data_5M64
# 
_entry.id   5M64 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.318 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5M64         
WWPDB D_1200001998 
EMDB  EMD-3449     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'RNA Polymerase I elongation complex with A49 tandem winged helix domain' 
_pdbx_database_related.db_id          EMD-3449 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5M64 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-24 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Tafur, L.'      1 
'Sadian, Y.'     2 
'Hoffmann, N.A.' 3 
'Jakobi, A.J.'   4 
'Wetzel, R.'     5 
'Hagen, W.J.H.'  6 
'Sachse, C.'     7 
'Muller, C.W.'   8 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            64 
_citation.language                  ? 
_citation.page_first                1135 
_citation.page_last                 1143 
_citation.title                     'Molecular Structures of Transcribing RNA Polymerase I.' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2016.11.013 
_citation.pdbx_database_id_PubMed   27867008 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Tafur, L.'      1 ? 
primary 'Sadian, Y.'     2 ? 
primary 'Hoffmann, N.A.' 3 ? 
primary 'Jakobi, A.J.'   4 ? 
primary 'Wetzel, R.'     5 ? 
primary 'Hagen, W.J.'    6 ? 
primary 'Sachse, C.'     7 ? 
primary 'Muller, C.W.'   8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5M64 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5M64 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     nat 'DNA-directed RNA polymerase I subunit RPA190'               186676.969 1 2.7.7.6 ? ? ? 
2  polymer     nat 'DNA-directed RNA polymerase I subunit RPA135'               135910.328 1 2.7.7.6 ? ? ? 
3  polymer     nat 'DNA-directed RNA polymerases I and III subunit RPAC1'       37732.613  1 ?       ? ? ? 
4  polymer     nat 'DNA-directed RNA polymerase I subunit RPA14'                14599.128  1 ?       ? ? ? 
5  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC1' 25117.094  1 ?       ? ? ? 
6  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC2' 17931.834  1 ?       ? ? ? 
7  polymer     nat 'DNA-directed RNA polymerase I subunit RPA43'                36264.852  1 ?       ? ? ? 
8  polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC3' 16525.363  1 ?       ? ? ? 
9  polymer     nat 'DNA-directed RNA polymerase I subunit RPA12'                13676.566  1 ?       ? ? ? 
10 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC5' 8290.732   1 ?       ? ? ? 
11 polymer     nat 'DNA-directed RNA polymerases I and III subunit RPAC2'       16167.860  1 ?       ? ? ? 
12 polymer     nat 'DNA-directed RNA polymerases I, II, and III subunit RPABC4' 7729.969   1 ?       ? ? ? 
13 polymer     nat 'DNA-directed RNA polymerase I subunit RPA49'                46721.707  1 ?       ? ? ? 
14 polymer     nat 'DNA-directed RNA polymerase I subunit RPA34'                26933.518  1 ?       ? ? ? 
15 polymer     nat 'Non-template DNA'                                           22000.131  1 ?       ? ? ? 
16 polymer     nat 'Template DNA'                                               21216.605  1 ?       ? ? ? 
17 polymer     nat RNA                                                          3177.932   1 ?       ? ? ? 
18 non-polymer syn 'ZINC ION'                                                   65.409     6 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  'DNA-directed RNA polymerase I 190 kDa polypeptide,A190,DNA-directed RNA polymerase I largest subunit'                          
2  'DNA-directed RNA polymerase I 135 kDa polypeptide,A135,DNA-directed RNA polymerase I polypeptide 2,RNA polymerase I subunit 2' 
3  'RNA polymerases I and III subunit AC1,C37,DNA-directed RNA polymerases I and III 40 kDa polypeptide,C40'                       
4  'A14,DNA-directed RNA polymerase I 14 kDa polypeptide'                                                                          
5  'RNA polymerases I,II,and III subunit ABC1,ABC27,DNA-directed RNA polymerases I,and III 27 kDa polypeptide'                     
6  'RNA polymerases I,II,and III subunit ABC2,ABC23,DNA-directed RNA polymerases I,and III 23 kDa polypeptide'                     
7  'A43,DNA-directed DNA-dependent RNA polymerase 36 kDa polypeptide'                                                              
8  'RNA polymerases I,II,and III subunit ABC3,ABC14.4,ABC14.5,DNA-directed RNA polymerases I,and III 14.5 kDa polypeptide'         
9  'A12,A12.2,DNA-directed RNA polymerase I 13.7 kDa polypeptide'                                                                  
10 'RNA polymerases I,II,and III subunit ABC5,ABC10-beta,ABC8,DNA-directed RNA polymerases I,and III 8.3 kDa polypeptide'          
11 'RNA polymerases I and III subunit AC2,AC19,DNA-directed RNA polymerases I and III 16 kDa polypeptide,RPA19'                    
12 'RNA polymerases I,II,and III subunit ABC4,ABC10-alpha'                                                                         
13 'A49,DNA-directed RNA polymerase I 49 kDa polypeptide'                                                                          
14 'A34,DNA-directed DNA-dependent RNA polymerase 34.5 kDa polypeptide,A34.5'                                                      
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'        no no 
;MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNED
EMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFS
PKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEV
KNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLN
DDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAA
RSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQ
LLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN
ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIF
KPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEV
YGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQ
EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVM
VSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRD
ADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
TLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSN
TAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSS
NSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMN
KVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLV
TEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNR
QGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA
;
;MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNED
EMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFS
PKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEV
KNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLN
DDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAA
RSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQ
LLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN
ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIF
KPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEV
YGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQ
EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVM
VSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRD
ADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
TLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSN
TAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSS
NSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMN
KVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLV
TEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNR
QGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA
;
A ? 
2  'polypeptide(L)'        no no 
;MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLN
SEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGG
LPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHL
QNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQ
EVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSR
IPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGL
YLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGY
GTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPA
YIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV
NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRI
GSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV
EPK
;
;MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLN
SEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGG
LPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHL
QNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQ
EVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSR
IPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGL
YLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGY
GTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPA
YIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV
NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRI
GSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV
EPK
;
B ? 
3  'polypeptide(L)'        no no 
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
C ? 
4  'polypeptide(L)'        no no 
;MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDT
NLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE
;
;MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDT
NLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE
;
D ? 
5  'polypeptide(L)'        no no 
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
E ? 
6  'polypeptide(L)'        no no 
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
F ? 
7  'polypeptide(L)'        no no 
;MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGV
VLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKN
NIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDG
ESSDSD
;
;MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGV
VLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKN
NIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDG
ESSDSD
;
G ? 
8  'polypeptide(L)'        no no 
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
H ? 
9  'polypeptide(L)'        no no 
;MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGA
TIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
;
;MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGA
TIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
;
I ? 
10 'polypeptide(L)'        no no MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD J ? 
11 'polypeptide(L)'        no no 
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
K ? 
12 'polypeptide(L)'        no no MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 
MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR L ? 
13 'polypeptide(L)'        no no 
;MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGL
FNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAID
IVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNS
KYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFI
DPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVP
FKLPEMTRRGRGPRR
;
;MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGL
FNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAID
IVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNS
KYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFI
DPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVP
FKLPEMTRRGRGPRR
;
M ? 
14 'polypeptide(L)'        no no 
;MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTM
TIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDV
PKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
;
;MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTM
TIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDV
PKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
;
N ? 
15 polydeoxyribonucleotide no no 
;(DG)(DG)(DT)(DT)(DT)(DA)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DG)(DT)(DA)(DC)(DA)(DA)
(DG)(DT)(DG)(DT)(DG)(DA)(DG)(DG)(DA)(DA)(DA)(DA)(DG)(DT)(DA)(DG)(DT)(DT)(DG)(DG)
(DC)(DG)(DT)(DA)(DG)(DC)(DA)(DG)(DG)(DA)(DG)(DA)(DA)(DG)(DT)(DA)(DA)(DA)(DG)(DC)
(DA)(DG)(DT)(DT)(DG)(DA)(DA)(DG)(DA)(DC)
;
GGTTTAGTCATGGAGTACAAGTGTGAGGAAAAGTAGTTGGCGTAGCAGGAGAAGTAAAGCAGTTGAAGAC S ? 
16 polydeoxyribonucleotide no no 
;(DG)(DT)(DC)(DT)(DT)(DC)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DT)(DT)(DC)(DG)(DC)(DA)(DT)
(DG)(DA)(DA)(DG)(DT)(DA)(DC)(DC)(DT)(DC)(DC)(DC)(DA)(DA)(DC)(DT)(DA)(DC)(DT)(DT)
(DT)(DT)(DC)(DC)(DT)(DC)(DA)(DC)(DA)(DC)(DT)(DT)(DG)(DT)(DA)(DC)(DT)(DC)(DC)(DA)
(DT)(DG)(DA)(DC)(DT)(DA)(DA)(DA)(DC)(DC)
;
GTCTTCAACTGCTTTCGCATGAAGTACCTCCCAACTACTTTTCCTCACACTTGTACTCCATGACTAAACC T ? 
17 polyribonucleotide      no no GAGGUACUUC GAGGUACUUC R ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    ASP n 
1  3    ILE n 
1  4    SER n 
1  5    LYS n 
1  6    PRO n 
1  7    VAL n 
1  8    GLY n 
1  9    SER n 
1  10   GLU n 
1  11   ILE n 
1  12   THR n 
1  13   SER n 
1  14   VAL n 
1  15   ASP n 
1  16   PHE n 
1  17   GLY n 
1  18   ILE n 
1  19   LEU n 
1  20   THR n 
1  21   ALA n 
1  22   LYS n 
1  23   GLU n 
1  24   ILE n 
1  25   ARG n 
1  26   ASN n 
1  27   LEU n 
1  28   SER n 
1  29   ALA n 
1  30   LYS n 
1  31   GLN n 
1  32   ILE n 
1  33   THR n 
1  34   ASN n 
1  35   PRO n 
1  36   THR n 
1  37   VAL n 
1  38   LEU n 
1  39   ASP n 
1  40   ASN n 
1  41   LEU n 
1  42   GLY n 
1  43   HIS n 
1  44   PRO n 
1  45   VAL n 
1  46   SER n 
1  47   GLY n 
1  48   GLY n 
1  49   LEU n 
1  50   TYR n 
1  51   ASP n 
1  52   LEU n 
1  53   ALA n 
1  54   LEU n 
1  55   GLY n 
1  56   ALA n 
1  57   PHE n 
1  58   LEU n 
1  59   ARG n 
1  60   ASN n 
1  61   LEU n 
1  62   CYS n 
1  63   SER n 
1  64   THR n 
1  65   CYS n 
1  66   GLY n 
1  67   LEU n 
1  68   ASP n 
1  69   GLU n 
1  70   LYS n 
1  71   PHE n 
1  72   CYS n 
1  73   PRO n 
1  74   GLY n 
1  75   HIS n 
1  76   GLN n 
1  77   GLY n 
1  78   HIS n 
1  79   ILE n 
1  80   GLU n 
1  81   LEU n 
1  82   PRO n 
1  83   VAL n 
1  84   PRO n 
1  85   CYS n 
1  86   TYR n 
1  87   ASN n 
1  88   PRO n 
1  89   LEU n 
1  90   PHE n 
1  91   PHE n 
1  92   ASN n 
1  93   GLN n 
1  94   LEU n 
1  95   TYR n 
1  96   ILE n 
1  97   TYR n 
1  98   LEU n 
1  99   ARG n 
1  100  ALA n 
1  101  SER n 
1  102  CYS n 
1  103  LEU n 
1  104  PHE n 
1  105  CYS n 
1  106  HIS n 
1  107  HIS n 
1  108  PHE n 
1  109  ARG n 
1  110  LEU n 
1  111  LYS n 
1  112  SER n 
1  113  VAL n 
1  114  GLU n 
1  115  VAL n 
1  116  HIS n 
1  117  ARG n 
1  118  TYR n 
1  119  ALA n 
1  120  CYS n 
1  121  LYS n 
1  122  LEU n 
1  123  ARG n 
1  124  LEU n 
1  125  LEU n 
1  126  GLN n 
1  127  TYR n 
1  128  GLY n 
1  129  LEU n 
1  130  ILE n 
1  131  ASP n 
1  132  GLU n 
1  133  SER n 
1  134  TYR n 
1  135  LYS n 
1  136  LEU n 
1  137  ASP n 
1  138  GLU n 
1  139  ILE n 
1  140  THR n 
1  141  LEU n 
1  142  GLY n 
1  143  SER n 
1  144  LEU n 
1  145  ASN n 
1  146  SER n 
1  147  SER n 
1  148  MET n 
1  149  TYR n 
1  150  THR n 
1  151  ASP n 
1  152  ASP n 
1  153  GLU n 
1  154  ALA n 
1  155  ILE n 
1  156  GLU n 
1  157  ASP n 
1  158  ASN n 
1  159  GLU n 
1  160  ASP n 
1  161  GLU n 
1  162  MET n 
1  163  ASP n 
1  164  GLY n 
1  165  GLU n 
1  166  GLY n 
1  167  SER n 
1  168  LYS n 
1  169  GLN n 
1  170  SER n 
1  171  LYS n 
1  172  ASP n 
1  173  ILE n 
1  174  SER n 
1  175  SER n 
1  176  THR n 
1  177  LEU n 
1  178  LEU n 
1  179  ASN n 
1  180  GLU n 
1  181  LEU n 
1  182  LYS n 
1  183  SER n 
1  184  LYS n 
1  185  ARG n 
1  186  SER n 
1  187  GLU n 
1  188  TYR n 
1  189  VAL n 
1  190  ASP n 
1  191  MET n 
1  192  ALA n 
1  193  ILE n 
1  194  ALA n 
1  195  LYS n 
1  196  ALA n 
1  197  LEU n 
1  198  SER n 
1  199  ASP n 
1  200  GLY n 
1  201  ARG n 
1  202  THR n 
1  203  THR n 
1  204  GLU n 
1  205  ARG n 
1  206  GLY n 
1  207  SER n 
1  208  PHE n 
1  209  THR n 
1  210  ALA n 
1  211  THR n 
1  212  VAL n 
1  213  ASN n 
1  214  ASP n 
1  215  GLU n 
1  216  ARG n 
1  217  LYS n 
1  218  LYS n 
1  219  LEU n 
1  220  VAL n 
1  221  HIS n 
1  222  GLU n 
1  223  PHE n 
1  224  HIS n 
1  225  LYS n 
1  226  LYS n 
1  227  LEU n 
1  228  LEU n 
1  229  SER n 
1  230  ARG n 
1  231  GLY n 
1  232  LYS n 
1  233  CYS n 
1  234  ASP n 
1  235  ASN n 
1  236  CYS n 
1  237  GLY n 
1  238  MET n 
1  239  PHE n 
1  240  SER n 
1  241  PRO n 
1  242  LYS n 
1  243  PHE n 
1  244  ARG n 
1  245  LYS n 
1  246  ASP n 
1  247  GLY n 
1  248  PHE n 
1  249  THR n 
1  250  LYS n 
1  251  ILE n 
1  252  PHE n 
1  253  GLU n 
1  254  THR n 
1  255  ALA n 
1  256  LEU n 
1  257  ASN n 
1  258  GLU n 
1  259  LYS n 
1  260  GLN n 
1  261  ILE n 
1  262  THR n 
1  263  ASN n 
1  264  ASN n 
1  265  ARG n 
1  266  VAL n 
1  267  LYS n 
1  268  GLY n 
1  269  PHE n 
1  270  ILE n 
1  271  ARG n 
1  272  GLN n 
1  273  ASP n 
1  274  MET n 
1  275  ILE n 
1  276  LYS n 
1  277  LYS n 
1  278  GLN n 
1  279  LYS n 
1  280  GLN n 
1  281  ALA n 
1  282  LYS n 
1  283  LYS n 
1  284  LEU n 
1  285  ASP n 
1  286  GLY n 
1  287  SER n 
1  288  ASN n 
1  289  GLU n 
1  290  ALA n 
1  291  SER n 
1  292  ALA n 
1  293  ASN n 
1  294  ASP n 
1  295  GLU n 
1  296  GLU n 
1  297  SER n 
1  298  PHE n 
1  299  ASP n 
1  300  VAL n 
1  301  GLY n 
1  302  ARG n 
1  303  ASN n 
1  304  PRO n 
1  305  THR n 
1  306  THR n 
1  307  ARG n 
1  308  PRO n 
1  309  LYS n 
1  310  THR n 
1  311  GLY n 
1  312  SER n 
1  313  THR n 
1  314  TYR n 
1  315  ILE n 
1  316  LEU n 
1  317  SER n 
1  318  THR n 
1  319  GLU n 
1  320  VAL n 
1  321  LYS n 
1  322  ASN n 
1  323  ILE n 
1  324  LEU n 
1  325  ASP n 
1  326  THR n 
1  327  VAL n 
1  328  PHE n 
1  329  ARG n 
1  330  LYS n 
1  331  GLU n 
1  332  GLN n 
1  333  CYS n 
1  334  VAL n 
1  335  LEU n 
1  336  GLN n 
1  337  TYR n 
1  338  VAL n 
1  339  PHE n 
1  340  HIS n 
1  341  SER n 
1  342  ARG n 
1  343  PRO n 
1  344  ASN n 
1  345  LEU n 
1  346  SER n 
1  347  ARG n 
1  348  LYS n 
1  349  LEU n 
1  350  VAL n 
1  351  LYS n 
1  352  ALA n 
1  353  ASP n 
1  354  SER n 
1  355  PHE n 
1  356  PHE n 
1  357  MET n 
1  358  ASP n 
1  359  VAL n 
1  360  LEU n 
1  361  VAL n 
1  362  VAL n 
1  363  PRO n 
1  364  PRO n 
1  365  THR n 
1  366  ARG n 
1  367  PHE n 
1  368  ARG n 
1  369  LEU n 
1  370  PRO n 
1  371  SER n 
1  372  LYS n 
1  373  LEU n 
1  374  GLY n 
1  375  GLU n 
1  376  GLU n 
1  377  VAL n 
1  378  HIS n 
1  379  GLU n 
1  380  ASN n 
1  381  SER n 
1  382  GLN n 
1  383  ASN n 
1  384  GLN n 
1  385  LEU n 
1  386  LEU n 
1  387  SER n 
1  388  LYS n 
1  389  VAL n 
1  390  LEU n 
1  391  THR n 
1  392  THR n 
1  393  SER n 
1  394  LEU n 
1  395  LEU n 
1  396  ILE n 
1  397  ARG n 
1  398  ASP n 
1  399  LEU n 
1  400  ASN n 
1  401  ASP n 
1  402  ASP n 
1  403  LEU n 
1  404  SER n 
1  405  LYS n 
1  406  LEU n 
1  407  GLN n 
1  408  LYS n 
1  409  ASP n 
1  410  LYS n 
1  411  VAL n 
1  412  SER n 
1  413  LEU n 
1  414  GLU n 
1  415  ASP n 
1  416  ARG n 
1  417  ARG n 
1  418  VAL n 
1  419  ILE n 
1  420  PHE n 
1  421  SER n 
1  422  ARG n 
1  423  LEU n 
1  424  MET n 
1  425  ASN n 
1  426  ALA n 
1  427  PHE n 
1  428  VAL n 
1  429  THR n 
1  430  ILE n 
1  431  GLN n 
1  432  ASN n 
1  433  ASP n 
1  434  VAL n 
1  435  ASN n 
1  436  ALA n 
1  437  PHE n 
1  438  ILE n 
1  439  ASP n 
1  440  SER n 
1  441  THR n 
1  442  LYS n 
1  443  ALA n 
1  444  GLN n 
1  445  GLY n 
1  446  ARG n 
1  447  THR n 
1  448  SER n 
1  449  GLY n 
1  450  LYS n 
1  451  VAL n 
1  452  PRO n 
1  453  ILE n 
1  454  PRO n 
1  455  GLY n 
1  456  VAL n 
1  457  LYS n 
1  458  GLN n 
1  459  ALA n 
1  460  LEU n 
1  461  GLU n 
1  462  LYS n 
1  463  LYS n 
1  464  GLU n 
1  465  GLY n 
1  466  LEU n 
1  467  PHE n 
1  468  ARG n 
1  469  LYS n 
1  470  HIS n 
1  471  MET n 
1  472  MET n 
1  473  GLY n 
1  474  LYS n 
1  475  ARG n 
1  476  VAL n 
1  477  ASN n 
1  478  TYR n 
1  479  ALA n 
1  480  ALA n 
1  481  ARG n 
1  482  SER n 
1  483  VAL n 
1  484  ILE n 
1  485  SER n 
1  486  PRO n 
1  487  ASP n 
1  488  PRO n 
1  489  ASN n 
1  490  ILE n 
1  491  GLU n 
1  492  THR n 
1  493  ASN n 
1  494  GLU n 
1  495  ILE n 
1  496  GLY n 
1  497  VAL n 
1  498  PRO n 
1  499  PRO n 
1  500  VAL n 
1  501  PHE n 
1  502  ALA n 
1  503  VAL n 
1  504  LYS n 
1  505  LEU n 
1  506  THR n 
1  507  TYR n 
1  508  PRO n 
1  509  GLU n 
1  510  PRO n 
1  511  VAL n 
1  512  THR n 
1  513  ALA n 
1  514  TYR n 
1  515  ASN n 
1  516  ILE n 
1  517  ALA n 
1  518  GLU n 
1  519  LEU n 
1  520  ARG n 
1  521  GLN n 
1  522  ALA n 
1  523  VAL n 
1  524  ILE n 
1  525  ASN n 
1  526  GLY n 
1  527  PRO n 
1  528  ASP n 
1  529  LYS n 
1  530  TRP n 
1  531  PRO n 
1  532  GLY n 
1  533  ALA n 
1  534  THR n 
1  535  GLN n 
1  536  ILE n 
1  537  GLN n 
1  538  ASN n 
1  539  GLU n 
1  540  ASP n 
1  541  GLY n 
1  542  SER n 
1  543  LEU n 
1  544  VAL n 
1  545  SER n 
1  546  LEU n 
1  547  ILE n 
1  548  GLY n 
1  549  MET n 
1  550  SER n 
1  551  VAL n 
1  552  GLU n 
1  553  GLN n 
1  554  ARG n 
1  555  LYS n 
1  556  ALA n 
1  557  LEU n 
1  558  ALA n 
1  559  ASN n 
1  560  GLN n 
1  561  LEU n 
1  562  LEU n 
1  563  THR n 
1  564  PRO n 
1  565  SER n 
1  566  SER n 
1  567  ASN n 
1  568  VAL n 
1  569  SER n 
1  570  THR n 
1  571  HIS n 
1  572  THR n 
1  573  LEU n 
1  574  ASN n 
1  575  LYS n 
1  576  LYS n 
1  577  VAL n 
1  578  TYR n 
1  579  ARG n 
1  580  HIS n 
1  581  ILE n 
1  582  LYS n 
1  583  ASN n 
1  584  ARG n 
1  585  ASP n 
1  586  VAL n 
1  587  VAL n 
1  588  LEU n 
1  589  MET n 
1  590  ASN n 
1  591  ARG n 
1  592  GLN n 
1  593  PRO n 
1  594  THR n 
1  595  LEU n 
1  596  HIS n 
1  597  LYS n 
1  598  ALA n 
1  599  SER n 
1  600  MET n 
1  601  MET n 
1  602  GLY n 
1  603  HIS n 
1  604  LYS n 
1  605  VAL n 
1  606  ARG n 
1  607  VAL n 
1  608  LEU n 
1  609  PRO n 
1  610  ASN n 
1  611  GLU n 
1  612  LYS n 
1  613  THR n 
1  614  LEU n 
1  615  ARG n 
1  616  LEU n 
1  617  HIS n 
1  618  TYR n 
1  619  ALA n 
1  620  ASN n 
1  621  THR n 
1  622  GLY n 
1  623  ALA n 
1  624  TYR n 
1  625  ASN n 
1  626  ALA n 
1  627  ASP n 
1  628  PHE n 
1  629  ASP n 
1  630  GLY n 
1  631  ASP n 
1  632  GLU n 
1  633  MET n 
1  634  ASN n 
1  635  MET n 
1  636  HIS n 
1  637  PHE n 
1  638  PRO n 
1  639  GLN n 
1  640  ASN n 
1  641  GLU n 
1  642  ASN n 
1  643  ALA n 
1  644  ARG n 
1  645  ALA n 
1  646  GLU n 
1  647  ALA n 
1  648  LEU n 
1  649  ASN n 
1  650  LEU n 
1  651  ALA n 
1  652  ASN n 
1  653  THR n 
1  654  ASP n 
1  655  SER n 
1  656  GLN n 
1  657  TYR n 
1  658  LEU n 
1  659  THR n 
1  660  PRO n 
1  661  THR n 
1  662  SER n 
1  663  GLY n 
1  664  SER n 
1  665  PRO n 
1  666  VAL n 
1  667  ARG n 
1  668  GLY n 
1  669  LEU n 
1  670  ILE n 
1  671  GLN n 
1  672  ASP n 
1  673  HIS n 
1  674  ILE n 
1  675  SER n 
1  676  ALA n 
1  677  GLY n 
1  678  VAL n 
1  679  TRP n 
1  680  LEU n 
1  681  THR n 
1  682  SER n 
1  683  LYS n 
1  684  ASP n 
1  685  SER n 
1  686  PHE n 
1  687  PHE n 
1  688  THR n 
1  689  ARG n 
1  690  GLU n 
1  691  GLN n 
1  692  TYR n 
1  693  GLN n 
1  694  GLN n 
1  695  TYR n 
1  696  ILE n 
1  697  TYR n 
1  698  GLY n 
1  699  CYS n 
1  700  ILE n 
1  701  ARG n 
1  702  PRO n 
1  703  GLU n 
1  704  ASP n 
1  705  GLY n 
1  706  HIS n 
1  707  THR n 
1  708  THR n 
1  709  ARG n 
1  710  SER n 
1  711  LYS n 
1  712  ILE n 
1  713  VAL n 
1  714  THR n 
1  715  LEU n 
1  716  PRO n 
1  717  PRO n 
1  718  THR n 
1  719  ILE n 
1  720  PHE n 
1  721  LYS n 
1  722  PRO n 
1  723  TYR n 
1  724  PRO n 
1  725  LEU n 
1  726  TRP n 
1  727  THR n 
1  728  GLY n 
1  729  LYS n 
1  730  GLN n 
1  731  ILE n 
1  732  ILE n 
1  733  THR n 
1  734  THR n 
1  735  VAL n 
1  736  LEU n 
1  737  LEU n 
1  738  ASN n 
1  739  VAL n 
1  740  THR n 
1  741  PRO n 
1  742  PRO n 
1  743  ASP n 
1  744  MET n 
1  745  PRO n 
1  746  GLY n 
1  747  ILE n 
1  748  ASN n 
1  749  LEU n 
1  750  ILE n 
1  751  SER n 
1  752  LYS n 
1  753  ASN n 
1  754  LYS n 
1  755  ILE n 
1  756  LYS n 
1  757  ASN n 
1  758  GLU n 
1  759  TYR n 
1  760  TRP n 
1  761  GLY n 
1  762  LYS n 
1  763  GLY n 
1  764  SER n 
1  765  LEU n 
1  766  GLU n 
1  767  ASN n 
1  768  GLU n 
1  769  VAL n 
1  770  LEU n 
1  771  PHE n 
1  772  LYS n 
1  773  ASP n 
1  774  GLY n 
1  775  ALA n 
1  776  LEU n 
1  777  LEU n 
1  778  CYS n 
1  779  GLY n 
1  780  ILE n 
1  781  LEU n 
1  782  ASP n 
1  783  LYS n 
1  784  SER n 
1  785  GLN n 
1  786  TYR n 
1  787  GLY n 
1  788  ALA n 
1  789  SER n 
1  790  LYS n 
1  791  TYR n 
1  792  GLY n 
1  793  ILE n 
1  794  VAL n 
1  795  HIS n 
1  796  SER n 
1  797  LEU n 
1  798  HIS n 
1  799  GLU n 
1  800  VAL n 
1  801  TYR n 
1  802  GLY n 
1  803  PRO n 
1  804  GLU n 
1  805  VAL n 
1  806  ALA n 
1  807  ALA n 
1  808  LYS n 
1  809  VAL n 
1  810  LEU n 
1  811  SER n 
1  812  VAL n 
1  813  LEU n 
1  814  GLY n 
1  815  ARG n 
1  816  LEU n 
1  817  PHE n 
1  818  THR n 
1  819  ASN n 
1  820  TYR n 
1  821  ILE n 
1  822  THR n 
1  823  ALA n 
1  824  THR n 
1  825  ALA n 
1  826  PHE n 
1  827  THR n 
1  828  CYS n 
1  829  GLY n 
1  830  MET n 
1  831  ASP n 
1  832  ASP n 
1  833  LEU n 
1  834  ARG n 
1  835  LEU n 
1  836  THR n 
1  837  ALA n 
1  838  GLU n 
1  839  GLY n 
1  840  ASN n 
1  841  LYS n 
1  842  TRP n 
1  843  ARG n 
1  844  THR n 
1  845  ASP n 
1  846  ILE n 
1  847  LEU n 
1  848  LYS n 
1  849  THR n 
1  850  SER n 
1  851  VAL n 
1  852  ASP n 
1  853  THR n 
1  854  GLY n 
1  855  ARG n 
1  856  GLU n 
1  857  ALA n 
1  858  ALA n 
1  859  ALA n 
1  860  GLU n 
1  861  VAL n 
1  862  THR n 
1  863  ASN n 
1  864  LEU n 
1  865  ASP n 
1  866  LYS n 
1  867  ASP n 
1  868  THR n 
1  869  PRO n 
1  870  ALA n 
1  871  ASP n 
1  872  ASP n 
1  873  PRO n 
1  874  GLU n 
1  875  LEU n 
1  876  LEU n 
1  877  LYS n 
1  878  ARG n 
1  879  LEU n 
1  880  GLN n 
1  881  GLU n 
1  882  ILE n 
1  883  LEU n 
1  884  ARG n 
1  885  ASP n 
1  886  ASN n 
1  887  ASN n 
1  888  LYS n 
1  889  SER n 
1  890  GLY n 
1  891  ILE n 
1  892  LEU n 
1  893  ASP n 
1  894  ALA n 
1  895  VAL n 
1  896  THR n 
1  897  SER n 
1  898  SER n 
1  899  LYS n 
1  900  VAL n 
1  901  ASN n 
1  902  ALA n 
1  903  ILE n 
1  904  THR n 
1  905  SER n 
1  906  GLN n 
1  907  VAL n 
1  908  VAL n 
1  909  SER n 
1  910  LYS n 
1  911  CYS n 
1  912  VAL n 
1  913  PRO n 
1  914  ASP n 
1  915  GLY n 
1  916  THR n 
1  917  MET n 
1  918  LYS n 
1  919  LYS n 
1  920  PHE n 
1  921  PRO n 
1  922  CYS n 
1  923  ASN n 
1  924  SER n 
1  925  MET n 
1  926  GLN n 
1  927  ALA n 
1  928  MET n 
1  929  ALA n 
1  930  LEU n 
1  931  SER n 
1  932  GLY n 
1  933  ALA n 
1  934  LYS n 
1  935  GLY n 
1  936  SER n 
1  937  ASN n 
1  938  VAL n 
1  939  ASN n 
1  940  VAL n 
1  941  SER n 
1  942  GLN n 
1  943  ILE n 
1  944  MET n 
1  945  CYS n 
1  946  LEU n 
1  947  LEU n 
1  948  GLY n 
1  949  GLN n 
1  950  GLN n 
1  951  ALA n 
1  952  LEU n 
1  953  GLU n 
1  954  GLY n 
1  955  ARG n 
1  956  ARG n 
1  957  VAL n 
1  958  PRO n 
1  959  VAL n 
1  960  MET n 
1  961  VAL n 
1  962  SER n 
1  963  GLY n 
1  964  LYS n 
1  965  THR n 
1  966  LEU n 
1  967  PRO n 
1  968  SER n 
1  969  PHE n 
1  970  LYS n 
1  971  PRO n 
1  972  TYR n 
1  973  GLU n 
1  974  THR n 
1  975  ASP n 
1  976  ALA n 
1  977  MET n 
1  978  ALA n 
1  979  GLY n 
1  980  GLY n 
1  981  TYR n 
1  982  VAL n 
1  983  LYS n 
1  984  GLY n 
1  985  ARG n 
1  986  PHE n 
1  987  TYR n 
1  988  SER n 
1  989  GLY n 
1  990  ILE n 
1  991  LYS n 
1  992  PRO n 
1  993  GLN n 
1  994  GLU n 
1  995  TYR n 
1  996  TYR n 
1  997  PHE n 
1  998  HIS n 
1  999  CYS n 
1  1000 MET n 
1  1001 ALA n 
1  1002 GLY n 
1  1003 ARG n 
1  1004 GLU n 
1  1005 GLY n 
1  1006 LEU n 
1  1007 ILE n 
1  1008 ASP n 
1  1009 THR n 
1  1010 ALA n 
1  1011 VAL n 
1  1012 LYS n 
1  1013 THR n 
1  1014 SER n 
1  1015 ARG n 
1  1016 SER n 
1  1017 GLY n 
1  1018 TYR n 
1  1019 LEU n 
1  1020 GLN n 
1  1021 ARG n 
1  1022 CYS n 
1  1023 LEU n 
1  1024 THR n 
1  1025 LYS n 
1  1026 GLN n 
1  1027 LEU n 
1  1028 GLU n 
1  1029 GLY n 
1  1030 VAL n 
1  1031 HIS n 
1  1032 VAL n 
1  1033 SER n 
1  1034 TYR n 
1  1035 ASP n 
1  1036 ASN n 
1  1037 SER n 
1  1038 ILE n 
1  1039 ARG n 
1  1040 ASP n 
1  1041 ALA n 
1  1042 ASP n 
1  1043 GLY n 
1  1044 THR n 
1  1045 LEU n 
1  1046 VAL n 
1  1047 GLN n 
1  1048 PHE n 
1  1049 MET n 
1  1050 TYR n 
1  1051 GLY n 
1  1052 GLY n 
1  1053 ASP n 
1  1054 ALA n 
1  1055 ILE n 
1  1056 ASP n 
1  1057 ILE n 
1  1058 THR n 
1  1059 LYS n 
1  1060 GLU n 
1  1061 SER n 
1  1062 HIS n 
1  1063 MET n 
1  1064 THR n 
1  1065 GLN n 
1  1066 PHE n 
1  1067 GLU n 
1  1068 PHE n 
1  1069 CYS n 
1  1070 LEU n 
1  1071 ASP n 
1  1072 ASN n 
1  1073 TYR n 
1  1074 TYR n 
1  1075 ALA n 
1  1076 LEU n 
1  1077 LEU n 
1  1078 LYS n 
1  1079 LYS n 
1  1080 TYR n 
1  1081 ASN n 
1  1082 PRO n 
1  1083 SER n 
1  1084 ALA n 
1  1085 LEU n 
1  1086 ILE n 
1  1087 GLU n 
1  1088 HIS n 
1  1089 LEU n 
1  1090 ASP n 
1  1091 VAL n 
1  1092 GLU n 
1  1093 SER n 
1  1094 ALA n 
1  1095 LEU n 
1  1096 LYS n 
1  1097 TYR n 
1  1098 SER n 
1  1099 LYS n 
1  1100 LYS n 
1  1101 THR n 
1  1102 LEU n 
1  1103 LYS n 
1  1104 TYR n 
1  1105 ARG n 
1  1106 LYS n 
1  1107 LYS n 
1  1108 HIS n 
1  1109 SER n 
1  1110 LYS n 
1  1111 GLU n 
1  1112 PRO n 
1  1113 HIS n 
1  1114 TYR n 
1  1115 LYS n 
1  1116 GLN n 
1  1117 SER n 
1  1118 VAL n 
1  1119 LYS n 
1  1120 TYR n 
1  1121 ASP n 
1  1122 PRO n 
1  1123 VAL n 
1  1124 LEU n 
1  1125 ALA n 
1  1126 LYS n 
1  1127 TYR n 
1  1128 ASN n 
1  1129 PRO n 
1  1130 ALA n 
1  1131 LYS n 
1  1132 TYR n 
1  1133 LEU n 
1  1134 GLY n 
1  1135 SER n 
1  1136 VAL n 
1  1137 SER n 
1  1138 GLU n 
1  1139 ASN n 
1  1140 PHE n 
1  1141 GLN n 
1  1142 ASP n 
1  1143 LYS n 
1  1144 LEU n 
1  1145 GLU n 
1  1146 SER n 
1  1147 PHE n 
1  1148 LEU n 
1  1149 ASP n 
1  1150 LYS n 
1  1151 ASN n 
1  1152 SER n 
1  1153 LYS n 
1  1154 LEU n 
1  1155 PHE n 
1  1156 LYS n 
1  1157 SER n 
1  1158 SER n 
1  1159 ASP n 
1  1160 GLY n 
1  1161 VAL n 
1  1162 ASN n 
1  1163 GLU n 
1  1164 LYS n 
1  1165 LYS n 
1  1166 PHE n 
1  1167 ARG n 
1  1168 ALA n 
1  1169 LEU n 
1  1170 MET n 
1  1171 GLN n 
1  1172 LEU n 
1  1173 LYS n 
1  1174 TYR n 
1  1175 MET n 
1  1176 ARG n 
1  1177 SER n 
1  1178 LEU n 
1  1179 ILE n 
1  1180 ASN n 
1  1181 PRO n 
1  1182 GLY n 
1  1183 GLU n 
1  1184 ALA n 
1  1185 VAL n 
1  1186 GLY n 
1  1187 ILE n 
1  1188 ILE n 
1  1189 ALA n 
1  1190 SER n 
1  1191 GLN n 
1  1192 SER n 
1  1193 VAL n 
1  1194 GLY n 
1  1195 GLU n 
1  1196 PRO n 
1  1197 SER n 
1  1198 THR n 
1  1199 GLN n 
1  1200 MET n 
1  1201 THR n 
1  1202 LEU n 
1  1203 ASN n 
1  1204 THR n 
1  1205 PHE n 
1  1206 HIS n 
1  1207 PHE n 
1  1208 ALA n 
1  1209 GLY n 
1  1210 HIS n 
1  1211 GLY n 
1  1212 ALA n 
1  1213 ALA n 
1  1214 ASN n 
1  1215 VAL n 
1  1216 THR n 
1  1217 LEU n 
1  1218 GLY n 
1  1219 ILE n 
1  1220 PRO n 
1  1221 ARG n 
1  1222 LEU n 
1  1223 ARG n 
1  1224 GLU n 
1  1225 ILE n 
1  1226 VAL n 
1  1227 MET n 
1  1228 THR n 
1  1229 ALA n 
1  1230 SER n 
1  1231 ALA n 
1  1232 ALA n 
1  1233 ILE n 
1  1234 LYS n 
1  1235 THR n 
1  1236 PRO n 
1  1237 GLN n 
1  1238 MET n 
1  1239 THR n 
1  1240 LEU n 
1  1241 PRO n 
1  1242 ILE n 
1  1243 TRP n 
1  1244 ASN n 
1  1245 ASP n 
1  1246 VAL n 
1  1247 SER n 
1  1248 ASP n 
1  1249 GLU n 
1  1250 GLN n 
1  1251 ALA n 
1  1252 ASP n 
1  1253 THR n 
1  1254 PHE n 
1  1255 CYS n 
1  1256 LYS n 
1  1257 SER n 
1  1258 ILE n 
1  1259 SER n 
1  1260 LYS n 
