  . ALA B 2 19 ? -21.057 -18.168 3.974   1.00 87.69  ? 298 ALA D CB  1 
ATOM   658  N  N   . LEU B 2 20 ? -22.009 -18.495 6.992   1.00 88.15  ? 299 LEU D N   1 
ATOM   659  C  CA  . LEU B 2 20 ? -21.662 -18.598 8.402   1.00 86.86  ? 299 LEU D CA  1 
ATOM   660  C  C   . LEU B 2 20 ? -22.456 -19.687 9.106   1.00 98.17  ? 299 LEU D C   1 
ATOM   661  O  O   . LEU B 2 20 ? -22.076 -20.116 10.201  1.00 103.20 ? 299 LEU D O   1 
ATOM   662  C  CB  . LEU B 2 20 ? -21.899 -17.257 9.098   1.00 73.87  ? 299 LEU D CB  1 
ATOM   663  C  CG  . LEU B 2 20 ? -20.930 -16.129 8.749   1.00 61.98  ? 299 LEU D CG  1 
ATOM   664  C  CD1 . LEU B 2 20 ? -21.325 -14.831 9.427   1.00 54.03  ? 299 LEU D CD1 1 
ATOM   665  C  CD2 . LEU B 2 20 ? -19.532 -16.539 9.159   1.00 62.02  ? 299 LEU D CD2 1 
ATOM   666  N  N   . GLY B 2 21 ? -23.531 -20.153 8.482   1.00 98.59  ? 300 GLY D N   1 
ATOM   667  C  CA  . GLY B 2 21 ? -24.392 -21.149 9.081   1.00 96.21  ? 300 GLY D CA  1 
ATOM   668  C  C   . GLY B 2 21 ? -25.334 -20.582 10.112  1.00 91.69  ? 300 GLY D C   1 
ATOM   669  O  O   . GLY B 2 21 ? -25.742 -21.302 11.025  1.00 99.05  ? 300 GLY D O   1 
ATOM   670  N  N   . VAL B 2 22 ? -25.682 -19.300 10.004  1.00 84.35  ? 301 VAL D N   1 
ATOM   671  C  CA  . VAL B 2 22 ? -26.524 -18.648 11.005  1.00 81.25  ? 301 VAL D CA  1 
ATOM   672  C  C   . VAL B 2 22 ? -27.971 -19.061 10.774  1.00 84.92  ? 301 VAL D C   1 
ATOM   673  O  O   . VAL B 2 22 ? -28.499 -18.919 9.666   1.00 90.28  ? 301 VAL D O   1 
ATOM   674  C  CB  . VAL B 2 22 ? -26.365 -17.121 10.946  1.00 78.59  ? 301 VAL D CB  1 
ATOM   675  C  CG1 . VAL B 2 22 ? -27.445 -16.434 11.779  1.00 76.41  ? 301 VAL D CG1 1 
ATOM   676  C  CG2 . VAL B 2 22 ? -24.973 -16.700 11.424  1.00 80.58  ? 301 VAL D CG2 1 
ATOM   677  N  N   . THR B 2 23 ? -28.619 -19.572 11.825  1.00 80.64  ? 302 THR D N   1 
ATOM   678  C  CA  . THR B 2 23 ? -30.003 -20.001 11.679  1.00 77.75  ? 302 THR D CA  1 
ATOM   679  C  C   . THR B 2 23 ? -30.977 -18.841 11.841  1.00 78.23  ? 302 THR D C   1 
ATOM   680  O  O   . THR B 2 23 ? -31.989 -18.780 11.134  1.00 84.40  ? 302 THR D O   1 
ATOM   681  C  CB  . THR B 2 23 ? -30.333 -21.111 12.678  1.00 72.86  ? 302 THR D CB  1 
ATOM   682  O  OG1 . THR B 2 23 ? -29.164 -21.906 12.913  1.00 73.44  ? 302 THR D OG1 1 
ATOM   683  C  CG2 . THR B 2 23 ? -31.425 -22.003 12.114  1.00 74.89  ? 302 THR D CG2 1 
ATOM   684  N  N   . ASP B 2 24 ? -30.693 -17.911 12.751  1.00 72.86  ? 303 ASP D N   1 
ATOM   685  C  CA  . ASP B 2 24 ? -31.635 -16.860 13.125  1.00 76.42  ? 303 ASP D CA  1 
ATOM   686  C  C   . ASP B 2 24 ? -31.060 -15.501 12.748  1.00 71.19  ? 303 ASP D C   1 
ATOM   687  O  O   . ASP B 2 24 ? -30.047 -15.074 13.312  1.00 71.10  ? 303 ASP D O   1 
ATOM   688  C  CB  . ASP B 2 24 ? -31.949 -16.922 14.622  1.00 81.20  ? 303 ASP D CB  1 
ATOM   689  C  CG  . ASP B 2 24 ? -33.095 -16.001 15.023  1.00 84.73  ? 303 ASP D CG  1 
ATOM   690  O  OD1 . ASP B 2 24 ? -33.071 -14.807 14.649  1.00 83.47  ? 303 ASP D OD1 1 
ATOM   691  O  OD2 . ASP B 2 24 ? -34.027 -16.475 15.712  1.00 89.81  ? 303 ASP D OD2 1 
ATOM   692  N  N   . LYS B 2 25 ? -31.737 -14.809 11.828  1.00 72.25  ? 304 LYS D N   1 
ATOM   693  C  CA  . LYS B 2 25 ? -31.226 -13.551 11.294  1.00 74.52  ? 304 LYS D CA  1 
ATOM   694  C  C   . LYS B 2 25 ? -31.244 -12.417 12.313  1.00 75.86  ? 304 LYS D C   1 
ATOM   695  O  O   . LYS B 2 25 ? -30.532 -11.425 12.119  1.00 77.56  ? 304 LYS D O   1 
ATOM   696  C  CB  . LYS B 2 25 ? -32.025 -13.140 10.055  1.00 77.27  ? 304 LYS D CB  1 
ATOM   697  N  N   . SER B 2 26 ? -32.041 -12.520 13.379  1.00 76.40  ? 305 SER D N   1 
ATOM   698  C  CA  . SER B 2 26 ? -32.054 -11.440 14.356  1.00 78.35  ? 305 SER D CA  1 
ATOM   699  C  C   . SER B 2 26 ? -30.895 -11.514 15.337  1.00 77.06  ? 305 SER D C   1 
ATOM   700  O  O   . SER B 2 26 ? -30.709 -10.572 16.115  1.00 79.80  ? 305 SER D O   1 
ATOM   701  C  CB  . SER B 2 26 ? -33.369 -11.440 15.139  1.00 82.10  ? 305 SER D CB  1 
ATOM   702  O  OG  . SER B 2 26 ? -33.421 -12.525 16.047  1.00 82.13  ? 305 SER D OG  1 
ATOM   703  N  N   . LEU B 2 27 ? -30.108 -12.592 15.312  1.00 71.95  ? 306 LEU D N   1 
ATOM   704  C  CA  . LEU B 2 27 ? -28.970 -12.733 16.208  1.00 67.07  ? 306 LEU D CA  1 
ATOM   705  C  C   . LEU B 2 27 ? -27.768 -12.081 15.543  1.00 68.84  ? 306 LEU D C   1 
ATOM   706  O  O   . LEU B 2 27 ? -27.259 -12.624 14.550  1.00 73.79  ? 306 LEU D O   1 
ATOM   707  C  CB  . LEU B 2 27 ? -28.695 -14.202 16.482  1.00 64.30  ? 306 LEU D CB  1 
ATOM   708  C  CG  . LEU B 2 27 ? -29.639 -14.942 17.435  1.00 69.23  ? 306 LEU D CG  1 
ATOM   709  C  CD1 . LEU B 2 27 ? -29.167 -16.377 17.637  1.00 67.20  ? 306 LEU D CD1 1 
ATOM   710  C  CD2 . LEU B 2 27 ? -29.784 -14.225 18.767  1.00 74.03  ? 306 LEU D CD2 1 
ATOM   711  N  N   . PRO B 2 28 ? -27.282 -10.943 16.024  1.00 66.42  ? 307 PRO D N   1 
ATOM   712  C  CA  . PRO B 2 28 ? -26.186 -10.274 15.332  1.00 68.52  ? 307 PRO D CA  1 
ATOM   713  C  C   . PRO B 2 28 ? -24.891 -11.044 15.507  1.00 74.12  ? 307 PRO D C   1 
ATOM   714  O  O   . PRO B 2 28 ? -24.485 -11.347 16.638  1.00 81.56  ? 307 PRO D O   1 
ATOM   715  C  CB  . PRO B 2 28 ? -26.110 -8.904  16.023  1.00 67.79  ? 307 PRO D CB  1 
ATOM   716  C  CG  . PRO B 2 28 ? -27.412 -8.743  16.729  1.00 68.32  ? 307 PRO D CG  1 
ATOM   717  C  CD  . PRO B 2 28 ? -27.800 -10.133 17.134  1.00 66.84  ? 307 PRO D CD  1 
ATOM   718  N  N   . PRO B 2 29 ? -24.226 -11.415 14.422  1.00 72.38  ? 308 PRO D N   1 
ATOM   719  C  CA  . PRO B 2 29 ? -22.918 -12.055 14.552  1.00 68.52  ? 308 PRO D CA  1 
ATOM   720  C  C   . PRO B 2 29 ? -21.827 -11.004 14.664  1.00 66.11  ? 308 PRO D C   1 
ATOM   721  O  O   . PRO B 2 29 ? -21.942 -9.887  14.158  1.00 67.42  ? 308 PRO D O   1 
ATOM   722  C  CB  . PRO B 2 29 ? -22.794 -12.861 13.253  1.00 66.05  ? 308 PRO D CB  1 
ATOM   723  C  CG  . PRO B 2 29 ? -23.593 -12.085 12.278  1.00 68.85  ? 308 PRO D CG  1 
ATOM   724  C  CD  . PRO B 2 29 ? -24.731 -11.458 13.040  1.00 72.06  ? 308 PRO D CD  1 
ATOM   725  N  N   . PHE B 2 30 ? -20.767 -11.373 15.376  1.00 65.42  ? 309 PHE D N   1 
ATOM   726  C  CA  . PHE B 2 30 ? -19.524 -10.631 15.563  1.00 65.41  ? 309 PHE D CA  1 
ATOM   727  C  C   . PHE B 2 30 ? -19.665 -9.486  16.562  1.00 65.26  ? 309 PHE D C   1 
ATOM   728  O  O   . PHE B 2 30 ? -18.642 -8.962  17.009  1.00 65.60  ? 309 PHE D O   1 
ATOM   729  C  CB  . PHE B 2 30 ? -18.964 -10.047 14.247  1.00 61.89  ? 309 PHE D CB  1 
ATOM   730  C  CG  . PHE B 2 30 ? -18.783 -11.056 13.170  1.00 56.43  ? 309 PHE D CG  1 
ATOM   731  C  CD1 . PHE B 2 30 ? -18.169 -12.265 13.433  1.00 56.09  ? 309 PHE D CD1 1 
ATOM   732  C  CD2 . PHE B 2 30 ? -19.260 -10.808 11.896  1.00 57.89  ? 309 PHE D CD2 1 
ATOM   733  C  CE1 . PHE B 2 30 ? -18.015 -13.202 12.443  1.00 60.33  ? 309 PHE D CE1 1 
ATOM   734  C  CE2 . PHE B 2 30 ? -19.107 -11.746 10.896  1.00 63.87  ? 309 PHE D CE2 1 
ATOM   735  C  CZ  . PHE B 2 30 ? -18.482 -12.948 11.173  1.00 64.30  ? 309 PHE D CZ  1 
ATOM   736  N  N   . ILE B 2 31 ? -20.879 -9.092  16.959  1.00 64.57  ? 310 ILE D N   1 
ATOM   737  C  CA  . ILE B 2 31 ? -21.008 -7.937  17.844  1.00 65.92  ? 310 ILE D CA  1 
ATOM   738  C  C   . ILE B 2 31 ? -20.532 -8.265  19.257  1.00 62.04  ? 310 ILE D C   1 
ATOM   739  O  O   . ILE B 2 31 ? -19.953 -7.408  19.939  1.00 43.80  ? 310 ILE D O   1 
ATOM   740  C  CB  . ILE B 2 31 ? -22.456 -7.407  17.846  1.00 70.64  ? 310 ILE D CB  1 
ATOM   741  C  CG1 . ILE B 2 31 ? -22.833 -6.879  16.460  1.00 77.98  ? 310 ILE D CG1 1 
ATOM   742  C  CG2 . ILE B 2 31 ? -22.625 -6.298  18.880  1.00 72.16  ? 310 ILE D CG2 1 
ATOM   743  C  CD1 . ILE B 2 31 ? -24.080 -6.017  16.458  1.00 82.98  ? 310 ILE D CD1 1 
ATOM   744  N  N   . TYR B 2 32 ? -20.749 -9.500  19.719  1.00 57.80  ? 311 TYR D N   1 
ATOM   745  C  CA  . TYR B 2 32 ? -20.353 -9.854  21.078  1.00 57.35  ? 311 TYR D CA  1 
ATOM   746  C  C   . TYR B 2 32 ? -18.857 -9.652  21.292  1.00 58.13  ? 311 TYR D C   1 
ATOM   747  O  O   . TYR B 2 32 ? -18.441 -9.069  22.299  1.00 56.33  ? 311 TYR D O   1 
ATOM   748  C  CB  . TYR B 2 32 ? -20.743 -11.291 21.403  1.00 59.03  ? 311 TYR D CB  1 
ATOM   749  C  CG  . TYR B 2 32 ? -20.408 -11.637 22.822  1.00 62.86  ? 311 TYR D CG  1 
ATOM   750  C  CD1 . TYR B 2 32 ? -21.198 -11.194 23.870  1.00 67.56  ? 311 TYR D CD1 1 
ATOM   751  C  CD2 . TYR B 2 32 ? -19.271 -12.361 23.120  1.00 63.44  ? 311 TYR D CD2 1 
ATOM   752  C  CE1 . TYR B 2 32 ? -20.875 -11.491 25.179  1.00 70.03  ? 311 TYR D CE1 1 
ATOM   753  C  CE2 . TYR B 2 32 ? -18.941 -12.665 24.419  1.00 67.29  ? 311 TYR D CE2 1 
ATOM   754  C  CZ  . TYR B 2 32 ? -19.743 -12.227 25.445  1.00 68.95  ? 311 TYR D CZ  1 
ATOM   755  O  OH  . TYR B 2 32 ? -19.406 -12.527 26.741  1.00 70.12  ? 311 TYR D OH  1 
ATOM   756  N  N   . ARG B 2 33 ? -18.032 -10.138 20.361  1.00 61.55  ? 312 ARG D N   1 
ATOM   757  C  CA  . ARG B 2 33 ? -16.589 -10.004 20.510  1.00 58.21  ? 312 ARG D CA  1 
ATOM   758  C  C   . ARG B 2 33 ? -16.102 -8.586  20.223  1.00 58.40  ? 312 ARG D C   1 
ATOM   759  O  O   . ARG B 2 33 ? -15.145 -8.134  20.863  1.00 60.77  ? 312 ARG D O   1 
ATOM   760  C  CB  . ARG B 2 33 ? -15.868 -10.998 19.603  1.00 57.94  ? 312 ARG D CB  1 
ATOM   761  C  CG  . ARG B 2 33 ? -15.999 -12.437 20.031  1.00 64.26  ? 312 ARG D CG  1 
ATOM   762  C  CD  . ARG B 2 33 ? -14.731 -13.185 19.691  1.00 75.10  ? 312 ARG D CD  1 
ATOM   763  N  NE  . ARG B 2 33 ? -13.577 -12.530 20.300  1.00 84.03  ? 312 ARG D NE  1 
ATOM   764  C  CZ  . ARG B 2 33 ? -12.321 -12.935 20.157  1.00 85.72  ? 312 ARG D CZ  1 
ATOM   765  N  NH1 . ARG B 2 33 ? -12.050 -14.005 19.420  1.00 88.68  ? 312 ARG D NH1 1 
ATOM   766  N  NH2 . ARG B 2 33 ? -11.334 -12.275 20.754  1.00 86.12  ? 312 ARG D NH2 1 
ATOM   767  N  N   . MET B 2 34 ? -16.715 -7.878  19.265  1.00 60.06  ? 313 MET D N   1 
ATOM   768  C  CA  . MET B 2 34 ? -16.336 -6.483  19.042  1.00 66.27  ? 313 MET D CA  1 
ATOM   769  C  C   . MET B 2 34 ? -16.458 -5.674  20.323  1.00 78.31  ? 313 MET D C   1 
ATOM   770  O  O   . MET B 2 34 ? -15.667 -4.757  20.568  1.00 80.30  ? 313 MET D O   1 
ATOM   771  C  CB  . MET B 2 34 ? -17.186 -5.843  17.944  1.00 64.76  ? 313 MET D CB  1 
ATOM   772  C  CG  . MET B 2 34 ? -16.931 -6.370  16.542  1.00 64.24  ? 313 MET D CG  1 
ATOM   773  S  SD  . MET B 2 34 ? -17.971 -5.500  15.361  1.00 63.49  ? 313 MET D SD  1 
ATOM   774  C  CE  . MET B 2 34 ? -17.635 -6.451  13.891  1.00 64.62  ? 313 MET D CE  1 
ATOM   775  N  N   . ARG B 2 35 ? -17.449 -6.006  21.149  1.00 88.01  ? 314 ARG D N   1 
ATOM   776  C  CA  . ARG B 2 35 ? -17.647 -5.318  22.416  1.00 91.08  ? 314 ARG D CA  1 
ATOM   777  C  C   . ARG B 2 35 ? -16.455 -5.533  23.333  1.00 84.67  ? 314 ARG D C   1 
ATOM   778  O  O   . ARG B 2 35 ? -16.120 -4.658  24.141  1.00 86.04  ? 314 ARG D O   1 
ATOM   779  C  CB  . ARG B 2 35 ? -18.910 -5.889  23.040  1.00 98.66  ? 314 ARG D CB  1 
ATOM   780  C  CG  . ARG B 2 35 ? -20.119 -5.513  22.240  1.00 105.59 ? 314 ARG D CG  1 
ATOM   781  C  CD  . ARG B 2 35 ? -21.445 -5.823  22.912  1.00 109.82 ? 314 ARG D CD  1 
ATOM   782  N  NE  . ARG B 2 35 ? -22.531 -5.111  22.258  1.00 114.42 ? 314 ARG D NE  1 
ATOM   783  C  CZ  . ARG B 2 35 ? -23.814 -5.356  22.492  1.00 125.60 ? 314 ARG D CZ  1 
ATOM   784  N  NH1 . ARG B 2 35 ? -24.152 -6.304  23.348  1.00 132.19 ? 314 ARG D NH1 1 
ATOM   785  N  NH2 . ARG B 2 35 ? -24.748 -4.668  21.856  1.00 130.06 ? 314 ARG D NH2 1 
ATOM   786  N  N   . GLN B 2 36 ? -15.765 -6.661  23.165  1.00 73.22  ? 315 GLN D N   1 
ATOM   787  C  CA  . GLN B 2 36 ? -14.592 -7.015  23.952  1.00 71.29  ? 315 GLN D CA  1 
ATOM   788  C  C   . GLN B 2 36 ? -13.334 -6.426  23.337  1.00 74.07  ? 315 GLN D C   1 
ATOM   789  O  O   . GLN B 2 36 ? -12.517 -5.816  24.032  1.00 78.23  ? 315 GLN D O   1 
ATOM   790  C  CB  . GLN B 2 36 ? -14.422 -8.532  24.023  1.00 68.13  ? 315 GLN D CB  1 
ATOM   791  C  CG  . GLN B 2 36 ? -15.587 -9.329  24.527  1.00 69.68  ? 315 GLN D CG  1 
ATOM   792  C  CD  . GLN B 2 36 ? -15.285 -10.822 24.453  1.00 71.96  ? 315 GLN D CD  1 
ATOM   793  O  OE1 . GLN B 2 36 ? -14.309 -11.232 23.826  1.00 71.47  ? 315 GLN D OE1 1 
ATOM   794  N  NE2 . GLN B 2 36 ? -16.132 -11.633 25.070  1.00 78.03  ? 315 GLN D NE2 1 
ATOM   795  N  N   . LEU B 2 37 ? -13.172 -6.625  22.029  1.00 68.51  ? 316 LEU D N   1 
ATOM   796  C  CA  . LEU B 2 37 ? -12.007 -6.119  21.322  1.00 60.23  ? 316 LEU D CA  1 
ATOM   797  C  C   . LEU B 2 37 ? -12.023 -4.601  21.243  1.00 65.09  ? 316 LEU D C   1 
ATOM   798  O  O   . LEU B 2 37 ? -10.957 -3.982  21.150  1.00 68.70  ? 316 LEU D O   1 
ATOM   799  C  CB  . LEU B 2 37 ? -11.955 -6.730  19.926  1.00 50.35  ? 316 LEU D CB  1 
ATOM   800  C  CG  . LEU B 2 37 ? -11.802 -8.249  19.914  1.00 49.35  ? 316 LEU D CG  1 
ATOM   801  C  CD1 . LEU B 2 37 ? -11.946 -8.805  18.497  1.00 46.80  ? 316 LEU D CD1 1 
ATOM   802  C  CD2 . LEU B 2 37 ? -10.468 -8.637  20.517  1.00 51.76  ? 316 LEU D CD2 1 
ATOM   803  N  N   . GLY B 2 38 ? -13.201 -3.984  21.316  1.00 64.50  ? 317 GLY D N   1 
ATOM   804  C  CA  . GLY B 2 38 ? -13.316 -2.557  21.107  1.00 66.35  ? 317 GLY D CA  1 
ATOM   805  C  C   . GLY B 2 38 ? -13.770 -2.237  19.695  1.00 66.59  ? 317 GLY D C   1 
ATOM   806  O  O   . GLY B 2 38 ? -13.923 -3.109  18.836  1.00 58.22  ? 317 GLY D O   1 
ATOM   807  N  N   . TYR B 2 39 ? -14.016 -0.963  19.464  1.00 76.59  ? 318 TYR D N   1 
ATOM   808  C  CA  . TYR B 2 39 ? -14.528 -0.561  18.169  1.00 79.44  ? 318 TYR D CA  1 
ATOM   809  C  C   . TYR B 2 39 ? -13.420 -0.779  17.145  1.00 81.65  ? 318 TYR D C   1 
ATOM   810  O  O   . TYR B 2 39 ? -12.263 -0.428  17.410  1.00 86.61  ? 318 TYR D O   1 
ATOM   811  C  CB  . TYR B 2 39 ? -14.943 0.901   18.201  1.00 86.66  ? 318 TYR D CB  1 
ATOM   812  C  CG  . TYR B 2 39 ? -15.825 1.319   17.058  1.00 92.25  ? 318 TYR D CG  1 
ATOM   813  C  CD1 . TYR B 2 39 ? -15.281 1.795   15.880  1.00 93.63  ? 318 TYR D CD1 1 
ATOM   814  C  CD2 . TYR B 2 39 ? -17.211 1.265   17.170  1.00 96.32  ? 318 TYR D CD2 1 
ATOM   815  C  CE1 . TYR B 2 39 ? -16.083 2.188   14.836  1.00 97.00  ? 318 TYR D CE1 1 
ATOM   816  C  CE2 . TYR B 2 39 ? -18.021 1.654   16.129  1.00 99.10  ? 318 TYR D CE2 1 
ATOM   817  C  CZ  . TYR B 2 39 ? -17.451 2.116   14.965  1.00 99.85  ? 318 TYR D CZ  1 
ATOM   818  O  OH  . TYR B 2 39 ? -18.257 2.500   13.923  1.00 102.86 ? 318 TYR D OH  1 
ATOM   819  N  N   . PRO B 2 40 ? -13.718 -1.370  15.991  1.00 79.75  ? 319 PRO D N   1 
ATOM   820  C  CA  . PRO B 2 40 ? -12.670 -1.612  14.988  1.00 77.11  ? 319 PRO D CA  1 
ATOM   821  C  C   . PRO B 2 40 ? -11.967 -0.325  14.609  1.00 78.91  ? 319 PRO D C   1 
ATOM   822  O  O   . PRO B 2 40 ? -12.596 0.612   14.092  1.00 77.54  ? 319 PRO D O   1 
ATOM   823  C  CB  . PRO B 2 40 ? -13.425 -2.206  13.787  1.00 74.76  ? 319 PRO D CB  1 
ATOM   824  C  CG  . PRO B 2 40 ? -14.860 -2.059  14.071  1.00 78.23  ? 319 PRO D CG  1 
ATOM   825  C  CD  . PRO B 2 40 ? -15.065 -1.740  15.524  1.00 80.70  ? 319 PRO D CD  1 
ATOM   826  N  N   . PRO B 2 41 ? -10.650 -0.254  14.822  1.00 80.99  ? 320 PRO D N   1 
ATOM   827  C  CA  . PRO B 2 41 ? -9.951  1.018   14.589  1.00 82.57  ? 320 PRO D CA  1 
ATOM   828  C  C   . PRO B 2 41 ? -10.014 1.473   13.145  1.00 85.03  ? 320 PRO D C   1 
ATOM   829  O  O   . PRO B 2 41 ? -10.025 2.683   12.892  1.00 87.10  ? 320 PRO D O   1 
ATOM   830  C  CB  . PRO B 2 41 ? -8.516  0.719   15.037  1.00 78.81  ? 320 PRO D CB  1 
ATOM   831  C  CG  . PRO B 2 41 ? -8.382  -0.758  14.907  1.00 76.60  ? 320 PRO D CG  1 
ATOM   832  C  CD  . PRO B 2 41 ? -9.727  -1.337  15.211  1.00 76.78  ? 320 PRO D CD  1 
ATOM   833  N  N   . GLY B 2 42 ? -10.074 0.548   12.184  1.00 86.85  ? 321 GLY D N   1 
ATOM   834  C  CA  . GLY B 2 42 ? -10.112 0.985   10.801  1.00 89.33  ? 321 GLY D CA  1 
ATOM   835  C  C   . GLY B 2 42 ? -11.405 1.662   10.385  1.00 90.29  ? 321 GLY D C   1 
ATOM   836  O  O   . GLY B 2 42 ? -11.428 2.303   9.329   1.00 91.74  ? 321 GLY D O   1 
ATOM   837  N  N   . TRP B 2 43 ? -12.457 1.580   11.205  1.00 86.20  ? 322 TRP D N   1 
ATOM   838  C  CA  . TRP B 2 43 ? -13.692 2.295   10.914  1.00 80.35  ? 322 TRP D CA  1 
ATOM   839  C  C   . TRP B 2 43 ? -13.726 3.676   11.547  1.00 87.47  ? 322 TRP D C   1 
ATOM   840  O  O   . TRP B 2 43 ? -14.428 4.556   11.035  1.00 92.55  ? 322 TRP D O   1 
ATOM   841  C  CB  . TRP B 2 43 ? -14.920 1.487   11.365  1.00 66.04  ? 322 TRP D CB  1 
ATOM   842  C  CG  . TRP B 2 43 ? -15.267 0.359   10.437  1.00 54.80  ? 322 TRP D CG  1 
ATOM   843  C  CD1 . TRP B 2 43 ? -15.128 -0.978  10.683  1.00 50.61  ? 322 TRP D CD1 1 
ATOM   844  C  CD2 . TRP B 2 43 ? -15.819 0.469   9.112   1.00 52.34  ? 322 TRP D CD2 1 
ATOM   845  N  NE1 . TRP B 2 43 ? -15.556 -1.710  9.595   1.00 43.06  ? 322 TRP D NE1 1 
ATOM   846  C  CE2 . TRP B 2 43 ? -15.979 -0.846  8.617   1.00 48.98  ? 322 TRP D CE2 1 
ATOM   847  C  CE3 . TRP B 2 43 ? -16.189 1.545   8.298   1.00 50.38  ? 322 TRP D CE3 1 
ATOM   848  C  CZ2 . TRP B 2 43 ? -16.495 -1.111  7.346   1.00 45.47  ? 322 TRP D CZ2 1 
ATOM   849  C  CZ3 . TRP B 2 43 ? -16.708 1.277   7.034   1.00 50.71  ? 322 TRP D CZ3 1 
ATOM   850  C  CH2 . TRP B 2 43 ? -16.853 -0.041  6.574   1.00 54.96  ? 322 TRP D CH2 1 
ATOM   851  N  N   . LEU B 2 44 ? -12.964 3.889   12.624  1.00 88.34  ? 323 LEU D N   1 
ATOM   852  C  CA  . LEU B 2 44 ? -12.864 5.220   13.209  1.00 93.47  ? 323 LEU D CA  1 
ATOM   853  C  C   . LEU B 2 44 ? -12.339 6.227   12.198  1.00 101.83 ? 323 LEU D C   1 
ATOM   854  O  O   . LEU B 2 44 ? -12.741 7.396   12.216  1.00 109.36 ? 323 LEU D O   1 
ATOM   855  C  CB  . LEU B 2 44 ? -11.958 5.182   14.441  1.00 90.41  ? 323 LEU D CB  1 
ATOM   856  N  N   . LYS B 2 45 ? -11.453 5.794   11.307  1.00 100.48 ? 324 LYS D N   1 
ATOM   857  C  CA  . LYS B 2 45 ? -10.891 6.688   10.300  1.00 102.63 ? 324 LYS D CA  1 
ATOM   858  C  C   . LYS B 2 45 ? -11.313 6.282   8.893   1.00 101.07 ? 324 LYS D C   1 
ATOM   859  O  O   . LYS B 2 45 ? -10.745 5.356   8.310   1.00 98.12  ? 324 LYS D O   1 
ATOM   860  C  CB  . LYS B 2 45 ? -9.363  6.711   10.391  1.00 100.71 ? 324 LYS D CB  1 
ATOM   861  N  N   . ALA C 1 10 ? -5.276  -23.105 29.144  1.00 136.69 ? 6   ALA B N   1 
ATOM   862  C  CA  . ALA C 1 10 ? -5.545  -24.149 28.161  1.00 138.54 ? 6   ALA B CA  1 
ATOM   863  C  C   . ALA C 1 10 ? -6.879  -24.826 28.446  1.00 133.34 ? 6   ALA B C   1 
ATOM   864  O  O   . ALA C 1 10 ? -7.939  -24.269 28.157  1.00 127.77 ? 6   ALA B O   1 
ATOM   865  C  CB  . ALA C 1 10 ? -4.423  -25.171 28.150  1.00 143.56 ? 6   ALA B CB  1 
ATOM   866  N  N   . GLU C 1 11 ? -6.821  -26.034 29.013  1.00 139.36 ? 7   GLU B N   1 
ATOM   867  C  CA  . GLU C 1 11 ? -8.046  -26.738 29.374  1.00 140.44 ? 7   GLU B CA  1 
ATOM   868  C  C   . GLU C 1 11 ? -8.857  -25.941 30.385  1.00 141.72 ? 7   GLU B C   1 
ATOM   869  O  O   . GLU C 1 11 ? -10.087 -25.856 30.280  1.00 138.00 ? 7   GLU B O   1 
ATOM   870  C  CB  . GLU C 1 11 ? -7.711  -28.124 29.926  1.00 147.49 ? 7   GLU B CB  1 
ATOM   871  N  N   . ALA C 1 12 ? -8.181  -25.335 31.365  1.00 145.03 ? 8   ALA B N   1 
ATOM   872  C  CA  . ALA C 1 12 ? -8.881  -24.566 32.389  1.00 144.15 ? 8   ALA B CA  1 
ATOM   873  C  C   . ALA C 1 12 ? -9.537  -23.317 31.815  1.00 146.61 ? 8   ALA B C   1 
ATOM   874  O  O   . ALA C 1 12 ? -10.575 -22.879 32.323  1.00 133.53 ? 8   ALA B O   1 
ATOM   875  C  CB  . ALA C 1 12 ? -7.918  -24.191 33.515  1.00 152.94 ? 8   ALA B CB  1 
ATOM   876  N  N   . ASP C 1 13 ? -8.959  -22.726 30.767  1.00 146.28 ? 9   ASP B N   1 
ATOM   877  C  CA  . ASP C 1 13 ? -9.590  -21.564 30.150  1.00 81.69  ? 9   ASP B CA  1 
ATOM   878  C  C   . ASP C 1 13 ? -10.874 -21.919 29.412  1.00 94.07  ? 9   ASP B C   1 
ATOM   879  O  O   . ASP C 1 13 ? -11.665 -21.017 29.112  1.00 86.49  ? 9   ASP B O   1 
ATOM   880  C  CB  . ASP C 1 13 ? -8.619  -20.878 29.190  1.00 86.80  ? 9   ASP B CB  1 
ATOM   881  N  N   . ARG C 1 14 ? -11.096 -23.199 29.109  1.00 96.60  ? 10  ARG B N   1 
ATOM   882  C  CA  . ARG C 1 14 ? -12.292 -23.642 28.407  1.00 92.41  ? 10  ARG B CA  1 
ATOM   883  C  C   . ARG C 1 14 ? -13.389 -24.131 29.341  1.00 91.29  ? 10  ARG B C   1 
ATOM   884  O  O   . ARG C 1 14 ? -14.530 -24.293 28.894  1.00 84.40  ? 10  ARG B O   1 
ATOM   885  C  CB  . ARG C 1 14 ? -11.942 -24.764 27.417  1.00 95.01  ? 10  ARG B CB  1 
ATOM   886  N  N   . THR C 1 15 ? -13.080 -24.358 30.615  1.00 99.07  ? 11  THR B N   1 
ATOM   887  C  CA  . THR C 1 15 ? -14.005 -24.989 31.546  1.00 105.63 ? 11  THR B CA  1 
ATOM   888  C  C   . THR C 1 15 ? -14.582 -23.956 32.513  1.00 102.18 ? 11  THR B C   1 
ATOM   889  O  O   . THR C 1 15 ? -13.888 -23.032 32.947  1.00 109.36 ? 11  THR B O   1 
ATOM   890  C  CB  . THR C 1 15 ? -13.303 -26.125 32.306  1.00 116.25 ? 11  THR B CB  1 
ATOM   891  O  OG1 . THR C 1 15 ? -14.270 -26.902 33.021  1.00 126.15 ? 11  THR B OG1 1 
ATOM   892  C  CG2 . THR C 1 15 ? -12.266 -25.579 33.280  1.00 121.62 ? 11  THR B CG2 1 
ATOM   893  N  N   . LEU C 1 16 ? -15.866 -24.109 32.831  1.00 98.96  ? 12  LEU B N   1 
ATOM   894  C  CA  . LEU C 1 16 ? -16.581 -23.192 33.709  1.00 94.50  ? 12  LEU B CA  1 
ATOM   895  C  C   . LEU C 1 16 ? -16.973 -23.891 35.006  1.00 91.61  ? 12  LEU B C   1 
ATOM   896  O  O   . LEU C 1 16 ? -17.274 -25.089 35.016  1.00 95.38  ? 12  LEU B O   1 
ATOM   897  C  CB  . LEU C 1 16 ? -17.842 -22.648 33.032  1.00 60.44  ? 12  LEU B CB  1 
ATOM   898  C  CG  . LEU C 1 16 ? -17.796 -21.227 32.467  1.00 72.44  ? 12  LEU B CG  1 
ATOM   899  C  CD1 . LEU C 1 16 ? -19.196 -20.746 32.113  1.00 52.21  ? 12  LEU B CD1 1 
ATOM   900  C  CD2 . LEU C 1 16 ? -17.129 -20.285 33.450  1.00 74.38  ? 12  LEU B CD2 1 
ATOM   901  N  N   . PHE C 1 17 ? -16.960 -23.135 36.102  1.00 83.62  ? 13  PHE B N   1 
ATOM   902  C  CA  . PHE C 1 17 ? -17.527 -23.599 37.360  1.00 81.65  ? 13  PHE B CA  1 
ATOM   903  C  C   . PHE C 1 17 ? -18.963 -23.118 37.480  1.00 71.99  ? 13  PHE B C   1 
ATOM   904  O  O   . PHE C 1 17 ? -19.242 -21.923 37.345  1.00 66.81  ? 13  PHE B O   1 
ATOM   905  C  CB  . PHE C 1 17 ? -16.734 -23.104 38.570  1.00 85.68  ? 13  PHE B CB  1 
ATOM   906  C  CG  . PHE C 1 17 ? -17.415 -23.388 39.883  1.00 90.03  ? 13  PHE B CG  1 
ATOM   907  C  CD1 . PHE C 1 17 ? -17.327 -24.642 40.472  1.00 94.50  ? 13  PHE B CD1 1 
ATOM   908  C  CD2 . PHE C 1 17 ? -18.166 -22.409 40.518  1.00 89.61  ? 13  PHE B CD2 1 
ATOM   909  C  CE1 . PHE C 1 17 ? -17.961 -24.910 41.671  1.00 95.04  ? 13  PHE B CE1 1 
ATOM   910  C  CE2 . PHE C 1 17 ? -18.807 -22.674 41.722  1.00 91.31  ? 13  PHE B CE2 1 
ATOM   911  C  CZ  . PHE C 1 17 ? -18.703 -23.926 42.296  1.00 94.66  ? 13  PHE B CZ  1 
ATOM   912  N  N   . VAL C 1 18 ? -19.868 -24.049 37.753  1.00 72.49  ? 14  VAL B N   1 
ATOM   913  C  CA  . VAL C 1 18 ? -21.274 -23.734 37.941  1.00 75.28  ? 14  VAL B CA  1 
ATOM   914  C  C   . VAL C 1 18 ? -21.693 -24.333 39.275  1.00 83.47  ? 14  VAL B C   1 
ATOM   915  O  O   . VAL C 1 18 ? -21.534 -25.538 39.496  1.00 90.51  ? 14  VAL B O   1 
ATOM   916  C  CB  . VAL C 1 18 ? -22.130 -24.272 36.785  1.00 74.04  ? 14  VAL B CB  1 
ATOM   917  C  CG1 . VAL C 1 18 ? -23.606 -24.007 37.032  1.00 77.47  ? 14  VAL B CG1 1 
ATOM   918  C  CG2 . VAL C 1 18 ? -21.676 -23.639 35.481  1.00 70.01  ? 14  VAL B CG2 1 
ATOM   919  N  N   . GLY C 1 19 ? -22.239 -23.501 40.161  1.00 83.09  ? 15  GLY B N   1 
ATOM   920  C  CA  . GLY C 1 19 ? -22.607 -23.916 41.494  1.00 89.75  ? 15  GLY B CA  1 
ATOM   921  C  C   . GLY C 1 19 ? -24.073 -23.657 41.784  1.00 88.24  ? 15  GLY B C   1 
ATOM   922  O  O   . GLY C 1 19 ? -24.842 -23.229 40.919  1.00 83.75  ? 15  GLY B O   1 
ATOM   923  N  N   . ASN C 1 20 ? -24.449 -23.957 43.030  1.00 90.03  ? 16  ASN B N   1 
ATOM   924  C  CA  . ASN C 1 20 ? -25.816 -23.753 43.505  1.00 89.78  ? 16  ASN B CA  1 
ATOM   925  C  C   . ASN C 1 20 ? -26.788 -24.611 42.694  1.00 89.75  ? 16  ASN B C   1 
ATOM   926  O  O   . ASN C 1 20 ? -27.945 -24.244 42.489  1.00 84.98  ? 16  ASN B O   1 
ATOM   927  C  CB  . ASN C 1 20 ? -26.207 -22.268 43.482  1.00 86.52  ? 16  ASN B CB  1 
ATOM   928  C  CG  . ASN C 1 20 ? -27.430 -21.976 44.328  1.00 89.20  ? 16  ASN B CG  1 
ATOM   929  O  OD1 . ASN C 1 20 ? -27.816 -22.772 45.183  1.00 92.48  ? 16  ASN B OD1 1 
ATOM   930  N  ND2 . ASN C 1 20 ? -28.039 -20.818 44.104  1.00 87.52  ? 16  ASN B ND2 1 
ATOM   931  N  N   . LEU C 1 21 ? -26.288 -25.742 42.203  1.00 97.01  ? 17  LEU B N   1 
ATOM   932  C  CA  . LEU C 1 21 ? -27.081 -26.642 41.376  1.00 100.93 ? 17  LEU B CA  1 
ATOM   933  C  C   . LEU C 1 21 ? -28.122 -27.390 42.186  1.00 106.49 ? 17  LEU B C   1 
ATOM   934  O  O   . LEU C 1 21 ? -27.860 -27.856 43.298  1.00 111.51 ? 17  LEU B O   1 
ATOM   935  C  CB  . LEU C 1 21 ? -26.188 -27.648 40.655  1.00 101.79 ? 17  LEU B CB  1 
ATOM   936  C  CG  . LEU C 1 21 ? -25.126 -27.004 39.778  1.00 96.50  ? 17  LEU B CG  1 
ATOM   937  C  CD1 . LEU C 1 21 ? -24.389 -28.076 39.036  1.00 72.51  ? 17  LEU B CD1 1 
ATOM   938  C  CD2 . LEU C 1 21 ? -25.772 -26.018 38.833  1.00 65.04  ? 17  LEU B CD2 1 
ATOM   939  N  N   . GLU C 1 22 ? -29.303 -27.514 41.601  1.00 107.28 ? 18  GLU B N   1 
ATOM   940  C  CA  . GLU C 1 22 ? -30.368 -28.295 42.191  1.00 115.54 ? 18  GLU B CA  1 
ATOM   941  C  C   . GLU C 1 22 ? -30.081 -29.792 42.108  1.00 124.16 ? 18  GLU B C   1 
ATOM   942  O  O   . GLU C 1 22 ? -29.355 -30.265 41.229  1.00 131.62 ? 18  GLU B O   1 
ATOM   943  C  CB  . GLU C 1 22 ? -31.684 -27.970 41.483  1.00 116.50 ? 18  GLU B CB  1 
ATOM   944  C  CG  . GLU C 1 22 ? -32.809 -28.960 41.725  1.00 119.74 ? 18  GLU B CG  1 
ATOM   945  C  CD  . GLU C 1 22 ? -33.289 -28.983 43.143  1.00 122.63 ? 18  GLU B CD  1 
ATOM   946  O  OE1 . GLU C 1 22 ? -32.613 -28.379 43.993  1.00 124.58 ? 18  GLU B OE1 1 
ATOM   947  O  OE2 . GLU C 1 22 ? -34.340 -29.606 43.397  1.00 123.97 ? 18  GLU B OE2 1 
ATOM   948  N  N   . THR C 1 23 ? -30.650 -30.538 43.062  1.00 126.70 ? 19  THR B N   1 
ATOM   949  C  CA  . THR C 1 23 ? -30.442 -31.979 43.117  1.00 129.12 ? 19  THR B CA  1 
ATOM   950  C  C   . THR C 1 23 ? -30.988 -32.675 41.880  1.00 129.95 ? 19  THR B C   1 
ATOM   951  O  O   . THR C 1 23 ? -30.448 -33.705 41.462  1.00 138.61 ? 19  THR B O   1 
ATOM   952  C  CB  . THR C 1 23 ? -31.103 -32.567 44.357  1.00 129.91 ? 19  THR B CB  1 
ATOM   953  O  OG1 . THR C 1 23 ? -32.518 -32.342 44.293  1.00 128.07 ? 19  THR B OG1 1 
ATOM   954  C  CG2 . THR C 1 23 ? -30.552 -31.920 45.589  1.00 129.74 ? 19  THR B CG2 1 
ATOM   955  N  N   . LYS C 1 24 ? -32.063 -32.144 41.290  1.00 120.50 ? 20  LYS B N   1 
ATOM   956  C  CA  . LYS C 1 24 ? -32.650 -32.793 40.125  1.00 117.86 ? 20  LYS B CA  1 
ATOM   957  C  C   . LYS C 1 24 ? -31.802 -32.610 38.878  1.00 111.94 ? 20  LYS B C   1 
ATOM   958  O  O   . LYS C 1 24 ? -31.947 -33.383 37.925  1.00 112.50 ? 20  LYS B O   1 
ATOM   959  C  CB  . LYS C 1 24 ? -34.043 -32.232 39.826  1.00 114.85 ? 20  LYS B CB  1 
ATOM   960  C  CG  . LYS C 1 24 ? -35.148 -32.464 40.837  1.00 118.92 ? 20  LYS B CG  1 
ATOM   961  C  CD  . LYS C 1 24 ? -36.418 -31.824 40.270  1.00 115.72 ? 20  LYS B CD  1 
ATOM   962  C  CE  . LYS C 1 24 ? -37.589 -31.853 41.236  1.00 119.89 ? 20  LYS B CE  1 
ATOM   963  N  NZ  . LYS C 1 24 ? -38.691 -30.931 40.828  1.00 117.14 ? 20  LYS B NZ  1 
ATOM   964  N  N   . VAL C 1 25 ? -30.924 -31.602 38.869  1.00 104.79 ? 21  VAL B N   1 
ATOM   965  C  CA  . VAL C 1 25 ? -30.104 -31.311 37.700  1.00 97.62  ? 21  VAL B CA  1 
ATOM   966  C  C   . VAL C 1 25 ? -29.213 -32.502 37.366  1.00 100.36 ? 21  VAL B C   1 
ATOM   967  O  O   . VAL C 1 25 ? -28.589 -33.110 38.247  1.00 104.77 ? 21  VAL B O   1 
ATOM   968  C  CB  . VAL C 1 25 ? -29.284 -30.032 37.939  1.00 93.48  ? 21  VAL B CB  1 
ATOM   969  C  CG1 . VAL C 1 25 ? -28.373 -29.752 36.762  1.00 93.61  ? 21  VAL B CG1 1 
ATOM   970  C  CG2 . VAL C 1 25 ? -30.203 -28.842 38.174  1.00 88.14  ? 21  VAL B CG2 1 
ATOM   971  N  N   . THR C 1 26 ? -29.159 -32.842 36.085  1.00 99.38  ? 22  THR B N   1 
ATOM   972  C  CA  . THR C 1 26 ? -28.367 -33.953 35.587  1.00 102.60 ? 22  THR B CA  1 
ATOM   973  C  C   . THR C 1 26 ? -27.316 -33.418 34.624  1.00 100.98 ? 22  THR B C   1 
ATOM   974  O  O   . THR C 1 26 ? -27.392 -32.275 34.163  1.00 94.95  ? 22  THR B O   1 
ATOM   975  C  CB  . THR C 1 26 ? -29.249 -34.993 34.884  1.00 102.71 ? 22  THR B CB  1 
ATOM   976  O  OG1 . THR C 1 26 ? -29.945 -34.366 33.799  1.00 100.14 ? 22  THR B OG1 1 
ATOM   977  C  CG2 . THR C 1 26 ? -30.257 -35.577 35.854  1.00 103.50 ? 22  THR B CG2 1 
ATOM   978  N  N   . GLU C 1 27 ? -26.324 -34.259 34.328  1.00 106.05 ? 23  GLU B N   1 
ATOM   979  C  CA  . GLU C 1 27 ? -25.293 -33.865 33.373  1.00 103.10 ? 23  GLU B CA  1 
ATOM   980  C  C   . GLU C 1 27 ? -25.900 -33.593 32.003  1.00 98.54  ? 23  GLU B C   1 
ATOM   981  O  O   . GLU C 1 27 ? -25.494 -32.654 31.309  1.00 93.79  ? 23  GLU B O   1 
ATOM   982  C  CB  . GLU C 1 27 ? -24.219 -34.944 33.273  1.00 107.38 ? 23  GLU B CB  1 
ATOM   983  C  CG  . GLU C 1 27 ? -23.454 -35.188 34.550  1.00 114.31 ? 23  GLU B CG  1 
ATOM   984  C  CD  . GLU C 1 27 ? -22.456 -36.335 34.415  1.00 125.09 ? 23  GLU B CD  1 
ATOM   985  O  OE1 . GLU C 1 27 ? -22.494 -37.038 33.375  1.00 129.51 ? 23  GLU B OE1 1 
ATOM   986  O  OE2 . GLU C 1 27 ? -21.632 -36.528 35.343  1.00 130.25 ? 23  GLU B OE2 1 
ATOM   987  N  N   . GLU C 1 28 ? -26.883 -34.404 31.602  1.00 99.32  ? 24  GLU B N   1 
ATOM   988  C  CA  . GLU C 1 28 ? -27.556 -34.188 30.326  1.00 94.51  ? 24  GLU B CA  1 
ATOM   989  C  C   . GLU C 1 28 ? -28.306 -32.862 30.301  1.00 88.84  ? 24  GLU B C   1 
ATOM   990  O  O   . GLU C 1 28 ? -28.429 -32.241 29.238  1.00 86.24  ? 24  GLU B O   1 
ATOM   991  C  CB  . GLU C 1 28 ? -28.509 -35.347 30.034  1.00 97.90  ? 24  GLU B CB  1 
ATOM   992  N  N   . LEU C 1 29 ? -28.828 -32.419 31.446  1.00 87.33  ? 25  LEU B N   1 
ATOM   993  C  CA  . LEU C 1 29 ? -29.527 -31.138 31.485  1.00 84.57  ? 25  LEU B CA  1 
ATOM   994  C  C   . LEU C 1 29 ? -28.558 -29.976 31.312  1.00 83.42  ? 25  LEU B C   1 
ATOM   995  O  O   . LEU C 1 29 ? -28.797 -29.072 30.504  1.00 80.66  ? 25  LEU B O   1 
ATOM   996  C  CB  . LEU C 1 29 ? -30.302 -30.987 32.792  1.00 85.00  ? 25  LEU B CB  1 
ATOM   997  C  CG  . LEU C 1 29 ? -31.238 -29.776 32.740  1.00 79.27  ? 25  LEU B CG  1 
ATOM   998  C  CD1 . LEU C 1 29 ? -32.386 -30.051 31.783  1.00 76.82  ? 25  LEU B CD1 1 
ATOM   999  C  CD2 . LEU C 1 29 ? -31.761 -29.394 34.121  1.00 84.75  ? 25  LEU B CD2 1 
ATOM   1000 N  N   . LEU C 1 30 ? -27.460 -29.979 32.071  1.00 86.00  ? 26  LEU B N   1 
ATOM   1001 C  CA  . LEU C 1 30 ? -26.484 -28.895 31.970  1.00 81.13  ? 26  LEU B CA  1 
ATOM   1002 C  C   . LEU C 1 30 ? -25.843 -28.852 30.590  1.00 82.87  ? 26  LEU B C   1 
ATOM   1003 O  O   . LEU C 1 30 ? -25.558 -27.768 30.067  1.00 81.58  ? 26  LEU B O   1 
ATOM   1004 C  CB  . LEU C 1 30 ? -25.419 -29.047 33.049  1.00 77.76  ? 26  LEU B CB  1 
ATOM   1005 C  CG  . LEU C 1 30 ? -25.931 -28.709 34.445  1.00 71.83  ? 26  LEU B CG  1 
ATOM   1006 C  CD1 . LEU C 1 30 ? -24.933 -29.138 35.488  1.00 74.85  ? 26  LEU B CD1 1 
ATOM   1007 C  CD2 . LEU C 1 30 ? -26.219 -27.218 34.561  1.00 66.32  ? 26  LEU B CD2 1 
ATOM   1008 N  N   . PHE C 1 31 ? -25.593 -30.021 29.996  1.00 86.36  ? 27  PHE B N   1 
ATOM   1009 C  CA  . PHE C 1 31 ? -25.104 -30.076 28.625  1.00 85.08  ? 27  PHE B CA  1 
ATOM   1010 C  C   . PHE C 1 31 ? -26.005 -29.269 27.702  1.00 79.22  ? 27  PHE B C   1 
ATOM   1011 O  O   . PHE C 1 31 ? -25.566 -28.300 27.069  1.00 76.12  ? 27  PHE B O   1 
ATOM   1012 C  CB  . PHE C 1 31 ? -25.032 -31.532 28.158  1.00 94.03  ? 27  PHE B CB  1 
ATOM   1013 C  CG  . PHE C 1 31 ? -24.278 -31.723 26.870  1.00 100.39 ? 27  PHE B CG  1 
ATOM   1014 C  CD1 . PHE C 1 31 ? -24.881 -31.451 25.650  1.00 100.74 ? 27  PHE B CD1 1 
ATOM   1015 C  CD2 . PHE C 1 31 ? -22.971 -32.186 26.874  1.00 104.77 ? 27  PHE B CD2 1 
ATOM   1016 C  CE1 . PHE C 1 31 ? -24.193 -31.620 24.465  1.00 101.63 ? 27  PHE B CE1 1 
ATOM   1017 C  CE2 . PHE C 1 31 ? -22.281 -32.359 25.693  1.00 105.84 ? 27  PHE B CE2 1 
ATOM   1018 C  CZ  . PHE C 1 31 ? -22.894 -32.076 24.487  1.00 104.92 ? 27  PHE B CZ  1 
ATOM   1019 N  N   . GLU C 1 32 ? -27.288 -29.639 27.655  1.00 79.37  ? 28  GLU B N   1 
ATOM   1020 C  CA  . GLU C 1 32 ? -28.233 -28.949 26.785  1.00 77.62  ? 28  GLU B CA  1 
ATOM   1021 C  C   . GLU C 1 32 ? -28.325 -27.470 27.125  1.00 74.29  ? 28  GLU B C   1 
ATOM   1022 O  O   . GLU C 1 32 ? -28.447 -26.627 26.229  1.00 72.76  ? 28  GLU B O   1 
ATOM   1023 C  CB  . GLU C 1 32 ? -29.616 -29.599 26.873  1.00 81.89  ? 28  GLU B CB  1 
ATOM   1024 C  CG  . GLU C 1 32 ? -30.626 -28.971 25.915  1.00 83.87  ? 28  GLU B CG  1 
ATOM   1025 C  CD  . GLU C 1 32 ? -32.034 -29.502 26.116  1.00 92.81  ? 28  GLU B CD  1 
ATOM   1026 O  OE1 . GLU C 1 32 ? -32.259 -30.227 27.110  1.00 98.22  ? 28  GLU B OE1 1 
ATOM   1027 O  OE2 . GLU C 1 32 ? -32.914 -29.194 25.282  1.00 94.43  ? 28  GLU B OE2 1 
ATOM   1028 N  N   . LEU C 1 33 ? -28.270 -27.130 28.414  1.00 75.91  ? 29  LEU B N   1 
ATOM   1029 C  CA  . LEU C 1 33 ? -28.400 -25.728 28.797  1.00 73.90  ? 29  LEU B CA  1 
ATOM   1030 C  C   . LEU C 1 33 ? -27.223 -24.913 28.277  1.00 74.77  ? 29  LEU B C   1 
ATOM   1031 O  O   . LEU C 1 33 ? -27.407 -23.888 27.608  1.00 69.76  ? 29  LEU B O   1 
ATOM   1032 C  CB  . LEU C 1 33 ? -28.509 -25.588 30.317  1.00 67.73  ? 29  LEU B CB  1 
ATOM   1033 C  CG  . LEU C 1 33 ? -28.641 -24.122 30.742  1.00 57.29  ? 29  LEU B CG  1 
ATOM   1034 C  CD1 . LEU C 1 33 ? -29.908 -23.545 30.143  1.00 50.38  ? 29  LEU B CD1 1 
ATOM   1035 C  CD2 . LEU C 1 33 ? -28.657 -23.963 32.249  1.00 59.28  ? 29  LEU B CD2 1 
ATOM   1036 N  N   . PHE C 1 34 ? -26.003 -25.364 28.554  1.00 80.33  ? 30  PHE B N   1 
ATOM   1037 C  CA  . PHE C 1 34 ? -24.832 -24.607 28.132  1.00 80.36  ? 30  PHE B CA  1 
ATOM   1038 C  C   . PHE C 1 34 ? -24.541 -24.757 26.649  1.00 79.02  ? 30  PHE B C   1 
ATOM   1039 O  O   . PHE C 1 34 ? -23.771 -23.963 26.094  1.00 76.08  ? 30  PHE B O   1 
ATOM   1040 C  CB  . PHE C 1 34 ? -23.623 -25.004 28.972  1.00 83.36  ? 30  PHE B CB  1 
ATOM   1041 C  CG  . PHE C 1 34 ? -23.629 -24.373 30.322  1.00 82.59  ? 30  PHE B CG  1 
ATOM   1042 C  CD1 . PHE C 1 34 ? -23.036 -23.141 30.524  1.00 81.20  ? 30  PHE B CD1 1 
ATOM   1043 C  CD2 . PHE C 1 34 ? -24.293 -24.974 31.368  1.00 84.07  ? 30  PHE B CD2 1 
ATOM   1044 C  CE1 . PHE C 1 34 ? -23.069 -22.539 31.750  1.00 83.78  ? 30  PHE B CE1 1 
ATOM   1045 C  CE2 . PHE C 1 34 ? -24.332 -24.381 32.609  1.00 87.46  ? 30  PHE B CE2 1 
ATOM   1046 C  CZ  . PHE C 1 34 ? -23.721 -23.158 32.802  1.00 87.20  ? 30  PHE B CZ  1 
ATOM   1047 N  N   . HIS C 1 35 ? -25.140 -25.756 25.999  1.00 77.22  ? 31  HIS B N   1 
ATOM   1048 C  CA  . HIS C 1 35 ? -25.068 -25.844 24.547  1.00 76.41  ? 31  HIS B CA  1 
ATOM   1049 C  C   . HIS C 1 35 ? -25.655 -24.605 23.882  1.00 73.03  ? 31  HIS B C   1 
ATOM   1050 O  O   . HIS C 1 35 ? -25.342 -24.329 22.720  1.00 78.30  ? 31  HIS B O   1 
ATOM   1051 C  CB  . HIS C 1 35 ? -25.794 -27.103 24.064  1.00 81.01  ? 31  HIS B CB  1 
ATOM   1052 C  CG  . HIS C 1 35 ? -25.207 -27.711 22.824  1.00 87.54  ? 31  HIS B CG  1 
ATOM   1053 N  ND1 . HIS C 1 35 ? -23.919 -28.200 22.771  1.00 91.74  ? 31  HIS B ND1 1 
ATOM   1054 C  CD2 . HIS C 1 35 ? -25.741 -27.924 21.599  1.00 89.70  ? 31  HIS B CD2 1 
ATOM   1055 C  CE1 . HIS C 1 35 ? -23.682 -28.680 21.565  1.00 95.33  ? 31  HIS B CE1 1 
ATOM   1056 N  NE2 . HIS C 1 35 ? -24.771 -28.526 20.834  1.00 94.45  ? 31  HIS B NE2 1 
ATOM   1057 N  N   . GLN C 1 36 ? -26.513 -23.864 24.590  1.00 67.00  ? 32  GLN B N   1 
ATOM   1058 C  CA  . GLN C 1 36 ? -27.040 -22.611 24.060  1.00 63.70  ? 32  GLN B CA  1 
ATOM   1059 C  C   . GLN C 1 36 ? -25.953 -21.559 23.911  1.00 66.26  ? 32  GLN B C   1 
ATOM   1060 O  O   . GLN C 1 36 ? -26.006 -20.745 22.984  1.00 70.49  ? 32  GLN B O   1 
ATOM   1061 C  CB  . GLN C 1 36 ? -28.148 -22.074 24.959  1.00 61.15  ? 32  GLN B CB  1 
ATOM   1062 C  CG  . GLN C 1 36 ? -29.410 -22.910 24.968  1.00 60.12  ? 32  GLN B CG  1 
ATOM   1063 C  CD  . GLN C 1 36 ? -30.137 -22.847 23.642  1.00 54.27  ? 32  GLN B CD  1 
ATOM   1064 O  OE1 . GLN C 1 36 ? -30.571 -21.774 23.205  1.00 48.30  ? 32  GLN B OE1 1 
ATOM   1065 N  NE2 . GLN C 1 36 ? -30.278 -24.003 22.993  1.00 56.02  ? 32  GLN B NE2 1 
ATOM   1066 N  N   . ALA C 1 37 ? -24.969 -21.550 24.810  1.00 66.47  ? 33  ALA B N   1 
ATOM   1067 C  CA  . ALA C 1 37 ? -23.928 -20.531 24.782  1.00 64.86  ? 33  ALA B CA  1 
ATOM   1068 C  C   . ALA C 1 37 ? -22.774 -20.870 23.844  1.00 69.40  ? 33  ALA B C   1 
ATOM   1069 O  O   . ALA C 1 37 ? -22.045 -19.961 23.428  1.00 71.07  ? 33  ALA B O   1 
ATOM   1070 C  CB  . ALA C 1 37 ? -23.415 -20.294 26.198  1.00 64.67  ? 33  ALA B CB  1 
ATOM   1071 N  N   . GLY C 1 38 ? -22.570 -22.142 23.529  1.00 72.66  ? 34  GLY B N   1 
ATOM   1072 C  CA  . GLY C 1 38 ? -21.538 -22.541 22.605  1.00 74.38  ? 34  GLY B CA  1 
ATOM   1073 C  C   . GLY C 1 38 ? -21.337 -24.039 22.655  1.00 79.90  ? 34  GLY B C   1 
ATOM   1074 O  O   . GLY C 1 38 ? -21.783 -24.708 23.593  1.00 85.96  ? 34  GLY B O   1 
ATOM   1075 N  N   . PRO C 1 39 ? -20.675 -24.593 21.641  1.00 74.84  ? 35  PRO B N   1 
ATOM   1076 C  CA  . PRO C 1 39 ? -20.446 -26.042 21.610  1.00 75.10  ? 35  PRO B CA  1 
ATOM   1077 C  C   . PRO C 1 39 ? -19.773 -26.526 22.884  1.00 74.28  ? 35  PRO B C   1 
ATOM   1078 O  O   . PRO C 1 39 ? -18.741 -25.999 23.306  1.00 76.75  ? 35  PRO B O   1 
ATOM   1079 C  CB  . PRO C 1 39 ? -19.554 -26.229 20.382  1.00 76.97  ? 35  PRO B CB  1 
ATOM   1080 C  CG  . PRO C 1 39 ? -19.941 -25.085 19.493  1.00 72.96  ? 35  PRO B CG  1 
ATOM   1081 C  CD  . PRO C 1 39 ? -20.206 -23.930 20.412  1.00 70.03  ? 35  PRO B CD  1 
ATOM   1082 N  N   . VAL C 1 40 ? -20.386 -27.530 23.513  1.00 73.45  ? 36  VAL B N   1 
ATOM   1083 C  CA  . VAL C 1 40 ? -19.929 -28.093 24.777  1.00 74.00  ? 36  VAL B CA  1 
ATOM   1084 C  C   . VAL C 1 40 ? -19.265 -29.439 24.526  1.00 81.69  ? 36  VAL B C   1 
ATOM   1085 O  O   . VAL C 1 40 ? -19.731 -30.229 23.696  1.00 85.44  ? 36  VAL B O   1 
ATOM   1086 C  CB  . VAL C 1 40 ? -21.105 -28.224 25.765  1.00 65.84  ? 36  VAL B CB  1 
ATOM   1087 C  CG1 . VAL C 1 40 ? -20.679 -28.956 27.022  1.00 69.12  ? 36  VAL B CG1 1 
ATOM   1088 C  CG2 . VAL C 1 40 ? -21.659 -26.841 26.103  1.00 54.40  ? 36  VAL B CG2 1 
ATOM   1089 N  N   . ILE C 1 41 ? -18.161 -29.692 25.227  1.00 85.58  ? 37  ILE B N   1 
ATOM   1090 C  CA  . ILE C 1 41 ? -17.460 -30.970 25.136  1.00 92.36  ? 37  ILE B CA  1 
ATOM   1091 C  C   . ILE C 1 41 ? -17.978 -31.972 26.163  1.00 97.58  ? 37  ILE B C   1 
ATOM   1092 O  O   . ILE C 1 41 ? -18.341 -33.100 25.815  1.00 102.05 ? 37  ILE B O   1 
ATOM   1093 C  CB  . ILE C 1 41 ? -15.941 -30.742 25.274  1.00 93.91  ? 37  ILE B CB  1 
ATOM   1094 C  CG1 . ILE C 1 41 ? -15.431 -29.931 24.079  1.00 89.37  ? 37  ILE B CG1 1 
ATOM   1095 C  CG2 . ILE C 1 41 ? -15.202 -32.064 25.390  1.00 99.22  ? 37  ILE B CG2 1 
ATOM   1096 C  CD1 . ILE C 1 41 ? -13.967 -29.562 24.157  1.00 92.06  ? 37  ILE B CD1 1 
ATOM   1097 N  N   . LYS C 1 42 ? -18.011 -31.589 27.440  1.00 97.91  ? 38  LYS B N   1 
ATOM   1098 C  CA  . LYS C 1 42 ? -18.466 -32.491 28.490  1.00 96.90  ? 38  LYS B CA  1 
ATOM   1099 C  C   . LYS C 1 42 ? -18.920 -31.673 29.691  1.00 93.49  ? 38  LYS B C   1 
ATOM   1100 O  O   . LYS C 1 42 ? -18.491 -30.532 29.885  1.00 90.73  ? 38  LYS B O   1 
ATOM   1101 C  CB  . LYS C 1 42 ? -17.366 -33.481 28.895  1.00 99.85  ? 38  LYS B CB  1 
ATOM   1102 N  N   . VAL C 1 43 ? -19.804 -32.274 30.488  1.00 94.24  ? 39  VAL B N   1 
ATOM   1103 C  CA  . VAL C 1 43 ? -20.231 -31.731 31.775  1.00 91.37  ? 39  VAL B CA  1 
ATOM   1104 C  C   . VAL C 1 43 ? -20.108 -32.828 32.822  1.00 95.89  ? 39  VAL B C   1 
ATOM   1105 O  O   . VAL C 1 43 ? -20.607 -33.940 32.619  1.00 99.22  ? 39  VAL B O   1 
ATOM   1106 C  CB  . VAL C 1 43 ? -21.674 -31.194 31.729  1.00 86.75  ? 39  VAL B CB  1 
ATOM   1107 C  CG1 . VAL C 1 43 ? -22.108 -30.716 33.105  1.00 86.57  ? 39  VAL B CG1 1 
ATOM   1108 C  CG2 . VAL C 1 43 ? -21.800 -30.076 30.699  1.00 83.42  ? 39  VAL B CG2 1 
ATOM   1109 N  N   . LYS C 1 44 ? -19.442 -32.520 33.933  1.00 96.40  ? 40  LYS B N   1 
ATOM   1110 C  CA  . LYS C 1 44 ? -19.224 -33.475 35.012  1.00 103.22 ? 40  LYS B CA  1 
ATOM   1111 C  C   . LYS C 1 44 ? -19.730 -32.919 36.338  1.00 100.07 ? 40  LYS B C   1 
ATOM   1112 O  O   . LYS C 1 44 ? -19.499 -31.748 36.657  1.00 95.68  ? 40  LYS B O   1 
ATOM   1113 C  CB  . LYS C 1 44 ? -17.741 -33.838 35.138  1.00 109.47 ? 40  LYS B CB  1 
ATOM   1114 N  N   . ILE C 1 45 ? -20.448 -33.749 37.088  1.00 102.52 ? 41  ILE B N   1 
ATOM   1115 C  CA  . ILE C 1 45 ? -20.842 -33.459 38.462  1.00 104.77 ? 41  ILE B CA  1 
ATOM   1116 C  C   . ILE C 1 45 ? -20.095 -34.435 39.371  1.00 112.18 ? 41  ILE B C   1 
ATOM   1117 O  O   . ILE C 1 45 ? -20.389 -35.639 39.354  1.00 116.90 ? 41  ILE B O   1 
ATOM   1118 C  CB  . ILE C 1 45 ? -22.361 -33.568 38.650  1.00 101.99 ? 41  ILE B CB  1 
ATOM   1119 C  CG1 . ILE C 1 45 ? -23.068 -32.503 37.810  1.00 95.78  ? 41  ILE B CG1 1 
ATOM   1120 C  CG2 . ILE C 1 45 ? -22.733 -33.440 40.122  1.00 103.72 ? 41  ILE B CG2 1 
ATOM   1121 C  CD1 . ILE C 1 45 ? -24.563 -32.677 37.712  1.00 93.32  ? 41  ILE B CD1 1 
ATOM   1122 N  N   . PRO C 1 46 ? -19.129 -33.972 40.187  1.00 114.38 ? 42  PRO B N   1 
ATOM   1123 C  CA  . PRO C 1 46 ? -18.274 -34.866 40.983  1.00 124.21 ? 42  PRO B CA  1 
ATOM   1124 C  C   . PRO C 1 46 ? -19.003 -35.565 42.133  1.00 131.98 ? 42  PRO B C   1 
ATOM   1125 O  O   . PRO C 1 46 ? -20.061 -35.107 42.561  1.00 132.23 ? 42  PRO B O   1 
ATOM   1126 C  CB  . PRO C 1 46 ? -17.191 -33.923 41.531  1.00 123.69 ? 42  PRO B CB  1 
ATOM   1127 C  CG  . PRO C 1 46 ? -17.283 -32.679 40.698  1.00 107.23 ? 42  PRO B CG  1 
ATOM   1128 C  CD  . PRO C 1 46 ? -18.726 -32.565 40.331  1.00 110.64 ? 42  PRO B CD  1 
ATOM   1129 N  N   . LYS C 1 52 ? -22.374 -39.981 46.156  1.00 151.76 ? 48  LYS B N   1 
ATOM   1130 C  CA  . LYS C 1 52 ? -23.452 -39.002 46.073  1.00 145.99 ? 48  LYS B CA  1 
ATOM   1131 C  C   . LYS C 1 52 ? -23.043 -37.823 45.198  1.00 138.84 ? 48  LYS B C   1 
ATOM   1132 O  O   . LYS C 1 52 ? -21.920 -37.335 45.300  1.00 140.13 ? 48  LYS B O   1 
ATOM   1133 C  CB  . LYS C 1 52 ? -23.846 -38.511 47.470  1.00 148.78 ? 48  LYS B CB  1 
ATOM   1134 N  N   . PRO C 1 53 ? -23.950 -37.376 44.331  1.00 132.97 ? 49  PRO B N   1 
ATOM   1135 C  CA  . PRO C 1 53 ? -23.660 -36.199 43.502  1.00 127.17 ? 49  PRO B CA  1 
ATOM   1136 C  C   . PRO C 1 53 ? -23.458 -34.948 44.347  1.00 126.47 ? 49  PRO B C   1 
ATOM   1137 O  O   . PRO C 1 53 ? -24.223 -34.670 45.273  1.00 127.02 ? 49  PRO B O   1 
ATOM   1138 C  CB  . PRO C 1 53 ? -24.901 -36.082 42.608  1.00 121.48 ? 49  PRO B CB  1 
ATOM   1139 C  CG  . PRO C 1 53 ? -25.499 -37.447 42.601  1.00 126.11 ? 49  PRO B CG  1 
ATOM   1140 C  CD  . PRO C 1 53 ? -25.227 -38.009 43.965  1.00 132.94 ? 49  PRO B CD  1 
ATOM   1141 N  N   . LYS C 1 54 ? -22.408 -34.197 44.024  1.00 125.61 ? 50  LYS B N   1 
ATOM   1142 C  CA  . LYS C 1 54 ? -22.135 -32.923 44.671  1.00 125.49 ? 50  LYS B CA  1 
ATOM   1143 C  C   . LYS C 1 54 ? -23.029 -31.825 44.085  1.00 118.60 ? 50  LYS B C   1 
ATOM   1144 O  O   . LYS C 1 54 ? -23.736 -32.020 43.093  1.00 112.05 ? 50  LYS B O   1 
ATOM   1145 C  CB  . LYS C 1 54 ? -20.660 -32.554 44.531  1.00 126.42 ? 50  LYS B CB  1 
ATOM   1146 N  N   . GLN C 1 55 ? -22.974 -30.646 44.705  1.00 119.52 ? 51  GLN B N   1 
ATOM   1147 C  CA  . GLN C 1 55 ? -23.851 -29.534 44.359  1.00 111.19 ? 51  GLN B CA  1 
ATOM   1148 C  C   . GLN C 1 55 ? -23.270 -28.606 43.295  1.00 104.96 ? 51  GLN B C   1 
ATOM   1149 O  O   . GLN C 1 55 ? -23.792 -27.503 43.112  1.00 95.01  ? 51  GLN B O   1 
ATOM   1150 C  CB  . GLN C 1 55 ? -24.189 -28.721 45.615  1.00 113.35 ? 51  GLN B CB  1 
ATOM   1151 N  N   . PHE C 1 56 ? -22.204 -29.008 42.605  1.00 111.07 ? 52  PHE B N   1 
ATOM   1152 C  CA  . PHE C 1 56 ? -21.598 -28.182 41.570  1.00 106.98 ? 52  PHE B CA  1 
ATOM   1153 C  C   . PHE C 1 56 ? -21.274 -29.036 40.350  1.00 102.50 ? 52  PHE B C   1 
ATOM   1154 O  O   . PHE C 1 56 ? -21.307 -30.268 40.398  1.00 106.51 ? 52  PHE B O   1 
ATOM   1155 C  CB  . PHE C 1 56 ? -20.326 -27.482 42.082  1.00 88.63  ? 52  PHE B CB  1 
ATOM   1156 N  N   . ALA C 1 57 ? -20.970 -28.368 39.238  1.00 96.52  ? 53  ALA B N   1 
ATOM   1157 C  CA  . ALA C 1 57 ? -20.622 -29.068 38.012  1.00 94.54  ? 53  ALA B CA  1 
ATOM   1158 C  C   . ALA C 1 57 ? -19.595 -28.260 37.237  1.00 90.27  ? 53  ALA B C   1 
ATOM   1159 O  O   . ALA C 1 57 ? -19.541 -27.031 37.337  1.00 86.73  ? 53  ALA B O   1 
ATOM   1160 C  CB  . ALA C 1 57 ? -21.844 -29.324 37.122  1.00 88.96  ? 53  ALA B CB  1 
ATOM   1161 N  N   . PHE C 1 58 ? -18.807 -28.969 36.430  1.00 94.76  ? 54  PHE B N   1 
ATOM   1162 C  CA  . PHE C 1 58 ? -17.862 -28.366 35.501  1.00 95.86  ? 54  PHE B CA  1 
ATOM   1163 C  C   . PHE C 1 58 ? -18.374 -28.558 34.082  1.00 92.12  ? 54  PHE B C   1 
ATOM   1164 O  O   . PHE C 1 58 ? -18.711 -29.678 33.679  1.00 93.50  ? 54  PHE B O   1 
ATOM   1165 C  CB  . PHE C 1 58 ? -16.459 -28.960 35.650  1.00 84.38  ? 54  PHE B CB  1 
ATOM   1166 C  CG  . PHE C 1 58 ? -15.798 -28.632 36.962  1.00 96.16  ? 54  PHE B CG  1 
ATOM   1167 C  CD1 . PHE C 1 58 ? -15.318 -27.355 37.202  1.00 94.89  ? 54  PHE B CD1 1 
ATOM   1168 C  CD2 . PHE C 1 58 ? -15.641 -29.596 37.947  1.00 94.69  ? 54  PHE B CD2 1 
ATOM   1169 C  CE1 . PHE C 1 58 ? -14.707 -27.037 38.401  1.00 92.50  ? 54  PHE B CE1 1 
ATOM   1170 C  CE2 . PHE C 1 58 ? -15.026 -29.284 39.150  1.00 99.35  ? 54  PHE B CE2 1 
ATOM   1171 C  CZ  . PHE C 1 58 ? -14.560 -28.001 39.376  1.00 98.29  ? 54  PHE B CZ  1 
ATOM   1172 N  N   . VAL C 1 59 ? -18.478 -27.454 33.355  1.00 90.82  ? 55  VAL B N   1 
ATOM   1173 C  CA  . VAL C 1 59 ? -18.855 -27.442 31.950  1.00 88.43  ? 55  VAL B CA  1 
ATOM   1174 C  C   . VAL C 1 59 ? -17.606 -27.084 31.154  1.00 89.69  ? 55  VAL B C   1 
ATOM   1175 O  O   . VAL C 1 59 ? -16.984 -26.044 31.405  1.00 86.08  ? 55  VAL B O   1 
ATOM   1176 C  CB  . VAL C 1 59 ? -19.997 -26.447 31.686  1.00 82.93  ? 55  VAL B CB  1 
ATOM   1177 C  CG1 . VAL C 1 59 ? -20.228 -26.282 30.193  1.00 81.60  ? 55  VAL B CG1 1 
ATOM   1178 C  CG2 . VAL C 1 59 ? -21.276 -26.893 32.387  1.00 81.01  ? 55  VAL B CG2 1 
ATOM   1179 N  N   . ASN C 1 60 ? -17.214 -27.951 30.225  1.00 99.13  ? 56  ASN B N   1 
ATOM   1180 C  CA  . ASN C 1 60 ? -16.014 -27.748 29.419  1.00 105.56 ? 56  ASN B CA  1 
ATOM   1181 C  C   . ASN C 1 60 ? -16.421 -27.378 27.997  1.00 96.40  ? 56  ASN B C   1 
ATOM   1182 O  O   . ASN C 1 60 ? -17.052 -28.182 27.303  1.00 94.67  ? 56  ASN B O   1 
ATOM   1183 C  CB  . ASN C 1 60 ? -15.143 -29.005 29.422  1.00 119.67 ? 56  ASN B CB  1 
ATOM   1184 C  CG  . ASN C 1 60 ? -13.876 -28.839 28.611  1.00 129.19 ? 56  ASN B CG  1 
ATOM   1185 O  OD1 . ASN C 1 60 ? -13.857 -29.096 27.407  1.00 133.59 ? 56  ASN B OD1 1 
ATOM   1186 N  ND2 . ASN C 1 60 ? -12.806 -28.410 29.269  1.00 133.96 ? 56  ASN B ND2 1 
ATOM   1187 N  N   . PHE C 1 61 ? -16.037 -26.180 27.558  1.00 90.10  ? 57  PHE B N   1 
ATOM   1188 C  CA  . PHE C 1 61 ? -16.422 -25.693 26.241  1.00 89.13  ? 57  PHE B CA  1 
ATOM   1189 C  C   . PHE C 1 61 ? -15.375 -26.055 25.192  1.00 99.24  ? 57  PHE B C   1 
ATOM   1190 O  O   . PHE C 1 61 ? -14.206 -26.309 25.496  1.00 110.64 ? 57  PHE B O   1 
ATOM   1191 C  CB  . PHE C 1 61 ? -16.625 -24.176 26.240  1.00 82.77  ? 57  PHE B CB  1 
ATOM   1192 C  CG  . PHE C 1 61 ? -17.931 -23.733 26.832  1.00 79.54  ? 57  PHE B CG  1 
ATOM   1193 C  CD1 . PHE C 1 61 ? -19.111 -23.874 26.118  1.00 75.88  ? 57  PHE B CD1 1 
ATOM   1194 C  CD2 . PHE C 1 61 ? -17.978 -23.136 28.083  1.00 77.35  ? 57  PHE B CD2 1 
ATOM   1195 C  CE1 . PHE C 1 61 ? -20.317 -23.463 26.658  1.00 68.08  ? 57  PHE B CE1 1 
ATOM   1196 C  CE2 . PHE C 1 61 ? -19.181 -22.719 28.622  1.00 68.32  ? 57  PHE B CE2 1 
ATOM   1197 C  CZ  . PHE C 1 61 ? -20.348 -22.884 27.908  1.00 64.17  ? 57  PHE B CZ  1 
ATOM   1198 N  N   . LYS C 1 62 ? -15.824 -26.083 23.936  1.00 95.60  ? 58  LYS B N   1 
ATOM   1199 C  CA  . LYS C 1 62 ? -14.906 -26.306 22.825  1.00 96.37  ? 58  LYS B CA  1 
ATOM   1200 C  C   . LYS C 1 62 ? -14.000 -25.099 22.606  1.00 93.90  ? 58  LYS B C   1 
ATOM   1201 O  O   . LYS C 1 62 ? -12.833 -25.256 22.227  1.00 100.23 ? 58  LYS B O   1 
ATOM   1202 C  CB  . LYS C 1 62 ? -15.692 -26.633 21.553  1.00 94.10  ? 58  LYS B CB  1 
ATOM   1203 N  N   . HIS C 1 63 ? -14.517 -23.888 22.818  1.00 84.59  ? 59  HIS B N   1 
ATOM   1204 C  CA  . HIS C 1 63 ? -13.747 -22.678 22.563  1.00 84.26  ? 59  HIS B CA  1 
ATOM   1205 C  C   . HIS C 1 63 ? -13.826 -21.707 23.733  1.00 76.96  ? 59  HIS B C   1 
ATOM   1206 O  O   . HIS C 1 63 ? -14.901 -21.486 24.300  1.00 73.12  ? 59  HIS B O   1 
ATOM   1207 C  CB  . HIS C 1 63 ? -14.237 -22.010 21.288  1.00 88.94  ? 59  HIS B CB  1 
ATOM   1208 C  CG  . HIS C 1 63 ? -14.252 -22.932 20.111  1.00 96.52  ? 59  HIS B CG  1 
ATOM   1209 N  ND1 . HIS C 1 63 ? -15.418 -23.460 19.599  1.00 96.93  ? 59  HIS B ND1 1 
ATOM   1210 C  CD2 . HIS C 1 63 ? -13.245 -23.449 19.370  1.00 102.05 ? 59  HIS B CD2 1 
ATOM   1211 C  CE1 . HIS C 1 63 ? -15.129 -24.245 18.578  1.00 99.93  ? 59  HIS B CE1 1 
ATOM   1212 N  NE2 . HIS C 1 63 ? -13.818 -24.257 18.418  1.00 103.20 ? 59  HIS B NE2 1 
ATOM   1213 N  N   . GLU C 1 64 ? -12.675 -21.107 24.057  1.00 81.83  ? 60  GLU B N   1 
ATOM   1214 C  CA  . GLU C 1 64 ? -12.577 -20.149 25.156  1.00 83.40  ? 60  GLU B CA  1 
ATOM   1215 C  C   . GLU C 1 64 ? -13.538 -18.979 24.989  1.00 80.20  ? 60  GLU B C   1 
ATOM   1216 O  O   . GLU C 1 64 ? -13.982 -18.402 25.987  1.00 82.93  ? 60  GLU B O   1 
ATOM   1217 C  CB  . GLU C 1 64 ? -11.137 -19.649 25.287  1.00 89.19  ? 60  GLU B CB  1 
ATOM   1218 N  N   . VAL C 1 65 ? -13.833 -18.578 23.750  1.00 81.71  ? 61  VAL B N   1 
ATOM   1219 C  CA  . VAL C 1 65 ? -14.739 -17.455 23.538  1.00 85.55  ? 61  VAL B CA  1 
ATOM   1220 C  C   . VAL C 1 65 ? -16.126 -17.772 24.081  1.00 86.76  ? 61  VAL B C   1 
ATOM   1221 O  O   . VAL C 1 65 ? -16.899 -16.855 24.383  1.00 83.37  ? 61  VAL B O   1 
ATOM   1222 C  CB  . VAL C 1 65 ? -14.815 -17.069 22.043  1.00 83.68  ? 61  VAL B CB  1 
ATOM   1223 C  CG1 . VAL C 1 65 ? -13.490 -16.508 21.565  1.00 86.89  ? 61  VAL B CG1 1 
ATOM   1224 C  CG2 . VAL C 1 65 ? -15.242 -18.264 21.193  1.00 82.40  ? 61  VAL B CG2 1 
ATOM   1225 N  N   . SER C 1 66 ? -16.475 -19.059 24.184  1.00 93.65  ? 62  SER B N   1 
ATOM   1226 C  CA  . SER C 1 66 ? -17.755 -19.448 24.761  1.00 91.19  ? 62  SER B CA  1 
ATOM   1227 C  C   . SER C 1 66 ? -17.833 -19.168 26.259  1.00 91.96  ? 62  SER B C   1 
ATOM   1228 O  O   . SER C 1 66 ? -18.940 -19.032 26.795  1.00 91.87  ? 62  SER B O   1 
ATOM   1229 C  CB  . SER C 1 66 ? -18.018 -20.935 24.516  1.00 93.97  ? 62  SER B CB  1 
ATOM   1230 O  OG  . SER C 1 66 ? -18.234 -21.193 23.142  1.00 95.66  ? 62  SER B OG  1 
ATOM   1231 N  N   . VAL C 1 67 ? -16.697 -19.091 26.948  1.00 87.22  ? 63  VAL B N   1 
ATOM   1232 C  CA  . VAL C 1 67 ? -16.702 -19.005 28.409  1.00 78.91  ? 63  VAL B CA  1 
ATOM   1233 C  C   . VAL C 1 67 ? -17.265 -17.666 28.874  1.00 76.17  ? 63  VAL B C   1 
ATOM   1234 O  O   . VAL C 1 67 ? -18.250 -17.667 29.624  1.00 77.61  ? 63  VAL B O   1 
ATOM   1235 C  CB  . VAL C 1 67 ? -15.300 -19.255 28.993  1.00 77.41  ? 63  VAL B CB  1 
ATOM   1236 C  CG1 . VAL C 1 67 ? -15.214 -18.720 30.413  1.00 76.60  ? 63  VAL B CG1 1 
ATOM   1237 C  CG2 . VAL C 1 67 ? -14.966 -20.738 28.964  1.00 81.27  ? 63  VAL B CG2 1 
ATOM   1238 N  N   . PRO C 1 68 ? -16.739 -16.508 28.443  1.00 71.67  ? 64  PRO B N   1 
ATOM   1239 C  CA  . PRO C 1 68 ? -17.337 -15.246 28.916  1.00 68.53  ? 64  PRO B CA  1 
ATOM   1240 C  C   . PRO C 1 68 ? -18.773 -15.082 28.467  1.00 65.91  ? 64  PRO B C   1 
ATOM   1241 O  O   . PRO C 1 68 ? -19.589 -14.508 29.202  1.00 67.38  ? 64  PRO B O   1 
ATOM   1242 C  CB  . PRO C 1 68 ? -16.428 -14.169 28.305  1.00 64.26  ? 64  PRO B CB  1 
ATOM   1243 C  CG  . PRO C 1 68 ? -15.168 -14.878 27.965  1.00 67.48  ? 64  PRO B CG  1 
ATOM   1244 C  CD  . PRO C 1 68 ? -15.605 -16.246 27.545  1.00 67.76  ? 64  PRO B CD  1 
ATOM   1245 N  N   . TYR C 1 69 ? -19.107 -15.588 27.279  1.00 64.86  ? 65  TYR B N   1 
ATOM   1246 C  CA  . TYR C 1 69 ? -20.474 -15.492 26.781  1.00 64.23  ? 65  TYR B CA  1 
ATOM   1247 C  C   . TYR C 1 69 ? -21.425 -16.290 27.660  1.00 64.98  ? 65  TYR B C   1 
ATOM   1248 O  O   . TYR C 1 69 ? -22.478 -15.788 28.068  1.00 67.47  ? 65  TYR B O   1 
ATOM   1249 C  CB  . TYR C 1 69 ? -20.545 -15.973 25.336  1.00 63.23  ? 65  TYR B CB  1 
ATOM   1250 C  CG  . TYR C 1 69 ? -21.890 -15.711 24.715  1.00 57.75  ? 65  TYR B CG  1 
ATOM   1251 C  CD1 . TYR C 1 69 ? -22.182 -14.468 24.175  1.00 57.00  ? 65  TYR B CD1 1 
ATOM   1252 C  CD2 . TYR C 1 69 ? -22.873 -16.697 24.682  1.00 54.90  ? 65  TYR B CD2 1 
ATOM   1253 C  CE1 . TYR C 1 69 ? -23.415 -14.206 23.615  1.00 56.89  ? 65  TYR B CE1 1 
ATOM   1254 C  CE2 . TYR C 1 69 ? -24.102 -16.448 24.120  1.00 54.63  ? 65  TYR B CE2 1 
ATOM   1255 C  CZ  . TYR C 1 69 ? -24.370 -15.199 23.592  1.00 55.30  ? 65  TYR B CZ  1 
ATOM   1256 O  OH  . TYR C 1 69 ? -25.597 -14.947 23.034  1.00 53.68  ? 65  TYR B OH  1 
ATOM   1257 N  N   . ALA C 1 70 ? -21.058 -17.537 27.976  1.00 63.88  ? 66  ALA B N   1 
ATOM   1258 C  CA  . ALA C 1 70 ? -21.911 -18.358 28.829  1.00 63.27  ? 66  ALA B CA  1 
ATOM   1259 C  C   . ALA C 1 70 ? -22.134 -17.691 30.178  1.00 59.94  ? 66  ALA B C   1 
ATOM   1260 O  O   . ALA C 1 70 ? -23.231 -17.762 30.746  1.00 55.13  ? 66  ALA B O   1 
ATOM   1261 C  CB  . ALA C 1 70 ? -21.288 -19.739 29.025  1.00 67.26  ? 66  ALA B CB  1 
ATOM   1262 N  N   . MET C 1 71 ? -21.104 -17.023 30.695  1.00 61.83  ? 67  MET B N   1 
ATOM   1263 C  CA  . MET C 1 71 ? -21.234 -16.303 31.954  1.00 61.49  ? 67  MET B CA  1 
ATOM   1264 C  C   . MET C 1 71 ? -22.304 -15.231 31.848  1.00 60.99  ? 67  MET B C   1 
ATOM   1265 O  O   . MET C 1 71 ? -23.150 -15.093 32.734  1.00 70.46  ? 67  MET B O   1 
ATOM   1266 C  CB  . MET C 1 71 ? -19.889 -15.691 32.339  1.00 67.78  ? 67  MET B CB  1 
ATOM   1267 C  CG  . MET C 1 71 ? -19.934 -14.712 33.492  1.00 72.49  ? 67  MET B CG  1 
ATOM   1268 S  SD  . MET C 1 71 ? -20.228 -15.524 35.070  1.00 77.05  ? 67  MET B SD  1 
ATOM   1269 C  CE  . MET C 1 71 ? -18.574 -16.076 35.450  1.00 82.69  ? 67  MET B CE  1 
ATOM   1270 N  N   . ASN C 1 72 ? -22.290 -14.466 30.757  1.00 54.77  ? 68  ASN B N   1 
ATOM   1271 C  CA  . ASN C 1 72 ? -23.256 -13.385 30.604  1.00 56.14  ? 68  ASN B CA  1 
ATOM   1272 C  C   . ASN C 1 72 ? -24.656 -13.925 30.340  1.00 57.27  ? 68  ASN B C   1 
ATOM   1273 O  O   . ASN C 1 72 ? -25.641 -13.392 30.865  1.00 58.54  ? 68  ASN B O   1 
ATOM   1274 C  CB  . ASN C 1 72 ? -22.813 -12.453 29.479  1.00 58.07  ? 68  ASN B CB  1 
ATOM   1275 C  CG  . ASN C 1 72 ? -21.632 -11.589 29.873  1.00 70.88  ? 68  ASN B CG  1 
ATOM   1276 O  OD1 . ASN C 1 72 ? -21.342 -11.431 31.061  1.00 78.72  ? 68  ASN B OD1 1 
ATOM   1277 N  ND2 . ASN C 1 72 ? -20.952 -11.011 28.883  1.00 73.55  ? 68  ASN B ND2 1 
ATOM   1278 N  N   . LEU C 1 73 ? -24.766 -14.981 29.535  1.00 57.56  ? 69  LEU B N   1 
ATOM   1279 C  CA  . LEU C 1 73 ? -26.083 -15.479 29.149  1.00 57.69  ? 69  LEU B CA  1 
ATOM   1280 C  C   . LEU C 1 73 ? -26.774 -16.217 30.289  1.00 61.91  ? 69  LEU B C   1 
ATOM   1281 O  O   . LEU C 1 73 ? -27.990 -16.091 30.469  1.00 62.44  ? 69  LEU B O   1 
ATOM   1282 C  CB  . LEU C 1 73 ? -25.957 -16.391 27.931  1.00 53.44  ? 69  LEU B CB  1 
ATOM   1283 C  CG  . LEU C 1 73 ? -27.298 -16.934 27.441  1.00 50.05  ? 69  LEU B CG  1 
ATOM   1284 C  CD1 . LEU C 1 73 ? -28.090 -15.862 26.709  1.00 49.94  ? 69  LEU B CD1 1 
ATOM   1285 C  CD2 . LEU C 1 73 ? -27.081 -18.146 26.560  1.00 48.18  ? 69  LEU B CD2 1 
ATOM   1286 N  N   . LEU C 1 74 ? -26.023 -16.997 31.063  1.00 61.44  ? 70  LEU B N   1 
ATOM   1287 C  CA  . LEU C 1 74 ? -26.627 -17.996 31.931  1.00 59.10  ? 70  LEU B CA  1 
ATOM   1288 C  C   . LEU C 1 74 ? -26.433 -17.752 33.415  1.00 65.57  ? 70  LEU B C   1 
ATOM   1289 O  O   . LEU C 1 74 ? -27.052 -18.461 34.216  1.00 70.75  ? 70  LEU B O   1 
ATOM   1290 C  CB  . LEU C 1 74 ? -26.088 -19.390 31.593  1.00 57.59  ? 70  LEU B CB  1 
ATOM   1291 C  CG  . LEU C 1 74 ? -26.393 -19.753 30.147  1.00 57.31  ? 70  LEU B CG  1 
ATOM   1292 C  CD1 . LEU C 1 74 ? -25.714 -21.046 29.770  1.00 61.15  ? 70  LEU B CD1 1 
ATOM   1293 C  CD2 . LEU C 1 74 ? -27.886 -19.856 29.958  1.00 56.75  ? 70  LEU B CD2 1 
ATOM   1294 N  N   . ASN C 1 75 ? -25.592 -16.801 33.813  1.00 66.93  ? 71  ASN B N   1 
ATOM   1295 C  CA  . ASN C 1 75 ? -25.384 -16.584 35.235  1.00 70.80  ? 71  ASN B CA  1 
ATOM   1296 C  C   . ASN C 1 75 ? -26.695 -16.136 35.866  1.00 79.89  ? 71  ASN B C   1 
ATOM   1297 O  O   . ASN C 1 75 ? -27.386 -15.263 35.335  1.00 82.74  ? 71  ASN B O   1 
ATOM   1298 C  CB  . ASN C 1 75 ? -24.291 -15.544 35.467  1.00 65.01  ? 71  ASN B CB  1 
ATOM   1299 C  CG  . ASN C 1 75 ? -23.719 -15.599 36.861  1.00 63.00  ? 71  ASN B CG  1 
ATOM   1300 O  OD1 . ASN C 1 75 ? -23.750 -16.646 37.510  1.00 62.05  ? 71  ASN B OD1 1 
ATOM   1301 N  ND2 . ASN C 1 75 ? -23.189 -14.477 37.334  1.00 64.69  ? 71  ASN B ND2 1 
ATOM   1302 N  N   . GLY C 1 76 ? -27.053 -16.762 36.988  1.00 87.09  ? 72  GLY B N   1 
ATOM   1303 C  CA  . GLY C 1 76 ? -28.247 -16.407 37.726  1.00 82.97  ? 72  GLY B CA  1 
ATOM   1304 C  C   . GLY C 1 76 ? -29.521 -17.044 37.225  1.00 73.03  ? 72  GLY B C   1 
ATOM   1305 O  O   . GLY C 1 76 ? -30.571 -16.862 37.852  1.00 76.48  ? 72  GLY B O   1 
ATOM   1306 N  N   . ILE C 1 77 ? -29.471 -17.766 36.105  1.00 64.51  ? 73  ILE B N   1 
ATOM   1307 C  CA  . ILE C 1 77 ? -30.649 -18.452 35.591  1.00 60.35  ? 73  ILE B CA  1 
ATOM   1308 C  C   . ILE C 1 77 ? -31.095 -19.490 36.612  1.00 61.05  ? 73  ILE B C   1 
ATOM   1309 O  O   . ILE C 1 77 ? -30.273 -20.231 37.167  1.00 62.76  ? 73  ILE B O   1 
ATOM   1310 C  CB  . ILE C 1 77 ? -30.324 -19.095 34.232  1.00 54.98  ? 73  ILE B CB  1 
ATOM   1311 C  CG1 . ILE C 1 77 ? -30.122 -18.021 33.164  1.00 52.05  ? 73  ILE B CG1 1 
ATOM   1312 C  CG2 . ILE C 1 77 ? -31.426 -20.048 33.800  1.00 52.57  ? 73  ILE B CG2 1 
ATOM   1313 C  CD1 . ILE C 1 77 ? -31.354 -17.198 32.882  1.00 51.68  ? 73  ILE B CD1 1 
ATOM   1314 N  N   . LYS C 1 78 ? -32.396 -19.542 36.882  1.00 62.31  ? 74  LYS B N   1 
ATOM   1315 C  CA  . LYS C 1 78 ? -32.930 -20.471 37.871  1.00 70.66  ? 74  LYS B CA  1 
ATOM   1316 C  C   . LYS C 1 78 ? -33.153 -21.833 37.224  1.00 72.42  ? 74  LYS B C   1 
ATOM   1317 O  O   . LYS C 1 78 ? -33.893 -21.942 36.241  1.00 72.23  ? 74  LYS B O   1 
ATOM   1318 C  CB  . LYS C 1 78 ? -34.231 -19.939 38.474  1.00 74.09  ? 74  LYS B CB  1 
ATOM   1319 C  CG  . LYS C 1 78 ? -34.039 -18.853 39.538  1.00 73.36  ? 74  LYS B CG  1 
ATOM   1320 C  CD  . LYS C 1 78 ? -35.357 -18.397 40.156  1.00 76.10  ? 74  LYS B CD  1 
ATOM   1321 C  CE  . LYS C 1 78 ? -35.120 -17.271 41.161  1.00 82.76  ? 74  LYS B CE  1 
ATOM   1322 N  NZ  . LYS C 1 78 ? -36.268 -17.111 42.104  1.00 89.29  ? 74  LYS B NZ  1 
ATOM   1323 N  N   . LEU C 1 79 ? -32.542 -22.869 37.799  1.00 78.64  ? 75  LEU B N   1 
ATOM   1324 C  CA  . LEU C 1 79 ? -32.775 -24.256 37.413  1.00 82.59  ? 75  LEU B CA  1 
ATOM   1325 C  C   . LEU C 1 79 ? -33.446 -24.930 38.601  1.00 85.96  ? 75  LEU B C   1 
ATOM   1326 O  O   . LEU C 1 79 ? -32.827 -25.089 39.660  1.00 87.60  ? 75  LEU B O   1 
ATOM   1327 C  CB  . LEU C 1 79 ? -31.474 -24.968 37.046  1.00 86.15  ? 75  LEU B CB  1 
ATOM   1328 C  CG  . LEU C 1 79 ? -30.817 -24.662 35.704  1.00 86.06  ? 75  LEU B CG  1 
ATOM   1329 C  CD1 . LEU C 1 79 ? -29.600 -25.545 35.516  1.00 89.02  ? 75  LEU B CD1 1 
ATOM   1330 C  CD2 . LEU C 1 79 ? -31.809 -24.895 34.585  1.00 84.89  ? 75  LEU B CD2 1 
ATOM   1331 N  N   . TYR C 1 80 ? -34.710 -25.314 38.425  1.00 85.71  ? 76  TYR B N   1 
ATOM   1332 C  CA  . TYR C 1 80 ? -35.505 -25.908 39.497  1.00 86.98  ? 76  TYR B CA  1 
ATOM   1333 C  C   . TYR C 1 80 ? -35.559 -24.985 40.713  1.00 87.86  ? 76  TYR B C   1 
ATOM   1334 O  O   . TYR C 1 80 ? -35.432 -25.427 41.857  1.00 91.86  ? 76  TYR B O   1 
ATOM   1335 C  CB  . TYR C 1 80 ? -34.984 -27.289 39.889  1.00 89.26  ? 76  TYR B CB  1 
ATOM   1336 C  CG  . TYR C 1 80 ? -35.021 -28.334 38.795  1.00 87.73  ? 76  TYR B CG  1 
ATOM   1337 C  CD1 . TYR C 1 80 ? -36.226 -28.779 38.271  1.00 87.89  ? 76  TYR B CD1 1 
ATOM   1338 C  CD2 . TYR C 1 80 ? -33.849 -28.891 38.302  1.00 91.31  ? 76  TYR B CD2 1 
ATOM   1339 C  CE1 . TYR C 1 80 ? -36.264 -29.735 37.280  1.00 90.05  ? 76  TYR B CE1 1 
ATOM   1340 C  CE2 . TYR C 1 80 ? -33.877 -29.850 37.305  1.00 93.87  ? 76  TYR B CE2 1 
ATOM   1341 C  CZ  . TYR C 1 80 ? -35.089 -30.267 36.801  1.00 92.97  ? 76  TYR B CZ  1 
ATOM   1342 O  OH  . TYR C 1 80 ? -35.141 -31.216 35.807  1.00 94.76  ? 76  TYR B OH  1 
ATOM   1343 N  N   . GLY C 1 81 ? -35.698 -23.685 40.460  1.00 85.30  ? 77  GLY B N   1 
ATOM   1344 C  CA  . GLY C 1 81 ? -35.880 -22.700 41.509  1.00 87.43  ? 77  GLY B CA  1 
ATOM   1345 C  C   . GLY C 1 81 ? -34.622 -22.130 42.131  1.00 89.59  ? 77  GLY B C   1 
ATOM   1346 O  O   . GLY C 1 81 ? -34.728 -21.230 42.975  1.00 96.92  ? 77  GLY B O   1 
ATOM   1347 N  N   . ARG C 1 82 ? -33.440 -22.612 41.751  1.00 84.12  ? 78  ARG B N   1 
ATOM   1348 C  CA  . ARG C 1 82 ? -32.190 -22.153 42.345  1.00 81.62  ? 78  ARG B CA  1 
ATOM   1349 C  C   . ARG C 1 82 ? -31.370 -21.440 41.284  1.00 75.93  ? 78  ARG B C   1 
ATOM   1350 O  O   . ARG C 1 82 ? -30.982 -22.072 40.286  1.00 75.44  ? 78  ARG B O   1 
ATOM   1351 C  CB  . ARG C 1 82 ? -31.372 -23.308 42.918  1.00 81.37  ? 78  ARG B CB  1 
ATOM   1352 C  CG  . ARG C 1 82 ? -32.120 -24.248 43.801  1.00 79.48  ? 78  ARG B CG  1 
ATOM   1353 C  CD  . ARG C 1 82 ? -31.198 -25.334 44.324  1.00 78.93  ? 78  ARG B CD  1 
ATOM   1354 N  NE  . ARG C 1 82 ? -29.987 -24.775 44.913  1.00 77.84  ? 78  ARG B NE  1 
ATOM   1355 C  CZ  . ARG C 1 82 ? -29.072 -25.493 45.557  1.00 82.29  ? 78  ARG B CZ  1 
ATOM   1356 N  NH1 . ARG C 1 82 ? -29.234 -26.801 45.702  1.00 85.70  ? 78  ARG B NH1 1 
ATOM   1357 N  NH2 . ARG C 1 82 ? -27.999 -24.901 46.060  1.00 84.17  ? 78  ARG B NH2 1 
ATOM   1358 N  N   . PRO C 1 83 ? -31.047 -20.160 41.453  1.00 58.81  ? 79  PRO B N   1 
ATOM   1359 C  CA  . PRO C 1 83 ? -30.238 -19.468 40.437  1.00 76.66  ? 79  PRO B CA  1 
ATOM   1360 C  C   . PRO C 1 83 ? -28.828 -20.035 40.452  1.00 78.11  ? 79  PRO B C   1 
ATOM   1361 O  O   . PRO C 1 83 ? -28.153 -20.014 41.483  1.00 80.11  ? 79  PRO B O   1 
ATOM   1362 C  CB  . PRO C 1 83 ? -30.266 -18.002 40.889  1.00 55.56  ? 79  PRO B CB  1 
ATOM   1363 C  CG  . PRO C 1 83 ? -30.601 -18.059 42.347  1.00 71.98  ? 79  PRO B CG  1 
ATOM   1364 C  CD  . PRO C 1 83 ? -31.460 -19.271 42.549  1.00 73.56  ? 79  PRO B CD  1 
ATOM   1365 N  N   . ILE C 1 84 ? -28.378 -20.533 39.298  1.00 74.27  ? 80  ILE B N   1 
ATOM   1366 C  CA  . ILE C 1 84 ? -27.038 -21.105 39.228  1.00 78.30  ? 80  ILE B CA  1 
ATOM   1367 C  C   . ILE C 1 84 ? -26.003 -19.996 39.372  1.00 85.62  ? 80  ILE B C   1 
ATOM   1368 O  O   . ILE C 1 84 ? -26.247 -18.833 39.022  1.00 88.50  ? 80  ILE B O   1 
ATOM   1369 C  CB  . ILE C 1 84 ? -26.848 -21.900 37.923  1.00 72.16  ? 80  ILE B CB  1 
ATOM   1370 C  CG1 . ILE C 1 84 ? -26.805 -20.972 36.709  1.00 65.19  ? 80  ILE B CG1 1 
ATOM   1371 C  CG2 . ILE C 1 84 ? -27.969 -22.908 37.756  1.00 70.42  ? 80  ILE B CG2 1 
ATOM   1372 C  CD1 . ILE C 1 84 ? -26.572 -21.707 35.392  1.00 47.53  ? 80  ILE B CD1 1 
ATOM   1373 N  N   . LYS C 1 85 ? -24.843 -20.355 39.927  1.00 91.66  ? 81  LYS B N   1 
ATOM   1374 C  CA  . LYS C 1 85 ? -23.756 -19.418 40.204  1.00 94.14  ? 81  LYS B CA  1 
ATOM   1375 C  C   . LYS C 1 85 ? -22.534 -19.883 39.420  1.00 98.76  ? 81  LYS B C   1 
ATOM   1376 O  O   . LYS C 1 85 ? -21.935 -20.916 39.741  1.00 106.68 ? 81  LYS B O   1 
ATOM   1377 C  CB  . LYS C 1 85 ? -23.462 -19.331 41.705  1.00 92.88  ? 81  LYS B CB  1 
ATOM   1378 N  N   . ILE C 1 86 ? -22.187 -19.124 38.385  1.00 89.85  ? 82  ILE B N   1 
ATOM   1379 C  CA  . ILE C 1 86 ? -21.110 -19.445 37.454  1.00 86.45  ? 82  ILE B CA  1 
ATOM   1380 C  C   . ILE C 1 86 ? -19.853 -18.668 37.822  1.00 90.10  ? 82  ILE B C   1 
ATOM   1381 O  O   . ILE C 1 86 ? -19.871 -17.433 37.882  1.00 91.33  ? 82  ILE B O   1 
ATOM   1382 C  CB  . ILE C 1 86 ? -21.527 -19.164 36.005  1.00 75.00  ? 82  ILE B CB  1 
ATOM   1383 C  CG1 . ILE C 1 86 ? -22.767 -19.987 35.645  1.00 70.58  ? 82  ILE B CG1 1 
ATOM   1384 C  CG2 . ILE C 1 86 ? -20.370 -19.407 35.069  1.00 69.09  ? 82  ILE B CG2 1 
ATOM   1385 C  CD1 . ILE C 1 86 ? -23.230 -19.810 34.226  1.00 61.83  ? 82  ILE B CD1 1 
ATOM   1386 N  N   . GLN C 1 87 ? -18.791 -19.388 38.179  1.00 92.04  ? 83  GLN B N   1 
ATOM   1387 C  CA  . GLN C 1 87 ? -17.475 -18.800 38.380  1.00 96.27  ? 83  GLN B CA  1 
ATOM   1388 C  C   . GLN C 1 87 ? -16.498 -19.198 37.275  1.00 99.06  ? 83  GLN B C   1 
ATOM   1389 O  O   . GLN C 1 87 ? -16.544 -20.316 36.751  1.00 99.53  ? 83  GLN B O   1 
ATOM   1390 C  CB  . GLN C 1 87 ? -16.917 -19.198 39.742  1.00 98.77  ? 83  GLN B CB  1 
ATOM   1391 C  CG  . GLN C 1 87 ? -17.810 -18.756 40.871  1.00 96.70  ? 83  GLN B CG  1 
ATOM   1392 C  CD  . GLN C 1 87 ? -17.398 -19.330 42.203  1.00 104.07 ? 83  GLN B CD  1 
ATOM   1393 O  OE1 . GLN C 1 87 ? -16.482 -20.144 42.281  1.00 108.50 ? 83  GLN B OE1 1 
ATOM   1394 N  NE2 . GLN C 1 87 ? -18.081 -18.913 43.264  1.00 106.40 ? 83  GLN B NE2 1 
ATOM   1395 N  N   . PHE C 1 88 ? -15.619 -18.262 36.913  1.00 100.90 ? 84  PHE B N   1 
ATOM   1396 C  CA  . PHE C 1 88 ? -14.512 -18.576 36.018  1.00 99.89  ? 84  PHE B CA  1 
ATOM   1397 C  C   . PHE C 1 88 ? -13.507 -19.466 36.743  1.00 106.88 ? 84  PHE B C   1 
ATOM   1398 O  O   . PHE C 1 88 ? -13.031 -19.121 37.832  1.00 111.64 ? 84  PHE B O   1 
ATOM   1399 C  CB  . PHE C 1 88 ? -13.812 -17.303 35.537  1.00 97.61  ? 84  PHE B CB  1 
ATOM   1400 C  CG  . PHE C 1 88 ? -14.668 -16.415 34.678  1.00 91.25  ? 84  PHE B CG  1 
ATOM   1401 C  CD1 . PHE C 1 88 ? -15.205 -16.882 33.491  1.00 87.76  ? 84  PHE B CD1 1 
ATOM   1402 C  CD2 . PHE C 1 88 ? -14.902 -15.100 35.042  1.00 90.22  ? 84  PHE B CD2 1 
ATOM   1403 C  CE1 . PHE C 1 88 ? -15.985 -16.057 32.691  1.00 83.84  ? 84  PHE B CE1 1 