1  1261 VAL n 
1  1262 LEU n 
1  1263 LEU n 
1  1264 SER n 
1  1265 GLU n 
1  1266 VAL n 
1  1267 ILE n 
1  1268 ASP n 
1  1269 LYS n 
1  1270 VAL n 
1  1271 ILE n 
1  1272 VAL n 
1  1273 THR n 
1  1274 GLU n 
1  1275 THR n 
1  1276 THR n 
1  1277 GLY n 
1  1278 THR n 
1  1279 SER n 
1  1280 ASN n 
1  1281 THR n 
1  1282 ALA n 
1  1283 GLY n 
1  1284 GLY n 
1  1285 ASN n 
1  1286 ALA n 
1  1287 ALA n 
1  1288 ARG n 
1  1289 SER n 
1  1290 TYR n 
1  1291 VAL n 
1  1292 ILE n 
1  1293 HIS n 
1  1294 MET n 
1  1295 ARG n 
1  1296 PHE n 
1  1297 PHE n 
1  1298 ASP n 
1  1299 ASN n 
1  1300 ASN n 
1  1301 GLU n 
1  1302 TYR n 
1  1303 SER n 
1  1304 GLU n 
1  1305 GLU n 
1  1306 TYR n 
1  1307 ASP n 
1  1308 VAL n 
1  1309 SER n 
1  1310 LYS n 
1  1311 GLU n 
1  1312 GLU n 
1  1313 LEU n 
1  1314 GLN n 
1  1315 ASN n 
1  1316 VAL n 
1  1317 ILE n 
1  1318 SER n 
1  1319 ASN n 
1  1320 GLN n 
1  1321 PHE n 
1  1322 ILE n 
1  1323 HIS n 
1  1324 LEU n 
1  1325 LEU n 
1  1326 GLU n 
1  1327 ALA n 
1  1328 ALA n 
1  1329 ILE n 
1  1330 VAL n 
1  1331 LYS n 
1  1332 GLU n 
1  1333 ILE n 
1  1334 LYS n 
1  1335 LYS n 
1  1336 GLN n 
1  1337 LYS n 
1  1338 ARG n 
1  1339 THR n 
1  1340 THR n 
1  1341 GLY n 
1  1342 PRO n 
1  1343 ASP n 
1  1344 ILE n 
1  1345 GLY n 
1  1346 VAL n 
1  1347 ALA n 
1  1348 VAL n 
1  1349 PRO n 
1  1350 ARG n 
1  1351 LEU n 
1  1352 GLN n 
1  1353 THR n 
1  1354 ASP n 
1  1355 VAL n 
1  1356 ALA n 
1  1357 ASN n 
1  1358 SER n 
1  1359 SER n 
1  1360 SER n 
1  1361 ASN n 
1  1362 SER n 
1  1363 LYS n 
1  1364 ARG n 
1  1365 LEU n 
1  1366 GLU n 
1  1367 GLU n 
1  1368 ASP n 
1  1369 ASN n 
1  1370 ASP n 
1  1371 GLU n 
1  1372 GLU n 
1  1373 GLN n 
1  1374 SER n 
1  1375 HIS n 
1  1376 LYS n 
1  1377 LYS n 
1  1378 THR n 
1  1379 LYS n 
1  1380 GLN n 
1  1381 ALA n 
1  1382 VAL n 
1  1383 SER n 
1  1384 TYR n 
1  1385 ASP n 
1  1386 GLU n 
1  1387 PRO n 
1  1388 ASP n 
1  1389 GLU n 
1  1390 ASP n 
1  1391 GLU n 
1  1392 ILE n 
1  1393 GLU n 
1  1394 THR n 
1  1395 MET n 
1  1396 ARG n 
1  1397 GLU n 
1  1398 ALA n 
1  1399 GLU n 
1  1400 LYS n 
1  1401 SER n 
1  1402 SER n 
1  1403 ASP n 
1  1404 GLU n 
1  1405 GLU n 
1  1406 GLY n 
1  1407 ILE n 
1  1408 ASP n 
1  1409 SER n 
1  1410 ASP n 
1  1411 LYS n 
1  1412 GLU n 
1  1413 SER n 
1  1414 ASP n 
1  1415 SER n 
1  1416 ASP n 
1  1417 SER n 
1  1418 GLU n 
1  1419 ASP n 
1  1420 GLU n 
1  1421 ASP n 
1  1422 VAL n 
1  1423 ASP n 
1  1424 MET n 
1  1425 ASN n 
1  1426 GLU n 
1  1427 GLN n 
1  1428 ILE n 
1  1429 ASN n 
1  1430 LYS n 
1  1431 SER n 
1  1432 ILE n 
1  1433 VAL n 
1  1434 GLU n 
1  1435 ALA n 
1  1436 ASN n 
1  1437 ASN n 
1  1438 ASN n 
1  1439 MET n 
1  1440 ASN n 
1  1441 LYS n 
1  1442 VAL n 
1  1443 GLN n 
1  1444 ARG n 
1  1445 ASP n 
1  1446 ARG n 
1  1447 GLN n 
1  1448 SER n 
1  1449 ALA n 
1  1450 ILE n 
1  1451 ILE n 
1  1452 SER n 
1  1453 HIS n 
1  1454 HIS n 
1  1455 ARG n 
1  1456 PHE n 
1  1457 ILE n 
1  1458 THR n 
1  1459 LYS n 
1  1460 TYR n 
1  1461 ASN n 
1  1462 PHE n 
1  1463 ASP n 
1  1464 ASP n 
1  1465 GLU n 
1  1466 SER n 
1  1467 GLY n 
1  1468 LYS n 
1  1469 TRP n 
1  1470 CYS n 
1  1471 GLU n 
1  1472 PHE n 
1  1473 LYS n 
1  1474 LEU n 
1  1475 GLU n 
1  1476 LEU n 
1  1477 ALA n 
1  1478 ALA n 
1  1479 ASP n 
1  1480 THR n 
1  1481 GLU n 
1  1482 LYS n 
1  1483 LEU n 
1  1484 LEU n 
1  1485 MET n 
1  1486 VAL n 
1  1487 ASN n 
1  1488 ILE n 
1  1489 VAL n 
1  1490 GLU n 
1  1491 GLU n 
1  1492 ILE n 
1  1493 CYS n 
1  1494 ARG n 
1  1495 LYS n 
1  1496 SER n 
1  1497 ILE n 
1  1498 ILE n 
1  1499 ARG n 
1  1500 GLN n 
1  1501 ILE n 
1  1502 PRO n 
1  1503 HIS n 
1  1504 ILE n 
1  1505 ASP n 
1  1506 ARG n 
1  1507 CYS n 
1  1508 VAL n 
1  1509 HIS n 
1  1510 PRO n 
1  1511 GLU n 
1  1512 PRO n 
1  1513 GLU n 
1  1514 ASN n 
1  1515 GLY n 
1  1516 LYS n 
1  1517 ARG n 
1  1518 VAL n 
1  1519 LEU n 
1  1520 VAL n 
1  1521 THR n 
1  1522 GLU n 
1  1523 GLY n 
1  1524 VAL n 
1  1525 ASN n 
1  1526 PHE n 
1  1527 GLN n 
1  1528 ALA n 
1  1529 MET n 
1  1530 TRP n 
1  1531 ASP n 
1  1532 GLN n 
1  1533 GLU n 
1  1534 ALA n 
1  1535 PHE n 
1  1536 ILE n 
1  1537 ASP n 
1  1538 VAL n 
1  1539 ASP n 
1  1540 GLY n 
1  1541 ILE n 
1  1542 THR n 
1  1543 SER n 
1  1544 ASN n 
1  1545 ASP n 
1  1546 VAL n 
1  1547 ALA n 
1  1548 ALA n 
1  1549 VAL n 
1  1550 LEU n 
1  1551 LYS n 
1  1552 THR n 
1  1553 TYR n 
1  1554 GLY n 
1  1555 VAL n 
1  1556 GLU n 
1  1557 ALA n 
1  1558 ALA n 
1  1559 ARG n 
1  1560 ASN n 
1  1561 THR n 
1  1562 ILE n 
1  1563 VAL n 
1  1564 ASN n 
1  1565 GLU n 
1  1566 ILE n 
1  1567 ASN n 
1  1568 ASN n 
1  1569 VAL n 
1  1570 PHE n 
1  1571 SER n 
1  1572 ARG n 
1  1573 TYR n 
1  1574 ALA n 
1  1575 ILE n 
1  1576 SER n 
1  1577 VAL n 
1  1578 SER n 
1  1579 PHE n 
1  1580 ARG n 
1  1581 HIS n 
1  1582 LEU n 
1  1583 ASP n 
1  1584 LEU n 
1  1585 ILE n 
1  1586 ALA n 
1  1587 ASP n 
1  1588 MET n 
1  1589 MET n 
1  1590 THR n 
1  1591 ARG n 
1  1592 GLN n 
1  1593 GLY n 
1  1594 THR n 
1  1595 TYR n 
1  1596 LEU n 
1  1597 ALA n 
1  1598 PHE n 
1  1599 ASN n 
1  1600 ARG n 
1  1601 GLN n 
1  1602 GLY n 
1  1603 MET n 
1  1604 GLU n 
1  1605 THR n 
1  1606 SER n 
1  1607 THR n 
1  1608 SER n 
1  1609 SER n 
1  1610 PHE n 
1  1611 MET n 
1  1612 LYS n 
1  1613 MET n 
1  1614 SER n 
1  1615 TYR n 
1  1616 GLU n 
1  1617 THR n 
1  1618 THR n 
1  1619 CYS n 
1  1620 GLN n 
1  1621 PHE n 
1  1622 LEU n 
1  1623 THR n 
1  1624 LYS n 
1  1625 ALA n 
1  1626 VAL n 
1  1627 LEU n 
1  1628 ASP n 
1  1629 ASN n 
1  1630 GLU n 
1  1631 ARG n 
1  1632 GLU n 
1  1633 GLN n 
1  1634 LEU n 
1  1635 ASP n 
1  1636 SER n 
1  1637 PRO n 
1  1638 SER n 
1  1639 ALA n 
1  1640 ARG n 
1  1641 ILE n 
1  1642 VAL n 
1  1643 VAL n 
1  1644 GLY n 
1  1645 LYS n 
1  1646 LEU n 
1  1647 ASN n 
1  1648 ASN n 
1  1649 VAL n 
1  1650 GLY n 
1  1651 THR n 
1  1652 GLY n 
1  1653 SER n 
1  1654 PHE n 
1  1655 ASP n 
1  1656 VAL n 
1  1657 LEU n 
1  1658 ALA n 
1  1659 LYS n 
1  1660 VAL n 
1  1661 PRO n 
1  1662 ASN n 
1  1663 ALA n 
1  1664 ALA n 
2  1    MET n 
2  2    SER n 
2  3    LYS n 
2  4    VAL n 
2  5    ILE n 
2  6    LYS n 
2  7    PRO n 
2  8    PRO n 
2  9    GLY n 
2  10   GLN n 
2  11   ALA n 
2  12   ARG n 
2  13   THR n 
2  14   ALA n 
2  15   ASP n 
2  16   PHE n 
2  17   ARG n 
2  18   THR n 
2  19   LEU n 
2  20   GLU n 
2  21   ARG n 
2  22   GLU n 
2  23   SER n 
2  24   ARG n 
2  25   PHE n 
2  26   ILE n 
2  27   ASN n 
2  28   PRO n 
2  29   PRO n 
2  30   LYS n 
2  31   ASP n 
2  32   LYS n 
2  33   SER n 
2  34   ALA n 
2  35   PHE n 
2  36   PRO n 
2  37   LEU n 
2  38   LEU n 
2  39   GLN n 
2  40   GLU n 
2  41   ALA n 
2  42   VAL n 
2  43   GLN n 
2  44   PRO n 
2  45   HIS n 
2  46   ILE n 
2  47   GLY n 
2  48   SER n 
2  49   PHE n 
2  50   ASN n 
2  51   ALA n 
2  52   LEU n 
2  53   THR n 
2  54   GLU n 
2  55   GLY n 
2  56   PRO n 
2  57   ASP n 
2  58   GLY n 
2  59   GLY n 
2  60   LEU n 
2  61   LEU n 
2  62   ASN n 
2  63   LEU n 
2  64   GLY n 
2  65   VAL n 
2  66   LYS n 
2  67   ASP n 
2  68   ILE n 
2  69   GLY n 
2  70   GLU n 
2  71   LYS n 
2  72   VAL n 
2  73   ILE n 
2  74   PHE n 
2  75   ASP n 
2  76   GLY n 
2  77   LYS n 
2  78   PRO n 
2  79   LEU n 
2  80   ASN n 
2  81   SER n 
2  82   GLU n 
2  83   ASP n 
2  84   GLU n 
2  85   ILE n 
2  86   SER n 
2  87   ASN n 
2  88   SER n 
2  89   GLY n 
2  90   TYR n 
2  91   LEU n 
2  92   GLY n 
2  93   ASN n 
2  94   LYS n 
2  95   LEU n 
2  96   SER n 
2  97   VAL n 
2  98   SER n 
2  99   VAL n 
2  100  GLU n 
2  101  GLN n 
2  102  VAL n 
2  103  SER n 
2  104  ILE n 
2  105  ALA n 
2  106  LYS n 
2  107  PRO n 
2  108  MET n 
2  109  SER n 
2  110  ASN n 
2  111  ASP n 
2  112  GLY n 
2  113  VAL n 
2  114  SER n 
2  115  SER n 
2  116  ALA n 
2  117  VAL n 
2  118  GLU n 
2  119  ARG n 
2  120  LYS n 
2  121  VAL n 
2  122  TYR n 
2  123  PRO n 
2  124  SER n 
2  125  GLU n 
2  126  SER n 
2  127  ARG n 
2  128  GLN n 
2  129  ARG n 
2  130  LEU n 
2  131  THR n 
2  132  SER n 
2  133  TYR n 
2  134  ARG n 
2  135  GLY n 
2  136  LYS n 
2  137  LEU n 
2  138  LEU n 
2  139  LEU n 
2  140  LYS n 
2  141  LEU n 
2  142  LYS n 
2  143  TRP n 
2  144  SER n 
2  145  VAL n 
2  146  ASN n 
2  147  ASN n 
2  148  GLY n 
2  149  GLU n 
2  150  GLU n 
2  151  ASN n 
2  152  LEU n 
2  153  PHE n 
2  154  GLU n 
2  155  VAL n 
2  156  ARG n 
2  157  ASP n 
2  158  CYS n 
2  159  GLY n 
2  160  GLY n 
2  161  LEU n 
2  162  PRO n 
2  163  VAL n 
2  164  MET n 
2  165  LEU n 
2  166  GLN n 
2  167  SER n 
2  168  ASN n 
2  169  ARG n 
2  170  CYS n 
2  171  HIS n 
2  172  LEU n 
2  173  ASN n 
2  174  LYS n 
2  175  MET n 
2  176  SER n 
2  177  PRO n 
2  178  TYR n 
2  179  GLU n 
2  180  LEU n 
2  181  VAL n 
2  182  GLN n 
2  183  HIS n 
2  184  LYS n 
2  185  GLU n 
2  186  GLU n 
2  187  SER n 
2  188  ASP n 
2  189  GLU n 
2  190  ILE n 
2  191  GLY n 
2  192  GLY n 
2  193  TYR n 
2  194  PHE n 
2  195  ILE n 
2  196  VAL n 
2  197  ASN n 
2  198  GLY n 
2  199  ILE n 
2  200  GLU n 
2  201  LYS n 
2  202  LEU n 
2  203  ILE n 
2  204  ARG n 
2  205  MET n 
2  206  LEU n 
2  207  ILE n 
2  208  VAL n 
2  209  GLN n 
2  210  ARG n 
2  211  ARG n 
2  212  ASN n 
2  213  HIS n 
2  214  PRO n 
2  215  MET n 
2  216  ALA n 
2  217  ILE n 
2  218  ILE n 
2  219  ARG n 
2  220  PRO n 
2  221  SER n 
2  222  PHE n 
2  223  ALA n 
2  224  ASN n 
2  225  ARG n 
2  226  GLY n 
2  227  ALA n 
2  228  SER n 
2  229  TYR n 
2  230  SER n 
2  231  HIS n 
2  232  TYR n 
2  233  GLY n 
2  234  ILE n 
2  235  GLN n 
2  236  ILE n 
2  237  ARG n 
2  238  SER n 
2  239  VAL n 
2  240  ARG n 
2  241  PRO n 
2  242  ASP n 
2  243  GLN n 
2  244  THR n 
2  245  SER n 
2  246  GLN n 
2  247  THR n 
2  248  ASN n 
2  249  VAL n 
2  250  LEU n 
2  251  HIS n 
2  252  TYR n 
2  253  LEU n 
2  254  ASN n 
2  255  ASP n 
2  256  GLY n 
2  257  GLN n 
2  258  VAL n 
2  259  THR n 
2  260  PHE n 
2  261  ARG n 
2  262  PHE n 
2  263  SER n 
2  264  TRP n 
2  265  ARG n 
2  266  LYS n 
2  267  ASN n 
2  268  GLU n 
2  269  TYR n 
2  270  LEU n 
2  271  VAL n 
2  272  PRO n 
2  273  VAL n 
2  274  VAL n 
2  275  MET n 
2  276  ILE n 
2  277  LEU n 
2  278  LYS n 
2  279  ALA n 
2  280  LEU n 
2  281  CYS n 
2  282  HIS n 
2  283  THR n 
2  284  SER n 
2  285  ASP n 
2  286  ARG n 
2  287  GLU n 
2  288  ILE n 
2  289  PHE n 
2  290  ASP n 
2  291  GLY n 
2  292  ILE n 
2  293  ILE n 
2  294  GLY n 
2  295  ASN n 
2  296  ASP n 
2  297  VAL n 
2  298  LYS n 
2  299  ASP n 
2  300  SER n 
2  301  PHE n 
2  302  LEU n 
2  303  THR n 
2  304  ASP n 
2  305  ARG n 
2  306  LEU n 
2  307  GLU n 
2  308  LEU n 
2  309  LEU n 
2  310  LEU n 
2  311  ARG n 
2  312  GLY n 
2  313  PHE n 
2  314  LYS n 
2  315  LYS n 
2  316  ARG n 
2  317  TYR n 
2  318  PRO n 
2  319  HIS n 
2  320  LEU n 
2  321  GLN n 
2  322  ASN n 
2  323  ARG n 
2  324  THR n 
2  325  GLN n 
2  326  VAL n 
2  327  LEU n 
2  328  GLN n 
2  329  TYR n 
2  330  LEU n 
2  331  GLY n 
2  332  ASP n 
2  333  LYS n 
2  334  PHE n 
2  335  ARG n 
2  336  VAL n 
2  337  VAL n 
2  338  PHE n 
2  339  GLN n 
2  340  ALA n 
2  341  SER n 
2  342  PRO n 
2  343  ASP n 
2  344  GLN n 
2  345  SER n 
2  346  ASP n 
2  347  LEU n 
2  348  GLU n 
2  349  VAL n 
2  350  GLY n 
2  351  GLN n 
2  352  GLU n 
2  353  VAL n 
2  354  LEU n 
2  355  ASP n 
2  356  ARG n 
2  357  ILE n 
2  358  VAL n 
2  359  LEU n 
2  360  VAL n 
2  361  HIS n 
2  362  LEU n 
2  363  GLY n 
2  364  LYS n 
2  365  ASP n 
2  366  GLY n 
2  367  SER n 
2  368  GLN n 
2  369  ASP n 
2  370  LYS n 
2  371  PHE n 
2  372  ARG n 
2  373  MET n 
2  374  LEU n 
2  375  LEU n 
2  376  PHE n 
2  377  MET n 
2  378  ILE n 
2  379  ARG n 
2  380  LYS n 
2  381  LEU n 
2  382  TYR n 
2  383  SER n 
2  384  LEU n 
2  385  VAL n 
2  386  ALA n 
2  387  GLY n 
2  388  GLU n 
2  389  CYS n 
2  390  SER n 
2  391  PRO n 
2  392  ASP n 
2  393  ASN n 
2  394  PRO n 
2  395  ASP n 
2  396  ALA n 
2  397  THR n 
2  398  GLN n 
2  399  HIS n 
2  400  GLN n 
2  401  GLU n 
2  402  VAL n 
2  403  LEU n 
2  404  LEU n 
2  405  GLY n 
2  406  GLY n 
2  407  PHE n 
2  408  LEU n 
2  409  TYR n 
2  410  GLY n 
2  411  MET n 
2  412  ILE n 
2  413  LEU n 
2  414  LYS n 
2  415  GLU n 
2  416  LYS n 
2  417  ILE n 
2  418  ASP n 
2  419  GLU n 
2  420  TYR n 
2  421  LEU n 
2  422  GLN n 
2  423  ASN n 
2  424  ILE n 
2  425  ILE n 
2  426  ALA n 
2  427  GLN n 
2  428  VAL n 
2  429  ARG n 
2  430  MET n 
2  431  ASP n 
2  432  ILE n 
2  433  ASN n 
2  434  ARG n 
2  435  GLY n 
2  436  MET n 
2  437  ALA n 
2  438  ILE n 
2  439  ASN n 
2  440  PHE n 
2  441  LYS n 
2  442  ASP n 
2  443  LYS n 
2  444  ARG n 
2  445  TYR n 
2  446  MET n 
2  447  SER n 
2  448  ARG n 
2  449  VAL n 
2  450  LEU n 
2  451  MET n 
2  452  ARG n 
2  453  VAL n 
2  454  ASN n 
2  455  GLU n 
2  456  ASN n 
2  457  ILE n 
2  458  GLY n 
2  459  SER n 
2  460  LYS n 
2  461  MET n 
2  462  GLN n 
2  463  TYR n 
2  464  PHE n 
2  465  LEU n 
2  466  SER n 
2  467  THR n 
2  468  GLY n 
2  469  ASN n 
2  470  LEU n 
2  471  VAL n 
2  472  SER n 
2  473  GLN n 
2  474  SER n 
2  475  GLY n 
2  476  LEU n 
2  477  ASP n 
2  478  LEU n 
2  479  GLN n 
2  480  GLN n 
2  481  VAL n 
2  482  SER n 
2  483  GLY n 
2  484  TYR n 
2  485  THR n 
2  486  VAL n 
2  487  VAL n 
2  488  ALA n 
2  489  GLU n 
2  490  LYS n 
2  491  ILE n 
2  492  ASN n 
2  493  PHE n 
2  494  TYR n 
2  495  ARG n 
2  496  PHE n 
2  497  ILE n 
2  498  SER n 
2  499  HIS n 
2  500  PHE n 
2  501  ARG n 
2  502  MET n 
2  503  VAL n 
2  504  HIS n 
2  505  ARG n 
2  506  GLY n 
2  507  SER n 
2  508  PHE n 
2  509  PHE n 
2  510  ALA n 
2  511  GLN n 
2  512  LEU n 
2  513  LYS n 
2  514  THR n 
2  515  THR n 
2  516  THR n 
2  517  VAL n 
2  518  ARG n 
2  519  LYS n 
2  520  LEU n 
2  521  LEU n 
2  522  PRO n 
2  523  GLU n 
2  524  SER n 
2  525  TRP n 
2  526  GLY n 
2  527  PHE n 
2  528  LEU n 
2  529  CYS n 
2  530  PRO n 
2  531  VAL n 
2  532  HIS n 
2  533  THR n 
2  534  PRO n 
2  535  ASP n 
2  536  GLY n 
2  537  SER n 
2  538  PRO n 
2  539  CYS n 
2  540  GLY n 
2  541  LEU n 
2  542  LEU n 
2  543  ASN n 
2  544  HIS n 
2  545  PHE n 
2  546  ALA n 
2  547  HIS n 
2  548  LYS n 
2  549  CYS n 
2  550  ARG n 
2  551  ILE n 
2  552  SER n 
2  553  THR n 
2  554  GLN n 
2  555  GLN n 
2  556  SER n 
2  557  ASP n 
2  558  VAL n 
2  559  SER n 
2  560  ARG n 
2  561  ILE n 
2  562  PRO n 
2  563  SER n 
2  564  ILE n 
2  565  LEU n 
2  566  TYR n 
2  567  SER n 
2  568  LEU n 
2  569  GLY n 
2  570  VAL n 
2  571  ALA n 
2  572  PRO n 
2  573  ALA n 
2  574  SER n 
2  575  HIS n 
2  576  THR n 
2  577  PHE n 
2  578  ALA n 
2  579  ALA n 
2  580  GLY n 
2  581  PRO n 
2  582  SER n 
2  583  LEU n 
2  584  CYS n 
2  585  CYS n 
2  586  VAL n 
2  587  GLN n 
2  588  ILE n 
2  589  ASP n 
2  590  GLY n 
2  591  LYS n 
2  592  ILE n 
2  593  ILE n 
2  594  GLY n 
2  595  TRP n 
2  596  VAL n 
2  597  SER n 
2  598  HIS n 
2  599  GLU n 
2  600  GLN n 
2  601  GLY n 
2  602  LYS n 
2  603  ILE n 
2  604  ILE n 
2  605  ALA n 
2  606  ASP n 
2  607  THR n 
2  608  LEU n 
2  609  ARG n 
2  610  TYR n 
2  611  TRP n 
2  612  LYS n 
2  613  VAL n 
2  614  GLU n 
2  615  GLY n 
2  616  LYS n 
2  617  THR n 
2  618  PRO n 
2  619  GLY n 
2  620  LEU n 
2  621  PRO n 
2  622  ILE n 
2  623  ASP n 
2  624  LEU n 
2  625  GLU n 
2  626  ILE n 
2  627  GLY n 
2  628  TYR n 
2  629  VAL n 
2  630  PRO n 
2  631  PRO n 
2  632  SER n 
2  633  THR n 
2  634  ARG n 
2  635  GLY n 
2  636  GLN n 
2  637  TYR n 
2  638  PRO n 
2  639  GLY n 
2  640  LEU n 
2  641  TYR n 
2  642  LEU n 
2  643  PHE n 
2  644  GLY n 
2  645  GLY n 
2  646  HIS n 
2  647  SER n 
2  648  ARG n 
2  649  MET n 
2  650  LEU n 
2  651  ARG n 
2  652  PRO n 
2  653  VAL n 
2  654  ARG n 
2  655  TYR n 
2  656  LEU n 
2  657  PRO n 
2  658  LEU n 
2  659  ASP n 
2  660  LYS n 
2  661  GLU n 
2  662  ASP n 
2  663  ILE n 
2  664  VAL n 
2  665  GLY n 
2  666  PRO n 
2  667  PHE n 
2  668  GLU n 
2  669  GLN n 
2  670  VAL n 
2  671  TYR n 
2  672  MET n 
2  673  ASN n 
2  674  ILE n 
2  675  ALA n 
2  676  VAL n 
2  677  THR n 
2  678  PRO n 
2  679  GLN n 
2  680  GLU n 
2  681  ILE n 
2  682  GLN n 
2  683  ASN n 
2  684  ASN n 
2  685  VAL n 
2  686  HIS n 
2  687  THR n 
2  688  HIS n 
2  689  VAL n 
2  690  GLU n 
2  691  PHE n 
2  692  THR n 
2  693  PRO n 
2  694  THR n 
2  695  ASN n 
2  696  ILE n 
2  697  LEU n 
2  698  SER n 
2  699  ILE n 
2  700  LEU n 
2  701  ALA n 
2  702  ASN n 
2  703  LEU n 
2  704  THR n 
2  705  PRO n 
2  706  PHE n 
2  707  SER n 
2  708  ASP n 
2  709  PHE n 
2  710  ASN n 
2  711  GLN n 
2  712  SER n 
2  713  PRO n 
2  714  ARG n 
2  715  ASN n 
2  716  MET n 
2  717  TYR n 
2  718  GLN n 
2  719  CYS n 
2  720  GLN n 
2  721  MET n 
2  722  GLY n 
2  723  LYS n 
2  724  GLN n 
2  725  THR n 
2  726  MET n 
2  727  GLY n 
2  728  THR n 
2  729  PRO n 
2  730  GLY n 
2  731  VAL n 
2  732  ALA n 
2  733  LEU n 
2  734  CYS n 
2  735  HIS n 
2  736  ARG n 
2  737  SER n 
2  738  ASP n 
2  739  ASN n 
2  740  LYS n 
2  741  LEU n 
2  742  TYR n 
2  743  ARG n 
2  744  LEU n 
2  745  GLN n 
2  746  THR n 
2  747  GLY n 
2  748  GLN n 
2  749  THR n 
2  750  PRO n 
2  751  ILE n 
2  752  VAL n 
2  753  LYS n 
2  754  ALA n 
2  755  ASN n 
2  756  LEU n 
2  757  TYR n 
2  758  ASP n 
2  759  ASP n 
2  760  TYR n 
2  761  GLY n 
2  762  MET n 
2  763  ASP n 
2  764  ASN n 
2  765  PHE n 
2  766  PRO n 
2  767  ASN n 
2  768  GLY n 
2  769  PHE n 
2  770  ASN n 
2  771  ALA n 
2  772  VAL n 
2  773  VAL n 
2  774  ALA n 
2  775  VAL n 
2  776  ILE n 
2  777  SER n 
2  778  TYR n 
2  779  THR n 
2  780  GLY n 
2  781  TYR n 
2  782  ASP n 
2  783  MET n 
2  784  ASP n 
2  785  ASP n 
2  786  ALA n 
2  787  MET n 
2  788  ILE n 
2  789  ILE n 
2  790  ASN n 
2  791  LYS n 
2  792  SER n 
2  793  ALA n 
2  794  ASP n 
2  795  GLU n 
2  796  ARG n 
2  797  GLY n 
2  798  PHE n 
2  799  GLY n 
2  800  TYR n 
2  801  GLY n 
2  802  THR n 
2  803  MET n 
2  804  TYR n 
2  805  LYS n 
2  806  THR n 
2  807  GLU n 
2  808  LYS n 
2  809  VAL n 
2  810  ASP n 
2  811  LEU n 
2  812  ALA n 
2  813  LEU n 
2  814  ASN n 
2  815  ARG n 
2  816  ASN n 
2  817  ARG n 
2  818  GLY n 
2  819  ASP n 
2  820  PRO n 
2  821  ILE n 
2  822  THR n 
2  823  GLN n 
2  824  HIS n 
2  825  PHE n 
2  826  GLY n 
2  827  PHE n 
2  828  GLY n 
2  829  ASN n 
2  830  ASP n 
2  831  GLU n 
2  832  TRP n 
2  833  PRO n 
2  834  LYS n 
2  835  GLU n 
2  836  TRP n 
2  837  LEU n 
2  838  GLU n 
2  839  LYS n 
2  840  LEU n 
2  841  ASP n 
2  842  GLU n 
2  843  ASP n 
2  844  GLY n 
2  845  LEU n 
2  846  PRO n 
2  847  TYR n 
2  848  ILE n 
2  849  GLY n 
2  850  THR n 
2  851  TYR n 
2  852  VAL n 
2  853  GLU n 
2  854  GLU n 
2  855  GLY n 
2  856  ASP n 
2  857  PRO n 
2  858  ILE n 
2  859  CYS n 
2  860  ALA n 
2  861  TYR n 
2  862  PHE n 
2  863  ASP n 
2  864  ASP n 
2  865  THR n 
2  866  LEU n 
2  867  ASN n 
2  868  LYS n 
2  869  THR n 
2  870  LYS n 
2  871  ILE n 
2  872  LYS n 
2  873  THR n 
2  874  TYR n 
2  875  HIS n 
2  876  SER n 
2  877  SER n 
2  878  GLU n 
2  879  PRO n 
2  880  ALA n 
2  881  TYR n 
2  882  ILE n 
2  883  GLU n 
2  884  GLU n 
2  885  VAL n 
2  886  ASN n 
2  887  LEU n 
2  888  ILE n 
2  889  GLY n 
2  890  ASP n 
2  891  GLU n 
2  892  SER n 
2  893  ASN n 
2  894  LYS n 
2  895  PHE n 
2  896  GLN n 
2  897  GLU n 
2  898  LEU n 
2  899  GLN n 
2  900  THR n 
2  901  VAL n 
2  902  SER n 
2  903  ILE n 
2  904  LYS n 
2  905  TYR n 
2  906  ARG n 
2  907  ILE n 
2  908  ARG n 
2  909  ARG n 
2  910  THR n 
2  911  PRO n 
2  912  GLN n 
2  913  ILE n 
2  914  GLY n 
2  915  ASP n 
2  916  LYS n 
2  917  PHE n 
2  918  SER n 
2  919  SER n 
2  920  ARG n 
2  921  HIS n 
2  922  GLY n 
2  923  GLN n 
2  924  LYS n 
2  925  GLY n 
2  926  VAL n 
2  927  CYS n 
2  928  SER n 
2  929  ARG n 
2  930  LYS n 
2  931  TRP n 
2  932  PRO n 
2  933  THR n 
2  934  ILE n 
2  935  ASP n 
2  936  MET n 
2  937  PRO n 
2  938  PHE n 
2  939  SER n 
2  940  GLU n 
2  941  THR n 
2  942  GLY n 
2  943  ILE n 
2  944  GLN n 
2  945  PRO n 
2  946  ASP n 
2  947  ILE n 
2  948  ILE n 
2  949  ILE n 
2  950  ASN n 
2  951  PRO n 
2  952  HIS n 
2  953  ALA n 
2  954  PHE n 
2  955  PRO n 
2  956  SER n 
2  957  ARG n 
2  958  MET n 
2  959  THR n 
2  960  ILE n 
2  961  GLY n 
2  962  MET n 
2  963  PHE n 
2  964  VAL n 
2  965  GLU n 
2  966  SER n 
2  967  LEU n 
2  968  ALA n 
2  969  GLY n 
2  970  LYS n 
2  971  ALA n 
2  972  GLY n 
2  973  ALA n 
2  974  LEU n 
2  975  HIS n 
2  976  GLY n 
2  977  ILE n 
2  978  ALA n 
2  979  GLN n 
2  980  ASP n 
2  981  SER n 
2  982  THR n 
2  983  PRO n 
2  984  TRP n 
2  985  ILE n 
2  986  PHE n 
2  987  ASN n 
2  988  GLU n 
2  989  ASP n 
2  990  ASP n 
2  991  THR n 
2  992  PRO n 
2  993  ALA n 
2  994  ASP n 
2  995  TYR n 
2  996  PHE n 
2  997  GLY n 
2  998  GLU n 
2  999  GLN n 
2  1000 LEU n 
2  1001 ALA n 
2  1002 LYS n 
2  1003 ALA n 
2  1004 GLY n 
2  1005 TYR n 
2  1006 ASN n 
2  1007 TYR n 
2  1008 HIS n 
2  1009 GLY n 
2  1010 ASN n 
2  1011 GLU n 
2  1012 PRO n 
2  1013 MET n 
2  1014 TYR n 
2  1015 SER n 
2  1016 GLY n 
2  1017 ALA n 
2  1018 THR n 
2  1019 GLY n 
2  1020 GLU n 
2  1021 GLU n 
2  1022 LEU n 
2  1023 ARG n 
2  1024 ALA n 
2  1025 ASP n 
2  1026 ILE n 
2  1027 TYR n 
2  1028 VAL n 
2  1029 GLY n 
2  1030 VAL n 
2  1031 VAL n 
2  1032 TYR n 
2  1033 TYR n 
2  1034 GLN n 
2  1035 ARG n 
2  1036 LEU n 
2  1037 ARG n 
2  1038 HIS n 
2  1039 MET n 
2  1040 VAL n 
2  1041 ASN n 
2  1042 ASP n 
2  1043 LYS n 
2  1044 PHE n 
2  1045 GLN n 
2  1046 VAL n 
2  1047 ARG n 
2  1048 SER n 
2  1049 THR n 
2  1050 GLY n 
2  1051 PRO n 
2  1052 VAL n 
2  1053 ASN n 
2  1054 SER n 
2  1055 LEU n 
2  1056 THR n 
2  1057 MET n 
2  1058 GLN n 
2  1059 PRO n 
2  1060 VAL n 
2  1061 LYS n 
2  1062 GLY n 
2  1063 ARG n 
2  1064 LYS n 
2  1065 ARG n 
2  1066 HIS n 
2  1067 GLY n 
2  1068 GLY n 
2  1069 ILE n 
2  1070 ARG n 
2  1071 VAL n 
2  1072 GLY n 
2  1073 GLU n 
2  1074 MET n 
2  1075 GLU n 
2  1076 ARG n 
2  1077 ASP n 
2  1078 ALA n 
2  1079 LEU n 
2  1080 ILE n 
2  1081 GLY n 
2  1082 HIS n 
2  1083 GLY n 
2  1084 THR n 
2  1085 SER n 
2  1086 PHE n 
2  1087 LEU n 
2  1088 LEU n 
2  1089 GLN n 
2  1090 ASP n 
2  1091 ARG n 
2  1092 LEU n 
2  1093 LEU n 
2  1094 ASN n 
2  1095 SER n 
2  1096 SER n 
2  1097 ASP n 
2  1098 TYR n 
2  1099 THR n 
2  1100 GLN n 
2  1101 ALA n 
2  1102 SER n 
2  1103 VAL n 
2  1104 CYS n 
2  1105 ARG n 
2  1106 GLU n 
2  1107 CYS n 
2  1108 GLY n 
2  1109 SER n 
2  1110 ILE n 
2  1111 LEU n 
2  1112 THR n 
2  1113 THR n 
2  1114 GLN n 
2  1115 GLN n 
2  1116 SER n 
2  1117 VAL n 
2  1118 PRO n 
2  1119 ARG n 
2  1120 ILE n 
2  1121 GLY n 
2  1122 SER n 
2  1123 ILE n 
2  1124 SER n 
2  1125 THR n 
2  1126 VAL n 
2  1127 CYS n 
2  1128 CYS n 
2  1129 ARG n 
2  1130 ARG n 
2  1131 CYS n 
2  1132 SER n 
2  1133 MET n 
2  1134 ARG n 
2  1135 PHE n 
2  1136 GLU n 
2  1137 ASP n 
2  1138 ALA n 
2  1139 LYS n 
2  1140 LYS n 
2  1141 LEU n 
2  1142 LEU n 
2  1143 THR n 
2  1144 LYS n 
2  1145 SER n 
2  1146 GLU n 
2  1147 ASP n 
2  1148 GLY n 
2  1149 GLU n 
2  1150 LYS n 
2  1151 ILE n 
2  1152 PHE n 
2  1153 ILE n 
2  1154 ASP n 
2  1155 ASP n 
2  1156 SER n 
2  1157 GLN n 
2  1158 ILE n 
2  1159 TRP n 
2  1160 GLU n 
2  1161 ASP n 
2  1162 GLY n 
2  1163 GLN n 
2  1164 GLY n 
2  1165 ASN n 
2  1166 LYS n 
2  1167 PHE n 
2  1168 VAL n 
2  1169 GLY n 
2  1170 GLY n 
2  1171 ASN n 
2  1172 GLU n 
2  1173 THR n 
2  1174 THR n 
2  1175 THR n 
2  1176 VAL n 
2  1177 ALA n 
2  1178 ILE n 
2  1179 PRO n 
2  1180 PHE n 
2  1181 VAL n 
2  1182 LEU n 
2  1183 LYS n 
2  1184 TYR n 
2  1185 LEU n 
2  1186 ASP n 
2  1187 SER n 
2  1188 GLU n 
2  1189 LEU n 
2  1190 SER n 
2  1191 ALA n 
2  1192 MET n 
2  1193 GLY n 
2  1194 ILE n 
2  1195 ARG n 
2  1196 LEU n 
2  1197 ARG n 
2  1198 TYR n 
2  1199 ASN n 
2  1200 VAL n 
2  1201 GLU n 
2  1202 PRO n 
2  1203 LYS n 
3  1    MET n 
3  2    SER n 
3  3    ASN n 
3  4    ILE n 
3  5    VAL n 
3  6    GLY n 
3  7    ILE n 
3  8    GLU n 
3  9    TYR n 
3  10   ASN n 
3  11   ARG n 
3  12   VAL n 
3  13   THR n 
3  14   ASN n 
3  15   THR n 
3  16   THR n 
3  17   SER n 
3  18   THR n 
3  19   ASP n 
3  20   PHE n 
3  21   PRO n 
3  22   GLY n 
3  23   PHE n 
3  24   SER n 
3  25   LYS n 
3  26   ASP n 
3  27   ALA n 
3  28   GLU n 
3  29   ASN n 
3  30   GLU n 
3  31   TRP n 
3  32   ASN n 
3  33   VAL n 
3  34   GLU n 
3  35   LYS n 
3  36   PHE n 
3  37   LYS n 
3  38   LYS n 
3  39   ASP n 
3  40   PHE n 
3  41   GLU n 
3  42   VAL n 
3  43   ASN n 
3  44   ILE n 
3  45   SER n 
3  46   SER n 
3  47   LEU n 
3  48   ASP n 
3  49   ALA n 
3  50   ARG n 
3  51   GLU n 
3  52   ALA n 
3  53   ASN n 
3  54   PHE n 
3  55   ASP n 
3  56   LEU n 
3  57   ILE n 
3  58   ASN n 
3  59   ILE n 
3  60   ASP n 
3  61   THR n 
3  62   SER n 
3  63   ILE n 
3  64   ALA n 
3  65   ASN n 
3  66   ALA n 
3  67   PHE n 
3  68   ARG n 
3  69   ARG n 
3  70   ILE n 
3  71   MET n 
3  72   ILE n 
3  73   SER n 
3  74   GLU n 
3  75   VAL n 
3  76   PRO n 
3  77   SER n 
3  78   VAL n 
3  79   ALA n 
3  80   ALA n 
3  81   GLU n 
3  82   TYR n 
3  83   VAL n 
3  84   TYR n 
3  85   PHE n 
3  86   PHE n 
3  87   ASN n 
3  88   ASN n 
3  89   THR n 
3  90   SER n 
3  91   VAL n 
3  92   ILE n 
3  93   GLN n 
3  94   ASP n 
3  95   GLU n 
3  96   VAL n 
3  97   LEU n 
3  98   ALA n 
3  99   HIS n 
3  100  ARG n 
3  101  ILE n 
3  102  GLY n 
3  103  LEU n 
3  104  VAL n 
3  105  PRO n 
3  106  LEU n 
3  107  LYS n 
3  108  VAL n 
3  109  ASP n 
3  110  PRO n 
3  111  ASP n 
3  112  MET n 
3  113  LEU n 
3  114  THR n 
3  115  TRP n 
3  116  VAL n 
3  117  ASP n 
3  118  SER n 
3  119  ASN n 
3  120  LEU n 
3  121  PRO n 
3  122  ASP n 
3  123  ASP n 
3  124  GLU n 
3  125  LYS n 
3  126  PHE n 
3  127  THR n 
3  128  ASP n 
3  129  GLU n 
3  130  ASN n 
3  131  THR n 
3  132  ILE n 
3  133  VAL n 
3  134  LEU n 
3  135  SER n 
3  136  LEU n 
3  137  ASN n 
3  138  VAL n 
3  139  LYS n 
3  140  CYS n 
3  141  THR n 
3  142  ARG n 
3  143  ASN n 
3  144  PRO n 
3  145  ASP n 
3  146  ALA n 
3  147  PRO n 
3  148  LYS n 
3  149  GLY n 
3  150  SER n 
3  151  THR n 
3  152  ASP n 
3  153  PRO n 
3  154  LYS n 
3  155  GLU n 
3  156  LEU n 
3  157  TYR n 
3  158  ASN n 
3  159  ASN n 
3  160  ALA n 
3  161  HIS n 
3  162  VAL n 
3  163  TYR n 
3  164  ALA n 
3  165  ARG n 
3  166  ASP n 
3  167  LEU n 
3  168  LYS n 
3  169  PHE n 
3  170  GLU n 
3  171  PRO n 
3  172  GLN n 
3  173  GLY n 
3  174  ARG n 
3  175  GLN n 
3  176  SER n 
3  177  THR n 
3  178  THR n 
3  179  PHE n 
3  180  ALA n 
3  181  ASP n 
3  182  CYS n 
3  183  PRO n 
3  184  VAL n 
3  185  VAL n 
3  186  PRO n 
3  187  ALA n 
3  188  ASP n 
3  189  PRO n 
3  190  ASP n 
3  191  ILE n 
3  192  LEU n 
3  193  LEU n 
3  194  ALA n 
3  195  LYS n 
3  196  LEU n 
3  197  ARG n 
3  198  PRO n 
3  199  GLY n 
3  200  GLN n 
3  201  GLU n 
3  202  ILE n 
3  203  SER n 
3  204  LEU n 
3  205  LYS n 
3  206  ALA n 
3  207  HIS n 
3  208  CYS n 
3  209  ILE n 
3  210  LEU n 
3  211  GLY n 
3  212  ILE n 
3  213  GLY n 
3  214  GLY n 
3  215  ASP n 
3  216  HIS n 
3  217  ALA n 
3  218  LYS n 
3  219  PHE n 
3  220  SER n 
3  221  PRO n 
3  222  VAL n 
3  223  SER n 
3  224  THR n 
3  225  ALA n 
3  226  SER n 
3  227  TYR n 
3  228  ARG n 
3  229  LEU n 
3  230  LEU n 
3  231  PRO n 
3  232  GLN n 
3  233  ILE n 
3  234  ASN n 
3  235  ILE n 
3  236  LEU n 
3  237  GLN n 
3  238  PRO n 
3  239  ILE n 
3  240  LYS n 
3  241  GLY n 
3  242  GLU n 
3  243  SER n 
3  244  ALA n 
3  245  ARG n 
3  246  ARG n 
3  247  PHE n 
3  248  GLN n 
3  249  LYS n 
3  250  CYS n 
3  251  PHE n 
3  252  PRO n 
3  253  PRO n 
3  254  GLY n 
3  255  VAL n 
3  256  ILE n 
3  257  GLY n 
3  258  ILE n 
3  259  ASP n 
3  260  GLU n 
3  261  GLY n 
3  262  SER n 
3  263  ASP n 
3  264  GLU n 
3  265  ALA n 
3  266  TYR n 
3  267  VAL n 
3  268  LYS n 
3  269  ASP n 
3  270  ALA n 
3  271  ARG n 
3  272  LYS n 
3  273  ASP n 
3  274  THR n 
3  275  VAL n 
3  276  SER n 
3  277  ARG n 
3  278  GLU n 
3  279  VAL n 
3  280  LEU n 
3  281  ARG n 
3  282  TYR n 
3  283  GLU n 
3  284  GLU n 
3  285  PHE n 
3  286  ALA n 
3  287  ASP n 
3  288  LYS n 
3  289  VAL n 
3  290  LYS n 
3  291  LEU n 
3  292  GLY n 
3  293  ARG n 
3  294  VAL n 
3  295  ARG n 
3  296  ASN n 
3  297  HIS n 
3  298  PHE n 
3  299  ILE n 
3  300  PHE n 
3  301  ASN n 
3  302  VAL n 
3  303  GLU n 
3  304  SER n 
3  305  ALA n 
3  306  GLY n 
3  307  ALA n 
3  308  MET n 
3  309  THR n 
3  310  PRO n 
3  311  GLU n 
3  312  GLU n 
3  313  ILE n 
3  314  PHE n 
3  315  PHE n 
3  316  LYS n 
3  317  SER n 
3  318  VAL n 
3  319  ARG n 
3  320  ILE n 
3  321  LEU n 
3  322  LYS n 
3  323  ASN n 
3  324  LYS n 
3  325  ALA n 
3  326  GLU n 
3  327  TYR n 
3  328  LEU n 
3  329  LYS n 
3  330  ASN n 
3  331  CYS n 
3  332  PRO n 
3  333  ILE n 
3  334  THR n 
3  335  GLN n 
4  1    MET n 
4  2    MET n 
4  3    LYS n 
4  4    GLY n 
4  5    SER n 
4  6    ARG n 
4  7    ARG n 
4  8    THR n 
4  9    GLY n 
4  10   ASN n 
4  11   ASN n 
4  12   THR n 
4  13   ALA n 
4  14   THR n 
4  15   THR n 
4  16   LEU n 
4  17   ASN n 
4  18   THR n 
4  19   PRO n 
4  20   VAL n 
4  21   VAL n 
4  22   ILE n 
4  23   HIS n 
4  24   ALA n 
4  25   THR n 
4  26   GLN n 
4  27   LEU n 
4  28   PRO n 
4  29   GLN n 
4  30   HIS n 
4  31   VAL n 
4  32   SER n 
4  33   THR n 
4  34   ASP n 
4  35   GLU n 
4  36   VAL n 
4  37   LEU n 
4  38   GLN n 
4  39   PHE n 
4  40   LEU n 
4  41   GLU n 
4  42   SER n 
4  43   PHE n 
4  44   ILE n 
4  45   ASP n 
4  46   GLU n 
4  47   LYS n 
4  48   GLU n 
4  49   ASN n 
4  50   ILE n 
4  51   ILE n 
4  52   ASP n 
4  53   SER n 
4  54   THR n 
4  55   THR n 
4  56   MET n 
4  57   ASN n 
4  58   THR n 
4  59   ILE n 
4  60   SER n 
4  61   GLY n 
4  62   ASN n 
4  63   ALA n 
4  64   ALA n 
4  65   ASP n 
4  66   ALA n 
4  67   ASP n 
4  68   ALA n 
4  69   ALA n 
4  70   ALA n 
4  71   VAL n 
4  72   ALA n 
4  73   ASN n 
4  74   THR n 
4  75   SER n 
4  76   LEU n 
4  77   ASN n 
4  78   ILE n 
4  79   ASP n 
4  80   THR n 
4  81   ASN n 
4  82   LEU n 
4  83   SER n 
4  84   SER n 
4  85   SER n 
4  86   ILE n 
4  87   SER n 
4  88   GLN n 
4  89   LEU n 
4  90   LYS n 
4  91   ARG n 
4  92   ILE n 
4  93   GLN n 
4  94   ARG n 
4  95   ASP n 
4  96   PHE n 
4  97   LYS n 
4  98   GLY n 
4  99   LEU n 
4  100  PRO n 
4  101  PRO n 
4  102  ALA n 
4  103  GLN n 
4  104  ASP n 
4  105  PHE n 
4  106  SER n 
4  107  ALA n 
4  108  ALA n 
4  109  PRO n 
4  110  ILE n 
4  111  GLN n 
4  112  VAL n 
4  113  SER n 
4  114  THR n 
4  115  THR n 
4  116  GLU n 
4  117  LYS n 
4  118  LYS n 
4  119  GLU n 
4  120  THR n 
4  121  SER n 
4  122  ILE n 
4  123  GLY n 
4  124  VAL n 
4  125  SER n 
4  126  ALA n 
4  127  THR n 
4  128  GLY n 
4  129  GLY n 
4  130  LYS n 
4  131  LYS n 
4  132  THR n 
4  133  THR n 
4  134  PHE n 
4  135  ALA n 
4  136  ASP n 
4  137  GLU n 
5  1    MET n 
5  2    ASP n 
5  3    GLN n 
5  4    GLU n 
5  5    ASN n 
5  6    GLU n 
5  7    ARG n 
5  8    ASN n 
5  9    ILE n 
5  10   SER n 
5  11   ARG n 
5  12   LEU n 
5  13   TRP n 
5  14   ARG n 
5  15   ALA n 
5  16   PHE n 
5  17   ARG n 
5  18   THR n 
5  19   VAL n 
5  20   LYS n 
5  21   GLU n 
5  22   MET n 
5  23   VAL n 
5  24   LYS n 
5  25   ASP n 
5  26   ARG n 
5  27   GLY n 
5  28   TYR n 
5  29   PHE n 
5  30   ILE n 
5  31   THR n 
5  32   GLN n 
5  33   GLU n 
5  34   GLU n 
5  35   VAL n 
5  36   GLU n 
5  37   LEU n 
5  38   PRO n 
5  39   LEU n 
5  40   GLU n 
5  41   ASP n 
5  42   PHE n 
5  43   LYS n 
5  44   ALA n 
5  45   LYS n 
5  46   TYR n 
5  47   CYS n 
5  48   ASP n 
5  49   SER n 
5  50   MET n 
5  51   GLY n 
5  52   ARG n 
5  53   PRO n 
5  54   GLN n 
5  55   ARG n 
5  56   LYS n 
5  57   MET n 
5  58   MET n 
5  59   SER n 
5  60   PHE n 
5  61   GLN n 
5  62   ALA n 
5  63   ASN n 
5  64   PRO n 
5  65   THR n 
5  66   GLU n 
5  67   GLU n 
5  68   SER n 
5  69   ILE n 
5  70   SER n 
5  71   LYS n 
5  72   PHE n 
5  73   PRO n 
5  74   ASP n 
5  75   MET n 
5  76   GLY n 
5  77   SER n 
5  78   LEU n 
5  79   TRP n 
5  80   VAL n 
5  81   GLU n 
5  82   PHE n 
5  83   CYS n 
5  84   ASP n 
5  85   GLU n 
5  86   PRO n 
5  87   SER n 
5  88   VAL n 
5  89   GLY n 
5  90   VAL n 
5  91   LYS n 
5  92   THR n 
5  93   MET n 
5  94   LYS n 
5  95   THR n 
5  96   PHE n 
5  97   VAL n 
5  98   ILE n 
5  99   HIS n 
5  100  ILE n 
5  101  GLN n 
5  102  GLU n 
5  103  LYS n 
5  104  ASN n 
5  105  PHE n 
5  106  GLN n 
5  107  THR n 
5  108  GLY n 
5  109  ILE n 
5  110  PHE n 
5  111  VAL n 
5  112  TYR n 
5  113  GLN n 
5  114  ASN n 
5  115  ASN n 
5  116  ILE n 
5  117  THR n 
5  118  PRO n 
5  119  SER n 
5  120  ALA n 
5  121  MET n 
5  122  LYS n 
5  123  LEU n 
5  124  VAL n 
5  125  PRO n 
5  126  SER n 
5  127  ILE n 
5  128  PRO n 
5  129  PRO n 
5  130  ALA n 
5  131  THR n 
5  132  ILE n 
5  133  GLU n 
5  134  THR n 
5  135  PHE n 
5  136  ASN n 
5  137  GLU n 
5  138  ALA n 
5  139  ALA n 
5  140  LEU n 
5  141  VAL n 
5  142  VAL n 
5  143  ASN n 
5  144  ILE n 
5  145  THR n 
5  146  HIS n 
5  147  HIS n 
5  148  GLU n 
5  149  LEU n 
5  150  VAL n 
5  151  PRO n 
5  152  LYS n 
5  153  HIS n 
5  154  ILE n 
5  155  ARG n 
5  156  LEU n 
5  157  SER n 
5  158  SER n 
5  159  ASP n 
5  160  GLU n 
5  161  LYS n 
5  162  ARG n 
5  163  GLU n 
5  164  LEU n 
5  165  LEU n 
5  166  LYS n 
5  167  ARG n 
5  168  TYR n 
5  169  ARG n 
5  170  LEU n 
5  171  LYS n 
5  172  GLU n 
5  173  SER n 
5  174  GLN n 
5  175  LEU n 
5  176  PRO n 
5  177  ARG n 
5  178  ILE n 
5  179  GLN n 
5  180  ARG n 
5  181  ALA n 
5  182  ASP n 
5  183  PRO n 
5  184  VAL n 
5  185  ALA n 
5  186  LEU n 
5  187  TYR n 
5  188  LEU n 
5  189  GLY n 
5  190  LEU n 
5  191  LYS n 
5  192  ARG n 
5  193  GLY n 
5  194  GLU n 
5  195  VAL n 
5  196  VAL n 
5  197  LYS n 
5  198  ILE n 
5  199  ILE n 
5  200  ARG n 
5  201  LYS n 
5  202  SER n 
5  203  GLU n 
5  204  THR n 
5  205  SER n 
5  206  GLY n 
5  207  ARG n 
5  208  TYR n 
5  209  ALA n 
5  210  SER n 
5  211  TYR n 
5  212  ARG n 
5  213  ILE n 
5  214  CYS n 
5  215  MET n 
6  1    MET n 
6  2    SER n 
6  3    ASP n 
6  4    TYR n 
6  5    GLU n 
6  6    GLU n 
6  7    ALA n 
6  8    PHE n 
6  9    ASN n 
6  10   ASP n 
6  11   GLY n 
6  12   ASN n 
6  13   GLU n 
6  14   ASN n 
6  15   PHE n 
6  16   GLU n 
6  17   ASP n 
6  18   PHE n 
6  19   ASP n 
6  20   VAL n 
6  21   GLU n 
6  22   HIS n 
6  23   PHE n 
6  24   SER n 
6  25   ASP n 
6  26   GLU n 
6  27   GLU n 
6  28   THR n 
6  29   TYR n 
6  30   GLU n 
6  31   GLU n 
6  32   LYS n 
6  33   PRO n 
6  34   GLN n 
6  35   PHE n 
6  36   LYS n 
6  37   ASP n 
6  38   GLY n 
6  39   GLU n 
6  40   THR n 
6  41   THR n 
6  42   ASP n 
6  43   ALA n 
6  44   ASN n 
6  45   GLY n 
6  46   LYS n 
6  47   THR n 
6  48   ILE n 
6  49   VAL n 
6  50   THR n 
6  51   GLY n 
6  52   GLY n 
6  53   ASN n 
6  54   GLY n 
6  55   PRO n 
6  56   GLU n 
6  57   ASP n 
6  58   PHE n 
6  59   GLN n 
6  60   GLN n 
6  61   HIS n 
6  62   GLU n 
6  63   GLN n 
6  64   ILE n 
6  65   ARG n 
6  66   ARG n 
6  67   LYS n 
6  68   THR n 
6  69   LEU n 
6  70   LYS n 
6  71   GLU n 
6  72   LYS n 
6  73   ALA n 
6  74   ILE n 
6  75   PRO n 
6  76   LYS n 
6  77   ASP n 
6  78   GLN n 
6  79   ARG n 
6  80   ALA n 
6  81   THR n 
6  82   THR n 
6  83   PRO n 
6  84   TYR n 
6  85   MET n 
6  86   THR n 
6  87   LYS n 
6  88   TYR n 
6  89   GLU n 
6  90   ARG n 
6  91   ALA n 
6  92   ARG n 
6  93   ILE n 
6  94   LEU n 
6  95   GLY n 
6  96   THR n 
6  97   ARG n 
6  98   ALA n 
6  99   LEU n 
6  100  GLN n 
6  101  ILE n 
6  102  SER n 
6  103  MET n 
6  104  ASN n 
6  105  ALA n 
6  106  PRO n 
6  107  VAL n 
6  108  PHE n 
6  109  VAL n 
6  110  ASP n 
6  111  LEU n 
6  112  GLU n 
6  113  GLY n 
6  114  GLU n 
6  115  THR n 
6  116  ASP n 
6  117  PRO n 
6  118  LEU n 
6  119  ARG n 
6  120  ILE n 
6  121  ALA n 
6  122  MET n 
6  123  LYS n 
6  124  GLU n 
6  125  LEU n 
6  126  ALA n 
6  127  GLU n 
6  128  LYS n 
6  129  LYS n 
6  130  ILE n 
6  131  PRO n 
6  132  LEU n 
6  133  VAL n 
6  134  ILE n 
6  135  ARG n 
6  136  ARG n 
6  137  TYR n 
6  138  LEU n 
6  139  PRO n 
6  140  ASP n 
6  141  GLY n 
6  142  SER n 
6  143  PHE n 
6  144  GLU n 
6  145  ASP n 
6  146  TRP n 
6  147  SER n 
6  148  VAL n 
6  149  GLU n 
6  150  GLU n 
6  151  LEU n 
6  152  ILE n 
6  153  VAL n 
6  154  ASP n 
6  155  LEU n 
7  1    MET n 
7  2    SER n 
7  3    GLN n 
7  4    VAL n 
7  5    LYS n 
7  6    ARG n 
7  7    ALA n 
7  8    ASN n 
7  9    GLU n 
7  10   ASN n 
7  11   ARG n 
7  12   GLU n 
7  13   THR n 
7  14   ALA n 
7  15   ARG n 
7  16   PHE n 
7  17   ILE n 
7  18   LYS n 
7  19   LYS n 
7  20   HIS n 
7  21   LYS n 
7  22   LYS n 
7  23   GLN n 
7  24   VAL n 
7  25   THR n 
7  26   ASN n 
7  27   PRO n 
7  28   ILE n 
7  29   ASP n 
7  30   GLU n 
7  31   LYS n 
7  32   ASN n 
7  33   GLY n 
7  34   THR n 
7  35   SER n 
7  36   ASN n 
7  37   CYS n 
7  38   ILE n 
7  39   VAL n 
7  40   ARG n 
7  41   VAL n 
7  42   PRO n 
7  43   ILE n 
7  44   ALA n 
7  45   LEU n 
7  46   TYR n 
7  47   VAL n 
7  48   SER n 
7  49   LEU n 
7  50   ALA n 
7  51   PRO n 
7  52   MET n 
7  53   TYR n 
7  54   LEU n 
7  55   GLU n 
7  56   ASN n 
7  57   PRO n 
7  58   LEU n 
7  59   GLN n 
7  60   GLY n 
7  61   VAL n 
7  62   MET n 
7  63   LYS n 
7  64   GLN n 
7  65   HIS n 
7  66   LEU n 
7  67   ASN n 
7  68   PRO n 
7  69   LEU n 
7  70   VAL n 
7  71   MET n 
7  72   LYS n 
7  73   TYR n 
7  74   ASN n 
7  75   ASN n 
7  76   LYS n 
7  77   VAL n 
7  78   GLY n 
7  79   GLY n 
7  80   VAL n 
7  81   VAL n 
7  82   LEU n 
7  83   GLY n 
7  84   TYR n 
7  85   GLU n 
7  86   GLY n 
7  87   LEU n 
7  88   LYS n 
7  89   ILE n 
7  90   LEU n 
7  91   ASP n 
7  92   ALA n 
7  93   ASP n 
7  94   PRO n 
7  95   LEU n 
7  96   SER n 
7  97   LYS n 
7  98   GLU n 
7  99   ASP n 
7  100  THR n 
7  101  SER n 
7  102  GLU n 
7  103  LYS n 
7  104  LEU n 
7  105  ILE n 
7  106  LYS n 
7  107  ILE n 
7  108  THR n 
7  109  PRO n 
7  110  ASP n 
7  111  THR n 
7  112  PRO n 
7  113  PHE n 
7  114  GLY n 
7  115  PHE n 
7  116  THR n 
7  117  TRP n 
7  118  CYS n 
7  119  HIS n 
7  120  VAL n 
7  121  ASN n 
7  122  LEU n 
7  123  TYR n 
7  124  VAL n 
7  125  TRP n 
7  126  GLN n 
7  127  PRO n 
7  128  GLN n 
7  129  VAL n 
7  130  GLY n 
7  131  ASP n 
7  132  VAL n 
7  133  LEU n 
7  134  GLU n 
7  135  GLY n 
7  136  TYR n 
7  137  ILE n 
7  138  PHE n 
7  139  ILE n 
7  140  GLN n 
7  141  SER n 
7  142  ALA n 
7  143  SER n 
7  144  HIS n 
7  145  ILE n 
7  146  GLY n 
7  147  LEU n 
7  148  LEU n 
7  149  ILE n 
7  150  HIS n 
7  151  ASP n 
7  152  ALA n 
7  153  PHE n 
7  154  ASN n 
7  155  ALA n 
7  156  SER n 
7  157  ILE n 
7  158  LYS n 
7  159  LYS n 
7  160  ASN n 
7  161  ASN n 
7  162  ILE n 
7  163  PRO n 
7  164  VAL n 
7  165  ASP n 
7  166  TRP n 
7  167  THR n 
7  168  PHE n 
7  169  VAL n 
7  170  HIS n 
7  171  ASN n 
7  172  ASP n 
7  173  VAL n 
7  174  GLU n 
7  175  GLU n 
7  176  ASP n 
7  177  ALA n 
7  178  ASP n 
7  179  VAL n 
7  180  ILE n 
7  181  ASN n 
7  182  THR n 
7  183  ASP n 
7  184  GLU n 
7  185  ASN n 
7  186  ASN n 
7  187  GLY n 
7  188  ASN n 
7  189  ASN n 
7  190  ASN n 
7  191  ASN n 
7  192  GLU n 
7  193  ASP n 
7  194  ASN n 
7  195  LYS n 
7  196  ASP n 
7  197  SER n 
7  198  ASN n 
7  199  GLY n 
7  200  GLY n 
7  201  SER n 
7  202  ASN n 
7  203  SER n 
7  204  LEU n 
7  205  GLY n 
7  206  LYS n 
7  207  PHE n 
7  208  SER n 
7  209  PHE n 
7  210  GLY n 
7  211  ASN n 
7  212  ARG n 
7  213  SER n 
7  214  LEU n 
7  215  GLY n 
7  216  HIS n 
7  217  TRP n 
7  218  VAL n 
7  219  ASP n 
7  220  SER n 
7  221  ASN n 
7  222  GLY n 
7  223  GLU n 
7  224  PRO n 
7  225  ILE n 
7  226  ASP n 
7  227  GLY n 
7  228  LYS n 
7  229  LEU n 
7  230  ARG n 
7  231  PHE n 
7  232  THR n 
7  233  VAL n 
7  234  ARG n 
7  235  ASN n 
7  236  VAL n 
7  237  HIS n 
7  238  THR n 
7  239  THR n 
7  240  GLY n 
7  241  ARG n 
7  242  VAL n 
7  243  VAL n 
7  244  SER n 
7  245  VAL n 
7  246  ASP n 
7  247  GLY n 
7  248  THR n 
7  249  LEU n 
7  250  ILE n 
7  251  SER n 
7  252  ASP n 
7  253  ALA n 
7  254  ASP n 
7  255  GLU n 
7  256  GLU n 
7  257  GLY n 
7  258  ASN n 
7  259  GLY n 
7  260  TYR n 
7  261  ASN n 
7  262  SER n 
7  263  SER n 
7  264  ARG n 
7  265  SER n 
7  266  GLN n 
7  267  ALA n 
7  268  GLU n 
7  269  SER n 
7  270  LEU n 
7  271  PRO n 
7  272  ILE n 
7  273  VAL n 
7  274  SER n 
7  275  ASN n 
7  276  LYS n 
7  277  LYS n 
7  278  ILE n 
7  279  VAL n 
7  280  PHE n 
7  281  ASP n 
7  282  ASP n 
7  283  GLU n 
7  284  VAL n 
7  285  SER n 
7  286  ILE n 
7  287  GLU n 
7  288  ASN n 
7  289  LYS n 
7  290  GLU n 
7  291  SER n 
7  292  HIS n 
7  293  LYS n 
7  294  GLU n 
7  295  LEU n 
7  296  ASP n 
7  297  LEU n 
7  298  PRO n 
7  299  GLU n 
7  300  VAL n 
7  301  LYS n 
7  302  GLU n 
7  303  ASP n 
7  304  ASN n 
7  305  GLY n 
7  306  SER n 
7  307  GLU n 
7  308  ILE n 
7  309  VAL n 
7  310  TYR n 
7  311  GLU n 
7  312  GLU n 
7  313  ASN n 
7  314  THR n 
7  315  SER n 
7  316  GLU n 
7  317  SER n 
7  318  ASN n 
7  319  ASP n 
7  320  GLY n 
7  321  GLU n 
7  322  SER n 
7  323  SER n 
7  324  ASP n 
7  325  SER n 
7  326  ASP n 
8  1    MET n 
8  2    SER n 
8  3    ASN n 
8  4    THR n 
8  5    LEU n 
8  6    PHE n 
8  7    ASP n 
8  8    ASP n 
8  9    ILE n 
8  10   PHE n 
8  11   GLN n 
8  12   VAL n 
8  13   SER n 
8  14   GLU n 
8  15   VAL n 
8  16   ASP n 
8  17   PRO n 
8  18   GLY n 
8  19   ARG n 
8  20   TYR n 
8  21   ASN n 
8  22   LYS n 
8  23   VAL n 
8  24   CYS n 
8  25   ARG n 
8  26   ILE n 
8  27   GLU n 
8  28   ALA n 
8  29   ALA n 
8  30   SER n 
8  31   THR n 
8  32   THR n 
8  33   GLN n 
8  34   ASP n 
8  35   GLN n 
8  36   CYS n 
8  37   LYS n 
8  38   LEU n 
8  39   THR n 
8  40   LEU n 
8  41   ASP n 
8  42   ILE n 
8  43   ASN n 
8  44   VAL n 
8  45   GLU n 
8  46   LEU n 
8  47   PHE n 
8  48   PRO n 
8  49   VAL n 
8  50   ALA n 
8  51   ALA n 
8  52   GLN n 
8  53   ASP n 
8  54   SER n 
8  55   LEU n 
8  56   THR n 
8  57   VAL n 
8  58   THR n 
8  59   ILE n 
8  60   ALA n 
8  61   SER n 
8  62   SER n 
8  63   LEU n 
8  64   ASN n 
8  65   LEU n 
8  66   GLU n 
8  67   ASP n 
8  68   THR n 
8  69   PRO n 
8  70   ALA n 
8  71   ASN n 
8  72   ASP n 
8  73   SER n 
8  74   SER n 
8  75   ALA n 
8  76   THR n 
8  77   ARG n 
8  78   SER n 
8  79   TRP n 
8  80   ARG n 
8  81   PRO n 
8  82   PRO n 
8  83   GLN n 
8  84   ALA n 
8  85   GLY n 
8  86   ASP n 
8  87   ARG n 
8  88   SER n 
8  89   LEU n 
8  90   ALA n 
8  91   ASP n 
8  92   ASP n 
8  93   TYR n 
8  94   ASP n 
8  95   TYR n 
8  96   VAL n 
8  97   MET n 
8  98   TYR n 
8  99   GLY n 
8  100  THR n 
8  101  ALA n 
8  102  TYR n 
8  103  LYS n 
8  104  PHE n 
8  105  GLU n 
8  106  GLU n 
8  107  VAL n 
8  108  SER n 
8  109  LYS n 
8  110  ASP n 
8  111  LEU n 
8  112  ILE n 
8  113  ALA n 
8  114  VAL n 
8  115  TYR n 
8  116  TYR n 
8  117  SER n 
8  118  PHE n 
8  119  GLY n 
8  120  GLY n 
8  121  LEU n 
8  122  LEU n 
8  123  MET n 
8  124  ARG n 
8  125  LEU n 
8  126  GLU n 
8  127  GLY n 
8  128  ASN n 
8  129  TYR n 
8  130  ARG n 
8  131  ASN n 
8  132  LEU n 
8  133  ASN n 
8  134  ASN n 
8  135  LEU n 
8  136  LYS n 
8  137  GLN n 
8  138  GLU n 
8  139  ASN n 
8  140  ALA n 
8  141  TYR n 
8  142  LEU n 
8  143  LEU n 
8  144  ILE n 
8  145  ARG n 
8  146  ARG n 
9  1    MET n 
9  2    SER n 
9  3    VAL n 
9  4    VAL n 
9  5    GLY n 
9  6    SER n 
9  7    LEU n 
9  8    ILE n 
9  9    PHE n 
9  10   CYS n 
9  11   LEU n 
9  12   ASP n 
9  13   CYS n 
9  14   GLY n 
9  15   ASP n 
9  16   LEU n 
9  17   LEU n 
9  18   GLU n 
9  19   ASN n 
9  20   PRO n 
9  21   ASN n 
9  22   ALA n 
9  23   VAL n 
9  24   LEU n 
9  25   GLY n 
9  26   SER n 
9  27   ASN n 
9  28   VAL n 
9  29   GLU n 
9  30   CYS n 
9  31   SER n 
9  32   GLN n 
9  33   CYS n 
9  34   LYS n 
9  35   ALA n 
9  36   ILE n 
9  37   TYR n 
9  38   PRO n 
9  39   LYS n 
9  40   SER n 
9  41   GLN n 
9  42   PHE n 
9  43   SER n 
9  44   ASN n 
9  45   LEU n 
9  46   LYS n 
9  47   VAL n 
9  48   VAL n 
9  49   THR n 
9  50   THR n 
9  51   THR n 
9  52   ALA n 
9  53   ASP n 
9  54   ASP n 
9  55   ALA n 
9  56   PHE n 
9  57   PRO n 
9  58   SER n 
9  59   SER n 
9  60   LEU n 
9  61   ARG n 
9  62   ALA n 
9  63   LYS n 
9  64   LYS n 
9  65   SER n 
9  66   VAL n 
9  67   VAL n 
9  68   LYS n 
9  69   THR n 
9  70   SER n 
9  71   LEU n 
9  72   LYS n 
9  73   LYS n 
9  74   ASN n 
9  75   GLU n 
9  76   LEU n 
9  77   LYS n 
9  78   ASP n 
9  79   GLY n 
9  80   ALA n 
9  81   THR n 
9  82   ILE n 
9  83   LYS n 
9  84   GLU n 
9  85   LYS n 
9  86   CYS n 
9  87   PRO n 
9  88   GLN n 
9  89   CYS n 
9  90   GLY n 
9  91   ASN n 
9  92   GLU n 
9  93   GLU n 
9  94   MET n 
9  95   ASN n 
9  96   TYR n 
9  97   HIS n 
9  98   THR n 
9  99   LEU n 
9  100  GLN n 
9  101  LEU n 
9  102  ARG n 
9  103  SER n 
9  104  ALA n 
9  105  ASP n 
9  106  GLU n 
9  107  GLY n 
9  108  ALA n 
9  109  THR n 
9  110  VAL n 
9  111  PHE n 
9  112  TYR n 
9  113  THR n 
9  114  CYS n 
9  115  THR n 
9  116  SER n 
9  117  CYS n 
9  118  GLY n 
9  119  TYR n 
9  120  LYS n 
9  121  PHE n 
9  122  ARG n 
9  123  THR n 
9  124  ASN n 
9  125  ASN n 
10 1    MET n 
10 2    ILE n 
10 3    VAL n 
10 4    PRO n 
10 5    VAL n 
10 6    ARG n 
10 7    CYS n 
10 8    PHE n 
10 9    SER n 
10 10   CYS n 
10 11   GLY n 
10 12   LYS n 
10 13   VAL n 
10 14   VAL n 
10 15   GLY n 
10 16   ASP n 
10 17   LYS n 
10 18   TRP n 
10 19   GLU n 
10 20   SER n 
10 21   TYR n 
10 22   LEU n 
10 23   ASN n 
10 24   LEU n 
10 25   LEU n 
10 26   GLN n 
10 27   GLU n 
10 28   ASP n 
10 29   GLU n 
10 30   LEU n 
10 31   ASP n 
10 32   GLU n 
10 33   GLY n 
10 34   THR n 
10 35   ALA n 
10 36   LEU n 
10 37   SER n 
10 38   ARG n 
10 39   LEU n 
10 40   GLY n 
10 41   LEU n 
10 42   LYS n 
10 43   ARG n 
10 44   TYR n 
10 45   CYS n 
10 46   CYS n 
10 47   ARG n 
10 48   ARG n 
10 49   MET n 
10 50   ILE n 
10 51   LEU n 
10 52   THR n 
10 53   HIS n 
10 54   VAL n 
10 55   ASP n 
10 56   LEU n 
10 57   ILE n 
10 58   GLU n 
10 59   LYS n 
10 60   PHE n 
10 61   LEU n 
10 62   ARG n 
10 63   TYR n 
10 64   ASN n 
10 65   PRO n 
10 66   LEU n 
10 67   GLU n 
10 68   LYS n 
10 69   ARG n 
10 70   ASP n 
11 1    MET n 
11 2    THR n 
11 3    GLU n 
11 4    ASP n 
11 5    ILE n 
11 6    GLU n 
11 7    GLN n 
11 8    LYS n 
11 9    LYS n 
11 10   THR n 
11 11   ALA n 
11 12   THR n 
11 13   GLU n 
11 14   VAL n 
11 15   THR n 
11 16   PRO n 
11 17   GLN n 
11 18   GLU n 
11 19   PRO n 
11 20   LYS n 
11 21   HIS n 
11 22   ILE n 
11 23   GLN n 
11 24   GLU n 
11 25   GLU n 
11 26   GLU n 
11 27   GLU n 
11 28   GLN n 
11 29   ASP n 
11 30   VAL n 
11 31   ASP n 
11 32   MET n 
11 33   THR n 
11 34   GLY n 
11 35   ASP n 
11 36   GLU n 
11 37   GLU n 
11 38   GLN n 
11 39   GLU n 
11 40   GLU n 
11 41   GLU n 
11 42   PRO n 
11 43   ASP n 
11 44   ARG n 
11 45   GLU n 
11 46   LYS n 
11 47   ILE n 
11 48   LYS n 
11 49   LEU n 
11 50   LEU n 
11 51   THR n 
11 52   GLN n 
11 53   ALA n 
11 54   THR n 
11 55   SER n 
11 56   GLU n 
11 57   ASP n 
11 58   GLY n 
11 59   THR n 
11 60   SER n 
11 61   ALA n 
11 62   SER n 
11 63   PHE n 
11 64   GLN n 
11 65   ILE n 
11 66   VAL n 
11 67   GLU n 
11 68   GLU n 
11 69   ASP n 
11 70   HIS n 
11 71   THR n 
11 72   LEU n 
11 73   GLY n 
11 74   ASN n 
11 75   ALA n 
11 76   LEU n 
11 77   ARG n 
11 78   TYR n 
11 79   VAL n 
11 80   ILE n 
11 81   MET n 
11 82   LYS n 
11 83   ASN n 
11 84   PRO n 
11 85   ASP n 
11 86   VAL n 
11 87   GLU n 
11 88   PHE n 
11 89   CYS n 
11 90   GLY n 
11 91   TYR n 
11 92   SER n 
11 93   ILE n 
11 94   PRO n 
11 95   HIS n 
11 96   PRO n 
11 97   SER n 
11 98   GLU n 
11 99   ASN n 
11 100  LEU n 
11 101  LEU n 
11 102  ASN n 
11 103  ILE n 
11 104  ARG n 
11 105  ILE n 
11 106  GLN n 
11 107  THR n 
11 108  TYR n 
11 109  GLY n 
11 110  GLU n 
11 111  THR n 
11 112  THR n 
11 113  ALA n 
11 114  VAL n 
11 115  ASP n 
11 116  ALA n 
11 117  LEU n 
11 118  GLN n 
11 119  LYS n 
11 120  GLY n 
11 121  LEU n 
11 122  LYS n 
11 123  ASP n 
11 124  LEU n 
11 125  MET n 
11 126  ASP n 
11 127  LEU n 
11 128  CYS n 
11 129  ASP n 
11 130  VAL n 
11 131  VAL n 
11 132  GLU n 
11 133  SER n 
11 134  LYS n 
11 135  PHE n 
11 136  THR n 
11 137  GLU n 
11 138  LYS n 
11 139  ILE n 
11 140  LYS n 
11 141  SER n 
11 142  MET n 
12 1    MET n 
12 2    SER n 
12 3    ARG n 
12 4    GLU n 
12 5    GLY n 
12 6    PHE n 
12 7    GLN n 
12 8    ILE n 
12 9    PRO n 
12 10   THR n 
12 11   ASN n 
12 12   LEU n 
12 13   ASP n 
12 14   ALA n 
12 15   ALA n 
12 16   ALA n 
12 17   ALA n 
12 18   GLY n 
12 19   THR n 
12 20   SER n 
12 21   GLN n 
12 22   ALA n 
12 23   ARG n 
12 24   THR n 
12 25   ALA n 
12 26   THR n 
12 27   LEU n 
12 28   LYS n 
12 29   TYR n 
12 30   ILE n 
12 31   CYS n 
12 32   ALA n 
12 33   GLU n 
12 34   CYS n 
12 35   SER n 
12 36   SER n 
12 37   LYS n 
12 38   LEU n 
12 39   SER n 
12 40   LEU n 
12 41   SER n 
12 42   ARG n 
12 43   THR n 
12 44   ASP n 
12 45   ALA n 
12 46   VAL n 
12 47   ARG n 
12 48   CYS n 
12 49   LYS n 
12 50   ASP n 
12 51   CYS n 
12 52   GLY n 
12 53   HIS n 
12 54   ARG n 
12 55   ILE n 
12 56   LEU n 
12 57   LEU n 
12 58   LYS n 
12 59   ALA n 
12 60   ARG n 
12 61   THR n 
12 62   LYS n 
12 63   ARG n 
12 64   LEU n 
12 65   VAL n 
12 66   GLN n 
12 67   PHE n 
12 68   GLU n 
12 69   ALA n 
12 70   ARG n 
13 1    MET n 
13 2    SER n 
13 3    VAL n 
13 4    LYS n 
13 5    ARG n 
13 6    SER n 
13 7    VAL n 
13 8    SER n 
13 9    GLU n 
13 10   ILE n 
13 11   GLU n 
13 12   ILE n 
13 13   GLU n 
13 14   SER n 
13 15   VAL n 
13 16   GLN n 
13 17   ASP n 
13 18   GLN n 
13 19   PRO n 
13 20   SER n 
13 21   VAL n 
13 22   ALA n 
13 23   VAL n 
13 24   GLY n 
13 25   SER n 
13 26   PHE n 
13 27   PHE n 
13 28   LYS n 
13 29   GLY n 
13 30   PHE n 
13 31   ARG n 
13 32   ALA n 
13 33   PRO n 
13 34   SER n 
13 35   ASP n 
13 36   THR n 
13 37   THR n 
13 38   PHE n 
13 39   ASP n 
13 40   LEU n 
13 41   TYR n 
13 42   LYS n 
13 43   LYS n 
13 44   LYS n 
13 45   LYS n 
13 46   SER n 
13 47   GLU n 
13 48   LYS n 
13 49   ASP n 
13 50   GLU n 
13 51   PHE n 
13 52   VAL n 
13 53   LEU n 
13 54   HIS n 
13 55   GLY n 
13 56   GLU n 
13 57   ASN n 
13 58   GLU n 
13 59   ARG n 
13 60   LEU n 
13 61   GLU n 
13 62   TYR n 
13 63   GLU n 
13 64   GLY n 
13 65   TYR n 
13 66   THR n 
13 67   ASP n 
13 68   SER n 
13 69   SER n 
13 70   SER n 
13 71   GLN n 
13 72   ALA n 
13 73   SER n 
13 74   ASN n 
13 75   GLN n 
13 76   TYR n 
13 77   VAL n 
13 78   VAL n 
13 79   GLY n 
13 80   LEU n 
13 81   PHE n 
13 82   ASN n 
13 83   PRO n 
13 84   GLU n 
13 85   LYS n 
13 86   LYS n 
13 87   SER n 
13 88   ILE n 
13 89   GLN n 
13 90   LEU n 
13 91   TYR n 
13 92   LYS n 
13 93   ALA n 
13 94   PRO n 
13 95   VAL n 
13 96   LEU n 
13 97   VAL n 
13 98   SER n 
13 99   LYS n 
13 100  VAL n 
13 101  VAL n 
13 102  SER n 
13 103  LYS n 
13 104  SER n 
13 105  SER n 
13 106  LYS n 
13 107  ASN n 
13 108  LEU n 
13 109  ARG n 
13 110  GLY n 
13 111  PRO n 
13 112  LYS n 
13 113  ILE n 
13 114  LYS n 
13 115  SER n 
13 116  LYS n 
13 117  SER n 
13 118  ASP n 
13 119  THR n 
13 120  ARG n 
13 121  PRO n 
13 122  SER n 
13 123  ALA n 
13 124  LEU n 
13 125  ARG n 
13 126  ASN n 
13 127  ALA n 
13 128  LEU n 
13 129  GLY n 
13 130  GLU n 
13 131  ALA n 
13 132  PHE n 
13 133  GLY n 
13 134  THR n 
13 135  LYS n 
13 136  LYS n 
13 137  ALA n 
13 138  LYS n 
13 139  LYS n 
13 140  ALA n 
13 141  ILE n 
13 142  ALA n 
13 143  ASP n 
13 144  LEU n 
13 145  GLU n 
13 146  ARG n 
13 147  ASN n 
13 148  ARG n 
13 149  ILE n 
13 150  ASP n 
13 151  SER n 
13 152  ASP n 
13 153  LYS n 
13 154  LEU n 
13 155  THR n 
13 156  ASP n 
13 157  SER n 
13 158  ALA n 
13 159  ILE n 
13 160  ASP n 
13 161  ILE n 
13 162  VAL n 
13 163  ASP n 
13 164  SER n 
13 165  VAL n 
13 166  ARG n 
13 167  THR n 
13 168  ALA n 
13 169  SER n 
13 170  LYS n 
13 171  ASP n 
13 172  LEU n 
13 173  PRO n 
13 174  THR n 
13 175  ARG n 
13 176  ALA n 
13 177  GLN n 
13 178  LEU n 
13 179  ASP n 
13 180  GLU n 
13 181  ILE n 
13 182  THR n 
13 183  SER n 
13 184  ASN n 
13 185  ASP n 
13 186  ARG n 
13 187  PRO n 
13 188  THR n 
13 189  PRO n 
13 190  LEU n 
13 191  ALA n 
13 192  ASN n 
13 193  ILE n 
13 194  ASP n 
13 195  ALA n 
13 196  THR n 
13 197  ASP n 
13 198  VAL n 
13 199  GLU n 
13 200  GLN n 
13 201  ILE n 
13 202  TYR n 
13 203  PRO n 
13 204  ILE n 
13 205  GLU n 
13 206  SER n 
13 207  ILE n 
13 208  ILE n 
13 209  PRO n 
13 210  LYS n 
13 211  LYS n 
13 212  GLU n 
13 213  LEU n 
13 214  GLN n 
13 215  PHE n 
13 216  ILE n 
13 217  ARG n 
13 218  VAL n 
13 219  SER n 
13 220  SER n 
13 221  ILE n 
13 222  LEU n 
13 223  LYS n 
13 224  GLU n 
13 225  ALA n 
13 226  ASP n 
13 227  LYS n 
13 228  GLU n 
13 229  LYS n 
13 230  LYS n 
13 231  LEU n 
13 232  GLU n 
13 233  LEU n 
13 234  PHE n 
13 235  PRO n 
13 236  TYR n 
13 237  GLN n 
13 238  ASN n 
13 239  ASN n 
13 240  SER n 
13 241  LYS n 
13 242  TYR n 
13 243  VAL n 
13 244  ALA n 
13 245  LYS n 
13 246  LYS n 
13 247  LEU n 
13 248  ASP n 
13 249  SER n 
13 250  LEU n 
13 251  THR n 
13 252  GLN n 
13 253  PRO n 
13 254  SER n 
13 255  GLN n 
13 256  MET n 
13 257  THR n 
13 258  LYS n 
13 259  LEU n 
13 260  GLN n 
13 261  LEU n 
13 262  LEU n 
13 263  TYR n 
13 264  TYR n 
13 265  LEU n 
13 266  SER n 
13 267  LEU n 
13 268  LEU n 
13 269  LEU n 
13 270  GLY n 
13 271  VAL n 
13 272  TYR n 
13 273  GLU n 
13 274  ASN n 
13 275  ARG n 
13 276  ARG n 
13 277  VAL n 
13 278  ASN n 
13 279  ASN n 
13 280  LYS n 
13 281  THR n 
13 282  LYS n 
13 283  LEU n 
13 284  LEU n 
13 285  GLU n 
13 286  ARG n 
13 287  LEU n 
13 288  ASN n 
13 289  SER n 
13 290  PRO n 
13 291  PRO n 
13 292  GLU n 
13 293  ILE n 
13 294  LEU n 
13 295  VAL n 
13 296  ASP n 
13 297  GLY n 
13 298  ILE n 
13 299  LEU n 
13 300  SER n 
13 301  ARG n 
13 302  PHE n 
13 303  THR n 
13 304  VAL n 
13 305  ILE n 
13 306  LYS n 
13 307  PRO n 
13 308  GLY n 
13 309  GLN n 
13 310  PHE n 
13 311  GLY n 
13 312  ARG n 
13 313  SER n 
13 314  LYS n 
13 315  ASP n 
13 316  ARG n 
13 317  SER n 
13 318  TYR n 
13 319  PHE n 
13 320  ILE n 
13 321  ASP n 
13 322  PRO n 
13 323  GLN n 
13 324  ASN n 
13 325  GLU n 
13 326  ASP n 
13 327  LYS n 
13 328  ILE n 
13 329  LEU n 
13 330  CYS n 
13 331  TYR n 
13 332  ILE n 
13 333  LEU n 
13 334  ALA n 
13 335  ILE n 
13 336  ILE n 
13 337  MET n 
13 338  HIS n 
13 339  LEU n 
13 340  ASP n 
13 341  ASN n 
13 342  PHE n 
13 343  ILE n 
13 344  VAL n 
13 345  GLU n 
13 346  ILE n 
13 347  THR n 
13 348  PRO n 
13 349  LEU n 
13 350  ALA n 
13 351  HIS n 
13 352  GLU n 
13 353  LEU n 
13 354  ASN n 
13 355  LEU n 
13 356  LYS n 
13 357  PRO n 
13 358  SER n 
13 359  LYS n 
13 360  VAL n 
13 361  VAL n 
13 362  SER n 
13 363  LEU n 
13 364  PHE n 
13 365  ARG n 
13 366  VAL n 
13 367  LEU n 
13 368  GLY n 
13 369  ALA n 
13 370  ILE n 
13 371  VAL n 
13 372  LYS n 
13 373  GLY n 
13 374  ALA n 
13 375  THR n 
13 376  VAL n 
13 377  ALA n 
13 378  GLN n 
13 379  ALA n 
13 380  GLU n 
13 381  ALA n 
13 382  PHE n 
13 383  GLY n 
13 384  ILE n 
13 385  PRO n 
13 386  LYS n 
13 387  SER n 
13 388  THR n 
13 389  ALA n 
13 390  ALA n 
13 391  SER n 
13 392  TYR n 
13 393  LYS n 
13 394  ILE n 
13 395  ALA n 
13 396  THR n 
13 397  MET n 
13 398  LYS n 
13 399  VAL n 
13 400  PRO n 
13 401  PHE n 
13 402  LYS n 
13 403  LEU n 
13 404  PRO n 
13 405  GLU n 
13 406  MET n 
13 407  THR n 
13 408  ARG n 
13 409  ARG n 
13 410  GLY n 
13 411  ARG n 
13 412  GLY n 
13 413  PRO n 
13 414  ARG n 
13 415  ARG n 
14 1    MET n 
14 2    SER n 
14 3    LYS n 
14 4    LEU n 
14 5    SER n 
14 6    LYS n 
14 7    ASP n 
14 8    TYR n 
14 9    VAL n 
14 10   SER n 
14 11   ASP n 
14 12   SER n 
14 13   ASP n 
14 14   SER n 
14 15   ASP n 
14 16   ASP n 
14 17   GLU n 
14 18   VAL n 
14 19   ILE n 
14 20   SER n 
14 21   ASN n 
14 22   GLU n 
14 23   PHE n 
14 24   SER n 
14 25   ILE n 
14 26   PRO n 
14 27   ASP n 
14 28   GLY n 
14 29   PHE n 
14 30   LYS n 
14 31   LYS n 
14 32   CYS n 
14 33   LYS n 
14 34   HIS n 
14 35   LEU n 
14 36   LYS n 
14 37   ASN n 
14 38   PHE n 
14 39   PRO n 
14 40   LEU n 
14 41   ASN n 
14 42   GLY n 
14 43   ASP n 
14 44   ASN n 
14 45   LYS n 
14 46   LYS n 
14 47   LYS n 
14 48   ALA n 
14 49   LYS n 
14 50   GLN n 
14 51   GLN n 
14 52   GLN n 
14 53   VAL n 
14 54   TRP n 
14 55   LEU n 
14 56   ILE n 
14 57   LYS n 
14 58   PHE n 
14 59   PRO n 
14 60   SER n 
14 61   ASN n 
14 62   VAL n 
14 63   ASP n 
14 64   ILE n 
14 65   SER n 
14 66   LYS n 
14 67   LEU n 
14 68   LYS n 
14 69   SER n 
14 70   LEU n 
14 71   PRO n 
14 72   VAL n 
14 73   ASP n 
14 74   PHE n 
14 75   GLU n 
14 76   SER n 
14 77   SER n 
14 78   THR n 
14 79   THR n 
14 80   MET n 
14 81   THR n 
14 82   ILE n 
14 83   ASP n 
14 84   LYS n 
14 85   HIS n 
14 86   ASP n 
14 87   TYR n 
14 88   LYS n 
14 89   ILE n 
14 90   MET n 
14 91   ASP n 
14 92   ASP n 
14 93   THR n 
14 94   ASP n 
14 95   ILE n 
14 96   GLU n 
14 97   SER n 
14 98   SER n 
14 99   LEU n 
14 100  THR n 
14 101  GLN n 
14 102  ASP n 
14 103  ASN n 
14 104  LEU n 
14 105  SER n 
14 106  ASN n 
14 107  MET n 
14 108  THR n 
14 109  LEU n 
14 110  LEU n 
14 111  VAL n 
14 112  PRO n 
14 113  SER n 
14 114  GLU n 
14 115  SER n 
14 116  LYS n 
14 117  GLU n 
14 118  SER n 
14 119  LEU n 
14 120  LYS n 
14 121  ILE n 
14 122  ALA n 
14 123  SER n 
14 124  THR n 
14 125  ALA n 
14 126  LYS n 
14 127  ASP n 
14 128  ASN n 
14 129  ALA n 
14 130  PRO n 
14 131  LEU n 
14 132  GLN n 
14 133  PHE n 
14 134  ASP n 
14 135  LYS n 
14 136  VAL n 
14 137  PHE n 
14 138  SER n 
14 139  VAL n 
14 140  SER n 
14 141  GLU n 
14 142  THR n 
14 143  ALA n 
14 144  LYS n 
14 145  ILE n 
14 146  PRO n 
14 147  ALA n 
14 148  ILE n 
14 149  ASP n 
14 150  TYR n 
14 151  SER n 
14 152  LYS n 
14 153  VAL n 
14 154  ARG n 
14 155  VAL n 
14 156  PRO n 
14 157  ARG n 
14 158  LYS n 
14 159  ASP n 
14 160  VAL n 
14 161  PRO n 
14 162  LYS n 
14 163  VAL n 
14 164  GLU n 
14 165  GLY n 
14 166  LEU n 
14 167  LYS n 
14 168  LEU n 
14 169  GLU n 
14 170  HIS n 
14 171  PHE n 
14 172  ALA n 
14 173  THR n 
14 174  GLY n 
14 175  TYR n 
14 176  ASP n 
14 177  ALA n 
14 178  GLU n 
14 179  ASP n 
14 180  PHE n 
14 181  HIS n 
14 182  VAL n 
14 183  ALA n 
14 184  GLU n 
14 185  GLU n 
14 186  VAL n 
14 187  LYS n 
14 188  GLU n 
14 189  ASN n 
14 190  LYS n 
14 191  LYS n 
14 192  GLU n 
14 193  PRO n 
14 194  LYS n 
14 195  LYS n 
14 196  ARG n 
14 197  SER n 
14 198  HIS n 
14 199  HIS n 
14 200  ASP n 
14 201  ASP n 
14 202  GLU n 
14 203  GLU n 
14 204  GLU n 
14 205  SER n 
14 206  SER n 
14 207  GLU n 
14 208  LYS n 
14 209  LYS n 
14 210  LYS n 
14 211  LYS n 
14 212  LYS n 
14 213  LYS n 
14 214  GLU n 
14 215  LYS n 
14 216  ARG n 
14 217  GLU n 
14 218  LYS n 
14 219  ARG n 
14 220  GLU n 
14 221  LYS n 
14 222  LYS n 
14 223  ASP n 
14 224  LYS n 
14 225  LYS n 
14 226  ASP n 
14 227  LYS n 
14 228  LYS n 
14 229  LYS n 
14 230  LYS n 
14 231  HIS n 
14 232  ARG n 
14 233  ASP n 
15 1    DG  n 
15 2    DG  n 
15 3    DT  n 
15 4    DT  n 
15 5    DT  n 
15 6    DA  n 
15 7    DG  n 
15 8    DT  n 
15 9    DC  n 
15 10   DA  n 
15 11   DT  n 
15 12   DG  n 
15 13   DG  n 
15 14   DA  n 
15 15   DG  n 
15 16   DT  n 
15 17   DA  n 
15 18   DC  n 
15 19   DA  n 
15 20   DA  n 
15 21   DG  n 
15 22   DT  n 
15 23   DG  n 
15 24   DT  n 
15 25   DG  n 
15 26   DA  n 
15 27   DG  n 
15 28   DG  n 
15 29   DA  n 
15 30   DA  n 
15 31   DA  n 
15 32   DA  n 
15 33   DG  n 
15 34   DT  n 
15 35   DA  n 
15 36   DG  n 
15 37   DT  n 
15 38   DT  n 
15 39   DG  n 
15 40   DG  n 
15 41   DC  n 
15 42   DG  n 
15 43   DT  n 
15 44   DA  n 
15 45   DG  n 
15 46   DC  n 
15 47   DA  n 
15 48   DG  n 
15 49   DG  n 
15 50   DA  n 
15 51   DG  n 
15 52   DA  n 
15 53   DA  n 
15 54   DG  n 
15 55   DT  n 
15 56   DA  n 
15 57   DA  n 
15 58   DA  n 
15 59   DG  n 
15 60   DC  n 
15 61   DA  n 
15 62   DG  n 
15 63   DT  n 
15 64   DT  n 
15 65   DG  n 
15 66   DA  n 
15 67   DA  n 
15 68   DG  n 
15 69   DA  n 
15 70   DC  n 
16 1    DG  n 
16 2    DT  n 
16 3    DC  n 
16 4    DT  n 
16 5    DT  n 
16 6    DC  n 
16 7    DA  n 
16 8    DA  n 
16 9    DC  n 
16 10   DT  n 
16 11   DG  n 
16 12   DC  n 
16 13   DT  n 
16 14   DT  n 
16 15   DT  n 
16 16   DC  n 
16 17   DG  n 
16 18   DC  n 
16 19   DA  n 
16 20   DT  n 
16 21   DG  n 
16 22   DA  n 
16 23   DA  n 
16 24   DG  n 
16 25   DT  n 
16 26   DA  n 
16 27   DC  n 
16 28   DC  n 
16 29   DT  n 
16 30   DC  n 
16 31   DC  n 
16 32   DC  n 
16 33   DA  n 
16 34   DA  n 
16 35   DC  n 
16 36   DT  n 
16 37   DA  n 
16 38   DC  n 
16 39   DT  n 
16 40   DT  n 
16 41   DT  n 
16 42   DT  n 
16 43   DC  n 
16 44   DC  n 
16 45   DT  n 
16 46   DC  n 
16 47   DA  n 
16 48   DC  n 
16 49   DA  n 
16 50   DC  n 
16 51   DT  n 
16 52   DT  n 
16 53   DG  n 
16 54   DT  n 
16 55   DA  n 
16 56   DC  n 
16 57   DT  n 
16 58   DC  n 
16 59   DC  n 
16 60   DA  n 
16 61   DT  n 
16 62   DG  n 
16 63   DA  n 
16 64   DC  n 
16 65   DT  n 
16 66   DA  n 
16 67   DA  n 
16 68   DA  n 
16 69   DC  n 
16 70   DC  n 
17 1    G   n 
17 2    A   n 
17 3    G   n 
17 4    G   n 
17 5    U   n 
17 6    A   n 
17 7    C   n 
17 8    U   n 
17 9    U   n 
17 10   C   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample 1 1664 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample 1 1203 
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample 1 335  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample 1 137  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample 1 215  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample 1 155  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample 1 326  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample 1 146  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample 1 125  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample 1 142  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample 1 70   
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample 1 415  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample 1 233  
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ?    