ATOM   1404 C  CE2 . PHE C 1 88 ? -15.677 -14.270 34.249  1.00 86.38  ? 84  PHE B CE2 1 
ATOM   1405 C  CZ  . PHE C 1 88 ? -16.222 -14.749 33.074  1.00 82.53  ? 84  PHE B CZ  1 
ATOM   1406 N  N   . ARG C 1 89 ? -13.176 -20.613 36.146  1.00 109.27 ? 85  ARG B N   1 
ATOM   1407 C  CA  . ARG C 1 89 ? -12.165 -21.473 36.753  1.00 118.59 ? 85  ARG B CA  1 
ATOM   1408 C  C   . ARG C 1 89 ? -10.766 -20.895 36.579  1.00 125.01 ? 85  ARG B C   1 
ATOM   1409 O  O   . ARG C 1 89 ? -9.889  -21.129 37.419  1.00 134.53 ? 85  ARG B O   1 
ATOM   1410 C  CB  . ARG C 1 89 ? -12.239 -22.881 36.162  1.00 117.73 ? 85  ARG B CB  1 
ATOM   1411 N  N   . SER C 1 90 ? -10.541 -20.145 35.504  1.00 120.14 ? 86  SER B N   1 
ATOM   1412 C  CA  . SER C 1 90 ? -9.265  -19.475 35.285  1.00 121.56 ? 86  SER B CA  1 
ATOM   1413 C  C   . SER C 1 90 ? -9.426  -17.965 35.419  1.00 119.51 ? 86  SER B C   1 
ATOM   1414 O  O   . SER C 1 90 ? -9.446  -17.245 34.423  1.00 115.48 ? 86  SER B O   1 
ATOM   1415 C  CB  . SER C 1 90 ? -8.696  -19.827 33.908  1.00 119.14 ? 86  SER B CB  1 
ATOM   1416 N  N   . PHE D 2 7  ? -27.202 -25.790 15.379  1.00 104.82 ? 286 PHE C N   1 
ATOM   1417 C  CA  . PHE D 2 7  ? -27.476 -24.936 16.535  1.00 103.02 ? 286 PHE C CA  1 
ATOM   1418 C  C   . PHE D 2 7  ? -28.814 -24.214 16.416  1.00 100.73 ? 286 PHE C C   1 
ATOM   1419 O  O   . PHE D 2 7  ? -28.941 -23.265 15.636  1.00 101.09 ? 286 PHE C O   1 
ATOM   1420 C  CB  . PHE D 2 7  ? -26.366 -23.907 16.746  1.00 100.25 ? 286 PHE C CB  1 
ATOM   1421 C  CG  . PHE D 2 7  ? -26.691 -22.903 17.802  1.00 98.96  ? 286 PHE C CG  1 
ATOM   1422 C  CD1 . PHE D 2 7  ? -26.861 -23.309 19.112  1.00 103.19 ? 286 PHE C CD1 1 
ATOM   1423 C  CD2 . PHE D 2 7  ? -26.819 -21.561 17.499  1.00 95.97  ? 286 PHE C CD2 1 
ATOM   1424 C  CE1 . PHE D 2 7  ? -27.164 -22.401 20.104  1.00 104.37 ? 286 PHE C CE1 1 
ATOM   1425 C  CE2 . PHE D 2 7  ? -27.115 -20.643 18.491  1.00 96.49  ? 286 PHE C CE2 1 
ATOM   1426 C  CZ  . PHE D 2 7  ? -27.292 -21.065 19.793  1.00 100.25 ? 286 PHE C CZ  1 
ATOM   1427 N  N   . LYS D 2 8  ? -29.844 -24.729 17.094  1.00 96.44  ? 287 LYS C N   1 
ATOM   1428 C  CA  . LYS D 2 8  ? -31.131 -24.049 17.118  1.00 89.95  ? 287 LYS C CA  1 
ATOM   1429 C  C   . LYS D 2 8  ? -31.311 -23.135 18.337  1.00 81.21  ? 287 LYS C C   1 
ATOM   1430 O  O   . LYS D 2 8  ? -31.610 -23.633 19.432  1.00 80.27  ? 287 LYS C O   1 
ATOM   1431 C  CB  . LYS D 2 8  ? -32.255 -25.085 17.067  1.00 91.84  ? 287 LYS C CB  1 
ATOM   1432 N  N   . PRO D 2 9  ? -31.154 -21.812 18.205  1.00 75.42  ? 288 PRO C N   1 
ATOM   1433 C  CA  . PRO D 2 9  ? -31.264 -20.919 19.374  1.00 73.69  ? 288 PRO C CA  1 
ATOM   1434 C  C   . PRO D 2 9  ? -32.686 -20.874 19.924  1.00 71.82  ? 288 PRO C C   1 
ATOM   1435 O  O   . PRO D 2 9  ? -33.660 -20.780 19.172  1.00 71.40  ? 288 PRO C O   1 
ATOM   1436 C  CB  . PRO D 2 9  ? -30.848 -19.548 18.825  1.00 73.06  ? 288 PRO C CB  1 
ATOM   1437 C  CG  . PRO D 2 9  ? -30.184 -19.822 17.525  1.00 72.41  ? 288 PRO C CG  1 
ATOM   1438 C  CD  . PRO D 2 9  ? -30.768 -21.086 16.988  1.00 73.59  ? 288 PRO C CD  1 
ATOM   1439 N  N   . GLY D 2 10 ? -32.804 -20.904 21.250  1.00 71.04  ? 289 GLY C N   1 
ATOM   1440 C  CA  . GLY D 2 10 ? -34.091 -20.828 21.916  1.00 73.71  ? 289 GLY C CA  1 
ATOM   1441 C  C   . GLY D 2 10 ? -34.985 -22.043 21.789  1.00 79.08  ? 289 GLY C C   1 
ATOM   1442 O  O   . GLY D 2 10 ? -36.126 -22.004 22.267  1.00 83.86  ? 289 GLY C O   1 
ATOM   1443 N  N   . VAL D 2 11 ? -34.524 -23.104 21.137  1.00 81.07  ? 290 VAL C N   1 
ATOM   1444 C  CA  . VAL D 2 11 ? -35.235 -24.377 21.094  1.00 80.61  ? 290 VAL C CA  1 
ATOM   1445 C  C   . VAL D 2 11 ? -34.718 -25.256 22.224  1.00 82.30  ? 290 VAL C C   1 
ATOM   1446 O  O   . VAL D 2 11 ? -33.526 -25.582 22.270  1.00 87.12  ? 290 VAL C O   1 
ATOM   1447 C  CB  . VAL D 2 11 ? -35.056 -25.073 19.738  1.00 79.06  ? 290 VAL C CB  1 
ATOM   1448 C  CG1 . VAL D 2 11 ? -35.639 -26.480 19.790  1.00 83.10  ? 290 VAL C CG1 1 
ATOM   1449 C  CG2 . VAL D 2 11 ? -35.701 -24.259 18.640  1.00 77.00  ? 290 VAL C CG2 1 
ATOM   1450 N  N   . ILE D 2 12 ? -35.602 -25.643 23.137  1.00 82.00  ? 291 ILE C N   1 
ATOM   1451 C  CA  . ILE D 2 12 ? -35.203 -26.476 24.260  1.00 84.11  ? 291 ILE C CA  1 
ATOM   1452 C  C   . ILE D 2 12 ? -36.173 -27.642 24.398  1.00 87.78  ? 291 ILE C C   1 
ATOM   1453 O  O   . ILE D 2 12 ? -37.283 -27.635 23.863  1.00 87.64  ? 291 ILE C O   1 
ATOM   1454 C  CB  . ILE D 2 12 ? -35.104 -25.685 25.586  1.00 85.60  ? 291 ILE C CB  1 
ATOM   1455 C  CG1 . ILE D 2 12 ? -36.437 -25.027 25.954  1.00 87.04  ? 291 ILE C CG1 1 
ATOM   1456 C  CG2 . ILE D 2 12 ? -33.981 -24.654 25.514  1.00 83.10  ? 291 ILE C CG2 1 
ATOM   1457 C  CD1 . ILE D 2 12 ? -36.388 -24.301 27.282  1.00 86.21  ? 291 ILE C CD1 1 
ATOM   1458 N  N   . SER D 2 13 ? -35.718 -28.661 25.121  1.00 89.60  ? 292 SER C N   1 
ATOM   1459 C  CA  . SER D 2 13 ? -36.484 -29.870 25.351  1.00 90.66  ? 292 SER C CA  1 
ATOM   1460 C  C   . SER D 2 13 ? -37.552 -29.621 26.411  1.00 93.41  ? 292 SER C C   1 
ATOM   1461 O  O   . SER D 2 13 ? -37.568 -28.593 27.093  1.00 90.18  ? 292 SER C O   1 
ATOM   1462 C  CB  . SER D 2 13 ? -35.566 -31.008 25.790  1.00 88.41  ? 292 SER C CB  1 
ATOM   1463 O  OG  . SER D 2 13 ? -35.081 -30.777 27.102  1.00 84.82  ? 292 SER C OG  1 
ATOM   1464 N  N   . GLU D 2 14 ? -38.460 -30.588 26.547  1.00 99.24  ? 293 GLU C N   1 
ATOM   1465 C  CA  . GLU D 2 14 ? -39.468 -30.473 27.592  1.00 100.30 ? 293 GLU C CA  1 
ATOM   1466 C  C   . GLU D 2 14 ? -38.823 -30.579 28.965  1.00 102.48 ? 293 GLU C C   1 
ATOM   1467 O  O   . GLU D 2 14 ? -39.223 -29.873 29.899  1.00 102.74 ? 293 GLU C O   1 
ATOM   1468 C  CB  . GLU D 2 14 ? -40.545 -31.543 27.417  1.00 101.49 ? 293 GLU C CB  1 
ATOM   1469 N  N   . GLU D 2 15 ? -37.789 -31.414 29.090  1.00 105.90 ? 294 GLU C N   1 
ATOM   1470 C  CA  . GLU D 2 15 ? -37.114 -31.573 30.373  1.00 110.03 ? 294 GLU C CA  1 
ATOM   1471 C  C   . GLU D 2 15 ? -36.475 -30.265 30.820  1.00 108.89 ? 294 GLU C C   1 
ATOM   1472 O  O   . GLU D 2 15 ? -36.588 -29.876 31.989  1.00 113.76 ? 294 GLU C O   1 
ATOM   1473 C  CB  . GLU D 2 15 ? -36.065 -32.684 30.275  1.00 114.21 ? 294 GLU C CB  1 
ATOM   1474 C  CG  . GLU D 2 15 ? -35.401 -33.024 31.598  1.00 119.88 ? 294 GLU C CG  1 
ATOM   1475 C  CD  . GLU D 2 15 ? -34.304 -34.067 31.461  1.00 123.70 ? 294 GLU C CD  1 
ATOM   1476 O  OE1 . GLU D 2 15 ? -33.901 -34.371 30.317  1.00 122.61 ? 294 GLU C OE1 1 
ATOM   1477 O  OE2 . GLU D 2 15 ? -33.847 -34.583 32.504  1.00 127.59 ? 294 GLU C OE2 1 
ATOM   1478 N  N   . LEU D 2 16 ? -35.810 -29.564 29.900  1.00 105.38 ? 295 LEU C N   1 
ATOM   1479 C  CA  . LEU D 2 16 ? -35.229 -28.272 30.247  1.00 102.00 ? 295 LEU C CA  1 
ATOM   1480 C  C   . LEU D 2 16 ? -36.313 -27.225 30.459  1.00 99.89  ? 295 LEU C C   1 
ATOM   1481 O  O   . LEU D 2 16 ? -36.188 -26.363 31.336  1.00 100.96 ? 295 LEU C O   1 
ATOM   1482 C  CB  . LEU D 2 16 ? -34.244 -27.825 29.169  1.00 100.21 ? 295 LEU C CB  1 
ATOM   1483 C  CG  . LEU D 2 16 ? -33.442 -26.563 29.499  1.00 96.22  ? 295 LEU C CG  1 
ATOM   1484 C  CD1 . LEU D 2 16 ? -32.890 -26.615 30.920  1.00 98.85  ? 295 LEU C CD1 1 
ATOM   1485 C  CD2 . LEU D 2 16 ? -32.316 -26.373 28.502  1.00 91.75  ? 295 LEU C CD2 1 
ATOM   1486 N  N   . GLN D 2 17 ? -37.384 -27.280 29.661  1.00 98.23  ? 296 GLN C N   1 
ATOM   1487 C  CA  . GLN D 2 17 ? -38.504 -26.362 29.849  1.00 96.19  ? 296 GLN C CA  1 
ATOM   1488 C  C   . GLN D 2 17 ? -39.092 -26.500 31.250  1.00 97.06  ? 296 GLN C C   1 
ATOM   1489 O  O   . GLN D 2 17 ? -39.381 -25.500 31.919  1.00 96.47  ? 296 GLN C O   1 
ATOM   1490 C  CB  . GLN D 2 17 ? -39.573 -26.612 28.783  1.00 96.78  ? 296 GLN C CB  1 
ATOM   1491 N  N   . ASP D 2 18 ? -39.289 -27.739 31.705  1.00 98.26  ? 297 ASP C N   1 
ATOM   1492 C  CA  . ASP D 2 18 ? -39.800 -27.956 33.053  1.00 99.68  ? 297 ASP C CA  1 
ATOM   1493 C  C   . ASP D 2 18 ? -38.827 -27.420 34.094  1.00 100.56 ? 297 ASP C C   1 
ATOM   1494 O  O   . ASP D 2 18 ? -39.242 -26.884 35.130  1.00 107.89 ? 297 ASP C O   1 
ATOM   1495 C  CB  . ASP D 2 18 ? -40.065 -29.446 33.280  1.00 102.43 ? 297 ASP C CB  1 
ATOM   1496 N  N   . ALA D 2 19 ? -37.524 -27.551 33.830  1.00 93.27  ? 298 ALA C N   1 
ATOM   1497 C  CA  . ALA D 2 19 ? -36.511 -27.040 34.749  1.00 90.67  ? 298 ALA C CA  1 
ATOM   1498 C  C   . ALA D 2 19 ? -36.567 -25.520 34.851  1.00 88.84  ? 298 ALA C C   1 
ATOM   1499 O  O   . ALA D 2 19 ? -36.351 -24.956 35.930  1.00 95.40  ? 298 ALA C O   1 
ATOM   1500 C  CB  . ALA D 2 19 ? -35.123 -27.500 34.302  1.00 87.99  ? 298 ALA C CB  1 
ATOM   1501 N  N   . LEU D 2 20 ? -36.822 -24.840 33.735  1.00 82.71  ? 299 LEU C N   1 
ATOM   1502 C  CA  . LEU D 2 20 ? -36.879 -23.383 33.730  1.00 80.58  ? 299 LEU C CA  1 
ATOM   1503 C  C   . LEU D 2 20 ? -38.199 -22.820 34.242  1.00 79.96  ? 299 LEU C C   1 
ATOM   1504 O  O   . LEU D 2 20 ? -38.260 -21.627 34.563  1.00 80.46  ? 299 LEU C O   1 
ATOM   1505 C  CB  . LEU D 2 20 ? -36.611 -22.859 32.320  1.00 66.58  ? 299 LEU C CB  1 
ATOM   1506 C  CG  . LEU D 2 20 ? -35.170 -23.141 31.899  1.00 65.72  ? 299 LEU C CG  1 
ATOM   1507 C  CD1 . LEU D 2 20 ? -34.944 -22.836 30.434  1.00 63.29  ? 299 LEU C CD1 1 
ATOM   1508 C  CD2 . LEU D 2 20 ? -34.206 -22.363 32.786  1.00 65.98  ? 299 LEU C CD2 1 
ATOM   1509 N  N   . GLY D 2 21 ? -39.244 -23.636 34.346  1.00 80.86  ? 300 GLY C N   1 
ATOM   1510 C  CA  . GLY D 2 21 ? -40.530 -23.122 34.771  1.00 80.24  ? 300 GLY C CA  1 
ATOM   1511 C  C   . GLY D 2 21 ? -41.320 -22.450 33.673  1.00 79.35  ? 300 GLY C C   1 
ATOM   1512 O  O   . GLY D 2 21 ? -42.124 -21.555 33.955  1.00 82.83  ? 300 GLY C O   1 
ATOM   1513 N  N   . VAL D 2 22 ? -41.098 -22.839 32.420  1.00 76.95  ? 301 VAL C N   1 
ATOM   1514 C  CA  . VAL D 2 22 ? -41.739 -22.204 31.272  1.00 80.82  ? 301 VAL C CA  1 
ATOM   1515 C  C   . VAL D 2 22 ? -43.081 -22.898 31.056  1.00 85.07  ? 301 VAL C C   1 
ATOM   1516 O  O   . VAL D 2 22 ? -43.153 -23.979 30.467  1.00 87.62  ? 301 VAL C O   1 
ATOM   1517 C  CB  . VAL D 2 22 ? -40.855 -22.269 30.026  1.00 65.86  ? 301 VAL C CB  1 
ATOM   1518 C  CG1 . VAL D 2 22 ? -41.566 -21.660 28.832  1.00 64.79  ? 301 VAL C CG1 1 
ATOM   1519 C  CG2 . VAL D 2 22 ? -39.528 -21.574 30.289  1.00 64.41  ? 301 VAL C CG2 1 
ATOM   1520 N  N   . THR D 2 23 ? -44.155 -22.261 31.529  1.00 86.61  ? 302 THR C N   1 
ATOM   1521 C  CA  . THR D 2 23 ? -45.493 -22.836 31.447  1.00 86.52  ? 302 THR C CA  1 
ATOM   1522 C  C   . THR D 2 23 ? -46.091 -22.774 30.046  1.00 92.22  ? 302 THR C C   1 
ATOM   1523 O  O   . THR D 2 23 ? -47.268 -23.119 29.889  1.00 97.53  ? 302 THR C O   1 
ATOM   1524 C  CB  . THR D 2 23 ? -46.429 -22.130 32.435  1.00 78.51  ? 302 THR C CB  1 
ATOM   1525 N  N   . ASP D 2 24 ? -45.332 -22.345 29.038  1.00 90.26  ? 303 ASP C N   1 
ATOM   1526 C  CA  . ASP D 2 24 ? -45.825 -22.257 27.663  1.00 94.48  ? 303 ASP C CA  1 
ATOM   1527 C  C   . ASP D 2 24 ? -44.735 -22.794 26.746  1.00 97.06  ? 303 ASP C C   1 
ATOM   1528 O  O   . ASP D 2 24 ? -43.658 -22.201 26.653  1.00 100.23 ? 303 ASP C O   1 
ATOM   1529 C  CB  . ASP D 2 24 ? -46.192 -20.818 27.301  1.00 95.94  ? 303 ASP C CB  1 
ATOM   1530 C  CG  . ASP D 2 24 ? -46.951 -20.713 25.985  1.00 99.85  ? 303 ASP C CG  1 
ATOM   1531 O  OD1 . ASP D 2 24 ? -46.654 -21.476 25.040  1.00 103.07 ? 303 ASP C OD1 1 
ATOM   1532 O  OD2 . ASP D 2 24 ? -47.852 -19.851 25.895  1.00 101.23 ? 303 ASP C OD2 1 
ATOM   1533 N  N   . LYS D 2 25 ? -45.027 -23.897 26.056  1.00 98.58  ? 304 LYS C N   1 
ATOM   1534 C  CA  . LYS D 2 25 ? -43.996 -24.600 25.298  1.00 98.11  ? 304 LYS C CA  1 
ATOM   1535 C  C   . LYS D 2 25 ? -43.426 -23.740 24.176  1.00 90.32  ? 304 LYS C C   1 
ATOM   1536 O  O   . LYS D 2 25 ? -42.213 -23.749 23.935  1.00 89.61  ? 304 LYS C O   1 
ATOM   1537 C  CB  . LYS D 2 25 ? -44.563 -25.901 24.731  1.00 104.68 ? 304 LYS C CB  1 
ATOM   1538 N  N   . SER D 2 26 ? -44.277 -22.984 23.484  1.00 91.54  ? 305 SER C N   1 
ATOM   1539 C  CA  . SER D 2 26 ? -43.852 -22.272 22.283  1.00 91.93  ? 305 SER C CA  1 
ATOM   1540 C  C   . SER D 2 26 ? -43.065 -21.001 22.568  1.00 90.42  ? 305 SER C C   1 
ATOM   1541 O  O   . SER D 2 26 ? -42.609 -20.368 21.607  1.00 94.36  ? 305 SER C O   1 
ATOM   1542 C  CB  . SER D 2 26 ? -45.062 -21.914 21.426  1.00 67.14  ? 305 SER C CB  1 
ATOM   1543 O  OG  . SER D 2 26 ? -45.653 -20.705 21.868  1.00 68.69  ? 305 SER C OG  1 
ATOM   1544 N  N   . LEU D 2 27 ? -42.901 -20.604 23.827  1.00 82.36  ? 306 LEU C N   1 
ATOM   1545 C  CA  . LEU D 2 27 ? -42.205 -19.366 24.149  1.00 79.99  ? 306 LEU C CA  1 
ATOM   1546 C  C   . LEU D 2 27 ? -40.703 -19.619 24.236  1.00 77.07  ? 306 LEU C C   1 
ATOM   1547 O  O   . LEU D 2 27 ? -40.254 -20.298 25.174  1.00 74.71  ? 306 LEU C O   1 
ATOM   1548 C  CB  . LEU D 2 27 ? -42.728 -18.796 25.459  1.00 81.26  ? 306 LEU C CB  1 
ATOM   1549 C  CG  . LEU D 2 27 ? -44.106 -18.121 25.397  1.00 83.05  ? 306 LEU C CG  1 
ATOM   1550 C  CD1 . LEU D 2 27 ? -44.473 -17.550 26.754  1.00 84.30  ? 306 LEU C CD1 1 
ATOM   1551 C  CD2 . LEU D 2 27 ? -44.182 -17.044 24.318  1.00 83.52  ? 306 LEU C CD2 1 
ATOM   1552 N  N   . PRO D 2 28 ? -39.899 -19.100 23.307  1.00 75.37  ? 307 PRO C N   1 
ATOM   1553 C  CA  . PRO D 2 28 ? -38.443 -19.363 23.312  1.00 70.10  ? 307 PRO C CA  1 
ATOM   1554 C  C   . PRO D 2 28 ? -37.767 -18.651 24.470  1.00 69.29  ? 307 PRO C C   1 
ATOM   1555 O  O   . PRO D 2 28 ? -37.953 -17.437 24.648  1.00 72.30  ? 307 PRO C O   1 
ATOM   1556 C  CB  . PRO D 2 28 ? -37.979 -18.808 21.958  1.00 67.31  ? 307 PRO C CB  1 
ATOM   1557 C  CG  . PRO D 2 28 ? -39.005 -17.783 21.601  1.00 68.97  ? 307 PRO C CG  1 
ATOM   1558 C  CD  . PRO D 2 28 ? -40.309 -18.244 22.178  1.00 74.38  ? 307 PRO C CD  1 
ATOM   1559 N  N   . PRO D 2 29 ? -36.928 -19.348 25.252  1.00 67.63  ? 308 PRO C N   1 
ATOM   1560 C  CA  . PRO D 2 29 ? -36.421 -18.748 26.496  1.00 71.69  ? 308 PRO C CA  1 
ATOM   1561 C  C   . PRO D 2 29 ? -35.291 -17.726 26.393  1.00 78.61  ? 308 PRO C C   1 
ATOM   1562 O  O   . PRO D 2 29 ? -35.423 -16.642 26.970  1.00 85.15  ? 308 PRO C O   1 
ATOM   1563 C  CB  . PRO D 2 29 ? -35.967 -19.976 27.298  1.00 68.63  ? 308 PRO C CB  1 
ATOM   1564 C  CG  . PRO D 2 29 ? -35.595 -20.981 26.271  1.00 68.12  ? 308 PRO C CG  1 
ATOM   1565 C  CD  . PRO D 2 29 ? -36.516 -20.753 25.100  1.00 67.58  ? 308 PRO C CD  1 
ATOM   1566 N  N   . PHE D 2 30 ? -34.183 -18.012 25.716  1.00 76.77  ? 309 PHE C N   1 
ATOM   1567 C  CA  . PHE D 2 30 ? -33.034 -17.117 25.840  1.00 76.61  ? 309 PHE C CA  1 
ATOM   1568 C  C   . PHE D 2 30 ? -32.943 -16.075 24.733  1.00 78.07  ? 309 PHE C C   1 
ATOM   1569 O  O   . PHE D 2 30 ? -32.080 -15.190 24.803  1.00 52.73  ? 309 PHE C O   1 
ATOM   1570 C  CB  . PHE D 2 30 ? -31.739 -17.930 25.888  1.00 71.10  ? 309 PHE C CB  1 
ATOM   1571 C  CG  . PHE D 2 30 ? -31.731 -18.943 26.981  1.00 68.63  ? 309 PHE C CG  1 
ATOM   1572 C  CD1 . PHE D 2 30 ? -31.527 -18.555 28.290  1.00 69.78  ? 309 PHE C CD1 1 
ATOM   1573 C  CD2 . PHE D 2 30 ? -31.969 -20.278 26.706  1.00 66.99  ? 309 PHE C CD2 1 
ATOM   1574 C  CE1 . PHE D 2 30 ? -31.537 -19.484 29.306  1.00 71.31  ? 309 PHE C CE1 1 
ATOM   1575 C  CE2 . PHE D 2 30 ? -31.979 -21.212 27.711  1.00 66.98  ? 309 PHE C CE2 1 
ATOM   1576 C  CZ  . PHE D 2 30 ? -31.763 -20.818 29.016  1.00 70.33  ? 309 PHE C CZ  1 
ATOM   1577 N  N   . ILE D 2 31 ? -33.846 -16.133 23.752  1.00 81.14  ? 310 ILE C N   1 
ATOM   1578 C  CA  . ILE D 2 31 ? -33.708 -15.345 22.532  1.00 52.01  ? 310 ILE C CA  1 
ATOM   1579 C  C   . ILE D 2 31 ? -33.577 -13.855 22.843  1.00 62.24  ? 310 ILE C C   1 
ATOM   1580 O  O   . ILE D 2 31 ? -32.649 -13.190 22.369  1.00 61.47  ? 310 ILE C O   1 
ATOM   1581 C  CB  . ILE D 2 31 ? -34.885 -15.635 21.585  1.00 52.38  ? 310 ILE C CB  1 
ATOM   1582 C  CG1 . ILE D 2 31 ? -34.663 -16.966 20.857  1.00 68.64  ? 310 ILE C CG1 1 
ATOM   1583 C  CG2 . ILE D 2 31 ? -35.083 -14.515 20.595  1.00 66.86  ? 310 ILE C CG2 1 
ATOM   1584 C  CD1 . ILE D 2 31 ? -33.396 -17.009 20.021  1.00 67.31  ? 310 ILE C CD1 1 
ATOM   1585 N  N   . TYR D 2 32 ? -34.475 -13.310 23.675  1.00 69.12  ? 311 TYR C N   1 
ATOM   1586 C  CA  . TYR D 2 32 ? -34.504 -11.855 23.844  1.00 76.26  ? 311 TYR C CA  1 
ATOM   1587 C  C   . TYR D 2 32 ? -33.211 -11.321 24.432  1.00 75.13  ? 311 TYR C C   1 
ATOM   1588 O  O   . TYR D 2 32 ? -32.728 -10.255 24.026  1.00 70.75  ? 311 TYR C O   1 
ATOM   1589 C  CB  . TYR D 2 32 ? -35.650 -11.434 24.778  1.00 55.59  ? 311 TYR C CB  1 
ATOM   1590 C  CG  . TYR D 2 32 ? -35.724 -9.923  24.959  1.00 56.84  ? 311 TYR C CG  1 
ATOM   1591 C  CD1 . TYR D 2 32 ? -36.554 -9.145  24.169  1.00 57.49  ? 311 TYR C CD1 1 
ATOM   1592 C  CD2 . TYR D 2 32 ? -34.934 -9.271  25.906  1.00 57.76  ? 311 TYR C CD2 1 
ATOM   1593 C  CE1 . TYR D 2 32 ? -36.604 -7.760  24.323  1.00 59.04  ? 311 TYR C CE1 1 
ATOM   1594 C  CE2 . TYR D 2 32 ? -34.973 -7.895  26.058  1.00 59.34  ? 311 TYR C CE2 1 
ATOM   1595 C  CZ  . TYR D 2 32 ? -35.812 -7.147  25.268  1.00 59.97  ? 311 TYR C CZ  1 
ATOM   1596 O  OH  . TYR D 2 32 ? -35.854 -5.782  25.418  1.00 61.93  ? 311 TYR C OH  1 
ATOM   1597 N  N   . ARG D 2 33 ? -32.593 -12.090 25.322  1.00 81.13  ? 312 ARG C N   1 
ATOM   1598 C  CA  . ARG D 2 33 ? -31.308 -11.715 25.892  1.00 79.79  ? 312 ARG C CA  1 
ATOM   1599 C  C   . ARG D 2 33 ? -30.155 -11.972 24.932  1.00 73.42  ? 312 ARG C C   1 
ATOM   1600 O  O   . ARG D 2 33 ? -29.184 -11.204 24.909  1.00 71.63  ? 312 ARG C O   1 
ATOM   1601 C  CB  . ARG D 2 33 ? -31.119 -12.479 27.209  1.00 78.52  ? 312 ARG C CB  1 
ATOM   1602 C  CG  . ARG D 2 33 ? -29.909 -12.088 28.007  1.00 75.89  ? 312 ARG C CG  1 
ATOM   1603 C  CD  . ARG D 2 33 ? -30.213 -11.179 29.172  1.00 74.86  ? 312 ARG C CD  1 
ATOM   1604 N  NE  . ARG D 2 33 ? -28.957 -10.812 29.795  1.00 81.22  ? 312 ARG C NE  1 
ATOM   1605 C  CZ  . ARG D 2 33 ? -28.147 -9.868  29.333  1.00 85.98  ? 312 ARG C CZ  1 
ATOM   1606 N  NH1 . ARG D 2 33 ? -26.900 -9.771  29.754  1.00 90.15  ? 312 ARG C NH1 1 
ATOM   1607 N  NH2 . ARG D 2 33 ? -28.536 -9.154  28.284  1.00 87.23  ? 312 ARG C NH2 1 
ATOM   1608 N  N   . MET D 2 34 ? -30.262 -13.031 24.126  1.00 71.09  ? 313 MET C N   1 
ATOM   1609 C  CA  . MET D 2 34 ? -29.191 -13.481 23.241  1.00 65.58  ? 313 MET C CA  1 
ATOM   1610 C  C   . MET D 2 34 ? -29.022 -12.545 22.049  1.00 65.49  ? 313 MET C C   1 
ATOM   1611 O  O   . MET D 2 34 ? -27.907 -12.362 21.548  1.00 72.72  ? 313 MET C O   1 
ATOM   1612 C  CB  . MET D 2 34 ? -29.505 -14.920 22.810  1.00 61.97  ? 313 MET C CB  1 
ATOM   1613 C  CG  . MET D 2 34 ? -28.469 -15.653 22.013  1.00 65.47  ? 313 MET C CG  1 
ATOM   1614 S  SD  . MET D 2 34 ? -29.037 -17.356 21.815  1.00 71.13  ? 313 MET C SD  1 
ATOM   1615 C  CE  . MET D 2 34 ? -28.882 -17.943 23.488  1.00 68.45  ? 313 MET C CE  1 
ATOM   1616 N  N   . ARG D 2 35 ? -30.131 -11.972 21.585  1.00 63.77  ? 314 ARG C N   1 
ATOM   1617 C  CA  . ARG D 2 35 ? -30.160 -11.030 20.472  1.00 64.24  ? 314 ARG C CA  1 
ATOM   1618 C  C   . ARG D 2 35 ? -29.407 -9.751  20.801  1.00 66.28  ? 314 ARG C C   1 
ATOM   1619 O  O   . ARG D 2 35 ? -28.857 -9.100  19.905  1.00 72.28  ? 314 ARG C O   1 
ATOM   1620 C  CB  . ARG D 2 35 ? -31.621 -10.708 20.262  1.00 69.60  ? 314 ARG C CB  1 
ATOM   1621 C  CG  . ARG D 2 35 ? -32.409 -11.865 19.746  1.00 72.72  ? 314 ARG C CG  1 
ATOM   1622 C  CD  . ARG D 2 35 ? -33.767 -11.373 19.392  1.00 77.02  ? 314 ARG C CD  1 
ATOM   1623 N  NE  . ARG D 2 35 ? -34.547 -12.262 18.558  1.00 75.12  ? 314 ARG C NE  1 
ATOM   1624 C  CZ  . ARG D 2 35 ? -35.845 -12.079 18.352  1.00 68.53  ? 314 ARG C CZ  1 
ATOM   1625 N  NH1 . ARG D 2 35 ? -36.455 -11.057 18.947  1.00 64.94  ? 314 ARG C NH1 1 
ATOM   1626 N  NH2 . ARG D 2 35 ? -36.529 -12.911 17.574  1.00 66.70  ? 314 ARG C NH2 1 
ATOM   1627 N  N   . GLN D 2 36 ? -29.348 -9.394  22.082  1.00 66.17  ? 315 GLN C N   1 
ATOM   1628 C  CA  . GLN D 2 36 ? -28.641 -8.207  22.533  1.00 69.82  ? 315 GLN C CA  1 
ATOM   1629 C  C   . GLN D 2 36 ? -27.171 -8.490  22.766  1.00 70.27  ? 315 GLN C C   1 
ATOM   1630 O  O   . GLN D 2 36 ? -26.321 -7.659  22.435  1.00 69.39  ? 315 GLN C O   1 
ATOM   1631 C  CB  . GLN D 2 36 ? -29.279 -7.643  23.807  1.00 72.20  ? 315 GLN C CB  1 
ATOM   1632 C  CG  . GLN D 2 36 ? -30.713 -7.166  23.669  1.00 74.20  ? 315 GLN C CG  1 
ATOM   1633 C  CD  . GLN D 2 36 ? -31.303 -6.736  24.998  1.00 76.89  ? 315 GLN C CD  1 
ATOM   1634 O  OE1 . GLN D 2 36 ? -30.789 -7.088  26.059  1.00 77.28  ? 315 GLN C OE1 1 
ATOM   1635 N  NE2 . GLN D 2 36 ? -32.332 -5.897  24.946  1.00 78.28  ? 315 GLN C NE2 1 
ATOM   1636 N  N   . LEU D 2 37 ? -26.853 -9.648  23.342  1.00 70.69  ? 316 LEU C N   1 
ATOM   1637 C  CA  . LEU D 2 37 ? -25.453 -10.045 23.421  1.00 69.09  ? 316 LEU C CA  1 
ATOM   1638 C  C   . LEU D 2 37 ? -24.891 -10.334 22.043  1.00 65.45  ? 316 LEU C C   1 
ATOM   1639 O  O   . LEU D 2 37 ? -23.685 -10.199 21.830  1.00 72.37  ? 316 LEU C O   1 
ATOM   1640 C  CB  . LEU D 2 37 ? -25.308 -11.270 24.308  1.00 53.56  ? 316 LEU C CB  1 
ATOM   1641 C  CG  . LEU D 2 37 ? -25.709 -11.061 25.758  1.00 55.30  ? 316 LEU C CG  1 
ATOM   1642 C  CD1 . LEU D 2 37 ? -25.694 -12.385 26.498  1.00 78.31  ? 316 LEU C CD1 1 
ATOM   1643 C  CD2 . LEU D 2 37 ? -24.791 -10.062 26.410  1.00 57.31  ? 316 LEU C CD2 1 
ATOM   1644 N  N   . GLY D 2 38 ? -25.738 -10.719 21.096  1.00 58.48  ? 317 GLY C N   1 
ATOM   1645 C  CA  . GLY D 2 38 ? -25.241 -11.130 19.803  1.00 57.51  ? 317 GLY C CA  1 
ATOM   1646 C  C   . GLY D 2 38 ? -25.104 -12.637 19.709  1.00 57.26  ? 317 GLY C C   1 
ATOM   1647 O  O   . GLY D 2 38 ? -25.209 -13.374 20.692  1.00 62.55  ? 317 GLY C O   1 
ATOM   1648 N  N   . TYR D 2 39 ? -24.780 -13.082 18.505  1.00 54.63  ? 318 TYR C N   1 
ATOM   1649 C  CA  . TYR D 2 39 ? -24.688 -14.503 18.230  1.00 55.47  ? 318 TYR C CA  1 
ATOM   1650 C  C   . TYR D 2 39 ? -23.504 -15.095 18.988  1.00 58.61  ? 318 TYR C C   1 
ATOM   1651 O  O   . TYR D 2 39 ? -22.423 -14.501 19.016  1.00 66.77  ? 318 TYR C O   1 
ATOM   1652 C  CB  . TYR D 2 39 ? -24.508 -14.723 16.726  1.00 58.43  ? 318 TYR C CB  1 
ATOM   1653 C  CG  . TYR D 2 39 ? -24.746 -16.132 16.216  1.00 60.02  ? 318 TYR C CG  1 
ATOM   1654 C  CD1 . TYR D 2 39 ? -25.951 -16.513 15.638  1.00 62.19  ? 318 TYR C CD1 1 
ATOM   1655 C  CD2 . TYR D 2 39 ? -23.733 -17.078 16.295  1.00 60.39  ? 318 TYR C CD2 1 
ATOM   1656 C  CE1 . TYR D 2 39 ? -26.137 -17.811 15.170  1.00 64.18  ? 318 TYR C CE1 1 
ATOM   1657 C  CE2 . TYR D 2 39 ? -23.908 -18.358 15.840  1.00 62.78  ? 318 TYR C CE2 1 
ATOM   1658 C  CZ  . TYR D 2 39 ? -25.106 -18.727 15.275  1.00 65.89  ? 318 TYR C CZ  1 
ATOM   1659 O  OH  . TYR D 2 39 ? -25.258 -20.020 14.815  1.00 69.55  ? 318 TYR C OH  1 
ATOM   1660 N  N   . PRO D 2 40 ? -23.689 -16.243 19.635  1.00 55.97  ? 319 PRO C N   1 
ATOM   1661 C  CA  . PRO D 2 40 ? -22.600 -16.863 20.399  1.00 60.04  ? 319 PRO C CA  1 
ATOM   1662 C  C   . PRO D 2 40 ? -21.365 -17.041 19.540  1.00 64.35  ? 319 PRO C C   1 
ATOM   1663 O  O   . PRO D 2 40 ? -21.426 -17.670 18.473  1.00 65.91  ? 319 PRO C O   1 
ATOM   1664 C  CB  . PRO D 2 40 ? -23.176 -18.224 20.829  1.00 60.78  ? 319 PRO C CB  1 
ATOM   1665 C  CG  . PRO D 2 40 ? -24.453 -18.401 20.105  1.00 59.08  ? 319 PRO C CG  1 
ATOM   1666 C  CD  . PRO D 2 40 ? -24.888 -17.090 19.533  1.00 57.19  ? 319 PRO C CD  1 
ATOM   1667 N  N   . PRO D 2 41 ? -20.233 -16.475 19.958  1.00 65.55  ? 320 PRO C N   1 
ATOM   1668 C  CA  . PRO D 2 41 ? -19.038 -16.531 19.107  1.00 68.53  ? 320 PRO C CA  1 
ATOM   1669 C  C   . PRO D 2 41 ? -18.550 -17.950 18.868  1.00 78.02  ? 320 PRO C C   1 
ATOM   1670 O  O   . PRO D 2 41 ? -18.005 -18.237 17.794  1.00 81.32  ? 320 PRO C O   1 
ATOM   1671 C  CB  . PRO D 2 41 ? -18.017 -15.694 19.887  1.00 64.94  ? 320 PRO C CB  1 
ATOM   1672 C  CG  . PRO D 2 41 ? -18.469 -15.764 21.306  1.00 65.88  ? 320 PRO C CG  1 
ATOM   1673 C  CD  . PRO D 2 41 ? -19.965 -15.843 21.261  1.00 65.99  ? 320 PRO C CD  1 
ATOM   1674 N  N   . GLY D 2 42 ? -18.741 -18.850 19.832  1.00 83.96  ? 321 GLY C N   1 
ATOM   1675 C  CA  . GLY D 2 42 ? -18.257 -20.208 19.674  1.00 85.47  ? 321 GLY C CA  1 
ATOM   1676 C  C   . GLY D 2 42 ? -19.014 -21.049 18.666  1.00 86.18  ? 321 GLY C C   1 
ATOM   1677 O  O   . GLY D 2 42 ? -18.513 -22.113 18.288  1.00 90.86  ? 321 GLY C O   1 
ATOM   1678 N  N   . TRP D 2 43 ? -20.176 -20.593 18.195  1.00 79.33  ? 322 TRP C N   1 
ATOM   1679 C  CA  . TRP D 2 43 ? -20.894 -21.319 17.150  1.00 74.74  ? 322 TRP C CA  1 
ATOM   1680 C  C   . TRP D 2 43 ? -20.524 -20.867 15.745  1.00 72.09  ? 322 TRP C C   1 
ATOM   1681 O  O   . TRP D 2 43 ? -20.660 -21.653 14.801  1.00 73.38  ? 322 TRP C O   1 
ATOM   1682 C  CB  . TRP D 2 43 ? -22.409 -21.199 17.355  1.00 71.15  ? 322 TRP C CB  1 
ATOM   1683 C  CG  . TRP D 2 43 ? -22.961 -22.096 18.428  1.00 69.05  ? 322 TRP C CG  1 
ATOM   1684 C  CD1 . TRP D 2 43 ? -23.407 -21.720 19.664  1.00 69.88  ? 322 TRP C CD1 1 
ATOM   1685 C  CD2 . TRP D 2 43 ? -23.168 -23.517 18.344  1.00 66.35  ? 322 TRP C CD2 1 
ATOM   1686 N  NE1 . TRP D 2 43 ? -23.854 -22.820 20.360  1.00 69.49  ? 322 TRP C NE1 1 
ATOM   1687 C  CE2 . TRP D 2 43 ? -23.719 -23.933 19.571  1.00 69.95  ? 322 TRP C CE2 1 
ATOM   1688 C  CE3 . TRP D 2 43 ? -22.925 -24.477 17.357  1.00 61.60  ? 322 TRP C CE3 1 
ATOM   1689 C  CZ2 . TRP D 2 43 ? -24.038 -25.266 19.831  1.00 70.26  ? 322 TRP C CZ2 1 
ATOM   1690 C  CZ3 . TRP D 2 43 ? -23.241 -25.798 17.621  1.00 61.36  ? 322 TRP C CZ3 1 
ATOM   1691 C  CH2 . TRP D 2 43 ? -23.792 -26.179 18.843  1.00 67.10  ? 322 TRP C CH2 1 
ATOM   1692 N  N   . LEU D 2 44 ? -20.082 -19.619 15.569  1.00 69.80  ? 323 LEU C N   1 
ATOM   1693 C  CA  . LEU D 2 44 ? -19.568 -19.221 14.263  1.00 68.78  ? 323 LEU C CA  1 
ATOM   1694 C  C   . LEU D 2 44 ? -18.351 -20.049 13.883  1.00 74.92  ? 323 LEU C C   1 
ATOM   1695 O  O   . LEU D 2 44 ? -18.149 -20.358 12.704  1.00 79.07  ? 323 LEU C O   1 
ATOM   1696 C  CB  . LEU D 2 44 ? -19.221 -17.736 14.255  1.00 63.18  ? 323 LEU C CB  1 
ATOM   1697 C  CG  . LEU D 2 44 ? -20.441 -16.821 14.234  1.00 59.92  ? 323 LEU C CG  1 
ATOM   1698 C  CD1 . LEU D 2 44 ? -20.021 -15.364 14.221  1.00 63.41  ? 323 LEU C CD1 1 
ATOM   1699 C  CD2 . LEU D 2 44 ? -21.319 -17.155 13.045  1.00 53.74  ? 323 LEU C CD2 1 
ATOM   1700 N  N   . LYS D 2 45 ? -17.537 -20.416 14.869  1.00 75.15  ? 324 LYS C N   1 
ATOM   1701 C  CA  . LYS D 2 45 ? -16.337 -21.199 14.637  1.00 76.40  ? 324 LYS C CA  1 
ATOM   1702 C  C   . LYS D 2 45 ? -16.283 -22.408 15.565  1.00 78.89  ? 324 LYS C C   1 
ATOM   1703 O  O   . LYS D 2 45 ? -15.441 -23.292 15.407  1.00 82.02  ? 324 LYS C O   1 
ATOM   1704 C  CB  . LYS D 2 45 ? -15.089 -20.333 14.823  1.00 79.53  ? 324 LYS C CB  1 
ATOM   1705 C  CG  . LYS D 2 45 ? -14.917 -19.710 16.199  1.00 79.19  ? 324 LYS C CG  1 
ATOM   1706 C  CD  . LYS D 2 45 ? -13.640 -18.883 16.213  1.00 80.96  ? 324 LYS C CD  1 
ATOM   1707 C  CE  . LYS D 2 45 ? -13.663 -17.805 17.280  1.00 82.67  ? 324 LYS C CE  1 
ATOM   1708 N  NZ  . LYS D 2 45 ? -12.470 -16.921 17.132  1.00 83.60  ? 324 LYS C NZ  1 
ATOM   1709 N  N   . ALA E 1 10 ? -27.479 -0.924  40.619  1.00 132.06 ? 6   ALA E N   1 
ATOM   1710 C  CA  . ALA E 1 10 ? -28.484 -1.626  39.830  1.00 123.22 ? 6   ALA E CA  1 
ATOM   1711 C  C   . ALA E 1 10 ? -29.891 -1.139  40.158  1.00 126.12 ? 6   ALA E C   1 
ATOM   1712 O  O   . ALA E 1 10 ? -30.804 -1.283  39.349  1.00 124.10 ? 6   ALA E O   1 
ATOM   1713 C  CB  . ALA E 1 10 ? -28.381 -3.123  40.059  1.00 114.78 ? 6   ALA E CB  1 
ATOM   1714 N  N   . GLU E 1 11 ? -30.046 -0.550  41.349  1.00 134.37 ? 7   GLU E N   1 
ATOM   1715 C  CA  . GLU E 1 11 ? -31.370 -0.178  41.845  1.00 136.71 ? 7   GLU E CA  1 
ATOM   1716 C  C   . GLU E 1 11 ? -32.015 0.903   40.986  1.00 138.90 ? 7   GLU E C   1 
ATOM   1717 O  O   . GLU E 1 11 ? -33.209 0.826   40.676  1.00 136.00 ? 7   GLU E O   1 
ATOM   1718 C  CB  . GLU E 1 11 ? -31.268 0.286   43.298  1.00 144.34 ? 7   GLU E CB  1 
ATOM   1719 N  N   . ALA E 1 12 ? -31.248 1.926   40.607  1.00 142.49 ? 8   ALA E N   1 
ATOM   1720 C  CA  . ALA E 1 12 ? -31.781 2.973   39.739  1.00 141.71 ? 8   ALA E CA  1 
ATOM   1721 C  C   . ALA E 1 12 ? -32.083 2.451   38.338  1.00 133.55 ? 8   ALA E C   1 
ATOM   1722 O  O   . ALA E 1 12 ? -32.972 2.975   37.658  1.00 131.31 ? 8   ALA E O   1 
ATOM   1723 C  CB  . ALA E 1 12 ? -30.807 4.150   39.673  1.00 149.58 ? 8   ALA E CB  1 
ATOM   1724 N  N   . ASP E 1 13 ? -31.342 1.438   37.884  1.00 128.83 ? 9   ASP E N   1 
ATOM   1725 C  CA  . ASP E 1 13 ? -31.514 0.924   36.529  1.00 120.52 ? 9   ASP E CA  1 
ATOM   1726 C  C   . ASP E 1 13 ? -32.876 0.268   36.323  1.00 114.80 ? 9   ASP E C   1 
ATOM   1727 O  O   . ASP E 1 13 ? -33.490 0.434   35.263  1.00 113.80 ? 9   ASP E O   1 
ATOM   1728 C  CB  . ASP E 1 13 ? -30.397 -0.065  36.203  1.00 118.34 ? 9   ASP E CB  1 
ATOM   1729 N  N   . ARG E 1 14 ? -33.370 -0.472  37.315  1.00 111.41 ? 10  ARG E N   1 
ATOM   1730 C  CA  . ARG E 1 14 ? -34.581 -1.286  37.143  1.00 102.06 ? 10  ARG E CA  1 
ATOM   1731 C  C   . ARG E 1 14 ? -35.876 -0.525  37.448  1.00 99.03  ? 10  ARG E C   1 
ATOM   1732 O  O   . ARG E 1 14 ? -36.780 -1.027  38.114  1.00 99.90  ? 10  ARG E O   1 
ATOM   1733 C  CB  . ARG E 1 14 ? -34.471 -2.567  37.974  1.00 101.67 ? 10  ARG E CB  1 
ATOM   1734 C  CG  . ARG E 1 14 ? -34.587 -2.418  39.502  1.00 109.40 ? 10  ARG E CG  1 
ATOM   1735 C  CD  . ARG E 1 14 ? -33.289 -2.742  40.214  1.00 115.41 ? 10  ARG E CD  1 
ATOM   1736 N  NE  . ARG E 1 14 ? -33.383 -3.883  41.124  1.00 117.29 ? 10  ARG E NE  1 
ATOM   1737 C  CZ  . ARG E 1 14 ? -33.848 -3.817  42.369  1.00 121.91 ? 10  ARG E CZ  1 
ATOM   1738 N  NH1 . ARG E 1 14 ? -33.888 -4.909  43.126  1.00 123.06 ? 10  ARG E NH1 1 
ATOM   1739 N  NH2 . ARG E 1 14 ? -34.274 -2.659  42.855  1.00 125.58 ? 10  ARG E NH2 1 
ATOM   1740 N  N   . THR E 1 15 ? -36.018 0.681   36.902  1.00 97.19  ? 11  THR E N   1 
ATOM   1741 C  CA  . THR E 1 15 ? -37.198 1.506   37.129  1.00 99.24  ? 11  THR E CA  1 
ATOM   1742 C  C   . THR E 1 15 ? -37.737 2.030   35.802  1.00 98.00  ? 11  THR E C   1 
ATOM   1743 O  O   . THR E 1 15 ? -36.969 2.425   34.920  1.00 102.16 ? 11  THR E O   1 
ATOM   1744 C  CB  . THR E 1 15 ? -36.887 2.682   38.067  1.00 108.98 ? 11  THR E CB  1 
ATOM   1745 O  OG1 . THR E 1 15 ? -36.296 2.191   39.278  1.00 113.76 ? 11  THR E OG1 1 
ATOM   1746 C  CG2 . THR E 1 15 ? -38.164 3.428   38.419  1.00 110.84 ? 11  THR E CG2 1 
ATOM   1747 N  N   . LEU E 1 16 ? -39.066 2.010   35.662  1.00 93.47  ? 12  LEU E N   1 
ATOM   1748 C  CA  . LEU E 1 16 ? -39.762 2.496   34.477  1.00 90.49  ? 12  LEU E CA  1 
ATOM   1749 C  C   . LEU E 1 16 ? -40.752 3.596   34.834  1.00 98.22  ? 12  LEU E C   1 
ATOM   1750 O  O   . LEU E 1 16 ? -41.482 3.494   35.826  1.00 104.79 ? 12  LEU E O   1 
ATOM   1751 C  CB  . LEU E 1 16 ? -40.526 1.366   33.786  1.00 81.80  ? 12  LEU E CB  1 
ATOM   1752 C  CG  . LEU E 1 16 ? -39.844 0.550   32.695  1.00 79.92  ? 12  LEU E CG  1 
ATOM   1753 C  CD1 . LEU E 1 16 ? -40.831 -0.446  32.139  1.00 75.85  ? 12  LEU E CD1 1 
ATOM   1754 C  CD2 . LEU E 1 16 ? -39.341 1.458   31.590  1.00 82.43  ? 12  LEU E CD2 1 
ATOM   1755 N  N   . PHE E 1 17 ? -40.781 4.645   34.012  1.00 97.94  ? 13  PHE E N   1 
ATOM   1756 C  CA  . PHE E 1 17 ? -41.746 5.731   34.143  1.00 104.49 ? 13  PHE E CA  1 
ATOM   1757 C  C   . PHE E 1 17 ? -42.832 5.566   33.083  1.00 107.21 ? 13  PHE E C   1 
ATOM   1758 O  O   . PHE E 1 17 ? -42.531 5.508   31.885  1.00 100.22 ? 13  PHE E O   1 
ATOM   1759 C  CB  . PHE E 1 17 ? -41.061 7.090   34.013  1.00 105.40 ? 13  PHE E CB  1 
ATOM   1760 N  N   . VAL E 1 18 ? -44.087 5.496   33.524  1.00 122.96 ? 14  VAL E N   1 
ATOM   1761 C  CA  . VAL E 1 18 ? -45.242 5.325   32.649  1.00 134.50 ? 14  VAL E CA  1 
ATOM   1762 C  C   . VAL E 1 18 ? -46.095 6.585   32.695  1.00 145.75 ? 14  VAL E C   1 
ATOM   1763 O  O   . VAL E 1 18 ? -46.512 7.021   33.775  1.00 157.21 ? 14  VAL E O   1 
ATOM   1764 C  CB  . VAL E 1 18 ? -46.076 4.092   33.040  1.00 66.24  ? 14  VAL E CB  1 
ATOM   1765 C  CG1 . VAL E 1 18 ? -45.763 2.929   32.126  1.00 60.53  ? 14  VAL E CG1 1 
ATOM   1766 C  CG2 . VAL E 1 18 ? -45.842 3.724   34.504  1.00 96.99  ? 14  VAL E CG2 1 
ATOM   1767 N  N   . GLY E 1 19 ? -46.350 7.171   31.521  1.00 134.70 ? 15  GLY E N   1 
ATOM   1768 C  CA  . GLY E 1 19 ? -47.172 8.353   31.409  1.00 144.55 ? 15  GLY E CA  1 
ATOM   1769 C  C   . GLY E 1 19 ? -48.437 8.046   30.620  1.00 144.91 ? 15  GLY E C   1 
ATOM   1770 O  O   . GLY E 1 19 ? -48.597 6.959   30.050  1.00 141.14 ? 15  GLY E O   1 
ATOM   1771 N  N   . ASN E 1 20 ? -49.353 9.018   30.618  1.00 144.79 ? 16  ASN E N   1 
ATOM   1772 C  CA  . ASN E 1 20 ? -50.633 8.944   29.916  1.00 140.43 ? 16  ASN E CA  1 
ATOM   1773 C  C   . ASN E 1 20 ? -51.584 7.933   30.544  1.00 135.33 ? 16  ASN E C   1 
ATOM   1774 O  O   . ASN E 1 20 ? -52.481 7.417   29.867  1.00 133.08 ? 16  ASN E O   1 
ATOM   1775 C  CB  . ASN E 1 20 ? -50.451 8.643   28.421  1.00 135.82 ? 16  ASN E CB  1 
ATOM   1776 C  CG  . ASN E 1 20 ? -51.668 9.033   27.595  1.00 138.34 ? 16  ASN E CG  1 
ATOM   1777 O  OD1 . ASN E 1 20 ? -52.566 9.724   28.075  1.00 144.48 ? 16  ASN E OD1 1 
ATOM   1778 N  ND2 . ASN E 1 20 ? -51.697 8.592   26.345  1.00 134.78 ? 16  ASN E ND2 1 
ATOM   1779 N  N   . LEU E 1 21 ? -51.405 7.624   31.826  1.00 134.78 ? 17  LEU E N   1 
ATOM   1780 C  CA  . LEU E 1 21 ? -52.340 6.735   32.499  1.00 134.03 ? 17  LEU E CA  1 
ATOM   1781 C  C   . LEU E 1 21 ? -53.721 7.375   32.531  1.00 141.50 ? 17  LEU E C   1 
ATOM   1782 O  O   . LEU E 1 21 ? -53.860 8.579   32.764  1.00 147.53 ? 17  LEU E O   1 
ATOM   1783 C  CB  . LEU E 1 21 ? -51.870 6.441   33.925  1.00 129.65 ? 17  LEU E CB  1 
ATOM   1784 C  CG  . LEU E 1 21 ? -50.497 5.801   34.125  1.00 120.07 ? 17  LEU E CG  1 
ATOM   1785 C  CD1 . LEU E 1 21 ? -50.113 5.854   35.589  1.00 122.08 ? 17  LEU E CD1 1 
ATOM   1786 C  CD2 . LEU E 1 21 ? -50.508 4.367   33.636  1.00 112.73 ? 17  LEU E CD2 1 
ATOM   1787 N  N   . GLU E 1 22 ? -54.746 6.564   32.288  1.00 143.11 ? 18  GLU E N   1 
ATOM   1788 C  CA  . GLU E 1 22 ? -56.104 7.069   32.387  1.00 148.66 ? 18  GLU E CA  1 
ATOM   1789 C  C   . GLU E 1 22 ? -56.422 7.425   33.838  1.00 149.47 ? 18  GLU E C   1 
ATOM   1790 O  O   . GLU E 1 22 ? -55.717 7.038   34.776  1.00 147.93 ? 18  GLU E O   1 
ATOM   1791 C  CB  . GLU E 1 22 ? -57.100 6.040   31.851  1.00 149.44 ? 18  GLU E CB  1 
ATOM   1792 N  N   . THR E 1 23 ? -57.504 8.183   34.020  1.00 152.71 ? 19  THR E N   1 
ATOM   1793 C  CA  . THR E 1 23 ? -57.885 8.586   35.369  1.00 155.66 ? 19  THR E CA  1 
ATOM   1794 C  C   . THR E 1 23 ? -58.322 7.390   36.208  1.00 154.44 ? 19  THR E C   1 
ATOM   1795 O  O   . THR E 1 23 ? -58.214 7.426   37.439  1.00 160.07 ? 19  THR E O   1 
ATOM   1796 C  CB  . THR E 1 23 ? -58.993 9.640   35.306  1.00 162.00 ? 19  THR E CB  1 
ATOM   1797 O  OG1 . THR E 1 23 ? -59.554 9.834   36.612  1.00 168.57 ? 19  THR E OG1 1 
ATOM   1798 C  CG2 . THR E 1 23 ? -60.090 9.213   34.342  1.00 161.10 ? 19  THR E CG2 1 
ATOM   1799 N  N   . LYS E 1 24 ? -58.811 6.326   35.566  1.00 149.74 ? 20  LYS E N   1 
ATOM   1800 C  CA  . LYS E 1 24 ? -59.305 5.149   36.268  1.00 149.75 ? 20  LYS E CA  1 
ATOM   1801 C  C   . LYS E 1 24 ? -58.219 4.131   36.604  1.00 145.16 ? 20  LYS E C   1 
ATOM   1802 O  O   . LYS E 1 24 ? -58.437 3.294   37.488  1.00 148.64 ? 20  LYS E O   1 
ATOM   1803 C  CB  . LYS E 1 24 ? -60.399 4.459   35.441  1.00 150.26 ? 20  LYS E CB  1 
ATOM   1804 N  N   . VAL E 1 25 ? -57.074 4.167   35.916  1.00 138.68 ? 21  VAL E N   1 
ATOM   1805 C  CA  . VAL E 1 25 ? -56.020 3.180   36.140  1.00 132.45 ? 21  VAL E CA  1 
ATOM   1806 C  C   . VAL E 1 25 ? -55.596 3.165   37.602  1.00 131.63 ? 21  VAL E C   1 
ATOM   1807 O  O   . VAL E 1 25 ? -55.413 4.216   38.228  1.00 134.69 ? 21  VAL E O   1 
ATOM   1808 C  CB  . VAL E 1 25 ? -54.817 3.472   35.226  1.00 130.34 ? 21  VAL E CB  1 
ATOM   1809 C  CG1 . VAL E 1 25 ? -53.694 2.474   35.471  1.00 126.39 ? 21  VAL E CG1 1 
ATOM   1810 C  CG2 . VAL E 1 25 ? -55.238 3.454   33.763  1.00 129.17 ? 21  VAL E CG2 1 
ATOM   1811 N  N   . THR E 1 26 ? -55.428 1.963   38.152  1.00 129.30 ? 22  THR E N   1 
ATOM   1812 C  CA  . THR E 1 26 ? -55.043 1.780   39.544  1.00 132.93 ? 22  THR E CA  1 
ATOM   1813 C  C   . THR E 1 26 ? -53.614 1.260   39.641  1.00 128.68 ? 22  THR E C   1 
ATOM   1814 O  O   . THR E 1 26 ? -53.052 0.728   38.679  1.00 124.22 ? 22  THR E O   1 
ATOM   1815 C  CB  . THR E 1 26 ? -55.988 0.810   40.262  1.00 135.18 ? 22  THR E CB  1 
ATOM   1816 O  OG1 . THR E 1 26 ? -55.795 -0.515  39.751  1.00 127.93 ? 22  THR E OG1 1 
ATOM   1817 C  CG2 . THR E 1 26 ? -57.439 1.223   40.059  1.00 141.26 ? 22  THR E CG2 1 
ATOM   1818 N  N   . GLU E 1 27 ? -53.029 1.428   40.831  1.00 131.69 ? 23  GLU E N   1 
ATOM   1819 C  CA  . GLU E 1 27 ? -51.677 0.932   41.071  1.00 127.43 ? 23  GLU E CA  1 
ATOM   1820 C  C   . GLU E 1 27 ? -51.617 -0.591  41.077  1.00 123.15 ? 23  GLU E C   1 
ATOM   1821 O  O   . GLU E 1 27 ? -50.621 -1.170  40.631  1.00 118.62 ? 23  GLU E O   1 
ATOM   1822 C  CB  . GLU E 1 27 ? -51.142 1.482   42.393  1.00 132.86 ? 23  GLU E CB  1 
ATOM   1823 N  N   . GLU E 1 28 ? -52.665 -1.255  41.573  1.00 122.72 ? 24  GLU E N   1 
ATOM   1824 C  CA  . GLU E 1 28 ? -52.677 -2.714  41.562  1.00 117.16 ? 24  GLU E CA  1 
ATOM   1825 C  C   . GLU E 1 28 ? -52.835 -3.259  40.150  1.00 111.00 ? 24  GLU E C   1 
ATOM   1826 O  O   . GLU E 1 28 ? -52.361 -4.363  39.855  1.00 106.80 ? 24  GLU E O   1 
ATOM   1827 C  CB  . GLU E 1 28 ? -53.791 -3.241  42.469  1.00 121.07 ? 24  GLU E CB  1 
ATOM   1828 N  N   . LEU E 1 29 ? -53.495 -2.506  39.268  1.00 110.47 ? 25  LEU E N   1 
ATOM   1829 C  CA  . LEU E 1 29 ? -53.668 -2.952  37.889  1.00 106.14 ? 25  LEU E CA  1 
ATOM   1830 C  C   . LEU E 1 29 ? -52.346 -2.909  37.132  1.00 103.27 ? 25  LEU E C   1 
ATOM   1831 O  O   . LEU E 1 29 ? -51.994 -3.862  36.427  1.00 100.43 ? 25  LEU E O   1 
ATOM   1832 C  CB  . LEU E 1 29 ? -54.726 -2.100  37.189  1.00 105.52 ? 25  LEU E CB  1 
ATOM   1833 N  N   . LEU E 1 30 ? -51.601 -1.805  37.258  1.00 102.40 ? 26  LEU E N   1 
ATOM   1834 C  CA  . LEU E 1 30 ? -50.295 -1.726  36.608  1.00 95.43  ? 26  LEU E CA  1 
ATOM   1835 C  C   . LEU E 1 30 ? -49.368 -2.838  37.079  1.00 93.31  ? 26  LEU E C   1 
ATOM   1836 O  O   . LEU E 1 30 ? -48.536 -3.321  36.302  1.00 93.20  ? 26  LEU E O   1 
ATOM   1837 C  CB  . LEU E 1 30 ? -49.652 -0.360  36.860  1.00 96.05  ? 26  LEU E CB  1 
ATOM   1838 C  CG  . LEU E 1 30 ? -50.225 0.869   36.144  1.00 95.38  ? 26  LEU E CG  1 
ATOM   1839 C  CD1 . LEU E 1 30 ? -49.367 2.100   36.418  1.00 94.36  ? 26  LEU E CD1 1 
ATOM   1840 C  CD2 . LEU E 1 30 ? -50.329 0.617   34.649  1.00 90.24  ? 26  LEU E CD2 1 
ATOM   1841 N  N   . PHE E 1 31 ? -49.505 -3.267  38.336  1.00 92.12  ? 27  PHE E N   1 
ATOM   1842 C  CA  . PHE E 1 31 ? -48.696 -4.372  38.844  1.00 88.90  ? 27  PHE E CA  1 
ATOM   1843 C  C   . PHE E 1 31 ? -48.967 -5.645  38.052  1.00 87.74  ? 27  PHE E C   1 
ATOM   1844 O  O   . PHE E 1 31 ? -48.035 -6.318  37.594  1.00 85.05  ? 27  PHE E O   1 
ATOM   1845 C  CB  . PHE E 1 31 ? -48.982 -4.584  40.331  1.00 92.70  ? 27  PHE E CB  1 
ATOM   1846 C  CG  . PHE E 1 31 ? -48.058 -5.567  41.000  1.00 87.98  ? 27  PHE E CG  1 
ATOM   1847 C  CD1 . PHE E 1 31 ? -48.323 -6.928  40.972  1.00 86.02  ? 27  PHE E CD1 1 
ATOM   1848 C  CD2 . PHE E 1 31 ? -46.924 -5.125  41.663  1.00 86.65  ? 27  PHE E CD2 1 
ATOM   1849 C  CE1 . PHE E 1 31 ? -47.471 -7.828  41.590  1.00 84.77  ? 27  PHE E CE1 1 
ATOM   1850 C  CE2 . PHE E 1 31 ? -46.071 -6.019  42.282  1.00 85.66  ? 27  PHE E CE2 1 
ATOM   1851 C  CZ  . PHE E 1 31 ? -46.344 -7.372  42.246  1.00 84.63  ? 27  PHE E CZ  1 
ATOM   1852 N  N   . GLU E 1 32 ? -50.248 -5.979  37.872  1.00 91.64  ? 28  GLU E N   1 
ATOM   1853 C  CA  . GLU E 1 32 ? -50.622 -7.176  37.126  1.00 91.98  ? 28  GLU E CA  1 
ATOM   1854 C  C   . GLU E 1 32 ? -50.150 -7.102  35.680  1.00 91.12  ? 28  GLU E C   1 
ATOM   1855 O  O   . GLU E 1 32 ? -49.731 -8.112  35.102  1.00 87.84  ? 28  GLU E O   1 
ATOM   1856 C  CB  . GLU E 1 32 ? -52.141 -7.351  37.182  1.00 96.80  ? 28  GLU E CB  1 
ATOM   1857 C  CG  . GLU E 1 32 ? -52.711 -8.390  36.233  1.00 96.96  ? 28  GLU E CG  1 
ATOM   1858 C  CD  . GLU E 1 32 ? -52.758 -9.782  36.819  1.00 98.76  ? 28  GLU E CD  1 
ATOM   1859 O  OE1 . GLU E 1 32 ? -51.933 -10.083 37.705  1.00 97.76  ? 28  GLU E OE1 1 
ATOM   1860 O  OE2 . GLU E 1 32 ? -53.629 -10.571 36.393  1.00 101.12 ? 28  GLU E OE2 1 
ATOM   1861 N  N   . LEU E 1 33 ? -50.223 -5.915  35.076  1.00 93.61  ? 29  LEU E N   1 
ATOM   1862 C  CA  . LEU E 1 33 ? -49.814 -5.746  33.687  1.00 86.21  ? 29  LEU E CA  1 
ATOM   1863 C  C   . LEU E 1 33 ? -48.317 -5.977  33.514  1.00 79.38  ? 29  LEU E C   1 
ATOM   1864 O  O   . LEU E 1 33 ? -47.893 -6.844  32.741  1.00 76.05  ? 29  LEU E O   1 
ATOM   1865 C  CB  . LEU E 1 33 ? -50.199 -4.353  33.201  1.00 86.72  ? 29  LEU E CB  1 
ATOM   1866 C  CG  . LEU E 1 33 ? -49.700 -4.002  31.803  1.00 84.37  ? 29  LEU E CG  1 
ATOM   1867 C  CD1 . LEU E 1 33 ? -50.287 -4.962  30.790  1.00 82.87  ? 29  LEU E CD1 1 
ATOM   1868 C  CD2 . LEU E 1 33 ? -50.048 -2.565  31.450  1.00 88.21  ? 29  LEU E CD2 1 
ATOM   1869 N  N   . PHE E 1 34 ? -47.497 -5.195  34.218  1.00 79.39  ? 30  PHE E N   1 
ATOM   1870 C  CA  . PHE E 1 34 ? -46.052 -5.318  34.090  1.00 76.38  ? 30  PHE E CA  1 
ATOM   1871 C  C   . PHE E 1 34 ? -45.513 -6.634  34.630  1.00 71.08  ? 30  PHE E C   1 
ATOM   1872 O  O   . PHE E 1 34 ? -44.359 -6.971  34.341  1.00 71.37  ? 30  PHE E O   1 
ATOM   1873 C  CB  . PHE E 1 34 ? -45.374 -4.136  34.776  1.00 82.52  ? 30  PHE E CB  1 
ATOM   1874 C  CG  . PHE E 1 34 ? -45.487 -2.857  34.005  1.00 87.89  ? 30  PHE E CG  1 
ATOM   1875 C  CD1 . PHE E 1 34 ? -46.616 -2.059  34.117  1.00 91.98  ? 30  PHE E CD1 1 
ATOM   1876 C  CD2 . PHE E 1 34 ? -44.469 -2.456  33.159  1.00 87.61  ? 30  PHE E CD2 1 
ATOM   1877 C  CE1 . PHE E 1 34 ? -46.720 -0.880  33.404  1.00 93.94  ? 30  PHE E CE1 1 
ATOM   1878 C  CE2 . PHE E 1 34 ? -44.569 -1.281  32.445  1.00 89.80  ? 30  PHE E CE2 1 
ATOM   1879 C  CZ  . PHE E 1 34 ? -45.696 -0.493  32.567  1.00 92.19  ? 30  PHE E CZ  1 
ATOM   1880 N  N   . HIS E 1 35 ? -46.310 -7.388  35.390  1.00 69.97  ? 31  HIS E N   1 
ATOM   1881 C  CA  . HIS E 1 35 ? -45.905 -8.733  35.777  1.00 69.12  ? 31  HIS E CA  1 
ATOM   1882 C  C   . HIS E 1 35 ? -45.691 -9.621  34.565  1.00 65.38  ? 31  HIS E C   1 
ATOM   1883 O  O   . HIS E 1 35 ? -44.938 -10.596 34.647  1.00 64.41  ? 31  HIS E O   1 
ATOM   1884 C  CB  . HIS E 1 35 ? -46.955 -9.361  36.695  1.00 72.80  ? 31  HIS E CB  1 
ATOM   1885 C  CG  . HIS E 1 35 ? -46.382 -10.214 37.786  1.00 72.71  ? 31  HIS E CG  1 
ATOM   1886 N  ND1 . HIS E 1 35 ? -45.507 -9.726  38.734  1.00 73.34  ? 31  HIS E ND1 1 
ATOM   1887 C  CD2 . HIS E 1 35 ? -46.564 -11.524 38.081  1.00 73.08  ? 31  HIS E CD2 1 
ATOM   1888 C  CE1 . HIS E 1 35 ? -45.175 -10.697 39.566  1.00 74.76  ? 31  HIS E CE1 1 
ATOM   1889 N  NE2 . HIS E 1 35 ? -45.803 -11.798 39.192  1.00 75.22  ? 31  HIS E NE2 1 
ATOM   1890 N  N   . GLN E 1 36 ? -46.342 -9.306  33.446  1.00 69.09  ? 32  GLN E N   1 
ATOM   1891 C  CA  . GLN E 1 36 ? -46.134 -10.066 32.217  1.00 73.67  ? 32  GLN E CA  1 
ATOM   1892 C  C   . GLN E 1 36 ? -44.700 -9.915  31.710  1.00 75.50  ? 32  GLN E C   1 
ATOM   1893 O  O   . GLN E 1 36 ? -44.082 -10.888 31.255  1.00 74.54  ? 32  GLN E O   1 
ATOM   1894 C  CB  . GLN E 1 36 ? -47.132 -9.589  31.159  1.00 72.66  ? 32  GLN E CB  1 
ATOM   1895 C  CG  . GLN E 1 36 ? -48.590 -9.712  31.571  1.00 72.81  ? 32  GLN E CG  1 
ATOM   1896 C  CD  . GLN E 1 36 ? -49.050 -11.141 31.776  1.00 75.96  ? 32  GLN E CD  1 
ATOM   1897 O  OE1 . GLN E 1 36 ? -48.868 -11.993 30.910  1.00 74.16  ? 32  GLN E OE1 1 
ATOM   1898 N  NE2 . GLN E 1 36 ? -49.650 -11.410 32.937  1.00 82.31  ? 32  GLN E NE2 1 
ATOM   1899 N  N   . ALA E 1 37 ? -44.160 -8.695  31.771  1.00 73.34  ? 33  ALA E N   1 
ATOM   1900 C  CA  . ALA E 1 37 ? -42.796 -8.446  31.312  1.00 72.49  ? 33  ALA E CA  1 
ATOM   1901 C  C   . ALA E 1 37 ? -41.758 -9.097  32.216  1.00 76.80  ? 33  ALA E C   1 
ATOM   1902 O  O   . ALA E 1 37 ? -40.711 -9.546  31.741  1.00 82.12  ? 33  ALA E O   1 
ATOM   1903 C  CB  . ALA E 1 37 ? -42.553 -6.941  31.221  1.00 74.14  ? 33  ALA E CB  1 
ATOM   1904 N  N   . GLY E 1 38 ? -41.999 -9.102  33.522  1.00 78.02  ? 34  GLY E N   1 
ATOM   1905 C  CA  . GLY E 1 38 ? -41.079 -9.697  34.461  1.00 81.46  ? 34  GLY E CA  1 
ATOM   1906 C  C   . GLY E 1 38 ? -41.564 -9.521  35.885  1.00 85.71  ? 34  GLY E C   1 
ATOM   1907 O  O   . GLY E 1 38 ? -42.557 -8.834  36.142  1.00 93.77  ? 34  GLY E O   1 
ATOM   1908 N  N   . PRO E 1 39 ? -40.902 -10.177 36.833  1.00 76.85  ? 35  PRO E N   1 
ATOM   1909 C  CA  . PRO E 1 39 ? -41.251 -9.973  38.242  1.00 76.68  ? 35  PRO E CA  1 
ATOM   1910 C  C   . PRO E 1 39 ? -41.205 -8.496  38.606  1.00 75.09  ? 35  PRO E C   1 
ATOM   1911 O  O   . PRO E 1 39 ? -40.243 -7.789  38.299  1.00 77.81  ? 35  PRO E O   1 
ATOM   1912 C  CB  . PRO E 1 39 ? -40.177 -10.774 38.983  1.00 78.03  ? 35  PRO E CB  1 
ATOM   1913 C  CG  . PRO E 1 39 ? -39.850 -11.877 38.046  1.00 76.50  ? 35  PRO E CG  1 
ATOM   1914 C  CD  . PRO E 1 39 ? -39.941 -11.277 36.657  1.00 74.09  ? 35  PRO E CD  1 
ATOM   1915 N  N   . VAL E 1 40 ? -42.270 -8.028  39.252  1.00 73.62  ? 36  VAL E N   1 
ATOM   1916 C  CA  . VAL E 1 40 ? -42.439 -6.625  39.615  1.00 71.50  ? 36  VAL E CA  1 
ATOM   1917 C  C   . VAL E 1 40 ? -42.403 -6.528  41.132  1.00 76.21  ? 36  VAL E C   1 
ATOM   1918 O  O   . VAL E 1 40 ? -43.074 -7.304  41.825  1.00 78.87  ? 36  VAL E O   1 
ATOM   1919 C  CB  . VAL E 1 40 ? -43.753 -6.055  39.052  1.00 70.30  ? 36  VAL E CB  1 
ATOM   1920 C  CG1 . VAL E 1 40 ? -43.948 -4.610  39.501  1.00 75.34  ? 36  VAL E CG1 1 
ATOM   1921 C  CG2 . VAL E 1 40 ? -43.769 -6.156  37.537  1.00 63.38  ? 36  VAL E CG2 1 
ATOM   1922 N  N   . ILE E 1 41 ? -41.606 -5.595  41.647  1.00 78.74  ? 37  ILE E N   1 
ATOM   1923 C  CA  . ILE E 1 41 ? -41.471 -5.437  43.092  1.00 86.40  ? 37  ILE E CA  1 
ATOM   1924 C  C   . ILE E 1 41 ? -42.593 -4.572  43.652  1.00 97.29  ? 37  ILE E C   1 
ATOM   1925 O  O   . ILE E 1 41 ? -43.354 -5.004  44.526  1.00 102.36 ? 37  ILE E O   1 
ATOM   1926 C  CB  . ILE E 1 41 ? -40.085 -4.862  43.437  1.00 84.61  ? 37  ILE E CB  1 
ATOM   1927 C  CG1 . ILE E 1 41 ? -39.016 -5.936  43.244  1.00 81.77  ? 37  ILE E CG1 1 
ATOM   1928 C  CG2 . ILE E 1 41 ? -40.058 -4.337  44.858  1.00 90.38  ? 37  ILE E CG2 1 
ATOM   1929 C  CD1 . ILE E 1 41 ? -39.278 -7.201  44.030  1.00 83.80  ? 37  ILE E CD1 1 
ATOM   1930 N  N   . LYS E 1 42 ? -42.704 -3.336  43.166  1.00 102.27 ? 38  LYS E N   1 
ATOM   1931 C  CA  . LYS E 1 42 ? -43.723 -2.417  43.649  1.00 111.87 ? 38  LYS E CA  1 
ATOM   1932 C  C   . LYS E 1 42 ? -43.973 -1.352  42.593  1.00 115.48 ? 38  LYS E C   1 
ATOM   1933 O  O   . LYS E 1 42 ? -43.081 -1.019  41.809  1.00 114.93 ? 38  LYS E O   1 
ATOM   1934 C  CB  . LYS E 1 42 ? -43.308 -1.764  44.973  1.00 117.96 ? 38  LYS E CB  1 
ATOM   1935 N  N   . VAL E 1 43 ? -45.202 -0.844  42.563  1.00 121.86 ? 39  VAL E N   1 
ATOM   1936 C  CA  . VAL E 1 43 ? -45.574 0.266   41.695  1.00 124.90 ? 39  VAL E CA  1 
ATOM   1937 C  C   . VAL E 1 43 ? -46.286 1.316   42.539  1.00 134.36 ? 39  VAL E C   1 
ATOM   1938 O  O   . VAL E 1 43 ? -47.190 0.988   43.317  1.00 138.58 ? 39  VAL E O   1 
ATOM   1939 C  CB  . VAL E 1 43 ? -46.443 -0.194  40.506  1.00 119.61 ? 39  VAL E CB  1 
ATOM   1940 C  CG1 . VAL E 1 43 ? -46.944 -1.608  40.730  1.00 117.66 ? 39  VAL E CG1 1 
ATOM   1941 C  CG2 . VAL E 1 43 ? -47.596 0.776   40.254  1.00 123.06 ? 39  VAL E CG2 1 
ATOM   1942 N  N   . LYS E 1 44 ? -45.849 2.568   42.413  1.00 138.26 ? 40  LYS E N   1 
ATOM   1943 C  CA  . LYS E 1 44 ? -46.401 3.685   43.169  1.00 141.09 ? 40  LYS E CA  1 
ATOM   1944 C  C   . LYS E 1 44 ? -46.749 4.809   42.205  1.00 139.64 ? 40  LYS E C   1 
ATOM   1945 O  O   . LYS E 1 44 ? -45.948 5.147   41.327  1.00 138.24 ? 40  LYS E O   1 
ATOM   1946 C  CB  . LYS E 1 44 ? -45.413 4.178   44.229  1.00 144.53 ? 40  LYS E CB  1 
ATOM   1947 N  N   . ILE E 1 45 ? -47.936 5.383   42.371  1.00 137.81 ? 41  ILE E N   1 
ATOM   1948 C  CA  . ILE E 1 45 ? -48.439 6.473   41.543  1.00 134.54 ? 41  ILE E CA  1 
ATOM   1949 C  C   . ILE E 1 45 ? -48.494 7.735   42.405  1.00 140.04 ? 41  ILE E C   1 
ATOM   1950 O  O   . ILE E 1 45 ? -49.344 7.831   43.303  1.00 146.72 ? 41  ILE E O   1 
ATOM   1951 C  CB  . ILE E 1 45 ? -49.814 6.145   40.947  1.00 132.51 ? 41  ILE E CB  1 
ATOM   1952 N  N   . PRO E 1 46 ? -47.614 8.724   42.179  1.00 137.84 ? 42  PRO E N   1 
ATOM   1953 C  CA  . PRO E 1 46 ? -47.557 9.962   42.969  1.00 146.08 ? 42  PRO E CA  1 
ATOM   1954 C  C   . PRO E 1 46 ? -48.848 10.777  42.903  1.00 151.23 ? 42  PRO E C   1 
ATOM   1955 O  O   . PRO E 1 46 ? -49.043 11.646  43.754  1.00 159.93 ? 42  PRO E O   1 
ATOM   1956 C  CB  . PRO E 1 46 ? -46.407 10.744  42.320  1.00 144.20 ? 42  PRO E CB  1 
ATOM   1957 C  CG  . PRO E 1 46 ? -45.602 9.723   41.601  1.00 134.50 ? 42  PRO E CG  1 
ATOM   1958 C  CD  . PRO E 1 46 ? -46.584 8.700   41.127  1.00 129.52 ? 42  PRO E CD  1 
ATOM   1959 N  N   . GLN E 1 55 ? -50.864 11.702  37.353  1.00 133.06 ? 51  GLN E N   1 
ATOM   1960 C  CA  . GLN E 1 55 ? -51.314 11.093  36.105  1.00 128.66 ? 51  GLN E CA  1 
ATOM   1961 C  C   . GLN E 1 55 ? -50.310 10.065  35.591  1.00 124.58 ? 51  GLN E C   1 
ATOM   1962 O  O   . GLN E 1 55 ? -50.547 9.408   34.580  1.00 117.54 ? 51  GLN E O   1 
ATOM   1963 C  CB  . GLN E 1 55 ? -51.553 12.167  35.040  1.00 129.08 ? 51  GLN E CB  1 
ATOM   1964 N  N   . PHE E 1 56 ? -49.192 9.927   36.298  1.00 129.90 ? 52  PHE E N   1 
ATOM   1965 C  CA  . PHE E 1 56 ? -48.151 8.973   35.950  1.00 128.93 ? 52  PHE E CA  1 
ATOM   1966 C  C   . PHE E 1 56 ? -47.813 8.118   37.164  1.00 130.98 ? 52  PHE E C   1 
ATOM   1967 O  O   . PHE E 1 56 ? -48.177 8.441   38.298  1.00 134.44 ? 52  PHE E O   1 
ATOM   1968 C  CB  . PHE E 1 56 ? -46.891 9.674   35.417  1.00 131.21 ? 52  PHE E CB  1 
ATOM   1969 C  CG  . PHE E 1 56 ? -46.406 10.805  36.277  1.00 101.75 ? 52  PHE E CG  1 
ATOM   1970 C  CD1 . PHE E 1 56 ? -45.646 10.559  37.410  1.00 108.89 ? 52  PHE E CD1 1 
ATOM   1971 C  CD2 . PHE E 1 56 ? -46.691 12.117  35.939  1.00 107.31 ? 52  PHE E CD2 1 
ATOM   1972 C  CE1 . PHE E 1 56 ? -45.195 11.599  38.199  1.00 117.27 ? 52  PHE E CE1 1 
ATOM   1973 C  CE2 . PHE E 1 56 ? -46.242 13.163  36.723  1.00 121.25 ? 52  PHE E CE2 1 
ATOM   1974 C  CZ  . PHE E 1 56 ? -45.493 12.903  37.854  1.00 123.20 ? 52  PHE E CZ  1 
ATOM   1975 N  N   . ALA E 1 57 ? -47.114 7.011   36.913  1.00 132.61 ? 53  ALA E N   1 
ATOM   1976 C  CA  . ALA E 1 57 ? -46.709 6.093   37.969  1.00 139.69 ? 53  ALA E CA  1 
ATOM   1977 C  C   . ALA E 1 57 ? -45.300 5.582   37.695  1.00 141.62 ? 53  ALA E C   1 
ATOM   1978 O  O   . ALA E 1 57 ? -44.729 5.804   36.624  1.00 143.70 ? 53  ALA E O   1 
ATOM   1979 C  CB  . ALA E 1 57 ? -47.684 4.916   38.101  1.00 137.80 ? 53  ALA E CB  1 
ATOM   1980 N  N   . PHE E 1 58 ? -44.733 4.905   38.694  1.00 132.47 ? 54  PHE E N   1 
ATOM   1981 C  CA  . PHE E 1 58 ? -43.398 4.327   38.619  1.00 120.71 ? 54  PHE E CA  1 
ATOM   1982 C  C   . PHE E 1 58 ? -43.462 2.827   38.876  1.00 112.46 ? 54  PHE E C   1 
ATOM   1983 O  O   . PHE E 1 58 ? -44.155 2.376   39.794  1.00 114.60 ? 54  PHE E O   1 
ATOM   1984 C  CB  . PHE E 1 58 ? -42.454 5.001   39.622  1.00 124.24 ? 54  PHE E CB  1 
ATOM   1985 C  CG  . PHE E 1 58 ? -42.053 6.400   39.232  1.00 127.35 ? 54  PHE E CG  1 
ATOM   1986 C  CD1 . PHE E 1 58 ? -42.922 7.464   39.425  1.00 131.63 ? 54  PHE E CD1 1 
ATOM   1987 C  CD2 . PHE E 1 58 ? -40.809 6.652   38.674  1.00 126.80 ? 54  PHE E CD2 1 
ATOM   1988 C  CE1 . PHE E 1 58 ? -42.559 8.751   39.066  1.00 135.21 ? 54  PHE E CE1 1 
ATOM   1989 C  CE2 . PHE E 1 58 ? -40.440 7.938   38.315  1.00 130.83 ? 54  PHE E CE2 1 
ATOM   1990 C  CZ  . PHE E 1 58 ? -41.317 8.989   38.512  1.00 135.03 ? 54  PHE E CZ  1 
ATOM   1991 N  N   . VAL E 1 59 ? -42.730 2.061   38.069  1.00 105.25 ? 55  VAL E N   1 
ATOM   1992 C  CA  . VAL E 1 59 ? -42.715 0.603   38.139  1.00 101.57 ? 55  VAL E CA  1 
ATOM   1993 C  C   . VAL E 1 59 ? -41.311 0.140   38.501  1.00 102.96 ? 55  VAL E C   1 
ATOM   1994 O  O   . VAL E 1 59 ? -40.337 0.528   37.846  1.00 106.88 ? 55  VAL E O   1 
ATOM   1995 C  CB  . VAL E 1 59 ? -43.157 -0.034  36.809  1.00 95.17  ? 55  VAL E CB  1 
ATOM   1996 C  CG1 . VAL E 1 59 ? -43.087 -1.550  36.898  1.00 89.98  ? 55  VAL E CG1 1 
ATOM   1997 C  CG2 . VAL E 1 59 ? -44.554 0.430   36.429  1.00 97.02  ? 55  VAL E CG2 1 
ATOM   1998 N  N   . ASN E 1 60 ? -41.210 -0.689  39.537  1.00 102.63 ? 56  ASN E N   1 
ATOM   1999 C  CA  . ASN E 1 60 ? -39.941 -1.258  39.974  1.00 105.51 ? 56  ASN E CA  1 
ATOM   2000 C  C   . ASN E 1 60 ? -39.923 -2.748  39.651  1.00 101.80 ? 56  ASN E C   1 
ATOM   2001 O  O   . ASN E 1 60 ? -40.736 -3.512  40.182  1.00 109.11 ? 56  ASN E O   1 
ATOM   2002 C  CB  . ASN E 1 60 ? -39.727 -1.026  41.470  1.00 115.45 ? 56  ASN E CB  1 
ATOM   2003 C  CG  . ASN E 1 60 ? -38.298 -1.305  41.907  1.00 121.46 ? 56  ASN E CG  1 
ATOM   2004 O  OD1 . ASN E 1 60 ? -38.012 -2.329  42.531  1.00 122.26 ? 56  ASN E OD1 1 
ATOM   2005 N  ND2 . ASN E 1 60 ? -37.393 -0.389  41.581  1.00 123.87 ? 56  ASN E ND2 1 
ATOM   2006 N  N   . PHE E 1 61 ? -38.994 -3.157  38.793  1.00 93.02  ? 57  PHE E N   1 
ATOM   2007 C  CA  . PHE E 1 61 ? -38.813 -4.554  38.427  1.00 85.35  ? 57  PHE E CA  1 
ATOM   2008 C  C   . PHE E 1 61 ? -37.784 -5.220  39.332  1.00 84.22  ? 57  PHE E C   1 
ATOM   2009 O  O   . PHE E 1 61 ? -36.930 -4.564  39.931  1.00 89.68  ? 57  PHE E O   1 
ATOM   2010 C  CB  . PHE E 1 61 ? -38.387 -4.680  36.966  1.00 80.33  ? 57  PHE E CB  1 
ATOM   2011 C  CG  . PHE E 1 61 ? -39.508 -4.489  35.991  1.00 75.18  ? 57  PHE E CG  1 
ATOM   2012 C  CD1 . PHE E 1 61 ? -40.393 -5.522  35.733  1.00 73.39  ? 57  PHE E CD1 1 
ATOM   2013 C  CD2 . PHE E 1 61 ? -39.680 -3.285  35.331  1.00 74.17  ? 57  PHE E CD2 1 
ATOM   2014 C  CE1 . PHE E 1 61 ? -41.429 -5.361  34.835  1.00 69.98  ? 57  PHE E CE1 1 
ATOM   2015 C  CE2 . PHE E 1 61 ? -40.717 -3.118  34.431  1.00 71.79  ? 57  PHE E CE2 1 
ATOM   2016 C  CZ  . PHE E 1 61 ? -41.593 -4.156  34.185  1.00 69.32  ? 57  PHE E CZ  1 
ATOM   2017 N  N   . LYS E 1 62 ? -37.895 -6.544  39.452  1.00 81.00  ? 58  LYS E N   1 
ATOM   2018 C  CA  . LYS E 1 62 ? -36.934 -7.272  40.272  1.00 84.74  ? 58  LYS E CA  1 
ATOM   2019 C  C   . LYS E 1 62 ? -35.558 -7.316  39.622  1.00 85.54  ? 58  LYS E C   1 
ATOM   2020 O  O   . LYS E 1 62 ? -34.543 -7.272  40.326  1.00 89.37  ? 58  LYS E O   1 
ATOM   2021 C  CB  . LYS E 1 62 ? -37.436 -8.688  40.547  1.00 84.20  ? 58  LYS E CB  1 
ATOM   2022 C  CG  . LYS E 1 62 ? -36.526 -9.471  41.479  1.00 88.78  ? 58  LYS E CG  1 
ATOM   2023 C  CD  . LYS E 1 62 ? -36.995 -10.897 41.695  1.00 89.46  ? 58  LYS E CD  1 
ATOM   2024 C  CE  . LYS E 1 62 ? -36.070 -11.618 42.664  1.00 95.25  ? 58  LYS E CE  1 
ATOM   2025 N  NZ  . LYS E 1 62 ? -36.458 -13.044 42.841  1.00 96.82  ? 58  LYS E NZ  1 
ATOM   2026 N  N   . HIS E 1 63 ? -35.497 -7.380  38.294  1.00 83.02  ? 59  HIS E N   1 
ATOM   2027 C  CA  . HIS E 1 63 ? -34.235 -7.417  37.568  1.00 83.08  ? 59  HIS E CA  1 
ATOM   2028 C  C   . HIS E 1 63 ? -34.223 -6.345  36.491  1.00 86.21  ? 59  HIS E C   1 
ATOM   2029 O  O   . HIS E 1 63 ? -35.272 -5.935  35.988  1.00 86.43  ? 59  HIS E O   1 
ATOM   2030 C  CB  . HIS E 1 63 ? -33.960 -8.774  36.908  1.00 79.01  ? 59  HIS E CB  1 
ATOM   2031 C  CG  . HIS E 1 63 ? -33.938 -9.923  37.861  1.00 81.18  ? 59  HIS E CG  1 
ATOM   2032 N  ND1 . HIS E 1 63 ? -35.066 -10.646 38.185  1.00 82.09  ? 59  HIS E ND1 1 
ATOM   2033 C  CD2 . HIS E 1 63 ? -32.921 -10.474 38.565  1.00 83.00  ? 59  HIS E CD2 1 
ATOM   2034 C  CE1 . HIS E 1 63 ? -34.743 -11.597 39.043  1.00 85.67  ? 59  HIS E CE1 1 
ATOM   2035 N  NE2 . HIS E 1 63 ? -33.448 -11.514 39.292  1.00 86.02  ? 59  HIS E NE2 1 
ATOM   2036 N  N   . GLU E 1 64 ? -33.014 -5.906  36.133  1.00 89.74  ? 60  GLU E N   1 
ATOM   2037 C  CA  . GLU E 1 64 ? -32.881 -4.878  35.111  1.00 86.82  ? 60  GLU E CA  1 
ATOM   2038 C  C   . GLU E 1 64 ? -33.293 -5.394  33.739  1.00 81.51  ? 60  GLU E C   1 
ATOM   2039 O  O   . GLU E 1 64 ? -33.858 -4.632  32.946  1.00 80.94  ? 60  GLU E O   1 
ATOM   2040 C  CB  . GLU E 1 64 ? -31.446 -4.357  35.070  1.00 90.35  ? 60  GLU E CB  1 
ATOM   2041 N  N   . VAL E 1 65 ? -33.069 -6.685  33.457  1.00 79.13  ? 61  VAL E N   1 
ATOM   2042 C  CA  . VAL E 1 65 ? -33.300 -7.206  32.109  1.00 76.71  ? 61  VAL E CA  1 
ATOM   2043 C  C   . VAL E 1 65 ? -34.738 -6.970  31.670  1.00 78.43  ? 61  VAL E C   1 
ATOM   2044 O  O   . VAL E 1 65 ? -35.009 -6.808  30.473  1.00 80.29  ? 61  VAL E O   1 
ATOM   2045 C  CB  . VAL E 1 65 ? -32.940 -8.705  32.027  1.00 73.39  ? 61  VAL E CB  1 
ATOM   2046 C  CG1 . VAL E 1 65 ? -31.485 -8.942  32.387  1.00 76.19  ? 61  VAL E CG1 1 
ATOM   2047 C  CG2 . VAL E 1 65 ? -33.866 -9.529  32.920  1.00 74.47  ? 61  VAL E CG2 1 
ATOM   2048 N  N   . SER E 1 66 ? -35.678 -6.932  32.618  1.00 78.69  ? 62  SER E N   1 
ATOM   2049 C  CA  . SER E 1 66 ? -37.079 -6.718  32.278  1.00 77.10  ? 62  SER E CA  1 
ATOM   2050 C  C   . SER E 1 66 ? -37.362 -5.299  31.795  1.00 79.09  ? 62  SER E C   1 
ATOM   2051 O  O   . SER E 1 66 ? -38.349 -5.099  31.079  1.00 81.63  ? 62  SER E O   1 
ATOM   2052 C  CB  . SER E 1 66 ? -37.976 -7.057  33.472  1.00 75.95  ? 62  SER E CB  1 
ATOM   2053 O  OG  . SER E 1 66 ? -38.029 -8.459  33.680  1.00 75.56  ? 62  SER E OG  1 
ATOM   2054 N  N   . VAL E 1 67 ? -36.538 -4.314  32.170  1.00 83.60  ? 63  VAL E N   1 
ATOM   2055 C  CA  . VAL E 1 67 ? -36.815 -2.930  31.773  1.00 88.35  ? 63  VAL E CA  1 
ATOM   2056 C  C   . VAL E 1 67 ? -36.882 -2.785  30.257  1.00 99.18  ? 63  VAL E C   1 
ATOM   2057 O  O   . VAL E 1 67 ? -37.898 -2.277  29.755  1.00 106.69 ? 63  VAL E O   1 
ATOM   2058 C  CB  . VAL E 1 67 ? -35.801 -1.973  32.421  1.00 86.21  ? 63  VAL E CB  1 
ATOM   2059 C  CG1 . VAL E 1 67 ? -36.153 -0.524  32.109  1.00 85.96  ? 63  VAL E CG1 1 
ATOM   2060 C  CG2 . VAL E 1 67 ? -35.731 -2.200  33.918  1.00 89.11  ? 63  VAL E CG2 1 
ATOM   2061 N  N   . PRO E 1 68 ? -35.881 -3.218  29.475  1.00 99.05  ? 64  PRO E N   1 
ATOM   2062 C  CA  . PRO E 1 68 ? -36.038 -3.136  28.012  1.00 96.61  ? 64  PRO E CA  1 
ATOM   2063 C  C   . PRO E 1 68 ? -37.175 -4.003  27.500  1.00 91.18  ? 64  PRO E C   1 
ATOM   2064 O  O   . PRO E 1 68 ? -37.887 -3.604  26.570  1.00 92.62  ? 64  PRO E O   1 
ATOM   2065 C  CB  . PRO E 1 68 ? -34.677 -3.613  27.481  1.00 97.24  ? 64  PRO E CB  1 
ATOM   2066 C  CG  . PRO E 1 68 ? -33.741 -3.473  28.629  1.00 102.37 ? 64  PRO E CG  1 
ATOM   2067 C  CD  . PRO E 1 68 ? -34.566 -3.779  29.834  1.00 102.53 ? 64  PRO E CD  1 
ATOM   2068 N  N   . TYR E 1 69 ? -37.358 -5.189  28.087  1.00 85.71  ? 65  TYR E N   1 
ATOM   2069 C  CA  . TYR E 1 69 ? -38.417 -6.090  27.646  1.00 78.16  ? 65  TYR E CA  1 
ATOM   2070 C  C   . TYR E 1 69 ? -39.792 -5.479  27.861  1.00 80.04  ? 65  TYR E C   1 
ATOM   2071 O  O   . TYR E 1 69 ? -40.660 -5.570  26.985  1.00 85.26  ? 65  TYR E O   1 
ATOM   2072 C  CB  . TYR E 1 69 ? -38.307 -7.418  28.394  1.00 72.74  ? 65  TYR E CB  1 
ATOM   2073 C  CG  . TYR E 1 69 ? -39.207 -8.514  27.885  1.00 69.93  ? 65  TYR E CG  1 
ATOM   2074 C  CD1 . TYR E 1 69 ? -40.482 -8.688  28.412  1.00 71.27  ? 65  TYR E CD1 1 
ATOM   2075 C  CD2 . TYR E 1 69 ? -38.786 -9.381  26.891  1.00 68.22  ? 65  TYR E CD2 1 
ATOM   2076 C  CE1 . TYR E 1 69 ? -41.310 -9.689  27.959  1.00 71.42  ? 65  TYR E CE1 1 
ATOM   2077 C  CE2 . TYR E 1 69 ? -39.610 -10.395 26.433  1.00 69.86  ? 65  TYR E CE2 1 
ATOM   2078 C  CZ  . TYR E 1 69 ? -40.870 -10.537 26.969  1.00 72.78  ? 65  TYR E CZ  1 
ATOM   2079 O  OH  . TYR E 1 69 ? -41.686 -11.541 26.517  1.00 77.74  ? 65  TYR E OH  1 
ATOM   2080 N  N   . ALA E 1 70 ? -40.012 -4.853  29.020  1.00 77.62  ? 66  ALA E N   1 
ATOM   2081 C  CA  . ALA E 1 70 ? -41.295 -4.203  29.278  1.00 76.24  ? 66  ALA E CA  1 
ATOM   2082 C  C   . ALA E 1 70 ? -41.589 -3.129  28.240  1.00 76.76  ? 66  ALA E C   1 
ATOM   2083 O  O   . ALA E 1 70 ? -42.719 -3.024  27.745  1.00 79.59  ? 66  ALA E O   1 
ATOM   2084 C  CB  . ALA E 1 70 ? -41.301 -3.606  30.684  1.00 77.36  ? 66  ALA E CB  1 
ATOM   2085 N  N   . MET E 1 71 ? -40.578 -2.337  27.881  1.00 77.33  ? 67  MET E N   1 
ATOM   2086 C  CA  . MET E 1 71 ? -40.757 -1.321  26.849  1.00 82.55  ? 67  MET E CA  1 
ATOM   2087 C  C   . MET E 1 71 ? -41.188 -1.962  25.541  1.00 85.03  ? 67  MET E C   1 
ATOM   2088 O  O   . MET E 1 71 ? -42.196 -1.569  24.942  1.00 89.05  ? 67  MET E O   1 
ATOM   2089 C  CB  . MET E 1 71 ? -39.460 -0.533  26.660  1.00 83.79  ? 67  MET E CB  1 
ATOM   2090 C  CG  . MET E 1 71 ? -39.515 0.551   25.590  1.00 84.83  ? 67  MET E CG  1 
ATOM   2091 S  SD  . MET E 1 71 ? -40.446 2.000   26.114  1.00 87.76  ? 67  MET E SD  1 
ATOM   2092 C  CE  . MET E 1 71 ? -39.531 2.487   27.579  1.00 91.43  ? 67  MET E CE  1 
ATOM   2093 N  N   . ASN E 1 72 ? -40.460 -2.993  25.112  1.00 84.36  ? 68  ASN E N   1 
ATOM   2094 C  CA  . ASN E 1 72 ? -40.760 -3.636  23.839  1.00 86.44  ? 68  ASN E CA  1 
ATOM   2095 C  C   . ASN E 1 72 ? -42.120 -4.319  23.866  1.00 83.57  ? 68  ASN E C   1 
ATOM   2096 O  O   . ASN E 1 72 ? -42.824 -4.347  22.851  1.00 85.64  ? 68  ASN E O   1 
ATOM   2097 C  CB  . ASN E 1 72 ? -39.660 -4.646  23.503  1.00 92.04  ? 68  ASN E CB  1 
ATOM   2098 C  CG  . ASN E 1 72 ? -38.302 -3.992  23.299  1.00 102.28 ? 68  ASN E CG  1 
ATOM   2099 O  OD1 . ASN E 1 72 ? -38.001 -2.957  23.894  1.00 110.57 ? 68  ASN E OD1 1 
ATOM   2100 N  ND2 . ASN E 1 72 ? -37.467 -4.615  22.476  1.00 101.17 ? 68  ASN E ND2 1 
ATOM   2101 N  N   . LEU E 1 73 ? -42.513 -4.857  25.019  1.00 81.75  ? 69  LEU E N   1 
ATOM   2102 C  CA  . LEU E 1 73 ? -43.749 -5.626  25.102  1.00 80.27  ? 69  LEU E CA  1 
ATOM   2103 C  C   . LEU E 1 73 ? -44.960 -4.730  25.335  1.00 84.38  ? 69  LEU E C   1 
ATOM   2104 O  O   . LEU E 1 73 ? -45.992 -4.892  24.676  1.00 88.98  ? 69  LEU E O   1 
ATOM   2105 C  CB  . LEU E 1 73 ? -43.630 -6.679  26.205  1.00 72.61  ? 69  LEU E CB  1 
ATOM   2106 C  CG  . LEU E 1 73 ? -44.834 -7.589  26.461  1.00 64.87  ? 69  LEU E CG  1 
ATOM   2107 C  CD1 . LEU E 1 73 ? -45.163 -8.416  25.229  1.00 60.80  ? 69  LEU E CD1 1 
ATOM   2108 C  CD2 . LEU E 1 73 ? -44.581 -8.491  27.666  1.00 64.72  ? 69  LEU E CD2 1 
ATOM   2109 N  N   . LEU E 1 74 ? -44.859 -3.783  26.272  1.00 83.10  ? 70  LEU E N   1 
ATOM   2110 C  CA  . LEU E 1 74 ? -46.043 -3.107  26.785  1.00 88.63  ? 70  LEU E CA  1 
ATOM   2111 C  C   . LEU E 1 74 ? -46.234 -1.670  26.316  1.00 92.40  ? 70  LEU E C   1 
ATOM   2112 O  O   . LEU E 1 74 ? -47.342 -1.146  26.462  1.00 95.57  ? 70  LEU E O   1 
ATOM   2113 C  CB  . LEU E 1 74 ? -46.034 -3.107  28.322  1.00 90.38  ? 70  LEU E CB  1 
ATOM   2114 C  CG  . LEU E 1 74 ? -46.022 -4.473  29.009  1.00 89.11  ? 70  LEU E CG  1 
ATOM   2115 C  CD1 . LEU E 1 74 ? -46.117 -4.299  30.514  1.00 91.56  ? 70  LEU E CD1 1 
ATOM   2116 C  CD2 . LEU E 1 74 ? -47.166 -5.327  28.501  1.00 85.73  ? 70  LEU E CD2 1 
ATOM   2117 N  N   . ASN E 1 75 ? -45.209 -1.018  25.771  1.00 93.07  ? 71  ASN E N   1 
ATOM   2118 C  CA  . ASN E 1 75 ? -45.346 0.391   25.413  1.00 97.69  ? 71  ASN E CA  1 
ATOM   2119 C  C   . ASN E 1 75 ? -46.406 0.585   24.335  1.00 100.54 ? 71  ASN E C   1 
ATOM   2120 O  O   . ASN E 1 75 ? -46.454 -0.155  23.348  1.00 96.84  ? 71  ASN E O   1 
ATOM   2121 C  CB  . ASN E 1 75 ? -44.006 0.961   24.945  1.00 98.82  ? 71  ASN E CB  1 
ATOM   2122 C  CG  . ASN E 1 75 ? -44.060 2.462   24.709  1.00 104.55 ? 71  ASN E CG  1 
ATOM   2123 O  OD1 . ASN E 1 75 ? -44.890 3.162   25.297  1.00 107.54 ? 71  ASN E OD1 1 
ATOM   2124 N  ND2 . ASN E 1 75 ? -43.159 2.968   23.866  1.00 104.81 ? 71  ASN E ND2 1 
ATOM   2125 N  N   . GLY E 1 76 ? -47.274 1.574   24.544  1.00 109.13 ? 72  GLY E N   1 
ATOM   2126 C  CA  . GLY E 1 76 ? -48.303 1.934   23.591  1.00 117.02 ? 72  GLY E CA  1 
ATOM   2127 C  C   . GLY E 1 76 ? -49.637 1.235   23.760  1.00 118.46 ? 72  GLY E C   1 
ATOM   2128 O  O   . GLY E 1 76 ? -50.606 1.617   23.090  1.00 120.70 ? 72  GLY E O   1 
ATOM   2129 N  N   . ILE E 1 77 ? -49.725 0.230   24.632  1.00 118.50 ? 73  ILE E N   1 
ATOM   2130 C  CA  . ILE E 1 77 ? -50.984 -0.474  24.843  1.00 122.85 ? 73  ILE E CA  1 
ATOM   2131 C  C   . ILE E 1 77 ? -52.005 0.474   25.456  1.00 126.31 ? 73  ILE E C   1 
ATOM   2132 O  O   . ILE E 1 77 ? -51.680 1.295   26.326  1.00 127.35 ? 73  ILE E O   1 
ATOM   2133 C  CB  . ILE E 1 77 ? -50.765 -1.718  25.721  1.00 123.39 ? 73  ILE E CB  1 
ATOM   2134 C  CG1 . ILE E 1 77 ? -49.916 -2.745  24.971  1.00 123.45 ? 73  ILE E CG1 1 
ATOM   2135 C  CG2 . ILE E 1 77 ? -52.092 -2.337  26.141  1.00 126.28 ? 73  ILE E CG2 1 
ATOM   2136 C  CD1 . ILE E 1 77 ? -50.498 -3.148  23.629  1.00 125.01 ? 73  ILE E CD1 1 
ATOM   2137 N  N   . LYS E 1 78 ? -53.253 0.357   25.014  1.00 120.91 ? 74  LYS E N   1 
ATOM   2138 C  CA  . LYS E 1 78 ? -54.298 1.282   25.435  1.00 118.17 ? 74  LYS E CA  1 
ATOM   2139 C  C   . LYS E 1 78 ? -54.907 0.822   26.752  1.00 115.13 ? 74  LYS E C   1 
ATOM   2140 O  O   . LYS E 1 78 ? -55.390 -0.311  26.858  1.00 117.46 ? 74  LYS E O   1 
ATOM   2141 C  CB  . LYS E 1 78 ? -55.375 1.398   24.359  1.00 121.21 ? 74  LYS E CB  1 
ATOM   2142 N  N   . LEU E 1 79 ? -54.861 1.691   27.760  1.00 112.46 ? 75  LEU E N   1 
ATOM   2143 C  CA  . LEU E 1 79 ? -55.525 1.466   29.039  1.00 108.27 ? 75  LEU E CA  1 
ATOM   2144 C  C   . LEU E 1 79 ? -56.731 2.391   29.118  1.00 111.01 ? 75  LEU E C   1 
ATOM   2145 O  O   . LEU E 1 79 ? -56.580 3.617   29.051  1.00 110.85 ? 75  LEU E O   1 
ATOM   2146 C  CB  . LEU E 1 79 ? -54.581 1.712   30.218  1.00 102.90 ? 75  LEU E CB  1 
ATOM   2147 C  CG  . LEU E 1 79 ? -53.618 0.596   30.624  1.00 95.53  ? 75  LEU E CG  1 
ATOM   2148 C  CD1 . LEU E 1 79 ? -52.872 0.987   31.890  1.00 96.30  ? 75  LEU E CD1 1 
ATOM   2149 C  CD2 . LEU E 1 79 ? -54.385 -0.695  30.838  1.00 93.86  ? 75  LEU E CD2 1 
ATOM   2150 N  N   . TYR E 1 80 ? -57.922 1.801   29.237  1.00 114.80 ? 76  TYR E N   1 
ATOM   2151 C  CA  . TYR E 1 80 ? -59.181 2.549   29.247  1.00 123.93 ? 76  TYR E CA  1 
ATOM   2152 C  C   . TYR E 1 80 ? -59.292 3.455   28.023  1.00 130.17 ? 76  TYR E C   1 
ATOM   2153 O  O   . TYR E 1 80 ? -59.843 4.556   28.084  1.00 136.65 ? 76  TYR E O   1 
ATOM   2154 C  CB  . TYR E 1 80 ? -59.343 3.348   30.543  1.00 123.97 ? 76  TYR E CB  1 
ATOM   2155 C  CG  . TYR E 1 80 ? -59.434 2.475   31.771  1.00 122.05 ? 76  TYR E CG  1 
ATOM   2156 C  CD1 . TYR E 1 80 ? -60.465 1.558   31.915  1.00 125.19 ? 76  TYR E CD1 1 
ATOM   2157 C  CD2 . TYR E 1 80 ? -58.491 2.565   32.784  1.00 118.80 ? 76  TYR E CD2 1 
ATOM   2158 C  CE1 . TYR E 1 80 ? -60.555 0.753   33.032  1.00 126.08 ? 76  TYR E CE1 1 
ATOM   2159 C  CE2 . TYR E 1 80 ? -58.572 1.763   33.908  1.00 119.82 ? 76  TYR E CE2 1 
ATOM   2160 C  CZ  . TYR E 1 80 ? -59.606 0.859   34.025  1.00 122.50 ? 76  TYR E CZ  1 
ATOM   2161 O  OH  . TYR E 1 80 ? -59.691 0.059   35.140  1.00 122.15 ? 76  TYR E OH  1 
ATOM   2162 N  N   . GLY E 1 81 ? -58.762 2.984   26.897  1.00 128.69 ? 77  GLY E N   1 
ATOM   2163 C  CA  . GLY E 1 81 ? -58.808 3.745   25.669  1.00 134.26 ? 77  GLY E CA  1 
ATOM   2164 C  C   . GLY E 1 81 ? -57.698 4.756   25.508  1.00 133.78 ? 77  GLY E C   1 
ATOM   2165 O  O   . GLY E 1 81 ? -57.632 5.420   24.464  1.00 136.81 ? 77  GLY E O   1 
ATOM   2166 N  N   . ARG E 1 82 ? -56.826 4.900   26.503  1.00 132.90 ? 78  ARG E N   1 
ATOM   2167 C  CA  . ARG E 1 82 ? -55.734 5.856   26.437  1.00 133.88 ? 78  ARG E CA  1 
ATOM   2168 C  C   . ARG E 1 82 ? -54.423 5.089   26.439  1.00 134.57 ? 78  ARG E C   1 
ATOM   2169 O  O   . ARG E 1 82 ? -54.115 4.407   27.429  1.00 135.74 ? 78  ARG E O   1 
ATOM   2170 C  CB  . ARG E 1 82 ? -55.789 6.831   27.614  1.00 134.90 ? 78  ARG E CB  1 
ATOM   2171 N  N   . PRO E 1 83 ? -53.624 5.173   25.376  1.00 134.30 ? 79  PRO E N   1 
ATOM   2172 C  CA  . PRO E 1 83 ? -52.406 4.357   25.306  1.00 127.43 ? 79  PRO E CA  1 
ATOM   2173 C  C   . PRO E 1 83 ? -51.356 4.833   26.295  1.00 125.87 ? 79  PRO E C   1 
ATOM   2174 O  O   . PRO E 1 83 ? -51.172 6.034   26.512  1.00 129.61 ? 79  PRO E O   1 
ATOM   2175 C  CB  . PRO E 1 83 ? -51.940 4.540   23.857  1.00 125.29 ? 79  PRO E CB  1 
ATOM   2176 C  CG  . PRO E 1 83 ? -52.490 5.863   23.458  1.00 130.63 ? 79  PRO E CG  1 
ATOM   2177 C  CD  . PRO E 1 83 ? -53.817 5.985   24.163  1.00 137.06 ? 79  PRO E CD  1 
ATOM   2178 N  N   . ILE E 1 84 ? -50.671 3.873   26.900  1.00 120.24 ? 80  ILE E N   1 
ATOM   2179 C  CA  . ILE E 1 84 ? -49.627 4.181   27.866  1.00 118.12 ? 80  ILE E CA  1 
ATOM   2180 C  C   . ILE E 1 84 ? -48.375 4.632   27.129  1.00 121.08 ? 80  ILE E C   1 
ATOM   2181 O  O   . ILE E 1 84 ? -48.094 4.206   26.001  1.00 122.74 ? 80  ILE E O   1 
ATOM   2182 C  CB  . ILE E 1 84 ? -49.339 2.969   28.772  1.00 108.62 ? 80  ILE E CB  1 
ATOM   2183 C  CG1 . ILE E 1 84 ? -48.788 1.795   27.960  1.00 97.00  ? 80  ILE E CG1 1 
ATOM   2184 C  CG2 . ILE E 1 84 ? -50.605 2.546   29.498  1.00 112.05 ? 80  ILE E CG2 1 
ATOM   2185 C  CD1 . ILE E 1 84 ? -48.573 0.540   28.779  1.00 91.52  ? 80  ILE E CD1 1 
ATOM   2186 N  N   . LYS E 1 85 ? -47.622 5.514   27.769  1.00 123.81 ? 81  LYS E N   1 
ATOM   2187 C  CA  . LYS E 1 85 ? -46.320 5.946   27.280  1.00 122.34 ? 81  LYS E CA  1 
ATOM   2188 C  C   . LYS E 1 85 ? -45.271 5.497   28.284  1.00 122.81 ? 81  LYS E C   1 
ATOM   2189 O  O   . LYS E 1 85 ? -45.286 5.938   29.439  1.00 129.64 ? 81  LYS E O   1 
ATOM   2190 C  CB  . LYS E 1 85 ? -46.274 7.461   27.086  1.00 127.18 ? 81  LYS E CB  1 
ATOM   2191 N  N   . ILE E 1 86 ? -44.363 4.628   27.846  1.00 115.06 ? 82  ILE E N   1 
ATOM   2192 C  CA  . ILE E 1 86 ? -43.325 4.078   28.706  1.00 113.78 ? 82  ILE E CA  1 
ATOM   2193 C  C   . ILE E 1 86 ? -42.017 4.773   28.366  1.00 116.99 ? 82  ILE E C   1 
ATOM   2194 O  O   . ILE E 1 86 ? -41.684 4.944   27.187  1.00 123.41 ? 82  ILE E O   1 
ATOM   2195 C  CB  . ILE E 1 86 ? -43.201 2.553   28.534  1.00 108.92 ? 82  ILE E CB  1 
ATOM   2196 N  N   . GLN E 1 87 ? -41.291 5.195   29.397  1.00 110.01 ? 83  GLN E N   1 
ATOM   2197 C  CA  . GLN E 1 87 ? -40.024 5.891   29.227  1.00 116.86 ? 83  GLN E CA  1 
ATOM   2198 C  C   . GLN E 1 87 ? -39.054 5.467   30.319  1.00 118.17 ? 83  GLN E C   1 
ATOM   2199 O  O   . GLN E 1 87 ? -39.457 5.149   31.441  1.00 120.57 ? 83  GLN E O   1 
ATOM   2200 C  CB  . GLN E 1 87 ? -40.212 7.413   29.253  1.00 120.79 ? 83  GLN E CB  1 
ATOM   2201 N  N   . PHE E 1 88 ? -37.767 5.462   29.978  1.00 121.62 ? 84  PHE E N   1 
ATOM   2202 C  CA  . PHE E 1 88 ? -36.730 5.121   30.940  1.00 126.00 ? 84  PHE E CA  1 
ATOM   2203 C  C   . PHE E 1 88 ? -36.424 6.303   31.849  1.00 132.98 ? 84  PHE E C   1 
ATOM   2204 O  O   . PHE E 1 88 ? -36.285 7.440   31.390  1.00 137.34 ? 84  PHE E O   1 
ATOM   2205 C  CB  . PHE E 1 88 ? -35.449 4.692   30.223  1.00 125.85 ? 84  PHE E CB  1 
ATOM   2206 C  CG  . PHE E 1 88 ? -35.620 3.498   29.328  1.00 121.37 ? 84  PHE E CG  1 
ATOM   2207 C  CD1 . PHE E 1 88 ? -35.445 2.215   29.821  1.00 118.36 ? 84  PHE E CD1 1 
ATOM   2208 C  CD2 . PHE E 1 88 ? -35.937 3.659   27.988  1.00 119.80 ? 84  PHE E CD2 1 
ATOM   2209 C  CE1 . PHE E 1 88 ? -35.594 1.115   28.998  1.00 113.52 ? 84  PHE E CE1 1 
ATOM   2210 C  CE2 . PHE E 1 88 ? -36.085 2.564   27.160  1.00 115.04 ? 84  PHE E CE2 1 
ATOM   2211 C  CZ  . PHE E 1 88 ? -35.916 1.290   27.666  1.00 111.92 ? 84  PHE E CZ  1 
ATOM   2212 N  N   . ARG E 1 89 ? -36.303 6.024   33.147  1.00 136.68 ? 85  ARG E N   1 
ATOM   2213 C  CA  . ARG E 1 89 ? -35.921 7.043   34.116  1.00 145.72 ? 85  ARG E CA  1 
ATOM   2214 C  C   . ARG E 1 89 ? -34.413 7.146   34.293  1.00 152.91 ? 85  ARG E C   1 
ATOM   2215 O  O   . ARG E 1 89 ? -33.942 8.075   34.959  1.00 162.02 ? 85  ARG E O   1 
ATOM   2216 C  CB  . ARG E 1 89 ? -36.577 6.762   35.473  1.00 145.36 ? 85  ARG E CB  1 
ATOM   2217 N  N   . SER E 1 90 ? -33.653 6.219   33.718  1.00 148.40 ? 86  SER E N   1 
ATOM   2218 C  CA  . SER E 1 90 ? -32.199 6.240   33.797  1.00 151.50 ? 86  SER E CA  1 
ATOM   2219 C  C   . SER E 1 90 ? -31.605 5.497   32.607  1.00 144.76 ? 86  SER E C   1 
ATOM   2220 O  O   . SER E 1 90 ? -30.472 5.754   32.206  1.00 147.19 ? 86  SER E O   1 
ATOM   2221 C  CB  . SER E 1 90 ? -31.712 5.619   35.109  1.00 154.64 ? 86  SER E CB  1 
ATOM   2222 N  N   . ARG F 2 6  ? -44.989 -21.669 37.602  1.00 80.25  ? 285 ARG F N   1 
ATOM   2223 C  CA  . ARG F 2 6  ? -45.716 -20.720 38.437  1.00 83.14  ? 285 ARG F CA  1 
ATOM   2224 C  C   . ARG F 2 6  ? -46.069 -19.432 37.671  1.00 83.96  ? 285 ARG F C   1 
ATOM   2225 O  O   . ARG F 2 6  ? -47.033 -18.754 38.022  1.00 91.52  ? 285 ARG F O   1 
ATOM   2226 C  CB  . ARG F 2 6  ? -44.903 -20.400 39.702  1.00 82.03  ? 285 ARG F CB  1 
ATOM   2227 C  CG  . ARG F 2 6  ? -45.694 -19.695 40.797  1.00 85.75  ? 285 ARG F CG  1 
ATOM   2228 C  CD  . ARG F 2 6  ? -46.876 -20.532 41.256  1.00 92.88  ? 285 ARG F CD  1 
ATOM   2229 N  NE  . ARG F 2 6  ? -47.828 -19.731 42.019  1.00 99.72  ? 285 ARG F NE  1 
ATOM   2230 C  CZ  . ARG F 2 6  ? -48.868 -20.234 42.675  1.00 107.28 ? 285 ARG F CZ  1 
ATOM   2231 N  NH1 . ARG F 2 6  ? -49.687 -19.432 43.348  1.00 109.09 ? 285 ARG F NH1 1 
ATOM   2232 N  NH2 . ARG F 2 6  ? -49.088 -21.543 42.666  1.00 110.71 ? 285 ARG F NH2 1 
ATOM   2233 N  N   . PHE F 2 7  ? -45.296 -19.101 36.632  1.00 79.94  ? 286 PHE F N   1 
ATOM   2234 C  CA  . PHE F 2 7  ? -45.574 -17.952 35.758  1.00 76.53  ? 286 PHE F CA  1 
ATOM   2235 C  C   . PHE F 2 7  ? -46.300 -18.450 34.514  1.00 78.61  ? 286 PHE F C   1 
ATOM   2236 O  O   . PHE F 2 7  ? -45.670 -18.965 33.589  1.00 81.73  ? 286 PHE F O   1 
ATOM   2237 C  CB  . PHE F 2 7  ? -44.293 -17.225 35.368  1.00 72.49  ? 286 PHE F CB  1 
ATOM   2238 C  CG  . PHE F 2 7  ? -44.487 -16.174 34.291  1.00 74.47  ? 286 PHE F CG  1 
ATOM   2239 C  CD1 . PHE F 2 7  ? -45.232 -15.030 34.535  1.00 75.30  ? 286 PHE F CD1 1 
ATOM   2240 C  CD2 . PHE F 2 7  ? -43.942 -16.349 33.020  1.00 72.11  ? 286 PHE F CD2 1 
ATOM   2241 C  CE1 . PHE F 2 7  ? -45.413 -14.071 33.538  1.00 73.71  ? 286 PHE F CE1 1 
ATOM   2242 C  CE2 . PHE F 2 7  ? -44.127 -15.399 32.022  1.00 68.15  ? 286 PHE F CE2 1 
ATOM   2243 C  CZ  . PHE F 2 7  ? -44.861 -14.262 32.282  1.00 69.73  ? 286 PHE F CZ  1 
ATOM   2244 N  N   . LYS F 2 8  ? -47.635 -18.381 34.527  1.00 80.04  ? 287 LYS F N   1 
ATOM   2245 C  CA  . LYS F 2 8  ? -48.413 -18.682 33.331  1.00 80.69  ? 287 LYS F CA  1 
ATOM   2246 C  C   . LYS F 2 8  ? -48.612 -17.427 32.484  1.00 79.34  ? 287 LYS F C   1 
ATOM   2247 O  O   . LYS F 2 8  ? -49.479 -16.603 32.807  1.00 78.86  ? 287 LYS F O   1 
ATOM   2248 C  CB  . LYS F 2 8  ? -49.768 -19.293 33.698  1.00 84.20  ? 287 LYS F CB  1 
ATOM   2249 N  N   . PRO F 2 9  ? -47.862 -17.246 31.394  1.00 75.49  ? 288 PRO F N   1 
ATOM   2250 C  CA  . PRO F 2 9  ? -47.983 -16.001 30.620  1.00 71.51  ? 288 PRO F CA  1 
ATOM   2251 C  C   . PRO F 2 9  ? -49.368 -15.829 29.995  1.00 73.22  ? 288 PRO F C   1 
ATOM   2252 O  O   . PRO F 2 9  ? -50.007 -16.794 29.561  1.00 72.82  ? 288 PRO F O   1 
ATOM   2253 C  CB  . PRO F 2 9  ? -46.893 -16.142 29.549  1.00 66.28  ? 288 PRO F CB  1 
ATOM   2254 C  CG  . PRO F 2 9  ? -46.450 -17.565 29.601  1.00 66.15  ? 288 PRO F CG  1 
ATOM   2255 C  CD  . PRO F 2 9  ? -46.697 -18.040 30.974  1.00 70.95  ? 288 PRO F CD  1 
ATOM   2256 N  N   . GLY F 2 10 ? -49.823 -14.576 29.952  1.00 73.60  ? 289 GLY F N   1 
ATOM   2257 C  CA  . GLY F 2 10 ? -51.077 -14.201 29.335  1.00 77.57  ? 289 GLY F CA  1 
ATOM   2258 C  C   . GLY F 2 10 ? -52.338 -14.488 30.120  1.00 79.91  ? 289 GLY F C   1 
ATOM   2259 O  O   . GLY F 2 10 ? -53.428 -14.229 29.600  1.00 85.45  ? 289 GLY F O   1 
ATOM   2260 N  N   . VAL F 2 11 ? -52.243 -15.005 31.343  1.00 77.14  ? 290 VAL F N   1 
ATOM   2261 C  CA  . VAL F 2 11 ? -53.413 -15.166 32.207  1.00 74.95  ? 290 VAL F CA  1 
ATOM   2262 C  C   . VAL F 2 11 ? -53.581 -13.887 33.014  1.00 76.26  ? 290 VAL F C   1 
ATOM   2263 O  O   . VAL F 2 11 ? -52.695 -13.508 33.792  1.00 75.19  ? 290 VAL F O   1 
ATOM   2264 C  CB  . VAL F 2 11 ? -53.271 -16.383 33.127  1.00 66.47  ? 290 VAL F CB  1 
ATOM   2265 C  CG1 . VAL F 2 11 ? -54.605 -16.736 33.746  1.00 73.11  ? 290 VAL F CG1 1 
ATOM   2266 C  CG2 . VAL F 2 11 ? -52.709 -17.549 32.345  1.00 63.04  ? 290 VAL F CG2 1 
ATOM   2267 N  N   . ILE F 2 12 ? -54.729 -13.229 32.844  1.00 80.72  ? 291 ILE F N   1 
ATOM   2268 C  CA  . ILE F 2 12 ? -54.993 -11.933 33.453  1.00 85.79  ? 291 ILE F CA  1 
ATOM   2269 C  C   . ILE F 2 12 ? -56.319 -11.930 34.202  1.00 92.88  ? 291 ILE F C   1 
ATOM   2270 O  O   . ILE F 2 12 ? -57.193 -12.773 33.988  1.00 95.92  ? 291 ILE F O   1 
ATOM   2271 C  CB  . ILE F 2 12 ? -54.993 -10.814 32.399  1.00 86.96  ? 291 ILE F CB  1 
ATOM   2272 C  CG1 . ILE F 2 12 ? -56.084 -11.074 31.360  1.00 93.23  ? 291 ILE F CG1 1 
ATOM   2273 C  CG2 . ILE F 2 12 ? -53.640 -10.735 31.738  1.00 78.10  ? 291 ILE F CG2 1 
ATOM   2274 C  CD1 . ILE F 2 12 ? -56.159 -10.021 30.287  1.00 98.28  ? 291 ILE F CD1 1 
ATOM   2275 N  N   . SER F 2 13 ? -56.447 -10.954 35.098  1.00 94.05  ? 292 SER F N   1 
ATOM   2276 C  CA  . SER F 2 13 ? -57.618 -10.805 35.947  1.00 99.56  ? 292 SER F CA  1 
ATOM   2277 C  C   . SER F 2 13 ? -58.757 -10.161 35.160  1.00 104.58 ? 292 SER F C   1 
ATOM   2278 O  O   . SER F 2 13 ? -58.571 -9.650  34.055  1.00 102.36 ? 292 SER F O   1 
ATOM   2279 C  CB  . SER F 2 13 ? -57.283 -9.973  37.183  1.00 103.55 ? 292 SER F CB  1 
ATOM   2280 O  OG  . SER F 2 13 ? -57.062 -8.614  36.846  1.00 107.46 ? 292 SER F OG  1 
ATOM   2281 N  N   . GLU F 2 14 ? -59.954 -10.188 35.749  1.00 110.47 ? 293 GLU F N   1 
ATOM   2282 C  CA  . GLU F 2 14 ? -61.108 -9.578  35.096  1.00 116.00 ? 293 GLU F CA  1 
ATOM   2283 C  C   . GLU F 2 14 ? -60.992 -8.058  35.047  1.00 116.89 ? 293 GLU F C   1 
ATOM   2284 O  O   . GLU F 2 14 ? -61.437 -7.429  34.079  1.00 118.42 ? 293 GLU F O   1 
ATOM   2285 C  CB  . GLU F 2 14 ? -62.396 -9.994  35.807  1.00 123.93 ? 293 GLU F CB  1 
ATOM   2286 N  N   . GLU F 2 15 ? -60.414 -7.448  36.085  1.00 117.25 ? 294 GLU F N   1 
ATOM   2287 C  CA  . GLU F 2 15 ? -60.254 -5.996  36.095  1.00 121.84 ? 294 GLU F CA  1 
ATOM   2288 C  C   . GLU F 2 15 ? -59.322 -5.531  34.983  1.00 123.49 ? 294 GLU F C   1 
ATOM   2289 O  O   . GLU F 2 15 ? -59.575 -4.510  34.333  1.00 128.86 ? 294 GLU F O   1 
ATOM   2290 C  CB  . GLU F 2 15 ? -59.738 -5.529  37.456  1.00 117.80 ? 294 GLU F CB  1 
ATOM   2291 N  N   . LEU F 2 16 ? -58.235 -6.267  34.754  1.00 118.81 ? 295 LEU F N   1 
ATOM   2292 C  CA  . LEU F 2 16 ? -57.289 -5.897  33.707  1.00 116.80 ? 295 LEU F CA  1 
ATOM   2293 C  C   . LEU F 2 16 ? -57.896 -6.055  32.317  1.00 122.08 ? 295 LEU F C   1 
ATOM   2294 O  O   . LEU F 2 16 ? -57.576 -5.279  31.410  1.00 122.68 ? 295 LEU F O   1 
ATOM   2295 C  CB  . LEU F 2 16 ? -56.016 -6.726  33.835  1.00 109.98 ? 295 LEU F CB  1 
ATOM   2296 C  CG  . LEU F 2 16 ? -54.965 -6.489  32.751  1.00 108.47 ? 295 LEU F CG  1 
ATOM   2297 C  CD1 . LEU F 2 16 ? -54.578 -5.022  32.721  1.00 111.87 ? 295 LEU F CD1 1 
ATOM   2298 C  CD2 . LEU F 2 16 ? -53.739 -7.360  32.957  1.00 102.23 ? 295 LEU F CD2 1 
ATOM   2299 N  N   . GLN F 2 17 ? -58.751 -7.062  32.121  1.00 127.47 ? 296 GLN F N   1 
ATOM   2300 C  CA  . GLN F 2 17 ? -59.394 -7.240  30.821  1.00 134.21 ? 296 GLN F CA  1 
ATOM   2301 C  C   . GLN F 2 17 ? -60.178 -6.001  30.409  1.00 144.19 ? 296 GLN F C   1 
ATOM   2302 O  O   . GLN F 2 17 ? -60.103 -5.565  29.253  1.00 145.01 ? 296 GLN F O   1 
ATOM   2303 C  CB  . GLN F 2 17 ? -60.315 -8.459  30.845  1.00 137.42 ? 296 GLN F CB  1 
ATOM   2304 C  CG  . GLN F 2 17 ? -59.602 -9.779  31.064  1.00 131.84 ? 296 GLN F CG  1 
ATOM   2305 C  CD  . GLN F 2 17 ? -60.228 -10.914 30.278  1.00 134.87 ? 296 GLN F CD  1 
ATOM   2306 O  OE1 . GLN F 2 17 ? -60.702 -10.720 29.159  1.00 140.73 ? 296 GLN F OE1 1 
ATOM   2307 N  NE2 . GLN F 2 17 ? -60.232 -12.107 30.860  1.00 131.86 ? 296 GLN F NE2 1 
ATOM   2308 N  N   . ASP F 2 18 ? -60.940 -5.423  31.340  1.00 153.29 ? 297 ASP F N   1 
ATOM   2309 C  CA  . ASP F 2 18 ? -61.734 -4.241  31.023  1.00 165.78 ? 297 ASP F CA  1 
ATOM   2310 C  C   . ASP F 2 18 ? -60.858 -3.056  30.631  1.00 170.33 ? 297 ASP F C   1 
ATOM   2311 O  O   . ASP F 2 18 ? -61.223 -2.276  29.745  1.00 175.27 ? 297 ASP F O   1 
ATOM   2312 C  CB  . ASP F 2 18 ? -62.618 -3.880  32.218  1.00 168.68 ? 297 ASP F CB  1 
ATOM   2313 N  N   . ALA F 2 19 ? -59.701 -2.899  31.279  1.00 170.57 ? 298 ALA F N   1 
ATOM   2314 C  CA  . ALA F 2 19 ? -58.822 -1.780  30.946  1.00 173.99 ? 298 ALA F CA  1 
ATOM   2315 C  C   . ALA F 2 19 ? -58.237 -1.904  29.541  1.00 169.52 ? 298 ALA F C   1 
ATOM   2316 O  O   . ALA F 2 19 ? -58.161 -0.911  28.806  1.00 172.85 ? 298 ALA F O   1 
ATOM   2317 C  CB  . ALA F 2 19 ? -57.706 -1.665  31.985  1.00 171.77 ? 298 ALA F CB  1 
ATOM   2318 N  N   . LEU F 2 20 ? -57.820 -3.107  29.145  1.00 159.32 ? 299 LEU F N   1 
ATOM   2319 C  CA  . LEU F 2 20 ? -57.223 -3.306  27.829  1.00 152.14 ? 299 LEU F CA  1 
ATOM   2320 C  C   . LEU F 2 20 ? -58.255 -3.388  26.712  1.00 155.44 ? 299 LEU F C   1 
ATOM   2321 O  O   . LEU F 2 20 ? -57.870 -3.369  25.538  1.00 156.02 ? 299 LEU F O   1 
ATOM   2322 C  CB  . LEU F 2 20 ? -56.359 -4.566  27.825  1.00 143.70 ? 299 LEU F CB  1 
ATOM   2323 N  N   . GLY F 2 21 ? -59.541 -3.472  27.048  1.00 157.10 ? 300 GLY F N   1 
ATOM   2324 C  CA  . GLY F 2 21 ? -60.582 -3.615  26.048  1.00 158.48 ? 300 GLY F CA  1 
ATOM   2325 C  C   . GLY F 2 21 ? -60.735 -4.983  25.419  1.00 151.79 ? 300 GLY F C   1 
ATOM   2326 O  O   . GLY F 2 21 ? -61.211 -5.080  24.285  1.00 154.33 ? 300 GLY F O   1 
ATOM   2327 N  N   . VAL F 2 22 ? -60.355 -6.049  26.119  1.00 142.95 ? 301 VAL F N   1 
ATOM   2328 C  CA  . VAL F 2 22 ? -60.399 -7.380  25.516  1.00 139.52 ? 301 VAL F CA  1 
ATOM   2329 C  C   . VAL F 2 22 ? -61.808 -7.951  25.640  1.00 147.43 ? 301 VAL F C   1 
ATOM   2330 O  O   . VAL F 2 22 ? -62.527 -7.682  26.610  1.00 152.30 ? 301 VAL F O   1 
ATOM   2331 C  CB  . VAL F 2 22 ? -59.356 -8.309  26.156  1.00 129.30 ? 301 VAL F CB  1 
ATOM   2332 N  N   . THR F 2 23 ? -62.209 -8.753  24.665  1.00 149.30 ? 302 THR F N   1 
ATOM   2333 C  CA  . THR F 2 23 ? -63.568 -9.275  24.676  1.00 154.84 ? 302 THR F CA  1 
ATOM   2334 C  C   . THR F 2 23 ? -63.582 -10.749 25.084  1.00 157.20 ? 302 THR F C   1 
ATOM   2335 O  O   . THR F 2 23 ? -63.905 -11.066 26.234  1.00 159.40 ? 302 THR F O   1 
ATOM   2336 C  CB  . THR F 2 23 ? -64.232 -9.064  23.314  1.00 153.41 ? 302 THR F CB  1 
ATOM   2337 O  OG1 . THR F 2 23 ? -63.445 -9.694  22.296  1.00 145.27 ? 302 THR F OG1 1 
ATOM   2338 C  CG2 . THR F 2 23 ? -64.378 -7.565  23.014  1.00 156.33 ? 302 THR F CG2 1 
ATOM   2339 N  N   . ASP F 2 24 ? -63.264 -11.654 24.159  1.00 157.93 ? 303 ASP F N   1 
ATOM   2340 C  CA  . ASP F 2 24 ? -63.255 -13.073 24.496  1.00 158.81 ? 303 ASP F CA  1 
ATOM   2341 C  C   . ASP F 2 24 ? -62.185 -13.368 25.544  1.00 154.83 ? 303 ASP F C   1 
ATOM   2342 O  O   . ASP F 2 24 ? -61.139 -12.715 25.604  1.00 151.55 ? 303 ASP F O   1 
ATOM   2343 C  CB  . ASP F 2 24 ? -63.023 -13.932 23.247  1.00 158.58 ? 303 ASP F CB  1 
ATOM   2344 C  CG  . ASP F 2 24 ? -63.287 -15.426 23.495  1.00 158.41 ? 303 ASP F CG  1 
ATOM   2345 O  OD1 . ASP F 2 24 ? -62.734 -15.991 24.472  1.00 154.07 ? 303 ASP F OD1 1 
ATOM   2346 O  OD2 . ASP F 2 24 ? -64.068 -16.026 22.716  1.00 162.77 ? 303 ASP F OD2 1 
ATOM   2347 N  N   . LYS F 2 25 ? -62.455 -14.379 26.370  1.00 158.18 ? 304 LYS F N   1 
ATOM   2348 C  CA  . LYS F 2 25 ? -61.674 -14.624 27.572  1.00 155.72 ? 304 LYS F CA  1 
ATOM   2349 C  C   . LYS F 2 25 ? -60.875 -15.921 27.542  1.00 153.27 ? 304 LYS F C   1 
ATOM   2350 O  O   . LYS F 2 25 ? -60.149 -16.200 28.501  1.00 159.90 ? 304 LYS F O   1 
ATOM   2351 C  CB  . LYS F 2 25 ? -62.593 -14.614 28.802  1.00 157.48 ? 304 LYS F CB  1 
ATOM   2352 N  N   . SER F 2 26 ? -60.986 -16.726 26.486  1.00 148.09 ? 305 SER F N   1 
ATOM   2353 C  CA  . SER F 2 26 ? -60.130 -17.900 26.368  1.00 139.80 ? 305 SER F CA  1 
ATOM   2354 C  C   . SER F 2 26 ? -58.868 -17.626 25.557  1.00 132.31 ? 305 SER F C   1 
ATOM   2355 O  O   . SER F 2 26 ? -57.992 -18.493 25.490  1.00 131.71 ? 305 SER F O   1 
ATOM   2356 C  CB  . SER F 2 26 ? -60.906 -19.061 25.734  1.00 142.69 ? 305 SER F CB  1 
ATOM   2357 N  N   . LEU F 2 27 ? -58.766 -16.442 24.952  1.00 125.34 ? 306 LEU F N   1 
ATOM   2358 C  CA  . LEU F 2 27 ? -57.618 -16.050 24.137  1.00 116.10 ? 306 LEU F CA  1 
ATOM   2359 C  C   . LEU F 2 27 ? -56.560 -15.322 24.961  1.00 108.79 ? 306 LEU F C   1 
ATOM   2360 O  O   . LEU F 2 27 ? -56.830 -14.221 25.460  1.00 113.17 ? 306 LEU F O   1 
ATOM   2361 C  CB  . LEU F 2 27 ? -58.068 -15.183 22.975  1.00 114.68 ? 306 LEU F CB  1 
ATOM   2362 C  CG  . LEU F 2 27 ? -58.647 -15.933 21.768  1.00 113.47 ? 306 LEU F CG  1 
ATOM   2363 C  CD1 . LEU F 2 27 ? -59.796 -16.896 22.089  1.00 115.64 ? 306 LEU F CD1 1 
ATOM   2364 C  CD2 . LEU F 2 27 ? -59.044 -14.939 20.696  1.00 115.76 ? 306 LEU F CD2 1 
ATOM   2365 N  N   . PRO F 2 28 ? -55.366 -15.883 25.131  1.00 101.26 ? 307 PRO F N   1 
ATOM   2366 C  CA  . PRO F 2 28 ? -54.349 -15.241 25.964  1.00 96.48  ? 307 PRO F CA  1 
ATOM   2367 C  C   . PRO F 2 28 ? -53.810 -13.986 25.302  1.00 97.10  ? 307 PRO F C   1 
ATOM   2368 O  O   . PRO F 2 28 ? -53.359 -14.034 24.149  1.00 101.99 ? 307 PRO F O   1 
ATOM   2369 C  CB  . PRO F 2 28 ? -53.252 -16.312 26.061  1.00 91.64  ? 307 PRO F CB  1 
ATOM   2370 C  CG  . PRO F 2 28 ? -53.912 -17.602 25.662  1.00 93.71  ? 307 PRO F CG  1 
ATOM   2371 C  CD  . PRO F 2 28 ? -54.936 -17.205 24.654  1.00 98.74  ? 307 PRO F CD  1 
ATOM   2372 N  N   . PRO F 2 29 ? -53.847 -12.842 25.984  1.00 95.27  ? 308 PRO F N   1 
ATOM   2373 C  CA  . PRO F 2 29 ? -53.242 -11.629 25.427  1.00 94.06  ? 308 PRO F CA  1 
ATOM   2374 C  C   . PRO F 2 29 ? -51.752 -11.578 25.730  1.00 90.01  ? 308 PRO F C   1 
ATOM   2375 O  O   . PRO F 2 29 ? -51.264 -12.168 26.696  1.00 89.40  ? 308 PRO F O   1 
ATOM   2376 C  CB  . PRO F 2 29 ? -53.997 -10.506 26.150  1.00 95.77  ? 308 PRO F CB  1 
ATOM   2377 C  CG  . PRO F 2 29 ? -54.354 -11.104 27.461  1.00 93.98  ? 308 PRO F CG  1 
ATOM   2378 C  CD  . PRO F 2 29 ? -54.606 -12.573 27.213  1.00 93.19  ? 308 PRO F CD  1 
ATOM   2379 N  N   . PHE F 2 30 ? -51.031 -10.850 24.875  1.00 88.40  ? 309 PHE F N   1 
ATOM   2380 C  CA  . PHE F 2 30 ? -49.596 -10.581 24.901  1.00 81.17  ? 309 PHE F CA  1 
ATOM   2381 C  C   . PHE F 2 30 ? -48.812 -11.785 24.426  1.00 78.41  ? 309 PHE F C   1 
ATOM   2382 O  O   . PHE F 2 30 ? -47.617 -11.657 24.174  1.00 77.68  ? 309 PHE F O   1 
ATOM   2383 C  CB  . PHE F 2 30 ? -49.047 -10.169 26.281  1.00 76.30  ? 309 PHE F CB  1 
ATOM   2384 C  CG  . PHE F 2 30 ? -49.721 -8.985  26.870  1.00 81.84  ? 309 PHE F CG  1 
ATOM   2385 C  CD1 . PHE F 2 30 ? -49.656 -7.757  26.239  1.00 87.01  ? 309 PHE F CD1 1 
ATOM   2386 C  CD2 . PHE F 2 30 ? -50.407 -9.090  28.067  1.00 81.70  ? 309 PHE F CD2 1 
ATOM   2387 C  CE1 . PHE F 2 30 ? -50.283 -6.658  26.782  1.00 91.40  ? 309 PHE F CE1 1 
ATOM   2388 C  CE2 . PHE F 2 30 ? -51.030 -8.001  28.616  1.00 84.18  ? 309 PHE F CE2 1 
ATOM   2389 C  CZ  . PHE F 2 30 ? -50.971 -6.781  27.972  1.00 88.96  ? 309 PHE F CZ  1 
ATOM   2390 N  N   . ILE F 2 31 ? -49.449 -12.942 24.253  1.00 79.12  ? 310 ILE F N   1 
ATOM   2391 C  CA  . ILE F 2 31 ? -48.720 -14.151 23.893  1.00 75.91  ? 310 ILE F CA  1 
ATOM   2392 C  C   . ILE F 2 31 ? -48.025 -13.993 22.548  1.00 79.44  ? 310 ILE F C   1 
ATOM   2393 O  O   . ILE F 2 31 ? -46.886 -14.442 22.374  1.00 77.40  ? 310 ILE F O   1 
ATOM   2394 C  CB  . ILE F 2 31 ? -49.668 -15.364 23.928  1.00 75.30  ? 310 ILE F CB  1 
ATOM   2395 C  CG1 . ILE F 2 31 ? -49.855 -15.829 25.366  1.00 68.32  ? 310 ILE F CG1 1 
ATOM   2396 C  CG2 . ILE F 2 31 ? -49.129 -16.532 23.119  1.00 79.86  ? 310 ILE F CG2 1 
ATOM   2397 C  CD1 . ILE F 2 31 ? -48.570 -16.268 26.034  1.00 61.79  ? 310 ILE F CD1 1 
ATOM   2398 N  N   . TYR F 2 32 ? -48.664 -13.302 21.595  1.00 85.17  ? 311 TYR F N   1 
ATOM   2399 C  CA  . TYR F 2 32 ? -48.182 -13.365 20.213  1.00 85.68  ? 311 TYR F CA  1 
ATOM   2400 C  C   . TYR F 2 32 ? -46.907 -12.546 20.005  1.00 83.50  ? 311 TYR F C   1 
ATOM   2401 O  O   . TYR F 2 32 ? -45.975 -13.025 19.352  1.00 79.78  ? 311 TYR F O   1 
ATOM   2402 C  CB  . TYR F 2 32 ? -49.263 -12.932 19.232  1.00 90.01  ? 311 TYR F CB  1 
ATOM   2403 C  CG  . TYR F 2 32 ? -48.844 -13.161 17.794  1.00 91.31  ? 311 TYR F CG  1 
ATOM   2404 C  CD1 . TYR F 2 32 ? -48.842 -14.443 17.253  1.00 91.07  ? 311 TYR F CD1 1 
ATOM   2405 C  CD2 . TYR F 2 32 ? -48.442 -12.109 16.982  1.00 92.32  ? 311 TYR F CD2 1 
ATOM   2406 C  CE1 . TYR F 2 32 ? -48.458 -14.671 15.942  1.00 91.80  ? 311 TYR F CE1 1 
ATOM   2407 C  CE2 . TYR F 2 32 ? -48.057 -12.328 15.663  1.00 93.90  ? 311 TYR F CE2 1 
ATOM   2408 C  CZ  . TYR F 2 32 ? -48.068 -13.613 15.153  1.00 93.48  ? 311 TYR F CZ  1 
ATOM   2409 O  OH  . TYR F 2 32 ? -47.690 -13.848 13.851  1.00 95.31  ? 311 TYR F OH  1 
ATOM   2410 N  N   . ARG F 2 33 ? -46.830 -11.309 20.524  1.00 84.77  ? 312 ARG F N   1 
ATOM   2411 C  CA  . ARG F 2 33 ? -45.519 -10.655 20.502  1.00 82.58  ? 312 ARG F CA  1 
ATOM   2412 C  C   . ARG F 2 33 ? -44.538 -11.395 21.399  1.00 81.41  ? 312 ARG F C   1 
ATOM   2413 O  O   . ARG F 2 33 ? -43.350 -11.482 21.078  1.00 83.61  ? 312 ARG F O   1 
ATOM   2414 C  CB  . ARG F 2 33 ? -45.555 -9.170  20.866  1.00 82.55  ? 312 ARG F CB  1 
ATOM   2415 C  CG  . ARG F 2 33 ? -46.420 -8.263  20.010  1.00 89.34  ? 312 ARG F CG  1 
ATOM   2416 C  CD  . ARG F 2 33 ? -46.129 -6.818  20.408  1.00 95.39  ? 312 ARG F CD  1 
ATOM   2417 N  NE  . ARG F 2 33 ? -44.693 -6.642  20.683  1.00 96.16  ? 312 ARG F NE  1 
ATOM   2418 C  CZ  . ARG F 2 33 ? -43.790 -6.211  19.803  1.00 99.62  ? 312 ARG F CZ  1 
ATOM   2419 N  NH1 . ARG F 2 33 ? -44.170 -5.901  18.568  1.00 106.12 ? 312 ARG F NH1 1 
ATOM   2420 N  NH2 . ARG F 2 33 ? -42.508 -6.085  20.158  1.00 95.30  ? 312 ARG F NH2 1 
ATOM   2421 N  N   . MET F 2 34 ? -44.984 -11.829 22.583  1.00 80.35  ? 313 MET F N   1 
ATOM   2422 C  CA  . MET F 2 34 ? -44.079 -12.530 23.488  1.00 77.25  ? 313 MET F CA  1 
ATOM   2423 C  C   . MET F 2 34 ? -43.383 -13.671 22.752  1.00 76.23  ? 313 MET F C   1 
ATOM   2424 O  O   . MET F 2 34 ? -42.197 -13.944 22.975  1.00 73.93  ? 313 MET F O   1 
ATOM   2425 C  CB  . MET F 2 34 ? -44.863 -13.040 24.698  1.00 77.20  ? 313 MET F CB  1 
ATOM   2426 C  CG  . MET F 2 34 ? -44.045 -13.666 25.793  1.00 73.05  ? 313 MET F CG  1 
ATOM   2427 S  SD  . MET F 2 34 ? -45.111 -14.056 27.198  1.00 71.22  ? 313 MET F SD  1 
ATOM   2428 C  CE  . MET F 2 34 ? -45.489 -12.403 27.776  1.00 70.95  ? 313 MET F CE  1 
ATOM   2429 N  N   . ARG F 2 35 ? -44.105 -14.328 21.842  1.00 81.49  ? 314 ARG F N   1 
ATOM   2430 C  CA  . ARG F 2 35 ? -43.512 -15.382 21.025  1.00 87.59  ? 314 ARG F CA  1 
ATOM   2431 C  C   . ARG F 2 35 ? -42.431 -14.829 20.110  1.00 89.26  ? 314 ARG F C   1 
ATOM   2432 O  O   . ARG F 2 35 ? -41.480 -15.539 19.763  1.00 88.62  ? 314 ARG F O   1 
ATOM   2433 C  CB  . ARG F 2 35 ? -44.596 -16.020 20.165  1.00 95.89  ? 314 ARG F CB  1 
ATOM   2434 C  CG  . ARG F 2 35 ? -45.614 -16.810 20.925  1.00 104.79 ? 314 ARG F CG  1 
ATOM   2435 C  CD  . ARG F 2 35 ? -46.473 -17.629 19.995  1.00 109.73 ? 314 ARG F CD  1 
ATOM   2436 N  NE  . ARG F 2 35 ? -47.183 -18.654 20.743  1.00 114.03 ? 314 ARG F NE  1 
ATOM   2437 C  CZ  . ARG F 2 35 ? -48.159 -19.398 20.242  1.00 123.80 ? 314 ARG F CZ  1 
ATOM   2438 N  NH1 . ARG F 2 35 ? -48.549 -19.223 18.989  1.00 129.20 ? 314 ARG F NH1 1 
ATOM   2439 N  NH2 . ARG F 2 35 ? -48.759 -20.301 21.003  1.00 126.88 ? 314 ARG F NH2 1 
ATOM   2440 N  N   . GLN F 2 36 ? -42.544 -13.558 19.737  1.00 85.13  ? 315 GLN F N   1 
ATOM   2441 C  CA  . GLN F 2 36 ? -41.569 -12.942 18.847  1.00 78.86  ? 315 GLN F CA  1 
ATOM   2442 C  C   . GLN F 2 36 ? -40.363 -12.454 19.628  1.00 74.69  ? 315 GLN F C   1 
ATOM   2443 O  O   . GLN F 2 36 ? -39.216 -12.716 19.253  1.00 77.85  ? 315 GLN F O   1 
ATOM   2444 C  CB  . GLN F 2 36 ? -42.225 -11.786 18.096  1.00 81.51  ? 315 GLN F CB  1 
ATOM   2445 C  CG  . GLN F 2 36 ? -43.450 -12.180 17.282  1.00 84.55  ? 315 GLN F CG  1 
ATOM   2446 C  CD  . GLN F 2 36 ? -44.161 -10.974 16.688  1.00 91.41  ? 315 GLN F CD  1 
ATOM   2447 O  OE1 . GLN F 2 36 ? -44.082 -9.871  17.227  1.00 92.99  ? 315 GLN F OE1 1 
ATOM   2448 N  NE2 . GLN F 2 36 ? -44.817 -11.177 15.549  1.00 95.05  ? 315 GLN F NE2 1 
ATOM   2449 N  N   . LEU F 2 37 ? -40.614 -11.738 20.723  1.00 70.82  ? 316 LEU F N   1 
ATOM   2450 C  CA  . LEU F 2 37 ? -39.525 -11.245 21.551  1.00 63.09  ? 316 LEU F CA  1 
ATOM   2451 C  C   . LEU F 2 37 ? -38.811 -12.378 22.263  1.00 59.34  ? 316 LEU F C   1 
ATOM   2452 O  O   . LEU F 2 37 ? -37.625 -12.257 22.576  1.00 64.58  ? 316 LEU F O   1 
ATOM   2453 C  CB  . LEU F 2 37 ? -40.052 -10.250 22.579  1.00 59.06  ? 316 LEU F CB  1 
ATOM   2454 C  CG  . LEU F 2 37 ? -40.683 -8.943  22.107  1.00 62.25  ? 316 LEU F CG  1 
ATOM   2455 C  CD1 . LEU F 2 37 ? -41.298 -8.213  23.303  1.00 65.15  ? 316 LEU F CD1 1 
ATOM   2456 C  CD2 . LEU F 2 37 ? -39.667 -8.070  21.396  1.00 64.59  ? 316 LEU F CD2 1 
ATOM   2457 N  N   . GLY F 2 38 ? -39.486 -13.492 22.495  1.00 58.02  ? 317 GLY F N   1 
ATOM   2458 C  CA  . GLY F 2 38 ? -38.918 -14.518 23.339  1.00 63.59  ? 317 GLY F CA  1 
ATOM   2459 C  C   . GLY F 2 38 ? -39.467 -14.431 24.754  1.00 67.93  ? 317 GLY F C   1 
ATOM   2460 O  O   . GLY F 2 38 ? -40.152 -13.480 25.143  1.00 69.58  ? 317 GLY F O   1 
ATOM   2461 N  N   . TYR F 2 39 ? -39.089 -15.415 25.553  1.00 68.02  ? 318 TYR F N   1 
ATOM   2462 C  CA  . TYR F 2 39 ? -39.601 -15.505 26.910  1.00 69.29  ? 318 TYR F CA  1 
ATOM   2463 C  C   . TYR F 2 39 ? -39.063 -14.338 27.726  1.00 77.35  ? 318 TYR F C   1 
ATOM   2464 O  O   . TYR F 2 39 ? -37.890 -13.981 27.592  1.00 81.75  ? 318 TYR F O   1 
ATOM   2465 C  CB  . TYR F 2 39 ? -39.159 -16.818 27.556  1.00 65.59  ? 318 TYR F CB  1 
ATOM   2466 C  CG  . TYR F 2 39 ? -39.885 -17.239 28.827  1.00 69.00  ? 318 TYR F CG  1 
ATOM   2467 C  CD1 . TYR F 2 39 ? -40.975 -18.101 28.790  1.00 70.37  ? 318 TYR F CD1 1 
ATOM   2468 C  CD2 . TYR F 2 39 ? -39.445 -16.799 30.075  1.00 68.00  ? 318 TYR F CD2 1 
ATOM   2469 C  CE1 . TYR F 2 39 ? -41.626 -18.491 29.950  1.00 67.26  ? 318 TYR F CE1 1 
ATOM   2470 C  CE2 . TYR F 2 39 ? -40.089 -17.191 31.237  1.00 67.89  ? 318 TYR F CE2 1 
ATOM   2471 C  CZ  . TYR F 2 39 ? -41.176 -18.038 31.168  1.00 68.77  ? 318 TYR F CZ  1 
ATOM   2472 O  OH  . TYR F 2 39 ? -41.809 -18.422 32.329  1.00 73.03  ? 318 TYR F OH  1 
ATOM   2473 N  N   . PRO F 2 40 ? -39.912 -13.686 28.517  1.00 79.59  ? 319 PRO F N   1 
ATOM   2474 C  CA  . PRO F 2 40 ? -39.457 -12.556 29.318  1.00 79.66  ? 319 PRO F CA  1 
ATOM   2475 C  C   . PRO F 2 40 ? -38.248 -12.963 30.129  1.00 79.88  ? 319 PRO F C   1 
ATOM   2476 O  O   . PRO F 2 40 ? -38.310 -13.908 30.928  1.00 82.19  ? 319 PRO F O   1 
ATOM   2477 C  CB  . PRO F 2 40 ? -40.656 -12.234 30.225  1.00 75.85  ? 319 PRO F CB  1 
ATOM   2478 C  CG  . PRO F 2 40 ? -41.629 -13.327 30.042  1.00 75.60  ? 319 PRO F CG  1 
ATOM   2479 C  CD  . PRO F 2 40 ? -41.288 -14.108 28.833  1.00 75.72  ? 319 PRO F CD  1 
ATOM   2480 N  N   . PRO F 2 41 ? -37.116 -12.289 29.920  1.00 71.00  ? 320 PRO F N   1 
ATOM   2481 C  CA  . PRO F 2 41 ? -35.876 -12.765 30.541  1.00 63.78  ? 320 PRO F CA  1 
ATOM   2482 C  C   . PRO F 2 41 ? -35.917 -12.761 32.054  1.00 59.23  ? 320 PRO F C   1 
ATOM   2483 O  O   . PRO F 2 41 ? -35.374 -13.684 32.678  1.00 57.64  ? 320 PRO F O   1 
ATOM   2484 C  CB  . PRO F 2 41 ? -34.832 -11.785 30.002  1.00 65.61  ? 320 PRO F CB  1 
ATOM   2485 C  CG  . PRO F 2 41 ? -35.628 -10.565 29.575  1.00 66.09  ? 320 PRO F CG  1 
ATOM   2486 C  CD  . PRO F 2 41 ? -36.881 -11.136 29.033  1.00 67.54  ? 320 PRO F CD  1 
ATOM   2487 N  N   . GLY F 2 42 ? -36.617 -11.807 32.662  1.00 59.36  ? 321 GLY F N   1 
ATOM   2488 C  CA  . GLY F 2 42 ? -36.625 -11.709 34.112  1.00 59.11  ? 321 GLY F CA  1 
ATOM   2489 C  C   . GLY F 2 42 ? -37.329 -12.842 34.825  1.00 59.99  ? 321 GLY F C   1 
ATOM   2490 O  O   . GLY F 2 42 ? -37.161 -12.985 36.039  1.00 63.70  ? 321 GLY F O   1 
ATOM   2491 N  N   . TRP F 2 43 ? -38.059 -13.672 34.101  1.00 60.92  ? 322 TRP F N   1 
ATOM   2492 C  CA  . TRP F 2 43 ? -38.683 -14.836 34.708  1.00 65.17  ? 322 TRP F CA  1 
ATOM   2493 C  C   . TRP F 2 43 ? -37.775 -16.052 34.715  1.00 69.22  ? 322 TRP F C   1 
ATOM   2494 O  O   . TRP F 2 43 ? -37.972 -16.947 35.540  1.00 69.78  ? 322 TRP F O   1 
ATOM   2495 C  CB  . TRP F 2 43 ? -39.982 -15.139 33.976  1.00 67.64  ? 322 TRP F CB  1 
ATOM   2496 C  CG  . TRP F 2 43 ? -41.072 -14.200 34.349  1.00 70.31  ? 322 TRP F CG  1 
ATOM   2497 C  CD1 . TRP F 2 43 ? -41.589 -13.200 33.579  1.00 71.94  ? 322 TRP F CD1 1 
ATOM   2498 C  CD2 . TRP F 2 43 ? -41.818 -14.191 35.576  1.00 67.58  ? 322 TRP F CD2 1 
ATOM   2499 N  NE1 . TRP F 2 43 ? -42.593 -12.554 34.258  1.00 71.72  ? 322 TRP F NE1 1 
ATOM   2500 C  CE2 . TRP F 2 43 ? -42.754 -13.143 35.484  1.00 68.76  ? 322 TRP F CE2 1 
ATOM   2501 C  CE3 . TRP F 2 43 ? -41.777 -14.960 36.746  1.00 61.85  ? 322 TRP F CE3 1 
ATOM   2502 C  CZ2 . TRP F 2 43 ? -43.640 -12.844 36.512  1.00 66.70  ? 322 TRP F CZ2 1 
ATOM   2503 C  CZ3 . TRP F 2 43 ? -42.657 -14.660 37.764  1.00 61.36  ? 322 TRP F CZ3 1 
ATOM   2504 C  CH2 . TRP F 2 43 ? -43.577 -13.613 37.641  1.00 64.31  ? 322 TRP F CH2 1 
ATOM   2505 N  N   . LEU F 2 44 ? -36.822 -16.133 33.788  1.00 74.82  ? 323 LEU F N   1 
ATOM   2506 C  CA  . LEU F 2 44 ? -35.820 -17.190 33.870  1.00 75.51  ? 323 LEU F CA  1 
ATOM   2507 C  C   . LEU F 2 44 ? -34.970 -17.045 35.129  1.00 77.82  ? 323 LEU F C   1 
ATOM   2508 O  O   . LEU F 2 44 ? -34.609 -18.045 35.763  1.00 78.40  ? 323 LEU F O   1 
ATOM   2509 C  CB  . LEU F 2 44 ? -34.969 -17.184 32.604  1.00 71.36  ? 323 LEU F CB  1 
ATOM   2510 C  CG  . LEU F 2 44 ? -35.880 -17.580 31.442  1.00 71.72  ? 323 LEU F CG  1 
ATOM   2511 C  CD1 . LEU F 2 44 ? -35.163 -17.556 30.108  1.00 79.18  ? 323 LEU F CD1 1 
ATOM   2512 C  CD2 . LEU F 2 44 ? -36.452 -18.959 31.708  1.00 65.25  ? 323 LEU F CD2 1 
ATOM   2513 N  N   . LYS F 2 45 ? -34.657 -15.810 35.520  1.00 79.07  ? 324 LYS F N   1 
ATOM   2514 C  CA  . LYS F 2 45 ? -33.882 -15.563 36.738  1.00 83.45  ? 324 LYS F CA  1 
ATOM   2515 C  C   . LYS F 2 45 ? -34.752 -15.696 37.984  1.00 90.39  ? 324 LYS F C   1 
ATOM   2516 O  O   . LYS F 2 45 ? -34.871 -14.763 38.786  1.00 94.28  ? 324 LYS F O   1 
ATOM   2517 C  CB  . LYS F 2 45 ? -33.245 -14.174 36.709  1.00 86.61  ? 324 LYS F CB  1 
ATOM   2518 C  CG  . LYS F 2 45 ? -32.485 -13.867 35.430  1.00 90.88  ? 324 LYS F CG  1 
ATOM   2519 C  CD  . LYS F 2 45 ? -31.013 -14.214 35.561  1.00 91.38  ? 324 LYS F CD  1 
ATOM   2520 C  CE  . LYS F 2 45 ? -30.316 -14.090 34.229  1.00 91.37  ? 324 LYS F CE  1 
ATOM   2521 N  NZ  . LYS F 2 45 ? -30.910 -13.002 33.403  1.00 92.69  ? 324 LYS F NZ  1 
ATOM   2522 N  N   . GLU G 1 11 ? -45.862 -2.894  -8.795  1.00 149.37 ? 7   GLU G N   1 
ATOM   2523 C  CA  . GLU G 1 11 ? -45.152 -4.098  -9.212  1.00 148.85 ? 7   GLU G CA  1 
ATOM   2524 C  C   . GLU G 1 11 ? -45.098 -4.201  -10.734 1.00 148.74 ? 7   GLU G C   1 
ATOM   2525 O  O   . GLU G 1 11 ? -44.057 -4.534  -11.309 1.00 147.53 ? 7   GLU G O   1 
ATOM   2526 C  CB  . GLU G 1 11 ? -45.811 -5.343  -8.621  1.00 154.06 ? 7   GLU G CB  1 
ATOM   2527 N  N   . ALA G 1 12 ? -46.229 -3.917  -11.389 1.00 153.74 ? 8   ALA G N   1 
ATOM   2528 C  CA  . ALA G 1 12 ? -46.241 -3.934  -12.848 1.00 154.41 ? 8   ALA G CA  1 
ATOM   2529 C  C   . ALA G 1 12 ? -45.376 -2.818  -13.423 1.00 148.84 ? 8   ALA G C   1 
ATOM   2530 O  O   . ALA G 1 12 ? -44.746 -2.996  -14.473 1.00 145.97 ? 8   ALA G O   1 
ATOM   2531 C  CB  . ALA G 1 12 ? -47.677 -3.811  -13.365 1.00 159.87 ? 8   ALA G CB  1 
ATOM   2532 N  N   . ASP G 1 13 ? -45.321 -1.668  -12.744 1.00 144.13 ? 9   ASP G N   1 
ATOM   2533 C  CA  . ASP G 1 13 ? -44.501 -0.567  -13.236 1.00 134.76 ? 9   ASP G CA  1 
ATOM   2534 C  C   . ASP G 1 13 ? -43.018 -0.907  -13.155 1.00 128.05 ? 9   ASP G C   1 
ATOM   2535 O  O   . ASP G 1 13 ? -42.256 -0.614  -14.082 1.00 124.45 ? 9   ASP G O   1 
ATOM   2536 C  CB  . ASP G 1 13 ? -44.804 0.710   -12.451 1.00 134.46 ? 9   ASP G CB  1 
ATOM   2537 N  N   . ARG G 1 14 ? -42.584 -1.508  -12.048 1.00 127.47 ? 10  ARG G N   1 
ATOM   2538 C  CA  . ARG G 1 14 ? -41.176 -1.850  -11.865 1.00 121.69 ? 10  ARG G CA  1 
ATOM   2539 C  C   . ARG G 1 14 ? -40.867 -3.263  -12.325 1.00 120.01 ? 10  ARG G C   1 
ATOM   2540 O  O   . ARG G 1 14 ? -40.092 -3.971  -11.674 1.00 121.10 ? 10  ARG G O   1 
ATOM   2541 C  CB  . ARG G 1 14 ? -40.788 -1.661  -10.403 1.00 124.01 ? 10  ARG G CB  1 
ATOM   2542 N  N   . THR G 1 15 ? -41.425 -3.700  -13.449 1.00 118.64 ? 11  THR G N   1 
ATOM   2543 C  CA  . THR G 1 15 ? -41.181 -5.044  -13.949 1.00 118.74 ? 11  THR G CA  1 
ATOM   2544 C  C   . THR G 1 15 ? -40.912 -4.995  -15.443 1.00 119.29 ? 11  THR G C   1 
ATOM   2545 O  O   . THR G 1 15 ? -41.638 -4.335  -16.193 1.00 120.22 ? 11  THR G O   1 
ATOM   2546 C  CB  . THR G 1 15 ? -42.367 -5.974  -13.667 1.00 121.90 ? 11  THR G CB  1 
ATOM   2547 N  N   . LEU G 1 16 ? -39.883 -5.718  -15.865 1.00 117.20 ? 12  LEU G N   1 
ATOM   2548 C  CA  . LEU G 1 16 ? -39.525 -5.867  -17.264 1.00 115.39 ? 12  LEU G CA  1 
ATOM   2549 C  C   . LEU G 1 16 ? -39.509 -7.352  -17.593 1.00 116.62 ? 12  LEU G C   1 
ATOM   2550 O  O   . LEU G 1 16 ? -39.018 -8.165  -16.804 1.00 118.12 ? 12  LEU G O   1 
ATOM   2551 C  CB  . LEU G 1 16 ? -38.162 -5.236  -17.566 1.00 110.35 ? 12  LEU G CB  1 
ATOM   2552 N  N   . PHE G 1 17 ? -40.036 -7.705  -18.758 1.00 117.16 ? 13  PHE G N   1 
ATOM   2553 C  CA  . PHE G 1 17 ? -40.037 -9.087  -19.213 1.00 120.12 ? 13  PHE G CA  1 
ATOM   2554 C  C   . PHE G 1 17 ? -38.898 -9.288  -20.203 1.00 115.14 ? 13  PHE G C   1 
ATOM   2555 O  O   . PHE G 1 17 ? -38.831 -8.598  -21.225 1.00 110.35 ? 13  PHE G O   1 
ATOM   2556 C  CB  . PHE G 1 17 ? -41.377 -9.448  -19.854 1.00 126.13 ? 13  PHE G CB  1 
ATOM   2557 N  N   . VAL G 1 18 ? -38.011 -10.232 -19.901 1.00 118.49 ? 14  VAL G N   1 
ATOM   2558 C  CA  . VAL G 1 18 ? -36.881 -10.559 -20.761 1.00 120.98 ? 14  VAL G CA  1 
ATOM   2559 C  C   . VAL G 1 18 ? -37.135 -11.954 -21.310 1.00 129.61 ? 14  VAL G C   1 
ATOM   2560 O  O   . VAL G 1 18 ? -37.222 -12.923 -20.546 1.00 136.11 ? 14  VAL G O   1 
ATOM   2561 C  CB  . VAL G 1 18 ? -35.547 -10.489 -20.002 1.00 120.16 ? 14  VAL G CB  1 
ATOM   2562 N  N   . GLY G 1 19 ? -37.241 -12.054 -22.638 1.00 128.51 ? 15  GLY G N   1 
ATOM   2563 C  CA  . GLY G 1 19 ? -37.525 -13.303 -23.304 1.00 134.47 ? 15  GLY G CA  1 
ATOM   2564 C  C   . GLY G 1 19 ? -36.406 -13.728 -24.243 1.00 130.83 ? 15  GLY G C   1 
ATOM   2565 O  O   . GLY G 1 19 ? -35.436 -12.997 -24.478 1.00 126.05 ? 15  GLY G O   1 
ATOM   2566 N  N   . ASN G 1 20 ? -36.558 -14.946 -24.770 1.00 136.12 ? 16  ASN G N   1 
ATOM   2567 C  CA  . ASN G 1 20 ? -35.643 -15.570 -25.723 1.00 138.09 ? 16  ASN G CA  1 
ATOM   2568 C  C   . ASN G 1 20 ? -34.319 -15.963 -25.079 1.00 136.02 ? 16  ASN G C   1 
ATOM   2569 O  O   . ASN G 1 20 ? -33.307 -16.112 -25.772 1.00 137.23 ? 16  ASN G O   1 
ATOM   2570 C  CB  . ASN G 1 20 ? -35.402 -14.658 -26.936 1.00 136.84 ? 16  ASN G CB  1 
ATOM   2571 C  CG  . ASN G 1 20 ? -34.925 -15.419 -28.160 1.00 141.77 ? 16  ASN G CG  1 
ATOM   2572 O  OD1 . ASN G 1 20 ? -34.987 -16.648 -28.210 1.00 147.05 ? 16  ASN G OD1 1 
ATOM   2573 N  ND2 . ASN G 1 20 ? -34.443 -14.685 -29.158 1.00 140.03 ? 16  ASN G ND2 1 
ATOM   2574 N  N   . LEU G 1 21 ? -34.308 -16.131 -23.760 1.00 134.80 ? 17  LEU G N   1 
ATOM   2575 C  CA  . LEU G 1 21 ? -33.117 -16.598 -23.063 1.00 133.17 ? 17  LEU G CA  1 
ATOM   2576 C  C   . LEU G 1 21 ? -32.776 -18.025 -23.479 1.00 137.61 ? 17  LEU G C   1 
ATOM   2577 O  O   . LEU G 1 21 ? -33.662 -18.863 -23.673 1.00 143.24 ? 17  LEU G O   1 
ATOM   2578 C  CB  . LEU G 1 21 ? -33.322 -16.529 -21.552 1.00 132.63 ? 17  LEU G CB  1 
ATOM   2579 N  N   . GLU G 1 22 ? -31.483 -18.295 -23.621 1.00 135.55 ? 18  GLU G N   1 
ATOM   2580 C  CA  . GLU G 1 22 ? -31.040 -19.644 -23.918 1.00 141.01 ? 18  GLU G CA  1 
ATOM   2581 C  C   . GLU G 1 22 ? -31.348 -20.570 -22.741 1.00 146.63 ? 18  GLU G C   1 
ATOM   2582 O  O   . GLU G 1 22 ? -31.660 -20.131 -21.630 1.00 145.76 ? 18  GLU G O   1 
ATOM   2583 C  CB  . GLU G 1 22 ? -29.544 -19.659 -24.237 1.00 138.80 ? 18  GLU G CB  1 
ATOM   2584 N  N   . THR G 1 23 ? -31.255 -21.876 -22.998 1.00 153.90 ? 19  THR G N   1 
ATOM   2585 C  CA  . THR G 1 23 ? -31.552 -22.853 -21.958 1.00 160.08 ? 19  THR G CA  1 
ATOM   2586 C  C   . THR G 1 23 ? -30.561 -22.790 -20.803 1.00 158.28 ? 19  THR G C   1 
ATOM   2587 O  O   . THR G 1 23 ? -30.905 -23.187 -19.684 1.00 162.04 ? 19  THR G O   1 
ATOM   2588 C  CB  . THR G 1 23 ? -31.564 -24.269 -22.544 1.00 168.86 ? 19  THR G CB  1 
ATOM   2589 N  N   . LYS G 1 24 ? -29.344 -22.299 -21.044 1.00 153.04 ? 20  LYS G N   1 
ATOM   2590 C  CA  . LYS G 1 24 ? -28.325 -22.271 -20.002 1.00 151.29 ? 20  LYS G CA  1 
ATOM   2591 C  C   . LYS G 1 24 ? -28.441 -21.060 -19.085 1.00 144.18 ? 20  LYS G C   1 
ATOM   2592 O  O   . LYS G 1 24 ? -27.910 -21.094 -17.968 1.00 145.67 ? 20  LYS G O   1 
ATOM   2593 C  CB  . LYS G 1 24 ? -26.927 -22.298 -20.629 1.00 149.22 ? 20  LYS G CB  1 
ATOM   2594 N  N   . VAL G 1 25 ? -29.097 -19.987 -19.536 1.00 136.81 ? 21  VAL G N   1 
ATOM   2595 C  CA  . VAL G 1 25 ? -29.230 -18.790 -18.714 1.00 130.62 ? 21  VAL G CA  1 
ATOM   2596 C  C   . VAL G 1 25 ? -29.922 -19.141 -17.404 1.00 135.67 ? 21  VAL G C   1 
ATOM   2597 O  O   . VAL G 1 25 ? -30.923 -19.869 -17.382 1.00 142.01 ? 21  VAL G O   1 
ATOM   2598 C  CB  . VAL G 1 25 ? -30.005 -17.703 -19.478 1.00 124.27 ? 21  VAL G CB  1 
ATOM   2599 C  CG1 . VAL G 1 25 ? -30.176 -16.458 -18.620 1.00 118.83 ? 21  VAL G CG1 1 
ATOM   2600 C  CG2 . VAL G 1 25 ? -29.299 -17.362 -20.785 1.00 121.76 ? 21  VAL G CG2 1 
ATOM   2601 N  N   . THR G 1 26 ? -29.387 -18.627 -16.301 1.00 132.31 ? 22  THR G N   1 
ATOM   2602 C  CA  . THR G 1 26 ? -29.942 -18.874 -14.980 1.00 132.76 ? 22  THR G CA  1 
ATOM   2603 C  C   . THR G 1 26 ? -30.573 -17.600 -14.437 1.00 128.30 ? 22  THR G C   1 
ATOM   2604 O  O   . THR G 1 26 ? -30.312 -16.494 -14.920 1.00 120.36 ? 22  THR G O   1 
ATOM   2605 C  CB  . THR G 1 26 ? -28.873 -19.378 -14.002 1.00 132.49 ? 22  THR G CB  1 
ATOM   2606 O  OG1 . THR G 1 26 ? -27.946 -18.324 -13.714 1.00 125.42 ? 22  THR G OG1 1 
ATOM   2607 C  CG2 . THR G 1 26 ? -28.125 -20.567 -14.586 1.00 136.26 ? 22  THR G CG2 1 
ATOM   2608 N  N   . GLU G 1 27 ? -31.422 -17.769 -13.420 1.00 134.76 ? 23  GLU G N   1 
ATOM   2609 C  CA  . GLU G 1 27 ? -32.027 -16.607 -12.778 1.00 136.31 ? 23  GLU G CA  1 
ATOM   2610 C  C   . GLU G 1 27 ? -30.975 -15.762 -12.075 1.00 137.41 ? 23  GLU G C   1 
ATOM   2611 O  O   . GLU G 1 27 ? -31.109 -14.535 -12.008 1.00 134.55 ? 23  GLU G O   1 
ATOM   2612 C  CB  . GLU G 1 27 ? -33.105 -17.051 -11.789 1.00 142.41 ? 23  GLU G CB  1 
ATOM   2613 N  N   . GLU G 1 28 ? -29.926 -16.399 -11.550 1.00 143.28 ? 24  GLU G N   1 
ATOM   2614 C  CA  . GLU G 1 28 ? -28.838 -15.650 -10.933 1.00 139.90 ? 24  GLU G CA  1 
ATOM   2615 C  C   . GLU G 1 28 ? -28.018 -14.899 -11.973 1.00 130.91 ? 24  GLU G C   1 
ATOM   2616 O  O   . GLU G 1 28 ? -27.448 -13.844 -11.669 1.00 127.43 ? 24  GLU G O   1 
ATOM   2617 C  CB  . GLU G 1 28 ? -27.938 -16.592 -10.133 1.00 147.66 ? 24  GLU G CB  1 
ATOM   2618 N  N   . LEU G 1 29 ? -27.951 -15.418 -13.200 1.00 127.98 ? 25  LEU G N   1 
ATOM   2619 C  CA  . LEU G 1 29 ? -27.187 -14.747 -14.245 1.00 120.38 ? 25  LEU G CA  1 
ATOM   2620 C  C   . LEU G 1 29 ? -27.876 -13.461 -14.678 1.00 113.82 ? 25  LEU G C   1 
ATOM   2621 O  O   . LEU G 1 29 ? -27.247 -12.399 -14.747 1.00 109.87 ? 25  LEU G O   1 
ATOM   2622 C  CB  . LEU G 1 29 ? -27.000 -15.683 -15.436 1.00 119.02 ? 25  LEU G CB  1 
ATOM   2623 C  CG  . LEU G 1 29 ? -26.037 -15.194 -16.514 1.00 111.61 ? 25  LEU G CG  1 
ATOM   2624 C  CD1 . LEU G 1 29 ? -24.677 -14.949 -15.893 1.00 111.85 ? 25  LEU G CD1 1 
ATOM   2625 C  CD2 . LEU G 1 29 ? -25.942 -16.203 -17.646 1.00 113.15 ? 25  LEU G CD2 1 
ATOM   2626 N  N   . LEU G 1 30 ? -29.179 -13.541 -14.964 1.00 114.59 ? 26  LEU G N   1 
ATOM   2627 C  CA  . LEU G 1 30 ? -29.945 -12.351 -15.315 1.00 109.31 ? 26  LEU G CA  1 
ATOM   2628 C  C   . LEU G 1 30 ? -29.931 -11.328 -14.188 1.00 110.02 ? 26  LEU G C   1 
ATOM   2629 O  O   . LEU G 1 30 ? -30.033 -10.122 -14.441 1.00 107.07 ? 26  LEU G O   1 
ATOM   2630 C  CB  . LEU G 1 30 ? -31.382 -12.737 -15.669 1.00 107.39 ? 26  LEU G CB  1 
ATOM   2631 C  CG  . LEU G 1 30 ? -31.584 -13.481 -16.992 1.00 104.26 ? 26  LEU G CG  1 
ATOM   2632 C  CD1 . LEU G 1 30 ? -33.065 -13.682 -17.275 1.00 106.16 ? 26  LEU G CD1 1 
ATOM   2633 C  CD2 . LEU G 1 30 ? -30.910 -12.745 -18.139 1.00 98.68  ? 26  LEU G CD2 1 
ATOM   2634 N  N   . PHE G 1 31 ? -29.834 -11.790 -12.940 1.00 115.85 ? 27  PHE G N   1 
ATOM   2635 C  CA  . PHE G 1 31 ? -29.764 -10.870 -11.810 1.00 118.84 ? 27  PHE G CA  1 
ATOM   2636 C  C   . PHE G 1 31 ? -28.514 -9.999  -11.883 1.00 118.42 ? 27  PHE G C   1 
ATOM   2637 O  O   . PHE G 1 31 ? -28.597 -8.768  -11.804 1.00 114.91 ? 27  PHE G O   1 
ATOM   2638 C  CB  . PHE G 1 31 ? -29.798 -11.656 -10.500 1.00 126.95 ? 27  PHE G CB  1 
ATOM   2639 C  CG  . PHE G 1 31 ? -29.917 -10.790 -9.278  1.00 131.64 ? 27  PHE G CG  1 
ATOM   2640 C  CD1 . PHE G 1 31 ? -28.791 -10.242 -8.683  1.00 132.46 ? 27  PHE G CD1 1 
ATOM   2641 C  CD2 . PHE G 1 31 ? -31.158 -10.517 -8.727  1.00 135.33 ? 27  PHE G CD2 1 
ATOM   2642 C  CE1 . PHE G 1 31 ? -28.902 -9.444  -7.561  1.00 135.30 ? 27  PHE G CE1 1 
ATOM   2643 C  CE2 . PHE G 1 31 ? -31.274 -9.720  -7.606  1.00 138.43 ? 27  PHE G CE2 1 
ATOM   2644 C  CZ  . PHE G 1 31 ? -30.145 -9.183  -7.023  1.00 138.11 ? 27  PHE G CZ  1 
ATOM   2645 N  N   . GLU G 1 32 ? -27.340 -10.623 -12.035 1.00 120.78 ? 28  GLU G N   1 
ATOM   2646 C  CA  . GLU G 1 32 ? -26.101 -9.852  -12.111 1.00 115.27 ? 28  GLU G CA  1 
ATOM   2647 C  C   . GLU G 1 32 ? -26.056 -8.987  -13.366 1.00 103.04 ? 28  GLU G C   1 
ATOM   2648 O  O   . GLU G 1 32 ? -25.548 -7.859  -13.333 1.00 98.87  ? 28  GLU G O   1 
ATOM   2649 C  CB  . GLU G 1 32 ? -24.887 -10.779 -12.065 1.00 119.92 ? 28  GLU G CB  1 
ATOM   2650 C  CG  . GLU G 1 32 ? -23.582 -10.054 -12.361 1.00 119.77 ? 28  GLU G CG  1 
ATOM   2651 C  CD  . GLU G 1 32 ? -22.474 -10.988 -12.794 1.00 124.82 ? 28  GLU G CD  1 
ATOM   2652 O  OE1 . GLU G 1 32 ? -21.301 -10.559 -12.789 1.00 124.97 ? 28  GLU G OE1 1 
ATOM   2653 O  OE2 . GLU G 1 32 ? -22.775 -12.149 -13.144 1.00 128.62 ? 28  GLU G OE2 1 
ATOM   2654 N  N   . LEU G 1 33 ? -26.572 -9.502  -14.483 1.00 98.38  ? 29  LEU G N   1 
ATOM   2655 C  CA  . LEU G 1 33 ? -26.536 -8.750  -15.731 1.00 93.84  ? 29  LEU G CA  1 
ATOM   2656 C  C   . LEU G 1 33 ? -27.346 -7.468  -15.613 1.00 93.91  ? 29  LEU G C   1 
ATOM   2657 O  O   . LEU G 1 33 ? -26.814 -6.363  -15.773 1.00 93.54  ? 29  LEU G O   1 
ATOM   2658 C  CB  . LEU G 1 33 ? -27.057 -9.613  -16.878 1.00 91.45  ? 29  LEU G CB  1 
ATOM   2659 C  CG  . LEU G 1 33 ? -27.172 -8.862  -18.201 1.00 82.24  ? 29  LEU G CG  1 
ATOM   2660 C  CD1 . LEU G 1 33 ? -25.803 -8.363  -18.614 1.00 78.62  ? 29  LEU G CD1 1 
ATOM   2661 C  CD2 . LEU G 1 33 ? -27.765 -9.748  -19.280 1.00 82.21  ? 29  LEU G CD2 1 
ATOM   2662 N  N   . PHE G 1 34 ? -28.639 -7.597  -15.307 1.00 94.78  ? 30  PHE G N   1 
ATOM   2663 C  CA  . PHE G 1 34 ? -29.511 -6.438  -15.173 1.00 87.69  ? 30  PHE G CA  1 
ATOM   2664 C  C   . PHE G 1 34 ? -29.137 -5.555  -13.992 1.00 87.50  ? 30  PHE G C   1 
ATOM   2665 O  O   . PHE G 1 34 ? -29.648 -4.434  -13.894 1.00 86.31  ? 30  PHE G O   1 
ATOM   2666 C  CB  . PHE G 1 34 ? -30.969 -6.886  -15.050 1.00 84.66  ? 30  PHE G CB  1 
ATOM   2667 C  CG  . PHE G 1 34 ? -31.580 -7.342  -16.346 1.00 77.86  ? 30  PHE G CG  1 
ATOM   2668 C  CD1 . PHE G 1 34 ? -32.263 -6.448  -17.151 1.00 73.49  ? 30  PHE G CD1 1 
ATOM   2669 C  CD2 . PHE G 1 34 ? -31.482 -8.662  -16.756 1.00 78.19  ? 30  PHE G CD2 1 
ATOM   2670 C  CE1 . PHE G 1 34 ? -32.834 -6.858  -18.338 1.00 73.28  ? 30  PHE G CE1 1 
ATOM   2671 C  CE2 . PHE G 1 34 ? -32.050 -9.079  -17.949 1.00 77.65  ? 30  PHE G CE2 1 
ATOM   2672 C  CZ  . PHE G 1 34 ? -32.726 -8.176  -18.740 1.00 75.21  ? 30  PHE G CZ  1 
ATOM   2673 N  N   . HIS G 1 35 ? -28.277 -6.037  -13.092 1.00 89.55  ? 31  HIS G N   1 
ATOM   2674 C  CA  . HIS G 1 35 ? -27.749 -5.188  -12.030 1.00 92.92  ? 31  HIS G CA  1 
ATOM   2675 C  C   . HIS G 1 35 ? -26.950 -4.015  -12.589 1.00 90.05  ? 31  HIS G C   1 
ATOM   2676 O  O   . HIS G 1 35 ? -26.819 -2.987  -11.914 1.00 87.32  ? 31  HIS G O   1 
ATOM   2677 C  CB  . HIS G 1 35 ? -26.884 -6.018  -11.078 1.00 100.71 ? 31  HIS G CB  1 
ATOM   2678 C  CG  . HIS G 1 35 ? -27.082 -5.683  -9.632  1.00 108.49 ? 31  HIS G CG  1 
ATOM   2679 N  ND1 . HIS G 1 35 ? -28.307 -5.790  -9.008  1.00 112.33 ? 31  HIS G ND1 1 
ATOM   2680 C  CD2 . HIS G 1 35 ? -26.211 -5.267  -8.681  1.00 111.47 ? 31  HIS G CD2 1 
ATOM   2681 C  CE1 . HIS G 1 35 ? -28.186 -5.443  -7.739  1.00 116.49 ? 31  HIS G CE1 1 
ATOM   2682 N  NE2 . HIS G 1 35 ? -26.924 -5.122  -7.514  1.00 116.42 ? 31  HIS G NE2 1 
ATOM   2683 N  N   . GLN G 1 36 ? -26.411 -4.147  -13.805 1.00 90.05  ? 32  GLN G N   1 
ATOM   2684 C  CA  . GLN G 1 36 ? -25.716 -3.029  -14.432 1.00 88.83  ? 32  GLN G CA  1 
ATOM   2685 C  C   . GLN G 1 36 ? -26.663 -1.867  -14.680 1.00 92.67  ? 32  GLN G C   1 
ATOM   2686 O  O   . GLN G 1 36 ? -26.298 -0.705  -14.474 1.00 94.61  ? 32  GLN G O   1 
ATOM   2687 C  CB  . GLN G 1 36 ? -25.082 -3.470  -15.751 1.00 84.12  ? 32  GLN G CB  1 
ATOM   2688 C  CG  . GLN G 1 36 ? -24.007 -4.523  -15.627 1.00 84.08  ? 32  GLN G CG  1 
ATOM   2689 C  CD  . GLN G 1 36 ? -22.802 -4.000  -14.875 1.00 84.75  ? 32  GLN G CD  1 
ATOM   2690 O  OE1 . GLN G 1 36 ? -22.291 -2.917  -15.179 1.00 81.71  ? 32  GLN G OE1 1 
ATOM   2691 N  NE2 . GLN G 1 36 ? -22.335 -4.767  -13.894 1.00 88.60  ? 32  GLN G NE2 1 
ATOM   2692 N  N   . ALA G 1 37 ? -27.879 -2.163  -15.139 1.00 96.45  ? 33  ALA G N   1 
ATOM   2693 C  CA  . ALA G 1 37 ? -28.855 -1.111  -15.396 1.00 100.82 ? 33  ALA G CA  1 
ATOM   2694 C  C   . ALA G 1 37 ? -29.344 -0.459  -14.106 1.00 96.87  ? 33  ALA G C   1 
ATOM   2695 O  O   . ALA G 1 37 ? -29.573 0.756   -14.069 1.00 96.65  ? 33  ALA G O   1 
ATOM   2696 C  CB  . ALA G 1 37 ? -30.030 -1.680  -16.188 1.00 105.50 ? 33  ALA G CB  1 
ATOM   2697 N  N   . GLY G 1 38 ? -29.541 -1.247  -13.053 1.00 93.37  ? 34  GLY G N   1 
ATOM   2698 C  CA  . GLY G 1 38 ? -29.982 -0.724  -11.781 1.00 91.94  ? 34  GLY G CA  1 
ATOM   2699 C  C   . GLY G 1 38 ? -30.172 -1.818  -10.749 1.00 94.12  ? 34  GLY G C   1 
ATOM   2700 O  O   . GLY G 1 38 ? -30.165 -3.011  -11.071 1.00 96.51  ? 34  GLY G O   1 
ATOM   2701 N  N   . PRO G 1 39 ? -30.338 -1.429  -9.484  1.00 92.57  ? 35  PRO G N   1 
ATOM   2702 C  CA  . PRO G 1 39 ? -30.578 -2.419  -8.427  1.00 97.12  ? 35  PRO G CA  1 
ATOM   2703 C  C   . PRO G 1 39 ? -31.803 -3.276  -8.716  1.00 101.66 ? 35  PRO G C   1 
ATOM   2704 O  O   . PRO G 1 39 ? -32.875 -2.772  -9.062  1.00 105.12 ? 35  PRO G O   1 
ATOM   2705 C  CB  . PRO G 1 39 ? -30.766 -1.559  -7.172  1.00 99.64  ? 35  PRO G CB  1 
ATOM   2706 C  CG  . PRO G 1 39 ? -31.058 -0.191  -7.669  1.00 94.33  ? 35  PRO G CG  1 
ATOM   2707 C  CD  . PRO G 1 39 ? -30.325 -0.056  -8.954  1.00 90.43  ? 35  PRO G CD  1 
ATOM   2708 N  N   . VAL G 1 40 ? -31.628 -4.586  -8.566  1.00 100.31 ? 36  VAL G N   1 
ATOM   2709 C  CA  . VAL G 1 40 ? -32.648 -5.578  -8.882  1.00 102.95 ? 36  VAL G CA  1 
ATOM   2710 C  C   . VAL G 1 40 ? -33.091 -6.249  -7.590  1.00 112.58 ? 36  VAL G C   1 
ATOM   2711 O  O   . VAL G 1 40 ? -32.256 -6.638  -6.764  1.00 115.77 ? 36  VAL G O   1 
ATOM   2712 C  CB  . VAL G 1 40 ? -32.128 -6.606  -9.901  1.00 97.21  ? 36  VAL G CB  1 
ATOM   2713 C  CG1 . VAL G 1 40 ? -33.175 -7.680  -10.144 1.00 100.61 ? 36  VAL G CG1 1 
ATOM   2714 C  CG2 . VAL G 1 40 ? -31.754 -5.905  -11.207 1.00 91.54  ? 36  VAL G CG2 1 
ATOM   2715 N  N   . ILE G 1 41 ? -34.406 -6.359  -7.408  1.00 116.54 ? 37  ILE G N   1 
ATOM   2716 C  CA  . ILE G 1 41 ? -34.958 -6.969  -6.200  1.00 124.94 ? 37  ILE G CA  1 
ATOM   2717 C  C   . ILE G 1 41 ? -34.958 -8.490  -6.313  1.00 127.58 ? 37  ILE G C   1 
ATOM   2718 O  O   . ILE G 1 41 ? -34.412 -9.195  -5.457  1.00 130.58 ? 37  ILE G O   1 
ATOM   2719 C  CB  . ILE G 1 41 ? -36.371 -6.423  -5.923  1.00 127.60 ? 37  ILE G CB  1 
ATOM   2720 N  N   . LYS G 1 42 ? -35.590 -9.017  -7.360  1.00 125.63 ? 38  LYS G N   1 
ATOM   2721 C  CA  . LYS G 1 42 ? -35.665 -10.458 -7.559  1.00 127.02 ? 38  LYS G CA  1 
ATOM   2722 C  C   . LYS G 1 42 ? -35.872 -10.748 -9.039  1.00 123.02 ? 38  LYS G C   1 
ATOM   2723 O  O   . LYS G 1 42 ? -36.479 -9.952  -9.761  1.00 119.98 ? 38  LYS G O   1 
ATOM   2724 C  CB  . LYS G 1 42 ? -36.797 -11.081 -6.733  1.00 132.39 ? 38  LYS G CB  1 
ATOM   2725 N  N   . VAL G 1 43 ? -35.361 -11.900 -9.478  1.00 123.51 ? 39  VAL G N   1 
ATOM   2726 C  CA  . VAL G 1 43 ? -35.537 -12.394 -10.839 1.00 119.02 ? 39  VAL G CA  1 
ATOM   2727 C  C   . VAL G 1 43 ? -36.081 -13.811 -10.757 1.00 126.69 ? 39  VAL G C   1 
ATOM   2728 O  O   . VAL G 1 43 ? -35.507 -14.660 -10.067 1.00 132.16 ? 39  VAL G O   1 
ATOM   2729 C  CB  . VAL G 1 43 ? -34.218 -12.379 -11.639 1.00 108.86 ? 39  VAL G CB  1 
ATOM   2730 C  CG1 . VAL G 1 43 ? -34.413 -13.018 -13.008 1.00 107.51 ? 39  VAL G CG1 1 
ATOM   2731 C  CG2 . VAL G 1 43 ? -33.689 -10.962 -11.766 1.00 100.41 ? 39  VAL G CG2 1 
ATOM   2732 N  N   . LYS G 1 44 ? -37.176 -14.070 -11.467 1.00 126.46 ? 40  LYS G N   1 
ATOM   2733 C  CA  . LYS G 1 44 ? -37.833 -15.369 -11.428 1.00 131.89 ? 40  LYS G CA  1 
ATOM   2734 C  C   . LYS G 1 44 ? -38.082 -15.875 -12.839 1.00 128.41 ? 40  LYS G C   1 
ATOM   2735 O  O   . LYS G 1 44 ? -38.559 -15.126 -13.698 1.00 124.26 ? 40  LYS G O   1 
ATOM   2736 C  CB  . LYS G 1 44 ? -39.158 -15.292 -10.660 1.00 138.47 ? 40  LYS G CB  1 
ATOM   2737 N  N   . ILE G 1 45 ? -37.761 -17.144 -13.072 1.00 129.97 ? 41  ILE G N   1 
ATOM   2738 C  CA  . ILE G 1 45 ? -38.022 -17.783 -14.357 1.00 128.36 ? 41  ILE G CA  1 
ATOM   2739 C  C   . ILE G 1 45 ? -39.119 -18.813 -14.119 1.00 133.56 ? 41  ILE G C   1 
ATOM   2740 O  O   . ILE G 1 45 ? -38.848 -19.891 -13.572 1.00 136.65 ? 41  ILE G O   1 
ATOM   2741 C  CB  . ILE G 1 45 ? -36.754 -18.433 -14.936 1.00 127.17 ? 41  ILE G CB  1 
ATOM   2742 C  CG1 . ILE G 1 45 ? -35.561 -17.483 -14.810 1.00 119.82 ? 41  ILE G CG1 1 
ATOM   2743 C  CG2 . ILE G 1 45 ? -36.973 -18.834 -16.386 1.00 126.56 ? 41  ILE G CG2 1 
ATOM   2744 C  CD1 . ILE G 1 45 ? -34.252 -18.082 -15.276 1.00 118.36 ? 41  ILE G CD1 1 
ATOM   2745 N  N   . PRO G 1 46 ? -40.372 -18.529 -14.509 1.00 135.12 ? 42  PRO G N   1 
ATOM   2746 C  CA  . PRO G 1 46 ? -41.514 -19.427 -14.298 1.00 144.60 ? 42  PRO G CA  1 
ATOM   2747 C  C   . PRO G 1 46 ? -41.383 -20.746 -15.056 1.00 150.16 ? 42  PRO G C   1 
ATOM   2748 O  O   . PRO G 1 46 ? -40.889 -21.718 -14.486 1.00 154.97 ? 42  PRO G O   1 
ATOM   2749 C  CB  . PRO G 1 46 ? -42.701 -18.610 -14.815 1.00 135.80 ? 42  PRO G CB  1 
ATOM   2750 N  N   . GLN G 1 55 ? -38.179 -20.054 -21.378 1.00 171.91 ? 51  GLN G N   1 
ATOM   2751 C  CA  . GLN G 1 55 ? -37.295 -19.319 -22.276 1.00 166.87 ? 51  GLN G CA  1 
ATOM   2752 C  C   . GLN G 1 55 ? -37.393 -17.819 -22.019 1.00 158.65 ? 51  GLN G C   1 
ATOM   2753 O  O   . GLN G 1 55 ? -36.693 -17.020 -22.646 1.00 155.49 ? 51  GLN G O   1 
ATOM   2754 C  CB  . GLN G 1 55 ? -37.628 -19.631 -23.736 1.00 172.54 ? 51  GLN G CB  1 
ATOM   2755 N  N   . PHE G 1 56 ? -38.275 -17.446 -21.094 1.00 150.59 ? 52  PHE G N   1 
ATOM   2756 C  CA  . PHE G 1 56 ? -38.447 -16.060 -20.691 1.00 137.80 ? 52  PHE G CA  1 
ATOM   2757 C  C   . PHE G 1 56 ? -38.361 -15.973 -19.176 1.00 134.10 ? 52  PHE G C   1 
ATOM   2758 O  O   . PHE G 1 56 ? -38.498 -16.973 -18.469 1.00 140.46 ? 52  PHE G O   1 
ATOM   2759 C  CB  . PHE G 1 56 ? -39.786 -15.489 -21.177 1.00 137.19 ? 52  PHE G CB  1 
ATOM   2760 N  N   . ALA G 1 57 ? -38.119 -14.761 -18.682 1.00 126.71 ? 53  ALA G N   1 
ATOM   2761 C  CA  . ALA G 1 57 ? -38.037 -14.515 -17.251 1.00 123.50 ? 53  ALA G CA  1 
ATOM   2762 C  C   . ALA G 1 57 ? -38.622 -13.145 -16.943 1.00 119.70 ? 53  ALA G C   1 
ATOM   2763 O  O   . ALA G 1 57 ? -38.882 -12.338 -17.840 1.00 117.46 ? 53  ALA G O   1 
ATOM   2764 C  CB  . ALA G 1 57 ? -36.593 -14.615 -16.744 1.00 118.76 ? 53  ALA G CB  1 
ATOM   2765 N  N   . PHE G 1 58 ? -38.818 -12.881 -15.654 1.00 120.43 ? 54  PHE G N   1 
ATOM   2766 C  CA  . PHE G 1 58 ? -39.330 -11.605 -15.178 1.00 117.07 ? 54  PHE G CA  1 
ATOM   2767 C  C   . PHE G 1 58 ? -38.307 -10.988 -14.235 1.00 113.68 ? 54  PHE G C   1 
ATOM   2768 O  O   . PHE G 1 58 ? -37.758 -11.679 -13.370 1.00 115.01 ? 54  PHE G O   1 
ATOM   2769 C  CB  . PHE G 1 58 ? -40.677 -11.771 -14.461 1.00 123.11 ? 54  PHE G CB  1 
ATOM   2770 C  CG  . PHE G 1 58 ? -41.826 -12.065 -15.381 1.00 127.58 ? 54  PHE G CG  1 
ATOM   2771 C  CD1 . PHE G 1 58 ? -42.400 -11.058 -16.139 1.00 125.65 ? 54  PHE G CD1 1 
ATOM   2772 C  CD2 . PHE G 1 58 ? -42.346 -13.345 -15.477 1.00 134.37 ? 54  PHE G CD2 1 
ATOM   2773 C  CE1 . PHE G 1 58 ? -43.463 -11.323 -16.984 1.00 129.68 ? 54  PHE G CE1 1 
ATOM   2774 C  CE2 . PHE G 1 58 ? -43.412 -13.616 -16.320 1.00 138.64 ? 54  PHE G CE2 1 
ATOM   2775 C  CZ  . PHE G 1 58 ? -43.971 -12.602 -17.073 1.00 136.21 ? 54  PHE G CZ  1 
ATOM   2776 N  N   . VAL G 1 59 ? -38.048 -9.694  -14.411 1.00 109.95 ? 55  VAL G N   1 
ATOM   2777 C  CA  . VAL G 1 59 ? -37.085 -8.954  -13.605 1.00 107.82 ? 55  VAL G CA  1 
ATOM   2778 C  C   . VAL G 1 59 ? -37.829 -7.841  -12.879 1.00 112.00 ? 55  VAL G C   1 
ATOM   2779 O  O   . VAL G 1 59 ? -38.549 -7.055  -13.505 1.00 110.57 ? 55  VAL G O   1 
ATOM   2780 C  CB  . VAL G 1 59 ? -35.939 -8.384  -14.460 1.00 99.69  ? 55  VAL G CB  1 
ATOM   2781 C  CG1 . VAL G 1 59 ? -34.986 -7.572  -13.595 1.00 98.11  ? 55  VAL G CG1 1 
ATOM   2782 C  CG2 . VAL G 1 59 ? -35.200 -9.509  -15.172 1.00 97.70  ? 55  VAL G CG2 1 
ATOM   2783 N  N   . ASN G 1 60 ? -37.653 -7.778  -11.562 1.00 119.31 ? 56  ASN G N   1 
ATOM   2784 C  CA  . ASN G 1 60 ? -38.276 -6.760  -10.727 1.00 128.19 ? 56  ASN G CA  1 
ATOM   2785 C  C   . ASN G 1 60 ? -37.203 -5.782  -10.275 1.00 128.02 ? 56  ASN G C   1 
ATOM   2786 O  O   . ASN G 1 60 ? -36.252 -6.172  -9.589  1.00 129.36 ? 56  ASN G O   1 
ATOM   2787 C  CB  . ASN G 1 60 ? -38.974 -7.388  -9.521  1.00 137.61 ? 56  ASN G CB  1 
ATOM   2788 N  N   . PHE G 1 61 ? -37.351 -4.521  -10.663 1.00 127.78 ? 57  PHE G N   1 
ATOM   2789 C  CA  . PHE G 1 61 ? -36.414 -3.493  -10.246 1.00 128.42 ? 57  PHE G CA  1 
ATOM   2790 C  C   . PHE G 1 61 ? -36.911 -2.830  -8.968  1.00 134.72 ? 57  PHE G C   1 
ATOM   2791 O  O   . PHE G 1 61 ? -38.115 -2.763  -8.707  1.00 140.80 ? 57  PHE G O   1 
ATOM   2792 C  CB  . PHE G 1 61 ? -36.239 -2.446  -11.346 1.00 126.31 ? 57  PHE G CB  1 
ATOM   2793 C  CG  . PHE G 1 61 ? -35.447 -2.932  -12.520 1.00 123.68 ? 57  PHE G CG  1 
ATOM   2794 C  CD1 . PHE G 1 61 ? -34.068 -3.002  -12.459 1.00 122.51 ? 57  PHE G CD1 1 
ATOM   2795 C  CD2 . PHE G 1 61 ? -36.084 -3.311  -13.689 1.00 123.55 ? 57  PHE G CD2 1 
ATOM   2796 C  CE1 . PHE G 1 61 ? -33.334 -3.447  -13.543 1.00 120.84 ? 57  PHE G CE1 1 
ATOM   2797 C  CE2 . PHE G 1 61 ? -35.360 -3.756  -14.774 1.00 122.84 ? 57  PHE G CE2 1 
ATOM   2798 C  CZ  . PHE G 1 61 ? -33.981 -3.826  -14.701 1.00 121.00 ? 57  PHE G CZ  1 
ATOM   2799 N  N   . LYS G 1 62 ? -35.964 -2.332  -8.171  1.00 132.48 ? 58  LYS G N   1 
ATOM   2800 C  CA  . LYS G 1 62 ? -36.332 -1.639  -6.941  1.00 134.07 ? 58  LYS G CA  1 
ATOM   2801 C  C   . LYS G 1 62 ? -36.977 -0.294  -7.238  1.00 131.11 ? 58  LYS G C   1 
ATOM   2802 O  O   . LYS G 1 62 ? -37.840 0.163   -6.480  1.00 136.72 ? 58  LYS G O   1 
ATOM   2803 C  CB  . LYS G 1 62 ? -35.105 -1.457  -6.047  1.00 134.18 ? 58  LYS G CB  1 
ATOM   2804 N  N   . HIS G 1 63 ? -36.582 0.343   -8.337  1.00 123.85 ? 59  HIS G N   1 
ATOM   2805 C  CA  . HIS G 1 63 ? -37.107 1.640   -8.729  1.00 122.41 ? 59  HIS G CA  1 
ATOM   2806 C  C   . HIS G 1 63 ? -37.633 1.547   -10.152 1.00 116.98 ? 59  HIS G C   1 
ATOM   2807 O  O   . HIS G 1 63 ? -37.160 0.736   -10.953 1.00 111.06 ? 59  HIS G O   1 
ATOM   2808 C  CB  . HIS G 1 63 ? -36.027 2.727   -8.658  1.00 118.76 ? 59  HIS G CB  1 
ATOM   2809 C  CG  . HIS G 1 63 ? -35.362 2.838   -7.322  1.00 120.00 ? 59  HIS G CG  1 
ATOM   2810 N  ND1 . HIS G 1 63 ? -34.252 2.095   -6.980  1.00 117.80 ? 59  HIS G ND1 1 
ATOM   2811 C  CD2 . HIS G 1 63 ? -35.638 3.618   -6.251  1.00 125.20 ? 59  HIS G CD2 1 
ATOM   2812 C  CE1 . HIS G 1 63 ? -33.881 2.405   -5.752  1.00 121.45 ? 59  HIS G CE1 1 
ATOM   2813 N  NE2 . HIS G 1 63 ? -34.704 3.327   -5.288  1.00 126.20 ? 59  HIS G NE2 1 
ATOM   2814 N  N   . GLU G 1 64 ? -38.621 2.388   -10.460 1.00 120.71 ? 60  GLU G N   1 
ATOM   2815 C  CA  . GLU G 1 64 ? -39.201 2.374   -11.799 1.00 118.59 ? 60  GLU G CA  1 
ATOM   2816 C  C   . GLU G 1 64 ? -38.223 2.902   -12.840 1.00 115.47 ? 60  GLU G C   1 
ATOM   2817 O  O   . GLU G 1 64 ? -38.260 2.462   -13.994 1.00 115.25 ? 60  GLU G O   1 
ATOM   2818 C  CB  . GLU G 1 64 ? -40.494 3.188   -11.826 1.00 121.41 ? 60  GLU G CB  1 
ATOM   2819 N  N   . VAL G 1 65 ? -37.362 3.854   -12.461 1.00 113.57 ? 61  VAL G N   1 
ATOM   2820 C  CA  . VAL G 1 65 ? -36.472 4.504   -13.423 1.00 106.08 ? 61  VAL G CA  1 
ATOM   2821 C  C   . VAL G 1 65 ? -35.538 3.503   -14.089 1.00 101.35 ? 61  VAL G C   1 
ATOM   2822 O  O   . VAL G 1 65 ? -35.092 3.726   -15.220 1.00 100.61 ? 61  VAL G O   1 
ATOM   2823 C  CB  . VAL G 1 65 ? -35.674 5.642   -12.757 1.00 103.99 ? 61  VAL G CB  1 
ATOM   2824 C  CG1 . VAL G 1 65 ? -36.616 6.692   -12.198 1.00 109.83 ? 61  VAL G CG1 1 
ATOM   2825 C  CG2 . VAL G 1 65 ? -34.770 5.096   -11.664 1.00 103.31 ? 61  VAL G CG2 1 
ATOM   2826 N  N   . SER G 1 66 ? -35.197 2.407   -13.402 1.00 97.15  ? 62  SER G N   1 
ATOM   2827 C  CA  . SER G 1 66 ? -34.294 1.432   -14.005 1.00 89.45  ? 62  SER G CA  1 
ATOM   2828 C  C   . SER G 1 66 ? -34.948 0.677   -15.155 1.00 87.26  ? 62  SER G C   1 
ATOM   2829 O  O   . SER G 1 66 ? -34.245 0.204   -16.056 1.00 84.59  ? 62  SER G O   1 
ATOM   2830 C  CB  . SER G 1 66 ? -33.776 0.452   -12.951 1.00 89.67  ? 62  SER G CB  1 
ATOM   2831 O  OG  . SER G 1 66 ? -32.833 1.078   -12.100 1.00 90.15  ? 62  SER G OG  1 
ATOM   2832 N  N   . VAL G 1 67 ? -36.278 0.556   -15.151 1.00 87.47  ? 63  VAL G N   1 
ATOM   2833 C  CA  . VAL G 1 67 ? -36.956 -0.181  -16.220 1.00 83.75  ? 63  VAL G CA  1 
ATOM   2834 C  C   . VAL G 1 67 ? -36.678 0.430   -17.588 1.00 82.89  ? 63  VAL G C   1 
ATOM   2835 O  O   . VAL G 1 67 ? -36.241 -0.305  -18.489 1.00 81.45  ? 63  VAL G O   1 
ATOM   2836 C  CB  . VAL G 1 67 ? -38.459 -0.308  -15.912 1.00 83.73  ? 63  VAL G CB  1 
ATOM   2837 C  CG1 . VAL G 1 67 ? -39.141 -1.162  -16.965 1.00 80.21  ? 63  VAL G CG1 1 
ATOM   2838 C  CG2 . VAL G 1 67 ? -38.673 -0.902  -14.527 1.00 89.19  ? 63  VAL G CG2 1 
ATOM   2839 N  N   . PRO G 1 68 ? -36.885 1.736   -17.818 1.00 83.60  ? 64  PRO G N   1 
ATOM   2840 C  CA  . PRO G 1 68 ? -36.534 2.288   -19.138 1.00 80.98  ? 64  PRO G CA  1 
ATOM   2841 C  C   . PRO G 1 68 ? -35.049 2.202   -19.439 1.00 79.03  ? 64  PRO G C   1 
ATOM   2842 O  O   . PRO G 1 68 ? -34.664 1.918   -20.581 1.00 76.70  ? 64  PRO G O   1 
ATOM   2843 C  CB  . PRO G 1 68 ? -37.005 3.749   -19.046 1.00 81.41  ? 64  PRO G CB  1 
ATOM   2844 C  CG  . PRO G 1 68 ? -37.976 3.777   -17.924 1.00 86.33  ? 64  PRO G CG  1 
ATOM   2845 C  CD  . PRO G 1 68 ? -37.455 2.777   -16.946 1.00 85.57  ? 64  PRO G CD  1 
ATOM   2846 N  N   . TYR G 1 69 ? -34.202 2.445   -18.436 1.00 81.47  ? 65  TYR G N   1 
ATOM   2847 C  CA  . TYR G 1 69 ? -32.760 2.405   -18.654 1.00 80.15  ? 65  TYR G CA  1 
ATOM   2848 C  C   . TYR G 1 69 ? -32.302 1.002   -19.027 1.00 79.51  ? 65  TYR G C   1 
ATOM   2849 O  O   . TYR G 1 69 ? -31.463 0.834   -19.919 1.00 78.94  ? 65  TYR G O   1 
ATOM   2850 C  CB  . TYR G 1 69 ? -32.032 2.908   -17.410 1.00 84.64  ? 65  TYR G CB  1 
ATOM   2851 C  CG  . TYR G 1 69 ? -30.567 3.189   -17.646 1.00 87.01  ? 65  TYR G CG  1 
ATOM   2852 C  CD1 . TYR G 1 69 ? -29.595 2.228   -17.393 1.00 86.97  ? 65  TYR G CD1 1 
ATOM   2853 C  CD2 . TYR G 1 69 ? -30.155 4.432   -18.105 1.00 87.79  ? 65  TYR G CD2 1 
ATOM   2854 C  CE1 . TYR G 1 69 ? -28.259 2.496   -17.607 1.00 88.31  ? 65  TYR G CE1 1 
ATOM   2855 C  CE2 . TYR G 1 69 ? -28.821 4.709   -18.320 1.00 88.73  ? 65  TYR G CE2 1 
ATOM   2856 C  CZ  . TYR G 1 69 ? -27.879 3.737   -18.070 1.00 89.07  ? 65  TYR G CZ  1 
ATOM   2857 O  OH  . TYR G 1 69 ? -26.549 4.012   -18.282 1.00 89.91  ? 65  TYR G OH  1 
ATOM   2858 N  N   . ALA G 1 70 ? -32.843 -0.017  -18.352 1.00 80.21  ? 66  ALA G N   1 
ATOM   2859 C  CA  . ALA G 1 70 ? -32.528 -1.396  -18.717 1.00 80.98  ? 66  ALA G CA  1 
ATOM   2860 C  C   . ALA G 1 70 ? -32.890 -1.667  -20.173 1.00 81.87  ? 66  ALA G C   1 
ATOM   2861 O  O   . ALA G 1 70 ? -32.188 -2.406  -20.874 1.00 83.09  ? 66  ALA G O   1 
ATOM   2862 C  CB  . ALA G 1 70 ? -33.253 -2.371  -17.789 1.00 84.57  ? 66  ALA G CB  1 
ATOM   2863 N  N   . MET G 1 71 ? -34.004 -1.097  -20.634 1.00 83.08  ? 67  MET G N   1 
ATOM   2864 C  CA  . MET G 1 71 ? -34.393 -1.240  -22.031 1.00 81.87  ? 67  MET G CA  1 
ATOM   2865 C  C   . MET G 1 71 ? -33.310 -0.692  -22.950 1.00 82.98  ? 67  MET G C   1 
ATOM   2866 O  O   . MET G 1 71 ? -32.903 -1.357  -23.909 1.00 84.92  ? 67  MET G O   1 
ATOM   2867 C  CB  . MET G 1 71 ? -35.728 -0.538  -22.274 1.00 79.52  ? 67  MET G CB  1 
ATOM   2868 C  CG  . MET G 1 71 ? -36.231 -0.618  -23.698 1.00 80.25  ? 67  MET G CG  1 
ATOM   2869 S  SD  . MET G 1 71 ? -36.876 -2.253  -24.104 1.00 86.38  ? 67  MET G SD  1 
ATOM   2870 C  CE  . MET G 1 71 ? -38.181 -2.420  -22.884 1.00 92.49  ? 67  MET G CE  1 
ATOM   2871 N  N   . ASN G 1 72 ? -32.829 0.525   -22.674 1.00 83.99  ? 68  ASN G N   1 
ATOM   2872 C  CA  . ASN G 1 72 ? -31.837 1.148   -23.551 1.00 86.14  ? 68  ASN G CA  1 
ATOM   2873 C  C   . ASN G 1 72 ? -30.491 0.433   -23.511 1.00 86.32  ? 68  ASN G C   1 
ATOM   2874 O  O   . ASN G 1 72 ? -29.789 0.376   -24.528 1.00 89.44  ? 68  ASN G O   1 
ATOM   2875 C  CB  . ASN G 1 72 ? -31.648 2.620   -23.183 1.00 88.32  ? 68  ASN G CB  1 
ATOM   2876 C  CG  . ASN G 1 72 ? -32.901 3.441   -23.398 1.00 95.83  ? 68  ASN G CG  1 
ATOM   2877 O  OD1 . ASN G 1 72 ? -34.017 2.941   -23.259 1.00 104.37 ? 68  ASN G OD1 1 
ATOM   2878 N  ND2 . ASN G 1 72 ? -32.722 4.712   -23.743 1.00 96.13  ? 68  ASN G ND2 1 
ATOM   2879 N  N   . LEU G 1 73 ? -30.105 -0.101  -22.355 1.00 83.73  ? 69  LEU G N   1 
ATOM   2880 C  CA  . LEU G 1 73 ? -28.774 -0.668  -22.176 1.00 83.33  ? 69  LEU G CA  1 
ATOM   2881 C  C   . LEU G 1 73 ? -28.675 -2.132  -22.592 1.00 87.87  ? 69  LEU G C   1 
ATOM   2882 O  O   . LEU G 1 73 ? -27.742 -2.513  -23.307 1.00 92.70  ? 69  LEU G O   1 
ATOM   2883 C  CB  . LEU G 1 73 ? -28.347 -0.511  -20.712 1.00 81.61  ? 69  LEU G CB  1 
ATOM   2884 C  CG  . LEU G 1 73 ? -26.979 -1.069  -20.314 1.00 78.06  ? 69  LEU G CG  1 
ATOM   2885 C  CD1 . LEU G 1 73 ? -25.873 -0.382  -21.088 1.00 78.57  ? 69  LEU G CD1 1 
ATOM   2886 C  CD2 . LEU G 1 73 ? -26.755 -0.914  -18.819 1.00 76.50  ? 69  LEU G CD2 1 
ATOM   2887 N  N   . LEU G 1 74 ? -29.617 -2.966  -22.148 1.00 88.31  ? 70  LEU G N   1 
ATOM   2888 C  CA  . LEU G 1 74 ? -29.446 -4.409  -22.209 1.00 88.08  ? 70  LEU G CA  1 
ATOM   2889 C  C   . LEU G 1 74 ? -30.290 -5.111  -23.259 1.00 93.70  ? 70  LEU G C   1 
ATOM   2890 O  O   . LEU G 1 74 ? -30.026 -6.283  -23.543 1.00 99.18  ? 70  LEU G O   1 
ATOM   2891 C  CB  . LEU G 1 74 ? -29.752 -5.034  -20.840 1.00 85.07  ? 70  LEU G CB  1 
ATOM   2892 C  CG  . LEU G 1 74 ? -28.857 -4.521  -19.716 1.00 81.58  ? 70  LEU G CG  1 
ATOM   2893 C  CD1 . LEU G 1 74 ? -29.171 -5.251  -18.438 1.00 85.99  ? 70  LEU G CD1 1 
ATOM   2894 C  CD2 . LEU G 1 74 ? -27.400 -4.690  -20.079 1.00 78.49  ? 70  LEU G CD2 1 
ATOM   2895 N  N   . ASN G 1 75 ? -31.307 -4.459  -23.815 1.00 94.62  ? 71  ASN G N   1 
ATOM   2896 C  CA  . ASN G 1 75 ? -32.164 -5.138  -24.776 1.00 95.22  ? 71  ASN G CA  1 
ATOM   2897 C  C   . ASN G 1 75 ? -31.357 -5.550  -25.999 1.00 90.05  ? 71  ASN G C   1 