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ?    
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ?    
;Baker's yeast
;
'Saccharomyces cerevisiae' 4932 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1  UNP RPA1_YEAST  P10964 ? 1  
;MDISKPVGSEITSVDFGILTAKEIRNLSAKQITNPTVLDNLGHPVSGGLYDLALGAFLRNLCSTCGLDEKFCPGHQGHIE
LPVPCYNPLFFNQLYIYLRASCLFCHHFRLKSVEVHRYACKLRLLQYGLIDESYKLDEITLGSLNSSMYTDDEAIEDNED
EMDGEGSKQSKDISSTLLNELKSKRSEYVDMAIAKALSDGRTTERGSFTATVNDERKKLVHEFHKKLLSRGKCDNCGMFS
PKFRKDGFTKIFETALNEKQITNNRVKGFIRQDMIKKQKQAKKLDGSNEASANDEESFDVGRNPTTRPKTGSTYILSTEV
KNILDTVFRKEQCVLQYVFHSRPNLSRKLVKADSFFMDVLVVPPTRFRLPSKLGEEVHENSQNQLLSKVLTTSLLIRDLN
DDLSKLQKDKVSLEDRRVIFSRLMNAFVTIQNDVNAFIDSTKAQGRTSGKVPIPGVKQALEKKEGLFRKHMMGKRVNYAA
RSVISPDPNIETNEIGVPPVFAVKLTYPEPVTAYNIAELRQAVINGPDKWPGATQIQNEDGSLVSLIGMSVEQRKALANQ
LLTPSSNVSTHTLNKKVYRHIKNRDVVLMNRQPTLHKASMMGHKVRVLPNEKTLRLHYANTGAYNADFDGDEMNMHFPQN
ENARAEALNLANTDSQYLTPTSGSPVRGLIQDHISAGVWLTSKDSFFTREQYQQYIYGCIRPEDGHTTRSKIVTLPPTIF
KPYPLWTGKQIITTVLLNVTPPDMPGINLISKNKIKNEYWGKGSLENEVLFKDGALLCGILDKSQYGASKYGIVHSLHEV
YGPEVAAKVLSVLGRLFTNYITATAFTCGMDDLRLTAEGNKWRTDILKTSVDTGREAAAEVTNLDKDTPADDPELLKRLQ
EILRDNNKSGILDAVTSSKVNAITSQVVSKCVPDGTMKKFPCNSMQAMALSGAKGSNVNVSQIMCLLGQQALEGRRVPVM
VSGKTLPSFKPYETDAMAGGYVKGRFYSGIKPQEYYFHCMAGREGLIDTAVKTSRSGYLQRCLTKQLEGVHVSYDNSIRD
ADGTLVQFMYGGDAIDITKESHMTQFEFCLDNYYALLKKYNPSALIEHLDVESALKYSKKTLKYRKKHSKEPHYKQSVKY
DPVLAKYNPAKYLGSVSENFQDKLESFLDKNSKLFKSSDGVNEKKFRALMQLKYMRSLINPGEAVGIIASQSVGEPSTQM
TLNTFHFAGHGAANVTLGIPRLREIVMTASAAIKTPQMTLPIWNDVSDEQADTFCKSISKVLLSEVIDKVIVTETTGTSN
TAGGNAARSYVIHMRFFDNNEYSEEYDVSKEELQNVISNQFIHLLEAAIVKEIKKQKRTTGPDIGVAVPRLQTDVANSSS
NSKRLEEDNDEEQSHKKTKQAVSYDEPDEDEIETMREAEKSSDEEGIDSDKESDSDSEDEDVDMNEQINKSIVEANNNMN
KVQRDRQSAIISHHRFITKYNFDDESGKWCEFKLELAADTEKLLMVNIVEEICRKSIIRQIPHIDRCVHPEPENGKRVLV
TEGVNFQAMWDQEAFIDVDGITSNDVAAVLKTYGVEAARNTIVNEINNVFSRYAISVSFRHLDLIADMMTRQGTYLAFNR
QGMETSTSSFMKMSYETTCQFLTKAVLDNEREQLDSPSARIVVGKLNNVGTGSFDVLAKVPNAA
;
1 
2  UNP RPA2_YEAST  P22138 ? 2  
;MSKVIKPPGQARTADFRTLERESRFINPPKDKSAFPLLQEAVQPHIGSFNALTEGPDGGLLNLGVKDIGEKVIFDGKPLN
SEDEISNSGYLGNKLSVSVEQVSIAKPMSNDGVSSAVERKVYPSESRQRLTSYRGKLLLKLKWSVNNGEENLFEVRDCGG
LPVMLQSNRCHLNKMSPYELVQHKEESDEIGGYFIVNGIEKLIRMLIVQRRNHPMAIIRPSFANRGASYSHYGIQIRSVR
PDQTSQTNVLHYLNDGQVTFRFSWRKNEYLVPVVMILKALCHTSDREIFDGIIGNDVKDSFLTDRLELLLRGFKKRYPHL
QNRTQVLQYLGDKFRVVFQASPDQSDLEVGQEVLDRIVLVHLGKDGSQDKFRMLLFMIRKLYSLVAGECSPDNPDATQHQ
EVLLGGFLYGMILKEKIDEYLQNIIAQVRMDINRGMAINFKDKRYMSRVLMRVNENIGSKMQYFLSTGNLVSQSGLDLQQ
VSGYTVVAEKINFYRFISHFRMVHRGSFFAQLKTTTVRKLLPESWGFLCPVHTPDGSPCGLLNHFAHKCRISTQQSDVSR
IPSILYSLGVAPASHTFAAGPSLCCVQIDGKIIGWVSHEQGKIIADTLRYWKVEGKTPGLPIDLEIGYVPPSTRGQYPGL
YLFGGHSRMLRPVRYLPLDKEDIVGPFEQVYMNIAVTPQEIQNNVHTHVEFTPTNILSILANLTPFSDFNQSPRNMYQCQ
MGKQTMGTPGVALCHRSDNKLYRLQTGQTPIVKANLYDDYGMDNFPNGFNAVVAVISYTGYDMDDAMIINKSADERGFGY
GTMYKTEKVDLALNRNRGDPITQHFGFGNDEWPKEWLEKLDEDGLPYIGTYVEEGDPICAYFDDTLNKTKIKTYHSSEPA
YIEEVNLIGDESNKFQELQTVSIKYRIRRTPQIGDKFSSRHGQKGVCSRKWPTIDMPFSETGIQPDIIINPHAFPSRMTI
GMFVESLAGKAGALHGIAQDSTPWIFNEDDTPADYFGEQLAKAGYNYHGNEPMYSGATGEELRADIYVGVVYYQRLRHMV
NDKFQVRSTGPVNSLTMQPVKGRKRHGGIRVGEMERDALIGHGTSFLLQDRLLNSSDYTQASVCRECGSILTTQQSVPRI
GSISTVCCRRCSMRFEDAKKLLTKSEDGEKIFIDDSQIWEDGQGNKFVGGNETTTVAIPFVLKYLDSELSAMGIRLRYNV
EPK
;
1 
3  UNP RPAC1_YEAST P07703 ? 3  
;MSNIVGIEYNRVTNTTSTDFPGFSKDAENEWNVEKFKKDFEVNISSLDAREANFDLINIDTSIANAFRRIMISEVPSVAA
EYVYFFNNTSVIQDEVLAHRIGLVPLKVDPDMLTWVDSNLPDDEKFTDENTIVLSLNVKCTRNPDAPKGSTDPKELYNNA
HVYARDLKFEPQGRQSTTFADCPVVPADPDILLAKLRPGQEISLKAHCILGIGGDHAKFSPVSTASYRLLPQINILQPIK
GESARRFQKCFPPGVIGIDEGSDEAYVKDARKDTVSREVLRYEEFADKVKLGRVRNHFIFNVESAGAMTPEEIFFKSVRI
LKNKAEYLKNCPITQ
;
1 
4  UNP RPA14_YEAST P50106 ? 4  
;MMKGSRRTGNNTATTLNTPVVIHATQLPQHVSTDEVLQFLESFIDEKENIIDSTTMNTISGNAADADAAAVANTSLNIDT
NLSSSISQLKRIQRDFKGLPPAQDFSAAPIQVSTTEKKETSIGVSATGGKKTTFADE
;
1 
5  UNP RPAB1_YEAST P20434 ? 5  
;MDQENERNISRLWRAFRTVKEMVKDRGYFITQEEVELPLEDFKAKYCDSMGRPQRKMMSFQANPTEESISKFPDMGSLWV
EFCDEPSVGVKTMKTFVIHIQEKNFQTGIFVYQNNITPSAMKLVPSIPPATIETFNEAALVVNITHHELVPKHIRLSSDE
KRELLKRYRLKESQLPRIQRADPVALYLGLKRGEVVKIIRKSETSGRYASYRICM
;
1 
6  UNP RPAB2_YEAST P20435 ? 6  
;MSDYEEAFNDGNENFEDFDVEHFSDEETYEEKPQFKDGETTDANGKTIVTGGNGPEDFQQHEQIRRKTLKEKAIPKDQRA
TTPYMTKYERARILGTRALQISMNAPVFVDLEGETDPLRIAMKELAEKKIPLVIRRYLPDGSFEDWSVEELIVDL
;
1 
7  UNP RPA43_YEAST P46669 ? 7  
;MSQVKRANENRETARFIKKHKKQVTNPIDEKNGTSNCIVRVPIALYVSLAPMYLENPLQGVMKQHLNPLVMKYNNKVGGV
VLGYEGLKILDADPLSKEDTSEKLIKITPDTPFGFTWCHVNLYVWQPQVGDVLEGYIFIQSASHIGLLIHDAFNASIKKN
NIPVDWTFVHNDVEEDADVINTDENNGNNNNEDNKDSNGGSNSLGKFSFGNRSLGHWVDSNGEPIDGKLRFTVRNVHTTG
RVVSVDGTLISDADEEGNGYNSSRSQAESLPIVSNKKIVFDDEVSIENKESHKELDLPEVKEDNGSEIVYEENTSESNDG
ESSDSD
;
1 
8  UNP RPAB3_YEAST P20436 ? 8  
;MSNTLFDDIFQVSEVDPGRYNKVCRIEAASTTQDQCKLTLDINVELFPVAAQDSLTVTIASSLNLEDTPANDSSATRSWR
PPQAGDRSLADDYDYVMYGTAYKFEEVSKDLIAVYYSFGGLLMRLEGNYRNLNNLKQENAYLLIRR
;
1 
9  UNP RPA12_YEAST P32529 ? 9  
;MSVVGSLIFCLDCGDLLENPNAVLGSNVECSQCKAIYPKSQFSNLKVVTTTADDAFPSSLRAKKSVVKTSLKKNELKDGA
TIKEKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN
;
1 
10 UNP RPAB5_YEAST P22139 ? 10 MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNPLEKRD 1 
11 UNP RPAC2_YEAST P28000 ? 11 
;MTEDIEQKKTATEVTPQEPKHIQEEEEQDVDMTGDEEQEEEPDREKIKLLTQATSEDGTSASFQIVEEDHTLGNALRYVI
MKNPDVEFCGYSIPHPSENLLNIRIQTYGETTAVDALQKGLKDLMDLCDVVESKFTEKIKSM
;
1 
12 UNP RPAB4_YEAST P40422 ? 12 MSREGFQIPTNLDAAAAGTSQARTATLKYICAECSSKLSLSRTDAVRCKDCGHRILLKARTKRLVQFEAR 1 
13 UNP RPA49_YEAST Q01080 ? 13 
;MSVKRSVSEIEIESVQDQPSVAVGSFFKGFRAPSDTTFDLYKKKKSEKDEFVLHGENERLEYEGYTDSSSQASNQYVVGL
FNPEKKSIQLYKAPVLVSKVVSKSSKNLRGPKIKSKSDTRPSALRNALGEAFGTKKAKKAIADLERNRIDSDKLTDSAID
IVDSVRTASKDLPTRAQLDEITSNDRPTPLANIDATDVEQIYPIESIIPKKELQFIRVSSILKEADKEKKLELFPYQNNS
KYVAKKLDSLTQPSQMTKLQLLYYLSLLLGVYENRRVNNKTKLLERLNSPPEILVDGILSRFTVIKPGQFGRSKDRSYFI
DPQNEDKILCYILAIIMHLDNFIVEITPLAHELNLKPSKVVSLFRVLGAIVKGATVAQAEAFGIPKSTAASYKIATMKVP
FKLPEMTRRGRGPRR
;
1 
14 UNP RPA34_YEAST P47006 ? 14 
;MSKLSKDYVSDSDSDDEVISNEFSIPDGFKKCKHLKNFPLNGDNKKKAKQQQVWLIKFPSNVDISKLKSLPVDFESSTTM
TIDKHDYKIMDDTDIESSLTQDNLSNMTLLVPSESKESLKIASTAKDNAPLQFDKVFSVSETAKIPAIDYSKVRVPRKDV
PKVEGLKLEHFATGYDAEDFHVAEEVKENKKEPKKRSHHDDEEESSEKKKKKKEKREKREKKDKKDKKKKHRD
;
1 
15 PDB 5M64        5M64   ? 15 ? 1 
16 PDB 5M64        5M64   ? 16 ? 1 
17 PDB 5M64        5M64   ? 17 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  5M64 A 1 ? 1664 ? P10964 1 ? 1664 ? 1 1664 
2  2  5M64 B 1 ? 1203 ? P22138 1 ? 1203 ? 1 1203 
3  3  5M64 C 1 ? 335  ? P07703 1 ? 335  ? 1 335  
4  4  5M64 D 1 ? 137  ? P50106 1 ? 137  ? 1 137  
5  5  5M64 E 1 ? 215  ? P20434 1 ? 215  ? 1 215  
6  6  5M64 F 1 ? 155  ? P20435 1 ? 155  ? 1 155  
7  7  5M64 G 1 ? 326  ? P46669 1 ? 326  ? 1 326  
8  8  5M64 H 1 ? 146  ? P20436 1 ? 146  ? 1 146  
9  9  5M64 I 1 ? 125  ? P32529 1 ? 125  ? 1 125  
10 10 5M64 J 1 ? 70   ? P22139 1 ? 70   ? 1 70   
11 11 5M64 K 1 ? 142  ? P28000 1 ? 142  ? 1 142  
12 12 5M64 L 1 ? 70   ? P40422 1 ? 70   ? 1 70   
13 13 5M64 M 1 ? 415  ? Q01080 1 ? 415  ? 1 415  
14 14 5M64 N 1 ? 233  ? P47006 1 ? 233  ? 1 233  
15 15 5M64 S 1 ? 70   ? 5M64   1 ? 70   ? 1 70   
16 16 5M64 T 1 ? 70   ? 5M64   1 ? 70   ? 1 70   
17 17 5M64 R 1 ? 10   ? 5M64   1 ? 10   ? 1 10   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5M64 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     5M64 
_struct.title                        'RNA Polymerase I elongation complex with A49 tandem winged helix domain' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase I subunit RPA190, DNA-directed RNA polymerase I subunit RPA135, DNA-directed RNA polymerases I and III subunit RPAC1, DNA-directed RNA polymerase I subunit RPA14, DNA-directed RNA polymerases I, II, and III subunit RPABC1, DNA-directed RNA polymerases I, II, and III subunit RPABC2, DNA-directed RNA polymerase I subunit RPA43, DNA-directed RNA polymerases I, II, and III subunit RPABC3, DNA-directed RNA polymerase I subunit RPA12, DNA-directed RNA polymerases I, II, and III subunit RPABC5, DNA-directed RNA polymerases I and III subunit RPAC2, DNA-directed RNA polymerases I, II, and III subunit RPABC4, DNA-directed RNA polymerase I subunit RPA49, DNA-directed RNA polymerase I subunit RPA34/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5M64 
_struct_keywords.text            'RNA Polymerase, transcription' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 5  ? 
F N N 6  ? 
G N N 7  ? 
H N N 8  ? 
I N N 9  ? 
J N N 10 ? 
K N N 11 ? 
L N N 12 ? 
M N N 13 ? 
N N N 14 ? 
O N N 15 ? 
P N N 16 ? 
Q N N 17 ? 
R N N 18 ? 
S N N 18 ? 
T N N 18 ? 
U N N 18 ? 
V N N 18 ? 
W N N 18 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 ASN A 87   ? SER A 101  ? ASN A 87   SER A 101  1 ? 15 
HELX_P HELX_P2   AA2 LYS A 111  ? GLN A 126  ? LYS A 111  GLN A 126  1 ? 16 
HELX_P HELX_P3   AA3 LEU A 129  ? GLU A 138  ? LEU A 129  GLU A 138  1 ? 10 
HELX_P HELX_P4   AA4 SER A 175  ? ASP A 199  ? SER A 175  ASP A 199  1 ? 25 
HELX_P HELX_P5   AA5 THR A 211  ? LYS A 225  ? THR A 211  LYS A 225  1 ? 15 
HELX_P HELX_P6   AA6 LYS A 226  ? ARG A 230  ? LYS A 226  ARG A 230  5 ? 5  
HELX_P HELX_P7   AA7 ASN A 257  ? LYS A 267  ? ASN A 257  LYS A 267  1 ? 11 
HELX_P HELX_P8   AA8 LEU A 316  ? GLU A 331  ? LEU A 316  GLU A 331  1 ? 16 
HELX_P HELX_P9   AA9 GLU A 331  ? PHE A 339  ? GLU A 331  PHE A 339  1 ? 9  
HELX_P HELX_P10  AB1 LYS A 351  ? PHE A 355  ? LYS A 351  PHE A 355  5 ? 5  
HELX_P HELX_P11  AB2 PRO A 364  ? LEU A 369  ? PRO A 364  LEU A 369  5 ? 6  
HELX_P HELX_P12  AB3 SER A 381  ? ASP A 398  ? SER A 381  ASP A 398  1 ? 18 
HELX_P HELX_P13  AB4 ASP A 398  ? LYS A 405  ? ASP A 398  LYS A 405  1 ? 8  
HELX_P HELX_P14  AB5 VAL A 418  ? ASP A 439  ? VAL A 418  ASP A 439  1 ? 22 
HELX_P HELX_P15  AB6 GLY A 465  ? LYS A 469  ? GLY A 465  LYS A 469  5 ? 5  
HELX_P HELX_P16  AB7 PRO A 498  ? LEU A 505  ? PRO A 498  LEU A 505  1 ? 8  
HELX_P HELX_P17  AB8 ALA A 517  ? GLY A 526  ? ALA A 517  GLY A 526  1 ? 10 
HELX_P HELX_P18  AB9 SER A 550  ? ASN A 559  ? SER A 550  ASN A 559  1 ? 10 
HELX_P HELX_P19  AC1 ASN A 567  ? HIS A 571  ? ASN A 567  HIS A 571  5 ? 5  
HELX_P HELX_P20  AC2 ALA A 619  ? ASN A 625  ? ALA A 619  ASN A 625  1 ? 7  
HELX_P HELX_P21  AC3 ASN A 640  ? LEU A 650  ? ASN A 640  LEU A 650  1 ? 11 
HELX_P HELX_P22  AC4 THR A 653  ? TYR A 657  ? THR A 653  TYR A 657  5 ? 5  
HELX_P HELX_P23  AC5 GLN A 671  ? SER A 682  ? GLN A 671  SER A 682  1 ? 12 
HELX_P HELX_P24  AC6 THR A 688  ? ARG A 701  ? THR A 688  ARG A 701  1 ? 14 
HELX_P HELX_P25  AC7 GLY A 728  ? THR A 740  ? GLY A 728  THR A 740  1 ? 13 
HELX_P HELX_P26  AC8 LYS A 756  ? GLY A 761  ? LYS A 756  GLY A 761  5 ? 6  
HELX_P HELX_P27  AC9 GLY A 792  ? TYR A 801  ? GLY A 792  TYR A 801  1 ? 10 
HELX_P HELX_P28  AD1 GLY A 802  ? ARG A 815  ? GLY A 802  ARG A 815  1 ? 14 
HELX_P HELX_P29  AD2 ARG A 815  ? THR A 824  ? ARG A 815  THR A 824  1 ? 10 
HELX_P HELX_P30  AD3 GLY A 829  ? LEU A 833  ? GLY A 829  LEU A 833  5 ? 5  
HELX_P HELX_P31  AD4 GLY A 839  ? THR A 849  ? GLY A 839  THR A 849  1 ? 11 
HELX_P HELX_P32  AD5 ASP A 852  ? THR A 862  ? ASP A 852  THR A 862  1 ? 11 
HELX_P HELX_P33  AD6 ASP A 872  ? LEU A 883  ? ASP A 872  LEU A 883  1 ? 12 
HELX_P HELX_P34  AD7 ASN A 886  ? ILE A 891  ? ASN A 886  ILE A 891  1 ? 6  
HELX_P HELX_P35  AD8 LEU A 892  ? CYS A 911  ? LEU A 892  CYS A 911  1 ? 20 
HELX_P HELX_P36  AD9 ASN A 923  ? GLY A 932  ? ASN A 923  GLY A 932  1 ? 10 
HELX_P HELX_P37  AE1 SER A 936  ? CYS A 945  ? SER A 936  CYS A 945  1 ? 10 
HELX_P HELX_P38  AE2 LYS A 991  ? LYS A 1025 ? LYS A 991  LYS A 1025 1 ? 35 
HELX_P HELX_P39  AE3 MET A 1049 ? ASP A 1053 ? MET A 1049 ASP A 1053 5 ? 5  
HELX_P HELX_P40  AE4 GLN A 1065 ? ASN A 1072 ? GLN A 1065 ASN A 1072 1 ? 8  
HELX_P HELX_P41  AE5 ASN A 1072 ? ASN A 1081 ? ASN A 1072 ASN A 1081 1 ? 10 
HELX_P HELX_P42  AE6 PRO A 1082 ? ILE A 1086 ? PRO A 1082 ILE A 1086 5 ? 5  
HELX_P HELX_P43  AE7 VAL A 1091 ? SER A 1109 ? VAL A 1091 SER A 1109 1 ? 19 
HELX_P HELX_P44  AE8 PRO A 1122 ? TYR A 1127 ? PRO A 1122 TYR A 1127 1 ? 6  
HELX_P HELX_P45  AE9 SER A 1137 ? LYS A 1150 ? SER A 1137 LYS A 1150 1 ? 14 
HELX_P HELX_P46  AF1 GLU A 1163 ? SER A 1177 ? GLU A 1163 SER A 1177 1 ? 15 
HELX_P HELX_P47  AF2 ALA A 1184 ? GLU A 1195 ? ALA A 1184 GLU A 1195 1 ? 12 
HELX_P HELX_P48  AF3 PRO A 1196 ? GLN A 1199 ? PRO A 1196 GLN A 1199 5 ? 4  
HELX_P HELX_P49  AF4 GLY A 1218 ? THR A 1228 ? GLY A 1218 THR A 1228 1 ? 11 
HELX_P HELX_P50  AF5 SER A 1247 ? SER A 1259 ? SER A 1247 SER A 1259 1 ? 13 
HELX_P HELX_P51  AF6 LEU A 1262 ? GLU A 1265 ? LEU A 1262 GLU A 1265 5 ? 4  
HELX_P HELX_P52  AF7 ASP A 1298 ? TYR A 1306 ? ASP A 1298 TYR A 1306 1 ? 9  
HELX_P HELX_P53  AF8 SER A 1309 ? GLN A 1320 ? SER A 1309 GLN A 1320 1 ? 12 
HELX_P HELX_P54  AF9 GLN A 1320 ? LYS A 1337 ? GLN A 1320 LYS A 1337 1 ? 18 
HELX_P HELX_P55  AG1 ASN A 1440 ? SER A 1452 ? ASN A 1440 SER A 1452 1 ? 13 
HELX_P HELX_P56  AG2 LEU A 1484 ? ARG A 1494 ? LEU A 1484 ARG A 1494 1 ? 11 
HELX_P HELX_P57  AG3 ALA A 1547 ? THR A 1552 ? ALA A 1547 THR A 1552 1 ? 6  
HELX_P HELX_P58  AG4 GLY A 1554 ? ARG A 1572 ? GLY A 1554 ARG A 1572 1 ? 19 
HELX_P HELX_P59  AG5 SER A 1578 ? THR A 1590 ? SER A 1578 THR A 1590 1 ? 13 
HELX_P HELX_P60  AG6 SER A 1609 ? SER A 1614 ? SER A 1609 SER A 1614 1 ? 6  
HELX_P HELX_P61  AG7 THR A 1617 ? ASN A 1629 ? THR A 1617 ASN A 1629 1 ? 13 
HELX_P HELX_P62  AG8 VAL A 1649 ? SER A 1653 ? VAL A 1649 SER A 1653 5 ? 5  
HELX_P HELX_P63  AG9 THR B 18   ? ASN B 27   ? THR B 18   ASN B 27   1 ? 10 
HELX_P HELX_P64  AH1 PHE B 35   ? VAL B 42   ? PHE B 35   VAL B 42   1 ? 8  
HELX_P HELX_P65  AH2 VAL B 42   ? ALA B 51   ? VAL B 42   ALA B 51   1 ? 10 
HELX_P HELX_P66  AH3 GLY B 59   ? ASP B 67   ? GLY B 59   ASP B 67   1 ? 9  
HELX_P HELX_P67  AH4 SER B 86   ? TYR B 90   ? SER B 86   TYR B 90   1 ? 5  
HELX_P HELX_P68  AH5 TYR B 122  ? ARG B 129  ? TYR B 122  ARG B 129  1 ? 8  
HELX_P HELX_P69  AH6 SER B 176  ? HIS B 183  ? SER B 176  HIS B 183  1 ? 8  
HELX_P HELX_P70  AH7 PRO B 220  ? GLY B 226  ? PRO B 220  GLY B 226  1 ? 7  
HELX_P HELX_P71  AH8 VAL B 273  ? LYS B 278  ? VAL B 273  LYS B 278  1 ? 6  
HELX_P HELX_P72  AH9 ARG B 286  ? ILE B 292  ? ARG B 286  ILE B 292  1 ? 7  
HELX_P HELX_P73  AI1 SER B 300  ? LYS B 315  ? SER B 300  LYS B 315  1 ? 16 
HELX_P HELX_P74  AI2 ASN B 322  ? PHE B 334  ? ASN B 322  PHE B 334  1 ? 13 
HELX_P HELX_P75  AI3 SER B 345  ? ARG B 356  ? SER B 345  ARG B 356  1 ? 12 
HELX_P HELX_P76  AI4 LEU B 359  ? GLY B 363  ? LEU B 359  GLY B 363  5 ? 5  
HELX_P HELX_P77  AI5 ASP B 365  ? GLN B 368  ? ASP B 365  GLN B 368  5 ? 4  
HELX_P HELX_P78  AI6 ASP B 369  ? ALA B 386  ? ASP B 369  ALA B 386  1 ? 18 
HELX_P HELX_P79  AI7 ALA B 396  ? GLN B 400  ? ALA B 396  GLN B 400  5 ? 5  
HELX_P HELX_P80  AI8 GLY B 405  ? LYS B 416  ? GLY B 405  LYS B 416  1 ? 12 
HELX_P HELX_P81  AI9 ILE B 417  ? ILE B 432  ? ILE B 417  ILE B 432  1 ? 16 
HELX_P HELX_P82  AJ1 ASP B 442  ? MET B 451  ? ASP B 442  MET B 451  1 ? 10 
HELX_P HELX_P83  AJ2 ILE B 457  ? GLY B 468  ? ILE B 457  GLY B 468  1 ? 12 
HELX_P HELX_P84  AJ3 ASN B 492  ? PHE B 500  ? ASN B 492  PHE B 500  1 ? 9  
HELX_P HELX_P85  AJ4 GLY B 506  ? GLN B 511  ? GLY B 506  GLN B 511  5 ? 6  
HELX_P HELX_P86  AJ5 LEU B 521  ? TRP B 525  ? LEU B 521  TRP B 525  5 ? 5  
HELX_P HELX_P87  AJ6 ARG B 560  ? TYR B 566  ? ARG B 560  TYR B 566  1 ? 7  
HELX_P HELX_P88  AJ7 HIS B 598  ? GLU B 614  ? HIS B 598  GLU B 614  1 ? 17 
HELX_P HELX_P89  AJ8 PHE B 667  ? MET B 672  ? PHE B 667  MET B 672  1 ? 6  
HELX_P HELX_P90  AJ9 THR B 692  ? LEU B 697  ? THR B 692  LEU B 697  5 ? 6  
HELX_P HELX_P91  AK1 SER B 698  ? THR B 704  ? SER B 698  THR B 704  1 ? 7  
HELX_P HELX_P92  AK2 PHE B 706  ? ASN B 710  ? PHE B 706  ASN B 710  5 ? 5  
HELX_P HELX_P93  AK3 GLN B 711  ? LYS B 723  ? GLN B 711  LYS B 723  1 ? 13 
HELX_P HELX_P94  AK4 ALA B 732  ? ARG B 736  ? ALA B 732  ARG B 736  5 ? 5  
HELX_P HELX_P95  AK5 ALA B 754  ? TYR B 760  ? ALA B 754  TYR B 760  1 ? 7  
HELX_P HELX_P96  AK6 GLY B 761  ? PHE B 765  ? GLY B 761  PHE B 765  5 ? 5  
HELX_P HELX_P97  AK7 ASN B 790  ? GLY B 797  ? ASN B 790  GLY B 797  1 ? 8  
HELX_P HELX_P98  AK8 ASN B 950  ? HIS B 952  ? ASN B 950  HIS B 952  5 ? 3  
HELX_P HELX_P99  AK9 ALA B 953  ? MET B 958  ? ALA B 953  MET B 958  1 ? 6  
HELX_P HELX_P100 AL1 ILE B 960  ? HIS B 975  ? ILE B 960  HIS B 975  1 ? 16 
HELX_P HELX_P101 AL2 THR B 991  ? PHE B 996  ? THR B 991  PHE B 996  1 ? 6  
HELX_P HELX_P102 AL3 PHE B 996  ? GLY B 1004 ? PHE B 996  GLY B 1004 1 ? 9  
HELX_P HELX_P103 AL4 GLY B 1072 ? HIS B 1082 ? GLY B 1072 HIS B 1082 1 ? 11 
HELX_P HELX_P104 AL5 SER B 1085 ? LEU B 1093 ? SER B 1085 LEU B 1093 1 ? 9  
HELX_P HELX_P105 AL6 PRO B 1179 ? MET B 1192 ? PRO B 1179 MET B 1192 1 ? 14 
HELX_P HELX_P106 AL7 ASN C 32   ? PHE C 40   ? ASN C 32   PHE C 40   1 ? 9  
HELX_P HELX_P107 AL8 ASP C 60   ? GLU C 74   ? ASP C 60   GLU C 74   1 ? 15 
HELX_P HELX_P108 AL9 GLN C 93   ? GLY C 102  ? GLN C 93   GLY C 102  1 ? 10 
HELX_P HELX_P109 AM1 PRO C 121  ? PHE C 126  ? PRO C 121  PHE C 126  1 ? 6  
HELX_P HELX_P110 AM2 ASP C 152  ? LEU C 156  ? ASP C 152  LEU C 156  1 ? 5  
HELX_P HELX_P111 AM3 GLY C 241  ? PHE C 251  ? GLY C 241  PHE C 251  1 ? 11 
HELX_P HELX_P112 AM4 ARG C 277  ? TYR C 282  ? ARG C 277  TYR C 282  5 ? 6  
HELX_P HELX_P113 AM5 PHE C 314  ? ASN C 330  ? PHE C 314  ASN C 330  1 ? 17 
HELX_P HELX_P114 AM6 ASP D 34   ? GLU D 48   ? ASP D 34   GLU D 48   1 ? 15 
HELX_P HELX_P115 AM7 LEU D 82   ? ILE D 92   ? LEU D 82   ILE D 92   1 ? 11 
HELX_P HELX_P116 AM8 GLU E 4    ? ASP E 25   ? GLU E 4    ASP E 25   1 ? 22 
HELX_P HELX_P117 AM9 THR E 31   ? GLU E 36   ? THR E 31   GLU E 36   1 ? 6  
HELX_P HELX_P118 AN1 PRO E 38   ? TYR E 46   ? PRO E 38   TYR E 46   1 ? 9  
HELX_P HELX_P119 AN2 THR E 65   ? SER E 70   ? THR E 65   SER E 70   1 ? 6  
HELX_P HELX_P120 AN3 GLY E 89   ? ASN E 104  ? GLY E 89   ASN E 104  1 ? 16 
HELX_P HELX_P121 AN4 ASN E 143  ? HIS E 147  ? ASN E 143  HIS E 147  5 ? 5  
HELX_P HELX_P122 AN5 SER E 158  ? ARG E 169  ? SER E 158  ARG E 169  1 ? 12 
HELX_P HELX_P123 AN6 LYS E 171  ? LEU E 175  ? LYS E 171  LEU E 175  5 ? 5  
HELX_P HELX_P124 AN7 ASP E 182  ? GLY E 189  ? ASP E 182  GLY E 189  1 ? 8  
HELX_P HELX_P125 AN8 GLU F 56   ? ALA F 73   ? GLU F 56   ALA F 73   1 ? 18 
HELX_P HELX_P126 AN9 THR F 86   ? SER F 102  ? THR F 86   SER F 102  1 ? 17 
HELX_P HELX_P127 AO1 ASP F 116  ? LYS F 128  ? ASP F 116  LYS F 128  1 ? 13 
HELX_P HELX_P128 AO2 GLU F 149  ? LEU F 151  ? GLU F 149  LEU F 151  5 ? 3  
HELX_P HELX_P129 AO3 GLU G 9    ? LYS G 18   ? GLU G 9    LYS G 18   1 ? 10 
HELX_P HELX_P130 AO4 ALA G 50   ? LEU G 54   ? ALA G 50   LEU G 54   5 ? 5  
HELX_P HELX_P131 AO5 ASN G 56   ? HIS G 65   ? ASN G 56   HIS G 65   1 ? 10 
HELX_P HELX_P132 AO6 LEU G 148  ? ALA G 152  ? LEU G 148  ALA G 152  5 ? 5  
HELX_P HELX_P133 AO7 SER H 88   ? TYR H 93   ? SER H 88   TYR H 93   5 ? 6  
HELX_P HELX_P134 AO8 ASN H 128  ? ASN H 133  ? ASN H 128  ASN H 133  5 ? 6  
HELX_P HELX_P135 AO9 SER I 58   ? LYS I 64   ? SER I 58   LYS I 64   1 ? 7  
HELX_P HELX_P136 AP1 ASP J 16   ? ASP J 28   ? ASP J 16   ASP J 28   1 ? 13 
HELX_P HELX_P137 AP2 ASP J 31   ? LEU J 39   ? ASP J 31   LEU J 39   1 ? 9  
HELX_P HELX_P138 AP3 ARG J 43   ? THR J 52   ? ARG J 43   THR J 52   1 ? 10 
HELX_P HELX_P139 AP4 LEU J 56   ? LEU J 61   ? LEU J 56   LEU J 61   1 ? 6  
HELX_P HELX_P140 AP5 ASP K 69   ? MET K 81   ? ASP K 69   MET K 81   1 ? 13 
HELX_P HELX_P141 AP6 THR K 112  ? SER K 141  ? THR K 112  SER K 141  1 ? 30 
HELX_P HELX_P142 AP7 PRO M 203  ? ILE M 207  ? PRO M 203  ILE M 207  5 ? 5  
HELX_P HELX_P143 AP8 PRO M 209  ? GLN M 214  ? PRO M 209  GLN M 214  1 ? 6  
HELX_P HELX_P144 AP9 LYS M 241  ? LEU M 247  ? LYS M 241  LEU M 247  1 ? 7  
HELX_P HELX_P145 AQ1 ASP M 248  ? LEU M 250  ? ASP M 248  LEU M 250  5 ? 3  
HELX_P HELX_P146 AQ2 GLN M 252  ? SER M 254  ? GLN M 252  SER M 254  5 ? 3  
HELX_P HELX_P147 AQ3 GLN M 255  ? ASN M 274  ? GLN M 255  ASN M 274  1 ? 20 
HELX_P HELX_P148 AQ4 ASN M 279  ? GLU M 285  ? ASN M 279  GLU M 285  1 ? 7  
HELX_P HELX_P149 AQ5 PRO M 291  ? THR M 303  ? PRO M 291  THR M 303  1 ? 13 
HELX_P HELX_P150 AQ6 GLY M 308  ? ASP M 315  ? GLY M 308  ASP M 315  1 ? 8  
HELX_P HELX_P151 AQ7 ASP M 321  ? ASP M 340  ? ASP M 321  ASP M 340  1 ? 20 
HELX_P HELX_P152 AQ8 ILE M 346  ? LEU M 353  ? ILE M 346  LEU M 353  1 ? 8  
HELX_P HELX_P153 AQ9 LYS M 356  ? GLY M 368  ? LYS M 356  GLY M 368  1 ? 13 
HELX_P HELX_P154 AR1 THR M 375  ? GLY M 383  ? THR M 375  GLY M 383  1 ? 9  
HELX_P HELX_P155 AR2 PRO M 385  ? ALA M 389  ? PRO M 385  ALA M 389  5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 62   SG  ? ? ? 1_555 A CYS 65  SG ? ? A CYS 62   A CYS 65   1_555 ? ? ? ? ? ? ?               2.556 ? 
disulf2  disulf ? ? A CYS 65   SG  ? ? ? 1_555 A CYS 72  SG ? ? A CYS 65   A CYS 72   1_555 ? ? ? ? ? ? ?               2.443 ? 
disulf3  disulf ? ? A CYS 102  SG  ? ? ? 1_555 A CYS 105 SG ? ? A CYS 102  A CYS 105  1_555 ? ? ? ? ? ? ?               2.738 ? 
disulf4  disulf ? ? A CYS 105  SG  ? ? ? 1_555 A CYS 236 SG ? ? A CYS 105  A CYS 236  1_555 ? ? ? ? ? ? ?               2.730 ? 
disulf5  disulf ? ? J CYS 10   SG  ? ? ? 1_555 J CYS 46  SG ? ? J CYS 10   J CYS 46   1_555 ? ? ? ? ? ? ?               2.378 ? 
disulf6  disulf ? ? L CYS 31   SG  ? ? ? 1_555 L CYS 48  SG ? ? L CYS 31   L CYS 48   1_555 ? ? ? ? ? ? ?               2.974 ? 
disulf7  disulf ? ? L CYS 31   SG  ? ? ? 1_555 L CYS 34  SG ? ? L CYS 31   L CYS 34   1_555 ? ? ? ? ? ? ?               2.878 ? 
disulf8  disulf ? ? L CYS 34   SG  ? ? ? 1_555 L CYS 48  SG ? ? L CYS 34   L CYS 48   1_555 ? ? ? ? ? ? ?               2.747 ? 
metalc1  metalc ? ? A CYS 62   SG  ? ? ? 1_555 S ZN  .   ZN ? ? A CYS 62   A ZN  1702 1_555 ? ? ? ? ? ? ?               2.313 ? 
metalc2  metalc ? ? A CYS 65   SG  ? ? ? 1_555 S ZN  .   ZN ? ? A CYS 65   A ZN  1702 1_555 ? ? ? ? ? ? ?               2.310 ? 
metalc3  metalc ? ? A CYS 72   SG  ? ? ? 1_555 S ZN  .   ZN ? ? A CYS 72   A ZN  1702 1_555 ? ? ? ? ? ? ?               2.312 ? 
metalc4  metalc ? ? A HIS 75   NE2 ? ? ? 1_555 S ZN  .   ZN ? ? A HIS 75   A ZN  1702 1_555 ? ? ? ? ? ? ?               2.030 ? 
metalc5  metalc ? ? A CYS 102  SG  ? ? ? 1_555 R ZN  .   ZN ? ? A CYS 102  A ZN  1701 1_555 ? ? ? ? ? ? ?               2.354 ? 
metalc6  metalc ? ? A CYS 105  SG  ? ? ? 1_555 R ZN  .   ZN ? ? A CYS 105  A ZN  1701 1_555 ? ? ? ? ? ? ?               2.333 ? 
metalc7  metalc ? ? A CYS 233  SG  ? ? ? 1_555 R ZN  .   ZN ? ? A CYS 233  A ZN  1701 1_555 ? ? ? ? ? ? ?               2.364 ? 
metalc8  metalc ? ? A CYS 236  SG  ? ? ? 1_555 R ZN  .   ZN ? ? A CYS 236  A ZN  1701 1_555 ? ? ? ? ? ? ?               2.303 ? 
metalc9  metalc ? ? B CYS 1104 SG  ? ? ? 1_555 T ZN  .   ZN ? ? B CYS 1104 B ZN  1301 1_555 ? ? ? ? ? ? ?               2.345 ? 
metalc10 metalc ? ? B CYS 1107 SG  ? ? ? 1_555 T ZN  .   ZN ? ? B CYS 1107 B ZN  1301 1_555 ? ? ? ? ? ? ?               2.321 ? 
metalc11 metalc ? ? B CYS 1128 SG  ? ? ? 1_555 T ZN  .   ZN ? ? B CYS 1128 B ZN  1301 1_555 ? ? ? ? ? ? ?               2.346 ? 
metalc12 metalc ? ? B CYS 1131 SG  ? ? ? 1_555 T ZN  .   ZN ? ? B CYS 1131 B ZN  1301 1_555 ? ? ? ? ? ? ?               2.331 ? 
metalc13 metalc ? ? I CYS 13   SG  ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 13   I ZN  201  1_555 ? ? ? ? ? ? ?               2.309 ? 
metalc14 metalc ? ? I CYS 30   SG  ? ? ? 1_555 U ZN  .   ZN ? ? I CYS 30   I ZN  201  1_555 ? ? ? ? ? ? ?               2.310 ? 
metalc15 metalc ? ? J CYS 7    SG  ? ? ? 1_555 V ZN  .   ZN ? ? J CYS 7    J ZN  101  1_555 ? ? ? ? ? ? ?               2.380 ? 
metalc16 metalc ? ? J CYS 10   SG  ? ? ? 1_555 V ZN  .   ZN ? ? J CYS 10   J ZN  101  1_555 ? ? ? ? ? ? ?               2.284 ? 
metalc17 metalc ? ? J CYS 45   SG  ? ? ? 1_555 V ZN  .   ZN ? ? J CYS 45   J ZN  101  1_555 ? ? ? ? ? ? ?               2.341 ? 
metalc18 metalc ? ? J CYS 46   SG  ? ? ? 1_555 V ZN  .   ZN ? ? J CYS 46   J ZN  101  1_555 ? ? ? ? ? ? ?               2.387 ? 
metalc19 metalc ? ? L CYS 31   SG  ? ? ? 1_555 W ZN  .   ZN ? ? L CYS 31   L ZN  101  1_555 ? ? ? ? ? ? ?               2.309 ? 
metalc20 metalc ? ? L CYS 34   SG  ? ? ? 1_555 W ZN  .   ZN ? ? L CYS 34   L ZN  101  1_555 ? ? ? ? ? ? ?               2.308 ? 
metalc21 metalc ? ? L CYS 48   SG  ? ? ? 1_555 W ZN  .   ZN ? ? L CYS 48   L ZN  101  1_555 ? ? ? ? ? ? ?               2.310 ? 
metalc22 metalc ? ? L CYS 51   SG  ? ? ? 1_555 W ZN  .   ZN ? ? L CYS 51   L ZN  101  1_555 ? ? ? ? ? ? ?               2.306 ? 
hydrog1  hydrog ? ? O DG  54   O6  ? ? ? 1_555 P DG  17  N2 ? ? S DG  54   T DG  17   1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ?     ? 
hydrog2  hydrog ? ? O DA  56   N1  ? ? ? 1_555 P DT  15  N3 ? ? S DA  56   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3  hydrog ? ? O DA  56   N6  ? ? ? 1_555 P DT  15  O4 ? ? S DA  56   T DT  15   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog4  hydrog ? ? O DA  57   N1  ? ? ? 1_555 P DT  14  N3 ? ? S DA  57   T DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5  hydrog ? ? O DA  57   N6  ? ? ? 1_555 P DT  14  O4 ? ? S DA  57   T DT  14   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6  hydrog ? ? O DA  58   N1  ? ? ? 1_555 P DT  13  N3 ? ? S DA  58   T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7  hydrog ? ? O DA  58   N6  ? ? ? 1_555 P DT  13  O4 ? ? S DA  58   T DT  13   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog8  hydrog ? ? O DG  59   N1  ? ? ? 1_555 P DC  12  N3 ? ? S DG  59   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9  hydrog ? ? O DG  59   N2  ? ? ? 1_555 P DC  12  O2 ? ? S DG  59   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10 hydrog ? ? O DG  59   O6  ? ? ? 1_555 P DC  12  N4 ? ? S DG  59   T DC  12   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog11 hydrog ? ? O DC  60   N3  ? ? ? 1_555 P DG  11  N1 ? ? S DC  60   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog12 hydrog ? ? O DC  60   N4  ? ? ? 1_555 P DG  11  O6 ? ? S DC  60   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog13 hydrog ? ? O DC  60   O2  ? ? ? 1_555 P DG  11  N2 ? ? S DC  60   T DG  11   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog14 hydrog ? ? O DA  61   N1  ? ? ? 1_555 P DT  10  N3 ? ? S DA  61   T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15 hydrog ? ? O DA  61   N6  ? ? ? 1_555 P DT  10  O4 ? ? S DA  61   T DT  10   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16 hydrog ? ? O DG  62   N1  ? ? ? 1_555 P DC  9   N3 ? ? S DG  62   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17 hydrog ? ? O DG  62   N2  ? ? ? 1_555 P DC  9   O2 ? ? S DG  62   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18 hydrog ? ? O DG  62   O6  ? ? ? 1_555 P DC  9   N4 ? ? S DG  62   T DC  9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog19 hydrog ? ? O DT  64   N3  ? ? ? 1_555 P DA  7   N1 ? ? S DT  64   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog20 hydrog ? ? O DT  64   O4  ? ? ? 1_555 P DA  7   N6 ? ? S DT  64   T DA  7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21 hydrog ? ? O DG  65   N1  ? ? ? 1_555 P DC  6   N3 ? ? S DG  65   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22 hydrog ? ? O DG  65   N2  ? ? ? 1_555 P DC  6   O2 ? ? S DG  65   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog23 hydrog ? ? O DG  65   O6  ? ? ? 1_555 P DC  6   N4 ? ? S DG  65   T DC  6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24 hydrog ? ? O DA  66   N1  ? ? ? 1_555 P DT  5   N3 ? ? S DA  66   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25 hydrog ? ? O DA  66   N6  ? ? ? 1_555 P DT  5   O4 ? ? S DA  66   T DT  5    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog26 hydrog ? ? O DA  67   N1  ? ? ? 1_555 P DT  4   N3 ? ? S DA  67   T DT  4    1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog27 hydrog ? ? O DG  68   N1  ? ? ? 1_555 P DT  4   O2 ? ? S DG  68   T DT  4    1_555 ? ? ? ? ? ? 'DG-DT MISPAIR' ?     ? 
hydrog28 hydrog ? ? P DG  21   O6  ? ? ? 1_555 Q C   10  N4 ? ? T DG  21   R C   10   1_555 ? ? ? ? ? ? 'DG-C PAIR'     ?     ? 
hydrog29 hydrog ? ? P DA  22   N1  ? ? ? 1_555 Q U   9   N3 ? ? T DA  22   R U   9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog30 hydrog ? ? P DA  22   N6  ? ? ? 1_555 Q U   9   O4 ? ? T DA  22   R U   9    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog31 hydrog ? ? P DA  23   N1  ? ? ? 1_555 Q U   8   N3 ? ? T DA  23   R U   8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog32 hydrog ? ? P DA  23   N6  ? ? ? 1_555 Q U   8   O4 ? ? T DA  23   R U   8    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33 hydrog ? ? P DG  24   N1  ? ? ? 1_555 Q C   7   N3 ? ? T DG  24   R C   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34 hydrog ? ? P DG  24   N2  ? ? ? 1_555 Q C   7   O2 ? ? T DG  24   R C   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35 hydrog ? ? P DG  24   O6  ? ? ? 1_555 Q C   7   N4 ? ? T DG  24   R C   7    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36 hydrog ? ? P DT  25   N3  ? ? ? 1_555 Q A   6   N1 ? ? T DT  25   R A   6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37 hydrog ? ? P DT  25   O4  ? ? ? 1_555 Q A   6   N6 ? ? T DT  25   R A   6    1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  TRP 530  A . ? TRP 530  A PRO 531  A ? PRO 531  A 1 -2.50 
2  GLN 592  A . ? GLN 592  A PRO 593  A ? PRO 593  A 1 -2.28 
3  LYS 721  A . ? LYS 721  A PRO 722  A ? PRO 722  A 1 -0.51 
4  VAL 912  A . ? VAL 912  A PRO 913  A ? PRO 913  A 1 -2.38 
5  PHE 920  A . ? PHE 920  A PRO 921  A ? PRO 921  A 1 -1.54 
6  SER 341  B . ? SER 341  B PRO 342  B ? PRO 342  B 1 -5.05 
7  GLU 1201 B . ? GLU 1201 B PRO 1202 B ? PRO 1202 B 1 -1.16 
8  PRO 128  E . ? PRO 128  E PRO 129  E ? PRO 129  E 1 -0.53 
9  TYR 37   I . ? TYR 37   I PRO 38   I ? PRO 38   I 1 -4.24 
10 VAL 399  M . ? VAL 399  M PRO 400  M ? PRO 400  M 1 0.18  
11 ILE 25   N . ? ILE 25   N PRO 26   N ? PRO 26   N 1 -0.94 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 6 ? 
AA8 ? 4 ? 
AA9 ? 2 ? 
AB1 ? 3 ? 
AB2 ? 2 ? 
AB3 ? 4 ? 
AB4 ? 5 ? 
AB5 ? 2 ? 
AB6 ? 7 ? 
AB7 ? 4 ? 
AB8 ? 4 ? 
AB9 ? 4 ? 
AC1 ? 3 ? 
AC2 ? 2 ? 
AC3 ? 5 ? 
AC4 ? 3 ? 
AC5 ? 4 ? 
AC6 ? 4 ? 
AC7 ? 5 ? 
AC8 ? 7 ? 
AC9 ? 3 ? 
AD1 ? 2 ? 
AD2 ? 2 ? 
AD3 ? 2 ? 
AD4 ? 2 ? 
AD5 ? 4 ? 
AD6 ? 5 ? 
AD7 ? 5 ? 
AD8 ? 2 ? 
AD9 ? 2 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 4 ? 
AE4 ? 4 ? 
AE5 ? 2 ? 
AE6 ? 3 ? 
AE7 ? 2 ? 
AE8 ? 5 ? 
AE9 ? 2 ? 
AF1 ? 3 ? 
AF2 ? 4 ? 
AF3 ? 4 ? 
AF4 ? 3 ? 
AF5 ? 7 ? 
AF6 ? 3 ? 
AF7 ? 2 ? 
AF8 ? 3 ? 
AF9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? parallel      
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? anti-parallel 
AA7 5 6 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB1 2 3 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB4 4 5 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB6 5 6 ? anti-parallel 
AB6 6 7 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB8 3 4 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC1 2 3 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC3 4 5 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC4 2 3 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC5 2 3 ? anti-parallel 
AC5 3 4 ? parallel      
AC6 1 2 ? anti-parallel 
AC6 2 3 ? parallel      
AC6 3 4 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? parallel      
AC8 2 3 ? anti-parallel 
AC8 3 4 ? parallel      
AC8 4 5 ? anti-parallel 
AC8 5 6 ? anti-parallel 
AC8 6 7 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AC9 2 3 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD4 1 2 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD5 3 4 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD6 2 3 ? anti-parallel 
AD6 3 4 ? anti-parallel 
AD6 4 5 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD7 4 5 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? anti-parallel 
AE3 2 3 ? parallel      
AE3 3 4 ? parallel      
AE4 1 2 ? anti-parallel 
AE4 2 3 ? anti-parallel 
AE4 3 4 ? parallel      
AE5 1 2 ? anti-parallel 
AE6 1 2 ? parallel      
AE6 2 3 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE8 2 3 ? anti-parallel 
AE8 3 4 ? anti-parallel 
AE8 4 5 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF2 2 3 ? anti-parallel 
AF2 3 4 ? anti-parallel 
AF3 1 2 ? anti-parallel 
AF3 2 3 ? anti-parallel 
AF3 3 4 ? anti-parallel 
AF4 1 2 ? anti-parallel 
AF4 2 3 ? anti-parallel 
AF5 1 2 ? anti-parallel 
AF5 2 3 ? anti-parallel 
AF5 3 4 ? anti-parallel 
AF5 4 5 ? anti-parallel 
AF5 5 6 ? parallel      
AF5 6 7 ? anti-parallel 
AF6 1 2 ? anti-parallel 
AF6 2 3 ? anti-parallel 
AF7 1 2 ? anti-parallel 
AF8 1 2 ? anti-parallel 
AF8 2 3 ? anti-parallel 
AF9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 1631 ? GLU A 1632 ? ARG A 1631 GLU A 1632 
AA1 2 ILE A 11   ? ILE A 18   ? ILE A 11   ILE A 18   
AA1 3 ILE B 1194 ? VAL B 1200 ? ILE B 1194 VAL B 1200 
AA2 1 LEU A 38   ? ASP A 39   ? LEU A 38   ASP A 39   
AA2 2 HIS A 43   ? PRO A 44   ? HIS A 43   PRO A 44   
AA3 1 GLU A 80   ? CYS A 85   ? GLU A 80   CYS A 85   
AA3 2 MET A 357  ? VAL A 359  ? MET A 357  VAL A 359  
AA4 1 PHE A 243  ? ARG A 244  ? PHE A 243  ARG A 244  
AA4 2 PHE A 252  ? GLU A 253  ? PHE A 252  GLU A 253  
AA4 3 THR A 313  ? TYR A 314  ? THR A 313  TYR A 314  
AA5 1 LYS A 372  ? LEU A 373  ? LYS A 372  LEU A 373  
AA5 2 GLU A 376  ? VAL A 377  ? GLU A 376  VAL A 377  
AA6 1 ARG A 475  ? VAL A 476  ? ARG A 475  VAL A 476  
AA6 2 ILE B 1069 ? ARG B 1070 ? ILE B 1069 ARG B 1070 
AA7 1 GLU A 494  ? ILE A 495  ? GLU A 494  ILE A 495  
AA7 2 MET A 600  ? VAL A 605  ? MET A 600  VAL A 605  
AA7 3 VAL A 586  ? ASN A 590  ? VAL A 586  ASN A 590  
AA7 4 ASN A 634  ? HIS A 636  ? ASN A 634  HIS A 636  
AA7 5 ALA A 479  ? ARG A 481  ? ALA A 479  ARG A 481  
AA7 6 GLN B 1045 ? ARG B 1047 ? GLN B 1045 ARG B 1047 
AA8 1 TYR A 507  ? PRO A 510  ? TYR A 507  PRO A 510  
AA8 2 LYS A 576  ? ARG A 579  ? LYS A 576  ARG A 579  
AA8 3 ALA A 533  ? GLN A 537  ? ALA A 533  GLN A 537  
AA8 4 LEU A 543  ? SER A 545  ? LEU A 543  SER A 545  
AA9 1 PHE A 686  ? PHE A 687  ? PHE A 686  PHE A 687  
AA9 2 TRP A 726  ? THR A 727  ? TRP A 726  THR A 727  
AB1 1 ILE A 750  ? SER A 751  ? ILE A 750  SER A 751  
AB1 2 VAL A 769  ? PHE A 771  ? VAL A 769  PHE A 771  
AB1 3 LEU A 776  ? CYS A 778  ? LEU A 776  CYS A 778  
AB2 1 HIS A 1031 ? VAL A 1032 ? HIS A 1031 VAL A 1032 
AB2 2 ILE A 1038 ? ARG A 1039 ? ILE A 1038 ARG A 1039 
AB3 1 ILE A 1504 ? CYS A 1507 ? ILE A 1504 CYS A 1507 
AB3 2 VAL A 1520 ? GLY A 1523 ? VAL A 1520 GLY A 1523 
AB3 3 MET A 1238 ? THR A 1239 ? MET A 1238 THR A 1239 
AB3 4 THR A 1542 ? SER A 1543 ? THR A 1542 SER A 1543 
AB4 1 ILE A 1457 ? PHE A 1462 ? ILE A 1457 PHE A 1462 
AB4 2 TRP A 1469 ? LEU A 1476 ? TRP A 1469 LEU A 1476 
AB4 3 ARG A 1288 ? PHE A 1296 ? ARG A 1288 PHE A 1296 
AB4 4 ILE A 1267 ? VAL A 1272 ? ILE A 1267 VAL A 1272 
AB4 5 THR I 49   ? THR I 50   ? THR I 49   THR I 50   
AB5 1 THR A 1275 ? THR A 1276 ? THR A 1275 THR A 1276 
AB5 2 LEU I 45   ? LYS I 46   ? LEU I 45   LYS I 46   
AB6 1 VAL D 21   ? ALA D 24   ? VAL D 21   ALA D 24   
AB6 2 ILE G 38   ? SER G 48   ? ILE G 38   SER G 48   
AB6 3 GLY G 114  ? TRP G 125  ? GLY G 114  TRP G 125  
AB6 4 LYS G 103  ? ILE G 107  ? LYS G 103  ILE G 107  
AB6 5 ASP A 1655 ? VAL A 1660 ? ASP A 1655 VAL A 1660 
AB6 6 VAL F 133  ? ARG F 136  ? VAL F 133  ARG F 136  
AB6 7 GLU F 144  ? SER F 147  ? GLU F 144  SER F 147  
AB7 1 VAL D 21   ? ALA D 24   ? VAL D 21   ALA D 24   
AB7 2 ILE G 38   ? SER G 48   ? ILE G 38   SER G 48   
AB7 3 GLY G 114  ? TRP G 125  ? GLY G 114  TRP G 125  
AB7 4 VAL G 80   ? GLU G 85   ? VAL G 80   GLU G 85   
AB8 1 LYS B 71   ? PHE B 74   ? LYS B 71   PHE B 74   
AB8 2 LYS B 94   ? VAL B 97   ? LYS B 94   VAL B 97   
AB8 3 LEU B 137  ? VAL B 145  ? LEU B 137  VAL B 145  
AB8 4 VAL B 99   ? ILE B 104  ? VAL B 99   ILE B 104  
AB9 1 LYS B 71   ? PHE B 74   ? LYS B 71   PHE B 74   
AB9 2 LYS B 94   ? VAL B 97   ? LYS B 94   VAL B 97   
AB9 3 LEU B 137  ? VAL B 145  ? LEU B 137  VAL B 145  
AB9 4 GLU B 150  ? ASP B 157  ? GLU B 150  ASP B 157  
AC1 1 PHE B 194  ? VAL B 196  ? PHE B 194  VAL B 196  
AC1 2 ILE B 199  ? ILE B 203  ? ILE B 199  ILE B 203  
AC1 3 THR B 485  ? VAL B 486  ? THR B 485  VAL B 486  
AC2 1 LEU B 206  ? VAL B 208  ? LEU B 206  VAL B 208  
AC2 2 GLU B 401  ? LEU B 403  ? GLU B 401  LEU B 403  
AC3 1 MET B 215  ? ILE B 218  ? MET B 215  ILE B 218  
AC3 2 TYR B 232  ? ARG B 237  ? TYR B 232  ARG B 237  
AC3 3 THR B 247  ? LEU B 250  ? THR B 247  LEU B 250  
AC3 4 THR B 259  ? ARG B 261  ? THR B 259  ARG B 261  
AC3 5 LEU B 270  ? PRO B 272  ? LEU B 270  PRO B 272  
AC4 1 ARG B 550  ? SER B 552  ? ARG B 550  SER B 552  
AC4 2 ARG B 648  ? TYR B 655  ? ARG B 648  TYR B 655  
AC4 3 LYS B 660  ? VAL B 664  ? LYS B 660  VAL B 664  
AC5 1 ARG B 550  ? SER B 552  ? ARG B 550  SER B 552  
AC5 2 ARG B 648  ? TYR B 655  ? ARG B 648  TYR B 655  
AC5 3 HIS B 688  ? VAL B 689  ? HIS B 688  VAL B 689  
AC5 4 ILE B 674  ? ALA B 675  ? ILE B 674  ALA B 675  
AC6 1 ILE B 592  ? SER B 597  ? ILE B 592  SER B 597  
AC6 2 LEU B 583  ? GLN B 587  ? LEU B 583  GLN B 587  
AC6 3 GLY B 639  ? PHE B 643  ? GLY B 639  PHE B 643  
AC6 4 GLU B 625  ? VAL B 629  ? GLU B 625  VAL B 629  
AC7 1 LYS B 740  ? LEU B 744  ? LYS B 740  LEU B 744  
AC7 2 GLY B 801  ? ASP B 810  ? GLY B 801  ASP B 810  
AC7 3 THR B 900  ? ARG B 909  ? THR B 900  ARG B 909  
AC7 4 ALA B 880  ? ILE B 888  ? ALA B 880  ILE B 888  
AC7 5 TYR B 851  ? VAL B 852  ? TYR B 851  VAL B 852  
AC8 1 PHE B 769  ? VAL B 775  ? PHE B 769  VAL B 775  
AC8 2 ILE B 947  ? ILE B 949  ? ILE B 947  ILE B 949  
AC8 3 ALA B 786  ? ILE B 789  ? ALA B 786  ILE B 789  
AC8 4 LYS B 924  ? CYS B 927  ? LYS B 924  CYS B 927  
AC8 5 LYS B 916  ? SER B 919  ? LYS B 916  SER B 919  
AC8 6 TYR B 1027 ? ARG B 1035 ? TYR B 1027 ARG B 1035 
AC8 7 PHE B 769  ? VAL B 775  ? PHE B 769  VAL B 775  
AC9 1 GLN B 823  ? HIS B 824  ? GLN B 823  HIS B 824  
AC9 2 PRO B 857  ? ASP B 863  ? PRO B 857  ASP B 863  
AC9 3 THR B 869  ? THR B 873  ? THR B 869  THR B 873  
AD1 1 PHE B 938  ? SER B 939  ? PHE B 938  SER B 939  
AD1 2 MET B 1013 ? TYR B 1014 ? MET B 1013 TYR B 1014 
AD2 1 THR B 1099 ? CYS B 1104 ? THR B 1099 CYS B 1104 
AD2 2 THR B 1173 ? ILE B 1178 ? THR B 1173 ILE B 1178 
AD3 1 THR B 1113 ? GLN B 1115 ? THR B 1113 GLN B 1115 
AD3 2 VAL B 1126 ? CYS B 1128 ? VAL B 1126 CYS B 1128 
AD4 1 SER B 1132 ? ARG B 1134 ? SER B 1132 ARG B 1134 
AD4 2 PHE B 1167 ? GLY B 1169 ? PHE B 1167 GLY B 1169 
AD5 1 GLU C 41   ? ASN C 43   ? GLU C 41   ASN C 43   
AD5 2 GLU C 51   ? ILE C 57   ? GLU C 51   ILE C 57   
AD5 3 ARG C 293  ? SER C 304  ? ARG C 293  SER C 304  
AD5 4 VAL C 222  ? PRO C 231  ? VAL C 222  PRO C 231  
AD6 1 LYS C 168  ? PHE C 169  ? LYS C 168  PHE C 169  
AD6 2 ILE C 132  ? LYS C 139  ? ILE C 132  LYS C 139  
AD6 3 GLU C 201  ? LEU C 204  ? GLU C 201  LEU C 204  
AD6 4 SER C 77   ? ASN C 88   ? SER C 77   ASN C 88   
AD6 5 VAL L 65   ? GLU L 68   ? VAL L 65   GLU L 68   
AD7 1 LYS C 168  ? PHE C 169  ? LYS C 168  PHE C 169  
AD7 2 ILE C 132  ? LYS C 139  ? ILE C 132  LYS C 139  
AD7 3 HIS C 207  ? GLY C 211  ? HIS C 207  GLY C 211  
AD7 4 SER C 77   ? ASN C 88   ? SER C 77   ASN C 88   
AD7 5 VAL L 65   ? GLU L 68   ? VAL L 65   GLU L 68   
AD8 1 THR C 141  ? ARG C 142  ? THR C 141  ARG C 142  
AD8 2 TYR C 157  ? ASN C 158  ? TYR C 157  ASN C 158  
AD9 1 HIS C 161  ? VAL C 162  ? HIS C 161  VAL C 162  
AD9 2 ALA C 194  ? LYS C 195  ? ALA C 194  LYS C 195  
AE1 1 ASN C 234  ? ILE C 235  ? ASN C 234  ILE C 235  
AE1 2 VAL C 289  ? LYS C 290  ? VAL C 289  LYS C 290  
AE2 1 ILE C 256  ? GLY C 257  ? ILE C 256  GLY C 257  
AE2 2 TYR C 266  ? VAL C 267  ? TYR C 266  VAL C 267  
AE3 1 PHE E 60   ? GLN E 61   ? PHE E 60   GLN E 61   
AE3 2 LEU E 78   ? PHE E 82   ? LEU E 78   PHE E 82   
AE3 3 THR E 107  ? VAL E 111  ? THR E 107  VAL E 111  
AE3 4 THR E 131  ? GLU E 133  ? THR E 131  GLU E 133  
AE4 1 LYS E 152  ? LEU E 156  ? LYS E 152  LEU E 156  
AE4 2 VAL E 195  ? ARG E 200  ? VAL E 195  ARG E 200  
AE4 3 TYR E 208  ? MET E 215  ? TYR E 208  MET E 215  
AE4 4 ARG E 177  ? GLN E 179  ? ARG E 177  GLN E 179  
AE5 1 VAL G 132  ? GLY G 135  ? VAL G 132  GLY G 135  
AE5 2 LEU G 229  ? THR G 232  ? LEU G 229  THR G 232  
AE6 1 ASN G 154  ? SER G 156  ? ASN G 154  SER G 156  
AE6 2 SER G 244  ? ASP G 246  ? SER G 244  ASP G 246  
AE6 3 ASN G 235  ? HIS G 237  ? ASN G 235  HIS G 237  
AE7 1 THR G 167  ? HIS G 170  ? THR G 167  HIS G 170  
AE7 2 GLY G 215  ? VAL G 218  ? GLY G 215  VAL G 218  
AE8 1 LYS H 37   ? LEU H 40   ? LYS H 37   LEU H 40   
AE8 2 ARG H 25   ? SER H 30   ? ARG H 25   SER H 30   
AE8 3 THR H 4    ? ASP H 16   ? THR H 4    ASP H 16   
AE8 4 SER H 54   ? ALA H 60   ? SER H 54   ALA H 60   
AE8 5 TYR H 141  ? ILE H 144  ? TYR H 141  ILE H 144  
AE9 1 THR H 100  ? LYS H 103  ? THR H 100  LYS H 103  
AE9 2 TYR H 115  ? SER H 117  ? TYR H 115  SER H 117  
AF1 1 VAL I 3    ? VAL I 4    ? VAL I 3    VAL I 4    
AF1 2 LEU I 7    ? CYS I 10   ? LEU I 7    CYS I 10   
AF1 3 ASP I 15   ? LEU I 16   ? ASP I 15   LEU I 16   
AF2 1 ILE K 47   ? LEU K 49   ? ILE K 47   LEU K 49   
AF2 2 SER K 60   ? VAL K 66   ? SER K 60   VAL K 66   
AF2 3 LEU K 100  ? THR K 107  ? LEU K 100  THR K 107  
AF2 4 VAL K 86   ? PHE K 88   ? VAL K 86   PHE K 88   
AF3 1 ILE K 47   ? LEU K 49   ? ILE K 47   LEU K 49   
AF3 2 SER K 60   ? VAL K 66   ? SER K 60   VAL K 66   
AF3 3 LEU K 100  ? THR K 107  ? LEU K 100  THR K 107  
AF3 4 TYR K 91   ? SER K 92   ? TYR K 91   SER K 92   
AF4 1 LYS L 37   ? LEU L 38   ? LYS L 37   LEU L 38   
AF4 2 TYR L 29   ? ILE L 30   ? TYR L 29   ILE L 30   
AF4 3 LEU L 57   ? LYS L 58   ? LEU L 57   LYS L 58   
AF5 1 LYS N 30   ? LYS N 31   ? LYS N 30   LYS N 31   
AF5 2 LEU M 40   ? LYS M 42   ? LEU M 40   LYS M 42   
AF5 3 VAL M 52   ? HIS M 54   ? VAL M 52   HIS M 54   
AF5 4 GLU M 63   ? TYR M 65   ? GLU M 63   TYR M 65   
AF5 5 VAL M 95   ? SER M 98   ? VAL M 95   SER M 98   
AF5 6 ALA M 22   ? SER M 25   ? ALA M 22   SER M 25   
AF5 7 THR N 108  ? LEU N 110  ? THR N 108  LEU N 110  
AF6 1 TYR M 91   ? LYS M 92   ? TYR M 91   LYS M 92   
AF6 2 ASN M 74   ? VAL M 78   ? ASN M 74   VAL M 78   
AF6 3 ILE N 56   ? PRO N 59   ? ILE N 56   PRO N 59   
AF7 1 LEU M 80   ? PHE M 81   ? LEU M 80   PHE M 81   
AF7 2 GLN N 52   ? VAL N 53   ? GLN N 52   VAL N 53   
AF8 1 VAL M 344  ? GLU M 345  ? VAL M 344  GLU M 345  
AF8 2 LYS M 393  ? THR M 396  ? LYS M 393  THR M 396  
AF8 3 ILE M 370  ? GLY M 373  ? ILE M 370  GLY M 373  
AF9 1 LYS N 88   ? ASP N 92   ? LYS N 88   ASP N 92   
AF9 2 VAL N 136  ? SER N 140  ? VAL N 136  SER N 140  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 O GLU A 1632 ? O GLU A 1632 N VAL A 14   ? N VAL A 14   
AA1 2 3 N ASP A 15   ? N ASP A 15   O ARG B 1197 ? O ARG B 1197 
AA2 1 2 N ASP A 39   ? N ASP A 39   O HIS A 43   ? O HIS A 43   
AA3 1 2 N CYS A 85   ? N CYS A 85   O MET A 357  ? O MET A 357  
AA4 1 2 N ARG A 244  ? N ARG A 244  O PHE A 252  ? O PHE A 252  
AA4 2 3 N GLU A 253  ? N GLU A 253  O THR A 313  ? O THR A 313  
AA5 1 2 N LEU A 373  ? N LEU A 373  O GLU A 376  ? O GLU A 376  
AA6 1 2 N VAL A 476  ? N VAL A 476  O ILE B 1069 ? O ILE B 1069 
AA7 1 2 N ILE A 495  ? N ILE A 495  O LYS A 604  ? O LYS A 604  
AA7 2 3 O HIS A 603  ? O HIS A 603  N VAL A 587  ? N VAL A 587  
AA7 3 4 N ASN A 590  ? N ASN A 590  O ASN A 634  ? O ASN A 634  
AA7 4 5 O MET A 635  ? O MET A 635  N ALA A 480  ? N ALA A 480  
AA7 5 6 N ARG A 481  ? N ARG A 481  O GLN B 1045 ? O GLN B 1045 
AA8 1 2 N GLU A 509  ? N GLU A 509  O VAL A 577  ? O VAL A 577  
AA8 2 3 O TYR A 578  ? O TYR A 578  N THR A 534  ? N THR A 534  
AA8 3 4 N ILE A 536  ? N ILE A 536  O VAL A 544  ? O VAL A 544  
AA9 1 2 N PHE A 687  ? N PHE A 687  O TRP A 726  ? O TRP A 726  
AB1 1 2 N SER A 751  ? N SER A 751  O VAL A 769  ? O VAL A 769  
AB1 2 3 N LEU A 770  ? N LEU A 770  O LEU A 777  ? O LEU A 777  
AB2 1 2 N HIS A 1031 ? N HIS A 1031 O ARG A 1039 ? O ARG A 1039 
AB3 1 2 N ARG A 1506 ? N ARG A 1506 O GLU A 1522 ? O GLU A 1522 
AB3 2 3 O THR A 1521 ? O THR A 1521 N MET A 1238 ? N MET A 1238 
AB3 3 4 N THR A 1239 ? N THR A 1239 O THR A 1542 ? O THR A 1542 
AB4 1 2 N LYS A 1459 ? N LYS A 1459 O LYS A 1473 ? O LYS A 1473 
AB4 2 3 O LEU A 1474 ? O LEU A 1474 N TYR A 1290 ? N TYR A 1290 
AB4 3 4 O HIS A 1293 ? O HIS A 1293 N ILE A 1271 ? N ILE A 1271 
AB4 4 5 N VAL A 1272 ? N VAL A 1272 O THR I 49   ? O THR I 49   
AB5 1 2 N THR A 1276 ? N THR A 1276 O LEU I 45   ? O LEU I 45   
AB6 1 2 N HIS D 23   ? N HIS D 23   O ALA G 44   ? O ALA G 44   
AB6 2 3 N ILE G 43   ? N ILE G 43   O VAL G 120  ? O VAL G 120  
AB6 3 4 O PHE G 115  ? O PHE G 115  N LYS G 106  ? N LYS G 106  
AB6 4 5 O ILE G 107  ? O ILE G 107  N VAL A 1656 ? N VAL A 1656 
AB6 5 6 N LEU A 1657 ? N LEU A 1657 O VAL F 133  ? O VAL F 133  
AB6 6 7 N ILE F 134  ? N ILE F 134  O TRP F 146  ? O TRP F 146  
AB7 1 2 N HIS D 23   ? N HIS D 23   O ALA G 44   ? O ALA G 44   
AB7 2 3 N ILE G 43   ? N ILE G 43   O VAL G 120  ? O VAL G 120  
AB7 3 4 O TYR G 123  ? O TYR G 123  N GLY G 83   ? N GLY G 83   
AB8 1 2 N ILE B 73   ? N ILE B 73   O LEU B 95   ? O LEU B 95   
AB8 2 3 N SER B 96   ? N SER B 96   O SER B 144  ? O SER B 144  
AB8 3 4 O LYS B 140  ? O LYS B 140  N GLN B 101  ? N GLN B 101  
AB9 1 2 N ILE B 73   ? N ILE B 73   O LEU B 95   ? O LEU B 95   
AB9 2 3 N SER B 96   ? N SER B 96   O SER B 144  ? O SER B 144  
AB9 3 4 N LEU B 141  ? N LEU B 141  O GLU B 154  ? O GLU B 154  
AC1 1 2 N VAL B 196  ? N VAL B 196  O ILE B 199  ? O ILE B 199  
AC1 2 3 N LEU B 202  ? N LEU B 202  O VAL B 486  ? O VAL B 486  
AC2 1 2 N LEU B 206  ? N LEU B 206  O LEU B 403  ? O LEU B 403  
AC3 1 2 N ILE B 217  ? N ILE B 217  O GLY B 233  ? O GLY B 233  
AC3 2 3 N ILE B 234  ? N ILE B 234  O LEU B 250  ? O LEU B 250  
AC3 3 4 N VAL B 249  ? N VAL B 249  O ARG B 261  ? O ARG B 261  
AC3 4 5 N PHE B 260  ? N PHE B 260  O VAL B 271  ? O VAL B 271  
AC4 1 2 N ARG B 550  ? N ARG B 550  O LEU B 650  ? O LEU B 650  
AC4 2 3 N VAL B 653  ? N VAL B 653  O ASP B 662  ? O ASP B 662  
AC5 1 2 N ARG B 550  ? N ARG B 550  O LEU B 650  ? O LEU B 650  
AC5 2 3 N ARG B 654  ? N ARG B 654  O VAL B 689  ? O VAL B 689  
AC5 3 4 O HIS B 688  ? O HIS B 688  N ALA B 675  ? N ALA B 675  
AC6 1 2 O VAL B 596  ? O VAL B 596  N CYS B 584  ? N CYS B 584  
AC6 2 3 N GLN B 587  ? N GLN B 587  O LEU B 640  ? O LEU B 640  
AC6 3 4 O PHE B 643  ? O PHE B 643  N GLU B 625  ? N GLU B 625  
AC7 1 2 N LEU B 741  ? N LEU B 741  O TYR B 804  ? O TYR B 804  
AC7 2 3 N VAL B 809  ? N VAL B 809  O VAL B 901  ? O VAL B 901  
AC7 3 4 O LYS B 904  ? O LYS B 904  N GLU B 883  ? N GLU B 883  
AC7 4 5 O ALA B 880  ? O ALA B 880  N VAL B 852  ? N VAL B 852  
AC8 1 2 N ALA B 774  ? N ALA B 774  O ILE B 949  ? O ILE B 949  
AC8 2 3 O ILE B 948  ? O ILE B 948  N ILE B 788  ? N ILE B 788  
AC8 3 4 N MET B 787  ? N MET B 787  O VAL B 926  ? O VAL B 926  
AC8 4 5 O GLY B 925  ? O GLY B 925  N PHE B 917  ? N PHE B 917  
AC8 5 6 N SER B 918  ? N SER B 918  O GLN B 1034 ? O GLN B 1034 
AC8 6 7 O GLY B 1029 ? O GLY B 1029 N VAL B 773  ? N VAL B 773  
AC9 1 2 N HIS B 824  ? N HIS B 824  O PHE B 862  ? O PHE B 862  
AC9 2 3 N CYS B 859  ? N CYS B 859  O LYS B 872  ? O LYS B 872  
AD1 1 2 N PHE B 938  ? N PHE B 938  O TYR B 1014 ? O TYR B 1014 
AD2 1 2 N VAL B 1103 ? N VAL B 1103 O THR B 1174 ? O THR B 1174 
AD3 1 2 N GLN B 1114 ? N GLN B 1114 O CYS B 1127 ? O CYS B 1127 
AD4 1 2 N MET B 1133 ? N MET B 1133 O VAL B 1168 ? O VAL B 1168 
AD5 1 2 N ASN C 43   ? N ASN C 43   O ASP C 55   ? O ASP C 55   
AD5 2 3 N ALA C 52   ? N ALA C 52   O VAL C 302  ? O VAL C 302  
AD5 3 4 O VAL C 294  ? O VAL C 294  N LEU C 230  ? N LEU C 230  
AD6 1 2 O LYS C 168  ? O LYS C 168  N SER C 135  ? N SER C 135  
AD6 2 3 N VAL C 138  ? N VAL C 138  O ILE C 202  ? O ILE C 202  
AD6 3 4 O SER C 203  ? O SER C 203  N PHE C 86   ? N PHE C 86   
AD6 4 5 N VAL C 83   ? N VAL C 83   O PHE L 67   ? O PHE L 67   
AD7 1 2 O LYS C 168  ? O LYS C 168  N SER C 135  ? N SER C 135  
AD7 2 3 N ILE C 132  ? N ILE C 132  O CYS C 208  ? O CYS C 208  
AD7 3 4 O ILE C 209  ? O ILE C 209  N ALA C 79   ? N ALA C 79   
AD7 4 5 N VAL C 83   ? N VAL C 83   O PHE L 67   ? O PHE L 67   
AD8 1 2 N THR C 141  ? N THR C 141  O ASN C 158  ? O ASN C 158  
AD9 1 2 N VAL C 162  ? N VAL C 162  O ALA C 194  ? O ALA C 194  
AE1 1 2 N ASN C 234  ? N ASN C 234  O LYS C 290  ? O LYS C 290  
AE2 1 2 N GLY C 257  ? N GLY C 257  O TYR C 266  ? O TYR C 266  
AE3 1 2 N PHE E 60   ? N PHE E 60   O VAL E 80   ? O VAL E 80   
AE3 2 3 N TRP E 79   ? N TRP E 79   O ILE E 109  ? O ILE E 109  
AE3 3 4 N PHE E 110  ? N PHE E 110  O GLU E 133  ? O GLU E 133  
AE4 1 2 N ILE E 154  ? N ILE E 154  O LYS E 197  ? O LYS E 197  
AE4 2 3 N ILE E 198  ? N ILE E 198  O SER E 210  ? O SER E 210  
AE4 3 4 O ILE E 213  ? O ILE E 213  N ILE E 178  ? N ILE E 178  
AE5 1 2 N LEU G 133  ? N LEU G 133  O PHE G 231  ? O PHE G 231  
AE6 1 2 N SER G 156  ? N SER G 156  O VAL G 245  ? O VAL G 245  
AE6 2 3 O ASP G 246  ? O ASP G 246  N ASN G 235  ? N ASN G 235  
AE7 1 2 N THR G 167  ? N THR G 167  O VAL G 218  ? O VAL G 218  
AE8 1 2 O LEU H 40   ? O LEU H 40   N ILE H 26   ? N ILE H 26   
AE8 2 3 O ALA H 29   ? O ALA H 29   N GLN H 11   ? N GLN H 11   
AE8 3 4 N LEU H 5    ? N LEU H 5    O ILE H 59   ? O ILE H 59   
AE8 4 5 N THR H 58   ? N THR H 58   O LEU H 143  ? O LEU H 143  
AE9 1 2 N THR H 100  ? N THR H 100  O SER H 117  ? O SER H 117  
AF1 1 2 N VAL I 4    ? N VAL I 4    O LEU I 7    ? O LEU I 7    
AF1 2 3 N CYS I 10   ? N CYS I 10   O ASP I 15   ? O ASP I 15   
AF2 1 2 N LYS K 48   ? N LYS K 48   O GLN K 64   ? O GLN K 64   
AF2 2 3 N PHE K 63   ? N PHE K 63   O ILE K 103  ? O ILE K 103  
AF2 3 4 O GLN K 106  ? O GLN K 106  N PHE K 88   ? N PHE K 88   
AF3 1 2 N LYS K 48   ? N LYS K 48   O GLN K 64   ? O GLN K 64   
AF3 2 3 N PHE K 63   ? N PHE K 63   O ILE K 103  ? O ILE K 103  
AF3 3 4 O ASN K 102  ? O ASN K 102  N SER K 92   ? N SER K 92   
AF4 1 2 O LEU L 38   ? O LEU L 38   N TYR L 29   ? N TYR L 29   
AF4 2 3 N ILE L 30   ? N ILE L 30   O LEU L 57   ? O LEU L 57   
AF5 1 2 O LYS N 30   ? O LYS N 30   N LYS M 42   ? N LYS M 42   
AF5 2 3 N TYR M 41   ? N TYR M 41   O VAL M 52   ? O VAL M 52   
AF5 3 4 N LEU M 53   ? N LEU M 53   O GLY M 64   ? O GLY M 64   
AF5 4 5 N TYR M 65   ? N TYR M 65   O VAL M 97   ? O VAL M 97   
AF5 5 6 O SER M 98   ? O SER M 98   N SER M 25   ? N SER M 25   
AF5 6 7 N GLY M 24   ? N GLY M 24   O THR N 108  ? O THR N 108  
AF6 1 2 O TYR M 91   ? O TYR M 91   N VAL M 78   ? N VAL M 78   
AF6 2 3 N GLN M 75   ? N GLN M 75   O PHE N 58   ? O PHE N 58   
AF7 1 2 N PHE M 81   ? N PHE M 81   O GLN N 52   ? O GLN N 52   
AF8 1 2 N VAL M 344  ? N VAL M 344  O ALA M 395  ? O ALA M 395  
AF8 2 3 O ILE M 394  ? O ILE M 394  N LYS M 372  ? N LYS M 372  
AF9 1 2 N LYS N 88   ? N LYS N 88   O SER N 140  ? O SER N 140  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN 1701 ? 4 'binding site for residue ZN A 1701' 
AC2 Software A ZN 1702 ? 5 'binding site for residue ZN A 1702' 
AC3 Software B ZN 1301 ? 4 'binding site for residue ZN B 1301' 
AC4 Software I ZN 201  ? 3 'binding site for residue ZN I 201'  
AC5 Software J ZN 101  ? 4 'binding site for residue ZN J 101'  
AC6 Software L ZN 101  ? 5 'binding site for residue ZN L 101'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 102  ? CYS A 102  . ? 1_555 ? 