ATOM   2898 O  O   . ASN G 1 75 ? -30.587 -4.757  -26.546 1.00 84.99  ? 71  ASN G O   1 
ATOM   2899 C  CB  . ASN G 1 75 ? -33.324 -4.235  -25.188 1.00 99.30  ? 71  ASN G CB  1 
ATOM   2900 C  CG  . ASN G 1 75 ? -34.317 -4.935  -26.093 1.00 103.82 ? 71  ASN G CG  1 
ATOM   2901 O  OD1 . ASN G 1 75 ? -34.453 -6.160  -26.058 1.00 107.07 ? 71  ASN G OD1 1 
ATOM   2902 N  ND2 . ASN G 1 75 ? -35.006 -4.160  -26.926 1.00 103.38 ? 71  ASN G ND2 1 
ATOM   2903 N  N   . GLY G 1 76 ? -31.533 -6.801  -26.421 1.00 92.52  ? 72  GLY G N   1 
ATOM   2904 C  CA  . GLY G 1 76 ? -30.859 -7.318  -27.590 1.00 94.90  ? 72  GLY G CA  1 
ATOM   2905 C  C   . GLY G 1 76 ? -29.527 -7.987  -27.331 1.00 95.14  ? 72  GLY G C   1 
ATOM   2906 O  O   . GLY G 1 76 ? -28.959 -8.573  -28.261 1.00 100.19 ? 72  GLY G O   1 
ATOM   2907 N  N   . ILE G 1 77 ? -29.011 -7.926  -26.100 1.00 91.36  ? 73  ILE G N   1 
ATOM   2908 C  CA  . ILE G 1 77 ? -27.728 -8.549  -25.799 1.00 91.66  ? 73  ILE G CA  1 
ATOM   2909 C  C   . ILE G 1 77 ? -27.833 -10.056 -25.985 1.00 96.69  ? 73  ILE G C   1 
ATOM   2910 O  O   . ILE G 1 77 ? -28.840 -10.680 -25.625 1.00 103.95 ? 73  ILE G O   1 
ATOM   2911 C  CB  . ILE G 1 77 ? -27.299 -8.199  -24.364 1.00 90.42  ? 73  ILE G CB  1 
ATOM   2912 C  CG1 . ILE G 1 77 ? -27.001 -6.706  -24.228 1.00 88.37  ? 73  ILE G CG1 1 
ATOM   2913 C  CG2 . ILE G 1 77 ? -26.091 -9.010  -23.946 1.00 92.59  ? 73  ILE G CG2 1 
ATOM   2914 C  CD1 . ILE G 1 77 ? -25.958 -6.202  -25.188 1.00 90.81  ? 73  ILE G CD1 1 
ATOM   2915 N  N   . LYS G 1 78 ? -26.791 -10.649 -26.567 1.00 95.31  ? 74  LYS G N   1 
ATOM   2916 C  CA  . LYS G 1 78 ? -26.769 -12.080 -26.843 1.00 101.97 ? 74  LYS G CA  1 
ATOM   2917 C  C   . LYS G 1 78 ? -26.221 -12.802 -25.619 1.00 104.78 ? 74  LYS G C   1 
ATOM   2918 O  O   . LYS G 1 78 ? -25.071 -12.577 -25.225 1.00 106.41 ? 74  LYS G O   1 
ATOM   2919 C  CB  . LYS G 1 78 ? -25.918 -12.389 -28.074 1.00 104.17 ? 74  LYS G CB  1 
ATOM   2920 N  N   . LEU G 1 79 ? -27.034 -13.678 -25.034 1.00 106.95 ? 75  LEU G N   1 
ATOM   2921 C  CA  . LEU G 1 79 ? -26.635 -14.509 -23.904 1.00 109.04 ? 75  LEU G CA  1 
ATOM   2922 C  C   . LEU G 1 79 ? -26.499 -15.945 -24.384 1.00 114.05 ? 75  LEU G C   1 
ATOM   2923 O  O   . LEU G 1 79 ? -27.474 -16.535 -24.862 1.00 116.57 ? 75  LEU G O   1 
ATOM   2924 C  CB  . LEU G 1 79 ? -27.644 -14.410 -22.760 1.00 106.85 ? 75  LEU G CB  1 
ATOM   2925 C  CG  . LEU G 1 79 ? -27.475 -13.163 -21.895 1.00 99.17  ? 75  LEU G CG  1 
ATOM   2926 C  CD1 . LEU G 1 79 ? -28.419 -13.213 -20.710 1.00 100.51 ? 75  LEU G CD1 1 
ATOM   2927 C  CD2 . LEU G 1 79 ? -26.026 -13.017 -21.440 1.00 96.53  ? 75  LEU G CD2 1 
ATOM   2928 N  N   . TYR G 1 80 ? -25.296 -16.505 -24.242 1.00 116.23 ? 76  TYR G N   1 
ATOM   2929 C  CA  . TYR G 1 80 ? -24.972 -17.828 -24.775 1.00 123.59 ? 76  TYR G CA  1 
ATOM   2930 C  C   . TYR G 1 80 ? -25.258 -17.896 -26.272 1.00 129.38 ? 76  TYR G C   1 
ATOM   2931 O  O   . TYR G 1 80 ? -25.674 -18.936 -26.792 1.00 136.90 ? 76  TYR G O   1 
ATOM   2932 C  CB  . TYR G 1 80 ? -25.720 -18.939 -24.030 1.00 126.54 ? 76  TYR G CB  1 
ATOM   2933 N  N   . GLY G 1 81 ? -25.040 -16.778 -26.967 1.00 125.66 ? 77  GLY G N   1 
ATOM   2934 C  CA  . GLY G 1 81 ? -25.241 -16.678 -28.398 1.00 125.07 ? 77  GLY G CA  1 
ATOM   2935 C  C   . GLY G 1 81 ? -26.646 -16.345 -28.855 1.00 121.02 ? 77  GLY G C   1 
ATOM   2936 O  O   . GLY G 1 81 ? -26.859 -16.184 -30.062 1.00 121.54 ? 77  GLY G O   1 
ATOM   2937 N  N   . ARG G 1 82 ? -27.608 -16.222 -27.942 1.00 119.61 ? 78  ARG G N   1 
ATOM   2938 C  CA  . ARG G 1 82 ? -28.995 -15.946 -28.306 1.00 118.84 ? 78  ARG G CA  1 
ATOM   2939 C  C   . ARG G 1 82 ? -29.424 -14.593 -27.755 1.00 112.87 ? 78  ARG G C   1 
ATOM   2940 O  O   . ARG G 1 82 ? -29.410 -14.397 -26.527 1.00 108.88 ? 78  ARG G O   1 
ATOM   2941 C  CB  . ARG G 1 82 ? -29.922 -17.047 -27.794 1.00 121.63 ? 78  ARG G CB  1 
ATOM   2942 C  CG  . ARG G 1 82 ? -31.370 -16.881 -28.220 1.00 121.36 ? 78  ARG G CG  1 
ATOM   2943 C  CD  . ARG G 1 82 ? -32.158 -18.152 -27.962 1.00 127.18 ? 78  ARG G CD  1 
ATOM   2944 N  NE  . ARG G 1 82 ? -32.127 -19.061 -29.103 1.00 132.90 ? 78  ARG G NE  1 
ATOM   2945 C  CZ  . ARG G 1 82 ? -32.541 -20.323 -29.061 1.00 139.67 ? 78  ARG G CZ  1 
ATOM   2946 N  NH1 . ARG G 1 82 ? -33.010 -20.831 -27.929 1.00 141.64 ? 78  ARG G NH1 1 
ATOM   2947 N  NH2 . ARG G 1 82 ? -32.482 -21.081 -30.149 1.00 145.21 ? 78  ARG G NH2 1 
ATOM   2948 N  N   . PRO G 1 83 ? -29.815 -13.640 -28.601 1.00 110.99 ? 79  PRO G N   1 
ATOM   2949 C  CA  . PRO G 1 83 ? -30.130 -12.299 -28.098 1.00 104.54 ? 79  PRO G CA  1 
ATOM   2950 C  C   . PRO G 1 83 ? -31.412 -12.296 -27.282 1.00 103.40 ? 79  PRO G C   1 
ATOM   2951 O  O   . PRO G 1 83 ? -32.393 -12.955 -27.631 1.00 108.48 ? 79  PRO G O   1 
ATOM   2952 C  CB  . PRO G 1 83 ? -30.280 -11.468 -29.376 1.00 104.16 ? 79  PRO G CB  1 
ATOM   2953 C  CG  . PRO G 1 83 ? -30.691 -12.462 -30.413 1.00 110.26 ? 79  PRO G CG  1 
ATOM   2954 C  CD  . PRO G 1 83 ? -29.971 -13.736 -30.062 1.00 113.87 ? 79  PRO G CD  1 
ATOM   2955 N  N   . ILE G 1 84 ? -31.395 -11.534 -26.192 1.00 98.68  ? 80  ILE G N   1 
ATOM   2956 C  CA  . ILE G 1 84 ? -32.555 -11.429 -25.318 1.00 97.39  ? 80  ILE G CA  1 
ATOM   2957 C  C   . ILE G 1 84 ? -33.518 -10.394 -25.882 1.00 101.72 ? 80  ILE G C   1 
ATOM   2958 O  O   . ILE G 1 84 ? -33.111 -9.394  -26.486 1.00 102.68 ? 80  ILE G O   1 
ATOM   2959 C  CB  . ILE G 1 84 ? -32.129 -11.073 -23.881 1.00 86.13  ? 80  ILE G CB  1 
ATOM   2960 C  CG1 . ILE G 1 84 ? -31.466 -9.694  -23.850 1.00 75.32  ? 80  ILE G CG1 1 
ATOM   2961 C  CG2 . ILE G 1 84 ? -31.174 -12.124 -23.337 1.00 87.66  ? 80  ILE G CG2 1 
ATOM   2962 C  CD1 . ILE G 1 84 ? -30.987 -9.269  -22.479 1.00 72.61  ? 80  ILE G CD1 1 
ATOM   2963 N  N   . LYS G 1 85 ? -34.810 -10.639 -25.693 1.00 103.19 ? 81  LYS G N   1 
ATOM   2964 C  CA  . LYS G 1 85 ? -35.853 -9.692  -26.067 1.00 103.38 ? 81  LYS G CA  1 
ATOM   2965 C  C   . LYS G 1 85 ? -36.508 -9.173  -24.794 1.00 104.34 ? 81  LYS G C   1 
ATOM   2966 O  O   . LYS G 1 85 ? -37.118 -9.945  -24.047 1.00 109.71 ? 81  LYS G O   1 
ATOM   2967 C  CB  . LYS G 1 85 ? -36.888 -10.343 -26.984 1.00 107.81 ? 81  LYS G CB  1 
ATOM   2968 N  N   . ILE G 1 86 ? -36.371 -7.872  -24.546 1.00 101.13 ? 82  ILE G N   1 
ATOM   2969 C  CA  . ILE G 1 86 ? -36.911 -7.226  -23.355 1.00 102.10 ? 82  ILE G CA  1 
ATOM   2970 C  C   . ILE G 1 86 ? -38.116 -6.389  -23.752 1.00 106.96 ? 82  ILE G C   1 
ATOM   2971 O  O   . ILE G 1 86 ? -38.083 -5.673  -24.760 1.00 106.35 ? 82  ILE G O   1 
ATOM   2972 C  CB  . ILE G 1 86 ? -35.854 -6.357  -22.649 1.00 97.58  ? 82  ILE G CB  1 
ATOM   2973 C  CG1 . ILE G 1 86 ? -34.672 -7.218  -22.212 1.00 97.32  ? 82  ILE G CG1 1 
ATOM   2974 C  CG2 . ILE G 1 86 ? -36.458 -5.644  -21.447 1.00 98.03  ? 82  ILE G CG2 1 
ATOM   2975 C  CD1 . ILE G 1 86 ? -33.524 -6.416  -21.661 1.00 93.26  ? 82  ILE G CD1 1 
ATOM   2976 N  N   . GLN G 1 87 ? -39.180 -6.478  -22.955 1.00 113.64 ? 83  GLN G N   1 
ATOM   2977 C  CA  . GLN G 1 87 ? -40.404 -5.732  -23.199 1.00 118.91 ? 83  GLN G CA  1 
ATOM   2978 C  C   . GLN G 1 87 ? -40.957 -5.236  -21.873 1.00 124.10 ? 83  GLN G C   1 
ATOM   2979 O  O   . GLN G 1 87 ? -40.820 -5.893  -20.838 1.00 126.04 ? 83  GLN G O   1 
ATOM   2980 C  CB  . GLN G 1 87 ? -41.456 -6.585  -23.926 1.00 122.39 ? 83  GLN G CB  1 
ATOM   2981 N  N   . PHE G 1 88 ? -41.581 -4.062  -21.915 1.00 127.42 ? 84  PHE G N   1 
ATOM   2982 C  CA  . PHE G 1 88 ? -42.185 -3.471  -20.730 1.00 131.77 ? 84  PHE G CA  1 
ATOM   2983 C  C   . PHE G 1 88 ? -43.532 -4.118  -20.434 1.00 141.04 ? 84  PHE G C   1 
ATOM   2984 O  O   . PHE G 1 88 ? -44.333 -4.364  -21.339 1.00 146.26 ? 84  PHE G O   1 
ATOM   2985 C  CB  . PHE G 1 88 ? -42.358 -1.963  -20.911 1.00 130.98 ? 84  PHE G CB  1 
ATOM   2986 N  N   . ARG G 1 89 ? -43.777 -4.393  -19.155 1.00 145.46 ? 85  ARG G N   1 
ATOM   2987 C  CA  . ARG G 1 89 ? -45.046 -4.959  -18.730 1.00 153.88 ? 85  ARG G CA  1 
ATOM   2988 C  C   . ARG G 1 89 ? -46.099 -3.908  -18.420 1.00 157.20 ? 85  ARG G C   1 
ATOM   2989 O  O   . ARG G 1 89 ? -47.263 -4.266  -18.207 1.00 163.59 ? 85  ARG G O   1 
ATOM   2990 C  CB  . ARG G 1 89 ? -44.842 -5.845  -17.500 1.00 156.99 ? 85  ARG G CB  1 
ATOM   2991 C  CG  . ARG G 1 89 ? -44.261 -7.207  -17.815 1.00 157.58 ? 85  ARG G CG  1 
ATOM   2992 C  CD  . ARG G 1 89 ? -44.087 -8.012  -16.546 1.00 161.51 ? 85  ARG G CD  1 
ATOM   2993 N  NE  . ARG G 1 89 ? -45.318 -8.065  -15.761 1.00 169.64 ? 85  ARG G NE  1 
ATOM   2994 C  CZ  . ARG G 1 89 ? -46.330 -8.890  -16.008 1.00 176.39 ? 85  ARG G CZ  1 
ATOM   2995 N  NH1 . ARG G 1 89 ? -47.408 -8.866  -15.235 1.00 182.83 ? 85  ARG G NH1 1 
ATOM   2996 N  NH2 . ARG G 1 89 ? -46.271 -9.737  -17.029 1.00 176.86 ? 85  ARG G NH2 1 
ATOM   2997 N  N   . SER G 1 90 ? -45.731 -2.633  -18.396 1.00 154.45 ? 86  SER G N   1 
ATOM   2998 C  CA  . SER G 1 90 ? -46.687 -1.569  -18.124 1.00 159.76 ? 86  SER G CA  1 
ATOM   2999 C  C   . SER G 1 90 ? -46.222 -0.268  -18.761 1.00 156.71 ? 86  SER G C   1 
ATOM   3000 O  O   . SER G 1 90 ? -45.679 -0.272  -19.865 1.00 153.38 ? 86  SER G O   1 
ATOM   3001 C  CB  . SER G 1 90 ? -46.880 -1.387  -16.616 1.00 163.05 ? 86  SER G CB  1 
ATOM   3002 N  N   . ARG H 2 6  ? -23.937 -3.515  -4.078  1.00 122.91 ? 285 ARG H N   1 
ATOM   3003 C  CA  . ARG H 2 6  ? -22.769 -2.780  -4.556  1.00 121.66 ? 285 ARG H CA  1 
ATOM   3004 C  C   . ARG H 2 6  ? -22.731 -2.716  -6.088  1.00 123.16 ? 285 ARG H C   1 
ATOM   3005 O  O   . ARG H 2 6  ? -22.740 -3.750  -6.761  1.00 129.02 ? 285 ARG H O   1 
ATOM   3006 C  CB  . ARG H 2 6  ? -21.486 -3.419  -4.021  1.00 122.19 ? 285 ARG H CB  1 
ATOM   3007 N  N   . PHE H 2 7  ? -22.669 -1.494  -6.627  1.00 117.84 ? 286 PHE H N   1 
ATOM   3008 C  CA  . PHE H 2 7  ? -22.744 -1.227  -8.066  1.00 114.33 ? 286 PHE H CA  1 
ATOM   3009 C  C   . PHE H 2 7  ? -21.375 -0.840  -8.618  1.00 116.40 ? 286 PHE H C   1 
ATOM   3010 O  O   . PHE H 2 7  ? -20.894 0.270   -8.369  1.00 115.68 ? 286 PHE H O   1 
ATOM   3011 C  CB  . PHE H 2 7  ? -23.763 -0.137  -8.382  1.00 107.86 ? 286 PHE H CB  1 
ATOM   3012 C  CG  . PHE H 2 7  ? -23.694 0.359   -9.808  1.00 103.91 ? 286 PHE H CG  1 
ATOM   3013 C  CD1 . PHE H 2 7  ? -23.963 -0.493  -10.872 1.00 104.70 ? 286 PHE H CD1 1 
ATOM   3014 C  CD2 . PHE H 2 7  ? -23.379 1.685   -10.084 1.00 99.49  ? 286 PHE H CD2 1 
ATOM   3015 C  CE1 . PHE H 2 7  ? -23.903 -0.034  -12.186 1.00 101.81 ? 286 PHE H CE1 1 
ATOM   3016 C  CE2 . PHE H 2 7  ? -23.320 2.147   -11.397 1.00 96.21  ? 286 PHE H CE2 1 
ATOM   3017 C  CZ  . PHE H 2 7  ? -23.582 1.286   -12.444 1.00 97.25  ? 286 PHE H CZ  1 
ATOM   3018 N  N   . LYS H 2 8  ? -20.721 -1.779  -9.301  1.00 119.57 ? 287 LYS H N   1 
ATOM   3019 C  CA  . LYS H 2 8  ? -19.456 -1.519  -9.985  1.00 120.02 ? 287 LYS H CA  1 
ATOM   3020 C  C   . LYS H 2 8  ? -19.664 -1.470  -11.496 1.00 118.07 ? 287 LYS H C   1 
ATOM   3021 O  O   . LYS H 2 8  ? -19.796 -2.526  -12.138 1.00 120.60 ? 287 LYS H O   1 
ATOM   3022 C  CB  . LYS H 2 8  ? -18.425 -2.588  -9.620  1.00 125.61 ? 287 LYS H CB  1 
ATOM   3023 N  N   . PRO H 2 9  ? -19.704 -0.286  -12.111 1.00 112.04 ? 288 PRO H N   1 
ATOM   3024 C  CA  . PRO H 2 9  ? -19.993 -0.210  -13.553 1.00 107.46 ? 288 PRO H CA  1 
ATOM   3025 C  C   . PRO H 2 9  ? -18.970 -0.959  -14.398 1.00 107.56 ? 288 PRO H C   1 
ATOM   3026 O  O   . PRO H 2 9  ? -17.760 -0.737  -14.295 1.00 108.79 ? 288 PRO H O   1 
ATOM   3027 C  CB  . PRO H 2 9  ? -19.964 1.297   -13.846 1.00 105.55 ? 288 PRO H CB  1 
ATOM   3028 C  CG  . PRO H 2 9  ? -19.375 1.944   -12.633 1.00 108.90 ? 288 PRO H CG  1 
ATOM   3029 C  CD  . PRO H 2 9  ? -19.689 1.044   -11.484 1.00 110.61 ? 288 PRO H CD  1 
ATOM   3030 N  N   . GLY H 2 10 ? -19.479 -1.849  -15.245 1.00 106.14 ? 289 GLY H N   1 
ATOM   3031 C  CA  . GLY H 2 10 ? -18.690 -2.644  -16.165 1.00 107.83 ? 289 GLY H CA  1 
ATOM   3032 C  C   . GLY H 2 10 ? -17.851 -3.745  -15.555 1.00 109.78 ? 289 GLY H C   1 
ATOM   3033 O  O   . GLY H 2 10 ? -17.114 -4.413  -16.290 1.00 114.17 ? 289 GLY H O   1 
ATOM   3034 N  N   . VAL H 2 11 ? -17.925 -3.955  -14.246 1.00 108.37 ? 290 VAL H N   1 
ATOM   3035 C  CA  . VAL H 2 11 ? -17.273 -5.087  -13.598 1.00 109.30 ? 290 VAL H CA  1 
ATOM   3036 C  C   . VAL H 2 11 ? -18.272 -6.234  -13.498 1.00 113.30 ? 290 VAL H C   1 
ATOM   3037 O  O   . VAL H 2 11 ? -19.309 -6.108  -12.835 1.00 109.55 ? 290 VAL H O   1 
ATOM   3038 C  CB  . VAL H 2 11 ? -16.739 -4.698  -12.214 1.00 106.90 ? 290 VAL H CB  1 
ATOM   3039 C  CG1 . VAL H 2 11 ? -15.765 -5.742  -11.708 1.00 112.73 ? 290 VAL H CG1 1 
ATOM   3040 C  CG2 . VAL H 2 11 ? -16.088 -3.328  -12.274 1.00 105.96 ? 290 VAL H CG2 1 
ATOM   3041 N  N   . ILE H 2 12 ? -17.953 -7.364  -14.135 1.00 114.94 ? 291 ILE H N   1 
ATOM   3042 C  CA  . ILE H 2 12 ? -18.827 -8.530  -14.141 1.00 91.88  ? 291 ILE H CA  1 
ATOM   3043 C  C   . ILE H 2 12 ? -18.017 -9.786  -13.850 1.00 127.67 ? 291 ILE H C   1 
ATOM   3044 O  O   . ILE H 2 12 ? -16.796 -9.825  -14.016 1.00 134.16 ? 291 ILE H O   1 
ATOM   3045 C  CB  . ILE H 2 12 ? -19.592 -8.693  -15.472 1.00 102.14 ? 291 ILE H CB  1 
ATOM   3046 C  CG1 . ILE H 2 12 ? -18.623 -8.834  -16.648 1.00 91.05  ? 291 ILE H CG1 1 
ATOM   3047 C  CG2 . ILE H 2 12 ? -20.538 -7.529  -15.688 1.00 85.94  ? 291 ILE H CG2 1 
ATOM   3048 C  CD1 . ILE H 2 12 ? -19.308 -9.044  -17.985 1.00 90.32  ? 291 ILE H CD1 1 
ATOM   3049 N  N   . SER H 2 13 ? -18.729 -10.827 -13.421 1.00 123.19 ? 292 SER H N   1 
ATOM   3050 C  CA  . SER H 2 13 ? -18.106 -12.088 -13.046 1.00 133.86 ? 292 SER H CA  1 
ATOM   3051 C  C   . SER H 2 13 ? -17.627 -12.843 -14.284 1.00 136.20 ? 292 SER H C   1 
ATOM   3052 O  O   . SER H 2 13 ? -17.937 -12.492 -15.424 1.00 133.23 ? 292 SER H O   1 
ATOM   3053 C  CB  . SER H 2 13 ? -19.079 -12.961 -12.254 1.00 138.40 ? 292 SER H CB  1 
ATOM   3054 O  OG  . SER H 2 13 ? -20.112 -13.458 -13.088 1.00 139.65 ? 292 SER H OG  1 
ATOM   3055 N  N   . GLU H 2 14 ? -16.849 -13.900 -14.039 1.00 143.80 ? 293 GLU H N   1 
ATOM   3056 C  CA  . GLU H 2 14 ? -16.369 -14.740 -15.130 1.00 149.44 ? 293 GLU H CA  1 
ATOM   3057 C  C   . GLU H 2 14 ? -17.501 -15.528 -15.780 1.00 151.70 ? 293 GLU H C   1 
ATOM   3058 O  O   . GLU H 2 14 ? -17.470 -15.767 -16.992 1.00 152.74 ? 293 GLU H O   1 
ATOM   3059 C  CB  . GLU H 2 14 ? -15.284 -15.690 -14.624 1.00 156.74 ? 293 GLU H CB  1 
ATOM   3060 N  N   . GLU H 2 15 ? -18.495 -15.956 -14.995 1.00 153.22 ? 294 GLU H N   1 
ATOM   3061 C  CA  . GLU H 2 15 ? -19.614 -16.698 -15.569 1.00 154.15 ? 294 GLU H CA  1 
ATOM   3062 C  C   . GLU H 2 15 ? -20.403 -15.827 -16.540 1.00 149.10 ? 294 GLU H C   1 
ATOM   3063 O  O   . GLU H 2 15 ? -20.747 -16.264 -17.645 1.00 148.59 ? 294 GLU H O   1 
ATOM   3064 C  CB  . GLU H 2 15 ? -20.520 -17.229 -14.458 1.00 156.29 ? 294 GLU H CB  1 
ATOM   3065 N  N   . LEU H 2 16 ? -20.692 -14.584 -16.149 1.00 144.32 ? 295 LEU H N   1 
ATOM   3066 C  CA  . LEU H 2 16 ? -21.371 -13.671 -17.062 1.00 139.01 ? 295 LEU H CA  1 
ATOM   3067 C  C   . LEU H 2 16 ? -20.440 -13.259 -18.193 1.00 141.20 ? 295 LEU H C   1 
ATOM   3068 O  O   . LEU H 2 16 ? -20.876 -13.105 -19.340 1.00 142.55 ? 295 LEU H O   1 
ATOM   3069 C  CB  . LEU H 2 16 ? -21.892 -12.453 -16.302 1.00 127.75 ? 295 LEU H CB  1 
ATOM   3070 C  CG  . LEU H 2 16 ? -22.698 -11.422 -17.094 1.00 116.06 ? 295 LEU H CG  1 
ATOM   3071 C  CD1 . LEU H 2 16 ? -23.814 -12.090 -17.882 1.00 117.35 ? 295 LEU H CD1 1 
ATOM   3072 C  CD2 . LEU H 2 16 ? -23.264 -10.364 -16.163 1.00 109.56 ? 295 LEU H CD2 1 
ATOM   3073 N  N   . GLN H 2 17 ? -19.152 -13.084 -17.884 1.00 143.03 ? 296 GLN H N   1 
ATOM   3074 C  CA  . GLN H 2 17 ? -18.164 -12.797 -18.918 1.00 143.17 ? 296 GLN H CA  1 
ATOM   3075 C  C   . GLN H 2 17 ? -18.160 -13.905 -19.960 1.00 145.28 ? 296 GLN H C   1 
ATOM   3076 O  O   . GLN H 2 17 ? -18.200 -13.644 -21.167 1.00 143.77 ? 296 GLN H O   1 
ATOM   3077 C  CB  . GLN H 2 17 ? -16.784 -12.646 -18.279 1.00 146.59 ? 296 GLN H CB  1 
ATOM   3078 C  CG  . GLN H 2 17 ? -15.894 -11.589 -18.891 1.00 145.29 ? 296 GLN H CG  1 
ATOM   3079 C  CD  . GLN H 2 17 ? -14.624 -11.389 -18.085 1.00 149.30 ? 296 GLN H CD  1 
ATOM   3080 O  OE1 . GLN H 2 17 ? -14.578 -11.692 -16.890 1.00 151.78 ? 296 GLN H OE1 1 
ATOM   3081 N  NE2 . GLN H 2 17 ? -13.586 -10.881 -18.735 1.00 150.78 ? 296 GLN H NE2 1 
ATOM   3082 N  N   . ASP H 2 18 ? -18.105 -15.158 -19.502 1.00 149.78 ? 297 ASP H N   1 
ATOM   3083 C  CA  . ASP H 2 18 ? -18.090 -16.285 -20.424 1.00 155.45 ? 297 ASP H CA  1 
ATOM   3084 C  C   . ASP H 2 18 ? -19.404 -16.369 -21.187 1.00 154.79 ? 297 ASP H C   1 
ATOM   3085 O  O   . ASP H 2 18 ? -19.423 -16.765 -22.358 1.00 157.12 ? 297 ASP H O   1 
ATOM   3086 C  CB  . ASP H 2 18 ? -17.820 -17.589 -19.673 1.00 162.26 ? 297 ASP H CB  1 
ATOM   3087 N  N   . ALA H 2 19 ? -20.512 -16.012 -20.530 1.00 151.63 ? 298 ALA H N   1 
ATOM   3088 C  CA  . ALA H 2 19 ? -21.815 -16.017 -21.185 1.00 149.61 ? 298 ALA H CA  1 
ATOM   3089 C  C   . ALA H 2 19 ? -21.865 -15.002 -22.319 1.00 142.43 ? 298 ALA H C   1 
ATOM   3090 O  O   . ALA H 2 19 ? -22.461 -15.265 -23.369 1.00 142.06 ? 298 ALA H O   1 
ATOM   3091 C  CB  . ALA H 2 19 ? -22.914 -15.734 -20.161 1.00 148.57 ? 298 ALA H CB  1 
ATOM   3092 N  N   . LEU H 2 20 ? -21.247 -13.835 -22.126 1.00 140.53 ? 299 LEU H N   1 
ATOM   3093 C  CA  . LEU H 2 20 ? -21.264 -12.805 -23.153 1.00 134.16 ? 299 LEU H CA  1 
ATOM   3094 C  C   . LEU H 2 20 ? -20.288 -13.080 -24.287 1.00 139.96 ? 299 LEU H C   1 
ATOM   3095 O  O   . LEU H 2 20 ? -20.410 -12.458 -25.347 1.00 139.16 ? 299 LEU H O   1 
ATOM   3096 C  CB  . LEU H 2 20 ? -20.942 -11.438 -22.545 1.00 125.92 ? 299 LEU H CB  1 
ATOM   3097 C  CG  . LEU H 2 20 ? -22.028 -10.772 -21.701 1.00 115.96 ? 299 LEU H CG  1 
ATOM   3098 C  CD1 . LEU H 2 20 ? -21.534 -9.445  -21.146 1.00 89.05  ? 299 LEU H CD1 1 
ATOM   3099 C  CD2 . LEU H 2 20 ? -23.280 -10.576 -22.528 1.00 111.74 ? 299 LEU H CD2 1 
ATOM   3100 N  N   . GLY H 2 21 ? -19.329 -13.982 -24.102 1.00 141.60 ? 300 GLY H N   1 
ATOM   3101 C  CA  . GLY H 2 21 ? -18.392 -14.229 -25.177 1.00 146.63 ? 300 GLY H CA  1 
ATOM   3102 C  C   . GLY H 2 21 ? -17.304 -13.191 -25.306 1.00 145.49 ? 300 GLY H C   1 
ATOM   3103 O  O   . GLY H 2 21 ? -16.840 -12.932 -26.422 1.00 147.37 ? 300 GLY H O   1 
ATOM   3104 N  N   . VAL H 2 22 ? -16.866 -12.594 -24.198 1.00 144.43 ? 301 VAL H N   1 
ATOM   3105 C  CA  . VAL H 2 22 ? -15.911 -11.500 -24.291 1.00 140.77 ? 301 VAL H CA  1 
ATOM   3106 C  C   . VAL H 2 22 ? -14.545 -12.077 -24.630 1.00 146.26 ? 301 VAL H C   1 
ATOM   3107 O  O   . VAL H 2 22 ? -14.062 -13.012 -23.977 1.00 152.19 ? 301 VAL H O   1 
ATOM   3108 C  CB  . VAL H 2 22 ? -15.873 -10.709 -22.975 1.00 135.38 ? 301 VAL H CB  1 
ATOM   3109 C  CG1 . VAL H 2 22 ? -15.091 -9.420  -23.153 1.00 131.77 ? 301 VAL H CG1 1 
ATOM   3110 C  CG2 . VAL H 2 22 ? -17.278 -10.430 -22.489 1.00 131.52 ? 301 VAL H CG2 1 
ATOM   3111 N  N   . THR H 2 23 ? -13.908 -11.507 -25.654 1.00 144.38 ? 302 THR H N   1 
ATOM   3112 C  CA  . THR H 2 23 ? -12.602 -11.989 -26.091 1.00 147.78 ? 302 THR H CA  1 
ATOM   3113 C  C   . THR H 2 23 ? -11.470 -11.477 -25.215 1.00 143.39 ? 302 THR H C   1 
ATOM   3114 O  O   . THR H 2 23 ? -10.465 -12.175 -25.041 1.00 148.08 ? 302 THR H O   1 
ATOM   3115 C  CB  . THR H 2 23 ? -12.364 -11.589 -27.549 1.00 150.59 ? 302 THR H CB  1 
ATOM   3116 O  OG1 . THR H 2 23 ? -12.327 -10.159 -27.655 1.00 150.01 ? 302 THR H OG1 1 
ATOM   3117 C  CG2 . THR H 2 23 ? -13.488 -12.123 -28.431 1.00 149.06 ? 302 THR H CG2 1 
ATOM   3118 N  N   . ASP H 2 24 ? -11.615 -10.281 -24.653 1.00 135.47 ? 303 ASP H N   1 
ATOM   3119 C  CA  . ASP H 2 24 ? -10.558 -9.642  -23.881 1.00 133.46 ? 303 ASP H CA  1 
ATOM   3120 C  C   . ASP H 2 24 ? -11.113 -9.272  -22.516 1.00 130.37 ? 303 ASP H C   1 
ATOM   3121 O  O   . ASP H 2 24 ? -12.093 -8.525  -22.424 1.00 127.65 ? 303 ASP H O   1 
ATOM   3122 C  CB  . ASP H 2 24 ? -10.030 -8.402  -24.608 1.00 130.41 ? 303 ASP H CB  1 
ATOM   3123 C  CG  . ASP H 2 24 ? -8.703  -7.925  -24.063 1.00 132.47 ? 303 ASP H CG  1 
ATOM   3124 O  OD1 . ASP H 2 24 ? -7.789  -7.677  -24.875 1.00 134.83 ? 303 ASP H OD1 1 
ATOM   3125 O  OD2 . ASP H 2 24 ? -8.571  -7.787  -22.830 1.00 134.13 ? 303 ASP H OD2 1 
ATOM   3126 N  N   . LYS H 2 25 ? -10.482 -9.788  -21.459 1.00 130.44 ? 304 LYS H N   1 
ATOM   3127 C  CA  . LYS H 2 25 ? -10.947 -9.494  -20.108 1.00 124.00 ? 304 LYS H CA  1 
ATOM   3128 C  C   . LYS H 2 25 ? -10.754 -8.026  -19.748 1.00 121.40 ? 304 LYS H C   1 
ATOM   3129 O  O   . LYS H 2 25 ? -11.536 -7.475  -18.965 1.00 118.52 ? 304 LYS H O   1 
ATOM   3130 C  CB  . LYS H 2 25 ? -10.226 -10.388 -19.098 1.00 127.96 ? 304 LYS H CB  1 
ATOM   3131 N  N   . SER H 2 26 ? -9.737  -7.376  -20.315 1.00 122.27 ? 305 SER H N   1 
ATOM   3132 C  CA  . SER H 2 26 ? -9.406  -6.006  -19.947 1.00 118.23 ? 305 SER H CA  1 
ATOM   3133 C  C   . SER H 2 26 ? -10.330 -4.970  -20.574 1.00 110.02 ? 305 SER H C   1 
ATOM   3134 O  O   . SER H 2 26 ? -10.208 -3.786  -20.243 1.00 108.90 ? 305 SER H O   1 
ATOM   3135 C  CB  . SER H 2 26 ? -7.964  -5.694  -20.346 1.00 122.83 ? 305 SER H CB  1 
ATOM   3136 O  OG  . SER H 2 26 ? -7.857  -5.535  -21.750 1.00 121.83 ? 305 SER H OG  1 
ATOM   3137 N  N   . LEU H 2 27 ? -11.227 -5.372  -21.476 1.00 106.17 ? 306 LEU H N   1 
ATOM   3138 C  CA  . LEU H 2 27 ? -12.171 -4.443  -22.084 1.00 101.60 ? 306 LEU H CA  1 
ATOM   3139 C  C   . LEU H 2 27 ? -13.425 -4.354  -21.225 1.00 100.82 ? 306 LEU H C   1 
ATOM   3140 O  O   . LEU H 2 27 ? -14.170 -5.343  -21.135 1.00 102.04 ? 306 LEU H O   1 
ATOM   3141 C  CB  . LEU H 2 27 ? -12.528 -4.878  -23.498 1.00 97.85  ? 306 LEU H CB  1 
ATOM   3142 C  CG  . LEU H 2 27 ? -11.502 -4.559  -24.586 1.00 97.05  ? 306 LEU H CG  1 
ATOM   3143 C  CD1 . LEU H 2 27 ? -12.011 -4.989  -25.949 1.00 95.02  ? 306 LEU H CD1 1 
ATOM   3144 C  CD2 . LEU H 2 27 ? -11.203 -3.075  -24.584 1.00 94.81  ? 306 LEU H CD2 1 
ATOM   3145 N  N   . PRO H 2 28 ? -13.697 -3.227  -20.573 1.00 96.51  ? 307 PRO H N   1 
ATOM   3146 C  CA  . PRO H 2 28 ? -14.879 -3.137  -19.714 1.00 92.95  ? 307 PRO H CA  1 
ATOM   3147 C  C   . PRO H 2 28 ? -16.146 -3.128  -20.549 1.00 92.88  ? 307 PRO H C   1 
ATOM   3148 O  O   . PRO H 2 28 ? -16.294 -2.299  -21.460 1.00 94.24  ? 307 PRO H O   1 
ATOM   3149 C  CB  . PRO H 2 28 ? -14.686 -1.800  -18.985 1.00 90.69  ? 307 PRO H CB  1 
ATOM   3150 C  CG  . PRO H 2 28 ? -13.803 -1.000  -19.881 1.00 91.73  ? 307 PRO H CG  1 
ATOM   3151 C  CD  . PRO H 2 28 ? -12.906 -1.986  -20.574 1.00 96.28  ? 307 PRO H CD  1 
ATOM   3152 N  N   . PRO H 2 29 ? -17.081 -4.036  -20.284 1.00 91.96  ? 308 PRO H N   1 
ATOM   3153 C  CA  . PRO H 2 29 ? -18.333 -4.050  -21.043 1.00 75.00  ? 308 PRO H CA  1 
ATOM   3154 C  C   . PRO H 2 29 ? -19.378 -3.099  -20.478 1.00 86.62  ? 308 PRO H C   1 
ATOM   3155 O  O   . PRO H 2 29 ? -19.343 -2.708  -19.310 1.00 84.00  ? 308 PRO H O   1 
ATOM   3156 C  CB  . PRO H 2 29 ? -18.800 -5.504  -20.898 1.00 78.43  ? 308 PRO H CB  1 
ATOM   3157 C  CG  . PRO H 2 29 ? -18.270 -5.918  -19.562 1.00 80.48  ? 308 PRO H CG  1 
ATOM   3158 C  CD  . PRO H 2 29 ? -16.959 -5.194  -19.382 1.00 80.01  ? 308 PRO H CD  1 
ATOM   3159 N  N   . PHE H 2 30 ? -20.293 -2.691  -21.363 1.00 88.12  ? 309 PHE H N   1 
ATOM   3160 C  CA  . PHE H 2 30 ? -21.455 -1.861  -21.040 1.00 87.13  ? 309 PHE H CA  1 
ATOM   3161 C  C   . PHE H 2 30 ? -21.063 -0.420  -20.752 1.00 86.09  ? 309 PHE H C   1 
ATOM   3162 O  O   . PHE H 2 30 ? -21.928 0.459   -20.736 1.00 86.16  ? 309 PHE H O   1 
ATOM   3163 C  CB  . PHE H 2 30 ? -22.256 -2.425  -19.859 1.00 68.95  ? 309 PHE H CB  1 
ATOM   3164 C  CG  . PHE H 2 30 ? -22.768 -3.813  -20.083 1.00 72.29  ? 309 PHE H CG  1 
ATOM   3165 C  CD1 . PHE H 2 30 ? -23.721 -4.054  -21.053 1.00 81.24  ? 309 PHE H CD1 1 
ATOM   3166 C  CD2 . PHE H 2 30 ? -22.310 -4.873  -19.323 1.00 75.34  ? 309 PHE H CD2 1 
ATOM   3167 C  CE1 . PHE H 2 30 ? -24.200 -5.330  -21.274 1.00 85.94  ? 309 PHE H CE1 1 
ATOM   3168 C  CE2 . PHE H 2 30 ? -22.788 -6.151  -19.536 1.00 78.94  ? 309 PHE H CE2 1 
ATOM   3169 C  CZ  . PHE H 2 30 ? -23.732 -6.380  -20.512 1.00 88.05  ? 309 PHE H CZ  1 
ATOM   3170 N  N   . ILE H 2 31 ? -19.770 -0.152  -20.561 1.00 66.15  ? 310 ILE H N   1 
ATOM   3171 C  CA  . ILE H 2 31 ? -19.368 1.198   -20.179 1.00 66.76  ? 310 ILE H CA  1 
ATOM   3172 C  C   . ILE H 2 31 ? -19.524 2.171   -21.340 1.00 90.84  ? 310 ILE H C   1 
ATOM   3173 O  O   . ILE H 2 31 ? -19.870 3.340   -21.128 1.00 89.08  ? 310 ILE H O   1 
ATOM   3174 C  CB  . ILE H 2 31 ? -17.934 1.193   -19.615 1.00 87.52  ? 310 ILE H CB  1 
ATOM   3175 C  CG1 . ILE H 2 31 ? -17.917 0.531   -18.240 1.00 88.85  ? 310 ILE H CG1 1 
ATOM   3176 C  CG2 . ILE H 2 31 ? -17.398 2.608   -19.467 1.00 88.54  ? 310 ILE H CG2 1 
ATOM   3177 C  CD1 . ILE H 2 31 ? -18.796 1.229   -17.220 1.00 87.69  ? 310 ILE H CD1 1 
ATOM   3178 N  N   . TYR H 2 32 ? -19.317 1.719   -22.580 1.00 92.58  ? 311 TYR H N   1 
ATOM   3179 C  CA  . TYR H 2 32 ? -19.475 2.648   -23.694 1.00 92.90  ? 311 TYR H CA  1 
ATOM   3180 C  C   . TYR H 2 32 ? -20.929 3.060   -23.867 1.00 94.70  ? 311 TYR H C   1 
ATOM   3181 O  O   . TYR H 2 32 ? -21.219 4.235   -24.123 1.00 95.68  ? 311 TYR H O   1 
ATOM   3182 C  CB  . TYR H 2 32 ? -18.951 2.051   -24.993 1.00 90.89  ? 311 TYR H CB  1 
ATOM   3183 C  CG  . TYR H 2 32 ? -19.003 3.081   -26.086 1.00 90.70  ? 311 TYR H CG  1 
ATOM   3184 C  CD1 . TYR H 2 32 ? -18.308 4.275   -25.956 1.00 93.82  ? 311 TYR H CD1 1 
ATOM   3185 C  CD2 . TYR H 2 32 ? -19.775 2.892   -27.216 1.00 90.31  ? 311 TYR H CD2 1 
ATOM   3186 C  CE1 . TYR H 2 32 ? -18.358 5.240   -26.934 1.00 95.29  ? 311 TYR H CE1 1 
ATOM   3187 C  CE2 . TYR H 2 32 ? -19.828 3.849   -28.205 1.00 94.06  ? 311 TYR H CE2 1 
ATOM   3188 C  CZ  . TYR H 2 32 ? -19.118 5.024   -28.059 1.00 95.71  ? 311 TYR H CZ  1 
ATOM   3189 O  OH  . TYR H 2 32 ? -19.170 5.984   -29.043 1.00 96.35  ? 311 TYR H OH  1 
ATOM   3190 N  N   . ARG H 2 33 ? -21.855 2.105   -23.747 1.00 97.82  ? 312 ARG H N   1 
ATOM   3191 C  CA  . ARG H 2 33 ? -23.276 2.428   -23.825 1.00 96.71  ? 312 ARG H CA  1 
ATOM   3192 C  C   . ARG H 2 33 ? -23.708 3.255   -22.619 1.00 92.08  ? 312 ARG H C   1 
ATOM   3193 O  O   . ARG H 2 33 ? -24.429 4.250   -22.771 1.00 92.31  ? 312 ARG H O   1 
ATOM   3194 C  CB  . ARG H 2 33 ? -24.074 1.129   -23.928 1.00 100.76 ? 312 ARG H CB  1 
ATOM   3195 C  CG  . ARG H 2 33 ? -25.551 1.207   -24.305 1.00 104.90 ? 312 ARG H CG  1 
ATOM   3196 C  CD  . ARG H 2 33 ? -25.803 1.406   -25.800 1.00 107.10 ? 312 ARG H CD  1 
ATOM   3197 N  NE  . ARG H 2 33 ? -27.167 1.879   -26.041 1.00 111.36 ? 312 ARG H NE  1 
ATOM   3198 C  CZ  . ARG H 2 33 ? -27.527 3.147   -26.223 1.00 113.65 ? 312 ARG H CZ  1 
ATOM   3199 N  NH1 . ARG H 2 33 ? -26.619 4.113   -26.197 1.00 115.56 ? 312 ARG H NH1 1 
ATOM   3200 N  NH2 . ARG H 2 33 ? -28.806 3.444   -26.429 1.00 115.64 ? 312 ARG H NH2 1 
ATOM   3201 N  N   . MET H 2 34 ? -23.242 2.883   -21.420 1.00 86.31  ? 313 MET H N   1 
ATOM   3202 C  CA  . MET H 2 34 ? -23.630 3.605   -20.207 1.00 82.14  ? 313 MET H CA  1 
ATOM   3203 C  C   . MET H 2 34 ? -23.129 5.041   -20.236 1.00 84.72  ? 313 MET H C   1 
ATOM   3204 O  O   . MET H 2 34 ? -23.802 5.952   -19.746 1.00 88.62  ? 313 MET H O   1 
ATOM   3205 C  CB  . MET H 2 34 ? -23.077 2.898   -18.962 1.00 79.38  ? 313 MET H CB  1 
ATOM   3206 C  CG  . MET H 2 34 ? -23.719 1.570   -18.603 1.00 80.05  ? 313 MET H CG  1 
ATOM   3207 S  SD  . MET H 2 34 ? -22.907 0.861   -17.151 1.00 83.08  ? 313 MET H SD  1 
ATOM   3208 C  CE  . MET H 2 34 ? -23.112 2.191   -15.976 1.00 83.63  ? 313 MET H CE  1 
ATOM   3209 N  N   . ARG H 2 35 ? -21.938 5.257   -20.795 1.00 85.64  ? 314 ARG H N   1 
ATOM   3210 C  CA  . ARG H 2 35 ? -21.377 6.601   -20.862 1.00 86.52  ? 314 ARG H CA  1 
ATOM   3211 C  C   . ARG H 2 35 ? -22.204 7.522   -21.755 1.00 84.35  ? 314 ARG H C   1 
ATOM   3212 O  O   . ARG H 2 35 ? -22.222 8.740   -21.539 1.00 85.60  ? 314 ARG H O   1 
ATOM   3213 C  CB  . ARG H 2 35 ? -19.911 6.498   -21.286 1.00 91.29  ? 314 ARG H CB  1 
ATOM   3214 C  CG  . ARG H 2 35 ? -19.131 7.787   -21.255 1.00 94.86  ? 314 ARG H CG  1 
ATOM   3215 C  CD  . ARG H 2 35 ? -17.787 7.601   -21.938 1.00 98.08  ? 314 ARG H CD  1 
ATOM   3216 N  NE  . ARG H 2 35 ? -16.842 7.041   -20.968 1.00 96.38  ? 314 ARG H NE  1 
ATOM   3217 C  CZ  . ARG H 2 35 ? -16.455 5.768   -20.926 1.00 91.77  ? 314 ARG H CZ  1 
ATOM   3218 N  NH1 . ARG H 2 35 ? -16.933 4.889   -21.798 1.00 88.67  ? 314 ARG H NH1 1 
ATOM   3219 N  NH2 . ARG H 2 35 ? -15.599 5.373   -19.992 1.00 91.65  ? 314 ARG H NH2 1 
ATOM   3220 N  N   . GLN H 2 36 ? -22.908 6.965   -22.742 1.00 81.82  ? 315 GLN H N   1 
ATOM   3221 C  CA  . GLN H 2 36 ? -23.764 7.789   -23.589 1.00 82.31  ? 315 GLN H CA  1 
ATOM   3222 C  C   . GLN H 2 36 ? -25.096 8.074   -22.910 1.00 78.49  ? 315 GLN H C   1 
ATOM   3223 O  O   . GLN H 2 36 ? -25.610 9.195   -22.984 1.00 77.41  ? 315 GLN H O   1 
ATOM   3224 C  CB  . GLN H 2 36 ? -24.023 7.101   -24.927 1.00 87.07  ? 315 GLN H CB  1 
ATOM   3225 C  CG  . GLN H 2 36 ? -22.788 6.732   -25.702 1.00 92.66  ? 315 GLN H CG  1 
ATOM   3226 C  CD  . GLN H 2 36 ? -23.142 5.963   -26.959 1.00 95.83  ? 315 GLN H CD  1 
ATOM   3227 O  OE1 . GLN H 2 36 ? -24.279 5.501   -27.117 1.00 96.28  ? 315 GLN H OE1 1 
ATOM   3228 N  NE2 . GLN H 2 36 ? -22.172 5.812   -27.857 1.00 97.51  ? 315 GLN H NE2 1 
ATOM   3229 N  N   . LEU H 2 37 ? -25.667 7.062   -22.252 1.00 78.38  ? 316 LEU H N   1 
ATOM   3230 C  CA  . LEU H 2 37 ? -26.973 7.180   -21.619 1.00 77.49  ? 316 LEU H CA  1 
ATOM   3231 C  C   . LEU H 2 37 ? -26.934 7.994   -20.331 1.00 80.49  ? 316 LEU H C   1 
ATOM   3232 O  O   . LEU H 2 37 ? -27.964 8.554   -19.943 1.00 87.40  ? 316 LEU H O   1 
ATOM   3233 C  CB  . LEU H 2 37 ? -27.539 5.786   -21.350 1.00 72.96  ? 316 LEU H CB  1 
ATOM   3234 C  CG  . LEU H 2 37 ? -27.841 4.931   -22.580 1.00 61.77  ? 316 LEU H CG  1 
ATOM   3235 C  CD1 . LEU H 2 37 ? -28.167 3.500   -22.191 1.00 61.39  ? 316 LEU H CD1 1 
ATOM   3236 C  CD2 . LEU H 2 37 ? -28.998 5.534   -23.357 1.00 63.55  ? 316 LEU H CD2 1 
ATOM   3237 N  N   . GLY H 2 38 ? -25.783 8.091   -19.671 1.00 79.09  ? 317 GLY H N   1 
ATOM   3238 C  CA  . GLY H 2 38 ? -25.700 8.736   -18.377 1.00 80.05  ? 317 GLY H CA  1 
ATOM   3239 C  C   . GLY H 2 38 ? -25.693 7.726   -17.246 1.00 78.28  ? 317 GLY H C   1 
ATOM   3240 O  O   . GLY H 2 38 ? -25.876 6.521   -17.437 1.00 75.38  ? 317 GLY H O   1 
ATOM   3241 N  N   . TYR H 2 39 ? -25.494 8.232   -16.033 1.00 80.41  ? 318 TYR H N   1 
ATOM   3242 C  CA  . TYR H 2 39 ? -25.391 7.332   -14.895 1.00 78.13  ? 318 TYR H CA  1 
ATOM   3243 C  C   . TYR H 2 39 ? -26.755 6.697   -14.673 1.00 76.12  ? 318 TYR H C   1 
ATOM   3244 O  O   . TYR H 2 39 ? -27.769 7.406   -14.648 1.00 78.86  ? 318 TYR H O   1 
ATOM   3245 C  CB  . TYR H 2 39 ? -24.946 8.092   -13.647 1.00 81.26  ? 318 TYR H CB  1 
ATOM   3246 C  CG  . TYR H 2 39 ? -24.448 7.228   -12.501 1.00 86.71  ? 318 TYR H CG  1 
ATOM   3247 C  CD1 . TYR H 2 39 ? -25.326 6.758   -11.535 1.00 86.76  ? 318 TYR H CD1 1 
ATOM   3248 C  CD2 . TYR H 2 39 ? -23.100 6.900   -12.370 1.00 91.44  ? 318 TYR H CD2 1 
ATOM   3249 C  CE1 . TYR H 2 39 ? -24.885 5.980   -10.467 1.00 86.97  ? 318 TYR H CE1 1 
ATOM   3250 C  CE2 . TYR H 2 39 ? -22.650 6.116   -11.306 1.00 92.13  ? 318 TYR H CE2 1 
ATOM   3251 C  CZ  . TYR H 2 39 ? -23.549 5.662   -10.362 1.00 90.20  ? 318 TYR H CZ  1 
ATOM   3252 O  OH  . TYR H 2 39 ? -23.117 4.886   -9.311  1.00 92.36  ? 318 TYR H OH  1 
ATOM   3253 N  N   . PRO H 2 40 ? -26.817 5.387   -14.467 1.00 74.92  ? 319 PRO H N   1 
ATOM   3254 C  CA  . PRO H 2 40 ? -28.102 4.718   -14.272 1.00 80.90  ? 319 PRO H CA  1 
ATOM   3255 C  C   . PRO H 2 40 ? -28.902 5.358   -13.158 1.00 87.47  ? 319 PRO H C   1 
ATOM   3256 O  O   . PRO H 2 40 ? -28.434 5.444   -12.015 1.00 91.88  ? 319 PRO H O   1 
ATOM   3257 C  CB  . PRO H 2 40 ? -27.719 3.274   -13.919 1.00 82.94  ? 319 PRO H CB  1 
ATOM   3258 C  CG  . PRO H 2 40 ? -26.255 3.242   -13.742 1.00 81.73  ? 319 PRO H CG  1 
ATOM   3259 C  CD  . PRO H 2 40 ? -25.659 4.493   -14.304 1.00 77.21  ? 319 PRO H CD  1 
ATOM   3260 N  N   . PRO H 2 41 ? -30.116 5.821   -13.465 1.00 87.51  ? 320 PRO H N   1 
ATOM   3261 C  CA  . PRO H 2 41 ? -30.899 6.545   -12.454 1.00 87.10  ? 320 PRO H CA  1 
ATOM   3262 C  C   . PRO H 2 41 ? -31.256 5.680   -11.270 1.00 93.01  ? 320 PRO H C   1 
ATOM   3263 O  O   . PRO H 2 41 ? -31.351 6.189   -10.149 1.00 95.98  ? 320 PRO H O   1 
ATOM   3264 C  CB  . PRO H 2 41 ? -32.138 6.996   -13.232 1.00 83.42  ? 320 PRO H CB  1 
ATOM   3265 C  CG  . PRO H 2 41 ? -32.261 5.993   -14.341 1.00 83.42  ? 320 PRO H CG  1 
ATOM   3266 C  CD  . PRO H 2 41 ? -30.859 5.635   -14.722 1.00 83.62  ? 320 PRO H CD  1 
ATOM   3267 N  N   . GLY H 2 42 ? -31.434 4.378   -11.477 1.00 96.63  ? 321 GLY H N   1 
ATOM   3268 C  CA  . GLY H 2 42 ? -31.799 3.538   -10.355 1.00 102.84 ? 321 GLY H CA  1 
ATOM   3269 C  C   . GLY H 2 42 ? -30.700 3.331   -9.328  1.00 105.58 ? 321 GLY H C   1 
ATOM   3270 O  O   . GLY H 2 42 ? -31.002 2.864   -8.224  1.00 108.57 ? 321 GLY H O   1 
ATOM   3271 N  N   . TRP H 2 43 ? -29.455 3.708   -9.632  1.00 103.31 ? 322 TRP H N   1 
ATOM   3272 C  CA  . TRP H 2 43 ? -28.403 3.611   -8.625  1.00 103.98 ? 322 TRP H CA  1 
ATOM   3273 C  C   . TRP H 2 43 ? -28.276 4.899   -7.830  1.00 108.24 ? 322 TRP H C   1 
ATOM   3274 O  O   . TRP H 2 43 ? -28.196 4.860   -6.599  1.00 111.79 ? 322 TRP H O   1 
ATOM   3275 C  CB  . TRP H 2 43 ? -27.067 3.252   -9.274  1.00 97.56  ? 322 TRP H CB  1 
ATOM   3276 C  CG  . TRP H 2 43 ? -27.018 1.827   -9.673  1.00 93.32  ? 322 TRP H CG  1 
ATOM   3277 C  CD1 . TRP H 2 43 ? -27.022 1.334   -10.945 1.00 88.77  ? 322 TRP H CD1 1 
ATOM   3278 C  CD2 . TRP H 2 43 ? -27.014 0.691   -8.799  1.00 92.57  ? 322 TRP H CD2 1 
ATOM   3279 N  NE1 . TRP H 2 43 ? -26.995 -0.039  -10.917 1.00 90.04  ? 322 TRP H NE1 1 
ATOM   3280 C  CE2 . TRP H 2 43 ? -26.992 -0.459  -9.612  1.00 92.74  ? 322 TRP H CE2 1 
ATOM   3281 C  CE3 . TRP H 2 43 ? -27.016 0.534   -7.408  1.00 90.54  ? 322 TRP H CE3 1 
ATOM   3282 C  CZ2 . TRP H 2 43 ? -26.969 -1.749  -9.082  1.00 93.21  ? 322 TRP H CZ2 1 
ATOM   3283 C  CZ3 . TRP H 2 43 ? -26.992 -0.747  -6.886  1.00 75.24  ? 322 TRP H CZ3 1 
ATOM   3284 C  CH2 . TRP H 2 43 ? -26.971 -1.872  -7.722  1.00 92.41  ? 322 TRP H CH2 1 
ATOM   3285 N  N   . LEU H 2 44 ? -28.266 6.043   -8.512  1.00 109.09 ? 323 LEU H N   1 
ATOM   3286 C  CA  . LEU H 2 44 ? -28.393 7.302   -7.802  1.00 110.06 ? 323 LEU H CA  1 
ATOM   3287 C  C   . LEU H 2 44 ? -29.726 7.268   -7.077  1.00 115.13 ? 323 LEU H C   1 
ATOM   3288 O  O   . LEU H 2 44 ? -30.730 6.823   -7.638  1.00 121.14 ? 323 LEU H O   1 
ATOM   3289 C  CB  . LEU H 2 44 ? -28.341 8.487   -8.765  1.00 107.35 ? 323 LEU H CB  1 
ATOM   3290 C  CG  . LEU H 2 44 ? -26.996 8.854   -9.388  1.00 109.78 ? 323 LEU H CG  1 
ATOM   3291 C  CD1 . LEU H 2 44 ? -27.167 9.986   -10.388 1.00 111.25 ? 323 LEU H CD1 1 
ATOM   3292 C  CD2 . LEU H 2 44 ? -25.998 9.238   -8.316  1.00 110.14 ? 323 LEU H CD2 1 
ATOM   3293 N  N   . LYS H 2 45 ? -29.723 7.697   -5.820  1.00 114.80 ? 324 LYS H N   1 
ATOM   3294 C  CA  . LYS H 2 45 ? -30.884 7.545   -4.946  1.00 118.86 ? 324 LYS H CA  1 
ATOM   3295 C  C   . LYS H 2 45 ? -31.127 6.072   -4.627  1.00 120.72 ? 324 LYS H C   1 
ATOM   3296 O  O   . LYS H 2 45 ? -31.585 5.309   -5.476  1.00 120.81 ? 324 LYS H O   1 
ATOM   3297 C  CB  . LYS H 2 45 ? -32.138 8.163   -5.573  1.00 120.25 ? 324 LYS H CB  1 
ATOM   3298 N  N   . GLU I 1 11 ? 7.152   24.307  25.860  1.00 158.15 ? 7   GLU I N   1 
ATOM   3299 C  CA  . GLU I 1 11 ? 5.791   24.177  25.354  1.00 156.55 ? 7   GLU I CA  1 
ATOM   3300 C  C   . GLU I 1 11 ? 5.776   23.533  23.972  1.00 155.99 ? 7   GLU I C   1 
ATOM   3301 O  O   . GLU I 1 11 ? 5.087   22.540  23.752  1.00 151.62 ? 7   GLU I O   1 
ATOM   3302 C  CB  . GLU I 1 11 ? 5.102   25.543  25.304  1.00 160.31 ? 7   GLU I CB  1 
ATOM   3303 N  N   . ALA I 1 12 ? 6.548   24.105  23.042  1.00 161.25 ? 8   ALA I N   1 
ATOM   3304 C  CA  . ALA I 1 12 ? 6.575   23.581  21.681  1.00 159.23 ? 8   ALA I CA  1 
ATOM   3305 C  C   . ALA I 1 12 ? 7.145   22.171  21.631  1.00 155.88 ? 8   ALA I C   1 
ATOM   3306 O  O   . ALA I 1 12 ? 6.760   21.377  20.766  1.00 152.69 ? 8   ALA I O   1 
ATOM   3307 C  CB  . ALA I 1 12 ? 7.378   24.511  20.773  1.00 163.74 ? 8   ALA I CB  1 
ATOM   3308 N  N   . ASP I 1 13 ? 8.061   21.839  22.542  1.00 157.62 ? 9   ASP I N   1 
ATOM   3309 C  CA  . ASP I 1 13 ? 8.570   20.477  22.629  1.00 154.19 ? 9   ASP I CA  1 
ATOM   3310 C  C   . ASP I 1 13 ? 7.608   19.539  23.347  1.00 151.31 ? 9   ASP I C   1 
ATOM   3311 O  O   . ASP I 1 13 ? 7.779   18.317  23.266  1.00 148.88 ? 9   ASP I O   1 
ATOM   3312 C  CB  . ASP I 1 13 ? 9.928   20.460  23.336  1.00 157.00 ? 9   ASP I CB  1 
ATOM   3313 N  N   . ARG I 1 14 ? 6.614   20.080  24.051  1.00 150.92 ? 10  ARG I N   1 
ATOM   3314 C  CA  . ARG I 1 14 ? 5.568   19.288  24.687  1.00 145.03 ? 10  ARG I CA  1 
ATOM   3315 C  C   . ARG I 1 14 ? 4.225   19.465  23.983  1.00 142.46 ? 10  ARG I C   1 
ATOM   3316 O  O   . ARG I 1 14 ? 3.168   19.291  24.594  1.00 141.56 ? 10  ARG I O   1 
ATOM   3317 C  CB  . ARG I 1 14 ? 5.448   19.649  26.168  1.00 147.11 ? 10  ARG I CB  1 
ATOM   3318 N  N   . THR I 1 15 ? 4.255   19.809  22.698  1.00 140.91 ? 11  THR I N   1 
ATOM   3319 C  CA  . THR I 1 15 ? 3.038   20.074  21.935  1.00 138.37 ? 11  THR I CA  1 
ATOM   3320 C  C   . THR I 1 15 ? 3.187   19.617  20.485  1.00 133.91 ? 11  THR I C   1 
ATOM   3321 O  O   . THR I 1 15 ? 2.281   19.002  19.919  1.00 129.79 ? 11  THR I O   1 
ATOM   3322 C  CB  . THR I 1 15 ? 2.676   21.577  21.965  1.00 144.59 ? 11  THR I CB  1 
ATOM   3323 O  OG1 . THR I 1 15 ? 2.198   21.932  23.269  1.00 146.48 ? 11  THR I OG1 1 
ATOM   3324 C  CG2 . THR I 1 15 ? 1.618   21.911  20.922  1.00 145.78 ? 11  THR I CG2 1 
ATOM   3325 N  N   . PHE I 1 17 ? 0.113   19.731  17.554  1.00 107.07 ? 13  PHE I N   1 
ATOM   3326 C  CA  . PHE I 1 17 ? -0.462  20.430  16.411  1.00 110.06 ? 13  PHE I CA  1 
ATOM   3327 C  C   . PHE I 1 17 ? -1.435  19.511  15.679  1.00 127.96 ? 13  PHE I C   1 
ATOM   3328 O  O   . PHE I 1 17 ? -1.085  18.378  15.337  1.00 127.50 ? 13  PHE I O   1 
ATOM   3329 C  CB  . PHE I 1 17 ? 0.641   20.914  15.459  1.00 112.06 ? 13  PHE I CB  1 
ATOM   3330 C  CG  . PHE I 1 17 ? 0.124   21.505  14.170  1.00 114.87 ? 13  PHE I CG  1 
ATOM   3331 C  CD1 . PHE I 1 17 ? -0.055  22.873  14.047  1.00 121.32 ? 13  PHE I CD1 1 
ATOM   3332 C  CD2 . PHE I 1 17 ? -0.171  20.700  13.081  1.00 111.43 ? 13  PHE I CD2 1 
ATOM   3333 C  CE1 . PHE I 1 17 ? -0.529  23.426  12.874  1.00 124.34 ? 13  PHE I CE1 1 
ATOM   3334 C  CE2 . PHE I 1 17 ? -0.650  21.248  11.905  1.00 114.29 ? 13  PHE I CE2 1 
ATOM   3335 C  CZ  . PHE I 1 17 ? -0.827  22.613  11.801  1.00 120.79 ? 13  PHE I CZ  1 
ATOM   3336 N  N   . VAL I 1 18 ? -2.651  19.997  15.442  1.00 122.03 ? 14  VAL I N   1 
ATOM   3337 C  CA  . VAL I 1 18 ? -3.678  19.244  14.728  1.00 120.83 ? 14  VAL I CA  1 
ATOM   3338 C  C   . VAL I 1 18 ? -4.219  20.106  13.599  1.00 126.99 ? 14  VAL I C   1 
ATOM   3339 O  O   . VAL I 1 18 ? -4.612  21.255  13.829  1.00 132.90 ? 14  VAL I O   1 
ATOM   3340 C  CB  . VAL I 1 18 ? -4.829  18.810  15.658  1.00 117.81 ? 14  VAL I CB  1 
ATOM   3341 C  CG1 . VAL I 1 18 ? -5.723  17.786  14.956  1.00 114.45 ? 14  VAL I CG1 1 
ATOM   3342 C  CG2 . VAL I 1 18 ? -4.285  18.258  16.965  1.00 114.43 ? 14  VAL I CG2 1 
ATOM   3343 N  N   . GLY I 1 19 ? -4.241  19.561  12.382  1.00 127.13 ? 15  GLY I N   1 
ATOM   3344 C  CA  . GLY I 1 19 ? -4.716  20.279  11.222  1.00 131.88 ? 15  GLY I CA  1 
ATOM   3345 C  C   . GLY I 1 19 ? -5.846  19.542  10.521  1.00 130.60 ? 15  GLY I C   1 
ATOM   3346 O  O   . GLY I 1 19 ? -6.314  18.491  10.967  1.00 125.83 ? 15  GLY I O   1 
ATOM   3347 N  N   . ASN I 1 20 ? -6.280  20.129  9.401   1.00 135.56 ? 16  ASN I N   1 
ATOM   3348 C  CA  . ASN I 1 20 ? -7.344  19.571  8.561   1.00 137.51 ? 16  ASN I CA  1 
ATOM   3349 C  C   . ASN I 1 20 ? -8.659  19.457  9.333   1.00 136.43 ? 16  ASN I C   1 
ATOM   3350 O  O   . ASN I 1 20 ? -9.456  18.550  9.087   1.00 132.73 ? 16  ASN I O   1 
ATOM   3351 C  CB  . ASN I 1 20 ? -6.959  18.212  7.963   1.00 134.17 ? 16  ASN I CB  1 
ATOM   3352 C  CG  . ASN I 1 20 ? -7.834  17.833  6.779   1.00 140.12 ? 16  ASN I CG  1 
ATOM   3353 O  OD1 . ASN I 1 20 ? -8.473  18.690  6.165   1.00 146.89 ? 16  ASN I OD1 1 
ATOM   3354 N  ND2 . ASN I 1 20 ? -7.892  16.541  6.474   1.00 136.54 ? 16  ASN I ND2 1 
ATOM   3355 N  N   . LEU I 1 21 ? -8.882  20.335  10.303  1.00 141.36 ? 17  LEU I N   1 
ATOM   3356 C  CA  . LEU I 1 21 ? -10.104 20.259  11.095  1.00 140.84 ? 17  LEU I CA  1 
ATOM   3357 C  C   . LEU I 1 21 ? -11.305 20.694  10.267  1.00 139.94 ? 17  LEU I C   1 
ATOM   3358 O  O   . LEU I 1 21 ? -11.253 21.702  9.556   1.00 145.98 ? 17  LEU I O   1 
ATOM   3359 C  CB  . LEU I 1 21 ? -9.984  21.128  12.345  1.00 121.63 ? 17  LEU I CB  1 
ATOM   3360 C  CG  . LEU I 1 21 ? -8.811  20.793  13.257  1.00 118.14 ? 17  LEU I CG  1 
ATOM   3361 C  CD1 . LEU I 1 21 ? -8.823  21.681  14.480  1.00 121.90 ? 17  LEU I CD1 1 
ATOM   3362 C  CD2 . LEU I 1 21 ? -8.892  19.329  13.660  1.00 111.56 ? 17  LEU I CD2 1 
ATOM   3363 N  N   . GLU I 1 22 ? -12.388 19.929  10.362  1.00 134.55 ? 18  GLU I N   1 
ATOM   3364 C  CA  . GLU I 1 22 ? -13.625 20.313  9.705   1.00 134.41 ? 18  GLU I CA  1 
ATOM   3365 C  C   . GLU I 1 22 ? -14.257 21.462  10.495  1.00 141.74 ? 18  GLU I C   1 
ATOM   3366 O  O   . GLU I 1 22 ? -13.957 21.672  11.674  1.00 144.23 ? 18  GLU I O   1 
ATOM   3367 C  CB  . GLU I 1 22 ? -14.561 19.107  9.582   1.00 124.79 ? 18  GLU I CB  1 
ATOM   3368 C  CG  . GLU I 1 22 ? -15.669 19.266  8.546   1.00 125.61 ? 18  GLU I CG  1 
ATOM   3369 C  CD  . GLU I 1 22 ? -16.935 19.868  9.098   1.00 136.71 ? 18  GLU I CD  1 
ATOM   3370 O  OE1 . GLU I 1 22 ? -17.065 19.967  10.334  1.00 137.17 ? 18  GLU I OE1 1 
ATOM   3371 O  OE2 . GLU I 1 22 ? -17.804 20.245  8.285   1.00 141.15 ? 18  GLU I OE2 1 
ATOM   3372 N  N   . THR I 1 23 ? -15.125 22.227  9.828   1.00 148.92 ? 19  THR I N   1 
ATOM   3373 C  CA  . THR I 1 23 ? -15.646 23.458  10.423  1.00 157.11 ? 19  THR I CA  1 
ATOM   3374 C  C   . THR I 1 23 ? -16.383 23.226  11.743  1.00 156.22 ? 19  THR I C   1 
ATOM   3375 O  O   . THR I 1 23 ? -16.378 24.109  12.610  1.00 161.17 ? 19  THR I O   1 
ATOM   3376 C  CB  . THR I 1 23 ? -16.565 24.174  9.431   1.00 165.43 ? 19  THR I CB  1 
ATOM   3377 O  OG1 . THR I 1 23 ? -17.642 23.306  9.057   1.00 164.94 ? 19  THR I OG1 1 
ATOM   3378 C  CG2 . THR I 1 23 ? -15.787 24.578  8.184   1.00 167.35 ? 19  THR I CG2 1 
ATOM   3379 N  N   . LYS I 1 24 ? -17.031 22.071  11.919  1.00 150.71 ? 20  LYS I N   1 
ATOM   3380 C  CA  . LYS I 1 24 ? -17.784 21.825  13.147  1.00 151.02 ? 20  LYS I CA  1 
ATOM   3381 C  C   . LYS I 1 24 ? -16.902 21.490  14.348  1.00 147.84 ? 20  LYS I C   1 
ATOM   3382 O  O   . LYS I 1 24 ? -17.380 21.580  15.485  1.00 147.65 ? 20  LYS I O   1 
ATOM   3383 C  CB  . LYS I 1 24 ? -18.798 20.696  12.941  1.00 146.95 ? 20  LYS I CB  1 
ATOM   3384 C  CG  . LYS I 1 24 ? -19.917 21.033  11.975  1.00 150.44 ? 20  LYS I CG  1 
ATOM   3385 C  CD  . LYS I 1 24 ? -20.850 19.852  11.809  1.00 146.27 ? 20  LYS I CD  1 
ATOM   3386 C  CE  . LYS I 1 24 ? -21.387 19.765  10.393  1.00 148.72 ? 20  LYS I CE  1 
ATOM   3387 N  NZ  . LYS I 1 24 ? -22.149 18.504  10.186  1.00 146.10 ? 20  LYS I NZ  1 
ATOM   3388 N  N   . VAL I 1 25 ? -15.646 21.093  14.127  1.00 144.75 ? 21  VAL I N   1 
ATOM   3389 C  CA  . VAL I 1 25 ? -14.759 20.740  15.232  1.00 143.38 ? 21  VAL I CA  1 
ATOM   3390 C  C   . VAL I 1 25 ? -14.580 21.923  16.176  1.00 148.48 ? 21  VAL I C   1 
ATOM   3391 O  O   . VAL I 1 25 ? -14.403 23.068  15.740  1.00 157.10 ? 21  VAL I O   1 
ATOM   3392 C  CB  . VAL I 1 25 ? -13.404 20.259  14.690  1.00 122.21 ? 21  VAL I CB  1 
ATOM   3393 C  CG1 . VAL I 1 25 ? -12.442 19.958  15.833  1.00 118.87 ? 21  VAL I CG1 1 
ATOM   3394 C  CG2 . VAL I 1 25 ? -13.598 19.044  13.801  1.00 117.48 ? 21  VAL I CG2 1 
ATOM   3395 N  N   . THR I 1 26 ? -14.640 21.654  17.482  1.00 146.00 ? 22  THR I N   1 
ATOM   3396 C  CA  . THR I 1 26 ? -14.466 22.687  18.493  1.00 148.48 ? 22  THR I CA  1 
ATOM   3397 C  C   . THR I 1 26 ? -13.251 22.375  19.364  1.00 145.40 ? 22  THR I C   1 
ATOM   3398 O  O   . THR I 1 26 ? -12.759 21.244  19.406  1.00 138.71 ? 22  THR I O   1 
ATOM   3399 C  CB  . THR I 1 26 ? -15.716 22.831  19.374  1.00 148.51 ? 22  THR I CB  1 
ATOM   3400 O  OG1 . THR I 1 26 ? -16.003 21.581  20.012  1.00 143.59 ? 22  THR I OG1 1 
ATOM   3401 C  CG2 . THR I 1 26 ? -16.912 23.254  18.534  1.00 151.59 ? 22  THR I CG2 1 
ATOM   3402 N  N   . GLU I 1 27 ? -12.776 23.410  20.065  1.00 152.42 ? 23  GLU I N   1 
ATOM   3403 C  CA  . GLU I 1 27 ? -11.633 23.253  20.964  1.00 152.48 ? 23  GLU I CA  1 
ATOM   3404 C  C   . GLU I 1 27 ? -11.953 22.314  22.120  1.00 151.63 ? 23  GLU I C   1 
ATOM   3405 O  O   . GLU I 1 27 ? -11.102 21.521  22.538  1.00 146.64 ? 23  GLU I O   1 
ATOM   3406 C  CB  . GLU I 1 27 ? -11.189 24.616  21.494  1.00 157.85 ? 23  GLU I CB  1 
ATOM   3407 N  N   . GLU I 1 28 ? -13.167 22.408  22.667  1.00 158.40 ? 24  GLU I N   1 
ATOM   3408 C  CA  . GLU I 1 28 ? -13.565 21.503  23.740  1.00 152.90 ? 24  GLU I CA  1 
ATOM   3409 C  C   . GLU I 1 28 ? -13.622 20.059  23.258  1.00 144.24 ? 24  GLU I C   1 
ATOM   3410 O  O   . GLU I 1 28 ? -13.378 19.131  24.039  1.00 141.23 ? 24  GLU I O   1 
ATOM   3411 C  CB  . GLU I 1 28 ? -14.915 21.930  24.316  1.00 155.04 ? 24  GLU I CB  1 
ATOM   3412 N  N   . LEU I 1 29 ? -13.956 19.851  21.983  1.00 143.05 ? 25  LEU I N   1 
ATOM   3413 C  CA  . LEU I 1 29 ? -14.007 18.501  21.431  1.00 135.86 ? 25  LEU I CA  1 
ATOM   3414 C  C   . LEU I 1 29 ? -12.622 17.872  21.348  1.00 133.51 ? 25  LEU I C   1 
ATOM   3415 O  O   . LEU I 1 29 ? -12.449 16.695  21.686  1.00 132.06 ? 25  LEU I O   1 
ATOM   3416 C  CB  . LEU I 1 29 ? -14.651 18.532  20.046  1.00 131.83 ? 25  LEU I CB  1 
ATOM   3417 C  CG  . LEU I 1 29 ? -15.069 17.188  19.446  1.00 122.02 ? 25  LEU I CG  1 
ATOM   3418 C  CD1 . LEU I 1 29 ? -16.267 16.609  20.177  1.00 121.49 ? 25  LEU I CD1 1 
ATOM   3419 C  CD2 . LEU I 1 29 ? -15.351 17.340  17.956  1.00 121.18 ? 25  LEU I CD2 1 
ATOM   3420 N  N   . LEU I 1 30 ? -11.624 18.636  20.897  1.00 131.49 ? 26  LEU I N   1 
ATOM   3421 C  CA  . LEU I 1 30 ? -10.268 18.100  20.796  1.00 126.78 ? 26  LEU I CA  1 
ATOM   3422 C  C   . LEU I 1 30 ? -9.666  17.824  22.170  1.00 125.60 ? 26  LEU I C   1 
ATOM   3423 O  O   . LEU I 1 30 ? -8.906  16.860  22.332  1.00 120.47 ? 26  LEU I O   1 
ATOM   3424 C  CB  . LEU I 1 30 ? -9.388  19.057  19.994  1.00 128.05 ? 26  LEU I CB  1 
ATOM   3425 C  CG  . LEU I 1 30 ? -9.677  19.117  18.491  1.00 127.49 ? 26  LEU I CG  1 
ATOM   3426 C  CD1 . LEU I 1 30 ? -8.922  20.263  17.845  1.00 130.64 ? 26  LEU I CD1 1 
ATOM   3427 C  CD2 . LEU I 1 30 ? -9.329  17.800  17.819  1.00 119.84 ? 26  LEU I CD2 1 
ATOM   3428 N  N   . PHE I 1 31 ? -9.970  18.668  23.161  1.00 127.10 ? 27  PHE I N   1 
ATOM   3429 C  CA  . PHE I 1 31 ? -9.531  18.413  24.533  1.00 124.47 ? 27  PHE I CA  1 
ATOM   3430 C  C   . PHE I 1 31 ? -9.945  17.018  24.994  1.00 118.24 ? 27  PHE I C   1 
ATOM   3431 O  O   . PHE I 1 31 ? -9.116  16.233  25.469  1.00 112.28 ? 27  PHE I O   1 
ATOM   3432 C  CB  . PHE I 1 31 ? -10.098 19.480  25.474  1.00 130.76 ? 27  PHE I CB  1 
ATOM   3433 C  CG  . PHE I 1 31 ? -9.452  19.499  26.838  1.00 131.81 ? 27  PHE I CG  1 
ATOM   3434 C  CD1 . PHE I 1 31 ? -9.802  18.570  27.806  1.00 128.39 ? 27  PHE I CD1 1 
ATOM   3435 C  CD2 . PHE I 1 31 ? -8.517  20.472  27.161  1.00 135.17 ? 27  PHE I CD2 1 
ATOM   3436 C  CE1 . PHE I 1 31 ? -9.214  18.594  29.056  1.00 128.12 ? 27  PHE I CE1 1 
ATOM   3437 C  CE2 . PHE I 1 31 ? -7.930  20.504  28.412  1.00 134.68 ? 27  PHE I CE2 1 
ATOM   3438 C  CZ  . PHE I 1 31 ? -8.280  19.564  29.360  1.00 131.32 ? 27  PHE I CZ  1 
ATOM   3439 N  N   . GLU I 1 32 ? -11.244 16.715  24.908  1.00 121.87 ? 28  GLU I N   1 
ATOM   3440 C  CA  . GLU I 1 32 ? -11.727 15.400  25.312  1.00 123.95 ? 28  GLU I CA  1 
ATOM   3441 C  C   . GLU I 1 32 ? -11.073 14.296  24.492  1.00 121.64 ? 28  GLU I C   1 
ATOM   3442 O  O   . GLU I 1 32 ? -10.744 13.229  25.024  1.00 120.41 ? 28  GLU I O   1 
ATOM   3443 C  CB  . GLU I 1 32 ? -13.251 15.336  25.178  1.00 127.16 ? 28  GLU I CB  1 
ATOM   3444 N  N   . LEU I 1 33 ? -10.880 14.534  23.193  1.00 120.76 ? 29  LEU I N   1 
ATOM   3445 C  CA  . LEU I 1 33 ? -10.307 13.511  22.322  1.00 117.94 ? 29  LEU I CA  1 
ATOM   3446 C  C   . LEU I 1 33 ? -8.856  13.213  22.686  1.00 116.67 ? 29  LEU I C   1 
ATOM   3447 O  O   . LEU I 1 33 ? -8.479  12.049  22.868  1.00 116.63 ? 29  LEU I O   1 
ATOM   3448 C  CB  . LEU I 1 33 ? -10.425 13.944  20.860  1.00 117.61 ? 29  LEU I CB  1 
ATOM   3449 C  CG  . LEU I 1 33 ? -9.845  12.998  19.808  1.00 113.20 ? 29  LEU I CG  1 
ATOM   3450 C  CD1 . LEU I 1 33 ? -10.520 11.639  19.872  1.00 111.72 ? 29  LEU I CD1 1 
ATOM   3451 C  CD2 . LEU I 1 33 ? -9.993  13.602  18.419  1.00 114.57 ? 29  LEU I CD2 1 
ATOM   3452 N  N   . PHE I 1 34 ? -8.020  14.246  22.792  1.00 116.66 ? 30  PHE I N   1 
ATOM   3453 C  CA  . PHE I 1 34 ? -6.613  14.008  23.098  1.00 114.43 ? 30  PHE I CA  1 
ATOM   3454 C  C   . PHE I 1 34 ? -6.368  13.678  24.565  1.00 113.27 ? 30  PHE I C   1 
ATOM   3455 O  O   . PHE I 1 34 ? -5.300  13.148  24.893  1.00 110.86 ? 30  PHE I O   1 
ATOM   3456 C  CB  . PHE I 1 34 ? -5.760  15.201  22.666  1.00 118.21 ? 30  PHE I CB  1 
ATOM   3457 C  CG  . PHE I 1 34 ? -5.449  15.207  21.194  1.00 116.77 ? 30  PHE I CG  1 
ATOM   3458 C  CD1 . PHE I 1 34 ? -6.346  15.739  20.282  1.00 118.64 ? 30  PHE I CD1 1 
ATOM   3459 C  CD2 . PHE I 1 34 ? -4.269  14.653  20.723  1.00 111.70 ? 30  PHE I CD2 1 
ATOM   3460 C  CE1 . PHE I 1 34 ? -6.062  15.732  18.928  1.00 116.29 ? 30  PHE I CE1 1 
ATOM   3461 C  CE2 . PHE I 1 34 ? -3.984  14.641  19.378  1.00 110.59 ? 30  PHE I CE2 1 
ATOM   3462 C  CZ  . PHE I 1 34 ? -4.882  15.182  18.478  1.00 112.83 ? 30  PHE I CZ  1 
ATOM   3463 N  N   . HIS I 1 35 ? -7.332  13.956  25.447  1.00 116.12 ? 31  HIS I N   1 
ATOM   3464 C  CA  . HIS I 1 35 ? -7.229  13.484  26.821  1.00 115.91 ? 31  HIS I CA  1 
ATOM   3465 C  C   . HIS I 1 35 ? -7.123  11.967  26.882  1.00 110.89 ? 31  HIS I C   1 
ATOM   3466 O  O   . HIS I 1 35 ? -6.657  11.425  27.889  1.00 112.35 ? 31  HIS I O   1 
ATOM   3467 C  CB  . HIS I 1 35 ? -8.424  13.967  27.646  1.00 117.70 ? 31  HIS I CB  1 
ATOM   3468 N  N   . GLN I 1 36 ? -7.539  11.275  25.819  1.00 106.22 ? 32  GLN I N   1 
ATOM   3469 C  CA  . GLN I 1 36 ? -7.387  9.826   25.758  1.00 105.17 ? 32  GLN I CA  1 
ATOM   3470 C  C   . GLN I 1 36 ? -5.921  9.420   25.749  1.00 106.19 ? 32  GLN I C   1 
ATOM   3471 O  O   . GLN I 1 36 ? -5.559  8.391   26.333  1.00 107.80 ? 32  GLN I O   1 
ATOM   3472 C  CB  . GLN I 1 36 ? -8.081  9.288   24.509  1.00 106.86 ? 32  GLN I CB  1 
ATOM   3473 C  CG  . GLN I 1 36 ? -9.591  9.381   24.541  1.00 112.15 ? 32  GLN I CG  1 
ATOM   3474 C  CD  . GLN I 1 36 ? -10.188 8.404   25.520  1.00 114.14 ? 32  GLN I CD  1 
ATOM   3475 O  OE1 . GLN I 1 36 ? -10.988 8.773   26.381  1.00 121.17 ? 32  GLN I OE1 1 
ATOM   3476 N  NE2 . GLN I 1 36 ? -9.801  7.140   25.392  1.00 111.32 ? 32  GLN I NE2 1 
ATOM   3477 N  N   . ALA I 1 37 ? -5.065  10.213  25.104  1.00 103.52 ? 33  ALA I N   1 
ATOM   3478 C  CA  . ALA I 1 37 ? -3.643  9.910   25.031  1.00 98.46  ? 33  ALA I CA  1 
ATOM   3479 C  C   . ALA I 1 37 ? -2.865  10.419  26.235  1.00 98.39  ? 33  ALA I C   1 
ATOM   3480 O  O   . ALA I 1 37 ? -1.780  9.904   26.524  1.00 96.26  ? 33  ALA I O   1 
ATOM   3481 C  CB  . ALA I 1 37 ? -3.037  10.517  23.760  1.00 101.42 ? 33  ALA I CB  1 
ATOM   3482 N  N   . GLY I 1 38 ? -3.371  11.433  26.927  1.00 101.19 ? 34  GLY I N   1 
ATOM   3483 C  CA  . GLY I 1 38 ? -2.718  11.947  28.105  1.00 84.55  ? 34  GLY I CA  1 
ATOM   3484 C  C   . GLY I 1 38 ? -3.329  13.253  28.565  1.00 112.60 ? 34  GLY I C   1 
ATOM   3485 O  O   . GLY I 1 38 ? -4.049  13.925  27.821  1.00 115.92 ? 34  GLY I O   1 
ATOM   3486 N  N   . PRO I 1 39 ? -3.047  13.633  29.809  1.00 114.42 ? 35  PRO I N   1 
ATOM   3487 C  CA  . PRO I 1 39 ? -3.603  14.876  30.353  1.00 119.19 ? 35  PRO I CA  1 
ATOM   3488 C  C   . PRO I 1 39 ? -3.290  16.072  29.468  1.00 123.21 ? 35  PRO I C   1 
ATOM   3489 O  O   . PRO I 1 39 ? -2.137  16.326  29.110  1.00 122.23 ? 35  PRO I O   1 
ATOM   3490 C  CB  . PRO I 1 39 ? -2.928  14.988  31.724  1.00 119.85 ? 35  PRO I CB  1 
ATOM   3491 C  CG  . PRO I 1 39 ? -2.652  13.576  32.107  1.00 115.97 ? 35  PRO I CG  1 
ATOM   3492 C  CD  . PRO I 1 39 ? -2.291  12.877  30.822  1.00 110.96 ? 35  PRO I CD  1 
ATOM   3493 N  N   . VAL I 1 40 ? -4.338  16.800  29.098  1.00 131.66 ? 36  VAL I N   1 
ATOM   3494 C  CA  . VAL I 1 40 ? -4.229  17.980  28.249  1.00 134.77 ? 36  VAL I CA  1 
ATOM   3495 C  C   . VAL I 1 40 ? -4.392  19.224  29.111  1.00 136.27 ? 36  VAL I C   1 
ATOM   3496 O  O   . VAL I 1 40 ? -5.252  19.276  29.999  1.00 138.11 ? 36  VAL I O   1 
ATOM   3497 C  CB  . VAL I 1 40 ? -5.276  17.944  27.118  1.00 137.25 ? 36  VAL I CB  1 
ATOM   3498 C  CG1 . VAL I 1 40 ? -5.257  19.241  26.325  1.00 142.82 ? 36  VAL I CG1 1 
ATOM   3499 C  CG2 . VAL I 1 40 ? -5.025  16.754  26.203  1.00 131.49 ? 36  VAL I CG2 1 
ATOM   3500 N  N   . ILE I 1 41 ? -3.561  20.229  28.850  1.00 134.78 ? 37  ILE I N   1 
ATOM   3501 C  CA  . ILE I 1 41 ? -3.657  21.508  29.543  1.00 136.96 ? 37  ILE I CA  1 
ATOM   3502 C  C   . ILE I 1 41 ? -4.599  22.458  28.818  1.00 139.09 ? 37  ILE I C   1 
ATOM   3503 O  O   . ILE I 1 41 ? -5.520  23.019  29.419  1.00 142.60 ? 37  ILE I O   1 
ATOM   3504 C  CB  . ILE I 1 41 ? -2.250  22.118  29.706  1.00 139.37 ? 37  ILE I CB  1 
ATOM   3505 C  CG1 . ILE I 1 41 ? -1.403  21.236  30.626  1.00 137.39 ? 37  ILE I CG1 1 
ATOM   3506 C  CG2 . ILE I 1 41 ? -2.339  23.539  30.241  1.00 145.97 ? 37  ILE I CG2 1 
ATOM   3507 C  CD1 . ILE I 1 41 ? 0.037   21.689  30.761  1.00 141.05 ? 37  ILE I CD1 1 
ATOM   3508 N  N   . LYS I 1 42 ? -4.385  22.648  27.518  1.00 136.74 ? 38  LYS I N   1 
ATOM   3509 C  CA  . LYS I 1 42 ? -5.201  23.563  26.736  1.00 139.15 ? 38  LYS I CA  1 
ATOM   3510 C  C   . LYS I 1 42 ? -5.132  23.159  25.272  1.00 136.97 ? 38  LYS I C   1 
ATOM   3511 O  O   . LYS I 1 42 ? -4.189  22.493  24.835  1.00 131.14 ? 38  LYS I O   1 
ATOM   3512 C  CB  . LYS I 1 42 ? -4.741  25.014  26.915  1.00 143.22 ? 38  LYS I CB  1 
ATOM   3513 N  N   . VAL I 1 43 ? -6.161  23.552  24.526  1.00 142.93 ? 39  VAL I N   1 
ATOM   3514 C  CA  . VAL I 1 43 ? -6.187  23.433  23.073  1.00 144.53 ? 39  VAL I CA  1 
ATOM   3515 C  C   . VAL I 1 43 ? -6.586  24.786  22.502  1.00 153.77 ? 39  VAL I C   1 
ATOM   3516 O  O   . VAL I 1 43 ? -7.593  25.366  22.922  1.00 157.13 ? 39  VAL I O   1 
ATOM   3517 C  CB  . VAL I 1 43 ? -7.155  22.333  22.594  1.00 122.95 ? 39  VAL I CB  1 
ATOM   3518 C  CG1 . VAL I 1 43 ? -7.215  22.306  21.074  1.00 122.60 ? 39  VAL I CG1 1 
ATOM   3519 C  CG2 . VAL I 1 43 ? -6.731  20.973  23.140  1.00 116.59 ? 39  VAL I CG2 1 
ATOM   3520 N  N   . LYS I 1 44 ? -5.806  25.284  21.544  1.00 158.72 ? 40  LYS I N   1 
ATOM   3521 C  CA  . LYS I 1 44 ? -6.053  26.586  20.938  1.00 164.91 ? 40  LYS I CA  1 
ATOM   3522 C  C   . LYS I 1 44 ? -6.226  26.434  19.435  1.00 163.17 ? 40  LYS I C   1 
ATOM   3523 O  O   . LYS I 1 44 ? -5.425  25.763  18.776  1.00 159.39 ? 40  LYS I O   1 
ATOM   3524 C  CB  . LYS I 1 44 ? -4.909  27.558  21.239  1.00 168.63 ? 40  LYS I CB  1 
ATOM   3525 N  N   . ILE I 1 45 ? -7.270  27.061  18.904  1.00 166.44 ? 41  ILE I N   1 
ATOM   3526 C  CA  . ILE I 1 45 ? -7.522  27.168  17.472  1.00 166.57 ? 41  ILE I CA  1 
ATOM   3527 C  C   . ILE I 1 45 ? -7.320  28.629  17.076  1.00 173.99 ? 41  ILE I C   1 
ATOM   3528 O  O   . ILE I 1 45 ? -8.107  29.494  17.489  1.00 180.36 ? 41  ILE I O   1 
ATOM   3529 C  CB  . ILE I 1 45 ? -8.930  26.681  17.103  1.00 164.88 ? 41  ILE I CB  1 
ATOM   3530 N  N   . PRO I 1 46 ? -6.292  28.956  16.296  1.00 173.53 ? 42  PRO I N   1 
ATOM   3531 C  CA  . PRO I 1 46 ? -6.006  30.365  16.000  1.00 179.63 ? 42  PRO I CA  1 
ATOM   3532 C  C   . PRO I 1 46 ? -7.070  30.972  15.096  1.00 184.93 ? 42  PRO I C   1 
ATOM   3533 O  O   . PRO I 1 46 ? -7.977  30.300  14.602  1.00 183.41 ? 42  PRO I O   1 
ATOM   3534 C  CB  . PRO I 1 46 ? -4.642  30.316  15.307  1.00 177.53 ? 42  PRO I CB  1 
ATOM   3535 N  N   . LYS I 1 47 ? -6.947  32.282  14.886  1.00 190.66 ? 43  LYS I N   1 
ATOM   3536 C  CA  . LYS I 1 47 ? -7.909  33.042  14.098  1.00 196.50 ? 43  LYS I CA  1 
ATOM   3537 C  C   . LYS I 1 47 ? -7.176  33.817  13.013  1.00 200.93 ? 43  LYS I C   1 
ATOM   3538 O  O   . LYS I 1 47 ? -6.150  34.451  13.282  1.00 204.50 ? 43  LYS I O   1 
ATOM   3539 C  CB  . LYS I 1 47 ? -8.718  33.994  14.988  1.00 201.93 ? 43  LYS I CB  1 
ATOM   3540 C  CG  . LYS I 1 47 ? -9.431  33.291  16.134  1.00 197.53 ? 43  LYS I CG  1 
ATOM   3541 C  CD  . LYS I 1 47 ? -10.840 33.822  16.329  1.00 200.33 ? 43  LYS I CD  1 
ATOM   3542 C  CE  . LYS I 1 47 ? -11.708 32.817  17.072  1.00 186.86 ? 43  LYS I CE  1 
ATOM   3543 N  NZ  . LYS I 1 47 ? -13.156 33.147  16.973  1.00 191.56 ? 43  LYS I NZ  1 
ATOM   3544 N  N   . ASP I 1 48 ? -7.708  33.769  11.794  1.00 200.19 ? 44  ASP I N   1 
ATOM   3545 C  CA  . ASP I 1 48 ? -7.084  34.420  10.649  1.00 203.62 ? 44  ASP I CA  1 
ATOM   3546 C  C   . ASP I 1 48 ? -7.337  35.926  10.708  1.00 212.99 ? 44  ASP I C   1 
ATOM   3547 O  O   . ASP I 1 48 ? -7.814  36.466  11.711  1.00 215.09 ? 44  ASP I O   1 
ATOM   3548 C  CB  . ASP I 1 48 ? -7.590  33.799  9.348   1.00 201.64 ? 44  ASP I CB  1 
ATOM   3549 C  CG  . ASP I 1 48 ? -9.080  33.996  9.146   1.00 207.34 ? 44  ASP I CG  1 
ATOM   3550 O  OD1 . ASP I 1 48 ? -9.809  34.130  10.150  1.00 208.79 ? 44  ASP I OD1 1 
ATOM   3551 O  OD2 . ASP I 1 48 ? -9.524  34.015  7.977   1.00 210.01 ? 44  ASP I OD2 1 
ATOM   3552 N  N   . LYS I 1 49 ? -7.019  36.626  9.617   1.00 219.22 ? 45  LYS I N   1 
ATOM   3553 C  CA  . LYS I 1 49 ? -7.132  38.080  9.581   1.00 231.50 ? 45  LYS I CA  1 
ATOM   3554 C  C   . LYS I 1 49 ? -8.573  38.568  9.638   1.00 235.13 ? 45  LYS I C   1 
ATOM   3555 O  O   . LYS I 1 49 ? -8.794  39.762  9.870   1.00 244.62 ? 45  LYS I O   1 
ATOM   3556 C  CB  . LYS I 1 49 ? -6.453  38.625  8.323   1.00 237.31 ? 45  LYS I CB  1 
ATOM   3557 N  N   . ASP I 1 50 ? -9.552  37.687  9.435   1.00 229.12 ? 46  ASP I N   1 
ATOM   3558 C  CA  . ASP I 1 50 ? -10.954 38.079  9.471   1.00 234.14 ? 46  ASP I CA  1 
ATOM   3559 C  C   . ASP I 1 50 ? -11.625 37.803  10.809  1.00 231.99 ? 46  ASP I C   1 
ATOM   3560 O  O   . ASP I 1 50 ? -12.677 38.390  11.087  1.00 237.92 ? 46  ASP I O   1 
ATOM   3561 C  CB  . ASP I 1 50 ? -11.733 37.359  8.363   1.00 231.59 ? 46  ASP I CB  1 
ATOM   3562 N  N   . GLY I 1 51 ? -11.047 36.938  11.640  1.00 223.87 ? 47  GLY I N   1 
ATOM   3563 C  CA  . GLY I 1 51 ? -11.652 36.537  12.891  1.00 221.25 ? 47  GLY I CA  1 
ATOM   3564 C  C   . GLY I 1 51 ? -12.287 35.163  12.869  1.00 212.31 ? 47  GLY I C   1 
ATOM   3565 O  O   . GLY I 1 51 ? -12.716 34.680  13.924  1.00 202.45 ? 47  GLY I O   1 
ATOM   3566 N  N   . LYS I 1 52 ? -12.360 34.528  11.705  1.00 207.73 ? 48  LYS I N   1 
ATOM   3567 C  CA  . LYS I 1 52 ? -12.928 33.192  11.615  1.00 198.20 ? 48  LYS I CA  1 
ATOM   3568 C  C   . LYS I 1 52 ? -11.967 32.172  12.222  1.00 189.24 ? 48  LYS I C   1 
ATOM   3569 O  O   . LYS I 1 52 ? -10.752 32.273  12.026  1.00 188.05 ? 48  LYS I O   1 
ATOM   3570 C  CB  . LYS I 1 52 ? -13.226 32.834  10.159  1.00 196.49 ? 48  LYS I CB  1 
ATOM   3571 N  N   . PRO I 1 53 ? -12.474 31.193  12.972  1.00 183.08 ? 49  PRO I N   1 
ATOM   3572 C  CA  . PRO I 1 53 ? -11.586 30.151  13.504  1.00 174.62 ? 49  PRO I CA  1 
ATOM   3573 C  C   . PRO I 1 53 ? -10.902 29.401  12.367  1.00 171.50 ? 49  PRO I C   1 
ATOM   3574 O  O   . PRO I 1 53 ? -11.533 29.026  11.376  1.00 170.95 ? 49  PRO I O   1 
ATOM   3575 C  CB  . PRO I 1 53 ? -12.536 29.248  14.300  1.00 169.43 ? 49  PRO I CB  1 
ATOM   3576 N  N   . LYS I 1 54 ? -9.602  29.179  12.524  1.00 169.44 ? 50  LYS I N   1 
ATOM   3577 C  CA  . LYS I 1 54 ? -8.818  28.500  11.508  1.00 158.95 ? 50  LYS I CA  1 
ATOM   3578 C  C   . LYS I 1 54 ? -9.086  26.997  11.515  1.00 150.80 ? 50  LYS I C   1 
ATOM   3579 O  O   . LYS I 1 54 ? -9.759  26.454  12.396  1.00 149.54 ? 50  LYS I O   1 
ATOM   3580 C  CB  . LYS I 1 54 ? -7.331  28.774  11.719  1.00 158.49 ? 50  LYS I CB  1 
ATOM   3581 N  N   . GLN I 1 55 ? -8.535  26.321  10.510  1.00 146.90 ? 51  GLN I N   1 
ATOM   3582 C  CA  . GLN I 1 55 ? -8.767  24.901  10.299  1.00 159.30 ? 51  GLN I CA  1 
ATOM   3583 C  C   . GLN I 1 55 ? -7.753  24.028  11.022  1.00 151.76 ? 51  GLN I C   1 
ATOM   3584 O  O   . GLN I 1 55 ? -7.683  22.825  10.748  1.00 146.27 ? 51  GLN I O   1 
ATOM   3585 C  CB  . GLN I 1 55 ? -8.752  24.583  8.799   1.00 139.01 ? 51  GLN I CB  1 
ATOM   3586 N  N   . PHE I 1 56 ? -6.973  24.598  11.938  1.00 151.63 ? 52  PHE I N   1 
ATOM   3587 C  CA  . PHE I 1 56 ? -5.982  23.846  12.691  1.00 149.44 ? 52  PHE I CA  1 
ATOM   3588 C  C   . PHE I 1 56 ? -6.061  24.229  14.163  1.00 153.63 ? 52  PHE I C   1 
ATOM   3589 O  O   . PHE I 1 56 ? -6.668  25.235  14.540  1.00 160.20 ? 52  PHE I O   1 
ATOM   3590 C  CB  . PHE I 1 56 ? -4.564  24.089  12.149  1.00 149.33 ? 52  PHE I CB  1 
ATOM   3591 N  N   . ALA I 1 57 ? -5.432  23.407  15.001  1.00 150.32 ? 53  ALA I N   1 
ATOM   3592 C  CA  . ALA I 1 57 ? -5.429  23.633  16.438  1.00 147.67 ? 53  ALA I CA  1 
ATOM   3593 C  C   . ALA I 1 57 ? -4.117  23.136  17.029  1.00 142.32 ? 53  ALA I C   1 
ATOM   3594 O  O   . ALA I 1 57 ? -3.448  22.264  16.467  1.00 137.59 ? 53  ALA I O   1 
ATOM   3595 C  CB  . ALA I 1 57 ? -6.619  22.945  17.117  1.00 145.37 ? 53  ALA I CB  1 
ATOM   3596 N  N   . PHE I 1 58 ? -3.759  23.705  18.178  1.00 142.26 ? 54  PHE I N   1 
ATOM   3597 C  CA  . PHE I 1 58 ? -2.608  23.276  18.964  1.00 137.56 ? 54  PHE I CA  1 
ATOM   3598 C  C   . PHE I 1 58 ? -3.096  22.604  20.240  1.00 134.16 ? 54  PHE I C   1 
ATOM   3599 O  O   . PHE I 1 58 ? -3.869  23.198  20.998  1.00 137.64 ? 54  PHE I O   1 
ATOM   3600 C  CB  . PHE I 1 58 ? -1.705  24.461  19.310  1.00 141.64 ? 54  PHE I CB  1 
ATOM   3601 C  CG  . PHE I 1 58 ? -1.055  25.103  18.116  1.00 142.69 ? 54  PHE I CG  1 
ATOM   3602 C  CD1 . PHE I 1 58 ? -0.004  24.480  17.463  1.00 139.30 ? 54  PHE I CD1 1 
ATOM   3603 C  CD2 . PHE I 1 58 ? -1.489  26.333  17.650  1.00 148.17 ? 54  PHE I CD2 1 
ATOM   3604 C  CE1 . PHE I 1 58 ? 0.600   25.075  16.369  1.00 141.81 ? 54  PHE I CE1 1 
ATOM   3605 C  CE2 . PHE I 1 58 ? -0.891  26.928  16.555  1.00 150.35 ? 54  PHE I CE2 1 
ATOM   3606 C  CZ  . PHE I 1 58 ? 0.153   26.297  15.913  1.00 147.17 ? 54  PHE I CZ  1 
ATOM   3607 N  N   . VAL I 1 59 ? -2.639  21.377  20.477  1.00 128.57 ? 55  VAL I N   1 
ATOM   3608 C  CA  . VAL I 1 59 ? -2.971  20.625  21.683  1.00 127.61 ? 55  VAL I CA  1 
ATOM   3609 C  C   . VAL I 1 59 ? -1.734  20.578  22.569  1.00 131.22 ? 55  VAL I C   1 
ATOM   3610 O  O   . VAL I 1 59 ? -0.681  20.079  22.150  1.00 130.42 ? 55  VAL I O   1 
ATOM   3611 C  CB  . VAL I 1 59 ? -3.467  19.208  21.353  1.00 119.22 ? 55  VAL I CB  1 
ATOM   3612 N  N   . ASN I 1 60 ? -1.864  21.074  23.798  1.00 134.70 ? 56  ASN I N   1 
ATOM   3613 C  CA  . ASN I 1 60 ? -0.755  21.157  24.744  1.00 134.85 ? 56  ASN I CA  1 
ATOM   3614 C  C   . ASN I 1 60 ? -0.919  20.082  25.812  1.00 132.88 ? 56  ASN I C   1 
ATOM   3615 O  O   . ASN I 1 60 ? -1.908  20.082  26.553  1.00 133.27 ? 56  ASN I O   1 
ATOM   3616 C  CB  . ASN I 1 60 ? -0.688  22.546  25.382  1.00 138.25 ? 56  ASN I CB  1 
ATOM   3617 N  N   . PHE I 1 61 ? 0.060   19.183  25.896  1.00 132.17 ? 57  PHE I N   1 
ATOM   3618 C  CA  . PHE I 1 61 ? 0.034   18.051  26.810  1.00 131.74 ? 57  PHE I CA  1 
ATOM   3619 C  C   . PHE I 1 61 ? 0.705   18.390  28.139  1.00 140.21 ? 57  PHE I C   1 
ATOM   3620 O  O   . PHE I 1 61 ? 1.526   19.305  28.240  1.00 144.91 ? 57  PHE I O   1 
ATOM   3621 C  CB  . PHE I 1 61 ? 0.712   16.837  26.173  1.00 123.05 ? 57  PHE I CB  1 
ATOM   3622 C  CG  . PHE I 1 61 ? -0.153  16.114  25.186  1.00 116.83 ? 57  PHE I CG  1 
ATOM   3623 C  CD1 . PHE I 1 61 ? -1.143  15.247  25.620  1.00 113.85 ? 57  PHE I CD1 1 
ATOM   3624 C  CD2 . PHE I 1 61 ? 0.000   16.320  23.828  1.00 115.57 ? 57  PHE I CD2 1 
ATOM   3625 C  CE1 . PHE I 1 61 ? -1.945  14.581  24.717  1.00 109.22 ? 57  PHE I CE1 1 
ATOM   3626 C  CE2 . PHE I 1 61 ? -0.805  15.658  22.920  1.00 111.74 ? 57  PHE I CE2 1 
ATOM   3627 C  CZ  . PHE I 1 61 ? -1.779  14.791  23.368  1.00 108.06 ? 57  PHE I CZ  1 
ATOM   3628 N  N   . LYS I 1 62 ? 0.338   17.621  29.167  1.00 143.27 ? 58  LYS I N   1 
ATOM   3629 C  CA  . LYS I 1 62 ? 0.929   17.799  30.489  1.00 149.74 ? 58  LYS I CA  1 
ATOM   3630 C  C   . LYS I 1 62 ? 2.391   17.368  30.522  1.00 152.10 ? 58  LYS I C   1 
ATOM   3631 O  O   . LYS I 1 62 ? 3.217   18.006  31.188  1.00 156.63 ? 58  LYS I O   1 
ATOM   3632 C  CB  . LYS I 1 62 ? 0.111   17.007  31.513  1.00 149.19 ? 58  LYS I CB  1 
ATOM   3633 C  CG  . LYS I 1 62 ? 0.611   17.051  32.944  1.00 153.05 ? 58  LYS I CG  1 
ATOM   3634 C  CD  . LYS I 1 62 ? -0.219  16.104  33.799  1.00 151.46 ? 58  LYS I CD  1 
ATOM   3635 C  CE  . LYS I 1 62 ? 0.235   16.074  35.246  1.00 154.48 ? 58  LYS I CE  1 
ATOM   3636 N  NZ  . LYS I 1 62 ? -0.477  15.001  35.997  1.00 151.82 ? 58  LYS I NZ  1 
ATOM   3637 N  N   . HIS I 1 63 ? 2.734   16.299  29.807  1.00 147.71 ? 59  HIS I N   1 
ATOM   3638 C  CA  . HIS I 1 63 ? 4.086   15.759  29.802  1.00 148.61 ? 59  HIS I CA  1 
ATOM   3639 C  C   . HIS I 1 63 ? 4.546   15.548  28.368  1.00 146.63 ? 59  HIS I C   1 
ATOM   3640 O  O   . HIS I 1 63 ? 3.757   15.144  27.508  1.00 143.89 ? 59  HIS I O   1 
ATOM   3641 C  CB  . HIS I 1 63 ? 4.175   14.436  30.572  1.00 146.70 ? 59  HIS I CB  1 
ATOM   3642 C  CG  . HIS I 1 63 ? 3.676   14.517  31.981  1.00 148.90 ? 59  HIS I CG  1 
ATOM   3643 N  ND1 . HIS I 1 63 ? 4.126   15.460  32.880  1.00 152.51 ? 59  HIS I ND1 1 
ATOM   3644 C  CD2 . HIS I 1 63 ? 2.769   13.763  32.646  1.00 147.29 ? 59  HIS I CD2 1 