2  AC1 4 CYS A 105  ? CYS A 105  . ? 1_555 ? 
3  AC1 4 CYS A 233  ? CYS A 233  . ? 1_555 ? 
4  AC1 4 CYS A 236  ? CYS A 236  . ? 1_555 ? 
5  AC2 5 CYS A 62   ? CYS A 62   . ? 1_555 ? 
6  AC2 5 THR A 64   ? THR A 64   . ? 1_555 ? 
7  AC2 5 CYS A 65   ? CYS A 65   . ? 1_555 ? 
8  AC2 5 CYS A 72   ? CYS A 72   . ? 1_555 ? 
9  AC2 5 HIS A 75   ? HIS A 75   . ? 1_555 ? 
10 AC3 4 CYS B 1104 ? CYS B 1104 . ? 1_555 ? 
11 AC3 4 CYS B 1107 ? CYS B 1107 . ? 1_555 ? 
12 AC3 4 CYS B 1128 ? CYS B 1128 . ? 1_555 ? 
13 AC3 4 CYS B 1131 ? CYS B 1131 . ? 1_555 ? 
14 AC4 3 CYS I 13   ? CYS I 13   . ? 1_555 ? 
15 AC4 3 CYS I 30   ? CYS I 30   . ? 1_555 ? 
16 AC4 3 ARG M 59   ? ARG M 59   . ? 1_555 ? 
17 AC5 4 CYS J 7    ? CYS J 7    . ? 1_555 ? 
18 AC5 4 CYS J 10   ? CYS J 10   . ? 1_555 ? 
19 AC5 4 CYS J 45   ? CYS J 45   . ? 1_555 ? 
20 AC5 4 CYS J 46   ? CYS J 46   . ? 1_555 ? 
21 AC6 5 CYS L 31   ? CYS L 31   . ? 1_555 ? 
22 AC6 5 CYS L 34   ? CYS L 34   . ? 1_555 ? 
23 AC6 5 CYS L 48   ? CYS L 48   . ? 1_555 ? 
24 AC6 5 ASP L 50   ? ASP L 50   . ? 1_555 ? 
25 AC6 5 CYS L 51   ? CYS L 51   . ? 1_555 ? 
# 
_atom_sites.entry_id                    5M64 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
SE 
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . MET A 1  1    ? 123.691 92.599  105.608 1.00 50.32  ? 1    MET A N     1 
ATOM   2     C  CA    . MET A 1  1    ? 124.289 92.148  104.357 1.00 50.06  ? 1    MET A CA    1 
ATOM   3     C  C     . MET A 1  1    ? 124.972 90.796  104.525 1.00 49.80  ? 1    MET A C     1 
ATOM   4     O  O     . MET A 1  1    ? 125.855 90.634  105.366 1.00 49.52  ? 1    MET A O     1 
ATOM   5     C  CB    . MET A 1  1    ? 125.290 93.183  103.839 1.00 50.15  ? 1    MET A CB    1 
ATOM   6     C  CG    . MET A 1  1    ? 126.161 92.693  102.696 1.00 50.44  ? 1    MET A CG    1 
ATOM   7     S  SD    . MET A 1  1    ? 127.286 93.971  102.105 1.00 50.24  ? 1    MET A SD    1 
ATOM   8     C  CE    . MET A 1  1    ? 128.063 94.469  103.640 1.00 49.52  ? 1    MET A CE    1 
ATOM   9     N  N     . ASP A 1  2    ? 124.553 89.827  103.715 1.00 51.81  ? 2    ASP A N     1 
ATOM   10    C  CA    . ASP A 1  2    ? 125.125 88.490  103.768 1.00 53.37  ? 2    ASP A CA    1 
ATOM   11    C  C     . ASP A 1  2    ? 126.458 88.462  103.030 1.00 54.38  ? 2    ASP A C     1 
ATOM   12    O  O     . ASP A 1  2    ? 126.555 88.916  101.887 1.00 54.97  ? 2    ASP A O     1 
ATOM   13    C  CB    . ASP A 1  2    ? 124.161 87.473  103.160 1.00 55.97  ? 2    ASP A CB    1 
ATOM   14    C  CG    . ASP A 1  2    ? 122.813 87.462  103.851 1.00 54.66  ? 2    ASP A CG    1 
ATOM   15    O  OD1   . ASP A 1  2    ? 122.764 87.738  105.067 1.00 53.32  ? 2    ASP A OD1   1 
ATOM   16    O  OD2   . ASP A 1  2    ? 121.800 87.178  103.177 1.00 53.74  ? 2    ASP A OD2   1 
ATOM   17    N  N     . ILE A 1  3    ? 127.488 87.926  103.692 1.00 53.31  ? 3    ILE A N     1 
ATOM   18    C  CA    . ILE A 1  3    ? 128.799 87.794  103.068 1.00 53.33  ? 3    ILE A CA    1 
ATOM   19    C  C     . ILE A 1  3    ? 128.823 86.722  101.990 1.00 54.07  ? 3    ILE A C     1 
ATOM   20    O  O     . ILE A 1  3    ? 129.788 86.645  101.221 1.00 54.19  ? 3    ILE A O     1 
ATOM   21    C  CB    . ILE A 1  3    ? 129.866 87.499  104.144 1.00 54.30  ? 3    ILE A CB    1 
ATOM   22    C  CG1   . ILE A 1  3    ? 131.263 87.881  103.646 1.00 54.62  ? 3    ILE A CG1   1 
ATOM   23    C  CG2   . ILE A 1  3    ? 129.823 86.035  104.555 1.00 52.47  ? 3    ILE A CG2   1 
ATOM   24    C  CD1   . ILE A 1  3    ? 132.361 87.636  104.658 1.00 51.80  ? 3    ILE A CD1   1 
ATOM   25    N  N     . SER A 1  4    ? 127.775 85.900  101.903 1.00 52.46  ? 4    SER A N     1 
ATOM   26    C  CA    . SER A 1  4    ? 127.738 84.843  100.897 1.00 52.71  ? 4    SER A CA    1 
ATOM   27    C  C     . SER A 1  4    ? 127.474 85.413  99.509  1.00 53.20  ? 4    SER A C     1 
ATOM   28    O  O     . SER A 1  4    ? 128.228 85.151  98.566  1.00 53.42  ? 4    SER A O     1 
ATOM   29    C  CB    . SER A 1  4    ? 126.677 83.807  101.268 1.00 52.28  ? 4    SER A CB    1 
ATOM   30    O  OG    . SER A 1  4    ? 126.559 82.815  100.263 1.00 52.31  ? 4    SER A OG    1 
ATOM   31    N  N     . LYS A 1  5    ? 126.400 86.192  99.363  1.00 52.31  ? 5    LYS A N     1 
ATOM   32    C  CA    . LYS A 1  5    ? 126.032 86.758  98.071  1.00 52.81  ? 5    LYS A CA    1 
ATOM   33    C  C     . LYS A 1  5    ? 126.672 88.131  97.910  1.00 53.96  ? 5    LYS A C     1 
ATOM   34    O  O     . LYS A 1  5    ? 126.307 89.062  98.644  1.00 54.99  ? 5    LYS A O     1 
ATOM   35    C  CB    . LYS A 1  5    ? 124.518 86.852  97.941  1.00 55.97  ? 5    LYS A CB    1 
ATOM   36    C  CG    . LYS A 1  5    ? 123.801 87.287  99.211  1.00 56.61  ? 5    LYS A CG    1 
ATOM   37    C  CD    . LYS A 1  5    ? 122.295 87.330  99.010  1.00 57.15  ? 5    LYS A CD    1 
ATOM   38    C  CE    . LYS A 1  5    ? 121.749 85.960  98.643  1.00 52.04  ? 5    LYS A CE    1 
ATOM   39    N  NZ    . LYS A 1  5    ? 120.273 85.983  98.451  1.00 52.73  ? 5    LYS A NZ    1 
ATOM   40    N  N     . PRO A 1  6    ? 127.614 88.306  96.992  1.00 50.88  ? 6    PRO A N     1 
ATOM   41    C  CA    . PRO A 1  6    ? 128.256 89.609  96.801  1.00 50.36  ? 6    PRO A CA    1 
ATOM   42    C  C     . PRO A 1  6    ? 127.419 90.497  95.885  1.00 50.18  ? 6    PRO A C     1 
ATOM   43    O  O     . PRO A 1  6    ? 126.308 90.156  95.483  1.00 50.32  ? 6    PRO A O     1 
ATOM   44    C  CB    . PRO A 1  6    ? 129.599 89.252  96.150  1.00 50.68  ? 6    PRO A CB    1 
ATOM   45    C  CG    . PRO A 1  6    ? 129.671 87.737  96.143  1.00 50.66  ? 6    PRO A CG    1 
ATOM   46    C  CD    . PRO A 1  6    ? 128.262 87.263  96.185  1.00 50.32  ? 6    PRO A CD    1 
ATOM   47    N  N     . VAL A 1  7    ? 127.982 91.658  95.559  1.00 52.05  ? 7    VAL A N     1 
ATOM   48    C  CA    . VAL A 1  7    ? 127.388 92.595  94.613  1.00 53.63  ? 7    VAL A CA    1 
ATOM   49    C  C     . VAL A 1  7    ? 128.249 92.597  93.356  1.00 54.55  ? 7    VAL A C     1 
ATOM   50    O  O     . VAL A 1  7    ? 129.483 92.661  93.438  1.00 55.21  ? 7    VAL A O     1 
ATOM   51    C  CB    . VAL A 1  7    ? 127.254 94.005  95.214  1.00 54.29  ? 7    VAL A CB    1 
ATOM   52    C  CG1   . VAL A 1  7    ? 128.597 94.511  95.728  1.00 53.63  ? 7    VAL A CG1   1 
ATOM   53    C  CG2   . VAL A 1  7    ? 126.673 94.967  94.190  1.00 53.37  ? 7    VAL A CG2   1 
ATOM   54    N  N     . GLY A 1  8    ? 127.604 92.498  92.198  1.00 53.63  ? 8    GLY A N     1 
ATOM   55    C  CA    . GLY A 1  8    ? 128.294 92.429  90.928  1.00 53.18  ? 8    GLY A CA    1 
ATOM   56    C  C     . GLY A 1  8    ? 128.497 93.747  90.214  1.00 52.36  ? 8    GLY A C     1 
ATOM   57    O  O     . GLY A 1  8    ? 128.874 93.742  89.039  1.00 52.71  ? 8    GLY A O     1 
ATOM   58    N  N     . SER A 1  9    ? 128.262 94.875  90.880  1.00 51.29  ? 9    SER A N     1 
ATOM   59    C  CA    . SER A 1  9    ? 128.418 96.177  90.250  1.00 50.76  ? 9    SER A CA    1 
ATOM   60    C  C     . SER A 1  9    ? 128.787 97.204  91.310  1.00 50.73  ? 9    SER A C     1 
ATOM   61    O  O     . SER A 1  9    ? 128.790 96.919  92.509  1.00 50.87  ? 9    SER A O     1 
ATOM   62    C  CB    . SER A 1  9    ? 127.144 96.596  89.507  1.00 50.58  ? 9    SER A CB    1 
ATOM   63    O  OG    . SER A 1  9    ? 126.824 95.676  88.478  1.00 50.16  ? 9    SER A OG    1 
ATOM   64    N  N     . GLU A 1  10   ? 129.105 98.412  90.848  1.00 51.11  ? 10   GLU A N     1 
ATOM   65    C  CA    . GLU A 1  10   ? 129.481 99.511  91.724  1.00 51.85  ? 10   GLU A CA    1 
ATOM   66    C  C     . GLU A 1  10   ? 128.837 100.797 91.228  1.00 52.56  ? 10   GLU A C     1 
ATOM   67    O  O     . GLU A 1  10   ? 128.753 101.033 90.019  1.00 52.97  ? 10   GLU A O     1 
ATOM   68    C  CB    . GLU A 1  10   ? 131.005 99.685  91.789  1.00 53.43  ? 10   GLU A CB    1 
ATOM   69    C  CG    . GLU A 1  10   ? 131.746 98.517  92.419  1.00 53.68  ? 10   GLU A CG    1 
ATOM   70    C  CD    . GLU A 1  10   ? 133.245 98.738  92.470  1.00 53.55  ? 10   GLU A CD    1 
ATOM   71    O  OE1   . GLU A 1  10   ? 133.708 99.794  91.988  1.00 51.88  ? 10   GLU A OE1   1 
ATOM   72    O  OE2   . GLU A 1  10   ? 133.961 97.857  92.991  1.00 51.59  ? 10   GLU A OE2   1 
ATOM   73    N  N     . ILE A 1  11   ? 128.386 101.622 92.167  1.00 52.82  ? 11   ILE A N     1 
ATOM   74    C  CA    . ILE A 1  11   ? 127.792 102.920 91.867  1.00 53.89  ? 11   ILE A CA    1 
ATOM   75    C  C     . ILE A 1  11   ? 128.833 103.983 92.196  1.00 53.69  ? 11   ILE A C     1 
ATOM   76    O  O     . ILE A 1  11   ? 129.204 104.161 93.361  1.00 53.42  ? 11   ILE A O     1 
ATOM   77    C  CB    . ILE A 1  11   ? 126.494 103.145 92.653  1.00 53.76  ? 11   ILE A CB    1 
ATOM   78    C  CG1   . ILE A 1  11   ? 125.496 102.020 92.369  1.00 53.91  ? 11   ILE A CG1   1 
ATOM   79    C  CG2   . ILE A 1  11   ? 125.889 104.496 92.305  1.00 55.28  ? 11   ILE A CG2   1 
ATOM   80    C  CD1   . ILE A 1  11   ? 125.080 101.922 90.918  1.00 56.15  ? 11   ILE A CD1   1 
ATOM   81    N  N     . THR A 1  12   ? 129.308 104.697 91.173  1.00 55.96  ? 12   THR A N     1 
ATOM   82    C  CA    . THR A 1  12   ? 130.368 105.678 91.355  1.00 56.49  ? 12   THR A CA    1 
ATOM   83    C  C     . THR A 1  12   ? 130.031 107.074 90.850  1.00 56.74  ? 12   THR A C     1 
ATOM   84    O  O     . THR A 1  12   ? 130.790 108.006 91.138  1.00 56.87  ? 12   THR A O     1 
ATOM   85    C  CB    . THR A 1  12   ? 131.661 105.211 90.668  1.00 56.81  ? 12   THR A CB    1 
ATOM   86    O  OG1   . THR A 1  12   ? 132.732 106.097 91.010  1.00 56.04  ? 12   THR A OG1   1 
ATOM   87    C  CG2   . THR A 1  12   ? 131.485 105.199 89.159  1.00 57.05  ? 12   THR A CG2   1 
ATOM   88    N  N     . SER A 1  13   ? 128.937 107.256 90.113  1.00 54.29  ? 13   SER A N     1 
ATOM   89    C  CA    . SER A 1  13   ? 128.549 108.577 89.641  1.00 53.60  ? 13   SER A CA    1 
ATOM   90    C  C     . SER A 1  13   ? 127.050 108.595 89.382  1.00 53.91  ? 13   SER A C     1 
ATOM   91    O  O     . SER A 1  13   ? 126.459 107.567 89.043  1.00 53.96  ? 13   SER A O     1 
ATOM   92    C  CB    . SER A 1  13   ? 129.322 108.973 88.377  1.00 53.20  ? 13   SER A CB    1 
ATOM   93    O  OG    . SER A 1  13   ? 129.078 108.067 87.318  1.00 52.25  ? 13   SER A OG    1 
ATOM   94    N  N     . VAL A 1  14   ? 126.447 109.770 89.549  1.00 54.05  ? 14   VAL A N     1 
ATOM   95    C  CA    . VAL A 1  14   ? 125.005 109.949 89.428  1.00 54.62  ? 14   VAL A CA    1 
ATOM   96    C  C     . VAL A 1  14   ? 124.728 111.213 88.625  1.00 55.23  ? 14   VAL A C     1 
ATOM   97    O  O     . VAL A 1  14   ? 125.413 112.228 88.789  1.00 55.88  ? 14   VAL A O     1 
ATOM   98    C  CB    . VAL A 1  14   ? 124.333 110.012 90.818  1.00 55.16  ? 14   VAL A CB    1 
ATOM   99    C  CG1   . VAL A 1  14   ? 125.090 110.955 91.730  1.00 54.17  ? 14   VAL A CG1   1 
ATOM   100   C  CG2   . VAL A 1  14   ? 122.885 110.453 90.699  1.00 53.99  ? 14   VAL A CG2   1 
ATOM   101   N  N     . ASP A 1  15   ? 123.726 111.144 87.748  1.00 54.36  ? 15   ASP A N     1 
ATOM   102   C  CA    . ASP A 1  15   ? 123.305 112.273 86.932  1.00 55.27  ? 15   ASP A CA    1 
ATOM   103   C  C     . ASP A 1  15   ? 121.795 112.435 87.032  1.00 56.13  ? 15   ASP A C     1 
ATOM   104   O  O     . ASP A 1  15   ? 121.052 111.450 86.992  1.00 56.65  ? 15   ASP A O     1 
ATOM   105   C  CB    . ASP A 1  15   ? 123.723 112.085 85.468  1.00 57.03  ? 15   ASP A CB    1 
ATOM   106   C  CG    . ASP A 1  15   ? 123.244 113.212 84.574  1.00 56.44  ? 15   ASP A CG    1 
ATOM   107   O  OD1   . ASP A 1  15   ? 123.801 114.325 84.667  1.00 55.58  ? 15   ASP A OD1   1 
ATOM   108   O  OD2   . ASP A 1  15   ? 122.317 112.980 83.769  1.00 55.25  ? 15   ASP A OD2   1 
ATOM   109   N  N     . PHE A 1  16   ? 121.346 113.681 87.162  1.00 57.13  ? 16   PHE A N     1 
ATOM   110   C  CA    . PHE A 1  16   ? 119.931 113.984 87.303  1.00 58.43  ? 16   PHE A CA    1 
ATOM   111   C  C     . PHE A 1  16   ? 119.288 114.109 85.921  1.00 58.26  ? 16   PHE A C     1 
ATOM   112   O  O     . PHE A 1  16   ? 119.892 113.775 84.898  1.00 58.19  ? 16   PHE A O     1 
ATOM   113   C  CB    . PHE A 1  16   ? 119.742 115.250 88.137  1.00 57.97  ? 16   PHE A CB    1 
ATOM   114   C  CG    . PHE A 1  16   ? 120.210 115.116 89.559  1.00 57.81  ? 16   PHE A CG    1 
ATOM   115   C  CD1   . PHE A 1  16   ? 120.245 113.877 90.178  1.00 58.00  ? 16   PHE A CD1   1 
ATOM   116   C  CD2   . PHE A 1  16   ? 120.615 116.229 90.276  1.00 58.32  ? 16   PHE A CD2   1 
ATOM   117   C  CE1   . PHE A 1  16   ? 120.674 113.751 91.486  1.00 58.18  ? 16   PHE A CE1   1 
ATOM   118   C  CE2   . PHE A 1  16   ? 121.044 116.110 91.585  1.00 59.51  ? 16   PHE A CE2   1 
ATOM   119   C  CZ    . PHE A 1  16   ? 121.074 114.869 92.190  1.00 59.81  ? 16   PHE A CZ    1 
ATOM   120   N  N     . GLY A 1  17   ? 118.053 114.591 85.879  1.00 60.12  ? 17   GLY A N     1 
ATOM   121   C  CA    . GLY A 1  17   ? 117.363 114.747 84.616  1.00 59.91  ? 17   GLY A CA    1 
ATOM   122   C  C     . GLY A 1  17   ? 115.933 115.201 84.835  1.00 59.77  ? 17   GLY A C     1 
ATOM   123   O  O     . GLY A 1  17   ? 115.526 115.525 85.952  1.00 59.60  ? 17   GLY A O     1 
ATOM   124   N  N     . ILE A 1  18   ? 115.181 115.214 83.736  1.00 60.15  ? 18   ILE A N     1 
ATOM   125   C  CA    . ILE A 1  18   ? 113.796 115.667 83.735  1.00 60.82  ? 18   ILE A CA    1 
ATOM   126   C  C     . ILE A 1  18   ? 112.968 114.696 82.901  1.00 60.95  ? 18   ILE A C     1 
ATOM   127   O  O     . ILE A 1  18   ? 113.482 114.024 82.002  1.00 60.76  ? 18   ILE A O     1 
ATOM   128   C  CB    . ILE A 1  18   ? 113.671 117.112 83.196  1.00 60.66  ? 18   ILE A CB    1 
ATOM   129   C  CG1   . ILE A 1  18   ? 112.305 117.710 83.539  1.00 61.47  ? 18   ILE A CG1   1 
ATOM   130   C  CG2   . ILE A 1  18   ? 113.919 117.154 81.694  1.00 62.03  ? 18   ILE A CG2   1 
ATOM   131   C  CD1   . ILE A 1  18   ? 112.093 117.936 85.018  1.00 62.64  ? 18   ILE A CD1   1 
ATOM   132   N  N     . LEU A 1  19   ? 111.678 114.617 83.216  1.00 63.27  ? 19   LEU A N     1 
ATOM   133   C  CA    . LEU A 1  19   ? 110.780 113.755 82.464  1.00 64.51  ? 19   LEU A CA    1 
ATOM   134   C  C     . LEU A 1  19   ? 110.470 114.365 81.098  1.00 65.09  ? 19   LEU A C     1 
ATOM   135   O  O     . LEU A 1  19   ? 110.560 115.578 80.892  1.00 65.13  ? 19   LEU A O     1 
ATOM   136   C  CB    . LEU A 1  19   ? 109.483 113.513 83.239  1.00 64.97  ? 19   LEU A CB    1 
ATOM   137   C  CG    . LEU A 1  19   ? 109.483 112.419 84.313  1.00 64.91  ? 19   LEU A CG    1 
ATOM   138   C  CD1   . LEU A 1  19   ? 109.980 111.100 83.737  1.00 65.35  ? 19   LEU A CD1   1 
ATOM   139   C  CD2   . LEU A 1  19   ? 110.300 112.821 85.536  1.00 65.05  ? 19   LEU A CD2   1 
ATOM   140   N  N     . THR A 1  20   ? 110.097 113.499 80.160  1.00 65.49  ? 20   THR A N     1 
ATOM   141   C  CA    . THR A 1  20   ? 109.802 113.897 78.791  1.00 66.19  ? 20   THR A CA    1 
ATOM   142   C  C     . THR A 1  20   ? 108.390 113.457 78.433  1.00 66.35  ? 20   THR A C     1 
ATOM   143   O  O     . THR A 1  20   ? 107.928 112.405 78.883  1.00 66.44  ? 20   THR A O     1 
ATOM   144   C  CB    . THR A 1  20   ? 110.812 113.289 77.804  1.00 66.25  ? 20   THR A CB    1 
ATOM   145   O  OG1   . THR A 1  20   ? 112.143 113.503 78.290  1.00 66.99  ? 20   THR A OG1   1 
ATOM   146   C  CG2   . THR A 1  20   ? 110.679 113.931 76.430  1.00 66.03  ? 20   THR A CG2   1 
ATOM   147   N  N     . ALA A 1  21   ? 107.710 114.269 77.618  1.00 68.69  ? 21   ALA A N     1 
ATOM   148   C  CA    . ALA A 1  21   ? 106.332 113.975 77.235  1.00 69.64  ? 21   ALA A CA    1 
ATOM   149   C  C     . ALA A 1  21   ? 106.195 112.641 76.510  1.00 70.06  ? 21   ALA A C     1 
ATOM   150   O  O     . ALA A 1  21   ? 105.089 112.094 76.449  1.00 69.73  ? 21   ALA A O     1 
ATOM   151   C  CB    . ALA A 1  21   ? 105.779 115.099 76.360  1.00 69.57  ? 21   ALA A CB    1 
ATOM   152   N  N     . LYS A 1  22   ? 107.286 112.107 75.962  1.00 69.59  ? 22   LYS A N     1 
ATOM   153   C  CA    . LYS A 1  22   ? 107.243 110.819 75.281  1.00 69.18  ? 22   LYS A CA    1 
ATOM   154   C  C     . LYS A 1  22   ? 107.435 109.652 76.242  1.00 69.92  ? 22   LYS A C     1 
ATOM   155   O  O     . LYS A 1  22   ? 106.823 108.594 76.060  1.00 70.36  ? 22   LYS A O     1 
ATOM   156   C  CB    . LYS A 1  22   ? 108.309 110.771 74.182  1.00 70.95  ? 22   LYS A CB    1 
ATOM   157   C  CG    . LYS A 1  22   ? 108.298 109.495 73.355  1.00 71.08  ? 22   LYS A CG    1 
ATOM   158   C  CD    . LYS A 1  22   ? 109.354 109.536 72.263  1.00 70.83  ? 22   LYS A CD    1 
ATOM   159   C  CE    . LYS A 1  22   ? 109.119 110.699 71.313  1.00 67.84  ? 22   LYS A CE    1 
ATOM   160   N  NZ    . LYS A 1  22   ? 107.791 110.611 70.645  1.00 67.81  ? 22   LYS A NZ    1 
ATOM   161   N  N     . GLU A 1  23   ? 108.268 109.825 77.271  1.00 66.55  ? 23   GLU A N     1 
ATOM   162   C  CA    . GLU A 1  23   ? 108.536 108.742 78.208  1.00 65.92  ? 23   GLU A CA    1 
ATOM   163   C  C     . GLU A 1  23   ? 107.537 108.688 79.355  1.00 65.70  ? 23   GLU A C     1 
ATOM   164   O  O     . GLU A 1  23   ? 107.519 107.697 80.095  1.00 65.43  ? 23   GLU A O     1 
ATOM   165   C  CB    . GLU A 1  23   ? 109.954 108.868 78.770  1.00 65.84  ? 23   GLU A CB    1 
ATOM   166   C  CG    . GLU A 1  23   ? 110.193 110.129 79.582  1.00 67.18  ? 23   GLU A CG    1 
ATOM   167   C  CD    . GLU A 1  23   ? 111.638 110.272 80.015  1.00 65.31  ? 23   GLU A CD    1 
ATOM   168   O  OE1   . GLU A 1  23   ? 112.448 109.379 79.689  1.00 65.93  ? 23   GLU A OE1   1 
ATOM   169   O  OE2   . GLU A 1  23   ? 111.965 111.276 80.681  1.00 65.45  ? 23   GLU A OE2   1 
ATOM   170   N  N     . ILE A 1  24   ? 106.704 109.717 79.523  1.00 66.62  ? 24   ILE A N     1 
ATOM   171   C  CA    . ILE A 1  24   ? 105.685 109.706 80.568  1.00 67.36  ? 24   ILE A CA    1 
ATOM   172   C  C     . ILE A 1  24   ? 104.492 108.885 80.097  1.00 67.92  ? 24   ILE A C     1 
ATOM   173   O  O     . ILE A 1  24   ? 103.492 108.752 80.811  1.00 67.82  ? 24   ILE A O     1 
ATOM   174   C  CB    . ILE A 1  24   ? 105.253 111.130 80.963  1.00 67.54  ? 24   ILE A CB    1 
ATOM   175   C  CG1   . ILE A 1  24   ? 104.709 111.886 79.750  1.00 68.44  ? 24   ILE A CG1   1 
ATOM   176   C  CG2   . ILE A 1  24   ? 106.404 111.880 81.619  1.00 66.73  ? 24   ILE A CG2   1 
ATOM   177   C  CD1   . ILE A 1  24   ? 104.131 113.243 80.090  1.00 67.45  ? 24   ILE A CD1   1 
ATOM   178   N  N     . ARG A 1  25   ? 104.589 108.332 78.888  1.00 64.64  ? 25   ARG A N     1 
ATOM   179   C  CA    . ARG A 1  25   ? 103.553 107.458 78.357  1.00 62.85  ? 25   ARG A CA    1 
ATOM   180   C  C     . ARG A 1  25   ? 103.903 105.986 78.519  1.00 64.44  ? 25   ARG A C     1 
ATOM   181   O  O     . ARG A 1  25   ? 102.999 105.153 78.665  1.00 65.75  ? 25   ARG A O     1 
ATOM   182   C  CB    . ARG A 1  25   ? 103.307 107.780 76.878  1.00 66.80  ? 25   ARG A CB    1 
ATOM   183   C  CG    . ARG A 1  25   ? 102.018 107.210 76.292  1.00 67.46  ? 25   ARG A CG    1 
ATOM   184   C  CD    . ARG A 1  25   ? 102.237 105.850 75.641  1.00 67.73  ? 25   ARG A CD    1 
ATOM   185   N  NE    . ARG A 1  25   ? 103.319 105.877 74.662  1.00 67.98  ? 25   ARG A NE    1 
ATOM   186   C  CZ    . ARG A 1  25   ? 103.147 106.109 73.365  1.00 67.61  ? 25   ARG A CZ    1 
ATOM   187   N  NH1   . ARG A 1  25   ? 101.933 106.334 72.884  1.00 59.71  ? 25   ARG A NH1   1 
ATOM   188   N  NH2   . ARG A 1  25   ? 104.192 106.114 72.547  1.00 58.85  ? 25   ARG A NH2   1 
ATOM   189   N  N     . ASN A 1  26   ? 105.191 105.646 78.510  1.00 57.64  ? 26   ASN A N     1 
ATOM   190   C  CA    . ASN A 1  26   ? 105.639 104.263 78.573  1.00 57.17  ? 26   ASN A CA    1 
ATOM   191   C  C     . ASN A 1  26   ? 106.231 103.880 79.923  1.00 57.89  ? 26   ASN A C     1 
ATOM   192   O  O     . ASN A 1  26   ? 106.611 102.719 80.107  1.00 58.62  ? 26   ASN A O     1 
ATOM   193   C  CB    . ASN A 1  26   ? 106.670 103.994 77.469  1.00 59.27  ? 26   ASN A CB    1 
ATOM   194   C  CG    . ASN A 1  26   ? 106.106 104.217 76.079  1.00 58.81  ? 26   ASN A CG    1 
ATOM   195   O  OD1   . ASN A 1  26   ? 104.928 103.963 75.826  1.00 56.23  ? 26   ASN A OD1   1 
ATOM   196   N  ND2   . ASN A 1  26   ? 106.948 104.692 75.169  1.00 56.14  ? 26   ASN A ND2   1 
ATOM   197   N  N     . LEU A 1  27   ? 106.324 104.815 80.870  1.00 55.39  ? 27   LEU A N     1 
ATOM   198   C  CA    . LEU A 1  27   ? 106.902 104.502 82.170  1.00 55.12  ? 27   LEU A CA    1 
ATOM   199   C  C     . LEU A 1  27   ? 105.906 103.848 83.118  1.00 55.92  ? 27   LEU A C     1 
ATOM   200   O  O     . LEU A 1  27   ? 106.297 103.439 84.216  1.00 56.57  ? 27   LEU A O     1 
ATOM   201   C  CB    . LEU A 1  27   ? 107.466 105.769 82.826  1.00 56.77  ? 27   LEU A CB    1 
ATOM   202   C  CG    . LEU A 1  27   ? 106.550 106.598 83.736  1.00 56.63  ? 27   LEU A CG    1 
ATOM   203   C  CD1   . LEU A 1  27   ? 107.338 107.716 84.409  1.00 54.19  ? 27   LEU A CD1   1 
ATOM   204   C  CD2   . LEU A 1  27   ? 105.342 107.156 82.999  1.00 53.70  ? 27   LEU A CD2   1 
ATOM   205   N  N     . SER A 1  28   ? 104.642 103.743 82.726  1.00 53.83  ? 28   SER A N     1 
ATOM   206   C  CA    . SER A 1  28   ? 103.584 103.212 83.571  1.00 53.18  ? 28   SER A CA    1 
ATOM   207   C  C     . SER A 1  28   ? 103.061 101.899 82.997  1.00 52.10  ? 28   SER A C     1 
ATOM   208   O  O     . SER A 1  28   ? 103.530 101.404 81.969  1.00 50.74  ? 28   SER A O     1 
ATOM   209   C  CB    . SER A 1  28   ? 102.455 104.233 83.719  1.00 54.06  ? 28   SER A CB    1 
ATOM   210   O  OG    . SER A 1  28   ? 101.311 103.644 84.312  1.00 54.77  ? 28   SER A OG    1 
ATOM   211   N  N     . ALA A 1  29   ? 102.071 101.335 83.684  1.00 54.27  ? 29   ALA A N     1 
ATOM   212   C  CA    . ALA A 1  29   ? 101.427 100.098 83.266  1.00 54.95  ? 29   ALA A CA    1 
ATOM   213   C  C     . ALA A 1  29   ? 99.922  100.221 83.093  1.00 54.82  ? 29   ALA A C     1 
ATOM   214   O  O     . ALA A 1  29   ? 99.357  99.522  82.249  1.00 55.63  ? 29   ALA A O     1 
ATOM   215   C  CB    . ALA A 1  29   ? 101.719 98.975  84.273  1.00 56.24  ? 29   ALA A CB    1 
ATOM   216   N  N     . LYS A 1  30   ? 99.261  101.085 83.859  1.00 55.67  ? 30   LYS A N     1 
ATOM   217   C  CA    . LYS A 1  30   ? 97.817  101.244 83.764  1.00 56.06  ? 30   LYS A CA    1 
ATOM   218   C  C     . LYS A 1  30   ? 97.434  102.608 84.317  1.00 56.93  ? 30   LYS A C     1 
ATOM   219   O  O     . LYS A 1  30   ? 98.031  103.080 85.289  1.00 57.72  ? 30   LYS A O     1 
ATOM   220   C  CB    . LYS A 1  30   ? 97.085  100.131 84.526  1.00 58.16  ? 30   LYS A CB    1 
ATOM   221   C  CG    . LYS A 1  30   ? 95.572  100.153 84.368  1.00 58.35  ? 30   LYS A CG    1 
ATOM   222   C  CD    . LYS A 1  30   ? 94.900  99.019  85.135  1.00 58.55  ? 30   LYS A CD    1 
ATOM   223   C  CE    . LYS A 1  30   ? 94.937  97.701  84.367  1.00 55.42  ? 30   LYS A CE    1 
ATOM   224   N  NZ    . LYS A 1  30   ? 96.284  97.065  84.338  1.00 54.79  ? 30   LYS A NZ    1 
ATOM   225   N  N     . GLN A 1  31   ? 96.440  103.233 83.691  1.00 56.00  ? 31   GLN A N     1 
ATOM   226   C  CA    . GLN A 1  31   ? 95.981  104.549 84.103  1.00 56.58  ? 31   GLN A CA    1 
ATOM   227   C  C     . GLN A 1  31   ? 95.116  104.451 85.359  1.00 56.97  ? 31   GLN A C     1 
ATOM   228   O  O     . GLN A 1  31   ? 94.668  103.374 85.762  1.00 57.12  ? 31   GLN A O     1 
ATOM   229   C  CB    . GLN A 1  31   ? 95.202  105.222 82.973  1.00 57.32  ? 31   GLN A CB    1 
ATOM   230   C  CG    . GLN A 1  31   ? 95.958  105.305 81.655  1.00 57.66  ? 31   GLN A CG    1 
ATOM   231   C  CD    . GLN A 1  31   ? 97.154  106.236 81.719  1.00 57.35  ? 31   GLN A CD    1 
ATOM   232   O  OE1   . GLN A 1  31   ? 97.224  107.120 82.573  1.00 56.82  ? 31   GLN A OE1   1 
ATOM   233   N  NE2   . GLN A 1  31   ? 98.104  106.040 80.812  1.00 57.48  ? 31   GLN A NE2   1 
ATOM   234   N  N     . ILE A 1  32   ? 94.882  105.604 85.980  1.00 56.95  ? 32   ILE A N     1 
ATOM   235   C  CA    . ILE A 1  32   ? 94.032  105.723 87.161  1.00 57.56  ? 32   ILE A CA    1 
ATOM   236   C  C     . ILE A 1  32   ? 92.983  106.782 86.850  1.00 57.54  ? 32   ILE A C     1 
ATOM   237   O  O     . ILE A 1  32   ? 93.319  107.961 86.679  1.00 56.93  ? 32   ILE A O     1 
ATOM   238   C  CB    . ILE A 1  32   ? 94.824  106.089 88.425  1.00 56.75  ? 32   ILE A CB    1 
ATOM   239   C  CG1   . ILE A 1  32   ? 95.755  104.945 88.837  1.00 58.34  ? 32   ILE A CG1   1 
ATOM   240   C  CG2   . ILE A 1  32   ? 93.877  106.439 89.564  1.00 58.08  ? 32   ILE A CG2   1 
ATOM   241   C  CD1   . ILE A 1  32   ? 97.133  104.999 88.202  1.00 57.69  ? 32   ILE A CD1   1 
ATOM   242   N  N     . THR A 1  33   ? 91.719  106.370 86.775  1.00 59.21  ? 33   THR A N     1 
ATOM   243   C  CA    . THR A 1  33   ? 90.642  107.255 86.348  1.00 60.38  ? 33   THR A CA    1 
ATOM   244   C  C     . THR A 1  33   ? 89.616  107.521 87.436  1.00 62.50  ? 33   THR A C     1 
ATOM   245   O  O     . THR A 1  33   ? 89.318  108.686 87.725  1.00 62.89  ? 33   THR A O     1 
ATOM   246   C  CB    . THR A 1  33   ? 89.944  106.671 85.108  1.00 63.55  ? 33   THR A CB    1 
ATOM   247   O  OG1   . THR A 1  33   ? 90.899  106.504 84.053  1.00 59.38  ? 33   THR A OG1   1 
ATOM   248   C  CG2   . THR A 1  33   ? 88.833  107.597 84.636  1.00 58.67  ? 33   THR A CG2   1 
ATOM   249   N  N     . ASN A 1  34   ? 89.059  106.478 88.048  1.00 59.12  ? 34   ASN A N     1 
ATOM   250   C  CA    . ASN A 1  34   ? 87.991  106.681 89.016  1.00 59.06  ? 34   ASN A CA    1 
ATOM   251   C  C     . ASN A 1  34   ? 88.527  107.364 90.274  1.00 59.31  ? 34   ASN A C     1 
ATOM   252   O  O     . ASN A 1  34   ? 89.589  106.992 90.782  1.00 59.45  ? 34   ASN A O     1 
ATOM   253   C  CB    . ASN A 1  34   ? 87.327  105.350 89.378  1.00 59.45  ? 34   ASN A CB    1 
ATOM   254   C  CG    . ASN A 1  34   ? 88.329  104.232 89.584  1.00 59.47  ? 34   ASN A CG    1 
ATOM   255   O  OD1   . ASN A 1  34   ? 89.527  104.471 89.720  1.00 58.81  ? 34   ASN A OD1   1 
ATOM   256   N  ND2   . ASN A 1  34   ? 87.839  102.997 89.607  1.00 57.67  ? 34   ASN A ND2   1 
ATOM   257   N  N     . PRO A 1  35   ? 87.793  108.409 90.815  1.00 60.09  ? 35   PRO A N     1 
ATOM   258   C  CA    . PRO A 1  35   ? 88.245  109.127 92.022  1.00 60.55  ? 35   PRO A CA    1 
ATOM   259   C  C     . PRO A 1  35   ? 87.904  108.379 93.307  1.00 60.67  ? 35   PRO A C     1 
ATOM   260   O  O     . PRO A 1  35   ? 87.198  108.881 94.186  1.00 60.80  ? 35   PRO A O     1 
ATOM   261   C  CB    . PRO A 1  35   ? 87.499  110.466 91.908  1.00 60.76  ? 35   PRO A CB    1 
ATOM   262   C  CG    . PRO A 1  35   ? 86.843  110.478 90.544  1.00 60.98  ? 35   PRO A CG    1 
ATOM   263   C  CD    . PRO A 1  35   ? 86.621  109.051 90.206  1.00 61.12  ? 35   PRO A CD    1 
ATOM   264   N  N     . THR A 1  36   ? 88.413  107.155 93.422  1.00 61.24  ? 36   THR A N     1 
ATOM   265   C  CA    . THR A 1  36   ? 88.157  106.336 94.596  1.00 61.51  ? 36   THR A CA    1 