ATOM   3645 C  CE1 . HIS I 1 63 ? 3.518   15.282  34.040  1.00 153.57 ? 59  HIS I CE1 1 
ATOM   3646 N  NE2 . HIS I 1 63 ? 2.690   14.260  33.924  1.00 150.64 ? 59  HIS I NE2 1 
ATOM   3647 N  N   . GLU I 1 64 ? 5.827   15.835  28.114  1.00 148.37 ? 60  GLU I N   1 
ATOM   3648 C  CA  . GLU I 1 64 ? 6.385   15.651  26.778  1.00 145.65 ? 60  GLU I CA  1 
ATOM   3649 C  C   . GLU I 1 64 ? 6.191   14.226  26.278  1.00 138.42 ? 60  GLU I C   1 
ATOM   3650 O  O   . GLU I 1 64 ? 6.037   14.003  25.071  1.00 134.60 ? 60  GLU I O   1 
ATOM   3651 C  CB  . GLU I 1 64 ? 7.870   16.019  26.774  1.00 147.71 ? 60  GLU I CB  1 
ATOM   3652 N  N   . VAL I 1 65 ? 6.205   13.249  27.188  1.00 136.33 ? 61  VAL I N   1 
ATOM   3653 C  CA  . VAL I 1 65 ? 6.056   11.850  26.797  1.00 132.44 ? 61  VAL I CA  1 
ATOM   3654 C  C   . VAL I 1 65 ? 4.692   11.594  26.168  1.00 130.96 ? 61  VAL I C   1 
ATOM   3655 O  O   . VAL I 1 65 ? 4.534   10.657  25.378  1.00 131.07 ? 61  VAL I O   1 
ATOM   3656 C  CB  . VAL I 1 65 ? 6.293   10.937  28.014  1.00 128.22 ? 61  VAL I CB  1 
ATOM   3657 N  N   . SER I 1 66 ? 3.686   12.407  26.506  1.00 130.09 ? 62  SER I N   1 
ATOM   3658 C  CA  . SER I 1 66 ? 2.359   12.243  25.920  1.00 128.40 ? 62  SER I CA  1 
ATOM   3659 C  C   . SER I 1 66 ? 2.312   12.585  24.435  1.00 124.49 ? 62  SER I C   1 
ATOM   3660 O  O   . SER I 1 66 ? 1.419   12.100  23.731  1.00 120.97 ? 62  SER I O   1 
ATOM   3661 C  CB  . SER I 1 66 ? 1.336   13.097  26.669  1.00 130.11 ? 62  SER I CB  1 
ATOM   3662 O  OG  . SER I 1 66 ? 1.110   12.601  27.975  1.00 131.93 ? 62  SER I OG  1 
ATOM   3663 N  N   . VAL I 1 67 ? 3.247   13.394  23.941  1.00 122.50 ? 63  VAL I N   1 
ATOM   3664 C  CA  . VAL I 1 67 ? 3.176   13.932  22.582  1.00 118.86 ? 63  VAL I CA  1 
ATOM   3665 C  C   . VAL I 1 67 ? 3.317   12.823  21.542  1.00 115.52 ? 63  VAL I C   1 
ATOM   3666 O  O   . VAL I 1 67 ? 2.473   12.737  20.641  1.00 116.42 ? 63  VAL I O   1 
ATOM   3667 C  CB  . VAL I 1 67 ? 4.225   15.035  22.361  1.00 120.90 ? 63  VAL I CB  1 
ATOM   3668 N  N   . PRO I 1 68 ? 4.350   11.969  21.592  1.00 113.10 ? 64  PRO I N   1 
ATOM   3669 C  CA  . PRO I 1 68 ? 4.430   10.894  20.589  1.00 110.19 ? 64  PRO I CA  1 
ATOM   3670 C  C   . PRO I 1 68 ? 3.284   9.902   20.679  1.00 109.11 ? 64  PRO I C   1 
ATOM   3671 O  O   . PRO I 1 68 ? 2.909   9.315   19.656  1.00 109.64 ? 64  PRO I O   1 
ATOM   3672 C  CB  . PRO I 1 68 ? 5.777   10.229  20.891  1.00 108.67 ? 64  PRO I CB  1 
ATOM   3673 C  CG  . PRO I 1 68 ? 5.999   10.492  22.326  1.00 110.21 ? 64  PRO I CG  1 
ATOM   3674 C  CD  . PRO I 1 68 ? 5.465   11.875  22.552  1.00 114.71 ? 64  PRO I CD  1 
ATOM   3675 N  N   . TYR I 1 69 ? 2.733   9.676   21.875  1.00 107.66 ? 65  TYR I N   1 
ATOM   3676 C  CA  . TYR I 1 69 ? 1.641   8.716   22.019  1.00 100.04 ? 65  TYR I CA  1 
ATOM   3677 C  C   . TYR I 1 69 ? 0.403   9.166   21.252  1.00 96.32  ? 65  TYR I C   1 
ATOM   3678 O  O   . TYR I 1 69 ? -0.222  8.366   20.546  1.00 93.55  ? 65  TYR I O   1 
ATOM   3679 C  CB  . TYR I 1 69 ? 1.315   8.502   23.496  1.00 99.31  ? 65  TYR I CB  1 
ATOM   3680 C  CG  . TYR I 1 69 ? 0.346   7.368   23.747  1.00 98.36  ? 65  TYR I CG  1 
ATOM   3681 C  CD1 . TYR I 1 69 ? -1.026  7.592   23.800  1.00 99.84  ? 65  TYR I CD1 1 
ATOM   3682 C  CD2 . TYR I 1 69 ? 0.805   6.071   23.931  1.00 97.81  ? 65  TYR I CD2 1 
ATOM   3683 C  CE1 . TYR I 1 69 ? -1.913  6.554   24.029  1.00 100.00 ? 65  TYR I CE1 1 
ATOM   3684 C  CE2 . TYR I 1 69 ? -0.076  5.022   24.160  1.00 98.72  ? 65  TYR I CE2 1 
ATOM   3685 C  CZ  . TYR I 1 69 ? -1.432  5.272   24.208  1.00 99.60  ? 65  TYR I CZ  1 
ATOM   3686 O  OH  . TYR I 1 69 ? -2.310  4.239   24.438  1.00 98.54  ? 65  TYR I OH  1 
ATOM   3687 N  N   . ALA I 1 70 ? 0.018   10.439  21.395  1.00 95.82  ? 66  ALA I N   1 
ATOM   3688 C  CA  . ALA I 1 70 ? -1.162  10.937  20.692  1.00 96.30  ? 66  ALA I CA  1 
ATOM   3689 C  C   . ALA I 1 70 ? -1.009  10.808  19.184  1.00 96.09  ? 66  ALA I C   1 
ATOM   3690 O  O   . ALA I 1 70 ? -1.979  10.510  18.476  1.00 97.35  ? 66  ALA I O   1 
ATOM   3691 C  CB  . ALA I 1 70 ? -1.426  12.393  21.069  1.00 100.23 ? 66  ALA I CB  1 
ATOM   3692 N  N   . MET I 1 71 ? 0.205   11.024  18.676  1.00 96.39  ? 67  MET I N   1 
ATOM   3693 C  CA  . MET I 1 71 ? 0.454   10.887  17.246  1.00 96.33  ? 67  MET I CA  1 
ATOM   3694 C  C   . MET I 1 71 ? 0.140   9.474   16.770  1.00 91.80  ? 67  MET I C   1 
ATOM   3695 O  O   . MET I 1 71 ? -0.516  9.285   15.740  1.00 91.13  ? 67  MET I O   1 
ATOM   3696 C  CB  . MET I 1 71 ? 1.903   11.262  16.935  1.00 101.47 ? 67  MET I CB  1 
ATOM   3697 C  CG  . MET I 1 71 ? 2.371   10.912  15.522  1.00 103.89 ? 67  MET I CG  1 
ATOM   3698 S  SD  . MET I 1 71 ? 1.681   11.959  14.219  1.00 107.85 ? 67  MET I SD  1 
ATOM   3699 C  CE  . MET I 1 71 ? 2.794   13.355  14.299  1.00 113.55 ? 67  MET I CE  1 
ATOM   3700 N  N   . ASN I 1 72 ? 0.601   8.464   17.510  1.00 91.73  ? 68  ASN I N   1 
ATOM   3701 C  CA  . ASN I 1 72 ? 0.375   7.085   17.087  1.00 93.87  ? 68  ASN I CA  1 
ATOM   3702 C  C   . ASN I 1 72 ? -1.086  6.682   17.264  1.00 95.06  ? 68  ASN I C   1 
ATOM   3703 O  O   . ASN I 1 72 ? -1.646  5.975   16.418  1.00 94.65  ? 68  ASN I O   1 
ATOM   3704 C  CB  . ASN I 1 72 ? 1.293   6.140   17.859  1.00 93.78  ? 68  ASN I CB  1 
ATOM   3705 N  N   . LEU I 1 73 ? -1.715  7.101   18.365  1.00 96.73  ? 69  LEU I N   1 
ATOM   3706 C  CA  . LEU I 1 73 ? -3.090  6.697   18.640  1.00 94.21  ? 69  LEU I CA  1 
ATOM   3707 C  C   . LEU I 1 73 ? -4.100  7.436   17.768  1.00 95.85  ? 69  LEU I C   1 
ATOM   3708 O  O   . LEU I 1 73 ? -5.081  6.838   17.308  1.00 94.33  ? 69  LEU I O   1 
ATOM   3709 C  CB  . LEU I 1 73 ? -3.423  6.922   20.118  1.00 92.13  ? 69  LEU I CB  1 
ATOM   3710 C  CG  . LEU I 1 73 ? -4.843  6.518   20.532  1.00 88.07  ? 69  LEU I CG  1 
ATOM   3711 C  CD1 . LEU I 1 73 ? -4.981  5.007   20.629  1.00 84.89  ? 69  LEU I CD1 1 
ATOM   3712 C  CD2 . LEU I 1 73 ? -5.256  7.197   21.832  1.00 88.63  ? 69  LEU I CD2 1 
ATOM   3713 N  N   . LEU I 1 74 ? -3.887  8.734   17.532  1.00 99.33  ? 70  LEU I N   1 
ATOM   3714 C  CA  . LEU I 1 74 ? -4.954  9.594   17.038  1.00 103.99 ? 70  LEU I CA  1 
ATOM   3715 C  C   . LEU I 1 74 ? -4.746  10.174  15.647  1.00 106.44 ? 70  LEU I C   1 
ATOM   3716 O  O   . LEU I 1 74 ? -5.687  10.773  15.114  1.00 109.75 ? 70  LEU I O   1 
ATOM   3717 C  CB  . LEU I 1 74 ? -5.189  10.756  18.012  1.00 108.19 ? 70  LEU I CB  1 
ATOM   3718 C  CG  . LEU I 1 74 ? -5.569  10.286  19.410  1.00 109.41 ? 70  LEU I CG  1 
ATOM   3719 C  CD1 . LEU I 1 74 ? -5.602  11.457  20.367  1.00 114.26 ? 70  LEU I CD1 1 
ATOM   3720 C  CD2 . LEU I 1 74 ? -6.903  9.582   19.373  1.00 109.11 ? 70  LEU I CD2 1 
ATOM   3721 N  N   . ASN I 1 75 ? -3.563  10.051  15.052  1.00 104.78 ? 71  ASN I N   1 
ATOM   3722 C  CA  . ASN I 1 75 ? -3.371  10.613  13.720  1.00 107.53 ? 71  ASN I CA  1 
ATOM   3723 C  C   . ASN I 1 75 ? -4.286  9.919   12.722  1.00 105.26 ? 71  ASN I C   1 
ATOM   3724 O  O   . ASN I 1 75 ? -4.401  8.690   12.716  1.00 102.15 ? 71  ASN I O   1 
ATOM   3725 C  CB  . ASN I 1 75 ? -1.918  10.491  13.272  1.00 109.51 ? 71  ASN I CB  1 
ATOM   3726 C  CG  . ASN I 1 75 ? -1.611  11.364  12.068  1.00 114.98 ? 71  ASN I CG  1 
ATOM   3727 O  OD1 . ASN I 1 75 ? -2.292  12.364  11.823  1.00 118.06 ? 71  ASN I OD1 1 
ATOM   3728 N  ND2 . ASN I 1 75 ? -0.588  10.989  11.307  1.00 117.05 ? 71  ASN I ND2 1 
ATOM   3729 N  N   . GLY I 1 76 ? -4.955  10.716  11.891  1.00 106.22 ? 72  GLY I N   1 
ATOM   3730 C  CA  . GLY I 1 76 ? -5.801  10.188  10.849  1.00 102.99 ? 72  GLY I CA  1 
ATOM   3731 C  C   . GLY I 1 76 ? -7.209  9.845   11.274  1.00 103.94 ? 72  GLY I C   1 
ATOM   3732 O  O   . GLY I 1 76 ? -8.019  9.486   10.414  1.00 105.50 ? 72  GLY I O   1 
ATOM   3733 N  N   . ILE I 1 77 ? -7.528  9.940   12.567  1.00 101.07 ? 73  ILE I N   1 
ATOM   3734 C  CA  . ILE I 1 77 ? -8.886  9.666   13.021  1.00 96.22  ? 73  ILE I CA  1 
ATOM   3735 C  C   . ILE I 1 77 ? -9.840  10.643  12.350  1.00 100.95 ? 73  ILE I C   1 
ATOM   3736 O  O   . ILE I 1 77 ? -9.581  11.853  12.295  1.00 105.72 ? 73  ILE I O   1 
ATOM   3737 C  CB  . ILE I 1 77 ? -8.967  9.772   14.551  1.00 88.54  ? 73  ILE I CB  1 
ATOM   3738 C  CG1 . ILE I 1 77 ? -8.191  8.629   15.206  1.00 78.19  ? 73  ILE I CG1 1 
ATOM   3739 C  CG2 . ILE I 1 77 ? -10.412 9.770   15.012  1.00 88.14  ? 73  ILE I CG2 1 
ATOM   3740 C  CD1 . ILE I 1 77 ? -8.745  7.258   14.899  1.00 73.41  ? 73  ILE I CD1 1 
ATOM   3741 N  N   . LYS I 1 78 ? -10.953 10.125  11.836  1.00 101.48 ? 74  LYS I N   1 
ATOM   3742 C  CA  . LYS I 1 78 ? -11.904 10.973  11.134  1.00 104.96 ? 74  LYS I CA  1 
ATOM   3743 C  C   . LYS I 1 78 ? -12.811 11.661  12.141  1.00 107.36 ? 74  LYS I C   1 
ATOM   3744 O  O   . LYS I 1 78 ? -13.382 11.011  13.022  1.00 107.44 ? 74  LYS I O   1 
ATOM   3745 C  CB  . LYS I 1 78 ? -12.733 10.151  10.145  1.00 102.51 ? 74  LYS I CB  1 
ATOM   3746 N  N   . LEU I 1 79 ? -12.932 12.981  12.013  1.00 111.90 ? 75  LEU I N   1 
ATOM   3747 C  CA  . LEU I 1 79 ? -13.881 13.786  12.778  1.00 117.89 ? 75  LEU I CA  1 
ATOM   3748 C  C   . LEU I 1 79 ? -14.874 14.415  11.810  1.00 126.05 ? 75  LEU I C   1 
ATOM   3749 O  O   . LEU I 1 79 ? -14.490 15.244  10.976  1.00 131.04 ? 75  LEU I O   1 
ATOM   3750 C  CB  . LEU I 1 79 ? -13.161 14.852  13.603  1.00 117.52 ? 75  LEU I CB  1 
ATOM   3751 C  CG  . LEU I 1 79 ? -12.422 14.354  14.848  1.00 111.51 ? 75  LEU I CG  1 
ATOM   3752 C  CD1 . LEU I 1 79 ? -11.826 15.518  15.628  1.00 112.32 ? 75  LEU I CD1 1 
ATOM   3753 C  CD2 . LEU I 1 79 ? -13.344 13.520  15.725  1.00 108.58 ? 75  LEU I CD2 1 
ATOM   3754 N  N   . TYR I 1 80 ? -16.146 14.022  11.926  1.00 125.14 ? 76  TYR I N   1 
ATOM   3755 C  CA  . TYR I 1 80 ? -17.204 14.487  11.030  1.00 129.90 ? 76  TYR I CA  1 
ATOM   3756 C  C   . TYR I 1 80 ? -16.858 14.167  9.578   1.00 132.38 ? 76  TYR I C   1 
ATOM   3757 O  O   . TYR I 1 80 ? -17.139 14.948  8.667   1.00 141.13 ? 76  TYR I O   1 
ATOM   3758 C  CB  . TYR I 1 80 ? -17.458 15.988  11.199  1.00 132.73 ? 76  TYR I CB  1 
ATOM   3759 C  CG  . TYR I 1 80 ? -17.903 16.412  12.582  1.00 131.29 ? 76  TYR I CG  1 
ATOM   3760 C  CD1 . TYR I 1 80 ? -19.123 16.003  13.104  1.00 130.52 ? 76  TYR I CD1 1 
ATOM   3761 C  CD2 . TYR I 1 80 ? -17.102 17.240  13.359  1.00 131.07 ? 76  TYR I CD2 1 
ATOM   3762 C  CE1 . TYR I 1 80 ? -19.527 16.403  14.365  1.00 131.26 ? 76  TYR I CE1 1 
ATOM   3763 C  CE2 . TYR I 1 80 ? -17.496 17.643  14.616  1.00 131.78 ? 76  TYR I CE2 1 
ATOM   3764 C  CZ  . TYR I 1 80 ? -18.707 17.222  15.116  1.00 132.77 ? 76  TYR I CZ  1 
ATOM   3765 O  OH  . TYR I 1 80 ? -19.099 17.624  16.372  1.00 136.56 ? 76  TYR I OH  1 
ATOM   3766 N  N   . GLY I 1 81 ? -16.243 13.006  9.363   1.00 125.37 ? 77  GLY I N   1 
ATOM   3767 C  CA  . GLY I 1 81 ? -15.905 12.555  8.032   1.00 125.40 ? 77  GLY I CA  1 
ATOM   3768 C  C   . GLY I 1 81 ? -14.584 13.062  7.499   1.00 126.91 ? 77  GLY I C   1 
ATOM   3769 O  O   . GLY I 1 81 ? -14.189 12.662  6.398   1.00 124.32 ? 77  GLY I O   1 
ATOM   3770 N  N   . ARG I 1 82 ? -13.884 13.923  8.240   1.00 130.06 ? 78  ARG I N   1 
ATOM   3771 C  CA  . ARG I 1 82 ? -12.635 14.516  7.779   1.00 131.74 ? 78  ARG I CA  1 
ATOM   3772 C  C   . ARG I 1 82 ? -11.473 14.024  8.628   1.00 130.43 ? 78  ARG I C   1 
ATOM   3773 O  O   . ARG I 1 82 ? -11.469 14.239  9.849   1.00 132.68 ? 78  ARG I O   1 
ATOM   3774 C  CB  . ARG I 1 82 ? -12.724 16.040  7.828   1.00 136.14 ? 78  ARG I CB  1 
ATOM   3775 C  CG  . ARG I 1 82 ? -11.575 16.763  7.154   1.00 135.84 ? 78  ARG I CG  1 
ATOM   3776 C  CD  . ARG I 1 82 ? -11.799 18.266  7.185   1.00 141.36 ? 78  ARG I CD  1 
ATOM   3777 N  NE  . ARG I 1 82 ? -11.817 18.856  5.851   1.00 143.72 ? 78  ARG I NE  1 
ATOM   3778 C  CZ  . ARG I 1 82 ? -11.830 20.163  5.616   1.00 149.99 ? 78  ARG I CZ  1 
ATOM   3779 N  NH1 . ARG I 1 82 ? -11.821 21.021  6.627   1.00 152.69 ? 78  ARG I NH1 1 
ATOM   3780 N  NH2 . ARG I 1 82 ? -11.850 20.615  4.370   1.00 154.26 ? 78  ARG I NH2 1 
ATOM   3781 N  N   . PRO I 1 83 ? -10.480 13.363  8.032   1.00 127.49 ? 79  PRO I N   1 
ATOM   3782 C  CA  . PRO I 1 83 ? -9.340  12.854  8.815   1.00 123.74 ? 79  PRO I CA  1 
ATOM   3783 C  C   . PRO I 1 83 ? -8.439  13.975  9.316   1.00 126.22 ? 79  PRO I C   1 
ATOM   3784 O  O   . PRO I 1 83 ? -7.979  14.813  8.538   1.00 132.37 ? 79  PRO I O   1 
ATOM   3785 C  CB  . PRO I 1 83 ? -8.601  11.947  7.823   1.00 119.07 ? 79  PRO I CB  1 
ATOM   3786 C  CG  . PRO I 1 83 ? -9.040  12.411  6.470   1.00 121.51 ? 79  PRO I CG  1 
ATOM   3787 C  CD  . PRO I 1 83 ? -10.437 12.934  6.623   1.00 125.83 ? 79  PRO I CD  1 
ATOM   3788 N  N   . ILE I 1 84 ? -8.207  13.997  10.633  1.00 119.70 ? 80  ILE I N   1 
ATOM   3789 C  CA  . ILE I 1 84 ? -7.302  14.983  11.219  1.00 116.42 ? 80  ILE I CA  1 
ATOM   3790 C  C   . ILE I 1 84 ? -5.856  14.643  10.861  1.00 113.04 ? 80  ILE I C   1 
ATOM   3791 O  O   . ILE I 1 84 ? -5.496  13.473  10.673  1.00 108.31 ? 80  ILE I O   1 
ATOM   3792 C  CB  . ILE I 1 84 ? -7.500  15.065  12.744  1.00 115.43 ? 80  ILE I CB  1 
ATOM   3793 C  CG1 . ILE I 1 84 ? -7.012  13.787  13.432  1.00 109.89 ? 80  ILE I CG1 1 
ATOM   3794 C  CG2 . ILE I 1 84 ? -8.956  15.332  13.082  1.00 118.55 ? 80  ILE I CG2 1 
ATOM   3795 C  CD1 . ILE I 1 84 ? -7.128  13.836  14.947  1.00 109.21 ? 80  ILE I CD1 1 
ATOM   3796 N  N   . LYS I 1 85 ? -5.017  15.679  10.755  1.00 114.20 ? 81  LYS I N   1 
ATOM   3797 C  CA  . LYS I 1 85 ? -3.607  15.538  10.381  1.00 107.23 ? 81  LYS I CA  1 
ATOM   3798 C  C   . LYS I 1 85 ? -2.732  16.138  11.481  1.00 106.41 ? 81  LYS I C   1 
ATOM   3799 O  O   . LYS I 1 85 ? -2.689  17.363  11.649  1.00 98.42  ? 81  LYS I O   1 
ATOM   3800 C  CB  . LYS I 1 85 ? -3.335  16.203  9.031   1.00 108.90 ? 81  LYS I CB  1 
ATOM   3801 N  N   . ILE I 1 86 ? -2.026  15.272  12.210  1.00 100.59 ? 82  ILE I N   1 
ATOM   3802 C  CA  . ILE I 1 86 ? -1.218  15.638  13.374  1.00 101.94 ? 82  ILE I CA  1 
ATOM   3803 C  C   . ILE I 1 86 ? 0.247   15.778  12.975  1.00 104.02 ? 82  ILE I C   1 
ATOM   3804 O  O   . ILE I 1 86 ? 0.851   14.823  12.475  1.00 101.71 ? 82  ILE I O   1 
ATOM   3805 C  CB  . ILE I 1 86 ? -1.351  14.601  14.499  1.00 95.30  ? 82  ILE I CB  1 
ATOM   3806 C  CG1 . ILE I 1 86 ? -2.810  14.404  14.905  1.00 93.01  ? 82  ILE I CG1 1 
ATOM   3807 C  CG2 . ILE I 1 86 ? -0.513  15.025  15.700  1.00 88.49  ? 82  ILE I CG2 1 
ATOM   3808 C  CD1 . ILE I 1 86 ? -2.980  13.403  16.040  1.00 87.59  ? 82  ILE I CD1 1 
ATOM   3809 N  N   . GLN I 1 87 ? 0.803   16.986  13.098  1.00 109.62 ? 83  GLN I N   1 
ATOM   3810 C  CA  . GLN I 1 87 ? 2.242   17.196  12.964  1.00 111.16 ? 83  GLN I CA  1 
ATOM   3811 C  C   . GLN I 1 87 ? 2.899   17.587  14.288  1.00 115.35 ? 83  GLN I C   1 
ATOM   3812 O  O   . GLN I 1 87 ? 2.290   18.245  15.137  1.00 117.45 ? 83  GLN I O   1 
ATOM   3813 C  CB  . GLN I 1 87 ? 2.552   18.253  11.905  1.00 113.78 ? 83  GLN I CB  1 
ATOM   3814 C  CG  . GLN I 1 87 ? 2.047   17.868  10.534  1.00 112.35 ? 83  GLN I CG  1 
ATOM   3815 C  CD  . GLN I 1 87 ? 2.161   19.000  9.543   1.00 116.99 ? 83  GLN I CD  1 
ATOM   3816 O  OE1 . GLN I 1 87 ? 2.527   20.120  9.902   1.00 121.01 ? 83  GLN I OE1 1 
ATOM   3817 N  NE2 . GLN I 1 87 ? 1.857   18.713  8.284   1.00 117.24 ? 83  GLN I NE2 1 
ATOM   3818 N  N   . PHE I 1 88 ? 4.155   17.169  14.457  1.00 118.28 ? 84  PHE I N   1 
ATOM   3819 C  CA  . PHE I 1 88 ? 4.955   17.626  15.587  1.00 122.50 ? 84  PHE I CA  1 
ATOM   3820 C  C   . PHE I 1 88 ? 5.318   19.098  15.416  1.00 127.21 ? 84  PHE I C   1 
ATOM   3821 O  O   . PHE I 1 88 ? 5.496   19.589  14.299  1.00 127.27 ? 84  PHE I O   1 
ATOM   3822 C  CB  . PHE I 1 88 ? 6.243   16.807  15.721  1.00 122.82 ? 84  PHE I CB  1 
ATOM   3823 C  CG  . PHE I 1 88 ? 6.017   15.365  16.067  1.00 121.00 ? 84  PHE I CG  1 
ATOM   3824 C  CD1 . PHE I 1 88 ? 5.413   15.012  17.262  1.00 122.12 ? 84  PHE I CD1 1 
ATOM   3825 C  CD2 . PHE I 1 88 ? 6.422   14.360  15.204  1.00 119.51 ? 84  PHE I CD2 1 
ATOM   3826 C  CE1 . PHE I 1 88 ? 5.204   13.684  17.585  1.00 118.70 ? 84  PHE I CE1 1 
ATOM   3827 C  CE2 . PHE I 1 88 ? 6.217   13.030  15.522  1.00 115.46 ? 84  PHE I CE2 1 
ATOM   3828 C  CZ  . PHE I 1 88 ? 5.608   12.692  16.713  1.00 115.02 ? 84  PHE I CZ  1 
ATOM   3829 N  N   . ARG I 1 89 ? 5.443   19.805  16.538  1.00 130.60 ? 85  ARG I N   1 
ATOM   3830 C  CA  . ARG I 1 89 ? 5.943   21.172  16.496  1.00 140.94 ? 85  ARG I CA  1 
ATOM   3831 C  C   . ARG I 1 89 ? 7.462   21.229  16.557  1.00 144.59 ? 85  ARG I C   1 
ATOM   3832 O  O   . ARG I 1 89 ? 8.069   22.137  15.973  1.00 150.83 ? 85  ARG I O   1 
ATOM   3833 C  CB  . ARG I 1 89 ? 5.349   21.995  17.646  1.00 145.60 ? 85  ARG I CB  1 
ATOM   3834 N  N   . SER I 1 90 ? 8.087   20.286  17.254  1.00 142.53 ? 86  SER I N   1 
ATOM   3835 C  CA  . SER I 1 90 ? 9.541   20.234  17.356  1.00 145.95 ? 86  SER I CA  1 
ATOM   3836 C  C   . SER I 1 90 ? 10.128  19.215  16.387  1.00 139.05 ? 86  SER I C   1 
ATOM   3837 O  O   . SER I 1 90 ? 10.847  18.302  16.797  1.00 135.13 ? 86  SER I O   1 
ATOM   3838 C  CB  . SER I 1 90 ? 9.969   19.896  18.787  1.00 145.20 ? 86  SER I CB  1 
ATOM   3839 N  N   . PHE J 2 7  ? -8.474  6.117   34.284  1.00 132.46 ? 286 PHE J N   1 
ATOM   3840 C  CA  . PHE J 2 7  ? -8.598  7.393   33.588  1.00 134.86 ? 286 PHE J CA  1 
ATOM   3841 C  C   . PHE J 2 7  ? -9.645  7.305   32.482  1.00 132.28 ? 286 PHE J C   1 
ATOM   3842 O  O   . PHE J 2 7  ? -9.556  8.023   31.479  1.00 130.77 ? 286 PHE J O   1 
ATOM   3843 C  CB  . PHE J 2 7  ? -7.241  7.836   33.017  1.00 132.68 ? 286 PHE J CB  1 
ATOM   3844 C  CG  . PHE J 2 7  ? -6.624  6.855   32.048  1.00 123.29 ? 286 PHE J CG  1 
ATOM   3845 C  CD1 . PHE J 2 7  ? -5.983  5.713   32.505  1.00 118.30 ? 286 PHE J CD1 1 
ATOM   3846 C  CD2 . PHE J 2 7  ? -6.665  7.092   30.682  1.00 119.71 ? 286 PHE J CD2 1 
ATOM   3847 C  CE1 . PHE J 2 7  ? -5.412  4.818   31.619  1.00 112.52 ? 286 PHE J CE1 1 
ATOM   3848 C  CE2 . PHE J 2 7  ? -6.093  6.200   29.790  1.00 112.95 ? 286 PHE J CE2 1 
ATOM   3849 C  CZ  . PHE J 2 7  ? -5.466  5.062   30.261  1.00 110.00 ? 286 PHE J CZ  1 
ATOM   3850 N  N   . LYS J 2 8  ? -10.631 6.439   32.687  1.00 132.40 ? 287 LYS J N   1 
ATOM   3851 C  CA  . LYS J 2 8  ? -11.750 6.249   31.771  1.00 131.93 ? 287 LYS J CA  1 
ATOM   3852 C  C   . LYS J 2 8  ? -11.276 6.112   30.319  1.00 127.32 ? 287 LYS J C   1 
ATOM   3853 O  O   . LYS J 2 8  ? -11.557 6.981   29.489  1.00 127.80 ? 287 LYS J O   1 
ATOM   3854 C  CB  . LYS J 2 8  ? -12.754 7.387   31.907  1.00 136.36 ? 287 LYS J CB  1 
ATOM   3855 N  N   . PRO J 2 9  ? -10.567 5.030   29.982  1.00 121.99 ? 288 PRO J N   1 
ATOM   3856 C  CA  . PRO J 2 9  ? -10.019 4.923   28.612  1.00 117.15 ? 288 PRO J CA  1 
ATOM   3857 C  C   . PRO J 2 9  ? -11.068 4.906   27.507  1.00 117.47 ? 288 PRO J C   1 
ATOM   3858 O  O   . PRO J 2 9  ? -10.927 5.653   26.526  1.00 119.66 ? 288 PRO J O   1 
ATOM   3859 C  CB  . PRO J 2 9  ? -9.203  3.619   28.661  1.00 112.13 ? 288 PRO J CB  1 
ATOM   3860 C  CG  . PRO J 2 9  ? -9.573  2.941   29.946  1.00 114.45 ? 288 PRO J CG  1 
ATOM   3861 C  CD  . PRO J 2 9  ? -9.992  4.011   30.882  1.00 121.09 ? 288 PRO J CD  1 
ATOM   3862 N  N   . GLY J 2 10 ? -12.115 4.101   27.618  1.00 118.60 ? 289 GLY J N   1 
ATOM   3863 C  CA  . GLY J 2 10 ? -13.123 4.019   26.579  1.00 121.10 ? 289 GLY J CA  1 
ATOM   3864 C  C   . GLY J 2 10 ? -14.396 4.818   26.773  1.00 129.38 ? 289 GLY J C   1 
ATOM   3865 O  O   . GLY J 2 10 ? -15.270 4.765   25.904  1.00 131.57 ? 289 GLY J O   1 
ATOM   3866 N  N   . VAL J 2 11 ? -14.507 5.605   27.840  1.00 132.39 ? 290 VAL J N   1 
ATOM   3867 C  CA  . VAL J 2 11 ? -15.648 6.500   28.016  1.00 132.71 ? 290 VAL J CA  1 
ATOM   3868 C  C   . VAL J 2 11 ? -15.416 7.825   27.296  1.00 133.87 ? 290 VAL J C   1 
ATOM   3869 O  O   . VAL J 2 11 ? -14.446 8.536   27.573  1.00 134.73 ? 290 VAL J O   1 
ATOM   3870 C  CB  . VAL J 2 11 ? -15.938 6.729   29.506  1.00 135.54 ? 290 VAL J CB  1 
ATOM   3871 N  N   . ILE J 2 12 ? -16.311 8.142   26.357  1.00 132.71 ? 291 ILE J N   1 
ATOM   3872 C  CA  . ILE J 2 12 ? -16.286 9.375   25.586  1.00 133.37 ? 291 ILE J CA  1 
ATOM   3873 C  C   . ILE J 2 12 ? -17.668 10.013  25.666  1.00 137.37 ? 291 ILE J C   1 
ATOM   3874 O  O   . ILE J 2 12 ? -18.664 9.361   25.990  1.00 136.92 ? 291 ILE J O   1 
ATOM   3875 C  CB  . ILE J 2 12 ? -15.894 9.149   24.112  1.00 129.30 ? 291 ILE J CB  1 
ATOM   3876 C  CG1 . ILE J 2 12 ? -16.884 8.191   23.444  1.00 126.51 ? 291 ILE J CG1 1 
ATOM   3877 C  CG2 . ILE J 2 12 ? -14.474 8.631   24.018  1.00 126.39 ? 291 ILE J CG2 1 
ATOM   3878 C  CD1 . ILE J 2 12 ? -16.607 7.950   21.978  1.00 121.93 ? 291 ILE J CD1 1 
ATOM   3879 N  N   . SER J 2 13 ? -17.722 11.305  25.347  1.00 139.91 ? 292 SER J N   1 
ATOM   3880 C  CA  . SER J 2 13 ? -18.973 12.042  25.428  1.00 143.13 ? 292 SER J CA  1 
ATOM   3881 C  C   . SER J 2 13 ? -19.899 11.673  24.267  1.00 138.99 ? 292 SER J C   1 
ATOM   3882 O  O   . SER J 2 13 ? -19.507 11.006  23.306  1.00 132.29 ? 292 SER J O   1 
ATOM   3883 C  CB  . SER J 2 13 ? -18.704 13.547  25.435  1.00 149.48 ? 292 SER J CB  1 
ATOM   3884 O  OG  . SER J 2 13 ? -18.239 13.986  24.170  1.00 148.42 ? 292 SER J OG  1 
ATOM   3885 N  N   . GLU J 2 14 ? -21.161 12.098  24.382  1.00 145.82 ? 293 GLU J N   1 
ATOM   3886 C  CA  . GLU J 2 14 ? -22.116 11.871  23.300  1.00 147.12 ? 293 GLU J CA  1 
ATOM   3887 C  C   . GLU J 2 14 ? -21.792 12.736  22.089  1.00 149.32 ? 293 GLU J C   1 
ATOM   3888 O  O   . GLU J 2 14 ? -21.957 12.297  20.945  1.00 147.07 ? 293 GLU J O   1 
ATOM   3889 C  CB  . GLU J 2 14 ? -23.537 12.145  23.789  1.00 153.72 ? 293 GLU J CB  1 
ATOM   3890 N  N   . GLU J 2 15 ? -21.333 13.969  22.320  1.00 155.46 ? 294 GLU J N   1 
ATOM   3891 C  CA  . GLU J 2 15 ? -20.966 14.847  21.211  1.00 157.93 ? 294 GLU J CA  1 
ATOM   3892 C  C   . GLU J 2 15 ? -19.776 14.289  20.439  1.00 152.57 ? 294 GLU J C   1 
ATOM   3893 O  O   . GLU J 2 15 ? -19.751 14.325  19.202  1.00 149.08 ? 294 GLU J O   1 
ATOM   3894 C  CB  . GLU J 2 15 ? -20.664 16.254  21.730  1.00 162.83 ? 294 GLU J CB  1 
ATOM   3895 N  N   . LEU J 2 16 ? -18.778 13.767  21.156  1.00 152.46 ? 295 LEU J N   1 
ATOM   3896 C  CA  . LEU J 2 16 ? -17.617 13.182  20.495  1.00 147.74 ? 295 LEU J CA  1 
ATOM   3897 C  C   . LEU J 2 16 ? -17.999 11.908  19.754  1.00 147.66 ? 295 LEU J C   1 
ATOM   3898 O  O   . LEU J 2 16 ? -17.446 11.618  18.686  1.00 139.37 ? 295 LEU J O   1 
ATOM   3899 C  CB  . LEU J 2 16 ? -16.514 12.914  21.519  1.00 145.80 ? 295 LEU J CB  1 
ATOM   3900 C  CG  . LEU J 2 16 ? -15.164 12.417  20.995  1.00 141.63 ? 295 LEU J CG  1 
ATOM   3901 C  CD1 . LEU J 2 16 ? -14.670 13.303  19.863  1.00 140.48 ? 295 LEU J CD1 1 
ATOM   3902 C  CD2 . LEU J 2 16 ? -14.145 12.369  22.125  1.00 141.31 ? 295 LEU J CD2 1 
ATOM   3903 N  N   . GLN J 2 17 ? -18.932 11.129  20.309  1.00 150.37 ? 296 GLN J N   1 
ATOM   3904 C  CA  . GLN J 2 17 ? -19.422 9.945   19.609  1.00 113.69 ? 296 GLN J CA  1 
ATOM   3905 C  C   . GLN J 2 17 ? -20.014 10.319  18.256  1.00 136.26 ? 296 GLN J C   1 
ATOM   3906 O  O   . GLN J 2 17 ? -19.769 9.640   17.253  1.00 132.45 ? 296 GLN J O   1 
ATOM   3907 C  CB  . GLN J 2 17 ? -20.457 9.217   20.466  1.00 116.58 ? 296 GLN J CB  1 
ATOM   3908 N  N   . ASP J 2 18 ? -20.826 11.378  18.217  1.00 142.62 ? 297 ASP J N   1 
ATOM   3909 C  CA  . ASP J 2 18 ? -21.376 11.838  16.947  1.00 145.82 ? 297 ASP J CA  1 
ATOM   3910 C  C   . ASP J 2 18 ? -20.272 12.335  16.019  1.00 149.07 ? 297 ASP J C   1 
ATOM   3911 O  O   . ASP J 2 18 ? -20.341 12.141  14.800  1.00 146.55 ? 297 ASP J O   1 
ATOM   3912 C  CB  . ASP J 2 18 ? -22.406 12.942  17.190  1.00 149.56 ? 297 ASP J CB  1 
ATOM   3913 N  N   . ALA J 2 19 ? -19.253 12.988  16.582  1.00 156.18 ? 298 ALA J N   1 
ATOM   3914 C  CA  . ALA J 2 19 ? -18.134 13.476  15.777  1.00 153.09 ? 298 ALA J CA  1 
ATOM   3915 C  C   . ALA J 2 19 ? -17.324 12.331  15.178  1.00 138.95 ? 298 ALA J C   1 
ATOM   3916 O  O   . ALA J 2 19 ? -16.864 12.420  14.034  1.00 136.99 ? 298 ALA J O   1 
ATOM   3917 C  CB  . ALA J 2 19 ? -17.239 14.385  16.622  1.00 160.10 ? 298 ALA J CB  1 
ATOM   3918 N  N   . LEU J 2 20 ? -17.130 11.252  15.937  1.00 132.79 ? 299 LEU J N   1 
ATOM   3919 C  CA  . LEU J 2 20 ? -16.330 10.128  15.472  1.00 123.35 ? 299 LEU J CA  1 
ATOM   3920 C  C   . LEU J 2 20 ? -17.065 9.223   14.492  1.00 121.54 ? 299 LEU J C   1 
ATOM   3921 O  O   . LEU J 2 20 ? -16.413 8.436   13.799  1.00 121.38 ? 299 LEU J O   1 
ATOM   3922 C  CB  . LEU J 2 20 ? -15.867 9.294   16.666  1.00 117.11 ? 299 LEU J CB  1 
ATOM   3923 C  CG  . LEU J 2 20 ? -14.840 9.919   17.603  1.00 111.49 ? 299 LEU J CG  1 
ATOM   3924 C  CD1 . LEU J 2 20 ? -14.666 9.058   18.838  1.00 105.23 ? 299 LEU J CD1 1 
ATOM   3925 C  CD2 . LEU J 2 20 ? -13.524 10.089  16.876  1.00 94.94  ? 299 LEU J CD2 1 
ATOM   3926 N  N   . GLY J 2 21 ? -18.388 9.327   14.400  1.00 118.30 ? 300 GLY J N   1 
ATOM   3927 C  CA  . GLY J 2 21 ? -19.147 8.444   13.533  1.00 119.25 ? 300 GLY J CA  1 
ATOM   3928 C  C   . GLY J 2 21 ? -19.409 7.077   14.125  1.00 119.45 ? 300 GLY J C   1 
ATOM   3929 O  O   . GLY J 2 21 ? -19.566 6.104   13.379  1.00 118.15 ? 300 GLY J O   1 
ATOM   3930 N  N   . VAL J 2 22 ? -19.445 6.980   15.450  1.00 129.56 ? 301 VAL J N   1 
ATOM   3931 C  CA  . VAL J 2 22 ? -19.598 5.714   16.161  1.00 131.48 ? 301 VAL J CA  1 
ATOM   3932 C  C   . VAL J 2 22 ? -21.070 5.342   16.278  1.00 136.75 ? 301 VAL J C   1 
ATOM   3933 O  O   . VAL J 2 22 ? -21.935 6.206   16.472  1.00 107.88 ? 301 VAL J O   1 
ATOM   3934 C  CB  . VAL J 2 22 ? -18.949 5.794   17.552  1.00 131.18 ? 301 VAL J CB  1 
ATOM   3935 C  CG1 . VAL J 2 22 ? -18.998 4.438   18.242  1.00 127.63 ? 301 VAL J CG1 1 
ATOM   3936 C  CG2 . VAL J 2 22 ? -17.531 6.298   17.451  1.00 95.53  ? 301 VAL J CG2 1 
ATOM   3937 N  N   . THR J 2 23 ? -21.369 4.060   16.103  1.00 139.00 ? 302 THR J N   1 
ATOM   3938 C  CA  . THR J 2 23 ? -22.705 3.552   16.390  1.00 151.12 ? 302 THR J CA  1 
ATOM   3939 C  C   . THR J 2 23 ? -22.827 3.407   17.905  1.00 161.54 ? 302 THR J C   1 
ATOM   3940 O  O   . THR J 2 23 ? -22.027 2.701   18.528  1.00 158.97 ? 302 THR J O   1 
ATOM   3941 C  CB  . THR J 2 23 ? -22.943 2.214   15.696  1.00 148.96 ? 302 THR J CB  1 
ATOM   3942 N  N   . ASP J 2 24 ? -23.804 4.095   18.504  1.00 178.32 ? 303 ASP J N   1 
ATOM   3943 C  CA  . ASP J 2 24 ? -23.970 4.082   19.958  1.00 178.74 ? 303 ASP J CA  1 
ATOM   3944 C  C   . ASP J 2 24 ? -24.227 2.668   20.462  1.00 178.95 ? 303 ASP J C   1 
ATOM   3945 O  O   . ASP J 2 24 ? -25.321 2.362   20.956  1.00 190.94 ? 303 ASP J O   1 
ATOM   3946 C  CB  . ASP J 2 24 ? -25.106 5.014   20.384  1.00 184.82 ? 303 ASP J CB  1 
ATOM   3947 N  N   . LYS J 2 25 ? -23.218 1.807   20.358  1.00 168.26 ? 304 LYS J N   1 
ATOM   3948 C  CA  . LYS J 2 25 ? -23.380 0.387   20.633  1.00 164.75 ? 304 LYS J CA  1 
ATOM   3949 C  C   . LYS J 2 25 ? -22.557 -0.091  21.823  1.00 165.44 ? 304 LYS J C   1 
ATOM   3950 O  O   . LYS J 2 25 ? -22.464 -1.305  22.040  1.00 105.68 ? 304 LYS J O   1 
ATOM   3951 C  CB  . LYS J 2 25 ? -23.028 -0.433  19.386  1.00 158.15 ? 304 LYS J CB  1 
ATOM   3952 N  N   . SER J 2 26 ? -21.966 0.822   22.598  1.00 107.58 ? 305 SER J N   1 
ATOM   3953 C  CA  . SER J 2 26 ? -21.140 0.526   23.763  1.00 105.91 ? 305 SER J CA  1 
ATOM   3954 C  C   . SER J 2 26 ? -19.798 -0.079  23.391  1.00 99.60  ? 305 SER J C   1 
ATOM   3955 O  O   . SER J 2 26 ? -19.018 -0.403  24.291  1.00 106.93 ? 305 SER J O   1 
ATOM   3956 C  CB  . SER J 2 26 ? -21.830 -0.401  24.773  1.00 125.49 ? 305 SER J CB  1 
ATOM   3957 O  OG  . SER J 2 26 ? -21.843 -1.734  24.297  1.00 122.04 ? 305 SER J OG  1 
ATOM   3958 N  N   . LEU J 2 27 ? -19.511 -0.268  22.110  1.00 118.52 ? 306 LEU J N   1 
ATOM   3959 C  CA  . LEU J 2 27 ? -18.229 -0.818  21.694  1.00 112.34 ? 306 LEU J CA  1 
ATOM   3960 C  C   . LEU J 2 27 ? -17.181 0.238   21.998  1.00 89.81  ? 306 LEU J C   1 
ATOM   3961 O  O   . LEU J 2 27 ? -17.144 1.268   21.313  1.00 90.39  ? 306 LEU J O   1 
ATOM   3962 C  CB  . LEU J 2 27 ? -18.236 -1.156  20.198  1.00 88.55  ? 306 LEU J CB  1 
ATOM   3963 C  CG  . LEU J 2 27 ? -18.891 -2.436  19.665  1.00 88.74  ? 306 LEU J CG  1 
ATOM   3964 C  CD1 . LEU J 2 27 ? -20.337 -2.576  20.080  1.00 93.80  ? 306 LEU J CD1 1 
ATOM   3965 C  CD2 . LEU J 2 27 ? -18.731 -2.523  18.144  1.00 86.37  ? 306 LEU J CD2 1 
ATOM   3966 N  N   . PRO J 2 28 ? -16.306 0.027   22.971  1.00 88.49  ? 307 PRO J N   1 
ATOM   3967 C  CA  . PRO J 2 28 ? -15.407 1.092   23.384  1.00 88.66  ? 307 PRO J CA  1 
ATOM   3968 C  C   . PRO J 2 28 ? -14.414 1.417   22.287  1.00 114.40 ? 307 PRO J C   1 
ATOM   3969 O  O   . PRO J 2 28 ? -13.666 0.542   21.824  1.00 114.99 ? 307 PRO J O   1 
ATOM   3970 C  CB  . PRO J 2 28 ? -14.712 0.505   24.619  1.00 111.05 ? 307 PRO J CB  1 
ATOM   3971 C  CG  . PRO J 2 28 ? -14.806 -0.971  24.451  1.00 108.35 ? 307 PRO J CG  1 
ATOM   3972 C  CD  . PRO J 2 28 ? -16.089 -1.221  23.722  1.00 87.07  ? 307 PRO J CD  1 
ATOM   3973 N  N   . PRO J 2 29 ? -14.363 2.673   21.860  1.00 107.46 ? 308 PRO J N   1 
ATOM   3974 C  CA  . PRO J 2 29 ? -13.421 3.059   20.813  1.00 100.26 ? 308 PRO J CA  1 
ATOM   3975 C  C   . PRO J 2 29 ? -12.057 3.325   21.415  1.00 100.76 ? 308 PRO J C   1 
ATOM   3976 O  O   . PRO J 2 29 ? -11.928 3.654   22.596  1.00 103.98 ? 308 PRO J O   1 
ATOM   3977 C  CB  . PRO J 2 29 ? -14.029 4.348   20.255  1.00 99.58  ? 308 PRO J CB  1 
ATOM   3978 C  CG  . PRO J 2 29 ? -14.717 4.947   21.444  1.00 103.06 ? 308 PRO J CG  1 
ATOM   3979 C  CD  . PRO J 2 29 ? -15.222 3.793   22.277  1.00 107.28 ? 308 PRO J CD  1 
ATOM   3980 N  N   . PHE J 2 30 ? -11.032 3.144   20.590  1.00 97.74  ? 309 PHE J N   1 
ATOM   3981 C  CA  . PHE J 2 30 ? -9.627  3.363   20.901  1.00 98.75  ? 309 PHE J CA  1 
ATOM   3982 C  C   . PHE J 2 30 ? -9.100  2.253   21.789  1.00 94.83  ? 309 PHE J C   1 
ATOM   3983 O  O   . PHE J 2 30 ? -7.895  2.205   22.032  1.00 92.80  ? 309 PHE J O   1 
ATOM   3984 C  CB  . PHE J 2 30 ? -9.343  4.723   21.569  1.00 105.78 ? 309 PHE J CB  1 
ATOM   3985 C  CG  . PHE J 2 30 ? -10.063 5.857   20.926  1.00 113.91 ? 309 PHE J CG  1 
ATOM   3986 C  CD1 . PHE J 2 30 ? -9.960  6.063   19.561  1.00 116.22 ? 309 PHE J CD1 1 
ATOM   3987 C  CD2 . PHE J 2 30 ? -10.880 6.688   21.670  1.00 119.87 ? 309 PHE J CD2 1 
ATOM   3988 C  CE1 . PHE J 2 30 ? -10.637 7.089   18.951  1.00 119.88 ? 309 PHE J CE1 1 
ATOM   3989 C  CE2 . PHE J 2 30 ? -11.565 7.717   21.066  1.00 124.84 ? 309 PHE J CE2 1 
ATOM   3990 C  CZ  . PHE J 2 30 ? -11.443 7.918   19.702  1.00 124.36 ? 309 PHE J CZ  1 
ATOM   3991 N  N   . ILE J 2 31 ? -9.948  1.351   22.279  1.00 96.44  ? 310 ILE J N   1 
ATOM   3992 C  CA  . ILE J 2 31 ? -9.460  0.307   23.167  1.00 98.11  ? 310 ILE J CA  1 
ATOM   3993 C  C   . ILE J 2 31 ? -8.508  -0.617  22.426  1.00 94.57  ? 310 ILE J C   1 
ATOM   3994 O  O   . ILE J 2 31 ? -7.443  -0.966  22.943  1.00 93.83  ? 310 ILE J O   1 
ATOM   3995 C  CB  . ILE J 2 31 ? -10.633 -0.460  23.802  1.00 101.74 ? 310 ILE J CB  1 
ATOM   3996 C  CG1 . ILE J 2 31 ? -11.202 0.342   24.970  1.00 104.85 ? 310 ILE J CG1 1 
ATOM   3997 C  CG2 . ILE J 2 31 ? -10.182 -1.830  24.291  1.00 101.69 ? 310 ILE J CG2 1 
ATOM   3998 C  CD1 . ILE J 2 31 ? -10.161 0.718   25.999  1.00 105.34 ? 310 ILE J CD1 1 
ATOM   3999 N  N   . TYR J 2 32 ? -8.848  -0.992  21.188  1.00 92.14  ? 311 TYR J N   1 
ATOM   4000 C  CA  . TYR J 2 32 ? -8.035  -1.975  20.482  1.00 85.25  ? 311 TYR J CA  1 
ATOM   4001 C  C   . TYR J 2 32 ? -6.617  -1.460  20.284  1.00 83.53  ? 311 TYR J C   1 
ATOM   4002 O  O   . TYR J 2 32 ? -5.648  -2.203  20.476  1.00 85.44  ? 311 TYR J O   1 
ATOM   4003 C  CB  . TYR J 2 32 ? -8.654  -2.338  19.138  1.00 79.45  ? 311 TYR J CB  1 
ATOM   4004 C  CG  . TYR J 2 32 ? -7.954  -3.517  18.538  1.00 74.35  ? 311 TYR J CG  1 
ATOM   4005 C  CD1 . TYR J 2 32 ? -8.015  -4.743  19.176  1.00 75.87  ? 311 TYR J CD1 1 
ATOM   4006 C  CD2 . TYR J 2 32 ? -7.207  -3.418  17.380  1.00 73.09  ? 311 TYR J CD2 1 
ATOM   4007 C  CE1 . TYR J 2 32 ? -7.371  -5.849  18.676  1.00 77.60  ? 311 TYR J CE1 1 
ATOM   4008 C  CE2 . TYR J 2 32 ? -6.549  -4.530  16.862  1.00 75.40  ? 311 TYR J CE2 1 
ATOM   4009 C  CZ  . TYR J 2 32 ? -6.640  -5.744  17.521  1.00 77.64  ? 311 TYR J CZ  1 
ATOM   4010 O  OH  . TYR J 2 32 ? -6.003  -6.862  17.035  1.00 78.72  ? 311 TYR J OH  1 
ATOM   4011 N  N   . ARG J 2 33 ? -6.476  -0.183  19.921  1.00 82.81  ? 312 ARG J N   1 
ATOM   4012 C  CA  . ARG J 2 33 ? -5.155  0.400   19.699  1.00 79.84  ? 312 ARG J CA  1 
ATOM   4013 C  C   . ARG J 2 33 ? -4.396  0.559   21.009  1.00 77.00  ? 312 ARG J C   1 
ATOM   4014 O  O   . ARG J 2 33 ? -3.226  0.168   21.110  1.00 75.62  ? 312 ARG J O   1 
ATOM   4015 C  CB  . ARG J 2 33 ? -5.296  1.748   18.996  1.00 83.95  ? 312 ARG J CB  1 
ATOM   4016 C  CG  . ARG J 2 33 ? -5.750  1.646   17.543  1.00 85.15  ? 312 ARG J CG  1 
ATOM   4017 C  CD  . ARG J 2 33 ? -4.608  1.193   16.649  1.00 80.15  ? 312 ARG J CD  1 
ATOM   4018 N  NE  . ARG J 2 33 ? -3.410  2.011   16.838  1.00 81.74  ? 312 ARG J NE  1 
ATOM   4019 C  CZ  . ARG J 2 33 ? -2.191  1.662   16.432  1.00 79.55  ? 312 ARG J CZ  1 
ATOM   4020 N  NH1 . ARG J 2 33 ? -2.002  0.502   15.816  1.00 78.56  ? 312 ARG J NH1 1 
ATOM   4021 N  NH2 . ARG J 2 33 ? -1.158  2.469   16.650  1.00 78.83  ? 312 ARG J NH2 1 
ATOM   4022 N  N   . MET J 2 34 ? -5.047  1.140   22.022  1.00 79.50  ? 313 MET J N   1 
ATOM   4023 C  CA  . MET J 2 34 ? -4.406  1.322   23.318  1.00 73.82  ? 313 MET J CA  1 
ATOM   4024 C  C   . MET J 2 34 ? -3.904  0.000   23.875  1.00 72.19  ? 313 MET J C   1 
ATOM   4025 O  O   . MET J 2 34 ? -2.836  -0.057  24.493  1.00 72.48  ? 313 MET J O   1 
ATOM   4026 C  CB  . MET J 2 34 ? -5.388  1.971   24.300  1.00 87.93  ? 313 MET J CB  1 
ATOM   4027 C  CG  . MET J 2 34 ? -5.741  3.404   23.934  1.00 90.36  ? 313 MET J CG  1 
ATOM   4028 S  SD  . MET J 2 34 ? -6.926  4.198   25.053  1.00 93.74  ? 313 MET J SD  1 
ATOM   4029 C  CE  . MET J 2 34 ? -6.079  4.120   26.622  1.00 96.88  ? 313 MET J CE  1 
ATOM   4030 N  N   . ARG J 2 35 ? -4.652  -1.082  23.641  1.00 74.24  ? 314 ARG J N   1 
ATOM   4031 C  CA  . ARG J 2 35 ? -4.220  -2.386  24.127  1.00 74.59  ? 314 ARG J CA  1 
ATOM   4032 C  C   . ARG J 2 35 ? -2.909  -2.816  23.484  1.00 69.64  ? 314 ARG J C   1 
ATOM   4033 O  O   . ARG J 2 35 ? -2.134  -3.558  24.097  1.00 67.45  ? 314 ARG J O   1 
ATOM   4034 C  CB  . ARG J 2 35 ? -5.318  -3.427  23.893  1.00 76.64  ? 314 ARG J CB  1 
ATOM   4035 C  CG  . ARG J 2 35 ? -6.536  -3.197  24.774  1.00 84.05  ? 314 ARG J CG  1 
ATOM   4036 C  CD  . ARG J 2 35 ? -7.522  -4.353  24.780  1.00 88.04  ? 314 ARG J CD  1 
ATOM   4037 N  NE  . ARG J 2 35 ? -8.426  -4.216  25.919  1.00 95.43  ? 314 ARG J NE  1 
ATOM   4038 C  CZ  . ARG J 2 35 ? -9.523  -4.940  26.107  1.00 99.40  ? 314 ARG J CZ  1 
ATOM   4039 N  NH1 . ARG J 2 35 ? -9.874  -5.859  25.219  1.00 100.96 ? 314 ARG J NH1 1 
ATOM   4040 N  NH2 . ARG J 2 35 ? -10.275 -4.733  27.179  1.00 101.68 ? 314 ARG J NH2 1 
ATOM   4041 N  N   . GLN J 2 36 ? -2.628  -2.343  22.272  1.00 69.38  ? 315 GLN J N   1 
ATOM   4042 C  CA  . GLN J 2 36 ? -1.360  -2.682  21.639  1.00 73.10  ? 315 GLN J CA  1 
ATOM   4043 C  C   . GLN J 2 36 ? -0.272  -1.678  21.997  1.00 78.52  ? 315 GLN J C   1 
ATOM   4044 O  O   . GLN J 2 36 ? 0.858   -2.068  22.306  1.00 77.94  ? 315 GLN J O   1 
ATOM   4045 C  CB  . GLN J 2 36 ? -1.512  -2.752  20.120  1.00 72.94  ? 315 GLN J CB  1 
ATOM   4046 C  CG  . GLN J 2 36 ? -2.567  -3.717  19.640  1.00 73.60  ? 315 GLN J CG  1 
ATOM   4047 C  CD  . GLN J 2 36 ? -2.716  -3.670  18.129  1.00 77.36  ? 315 GLN J CD  1 
ATOM   4048 O  OE1 . GLN J 2 36 ? -2.195  -2.762  17.463  1.00 77.31  ? 315 GLN J OE1 1 
ATOM   4049 N  NE2 . GLN J 2 36 ? -3.449  -4.638  17.581  1.00 78.66  ? 315 GLN J NE2 1 
ATOM   4050 N  N   . LEU J 2 37 ? -0.606  -0.386  21.968  1.00 79.94  ? 316 LEU J N   1 
ATOM   4051 C  CA  . LEU J 2 37 ? 0.381   0.653   22.241  1.00 84.41  ? 316 LEU J CA  1 
ATOM   4052 C  C   . LEU J 2 37 ? 0.810   0.654   23.698  1.00 91.55  ? 316 LEU J C   1 
ATOM   4053 O  O   . LEU J 2 37 ? 1.938   1.047   24.004  1.00 98.75  ? 316 LEU J O   1 
ATOM   4054 C  CB  . LEU J 2 37 ? -0.193  2.014   21.864  1.00 73.92  ? 316 LEU J CB  1 
ATOM   4055 C  CG  . LEU J 2 37 ? -0.533  2.268   20.398  1.00 80.35  ? 316 LEU J CG  1 
ATOM   4056 C  CD1 . LEU J 2 37 ? -1.279  3.579   20.231  1.00 82.26  ? 316 LEU J CD1 1 
ATOM   4057 C  CD2 . LEU J 2 37 ? 0.737   2.296   19.580  1.00 72.19  ? 316 LEU J CD2 1 
ATOM   4058 N  N   . GLY J 2 38 ? -0.051  0.192   24.598  1.00 93.77  ? 317 GLY J N   1 
ATOM   4059 C  CA  . GLY J 2 38 ? 0.199   0.276   26.022  1.00 96.88  ? 317 GLY J CA  1 
ATOM   4060 C  C   . GLY J 2 38 ? -0.503  1.467   26.650  1.00 99.22  ? 317 GLY J C   1 
ATOM   4061 O  O   . GLY J 2 38 ? -1.074  2.328   25.976  1.00 98.53  ? 317 GLY J O   1 
ATOM   4062 N  N   . TYR J 2 39 ? -0.427  1.527   27.975  1.00 105.71 ? 318 TYR J N   1 
ATOM   4063 C  CA  . TYR J 2 39 ? -1.131  2.578   28.695  1.00 110.13 ? 318 TYR J CA  1 
ATOM   4064 C  C   . TYR J 2 39 ? -0.480  3.926   28.396  1.00 112.32 ? 318 TYR J C   1 
ATOM   4065 O  O   . TYR J 2 39 ? 0.751   4.038   28.407  1.00 116.97 ? 318 TYR J O   1 
ATOM   4066 C  CB  . TYR J 2 39 ? -1.129  2.316   30.199  1.00 108.62 ? 318 TYR J CB  1 
ATOM   4067 N  N   . PRO J 2 40 ? -1.276  4.955   28.121  1.00 113.10 ? 319 PRO J N   1 
ATOM   4068 C  CA  . PRO J 2 40 ? -0.724  6.275   27.809  1.00 95.97  ? 319 PRO J CA  1 
ATOM   4069 C  C   . PRO J 2 40 ? 0.241   6.742   28.881  1.00 111.44 ? 319 PRO J C   1 
ATOM   4070 O  O   . PRO J 2 40 ? -0.129  6.854   30.059  1.00 115.69 ? 319 PRO J O   1 
ATOM   4071 C  CB  . PRO J 2 40 ? -1.972  7.168   27.761  1.00 98.26  ? 319 PRO J CB  1 
ATOM   4072 C  CG  . PRO J 2 40 ? -3.089  6.235   27.429  1.00 117.15 ? 319 PRO J CG  1 
ATOM   4073 C  CD  . PRO J 2 40 ? -2.749  4.958   28.134  1.00 113.51 ? 319 PRO J CD  1 
ATOM   4074 N  N   . PRO J 2 41 ? 1.492   7.035   28.504  1.00 110.49 ? 320 PRO J N   1 
ATOM   4075 C  CA  . PRO J 2 41 ? 2.507   7.353   29.520  1.00 112.51 ? 320 PRO J CA  1 
ATOM   4076 C  C   . PRO J 2 41 ? 2.195   8.593   30.331  1.00 116.69 ? 320 PRO J C   1 
ATOM   4077 O  O   . PRO J 2 41 ? 2.598   8.669   31.498  1.00 116.30 ? 320 PRO J O   1 
ATOM   4078 C  CB  . PRO J 2 41 ? 3.784   7.531   28.688  1.00 112.41 ? 320 PRO J CB  1 
ATOM   4079 N  N   . GLY J 2 42 ? 1.513   9.580   29.752  1.00 119.70 ? 321 GLY J N   1 
ATOM   4080 C  CA  . GLY J 2 42 ? 1.208   10.776  30.516  1.00 131.70 ? 321 GLY J CA  1 
ATOM   4081 C  C   . GLY J 2 42 ? 0.156   10.588  31.594  1.00 137.38 ? 321 GLY J C   1 
ATOM   4082 O  O   . GLY J 2 42 ? 0.010   11.469  32.450  1.00 144.91 ? 321 GLY J O   1 
ATOM   4083 N  N   . TRP J 2 43 ? -0.555  9.459   31.586  1.00 133.94 ? 322 TRP J N   1 
ATOM   4084 C  CA  . TRP J 2 43 ? -1.516  9.141   32.634  1.00 137.97 ? 322 TRP J CA  1 
ATOM   4085 C  C   . TRP J 2 43 ? -0.902  8.344   33.777  1.00 145.20 ? 322 TRP J C   1 
ATOM   4086 O  O   . TRP J 2 43 ? -1.484  8.314   34.865  1.00 147.50 ? 322 TRP J O   1 
ATOM   4087 C  CB  . TRP J 2 43 ? -2.722  8.370   32.075  1.00 133.98 ? 322 TRP J CB  1 
ATOM   4088 C  CG  . TRP J 2 43 ? -3.705  9.213   31.291  1.00 135.51 ? 322 TRP J CG  1 
ATOM   4089 C  CD1 . TRP J 2 43 ? -3.952  9.146   29.946  1.00 132.06 ? 322 TRP J CD1 1 
ATOM   4090 C  CD2 . TRP J 2 43 ? -4.544  10.266  31.799  1.00 140.45 ? 322 TRP J CD2 1 
ATOM   4091 N  NE1 . TRP J 2 43 ? -4.906  10.073  29.595  1.00 135.41 ? 322 TRP J NE1 1 
ATOM   4092 C  CE2 . TRP J 2 43 ? -5.279  10.777  30.711  1.00 140.33 ? 322 TRP J CE2 1 
ATOM   4093 C  CE3 . TRP J 2 43 ? -4.746  10.822  33.067  1.00 143.18 ? 322 TRP J CE3 1 
ATOM   4094 C  CZ2 . TRP J 2 43 ? -6.202  11.818  30.852  1.00 143.31 ? 322 TRP J CZ2 1 
ATOM   4095 C  CZ3 . TRP J 2 43 ? -5.662  11.855  33.203  1.00 147.43 ? 322 TRP J CZ3 1 
ATOM   4096 C  CH2 . TRP J 2 43 ? -6.376  12.340  32.102  1.00 146.87 ? 322 TRP J CH2 1 
ATOM   4097 N  N   . LEU J 2 44 ? 0.223   7.672   33.545  1.00 144.15 ? 323 LEU J N   1 
ATOM   4098 C  CA  . LEU J 2 44 ? 0.927   6.951   34.603  1.00 116.17 ? 323 LEU J CA  1 
ATOM   4099 C  C   . LEU J 2 44 ? 1.329   7.870   35.751  1.00 132.32 ? 323 LEU J C   1 
ATOM   4100 O  O   . LEU J 2 44 ? 2.267   8.657   35.634  1.00 127.23 ? 323 LEU J O   1 
ATOM   4101 C  CB  . LEU J 2 44 ? 2.169   6.262   34.040  1.00 113.26 ? 323 LEU J CB  1 
ATOM   4102 N  N   . ASP K 1 13 ? -43.507 30.669  -3.745  1.00 128.48 ? 9   ASP K N   1 
ATOM   4103 C  CA  . ASP K 1 13 ? -43.748 29.788  -4.881  1.00 126.51 ? 9   ASP K CA  1 
ATOM   4104 C  C   . ASP K 1 13 ? -42.440 29.393  -5.556  1.00 125.93 ? 9   ASP K C   1 
ATOM   4105 O  O   . ASP K 1 13 ? -42.380 28.394  -6.275  1.00 123.67 ? 9   ASP K O   1 
ATOM   4106 C  CB  . ASP K 1 13 ? -44.676 30.458  -5.894  1.00 126.87 ? 9   ASP K CB  1 
ATOM   4107 N  N   . ARG K 1 14 ? -41.396 30.187  -5.332  1.00 125.47 ? 10  ARG K N   1 
ATOM   4108 C  CA  . ARG K 1 14 ? -40.083 29.911  -5.899  1.00 118.99 ? 10  ARG K CA  1 
ATOM   4109 C  C   . ARG K 1 14 ? -39.174 29.149  -4.945  1.00 118.18 ? 10  ARG K C   1 
ATOM   4110 O  O   . ARG K 1 14 ? -38.024 28.872  -5.299  1.00 117.20 ? 10  ARG K O   1 
ATOM   4111 C  CB  . ARG K 1 14 ? -39.402 31.216  -6.322  1.00 119.34 ? 10  ARG K CB  1 
ATOM   4112 N  N   . THR K 1 15 ? -39.652 28.809  -3.751  1.00 118.20 ? 11  THR K N   1 
ATOM   4113 C  CA  . THR K 1 15 ? -38.847 28.139  -2.742  1.00 116.14 ? 11  THR K CA  1 
ATOM   4114 C  C   . THR K 1 15 ? -39.337 26.713  -2.536  1.00 112.92 ? 11  THR K C   1 
ATOM   4115 O  O   . THR K 1 15 ? -40.546 26.457  -2.510  1.00 111.35 ? 11  THR K O   1 
ATOM   4116 C  CB  . THR K 1 15 ? -38.889 28.897  -1.413  1.00 119.14 ? 11  THR K CB  1 
ATOM   4117 N  N   . LEU K 1 16 ? -38.391 25.788  -2.391  1.00 112.84 ? 12  LEU K N   1 
ATOM   4118 C  CA  . LEU K 1 16 ? -38.685 24.383  -2.161  1.00 115.22 ? 12  LEU K CA  1 
ATOM   4119 C  C   . LEU K 1 16 ? -38.032 23.918  -0.867  1.00 121.27 ? 12  LEU K C   1 
ATOM   4120 O  O   . LEU K 1 16 ? -37.017 24.470  -0.430  1.00 126.44 ? 12  LEU K O   1 
ATOM   4121 C  CB  . LEU K 1 16 ? -38.199 23.513  -3.327  1.00 111.56 ? 12  LEU K CB  1 
ATOM   4122 N  N   . PHE K 1 17 ? -38.625 22.895  -0.260  1.00 121.54 ? 13  PHE K N   1 
ATOM   4123 C  CA  . PHE K 1 17 ? -38.150 22.329  0.994   1.00 125.38 ? 13  PHE K CA  1 
ATOM   4124 C  C   . PHE K 1 17 ? -37.461 20.996  0.737   1.00 123.59 ? 13  PHE K C   1 
ATOM   4125 O  O   . PHE K 1 17 ? -37.946 20.174  -0.046  1.00 123.40 ? 13  PHE K O   1 
ATOM   4126 C  CB  . PHE K 1 17 ? -39.314 22.144  1.973   1.00 130.55 ? 13  PHE K CB  1 
ATOM   4127 C  CG  . PHE K 1 17 ? -38.978 21.313  3.183   1.00 135.51 ? 13  PHE K CG  1 
ATOM   4128 C  CD1 . PHE K 1 17 ? -38.359 21.882  4.286   1.00 139.37 ? 13  PHE K CD1 1 
ATOM   4129 C  CD2 . PHE K 1 17 ? -39.308 19.966  3.227   1.00 135.43 ? 13  PHE K CD2 1 
ATOM   4130 C  CE1 . PHE K 1 17 ? -38.060 21.119  5.400   1.00 143.65 ? 13  PHE K CE1 1 
ATOM   4131 C  CE2 . PHE K 1 17 ? -39.010 19.199  4.337   1.00 139.59 ? 13  PHE K CE2 1 
ATOM   4132 C  CZ  . PHE K 1 17 ? -38.386 19.776  5.424   1.00 143.95 ? 13  PHE K CZ  1 
ATOM   4133 N  N   . VAL K 1 18 ? -36.322 20.791  1.396   1.00 121.07 ? 14  VAL K N   1 
ATOM   4134 C  CA  . VAL K 1 18 ? -35.564 19.548  1.310   1.00 116.90 ? 14  VAL K CA  1 
ATOM   4135 C  C   . VAL K 1 18 ? -35.148 19.151  2.718   1.00 117.42 ? 14  VAL K C   1 
ATOM   4136 O  O   . VAL K 1 18 ? -34.639 19.983  3.479   1.00 117.53 ? 14  VAL K O   1 
ATOM   4137 C  CB  . VAL K 1 18 ? -34.333 19.681  0.392   1.00 113.70 ? 14  VAL K CB  1 
ATOM   4138 N  N   . GLY K 1 19 ? -35.366 17.882  3.063   1.00 117.61 ? 15  GLY K N   1 
ATOM   4139 C  CA  . GLY K 1 19 ? -35.089 17.389  4.395   1.00 122.35 ? 15  GLY K CA  1 
ATOM   4140 C  C   . GLY K 1 19 ? -34.512 15.986  4.348   1.00 120.50 ? 15  GLY K C   1 
ATOM   4141 O  O   . GLY K 1 19 ? -34.291 15.423  3.274   1.00 117.86 ? 15  GLY K O   1 
ATOM   4142 N  N   . ASN K 1 20 ? -34.271 15.437  5.539   1.00 126.66 ? 16  ASN K N   1 
ATOM   4143 C  CA  . ASN K 1 20 ? -33.629 14.144  5.765   1.00 128.90 ? 16  ASN K CA  1 
ATOM   4144 C  C   . ASN K 1 20 ? -32.168 14.150  5.334   1.00 131.14 ? 16  ASN K C   1 
ATOM   4145 O  O   . ASN K 1 20 ? -31.549 13.083  5.229   1.00 133.24 ? 16  ASN K O   1 
ATOM   4146 C  CB  . ASN K 1 20 ? -34.388 13.006  5.067   1.00 127.80 ? 16  ASN K CB  1 
ATOM   4147 C  CG  . ASN K 1 20 ? -34.107 11.645  5.676   1.00 135.39 ? 16  ASN K CG  1 
ATOM   4148 O  OD1 . ASN K 1 20 ? -33.313 11.510  6.608   1.00 142.51 ? 16  ASN K OD1 1 
ATOM   4149 N  ND2 . ASN K 1 20 ? -34.773 10.627  5.153   1.00 133.43 ? 16  ASN K ND2 1 
ATOM   4150 N  N   . LEU K 1 21 ? -31.595 15.330  5.089   1.00 131.21 ? 17  LEU K N   1 
ATOM   4151 C  CA  . LEU K 1 21 ? -30.184 15.423  4.732   1.00 136.38 ? 17  LEU K CA  1 
ATOM   4152 C  C   . LEU K 1 21 ? -29.315 14.873  5.854   1.00 143.80 ? 17  LEU K C   1 
ATOM   4153 O  O   . LEU K 1 21 ? -29.590 15.084  7.039   1.00 149.45 ? 17  LEU K O   1 
ATOM   4154 C  CB  . LEU K 1 21 ? -29.802 16.874  4.437   1.00 135.07 ? 17  LEU K CB  1 
ATOM   4155 N  N   . GLU K 1 22 ? -28.263 14.156  5.474   1.00 145.80 ? 18  GLU K N   1 
ATOM   4156 C  CA  . GLU K 1 22 ? -27.338 13.616  6.455   1.00 152.25 ? 18  GLU K CA  1 
ATOM   4157 C  C   . GLU K 1 22 ? -26.618 14.748  7.181   1.00 157.82 ? 18  GLU K C   1 
ATOM   4158 O  O   . GLU K 1 22 ? -26.620 15.905  6.748   1.00 157.28 ? 18  GLU K O   1 
ATOM   4159 C  CB  . GLU K 1 22 ? -26.329 12.685  5.782   1.00 153.63 ? 18  GLU K CB  1 
ATOM   4160 N  N   . THR K 1 23 ? -25.999 14.400  8.310   1.00 163.76 ? 19  THR K N   1 
ATOM   4161 C  CA  . THR K 1 23 ? -25.295 15.402  9.101   1.00 168.08 ? 19  THR K CA  1 
ATOM   4162 C  C   . THR K 1 23 ? -24.139 16.019  8.326   1.00 169.11 ? 19  THR K C   1 
ATOM   4163 O  O   . THR K 1 23 ? -23.790 17.184  8.555   1.00 171.82 ? 19  THR K O   1 
ATOM   4164 C  CB  . THR K 1 23 ? -24.788 14.782  10.402  1.00 175.48 ? 19  THR K CB  1 
ATOM   4165 N  N   . LYS K 1 24 ? -23.539 15.265  7.403   1.00 167.08 ? 20  LYS K N   1 
ATOM   4166 C  CA  . LYS K 1 24 ? -22.418 15.777  6.624   1.00 166.39 ? 20  LYS K CA  1 
ATOM   4167 C  C   . LYS K 1 24 ? -22.851 16.750  5.534   1.00 161.32 ? 20  LYS K C   1 
ATOM   4168 O  O   . LYS K 1 24 ? -22.038 17.579  5.110   1.00 163.86 ? 20  LYS K O   1 
ATOM   4169 C  CB  . LYS K 1 24 ? -21.639 14.616  6.000   1.00 164.51 ? 20  LYS K CB  1 
ATOM   4170 C  CG  . LYS K 1 24 ? -20.875 13.768  7.006   1.00 168.77 ? 20  LYS K CG  1 
ATOM   4171 C  CD  . LYS K 1 24 ? -20.294 12.517  6.363   1.00 168.55 ? 20  LYS K CD  1 
ATOM   4172 C  CE  . LYS K 1 24 ? -21.398 11.599  5.860   1.00 162.41 ? 20  LYS K CE  1 
ATOM   4173 N  NZ  . LYS K 1 24 ? -20.864 10.337  5.276   1.00 164.74 ? 20  LYS K NZ  1 
ATOM   4174 N  N   . VAL K 1 25 ? -24.106 16.674  5.079   1.00 154.63 ? 21  VAL K N   1 
ATOM   4175 C  CA  . VAL K 1 25 ? -24.564 17.545  4.001   1.00 149.48 ? 21  VAL K CA  1 
ATOM   4176 C  C   . VAL K 1 25 ? -24.505 19.002  4.441   1.00 153.12 ? 21  VAL K C   1 
ATOM   4177 O  O   . VAL K 1 25 ? -24.790 19.337  5.599   1.00 156.56 ? 21  VAL K O   1 
ATOM   4178 C  CB  . VAL K 1 25 ? -25.985 17.153  3.564   1.00 141.20 ? 21  VAL K CB  1 
ATOM   4179 N  N   . THR K 1 26 ? -24.137 19.880  3.507   1.00 144.82 ? 22  THR K N   1 
ATOM   4180 C  CA  . THR K 1 26 ? -23.952 21.298  3.786   1.00 139.87 ? 22  THR K CA  1 
ATOM   4181 C  C   . THR K 1 26 ? -24.798 22.134  2.837   1.00 130.43 ? 22  THR K C   1 
ATOM   4182 O  O   . THR K 1 26 ? -25.235 21.668  1.782   1.00 125.68 ? 22  THR K O   1 
ATOM   4183 C  CB  . THR K 1 26 ? -22.480 21.716  3.656   1.00 142.51 ? 22  THR K CB  1 
ATOM   4184 O  OG1 . THR K 1 26 ? -22.010 21.425  2.333   1.00 138.76 ? 22  THR K OG1 1 
ATOM   4185 C  CG2 . THR K 1 26 ? -21.624 20.970  4.666   1.00 148.70 ? 22  THR K CG2 1 
ATOM   4186 N  N   . GLU K 1 27 ? -25.015 23.393  3.229   1.00 130.57 ? 23  GLU K N   1 
ATOM   4187 C  CA  . GLU K 1 27 ? -25.778 24.313  2.393   1.00 126.70 ? 23  GLU K CA  1 
ATOM   4188 C  C   . GLU K 1 27 ? -25.070 24.588  1.073   1.00 125.65 ? 23  GLU K C   1 
ATOM   4189 O  O   . GLU K 1 27 ? -25.728 24.817  0.053   1.00 123.14 ? 23  GLU K O   1 
ATOM   4190 C  CB  . GLU K 1 27 ? -26.028 25.622  3.142   1.00 127.56 ? 23  GLU K CB  1 
ATOM   4191 N  N   . GLU K 1 28 ? -23.734 24.574  1.073   1.00 129.61 ? 24  GLU K N   1 
ATOM   4192 C  CA  . GLU K 1 28 ? -22.995 24.776  -0.168  1.00 131.35 ? 24  GLU K CA  1 
ATOM   4193 C  C   . GLU K 1 28 ? -23.167 23.598  -1.117  1.00 130.34 ? 24  GLU K C   1 
ATOM   4194 O  O   . GLU K 1 28 ? -23.072 23.768  -2.337  1.00 130.13 ? 24  GLU K O   1 
ATOM   4195 C  CB  . GLU K 1 28 ? -21.514 25.005  0.132   1.00 135.95 ? 24  GLU K CB  1 
ATOM   4196 N  N   . LEU K 1 29 ? -23.413 22.402  -0.579  1.00 130.97 ? 25  LEU K N   1 
ATOM   4197 C  CA  . LEU K 1 29 ? -23.636 21.239  -1.428  1.00 128.08 ? 25  LEU K CA  1 
ATOM   4198 C  C   . LEU K 1 29 ? -25.049 21.227  -1.995  1.00 122.92 ? 25  LEU K C   1 
ATOM   4199 O  O   . LEU K 1 29 ? -25.255 20.828  -3.147  1.00 121.41 ? 25  LEU K O   1 
ATOM   4200 C  CB  . LEU K 1 29 ? -23.371 19.953  -0.645  1.00 128.70 ? 25  LEU K CB  1 
ATOM   4201 C  CG  . LEU K 1 29 ? -23.468 18.673  -1.475  1.00 123.54 ? 25  LEU K CG  1 
ATOM   4202 C  CD1 . LEU K 1 29 ? -22.504 18.748  -2.645  1.00 122.31 ? 25  LEU K CD1 1 
ATOM   4203 C  CD2 . LEU K 1 29 ? -23.193 17.443  -0.624  1.00 127.71 ? 25  LEU K CD2 1 
ATOM   4204 N  N   . LEU K 1 30 ? -26.033 21.660  -1.202  1.00 122.57 ? 26  LEU K N   1 
ATOM   4205 C  CA  . LEU K 1 30 ? -27.406 21.710  -1.691  1.00 119.62 ? 26  LEU K CA  1 
ATOM   4206 C  C   . LEU K 1 30 ? -27.547 22.673  -2.861  1.00 121.12 ? 26  LEU K C   1 
ATOM   4207 O  O   . LEU K 1 30 ? -28.373 22.448  -3.753  1.00 119.45 ? 26  LEU K O   1 
ATOM   4208 C  CB  . LEU K 1 30 ? -28.354 22.107  -0.559  1.00 117.96 ? 26  LEU K CB  1 
ATOM   4209 N  N   . PHE K 1 31 ? -26.753 23.745  -2.877  1.00 124.40 ? 27  PHE K N   1 
ATOM   4210 C  CA  . PHE K 1 31 ? -26.812 24.700  -3.979  1.00 122.55 ? 27  PHE K CA  1 
ATOM   4211 C  C   . PHE K 1 31 ? -26.379 24.046  -5.286  1.00 120.21 ? 27  PHE K C   1 
ATOM   4212 O  O   . PHE K 1 31 ? -27.107 24.079  -6.284  1.00 115.52 ? 27  PHE K O   1 
ATOM   4213 C  CB  . PHE K 1 31 ? -25.940 25.917  -3.665  1.00 128.13 ? 27  PHE K CB  1 
ATOM   4214 C  CG  . PHE K 1 31 ? -26.031 27.015  -4.691  1.00 128.39 ? 27  PHE K CG  1 
ATOM   4215 C  CD1 . PHE K 1 31 ? -25.236 26.993  -5.828  1.00 128.91 ? 27  PHE K CD1 1 
ATOM   4216 C  CD2 . PHE K 1 31 ? -26.906 28.074  -4.514  1.00 127.97 ? 27  PHE K CD2 1 
ATOM   4217 C  CE1 . PHE K 1 31 ? -25.320 27.999  -6.771  1.00 128.36 ? 27  PHE K CE1 1 
ATOM   4218 C  CE2 . PHE K 1 31 ? -26.991 29.085  -5.454  1.00 127.99 ? 27  PHE K CE2 1 
ATOM   4219 C  CZ  . PHE K 1 31 ? -26.195 29.047  -6.583  1.00 127.78 ? 27  PHE K CZ  1 
ATOM   4220 N  N   . GLU K 1 32 ? -25.190 23.438  -5.290  1.00 122.34 ? 28  GLU K N   1 
ATOM   4221 C  CA  . GLU K 1 32 ? -24.653 22.854  -6.516  1.00 119.63 ? 28  GLU K CA  1 
ATOM   4222 C  C   . GLU K 1 32 ? -25.576 21.776  -7.071  1.00 115.26 ? 28  GLU K C   1 
ATOM   4223 O  O   . GLU K 1 32 ? -25.703 21.628  -8.291  1.00 111.66 ? 28  GLU K O   1 
ATOM   4224 C  CB  . GLU K 1 32 ? -23.257 22.289  -6.260  1.00 123.18 ? 28  GLU K CB  1 
ATOM   4225 N  N   . LEU K 1 33 ? -26.243 21.024  -6.192  1.00 115.26 ? 29  LEU K N   1 
ATOM   4226 C  CA  . LEU K 1 33 ? -27.140 19.969  -6.652  1.00 113.29 ? 29  LEU K CA  1 
ATOM   4227 C  C   . LEU K 1 33 ? -28.367 20.556  -7.337  1.00 114.46 ? 29  LEU K C   1 
ATOM   4228 O  O   . LEU K 1 33 ? -28.636 20.273  -8.509  1.00 113.69 ? 29  LEU K O   1 
ATOM   4229 C  CB  . LEU K 1 33 ? -27.549 19.075  -5.482  1.00 109.18 ? 29  LEU K CB  1 
ATOM   4230 C  CG  . LEU K 1 33 ? -28.470 17.916  -5.867  1.00 102.95 ? 29  LEU K CG  1 
ATOM   4231 C  CD1 . LEU K 1 33 ? -27.872 17.146  -7.029  1.00 103.47 ? 29  LEU K CD1 1 
ATOM   4232 C  CD2 . LEU K 1 33 ? -28.721 16.992  -4.683  1.00 103.21 ? 29  LEU K CD2 1 
ATOM   4233 N  N   . PHE K 1 34 ? -29.128 21.382  -6.615  1.00 117.73 ? 30  PHE K N   1 
ATOM   4234 C  CA  . PHE K 1 34 ? -30.339 21.956  -7.187  1.00 119.12 ? 30  PHE K CA  1 
ATOM   4235 C  C   . PHE K 1 34 ? -30.044 22.941  -8.309  1.00 120.95 ? 30  PHE K C   1 
ATOM   4236 O  O   . PHE K 1 34 ? -30.928 23.201  -9.134  1.00 117.76 ? 30  PHE K O   1 
ATOM   4237 C  CB  . PHE K 1 34 ? -31.169 22.626  -6.094  1.00 120.57 ? 30  PHE K CB  1 
ATOM   4238 C  CG  . PHE K 1 34 ? -31.852 21.653  -5.187  1.00 121.55 ? 30  PHE K CG  1 
ATOM   4239 C  CD1 . PHE K 1 34 ? -33.169 21.293  -5.404  1.00 120.41 ? 30  PHE K CD1 1 
ATOM   4240 C  CD2 . PHE K 1 34 ? -31.169 21.076  -4.132  1.00 124.88 ? 30  PHE K CD2 1 
ATOM   4241 C  CE1 . PHE K 1 34 ? -33.798 20.387  -4.575  1.00 121.87 ? 30  PHE K CE1 1 
ATOM   4242 C  CE2 . PHE K 1 34 ? -31.791 20.171  -3.300  1.00 126.76 ? 30  PHE K CE2 1 
ATOM   4243 C  CZ  . PHE K 1 34 ? -33.108 19.825  -3.521  1.00 125.32 ? 30  PHE K CZ  1 
ATOM   4244 N  N   . HIS K 1 35 ? -28.824 23.483  -8.367  1.00 126.04 ? 31  HIS K N   1 
ATOM   4245 C  CA  . HIS K 1 35 ? -28.446 24.345  -9.481  1.00 127.87 ? 31  HIS K CA  1 
ATOM   4246 C  C   . HIS K 1 35 ? -28.582 23.639  -10.822 1.00 119.31 ? 31  HIS K C   1 
ATOM   4247 O  O   . HIS K 1 35 ? -28.684 24.307  -11.854 1.00 116.85 ? 31  HIS K O   1 
ATOM   4248 C  CB  . HIS K 1 35 ? -27.011 24.849  -9.301  1.00 140.05 ? 31  HIS K CB  1 
ATOM   4249 C  CG  . HIS K 1 35 ? -26.807 26.264  -9.745  1.00 149.92 ? 31  HIS K CG  1 
ATOM   4250 N  ND1 . HIS K 1 35 ? -27.445 27.330  -9.148  1.00 151.63 ? 31  HIS K ND1 1 
ATOM   4251 C  CD2 . HIS K 1 35 ? -26.039 26.789  -10.729 1.00 156.39 ? 31  HIS K CD2 1 
ATOM   4252 C  CE1 . HIS K 1 35 ? -27.078 28.451  -9.744  1.00 154.77 ? 31  HIS K CE1 1 
ATOM   4253 N  NE2 . HIS K 1 35 ? -26.225 28.150  -10.707 1.00 158.04 ? 31  HIS K NE2 1 
ATOM   4254 N  N   . GLN K 1 36 ? -28.584 22.305  -10.834 1.00 114.94 ? 32  GLN K N   1 
ATOM   4255 C  CA  . GLN K 1 36 ? -28.799 21.583  -12.082 1.00 111.27 ? 32  GLN K CA  1 
ATOM   4256 C  C   . GLN K 1 36 ? -30.223 21.760  -12.588 1.00 105.20 ? 32  GLN K C   1 
ATOM   4257 O  O   . GLN K 1 36 ? -30.440 21.960  -13.789 1.00 103.38 ? 32  GLN K O   1 
ATOM   4258 C  CB  . GLN K 1 36 ? -28.490 20.102  -11.895 1.00 112.37 ? 32  GLN K CB  1 
ATOM   4259 C  CG  . GLN K 1 36 ? -27.019 19.781  -11.803 1.00 115.93 ? 32  GLN K CG  1 
ATOM   4260 C  CD  . GLN K 1 36 ? -26.761 18.302  -11.957 1.00 115.87 ? 32  GLN K CD  1 
ATOM   4261 O  OE1 . GLN K 1 36 ? -27.133 17.698  -12.961 1.00 113.66 ? 32  GLN K OE1 1 
ATOM   4262 N  NE2 . GLN K 1 36 ? -26.144 17.703  -10.950 1.00 118.03 ? 32  GLN K NE2 1 
ATOM   4263 N  N   . ALA K 1 37 ? -31.211 21.683  -11.692 1.00 102.05 ? 33  ALA K N   1 
ATOM   4264 C  CA  . ALA K 1 37 ? -32.603 21.790  -12.121 1.00 97.42  ? 33  ALA K CA  1 
ATOM   4265 C  C   . ALA K 1 37 ? -32.948 23.201  -12.582 1.00 95.20  ? 33  ALA K C   1 
ATOM   4266 O  O   . ALA K 1 37 ? -33.769 23.372  -13.492 1.00 91.62  ? 33  ALA K O   1 
ATOM   4267 C  CB  . ALA K 1 37 ? -33.538 21.355  -10.994 1.00 95.74  ? 33  ALA K CB  1 
ATOM   4268 N  N   . GLY K 1 38 ? -32.340 24.217  -11.978 1.00 98.14  ? 34  GLY K N   1 
ATOM   4269 C  CA  . GLY K 1 38 ? -32.589 25.586  -12.359 1.00 100.38 ? 34  GLY K CA  1 
ATOM   4270 C  C   . GLY K 1 38 ? -31.728 26.571  -11.595 1.00 104.62 ? 34  GLY K C   1 
ATOM   4271 O  O   . GLY K 1 38 ? -31.033 26.217  -10.636 1.00 107.45 ? 34  GLY K O   1 
ATOM   4272 N  N   . PRO K 1 39 ? -31.753 27.836  -12.016 1.00 105.95 ? 35  PRO K N   1 
ATOM   4273 C  CA  . PRO K 1 39 ? -30.997 28.866  -11.292 1.00 112.64 ? 35  PRO K CA  1 
ATOM   4274 C  C   . PRO K 1 39 ? -31.519 29.011  -9.871  1.00 120.06 ? 35  PRO K C   1 
ATOM   4275 O  O   . PRO K 1 39 ? -32.715 29.213  -9.648  1.00 124.38 ? 35  PRO K O   1 
ATOM   4276 C  CB  . PRO K 1 39 ? -31.238 30.136  -12.116 1.00 111.03 ? 35  PRO K CB  1 
ATOM   4277 C  CG  . PRO K 1 39 ? -31.731 29.659  -13.442 1.00 107.53 ? 35  PRO K CG  1 
ATOM   4278 C  CD  . PRO K 1 39 ? -32.473 28.390  -13.173 1.00 103.53 ? 35  PRO K CD  1 
ATOM   4279 N  N   . VAL K 1 40 ? -30.610 28.901  -8.907  1.00 123.29 ? 36  VAL K N   1 
ATOM   4280 C  CA  . VAL K 1 40 ? -30.960 28.905  -7.492  1.00 127.59 ? 36  VAL K CA  1 
ATOM   4281 C  C   . VAL K 1 40 ? -30.597 30.256  -6.896  1.00 133.30 ? 36  VAL K C   1 
ATOM   4282 O  O   . VAL K 1 40 ? -29.507 30.786  -7.147  1.00 136.90 ? 36  VAL K O   1 
ATOM   4283 C  CB  . VAL K 1 40 ? -30.254 27.765  -6.739  1.00 128.13 ? 36  VAL K CB  1 
ATOM   4284 C  CG1 . VAL K 1 40 ? -30.671 27.758  -5.272  1.00 132.58 ? 36  VAL K CG1 1 
ATOM   4285 C  CG2 . VAL K 1 40 ? -30.567 26.429  -7.389  1.00 124.63 ? 36  VAL K CG2 1 
ATOM   4286 N  N   . ILE K 1 41 ? -31.515 30.814  -6.106  1.00 132.19 ? 37  ILE K N   1 
ATOM   4287 C  CA  . ILE K 1 41 ? -31.240 32.063  -5.404  1.00 137.13 ? 37  ILE K CA  1 
ATOM   4288 C  C   . ILE K 1 41 ? -30.316 31.807  -4.219  1.00 139.70 ? 37  ILE K C   1 
ATOM   4289 O  O   . ILE K 1 41 ? -29.175 32.280  -4.181  1.00 143.71 ? 37  ILE K O   1 
ATOM   4290 C  CB  . ILE K 1 41 ? -32.553 32.731  -4.960  1.00 138.23 ? 37  ILE K CB  1 
ATOM   4291 N  N   . LYS K 1 42 ? -30.792 31.039  -3.242  1.00 139.67 ? 38  LYS K N   1 
ATOM   4292 C  CA  . LYS K 1 42 ? -30.007 30.751  -2.052  1.00 141.54 ? 38  LYS K CA  1 
ATOM   4293 C  C   . LYS K 1 42 ? -30.433 29.406  -1.483  1.00 141.79 ? 38  LYS K C   1 
ATOM   4294 O  O   . LYS K 1 42 ? -31.468 28.845  -1.855  1.00 139.79 ? 38  LYS K O   1 
ATOM   4295 C  CB  . LYS K 1 42 ? -30.157 31.858  -1.000  1.00 142.30 ? 38  LYS K CB  1 
ATOM   4296 N  N   . VAL K 1 43 ? -29.614 28.893  -0.568  1.00 145.61 ? 39  VAL K N   1 
ATOM   4297 C  CA  . VAL K 1 43 ? -29.887 27.644  0.135   1.00 146.66 ? 39  VAL K CA  1 
ATOM   4298 C  C   . VAL K 1 43 ? -29.379 27.784  1.563   1.00 153.80 ? 39  VAL K C   1 
ATOM   4299 O  O   . VAL K 1 43 ? -28.211 28.123  1.780   1.00 158.30 ? 39  VAL K O   1 
ATOM   4300 C  CB  . VAL K 1 43 ? -29.233 26.433  -0.557  1.00 143.57 ? 39  VAL K CB  1 
ATOM   4301 N  N   . LYS K 1 44 ? -30.249 27.515  2.532   1.00 155.43 ? 40  LYS K N   1 
ATOM   4302 C  CA  . LYS K 1 44 ? -29.894 27.665  3.940   1.00 159.72 ? 40  LYS K CA  1 
ATOM   4303 C  C   . LYS K 1 44 ? -29.984 26.341  4.693   1.00 159.81 ? 40  LYS K C   1 
ATOM   4304 O  O   . LYS K 1 44 ? -29.604 26.255  5.861   1.00 164.14 ? 40  LYS K O   1 
ATOM   4305 C  CB  . LYS K 1 44 ? -30.796 28.707  4.606   1.00 160.23 ? 40  LYS K CB  1 
ATOM   4306 N  N   . LYS K 1 52 ? -26.196 24.095  16.387  1.00 220.54 ? 48  LYS K N   1 
ATOM   4307 C  CA  . LYS K 1 52 ? -26.116 22.897  15.561  1.00 211.28 ? 48  LYS K CA  1 
ATOM   4308 C  C   . LYS K 1 52 ? -27.172 22.923  14.462  1.00 198.19 ? 48  LYS K C   1 
ATOM   4309 O  O   . LYS K 1 52 ? -28.321 23.286  14.711  1.00 186.07 ? 48  LYS K O   1 
ATOM   4310 C  CB  . LYS K 1 52 ? -26.278 21.641  16.419  1.00 163.86 ? 48  LYS K CB  1 
ATOM   4311 N  N   . PRO K 1 53 ? -26.778 22.541  13.248  1.00 196.88 ? 49  PRO K N   1 
ATOM   4312 C  CA  . PRO K 1 53 ? -27.733 22.527  12.135  1.00 189.14 ? 49  PRO K CA  1 
ATOM   4313 C  C   . PRO K 1 53 ? -28.845 21.515  12.365  1.00 181.82 ? 49  PRO K C   1 
ATOM   4314 O  O   . PRO K 1 53 ? -28.669 20.506  13.052  1.00 184.43 ? 49  PRO K O   1 
ATOM   4315 C  CB  . PRO K 1 53 ? -26.870 22.140  10.927  1.00 187.40 ? 49  PRO K CB  1 
ATOM   4316 C  CG  . PRO K 1 53 ? -25.466 22.448  11.335  1.00 193.84 ? 49  PRO K CG  1 
ATOM   4317 C  CD  . PRO K 1 53 ? -25.416 22.194  12.812  1.00 200.38 ? 49  PRO K CD  1 
ATOM   4318 N  N   . LYS K 1 54 ? -30.003 21.800  11.778  1.00 175.18 ? 50  LYS K N   1 
ATOM   4319 C  CA  . LYS K 1 54 ? -31.130 20.880  11.823  1.00 171.03 ? 50  LYS K CA  1 
ATOM   4320 C  C   . LYS K 1 54 ? -30.962 19.838  10.717  1.00 163.23 ? 50  LYS K C   1 
ATOM   4321 O  O   . LYS K 1 54 ? -29.936 19.781  10.033  1.00 163.01 ? 50  LYS K O   1 
ATOM   4322 C  CB  . LYS K 1 54 ? -32.445 21.647  11.706  1.00 168.38 ? 50  LYS K CB  1 
ATOM   4323 N  N   . GLN K 1 55 ? -31.976 18.996  10.525  1.00 157.93 ? 51  GLN K N   1 
ATOM   4324 C  CA  . GLN K 1 55 ? -31.939 17.953  9.511   1.00 151.36 ? 51  GLN K CA  1 
ATOM   4325 C  C   . GLN K 1 55 ? -32.700 18.338  8.244   1.00 144.42 ? 51  GLN K C   1 
ATOM   4326 O  O   . GLN K 1 55 ? -33.070 17.458  7.460   1.00 141.58 ? 51  GLN K O   1 
ATOM   4327 C  CB  . GLN K 1 55 ? -32.489 16.644  10.083  1.00 151.54 ? 51  GLN K CB  1 
ATOM   4328 N  N   . PHE K 1 56 ? -32.935 19.632  8.026   1.00 142.16 ? 52  PHE K N   1 
ATOM   4329 C  CA  . PHE K 1 56 ? -33.692 20.094  6.869   1.00 135.67 ? 52  PHE K CA  1 
ATOM   4330 C  C   . PHE K 1 56 ? -33.222 21.488  6.474   1.00 137.39 ? 52  PHE K C   1 
ATOM   4331 O  O   . PHE K 1 56 ? -32.621 22.212  7.273   1.00 143.44 ? 52  PHE K O   1 
ATOM   4332 C  CB  . PHE K 1 56 ? -35.200 20.100  7.153   1.00 131.34 ? 52  PHE K CB  1 
ATOM   4333 C  CG  . PHE K 1 56 ? -35.593 20.960  8.322   1.00 134.14 ? 52  PHE K CG  1 
ATOM   4334 C  CD1 . PHE K 1 56 ? -35.831 22.316  8.155   1.00 133.57 ? 52  PHE K CD1 1 
ATOM   4335 C  CD2 . PHE K 1 56 ? -35.730 20.413  9.589   1.00 137.72 ? 52  PHE K CD2 1 
ATOM   4336 C  CE1 . PHE K 1 56 ? -36.192 23.109  9.230   1.00 136.21 ? 52  PHE K CE1 1 
ATOM   4337 C  CE2 . PHE K 1 56 ? -36.094 21.202  10.663  1.00 140.28 ? 52  PHE K CE2 1 
ATOM   4338 C  CZ  . PHE K 1 56 ? -36.325 22.551  10.482  1.00 139.77 ? 52  PHE K CZ  1 
ATOM   4339 N  N   . ALA K 1 57 ? -33.521 21.864  5.230   1.00 133.24 ? 53  ALA K N   1 
ATOM   4340 C  CA  . ALA K 1 57 ? -33.156 23.175  4.708   1.00 132.67 ? 53  ALA K CA  1 
ATOM   4341 C  C   . ALA K 1 57 ? -34.127 23.564  3.600   1.00 130.41 ? 53  ALA K C   1 
ATOM   4342 O  O   . ALA K 1 57 ? -34.931 22.752  3.134   1.00 125.85 ? 53  ALA K O   1 
ATOM   4343 C  CB  . ALA K 1 57 ? -31.711 23.193  4.195   1.00 131.34 ? 53  ALA K CB  1 
ATOM   4344 N  N   . PHE K 1 58 ? -34.036 24.821  3.169   1.00 133.91 ? 54  PHE K N   1 
ATOM   4345 C  CA  . PHE K 1 58 ? -34.931 25.378  2.161   1.00 135.06 ? 54  PHE K CA  1 
ATOM   4346 C  C   . PHE K 1 58 ? -34.123 25.965  1.013   1.00 135.61 ? 54  PHE K C   1 
ATOM   4347 O  O   . PHE K 1 58 ? -33.160 26.705  1.240   1.00 139.74 ? 54  PHE K O   1 
ATOM   4348 C  CB  . PHE K 1 58 ? -35.837 26.455  2.762   1.00 138.39 ? 54  PHE K CB  1 
ATOM   4349 N  N   . VAL K 1 59 ? -34.528 25.647  -0.215  1.00 134.14 ? 55  VAL K N   1 
ATOM   4350 C  CA  . VAL K 1 59 ? -33.845 26.100  -1.422  1.00 134.86 ? 55  VAL K CA  1 
ATOM   4351 C  C   . VAL K 1 59 ? -34.814 26.972  -2.209  1.00 137.35 ? 55  VAL K C   1 
ATOM   4352 O  O   . VAL K 1 59 ? -35.804 26.472  -2.760  1.00 137.08 ? 55  VAL K O   1 
ATOM   4353 C  CB  . VAL K 1 59 ? -33.344 24.928  -2.278  1.00 129.08 ? 55  VAL K CB  1 
ATOM   4354 N  N   . ASN K 1 60 ? -34.533 28.270  -2.266  1.00 140.03 ? 56  ASN K N   1 
ATOM   4355 C  CA  . ASN K 1 60 ? -35.324 29.198  -3.061  1.00 140.65 ? 56  ASN K CA  1 
ATOM   4356 C  C   . ASN K 1 60 ? -34.740 29.288  -4.465  1.00 139.99 ? 56  ASN K C   1 
ATOM   4357 O  O   . ASN K 1 60 ? -33.527 29.449  -4.630  1.00 141.90 ? 56  ASN K O   1 
ATOM   4358 C  CB  . ASN K 1 60 ? -35.356 30.580  -2.408  1.00 144.76 ? 56  ASN K CB  1 
ATOM   4359 N  N   . PHE K 1 61 ? -35.601 29.178  -5.470  1.00 137.05 ? 57  PHE K N   1 
ATOM   4360 C  CA  . PHE K 1 61 ? -35.180 29.244  -6.861  1.00 135.43 ? 57  PHE K CA  1 
ATOM   4361 C  C   . PHE K 1 61 ? -35.350 30.656  -7.411  1.00 137.85 ? 57  PHE K C   1 
ATOM   4362 O  O   . PHE K 1 61 ? -35.971 31.526  -6.795  1.00 139.57 ? 57  PHE K O   1 
ATOM   4363 C  CB  . PHE K 1 61 ? -35.967 28.242  -7.711  1.00 132.25 ? 57  PHE K CB  1 
ATOM   4364 C  CG  . PHE K 1 61 ? -35.383 26.861  -7.712  1.00 130.89 ? 57  PHE K CG  1 
ATOM   4365 C  CD1 . PHE K 1 61 ? -34.327 26.543  -8.551  1.00 130.52 ? 57  PHE K CD1 1 
ATOM   4366 C  CD2 . PHE K 1 61 ? -35.891 25.878  -6.878  1.00 130.54 ? 57  PHE K CD2 1 
ATOM   4367 C  CE1 . PHE K 1 61 ? -33.785 25.272  -8.558  1.00 129.13 ? 57  PHE K CE1 1 
ATOM   4368 C  CE2 . PHE K 1 61 ? -35.351 24.602  -6.882  1.00 129.47 ? 57  PHE K CE2 1 
ATOM   4369 C  CZ  . PHE K 1 61 ? -34.297 24.301  -7.723  1.00 128.62 ? 57  PHE K CZ  1 
ATOM   4370 N  N   . LYS K 1 62 ? -34.778 30.875  -8.594  1.00 139.74 ? 58  LYS K N   1 
ATOM   4371 C  CA  . LYS K 1 62 ? -34.887 32.158  -9.271  1.00 144.92 ? 58  LYS K CA  1 
ATOM   4372 C  C   . LYS K 1 62 ? -36.109 32.249  -10.172 1.00 144.87 ? 58  LYS K C   1 
ATOM   4373 O  O   . LYS K 1 62 ? -36.507 33.360  -10.541 1.00 149.67 ? 58  LYS K O   1 
ATOM   4374 C  CB  . LYS K 1 62 ? -33.626 32.432  -10.097 1.00 146.35 ? 58  LYS K CB  1 
ATOM   4375 N  N   . HIS K 1 63 ? -36.712 31.117  -10.532 1.00 141.74 ? 59  HIS K N   1 
ATOM   4376 C  CA  . HIS K 1 63 ? -37.890 31.099  -11.387 1.00 142.37 ? 59  HIS K CA  1 
ATOM   4377 C  C   . HIS K 1 63 ? -38.870 30.055  -10.870 1.00 140.71 ? 59  HIS K C   1 
ATOM   4378 O  O   . HIS K 1 63 ? -38.468 28.998  -10.375 1.00 139.82 ? 59  HIS K O   1 
ATOM   4379 C  CB  . HIS K 1 63 ? -37.522 30.802  -12.848 1.00 142.08 ? 59  HIS K CB  1 
ATOM   4380 C  CG  . HIS K 1 63 ? -36.351 31.590  -13.347 1.00 145.33 ? 59  HIS K CG  1 
ATOM   4381 N  ND1 . HIS K 1 63 ? -35.046 31.244  -13.064 1.00 145.63 ? 59  HIS K ND1 1 
ATOM   4382 C  CD2 . HIS K 1 63 ? -36.286 32.711  -14.104 1.00 148.34 ? 59  HIS K CD2 1 
ATOM   4383 C  CE1 . HIS K 1 63 ? -34.229 32.116  -13.629 1.00 148.59 ? 59  HIS K CE1 1 
ATOM   4384 N  NE2 . HIS K 1 63 ? -34.956 33.016  -14.266 1.00 149.92 ? 59  HIS K NE2 1 
ATOM   4385 N  N   . GLU K 1 64 ? -40.167 30.361  -10.998 1.00 140.27 ? 60  GLU K N   1 
ATOM   4386 C  CA  . GLU K 1 64 ? -41.198 29.478  -10.457 1.00 137.39 ? 60  GLU K CA  1 
ATOM   4387 C  C   . GLU K 1 64 ? -41.242 28.133  -11.177 1.00 128.68 ? 60  GLU K C   1 
ATOM   4388 O  O   . GLU K 1 64 ? -41.521 27.108  -10.544 1.00 130.43 ? 60  GLU K O   1 
ATOM   4389 C  CB  . GLU K 1 64 ? -42.571 30.154  -10.526 1.00 142.52 ? 60  GLU K CB  1 
ATOM   4390 C  CG  . GLU K 1 64 ? -43.684 29.358  -9.848  1.00 143.28 ? 60  GLU K CG  1 
ATOM   4391 C  CD  . GLU K 1 64 ? -45.028 30.065  -9.887  1.00 147.74 ? 60  GLU K CD  1 
ATOM   4392 O  OE1 . GLU K 1 64 ? -46.064 29.378  -10.021 1.00 147.82 ? 60  GLU K OE1 1 
ATOM   4393 O  OE2 . GLU K 1 64 ? -45.048 31.310  -9.783  1.00 150.92 ? 60  GLU K OE2 1 
ATOM   4394 N  N   . VAL K 1 65 ? -40.969 28.110  -12.485 1.00 120.50 ? 61  VAL K N   1 
ATOM   4395 C  CA  . VAL K 1 65 ? -41.040 26.869  -13.252 1.00 113.27 ? 61  VAL K CA  1 
ATOM   4396 C  C   . VAL K 1 65 ? -40.031 25.825  -12.798 1.00 109.08 ? 61  VAL K C   1 
ATOM   4397 O  O   . VAL K 1 65 ? -40.185 24.645  -13.133 1.00 107.51 ? 61  VAL K O   1 
ATOM   4398 C  CB  . VAL K 1 65 ? -40.841 27.143  -14.759 1.00 111.66 ? 61  VAL K CB  1 
ATOM   4399 N  N   . SER K 1 66 ? -38.998 26.226  -12.050 1.00 107.96 ? 62  SER K N   1 
ATOM   4400 C  CA  . SER K 1 66 ? -37.984 25.272  -11.605 1.00 105.09 ? 62  SER K CA  1 
ATOM   4401 C  C   . SER K 1 66 ? -38.520 24.303  -10.557 1.00 108.11 ? 62  SER K C   1 
ATOM   4402 O  O   . SER K 1 66 ? -38.021 23.176  -10.449 1.00 107.79 ? 62  SER K O   1 
ATOM   4403 C  CB  . SER K 1 66 ? -36.770 26.015  -11.043 1.00 101.00 ? 62  SER K CB  1 
ATOM   4404 O  OG  . SER K 1 66 ? -36.175 26.840  -12.026 1.00 98.73  ? 62  SER K OG  1 
ATOM   4405 N  N   . VAL K 1 67 ? -39.522 24.720  -9.773  1.00 109.95 ? 63  VAL K N   1 
ATOM   4406 C  CA  . VAL K 1 67 ? -39.950 23.915  -8.623  1.00 108.08 ? 63  VAL K CA  1 
ATOM   4407 C  C   . VAL K 1 67 ? -40.457 22.534  -9.026  1.00 106.39 ? 63  VAL K C   1 
ATOM   4408 O  O   . VAL K 1 67 ? -39.957 21.536  -8.481  1.00 108.84 ? 63  VAL K O   1 
ATOM   4409 C  CB  . VAL K 1 67 ? -40.969 24.701  -7.776  1.00 106.58 ? 63  VAL K CB  1 
ATOM   4410 C  CG1 . VAL K 1 67 ? -41.573 23.808  -6.697  1.00 104.70 ? 63  VAL K CG1 1 
ATOM   4411 C  CG2 . VAL K 1 67 ? -40.306 25.920  -7.153  1.00 109.05 ? 63  VAL K CG2 1 
ATOM   4412 N  N   . PRO K 1 68 ? -41.418 22.389  -9.950  1.00 100.06 ? 64  PRO K N   1 
ATOM   4413 C  CA  . PRO K 1 68 ? -41.833 21.025  -10.321 1.00 97.57  ? 64  PRO K CA  1 
ATOM   4414 C  C   . PRO K 1 68 ? -40.693 20.212  -10.904 1.00 97.62  ? 64  PRO K C   1 
ATOM   4415 O  O   . PRO K 1 68 ? -40.551 19.022  -10.590 1.00 100.63 ? 64  PRO K O   1 
ATOM   4416 C  CB  . PRO K 1 68 ? -42.946 21.256  -11.354 1.00 98.18  ? 64  PRO K CB  1 
ATOM   4417 C  CG  . PRO K 1 68 ? -43.352 22.674  -11.194 1.00 100.97 ? 64  PRO K CG  1 
ATOM   4418 C  CD  . PRO K 1 68 ? -42.131 23.404  -10.744 1.00 99.93  ? 64  PRO K CD  1 
ATOM   4419 N  N   . TYR K 1 69 ? -39.862 20.840  -11.740 1.00 92.83  ? 65  TYR K N   1 
ATOM   4420 C  CA  . TYR K 1 69 ? -38.767 20.127  -12.387 1.00 84.66  ? 65  TYR K CA  1 
ATOM   4421 C  C   . TYR K 1 69 ? -37.758 19.618  -11.367 1.00 79.97  ? 65  TYR K C   1 
ATOM   4422 O  O   . TYR K 1 69 ? -37.284 18.480  -11.467 1.00 74.02  ? 65  TYR K O   1 
ATOM   4423 C  CB  . TYR K 1 69 ? -38.087 21.039  -13.404 1.00 86.13  ? 65  TYR K CB  1 
ATOM   4424 C  CG  . TYR K 1 69 ? -37.134 20.325  -14.334 1.00 88.10  ? 65  TYR K CG  1 
ATOM   4425 C  CD1 . TYR K 1 69 ? -37.612 19.531  -15.367 1.00 88.78  ? 65  TYR K CD1 1 
ATOM   4426 C  CD2 . TYR K 1 69 ? -35.757 20.457  -14.191 1.00 89.64  ? 65  TYR K CD2 1 
ATOM   4427 C  CE1 . TYR K 1 69 ? -36.748 18.878  -16.225 1.00 89.53  ? 65  TYR K CE1 1 
ATOM   4428 C  CE2 . TYR K 1 69 ? -34.884 19.810  -15.047 1.00 89.32  ? 65  TYR K CE2 1 
ATOM   4429 C  CZ  . TYR K 1 69 ? -35.387 19.022  -16.062 1.00 89.49  ? 65  TYR K CZ  1 
ATOM   4430 O  OH  . TYR K 1 69 ? -34.531 18.376  -16.922 1.00 91.21  ? 65  TYR K OH  1 
ATOM   4431 N  N   . ALA K 1 70 ? -37.407 20.452  -10.385 1.00 82.87  ? 66  ALA K N   1 
ATOM   4432 C  CA  . ALA K 1 70 ? -36.517 20.006  -9.319  1.00 85.77  ? 66  ALA K CA  1 
ATOM   4433 C  C   . ALA K 1 70 ? -37.091 18.787  -8.610  1.00 88.28  ? 66  ALA K C   1 
ATOM   4434 O  O   . ALA K 1 70 ? -36.382 17.801  -8.377  1.00 90.02  ? 66  ALA K O   1 
ATOM   4435 C  CB  . ALA K 1 70 ? -36.268 21.142  -8.328  1.00 71.57  ? 66  ALA K CB  1 
ATOM   4436 N  N   . MET K 1 71 ? -38.386 18.829  -8.279  1.00 89.49  ? 67  MET K N   1 
ATOM   4437 C  CA  . MET K 1 71 ? -39.029 17.700  -7.611  1.00 89.43  ? 67  MET K CA  1 
ATOM   4438 C  C   . MET K 1 71 ? -38.935 16.432  -8.451  1.00 90.41  ? 67  MET K C   1 
ATOM   4439 O  O   . MET K 1 71 ? -38.582 15.363  -7.941  1.00 89.56  ? 67  MET K O   1 
ATOM   4440 C  CB  . MET K 1 71 ? -40.489 18.032  -7.307  1.00 90.18  ? 67  MET K CB  1 
ATOM   4441 C  CG  . MET K 1 71 ? -41.320 16.829  -6.865  1.00 91.51  ? 67  MET K CG  1 
ATOM   4442 S  SD  . MET K 1 71 ? -41.274 16.512  -5.086  1.00 93.23  ? 67  MET K SD  1 
ATOM   4443 C  CE  . MET K 1 71 ? -42.140 17.959  -4.472  1.00 94.55  ? 67  MET K CE  1 
ATOM   4444 N  N   . ASN K 1 72 ? -39.255 16.530  -9.746  1.00 91.93  ? 68  ASN K N   1 
ATOM   4445 C  CA  . ASN K 1 72 ? -39.137 15.367  -10.620 1.00 90.52  ? 68  ASN K CA  1 
ATOM   4446 C  C   . ASN K 1 72 ? -37.714 14.836  -10.635 1.00 90.95  ? 68  ASN K C   1 
ATOM   4447 O  O   . ASN K 1 72 ? -37.494 13.620  -10.596 1.00 94.49  ? 68  ASN K O   1 
ATOM   4448 C  CB  . ASN K 1 72 ? -39.583 15.722  -12.041 1.00 92.55  ? 68  ASN K CB  1 
ATOM   4449 C  CG  . ASN K 1 72 ? -41.079 15.961  -12.142 1.00 97.89  ? 68  ASN K CG  1 
ATOM   4450 O  OD1 . ASN K 1 72 ? -41.845 15.550  -11.270 1.00 102.70 ? 68  ASN K OD1 1 
ATOM   4451 N  ND2 . ASN K 1 72 ? -41.503 16.619  -13.219 1.00 98.10  ? 68  ASN K ND2 1 
ATOM   4452 N  N   . LEU K 1 73 ? -36.731 15.737  -10.656 1.00 89.97  ? 69  LEU K N   1 
ATOM   4453 C  CA  . LEU K 1 73 ? -35.350 15.325  -10.882 1.00 91.16  ? 69  LEU K CA  1 
ATOM   4454 C  C   . LEU K 1 73 ? -34.662 14.859  -9.603  1.00 91.13  ? 69  LEU K C   1 
ATOM   4455 O  O   . LEU K 1 73 ? -33.976 13.832  -9.608  1.00 92.73  ? 69  LEU K O   1 
ATOM   4456 C  CB  . LEU K 1 73 ? -34.564 16.476  -11.505 1.00 92.36  ? 69  LEU K CB  1 
ATOM   4457 C  CG  . LEU K 1 73 ? -33.123 16.128  -11.868 1.00 94.27  ? 69  LEU K CG  1 
ATOM   4458 C  CD1 . LEU K 1 73 ? -33.098 15.162  -13.038 1.00 71.37  ? 69  LEU K CD1 1 
ATOM   4459 C  CD2 . LEU K 1 73 ? -32.328 17.381  -12.174 1.00 71.94  ? 69  LEU K CD2 1 
ATOM   4460 N  N   . LEU K 1 74 ? -34.840 15.585  -8.501  1.00 90.37  ? 70  LEU K N   1 
ATOM   4461 C  CA  . LEU K 1 74 ? -33.974 15.445  -7.340  1.00 92.68  ? 70  LEU K CA  1 
ATOM   4462 C  C   . LEU K 1 74 ? -34.652 14.852  -6.111  1.00 94.64  ? 70  LEU K C   1 
ATOM   4463 O  O   . LEU K 1 74 ? -33.999 14.726  -5.070  1.00 98.21  ? 70  LEU K O   1 
ATOM   4464 C  CB  . LEU K 1 74 ? -33.376 16.809  -6.986  1.00 94.12  ? 70  LEU K CB  1 
ATOM   4465 C  CG  . LEU K 1 74 ? -32.611 17.456  -8.142  1.00 94.76  ? 70  LEU K CG  1 
ATOM   4466 C  CD1 . LEU K 1 74 ? -32.104 18.831  -7.752  1.00 96.51  ? 70  LEU K CD1 1 
ATOM   4467 C  CD2 . LEU K 1 74 ? -31.460 16.565  -8.588  1.00 96.74  ? 70  LEU K CD2 1 
ATOM   4468 N  N   . ASN K 1 75 ? -35.928 14.481  -6.188  1.00 94.45  ? 71  ASN K N   1 
ATOM   4469 C  CA  . ASN K 1 75 ? -36.606 13.919  -5.026  1.00 97.19  ? 71  ASN K CA  1 
ATOM   4470 C  C   . ASN K 1 75 ? -36.313 12.429  -4.913  1.00 95.56  ? 71  ASN K C   1 
ATOM   4471 O  O   . ASN K 1 75 ? -36.510 11.670  -5.868  1.00 91.61  ? 71  ASN K O   1 
ATOM   4472 C  CB  . ASN K 1 75 ? -38.112 14.160  -5.107  1.00 100.32 ? 71  ASN K CB  1 
ATOM   4473 C  CG  . ASN K 1 75 ? -38.834 13.732  -3.847  1.00 103.94 ? 71  ASN K CG  1 
ATOM   4474 O  OD1 . ASN K 1 75 ? -38.225 13.578  -2.787  1.00 104.43 ? 71  ASN K OD1 1 
ATOM   4475 N  ND2 . ASN K 1 75 ? -40.143 13.535  -3.955  1.00 105.55 ? 71  ASN K ND2 1 
ATOM   4476 N  N   . GLY K 1 76 ? -35.851 12.015  -3.735  1.00 100.02 ? 72  GLY K N   1 
ATOM   4477 C  CA  . GLY K 1 76 ? -35.414 10.658  -3.496  1.00 102.55 ? 72  GLY K CA  1 
ATOM   4478 C  C   . GLY K 1 76 ? -33.916 10.460  -3.579  1.00 103.92 ? 72  GLY K C   1 
ATOM   4479 O  O   . GLY K 1 76 ? -33.433 9.381   -3.215  1.00 105.66 ? 72  GLY K O   1 
ATOM   4480 N  N   . ILE K 1 77 ? -33.172 11.479  -4.023  1.00 103.46 ? 73  ILE K N   1 
ATOM   4481 C  CA  . ILE K 1 77 ? -31.739 11.336  -4.252  1.00 106.65 ? 73  ILE K CA  1 
ATOM   4482 C  C   . ILE K 1 77 ? -31.030 11.022  -2.945  1.00 110.97 ? 73  ILE K C   1 
ATOM   4483 O  O   . ILE K 1 77 ? -31.255 11.678  -1.920  1.00 115.96 ? 73  ILE K O   1 
ATOM   4484 C  CB  . ILE K 1 77 ? -31.175 12.605  -4.909  1.00 108.48 ? 73  ILE K CB  1 
ATOM   4485 C  CG1 . ILE K 1 77 ? -31.746 12.766  -6.318  1.00 109.19 ? 73  ILE K CG1 1 
ATOM   4486 C  CG2 . ILE K 1 77 ? -29.657 12.556  -4.956  1.00 111.43 ? 73  ILE K CG2 1 
ATOM   4487 C  CD1 . ILE K 1 77 ? -31.424 11.612  -7.238  1.00 110.32 ? 73  ILE K CD1 1 
ATOM   4488 N  N   . LYS K 1 78 ? -30.165 10.010  -2.978  1.00 110.39 ? 74  LYS K N   1 
ATOM   4489 C  CA  . LYS K 1 78 ? -29.437 9.557   -1.800  1.00 112.01 ? 74  LYS K CA  1 
ATOM   4490 C  C   . LYS K 1 78 ? -28.144 10.350  -1.664  1.00 112.10 ? 74  LYS K C   1 
ATOM   4491 O  O   . LYS K 1 78 ? -27.278 10.295  -2.543  1.00 113.51 ? 74  LYS K O   1 
ATOM   4492 C  CB  . LYS K 1 78 ? -29.138 8.061   -1.888  1.00 113.65 ? 74  LYS K CB  1 
ATOM   4493 N  N   . LEU K 1 79 ? -28.015 11.080  -0.560  1.00 112.21 ? 75  LEU K N   1 
ATOM   4494 C  CA  . LEU K 1 79 ? -26.813 11.839  -0.241  1.00 114.23 ? 75  LEU K CA  1 
ATOM   4495 C  C   . LEU K 1 79 ? -26.191 11.249  1.016   1.00 121.41 ? 75  LEU K C   1 
ATOM   4496 O  O   . LEU K 1 79 ? -26.818 11.257  2.082   1.00 121.67 ? 75  LEU K O   1 
ATOM   4497 C  CB  . LEU K 1 79 ? -27.135 13.321  -0.041  1.00 110.26 ? 75  LEU K CB  1 
ATOM   4498 C  CG  . LEU K 1 79 ? -27.432 14.125  -1.307  1.00 104.57 ? 75  LEU K CG  1 
ATOM   4499 C  CD1 . LEU K 1 79 ? -27.783 15.565  -0.955  1.00 103.27 ? 75  LEU K CD1 1 
ATOM   4500 C  CD2 . LEU K 1 79 ? -26.248 14.062  -2.258  1.00 99.72  ? 75  LEU K CD2 1 
ATOM   4501 N  N   . TYR K 1 80 ? -24.962 10.745  0.888   1.00 128.93 ? 76  TYR K N   1 
ATOM   4502 C  CA  . TYR K 1 80 ? -24.245 10.100  1.988   1.00 137.98 ? 76  TYR K CA  1 
ATOM   4503 C  C   . TYR K 1 80 ? -25.053 8.952   2.594   1.00 143.29 ? 76  TYR K C   1 
ATOM   4504 O  O   . TYR K 1 80 ? -24.991 8.704   3.801   1.00 150.47 ? 76  TYR K O   1 
ATOM   4505 C  CB  . TYR K 1 80 ? -23.853 11.111  3.073   1.00 138.49 ? 76  TYR K CB  1 
ATOM   4506 C  CG  . TYR K 1 80 ? -23.024 12.278  2.573   1.00 135.49 ? 76  TYR K CG  1 
ATOM   4507 C  CD1 . TYR K 1 80 ? -21.660 12.142  2.335   1.00 137.99 ? 76  TYR K CD1 1 
ATOM   4508 C  CD2 . TYR K 1 80 ? -23.607 13.521  2.350   1.00 129.97 ? 76  TYR K CD2 1 
ATOM   4509 C  CE1 . TYR K 1 80 ? -20.904 13.208  1.879   1.00 135.88 ? 76  TYR K CE1 1 
ATOM   4510 C  CE2 . TYR K 1 80 ? -22.859 14.592  1.897   1.00 128.12 ? 76  TYR K CE2 1 
ATOM   4511 C  CZ  . TYR K 1 80 ? -21.508 14.431  1.665   1.00 130.39 ? 76  TYR K CZ  1 
ATOM   4512 O  OH  . TYR K 1 80 ? -20.760 15.493  1.212   1.00 126.84 ? 76  TYR K OH  1 
ATOM   4513 N  N   . GLY K 1 81 ? -25.820 8.248   1.761   1.00 142.86 ? 77  GLY K N   1 
ATOM   4514 C  CA  . GLY K 1 81 ? -26.567 7.083   2.188   1.00 146.46 ? 77  GLY K CA  1 
ATOM   4515 C  C   . GLY K 1 81 ? -27.986 7.337   2.654   1.00 145.55 ? 77  GLY K C   1 
ATOM   4516 O  O   . GLY K 1 81 ? -28.687 6.375   2.996   1.00 151.25 ? 77  GLY K O   1 
ATOM   4517 N  N   . ARG K 1 82 ? -28.438 8.588   2.679   1.00 136.60 ? 78  ARG K N   1 
ATOM   4518 C  CA  . ARG K 1 82 ? -29.781 8.922   3.140   1.00 130.43 ? 78  ARG K CA  1 
ATOM   4519 C  C   . ARG K 1 82 ? -30.534 9.655   2.038   1.00 119.52 ? 78  ARG K C   1 
ATOM   4520 O  O   . ARG K 1 82 ? -30.127 10.763  1.648   1.00 118.02 ? 78  ARG K O   1 
ATOM   4521 C  CB  . ARG K 1 82 ? -29.726 9.777   4.411   1.00 134.90 ? 78  ARG K CB  1 
ATOM   4522 N  N   . PRO K 1 83 ? -31.625 9.097   1.516   1.00 113.01 ? 79  PRO K N   1 
ATOM   4523 C  CA  . PRO K 1 83 ? -32.392 9.802   0.481   1.00 106.88 ? 79  PRO K CA  1 
ATOM   4524 C  C   . PRO K 1 83 ? -33.011 11.077  1.030   1.00 106.47 ? 79  PRO K C   1 
ATOM   4525 O  O   . PRO K 1 83 ? -33.484 11.118  2.167   1.00 111.05 ? 79  PRO K O   1 
ATOM   4526 C  CB  . PRO K 1 83 ? -33.464 8.783   0.078   1.00 104.35 ? 79  PRO K CB  1 
ATOM   4527 C  CG  . PRO K 1 83 ? -33.600 7.890   1.277   1.00 108.71 ? 79  PRO K CG  1 
ATOM   4528 C  CD  . PRO K 1 83 ? -32.215 7.792   1.855   1.00 113.80 ? 79  PRO K CD  1 
ATOM   4529 N  N   . ILE K 1 84 ? -32.997 12.127  0.213   1.00 104.10 ? 80  ILE K N   1 
ATOM   4530 C  CA  . ILE K 1 84 ? -33.510 13.426  0.631   1.00 105.07 ? 80  ILE K CA  1 
ATOM   4531 C  C   . ILE K 1 84 ? -34.996 13.501  0.310   1.00 106.00 ? 80  ILE K C   1 
ATOM   4532 O  O   . ILE K 1 84 ? -35.458 12.987  -0.717  1.00 103.58 ? 80  ILE K O   1 
ATOM   4533 C  CB  . ILE K 1 84 ? -32.723 14.577  -0.030  1.00 100.20 ? 80  ILE K CB  1 
ATOM   4534 C  CG1 . ILE K 1 84 ? -33.049 14.688  -1.520  1.00 96.45  ? 80  ILE K CG1 1 
ATOM   4535 C  CG2 . ILE K 1 84 ? -31.232 14.379  0.170   1.00 92.62  ? 80  ILE K CG2 1 
ATOM   4536 C  CD1 . ILE K 1 84 ? -32.558 15.973  -2.158  1.00 95.71  ? 80  ILE K CD1 1 
ATOM   4537 N  N   . LYS K 1 85 ? -35.753 14.129  1.205   1.00 109.99 ? 81  LYS K N   1 
ATOM   4538 C  CA  . LYS K 1 85 ? -37.201 14.246  1.083   1.00 109.88 ? 81  LYS K CA  1 
ATOM   4539 C  C   . LYS K 1 85 ? -37.544 15.678  0.697   1.00 109.87 ? 81  LYS K C   1 
ATOM   4540 O  O   . LYS K 1 85 ? -37.260 16.613  1.453   1.00 111.18 ? 81  LYS K O   1 
ATOM   4541 C  CB  . LYS K 1 85 ? -37.893 13.860  2.390   1.00 110.95 ? 81  LYS K CB  1 
ATOM   4542 N  N   . ILE K 1 86 ? -38.156 15.845  -0.471  1.00 110.75 ? 82  ILE K N   1 
ATOM   4543 C  CA  . ILE K 1 86 ? -38.524 17.157  -0.985  1.00 110.25 ? 82  ILE K CA  1 
ATOM   4544 C  C   . ILE K 1 86 ? -40.017 17.366  -0.783  1.00 110.80 ? 82  ILE K C   1 
ATOM   4545 O  O   . ILE K 1 86 ? -40.822 16.467  -1.062  1.00 109.30 ? 82  ILE K O   1 
ATOM   4546 C  CB  . ILE K 1 86 ? -38.142 17.302  -2.468  1.00 107.23 ? 82  ILE K CB  1 
ATOM   4547 C  CG1 . ILE K 1 86 ? -36.637 17.098  -2.651  1.00 107.29 ? 82  ILE K CG1 1 
ATOM   4548 C  CG2 . ILE K 1 86 ? -38.568 18.667  -2.998  1.00 105.75 ? 82  ILE K CG2 1 
ATOM   4549 C  CD1 . ILE K 1 86 ? -36.154 17.382  -4.052  1.00 103.52 ? 82  ILE K CD1 1 
ATOM   4550 N  N   . GLN K 1 87 ? -40.386 18.545  -0.287  1.00 111.80 ? 83  GLN K N   1 
ATOM   4551 C  CA  . GLN K 1 87 ? -41.776 18.955  -0.171  1.00 114.82 ? 83  GLN K CA  1 
ATOM   4552 C  C   . GLN K 1 87 ? -41.943 20.328  -0.803  1.00 114.70 ? 83  GLN K C   1 
ATOM   4553 O  O   . GLN K 1 87 ? -41.043 21.170  -0.743  1.00 112.80 ? 83  GLN K O   1 
ATOM   4554 C  CB  . GLN K 1 87 ? -42.243 19.001  1.291   1.00 121.13 ? 83  GLN K CB  1 
ATOM   4555 C  CG  . GLN K 1 87 ? -42.433 17.643  1.940   1.00 124.48 ? 83  GLN K CG  1 
ATOM   4556 C  CD  . GLN K 1 87 ? -43.189 17.734  3.255   1.00 130.82 ? 83  GLN K CD  1 
ATOM   4557 O  OE1 . GLN K 1 87 ? -44.185 17.037  3.459   1.00 133.19 ? 83  GLN K OE1 1 
ATOM   4558 N  NE2 . GLN K 1 87 ? -42.719 18.593  4.153   1.00 133.58 ? 83  GLN K NE2 1 
ATOM   4559 N  N   . PHE K 1 88 ? -43.103 20.544  -1.414  1.00 117.78 ? 84  PHE K N   1 
ATOM   4560 C  CA  . PHE K 1 88 ? -43.414 21.843  -1.989  1.00 121.64 ? 84  PHE K CA  1 
ATOM   4561 C  C   . PHE K 1 88 ? -43.910 22.794  -0.906  1.00 129.03 ? 84  PHE K C   1 
ATOM   4562 O  O   . PHE K 1 88 ? -44.522 22.381  0.083   1.00 132.53 ? 84  PHE K O   1 
ATOM   4563 C  CB  . PHE K 1 88 ? -44.463 21.711  -3.094  1.00 119.45 ? 84  PHE K CB  1 
ATOM   4564 N  N   . ARG K 1 89 ? -43.644 24.083  -1.106  1.00 132.49 ? 85  ARG K N   1 
ATOM   4565 C  CA  . ARG K 1 89 ? -43.995 25.088  -0.113  1.00 138.20 ? 85  ARG K CA  1 
ATOM   4566 C  C   . ARG K 1 89 ? -45.389 25.666  -0.308  1.00 144.16 ? 85  ARG K C   1 
ATOM   4567 O  O   . ARG K 1 89 ? -45.946 26.235  0.639   1.00 147.95 ? 85  ARG K O   1 
ATOM   4568 C  CB  . ARG K 1 89 ? -42.970 26.227  -0.130  1.00 138.46 ? 85  ARG K CB  1 
ATOM   4569 N  N   . SER K 1 90 ? -45.965 25.537  -1.498  1.00 141.85 ? 86  SER K N   1 
ATOM   4570 C  CA  . SER K 1 90 ? -47.279 26.109  -1.774  1.00 144.51 ? 86  SER K CA  1 
ATOM   4571 C  C   . SER K 1 90 ? -48.206 25.096  -2.443  1.00 143.11 ? 86  SER K C   1 
ATOM   4572 O  O   . SER K 1 90 ? -47.903 23.905  -2.503  1.00 140.91 ? 86  SER K O   1 
ATOM   4573 C  CB  . SER K 1 90 ? -47.143 27.355  -2.652  1.00 144.79 ? 86  SER K CB  1 
ATOM   4574 N  N   . PHE L 2 7  ? -23.820 26.557  -18.392 1.00 147.57 ? 286 PHE L N   1 
ATOM   4575 C  CA  . PHE L 2 7  ? -24.458 25.470  -17.660 1.00 147.40 ? 286 PHE L CA  1 
ATOM   4576 C  C   . PHE L 2 7  ? -24.112 24.123  -18.266 1.00 141.64 ? 286 PHE L C   1 
ATOM   4577 O  O   . PHE L 2 7  ? -24.381 23.867  -19.435 1.00 138.85 ? 286 PHE L O   1 
ATOM   4578 C  CB  . PHE L 2 7  ? -25.972 25.647  -17.617 1.00 149.61 ? 286 PHE L CB  1 
ATOM   4579 C  CG  . PHE L 2 7  ? -26.693 24.454  -17.067 1.00 149.54 ? 286 PHE L CG  1 
ATOM   4580 C  CD1 . PHE L 2 7  ? -26.514 24.068  -15.748 1.00 153.12 ? 286 PHE L CD1 1 
ATOM   4581 C  CD2 . PHE L 2 7  ? -27.537 23.707  -17.873 1.00 144.75 ? 286 PHE L CD2 1 
ATOM   4582 C  CE1 . PHE L 2 7  ? -27.168 22.969  -15.242 1.00 151.12 ? 286 PHE L CE1 1 
ATOM   4583 C  CE2 . PHE L 2 7  ? -28.198 22.609  -17.372 1.00 142.39 ? 286 PHE L CE2 1 
ATOM   4584 C  CZ  . PHE L 2 7  ? -28.001 22.229  -16.058 1.00 145.89 ? 286 PHE L CZ  1 
ATOM   4585 N  N   . LYS L 2 8  ? -23.443 23.301  -17.467 1.00 139.97 ? 287 LYS L N   1 
ATOM   4586 C  CA  . LYS L 2 8  ? -23.079 21.931  -17.811 1.00 136.48 ? 287 LYS L CA  1 
ATOM   4587 C  C   . LYS L 2 8  ? -23.934 20.977  -16.986 1.00 133.35 ? 287 LYS L C   1 
ATOM   4588 O  O   . LYS L 2 8  ? -23.678 20.800  -15.785 1.00 133.39 ? 287 LYS L O   1 
ATOM   4589 C  CB  . LYS L 2 8  ? -21.592 21.691  -17.555 1.00 137.53 ? 287 LYS L CB  1 
ATOM   4590 N  N   . PRO L 2 9  ? -24.968 20.359  -17.566 1.00 129.07 ? 288 PRO L N   1 
ATOM   4591 C  CA  . PRO L 2 9  ? -25.862 19.515  -16.747 1.00 128.97 ? 288 PRO L CA  1 
ATOM   4592 C  C   . PRO L 2 9  ? -25.174 18.380  -15.997 1.00 128.69 ? 288 PRO L C   1 
ATOM   4593 O  O   . PRO L 2 9  ? -25.330 18.294  -14.773 1.00 129.29 ? 288 PRO L O   1 
ATOM   4594 C  CB  . PRO L 2 9  ? -26.877 18.986  -17.777 1.00 126.93 ? 288 PRO L CB  1 
ATOM   4595 C  CG  . PRO L 2 9  ? -26.323 19.331  -19.129 1.00 125.62 ? 288 PRO L CG  1 
ATOM   4596 C  CD  . PRO L 2 9  ? -25.472 20.537  -18.935 1.00 127.09 ? 288 PRO L CD  1 
ATOM   4597 N  N   . GLY L 2 10 ? -24.413 17.516  -16.662 1.00 126.88 ? 289 GLY L N   1 
ATOM   4598 C  CA  . GLY L 2 10 ? -23.807 16.419  -15.932 1.00 128.37 ? 289 GLY L CA  1 
ATOM   4599 C  C   . GLY L 2 10 ? -22.477 16.682  -15.261 1.00 129.04 ? 289 GLY L C   1 
ATOM   4600 O  O   . GLY L 2 10 ? -21.928 15.765  -14.644 1.00 130.60 ? 289 GLY L O   1 
ATOM   4601 N  N   . VAL L 2 11 ? -21.959 17.905  -15.312 1.00 131.13 ? 290 VAL L N   1 
ATOM   4602 C  CA  . VAL L 2 11 ? -20.748 18.272  -14.582 1.00 135.48 ? 290 VAL L CA  1 
ATOM   4603 C  C   . VAL L 2 11 ? -21.073 18.779  -13.178 1.00 137.62 ? 290 VAL L C   1 
ATOM   4604 O  O   . VAL L 2 11 ? -21.778 19.780  -13.011 1.00 142.95 ? 290 VAL L O   1 
ATOM   4605 C  CB  . VAL L 2 11 ? -19.945 19.319  -15.364 1.00 138.28 ? 290 VAL L CB  1 
ATOM   4606 C  CG1 . VAL L 2 11 ? -18.592 19.531  -14.717 1.00 142.52 ? 290 VAL L CG1 1 
ATOM   4607 C  CG2 . VAL L 2 11 ? -19.783 18.861  -16.801 1.00 137.13 ? 290 VAL L CG2 1 
ATOM   4608 N  N   . ILE L 2 12 ? -20.527 18.092  -12.167 1.00 134.75 ? 291 ILE L N   1 
ATOM   4609 C  CA  . ILE L 2 12 ? -20.696 18.420  -10.756 1.00 134.83 ? 291 ILE L CA  1 
ATOM   4610 C  C   . ILE L 2 12 ? -19.323 18.385  -10.094 1.00 137.24 ? 291 ILE L C   1 
ATOM   4611 O  O   . ILE L 2 12 ? -18.354 17.869  -10.652 1.00 136.57 ? 291 ILE L O   1 
ATOM   4612 C  CB  . ILE L 2 12 ? -21.663 17.460  -10.035 1.00 134.12 ? 291 ILE L CB  1 
ATOM   4613 C  CG1 . ILE L 2 12 ? -21.150 16.019  -10.119 1.00 132.55 ? 291 ILE L CG1 1 
ATOM   4614 C  CG2 . ILE L 2 12 ? -23.043 17.556  -10.637 1.00 133.91 ? 291 ILE L CG2 1 
ATOM   4615 C  CD1 . ILE L 2 12 ? -22.027 15.019  -9.399  1.00 131.12 ? 291 ILE L CD1 1 
ATOM   4616 N  N   . SER L 2 13 ? -19.251 18.933  -8.882  1.00 138.33 ? 292 SER L N   1 
ATOM   4617 C  CA  . SER L 2 13 ? -17.977 18.988  -8.182  1.00 138.86 ? 292 SER L CA  1 
ATOM   4618 C  C   . SER L 2 13 ? -17.569 17.598  -7.692  1.00 138.87 ? 292 SER L C   1 
ATOM   4619 O  O   . SER L 2 13 ? -18.364 16.653  -7.665  1.00 139.07 ? 292 SER L O   1 
ATOM   4620 C  CB  . SER L 2 13 ? -18.048 19.958  -7.002  1.00 138.75 ? 292 SER L CB  1 
ATOM   4621 O  OG  . SER L 2 13 ? -18.857 19.438  -5.961  1.00 136.36 ? 292 SER L OG  1 
ATOM   4622 N  N   . GLU L 2 14 ? -16.304 17.485  -7.280  1.00 137.08 ? 293 GLU L N   1 
ATOM   4623 C  CA  . GLU L 2 14 ? -15.815 16.223  -6.730  1.00 135.59 ? 293 GLU L CA  1 
ATOM   4624 C  C   . GLU L 2 14 ? -16.460 15.919  -5.385  1.00 134.81 ? 293 GLU L C   1 
ATOM   4625 O  O   . GLU L 2 14 ? -16.703 14.750  -5.063  1.00 132.95 ? 293 GLU L O   1 
ATOM   4626 C  CB  . GLU L 2 14 ? -14.292 16.258  -6.598  1.00 137.61 ? 293 GLU L CB  1 
ATOM   4627 N  N   . GLU L 2 15 ? -16.732 16.955  -4.588  1.00 137.49 ? 294 GLU L N   1 
ATOM   4628 C  CA  . GLU L 2 15 ? -17.382 16.754  -3.298  1.00 139.76 ? 294 GLU L CA  1 
ATOM   4629 C  C   . GLU L 2 15 ? -18.783 16.184  -3.475  1.00 137.51 ? 294 GLU L C   1 
ATOM   4630 O  O   . GLU L 2 15 ? -19.209 15.311  -2.710  1.00 138.59 ? 294 GLU L O   1 
ATOM   4631 C  CB  . GLU L 2 15 ? -17.429 18.072  -2.523  1.00 142.70 ? 294 GLU L CB  1 
ATOM   4632 N  N   . LEU L 2 16 ? -19.519 16.675  -4.475  1.00 135.83 ? 295 LEU L N   1 
ATOM   4633 C  CA  . LEU L 2 16 ? -20.859 16.158  -4.736  1.00 135.74 ? 295 LEU L CA  1 
ATOM   4634 C  C   . LEU L 2 16 ? -20.813 14.722  -5.247  1.00 134.67 ? 295 LEU L C   1 
ATOM   4635 O  O   . LEU L 2 16 ? -21.700 13.918  -4.933  1.00 133.23 ? 295 LEU L O   1 
ATOM   4636 C  CB  . LEU L 2 16 ? -21.585 17.060  -5.734  1.00 134.71 ? 295 LEU L CB  1 
ATOM   4637 N  N   . GLN L 2 17 ? -19.797 14.385  -6.047  1.00 135.02 ? 296 GLN L N   1 
ATOM   4638 C  CA  . GLN L 2 17 ? -19.655 13.016  -6.538  1.00 134.28 ? 296 GLN L CA  1 
ATOM   4639 C  C   . GLN L 2 17 ? -19.544 12.020  -5.390  1.00 136.30 ? 296 GLN L C   1 
ATOM   4640 O  O   . GLN L 2 17 ? -20.212 10.980  -5.390  1.00 134.66 ? 296 GLN L O   1 
ATOM   4641 C  CB  . GLN L 2 17 ? -18.434 12.914  -7.453  1.00 134.99 ? 296 GLN L CB  1 
ATOM   4642 C  CG  . GLN L 2 17 ? -18.583 13.652  -8.770  1.00 135.39 ? 296 GLN L CG  1 
ATOM   4643 C  CD  . GLN L 2 17 ? -17.315 13.626  -9.602  1.00 138.51 ? 296 GLN L CD  1 
ATOM   4644 O  OE1 . GLN L 2 17 ? -16.575 12.642  -9.597  1.00 141.07 ? 296 GLN L OE1 1 
ATOM   4645 N  NE2 . GLN L 2 17 ? -17.054 14.714  -10.316 1.00 138.59 ? 296 GLN L NE2 1 
ATOM   4646 N  N   . ASP L 2 18 ? -18.696 12.320  -4.401  1.00 142.74 ? 297 ASP L N   1 
ATOM   4647 C  CA  . ASP L 2 18 ? -18.565 11.433  -3.249  1.00 148.73 ? 297 ASP L CA  1 
ATOM   4648 C  C   . ASP L 2 18 ? -19.869 11.362  -2.463  1.00 148.95 ? 297 ASP L C   1 
ATOM   4649 O  O   . ASP L 2 18 ? -20.220 10.309  -1.917  1.00 151.58 ? 297 ASP L O   1 
ATOM   4650 C  CB  . ASP L 2 18 ? -17.418 11.898  -2.349  1.00 150.80 ? 297 ASP L CB  1 
ATOM   4651 N  N   . ALA L 2 19 ? -20.592 12.482  -2.385  1.00 143.05 ? 298 ALA L N   1 
ATOM   4652 C  CA  . ALA L 2 19 ? -21.874 12.492  -1.691  1.00 137.62 ? 298 ALA L CA  1 
ATOM   4653 C  C   . ALA L 2 19 ? -22.888 11.605  -2.400  1.00 131.03 ? 298 ALA L C   1 
ATOM   4654 O  O   . ALA L 2 19 ? -23.661 10.890  -1.752  1.00 129.96 ? 298 ALA L O   1 
ATOM   4655 C  CB  . ALA L 2 19 ? -22.397 13.924  -1.579  1.00 137.45 ? 298 ALA L CB  1 
ATOM   4656 N  N   . LEU L 2 20 ? -22.888 11.624  -3.735  1.00 128.34 ? 299 LEU L N   1 
ATOM   4657 C  CA  . LEU L 2 20 ? -23.839 10.831  -4.502  1.00 124.93 ? 299 LEU L CA  1 
ATOM   4658 C  C   . LEU L 2 20 ? -23.457 9.360   -4.578  1.00 129.36 ? 299 LEU L C   1 
ATOM   4659 O  O   . LEU L 2 20 ? -24.305 8.530   -4.923  1.00 126.59 ? 299 LEU L O   1 
ATOM   4660 C  CB  . LEU L 2 20 ? -23.971 11.404  -5.914  1.00 119.12 ? 299 LEU L CB  1 
ATOM   4661 C  CG  . LEU L 2 20 ? -24.654 12.769  -5.996  1.00 117.71 ? 299 LEU L CG  1 
ATOM   4662 C  CD1 . LEU L 2 20 ? -24.541 13.360  -7.389  1.00 115.30 ? 299 LEU L CD1 1 
ATOM   4663 C  CD2 . LEU L 2 20 ? -26.109 12.631  -5.596  1.00 97.68  ? 299 LEU L CD2 1 
ATOM   4664 N  N   . GLY L 2 21 ? -22.214 9.022   -4.254  1.00 139.00 ? 300 GLY L N   1 
ATOM   4665 C  CA  . GLY L 2 21 ? -21.762 7.646   -4.297  1.00 147.28 ? 300 GLY L CA  1 
ATOM   4666 C  C   . GLY L 2 21 ? -21.399 7.107   -5.661  1.00 153.97 ? 300 GLY L C   1 
ATOM   4667 O  O   . GLY L 2 21 ? -21.500 5.896   -5.884  1.00 152.43 ? 300 GLY L O   1 
ATOM   4668 N  N   . VAL L 2 22 ? -20.998 7.966   -6.592  1.00 164.93 ? 301 VAL L N   1 
ATOM   4669 C  CA  . VAL L 2 22 ? -20.699 7.539   -7.956  1.00 163.20 ? 301 VAL L CA  1 
ATOM   4670 C  C   . VAL L 2 22 ? -19.252 7.059   -7.994  1.00 163.41 ? 301 VAL L C   1 
ATOM   4671 O  O   . VAL L 2 22 ? -18.356 7.708   -7.438  1.00 169.89 ? 301 VAL L O   1 
ATOM   4672 C  CB  . VAL L 2 22 ? -20.950 8.669   -8.967  1.00 161.30 ? 301 VAL L CB  1 
ATOM   4673 C  CG1 . VAL L 2 22 ? -22.430 8.990   -9.035  1.00 159.77 ? 301 VAL L CG1 1 
ATOM   4674 C  CG2 . VAL L 2 22 ? -20.155 9.910   -8.601  1.00 164.20 ? 301 VAL L CG2 1 
ATOM   4675 N  N   . THR L 2 23 ? -19.015 5.918   -8.640  1.00 155.69 ? 302 THR L N   1 
ATOM   4676 C  CA  . THR L 2 23 ? -17.658 5.394   -8.740  1.00 149.92 ? 302 THR L CA  1 
ATOM   4677 C  C   . THR L 2 23 ? -16.896 5.964   -9.929  1.00 145.76 ? 302 THR L C   1 
ATOM   4678 O  O   . THR L 2 23 ? -15.731 6.353   -9.784  1.00 151.64 ? 302 THR L O   1 
ATOM   4679 C  CB  . THR L 2 23 ? -17.686 3.868   -8.830  1.00 145.17 ? 302 THR L CB  1 
ATOM   4680 O  OG1 . THR L 2 23 ? -18.258 3.477   -10.082 1.00 141.13 ? 302 THR L OG1 1 
ATOM   4681 C  CG2 . THR L 2 23 ? -18.515 3.287   -7.693  1.00 143.87 ? 302 THR L CG2 1 
ATOM   4682 N  N   . ASP L 2 24 ? -17.518 6.016   -11.103 1.00 133.58 ? 303 ASP L N   1 
ATOM   4683 C  CA  . ASP L 2 24 ? -16.881 6.541   -12.304 1.00 129.89 ? 303 ASP L CA  1 
ATOM   4684 C  C   . ASP L 2 24 ? -17.295 7.992   -12.507 1.00 126.73 ? 303 ASP L C   1 
ATOM   4685 O  O   . ASP L 2 24 ? -18.483 8.319   -12.430 1.00 126.85 ? 303 ASP L O   1 
ATOM   4686 C  CB  . ASP L 2 24 ? -17.251 5.709   -13.535 1.00 125.38 ? 303 ASP L CB  1 
ATOM   4687 N  N   . LYS L 2 25 ? -16.315 8.859   -12.771 1.00 127.15 ? 304 LYS L N   1 
ATOM   4688 C  CA  . LYS L 2 25 ? -16.615 10.272  -12.974 1.00 126.47 ? 304 LYS L CA  1 
ATOM   4689 C  C   . LYS L 2 25 ? -17.130 10.555  -14.378 1.00 122.55 ? 304 LYS L C   1 
ATOM   4690 O  O   . LYS L 2 25 ? -17.962 11.452  -14.559 1.00 125.15 ? 304 LYS L O   1 
ATOM   4691 C  CB  . LYS L 2 25 ? -15.376 11.123  -12.695 1.00 129.00 ? 304 LYS L CB  1 
ATOM   4692 N  N   . SER L 2 26 ? -16.667 9.802   -15.378 1.00 118.20 ? 305 SER L N   1 
ATOM   4693 C  CA  . SER L 2 26 ? -17.076 10.063  -16.755 1.00 116.12 ? 305 SER L CA  1 
ATOM   4694 C  C   . SER L 2 26 ? -18.533 9.699   -17.030 1.00 112.18 ? 305 SER L C   1 
ATOM   4695 O  O   . SER L 2 26 ? -19.014 9.959   -18.141 1.00 109.62 ? 305 SER L O   1 
ATOM   4696 C  CB  . SER L 2 26 ? -16.169 9.305   -17.726 1.00 115.86 ? 305 SER L CB  1 
ATOM   4697 N  N   . LEU L 2 27 ? -19.236 9.087   -16.076 1.00 112.63 ? 306 LEU L N   1 
ATOM   4698 C  CA  . LEU L 2 27 ? -20.640 8.738   -16.257 1.00 110.77 ? 306 LEU L CA  1 
ATOM   4699 C  C   . LEU L 2 27 ? -21.500 9.921   -15.827 1.00 108.23 ? 306 LEU L C   1 
ATOM   4700 O  O   . LEU L 2 27 ? -21.551 10.226  -14.626 1.00 111.01 ? 306 LEU L O   1 
ATOM   4701 C  CB  . LEU L 2 27 ? -20.995 7.499   -15.451 1.00 111.93 ? 306 LEU L CB  1 
ATOM   4702 C  CG  . LEU L 2 27 ? -20.492 6.165   -16.010 1.00 87.29  ? 306 LEU L CG  1 
ATOM   4703 C  CD1 . LEU L 2 27 ? -20.993 5.003   -15.162 1.00 87.59  ? 306 LEU L CD1 1 
ATOM   4704 C  CD2 . LEU L 2 27 ? -20.864 5.987   -17.464 1.00 85.55  ? 306 LEU L CD2 1 
ATOM   4705 N  N   . PRO L 2 28 ? -22.199 10.597  -16.735 1.00 104.23 ? 307 PRO L N   1 
ATOM   4706 C  CA  . PRO L 2 28 ? -22.927 11.817  -16.351 1.00 105.57 ? 307 PRO L CA  1 
ATOM   4707 C  C   . PRO L 2 28 ? -24.110 11.504  -15.451 1.00 110.72 ? 307 PRO L C   1 
ATOM   4708 O  O   . PRO L 2 28 ? -24.982 10.703  -15.815 1.00 112.05 ? 307 PRO L O   1 
ATOM   4709 C  CB  . PRO L 2 28 ? -23.396 12.385  -17.700 1.00 101.22 ? 307 PRO L CB  1 
ATOM   4710 C  CG  . PRO L 2 28 ? -22.526 11.727  -18.735 1.00 101.26 ? 307 PRO L CG  1 
ATOM   4711 C  CD  . PRO L 2 28 ? -22.244 10.357  -18.185 1.00 101.76 ? 307 PRO L CD  1 
ATOM   4712 N  N   . PRO L 2 29 ? -24.179 12.123  -14.270 1.00 114.41 ? 308 PRO L N   1 
ATOM   4713 C  CA  . PRO L 2 29 ? -25.319 11.919  -13.370 1.00 113.27 ? 308 PRO L CA  1 
ATOM   4714 C  C   . PRO L 2 29 ? -26.474 12.852  -13.708 1.00 108.09 ? 308 PRO L C   1 
ATOM   4715 O  O   . PRO L 2 29 ? -26.276 14.018  -14.060 1.00 106.63 ? 308 PRO L O   1 
ATOM   4716 C  CB  . PRO L 2 29 ? -24.726 12.243  -11.991 1.00 117.43 ? 308 PRO L CB  1 
ATOM   4717 C  CG  . PRO L 2 29 ? -23.658 13.235  -12.276 1.00 121.28 ? 308 PRO L CG  1 
ATOM   4718 C  CD  . PRO L 2 29 ? -23.096 12.892  -13.633 1.00 118.64 ? 308 PRO L CD  1 
ATOM   4719 N  N   . PHE L 2 30 ? -27.692 12.306  -13.616 1.00 110.69 ? 309 PHE L N   1 
ATOM   4720 C  CA  . PHE L 2 30 ? -28.949 13.020  -13.833 0.80 110.26 ? 309 PHE L CA  1 
ATOM   4721 C  C   . PHE L 2 30 ? -29.223 13.256  -15.308 1.00 106.95 ? 309 PHE L C   1 
ATOM   4722 O  O   . PHE L 2 30 ? -30.315 13.706  -15.662 1.00 106.14 ? 309 PHE L O   1 
ATOM   4723 C  CB  . PHE L 2 30 ? -28.980 14.360  -13.091 1.00 85.70  ? 309 PHE L CB  1 
ATOM   4724 N  N   . ILE L 2 31 ? -28.259 12.944  -16.173 1.00 104.27 ? 310 ILE L N   1 
ATOM   4725 C  CA  . ILE L 2 31 ? -28.445 13.197  -17.598 1.00 79.85  ? 310 ILE L CA  1 
ATOM   4726 C  C   . ILE L 2 31 ? -29.576 12.340  -18.157 1.00 83.74  ? 310 ILE L C   1 
ATOM   4727 O  O   . ILE L 2 31 ? -30.432 12.834  -18.899 1.00 77.65  ? 310 ILE L O   1 
ATOM   4728 C  CB  . ILE L 2 31 ? -27.122 12.962  -18.349 1.00 79.71  ? 310 ILE L CB  1 
ATOM   4729 N  N   . TYR L 2 32 ? -29.619 11.054  -17.788 1.00 85.45  ? 311 TYR L N   1 
ATOM   4730 C  CA  . TYR L 2 32 ? -30.589 10.141  -18.390 1.00 85.78  ? 311 TYR L CA  1 
ATOM   4731 C  C   . TYR L 2 32 ? -32.020 10.553  -18.081 1.00 92.17  ? 311 TYR L C   1 
ATOM   4732 O  O   . TYR L 2 32 ? -32.886 10.498  -18.960 1.00 95.96  ? 311 TYR L O   1 
ATOM   4733 C  CB  . TYR L 2 32 ? -30.348 8.708   -17.915 1.00 85.99  ? 311 TYR L CB  1 
ATOM   4734 C  CG  . TYR L 2 32 ? -31.264 7.715   -18.579 1.00 85.50  ? 311 TYR L CG  1 
ATOM   4735 C  CD1 . TYR L 2 32 ? -31.126 7.409   -19.921 1.00 88.46  ? 311 TYR L CD1 1 
ATOM   4736 C  CD2 . TYR L 2 32 ? -32.281 7.097   -17.867 1.00 88.12  ? 311 TYR L CD2 1 
ATOM   4737 C  CE1 . TYR L 2 32 ? -31.976 6.507   -20.540 1.00 91.88  ? 311 TYR L CE1 1 
ATOM   4738 C  CE2 . TYR L 2 32 ? -33.133 6.199   -18.473 1.00 91.35  ? 311 TYR L CE2 1 
ATOM   4739 C  CZ  . TYR L 2 32 ? -32.977 5.906   -19.808 1.00 92.58  ? 311 TYR L CZ  1 
ATOM   4740 O  OH  . TYR L 2 32 ? -33.830 5.008   -20.407 1.00 92.98  ? 311 TYR L OH  1 
ATOM   4741 N  N   . ARG L 2 33 ? -32.296 10.946  -16.834 1.00 93.43  ? 312 ARG L N   1 
ATOM   4742 C  CA  . ARG L 2 33 ? -33.642 11.399  -16.495 1.00 89.92  ? 312 ARG L CA  1 
ATOM   4743 C  C   . ARG L 2 33 ? -33.886 12.814  -17.005 1.00 93.66  ? 312 ARG L C   1 
ATOM   4744 O  O   . ARG L 2 33 ? -35.006 13.149  -17.411 1.00 93.89  ? 312 ARG L O   1 
ATOM   4745 C  CB  . ARG L 2 33 ? -33.861 11.326  -14.982 1.00 88.05  ? 312 ARG L CB  1 
ATOM   4746 N  N   . MET L 2 34 ? -32.848 13.652  -16.992 1.00 96.64  ? 313 MET L N   1 
ATOM   4747 C  CA  . MET L 2 34 ? -32.967 14.995  -17.545 1.00 80.10  ? 313 MET L CA  1 
ATOM   4748 C  C   . MET L 2 34 ? -33.191 14.947  -19.051 1.00 98.04  ? 313 MET L C   1 
ATOM   4749 O  O   . MET L 2 34 ? -33.899 15.794  -19.609 1.00 101.99 ? 313 MET L O   1 
ATOM   4750 C  CB  . MET L 2 34 ? -31.711 15.797  -17.204 1.00 81.27  ? 313 MET L CB  1 
ATOM   4751 C  CG  . MET L 2 34 ? -31.725 17.247  -17.593 1.00 82.25  ? 313 MET L CG  1 
ATOM   4752 S  SD  . MET L 2 34 ? -30.212 18.054  -17.005 1.00 108.89 ? 313 MET L SD  1 
ATOM   4753 C  CE  . MET L 2 34 ? -30.487 18.068  -15.241 1.00 86.14  ? 313 MET L CE  1 
ATOM   4754 N  N   . ARG L 2 35 ? -32.575 13.975  -19.730 1.00 92.67  ? 314 ARG L N   1 
ATOM   4755 C  CA  . ARG L 2 35 ? -32.789 13.844  -21.167 1.00 92.68  ? 314 ARG L CA  1 
ATOM   4756 C  C   . ARG L 2 35 ? -34.228 13.470  -21.492 1.00 95.72  ? 314 ARG L C   1 
ATOM   4757 O  O   . ARG L 2 35 ? -34.738 13.844  -22.552 1.00 99.97  ? 314 ARG L O   1 
ATOM   4758 C  CB  . ARG L 2 35 ? -31.833 12.803  -21.751 1.00 89.83  ? 314 ARG L CB  1 
ATOM   4759 N  N   . GLN L 2 36 ? -34.917 12.782  -20.583 1.00 95.41  ? 315 GLN L N   1 
ATOM   4760 C  CA  . GLN L 2 36 ? -36.299 12.400  -20.849 1.00 95.74  ? 315 GLN L CA  1 
ATOM   4761 C  C   . GLN L 2 36 ? -37.315 13.356  -20.243 1.00 96.34  ? 315 GLN L C   1 
ATOM   4762 O  O   . GLN L 2 36 ? -38.406 13.509  -20.801 1.00 95.66  ? 315 GLN L O   1 
ATOM   4763 C  CB  . GLN L 2 36 ? -36.574 10.969  -20.365 1.00 95.87  ? 315 GLN L CB  1 
ATOM   4764 C  CG  . GLN L 2 36 ? -36.332 10.719  -18.893 1.00 98.96  ? 315 GLN L CG  1 
ATOM   4765 C  CD  . GLN L 2 36 ? -36.581 9.273   -18.508 1.00 100.91 ? 315 GLN L CD  1 
ATOM   4766 O  OE1 . GLN L 2 36 ? -36.562 8.379   -19.358 1.00 98.86  ? 315 GLN L OE1 1 
ATOM   4767 N  NE2 . GLN L 2 36 ? -36.827 9.036   -17.223 1.00 103.21 ? 315 GLN L NE2 1 
ATOM   4768 N  N   . LEU L 2 37 ? -36.990 14.014  -19.129 1.00 97.99  ? 316 LEU L N   1 
ATOM   4769 C  CA  . LEU L 2 37 ? -37.828 15.114  -18.663 1.00 99.88  ? 316 LEU L CA  1 
ATOM   4770 C  C   . LEU L 2 37 ? -37.801 16.298  -19.616 1.00 101.34 ? 316 LEU L C   1 
ATOM   4771 O  O   . LEU L 2 37 ? -38.760 17.077  -19.643 1.00 109.09 ? 316 LEU L O   1 
ATOM   4772 C  CB  . LEU L 2 37 ? -37.401 15.578  -17.269 1.00 100.67 ? 316 LEU L CB  1 
ATOM   4773 C  CG  . LEU L 2 37 ? -37.556 14.603  -16.103 1.00 100.11 ? 316 LEU L CG  1 
ATOM   4774 C  CD1 . LEU L 2 37 ? -36.907 15.177  -14.854 1.00 102.56 ? 316 LEU L CD1 1 
ATOM   4775 C  CD2 . LEU L 2 37 ? -39.028 14.269  -15.852 1.00 99.38  ? 316 LEU L CD2 1 
ATOM   4776 N  N   . GLY L 2 38 ? -36.736 16.456  -20.394 1.00 99.58  ? 317 GLY L N   1 
ATOM   4777 C  CA  . GLY L 2 38 ? -36.578 17.629  -21.227 1.00 100.34 ? 317 GLY L CA  1 
ATOM   4778 C  C   . GLY L 2 38 ? -35.670 18.672  -20.592 1.00 99.03  ? 317 GLY L C   1 
ATOM   4779 O  O   . GLY L 2 38 ? -35.245 18.568  -19.439 1.00 82.16  ? 317 GLY L O   1 
ATOM   4780 N  N   . TYR L 2 39 ? -35.389 19.704  -21.373 1.00 94.96  ? 318 TYR L N   1 
ATOM   4781 C  CA  . TYR L 2 39 ? -34.470 20.748  -20.942 1.00 91.21  ? 318 TYR L CA  1 
ATOM   4782 C  C   . TYR L 2 39 ? -35.064 21.564  -19.802 1.00 91.94  ? 318 TYR L C   1 
ATOM   4783 O  O   . TYR L 2 39 ? -36.239 21.941  -19.861 1.00 94.95  ? 318 TYR L O   1 
ATOM   4784 C  CB  . TYR L 2 39 ? -34.163 21.660  -22.126 1.00 91.34  ? 318 TYR L CB  1 
ATOM   4785 C  CG  . TYR L 2 39 ? -32.978 22.575  -21.952 1.00 93.44  ? 318 TYR L CG  1 
ATOM   4786 C  CD1 . TYR L 2 39 ? -33.159 23.840  -21.409 1.00 96.91  ? 318 TYR L CD1 1 
ATOM   4787 C  CD2 . TYR L 2 39 ? -31.694 22.199  -22.326 1.00 92.64  ? 318 TYR L CD2 1 
ATOM   4788 C  CE1 . TYR L 2 39 ? -32.113 24.708  -21.242 1.00 98.59  ? 318 TYR L CE1 1 
ATOM   4789 C  CE2 . TYR L 2 39 ? -30.625 23.076  -22.152 1.00 94.80  ? 318 TYR L CE2 1 
ATOM   4790 C  CZ  . TYR L 2 39 ? -30.856 24.327  -21.609 1.00 97.56  ? 318 TYR L CZ  1 
ATOM   4791 O  OH  . TYR L 2 39 ? -29.847 25.229  -21.414 1.00 99.44  ? 318 TYR L OH  1 
ATOM   4792 N  N   . PRO L 2 40 ? -34.299 21.836  -18.751 1.00 91.86  ? 319 PRO L N   1 
ATOM   4793 C  CA  . PRO L 2 40 ? -34.820 22.619  -17.632 1.00 98.25  ? 319 PRO L CA  1 
ATOM   4794 C  C   . PRO L 2 40 ? -35.281 23.981  -18.114 1.00 105.23 ? 319 PRO L C   1 
ATOM   4795 O  O   . PRO L 2 40 ? -34.488 24.753  -18.673 1.00 106.47 ? 319 PRO L O   1 
ATOM   4796 C  CB  . PRO L 2 40 ? -33.628 22.735  -16.669 1.00 96.74  ? 319 PRO L CB  1 
ATOM   4797 C  CG  . PRO L 2 40 ? -32.444 22.195  -17.385 1.00 92.72  ? 319 PRO L CG  1 
ATOM   4798 C  CD  . PRO L 2 40 ? -32.892 21.439  -18.587 1.00 89.26  ? 319 PRO L CD  1 
ATOM   4799 N  N   . PRO L 2 41 ? -36.559 24.306  -17.924 1.00 107.82 ? 320 PRO L N   1 
ATOM   4800 C  CA  . PRO L 2 41 ? -37.083 25.559  -18.489 1.00 110.49 ? 320 PRO L CA  1 
ATOM   4801 C  C   . PRO L 2 41 ? -36.435 26.802  -17.907 1.00 116.18 ? 320 PRO L C   1 
ATOM   4802 O  O   . PRO L 2 41 ? -36.346 27.826  -18.596 1.00 119.80 ? 320 PRO L O   1 
ATOM   4803 C  CB  . PRO L 2 41 ? -38.580 25.484  -18.163 1.00 109.14 ? 320 PRO L CB  1 
ATOM   4804 C  CG  . PRO L 2 41 ? -38.851 24.016  -17.951 1.00 105.07 ? 320 PRO L CG  1 
ATOM   4805 C  CD  . PRO L 2 41 ? -37.614 23.481  -17.316 1.00 92.81  ? 320 PRO L CD  1 
ATOM   4806 N  N   . GLY L 2 42 ? -36.008 26.755  -16.646 1.00 115.98 ? 321 GLY L N   1 
ATOM   4807 C  CA  . GLY L 2 42 ? -35.398 27.913  -16.018 1.00 124.53 ? 321 GLY L CA  1 
ATOM   4808 C  C   . GLY L 2 42 ? -33.989 28.247  -16.484 1.00 129.04 ? 321 GLY L C   1 
ATOM   4809 O  O   . GLY L 2 42 ? -33.513 29.347  -16.180 1.00 134.17 ? 321 GLY L O   1 
ATOM   4810 N  N   . TRP L 2 43 ? -33.324 27.353  -17.225 1.00 127.65 ? 322 TRP L N   1 
ATOM   4811 C  CA  . TRP L 2 43 ? -32.003 27.639  -17.787 1.00 126.88 ? 322 TRP L CA  1 
ATOM   4812 C  C   . TRP L 2 43 ? -32.025 28.216  -19.197 1.00 126.11 ? 322 TRP L C   1 
ATOM   4813 O  O   . TRP L 2 43 ? -30.999 28.750  -19.634 1.00 129.17 ? 322 TRP L O   1 
ATOM   4814 C  CB  . TRP L 2 43 ? -31.096 26.398  -17.773 1.00 123.97 ? 322 TRP L CB  1 
ATOM   4815 C  CG  . TRP L 2 43 ? -30.512 26.090  -16.420 1.00 126.73 ? 322 TRP L CG  1 
ATOM   4816 C  CD1 . TRP L 2 43 ? -30.799 25.021  -15.625 1.00 128.31 ? 322 TRP L CD1 1 
ATOM   4817 C  CD2 . TRP L 2 43 ? -29.571 26.892  -15.690 1.00 130.36 ? 322 TRP L CD2 1 
ATOM   4818 N  NE1 . TRP L 2 43 ? -30.077 25.092  -14.457 1.00 130.27 ? 322 TRP L NE1 1 
ATOM   4819 C  CE2 . TRP L 2 43 ? -29.319 26.234  -14.470 1.00 132.06 ? 322 TRP L CE2 1 
ATOM   4820 C  CE3 . TRP L 2 43 ? -28.912 28.097  -15.952 1.00 133.76 ? 322 TRP L CE3 1 
ATOM   4821 C  CZ2 . TRP L 2 43 ? -28.438 26.741  -13.514 1.00 136.72 ? 322 TRP L CZ2 1 
ATOM   4822 C  CZ3 . TRP L 2 43 ? -28.035 28.599  -14.999 1.00 138.43 ? 322 TRP L CZ3 1 
ATOM   4823 C  CH2 . TRP L 2 43 ? -27.807 27.921  -13.796 1.00 139.56 ? 322 TRP L CH2 1 
ATOM   4824 N  N   . LEU L 2 44 ? -33.124 28.084  -19.933 1.00 120.60 ? 323 LEU L N   1 
ATOM   4825 C  CA  . LEU L 2 44 ? -33.199 28.676  -21.269 1.00 115.58 ? 323 LEU L CA  1 
ATOM   4826 C  C   . LEU L 2 44 ? -32.930 30.178  -21.252 1.00 116.50 ? 323 LEU L C   1 
ATOM   4827 O  O   . LEU L 2 44 ? -33.838 30.983  -21.058 1.00 117.70 ? 323 LEU L O   1 
ATOM   4828 C  CB  . LEU L 2 44 ? -34.569 28.421  -21.896 1.00 112.66 ? 323 LEU L CB  1 
ATOM   4829 C  CG  . LEU L 2 44 ? -34.859 27.031  -22.457 1.00 106.75 ? 323 LEU L CG  1 
ATOM   4830 C  CD1 . LEU L 2 44 ? -36.275 26.979  -23.018 1.00 107.04 ? 323 LEU L CD1 1 
ATOM   4831 C  CD2 . LEU L 2 44 ? -33.840 26.663  -23.524 1.00 103.04 ? 323 LEU L CD2 1 
ATOM   4832 N  N   . GLU M 1 11 ? 31.115  1.215   43.425  1.00 130.12 ? 7   GLU M N   1 
ATOM   4833 C  CA  . GLU M 1 11 ? 29.739  0.915   43.799  1.00 130.77 ? 7   GLU M CA  1 
ATOM   4834 C  C   . GLU M 1 11 ? 28.863  2.158   43.692  1.00 129.67 ? 7   GLU M C   1 
ATOM   4835 O  O   . GLU M 1 11 ? 27.642  2.061   43.581  1.00 128.31 ? 7   GLU M O   1 
ATOM   4836 C  CB  . GLU M 1 11 ? 29.682  0.351   45.221  1.00 133.10 ? 7   GLU M CB  1 
ATOM   4837 N  N   . ALA M 1 12 ? 29.500  3.329   43.728  1.00 130.16 ? 8   ALA M N   1 
ATOM   4838 C  CA  . ALA M 1 12 ? 28.746  4.577   43.689  1.00 129.56 ? 8   ALA M CA  1 
ATOM   4839 C  C   . ALA M 1 12 ? 28.120  4.819   42.324  1.00 128.14 ? 8   ALA M C   1 
ATOM   4840 O  O   . ALA M 1 12 ? 27.127  5.547   42.222  1.00 127.83 ? 8   ALA M O   1 
ATOM   4841 C  CB  . ALA M 1 12 ? 29.650  5.748   44.073  1.00 129.69 ? 8   ALA M CB  1 
ATOM   4842 N  N   . ASP M 1 13 ? 28.673  4.216   41.270  1.00 128.02 ? 9   ASP M N   1 
ATOM   4843 C  CA  . ASP M 1 13 ? 28.127  4.438   39.938  1.00 127.99 ? 9   ASP M CA  1 
ATOM   4844 C  C   . ASP M 1 13 ? 26.828  3.673   39.727  1.00 134.27 ? 9   ASP M C   1 
ATOM   4845 O  O   . ASP M 1 13 ? 25.945  4.147   39.006  1.00 135.56 ? 9   ASP M O   1 
ATOM   4846 C  CB  . ASP M 1 13 ? 29.156  4.044   38.879  1.00 124.06 ? 9   ASP M CB  1 
ATOM   4847 N  N   . ARG M 1 14 ? 26.690  2.501   40.343  1.00 138.51 ? 10  ARG M N   1 
ATOM   4848 C  CA  . ARG M 1 14 ? 25.532  1.639   40.105  1.00 141.36 ? 10  ARG M CA  1 
ATOM   4849 C  C   . ARG M 1 14 ? 24.551  1.747   41.272  1.00 146.76 ? 10  ARG M C   1 
ATOM   4850 O  O   . ARG M 1 14 ? 24.340  0.813   42.048  1.00 148.84 ? 10  ARG M O   1 
ATOM   4851 C  CB  . ARG M 1 14 ? 25.985  0.201   39.879  1.00 139.72 ? 10  ARG M CB  1 
ATOM   4852 N  N   . THR M 1 15 ? 23.935  2.923   41.376  1.00 150.77 ? 11  THR M N   1 
ATOM   4853 C  CA  . THR M 1 15 ? 22.973  3.184   42.437  1.00 151.14 ? 11  THR M CA  1 
ATOM   4854 C  C   . THR M 1 15 ? 22.121  4.387   42.054  1.00 148.57 ? 11  THR M C   1 
ATOM   4855 O  O   . THR M 1 15 ? 22.523  5.221   41.239  1.00 151.36 ? 11  THR M O   1 
ATOM   4856 C  CB  . THR M 1 15 ? 23.667  3.424   43.784  1.00 152.43 ? 11  THR M CB  1 
ATOM   4857 N  N   . LEU M 1 16 ? 20.936  4.464   42.661  1.00 143.81 ? 12  LEU M N   1 
ATOM   4858 C  CA  . LEU M 1 16 ? 19.992  5.543   42.405  1.00 140.70 ? 12  LEU M CA  1 
ATOM   4859 C  C   . LEU M 1 16 ? 19.259  5.905   43.690  1.00 140.23 ? 12  LEU M C   1 
ATOM   4860 O  O   . LEU M 1 16 ? 19.143  5.095   44.614  1.00 142.07 ? 12  LEU M O   1 
ATOM   4861 C  CB  . LEU M 1 16 ? 18.975  5.163   41.319  1.00 140.22 ? 12  LEU M CB  1 
ATOM   4862 N  N   . PHE M 1 17 ? 18.748  7.133   43.730  1.00 140.29 ? 13  PHE M N   1 
ATOM   4863 C  CA  . PHE M 1 17 ? 17.997  7.645   44.869  1.00 143.41 ? 13  PHE M CA  1 
ATOM   4864 C  C   . PHE M 1 17 ? 16.553  7.909   44.460  1.00 147.32 ? 13  PHE M C   1 
ATOM   4865 O  O   . PHE M 1 17 ? 16.290  8.382   43.351  1.00 147.06 ? 13  PHE M O   1 
ATOM   4866 C  CB  . PHE M 1 17 ? 18.627  8.930   45.416  1.00 140.26 ? 13  PHE M CB  1 
ATOM   4867 N  N   . VAL M 1 18 ? 15.618  7.605   45.362  1.00 150.79 ? 14  VAL M N   1 
ATOM   4868 C  CA  . VAL M 1 18 ? 14.188  7.741   45.101  1.00 149.31 ? 14  VAL M CA  1 
ATOM   4869 C  C   . VAL M 1 18 ? 13.552  8.505   46.255  1.00 152.67 ? 14  VAL M C   1 
ATOM   4870 O  O   . VAL M 1 18 ? 13.816  8.203   47.424  1.00 154.38 ? 14  VAL M O   1 
ATOM   4871 C  CB  . VAL M 1 18 ? 13.507  6.371   44.920  1.00 147.10 ? 14  VAL M CB  1 
ATOM   4872 N  N   . GLY M 1 19 ? 12.700  9.486   45.927  1.00 148.96 ? 15  GLY M N   1 
ATOM   4873 C  CA  . GLY M 1 19 ? 12.082  10.319  46.937  1.00 145.80 ? 15  GLY M CA  1 
ATOM   4874 C  C   . GLY M 1 19 ? 10.609  10.546  46.658  1.00 139.35 ? 15  GLY M C   1 
ATOM   4875 O  O   . GLY M 1 19 ? 10.080  10.146  45.617  1.00 136.03 ? 15  GLY M O   1 
ATOM   4876 N  N   . ASN M 1 20 ? 9.959   11.210  47.618  1.00 138.58 ? 16  ASN M N   1 
ATOM   4877 C  CA  . ASN M 1 20 ? 8.521   11.493  47.581  1.00 135.74 ? 16  ASN M CA  1 
ATOM   4878 C  C   . ASN M 1 20 ? 7.706   10.199  47.563  1.00 133.77 ? 16  ASN M C   1 
ATOM   4879 O  O   . ASN M 1 20 ? 6.828   9.995   46.723  1.00 132.25 ? 16  ASN M O   1 
ATOM   4880 C  CB  . ASN M 1 20 ? 8.155   12.395  46.398  1.00 132.31 ? 16  ASN M CB  1 
ATOM   4881 C  CG  . ASN M 1 20 ? 6.777   13.023  46.547  1.00 132.52 ? 16  ASN M CG  1 
ATOM   4882 O  OD1 . ASN M 1 20 ? 6.259   13.149  47.656  1.00 134.21 ? 16  ASN M OD1 1 
ATOM   4883 N  ND2 . ASN M 1 20 ? 6.179   13.416  45.430  1.00 131.67 ? 16  ASN M ND2 1 
ATOM   4884 N  N   . LEU M 1 21 ? 8.004   9.321   48.517  1.00 134.20 ? 17  LEU M N   1 
ATOM   4885 C  CA  . LEU M 1 21 ? 7.326   8.034   48.628  1.00 134.31 ? 17  LEU M CA  1 
ATOM   4886 C  C   . LEU M 1 21 ? 6.042   8.156   49.443  1.00 136.70 ? 17  LEU M C   1 
ATOM   4887 O  O   . LEU M 1 21 ? 5.520   7.161   49.946  1.00 138.19 ? 17  LEU M O   1 
ATOM   4888 C  CB  . LEU M 1 21 ? 8.248   6.989   49.266  1.00 135.64 ? 17  LEU M CB  1 
ATOM   4889 C  CG  . LEU M 1 21 ? 9.327   6.310   48.414  1.00 134.64 ? 17  LEU M CG  1 
ATOM   4890 C  CD1 . LEU M 1 21 ? 10.373  7.291   47.901  1.00 132.37 ? 17  LEU M CD1 1 
ATOM   4891 C  CD2 . LEU M 1 21 ? 9.995   5.190   49.201  1.00 137.18 ? 17  LEU M CD2 1 
ATOM   4892 N  N   . THR M 1 23 ? 4.293   6.705   51.873  1.00 141.67 ? 19  THR M N   1 
ATOM   4893 C  CA  . THR M 1 23 ? 4.284   5.825   53.035  1.00 143.48 ? 19  THR M CA  1 
ATOM   4894 C  C   . THR M 1 23 ? 4.006   4.383   52.629  1.00 143.99 ? 19  THR M C   1 
ATOM   4895 O  O   . THR M 1 23 ? 4.599   3.450   53.172  1.00 145.05 ? 19  THR M O   1 
ATOM   4896 C  CB  . THR M 1 23 ? 3.233   6.265   54.071  1.00 144.94 ? 19  THR M CB  1 
ATOM   4897 N  N   . LYS M 1 24 ? 3.100   4.206   51.670  1.00 143.18 ? 20  LYS M N   1 
ATOM   4898 C  CA  . LYS M 1 24 ? 2.735   2.874   51.209  1.00 146.20 ? 20  LYS M CA  1 
ATOM   4899 C  C   . LYS M 1 24 ? 3.751   2.277   50.241  1.00 148.93 ? 20  LYS M C   1 
ATOM   4900 O  O   . LYS M 1 24 ? 3.524   1.172   49.738  1.00 151.38 ? 20  LYS M O   1 
ATOM   4901 C  CB  . LYS M 1 24 ? 1.351   2.907   50.555  1.00 144.97 ? 20  LYS M CB  1 
ATOM   4902 N  N   . VAL M 1 25 ? 4.853   2.970   49.968  1.00 146.78 ? 21  VAL M N   1 
ATOM   4903 C  CA  . VAL M 1 25 ? 5.904   2.431   49.112  1.00 143.71 ? 21  VAL M CA  1 
ATOM   4904 C  C   . VAL M 1 25 ? 6.826   1.556   49.952  1.00 146.89 ? 21  VAL M C   1 
ATOM   4905 O  O   . VAL M 1 25 ? 7.286   1.967   51.025  1.00 147.95 ? 21  VAL M O   1 
ATOM   4906 C  CB  . VAL M 1 25 ? 6.685   3.562   48.425  1.00 139.71 ? 21  VAL M CB  1 
ATOM   4907 N  N   . THR M 1 26 ? 7.099   0.346   49.466  1.00 148.75 ? 22  THR M N   1 
ATOM   4908 C  CA  . THR M 1 26 ? 7.897   -0.634  50.185  1.00 153.59 ? 22  THR M CA  1 
ATOM   4909 C  C   . THR M 1 26 ? 9.093   -1.068  49.345  1.00 157.84 ? 22  THR M C   1 
ATOM   4910 O  O   . THR M 1 26 ? 9.080   -0.985  48.113  1.00 158.34 ? 22  THR M O   1 
ATOM   4911 C  CB  . THR M 1 26 ? 7.066   -1.869  50.561  1.00 153.41 ? 22  THR M CB  1 
ATOM   4912 O  OG1 . THR M 1 26 ? 6.678   -2.568  49.372  1.00 150.50 ? 22  THR M OG1 1 
ATOM   4913 C  CG2 . THR M 1 26 ? 5.818   -1.462  51.329  1.00 154.73 ? 22  THR M CG2 1 
ATOM   4914 N  N   . GLU M 1 27 ? 10.125  -1.545  50.032  1.00 162.74 ? 23  GLU M N   1 
ATOM   4915 C  CA  . GLU M 1 27 ? 11.341  -2.015  49.374  1.00 162.84 ? 23  GLU M CA  1 
ATOM   4916 C  C   . GLU M 1 27 ? 11.095  -3.308  48.606  1.00 163.75 ? 23  GLU M C   1 
ATOM   4917 O  O   . GLU M 1 27 ? 11.955  -4.188  48.569  1.00 164.19 ? 23  GLU M O   1 
ATOM   4918 C  CB  . GLU M 1 27 ? 12.459  -2.224  50.399  1.00 165.14 ? 23  GLU M CB  1 
ATOM   4919 N  N   . LEU M 1 29 ? 8.334   -4.022  46.744  1.00 126.55 ? 25  LEU M N   1 
ATOM   4920 C  CA  . LEU M 1 29 ? 7.609   -3.503  45.590  1.00 124.11 ? 25  LEU M CA  1 
ATOM   4921 C  C   . LEU M 1 29 ? 8.546   -2.731  44.669  1.00 119.82 ? 25  LEU M C   1 
ATOM   4922 O  O   . LEU M 1 29 ? 8.562   -2.954  43.456  1.00 116.30 ? 25  LEU M O   1 
ATOM   4923 C  CB  . LEU M 1 29 ? 6.451   -2.605  46.035  1.00 124.86 ? 25  LEU M CB  1 
ATOM   4924 N  N   . LEU M 1 30 ? 9.330   -1.823  45.260  1.00 119.07 ? 26  LEU M N   1 
ATOM   4925 C  CA  . LEU M 1 30 ? 10.261  -1.020  44.473  1.00 116.77 ? 26  LEU M CA  1 
ATOM   4926 C  C   . LEU M 1 30 ? 11.269  -1.890  43.732  1.00 117.72 ? 26  LEU M C   1 
ATOM   4927 O  O   . LEU M 1 30 ? 11.682  -1.547  42.617  1.00 116.97 ? 26  LEU M O   1 
ATOM   4928 C  CB  . LEU M 1 30 ? 10.990  -0.023  45.377  1.00 116.26 ? 26  LEU M CB  1 
ATOM   4929 N  N   . PHE M 1 31 ? 11.675  -3.011  44.332  1.00 119.38 ? 27  PHE M N   1 
ATOM   4930 C  CA  . PHE M 1 31 ? 12.634  -3.894  43.677  1.00 118.75 ? 27  PHE M CA  1 
ATOM   4931 C  C   . PHE M 1 31 ? 12.064  -4.467  42.387  1.00 117.83 ? 27  PHE M C   1 
ATOM   4932 O  O   . PHE M 1 31 ? 12.769  -4.551  41.375  1.00 116.83 ? 27  PHE M O   1 
ATOM   4933 C  CB  . PHE M 1 31 ? 13.046  -5.019  44.626  1.00 120.56 ? 27  PHE M CB  1 
ATOM   4934 N  N   . GLU M 1 32 ? 10.790  -4.869  42.402  1.00 118.94 ? 28  GLU M N   1 
ATOM   4935 C  CA  . GLU M 1 32 ? 10.161  -5.369  41.183  1.00 118.77 ? 28  GLU M CA  1 
ATOM   4936 C  C   . GLU M 1 32 ? 10.094  -4.287  40.117  1.00 118.60 ? 28  GLU M C   1 
ATOM   4937 O  O   . GLU M 1 32 ? 10.338  -4.552  38.934  1.00 114.01 ? 28  GLU M O   1 
ATOM   4938 C  CB  . GLU M 1 32 ? 8.758   -5.891  41.484  1.00 118.84 ? 28  GLU M CB  1 
ATOM   4939 C  CG  . GLU M 1 32 ? 7.982   -6.297  40.246  1.00 119.67 ? 28  GLU M CG  1 
ATOM   4940 C  CD  . GLU M 1 32 ? 6.508   -5.954  40.335  1.00 123.00 ? 28  GLU M CD  1 
ATOM   4941 O  OE1 . GLU M 1 32 ? 6.100   -5.316  41.327  1.00 124.70 ? 28  GLU M OE1 1 
ATOM   4942 O  OE2 . GLU M 1 32 ? 5.756   -6.320  39.408  1.00 124.25 ? 28  GLU M OE2 1 
ATOM   4943 N  N   . LEU M 1 33 ? 9.761   -3.059  40.520  1.00 120.93 ? 29  LEU M N   1 
ATOM   4944 C  CA  . LEU M 1 33 ? 9.648   -1.965  39.562  1.00 122.40 ? 29  LEU M CA  1 
ATOM   4945 C  C   . LEU M 1 33 ? 10.980  -1.703  38.871  1.00 127.75 ? 29  LEU M C   1 
ATOM   4946 O  O   . LEU M 1 33 ? 11.045  -1.577  37.642  1.00 131.52 ? 29  LEU M O   1 
ATOM   4947 C  CB  . LEU M 1 33 ? 9.150   -0.704  40.273  1.00 118.09 ? 29  LEU M CB  1 
ATOM   4948 C  CG  . LEU M 1 33 ? 8.928   0.518   39.384  1.00 110.52 ? 29  LEU M CG  1 
ATOM   4949 C  CD1 . LEU M 1 33 ? 8.079   0.123   38.201  1.00 106.27 ? 29  LEU M CD1 1 
ATOM   4950 C  CD2 . LEU M 1 33 ? 8.288   1.654   40.159  1.00 95.49  ? 29  LEU M CD2 1 
ATOM   4951 N  N   . PHE M 1 34 ? 12.059  -1.624  39.647  1.00 124.69 ? 30  PHE M N   1 
ATOM   4952 C  CA  . PHE M 1 34 ? 13.358  -1.307  39.074  1.00 127.19 ? 30  PHE M CA  1 
ATOM   4953 C  C   . PHE M 1 34 ? 14.033  -2.512  38.441  1.00 130.91 ? 30  PHE M C   1 
ATOM   4954 O  O   . PHE M 1 34 ? 14.917  -2.332  37.595  1.00 129.49 ? 30  PHE M O   1 
ATOM   4955 C  CB  . PHE M 1 34 ? 14.264  -0.689  40.136  1.00 123.96 ? 30  PHE M CB  1 
ATOM   4956 C  CG  . PHE M 1 34 ? 14.048  0.782   40.319  1.00 122.01 ? 30  PHE M CG  1 
ATOM   4957 C  CD1 . PHE M 1 34 ? 13.027  1.251   41.128  1.00 122.32 ? 30  PHE M CD1 1 
ATOM   4958 C  CD2 . PHE M 1 34 ? 14.855  1.699   39.667  1.00 119.32 ? 30  PHE M CD2 1 
ATOM   4959 C  CE1 . PHE M 1 34 ? 12.824  2.609   41.289  1.00 120.80 ? 30  PHE M CE1 1 
ATOM   4960 C  CE2 . PHE M 1 34 ? 14.659  3.055   39.827  1.00 117.85 ? 30  PHE M CE2 1 
ATOM   4961 C  CZ  . PHE M 1 34 ? 13.643  3.510   40.638  1.00 119.06 ? 30  PHE M CZ  1 
ATOM   4962 N  N   . HIS M 1 35 ? 13.641  -3.730  38.822  1.00 140.20 ? 31  HIS M N   1 
ATOM   4963 C  CA  . HIS M 1 35 ? 14.113  -4.904  38.097  1.00 140.62 ? 31  HIS M CA  1 
ATOM   4964 C  C   . HIS M 1 35 ? 13.724  -4.832  36.628  1.00 137.82 ? 31  HIS M C   1 
ATOM   4965 O  O   . HIS M 1 35 ? 14.418  -5.388  35.773  1.00 145.26 ? 31  HIS M O   1 
ATOM   4966 C  CB  . HIS M 1 35 ? 13.558  -6.179  38.732  1.00 139.56 ? 31  HIS M CB  1 
ATOM   4967 N  N   . GLN M 1 36 ? 12.632  -4.134  36.315  1.00 128.99 ? 32  GLN M N   1 
ATOM   4968 C  CA  . GLN M 1 36 ? 12.168  -4.062  34.934  1.00 120.50 ? 32  GLN M CA  1 
ATOM   4969 C  C   . GLN M 1 36 ? 13.040  -3.131  34.101  1.00 113.66 ? 32  GLN M C   1 
ATOM   4970 O  O   . GLN M 1 36 ? 13.295  -3.399  32.921  1.00 111.29 ? 32  GLN M O   1 
ATOM   4971 C  CB  . GLN M 1 36 ? 10.713  -3.607  34.907  1.00 119.00 ? 32  GLN M CB  1 
ATOM   4972 C  CG  . GLN M 1 36 ? 9.949   -4.054  33.686  1.00 117.76 ? 32  GLN M CG  1 
ATOM   4973 C  CD  . GLN M 1 36 ? 8.466   -3.809  33.829  1.00 117.40 ? 32  GLN M CD  1 
ATOM   4974 O  OE1 . GLN M 1 36 ? 7.649   -4.454  33.170  1.00 119.96 ? 32  GLN M OE1 1 
ATOM   4975 N  NE2 . GLN M 1 36 ? 8.108   -2.871  34.697  1.00 115.28 ? 32  GLN M NE2 1 
ATOM   4976 N  N   . ALA M 1 37 ? 13.506  -2.030  34.692  1.00 111.16 ? 33  ALA M N   1 
ATOM   4977 C  CA  . ALA M 1 37 ? 14.383  -1.121  33.963  1.00 111.55 ? 33  ALA M CA  1 
ATOM   4978 C  C   . ALA M 1 37 ? 15.799  -1.667  33.834  1.00 115.06 ? 33  ALA M C   1 
ATOM   4979 O  O   . ALA M 1 37 ? 16.579  -1.150  33.028  1.00 115.48 ? 33  ALA M O   1 
ATOM   4980 C  CB  . ALA M 1 37 ? 14.410  0.248   34.645  1.00 110.23 ? 33  ALA M CB  1 
ATOM   4981 N  N   . GLY M 1 38 ? 16.143  -2.695  34.604  1.00 119.95 ? 34  GLY M N   1 
ATOM   4982 C  CA  . GLY M 1 38 ? 17.460  -3.284  34.568  1.00 122.79 ? 34  GLY M CA  1 
ATOM   4983 C  C   . GLY M 1 38 ? 17.704  -4.174  35.771  1.00 130.03 ? 34  GLY M C   1 
ATOM   4984 O  O   . GLY M 1 38 ? 17.025  -4.067  36.797  1.00 133.95 ? 34  GLY M O   1 
ATOM   4985 N  N   . PRO M 1 39 ? 18.670  -5.084  35.662  1.00 133.59 ? 35  PRO M N   1 
ATOM   4986 C  CA  . PRO M 1 39 ? 18.982  -5.969  36.794  1.00 137.83 ? 35  PRO M CA  1 
ATOM   4987 C  C   . PRO M 1 39 ? 19.437  -5.176  38.011  1.00 140.84 ? 35  PRO M C   1 
ATOM   4988 O  O   . PRO M 1 39 ? 20.303  -4.302  37.920  1.00 138.96 ? 35  PRO M O   1 
ATOM   4989 C  CB  . PRO M 1 39 ? 20.100  -6.862  36.246  1.00 136.60 ? 35  PRO M CB  1 
ATOM   4990 C  CG  . PRO M 1 39 ? 19.872  -6.868  34.771  1.00 134.71 ? 35  PRO M CG  1 
ATOM   4991 C  CD  . PRO M 1 39 ? 19.381  -5.485  34.437  1.00 132.60 ? 35  PRO M CD  1 
ATOM   4992 N  N   . VAL M 1 40 ? 18.838  -5.489  39.159  1.00 145.07 ? 36  VAL M N   1 
ATOM   4993 C  CA  . VAL M 1 40 ? 19.072  -4.769  40.405  1.00 146.82 ? 36  VAL M CA  1 
ATOM   4994 C  C   . VAL M 1 40 ? 19.658  -5.738  41.422  1.00 151.88 ? 36  VAL M C   1 
ATOM   4995 O  O   . VAL M 1 40 ? 19.162  -6.862  41.575  1.00 155.12 ? 36  VAL M O   1 
ATOM   4996 C  CB  . VAL M 1 40 ? 17.781  -4.128  40.944  1.00 145.51 ? 36  VAL M CB  1 
ATOM   4997 N  N   . ILE M 1 41 ? 20.701  -5.296  42.124  1.00 152.23 ? 37  ILE M N   1 
ATOM   4998 C  CA  . ILE M 1 41 ? 21.377  -6.161  43.086  1.00 153.33 ? 37  ILE M CA  1 
ATOM   4999 C  C   . ILE M 1 41 ? 20.637  -6.171  44.418  1.00 155.01 ? 37  ILE M C   1 
ATOM   5000 O  O   . ILE M 1 41 ? 20.398  -7.233  45.004  1.00 157.71 ? 37  ILE M O   1 
ATOM   5001 C  CB  . ILE M 1 41 ? 22.843  -5.722  43.258  1.00 150.07 ? 37  ILE M CB  1 
ATOM   5002 N  N   . LYS M 1 42 ? 20.272  -4.995  44.920  1.00 155.51 ? 38  LYS M N   1 
ATOM   5003 C  CA  . LYS M 1 42 ? 19.535  -4.895  46.171  1.00 152.47 ? 38  LYS M CA  1 
ATOM   5004 C  C   . LYS M 1 42 ? 18.775  -3.579  46.181  1.00 149.72 ? 38  LYS M C   1 
ATOM   5005 O  O   . LYS M 1 42 ? 19.070  -2.664  45.408  1.00 149.15 ? 38  LYS M O   1 
ATOM   5006 C  CB  . LYS M 1 42 ? 20.463  -4.994  47.389  1.00 153.22 ? 38  LYS M CB  1 
ATOM   5007 N  N   . VAL M 1 43 ? 17.787  -3.501  47.066  1.00 145.35 ? 39  VAL M N   1 
ATOM   5008 C  CA  . VAL M 1 43 ? 17.003  -2.285  47.234  1.00 139.64 ? 39  VAL M CA  1 
ATOM   5009 C  C   . VAL M 1 43 ? 16.880  -1.949  48.715  1.00 139.34 ? 39  VAL M C   1 
ATOM   5010 O  O   . VAL M 1 43 ? 17.603  -2.497  49.548  1.00 139.87 ? 39  VAL M O   1 
ATOM   5011 C  CB  . VAL M 1 43 ? 15.613  -2.416  46.586  1.00 137.52 ? 39  VAL M CB  1 
ATOM   5012 C  CG1 . VAL M 1 43 ? 14.727  -1.251  46.992  1.00 136.86 ? 39  VAL M CG1 1 
ATOM   5013 C  CG2 . VAL M 1 43 ? 15.739  -2.476  45.073  1.00 134.08 ? 39  VAL M CG2 1 
ATOM   5014 N  N   . GLN M 1 55 ? 10.632  7.581   53.654  1.00 167.41 ? 51  GLN M N   1 
ATOM   5015 C  CA  . GLN M 1 55 ? 10.236  8.348   52.479  1.00 166.54 ? 51  GLN M CA  1 
ATOM   5016 C  C   . GLN M 1 55 ? 11.345  8.368   51.435  1.00 167.74 ? 51  GLN M C   1 
ATOM   5017 O  O   . GLN M 1 55 ? 11.235  9.047   50.415  1.00 168.95 ? 51  GLN M O   1 
ATOM   5018 C  CB  . GLN M 1 55 ? 9.866   9.779   52.872  1.00 164.17 ? 51  GLN M CB  1 
ATOM   5019 N  N   . PHE M 1 56 ? 12.418  7.626   51.699  1.00 168.23 ? 52  PHE M N   1 
ATOM   5020 C  CA  . PHE M 1 56 ? 13.563  7.550   50.805  1.00 166.26 ? 52  PHE M CA  1 
ATOM   5021 C  C   . PHE M 1 56 ? 13.950  6.094   50.598  1.00 164.46 ? 52  PHE M C   1 
ATOM   5022 O  O   . PHE M 1 56 ? 13.908  5.294   51.538  1.00 167.78 ? 52  PHE M O   1 
ATOM   5023 C  CB  . PHE M 1 56 ? 14.758  8.336   51.362  1.00 165.19 ? 52  PHE M CB  1 
ATOM   5024 N  N   . ALA M 1 57 ? 14.329  5.756   49.367  1.00 160.56 ? 53  ALA M N   1 
ATOM   5025 C  CA  . ALA M 1 57 ? 14.716  4.399   49.013  1.00 158.35 ? 53  ALA M CA  1 
ATOM   5026 C  C   . ALA M 1 57 ? 16.024  4.415   48.235  1.00 152.05 ? 53  ALA M C   1 
ATOM   5027 O  O   . ALA M 1 57 ? 16.321  5.362   47.502  1.00 152.16 ? 53  ALA M O   1 
ATOM   5028 C  CB  . ALA M 1 57 ? 13.629  3.700   48.185  1.00 156.88 ? 53  ALA M CB  1 
ATOM   5029 N  N   . PHE M 1 58 ? 16.803  3.350   48.406  1.00 151.98 ? 54  PHE M N   1 
ATOM   5030 C  CA  . PHE M 1 58 ? 18.070  3.171   47.711  1.00 149.52 ? 54  PHE M CA  1 
ATOM   5031 C  C   . PHE M 1 58 ? 18.000  1.897   46.882  1.00 147.73 ? 54  PHE M C   1 
ATOM   5032 O  O   . PHE M 1 58 ? 17.557  0.856   47.377  1.00 151.16 ? 54  PHE M O   1 
ATOM   5033 C  CB  . PHE M 1 58 ? 19.239  3.102   48.699  1.00 151.41 ? 54  PHE M CB  1 
ATOM   5034 N  N   . VAL M 1 59 ? 18.433  1.983   45.626  1.00 141.58 ? 55  VAL M N   1 
ATOM   5035 C  CA  . VAL M 1 59 ? 18.380  0.866   44.690  1.00 138.25 ? 55  VAL M CA  1 
ATOM   5036 C  C   . VAL M 1 59 ? 19.767  0.670   44.094  1.00 136.35 ? 55  VAL M C   1 
ATOM   5037 O  O   . VAL M 1 59 ? 20.393  1.634   43.641  1.00 134.15 ? 55  VAL M O   1 
ATOM   5038 C  CB  . VAL M 1 59 ? 17.344  1.104   43.574  1.00 136.67 ? 55  VAL M CB  1 
ATOM   5039 C  CG1 . VAL M 1 59 ? 17.450  0.025   42.512  1.00 135.89 ? 55  VAL M CG1 1 
ATOM   5040 C  CG2 . VAL M 1 59 ? 15.940  1.142   44.155  1.00 139.61 ? 55  VAL M CG2 1 
ATOM   5041 N  N   . ASN M 1 60 ? 20.240  -0.576  44.089  1.00 136.89 ? 56  ASN M N   1 
ATOM   5042 C  CA  . ASN M 1 60 ? 21.549  -0.926  43.550  1.00 137.27 ? 56  ASN M CA  1 
ATOM   5043 C  C   . ASN M 1 60 ? 21.361  -1.834  42.342  1.00 137.25 ? 56  ASN M C   1 
ATOM   5044 O  O   . ASN M 1 60 ? 20.730  -2.891  42.449  1.00 139.86 ? 56  ASN M O   1 
ATOM   5045 C  CB  . ASN M 1 60 ? 22.414  -1.612  44.609  1.00 137.55 ? 56  ASN M CB  1 
ATOM   5046 N  N   . PHE M 1 61 ? 21.909  -1.420  41.201  1.00 132.94 ? 57  PHE M N   1 
ATOM   5047 C  CA  . PHE M 1 61 ? 21.851  -2.179  39.959  1.00 131.87 ? 57  PHE M CA  1 
ATOM   5048 C  C   . PHE M 1 61 ? 23.143  -2.962  39.750  1.00 132.70 ? 57  PHE M C   1 
ATOM   5049 O  O   . PHE M 1 61 ? 24.205  -2.592  40.256  1.00 136.11 ? 57  PHE M O   1 
ATOM   5050 C  CB  . PHE M 1 61 ? 21.624  -1.258  38.757  1.00 127.98 ? 57  PHE M CB  1 
ATOM   5051 C  CG  . PHE M 1 61 ? 20.267  -0.619  38.718  1.00 127.42 ? 57  PHE M CG  1 
ATOM   5052 C  CD1 . PHE M 1 61 ? 19.169  -1.324  38.255  1.00 126.70 ? 57  PHE M CD1 1 
ATOM   5053 C  CD2 . PHE M 1 61 ? 20.094  0.696   39.119  1.00 126.78 ? 57  PHE M CD2 1 
ATOM   5054 C  CE1 . PHE M 1 61 ? 17.923  -0.736  38.205  1.00 127.38 ? 57  PHE M CE1 1 
ATOM   5055 C  CE2 . PHE M 1 61 ? 18.851  1.290   39.072  1.00 127.38 ? 57  PHE M CE2 1 
ATOM   5056 C  CZ  . PHE M 1 61 ? 17.765  0.572   38.613  1.00 128.20 ? 57  PHE M CZ  1 
ATOM   5057 N  N   . LYS M 1 62 ? 23.047  -4.043  38.970  1.00 129.27 ? 58  LYS M N   1 
ATOM   5058 C  CA  . LYS M 1 62 ? 24.215  -4.888  38.739  1.00 128.28 ? 58  LYS M CA  1 
ATOM   5059 C  C   . LYS M 1 62 ? 25.217  -4.232  37.798  1.00 124.54 ? 58  LYS M C   1 
ATOM   5060 O  O   . LYS M 1 62 ? 26.423  -4.486  37.904  1.00 127.37 ? 58  LYS M O   1 
ATOM   5061 C  CB  . LYS M 1 62 ? 23.785  -6.245  38.184  1.00 129.82 ? 58  LYS M CB  1 
ATOM   5062 N  N   . HIS M 1 63 ? 24.748  -3.400  36.873  1.00 119.51 ? 59  HIS M N   1 
ATOM   5063 C  CA  . HIS M 1 63 ? 25.612  -2.754  35.896  1.00 113.50 ? 59  HIS M CA  1 
ATOM   5064 C  C   . HIS M 1 63 ? 25.304  -1.266  35.859  1.00 111.41 ? 59  HIS M C   1 
ATOM   5065 O  O   . HIS M 1 63 ? 24.144  -0.862  35.974  1.00 110.76 ? 59  HIS M O   1 
ATOM   5066 C  CB  . HIS M 1 63 ? 25.427  -3.362  34.503  1.00 111.16 ? 59  HIS M CB  1 
ATOM   5067 C  CG  . HIS M 1 63 ? 25.174  -4.838  34.521  1.00 115.45 ? 59  HIS M CG  1 
ATOM   5068 N  ND1 . HIS M 1 63 ? 23.908  -5.374  34.629  1.00 117.90 ? 59  HIS M ND1 1 
ATOM   5069 C  CD2 . HIS M 1 63 ? 26.024  -5.890  34.458  1.00 118.03 ? 59  HIS M CD2 1 
ATOM   5070 C  CE1 . HIS M 1 63 ? 23.989  -6.692  34.623  1.00 120.62 ? 59  HIS M CE1 1 
ATOM   5071 N  NE2 . HIS M 1 63 ? 25.261  -7.031  34.520  1.00 121.06 ? 59  HIS M NE2 1 
ATOM   5072 N  N   . GLU M 1 64 ? 26.351  -0.456  35.689  1.00 114.71 ? 60  GLU M N   1 
ATOM   5073 C  CA  . GLU M 1 64 ? 26.179  0.992   35.661  1.00 116.52 ? 60  GLU M CA  1 
ATOM   5074 C  C   . GLU M 1 64 ? 25.286  1.455   34.515  1.00 118.70 ? 60  GLU M C   1 
ATOM   5075 O  O   . GLU M 1 64 ? 24.724  2.552   34.597  1.00 121.05 ? 60  GLU M O   1 
ATOM   5076 C  CB  . GLU M 1 64 ? 27.541  1.683   35.570  1.00 113.89 ? 60  GLU M CB  1 
ATOM   5077 N  N   . VAL M 1 65 ? 25.138  0.652   33.455  1.00 119.16 ? 61  VAL M N   1 
ATOM   5078 C  CA  . VAL M 1 65 ? 24.275  1.040   32.342  1.00 118.75 ? 61  VAL M CA  1 
ATOM   5079 C  C   . VAL M 1 65 ? 22.807  1.093   32.746  1.00 116.88 ? 61  VAL M C   1 
ATOM   5080 O  O   . VAL M 1 65 ? 22.015  1.771   32.082  1.00 116.86 ? 61  VAL M O   1 
ATOM   5081 C  CB  . VAL M 1 65 ? 24.452  0.088   31.143  1.00 119.45 ? 61  VAL M CB  1 
ATOM   5082 C  CG1 . VAL M 1 65 ? 25.848  0.221   30.552  1.00 120.85 ? 61  VAL M CG1 1 
ATOM   5083 C  CG2 . VAL M 1 65 ? 24.195  -1.345  31.565  1.00 119.92 ? 61  VAL M CG2 1 
ATOM   5084 N  N   . SER M 1 66 ? 22.420  0.397   33.818  1.00 116.34 ? 62  SER M N   1 
ATOM   5085 C  CA  . SER M 1 66 ? 21.018  0.391   34.228  1.00 113.47 ? 62  SER M CA  1 
ATOM   5086 C  C   . SER M 1 66 ? 20.590  1.730   34.814  1.00 111.24 ? 62  SER M C   1 
ATOM   5087 O  O   . SER M 1 66 ? 19.424  2.118   34.678  1.00 112.95 ? 62  SER M O   1 
ATOM   5088 C  CB  . SER M 1 66 ? 20.768  -0.725  35.241  1.00 114.32 ? 62  SER M CB  1 
ATOM   5089 O  OG  . SER M 1 66 ? 20.967  -1.999  34.659  1.00 113.23 ? 62  SER M OG  1 
ATOM   5090 N  N   . VAL M 1 67 ? 21.513  2.442   35.467  1.00 106.23 ? 63  VAL M N   1 
ATOM   5091 C  CA  . VAL M 1 67 ? 21.154  3.704   36.119  1.00 110.06 ? 63  VAL M CA  1 
ATOM   5092 C  C   . VAL M 1 67 ? 20.576  4.716   35.135  1.00 109.86 ? 63  VAL M C   1 
ATOM   5093 O  O   . VAL M 1 67 ? 19.462  5.209   35.378  1.00 112.66 ? 63  VAL M O   1 
ATOM   5094 C  CB  . VAL M 1 67 ? 22.357  4.256   36.903  1.00 108.80 ? 63  VAL M CB  1 
ATOM   5095 N  N   . PRO M 1 68 ? 21.247  5.068   34.028  1.00 106.74 ? 64  PRO M N   1 
ATOM   5096 C  CA  . PRO M 1 68 ? 20.639  6.051   33.114  1.00 105.68 ? 64  PRO M CA  1 
ATOM   5097 C  C   . PRO M 1 68 ? 19.334  5.569   32.510  1.00 104.44 ? 64  PRO M C   1 
ATOM   5098 O  O   . PRO M 1 68 ? 18.396  6.360   32.353  1.00 106.72 ? 64  PRO M O   1 
ATOM   5099 C  CB  . PRO M 1 68 ? 21.723  6.256   32.044  1.00 102.90 ? 64  PRO M CB  1 
ATOM   5100 C  CG  . PRO M 1 68 ? 22.986  5.764   32.664  1.00 103.29 ? 64  PRO M CG  1 
ATOM   5101 C  CD  . PRO M 1 68 ? 22.560  4.623   33.531  1.00 104.95 ? 64  PRO M CD  1 
ATOM   5102 N  N   . TYR M 1 69 ? 19.248  4.282   32.165  1.00 101.55 ? 65  TYR M N   1 
ATOM   5103 C  CA  . TYR M 1 69 ? 18.007  3.743   31.619  1.00 99.89  ? 65  TYR M CA  1 
ATOM   5104 C  C   . TYR M 1 69 ? 16.874  3.848   32.632  1.00 103.54 ? 65  TYR M C   1 
ATOM   5105 O  O   . TYR M 1 69 ? 15.750  4.224   32.280  1.00 103.64 ? 65  TYR M O   1 
ATOM   5106 C  CB  . TYR M 1 69 ? 18.211  2.290   31.193  1.00 95.92  ? 65  TYR M CB  1 
ATOM   5107 C  CG  . TYR M 1 69 ? 17.077  1.721   30.372  1.00 92.56  ? 65  TYR M CG  1 
ATOM   5108 C  CD1 . TYR M 1 69 ? 17.144  1.700   28.986  1.00 89.90  ? 65  TYR M CD1 1 
ATOM   5109 C  CD2 . TYR M 1 69 ? 15.937  1.206   30.979  1.00 91.52  ? 65  TYR M CD2 1 
ATOM   5110 C  CE1 . TYR M 1 69 ? 16.109  1.179   28.226  1.00 87.16  ? 65  TYR M CE1 1 
ATOM   5111 C  CE2 . TYR M 1 69 ? 14.899  0.686   30.227  1.00 88.47  ? 65  TYR M CE2 1 
ATOM   5112 C  CZ  . TYR M 1 69 ? 14.992  0.676   28.854  1.00 86.11  ? 65  TYR M CZ  1 
ATOM   5113 O  OH  . TYR M 1 69 ? 13.964  0.163   28.103  1.00 85.79  ? 65  TYR M OH  1 
ATOM   5114 N  N   . ALA M 1 70 ? 17.152  3.519   33.897  1.00 105.52 ? 66  ALA M N   1 
ATOM   5115 C  CA  . ALA M 1 70 ? 16.138  3.624   34.941  1.00 104.70 ? 66  ALA M CA  1 
ATOM   5116 C  C   . ALA M 1 70 ? 15.707  5.066   35.193  1.00 104.56 ? 66  ALA M C   1 
ATOM   5117 O  O   . ALA M 1 70 ? 14.599  5.292   35.693  1.00 104.85 ? 66  ALA M O   1 
ATOM   5118 C  CB  . ALA M 1 70 ? 16.646  3.001   36.245  1.00 103.93 ? 66  ALA M CB  1 
ATOM   5119 N  N   . MET M 1 71 ? 16.560  6.044   34.879  1.00 105.59 ? 67  MET M N   1 
ATOM   5120 C  CA  . MET M 1 71 ? 16.163  7.442   35.019  1.00 109.84 ? 67  MET M CA  1 
ATOM   5121 C  C   . MET M 1 71 ? 15.120  7.826   33.975  1.00 110.88 ? 67  MET M C   1 
ATOM   5122 O  O   . MET M 1 71 ? 14.091  8.426   34.302  1.00 111.75 ? 67  MET M O   1 
ATOM   5123 C  CB  . MET M 1 71 ? 17.388  8.354   34.915  1.00 112.11 ? 67  MET M CB  1 
ATOM   5124 C  CG  . MET M 1 71 ? 17.080  9.841   35.060  1.00 114.56 ? 67  MET M CG  1 
ATOM   5125 S  SD  . MET M 1 71 ? 16.377  10.241  36.672  1.00 117.69 ? 67  MET M SD  1 
ATOM   5126 C  CE  . MET M 1 71 ? 17.652  9.606   37.757  1.00 118.82 ? 67  MET M CE  1 
ATOM   5127 N  N   . ASN M 1 72 ? 15.362  7.477   32.711  1.00 111.87 ? 68  ASN M N   1 
ATOM   5128 C  CA  . ASN M 1 72 ? 14.490  7.920   31.633  1.00 114.04 ? 68  ASN M CA  1 
ATOM   5129 C  C   . ASN M 1 72 ? 13.146  7.207   31.621  1.00 113.46 ? 68  ASN M C   1 
ATOM   5130 O  O   . ASN M 1 72 ? 12.175  7.768   31.104  1.00 114.44 ? 68  ASN M O   1 
ATOM   5131 C  CB  . ASN M 1 72 ? 15.183  7.728   30.284  1.00 117.50 ? 68  ASN M CB  1 
ATOM   5132 C  CG  . ASN M 1 72 ? 16.448  8.562   30.159  1.00 122.55 ? 68  ASN M CG  1 
ATOM   5133 O  OD1 . ASN M 1 72 ? 16.735  9.409   31.009  1.00 126.30 ? 68  ASN M OD1 1 
ATOM   5134 N  ND2 . ASN M 1 72 ? 17.205  8.332   29.089  1.00 122.27 ? 68  ASN M ND2 1 
ATOM   5135 N  N   . LEU M 1 73 ? 13.057  6.000   32.182  1.00 113.80 ? 69  LEU M N   1 
ATOM   5136 C  CA  . LEU M 1 73 ? 11.831  5.214   32.105  1.00 112.97 ? 69  LEU M CA  1 
ATOM   5137 C  C   . LEU M 1 73 ? 10.927  5.360   33.323  1.00 111.73 ? 69  LEU M C   1 
ATOM   5138 O  O   . LEU M 1 73 ? 9.707   5.198   33.194  1.00 110.37 ? 69  LEU M O   1 