ATOM   266   C  C     . THR A 1  36   ? 89.339  105.405 94.822  1.00 61.03  ? 36   THR A C     1 
ATOM   267   O  O     . THR A 1  36   ? 89.976  104.942 93.873  1.00 60.59  ? 36   THR A O     1 
ATOM   268   C  CB    . THR A 1  36   ? 86.861  105.527 94.454  1.00 60.68  ? 36   THR A CB    1 
ATOM   269   O  OG1   . THR A 1  36   ? 86.729  104.631 95.564  1.00 62.06  ? 36   THR A OG1   1 
ATOM   270   C  CG2   . THR A 1  36   ? 86.862  104.730 93.156  1.00 62.34  ? 36   THR A CG2   1 
ATOM   271   N  N     . VAL A 1  37   ? 89.626  105.144 96.094  1.00 62.56  ? 37   VAL A N     1 
ATOM   272   C  CA    . VAL A 1  37   ? 90.702  104.227 96.455  1.00 63.22  ? 37   VAL A CA    1 
ATOM   273   C  C     . VAL A 1  37   ? 90.210  102.784 96.482  1.00 63.62  ? 37   VAL A C     1 
ATOM   274   O  O     . VAL A 1  37   ? 90.907  101.876 96.021  1.00 63.90  ? 37   VAL A O     1 
ATOM   275   C  CB    . VAL A 1  37   ? 91.319  104.650 97.804  1.00 63.61  ? 37   VAL A CB    1 
ATOM   276   C  CG1   . VAL A 1  37   ? 90.233  104.894 98.843  1.00 63.53  ? 37   VAL A CG1   1 
ATOM   277   C  CG2   . VAL A 1  37   ? 92.307  103.606 98.293  1.00 63.45  ? 37   VAL A CG2   1 
ATOM   278   N  N     . LEU A 1  38   ? 89.005  102.555 97.000  1.00 64.42  ? 38   LEU A N     1 
ATOM   279   C  CA    . LEU A 1  38   ? 88.394  101.234 96.992  1.00 65.37  ? 38   LEU A CA    1 
ATOM   280   C  C     . LEU A 1  38   ? 86.905  101.390 97.258  1.00 64.37  ? 38   LEU A C     1 
ATOM   281   O  O     . LEU A 1  38   ? 86.480  102.311 97.960  1.00 64.20  ? 38   LEU A O     1 
ATOM   282   C  CB    . LEU A 1  38   ? 89.030  100.298 98.031  1.00 64.20  ? 38   LEU A CB    1 
ATOM   283   C  CG    . LEU A 1  38   ? 88.572  100.378 99.492  1.00 64.18  ? 38   LEU A CG    1 
ATOM   284   C  CD1   . LEU A 1  38   ? 89.128  99.202  100.282 1.00 67.74  ? 38   LEU A CD1   1 
ATOM   285   C  CD2   . LEU A 1  38   ? 88.981  101.692 100.138 1.00 68.73  ? 38   LEU A CD2   1 
ATOM   286   N  N     . ASP A 1  39   ? 86.120  100.484 96.683  1.00 68.93  ? 39   ASP A N     1 
ATOM   287   C  CA    . ASP A 1  39   ? 84.677  100.490 96.876  1.00 69.18  ? 39   ASP A CA    1 
ATOM   288   C  C     . ASP A 1  39   ? 84.341  99.774  98.184  1.00 69.73  ? 39   ASP A C     1 
ATOM   289   O  O     . ASP A 1  39   ? 85.213  99.497  99.012  1.00 70.11  ? 39   ASP A O     1 
ATOM   290   C  CB    . ASP A 1  39   ? 83.977  99.856  95.676  1.00 70.28  ? 39   ASP A CB    1 
ATOM   291   C  CG    . ASP A 1  39   ? 84.348  98.398  95.487  1.00 70.24  ? 39   ASP A CG    1 
ATOM   292   O  OD1   . ASP A 1  39   ? 85.471  98.013  95.874  1.00 68.36  ? 39   ASP A OD1   1 
ATOM   293   O  OD2   . ASP A 1  39   ? 83.516  97.637  94.950  1.00 67.64  ? 39   ASP A OD2   1 
ATOM   294   N  N     . ASN A 1  40   ? 83.063  99.467  98.383  1.00 67.66  ? 40   ASN A N     1 
ATOM   295   C  CA    . ASN A 1  40   ? 82.636  98.767  99.585  1.00 67.08  ? 40   ASN A CA    1 
ATOM   296   C  C     . ASN A 1  40   ? 83.080  97.306  99.527  1.00 67.66  ? 40   ASN A C     1 
ATOM   297   O  O     . ASN A 1  40   ? 83.765  96.867  98.598  1.00 68.29  ? 40   ASN A O     1 
ATOM   298   C  CB    . ASN A 1  40   ? 81.122  98.875  99.750  1.00 68.46  ? 40   ASN A CB    1 
ATOM   299   C  CG    . ASN A 1  40   ? 80.654  100.309 99.907  1.00 68.56  ? 40   ASN A CG    1 
ATOM   300   O  OD1   . ASN A 1  40   ? 81.365  101.149 100.457 1.00 66.30  ? 40   ASN A OD1   1 
ATOM   301   N  ND2   . ASN A 1  40   ? 79.451  100.595 99.423  1.00 65.36  ? 40   ASN A ND2   1 
ATOM   302   N  N     . LEU A 1  41   ? 82.695  96.550  100.557 1.00 67.06  ? 41   LEU A N     1 
ATOM   303   C  CA    . LEU A 1  41   ? 82.970  95.126  100.734 1.00 67.84  ? 41   LEU A CA    1 
ATOM   304   C  C     . LEU A 1  41   ? 84.449  94.852  101.000 1.00 67.45  ? 41   LEU A C     1 
ATOM   305   O  O     . LEU A 1  41   ? 84.812  93.706  101.289 1.00 66.95  ? 41   LEU A O     1 
ATOM   306   C  CB    . LEU A 1  41   ? 82.478  94.298  99.533  1.00 66.42  ? 41   LEU A CB    1 
ATOM   307   C  CG    . LEU A 1  41   ? 82.255  92.779  99.585  1.00 66.90  ? 41   LEU A CG    1 
ATOM   308   C  CD1   . LEU A 1  41   ? 83.490  91.992  99.166  1.00 68.34  ? 41   LEU A CD1   1 
ATOM   309   C  CD2   . LEU A 1  41   ? 81.792  92.357  100.971 1.00 67.93  ? 41   LEU A CD2   1 
ATOM   310   N  N     . GLY A 1  42   ? 85.308  95.869  100.967 1.00 68.60  ? 42   GLY A N     1 
ATOM   311   C  CA    . GLY A 1  42   ? 86.705  95.697  101.315 1.00 68.73  ? 42   GLY A CA    1 
ATOM   312   C  C     . GLY A 1  42   ? 87.558  95.061  100.236 1.00 67.95  ? 42   GLY A C     1 
ATOM   313   O  O     . GLY A 1  42   ? 88.099  93.968  100.434 1.00 67.42  ? 42   GLY A O     1 
ATOM   314   N  N     . HIS A 1  43   ? 87.692  95.733  99.095  1.00 66.90  ? 43   HIS A N     1 
ATOM   315   C  CA    . HIS A 1  43   ? 88.535  95.249  98.010  1.00 65.87  ? 43   HIS A CA    1 
ATOM   316   C  C     . HIS A 1  43   ? 88.835  96.410  97.076  1.00 66.93  ? 43   HIS A C     1 
ATOM   317   O  O     . HIS A 1  43   ? 88.000  97.309  96.927  1.00 68.22  ? 43   HIS A O     1 
ATOM   318   C  CB    . HIS A 1  43   ? 87.856  94.105  97.242  1.00 68.71  ? 43   HIS A CB    1 
ATOM   319   C  CG    . HIS A 1  43   ? 86.592  94.507  96.549  1.00 69.47  ? 43   HIS A CG    1 
ATOM   320   N  ND1   . HIS A 1  43   ? 85.363  94.498  97.175  1.00 69.53  ? 43   HIS A ND1   1 
ATOM   321   C  CD2   . HIS A 1  43   ? 86.364  94.927  95.282  1.00 68.99  ? 43   HIS A CD2   1 
ATOM   322   C  CE1   . HIS A 1  43   ? 84.435  94.895  96.324  1.00 63.28  ? 43   HIS A CE1   1 
ATOM   323   N  NE2   . HIS A 1  43   ? 85.016  95.162  95.168  1.00 62.57  ? 43   HIS A NE2   1 
ATOM   324   N  N     . PRO A 1  44   ? 90.008  96.429  96.446  1.00 60.62  ? 44   PRO A N     1 
ATOM   325   C  CA    . PRO A 1  44   ? 90.331  97.511  95.509  1.00 59.60  ? 44   PRO A CA    1 
ATOM   326   C  C     . PRO A 1  44   ? 89.459  97.449  94.264  1.00 59.62  ? 44   PRO A C     1 
ATOM   327   O  O     . PRO A 1  44   ? 88.718  96.494  94.025  1.00 59.73  ? 44   PRO A O     1 
ATOM   328   C  CB    . PRO A 1  44   ? 91.806  97.267  95.170  1.00 59.98  ? 44   PRO A CB    1 
ATOM   329   C  CG    . PRO A 1  44   ? 92.319  96.394  96.275  1.00 59.44  ? 44   PRO A CG    1 
ATOM   330   C  CD    . PRO A 1  44   ? 91.158  95.540  96.679  1.00 59.73  ? 44   PRO A CD    1 
ATOM   331   N  N     . VAL A 1  45   ? 89.565  98.500  93.453  1.00 59.29  ? 45   VAL A N     1 
ATOM   332   C  CA    . VAL A 1  45   ? 88.793  98.624  92.226  1.00 59.29  ? 45   VAL A CA    1 
ATOM   333   C  C     . VAL A 1  45   ? 89.751  98.689  91.042  1.00 59.38  ? 45   VAL A C     1 
ATOM   334   O  O     . VAL A 1  45   ? 90.943  98.976  91.186  1.00 59.72  ? 45   VAL A O     1 
ATOM   335   C  CB    . VAL A 1  45   ? 87.869  99.859  92.241  1.00 59.25  ? 45   VAL A CB    1 
ATOM   336   C  CG1   . VAL A 1  45   ? 86.865  99.755  93.377  1.00 58.82  ? 45   VAL A CG1   1 
ATOM   337   C  CG2   . VAL A 1  45   ? 88.689  101.134 92.361  1.00 58.76  ? 45   VAL A CG2   1 
ATOM   338   N  N     . SER A 1  46   ? 89.209  98.413  89.860  1.00 58.33  ? 46   SER A N     1 
ATOM   339   C  CA    . SER A 1  46   ? 90.003  98.472  88.640  1.00 58.12  ? 46   SER A CA    1 
ATOM   340   C  C     . SER A 1  46   ? 90.320  99.918  88.284  1.00 58.67  ? 46   SER A C     1 
ATOM   341   O  O     . SER A 1  46   ? 89.458  100.798 88.356  1.00 58.73  ? 46   SER A O     1 
ATOM   342   C  CB    . SER A 1  46   ? 89.260  97.796  87.488  1.00 57.25  ? 46   SER A CB    1 
ATOM   343   O  OG    . SER A 1  46   ? 88.021  98.435  87.236  1.00 56.82  ? 46   SER A OG    1 
ATOM   344   N  N     . GLY A 1  47   ? 91.569  100.160 87.890  1.00 56.52  ? 47   GLY A N     1 
ATOM   345   C  CA    . GLY A 1  47   ? 92.004  101.510 87.581  1.00 55.77  ? 47   GLY A CA    1 
ATOM   346   C  C     . GLY A 1  47   ? 91.960  102.464 88.750  1.00 55.05  ? 47   GLY A C     1 
ATOM   347   O  O     . GLY A 1  47   ? 91.915  103.680 88.547  1.00 54.86  ? 47   GLY A O     1 
ATOM   348   N  N     . GLY A 1  48   ? 91.980  101.946 89.980  1.00 54.34  ? 48   GLY A N     1 
ATOM   349   C  CA    . GLY A 1  48   ? 91.882  102.772 91.163  1.00 53.78  ? 48   GLY A CA    1 
ATOM   350   C  C     . GLY A 1  48   ? 93.236  103.240 91.665  1.00 52.71  ? 48   GLY A C     1 
ATOM   351   O  O     . GLY A 1  48   ? 94.290  102.901 91.128  1.00 52.65  ? 48   GLY A O     1 
ATOM   352   N  N     . LEU A 1  49   ? 93.190  104.058 92.717  1.00 51.62  ? 49   LEU A N     1 
ATOM   353   C  CA    . LEU A 1  49   ? 94.418  104.564 93.321  1.00 50.89  ? 49   LEU A CA    1 
ATOM   354   C  C     . LEU A 1  49   ? 95.261  103.425 93.883  1.00 49.91  ? 49   LEU A C     1 
ATOM   355   O  O     . LEU A 1  49   ? 96.459  103.321 93.597  1.00 49.37  ? 49   LEU A O     1 
ATOM   356   C  CB    . LEU A 1  49   ? 94.083  105.584 94.409  1.00 49.15  ? 49   LEU A CB    1 
ATOM   357   C  CG    . LEU A 1  49   ? 95.255  106.356 95.015  1.00 49.15  ? 49   LEU A CG    1 
ATOM   358   C  CD1   . LEU A 1  49   ? 96.079  107.020 93.924  1.00 51.42  ? 49   LEU A CD1   1 
ATOM   359   C  CD2   . LEU A 1  49   ? 94.748  107.389 96.007  1.00 51.79  ? 49   LEU A CD2   1 
ATOM   360   N  N     . TYR A 1  50   ? 94.649  102.557 94.688  1.00 51.53  ? 50   TYR A N     1 
ATOM   361   C  CA    . TYR A 1  50   ? 95.325  101.362 95.195  1.00 51.60  ? 50   TYR A CA    1 
ATOM   362   C  C     . TYR A 1  50   ? 95.060  100.169 94.274  1.00 52.28  ? 50   TYR A C     1 
ATOM   363   O  O     . TYR A 1  50   ? 94.578  99.115  94.685  1.00 53.57  ? 50   TYR A O     1 
ATOM   364   C  CB    . TYR A 1  50   ? 94.883  101.064 96.624  1.00 54.45  ? 50   TYR A CB    1 
ATOM   365   C  CG    . TYR A 1  50   ? 95.500  101.960 97.676  1.00 55.66  ? 50   TYR A CG    1 
ATOM   366   C  CD1   . TYR A 1  50   ? 96.403  102.957 97.330  1.00 56.11  ? 50   TYR A CD1   1 
ATOM   367   C  CD2   . TYR A 1  50   ? 95.191  101.796 99.020  1.00 56.52  ? 50   TYR A CD2   1 
ATOM   368   C  CE1   . TYR A 1  50   ? 96.969  103.772 98.292  1.00 55.52  ? 50   TYR A CE1   1 
ATOM   369   C  CE2   . TYR A 1  50   ? 95.751  102.606 99.988  1.00 54.61  ? 50   TYR A CE2   1 
ATOM   370   C  CZ    . TYR A 1  50   ? 96.641  103.592 99.619  1.00 51.37  ? 50   TYR A CZ    1 
ATOM   371   O  OH    . TYR A 1  50   ? 97.203  104.401 100.580 1.00 52.03  ? 50   TYR A OH    1 
ATOM   372   N  N     . ASP A 1  51   ? 95.391  100.358 92.999  1.00 51.18  ? 51   ASP A N     1 
ATOM   373   C  CA    . ASP A 1  51   ? 95.187  99.313  92.010  1.00 51.14  ? 51   ASP A CA    1 
ATOM   374   C  C     . ASP A 1  51   ? 96.248  98.226  92.157  1.00 51.13  ? 51   ASP A C     1 
ATOM   375   O  O     . ASP A 1  51   ? 97.340  98.448  92.684  1.00 51.25  ? 51   ASP A O     1 
ATOM   376   C  CB    . ASP A 1  51   ? 95.225  99.896  90.596  1.00 51.37  ? 51   ASP A CB    1 
ATOM   377   C  CG    . ASP A 1  51   ? 94.618  98.965  89.560  1.00 51.56  ? 51   ASP A CG    1 
ATOM   378   O  OD1   . ASP A 1  51   ? 94.411  97.772  89.868  1.00 51.33  ? 51   ASP A OD1   1 
ATOM   379   O  OD2   . ASP A 1  51   ? 94.350  99.427  88.431  1.00 51.77  ? 51   ASP A OD2   1 
ATOM   380   N  N     . LEU A 1  52   ? 95.905  97.031  91.678  1.00 51.45  ? 52   LEU A N     1 
ATOM   381   C  CA    . LEU A 1  52   ? 96.824  95.901  91.698  1.00 51.85  ? 52   LEU A CA    1 
ATOM   382   C  C     . LEU A 1  52   ? 97.840  95.946  90.564  1.00 52.83  ? 52   LEU A C     1 
ATOM   383   O  O     . LEU A 1  52   ? 98.710  95.071  90.500  1.00 53.82  ? 52   LEU A O     1 
ATOM   384   C  CB    . LEU A 1  52   ? 96.046  94.582  91.637  1.00 54.05  ? 52   LEU A CB    1 
ATOM   385   C  CG    . LEU A 1  52   ? 95.114  94.241  92.805  1.00 54.17  ? 52   LEU A CG    1 
ATOM   386   C  CD1   . LEU A 1  52   ? 95.733  94.654  94.134  1.00 51.48  ? 52   LEU A CD1   1 
ATOM   387   C  CD2   . LEU A 1  52   ? 93.729  94.855  92.629  1.00 51.33  ? 52   LEU A CD2   1 
ATOM   388   N  N     . ALA A 1  53   ? 97.752  96.935  89.673  1.00 51.31  ? 53   ALA A N     1 
ATOM   389   C  CA    . ALA A 1  53   ? 98.683  97.019  88.554  1.00 51.32  ? 53   ALA A CA    1 
ATOM   390   C  C     . ALA A 1  53   ? 100.019 97.614  88.983  1.00 51.45  ? 53   ALA A C     1 
ATOM   391   O  O     . ALA A 1  53   ? 101.081 97.072  88.656  1.00 51.21  ? 53   ALA A O     1 
ATOM   392   C  CB    . ALA A 1  53   ? 98.068  97.842  87.420  1.00 50.84  ? 53   ALA A CB    1 
ATOM   393   N  N     . LEU A 1  54   ? 99.986  98.725  89.716  1.00 51.36  ? 54   LEU A N     1 
ATOM   394   C  CA    . LEU A 1  54   ? 101.202 99.395  90.159  1.00 51.48  ? 54   LEU A CA    1 
ATOM   395   C  C     . LEU A 1  54   ? 101.781 98.798  91.438  1.00 51.34  ? 54   LEU A C     1 
ATOM   396   O  O     . LEU A 1  54   ? 102.668 99.411  92.042  1.00 51.26  ? 54   LEU A O     1 
ATOM   397   C  CB    . LEU A 1  54   ? 100.944 100.894 90.357  1.00 51.53  ? 54   LEU A CB    1 
ATOM   398   C  CG    . LEU A 1  54   ? 100.089 101.358 91.539  1.00 51.14  ? 54   LEU A CG    1 
ATOM   399   C  CD1   . LEU A 1  54   ? 100.385 102.815 91.850  1.00 53.03  ? 54   LEU A CD1   1 
ATOM   400   C  CD2   . LEU A 1  54   ? 98.605  101.172 91.263  1.00 51.98  ? 54   LEU A CD2   1 
ATOM   401   N  N     . GLY A 1  55   ? 101.312 97.637  91.857  1.00 51.98  ? 55   GLY A N     1 
ATOM   402   C  CA    . GLY A 1  55   ? 101.814 96.974  93.046  1.00 52.12  ? 55   GLY A CA    1 
ATOM   403   C  C     . GLY A 1  55   ? 100.690 96.312  93.819  1.00 52.48  ? 55   GLY A C     1 
ATOM   404   O  O     . GLY A 1  55   ? 99.507  96.592  93.626  1.00 52.85  ? 55   GLY A O     1 
ATOM   405   N  N     . ALA A 1  56   ? 101.073 95.410  94.719  1.00 52.74  ? 56   ALA A N     1 
ATOM   406   C  CA    . ALA A 1  56   ? 100.107 94.697  95.537  1.00 53.06  ? 56   ALA A CA    1 
ATOM   407   C  C     . ALA A 1  56   ? 99.652  95.561  96.710  1.00 53.07  ? 56   ALA A C     1 
ATOM   408   O  O     . ALA A 1  56   ? 100.331 96.504  97.124  1.00 52.49  ? 56   ALA A O     1 
ATOM   409   C  CB    . ALA A 1  56   ? 100.698 93.382  96.047  1.00 51.97  ? 56   ALA A CB    1 
ATOM   410   N  N     . PHE A 1  57   ? 98.483  95.220  97.247  1.00 52.45  ? 57   PHE A N     1 
ATOM   411   C  CA    . PHE A 1  57   ? 97.908  95.947  98.370  1.00 52.58  ? 57   PHE A CA    1 
ATOM   412   C  C     . PHE A 1  57   ? 97.061  94.993  99.197  1.00 52.45  ? 57   PHE A C     1 
ATOM   413   O  O     . PHE A 1  57   ? 96.152  94.353  98.663  1.00 52.73  ? 57   PHE A O     1 
ATOM   414   C  CB    . PHE A 1  57   ? 97.059  97.130  97.889  1.00 53.31  ? 57   PHE A CB    1 
ATOM   415   C  CG    . PHE A 1  57   ? 96.174  97.712  98.953  1.00 53.55  ? 57   PHE A CG    1 
ATOM   416   C  CD1   . PHE A 1  57   ? 96.705  98.494  99.965  1.00 53.42  ? 57   PHE A CD1   1 
ATOM   417   C  CD2   . PHE A 1  57   ? 94.808  97.483  98.938  1.00 53.09  ? 57   PHE A CD2   1 
ATOM   418   C  CE1   . PHE A 1  57   ? 95.893  99.030  100.945 1.00 52.70  ? 57   PHE A CE1   1 
ATOM   419   C  CE2   . PHE A 1  57   ? 93.990  98.018  99.915  1.00 53.47  ? 57   PHE A CE2   1 
ATOM   420   C  CZ    . PHE A 1  57   ? 94.533  98.793  100.920 1.00 53.34  ? 57   PHE A CZ    1 
ATOM   421   N  N     . LEU A 1  58   ? 97.361  94.912  100.495 1.00 55.11  ? 58   LEU A N     1 
ATOM   422   C  CA    . LEU A 1  58   ? 96.647  94.041  101.429 1.00 56.68  ? 58   LEU A CA    1 
ATOM   423   C  C     . LEU A 1  58   ? 96.704  92.584  100.963 1.00 57.23  ? 58   LEU A C     1 
ATOM   424   O  O     . LEU A 1  58   ? 95.695  91.977  100.598 1.00 57.96  ? 58   LEU A O     1 
ATOM   425   C  CB    . LEU A 1  58   ? 95.201  94.514  101.623 1.00 58.08  ? 58   LEU A CB    1 
ATOM   426   C  CG    . LEU A 1  58   ? 94.423  93.907  102.794 1.00 58.33  ? 58   LEU A CG    1 
ATOM   427   C  CD1   . LEU A 1  58   ? 95.119  94.205  104.114 1.00 58.13  ? 58   LEU A CD1   1 
ATOM   428   C  CD2   . LEU A 1  58   ? 92.991  94.421  102.810 1.00 57.87  ? 58   LEU A CD2   1 
ATOM   429   N  N     . ARG A 1  59   ? 97.931  92.056  100.931 1.00 59.92  ? 59   ARG A N     1 
ATOM   430   C  CA    . ARG A 1  59   ? 98.251  90.655  100.617 1.00 61.16  ? 59   ARG A CA    1 
ATOM   431   C  C     . ARG A 1  59   ? 97.616  90.180  99.307  1.00 62.41  ? 59   ARG A C     1 
ATOM   432   O  O     . ARG A 1  59   ? 97.538  88.975  99.050  1.00 63.19  ? 59   ARG A O     1 
ATOM   433   C  CB    . ARG A 1  59   ? 97.895  89.708  101.780 1.00 63.75  ? 59   ARG A CB    1 
ATOM   434   C  CG    . ARG A 1  59   ? 96.416  89.513  102.116 1.00 64.58  ? 59   ARG A CG    1 
ATOM   435   C  CD    . ARG A 1  59   ? 95.860  88.224  101.531 1.00 65.28  ? 59   ARG A CD    1 
ATOM   436   N  NE    . ARG A 1  59   ? 96.563  87.045  102.029 1.00 65.39  ? 59   ARG A NE    1 
ATOM   437   C  CZ    . ARG A 1  59   ? 96.509  85.847  101.454 1.00 65.49  ? 59   ARG A CZ    1 
ATOM   438   N  NH1   . ARG A 1  59   ? 95.785  85.668  100.358 1.00 60.41  ? 59   ARG A NH1   1 
ATOM   439   N  NH2   . ARG A 1  59   ? 97.181  84.830  101.975 1.00 60.14  ? 59   ARG A NH2   1 
ATOM   440   N  N     . ASN A 1  60   ? 97.186  91.106  98.454  1.00 59.56  ? 60   ASN A N     1 
ATOM   441   C  CA    . ASN A 1  60   ? 96.626  90.730  97.167  1.00 58.61  ? 60   ASN A CA    1 
ATOM   442   C  C     . ASN A 1  60   ? 97.726  90.271  96.214  1.00 59.11  ? 60   ASN A C     1 
ATOM   443   O  O     . ASN A 1  60   ? 98.914  90.548  96.409  1.00 59.50  ? 60   ASN A O     1 
ATOM   444   C  CB    . ASN A 1  60   ? 95.858  91.899  96.547  1.00 59.72  ? 60   ASN A CB    1 
ATOM   445   C  CG    . ASN A 1  60   ? 94.571  92.210  97.283  1.00 59.82  ? 60   ASN A CG    1 
ATOM   446   O  OD1   . ASN A 1  60   ? 93.882  91.312  97.761  1.00 57.59  ? 60   ASN A OD1   1 
ATOM   447   N  ND2   . ASN A 1  60   ? 94.241  93.493  97.377  1.00 57.57  ? 60   ASN A ND2   1 
ATOM   448   N  N     . LEU A 1  61   ? 97.313  89.560  95.170  1.00 56.69  ? 61   LEU A N     1 
ATOM   449   C  CA    . LEU A 1  61   ? 98.228  89.089  94.139  1.00 56.85  ? 61   LEU A CA    1 
ATOM   450   C  C     . LEU A 1  61   ? 98.389  90.185  93.092  1.00 57.55  ? 61   LEU A C     1 
ATOM   451   O  O     . LEU A 1  61   ? 97.400  90.638  92.504  1.00 58.47  ? 61   LEU A O     1 
ATOM   452   C  CB    . LEU A 1  61   ? 97.710  87.796  93.509  1.00 59.00  ? 61   LEU A CB    1 
ATOM   453   C  CG    . LEU A 1  61   ? 98.703  86.882  92.783  1.00 58.54  ? 61   LEU A CG    1 
ATOM   454   C  CD1   . LEU A 1  61   ? 98.989  87.360  91.366  1.00 56.64  ? 61   LEU A CD1   1 
ATOM   455   C  CD2   . LEU A 1  61   ? 99.996  86.759  93.578  1.00 56.40  ? 61   LEU A CD2   1 
ATOM   456   N  N     . CYS A 1  62   ? 99.630  90.615  92.869  1.00 57.08  ? 62   CYS A N     1 
ATOM   457   C  CA    . CYS A 1  62   ? 99.895  91.684  91.915  1.00 57.89  ? 62   CYS A CA    1 
ATOM   458   C  C     . CYS A 1  62   ? 99.491  91.258  90.509  1.00 58.21  ? 62   CYS A C     1 
ATOM   459   O  O     . CYS A 1  62   ? 99.884  90.189  90.032  1.00 58.73  ? 62   CYS A O     1 
ATOM   460   C  CB    . CYS A 1  62   ? 101.373 92.068  91.951  1.00 58.58  ? 62   CYS A CB    1 
ATOM   461   S  SG    . CYS A 1  62   ? 101.826 93.406  90.822  1.00 58.27  ? 62   CYS A SG    1 
ATOM   462   N  N     . SER A 1  63   ? 98.702  92.104  89.844  1.00 59.66  ? 63   SER A N     1 
ATOM   463   C  CA    . SER A 1  63   ? 98.185  91.749  88.527  1.00 60.37  ? 63   SER A CA    1 
ATOM   464   C  C     . SER A 1  63   ? 99.253  91.859  87.446  1.00 60.61  ? 63   SER A C     1 
ATOM   465   O  O     . SER A 1  63   ? 99.172  91.161  86.429  1.00 60.44  ? 63   SER A O     1 
ATOM   466   C  CB    . SER A 1  63   ? 96.985  92.632  88.181  1.00 60.14  ? 63   SER A CB    1 
ATOM   467   O  OG    . SER A 1  63   ? 97.357  93.998  88.125  1.00 60.68  ? 63   SER A OG    1 
ATOM   468   N  N     . THR A 1  64   ? 100.252 92.720  87.640  1.00 58.99  ? 64   THR A N     1 
ATOM   469   C  CA    . THR A 1  64   ? 101.304 92.925  86.648  1.00 58.05  ? 64   THR A CA    1 
ATOM   470   C  C     . THR A 1  64   ? 102.546 92.092  86.948  1.00 57.98  ? 64   THR A C     1 
ATOM   471   O  O     . THR A 1  64   ? 102.986 91.304  86.106  1.00 57.81  ? 64   THR A O     1 
ATOM   472   C  CB    . THR A 1  64   ? 101.669 94.413  86.565  1.00 57.88  ? 64   THR A CB    1 
ATOM   473   O  OG1   . THR A 1  64   ? 101.938 94.919  87.878  1.00 56.94  ? 64   THR A OG1   1 
ATOM   474   C  CG2   . THR A 1  64   ? 100.532 95.207  85.938  1.00 56.71  ? 64   THR A CG2   1 
ATOM   475   N  N     . CYS A 1  65   ? 103.125 92.254  88.140  1.00 56.31  ? 65   CYS A N     1 
ATOM   476   C  CA    . CYS A 1  65   ? 104.337 91.518  88.479  1.00 56.40  ? 65   CYS A CA    1 
ATOM   477   C  C     . CYS A 1  65   ? 104.050 90.055  88.794  1.00 57.05  ? 65   CYS A C     1 
ATOM   478   O  O     . CYS A 1  65   ? 104.903 89.195  88.549  1.00 58.16  ? 65   CYS A O     1 
ATOM   479   C  CB    . CYS A 1  65   ? 105.046 92.181  89.660  1.00 56.33  ? 65   CYS A CB    1 
ATOM   480   S  SG    . CYS A 1  65   ? 104.076 92.247  91.181  1.00 56.92  ? 65   CYS A SG    1 
ATOM   481   N  N     . GLY A 1  66   ? 102.872 89.754  89.334  1.00 56.26  ? 66   GLY A N     1 
ATOM   482   C  CA    . GLY A 1  66   ? 102.525 88.382  89.643  1.00 56.61  ? 66   GLY A CA    1 
ATOM   483   C  C     . GLY A 1  66   ? 103.172 87.831  90.892  1.00 56.89  ? 66   GLY A C     1 
ATOM   484   O  O     . GLY A 1  66   ? 103.409 86.621  90.976  1.00 56.94  ? 66   GLY A O     1 
ATOM   485   N  N     . LEU A 1  67   ? 103.467 88.683  91.871  1.00 57.25  ? 67   LEU A N     1 
ATOM   486   C  CA    . LEU A 1  67   ? 104.105 88.270  93.111  1.00 57.76  ? 67   LEU A CA    1 
ATOM   487   C  C     . LEU A 1  67   ? 103.382 88.903  94.291  1.00 57.35  ? 67   LEU A C     1 
ATOM   488   O  O     . LEU A 1  67   ? 102.491 89.742  94.130  1.00 57.31  ? 67   LEU A O     1 
ATOM   489   C  CB    . LEU A 1  67   ? 105.593 88.650  93.128  1.00 57.58  ? 67   LEU A CB    1 
ATOM   490   C  CG    . LEU A 1  67   ? 106.477 87.988  92.067  1.00 57.29  ? 67   LEU A CG    1 
ATOM   491   C  CD1   . LEU A 1  67   ? 107.895 88.530  92.133  1.00 58.82  ? 67   LEU A CD1   1 
ATOM   492   C  CD2   . LEU A 1  67   ? 106.470 86.476  92.232  1.00 58.97  ? 67   LEU A CD2   1 
ATOM   493   N  N     . ASP A 1  68   ? 103.779 88.490  95.491  1.00 59.79  ? 68   ASP A N     1 
ATOM   494   C  CA    . ASP A 1  68   ? 103.180 88.986  96.720  1.00 60.32  ? 68   ASP A CA    1 
ATOM   495   C  C     . ASP A 1  68   ? 103.892 90.265  97.161  1.00 60.61  ? 68   ASP A C     1 
ATOM   496   O  O     . ASP A 1  68   ? 104.685 90.851  96.418  1.00 60.71  ? 68   ASP A O     1 
ATOM   497   C  CB    . ASP A 1  68   ? 103.225 87.907  97.800  1.00 60.78  ? 68   ASP A CB    1 
ATOM   498   C  CG    . ASP A 1  68   ? 104.635 87.437  98.096  1.00 60.85  ? 68   ASP A CG    1 
ATOM   499   O  OD1   . ASP A 1  68   ? 105.494 87.522  97.192  1.00 60.06  ? 68   ASP A OD1   1 
ATOM   500   O  OD2   . ASP A 1  68   ? 104.886 86.983  99.233  1.00 60.68  ? 68   ASP A OD2   1 
ATOM   501   N  N     . GLU A 1  69   ? 103.612 90.713  98.384  1.00 58.95  ? 69   GLU A N     1 
ATOM   502   C  CA    . GLU A 1  69   ? 104.211 91.926  98.926  1.00 57.95  ? 69   GLU A CA    1 
ATOM   503   C  C     . GLU A 1  69   ? 105.603 91.699  99.503  1.00 58.43  ? 69   GLU A C     1 
ATOM   504   O  O     . GLU A 1  69   ? 106.118 92.580  100.199 1.00 58.84  ? 69   GLU A O     1 
ATOM   505   C  CB    . GLU A 1  69   ? 103.298 92.526  100.000 1.00 59.21  ? 69   GLU A CB    1 
ATOM   506   C  CG    . GLU A 1  69   ? 101.922 92.925  99.496  1.00 59.98  ? 69   GLU A CG    1 
ATOM   507   C  CD    . GLU A 1  69   ? 101.063 93.547  100.579 1.00 58.85  ? 69   GLU A CD    1 
ATOM   508   O  OE1   . GLU A 1  69   ? 101.537 93.656  101.729 1.00 56.52  ? 69   GLU A OE1   1 
ATOM   509   O  OE2   . GLU A 1  69   ? 99.912  93.930  100.280 1.00 56.52  ? 69   GLU A OE2   1 
ATOM   510   N  N     . LYS A 1  70   ? 106.220 90.548  99.235  1.00 55.40  ? 70   LYS A N     1 
ATOM   511   C  CA    . LYS A 1  70   ? 107.558 90.252  99.727  1.00 54.97  ? 70   LYS A CA    1 
ATOM   512   C  C     . LYS A 1  70   ? 108.594 90.138  98.620  1.00 55.75  ? 70   LYS A C     1 
ATOM   513   O  O     . LYS A 1  70   ? 109.794 90.121  98.918  1.00 56.42  ? 70   LYS A O     1 
ATOM   514   C  CB    . LYS A 1  70   ? 107.555 88.952  100.549 1.00 57.03  ? 70   LYS A CB    1 
ATOM   515   C  CG    . LYS A 1  70   ? 107.051 89.102  101.982 1.00 57.83  ? 70   LYS A CG    1 
ATOM   516   C  CD    . LYS A 1  70   ? 105.536 89.224  102.049 1.00 58.28  ? 70   LYS A CD    1 
ATOM   517   C  CE    . LYS A 1  70   ? 105.057 89.384  103.483 1.00 53.89  ? 70   LYS A CE    1 
ATOM   518   N  NZ    . LYS A 1  70   ? 103.576 89.517  103.563 1.00 53.05  ? 70   LYS A NZ    1 
ATOM   519   N  N     . PHE A 1  71   ? 108.172 90.058  97.359  1.00 53.75  ? 71   PHE A N     1 
ATOM   520   C  CA    . PHE A 1  71   ? 109.095 89.977  96.234  1.00 54.11  ? 71   PHE A CA    1 
ATOM   521   C  C     . PHE A 1  71   ? 108.831 90.996  95.137  1.00 55.01  ? 71   PHE A C     1 
ATOM   522   O  O     . PHE A 1  71   ? 109.735 91.247  94.331  1.00 55.75  ? 71   PHE A O     1 
ATOM   523   C  CB    . PHE A 1  71   ? 109.069 88.571  95.614  1.00 56.01  ? 71   PHE A CB    1 
ATOM   524   C  CG    . PHE A 1  71   ? 109.554 87.491  96.539  1.00 56.31  ? 71   PHE A CG    1 
ATOM   525   C  CD1   . PHE A 1  71   ? 110.898 87.163  96.597  1.00 56.47  ? 71   PHE A CD1   1 
ATOM   526   C  CD2   . PHE A 1  71   ? 108.666 86.803  97.348  1.00 56.71  ? 71   PHE A CD2   1 
ATOM   527   C  CE1   . PHE A 1  71   ? 111.348 86.170  97.446  1.00 56.49  ? 71   PHE A CE1   1 
ATOM   528   C  CE2   . PHE A 1  71   ? 109.109 85.808  98.199  1.00 53.70  ? 71   PHE A CE2   1 
ATOM   529   C  CZ    . PHE A 1  71   ? 110.452 85.492  98.248  1.00 53.59  ? 71   PHE A CZ    1 
ATOM   530   N  N     . CYS A 1  72   ? 107.641 91.589  95.072  1.00 53.42  ? 72   CYS A N     1 
ATOM   531   C  CA    . CYS A 1  72   ? 107.330 92.582  94.053  1.00 53.50  ? 72   CYS A CA    1 
ATOM   532   C  C     . CYS A 1  72   ? 107.850 93.948  94.483  1.00 54.85  ? 72   CYS A C     1 
ATOM   533   O  O     . CYS A 1  72   ? 107.396 94.496  95.495  1.00 56.51  ? 72   CYS A O     1 
ATOM   534   C  CB    . CYS A 1  72   ? 105.823 92.640  93.796  1.00 52.45  ? 72   CYS A CB    1 
ATOM   535   S  SG    . CYS A 1  72   ? 105.322 93.846  92.545  1.00 52.20  ? 72   CYS A SG    1 
ATOM   536   N  N     . PRO A 1  73   ? 108.798 94.528  93.746  1.00 51.76  ? 73   PRO A N     1 
ATOM   537   C  CA    . PRO A 1  73   ? 109.359 95.829  94.126  1.00 51.09  ? 73   PRO A CA    1 
ATOM   538   C  C     . PRO A 1  73   ? 108.489 97.025  93.775  1.00 51.89  ? 73   PRO A C     1 
ATOM   539   O  O     . PRO A 1  73   ? 108.950 98.161  93.917  1.00 52.29  ? 73   PRO A O     1 
ATOM   540   C  CB    . PRO A 1  73   ? 110.673 95.866  93.332  1.00 52.05  ? 73   PRO A CB    1 
ATOM   541   C  CG    . PRO A 1  73   ? 110.373 95.080  92.107  1.00 49.84  ? 73   PRO A CG    1 
ATOM   542   C  CD    . PRO A 1  73   ? 109.440 93.978  92.539  1.00 49.07  ? 73   PRO A CD    1 
ATOM   543   N  N     . GLY A 1  74   ? 107.256 96.811  93.326  1.00 49.03  ? 74   GLY A N     1 