ATOM   5139 C  CB  . LEU M 1 73 ? 12.157  3.726   31.907  1.00 111.60 ? 69  LEU M CB  1 
ATOM   5140 N  N   . LEU M 1 74 ? 11.480  5.651   34.501  1.00 110.73 ? 70  LEU M N   1 
ATOM   5141 C  CA  . LEU M 1 74 ? 10.701  5.618   35.731  1.00 110.17 ? 70  LEU M CA  1 
ATOM   5142 C  C   . LEU M 1 74 ? 10.660  6.940   36.485  1.00 111.79 ? 70  LEU M C   1 
ATOM   5143 O  O   . LEU M 1 74 ? 10.042  7.000   37.556  1.00 117.11 ? 70  LEU M O   1 
ATOM   5144 C  CB  . LEU M 1 74 ? 11.229  4.520   36.667  1.00 105.90 ? 70  LEU M CB  1 
ATOM   5145 C  CG  . LEU M 1 74 ? 11.307  3.097   36.105  1.00 99.68  ? 70  LEU M CG  1 
ATOM   5146 C  CD1 . LEU M 1 74 ? 11.576  2.095   37.217  1.00 100.18 ? 70  LEU M CD1 1 
ATOM   5147 C  CD2 . LEU M 1 74 ? 10.040  2.736   35.359  1.00 97.33  ? 70  LEU M CD2 1 
ATOM   5148 N  N   . ASN M 1 75 ? 11.287  7.995   35.972  1.00 109.72 ? 71  ASN M N   1 
ATOM   5149 C  CA  . ASN M 1 75 ? 11.235  9.287   36.644  1.00 108.76 ? 71  ASN M CA  1 
ATOM   5150 C  C   . ASN M 1 75 ? 9.828   9.865   36.564  1.00 112.85 ? 71  ASN M C   1 
ATOM   5151 O  O   . ASN M 1 75 ? 9.173   9.807   35.520  1.00 114.78 ? 71  ASN M O   1 
ATOM   5152 C  CB  . ASN M 1 75 ? 12.236  10.256  36.016  1.00 109.02 ? 71  ASN M CB  1 
ATOM   5153 C  CG  . ASN M 1 75 ? 12.710  11.322  36.989  1.00 113.98 ? 71  ASN M CG  1 
ATOM   5154 O  OD1 . ASN M 1 75 ? 12.128  11.509  38.060  1.00 114.83 ? 71  ASN M OD1 1 
ATOM   5155 N  ND2 . ASN M 1 75 ? 13.773  12.030  36.617  1.00 114.97 ? 71  ASN M ND2 1 
ATOM   5156 N  N   . GLY M 1 76 ? 9.357   10.418  37.681  1.00 116.60 ? 72  GLY M N   1 
ATOM   5157 C  CA  . GLY M 1 76 ? 8.044   11.025  37.733  1.00 119.76 ? 72  GLY M CA  1 
ATOM   5158 C  C   . GLY M 1 76 ? 6.883   10.057  37.812  1.00 120.93 ? 72  GLY M C   1 
ATOM   5159 O  O   . GLY M 1 76 ? 5.726   10.497  37.750  1.00 123.19 ? 72  GLY M O   1 
ATOM   5160 N  N   . ILE M 1 77 ? 7.148   8.756   37.936  1.00 120.67 ? 73  ILE M N   1 
ATOM   5161 C  CA  . ILE M 1 77 ? 6.081   7.777   38.099  1.00 117.72 ? 73  ILE M CA  1 
ATOM   5162 C  C   . ILE M 1 77 ? 5.419   7.976   39.455  1.00 122.80 ? 73  ILE M C   1 
ATOM   5163 O  O   . ILE M 1 77 ? 6.098   8.144   40.477  1.00 125.79 ? 73  ILE M O   1 
ATOM   5164 C  CB  . ILE M 1 77 ? 6.635   6.351   37.947  1.00 111.25 ? 73  ILE M CB  1 
ATOM   5165 C  CG1 . ILE M 1 77 ? 7.083   6.104   36.506  1.00 106.32 ? 73  ILE M CG1 1 
ATOM   5166 C  CG2 . ILE M 1 77 ? 5.604   5.318   38.365  1.00 111.26 ? 73  ILE M CG2 1 
ATOM   5167 C  CD1 . ILE M 1 77 ? 5.983   6.293   35.487  1.00 104.78 ? 73  ILE M CD1 1 
ATOM   5168 N  N   . LYS M 1 78 ? 4.087   7.970   39.471  1.00 126.24 ? 74  LYS M N   1 
ATOM   5169 C  CA  . LYS M 1 78 ? 3.323   8.192   40.696  1.00 129.05 ? 74  LYS M CA  1 
ATOM   5170 C  C   . LYS M 1 78 ? 2.955   6.841   41.300  1.00 129.87 ? 74  LYS M C   1 
ATOM   5171 O  O   . LYS M 1 78 ? 2.164   6.090   40.722  1.00 132.88 ? 74  LYS M O   1 
ATOM   5172 C  CB  . LYS M 1 78 ? 2.077   9.027   40.411  1.00 131.37 ? 74  LYS M CB  1 
ATOM   5173 C  CG  . LYS M 1 78 ? 2.358   10.295  39.620  1.00 132.69 ? 74  LYS M CG  1 
ATOM   5174 C  CD  . LYS M 1 78 ? 1.131   11.185  39.530  1.00 136.13 ? 74  LYS M CD  1 
ATOM   5175 C  CE  . LYS M 1 78 ? 1.423   12.408  38.673  1.00 137.44 ? 74  LYS M CE  1 
ATOM   5176 N  NZ  . LYS M 1 78 ? 0.332   13.417  38.717  1.00 139.75 ? 74  LYS M NZ  1 
ATOM   5177 N  N   . LEU M 1 79 ? 3.531   6.534   42.460  1.00 129.96 ? 75  LEU M N   1 
ATOM   5178 C  CA  . LEU M 1 79 ? 3.215   5.321   43.205  1.00 131.91 ? 75  LEU M CA  1 
ATOM   5179 C  C   . LEU M 1 79 ? 2.178   5.660   44.269  1.00 134.51 ? 75  LEU M C   1 
ATOM   5180 O  O   . LEU M 1 79 ? 2.417   6.525   45.121  1.00 136.38 ? 75  LEU M O   1 
ATOM   5181 C  CB  . LEU M 1 79 ? 4.469   4.722   43.841  1.00 130.89 ? 75  LEU M CB  1 
ATOM   5182 N  N   . TYR M 1 80 ? 1.036   4.977   44.216  1.00 134.08 ? 76  TYR M N   1 
ATOM   5183 C  CA  . TYR M 1 80 ? -0.108  5.270   45.079  1.00 133.28 ? 76  TYR M CA  1 
ATOM   5184 C  C   . TYR M 1 80 ? -0.517  6.738   44.975  1.00 131.78 ? 76  TYR M C   1 
ATOM   5185 O  O   . TYR M 1 80 ? -1.163  7.276   45.874  1.00 132.36 ? 76  TYR M O   1 
ATOM   5186 C  CB  . TYR M 1 80 ? 0.194   4.911   46.538  1.00 131.53 ? 76  TYR M CB  1 
ATOM   5187 C  CG  . TYR M 1 80 ? 0.364   3.431   46.798  1.00 131.25 ? 76  TYR M CG  1 
ATOM   5188 C  CD1 . TYR M 1 80 ? -0.730  2.570   46.783  1.00 131.14 ? 76  TYR M CD1 1 
ATOM   5189 C  CD2 . TYR M 1 80 ? 1.614   2.896   47.076  1.00 131.39 ? 76  TYR M CD2 1 
ATOM   5190 C  CE1 . TYR M 1 80 ? -0.579  1.215   47.029  1.00 132.12 ? 76  TYR M CE1 1 
ATOM   5191 C  CE2 . TYR M 1 80 ? 1.775   1.545   47.322  1.00 132.56 ? 76  TYR M CE2 1 
ATOM   5192 C  CZ  . TYR M 1 80 ? 0.677   0.709   47.299  1.00 132.32 ? 76  TYR M CZ  1 
ATOM   5193 O  OH  . TYR M 1 80 ? 0.839   -0.635  47.546  1.00 132.40 ? 76  TYR M OH  1 
ATOM   5194 N  N   . PRO M 1 83 ? 4.021   11.497  42.617  1.00 128.54 ? 79  PRO M N   1 
ATOM   5195 C  CA  . PRO M 1 83 ? 5.201   11.405  41.748  1.00 124.26 ? 79  PRO M CA  1 
ATOM   5196 C  C   . PRO M 1 83 ? 6.468   11.021  42.508  1.00 122.83 ? 79  PRO M C   1 
ATOM   5197 O  O   . PRO M 1 83 ? 6.630   11.389  43.669  1.00 124.70 ? 79  PRO M O   1 
ATOM   5198 C  CB  . PRO M 1 83 ? 5.319   12.819  41.171  1.00 125.01 ? 79  PRO M CB  1 
ATOM   5199 C  CG  . PRO M 1 83 ? 3.927   13.349  41.197  1.00 127.87 ? 79  PRO M CG  1 
ATOM   5200 C  CD  . PRO M 1 83 ? 3.286   12.761  42.424  1.00 130.34 ? 79  PRO M CD  1 
ATOM   5201 N  N   . ILE M 1 84 ? 7.351   10.277  41.850  1.00 121.39 ? 80  ILE M N   1 
ATOM   5202 C  CA  . ILE M 1 84 ? 8.636   9.876   42.410  1.00 123.86 ? 80  ILE M CA  1 
ATOM   5203 C  C   . ILE M 1 84 ? 9.734   10.607  41.653  1.00 124.58 ? 80  ILE M C   1 
ATOM   5204 O  O   . ILE M 1 84 ? 9.791   10.551  40.419  1.00 124.13 ? 80  ILE M O   1 
ATOM   5205 C  CB  . ILE M 1 84 ? 8.837   8.353   42.336  1.00 123.30 ? 80  ILE M CB  1 
ATOM   5206 N  N   . LYS M 1 85 ? 10.603  11.291  42.391  1.00 126.06 ? 81  LYS M N   1 
ATOM   5207 C  CA  . LYS M 1 85 ? 11.707  12.048  41.817  1.00 128.33 ? 81  LYS M CA  1 
ATOM   5208 C  C   . LYS M 1 85 ? 13.004  11.291  42.066  1.00 131.62 ? 81  LYS M C   1 
ATOM   5209 O  O   . LYS M 1 85 ? 13.394  11.082  43.220  1.00 135.29 ? 81  LYS M O   1 
ATOM   5210 C  CB  . LYS M 1 85 ? 11.777  13.453  42.415  1.00 128.81 ? 81  LYS M CB  1 
ATOM   5211 N  N   . ILE M 1 86 ? 13.667  10.888  40.986  1.00 130.34 ? 82  ILE M N   1 
ATOM   5212 C  CA  . ILE M 1 86 ? 14.909  10.127  41.056  1.00 128.89 ? 82  ILE M CA  1 
ATOM   5213 C  C   . ILE M 1 86 ? 16.068  11.058  40.736  1.00 128.16 ? 82  ILE M C   1 
ATOM   5214 O  O   . ILE M 1 86 ? 16.023  11.801  39.748  1.00 127.55 ? 82  ILE M O   1 
ATOM   5215 C  CB  . ILE M 1 86 ? 14.886  8.928   40.093  1.00 125.87 ? 82  ILE M CB  1 
ATOM   5216 N  N   . GLN M 1 87 ? 17.107  11.017  41.567  1.00 129.45 ? 83  GLN M N   1 
ATOM   5217 C  CA  . GLN M 1 87 ? 18.302  11.824  41.370  1.00 130.12 ? 83  GLN M CA  1 
ATOM   5218 C  C   . GLN M 1 87 ? 19.532  10.930  41.420  1.00 129.23 ? 83  GLN M C   1 
ATOM   5219 O  O   . GLN M 1 87 ? 19.604  10.004  42.233  1.00 130.15 ? 83  GLN M O   1 
ATOM   5220 C  CB  . GLN M 1 87 ? 18.411  12.929  42.425  1.00 132.68 ? 83  GLN M CB  1 
ATOM   5221 N  N   . PHE M 1 88 ? 20.497  11.216  40.549  1.00 126.92 ? 84  PHE M N   1 
ATOM   5222 C  CA  . PHE M 1 88 ? 21.694  10.393  40.434  1.00 126.18 ? 84  PHE M CA  1 
ATOM   5223 C  C   . PHE M 1 88 ? 22.653  10.661  41.586  1.00 129.81 ? 84  PHE M C   1 
ATOM   5224 O  O   . PHE M 1 88 ? 22.833  11.806  42.015  1.00 131.64 ? 84  PHE M O   1 
ATOM   5225 C  CB  . PHE M 1 88 ? 22.394  10.655  39.101  1.00 122.55 ? 84  PHE M CB  1 
ATOM   5226 N  N   . ARG M 1 89 ? 23.283  9.597   42.074  1.00 130.25 ? 85  ARG M N   1 
ATOM   5227 C  CA  . ARG M 1 89 ? 24.227  9.704   43.182  1.00 129.84 ? 85  ARG M CA  1 
ATOM   5228 C  C   . ARG M 1 89 ? 25.613  10.105  42.687  1.00 127.96 ? 85  ARG M C   1 
ATOM   5229 O  O   . ARG M 1 89 ? 26.552  10.228  43.474  1.00 129.78 ? 85  ARG M O   1 
ATOM   5230 C  CB  . ARG M 1 89 ? 24.303  8.382   43.951  1.00 130.43 ? 85  ARG M CB  1 
ATOM   5231 N  N   . PHE N 2 7  ? 13.074  -11.673 33.410  1.00 124.97 ? 286 PHE N N   1 
ATOM   5232 C  CA  . PHE N 2 7  ? 12.667  -10.362 32.914  1.00 123.85 ? 286 PHE N CA  1 
ATOM   5233 C  C   . PHE N 2 7  ? 11.510  -10.468 31.932  1.00 121.10 ? 286 PHE N C   1 
ATOM   5234 O  O   . PHE N 2 7  ? 11.667  -10.985 30.831  1.00 116.90 ? 286 PHE N O   1 
ATOM   5235 C  CB  . PHE N 2 7  ? 13.842  -9.647  32.245  1.00 124.63 ? 286 PHE N CB  1 
ATOM   5236 C  CG  . PHE N 2 7  ? 13.466  -8.345  31.612  1.00 125.18 ? 286 PHE N CG  1 
ATOM   5237 C  CD1 . PHE N 2 7  ? 13.006  -7.297  32.388  1.00 128.19 ? 286 PHE N CD1 1 
ATOM   5238 C  CD2 . PHE N 2 7  ? 13.567  -8.166  30.244  1.00 123.35 ? 286 PHE N CD2 1 
ATOM   5239 C  CE1 . PHE N 2 7  ? 12.651  -6.097  31.814  1.00 127.64 ? 286 PHE N CE1 1 
ATOM   5240 C  CE2 . PHE N 2 7  ? 13.222  -6.962  29.664  1.00 123.10 ? 286 PHE N CE2 1 
ATOM   5241 C  CZ  . PHE N 2 7  ? 12.759  -5.925  30.452  1.00 124.81 ? 286 PHE N CZ  1 
ATOM   5242 N  N   . LYS N 2 8  ? 10.344  -9.972  32.337  1.00 124.65 ? 287 LYS N N   1 
ATOM   5243 C  CA  . LYS N 2 8  ? 9.158   -9.960  31.483  1.00 126.37 ? 287 LYS N CA  1 
ATOM   5244 C  C   . LYS N 2 8  ? 8.661   -8.524  31.369  1.00 126.63 ? 287 LYS N C   1 
ATOM   5245 O  O   . LYS N 2 8  ? 8.048   -8.001  32.316  1.00 128.80 ? 287 LYS N O   1 
ATOM   5246 C  CB  . LYS N 2 8  ? 8.071   -10.877 32.033  1.00 128.29 ? 287 LYS N CB  1 
ATOM   5247 N  N   . PRO N 2 9  ? 8.921   -7.849  30.249  1.00 125.50 ? 288 PRO N N   1 
ATOM   5248 C  CA  . PRO N 2 9  ? 8.532   -6.438  30.137  1.00 126.35 ? 288 PRO N CA  1 
ATOM   5249 C  C   . PRO N 2 9  ? 7.017   -6.274  30.197  1.00 128.99 ? 288 PRO N C   1 
ATOM   5250 O  O   . PRO N 2 9  ? 6.265   -7.071  29.633  1.00 130.79 ? 288 PRO N O   1 
ATOM   5251 C  CB  . PRO N 2 9  ? 9.084   -6.022  28.767  1.00 123.45 ? 288 PRO N CB  1 
ATOM   5252 C  CG  . PRO N 2 9  ? 10.121  -7.016  28.436  1.00 122.76 ? 288 PRO N CG  1 
ATOM   5253 C  CD  . PRO N 2 9  ? 9.734   -8.300  29.107  1.00 123.49 ? 288 PRO N CD  1 
ATOM   5254 N  N   . GLY N 2 10 ? 6.576   -5.227  30.889  1.00 136.48 ? 289 GLY N N   1 
ATOM   5255 C  CA  . GLY N 2 10 ? 5.164   -4.946  31.031  1.00 138.62 ? 289 GLY N CA  1 
ATOM   5256 C  C   . GLY N 2 10 ? 4.385   -5.932  31.872  1.00 136.58 ? 289 GLY N C   1 
ATOM   5257 O  O   . GLY N 2 10 ? 3.162   -5.794  31.981  1.00 140.01 ? 289 GLY N O   1 
ATOM   5258 N  N   . VAL N 2 11 ? 5.044   -6.927  32.459  1.00 124.83 ? 290 VAL N N   1 
ATOM   5259 C  CA  . VAL N 2 11 ? 4.412   -7.829  33.411  1.00 126.07 ? 290 VAL N CA  1 
ATOM   5260 C  C   . VAL N 2 11 ? 4.681   -7.293  34.810  1.00 129.15 ? 290 VAL N C   1 
ATOM   5261 O  O   . VAL N 2 11 ? 5.829   -6.996  35.163  1.00 128.93 ? 290 VAL N O   1 
ATOM   5262 C  CB  . VAL N 2 11 ? 4.942   -9.265  33.255  1.00 123.17 ? 290 VAL N CB  1 
ATOM   5263 N  N   . ILE N 2 12 ? 3.622   -7.153  35.608  1.00 131.10 ? 291 ILE N N   1 
ATOM   5264 C  CA  . ILE N 2 12 ? 3.734   -6.569  36.936  1.00 137.02 ? 291 ILE N CA  1 
ATOM   5265 C  C   . ILE N 2 12 ? 2.977   -7.433  37.934  1.00 141.53 ? 291 ILE N C   1 
ATOM   5266 O  O   . ILE N 2 12 ? 2.052   -8.171  37.584  1.00 142.25 ? 291 ILE N O   1 
ATOM   5267 C  CB  . ILE N 2 12 ? 3.211   -5.117  36.981  1.00 137.72 ? 291 ILE N CB  1 
ATOM   5268 N  N   . SER N 2 13 ? 3.387   -7.326  39.195  1.00 144.20 ? 292 SER N N   1 
ATOM   5269 C  CA  . SER N 2 13 ? 2.693   -8.002  40.279  1.00 145.69 ? 292 SER N CA  1 
ATOM   5270 C  C   . SER N 2 13 ? 1.282   -7.441  40.433  1.00 146.21 ? 292 SER N C   1 
ATOM   5271 O  O   . SER N 2 13 ? 0.910   -6.429  39.830  1.00 145.63 ? 292 SER N O   1 
ATOM   5272 C  CB  . SER N 2 13 ? 3.467   -7.848  41.588  1.00 148.51 ? 292 SER N CB  1 
ATOM   5273 O  OG  . SER N 2 13 ? 3.567   -6.484  41.961  1.00 149.54 ? 292 SER N OG  1 
ATOM   5274 N  N   . GLU N 2 14 ? 0.484   -8.116  41.260  1.00 146.94 ? 293 GLU N N   1 
ATOM   5275 C  CA  . GLU N 2 14 ? -0.860  -7.621  41.530  1.00 146.23 ? 293 GLU N CA  1 
ATOM   5276 C  C   . GLU N 2 14 ? -0.828  -6.375  42.405  1.00 149.31 ? 293 GLU N C   1 
ATOM   5277 O  O   . GLU N 2 14 ? -1.684  -5.495  42.262  1.00 150.60 ? 293 GLU N O   1 
ATOM   5278 C  CB  . GLU N 2 14 ? -1.704  -8.715  42.186  1.00 147.97 ? 293 GLU N CB  1 
ATOM   5279 N  N   . GLU N 2 15 ? 0.149   -6.280  43.308  1.00 151.83 ? 294 GLU N N   1 
ATOM   5280 C  CA  . GLU N 2 15 ? 0.233   -5.118  44.184  1.00 158.38 ? 294 GLU N CA  1 
ATOM   5281 C  C   . GLU N 2 15 ? 0.633   -3.873  43.406  1.00 159.35 ? 294 GLU N C   1 
ATOM   5282 O  O   . GLU N 2 15 ? 0.014   -2.815  43.550  1.00 162.96 ? 294 GLU N O   1 
ATOM   5283 C  CB  . GLU N 2 15 ? 1.224   -5.385  45.316  1.00 160.95 ? 294 GLU N CB  1 
ATOM   5284 N  N   . LEU N 2 16 ? 1.663   -3.983  42.567  1.00 158.57 ? 295 LEU N N   1 
ATOM   5285 C  CA  . LEU N 2 16 ? 2.195   -2.804  41.892  1.00 158.19 ? 295 LEU N CA  1 
ATOM   5286 C  C   . LEU N 2 16 ? 1.282   -2.352  40.761  1.00 161.60 ? 295 LEU N C   1 
ATOM   5287 O  O   . LEU N 2 16 ? 1.011   -1.155  40.612  1.00 162.62 ? 295 LEU N O   1 
ATOM   5288 C  CB  . LEU N 2 16 ? 3.600   -3.092  41.368  1.00 151.59 ? 295 LEU N CB  1 
ATOM   5289 N  N   . GLN N 2 17 ? 0.784   -3.297  39.961  1.00 166.66 ? 296 GLN N N   1 
ATOM   5290 C  CA  . GLN N 2 17 ? -0.024  -2.934  38.800  1.00 171.02 ? 296 GLN N CA  1 
ATOM   5291 C  C   . GLN N 2 17 ? -1.343  -2.302  39.227  1.00 179.99 ? 296 GLN N C   1 
ATOM   5292 O  O   . GLN N 2 17 ? -1.740  -1.252  38.707  1.00 181.15 ? 296 GLN N O   1 
ATOM   5293 C  CB  . GLN N 2 17 ? -0.272  -4.165  37.926  1.00 167.21 ? 296 GLN N CB  1 
ATOM   5294 N  N   . ASP N 2 18 ? -2.037  -2.931  40.177  1.00 188.53 ? 297 ASP N N   1 
ATOM   5295 C  CA  . ASP N 2 18 ? -3.309  -2.388  40.640  1.00 197.42 ? 297 ASP N CA  1 
ATOM   5296 C  C   . ASP N 2 18 ? -3.120  -1.072  41.384  1.00 203.68 ? 297 ASP N C   1 
ATOM   5297 O  O   . ASP N 2 18 ? -4.004  -0.209  41.346  1.00 204.29 ? 297 ASP N O   1 
ATOM   5298 C  CB  . ASP N 2 18 ? -4.022  -3.406  41.531  1.00 203.72 ? 297 ASP N CB  1 
ATOM   5299 N  N   . ALA N 2 19 ? -1.979  -0.897  42.056  1.00 205.31 ? 298 ALA N N   1 
ATOM   5300 C  CA  . ALA N 2 19 ? -1.763  0.316   42.838  1.00 206.81 ? 298 ALA N CA  1 
ATOM   5301 C  C   . ALA N 2 19 ? -1.649  1.545   41.946  1.00 202.71 ? 298 ALA N C   1 
ATOM   5302 O  O   . ALA N 2 19 ? -2.131  2.624   42.305  1.00 207.17 ? 298 ALA N O   1 
ATOM   5303 C  CB  . ALA N 2 19 ? -0.512  0.176   43.703  1.00 208.99 ? 298 ALA N CB  1 
ATOM   5304 N  N   . LEU N 2 20 ? -1.011  1.405   40.782  1.00 184.41 ? 299 LEU N N   1 
ATOM   5305 C  CA  . LEU N 2 20 ? -0.806  2.556   39.910  1.00 171.48 ? 299 LEU N CA  1 
ATOM   5306 C  C   . LEU N 2 20 ? -2.097  3.030   39.256  1.00 159.75 ? 299 LEU N C   1 
ATOM   5307 O  O   . LEU N 2 20 ? -2.154  4.171   38.788  1.00 155.59 ? 299 LEU N O   1 
ATOM   5308 C  CB  . LEU N 2 20 ? 0.231   2.226   38.837  1.00 168.41 ? 299 LEU N CB  1 
ATOM   5309 N  N   . GLY N 2 21 ? -3.125  2.191   39.212  1.00 154.06 ? 300 GLY N N   1 
ATOM   5310 C  CA  . GLY N 2 21 ? -4.410  2.574   38.667  1.00 150.33 ? 300 GLY N CA  1 
ATOM   5311 C  C   . GLY N 2 21 ? -4.631  2.031   37.267  1.00 142.01 ? 300 GLY N C   1 
ATOM   5312 O  O   . GLY N 2 21 ? -3.730  1.500   36.612  1.00 140.78 ? 300 GLY N O   1 
ATOM   5313 N  N   . VAL N 2 22 ? -5.868  2.182   36.808  1.00 138.79 ? 301 VAL N N   1 
ATOM   5314 C  CA  . VAL N 2 22 ? -6.264  1.677   35.500  1.00 131.63 ? 301 VAL N CA  1 
ATOM   5315 C  C   . VAL N 2 22 ? -7.600  2.273   35.071  1.00 132.59 ? 301 VAL N C   1 
ATOM   5316 O  O   . VAL N 2 22 ? -7.678  3.445   34.704  1.00 133.20 ? 301 VAL N O   1 
ATOM   5317 C  CB  . VAL N 2 22 ? -6.335  0.144   35.503  1.00 127.73 ? 301 VAL N CB  1 
ATOM   5318 N  N   . ASP N 2 24 ? -9.338  -1.258  34.410  1.00 148.13 ? 303 ASP N N   1 
ATOM   5319 C  CA  . ASP N 2 24 ? -8.739  -1.260  33.078  1.00 144.54 ? 303 ASP N CA  1 
ATOM   5320 C  C   . ASP N 2 24 ? -7.349  -1.895  33.102  1.00 140.12 ? 303 ASP N C   1 
ATOM   5321 O  O   . ASP N 2 24 ? -6.394  -1.342  32.559  1.00 138.10 ? 303 ASP N O   1 
ATOM   5322 C  CB  . ASP N 2 24 ? -8.659  0.166   32.522  1.00 143.74 ? 303 ASP N CB  1 
ATOM   5323 N  N   . LYS N 2 25 ? -7.243  -3.062  33.740  1.00 137.78 ? 304 LYS N N   1 
ATOM   5324 C  CA  . LYS N 2 25 ? -5.956  -3.732  33.906  1.00 133.43 ? 304 LYS N CA  1 
ATOM   5325 C  C   . LYS N 2 25 ? -5.417  -4.336  32.615  1.00 129.10 ? 304 LYS N C   1 
ATOM   5326 O  O   . LYS N 2 25 ? -4.301  -4.872  32.630  1.00 121.59 ? 304 LYS N O   1 
ATOM   5327 C  CB  . LYS N 2 25 ? -6.066  -4.827  34.971  1.00 132.16 ? 304 LYS N CB  1 
ATOM   5328 N  N   . SER N 2 26 ? -6.165  -4.277  31.515  1.00 136.93 ? 305 SER N N   1 
ATOM   5329 C  CA  . SER N 2 26 ? -5.729  -4.875  30.259  1.00 139.26 ? 305 SER N CA  1 
ATOM   5330 C  C   . SER N 2 26 ? -4.742  -4.004  29.493  1.00 135.08 ? 305 SER N C   1 
ATOM   5331 O  O   . SER N 2 26 ? -4.236  -4.436  28.451  1.00 95.24  ? 305 SER N O   1 
ATOM   5332 C  CB  . SER N 2 26 ? -6.941  -5.178  29.376  1.00 99.71  ? 305 SER N CB  1 
ATOM   5333 N  N   . LEU N 2 27 ? -4.456  -2.797  29.978  1.00 124.44 ? 306 LEU N N   1 
ATOM   5334 C  CA  . LEU N 2 27 ? -3.514  -1.907  29.317  1.00 114.82 ? 306 LEU N CA  1 
ATOM   5335 C  C   . LEU N 2 27 ? -2.156  -2.002  29.995  1.00 111.76 ? 306 LEU N C   1 
ATOM   5336 O  O   . LEU N 2 27 ? -2.006  -1.506  31.122  1.00 116.54 ? 306 LEU N O   1 
ATOM   5337 C  CB  . LEU N 2 27 ? -4.022  -0.468  29.357  1.00 112.53 ? 306 LEU N CB  1 
ATOM   5338 C  CG  . LEU N 2 27 ? -5.252  -0.111  28.531  1.00 112.12 ? 306 LEU N CG  1 
ATOM   5339 C  CD1 . LEU N 2 27 ? -5.549  1.361   28.701  1.00 114.29 ? 306 LEU N CD1 1 
ATOM   5340 C  CD2 . LEU N 2 27 ? -5.012  -0.450  27.079  1.00 106.57 ? 306 LEU N CD2 1 
ATOM   5341 N  N   . PRO N 2 28 ? -1.146  -2.606  29.371  1.00 107.79 ? 307 PRO N N   1 
ATOM   5342 C  CA  . PRO N 2 28 ? 0.194   -2.647  29.981  1.00 107.94 ? 307 PRO N CA  1 
ATOM   5343 C  C   . PRO N 2 28 ? 0.839   -1.272  29.963  1.00 108.50 ? 307 PRO N C   1 
ATOM   5344 O  O   . PRO N 2 28 ? 0.840   -0.591  28.929  1.00 110.43 ? 307 PRO N O   1 
ATOM   5345 C  CB  . PRO N 2 28 ? 0.956   -3.640  29.090  1.00 104.01 ? 307 PRO N CB  1 
ATOM   5346 C  CG  . PRO N 2 28 ? 0.260   -3.574  27.772  1.00 101.87 ? 307 PRO N CG  1 
ATOM   5347 C  CD  . PRO N 2 28 ? -1.188  -3.283  28.063  1.00 105.63 ? 307 PRO N CD  1 
ATOM   5348 N  N   . PRO N 2 29 ? 1.406   -0.826  31.088  1.00 109.90 ? 308 PRO N N   1 
ATOM   5349 C  CA  . PRO N 2 29 ? 1.818   0.582   31.196  1.00 112.12 ? 308 PRO N CA  1 
ATOM   5350 C  C   . PRO N 2 29 ? 3.206   0.910   30.664  1.00 111.44 ? 308 PRO N C   1 
ATOM   5351 O  O   . PRO N 2 29 ? 3.399   1.964   30.051  1.00 113.61 ? 308 PRO N O   1 
ATOM   5352 C  CB  . PRO N 2 29 ? 1.742   0.838   32.705  1.00 114.38 ? 308 PRO N CB  1 
ATOM   5353 C  CG  . PRO N 2 29 ? 2.045   -0.488  33.315  1.00 112.40 ? 308 PRO N CG  1 
ATOM   5354 C  CD  . PRO N 2 29 ? 1.461   -1.522  32.385  1.00 110.17 ? 308 PRO N CD  1 
ATOM   5355 N  N   . PHE N 2 30 ? 4.184   0.034   30.892  1.00 109.79 ? 309 PHE N N   1 
ATOM   5356 C  CA  . PHE N 2 30 ? 5.580   0.396   30.674  1.00 107.31 ? 309 PHE N CA  1 
ATOM   5357 C  C   . PHE N 2 30 ? 6.087   0.126   29.266  1.00 102.11 ? 309 PHE N C   1 
ATOM   5358 O  O   . PHE N 2 30 ? 7.222   0.503   28.953  1.00 99.36  ? 309 PHE N O   1 
ATOM   5359 C  CB  . PHE N 2 30 ? 6.476   -0.348  31.666  1.00 107.31 ? 309 PHE N CB  1 
ATOM   5360 C  CG  . PHE N 2 30 ? 6.427   0.211   33.041  1.00 109.68 ? 309 PHE N CG  1 
ATOM   5361 C  CD1 . PHE N 2 30 ? 6.745   1.536   33.259  1.00 111.10 ? 309 PHE N CD1 1 
ATOM   5362 C  CD2 . PHE N 2 30 ? 6.054   -0.575  34.115  1.00 112.67 ? 309 PHE N CD2 1 
ATOM   5363 C  CE1 . PHE N 2 30 ? 6.697   2.071   34.524  1.00 117.24 ? 309 PHE N CE1 1 
ATOM   5364 C  CE2 . PHE N 2 30 ? 6.006   -0.048  35.387  1.00 117.18 ? 309 PHE N CE2 1 
ATOM   5365 C  CZ  . PHE N 2 30 ? 6.326   1.281   35.590  1.00 119.34 ? 309 PHE N CZ  1 
ATOM   5366 N  N   . ILE N 2 31 ? 5.289   -0.503  28.412  1.00 98.71  ? 310 ILE N N   1 
ATOM   5367 C  CA  . ILE N 2 31 ? 5.842   -1.082  27.194  1.00 96.10  ? 310 ILE N CA  1 
ATOM   5368 C  C   . ILE N 2 31 ? 6.015   -0.030  26.105  1.00 97.50  ? 310 ILE N C   1 
ATOM   5369 O  O   . ILE N 2 31 ? 6.993   -0.067  25.348  1.00 94.05  ? 310 ILE N O   1 
ATOM   5370 C  CB  . ILE N 2 31 ? 4.948   -2.246  26.729  1.00 97.26  ? 310 ILE N CB  1 
ATOM   5371 C  CG1 . ILE N 2 31 ? 5.106   -3.451  27.653  1.00 99.15  ? 310 ILE N CG1 1 
ATOM   5372 C  CG2 . ILE N 2 31 ? 5.332   -2.667  25.352  1.00 97.23  ? 310 ILE N CG2 1 
ATOM   5373 C  CD1 . ILE N 2 31 ? 6.523   -3.962  27.697  1.00 97.45  ? 310 ILE N CD1 1 
ATOM   5374 N  N   . TYR N 2 32 ? 5.096   0.938   26.032  1.00 101.15 ? 311 TYR N N   1 
ATOM   5375 C  CA  . TYR N 2 32 ? 5.226   2.034   25.075  1.00 101.89 ? 311 TYR N CA  1 
ATOM   5376 C  C   . TYR N 2 32 ? 6.569   2.748   25.184  1.00 103.47 ? 311 TYR N C   1 
ATOM   5377 O  O   . TYR N 2 32 ? 7.277   2.907   24.183  1.00 87.23  ? 311 TYR N O   1 
ATOM   5378 C  CB  . TYR N 2 32 ? 4.076   3.031   25.242  1.00 90.37  ? 311 TYR N CB  1 
ATOM   5379 C  CG  . TYR N 2 32 ? 4.044   4.011   24.101  1.00 90.66  ? 311 TYR N CG  1 
ATOM   5380 C  CD1 . TYR N 2 32 ? 3.465   3.671   22.890  1.00 89.70  ? 311 TYR N CD1 1 
ATOM   5381 C  CD2 . TYR N 2 32 ? 4.639   5.257   24.214  1.00 92.16  ? 311 TYR N CD2 1 
ATOM   5382 C  CE1 . TYR N 2 32 ? 3.459   4.556   21.826  1.00 99.55  ? 311 TYR N CE1 1 
ATOM   5383 C  CE2 . TYR N 2 32 ? 4.639   6.150   23.157  1.00 92.71  ? 311 TYR N CE2 1 
ATOM   5384 C  CZ  . TYR N 2 32 ? 4.046   5.796   21.965  1.00 99.04  ? 311 TYR N CZ  1 
ATOM   5385 O  OH  . TYR N 2 32 ? 4.044   6.684   20.908  1.00 98.87  ? 311 TYR N OH  1 
ATOM   5386 N  N   . ARG N 2 33 ? 6.934   3.204   26.383  1.00 107.48 ? 312 ARG N N   1 
ATOM   5387 C  CA  . ARG N 2 33 ? 8.201   3.918   26.513  1.00 90.42  ? 312 ARG N CA  1 
ATOM   5388 C  C   . ARG N 2 33 ? 9.386   2.979   26.347  1.00 90.08  ? 312 ARG N C   1 
ATOM   5389 O  O   . ARG N 2 33 ? 10.426  3.383   25.815  1.00 88.36  ? 312 ARG N O   1 
ATOM   5390 C  CB  . ARG N 2 33 ? 8.276   4.636   27.860  1.00 93.15  ? 312 ARG N CB  1 
ATOM   5391 N  N   . MET N 2 34 ? 9.238   1.725   26.777  1.00 91.22  ? 313 MET N N   1 
ATOM   5392 C  CA  . MET N 2 34 ? 10.331  0.763   26.705  1.00 91.16  ? 313 MET N CA  1 
ATOM   5393 C  C   . MET N 2 34 ? 10.641  0.368   25.266  1.00 90.75  ? 313 MET N C   1 
ATOM   5394 O  O   . MET N 2 34 ? 11.807  0.120   24.931  1.00 94.10  ? 313 MET N O   1 
ATOM   5395 C  CB  . MET N 2 34 ? 9.972   -0.466  27.541  1.00 93.97  ? 313 MET N CB  1 
ATOM   5396 C  CG  . MET N 2 34 ? 11.107  -1.421  27.834  1.00 95.42  ? 313 MET N CG  1 
ATOM   5397 S  SD  . MET N 2 34 ? 10.580  -2.678  29.023  1.00 97.53  ? 313 MET N SD  1 
ATOM   5398 C  CE  . MET N 2 34 ? 10.442  -1.698  30.505  1.00 98.38  ? 313 MET N CE  1 
ATOM   5399 N  N   . ARG N 2 35 ? 9.624   0.307   24.404  1.00 91.68  ? 314 ARG N N   1 
ATOM   5400 C  CA  . ARG N 2 35 ? 9.857   -0.093  23.021  1.00 82.62  ? 314 ARG N CA  1 
ATOM   5401 C  C   . ARG N 2 35 ? 10.571  0.994   22.236  1.00 103.52 ? 314 ARG N C   1 
ATOM   5402 O  O   . ARG N 2 35 ? 11.267  0.696   21.259  1.00 108.75 ? 314 ARG N O   1 
ATOM   5403 C  CB  . ARG N 2 35 ? 8.537   -0.406  22.327  1.00 82.39  ? 314 ARG N CB  1 
ATOM   5404 C  CG  . ARG N 2 35 ? 7.831   -1.631  22.814  1.00 98.15  ? 314 ARG N CG  1 
ATOM   5405 C  CD  . ARG N 2 35 ? 6.715   -1.970  21.868  1.00 98.72  ? 314 ARG N CD  1 
ATOM   5406 N  NE  . ARG N 2 35 ? 6.234   -3.328  22.061  1.00 98.20  ? 314 ARG N NE  1 
ATOM   5407 C  CZ  . ARG N 2 35 ? 4.960   -3.623  22.278  1.00 82.14  ? 314 ARG N CZ  1 
ATOM   5408 N  NH1 . ARG N 2 35 ? 4.065   -2.648  22.338  1.00 83.08  ? 314 ARG N NH1 1 
ATOM   5409 N  NH2 . ARG N 2 35 ? 4.588   -4.882  22.459  1.00 82.06  ? 314 ARG N NH2 1 
ATOM   5410 N  N   . GLN N 2 36 ? 10.397  2.255   22.626  1.00 97.27  ? 315 GLN N N   1 
ATOM   5411 C  CA  . GLN N 2 36 ? 11.069  3.336   21.920  1.00 98.67  ? 315 GLN N CA  1 
ATOM   5412 C  C   . GLN N 2 36 ? 12.434  3.639   22.520  1.00 101.26 ? 315 GLN N C   1 
ATOM   5413 O  O   . GLN N 2 36 ? 13.377  3.940   21.783  1.00 107.94 ? 315 GLN N O   1 
ATOM   5414 C  CB  . GLN N 2 36 ? 10.194  4.594   21.906  1.00 100.13 ? 315 GLN N CB  1 
ATOM   5415 C  CG  . GLN N 2 36 ? 9.922   5.196   23.266  1.00 100.88 ? 315 GLN N CG  1 
ATOM   5416 C  CD  . GLN N 2 36 ? 9.176   6.504   23.165  1.00 102.90 ? 315 GLN N CD  1 
ATOM   5417 O  OE1 . GLN N 2 36 ? 8.389   6.708   22.241  1.00 101.04 ? 315 GLN N OE1 1 
ATOM   5418 N  NE2 . GLN N 2 36 ? 9.427   7.407   24.110  1.00 107.78 ? 315 GLN N NE2 1 
ATOM   5419 N  N   . LEU N 2 37 ? 12.565  3.553   23.846  1.00 97.88  ? 316 LEU N N   1 
ATOM   5420 C  CA  . LEU N 2 37 ? 13.882  3.660   24.460  1.00 95.39  ? 316 LEU N CA  1 
ATOM   5421 C  C   . LEU N 2 37 ? 14.786  2.508   24.046  1.00 97.12  ? 316 LEU N C   1 
ATOM   5422 O  O   . LEU N 2 37 ? 16.004  2.689   23.947  1.00 102.46 ? 316 LEU N O   1 
ATOM   5423 C  CB  . LEU N 2 37 ? 13.758  3.706   25.981  1.00 93.92  ? 316 LEU N CB  1 
ATOM   5424 C  CG  . LEU N 2 37 ? 13.071  4.935   26.581  1.00 93.45  ? 316 LEU N CG  1 
ATOM   5425 C  CD1 . LEU N 2 37 ? 12.972  4.816   28.096  1.00 94.62  ? 316 LEU N CD1 1 
ATOM   5426 C  CD2 . LEU N 2 37 ? 13.789  6.217   26.185  1.00 92.87  ? 316 LEU N CD2 1 
ATOM   5427 N  N   . GLY N 2 38 ? 14.219  1.332   23.787  1.00 94.30  ? 317 GLY N N   1 
ATOM   5428 C  CA  . GLY N 2 38 ? 15.019  0.178   23.440  1.00 96.62  ? 317 GLY N CA  1 
ATOM   5429 C  C   . GLY N 2 38 ? 15.165  -0.784  24.605  1.00 96.95  ? 317 GLY N C   1 
ATOM   5430 O  O   . GLY N 2 38 ? 14.751  -0.520  25.737  1.00 99.98  ? 317 GLY N O   1 
ATOM   5431 N  N   . TYR N 2 39 ? 15.784  -1.917  24.310  1.00 96.37  ? 318 TYR N N   1 
ATOM   5432 C  CA  . TYR N 2 39 ? 15.929  -2.961  25.310  1.00 98.12  ? 318 TYR N CA  1 
ATOM   5433 C  C   . TYR N 2 39 ? 16.887  -2.475  26.390  1.00 99.58  ? 318 TYR N C   1 
ATOM   5434 O  O   . TYR N 2 39 ? 17.931  -1.896  26.069  1.00 101.75 ? 318 TYR N O   1 
ATOM   5435 C  CB  . TYR N 2 39 ? 16.466  -4.227  24.645  1.00 100.05 ? 318 TYR N CB  1 
ATOM   5436 C  CG  . TYR N 2 39 ? 16.337  -5.504  25.441  1.00 105.72 ? 318 TYR N CG  1 
ATOM   5437 C  CD1 . TYR N 2 39 ? 15.232  -6.335  25.301  1.00 107.40 ? 318 TYR N CD1 1 
ATOM   5438 C  CD2 . TYR N 2 39 ? 17.348  -5.902  26.303  1.00 109.97 ? 318 TYR N CD2 1 
ATOM   5439 C  CE1 . TYR N 2 39 ? 15.129  -7.516  26.020  1.00 110.10 ? 318 TYR N CE1 1 
ATOM   5440 C  CE2 . TYR N 2 39 ? 17.254  -7.076  27.015  1.00 112.89 ? 318 TYR N CE2 1 
ATOM   5441 C  CZ  . TYR N 2 39 ? 16.145  -7.880  26.876  1.00 112.55 ? 318 TYR N CZ  1 
ATOM   5442 O  OH  . TYR N 2 39 ? 16.062  -9.050  27.596  1.00 113.75 ? 318 TYR N OH  1 
ATOM   5443 N  N   . PRO N 2 40 ? 16.562  -2.664  27.666  1.00 100.80 ? 319 PRO N N   1 
ATOM   5444 C  CA  . PRO N 2 40 ? 17.447  -2.200  28.737  1.00 102.41 ? 319 PRO N CA  1 
ATOM   5445 C  C   . PRO N 2 40 ? 18.833  -2.794  28.582  1.00 102.39 ? 319 PRO N C   1 
ATOM   5446 O  O   . PRO N 2 40 ? 18.986  -4.022  28.509  1.00 101.23 ? 319 PRO N O   1 
ATOM   5447 C  CB  . PRO N 2 40 ? 16.758  -2.709  30.014  1.00 105.46 ? 319 PRO N CB  1 
ATOM   5448 C  CG  . PRO N 2 40 ? 15.349  -2.981  29.617  1.00 104.62 ? 319 PRO N CG  1 
ATOM   5449 C  CD  . PRO N 2 40 ? 15.425  -3.437  28.189  1.00 102.64 ? 319 PRO N CD  1 
ATOM   5450 N  N   . PRO N 2 41 ? 19.867  -1.954  28.525  1.00 104.69 ? 320 PRO N N   1 
ATOM   5451 C  CA  . PRO N 2 41 ? 21.208  -2.468  28.209  1.00 107.72 ? 320 PRO N CA  1 
ATOM   5452 C  C   . PRO N 2 41 ? 21.731  -3.453  29.234  1.00 113.05 ? 320 PRO N C   1 
ATOM   5453 O  O   . PRO N 2 41 ? 22.474  -4.373  28.873  1.00 115.45 ? 320 PRO N O   1 
ATOM   5454 C  CB  . PRO N 2 41 ? 22.070  -1.198  28.161  1.00 108.66 ? 320 PRO N CB  1 
ATOM   5455 C  CG  . PRO N 2 41 ? 21.103  -0.057  28.106  1.00 106.66 ? 320 PRO N CG  1 
ATOM   5456 C  CD  . PRO N 2 41 ? 19.890  -0.519  28.837  1.00 105.91 ? 320 PRO N CD  1 
ATOM   5457 N  N   . GLY N 2 42 ? 21.366  -3.292  30.505  1.00 115.73 ? 321 GLY N N   1 
ATOM   5458 C  CA  . GLY N 2 42 ? 21.861  -4.193  31.527  1.00 121.74 ? 321 GLY N CA  1 
ATOM   5459 C  C   . GLY N 2 42 ? 21.330  -5.610  31.436  1.00 124.93 ? 321 GLY N C   1 
ATOM   5460 O  O   . GLY N 2 42 ? 21.869  -6.493  32.111  1.00 128.00 ? 321 GLY N O   1 
ATOM   5461 N  N   . TRP N 2 43 ? 20.307  -5.852  30.614  1.00 123.91 ? 322 TRP N N   1 
ATOM   5462 C  CA  . TRP N 2 43 ? 19.800  -7.201  30.396  1.00 127.50 ? 322 TRP N CA  1 
ATOM   5463 C  C   . TRP N 2 43 ? 20.480  -7.931  29.244  1.00 129.86 ? 322 TRP N C   1 
ATOM   5464 O  O   . TRP N 2 43 ? 20.229  -9.127  29.059  1.00 131.18 ? 322 TRP N O   1 
ATOM   5465 C  CB  . TRP N 2 43 ? 18.289  -7.173  30.127  1.00 127.63 ? 322 TRP N CB  1 
ATOM   5466 C  CG  . TRP N 2 43 ? 17.424  -6.874  31.313  1.00 130.18 ? 322 TRP N CG  1 
ATOM   5467 C  CD1 . TRP N 2 43 ? 16.719  -5.728  31.545  1.00 129.72 ? 322 TRP N CD1 1 
ATOM   5468 C  CD2 . TRP N 2 43 ? 17.155  -7.740  32.423  1.00 134.65 ? 322 TRP N CD2 1 
ATOM   5469 N  NE1 . TRP N 2 43 ? 16.034  -5.824  32.731  1.00 132.07 ? 322 TRP N NE1 1 
ATOM   5470 C  CE2 . TRP N 2 43 ? 16.286  -7.050  33.290  1.00 135.83 ? 322 TRP N CE2 1 
ATOM   5471 C  CE3 . TRP N 2 43 ? 17.568  -9.031  32.770  1.00 137.92 ? 322 TRP N CE3 1 
ATOM   5472 C  CZ2 . TRP N 2 43 ? 15.823  -7.606  34.480  1.00 140.90 ? 322 TRP N CZ2 1 
ATOM   5473 C  CZ3 . TRP N 2 43 ? 17.106  -9.581  33.954  1.00 141.88 ? 322 TRP N CZ3 1 
ATOM   5474 C  CH2 . TRP N 2 43 ? 16.244  -8.868  34.795  1.00 143.64 ? 322 TRP N CH2 1 
ATOM   5475 N  N   . LEU N 2 44 ? 21.318  -7.254  28.466  1.00 131.03 ? 323 LEU N N   1 
ATOM   5476 C  CA  . LEU N 2 44 ? 21.914  -7.867  27.281  1.00 130.47 ? 323 LEU N CA  1 
ATOM   5477 C  C   . LEU N 2 44 ? 22.891  -8.979  27.651  1.00 132.36 ? 323 LEU N C   1 
ATOM   5478 O  O   . LEU N 2 44 ? 24.107  -8.805  27.554  1.00 133.06 ? 323 LEU N O   1 
ATOM   5479 C  CB  . LEU N 2 44 ? 22.624  -6.811  26.433  1.00 130.14 ? 323 LEU N CB  1 
HETATM 5480 BR BR  . BR  O 3 .  ? -17.569 -13.873 16.527  1.00 106.49 ? 401 BR  D BR  1 
HETATM 5481 BR BR  . BR  P 3 .  ? -32.495 -15.319 29.371  1.00 86.28  ? 401 BR  C BR  1 
HETATM 5482 BR BR  . BR  Q 3 .  ? -39.092 -23.619 23.197  1.00 230.27 ? 402 BR  C BR  1 
HETATM 5483 BR BR  . BR  R 3 .  ? -50.085 -8.350  22.328  1.00 157.18 ? 401 BR  F BR  1 
HETATM 5484 BR BR  . BR  S 3 .  ? -37.860 5.855   -8.638  1.00 232.84 ? 101 BR  G BR  1 
HETATM 5485 BR BR  . BR  T 3 .  ? -23.083 -2.978  -24.772 1.00 160.83 ? 401 BR  H BR  1 
HETATM 5486 BR BR  . BR  U 3 .  ? -8.380  3.534   17.479  1.00 130.13 ? 401 BR  J BR  1 
HETATM 5487 BR BR  . BR  V 3 .  ? -31.219 10.533  -11.893 1.00 128.16 ? 401 BR  L BR  1 
HETATM 5488 BR BR  . BR  W 3 .  ? 5.496   4.995   31.108  1.00 165.45 ? 401 BR  N BR  1 
HETATM 5489 O  O   . HOH X 4 .  ? -14.215 -30.071 32.281  1.00 72.64  ? 101 HOH B O   1 
HETATM 5490 O  O   . HOH X 4 .  ? -21.852 -23.614 45.322  1.00 45.10  ? 102 HOH B O   1 
HETATM 5491 O  O   . HOH X 4 .  ? -33.342 -17.368 44.933  0.50 41.91  ? 103 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  GLY 1  -3  ?   ?   ?   A . n 
A 1 2  PRO 2  -2  ?   ?   ?   A . n 
A 1 3  ASP 3  -1  ?   ?   ?   A . n 
A 1 4  SER 4  0   ?   ?   ?   A . n 
A 1 5  MET 5  1   ?   ?   ?   A . n 
A 1 6  GLY 6  2   ?   ?   ?   A . n 
A 1 7  ALA 7  3   ?   ?   ?   A . n 
A 1 8  ALA 8  4   ?   ?   ?   A . n 
A 1 9  ALA 9  5   ?   ?   ?   A . n 
A 1 10 ALA 10 6   ?   ?   ?   A . n 
A 1 11 GLU 11 7   7   GLU GLU A . n 
A 1 12 ALA 12 8   8   ALA ALA A . n 
A 1 13 ASP 13 9   9   ASP ASP A . n 
A 1 14 ARG 14 10  10  ARG ARG A . n 
A 1 15 THR 15 11  11  THR THR A . n 
A 1 16 LEU 16 12  12  LEU LEU A . n 
A 1 17 PHE 17 13  13  PHE PHE A . n 
A 1 18 VAL 18 14  14  VAL VAL A . n 
A 1 19 GLY 19 15  15  GLY GLY A . n 
A 1 20 ASN 20 16  16  ASN ASN A . n 
A 1 21 LEU 21 17  17  LEU LEU A . n 
A 1 22 GLU 22 18  18  GLU GLU A . n 
A 1 23 THR 23 19  19  THR THR A . n 
A 1 24 LYS 24 20  20  LYS LYS A . n 
A 1 25 VAL 25 21  21  VAL VAL A . n 
A 1 26 THR 26 22  22  THR THR A . n 
A 1 27 GLU 27 23  23  GLU GLU A . n 
A 1 28 GLU 28 24  24  GLU GLU A . n 
A 1 29 LEU 29 25  25  LEU LEU A . n 
A 1 30 LEU 30 26  26  LEU LEU A . n 
A 1 31 PHE 31 27  27  PHE PHE A . n 
A 1 32 GLU 32 28  28  GLU GLU A . n 
A 1 33 LEU 33 29  29  LEU LEU A . n 
A 1 34 PHE 34 30  30  PHE PHE A . n 
A 1 35 HIS 35 31  31  HIS HIS A . n 
A 1 36 GLN 36 32  32  GLN GLN A . n 
A 1 37 ALA 37 33  33  ALA ALA A . n 
A 1 38 GLY 38 34  34  GLY GLY A . n 
A 1 39 PRO 39 35  35  PRO PRO A . n 
A 1 40 VAL 40 36  36  VAL VAL A . n 
A 1 41 ILE 41 37  37  ILE ILE A . n 
A 1 42 LYS 42 38  38  LYS LYS A . n 
A 1 43 VAL 43 39  39  VAL VAL A . n 
A 1 44 LYS 44 40  40  LYS LYS A . n 
A 1 45 ILE 45 41  41  ILE ILE A . n 
A 1 46 PRO 46 42  42  PRO PRO A . n 
A 1 47 LYS 47 43  43  LYS LYS A . n 
A 1 48 ASP 48 44  44  ASP ASP A . n 
A 1 49 LYS 49 45  45  LYS LYS A . n 
A 1 50 ASP 50 46  46  ASP ASP A . n 
A 1 51 GLY 51 47  47  GLY GLY A . n 
A 1 52 LYS 52 48  48  LYS LYS A . n 
A 1 53 PRO 53 49  49  PRO PRO A . n 
A 1 54 LYS 54 50  50  LYS LYS A . n 
A 1 55 GLN 55 51  51  GLN GLN A . n 
A 1 56 PHE 56 52  52  PHE PHE A . n 
A 1 57 ALA 57 53  53  ALA ALA A . n 
A 1 58 PHE 58 54  54  PHE PHE A . n 
A 1 59 VAL 59 55  55  VAL VAL A . n 
A 1 60 ASN 60 56  56  ASN ASN A . n 
A 1 61 PHE 61 57  57  PHE PHE A . n 
A 1 62 LYS 62 58  58  LYS LYS A . n 
A 1 63 HIS 63 59  59  HIS HIS A . n 
A 1 64 GLU 64 60  60  GLU GLU A . n 
A 1 65 VAL 65 61  61  VAL VAL A . n 
A 1 66 SER 66 62  62  SER SER A . n 
A 1 67 VAL 67 63  63  VAL VAL A . n 
A 1 68 PRO 68 64  64  PRO PRO A . n 
A 1 69 TYR 69 65  65  TYR TYR A . n 
A 1 70 ALA 70 66  66  ALA ALA A . n 
A 1 71 MET 71 67  67  MET MET A . n 
A 1 72 ASN 72 68  68  ASN ASN A . n 
A 1 73 LEU 73 69  69  LEU LEU A . n 
A 1 74 LEU 74 70  70  LEU LEU A . n 
A 1 75 ASN 75 71  71  ASN ASN A . n 
A 1 76 GLY 76 72  72  GLY GLY A . n 
A 1 77 ILE 77 73  73  ILE ILE A . n 
A 1 78 LYS 78 74  74  LYS LYS A . n 
A 1 79 LEU 79 75  75  LEU LEU A . n 
A 1 80 TYR 80 76  76  TYR TYR A . n 
A 1 81 GLY 81 77  77  GLY GLY A . n 
A 1 82 ARG 82 78  78  ARG ARG A . n 
A 1 83 PRO 83 79  79  PRO PRO A . n 
A 1 84 ILE 84 80  80  ILE ILE A . n 
A 1 85 LYS 85 81  81  LYS LYS A . n 
A 1 86 ILE 86 82  82  ILE ILE A . n 
A 1 87 GLN 87 83  83  GLN GLN A . n 
A 1 88 PHE 88 84  84  PHE PHE A . n 
A 1 89 ARG 89 85  ?   ?   ?   A . n 
A 1 90 SER 90 86  ?   ?   ?   A . n 
B 2 1  GLY 1  280 ?   ?   ?   D . n 
B 2 2  PRO 2  281 ?   ?   ?   D . n 
B 2 3  ASP 3  282 ?   ?   ?   D . n 
B 2 4  SER 4  283 ?   ?   ?   D . n 
B 2 5  MET 5  284 ?   ?   ?   D . n 
B 2 6  ARG 6  285 ?   ?   ?   D . n 
B 2 7  PHE 7  286 286 PHE PHE D . n 
B 2 8  LYS 8  287 287 LYS LYS D . n 
B 2 9  PRO 9  288 288 PRO PRO D . n 
B 2 10 GLY 10 289 289 GLY GLY D . n 
B 2 11 VAL 11 290 290 VAL VAL D . n 
B 2 12 ILE 12 291 291 ILE ILE D . n 
B 2 13 SER 13 292 292 SER SER D . n 
B 2 14 GLU 14 293 293 GLU GLU D . n 
B 2 15 GLU 15 294 294 GLU GLU D . n 
B 2 16 LEU 16 295 295 LEU LEU D . n 
B 2 17 GLN 17 296 296 GLN GLN D . n 
B 2 18 ASP 18 297 297 ASP ASP D . n 
B 2 19 ALA 19 298 298 ALA ALA D . n 
B 2 20 LEU 20 299 299 LEU LEU D . n 
B 2 21 GLY 21 300 300 GLY GLY D . n 
B 2 22 VAL 22 301 301 VAL VAL D . n 
B 2 23 THR 23 302 302 THR THR D . n 
B 2 24 ASP 24 303 303 ASP ASP D . n 
B 2 25 LYS 25 304 304 LYS LYS D . n 
B 2 26 SER 26 305 305 SER SER D . n 
B 2 27 LEU 27 306 306 LEU LEU D . n 
B 2 28 PRO 28 307 307 PRO PRO D . n 
B 2 29 PRO 29 308 308 PRO PRO D . n 
B 2 30 PHE 30 309 309 PHE PHE D . n 
B 2 31 ILE 31 310 310 ILE ILE D . n 
B 2 32 TYR 32 311 311 TYR TYR D . n 
B 2 33 ARG 33 312 312 ARG ARG D . n 
B 2 34 MET 34 313 313 MET MET D . n 
B 2 35 ARG 35 314 314 ARG ARG D . n 
B 2 36 GLN 36 315 315 GLN GLN D . n 
B 2 37 LEU 37 316 316 LEU LEU D . n 
B 2 38 GLY 38 317 317 GLY GLY D . n 
B 2 39 TYR 39 318 318 TYR TYR D . n 
B 2 40 PRO 40 319 319 PRO PRO D . n 
B 2 41 PRO 41 320 320 PRO PRO D . n 
B 2 42 GLY 42 321 321 GLY GLY D . n 
B 2 43 TRP 43 322 322 TRP TRP D . n 
B 2 44 LEU 44 323 323 LEU LEU D . n 
B 2 45 LYS 45 324 324 LYS LYS D . n 
C 1 1  GLY 1  -3  ?   ?   ?   B . n 
C 1 2  PRO 2  -2  ?   ?   ?   B . n 
C 1 3  ASP 3  -1  ?   ?   ?   B . n 
C 1 4  SER 4  0   ?   ?   ?   B . n 
C 1 5  MET 5  1   ?   ?   ?   B . n 
C 1 6  GLY 6  2   ?   ?   ?   B . n 
C 1 7  ALA 7  3   ?   ?   ?   B . n 
C 1 8  ALA 8  4   ?   ?   ?   B . n 
C 1 9  ALA 9  5   ?   ?   ?   B . n 
C 1 10 ALA 10 6   6   ALA ALA B . n 
C 1 11 GLU 11 7   7   GLU GLU B . n 
C 1 12 ALA 12 8   8   ALA ALA B . n 
C 1 13 ASP 13 9   9   ASP ASP B . n 
C 1 14 ARG 14 10  10  ARG ARG B . n 
C 1 15 THR 15 11  11  THR THR B . n 
C 1 16 LEU 16 12  12  LEU LEU B . n 
C 1 17 PHE 17 13  13  PHE PHE B . n 
C 1 18 VAL 18 14  14  VAL VAL B . n 
C 1 19 GLY 19 15  15  GLY GLY B . n 
C 1 20 ASN 20 16  16  ASN ASN B . n 
C 1 21 LEU 21 17  17  LEU LEU B . n 
C 1 22 GLU 22 18  18  GLU GLU B . n 
C 1 23 THR 23 19  19  THR THR B . n 
C 1 24 LYS 24 20  20  LYS LYS B . n 
C 1 25 VAL 25 21  21  VAL VAL B . n 
C 1 26 THR 26 22  22  THR THR B . n 
C 1 27 GLU 27 23  23  GLU GLU B . n 
C 1 28 GLU 28 24  24  GLU GLU B . n 
C 1 29 LEU 29 25  25  LEU LEU B . n 
C 1 30 LEU 30 26  26  LEU LEU B . n 
C 1 31 PHE 31 27  27  PHE PHE B . n 
C 1 32 GLU 32 28  28  GLU GLU B . n 
C 1 33 LEU 33 29  29  LEU LEU B . n 
C 1 34 PHE 34 30  30  PHE PHE B . n 
C 1 35 HIS 35 31  31  HIS HIS B . n 
C 1 36 GLN 36 32  32  GLN GLN B . n 
C 1 37 ALA 37 33  33  ALA ALA B . n 
C 1 38 GLY 38 34  34  GLY GLY B . n 
C 1 39 PRO 39 35  35  PRO PRO B . n 
C 1 40 VAL 40 36  36  VAL VAL B . n 
C 1 41 ILE 41 37  37  ILE ILE B . n 
C 1 42 LYS 42 38  38  LYS LYS B . n 
C 1 43 VAL 43 39  39  VAL VAL B . n 
C 1 44 LYS 44 40  40  LYS LYS B . n 
C 1 45 ILE 45 41  41  ILE ILE B . n 
C 1 46 PRO 46 42  42  PRO PRO B . n 
C 1 47 LYS 47 43  ?   ?   ?   B . n 
C 1 48 ASP 48 44  ?   ?   ?   B . n 
C 1 49 LYS 49 45  ?   ?   ?   B . n 
C 1 50 ASP 50 46  ?   ?   ?   B . n 
C 1 51 GLY 51 47  ?   ?   ?   B . n 
C 1 52 LYS 52 48  48  LYS LYS B . n 
C 1 53 PRO 53 49  49  PRO PRO B . n 
C 1 54 LYS 54 50  50  LYS LYS B . n 
C 1 55 GLN 55 51  51  GLN GLN B . n 
C 1 56 PHE 56 52  52  PHE PHE B . n 
C 1 57 ALA 57 53  53  ALA ALA B . n 
C 1 58 PHE 58 54  54  PHE PHE B . n 
C 1 59 VAL 59 55  55  VAL VAL B . n 
C 1 60 ASN 60 56  56  ASN ASN B . n 
C 1 61 PHE 61 57  57  PHE PHE B . n 
C 1 62 LYS 62 58  58  LYS LYS B . n 
C 1 63 HIS 63 59  59  HIS HIS B . n 
C 1 64 GLU 64 60  60  GLU GLU B . n 
C 1 65 VAL 65 61  61  VAL VAL B . n 
C 1 66 SER 66 62  62  SER SER B . n 
C 1 67 VAL 67 63  63  VAL VAL B . n 
C 1 68 PRO 68 64  64  PRO PRO B . n 
C 1 69 TYR 69 65  65  TYR TYR B . n 
C 1 70 ALA 70 66  66  ALA ALA B . n 
C 1 71 MET 71 67  67  MET MET B . n 
C 1 72 ASN 72 68  68  ASN ASN B . n 
C 1 73 LEU 73 69  69  LEU LEU B . n 
C 1 74 LEU 74 70  70  LEU LEU B . n 
C 1 75 ASN 75 71  71  ASN ASN B . n 
C 1 76 GLY 76 72  72  GLY GLY B . n 
C 1 77 ILE 77 73  73  ILE ILE B . n 
C 1 78 LYS 78 74  74  LYS LYS B . n 
C 1 79 LEU 79 75  75  LEU LEU B . n 
C 1 80 TYR 80 76  76  TYR TYR B . n 
C 1 81 GLY 81 77  77  GLY GLY B . n 
C 1 82 ARG 82 78  78  ARG ARG B . n 
C 1 83 PRO 83 79  79  PRO PRO B . n 
C 1 84 ILE 84 80  80  ILE ILE B . n 
C 1 85 LYS 85 81  81  LYS LYS B . n 
C 1 86 ILE 86 82  82  ILE ILE B . n 
C 1 87 GLN 87 83  83  GLN GLN B . n 
C 1 88 PHE 88 84  84  PHE PHE B . n 
C 1 89 ARG 89 85  85  ARG ARG B . n 
C 1 90 SER 90 86  86  SER SER B . n 
D 2 1  GLY 1  280 ?   ?   ?   C . n 
D 2 2  PRO 2  281 ?   ?   ?   C . n 
D 2 3  ASP 3  282 ?   ?   ?   C . n 
D 2 4  SER 4  283 ?   ?   ?   C . n 
D 2 5  MET 5  284 ?   ?   ?   C . n 
D 2 6  ARG 6  285 ?   ?   ?   C . n 
D 2 7  PHE 7  286 286 PHE PHE C . n 
D 2 8  LYS 8  287 287 LYS LYS C . n 
D 2 9  PRO 9  288 288 PRO PRO C . n 
D 2 10 GLY 10 289 289 GLY GLY C . n 
D 2 11 VAL 11 290 290 VAL VAL C . n 
D 2 12 ILE 12 291 291 ILE ILE C . n 
D 2 13 SER 13 292 292 SER SER C . n 
D 2 14 GLU 14 293 293 GLU GLU C . n 
D 2 15 GLU 15 294 294 GLU GLU C . n 
D 2 16 LEU 16 295 295 LEU LEU C . n 
D 2 17 GLN 17 296 296 GLN GLN C . n 
D 2 18 ASP 18 297 297 ASP ASP C . n 
D 2 19 ALA 19 298 298 ALA ALA C . n 
D 2 20 LEU 20 299 299 LEU LEU C . n 
D 2 21 GLY 21 300 300 GLY GLY C . n 
D 2 22 VAL 22 301 301 VAL VAL C . n 
D 2 23 THR 23 302 302 THR THR C . n 
D 2 24 ASP 24 303 303 ASP ASP C . n 
D 2 25 LYS 25 304 304 LYS LYS C . n 
D 2 26 SER 26 305 305 SER SER C . n 
D 2 27 LEU 27 306 306 LEU LEU C . n 
D 2 28 PRO 28 307 307 PRO PRO C . n 
D 2 29 PRO 29 308 308 PRO PRO C . n 
D 2 30 PHE 30 309 309 PHE PHE C . n 
D 2 31 ILE 31 310 310 ILE ILE C . n 
D 2 32 TYR 32 311 311 TYR TYR C . n 
D 2 33 ARG 33 312 312 ARG ARG C . n 
D 2 34 MET 34 313 313 MET MET C . n 
D 2 35 ARG 35 314 314 ARG ARG C . n 
D 2 36 GLN 36 315 315 GLN GLN C . n 
D 2 37 LEU 37 316 316 LEU LEU C . n 
D 2 38 GLY 38 317 317 GLY GLY C . n 
D 2 39 TYR 39 318 318 TYR TYR C . n 
D 2 40 PRO 40 319 319 PRO PRO C . n 
D 2 41 PRO 41 320 320 PRO PRO C . n 
D 2 42 GLY 42 321 321 GLY GLY C . n 
D 2 43 TRP 43 322 322 TRP TRP C . n 
D 2 44 LEU 44 323 323 LEU LEU C . n 
D 2 45 LYS 45 324 324 LYS LYS C . n 
E 1 1  GLY 1  -3  ?   ?   ?   E . n 
E 1 2  PRO 2  -2  ?   ?   ?   E . n 
E 1 3  ASP 3  -1  ?   ?   ?   E . n 
E 1 4  SER 4  0   ?   ?   ?   E . n 
E 1 5  MET 5  1   ?   ?   ?   E . n 
E 1 6  GLY 6  2   ?   ?   ?   E . n 
E 1 7  ALA 7  3   ?   ?   ?   E . n 
E 1 8  ALA 8  4   ?   ?   ?   E . n 
E 1 9  ALA 9  5   ?   ?   ?   E . n 
E 1 10 ALA 10 6   6   ALA ALA E . n 
E 1 11 GLU 11 7   7   GLU GLU E . n 
E 1 12 ALA 12 8   8   ALA ALA E . n 
E 1 13 ASP 13 9   9   ASP ASP E . n 
E 1 14 ARG 14 10  10  ARG ARG E . n 
E 1 15 THR 15 11  11  THR THR E . n 
E 1 16 LEU 16 12  12  LEU LEU E . n 
E 1 17 PHE 17 13  13  PHE PHE E . n 
E 1 18 VAL 18 14  14  VAL VAL E . n 
E 1 19 GLY 19 15  15  GLY GLY E . n 
E 1 20 ASN 20 16  16  ASN ASN E . n 
E 1 21 LEU 21 17  17  LEU LEU E . n 
E 1 22 GLU 22 18  18  GLU GLU E . n 
E 1 23 THR 23 19  19  THR THR E . n 
E 1 24 LYS 24 20  20  LYS LYS E . n 
E 1 25 VAL 25 21  21  VAL VAL E . n 
E 1 26 THR 26 22  22  THR THR E . n 
E 1 27 GLU 27 23  23  GLU GLU E . n 
E 1 28 GLU 28 24  24  GLU GLU E . n 
E 1 29 LEU 29 25  25  LEU LEU E . n 
E 1 30 LEU 30 26  26  LEU LEU E . n 
E 1 31 PHE 31 27  27  PHE PHE E . n 
E 1 32 GLU 32 28  28  GLU GLU E . n 
E 1 33 LEU 33 29  29  LEU LEU E . n 
E 1 34 PHE 34 30  30  PHE PHE E . n 
E 1 35 HIS 35 31  31  HIS HIS E . n 
E 1 36 GLN 36 32  32  GLN GLN E . n 
E 1 37 ALA 37 33  33  ALA ALA E . n 
E 1 38 GLY 38 34  34  GLY GLY E . n 
E 1 39 PRO 39 35  35  PRO PRO E . n 
E 1 40 VAL 40 36  36  VAL VAL E . n 
E 1 41 ILE 41 37  37  ILE ILE E . n 
E 1 42 LYS 42 38  38  LYS LYS E . n 
E 1 43 VAL 43 39  39  VAL VAL E . n 
E 1 44 LYS 44 40  40  LYS LYS E . n 
E 1 45 ILE 45 41  41  ILE ILE E . n 
E 1 46 PRO 46 42  42  PRO PRO E . n 
E 1 47 LYS 47 43  ?   ?   ?   E . n 
E 1 48 ASP 48 44  ?   ?   ?   E . n 
E 1 49 LYS 49 45  ?   ?   ?   E . n 
E 1 50 ASP 50 46  ?   ?   ?   E . n 
E 1 51 GLY 51 47  ?   ?   ?   E . n 
E 1 52 LYS 52 48  ?   ?   ?   E . n 
E 1 53 PRO 53 49  ?   ?   ?   E . n 
E 1 54 LYS 54 50  ?   ?   ?   E . n 
E 1 55 GLN 55 51  51  GLN GLN E . n 
E 1 56 PHE 56 52  52  PHE PHE E . n 
E 1 57 ALA 57 53  53  ALA ALA E . n 
E 1 58 PHE 58 54  54  PHE PHE E . n 
E 1 59 VAL 59 55  55  VAL VAL E . n 
E 1 60 ASN 60 56  56  ASN ASN E . n 
E 1 61 PHE 61 57  57  PHE PHE E . n 
E 1 62 LYS 62 58  58  LYS LYS E . n 
E 1 63 HIS 63 59  59  HIS HIS E . n 
E 1 64 GLU 64 60  60  GLU GLU E . n 
E 1 65 VAL 65 61  61  VAL VAL E . n 
E 1 66 SER 66 62  62  SER SER E . n 
E 1 67 VAL 67 63  63  VAL VAL E . n 
E 1 68 PRO 68 64  64  PRO PRO E . n 
E 1 69 TYR 69 65  65  TYR TYR E . n 
E 1 70 ALA 70 66  66  ALA ALA E . n 
E 1 71 MET 71 67  67  MET MET E . n 
E 1 72 ASN 72 68  68  ASN ASN E . n 
E 1 73 LEU 73 69  69  LEU LEU E . n 
E 1 74 LEU 74 70  70  LEU LEU E . n 
E 1 75 ASN 75 71  71  ASN ASN E . n 
E 1 76 GLY 76 72  72  GLY GLY E . n 
E 1 77 ILE 77 73  73  ILE ILE E . n 
E 1 78 LYS 78 74  74  LYS LYS E . n 
E 1 79 LEU 79 75  75  LEU LEU E . n 
E 1 80 TYR 80 76  76  TYR TYR E . n 
E 1 81 GLY 81 77  77  GLY GLY E . n 
E 1 82 ARG 82 78  78  ARG ARG E . n 
E 1 83 PRO 83 79  79  PRO PRO E . n 
E 1 84 ILE 84 80  80  ILE ILE E . n 
E 1 85 LYS 85 81  81  LYS LYS E . n 
E 1 86 ILE 86 82  82  ILE ILE E . n 
E 1 87 GLN 87 83  83  GLN GLN E . n 
E 1 88 PHE 88 84  84  PHE PHE E . n 
E 1 89 ARG 89 85  85  ARG ARG E . n 
E 1 90 SER 90 86  86  SER SER E . n 
F 2 1  GLY 1  280 ?   ?   ?   F . n 
F 2 2  PRO 2  281 ?   ?   ?   F . n 
F 2 3  ASP 3  282 ?   ?   ?   F . n 
F 2 4  SER 4  283 ?   ?   ?   F . n 
F 2 5  MET 5  284 ?   ?   ?   F . n 
F 2 6  ARG 6  285 285 ARG ARG F . n 
F 2 7  PHE 7  286 286 PHE PHE F . n 
F 2 8  LYS 8  287 287 LYS LYS F . n 
F 2 9  PRO 9  288 288 PRO PRO F . n 
F 2 10 GLY 10 289 289 GLY GLY F . n 
F 2 11 VAL 11 290 290 VAL VAL F . n 
F 2 12 ILE 12 291 291 ILE ILE F . n 
F 2 13 SER 13 292 292 SER SER F . n 
F 2 14 GLU 14 293 293 GLU GLU F . n 
F 2 15 GLU 15 294 294 GLU GLU F . n 
F 2 16 LEU 16 295 295 LEU LEU F . n 
F 2 17 GLN 17 296 296 GLN GLN F . n 
F 2 18 ASP 18 297 297 ASP ASP F . n 
F 2 19 ALA 19 298 298 ALA ALA F . n 
F 2 20 LEU 20 299 299 LEU LEU F . n 
F 2 21 GLY 21 300 300 GLY GLY F . n 
F 2 22 VAL 22 301 301 VAL VAL F . n 
F 2 23 THR 23 302 302 THR THR F . n 
F 2 24 ASP 24 303 303 ASP ASP F . n 
F 2 25 LYS 25 304 304 LYS LYS F . n 
F 2 26 SER 26 305 305 SER SER F . n 
F 2 27 LEU 27 306 306 LEU LEU F . n 
F 2 28 PRO 28 307 307 PRO PRO F . n 
F 2 29 PRO 29 308 308 PRO PRO F . n 
F 2 30 PHE 30 309 309 PHE PHE F . n 
F 2 31 ILE 31 310 310 ILE ILE F . n 
F 2 32 TYR 32 311 311 TYR TYR F . n 
F 2 33 ARG 33 312 312 ARG ARG F . n 
F 2 34 MET 34 313 313 MET MET F . n 
F 2 35 ARG 35 314 314 ARG ARG F . n 
F 2 36 GLN 36 315 315 GLN GLN F . n 
F 2 37 LEU 37 316 316 LEU LEU F . n 
F 2 38 GLY 38 317 317 GLY GLY F . n 
F 2 39 TYR 39 318 318 TYR TYR F . n 
F 2 40 PRO 40 319 319 PRO PRO F . n 
F 2 41 PRO 41 320 320 PRO PRO F . n 
F 2 42 GLY 42 321 321 GLY GLY F . n 
F 2 43 TRP 43 322 322 TRP TRP F . n 
F 2 44 LEU 44 323 323 LEU LEU F . n 
F 2 45 LYS 45 324 324 LYS LYS F . n 
G 1 1  GLY 1  -3  ?   ?   ?   G . n 
G 1 2  PRO 2  -2  ?   ?   ?   G . n 
G 1 3  ASP 3  -1  ?   ?   ?   G . n 
G 1 4  SER 4  0   ?   ?   ?   G . n 
G 1 5  MET 5  1   ?   ?   ?   G . n 
G 1 6  GLY 6  2   ?   ?   ?   G . n 
G 1 7  ALA 7  3   ?   ?   ?   G . n 
G 1 8  ALA 8  4   ?   ?   ?   G . n 
G 1 9  ALA 9  5   ?   ?   ?   G . n 
G 1 10 ALA 10 6   ?   ?   ?   G . n 
G 1 11 GLU 11 7   7   GLU GLU G . n 
G 1 12 ALA 12 8   8   ALA ALA G . n 
G 1 13 ASP 13 9   9   ASP ASP G . n 
G 1 14 ARG 14 10  10  ARG ARG G . n 
G 1 15 THR 15 11  11  THR THR G . n 
G 1 16 LEU 16 12  12  LEU LEU G . n 
G 1 17 PHE 17 13  13  PHE PHE G . n 
G 1 18 VAL 18 14  14  VAL VAL G . n 
G 1 19 GLY 19 15  15  GLY GLY G . n 
G 1 20 ASN 20 16  16  ASN ASN G . n 
G 1 21 LEU 21 17  17  LEU LEU G . n 
G 1 22 GLU 22 18  18  GLU GLU G . n 
G 1 23 THR 23 19  19  THR THR G . n 
G 1 24 LYS 24 20  20  LYS LYS G . n 
G 1 25 VAL 25 21  21  VAL VAL G . n 
G 1 26 THR 26 22  22  THR THR G . n 
G 1 27 GLU 27 23  23  GLU GLU G . n 
G 1 28 GLU 28 24  24  GLU GLU G . n 
G 1 29 LEU 29 25  25  LEU LEU G . n 
G 1 30 LEU 30 26  26  LEU LEU G . n 
G 1 31 PHE 31 27  27  PHE PHE G . n 
G 1 32 GLU 32 28  28  GLU GLU G . n 
G 1 33 LEU 33 29  29  LEU LEU G . n 
G 1 34 PHE 34 30  30  PHE PHE G . n 
G 1 35 HIS 35 31  31  HIS HIS G . n 
G 1 36 GLN 36 32  32  GLN GLN G . n 
G 1 37 ALA 37 33  33  ALA ALA G . n 
G 1 38 GLY 38 34  34  GLY GLY G . n 
G 1 39 PRO 39 35  35  PRO PRO G . n 
G 1 40 VAL 40 36  36  VAL VAL G . n 
G 1 41 ILE 41 37  37  ILE ILE G . n 
G 1 42 LYS 42 38  38  LYS LYS G . n 
G 1 43 VAL 43 39  39  VAL VAL G . n 
G 1 44 LYS 44 40  40  LYS LYS G . n 
G 1 45 ILE 45 41  41  ILE ILE G . n 
G 1 46 PRO 46 42  42  PRO PRO G . n 
G 1 47 LYS 47 43  ?   ?   ?   G . n 
G 1 48 ASP 48 44  ?   ?   ?   G . n 
G 1 49 LYS 49 45  ?   ?   ?   G . n 
G 1 50 ASP 50 46  ?   ?   ?   G . n 
G 1 51 GLY 51 47  ?   ?   ?   G . n 
G 1 52 LYS 52 48  ?   ?   ?   G . n 
G 1 53 PRO 53 49  ?   ?   ?   G . n 
G 1 54 LYS 54 50  ?   ?   ?   G . n 
G 1 55 GLN 55 51  51  GLN GLN G . n 
G 1 56 PHE 56 52  52  PHE PHE G . n 
G 1 57 ALA 57 53  53  ALA ALA G . n 
G 1 58 PHE 58 54  54  PHE PHE G . n 
G 1 59 VAL 59 55  55  VAL VAL G . n 
G 1 60 ASN 60 56  56  ASN ASN G . n 
G 1 61 PHE 61 57  57  PHE PHE G . n 
G 1 62 LYS 62 58  58  LYS LYS G . n 
G 1 63 HIS 63 59  59  HIS HIS G . n 
G 1 64 GLU 64 60  60  GLU GLU G . n 
G 1 65 VAL 65 61  61  VAL VAL G . n 
G 1 66 SER 66 62  62  SER SER G . n 
G 1 67 VAL 67 63  63  VAL VAL G . n 
G 1 68 PRO 68 64  64  PRO PRO G . n 
G 1 69 TYR 69 65  65  TYR TYR G . n 
G 1 70 ALA 70 66  66  ALA ALA G . n 
G 1 71 MET 71 67  67  MET MET G . n 
G 1 72 ASN 72 68  68  ASN ASN G . n 
G 1 73 LEU 73 69  69  LEU LEU G . n 
G 1 74 LEU 74 70  70  LEU LEU G . n 
G 1 75 ASN 75 71  71  ASN ASN G . n 
G 1 76 GLY 76 72  72  GLY GLY G . n 
G 1 77 ILE 77 73  73  ILE ILE G . n 
G 1 78 LYS 78 74  74  LYS LYS G . n 
G 1 79 LEU 79 75  75  LEU LEU G . n 
G 1 80 TYR 80 76  76  TYR TYR G . n 
G 1 81 GLY 81 77  77  GLY GLY G . n 
G 1 82 ARG 82 78  78  ARG ARG G . n 
G 1 83 PRO 83 79  79  PRO PRO G . n 
G 1 84 ILE 84 80  80  ILE ILE G . n 
G 1 85 LYS 85 81  81  LYS LYS G . n 
G 1 86 ILE 86 82  82  ILE ILE G . n 
G 1 87 GLN 87 83  83  GLN GLN G . n 
G 1 88 PHE 88 84  84  PHE PHE G . n 
G 1 89 ARG 89 85  85  ARG ARG G . n 
G 1 90 SER 90 86  86  SER SER G . n 
H 2 1  GLY 1  280 ?   ?   ?   H . n 
H 2 2  PRO 2  281 ?   ?   ?   H . n 
H 2 3  ASP 3  282 ?   ?   ?   H . n 
H 2 4  SER 4  283 ?   ?   ?   H . n 
H 2 5  MET 5  284 ?   ?   ?   H . n 
H 2 6  ARG 6  285 285 ARG ARG H . n 
H 2 7  PHE 7  286 286 PHE PHE H . n 
H 2 8  LYS 8  287 287 LYS LYS H . n 
H 2 9  PRO 9  288 288 PRO PRO H . n 
H 2 10 GLY 10 289 289 GLY GLY H . n 
H 2 11 VAL 11 290 290 VAL VAL H . n 
H 2 12 ILE 12 291 291 ILE ILE H . n 
H 2 13 SER 13 292 292 SER SER H . n 
H 2 14 GLU 14 293 293 GLU GLU H . n 
H 2 15 GLU 15 294 294 GLU GLU H . n 
H 2 16 LEU 16 295 295 LEU LEU H . n 
H 2 17 GLN 17 296 296 GLN GLN H . n 
H 2 18 ASP 18 297 297 ASP ASP H . n 
H 2 19 ALA 19 298 298 ALA ALA H . n 
H 2 20 LEU 20 299 299 LEU LEU H . n 
H 2 21 GLY 21 300 300 GLY GLY H . n 
H 2 22 VAL 22 301 301 VAL VAL H . n 
H 2 23 THR 23 302 302 THR THR H . n 
H 2 24 ASP 24 303 303 ASP ASP H . n 
H 2 25 LYS 25 304 304 LYS LYS H . n 
H 2 26 SER 26 305 305 SER SER H . n 
H 2 27 LEU 27 306 306 LEU LEU H . n 
H 2 28 PRO 28 307 307 PRO PRO H . n 
H 2 29 PRO 29 308 308 PRO PRO H . n 
H 2 30 PHE 30 309 309 PHE PHE H . n 
H 2 31 ILE 31 310 310 ILE ILE H . n 
H 2 32 TYR 32 311 311 TYR TYR H . n 
H 2 33 ARG 33 312 312 ARG ARG H . n 
H 2 34 MET 34 313 313 MET MET H . n 
H 2 35 ARG 35 314 314 ARG ARG H . n 
H 2 36 GLN 36 315 315 GLN GLN H . n 
H 2 37 LEU 37 316 316 LEU LEU H . n 
H 2 38 GLY 38 317 317 GLY GLY H . n 
H 2 39 TYR 39 318 318 TYR TYR H . n 
H 2 40 PRO 40 319 319 PRO PRO H . n 
H 2 41 PRO 41 320 320 PRO PRO H . n 
H 2 42 GLY 42 321 321 GLY GLY H . n 
H 2 43 TRP 43 322 322 TRP TRP H . n 
H 2 44 LEU 44 323 323 LEU LEU H . n 
H 2 45 LYS 45 324 324 LYS LYS H . n 
I 1 1  GLY 1  -3  ?   ?   ?   I . n 
I 1 2  PRO 2  -2  ?   ?   ?   I . n 
I 1 3  ASP 3  -1  ?   ?   ?   I . n 
I 1 4  SER 4  0   ?   ?   ?   I . n 
I 1 5  MET 5  1   ?   ?   ?   I . n 
I 1 6  GLY 6  2   ?   ?   ?   I . n 
I 1 7  ALA 7  3   ?   ?   ?   I . n 
I 1 8  ALA 8  4   ?   ?   ?   I . n 
I 1 9  ALA 9  5   ?   ?   ?   I . n 
I 1 10 ALA 10 6   ?   ?   ?   I . n 
I 1 11 GLU 11 7   7   GLU GLU I . n 
I 1 12 ALA 12 8   8   ALA ALA I . n 
I 1 13 ASP 13 9   9   ASP ASP I . n 
I 1 14 ARG 14 10  10  ARG ARG I . n 
I 1 15 THR 15 11  11  THR THR I . n 
I 1 16 LEU 16 12  ?   ?   ?   I . n 
I 1 17 PHE 17 13  13  PHE PHE I . n 
I 1 18 VAL 18 14  14  VAL VAL I . n 
I 1 19 GLY 19 15  15  GLY GLY I . n 
I 1 20 ASN 20 16  16  ASN ASN I . n 
I 1 21 LEU 21 17  17  LEU LEU I . n 
I 1 22 GLU 22 18  18  GLU GLU I . n 
I 1 23 THR 23 19  19  THR THR I . n 
I 1 24 LYS 24 20  20  LYS LYS I . n 
I 1 25 VAL 25 21  21  VAL VAL I . n 
I 1 26 THR 26 22  22  THR THR I . n 
I 1 27 GLU 27 23  23  GLU GLU I . n 
I 1 28 GLU 28 24  24  GLU GLU I . n 
I 1 29 LEU 29 25  25  LEU LEU I . n 
I 1 30 LEU 30 26  26  LEU LEU I . n 
I 1 31 PHE 31 27  27  PHE PHE I . n 
I 1 32 GLU 32 28  28  GLU GLU I . n 
I 1 33 LEU 33 29  29  LEU LEU I . n 
I 1 34 PHE 34 30  30  PHE PHE I . n 
I 1 35 HIS 35 31  31  HIS HIS I . n 
I 1 36 GLN 36 32  32  GLN GLN I . n 
I 1 37 ALA 37 33  33  ALA ALA I . n 
I 1 38 GLY 38 34  34  GLY GLY I . n 
I 1 39 PRO 39 35  35  PRO PRO I . n 
I 1 40 VAL 40 36  36  VAL VAL I . n 
I 1 41 ILE 41 37  37  ILE ILE I . n 
I 1 42 LYS 42 38  38  LYS LYS I . n 
I 1 43 VAL 43 39  39  VAL VAL I . n 
I 1 44 LYS 44 40  40  LYS LYS I . n 
I 1 45 ILE 45 41  41  ILE ILE I . n 
I 1 46 PRO 46 42  42  PRO PRO I . n 
I 1 47 LYS 47 43  43  LYS LYS I . n 
I 1 48 ASP 48 44  44  ASP ASP I . n 
I 1 49 LYS 49 45  45  LYS LYS I . n 
I 1 50 ASP 50 46  46  ASP ASP I . n 
I 1 51 GLY 51 47  47  GLY GLY I . n 
I 1 52 LYS 52 48  48  LYS LYS I . n 
I 1 53 PRO 53 49  49  PRO PRO I . n 
I 1 54 LYS 54 50  50  LYS LYS I . n 
I 1 55 GLN 55 51  51  GLN GLN I . n 
I 1 56 PHE 56 52  52  PHE PHE I . n 
I 1 57 ALA 57 53  53  ALA ALA I . n 
I 1 58 PHE 58 54  54  PHE PHE I . n 
I 1 59 VAL 59 55  55  VAL VAL I . n 
I 1 60 ASN 60 56  56  ASN ASN I . n 
I 1 61 PHE 61 57  57  PHE PHE I . n 
I 1 62 LYS 62 58  58  LYS LYS I . n 
I 1 63 HIS 63 59  59  HIS HIS I . n 
I 1 64 GLU 64 60  60  GLU GLU I . n 
I 1 65 VAL 65 61  61  VAL VAL I . n 
I 1 66 SER 66 62  62  SER SER I . n 
I 1 67 VAL 67 63  63  VAL VAL I . n 
I 1 68 PRO 68 64  64  PRO PRO I . n 
I 1 69 TYR 69 65  65  TYR TYR I . n 
I 1 70 ALA 70 66  66  ALA ALA I . n 
I 1 71 MET 71 67  67  MET MET I . n 
I 1 72 ASN 72 68  68  ASN ASN I . n 
I 1 73 LEU 73 69  69  LEU LEU I . n 
I 1 74 LEU 74 70  70  LEU LEU I . n 
I 1 75 ASN 75 71  71  ASN ASN I . n 
I 1 76 GLY 76 72  72  GLY GLY I . n 
I 1 77 ILE 77 73  73  ILE ILE I . n 
I 1 78 LYS 78 74  74  LYS LYS I . n 
I 1 79 LEU 79 75  75  LEU LEU I . n 
I 1 80 TYR 80 76  76  TYR TYR I . n 
I 1 81 GLY 81 77  77  GLY GLY I . n 
I 1 82 ARG 82 78  78  ARG ARG I . n 
I 1 83 PRO 83 79  79  PRO PRO I . n 
I 1 84 ILE 84 80  80  ILE ILE I . n 
I 1 85 LYS 85 81  81  LYS LYS I . n 
I 1 86 ILE 86 82  82  ILE ILE I . n 
I 1 87 GLN 87 83  83  GLN GLN I . n 
I 1 88 PHE 88 84  84  PHE PHE I . n 
I 1 89 ARG 89 85  85  ARG ARG I . n 
I 1 90 SER 90 86  86  SER SER I . n 
J 2 1  GLY 1  280 ?   ?   ?   J . n 
J 2 2  PRO 2  281 ?   ?   ?   J . n 
J 2 3  ASP 3  282 ?   ?   ?   J . n 
J 2 4  SER 4  283 ?   ?   ?   J . n 
J 2 5  MET 5  284 ?   ?   ?   J . n 
J 2 6  ARG 6  285 ?   ?   ?   J . n 
J 2 7  PHE 7  286 286 PHE PHE J . n 
J 2 8  LYS 8  287 287 LYS LYS J . n 
J 2 9  PRO 9  288 288 PRO PRO J . n 
J 2 10 GLY 10 289 289 GLY GLY J . n 
J 2 11 VAL 11 290 290 VAL VAL J . n 
J 2 12 ILE 12 291 291 ILE ILE J . n 
J 2 13 SER 13 292 292 SER SER J . n 
J 2 14 GLU 14 293 293 GLU GLU J . n 
J 2 15 GLU 15 294 294 GLU GLU J . n 
J 2 16 LEU 16 295 295 LEU LEU J . n 
J 2 17 GLN 17 296 296 GLN GLN J . n 
J 2 18 ASP 18 297 297 ASP ASP J . n 
J 2 19 ALA 19 298 298 ALA ALA J . n 
J 2 20 LEU 20 299 299 LEU LEU J . n 
J 2 21 GLY 21 300 300 GLY GLY J . n 
J 2 22 VAL 22 301 301 VAL VAL J . n 
J 2 23 THR 23 302 302 THR THR J . n 
J 2 24 ASP 24 303 303 ASP ASP J . n 
J 2 25 LYS 25 304 304 LYS LYS J . n 
J 2 26 SER 26 305 305 SER SER J . n 
J 2 27 LEU 27 306 306 LEU LEU J . n 
J 2 28 PRO 28 307 307 PRO PRO J . n 
J 2 29 PRO 29 308 308 PRO PRO J . n 
J 2 30 PHE 30 309 309 PHE PHE J . n 
J 2 31 ILE 31 310 310 ILE ILE J . n 
J 2 32 TYR 32 311 311 TYR TYR J . n 
J 2 33 ARG 33 312 312 ARG ARG J . n 
J 2 34 MET 34 313 313 MET MET J . n 
J 2 35 ARG 35 314 314 ARG ARG J . n 
J 2 36 GLN 36 315 315 GLN GLN J . n 
J 2 37 LEU 37 316 316 LEU LEU J . n 
J 2 38 GLY 38 317 317 GLY GLY J . n 
J 2 39 TYR 39 318 318 TYR TYR J . n 
J 2 40 PRO 40 319 319 PRO PRO J . n 
J 2 41 PRO 41 320 320 PRO PRO J . n 
J 2 42 GLY 42 321 321 GLY GLY J . n 
J 2 43 TRP 43 322 322 TRP TRP J . n 
J 2 44 LEU 44 323 323 LEU LEU J . n 
J 2 45 LYS 45 324 ?   ?   ?   J . n 
K 1 1  GLY 1  -3  ?   ?   ?   K . n 
K 1 2  PRO 2  -2  ?   ?   ?   K . n 
K 1 3  ASP 3  -1  ?   ?   ?   K . n 
K 1 4  SER 4  0   ?   ?   ?   K . n 
K 1 5  MET 5  1   ?   ?   ?   K . n 
K 1 6  GLY 6  2   ?   ?   ?   K . n 
K 1 7  ALA 7  3   ?   ?   ?   K . n 
K 1 8  ALA 8  4   ?   ?   ?   K . n 
K 1 9  ALA 9  5   ?   ?   ?   K . n 
K 1 10 ALA 10 6   ?   ?   ?   K . n 
K 1 11 GLU 11 7   ?   ?   ?   K . n 
K 1 12 ALA 12 8   ?   ?   ?   K . n 
K 1 13 ASP 13 9   9   ASP ASP K . n 
K 1 14 ARG 14 10  10  ARG ARG K . n 
K 1 15 THR 15 11  11  THR THR K . n 
K 1 16 LEU 16 12  12  LEU LEU K . n 
K 1 17 PHE 17 13  13  PHE PHE K . n 
K 1 18 VAL 18 14  14  VAL VAL K . n 
K 1 19 GLY 19 15  15  GLY GLY K . n 
K 1 20 ASN 20 16  16  ASN ASN K . n 
K 1 21 LEU 21 17  17  LEU LEU K . n 
K 1 22 GLU 22 18  18  GLU GLU K . n 
K 1 23 THR 23 19  19  THR THR K . n 
K 1 24 LYS 24 20  20  LYS LYS K . n 
K 1 25 VAL 25 21  21  VAL VAL K . n 
K 1 26 THR 26 22  22  THR THR K . n 
K 1 27 GLU 27 23  23  GLU GLU K . n 
K 1 28 GLU 28 24  24  GLU GLU K . n 
K 1 29 LEU 29 25  25  LEU LEU K . n 
K 1 30 LEU 30 26  26  LEU LEU K . n 
K 1 31 PHE 31 27  27  PHE PHE K . n 
K 1 32 GLU 32 28  28  GLU GLU K . n 
K 1 33 LEU 33 29  29  LEU LEU K . n 
K 1 34 PHE 34 30  30  PHE PHE K . n 
K 1 35 HIS 35 31  31  HIS HIS K . n 
K 1 36 GLN 36 32  32  GLN GLN K . n 
K 1 37 ALA 37 33  33  ALA ALA K . n 
K 1 38 GLY 38 34  34  GLY GLY K . n 
K 1 39 PRO 39 35  35  PRO PRO K . n 
K 1 40 VAL 40 36  36  VAL VAL K . n 
K 1 41 ILE 41 37  37  ILE ILE K . n 
K 1 42 LYS 42 38  38  LYS LYS K . n 
K 1 43 VAL 43 39  39  VAL VAL K . n 
K 1 44 LYS 44 40  40  LYS LYS K . n 
K 1 45 ILE 45 41  ?   ?   ?   K . n 
K 1 46 PRO 46 42  ?   ?   ?   K . n 
K 1 47 LYS 47 43  ?   ?   ?   K . n 
K 1 48 ASP 48 44  ?   ?   ?   K . n 
K 1 49 LYS 49 45  ?   ?   ?   K . n 
K 1 50 ASP 50 46  ?   ?   ?   K . n 
K 1 51 GLY 51 47  ?   ?   ?   K . n 
K 1 52 LYS 52 48  48  LYS LYS K . n 
K 1 53 PRO 53 49  49  PRO PRO K . n 
K 1 54 LYS 54 50  50  LYS LYS K . n 
K 1 55 GLN 55 51  51  GLN GLN K . n 
K 1 56 PHE 56 52  52  PHE PHE K . n 
K 1 57 ALA 57 53  53  ALA ALA K . n 
K 1 58 PHE 58 54  54  PHE PHE K . n 
K 1 59 VAL 59 55  55  VAL VAL K . n 
K 1 60 ASN 60 56  56  ASN ASN K . n 
K 1 61 PHE 61 57  57  PHE PHE K . n 
K 1 62 LYS 62 58  58  LYS LYS K . n 
K 1 63 HIS 63 59  59  HIS HIS K . n 
K 1 64 GLU 64 60  60  GLU GLU K . n 
K 1 65 VAL 65 61  61  VAL VAL K . n 
K 1 66 SER 66 62  62  SER SER K . n 
K 1 67 VAL 67 63  63  VAL VAL K . n 
K 1 68 PRO 68 64  64  PRO PRO K . n 
K 1 69 TYR 69 65  65  TYR TYR K . n 
K 1 70 ALA 70 66  66  ALA ALA K . n 
K 1 71 MET 71 67  67  MET MET K . n 
K 1 72 ASN 72 68  68  ASN ASN K . n 
K 1 73 LEU 73 69  69  LEU LEU K . n 
K 1 74 LEU 74 70  70  LEU LEU K . n 
K 1 75 ASN 75 71  71  ASN ASN K . n 
K 1 76 GLY 76 72  72  GLY GLY K . n 
K 1 77 ILE 77 73  73  ILE ILE K . n 
K 1 78 LYS 78 74  74  LYS LYS K . n 
K 1 79 LEU 79 75  75  LEU LEU K . n 
K 1 80 TYR 80 76  76  TYR TYR K . n 
K 1 81 GLY 81 77  77  GLY GLY K . n 
K 1 82 ARG 82 78  78  ARG ARG K . n 
K 1 83 PRO 83 79  79  PRO PRO K . n 
K 1 84 ILE 84 80  80  ILE ILE K . n 
K 1 85 LYS 85 81  81  LYS LYS K . n 
K 1 86 ILE 86 82  82  ILE ILE K . n 
K 1 87 GLN 87 83  83  GLN GLN K . n 
K 1 88 PHE 88 84  84  PHE PHE K . n 
K 1 89 ARG 89 85  85  ARG ARG K . n 
K 1 90 SER 90 86  86  SER SER K . n 
L 2 1  GLY 1  280 ?   ?   ?   L . n 
L 2 2  PRO 2  281 ?   ?   ?   L . n 
L 2 3  ASP 3  282 ?   ?   ?   L . n 
L 2 4  SER 4  283 ?   ?   ?   L . n 
L 2 5  MET 5  284 ?   ?   ?   L . n 
L 2 6  ARG 6  285 ?   ?   ?   L . n 
L 2 7  PHE 7  286 286 PHE PHE L . n 
L 2 8  LYS 8  287 287 LYS LYS L . n 
L 2 9  PRO 9  288 288 PRO PRO L . n 
L 2 10 GLY 10 289 289 GLY GLY L . n 
L 2 11 VAL 11 290 290 VAL VAL L . n 
L 2 12 ILE 12 291 291 ILE ILE L . n 
L 2 13 SER 13 292 292 SER SER L . n 
L 2 14 GLU 14 293 293 GLU GLU L . n 
L 2 15 GLU 15 294 294 GLU GLU L . n 
L 2 16 LEU 16 295 295 LEU LEU L . n 
L 2 17 GLN 17 296 296 GLN GLN L . n 
L 2 18 ASP 18 297 297 ASP ASP L . n 
L 2 19 ALA 19 298 298 ALA ALA L . n 
L 2 20 LEU 20 299 299 LEU LEU L . n 
L 2 21 GLY 21 300 300 GLY GLY L . n 
L 2 22 VAL 22 301 301 VAL VAL L . n 
L 2 23 THR 23 302 302 THR THR L . n 
L 2 24 ASP 24 303 303 ASP ASP L . n 
L 2 25 LYS 25 304 304 LYS LYS L . n 
L 2 26 SER 26 305 305 SER SER L . n 
L 2 27 LEU 27 306 306 LEU LEU L . n 
L 2 28 PRO 28 307 307 PRO PRO L . n 
L 2 29 PRO 29 308 308 PRO PRO L . n 
L 2 30 PHE 30 309 309 PHE PHE L . n 
L 2 31 ILE 31 310 310 ILE ILE L . n 
L 2 32 TYR 32 311 311 TYR TYR L . n 
L 2 33 ARG 33 312 312 ARG ARG L . n 
L 2 34 MET 34 313 313 MET MET L . n 
L 2 35 ARG 35 314 314 ARG ARG L . n 
L 2 36 GLN 36 315 315 GLN GLN L . n 
L 2 37 LEU 37 316 316 LEU LEU L . n 
L 2 38 GLY 38 317 317 GLY GLY L . n 
L 2 39 TYR 39 318 318 TYR TYR L . n 
L 2 40 PRO 40 319 319 PRO PRO L . n 
L 2 41 PRO 41 320 320 PRO PRO L . n 
L 2 42 GLY 42 321 321 GLY GLY L . n 
L 2 43 TRP 43 322 322 TRP TRP L . n 
L 2 44 LEU 44 323 323 LEU LEU L . n 
L 2 45 LYS 45 324 ?   ?   ?   L . n 
M 1 1  GLY 1  -3  ?   ?   ?   M . n 
M 1 2  PRO 2  -2  ?   ?   ?   M . n 
M 1 3  ASP 3  -1  ?   ?   ?   M . n 
M 1 4  SER 4  0   ?   ?   ?   M . n 
M 1 5  MET 5  1   ?   ?   ?   M . n 
M 1 6  GLY 6  2   ?   ?   ?   M . n 
M 1 7  ALA 7  3   ?   ?   ?   M . n 
M 1 8  ALA 8  4   ?   ?   ?   M . n 
M 1 9  ALA 9  5   ?   ?   ?   M . n 
M 1 10 ALA 10 6   ?   ?   ?   M . n 
M 1 11 GLU 11 7   7   GLU GLU M . n 
M 1 12 ALA 12 8   8   ALA ALA M . n 
M 1 13 ASP 13 9   9   ASP ASP M . n 
M 1 14 ARG 14 10  10  ARG ARG M . n 
M 1 15 THR 15 11  11  THR THR M . n 
M 1 16 LEU 16 12  12  LEU LEU M . n 
M 1 17 PHE 17 13  13  PHE PHE M . n 
M 1 18 VAL 18 14  14  VAL VAL M . n 
M 1 19 GLY 19 15  15  GLY GLY M . n 
M 1 20 ASN 20 16  16  ASN ASN M . n 
M 1 21 LEU 21 17  17  LEU LEU M . n 
M 1 22 GLU 22 18  ?   ?   ?   M . n 
M 1 23 THR 23 19  19  THR THR M . n 
M 1 24 LYS 24 20  20  LYS LYS M . n 
M 1 25 VAL 25 21  21  VAL VAL M . n 
M 1 26 THR 26 22  22  THR THR M . n 
M 1 27 GLU 27 23  23  GLU GLU M . n 
M 1 28 GLU 28 24  ?   ?   ?   M . n 
M 1 29 LEU 29 25  25  LEU LEU M . n 
M 1 30 LEU 30 26  26  LEU LEU M . n 
M 1 31 PHE 31 27  27  PHE PHE M . n 
M 1 32 GLU 32 28  28  GLU GLU M . n 
M 1 33 LEU 33 29  29  LEU LEU M . n 
M 1 34 PHE 34 30  30  PHE PHE M . n 
M 1 35 HIS 35 31  31  HIS HIS M . n 
M 1 36 GLN 36 32  32  GLN GLN M . n 
M 1 37 ALA 37 33  33  ALA ALA M . n 
M 1 38 GLY 38 34  34  GLY GLY M . n 
M 1 39 PRO 39 35  35  PRO PRO M . n 
M 1 40 VAL 40 36  36  VAL VAL M . n 
M 1 41 ILE 41 37  37  ILE ILE M . n 
M 1 42 LYS 42 38  38  LYS LYS M . n 
M 1 43 VAL 43 39  39  VAL VAL M . n 
M 1 44 LYS 44 40  ?   ?   ?   M . n 
M 1 45 ILE 45 41  ?   ?   ?   M . n 
M 1 46 PRO 46 42  ?   ?   ?   M . n 
M 1 47 LYS 47 43  ?   ?   ?   M . n 
M 1 48 ASP 48 44  ?   ?   ?   M . n 
M 1 49 LYS 49 45  ?   ?   ?   M . n 
M 1 50 ASP 50 46  ?   ?   ?   M . n 
M 1 51 GLY 51 47  ?   ?   ?   M . n 
M 1 52 LYS 52 48  ?   ?   ?   M . n 
M 1 53 PRO 53 49  ?   ?   ?   M . n 
M 1 54 LYS 54 50  ?   ?   ?   M . n 
M 1 55 GLN 55 51  51  GLN GLN M . n 
M 1 56 PHE 56 52  52  PHE PHE M . n 
M 1 57 ALA 57 53  53  ALA ALA M . n 
M 1 58 PHE 58 54  54  PHE PHE M . n 
M 1 59 VAL 59 55  55  VAL VAL M . n 
M 1 60 ASN 60 56  56  ASN ASN M . n 
M 1 61 PHE 61 57  57  PHE PHE M . n 
M 1 62 LYS 62 58  58  LYS LYS M . n 
M 1 63 HIS 63 59  59  HIS HIS M . n 
M 1 64 GLU 64 60  60  GLU GLU M . n 
M 1 65 VAL 65 61  61  VAL VAL M . n 
M 1 66 SER 66 62  62  SER SER M . n 
M 1 67 VAL 67 63  63  VAL VAL M . n 
M 1 68 PRO 68 64  64  PRO PRO M . n 
M 1 69 TYR 69 65  65  TYR TYR M . n 
M 1 70 ALA 70 66  66  ALA ALA M . n 
M 1 71 MET 71 67  67  MET MET M . n 
M 1 72 ASN 72 68  68  ASN ASN M . n 
M 1 73 LEU 73 69  69  LEU LEU M . n 
M 1 74 LEU 74 70  70  LEU LEU M . n 
M 1 75 ASN 75 71  71  ASN ASN M . n 
M 1 76 GLY 76 72  72  GLY GLY M . n 
M 1 77 ILE 77 73  73  ILE ILE M . n 
M 1 78 LYS 78 74  74  LYS LYS M . n 
M 1 79 LEU 79 75  75  LEU LEU M . n 
M 1 80 TYR 80 76  76  TYR TYR M . n 
M 1 81 GLY 81 77  ?   ?   ?   M . n 
M 1 82 ARG 82 78  ?   ?   ?   M . n 
M 1 83 PRO 83 79  79  PRO PRO M . n 
M 1 84 ILE 84 80  80  ILE ILE M . n 
M 1 85 LYS 85 81  81  LYS LYS M . n 
M 1 86 ILE 86 82  82  ILE ILE M . n 
M 1 87 GLN 87 83  83  GLN GLN M . n 
M 1 88 PHE 88 84  84  PHE PHE M . n 
M 1 89 ARG 89 85  85  ARG ARG M . n 
M 1 90 SER 90 86  ?   ?   ?   M . n 
N 2 1  GLY 1  280 ?   ?   ?   N . n 
N 2 2  PRO 2  281 ?   ?   ?   N . n 
N 2 3  ASP 3  282 ?   ?   ?   N . n 
N 2 4  SER 4  283 ?   ?   ?   N . n 
N 2 5  MET 5  284 ?   ?   ?   N . n 
N 2 6  ARG 6  285 ?   ?   ?   N . n 
N 2 7  PHE 7  286 286 PHE PHE N . n 
N 2 8  LYS 8  287 287 LYS LYS N . n 
N 2 9  PRO 9  288 288 PRO PRO N . n 
N 2 10 GLY 10 289 289 GLY GLY N . n 
N 2 11 VAL 11 290 290 VAL VAL N . n 
N 2 12 ILE 12 291 291 ILE ILE N . n 
N 2 13 SER 13 292 292 SER SER N . n 
N 2 14 GLU 14 293 293 GLU GLU N . n 
N 2 15 GLU 15 294 294 GLU GLU N . n 
N 2 16 LEU 16 295 295 LEU LEU N . n 
N 2 17 GLN 17 296 296 GLN GLN N . n 
N 2 18 ASP 18 297 297 ASP ASP N . n 
N 2 19 ALA 19 298 298 ALA ALA N . n 
N 2 20 LEU 20 299 299 LEU LEU N . n 
N 2 21 GLY 21 300 300 GLY GLY N . n 
N 2 22 VAL 22 301 301 VAL VAL N . n 
N 2 23 THR 23 302 ?   ?   ?   N . n 
N 2 24 ASP 24 303 303 ASP ASP N . n 
N 2 25 LYS 25 304 304 LYS LYS N . n 
N 2 26 SER 26 305 305 SER SER N . n 
N 2 27 LEU 27 306 306 LEU LEU N . n 
N 2 28 PRO 28 307 307 PRO PRO N . n 
N 2 29 PRO 29 308 308 PRO PRO N . n 
N 2 30 PHE 30 309 309 PHE PHE N . n 
N 2 31 ILE 31 310 310 ILE ILE N . n 
N 2 32 TYR 32 311 311 TYR TYR N . n 
N 2 33 ARG 33 312 312 ARG ARG N . n 
N 2 34 MET 34 313 313 MET MET N . n 
N 2 35 ARG 35 314 314 ARG ARG N . n 
N 2 36 GLN 36 315 315 GLN GLN N . n 
N 2 37 LEU 37 316 316 LEU LEU N . n 
N 2 38 GLY 38 317 317 GLY GLY N . n 
N 2 39 TYR 39 318 318 TYR TYR N . n 
N 2 40 PRO 40 319 319 PRO PRO N . n 
N 2 41 PRO 41 320 320 PRO PRO N . n 
N 2 42 GLY 42 321 321 GLY GLY N . n 
N 2 43 TRP 43 322 322 TRP TRP N . n 
N 2 44 LEU 44 323 323 LEU LEU N . n 
N 2 45 LYS 45 324 ?   ?   ?   N . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
O 3 BR  1 401 325 BR  BR  D . 
P 3 BR  1 401 325 BR  BR  C . 
Q 3 BR  1 402 326 BR  BR  C . 
R 3 BR  1 401 325 BR  BR  F . 
S 3 BR  1 101 87  BR  BR  G . 
T 3 BR  1 401 325 BR  BR  H . 
U 3 BR  1 401 324 BR  BR  J . 
V 3 BR  1 401 324 BR  BR  L . 
W 3 BR  1 401 324 BR  BR  N . 
X 4 HOH 1 101 89  HOH HOH B . 
X 4 HOH 2 102 88  HOH HOH B . 
X 4 HOH 3 103 87  HOH HOH B . 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 software_defined_assembly PISA dimeric 2 
2 software_defined_assembly PISA dimeric 2 
3 software_defined_assembly PISA dimeric 2 
4 software_defined_assembly PISA dimeric 2 
5 software_defined_assembly PISA dimeric 2 
6 software_defined_assembly PISA dimeric 2 
7 software_defined_assembly PISA dimeric 2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,B,O     
2 1 C,D,P,Q,X 
3 1 E,F,R     
4 1 G,H,S,T   
5 1 I,J,U     
6 1 K,L,V     
7 1 M,N,W     
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1720 ? 
1 MORE         -12  ? 
1 'SSA (A^2)'  6400 ? 
2 'ABSA (A^2)' 1980 ? 
2 MORE         -12  ? 
2 'SSA (A^2)'  6140 ? 
3 'ABSA (A^2)' 1790 ? 
3 MORE         -13  ? 
3 'SSA (A^2)'  6290 ? 
4 'ABSA (A^2)' 1840 ? 
4 MORE         -12  ? 
4 'SSA (A^2)'  5920 ? 
5 'ABSA (A^2)' 1590 ? 
5 MORE         -13  ? 
5 'SSA (A^2)'  6400 ? 
6 'ABSA (A^2)' 1540 ? 
6 MORE         -13  ? 
6 'SSA (A^2)'  6090 ? 
7 'ABSA (A^2)' 1470 ? 
7 MORE         -11  ? 
7 'SSA (A^2)'  6160 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     103 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   X 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
_pdbx_audit_revision_history.ordinal             1 
_pdbx_audit_revision_history.data_content_type   'Structure model' 
_pdbx_audit_revision_history.major_revision      1 
_pdbx_audit_revision_history.minor_revision      0 
_pdbx_audit_revision_history.revision_date       2016-12-14 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.10     1 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? xia2        ? ? ? .        2 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? .        3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0135 4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER      ? ? ? .        5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NE2 
_pdbx_validate_close_contact.auth_asym_id_1   I 
_pdbx_validate_close_contact.auth_comp_id_1   GLN 
_pdbx_validate_close_contact.auth_seq_id_1    32 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   J 
_pdbx_validate_close_contact.auth_comp_id_2   PRO 
_pdbx_validate_close_contact.auth_seq_id_2    288 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OG1 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    THR 
_pdbx_validate_symm_contact.auth_seq_id_1     19 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OG1 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    THR 
_pdbx_validate_symm_contact.auth_seq_id_2     19 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   2_556 
_pdbx_validate_symm_contact.dist              2.09 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE D 309 ? ? 76.93   -12.95  
2  1 ARG E 10  ? ? -88.26  47.74   
3  1 THR F 302 ? ? -105.27 -79.48  
4  1 PHE F 309 ? ? 76.24   -9.94   
5  1 ARG G 10  ? ? -92.71  41.13   
6  1 PHE H 309 ? ? 72.74   -13.08  
7  1 ASP I 44  ? ? -76.56  -169.24 
8  1 ASP J 303 ? ? -60.44  67.70   
9  1 PHE J 309 ? ? 74.39   -7.21   
10 1 PHE L 309 ? ? 76.21   -7.54   
11 1 ARG M 10  ? ? -102.85 68.68   
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A GLU 7   ? CG  ? A GLU 11 CG  
2   1 Y 1 A GLU 7   ? CD  ? A GLU 11 CD  
3   1 Y 1 A GLU 7   ? OE1 ? A GLU 11 OE1 
4   1 Y 1 A GLU 7   ? OE2 ? A GLU 11 OE2 
5   1 Y 1 A LYS 20  ? CG  ? A LYS 24 CG  
6   1 Y 1 A LYS 20  ? CD  ? A LYS 24 CD  
7   1 Y 1 A LYS 20  ? CE  ? A LYS 24 CE  
8   1 Y 1 A LYS 20  ? NZ  ? A LYS 24 NZ  
9   1 Y 1 A GLU 24  ? CG  ? A GLU 28 CG  
10  1 Y 1 A GLU 24  ? CD  ? A GLU 28 CD  
11  1 Y 1 A GLU 24  ? OE1 ? A GLU 28 OE1 
12  1 Y 1 A GLU 24  ? OE2 ? A GLU 28 OE2 
13  1 Y 1 A LYS 38  ? CG  ? A LYS 42 CG  
14  1 Y 1 A LYS 38  ? CD  ? A LYS 42 CD  
15  1 Y 1 A LYS 38  ? CE  ? A LYS 42 CE  
16  1 Y 1 A LYS 38  ? NZ  ? A LYS 42 NZ  
17  1 Y 1 A LYS 40  ? CG  ? A LYS 44 CG  
18  1 Y 1 A LYS 40  ? CD  ? A LYS 44 CD  
19  1 Y 1 A LYS 40  ? CE  ? A LYS 44 CE  
20  1 Y 1 A LYS 40  ? NZ  ? A LYS 44 NZ  
21  1 Y 1 A LYS 43  ? CG  ? A LYS 47 CG  
22  1 Y 1 A LYS 43  ? CD  ? A LYS 47 CD  
23  1 Y 1 A LYS 43  ? CE  ? A LYS 47 CE  
24  1 Y 1 A LYS 43  ? NZ  ? A LYS 47 NZ  
25  1 Y 1 A ASP 44  ? CG  ? A ASP 48 CG  
26  1 Y 1 A ASP 44  ? OD1 ? A ASP 48 OD1 
27  1 Y 1 A ASP 44  ? OD2 ? A ASP 48 OD2 
28  1 Y 1 A LYS 45  ? CG  ? A LYS 49 CG  
29  1 Y 1 A LYS 45  ? CD  ? A LYS 49 CD  
30  1 Y 1 A LYS 45  ? CE  ? A LYS 49 CE  
31  1 Y 1 A LYS 45  ? NZ  ? A LYS 49 NZ  
32  1 Y 1 A ASP 46  ? CG  ? A ASP 50 CG  
33  1 Y 1 A ASP 46  ? OD1 ? A ASP 50 OD1 
34  1 Y 1 A ASP 46  ? OD2 ? A ASP 50 OD2 
35  1 Y 1 A LYS 48  ? CG  ? A LYS 52 CG  
36  1 Y 1 A LYS 48  ? CD  ? A LYS 52 CD  
37  1 Y 1 A LYS 48  ? CE  ? A LYS 52 CE  
38  1 Y 1 A LYS 48  ? NZ  ? A LYS 52 NZ  
39  1 Y 1 A GLN 51  ? CG  ? A GLN 55 CG  
40  1 Y 1 A GLN 51  ? CD  ? A GLN 55 CD  
41  1 Y 1 A GLN 51  ? OE1 ? A GLN 55 OE1 
42  1 Y 1 A GLN 51  ? NE2 ? A GLN 55 NE2 
43  1 Y 1 A ASN 56  ? CG  ? A ASN 60 CG  
44  1 Y 1 A ASN 56  ? OD1 ? A ASN 60 OD1 
45  1 Y 1 A ASN 56  ? ND2 ? A ASN 60 ND2 
46  1 Y 1 A GLU 60  ? CG  ? A GLU 64 CG  
47  1 Y 1 A GLU 60  ? CD  ? A GLU 64 CD  
48  1 Y 1 A GLU 60  ? OE1 ? A GLU 64 OE1 
49  1 Y 1 A GLU 60  ? OE2 ? A GLU 64 OE2 
50  1 Y 1 A ARG 78  ? CG  ? A ARG 82 CG  
51  1 Y 1 A ARG 78  ? CD  ? A ARG 82 CD  
52  1 Y 1 A ARG 78  ? NE  ? A ARG 82 NE  
53  1 Y 1 A ARG 78  ? CZ  ? A ARG 82 CZ  
54  1 Y 1 A ARG 78  ? NH1 ? A ARG 82 NH1 
55  1 Y 1 A ARG 78  ? NH2 ? A ARG 82 NH2 
56  1 Y 1 A PHE 84  ? CG  ? A PHE 88 CG  
57  1 Y 1 A PHE 84  ? CD1 ? A PHE 88 CD1 
58  1 Y 1 A PHE 84  ? CD2 ? A PHE 88 CD2 
59  1 Y 1 A PHE 84  ? CE1 ? A PHE 88 CE1 
60  1 Y 1 A PHE 84  ? CE2 ? A PHE 88 CE2 
61  1 Y 1 A PHE 84  ? CZ  ? A PHE 88 CZ  
62  1 Y 1 D LYS 287 ? CG  ? B LYS 8  CG  
63  1 Y 1 D LYS 287 ? CD  ? B LYS 8  CD  
64  1 Y 1 D LYS 287 ? CE  ? B LYS 8  CE  
65  1 Y 1 D LYS 287 ? NZ  ? B LYS 8  NZ  
66  1 Y 1 D GLU 293 ? CG  ? B GLU 14 CG  
67  1 Y 1 D GLU 293 ? CD  ? B GLU 14 CD  
68  1 Y 1 D GLU 293 ? OE1 ? B GLU 14 OE1 
69  1 Y 1 D GLU 293 ? OE2 ? B GLU 14 OE2 
70  1 Y 1 D GLU 294 ? CG  ? B GLU 15 CG  
71  1 Y 1 D GLU 294 ? CD  ? B GLU 15 CD  
72  1 Y 1 D GLU 294 ? OE1 ? B GLU 15 OE1 
73  1 Y 1 D GLU 294 ? OE2 ? B GLU 15 OE2 
74  1 Y 1 D ASP 297 ? CG  ? B ASP 18 CG  
75  1 Y 1 D ASP 297 ? OD1 ? B ASP 18 OD1 
76  1 Y 1 D ASP 297 ? OD2 ? B ASP 18 OD2 
77  1 Y 1 D LYS 304 ? CG  ? B LYS 25 CG  
78  1 Y 1 D LYS 304 ? CD  ? B LYS 25 CD  
79  1 Y 1 D LYS 304 ? CE  ? B LYS 25 CE  
80  1 Y 1 D LYS 304 ? NZ  ? B LYS 25 NZ  
81  1 Y 1 D LEU 323 ? CG  ? B LEU 44 CG  
82  1 Y 1 D LEU 323 ? CD1 ? B LEU 44 CD1 
83  1 Y 1 D LEU 323 ? CD2 ? B LEU 44 CD2 
84  1 Y 1 D LYS 324 ? CG  ? B LYS 45 CG  
85  1 Y 1 D LYS 324 ? CD  ? B LYS 45 CD  
86  1 Y 1 D LYS 324 ? CE  ? B LYS 45 CE  
87  1 Y 1 D LYS 324 ? NZ  ? B LYS 45 NZ  
88  1 Y 1 B GLU 7   ? CG  ? C GLU 11 CG  
89  1 Y 1 B GLU 7   ? CD  ? C GLU 11 CD  
90  1 Y 1 B GLU 7   ? OE1 ? C GLU 11 OE1 
91  1 Y 1 B GLU 7   ? OE2 ? C GLU 11 OE2 
92  1 Y 1 B ASP 9   ? CG  ? C ASP 13 CG  
93  1 Y 1 B ASP 9   ? OD1 ? C ASP 13 OD1 
94  1 Y 1 B ASP 9   ? OD2 ? C ASP 13 OD2 
95  1 Y 1 B ARG 10  ? CG  ? C ARG 14 CG  
96  1 Y 1 B ARG 10  ? CD  ? C ARG 14 CD  
97  1 Y 1 B ARG 10  ? NE  ? C ARG 14 NE  
98  1 Y 1 B ARG 10  ? CZ  ? C ARG 14 CZ  
99  1 Y 1 B ARG 10  ? NH1 ? C ARG 14 NH1 
100 1 Y 1 B ARG 10  ? NH2 ? C ARG 14 NH2 
101 1 Y 1 B GLU 24  ? CG  ? C GLU 28 CG  
102 1 Y 1 B GLU 24  ? CD  ? C GLU 28 CD  
103 1 Y 1 B GLU 24  ? OE1 ? C GLU 28 OE1 
104 1 Y 1 B GLU 24  ? OE2 ? C GLU 28 OE2 
105 1 Y 1 B LYS 38  ? CG  ? C LYS 42 CG  
106 1 Y 1 B LYS 38  ? CD  ? C LYS 42 CD  
107 1 Y 1 B LYS 38  ? CE  ? C LYS 42 CE  
108 1 Y 1 B LYS 38  ? NZ  ? C LYS 42 NZ  
109 1 Y 1 B LYS 40  ? CG  ? C LYS 44 CG  
110 1 Y 1 B LYS 40  ? CD  ? C LYS 44 CD  
111 1 Y 1 B LYS 40  ? CE  ? C LYS 44 CE  
112 1 Y 1 B LYS 40  ? NZ  ? C LYS 44 NZ  
113 1 Y 1 B LYS 48  ? CG  ? C LYS 52 CG  
114 1 Y 1 B LYS 48  ? CD  ? C LYS 52 CD  
115 1 Y 1 B LYS 48  ? CE  ? C LYS 52 CE  
116 1 Y 1 B LYS 48  ? NZ  ? C LYS 52 NZ  
117 1 Y 1 B LYS 50  ? CG  ? C LYS 54 CG  
118 1 Y 1 B LYS 50  ? CD  ? C LYS 54 CD  
119 1 Y 1 B LYS 50  ? CE  ? C LYS 54 CE  
120 1 Y 1 B LYS 50  ? NZ  ? C LYS 54 NZ  
121 1 Y 1 B GLN 51  ? CG  ? C GLN 55 CG  
122 1 Y 1 B GLN 51  ? CD  ? C GLN 55 CD  
123 1 Y 1 B GLN 51  ? OE1 ? C GLN 55 OE1 
124 1 Y 1 B GLN 51  ? NE2 ? C GLN 55 NE2 
125 1 Y 1 B PHE 52  ? CG  ? C PHE 56 CG  
126 1 Y 1 B PHE 52  ? CD1 ? C PHE 56 CD1 
127 1 Y 1 B PHE 52  ? CD2 ? C PHE 56 CD2 
128 1 Y 1 B PHE 52  ? CE1 ? C PHE 56 CE1 
129 1 Y 1 B PHE 52  ? CE2 ? C PHE 56 CE2 
130 1 Y 1 B PHE 52  ? CZ  ? C PHE 56 CZ  
131 1 Y 1 B LYS 58  ? CG  ? C LYS 62 CG  
132 1 Y 1 B LYS 58  ? CD  ? C LYS 62 CD  
133 1 Y 1 B LYS 58  ? CE  ? C LYS 62 CE  
134 1 Y 1 B LYS 58  ? NZ  ? C LYS 62 NZ  
135 1 Y 1 B GLU 60  ? CG  ? C GLU 64 CG  
136 1 Y 1 B GLU 60  ? CD  ? C GLU 64 CD  
137 1 Y 1 B GLU 60  ? OE1 ? C GLU 64 OE1 
138 1 Y 1 B GLU 60  ? OE2 ? C GLU 64 OE2 
139 1 Y 1 B LYS 81  ? CG  ? C LYS 85 CG  
140 1 Y 1 B LYS 81  ? CD  ? C LYS 85 CD  
141 1 Y 1 B LYS 81  ? CE  ? C LYS 85 CE  
142 1 Y 1 B LYS 81  ? NZ  ? C LYS 85 NZ  
143 1 Y 1 B ARG 85  ? CG  ? C ARG 89 CG  
144 1 Y 1 B ARG 85  ? CD  ? C ARG 89 CD  
145 1 Y 1 B ARG 85  ? NE  ? C ARG 89 NE  
146 1 Y 1 B ARG 85  ? CZ  ? C ARG 89 CZ  
147 1 Y 1 B ARG 85  ? NH1 ? C ARG 89 NH1 
148 1 Y 1 B ARG 85  ? NH2 ? C ARG 89 NH2 
149 1 Y 1 B SER 86  ? OG  ? C SER 90 OG  
150 1 Y 1 C LYS 287 ? CG  ? D LYS 8  CG  
151 1 Y 1 C LYS 287 ? CD  ? D LYS 8  CD  
152 1 Y 1 C LYS 287 ? CE  ? D LYS 8  CE  
153 1 Y 1 C LYS 287 ? NZ  ? D LYS 8  NZ  
154 1 Y 1 C GLU 293 ? CG  ? D GLU 14 CG  
155 1 Y 1 C GLU 293 ? CD  ? D GLU 14 CD  
156 1 Y 1 C GLU 293 ? OE1 ? D GLU 14 OE1 
157 1 Y 1 C GLU 293 ? OE2 ? D GLU 14 OE2 
158 1 Y 1 C GLN 296 ? CG  ? D GLN 17 CG  
159 1 Y 1 C GLN 296 ? CD  ? D GLN 17 CD  
160 1 Y 1 C GLN 296 ? OE1 ? D GLN 17 OE1 
161 1 Y 1 C GLN 296 ? NE2 ? D GLN 17 NE2 
162 1 Y 1 C ASP 297 ? CG  ? D ASP 18 CG  
163 1 Y 1 C ASP 297 ? OD1 ? D ASP 18 OD1 
164 1 Y 1 C ASP 297 ? OD2 ? D ASP 18 OD2 
165 1 Y 1 C THR 302 ? OG1 ? D THR 23 OG1 
166 1 Y 1 C THR 302 ? CG2 ? D THR 23 CG2 
167 1 Y 1 C LYS 304 ? CG  ? D LYS 25 CG  
168 1 Y 1 C LYS 304 ? CD  ? D LYS 25 CD  
169 1 Y 1 C LYS 304 ? CE  ? D LYS 25 CE  
170 1 Y 1 C LYS 304 ? NZ  ? D LYS 25 NZ  
171 1 Y 1 E GLU 7   ? CG  ? E GLU 11 CG  
172 1 Y 1 E GLU 7   ? CD  ? E GLU 11 CD  
173 1 Y 1 E GLU 7   ? OE1 ? E GLU 11 OE1 
174 1 Y 1 E GLU 7   ? OE2 ? E GLU 11 OE2 
175 1 Y 1 E ASP 9   ? CG  ? E ASP 13 CG  
176 1 Y 1 E ASP 9   ? OD1 ? E ASP 13 OD1 
177 1 Y 1 E ASP 9   ? OD2 ? E ASP 13 OD2 
178 1 Y 1 E PHE 13  ? CG  ? E PHE 17 CG  
179 1 Y 1 E PHE 13  ? CD1 ? E PHE 17 CD1 
180 1 Y 1 E PHE 13  ? CD2 ? E PHE 17 CD2 
181 1 Y 1 E PHE 13  ? CE1 ? E PHE 17 CE1 
182 1 Y 1 E PHE 13  ? CE2 ? E PHE 17 CE2 
183 1 Y 1 E PHE 13  ? CZ  ? E PHE 17 CZ  
184 1 Y 1 E GLU 18  ? CG  ? E GLU 22 CG  
185 1 Y 1 E GLU 18  ? CD  ? E GLU 22 CD  
186 1 Y 1 E GLU 18  ? OE1 ? E GLU 22 OE1 
187 1 Y 1 E GLU 18  ? OE2 ? E GLU 22 OE2 
188 1 Y 1 E LYS 20  ? CG  ? E LYS 24 CG  
189 1 Y 1 E LYS 20  ? CD  ? E LYS 24 CD  
190 1 Y 1 E LYS 20  ? CE  ? E LYS 24 CE  
191 1 Y 1 E LYS 20  ? NZ  ? E LYS 24 NZ  
192 1 Y 1 E GLU 23  ? CG  ? E GLU 27 CG  
193 1 Y 1 E GLU 23  ? CD  ? E GLU 27 CD  
194 1 Y 1 E GLU 23  ? OE1 ? E GLU 27 OE1 
195 1 Y 1 E GLU 23  ? OE2 ? E GLU 27 OE2 
196 1 Y 1 E GLU 24  ? CG  ? E GLU 28 CG  
197 1 Y 1 E GLU 24  ? CD  ? E GLU 28 CD  
198 1 Y 1 E GLU 24  ? OE1 ? E GLU 28 OE1 
199 1 Y 1 E GLU 24  ? OE2 ? E GLU 28 OE2 
200 1 Y 1 E LEU 25  ? CG  ? E LEU 29 CG  
201 1 Y 1 E LEU 25  ? CD1 ? E LEU 29 CD1 
202 1 Y 1 E LEU 25  ? CD2 ? E LEU 29 CD2 
203 1 Y 1 E LYS 38  ? CG  ? E LYS 42 CG  
204 1 Y 1 E LYS 38  ? CD  ? E LYS 42 CD  
205 1 Y 1 E LYS 38  ? CE  ? E LYS 42 CE  
206 1 Y 1 E LYS 38  ? NZ  ? E LYS 42 NZ  
207 1 Y 1 E LYS 40  ? CG  ? E LYS 44 CG  
208 1 Y 1 E LYS 40  ? CD  ? E LYS 44 CD  
209 1 Y 1 E LYS 40  ? CE  ? E LYS 44 CE  
210 1 Y 1 E LYS 40  ? NZ  ? E LYS 44 NZ  
211 1 Y 1 E ILE 41  ? CG1 ? E ILE 45 CG1 
212 1 Y 1 E ILE 41  ? CG2 ? E ILE 45 CG2 
213 1 Y 1 E ILE 41  ? CD1 ? E ILE 45 CD1 
214 1 Y 1 E GLN 51  ? CG  ? E GLN 55 CG  
215 1 Y 1 E GLN 51  ? CD  ? E GLN 55 CD  
216 1 Y 1 E GLN 51  ? OE1 ? E GLN 55 OE1 
217 1 Y 1 E GLN 51  ? NE2 ? E GLN 55 NE2 
218 1 Y 1 E GLU 60  ? CG  ? E GLU 64 CG  
219 1 Y 1 E GLU 60  ? CD  ? E GLU 64 CD  
220 1 Y 1 E GLU 60  ? OE1 ? E GLU 64 OE1 
221 1 Y 1 E GLU 60  ? OE2 ? E GLU 64 OE2 
222 1 Y 1 E LYS 74  ? CG  ? E LYS 78 CG  
223 1 Y 1 E LYS 74  ? CD  ? E LYS 78 CD  
224 1 Y 1 E LYS 74  ? CE  ? E LYS 78 CE  
225 1 Y 1 E LYS 74  ? NZ  ? E LYS 78 NZ  
226 1 Y 1 E ARG 78  ? CG  ? E ARG 82 CG  
227 1 Y 1 E ARG 78  ? CD  ? E ARG 82 CD  
228 1 Y 1 E ARG 78  ? NE  ? E ARG 82 NE  
229 1 Y 1 E ARG 78  ? CZ  ? E ARG 82 CZ  
230 1 Y 1 E ARG 78  ? NH1 ? E ARG 82 NH1 
231 1 Y 1 E ARG 78  ? NH2 ? E ARG 82 NH2 
232 1 Y 1 E LYS 81  ? CG  ? E LYS 85 CG  
233 1 Y 1 E LYS 81  ? CD  ? E LYS 85 CD  
234 1 Y 1 E LYS 81  ? CE  ? E LYS 85 CE  
235 1 Y 1 E LYS 81  ? NZ  ? E LYS 85 NZ  
236 1 Y 1 E ILE 82  ? CG1 ? E ILE 86 CG1 
237 1 Y 1 E ILE 82  ? CG2 ? E ILE 86 CG2 
238 1 Y 1 E ILE 82  ? CD1 ? E ILE 86 CD1 
239 1 Y 1 E GLN 83  ? CG  ? E GLN 87 CG  
240 1 Y 1 E GLN 83  ? CD  ? E GLN 87 CD  
241 1 Y 1 E GLN 83  ? OE1 ? E GLN 87 OE1 
242 1 Y 1 E GLN 83  ? NE2 ? E GLN 87 NE2 
243 1 Y 1 E ARG 85  ? CG  ? E ARG 89 CG  
244 1 Y 1 E ARG 85  ? CD  ? E ARG 89 CD  
245 1 Y 1 E ARG 85  ? NE  ? E ARG 89 NE  
246 1 Y 1 E ARG 85  ? CZ  ? E ARG 89 CZ  
247 1 Y 1 E ARG 85  ? NH1 ? E ARG 89 NH1 
248 1 Y 1 E ARG 85  ? NH2 ? E ARG 89 NH2 
249 1 Y 1 E SER 86  ? OG  ? E SER 90 OG  
250 1 Y 1 F LYS 287 ? CG  ? F LYS 8  CG  
251 1 Y 1 F LYS 287 ? CD  ? F LYS 8  CD  
252 1 Y 1 F LYS 287 ? CE  ? F LYS 8  CE  
253 1 Y 1 F LYS 287 ? NZ  ? F LYS 8  NZ  
254 1 Y 1 F GLU 293 ? CG  ? F GLU 14 CG  
255 1 Y 1 F GLU 293 ? CD  ? F GLU 14 CD  
256 1 Y 1 F GLU 293 ? OE1 ? F GLU 14 OE1 
257 1 Y 1 F GLU 293 ? OE2 ? F GLU 14 OE2 
258 1 Y 1 F GLU 294 ? CG  ? F GLU 15 CG  
259 1 Y 1 F GLU 294 ? CD  ? F GLU 15 CD  
260 1 Y 1 F GLU 294 ? OE1 ? F GLU 15 OE1 
261 1 Y 1 F GLU 294 ? OE2 ? F GLU 15 OE2 
262 1 Y 1 F ASP 297 ? CG  ? F ASP 18 CG  
263 1 Y 1 F ASP 297 ? OD1 ? F ASP 18 OD1 
264 1 Y 1 F ASP 297 ? OD2 ? F ASP 18 OD2 
265 1 Y 1 F LEU 299 ? CG  ? F LEU 20 CG  
266 1 Y 1 F LEU 299 ? CD1 ? F LEU 20 CD1 
267 1 Y 1 F LEU 299 ? CD2 ? F LEU 20 CD2 
268 1 Y 1 F VAL 301 ? CG1 ? F VAL 22 CG1 
269 1 Y 1 F VAL 301 ? CG2 ? F VAL 22 CG2 
270 1 Y 1 F LYS 304 ? CG  ? F LYS 25 CG  
271 1 Y 1 F LYS 304 ? CD  ? F LYS 25 CD  
272 1 Y 1 F LYS 304 ? CE  ? F LYS 25 CE  
273 1 Y 1 F LYS 304 ? NZ  ? F LYS 25 NZ  
274 1 Y 1 F SER 305 ? OG  ? F SER 26 OG  
275 1 Y 1 G GLU 7   ? CG  ? G GLU 11 CG  
276 1 Y 1 G GLU 7   ? CD  ? G GLU 11 CD  
277 1 Y 1 G GLU 7   ? OE1 ? G GLU 11 OE1 
278 1 Y 1 G GLU 7   ? OE2 ? G GLU 11 OE2 
279 1 Y 1 G ASP 9   ? CG  ? G ASP 13 CG  
280 1 Y 1 G ASP 9   ? OD1 ? G ASP 13 OD1 
281 1 Y 1 G ASP 9   ? OD2 ? G ASP 13 OD2 
282 1 Y 1 G ARG 10  ? CG  ? G ARG 14 CG  
283 1 Y 1 G ARG 10  ? CD  ? G ARG 14 CD  
284 1 Y 1 G ARG 10  ? NE  ? G ARG 14 NE  
285 1 Y 1 G ARG 10  ? CZ  ? G ARG 14 CZ  
286 1 Y 1 G ARG 10  ? NH1 ? G ARG 14 NH1 
287 1 Y 1 G ARG 10  ? NH2 ? G ARG 14 NH2 
288 1 Y 1 G THR 11  ? OG1 ? G THR 15 OG1 
289 1 Y 1 G THR 11  ? CG2 ? G THR 15 CG2 
290 1 Y 1 G LEU 12  ? CG  ? G LEU 16 CG  
291 1 Y 1 G LEU 12  ? CD1 ? G LEU 16 CD1 
292 1 Y 1 G LEU 12  ? CD2 ? G LEU 16 CD2 
293 1 Y 1 G PHE 13  ? CG  ? G PHE 17 CG  
294 1 Y 1 G PHE 13  ? CD1 ? G PHE 17 CD1 
295 1 Y 1 G PHE 13  ? CD2 ? G PHE 17 CD2 
296 1 Y 1 G PHE 13  ? CE1 ? G PHE 17 CE1 
297 1 Y 1 G PHE 13  ? CE2 ? G PHE 17 CE2 
298 1 Y 1 G PHE 13  ? CZ  ? G PHE 17 CZ  
299 1 Y 1 G VAL 14  ? CG1 ? G VAL 18 CG1 
300 1 Y 1 G VAL 14  ? CG2 ? G VAL 18 CG2 
301 1 Y 1 G LEU 17  ? CG  ? G LEU 21 CG  
302 1 Y 1 G LEU 17  ? CD1 ? G LEU 21 CD1 
303 1 Y 1 G LEU 17  ? CD2 ? G LEU 21 CD2 
304 1 Y 1 G GLU 18  ? CG  ? G GLU 22 CG  
305 1 Y 1 G GLU 18  ? CD  ? G GLU 22 CD  
306 1 Y 1 G GLU 18  ? OE1 ? G GLU 22 OE1 
307 1 Y 1 G GLU 18  ? OE2 ? G GLU 22 OE2 
308 1 Y 1 G THR 19  ? OG1 ? G THR 23 OG1 
309 1 Y 1 G THR 19  ? CG2 ? G THR 23 CG2 
310 1 Y 1 G LYS 20  ? CG  ? G LYS 24 CG  
311 1 Y 1 G LYS 20  ? CD  ? G LYS 24 CD  
312 1 Y 1 G LYS 20  ? CE  ? G LYS 24 CE  
313 1 Y 1 G LYS 20  ? NZ  ? G LYS 24 NZ  
314 1 Y 1 G GLU 23  ? CG  ? G GLU 27 CG  
315 1 Y 1 G GLU 23  ? CD  ? G GLU 27 CD  
316 1 Y 1 G GLU 23  ? OE1 ? G GLU 27 OE1 
317 1 Y 1 G GLU 23  ? OE2 ? G GLU 27 OE2 
318 1 Y 1 G GLU 24  ? CG  ? G GLU 28 CG  
319 1 Y 1 G GLU 24  ? CD  ? G GLU 28 CD  
320 1 Y 1 G GLU 24  ? OE1 ? G GLU 28 OE1 
321 1 Y 1 G GLU 24  ? OE2 ? G GLU 28 OE2 
322 1 Y 1 G ILE 37  ? CG1 ? G ILE 41 CG1 
323 1 Y 1 G ILE 37  ? CG2 ? G ILE 41 CG2 
324 1 Y 1 G ILE 37  ? CD1 ? G ILE 41 CD1 
325 1 Y 1 G LYS 38  ? CG  ? G LYS 42 CG  
326 1 Y 1 G LYS 38  ? CD  ? G LYS 42 CD  
327 1 Y 1 G LYS 38  ? CE  ? G LYS 42 CE  
328 1 Y 1 G LYS 38  ? NZ  ? G LYS 42 NZ  
329 1 Y 1 G LYS 40  ? CG  ? G LYS 44 CG  
330 1 Y 1 G LYS 40  ? CD  ? G LYS 44 CD  
331 1 Y 1 G LYS 40  ? CE  ? G LYS 44 CE  
332 1 Y 1 G LYS 40  ? NZ  ? G LYS 44 NZ  
333 1 Y 1 G PRO 42  ? CG  ? G PRO 46 CG  
334 1 Y 1 G PRO 42  ? CD  ? G PRO 46 CD  
335 1 Y 1 G GLN 51  ? CG  ? G GLN 55 CG  
336 1 Y 1 G GLN 51  ? CD  ? G GLN 55 CD  
337 1 Y 1 G GLN 51  ? OE1 ? G GLN 55 OE1 
338 1 Y 1 G GLN 51  ? NE2 ? G GLN 55 NE2 
339 1 Y 1 G PHE 52  ? CG  ? G PHE 56 CG  
340 1 Y 1 G PHE 52  ? CD1 ? G PHE 56 CD1 
341 1 Y 1 G PHE 52  ? CD2 ? G PHE 56 CD2 
342 1 Y 1 G PHE 52  ? CE1 ? G PHE 56 CE1 
343 1 Y 1 G PHE 52  ? CE2 ? G PHE 56 CE2 
344 1 Y 1 G PHE 52  ? CZ  ? G PHE 56 CZ  
345 1 Y 1 G ASN 56  ? CG  ? G ASN 60 CG  
346 1 Y 1 G ASN 56  ? OD1 ? G ASN 60 OD1 
347 1 Y 1 G ASN 56  ? ND2 ? G ASN 60 ND2 
348 1 Y 1 G LYS 58  ? CG  ? G LYS 62 CG  
349 1 Y 1 G LYS 58  ? CD  ? G LYS 62 CD  
350 1 Y 1 G LYS 58  ? CE  ? G LYS 62 CE  
351 1 Y 1 G LYS 58  ? NZ  ? G LYS 62 NZ  
352 1 Y 1 G GLU 60  ? CG  ? G GLU 64 CG  
353 1 Y 1 G GLU 60  ? CD  ? G GLU 64 CD  
354 1 Y 1 G GLU 60  ? OE1 ? G GLU 64 OE1 
355 1 Y 1 G GLU 60  ? OE2 ? G GLU 64 OE2 
356 1 Y 1 G LYS 74  ? CG  ? G LYS 78 CG  
357 1 Y 1 G LYS 74  ? CD  ? G LYS 78 CD  
358 1 Y 1 G LYS 74  ? CE  ? G LYS 78 CE  
359 1 Y 1 G LYS 74  ? NZ  ? G LYS 78 NZ  
360 1 Y 1 G TYR 76  ? CG  ? G TYR 80 CG  
361 1 Y 1 G TYR 76  ? CD1 ? G TYR 80 CD1 
362 1 Y 1 G TYR 76  ? CD2 ? G TYR 80 CD2 
363 1 Y 1 G TYR 76  ? CE1 ? G TYR 80 CE1 
364 1 Y 1 G TYR 76  ? CE2 ? G TYR 80 CE2 
365 1 Y 1 G TYR 76  ? CZ  ? G TYR 80 CZ  
366 1 Y 1 G TYR 76  ? OH  ? G TYR 80 OH  
367 1 Y 1 G LYS 81  ? CG  ? G LYS 85 CG  
368 1 Y 1 G LYS 81  ? CD  ? G LYS 85 CD  
369 1 Y 1 G LYS 81  ? CE  ? G LYS 85 CE  
370 1 Y 1 G LYS 81  ? NZ  ? G LYS 85 NZ  
371 1 Y 1 G GLN 83  ? CG  ? G GLN 87 CG  
372 1 Y 1 G GLN 83  ? CD  ? G GLN 87 CD  
373 1 Y 1 G GLN 83  ? OE1 ? G GLN 87 OE1 
374 1 Y 1 G GLN 83  ? NE2 ? G GLN 87 NE2 
375 1 Y 1 G PHE 84  ? CG  ? G PHE 88 CG  
376 1 Y 1 G PHE 84  ? CD1 ? G PHE 88 CD1 
377 1 Y 1 G PHE 84  ? CD2 ? G PHE 88 CD2 
378 1 Y 1 G PHE 84  ? CE1 ? G PHE 88 CE1 
379 1 Y 1 G PHE 84  ? CE2 ? G PHE 88 CE2 
380 1 Y 1 G PHE 84  ? CZ  ? G PHE 88 CZ  
381 1 Y 1 G SER 86  ? OG  ? G SER 90 OG  
382 1 Y 1 H ARG 285 ? CG  ? H ARG 6  CG  
383 1 Y 1 H ARG 285 ? CD  ? H ARG 6  CD  
384 1 Y 1 H ARG 285 ? NE  ? H ARG 6  NE  
385 1 Y 1 H ARG 285 ? CZ  ? H ARG 6  CZ  
386 1 Y 1 H ARG 285 ? NH1 ? H ARG 6  NH1 
387 1 Y 1 H ARG 285 ? NH2 ? H ARG 6  NH2 
388 1 Y 1 H LYS 287 ? CG  ? H LYS 8  CG  
389 1 Y 1 H LYS 287 ? CD  ? H LYS 8  CD  
390 1 Y 1 H LYS 287 ? CE  ? H LYS 8  CE  
391 1 Y 1 H LYS 287 ? NZ  ? H LYS 8  NZ  
392 1 Y 1 H GLU 293 ? CG  ? H GLU 14 CG  
393 1 Y 1 H GLU 293 ? CD  ? H GLU 14 CD  
394 1 Y 1 H GLU 293 ? OE1 ? H GLU 14 OE1 
395 1 Y 1 H GLU 293 ? OE2 ? H GLU 14 OE2 
396 1 Y 1 H GLU 294 ? CG  ? H GLU 15 CG  
397 1 Y 1 H GLU 294 ? CD  ? H GLU 15 CD  
398 1 Y 1 H GLU 294 ? OE1 ? H GLU 15 OE1 
399 1 Y 1 H GLU 294 ? OE2 ? H GLU 15 OE2 
400 1 Y 1 H ASP 297 ? CG  ? H ASP 18 CG  
401 1 Y 1 H ASP 297 ? OD1 ? H ASP 18 OD1 
402 1 Y 1 H ASP 297 ? OD2 ? H ASP 18 OD2 
403 1 Y 1 H LYS 304 ? CG  ? H LYS 25 CG  
404 1 Y 1 H LYS 304 ? CD  ? H LYS 25 CD  
405 1 Y 1 H LYS 304 ? CE  ? H LYS 25 CE  
406 1 Y 1 H LYS 304 ? NZ  ? H LYS 25 NZ  
407 1 Y 1 H LYS 324 ? CG  ? H LYS 45 CG  
408 1 Y 1 H LYS 324 ? CD  ? H LYS 45 CD  
409 1 Y 1 H LYS 324 ? CE  ? H LYS 45 CE  
410 1 Y 1 H LYS 324 ? NZ  ? H LYS 45 NZ  
411 1 Y 1 I GLU 7   ? CG  ? I GLU 11 CG  
412 1 Y 1 I GLU 7   ? CD  ? I GLU 11 CD  
413 1 Y 1 I GLU 7   ? OE1 ? I GLU 11 OE1 
414 1 Y 1 I GLU 7   ? OE2 ? I GLU 11 OE2 
415 1 Y 1 I ASP 9   ? CG  ? I ASP 13 CG  
416 1 Y 1 I ASP 9   ? OD1 ? I ASP 13 OD1 
417 1 Y 1 I ASP 9   ? OD2 ? I ASP 13 OD2 
418 1 Y 1 I ARG 10  ? CG  ? I ARG 14 CG  
419 1 Y 1 I ARG 10  ? CD  ? I ARG 14 CD  
420 1 Y 1 I ARG 10  ? NE  ? I ARG 14 NE  
421 1 Y 1 I ARG 10  ? CZ  ? I ARG 14 CZ  
422 1 Y 1 I ARG 10  ? NH1 ? I ARG 14 NH1 
423 1 Y 1 I ARG 10  ? NH2 ? I ARG 14 NH2 
424 1 Y 1 I GLU 23  ? CG  ? I GLU 27 CG  
425 1 Y 1 I GLU 23  ? CD  ? I GLU 27 CD  
426 1 Y 1 I GLU 23  ? OE1 ? I GLU 27 OE1 
427 1 Y 1 I GLU 23  ? OE2 ? I GLU 27 OE2 
428 1 Y 1 I GLU 24  ? CG  ? I GLU 28 CG  
429 1 Y 1 I GLU 24  ? CD  ? I GLU 28 CD  
430 1 Y 1 I GLU 24  ? OE1 ? I GLU 28 OE1 
431 1 Y 1 I GLU 24  ? OE2 ? I GLU 28 OE2 
432 1 Y 1 I GLU 28  ? CG  ? I GLU 32 CG  
433 1 Y 1 I GLU 28  ? CD  ? I GLU 32 CD  
434 1 Y 1 I GLU 28  ? OE1 ? I GLU 32 OE1 
435 1 Y 1 I GLU 28  ? OE2 ? I GLU 32 OE2 
436 1 Y 1 I HIS 31  ? CG  ? I HIS 35 CG  
437 1 Y 1 I HIS 31  ? ND1 ? I HIS 35 ND1 
438 1 Y 1 I HIS 31  ? CD2 ? I HIS 35 CD2 
439 1 Y 1 I HIS 31  ? CE1 ? I HIS 35 CE1 
440 1 Y 1 I HIS 31  ? NE2 ? I HIS 35 NE2 
441 1 Y 1 I LYS 38  ? CG  ? I LYS 42 CG  
442 1 Y 1 I LYS 38  ? CD  ? I LYS 42 CD  
443 1 Y 1 I LYS 38  ? CE  ? I LYS 42 CE  
444 1 Y 1 I LYS 38  ? NZ  ? I LYS 42 NZ  
445 1 Y 1 I LYS 40  ? CG  ? I LYS 44 CG  
446 1 Y 1 I LYS 40  ? CD  ? I LYS 44 CD  
447 1 Y 1 I LYS 40  ? CE  ? I LYS 44 CE  
448 1 Y 1 I LYS 40  ? NZ  ? I LYS 44 NZ  
449 1 Y 1 I ILE 41  ? CG1 ? I ILE 45 CG1 
450 1 Y 1 I ILE 41  ? CG2 ? I ILE 45 CG2 
451 1 Y 1 I ILE 41  ? CD1 ? I ILE 45 CD1 
452 1 Y 1 I PRO 42  ? CG  ? I PRO 46 CG  
453 1 Y 1 I PRO 42  ? CD  ? I PRO 46 CD  
454 1 Y 1 I LYS 45  ? CG  ? I LYS 49 CG  
455 1 Y 1 I LYS 45  ? CD  ? I LYS 49 CD  
456 1 Y 1 I LYS 45  ? CE  ? I LYS 49 CE  
457 1 Y 1 I LYS 45  ? NZ  ? I LYS 49 NZ  
458 1 Y 1 I ASP 46  ? CG  ? I ASP 50 CG  
459 1 Y 1 I ASP 46  ? OD1 ? I ASP 50 OD1 
460 1 Y 1 I ASP 46  ? OD2 ? I ASP 50 OD2 
461 1 Y 1 I LYS 48  ? CG  ? I LYS 52 CG  
462 1 Y 1 I LYS 48  ? CD  ? I LYS 52 CD  
463 1 Y 1 I LYS 48  ? CE  ? I LYS 52 CE  
464 1 Y 1 I LYS 48  ? NZ  ? I LYS 52 NZ  
465 1 Y 1 I PRO 49  ? CG  ? I PRO 53 CG  
466 1 Y 1 I PRO 49  ? CD  ? I PRO 53 CD  
467 1 Y 1 I LYS 50  ? CG  ? I LYS 54 CG  
468 1 Y 1 I LYS 50  ? CD  ? I LYS 54 CD  
469 1 Y 1 I LYS 50  ? CE  ? I LYS 54 CE  
470 1 Y 1 I LYS 50  ? NZ  ? I LYS 54 NZ  
471 1 Y 1 I GLN 51  ? CG  ? I GLN 55 CG  
472 1 Y 1 I GLN 51  ? CD  ? I GLN 55 CD  
473 1 Y 1 I GLN 51  ? OE1 ? I GLN 55 OE1 
474 1 Y 1 I GLN 51  ? NE2 ? I GLN 55 NE2 
475 1 Y 1 I PHE 52  ? CG  ? I PHE 56 CG  
476 1 Y 1 I PHE 52  ? CD1 ? I PHE 56 CD1 
477 1 Y 1 I PHE 52  ? CD2 ? I PHE 56 CD2 
478 1 Y 1 I PHE 52  ? CE1 ? I PHE 56 CE1 
479 1 Y 1 I PHE 52  ? CE2 ? I PHE 56 CE2 
480 1 Y 1 I PHE 52  ? CZ  ? I PHE 56 CZ  
481 1 Y 1 I VAL 55  ? CG1 ? I VAL 59 CG1 
482 1 Y 1 I VAL 55  ? CG2 ? I VAL 59 CG2 
483 1 Y 1 I ASN 56  ? CG  ? I ASN 60 CG  
484 1 Y 1 I ASN 56  ? OD1 ? I ASN 60 OD1 
485 1 Y 1 I ASN 56  ? ND2 ? I ASN 60 ND2 
486 1 Y 1 I GLU 60  ? CG  ? I GLU 64 CG  
487 1 Y 1 I GLU 60  ? CD  ? I GLU 64 CD  
488 1 Y 1 I GLU 60  ? OE1 ? I GLU 64 OE1 
489 1 Y 1 I GLU 60  ? OE2 ? I GLU 64 OE2 
490 1 Y 1 I VAL 61  ? CG1 ? I VAL 65 CG1 
491 1 Y 1 I VAL 61  ? CG2 ? I VAL 65 CG2 
492 1 Y 1 I VAL 63  ? CG1 ? I VAL 67 CG1 
493 1 Y 1 I VAL 63  ? CG2 ? I VAL 67 CG2 
494 1 Y 1 I ASN 68  ? CG  ? I ASN 72 CG  
495 1 Y 1 I ASN 68  ? OD1 ? I ASN 72 OD1 
496 1 Y 1 I ASN 68  ? ND2 ? I ASN 72 ND2 
497 1 Y 1 I LYS 74  ? CG  ? I LYS 78 CG  
498 1 Y 1 I LYS 74  ? CD  ? I LYS 78 CD  
499 1 Y 1 I LYS 74  ? CE  ? I LYS 78 CE  
500 1 Y 1 I LYS 74  ? NZ  ? I LYS 78 NZ  
501 1 Y 1 I LYS 81  ? CG  ? I LYS 85 CG  
502 1 Y 1 I LYS 81  ? CD  ? I LYS 85 CD  
503 1 Y 1 I LYS 81  ? CE  ? I LYS 85 CE  
504 1 Y 1 I LYS 81  ? NZ  ? I LYS 85 NZ  
505 1 Y 1 I ARG 85  ? CG  ? I ARG 89 CG  
506 1 Y 1 I ARG 85  ? CD  ? I ARG 89 CD  
507 1 Y 1 I ARG 85  ? NE  ? I ARG 89 NE  
508 1 Y 1 I ARG 85  ? CZ  ? I ARG 89 CZ  
509 1 Y 1 I ARG 85  ? NH1 ? I ARG 89 NH1 
510 1 Y 1 I ARG 85  ? NH2 ? I ARG 89 NH2 
511 1 Y 1 I SER 86  ? OG  ? I SER 90 OG  
512 1 Y 1 J LYS 287 ? CG  ? J LYS 8  CG  
513 1 Y 1 J LYS 287 ? CD  ? J LYS 8  CD  
514 1 Y 1 J LYS 287 ? CE  ? J LYS 8  CE  
515 1 Y 1 J LYS 287 ? NZ  ? J LYS 8  NZ  
516 1 Y 1 J VAL 290 ? CG1 ? J VAL 11 CG1 
517 1 Y 1 J VAL 290 ? CG2 ? J VAL 11 CG2 
518 1 Y 1 J GLU 293 ? CG  ? J GLU 14 CG  
519 1 Y 1 J GLU 293 ? CD  ? J GLU 14 CD  
520 1 Y 1 J GLU 293 ? OE1 ? J GLU 14 OE1 
521 1 Y 1 J GLU 293 ? OE2 ? J GLU 14 OE2 
522 1 Y 1 J GLU 294 ? CG  ? J GLU 15 CG  
523 1 Y 1 J GLU 294 ? CD  ? J GLU 15 CD  
524 1 Y 1 J GLU 294 ? OE1 ? J GLU 15 OE1 
525 1 Y 1 J GLU 294 ? OE2 ? J GLU 15 OE2 
526 1 Y 1 J GLN 296 ? CG  ? J GLN 17 CG  
527 1 Y 1 J GLN 296 ? CD  ? J GLN 17 CD  
528 1 Y 1 J GLN 296 ? OE1 ? J GLN 17 OE1 
529 1 Y 1 J GLN 296 ? NE2 ? J GLN 17 NE2 
530 1 Y 1 J ASP 297 ? CG  ? J ASP 18 CG  
531 1 Y 1 J ASP 297 ? OD1 ? J ASP 18 OD1 
532 1 Y 1 J ASP 297 ? OD2 ? J ASP 18 OD2 
533 1 Y 1 J THR 302 ? OG1 ? J THR 23 OG1 
534 1 Y 1 J THR 302 ? CG2 ? J THR 23 CG2 
535 1 Y 1 J ASP 303 ? CG  ? J ASP 24 CG  
536 1 Y 1 J ASP 303 ? OD1 ? J ASP 24 OD1 
537 1 Y 1 J ASP 303 ? OD2 ? J ASP 24 OD2 
538 1 Y 1 J LYS 304 ? CG  ? J LYS 25 CG  
539 1 Y 1 J LYS 304 ? CD  ? J LYS 25 CD  
540 1 Y 1 J LYS 304 ? CE  ? J LYS 25 CE  
541 1 Y 1 J LYS 304 ? NZ  ? J LYS 25 NZ  
542 1 Y 1 J TYR 318 ? CG  ? J TYR 39 CG  
543 1 Y 1 J TYR 318 ? CD1 ? J TYR 39 CD1 
544 1 Y 1 J TYR 318 ? CD2 ? J TYR 39 CD2 
545 1 Y 1 J TYR 318 ? CE1 ? J TYR 39 CE1 
546 1 Y 1 J TYR 318 ? CE2 ? J TYR 39 CE2 
547 1 Y 1 J TYR 318 ? CZ  ? J TYR 39 CZ  
548 1 Y 1 J TYR 318 ? OH  ? J TYR 39 OH  
549 1 Y 1 J PRO 320 ? CG  ? J PRO 41 CG  
550 1 Y 1 J PRO 320 ? CD  ? J PRO 41 CD  
551 1 Y 1 J LEU 323 ? CG  ? J LEU 44 CG  
552 1 Y 1 J LEU 323 ? CD1 ? J LEU 44 CD1 
553 1 Y 1 J LEU 323 ? CD2 ? J LEU 44 CD2 
554 1 Y 1 K ASP 9   ? CG  ? K ASP 13 CG  
555 1 Y 1 K ASP 9   ? OD1 ? K ASP 13 OD1 
556 1 Y 1 K ASP 9   ? OD2 ? K ASP 13 OD2 
557 1 Y 1 K ARG 10  ? CG  ? K ARG 14 CG  
558 1 Y 1 K ARG 10  ? CD  ? K ARG 14 CD  
559 1 Y 1 K ARG 10  ? NE  ? K ARG 14 NE  
560 1 Y 1 K ARG 10  ? CZ  ? K ARG 14 CZ  
561 1 Y 1 K ARG 10  ? NH1 ? K ARG 14 NH1 
562 1 Y 1 K ARG 10  ? NH2 ? K ARG 14 NH2 
563 1 Y 1 K THR 11  ? OG1 ? K THR 15 OG1 
564 1 Y 1 K THR 11  ? CG2 ? K THR 15 CG2 
565 1 Y 1 K LEU 12  ? CG  ? K LEU 16 CG  
566 1 Y 1 K LEU 12  ? CD1 ? K LEU 16 CD1 
567 1 Y 1 K LEU 12  ? CD2 ? K LEU 16 CD2 
568 1 Y 1 K VAL 14  ? CG1 ? K VAL 18 CG1 
569 1 Y 1 K VAL 14  ? CG2 ? K VAL 18 CG2 
570 1 Y 1 K LEU 17  ? CG  ? K LEU 21 CG  
571 1 Y 1 K LEU 17  ? CD1 ? K LEU 21 CD1 
572 1 Y 1 K LEU 17  ? CD2 ? K LEU 21 CD2 
573 1 Y 1 K GLU 18  ? CG  ? K GLU 22 CG  
574 1 Y 1 K GLU 18  ? CD  ? K GLU 22 CD  
575 1 Y 1 K GLU 18  ? OE1 ? K GLU 22 OE1 
576 1 Y 1 K GLU 18  ? OE2 ? K GLU 22 OE2 
577 1 Y 1 K THR 19  ? OG1 ? K THR 23 OG1 
578 1 Y 1 K THR 19  ? CG2 ? K THR 23 CG2 
579 1 Y 1 K VAL 21  ? CG1 ? K VAL 25 CG1 
580 1 Y 1 K VAL 21  ? CG2 ? K VAL 25 CG2 
581 1 Y 1 K GLU 23  ? CG  ? K GLU 27 CG  
582 1 Y 1 K GLU 23  ? CD  ? K GLU 27 CD  
583 1 Y 1 K GLU 23  ? OE1 ? K GLU 27 OE1 
584 1 Y 1 K GLU 23  ? OE2 ? K GLU 27 OE2 
585 1 Y 1 K GLU 24  ? CG  ? K GLU 28 CG  
586 1 Y 1 K GLU 24  ? CD  ? K GLU 28 CD  
587 1 Y 1 K GLU 24  ? OE1 ? K GLU 28 OE1 
588 1 Y 1 K GLU 24  ? OE2 ? K GLU 28 OE2 
589 1 Y 1 K LEU 26  ? CG  ? K LEU 30 CG  
590 1 Y 1 K LEU 26  ? CD1 ? K LEU 30 CD1 
591 1 Y 1 K LEU 26  ? CD2 ? K LEU 30 CD2 
592 1 Y 1 K GLU 28  ? CG  ? K GLU 32 CG  
593 1 Y 1 K GLU 28  ? CD  ? K GLU 32 CD  
594 1 Y 1 K GLU 28  ? OE1 ? K GLU 32 OE1 
595 1 Y 1 K GLU 28  ? OE2 ? K GLU 32 OE2 
596 1 Y 1 K ILE 37  ? CG1 ? K ILE 41 CG1 
597 1 Y 1 K ILE 37  ? CG2 ? K ILE 41 CG2 
598 1 Y 1 K ILE 37  ? CD1 ? K ILE 41 CD1 
599 1 Y 1 K LYS 38  ? CG  ? K LYS 42 CG  
600 1 Y 1 K LYS 38  ? CD  ? K LYS 42 CD  
601 1 Y 1 K LYS 38  ? CE  ? K LYS 42 CE  
602 1 Y 1 K LYS 38  ? NZ  ? K LYS 42 NZ  
603 1 Y 1 K VAL 39  ? CG1 ? K VAL 43 CG1 
604 1 Y 1 K VAL 39  ? CG2 ? K VAL 43 CG2 
605 1 Y 1 K LYS 40  ? CG  ? K LYS 44 CG  
606 1 Y 1 K LYS 40  ? CD  ? K LYS 44 CD  
607 1 Y 1 K LYS 40  ? CE  ? K LYS 44 CE  
608 1 Y 1 K LYS 40  ? NZ  ? K LYS 44 NZ  
609 1 Y 1 K LYS 48  ? CG  ? K LYS 52 CG  
610 1 Y 1 K LYS 48  ? CD  ? K LYS 52 CD  
611 1 Y 1 K LYS 48  ? CE  ? K LYS 52 CE  
612 1 Y 1 K LYS 48  ? NZ  ? K LYS 52 NZ  
613 1 Y 1 K LYS 50  ? CG  ? K LYS 54 CG  
614 1 Y 1 K LYS 50  ? CD  ? K LYS 54 CD  
615 1 Y 1 K LYS 50  ? CE  ? K LYS 54 CE  
616 1 Y 1 K LYS 50  ? NZ  ? K LYS 54 NZ  
617 1 Y 1 K GLN 51  ? CG  ? K GLN 55 CG  
618 1 Y 1 K GLN 51  ? CD  ? K GLN 55 CD  
619 1 Y 1 K GLN 51  ? OE1 ? K GLN 55 OE1 
620 1 Y 1 K GLN 51  ? NE2 ? K GLN 55 NE2 
621 1 Y 1 K PHE 54  ? CG  ? K PHE 58 CG  
622 1 Y 1 K PHE 54  ? CD1 ? K PHE 58 CD1 
623 1 Y 1 K PHE 54  ? CD2 ? K PHE 58 CD2 
624 1 Y 1 K PHE 54  ? CE1 ? K PHE 58 CE1 
625 1 Y 1 K PHE 54  ? CE2 ? K PHE 58 CE2 
626 1 Y 1 K PHE 54  ? CZ  ? K PHE 58 CZ  
627 1 Y 1 K VAL 55  ? CG1 ? K VAL 59 CG1 
628 1 Y 1 K VAL 55  ? CG2 ? K VAL 59 CG2 
629 1 Y 1 K ASN 56  ? CG  ? K ASN 60 CG  
630 1 Y 1 K ASN 56  ? OD1 ? K ASN 60 OD1 
631 1 Y 1 K ASN 56  ? ND2 ? K ASN 60 ND2 
632 1 Y 1 K LYS 58  ? CG  ? K LYS 62 CG  
633 1 Y 1 K LYS 58  ? CD  ? K LYS 62 CD  
634 1 Y 1 K LYS 58  ? CE  ? K LYS 62 CE  
635 1 Y 1 K LYS 58  ? NZ  ? K LYS 62 NZ  
636 1 Y 1 K VAL 61  ? CG1 ? K VAL 65 CG1 
637 1 Y 1 K VAL 61  ? CG2 ? K VAL 65 CG2 
638 1 Y 1 K LYS 74  ? CG  ? K LYS 78 CG  
639 1 Y 1 K LYS 74  ? CD  ? K LYS 78 CD  
640 1 Y 1 K LYS 74  ? CE  ? K LYS 78 CE  
641 1 Y 1 K LYS 74  ? NZ  ? K LYS 78 NZ  
642 1 Y 1 K ARG 78  ? CG  ? K ARG 82 CG  
643 1 Y 1 K ARG 78  ? CD  ? K ARG 82 CD  
644 1 Y 1 K ARG 78  ? NE  ? K ARG 82 NE  
645 1 Y 1 K ARG 78  ? CZ  ? K ARG 82 CZ  
646 1 Y 1 K ARG 78  ? NH1 ? K ARG 82 NH1 
647 1 Y 1 K ARG 78  ? NH2 ? K ARG 82 NH2 
648 1 Y 1 K LYS 81  ? CG  ? K LYS 85 CG  
649 1 Y 1 K LYS 81  ? CD  ? K LYS 85 CD  
650 1 Y 1 K LYS 81  ? CE  ? K LYS 85 CE  
651 1 Y 1 K LYS 81  ? NZ  ? K LYS 85 NZ  
652 1 Y 1 K PHE 84  ? CG  ? K PHE 88 CG  
653 1 Y 1 K PHE 84  ? CD1 ? K PHE 88 CD1 
654 1 Y 1 K PHE 84  ? CD2 ? K PHE 88 CD2 
655 1 Y 1 K PHE 84  ? CE1 ? K PHE 88 CE1 
656 1 Y 1 K PHE 84  ? CE2 ? K PHE 88 CE2 
657 1 Y 1 K PHE 84  ? CZ  ? K PHE 88 CZ  
658 1 Y 1 K ARG 85  ? CG  ? K ARG 89 CG  
659 1 Y 1 K ARG 85  ? CD  ? K ARG 89 CD  
660 1 Y 1 K ARG 85  ? NE  ? K ARG 89 NE  
661 1 Y 1 K ARG 85  ? CZ  ? K ARG 89 CZ  
662 1 Y 1 K ARG 85  ? NH1 ? K ARG 89 NH1 
663 1 Y 1 K ARG 85  ? NH2 ? K ARG 89 NH2 
664 1 Y 1 K SER 86  ? OG  ? K SER 90 OG  
665 1 Y 1 L LYS 287 ? CG  ? L LYS 8  CG  
666 1 Y 1 L LYS 287 ? CD  ? L LYS 8  CD  
667 1 Y 1 L LYS 287 ? CE  ? L LYS 8  CE  
668 1 Y 1 L LYS 287 ? NZ  ? L LYS 8  NZ  
669 1 Y 1 L GLU 293 ? CG  ? L GLU 14 CG  
670 1 Y 1 L GLU 293 ? CD  ? L GLU 14 CD  
671 1 Y 1 L GLU 293 ? OE1 ? L GLU 14 OE1 
672 1 Y 1 L GLU 293 ? OE2 ? L GLU 14 OE2 
673 1 Y 1 L GLU 294 ? CG  ? L GLU 15 CG  
674 1 Y 1 L GLU 294 ? CD  ? L GLU 15 CD  
675 1 Y 1 L GLU 294 ? OE1 ? L GLU 15 OE1 
676 1 Y 1 L GLU 294 ? OE2 ? L GLU 15 OE2 
677 1 Y 1 L LEU 295 ? CG  ? L LEU 16 CG  
678 1 Y 1 L LEU 295 ? CD1 ? L LEU 16 CD1 
679 1 Y 1 L LEU 295 ? CD2 ? L LEU 16 CD2 
680 1 Y 1 L ASP 297 ? CG  ? L ASP 18 CG  
681 1 Y 1 L ASP 297 ? OD1 ? L ASP 18 OD1 
682 1 Y 1 L ASP 297 ? OD2 ? L ASP 18 OD2 
683 1 Y 1 L ASP 303 ? CG  ? L ASP 24 CG  
684 1 Y 1 L ASP 303 ? OD1 ? L ASP 24 OD1 
685 1 Y 1 L ASP 303 ? OD2 ? L ASP 24 OD2 
686 1 Y 1 L LYS 304 ? CG  ? L LYS 25 CG  
687 1 Y 1 L LYS 304 ? CD  ? L LYS 25 CD  
688 1 Y 1 L LYS 304 ? CE  ? L LYS 25 CE  
689 1 Y 1 L LYS 304 ? NZ  ? L LYS 25 NZ  
690 1 Y 1 L SER 305 ? OG  ? L SER 26 OG  
691 1 Y 1 L PHE 309 ? CG  ? L PHE 30 CG  
692 1 Y 1 L PHE 309 ? CD1 ? L PHE 30 CD1 
693 1 Y 1 L PHE 309 ? CD2 ? L PHE 30 CD2 
694 1 Y 1 L PHE 309 ? CE1 ? L PHE 30 CE1 
695 1 Y 1 L PHE 309 ? CE2 ? L PHE 30 CE2 
696 1 Y 1 L PHE 309 ? CZ  ? L PHE 30 CZ  
697 1 Y 1 L ILE 310 ? CG1 ? L ILE 31 CG1 
698 1 Y 1 L ILE 310 ? CG2 ? L ILE 31 CG2 
699 1 Y 1 L ILE 310 ? CD1 ? L ILE 31 CD1 
700 1 Y 1 L ARG 312 ? CG  ? L ARG 33 CG  
701 1 Y 1 L ARG 312 ? CD  ? L ARG 33 CD  
702 1 Y 1 L ARG 312 ? NE  ? L ARG 33 NE  
703 1 Y 1 L ARG 312 ? CZ  ? L ARG 33 CZ  
704 1 Y 1 L ARG 312 ? NH1 ? L ARG 33 NH1 
705 1 Y 1 L ARG 312 ? NH2 ? L ARG 33 NH2 
706 1 Y 1 L ARG 314 ? CG  ? L ARG 35 CG  
707 1 Y 1 L ARG 314 ? CD  ? L ARG 35 CD  
708 1 Y 1 L ARG 314 ? NE  ? L ARG 35 NE  
709 1 Y 1 L ARG 314 ? CZ  ? L ARG 35 CZ  
710 1 Y 1 L ARG 314 ? NH1 ? L ARG 35 NH1 
711 1 Y 1 L ARG 314 ? NH2 ? L ARG 35 NH2 
712 1 Y 1 M GLU 7   ? CG  ? M GLU 11 CG  
713 1 Y 1 M GLU 7   ? CD  ? M GLU 11 CD  
714 1 Y 1 M GLU 7   ? OE1 ? M GLU 11 OE1 
715 1 Y 1 M GLU 7   ? OE2 ? M GLU 11 OE2 
716 1 Y 1 M ASP 9   ? CG  ? M ASP 13 CG  
717 1 Y 1 M ASP 9   ? OD1 ? M ASP 13 OD1 
718 1 Y 1 M ASP 9   ? OD2 ? M ASP 13 OD2 
719 1 Y 1 M ARG 10  ? CG  ? M ARG 14 CG  
720 1 Y 1 M ARG 10  ? CD  ? M ARG 14 CD  
721 1 Y 1 M ARG 10  ? NE  ? M ARG 14 NE  
722 1 Y 1 M ARG 10  ? CZ  ? M ARG 14 CZ  
723 1 Y 1 M ARG 10  ? NH1 ? M ARG 14 NH1 
724 1 Y 1 M ARG 10  ? NH2 ? M ARG 14 NH2 
725 1 Y 1 M THR 11  ? OG1 ? M THR 15 OG1 
726 1 Y 1 M THR 11  ? CG2 ? M THR 15 CG2 
727 1 Y 1 M LEU 12  ? CG  ? M LEU 16 CG  
728 1 Y 1 M LEU 12  ? CD1 ? M LEU 16 CD1 
729 1 Y 1 M LEU 12  ? CD2 ? M LEU 16 CD2 
730 1 Y 1 M PHE 13  ? CG  ? M PHE 17 CG  
731 1 Y 1 M PHE 13  ? CD1 ? M PHE 17 CD1 
732 1 Y 1 M PHE 13  ? CD2 ? M PHE 17 CD2 
733 1 Y 1 M PHE 13  ? CE1 ? M PHE 17 CE1 
734 1 Y 1 M PHE 13  ? CE2 ? M PHE 17 CE2 
735 1 Y 1 M PHE 13  ? CZ  ? M PHE 17 CZ  
736 1 Y 1 M VAL 14  ? CG1 ? M VAL 18 CG1 
737 1 Y 1 M VAL 14  ? CG2 ? M VAL 18 CG2 
738 1 Y 1 M THR 19  ? OG1 ? M THR 23 OG1 
739 1 Y 1 M THR 19  ? CG2 ? M THR 23 CG2 
740 1 Y 1 M LYS 20  ? CG  ? M LYS 24 CG  
741 1 Y 1 M LYS 20  ? CD  ? M LYS 24 CD  
742 1 Y 1 M LYS 20  ? CE  ? M LYS 24 CE  
743 1 Y 1 M LYS 20  ? NZ  ? M LYS 24 NZ  
744 1 Y 1 M VAL 21  ? CG1 ? M VAL 25 CG1 
745 1 Y 1 M VAL 21  ? CG2 ? M VAL 25 CG2 
746 1 Y 1 M GLU 23  ? CG  ? M GLU 27 CG  
747 1 Y 1 M GLU 23  ? CD  ? M GLU 27 CD  
748 1 Y 1 M GLU 23  ? OE1 ? M GLU 27 OE1 
749 1 Y 1 M GLU 23  ? OE2 ? M GLU 27 OE2 
750 1 Y 1 M LEU 25  ? CG  ? M LEU 29 CG  
751 1 Y 1 M LEU 25  ? CD1 ? M LEU 29 CD1 
752 1 Y 1 M LEU 25  ? CD2 ? M LEU 29 CD2 
753 1 Y 1 M LEU 26  ? CG  ? M LEU 30 CG  
754 1 Y 1 M LEU 26  ? CD1 ? M LEU 30 CD1 
755 1 Y 1 M LEU 26  ? CD2 ? M LEU 30 CD2 
756 1 Y 1 M PHE 27  ? CG  ? M PHE 31 CG  
757 1 Y 1 M PHE 27  ? CD1 ? M PHE 31 CD1 
758 1 Y 1 M PHE 27  ? CD2 ? M PHE 31 CD2 
759 1 Y 1 M PHE 27  ? CE1 ? M PHE 31 CE1 
760 1 Y 1 M PHE 27  ? CE2 ? M PHE 31 CE2 
761 1 Y 1 M PHE 27  ? CZ  ? M PHE 31 CZ  
762 1 Y 1 M HIS 31  ? CG  ? M HIS 35 CG  
763 1 Y 1 M HIS 31  ? ND1 ? M HIS 35 ND1 
764 1 Y 1 M HIS 31  ? CD2 ? M HIS 35 CD2 
765 1 Y 1 M HIS 31  ? CE1 ? M HIS 35 CE1 
766 1 Y 1 M HIS 31  ? NE2 ? M HIS 35 NE2 
767 1 Y 1 M VAL 36  ? CG1 ? M VAL 40 CG1 
768 1 Y 1 M VAL 36  ? CG2 ? M VAL 40 CG2 
769 1 Y 1 M ILE 37  ? CG1 ? M ILE 41 CG1 
770 1 Y 1 M ILE 37  ? CG2 ? M ILE 41 CG2 
771 1 Y 1 M ILE 37  ? CD1 ? M ILE 41 CD1 
772 1 Y 1 M LYS 38  ? CG  ? M LYS 42 CG  
773 1 Y 1 M LYS 38  ? CD  ? M LYS 42 CD  
774 1 Y 1 M LYS 38  ? CE  ? M LYS 42 CE  
775 1 Y 1 M LYS 38  ? NZ  ? M LYS 42 NZ  
776 1 Y 1 M GLN 51  ? CG  ? M GLN 55 CG  
777 1 Y 1 M GLN 51  ? CD  ? M GLN 55 CD  
778 1 Y 1 M GLN 51  ? OE1 ? M GLN 55 OE1 
779 1 Y 1 M GLN 51  ? NE2 ? M GLN 55 NE2 
780 1 Y 1 M PHE 52  ? CG  ? M PHE 56 CG  
781 1 Y 1 M PHE 52  ? CD1 ? M PHE 56 CD1 
782 1 Y 1 M PHE 52  ? CD2 ? M PHE 56 CD2 
783 1 Y 1 M PHE 52  ? CE1 ? M PHE 56 CE1 
784 1 Y 1 M PHE 52  ? CE2 ? M PHE 56 CE2 
785 1 Y 1 M PHE 52  ? CZ  ? M PHE 56 CZ  
786 1 Y 1 M PHE 54  ? CG  ? M PHE 58 CG  
787 1 Y 1 M PHE 54  ? CD1 ? M PHE 58 CD1 
788 1 Y 1 M PHE 54  ? CD2 ? M PHE 58 CD2 
789 1 Y 1 M PHE 54  ? CE1 ? M PHE 58 CE1 
790 1 Y 1 M PHE 54  ? CE2 ? M PHE 58 CE2 
791 1 Y 1 M PHE 54  ? CZ  ? M PHE 58 CZ  
792 1 Y 1 M ASN 56  ? CG  ? M ASN 60 CG  
793 1 Y 1 M ASN 56  ? OD1 ? M ASN 60 OD1 
794 1 Y 1 M ASN 56  ? ND2 ? M ASN 60 ND2 
795 1 Y 1 M LYS 58  ? CG  ? M LYS 62 CG  
796 1 Y 1 M LYS 58  ? CD  ? M LYS 62 CD  
797 1 Y 1 M LYS 58  ? CE  ? M LYS 62 CE  
798 1 Y 1 M LYS 58  ? NZ  ? M LYS 62 NZ  
799 1 Y 1 M GLU 60  ? CG  ? M GLU 64 CG  
800 1 Y 1 M GLU 60  ? CD  ? M GLU 64 CD  
801 1 Y 1 M GLU 60  ? OE1 ? M GLU 64 OE1 
802 1 Y 1 M GLU 60  ? OE2 ? M GLU 64 OE2 
803 1 Y 1 M VAL 63  ? CG1 ? M VAL 67 CG1 
804 1 Y 1 M VAL 63  ? CG2 ? M VAL 67 CG2 
805 1 Y 1 M LEU 69  ? CG  ? M LEU 73 CG  
806 1 Y 1 M LEU 69  ? CD1 ? M LEU 73 CD1 
807 1 Y 1 M LEU 69  ? CD2 ? M LEU 73 CD2 
808 1 Y 1 M LEU 75  ? CG  ? M LEU 79 CG  
809 1 Y 1 M LEU 75  ? CD1 ? M LEU 79 CD1 
810 1 Y 1 M LEU 75  ? CD2 ? M LEU 79 CD2 
811 1 Y 1 M ILE 80  ? CG1 ? M ILE 84 CG1 
812 1 Y 1 M ILE 80  ? CG2 ? M ILE 84 CG2 
813 1 Y 1 M ILE 80  ? CD1 ? M ILE 84 CD1 
814 1 Y 1 M LYS 81  ? CG  ? M LYS 85 CG  
815 1 Y 1 M LYS 81  ? CD  ? M LYS 85 CD  
816 1 Y 1 M LYS 81  ? CE  ? M LYS 85 CE  
817 1 Y 1 M LYS 81  ? NZ  ? M LYS 85 NZ  
818 1 Y 1 M ILE 82  ? CG1 ? M ILE 86 CG1 
819 1 Y 1 M ILE 82  ? CG2 ? M ILE 86 CG2 
820 1 Y 1 M ILE 82  ? CD1 ? M ILE 86 CD1 
821 1 Y 1 M GLN 83  ? CG  ? M GLN 87 CG  
822 1 Y 1 M GLN 83  ? CD  ? M GLN 87 CD  
823 1 Y 1 M GLN 83  ? OE1 ? M GLN 87 OE1 
824 1 Y 1 M GLN 83  ? NE2 ? M GLN 87 NE2 
825 1 Y 1 M PHE 84  ? CG  ? M PHE 88 CG  
826 1 Y 1 M PHE 84  ? CD1 ? M PHE 88 CD1 
827 1 Y 1 M PHE 84  ? CD2 ? M PHE 88 CD2 
828 1 Y 1 M PHE 84  ? CE1 ? M PHE 88 CE1 
829 1 Y 1 M PHE 84  ? CE2 ? M PHE 88 CE2 
830 1 Y 1 M PHE 84  ? CZ  ? M PHE 88 CZ  
831 1 Y 1 M ARG 85  ? CG  ? M ARG 89 CG  
832 1 Y 1 M ARG 85  ? CD  ? M ARG 89 CD  
833 1 Y 1 M ARG 85  ? NE  ? M ARG 89 NE  
834 1 Y 1 M ARG 85  ? CZ  ? M ARG 89 CZ  
835 1 Y 1 M ARG 85  ? NH1 ? M ARG 89 NH1 
836 1 Y 1 M ARG 85  ? NH2 ? M ARG 89 NH2 
837 1 Y 1 N LYS 287 ? CG  ? N LYS 8  CG  
838 1 Y 1 N LYS 287 ? CD  ? N LYS 8  CD  
839 1 Y 1 N LYS 287 ? CE  ? N LYS 8  CE  
840 1 Y 1 N LYS 287 ? NZ  ? N LYS 8  NZ  
841 1 Y 1 N VAL 290 ? CG1 ? N VAL 11 CG1 
842 1 Y 1 N VAL 290 ? CG2 ? N VAL 11 CG2 
843 1 Y 1 N ILE 291 ? CG1 ? N ILE 12 CG1 
844 1 Y 1 N ILE 291 ? CG2 ? N ILE 12 CG2 
845 1 Y 1 N ILE 291 ? CD1 ? N ILE 12 CD1 
846 1 Y 1 N GLU 293 ? CG  ? N GLU 14 CG  
847 1 Y 1 N GLU 293 ? CD  ? N GLU 14 CD  
848 1 Y 1 N GLU 293 ? OE1 ? N GLU 14 OE1 
849 1 Y 1 N GLU 293 ? OE2 ? N GLU 14 OE2 
850 1 Y 1 N GLU 294 ? CG  ? N GLU 15 CG  
851 1 Y 1 N GLU 294 ? CD  ? N GLU 15 CD  
852 1 Y 1 N GLU 294 ? OE1 ? N GLU 15 OE1 
853 1 Y 1 N GLU 294 ? OE2 ? N GLU 15 OE2 
854 1 Y 1 N LEU 295 ? CG  ? N LEU 16 CG  
855 1 Y 1 N LEU 295 ? CD1 ? N LEU 16 CD1 
856 1 Y 1 N LEU 295 ? CD2 ? N LEU 16 CD2 
857 1 Y 1 N GLN 296 ? CG  ? N GLN 17 CG  
858 1 Y 1 N GLN 296 ? CD  ? N GLN 17 CD  
859 1 Y 1 N GLN 296 ? OE1 ? N GLN 17 OE1 
860 1 Y 1 N GLN 296 ? NE2 ? N GLN 17 NE2 
861 1 Y 1 N ASP 297 ? CG  ? N ASP 18 CG  
862 1 Y 1 N ASP 297 ? OD1 ? N ASP 18 OD1 
863 1 Y 1 N ASP 297 ? OD2 ? N ASP 18 OD2 
864 1 Y 1 N LEU 299 ? CG  ? N LEU 20 CG  
865 1 Y 1 N LEU 299 ? CD1 ? N LEU 20 CD1 
866 1 Y 1 N LEU 299 ? CD2 ? N LEU 20 CD2 
867 1 Y 1 N VAL 301 ? CG1 ? N VAL 22 CG1 
868 1 Y 1 N VAL 301 ? CG2 ? N VAL 22 CG2 
869 1 Y 1 N ASP 303 ? CG  ? N ASP 24 CG  
870 1 Y 1 N ASP 303 ? OD1 ? N ASP 24 OD1 
871 1 Y 1 N ASP 303 ? OD2 ? N ASP 24 OD2 
872 1 Y 1 N LYS 304 ? CG  ? N LYS 25 CG  
873 1 Y 1 N LYS 304 ? CD  ? N LYS 25 CD  
874 1 Y 1 N LYS 304 ? CE  ? N LYS 25 CE  
875 1 Y 1 N LYS 304 ? NZ  ? N LYS 25 NZ  
876 1 Y 1 N SER 305 ? OG  ? N SER 26 OG  
877 1 Y 1 N ARG 312 ? CG  ? N ARG 33 CG  
878 1 Y 1 N ARG 312 ? CD  ? N ARG 33 CD  
879 1 Y 1 N ARG 312 ? NE  ? N ARG 33 NE  
880 1 Y 1 N ARG 312 ? CZ  ? N ARG 33 CZ  
881 1 Y 1 N ARG 312 ? NH1 ? N ARG 33 NH1 
882 1 Y 1 N ARG 312 ? NH2 ? N ARG 33 NH2 
883 1 Y 1 N LEU 323 ? CG  ? N LEU 44 CG  
884 1 Y 1 N LEU 323 ? CD1 ? N LEU 44 CD1 
885 1 Y 1 N LEU 323 ? CD2 ? N LEU 44 CD2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY -3  ? A GLY 1  
2   1 Y 1 A PRO -2  ? A PRO 2  
3   1 Y 1 A ASP -1  ? A ASP 3  
4   1 Y 1 A SER 0   ? A SER 4  
5   1 Y 1 A MET 1   ? A MET 5  
6   1 Y 1 A GLY 2   ? A GLY 6  
7   1 Y 1 A ALA 3   ? A ALA 7  
8   1 Y 1 A ALA 4   ? A ALA 8  
9   1 Y 1 A ALA 5   ? A ALA 9  
10  1 Y 1 A ALA 6   ? A ALA 10 
11  1 Y 1 A ARG 85  ? A ARG 89 
12  1 Y 1 A SER 86  ? A SER 90 
13  1 Y 1 D GLY 280 ? B GLY 1  
14  1 Y 1 D PRO 281 ? B PRO 2  
15  1 Y 1 D ASP 282 ? B ASP 3  
16  1 Y 1 D SER 283 ? B SER 4  
17  1 Y 1 D MET 284 ? B MET 5  
18  1 Y 1 D ARG 285 ? B ARG 6  
19  1 Y 1 B GLY -3  ? C GLY 1  
20  1 Y 1 B PRO -2  ? C PRO 2  
21  1 Y 1 B ASP -1  ? C ASP 3  
22  1 Y 1 B SER 0   ? C SER 4  
23  1 Y 1 B MET 1   ? C MET 5  
24  1 Y 1 B GLY 2   ? C GLY 6  
25  1 Y 1 B ALA 3   ? C ALA 7  
26  1 Y 1 B ALA 4   ? C ALA 8  
27  1 Y 1 B ALA 5   ? C ALA 9  
28  1 Y 1 B LYS 43  ? C LYS 47 
29  1 Y 1 B ASP 44  ? C ASP 48 
30  1 Y 1 B LYS 45  ? C LYS 49 
31  1 Y 1 B ASP 46  ? C ASP 50 
32  1 Y 1 B GLY 47  ? C GLY 51 
33  1 Y 1 C GLY 280 ? D GLY 1  
34  1 Y 1 C PRO 281 ? D PRO 2  
35  1 Y 1 C ASP 282 ? D ASP 3  
36  1 Y 1 C SER 283 ? D SER 4  
37  1 Y 1 C MET 284 ? D MET 5  
38  1 Y 1 C ARG 285 ? D ARG 6  
39  1 Y 1 E GLY -3  ? E GLY 1  
40  1 Y 1 E PRO -2  ? E PRO 2  
41  1 Y 1 E ASP -1  ? E ASP 3  
42  1 Y 1 E SER 0   ? E SER 4  
43  1 Y 1 E MET 1   ? E MET 5  
44  1 Y 1 E GLY 2   ? E GLY 6  
45  1 Y 1 E ALA 3   ? E ALA 7  
46  1 Y 1 E ALA 4   ? E ALA 8  
47  1 Y 1 E ALA 5   ? E ALA 9  
48  1 Y 1 E LYS 43  ? E LYS 47 
49  1 Y 1 E ASP 44  ? E ASP 48 
50  1 Y 1 E LYS 45  ? E LYS 49 
51  1 Y 1 E ASP 46  ? E ASP 50 
52  1 Y 1 E GLY 47  ? E GLY 51 
53  1 Y 1 E LYS 48  ? E LYS 52 
54  1 Y 1 E PRO 49  ? E PRO 53 
55  1 Y 1 E LYS 50  ? E LYS 54 
56  1 Y 1 F GLY 280 ? F GLY 1  
57  1 Y 1 F PRO 281 ? F PRO 2  
58  1 Y 1 F ASP 282 ? F ASP 3  
59  1 Y 1 F SER 283 ? F SER 4  
60  1 Y 1 F MET 284 ? F MET 5  
61  1 Y 1 G GLY -3  ? G GLY 1  
62  1 Y 1 G PRO -2  ? G PRO 2  
63  1 Y 1 G ASP -1  ? G ASP 3  
64  1 Y 1 G SER 0   ? G SER 4  
65  1 Y 1 G MET 1   ? G MET 5  
66  1 Y 1 G GLY 2   ? G GLY 6  
67  1 Y 1 G ALA 3   ? G ALA 7  
68  1 Y 1 G ALA 4   ? G ALA 8  
69  1 Y 1 G ALA 5   ? G ALA 9  
70  1 Y 1 G ALA 6   ? G ALA 10 
71  1 Y 1 G LYS 43  ? G LYS 47 
72  1 Y 1 G ASP 44  ? G ASP 48 
73  1 Y 1 G LYS 45  ? G LYS 49 
74  1 Y 1 G ASP 46  ? G ASP 50 
75  1 Y 1 G GLY 47  ? G GLY 51 
76  1 Y 1 G LYS 48  ? G LYS 52 
77  1 Y 1 G PRO 49  ? G PRO 53 
78  1 Y 1 G LYS 50  ? G LYS 54 
79  1 Y 1 H GLY 280 ? H GLY 1  
80  1 Y 1 H PRO 281 ? H PRO 2  
81  1 Y 1 H ASP 282 ? H ASP 3  
82  1 Y 1 H SER 283 ? H SER 4  
83  1 Y 1 H MET 284 ? H MET 5  
84  1 Y 1 I GLY -3  ? I GLY 1  
85  1 Y 1 I PRO -2  ? I PRO 2  
86  1 Y 1 I ASP -1  ? I ASP 3  
87  1 Y 1 I SER 0   ? I SER 4  
88  1 Y 1 I MET 1   ? I MET 5  
89  1 Y 1 I GLY 2   ? I GLY 6  
90  1 Y 1 I ALA 3   ? I ALA 7  
91  1 Y 1 I ALA 4   ? I ALA 8  
92  1 Y 1 I ALA 5   ? I ALA 9  
93  1 Y 1 I ALA 6   ? I ALA 10 
94  1 Y 1 I LEU 12  ? I LEU 16 
95  1 Y 1 J GLY 280 ? J GLY 1  
96  1 Y 1 J PRO 281 ? J PRO 2  
97  1 Y 1 J ASP 282 ? J ASP 3  
98  1 Y 1 J SER 283 ? J SER 4  
99  1 Y 1 J MET 284 ? J MET 5  
100 1 Y 1 J ARG 285 ? J ARG 6  
101 1 Y 1 J LYS 324 ? J LYS 45 
102 1 Y 1 K GLY -3  ? K GLY 1  
103 1 Y 1 K PRO -2  ? K PRO 2  
104 1 Y 1 K ASP -1  ? K ASP 3  
105 1 Y 1 K SER 0   ? K SER 4  
106 1 Y 1 K MET 1   ? K MET 5  
107 1 Y 1 K GLY 2   ? K GLY 6  
108 1 Y 1 K ALA 3   ? K ALA 7  
109 1 Y 1 K ALA 4   ? K ALA 8  
110 1 Y 1 K ALA 5   ? K ALA 9  
111 1 Y 1 K ALA 6   ? K ALA 10 
112 1 Y 1 K GLU 7   ? K GLU 11 
113 1 Y 1 K ALA 8   ? K ALA 12 
114 1 Y 1 K ILE 41  ? K ILE 45 
115 1 Y 1 K PRO 42  ? K PRO 46 
116 1 Y 1 K LYS 43  ? K LYS 47 
117 1 Y 1 K ASP 44  ? K ASP 48 
118 1 Y 1 K LYS 45  ? K LYS 49 
119 1 Y 1 K ASP 46  ? K ASP 50 
120 1 Y 1 K GLY 47  ? K GLY 51 
121 1 Y 1 L GLY 280 ? L GLY 1  
122 1 Y 1 L PRO 281 ? L PRO 2  
123 1 Y 1 L ASP 282 ? L ASP 3  
124 1 Y 1 L SER 283 ? L SER 4  
125 1 Y 1 L MET 284 ? L MET 5  
126 1 Y 1 L ARG 285 ? L ARG 6  
127 1 Y 1 L LYS 324 ? L LYS 45 
128 1 Y 1 M GLY -3  ? M GLY 1  
129 1 Y 1 M PRO -2  ? M PRO 2  
130 1 Y 1 M ASP -1  ? M ASP 3  
131 1 Y 1 M SER 0   ? M SER 4  
132 1 Y 1 M MET 1   ? M MET 5  
133 1 Y 1 M GLY 2   ? M GLY 6  
134 1 Y 1 M ALA 3   ? M ALA 7  
135 1 Y 1 M ALA 4   ? M ALA 8  
136 1 Y 1 M ALA 5   ? M ALA 9  
137 1 Y 1 M ALA 6   ? M ALA 10 
138 1 Y 1 M GLU 18  ? M GLU 22 
139 1 Y 1 M GLU 24  ? M GLU 28 
140 1 Y 1 M LYS 40  ? M LYS 44 
141 1 Y 1 M ILE 41  ? M ILE 45 
142 1 Y 1 M PRO 42  ? M PRO 46 
143 1 Y 1 M LYS 43  ? M LYS 47 
144 1 Y 1 M ASP 44  ? M ASP 48 
145 1 Y 1 M LYS 45  ? M LYS 49 
146 1 Y 1 M ASP 46  ? M ASP 50 
147 1 Y 1 M GLY 47  ? M GLY 51 
148 1 Y 1 M LYS 48  ? M LYS 52 
149 1 Y 1 M PRO 49  ? M PRO 53 
150 1 Y 1 M LYS 50  ? M LYS 54 
151 1 Y 1 M GLY 77  ? M GLY 81 
152 1 Y 1 M ARG 78  ? M ARG 82 
153 1 Y 1 M SER 86  ? M SER 90 
154 1 Y 1 N GLY 280 ? N GLY 1  
155 1 Y 1 N PRO 281 ? N PRO 2  
156 1 Y 1 N ASP 282 ? N ASP 3  
157 1 Y 1 N SER 283 ? N SER 4  
158 1 Y 1 N MET 284 ? N MET 5  
159 1 Y 1 N ARG 285 ? N ARG 6  
160 1 Y 1 N THR 302 ? N THR 23 
161 1 Y 1 N LYS 324 ? N LYS 45 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'BROMIDE ION' BR  
4 water         HOH 
#