ATOM   544   C  CA    . GLY A 1  74   ? 106.382 97.897  92.942  1.00 48.62  ? 74   GLY A CA    1 
ATOM   545   C  C     . GLY A 1  74   ? 106.486 98.234  91.466  1.00 48.25  ? 74   GLY A C     1 
ATOM   546   O  O     . GLY A 1  74   ? 107.319 97.710  90.722  1.00 48.26  ? 74   GLY A O     1 
ATOM   547   N  N     . HIS A 1  75   ? 105.610 99.139  91.036  1.00 48.13  ? 75   HIS A N     1 
ATOM   548   C  CA    . HIS A 1  75   ? 105.564 99.578  89.648  1.00 48.28  ? 75   HIS A CA    1 
ATOM   549   C  C     . HIS A 1  75   ? 105.285 101.077 89.631  1.00 50.05  ? 75   HIS A C     1 
ATOM   550   O  O     . HIS A 1  75   ? 105.326 101.749 90.666  1.00 52.09  ? 75   HIS A O     1 
ATOM   551   C  CB    . HIS A 1  75   ? 104.520 98.776  88.858  1.00 53.05  ? 75   HIS A CB    1 
ATOM   552   C  CG    . HIS A 1  75   ? 104.759 97.298  88.866  1.00 53.80  ? 75   HIS A CG    1 
ATOM   553   N  ND1   . HIS A 1  75   ? 105.714 96.694  88.078  1.00 54.52  ? 75   HIS A ND1   1 
ATOM   554   C  CD2   . HIS A 1  75   ? 104.169 96.305  89.571  1.00 53.37  ? 75   HIS A CD2   1 
ATOM   555   C  CE1   . HIS A 1  75   ? 105.702 95.391  88.295  1.00 47.28  ? 75   HIS A CE1   1 
ATOM   556   N  NE2   . HIS A 1  75   ? 104.772 95.128  89.196  1.00 46.65  ? 75   HIS A NE2   1 
ATOM   557   N  N     . GLN A 1  76   ? 104.999 101.606 88.444  1.00 47.57  ? 76   GLN A N     1 
ATOM   558   C  CA    . GLN A 1  76   ? 104.811 103.035 88.251  1.00 47.98  ? 76   GLN A CA    1 
ATOM   559   C  C     . GLN A 1  76   ? 103.479 103.295 87.559  1.00 48.97  ? 76   GLN A C     1 
ATOM   560   O  O     . GLN A 1  76   ? 103.000 102.480 86.768  1.00 49.65  ? 76   GLN A O     1 
ATOM   561   C  CB    . GLN A 1  76   ? 105.963 103.636 87.426  1.00 49.71  ? 76   GLN A CB    1 
ATOM   562   C  CG    . GLN A 1  76   ? 105.962 105.155 87.344  1.00 49.68  ? 76   GLN A CG    1 
ATOM   563   C  CD    . GLN A 1  76   ? 106.081 105.811 88.704  1.00 49.65  ? 76   GLN A CD    1 
ATOM   564   O  OE1   . GLN A 1  76   ? 105.154 106.473 89.170  1.00 47.24  ? 76   GLN A OE1   1 
ATOM   565   N  NE2   . GLN A 1  76   ? 107.228 105.632 89.350  1.00 47.09  ? 76   GLN A NE2   1 
ATOM   566   N  N     . GLY A 1  77   ? 102.886 104.448 87.873  1.00 46.53  ? 77   GLY A N     1 
ATOM   567   C  CA    . GLY A 1  77   ? 101.654 104.877 87.243  1.00 46.28  ? 77   GLY A CA    1 
ATOM   568   C  C     . GLY A 1  77   ? 101.574 106.387 87.245  1.00 45.84  ? 77   GLY A C     1 
ATOM   569   O  O     . GLY A 1  77   ? 102.381 107.070 87.881  1.00 45.21  ? 77   GLY A O     1 
ATOM   570   N  N     . HIS A 1  78   ? 100.585 106.908 86.522  1.00 45.84  ? 78   HIS A N     1 
ATOM   571   C  CA    . HIS A 1  78   ? 100.420 108.349 86.388  1.00 45.88  ? 78   HIS A CA    1 
ATOM   572   C  C     . HIS A 1  78   ? 98.950  108.663 86.138  1.00 45.99  ? 78   HIS A C     1 
ATOM   573   O  O     . HIS A 1  78   ? 98.107  107.767 86.042  1.00 45.88  ? 78   HIS A O     1 
ATOM   574   C  CB    . HIS A 1  78   ? 101.304 108.906 85.267  1.00 46.06  ? 78   HIS A CB    1 
ATOM   575   C  CG    . HIS A 1  78   ? 100.892 108.466 83.896  1.00 46.12  ? 78   HIS A CG    1 
ATOM   576   N  ND1   . HIS A 1  78   ? 101.412 107.344 83.288  1.00 46.08  ? 78   HIS A ND1   1 
ATOM   577   C  CD2   . HIS A 1  78   ? 100.011 108.997 83.017  1.00 45.91  ? 78   HIS A CD2   1 
ATOM   578   C  CE1   . HIS A 1  78   ? 100.869 107.203 82.091  1.00 46.36  ? 78   HIS A CE1   1 
ATOM   579   N  NE2   . HIS A 1  78   ? 100.015 108.193 81.903  1.00 45.95  ? 78   HIS A NE2   1 
ATOM   580   N  N     . ILE A 1  79   ? 98.651  109.956 86.033  1.00 48.34  ? 79   ILE A N     1 
ATOM   581   C  CA    . ILE A 1  79   ? 97.305  110.448 85.769  1.00 50.54  ? 79   ILE A CA    1 
ATOM   582   C  C     . ILE A 1  79   ? 97.377  111.470 84.643  1.00 52.30  ? 79   ILE A C     1 
ATOM   583   O  O     . ILE A 1  79   ? 98.275  112.317 84.617  1.00 53.69  ? 79   ILE A O     1 
ATOM   584   C  CB    . ILE A 1  79   ? 96.665  111.063 87.034  1.00 53.88  ? 79   ILE A CB    1 
ATOM   585   C  CG1   . ILE A 1  79   ? 95.353  111.773 86.687  1.00 52.47  ? 79   ILE A CG1   1 
ATOM   586   C  CG2   . ILE A 1  79   ? 97.638  112.011 87.724  1.00 50.80  ? 79   ILE A CG2   1 
ATOM   587   C  CD1   . ILE A 1  79   ? 94.737  112.524 87.846  1.00 50.26  ? 79   ILE A CD1   1 
ATOM   588   N  N     . GLU A 1  80   ? 96.433  111.383 83.708  1.00 52.10  ? 80   GLU A N     1 
ATOM   589   C  CA    . GLU A 1  80   ? 96.387  112.313 82.588  1.00 53.39  ? 80   GLU A CA    1 
ATOM   590   C  C     . GLU A 1  80   ? 95.714  113.613 83.012  1.00 54.48  ? 80   GLU A C     1 
ATOM   591   O  O     . GLU A 1  80   ? 94.660  113.597 83.654  1.00 55.11  ? 80   GLU A O     1 
ATOM   592   C  CB    . GLU A 1  80   ? 95.642  111.690 81.408  1.00 55.49  ? 80   GLU A CB    1 
ATOM   593   C  CG    . GLU A 1  80   ? 96.301  110.440 80.843  1.00 55.84  ? 80   GLU A CG    1 
ATOM   594   C  CD    . GLU A 1  80   ? 97.630  110.729 80.171  1.00 55.64  ? 80   GLU A CD    1 
ATOM   595   O  OE1   . GLU A 1  80   ? 97.842  111.881 79.733  1.00 54.06  ? 80   GLU A OE1   1 
ATOM   596   O  OE2   . GLU A 1  80   ? 98.463  109.804 80.079  1.00 53.90  ? 80   GLU A OE2   1 
ATOM   597   N  N     . LEU A 1  81   ? 96.329  114.740 82.650  1.00 55.86  ? 81   LEU A N     1 
ATOM   598   C  CA    . LEU A 1  81   ? 95.808  116.055 82.982  1.00 57.43  ? 81   LEU A CA    1 
ATOM   599   C  C     . LEU A 1  81   ? 95.295  116.761 81.731  1.00 58.55  ? 81   LEU A C     1 
ATOM   600   O  O     . LEU A 1  81   ? 95.822  116.555 80.632  1.00 59.07  ? 81   LEU A O     1 
ATOM   601   C  CB    . LEU A 1  81   ? 96.881  116.925 83.648  1.00 59.20  ? 81   LEU A CB    1 
ATOM   602   C  CG    . LEU A 1  81   ? 97.429  116.424 84.986  1.00 59.22  ? 81   LEU A CG    1 
ATOM   603   C  CD1   . LEU A 1  81   ? 98.499  117.365 85.515  1.00 57.76  ? 81   LEU A CD1   1 
ATOM   604   C  CD2   . LEU A 1  81   ? 96.307  116.258 85.998  1.00 56.97  ? 81   LEU A CD2   1 
ATOM   605   N  N     . PRO A 1  82   ? 94.261  117.599 81.861  1.00 59.58  ? 82   PRO A N     1 
ATOM   606   C  CA    . PRO A 1  82   ? 93.739  118.284 80.666  1.00 61.53  ? 82   PRO A CA    1 
ATOM   607   C  C     . PRO A 1  82   ? 94.686  119.335 80.115  1.00 61.37  ? 82   PRO A C     1 
ATOM   608   O  O     . PRO A 1  82   ? 94.863  119.420 78.894  1.00 60.48  ? 82   PRO A O     1 
ATOM   609   C  CB    . PRO A 1  82   ? 92.426  118.902 81.168  1.00 59.76  ? 82   PRO A CB    1 
ATOM   610   C  CG    . PRO A 1  82   ? 92.633  119.077 82.635  1.00 62.78  ? 82   PRO A CG    1 
ATOM   611   C  CD    . PRO A 1  82   ? 93.484  117.918 83.071  1.00 64.91  ? 82   PRO A CD    1 
ATOM   612   N  N     . VAL A 1  83   ? 95.302  120.139 80.977  1.00 62.32  ? 83   VAL A N     1 
ATOM   613   C  CA    . VAL A 1  83   ? 96.204  121.200 80.537  1.00 62.20  ? 83   VAL A CA    1 
ATOM   614   C  C     . VAL A 1  83   ? 97.543  121.052 81.249  1.00 61.46  ? 83   VAL A C     1 
ATOM   615   O  O     . VAL A 1  83   ? 97.584  120.606 82.406  1.00 61.17  ? 83   VAL A O     1 
ATOM   616   C  CB    . VAL A 1  83   ? 95.594  122.590 80.786  1.00 61.01  ? 83   VAL A CB    1 
ATOM   617   C  CG1   . VAL A 1  83   ? 94.386  122.809 79.887  1.00 61.99  ? 83   VAL A CG1   1 
ATOM   618   C  CG2   . VAL A 1  83   ? 95.208  122.749 82.249  1.00 62.14  ? 83   VAL A CG2   1 
ATOM   619   N  N     . PRO A 1  84   ? 98.657  121.391 80.602  1.00 61.29  ? 84   PRO A N     1 
ATOM   620   C  CA    . PRO A 1  84   ? 99.955  121.327 81.284  1.00 60.25  ? 84   PRO A CA    1 
ATOM   621   C  C     . PRO A 1  84   ? 100.023 122.333 82.424  1.00 60.77  ? 84   PRO A C     1 
ATOM   622   O  O     . PRO A 1  84   ? 99.700  123.511 82.258  1.00 61.14  ? 84   PRO A O     1 
ATOM   623   C  CB    . PRO A 1  84   ? 100.958 121.662 80.173  1.00 61.49  ? 84   PRO A CB    1 
ATOM   624   C  CG    . PRO A 1  84   ? 100.227 121.384 78.895  1.00 59.14  ? 84   PRO A CG    1 
ATOM   625   C  CD    . PRO A 1  84   ? 98.797  121.725 79.175  1.00 58.78  ? 84   PRO A CD    1 
ATOM   626   N  N     . CYS A 1  85   ? 100.449 121.858 83.589  1.00 58.45  ? 85   CYS A N     1 
ATOM   627   C  CA    . CYS A 1  85   ? 100.535 122.685 84.782  1.00 58.12  ? 85   CYS A CA    1 
ATOM   628   C  C     . CYS A 1  85   ? 101.938 123.259 84.945  1.00 58.32  ? 85   CYS A C     1 
ATOM   629   O  O     . CYS A 1  85   ? 102.881 122.888 84.244  1.00 58.77  ? 85   CYS A O     1 
ATOM   630   C  CB    . CYS A 1  85   ? 100.149 121.881 86.026  1.00 57.83  ? 85   CYS A CB    1 
ATOM   631   S  SG    . CYS A 1  85   ? 100.516 122.735 87.571  1.00 57.91  ? 85   CYS A SG    1 
ATOM   632   N  N     . TYR A 1  86   ? 102.063 124.182 85.894  1.00 57.21  ? 86   TYR A N     1 
ATOM   633   C  CA    . TYR A 1  86   ? 103.341 124.792 86.222  1.00 56.51  ? 86   TYR A CA    1 
ATOM   634   C  C     . TYR A 1  86   ? 104.067 123.928 87.252  1.00 56.50  ? 86   TYR A C     1 
ATOM   635   O  O     . TYR A 1  86   ? 103.668 122.795 87.539  1.00 56.02  ? 86   TYR A O     1 
ATOM   636   C  CB    . TYR A 1  86   ? 103.133 126.219 86.730  1.00 56.51  ? 86   TYR A CB    1 
ATOM   637   C  CG    . TYR A 1  86   ? 102.475 127.149 85.734  1.00 56.64  ? 86   TYR A CG    1 
ATOM   638   C  CD1   . TYR A 1  86   ? 102.558 126.910 84.369  1.00 56.28  ? 86   TYR A CD1   1 
ATOM   639   C  CD2   . TYR A 1  86   ? 101.773 128.267 86.163  1.00 56.61  ? 86   TYR A CD2   1 
ATOM   640   C  CE1   . TYR A 1  86   ? 101.957 127.759 83.457  1.00 55.66  ? 86   TYR A CE1   1 
ATOM   641   C  CE2   . TYR A 1  86   ? 101.170 129.122 85.259  1.00 55.34  ? 86   TYR A CE2   1 
ATOM   642   C  CZ    . TYR A 1  86   ? 101.264 128.863 83.909  1.00 55.74  ? 86   TYR A CZ    1 
ATOM   643   O  OH    . TYR A 1  86   ? 100.665 129.710 83.006  1.00 54.80  ? 86   TYR A OH    1 
ATOM   644   N  N     . ASN A 1  87   ? 105.150 124.452 87.814  1.00 56.09  ? 87   ASN A N     1 
ATOM   645   C  CA    . ASN A 1  87   ? 105.879 123.750 88.861  1.00 56.45  ? 87   ASN A CA    1 
ATOM   646   C  C     . ASN A 1  87   ? 106.602 124.756 89.747  1.00 56.15  ? 87   ASN A C     1 
ATOM   647   O  O     . ASN A 1  87   ? 107.535 125.427 89.287  1.00 56.31  ? 87   ASN A O     1 
ATOM   648   C  CB    . ASN A 1  87   ? 106.870 122.754 88.256  1.00 55.89  ? 87   ASN A CB    1 
ATOM   649   C  CG    . ASN A 1  87   ? 107.347 121.718 89.259  1.00 56.67  ? 87   ASN A CG    1 
ATOM   650   O  OD1   . ASN A 1  87   ? 107.306 121.941 90.470  1.00 57.72  ? 87   ASN A OD1   1 
ATOM   651   N  ND2   . ASN A 1  87   ? 107.804 120.576 88.757  1.00 58.28  ? 87   ASN A ND2   1 
ATOM   652   N  N     . PRO A 1  88   ? 106.199 124.898 91.013  1.00 58.56  ? 88   PRO A N     1 
ATOM   653   C  CA    . PRO A 1  88   ? 106.929 125.800 91.919  1.00 58.66  ? 88   PRO A CA    1 
ATOM   654   C  C     . PRO A 1  88   ? 108.400 125.454 92.060  1.00 58.69  ? 88   PRO A C     1 
ATOM   655   O  O     . PRO A 1  88   ? 109.202 126.338 92.386  1.00 58.73  ? 88   PRO A O     1 
ATOM   656   C  CB    . PRO A 1  88   ? 106.184 125.638 93.251  1.00 58.77  ? 88   PRO A CB    1 
ATOM   657   C  CG    . PRO A 1  88   ? 104.813 125.192 92.860  1.00 57.72  ? 88   PRO A CG    1 
ATOM   658   C  CD    . PRO A 1  88   ? 105.001 124.325 91.647  1.00 58.37  ? 88   PRO A CD    1 
ATOM   659   N  N     . LEU A 1  89   ? 108.781 124.196 91.826  1.00 55.40  ? 89   LEU A N     1 
ATOM   660   C  CA    . LEU A 1  89   ? 110.187 123.816 91.798  1.00 53.65  ? 89   LEU A CA    1 
ATOM   661   C  C     . LEU A 1  89   ? 110.912 124.363 90.577  1.00 53.46  ? 89   LEU A C     1 
ATOM   662   O  O     . LEU A 1  89   ? 112.145 124.307 90.531  1.00 53.65  ? 89   LEU A O     1 
ATOM   663   C  CB    . LEU A 1  89   ? 110.311 122.293 91.841  1.00 54.17  ? 89   LEU A CB    1 
ATOM   664   C  CG    . LEU A 1  89   ? 109.551 121.612 92.979  1.00 53.64  ? 89   LEU A CG    1 
ATOM   665   C  CD1   . LEU A 1  89   ? 109.404 120.125 92.709  1.00 52.48  ? 89   LEU A CD1   1 
ATOM   666   C  CD2   . LEU A 1  89   ? 110.248 121.853 94.309  1.00 51.95  ? 89   LEU A CD2   1 
ATOM   667   N  N     . PHE A 1  90   ? 110.182 124.876 89.590  1.00 52.01  ? 90   PHE A N     1 
ATOM   668   C  CA    . PHE A 1  90   ? 110.782 125.515 88.427  1.00 52.22  ? 90   PHE A CA    1 
ATOM   669   C  C     . PHE A 1  90   ? 110.160 126.853 88.067  1.00 52.48  ? 90   PHE A C     1 
ATOM   670   O  O     . PHE A 1  90   ? 110.751 127.582 87.261  1.00 52.26  ? 90   PHE A O     1 
ATOM   671   C  CB    . PHE A 1  90   ? 110.705 124.591 87.202  1.00 52.31  ? 90   PHE A CB    1 
ATOM   672   C  CG    . PHE A 1  90   ? 111.587 123.379 87.300  1.00 52.23  ? 90   PHE A CG    1 
ATOM   673   C  CD1   . PHE A 1  90   ? 112.938 123.466 87.010  1.00 52.32  ? 90   PHE A CD1   1 
ATOM   674   C  CD2   . PHE A 1  90   ? 111.065 122.154 87.681  1.00 52.21  ? 90   PHE A CD2   1 
ATOM   675   C  CE1   . PHE A 1  90   ? 113.753 122.353 87.099  1.00 52.19  ? 90   PHE A CE1   1 
ATOM   676   C  CE2   . PHE A 1  90   ? 111.876 121.039 87.771  1.00 52.52  ? 90   PHE A CE2   1 
ATOM   677   C  CZ    . PHE A 1  90   ? 113.222 121.138 87.479  1.00 52.82  ? 90   PHE A CZ    1 
ATOM   678   N  N     . PHE A 1  91   ? 108.998 127.203 88.628  1.00 52.87  ? 91   PHE A N     1 
ATOM   679   C  CA    . PHE A 1  91   ? 108.353 128.467 88.283  1.00 53.93  ? 91   PHE A CA    1 
ATOM   680   C  C     . PHE A 1  91   ? 109.252 129.653 88.605  1.00 54.21  ? 91   PHE A C     1 
ATOM   681   O  O     . PHE A 1  91   ? 109.319 130.616 87.834  1.00 55.05  ? 91   PHE A O     1 
ATOM   682   C  CB    . PHE A 1  91   ? 107.015 128.595 89.012  1.00 55.53  ? 91   PHE A CB    1 
ATOM   683   C  CG    . PHE A 1  91   ? 106.278 129.870 88.706  1.00 55.86  ? 91   PHE A CG    1 
ATOM   684   C  CD1   . PHE A 1  91   ? 105.516 129.985 87.554  1.00 55.83  ? 91   PHE A CD1   1 
ATOM   685   C  CD2   . PHE A 1  91   ? 106.344 130.951 89.570  1.00 55.34  ? 91   PHE A CD2   1 
ATOM   686   C  CE1   . PHE A 1  91   ? 104.837 131.155 87.269  1.00 55.28  ? 91   PHE A CE1   1 
ATOM   687   C  CE2   . PHE A 1  91   ? 105.668 132.123 89.289  1.00 54.70  ? 91   PHE A CE2   1 
ATOM   688   C  CZ    . PHE A 1  91   ? 104.912 132.225 88.138  1.00 55.66  ? 91   PHE A CZ    1 
ATOM   689   N  N     . ASN A 1  92   ? 109.958 129.600 89.734  1.00 54.98  ? 92   ASN A N     1 
ATOM   690   C  CA    . ASN A 1  92   ? 110.870 130.677 90.095  1.00 55.89  ? 92   ASN A CA    1 
ATOM   691   C  C     . ASN A 1  92   ? 112.085 130.751 89.178  1.00 56.94  ? 92   ASN A C     1 
ATOM   692   O  O     . ASN A 1  92   ? 112.877 131.691 89.307  1.00 58.40  ? 92   ASN A O     1 
ATOM   693   C  CB    . ASN A 1  92   ? 111.325 130.513 91.548  1.00 58.96  ? 92   ASN A CB    1 
ATOM   694   C  CG    . ASN A 1  92   ? 111.682 131.836 92.206  1.00 58.92  ? 92   ASN A CG    1 
ATOM   695   O  OD1   . ASN A 1  92   ? 111.425 132.038 93.393  1.00 55.30  ? 92   ASN A OD1   1 
ATOM   696   N  ND2   . ASN A 1  92   ? 112.275 132.744 91.439  1.00 55.49  ? 92   ASN A ND2   1 
ATOM   697   N  N     . GLN A 1  93   ? 112.253 129.797 88.263  1.00 54.76  ? 93   GLN A N     1 
ATOM   698   C  CA    . GLN A 1  93   ? 113.405 129.758 87.373  1.00 54.52  ? 93   GLN A CA    1 
ATOM   699   C  C     . GLN A 1  93   ? 113.065 130.136 85.940  1.00 54.59  ? 93   GLN A C     1 
ATOM   700   O  O     . GLN A 1  93   ? 113.725 131.004 85.361  1.00 54.88  ? 93   GLN A O     1 
ATOM   701   C  CB    . GLN A 1  93   ? 114.049 128.365 87.410  1.00 54.69  ? 93   GLN A CB    1 
ATOM   702   C  CG    . GLN A 1  93   ? 114.446 127.902 88.807  1.00 54.73  ? 93   GLN A CG    1 
ATOM   703   C  CD    . GLN A 1  93   ? 115.321 128.907 89.537  1.00 54.42  ? 93   GLN A CD    1 
ATOM   704   O  OE1   . GLN A 1  93   ? 115.119 129.173 90.722  1.00 54.39  ? 93   GLN A OE1   1 
ATOM   705   N  NE2   . GLN A 1  93   ? 116.302 129.464 88.836  1.00 54.95  ? 93   GLN A NE2   1 
ATOM   706   N  N     . LEU A 1  94   ? 112.052 129.508 85.339  1.00 53.99  ? 94   LEU A N     1 
ATOM   707   C  CA    . LEU A 1  94   ? 111.706 129.837 83.961  1.00 53.66  ? 94   LEU A CA    1 
ATOM   708   C  C     . LEU A 1  94   ? 110.883 131.112 83.848  1.00 52.97  ? 94   LEU A C     1 
ATOM   709   O  O     . LEU A 1  94   ? 110.709 131.618 82.733  1.00 52.26  ? 94   LEU A O     1 
ATOM   710   C  CB    . LEU A 1  94   ? 110.943 128.687 83.294  1.00 52.48  ? 94   LEU A CB    1 
ATOM   711   C  CG    . LEU A 1  94   ? 109.413 128.685 83.385  1.00 51.71  ? 94   LEU A CG    1 
ATOM   712   C  CD1   . LEU A 1  94   ? 108.820 127.746 82.346  1.00 53.68  ? 94   LEU A CD1   1 
ATOM   713   C  CD2   . LEU A 1  94   ? 108.939 128.302 84.769  1.00 54.18  ? 94   LEU A CD2   1 
ATOM   714   N  N     . TYR A 1  95   ? 110.371 131.642 84.963  1.00 52.88  ? 95   TYR A N     1 
ATOM   715   C  CA    . TYR A 1  95   ? 109.631 132.898 84.902  1.00 52.08  ? 95   TYR A CA    1 
ATOM   716   C  C     . TYR A 1  95   ? 110.533 134.053 84.491  1.00 51.46  ? 95   TYR A C     1 
ATOM   717   O  O     . TYR A 1  95   ? 110.049 135.045 83.931  1.00 51.03  ? 95   TYR A O     1 
ATOM   718   C  CB    . TYR A 1  95   ? 108.968 133.197 86.245  1.00 51.70  ? 95   TYR A CB    1 
ATOM   719   C  CG    . TYR A 1  95   ? 108.116 134.442 86.233  1.00 52.03  ? 95   TYR A CG    1 
ATOM   720   C  CD1   . TYR A 1  95   ? 106.830 134.420 85.710  1.00 51.43  ? 95   TYR A CD1   1 
ATOM   721   C  CD2   . TYR A 1  95   ? 108.596 135.642 86.740  1.00 51.21  ? 95   TYR A CD2   1 
ATOM   722   C  CE1   . TYR A 1  95   ? 106.048 135.557 85.693  1.00 50.90  ? 95   TYR A CE1   1 
ATOM   723   C  CE2   . TYR A 1  95   ? 107.821 136.782 86.726  1.00 50.55  ? 95   TYR A CE2   1 
ATOM   724   C  CZ    . TYR A 1  95   ? 106.548 136.734 86.203  1.00 51.90  ? 95   TYR A CZ    1 
ATOM   725   O  OH    . TYR A 1  95   ? 105.774 137.871 86.188  1.00 51.66  ? 95   TYR A OH    1 
ATOM   726   N  N     . ILE A 1  96   ? 111.833 133.948 84.766  1.00 52.07  ? 96   ILE A N     1 
ATOM   727   C  CA    . ILE A 1  96   ? 112.784 134.931 84.254  1.00 52.39  ? 96   ILE A CA    1 
ATOM   728   C  C     . ILE A 1  96   ? 112.735 134.957 82.732  1.00 53.33  ? 96   ILE A C     1 
ATOM   729   O  O     . ILE A 1  96   ? 112.655 136.024 82.112  1.00 54.32  ? 96   ILE A O     1 
ATOM   730   C  CB    . ILE A 1  96   ? 114.204 134.630 84.772  1.00 54.81  ? 96   ILE A CB    1 
ATOM   731   C  CG1   . ILE A 1  96   ? 114.397 135.188 86.187  1.00 53.38  ? 96   ILE A CG1   1 
ATOM   732   C  CG2   . ILE A 1  96   ? 115.257 135.192 83.826  1.00 51.51  ? 96   ILE A CG2   1 
ATOM   733   C  CD1   . ILE A 1  96   ? 113.766 134.354 87.284  1.00 51.83  ? 96   ILE A CD1   1 
ATOM   734   N  N     . TYR A 1  97   ? 112.765 133.777 82.108  1.00 50.14  ? 97   TYR A N     1 
ATOM   735   C  CA    . TYR A 1  97   ? 112.592 133.702 80.662  1.00 49.44  ? 97   TYR A CA    1 
ATOM   736   C  C     . TYR A 1  97   ? 111.172 134.067 80.252  1.00 48.78  ? 97   TYR A C     1 
ATOM   737   O  O     . TYR A 1  97   ? 110.962 134.604 79.158  1.00 48.50  ? 97   TYR A O     1 
ATOM   738   C  CB    . TYR A 1  97   ? 112.940 132.301 80.161  1.00 48.84  ? 97   TYR A CB    1 
ATOM   739   C  CG    . TYR A 1  97   ? 114.295 131.804 80.611  1.00 49.46  ? 97   TYR A CG    1 
ATOM   740   C  CD1   . TYR A 1  97   ? 115.444 132.122 79.899  1.00 49.42  ? 97   TYR A CD1   1 
ATOM   741   C  CD2   . TYR A 1  97   ? 114.425 131.012 81.744  1.00 49.44  ? 97   TYR A CD2   1 
ATOM   742   C  CE1   . TYR A 1  97   ? 116.684 131.669 80.305  1.00 49.10  ? 97   TYR A CE1   1 
ATOM   743   C  CE2   . TYR A 1  97   ? 115.661 130.555 82.159  1.00 48.58  ? 97   TYR A CE2   1 
ATOM   744   C  CZ    . TYR A 1  97   ? 116.787 130.886 81.435  1.00 49.52  ? 97   TYR A CZ    1 
ATOM   745   O  OH    . TYR A 1  97   ? 118.020 130.433 81.843  1.00 49.86  ? 97   TYR A OH    1 
ATOM   746   N  N     . LEU A 1  98   ? 110.189 133.785 81.110  1.00 49.62  ? 98   LEU A N     1 
ATOM   747   C  CA    . LEU A 1  98   ? 108.802 134.098 80.780  1.00 49.92  ? 98   LEU A CA    1 
ATOM   748   C  C     . LEU A 1  98   ? 108.568 135.604 80.745  1.00 50.39  ? 98   LEU A C     1 
ATOM   749   O  O     . LEU A 1  98   ? 107.777 136.095 79.931  1.00 50.67  ? 98   LEU A O     1 
ATOM   750   C  CB    . LEU A 1  98   ? 107.864 133.418 81.781  1.00 50.32  ? 98   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1  98   ? 106.354 133.392 81.525  1.00 51.17  ? 98   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1  98   ? 105.663 134.613 82.116  1.00 49.82  ? 98   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1  98   ? 106.052 133.265 80.037  1.00 49.73  ? 98   LEU A CD2   1 
ATOM   754   N  N     . ARG A 1  99   ? 109.245 136.352 81.615  1.00 50.27  ? 99   ARG A N     1 
ATOM   755   C  CA    . ARG A 1  99   ? 109.090 137.800 81.660  1.00 51.16  ? 99   ARG A CA    1 
ATOM   756   C  C     . ARG A 1  99   ? 110.086 138.537 80.774  1.00 51.88  ? 99   ARG A C     1 
ATOM   757   O  O     . ARG A 1  99   ? 109.920 139.743 80.554  1.00 52.18  ? 99   ARG A O     1 
ATOM   758   C  CB    . ARG A 1  99   ? 109.227 138.310 83.099  1.00 52.54  ? 99   ARG A CB    1 
ATOM   759   C  CG    . ARG A 1  99   ? 110.653 138.313 83.625  1.00 52.85  ? 99   ARG A CG    1 
ATOM   760   C  CD    . ARG A 1  99   ? 110.842 139.361 84.714  1.00 53.55  ? 99   ARG A CD    1 
ATOM   761   N  NE    . ARG A 1  99   ? 110.282 138.949 85.998  1.00 54.04  ? 99   ARG A NE    1 
ATOM   762   C  CZ    . ARG A 1  99   ? 110.988 138.384 86.973  1.00 53.72  ? 99   ARG A CZ    1 
ATOM   763   N  NH1   . ARG A 1  99   ? 110.400 138.044 88.111  1.00 51.42  ? 99   ARG A NH1   1 
ATOM   764   N  NH2   . ARG A 1  99   ? 112.286 138.163 86.810  1.00 51.15  ? 99   ARG A NH2   1 
ATOM   765   N  N     . ALA A 1  100  ? 111.109 137.854 80.261  1.00 52.23  ? 100  ALA A N     1 
ATOM   766   C  CA    . ALA A 1  100  ? 112.117 138.490 79.422  1.00 53.32  ? 100  ALA A CA    1 
ATOM   767   C  C     . ALA A 1  100  ? 111.952 138.185 77.942  1.00 53.31  ? 100  ALA A C     1 
ATOM   768   O  O     . ALA A 1  100  ? 112.395 138.980 77.107  1.00 54.72  ? 100  ALA A O     1 
ATOM   769   C  CB    . ALA A 1  100  ? 113.524 138.069 79.863  1.00 54.98  ? 100  ALA A CB    1 
ATOM   770   N  N     . SER A 1  101  ? 111.335 137.059 77.595  1.00 56.59  ? 101  SER A N     1 
ATOM   771   C  CA    . SER A 1  101  ? 111.168 136.702 76.193  1.00 58.12  ? 101  SER A CA    1 
ATOM   772   C  C     . SER A 1  101  ? 110.155 137.620 75.523  1.00 58.18  ? 101  SER A C     1 
ATOM   773   O  O     . SER A 1  101  ? 109.097 137.922 76.082  1.00 58.30  ? 101  SER A O     1 
ATOM   774   C  CB    . SER A 1  101  ? 110.723 135.246 76.062  1.00 59.56  ? 101  SER A CB    1 
ATOM   775   O  OG    . SER A 1  101  ? 110.521 134.897 74.704  1.00 59.61  ? 101  SER A OG    1 
ATOM   776   N  N     . CYS A 1  102  ? 110.487 138.065 74.314  1.00 61.40  ? 102  CYS A N     1 
ATOM   777   C  CA    . CYS A 1  102  ? 109.589 138.919 73.555  1.00 62.97  ? 102  CYS A CA    1 
ATOM   778   C  C     . CYS A 1  102  ? 108.389 138.119 73.058  1.00 63.55  ? 102  CYS A C     1 
ATOM   779   O  O     . CYS A 1  102  ? 108.459 136.902 72.870  1.00 64.48  ? 102  CYS A O     1 
ATOM   780   C  CB    . CYS A 1  102  ? 110.329 139.554 72.378  1.00 64.09  ? 102  CYS A CB    1 
ATOM   781   S  SG    . CYS A 1  102  ? 109.420 140.856 71.516  1.00 64.19  ? 102  CYS A SG    1 
ATOM   782   N  N     . LEU A 1  103  ? 107.275 138.820 72.844  1.00 65.56  ? 103  LEU A N     1 
ATOM   783   C  CA    . LEU A 1  103  ? 106.030 138.173 72.454  1.00 66.66  ? 103  LEU A CA    1 
ATOM   784   C  C     . LEU A 1  103  ? 105.765 138.206 70.955  1.00 66.91  ? 103  LEU A C     1 
ATOM   785   O  O     . LEU A 1  103  ? 105.003 137.367 70.461  1.00 66.88  ? 103  LEU A O     1 
ATOM   786   C  CB    . LEU A 1  103  ? 104.846 138.811 73.197  1.00 66.67  ? 103  LEU A CB    1 
ATOM   787   C  CG    . LEU A 1  103  ? 104.800 140.337 73.325  1.00 66.91  ? 103  LEU A CG    1 
ATOM   788   C  CD1   . LEU A 1  103  ? 104.211 140.993 72.084  1.00 67.06  ? 103  LEU A CD1   1 
ATOM   789   C  CD2   . LEU A 1  103  ? 104.021 140.741 74.568  1.00 67.46  ? 103  LEU A CD2   1 
ATOM   790   N  N     . PHE A 1  104  ? 106.365 139.141 70.223  1.00 67.17  ? 104  PHE A N     1 
ATOM   791   C  CA    . PHE A 1  104  ? 106.198 139.227 68.776  1.00 67.53  ? 104  PHE A CA    1 
ATOM   792   C  C     . PHE A 1  104  ? 107.427 138.785 67.997  1.00 68.46  ? 104  PHE A C     1 
ATOM   793   O  O     . PHE A 1  104  ? 107.288 138.168 66.939  1.00 69.98  ? 104  PHE A O     1 
ATOM   794   C  CB    . PHE A 1  104  ? 105.830 140.659 68.367  1.00 70.91  ? 104  PHE A CB    1 
ATOM   795   C  CG    . PHE A 1  104  ? 104.383 140.997 68.587  1.00 72.12  ? 104  PHE A CG    1 
ATOM   796   C  CD1   . PHE A 1  104  ? 103.430 139.995 68.684  1.00 73.40  ? 104  PHE A CD1   1 
ATOM   797   C  CD2   . PHE A 1  104  ? 103.973 142.316 68.694  1.00 73.13  ? 104  PHE A CD2   1 
ATOM   798   C  CE1   . PHE A 1  104  ? 102.098 140.302 68.886  1.00 71.44  ? 104  PHE A CE1   1 
ATOM   799   C  CE2   . PHE A 1  104  ? 102.642 142.629 68.896  1.00 66.50  ? 104  PHE A CE2   1 
ATOM   800   C  CZ    . PHE A 1  104  ? 101.703 141.621 68.992  1.00 66.82  ? 104  PHE A CZ    1 
ATOM   801   N  N     . CYS A 1  105  ? 108.627 139.084 68.491  1.00 65.31  ? 105  CYS A N     1 
ATOM   802   C  CA    . CYS A 1  105  ? 109.851 138.649 67.831  1.00 64.67  ? 105  CYS A CA    1 
ATOM   803   C  C     . CYS A 1  105  ? 110.308 137.268 68.278  1.00 64.70  ? 105  CYS A C     1 
ATOM   804   O  O     . CYS A 1  105  ? 111.133 136.653 67.592  1.00 64.75  ? 105  CYS A O     1 
ATOM   805   C  CB    . CYS A 1  105  ? 110.974 139.663 68.071  1.00 63.97  ? 105  CYS A CB    1 
ATOM   806   S  SG    . CYS A 1  105  ? 111.366 139.964 69.809  1.00 63.96  ? 105  CYS A SG    1 
ATOM   807   N  N     . HIS A 1  106  ? 109.801 136.777 69.408  1.00 63.13  ? 106  HIS A N     1 
ATOM   808   C  CA    . HIS A 1  106  ? 110.106 135.461 69.965  1.00 62.88  ? 106  HIS A CA    1 
ATOM   809   C  C     . HIS A 1  106  ? 111.580 135.284 70.309  1.00 64.10  ? 106  HIS A C     1 
ATOM   810   O  O     . HIS A 1  106  ? 112.020 134.155 70.564  1.00 64.56  ? 106  HIS A O     1 
ATOM   811   C  CB    . HIS A 1  106  ? 109.649 134.334 69.028  1.00 64.82  ? 106  HIS A CB    1 
ATOM   812   C  CG    . HIS A 1  106  ? 108.162 134.227 68.894  1.00 64.51  ? 106  HIS A CG    1 
ATOM   813   N  ND1   . HIS A 1  106  ? 107.552 133.308 68.067  1.00 64.41  ? 106  HIS A ND1   1 
ATOM   814   C  CD2   . HIS A 1  106  ? 107.161 134.922 69.485  1.00 64.40  ? 106  HIS A CD2   1 
ATOM   815   C  CE1   . HIS A 1  106  ? 106.241 133.443 68.153  1.00 61.46  ? 106  HIS A CE1   1 
ATOM   816   N  NE2   . HIS A 1  106  ? 105.978 134.415 69.008  1.00 60.96  ? 106  HIS A NE2   1 
ATOM   817   N  N     . HIS A 1  107  ? 112.358 136.362 70.321  1.00 60.12  ? 107  HIS A N     1 
ATOM   818   C  CA    . HIS A 1  107  ? 113.736 136.332 70.778  1.00 59.14  ? 107  HIS A CA    1 
ATOM   819   C  C     . HIS A 1  107  ? 113.831 136.971 72.159  1.00 59.89  ? 107  HIS A C     1 
ATOM   820   O  O     . HIS A 1  107  ? 112.853 137.482 72.708  1.00 61.06  ? 107  HIS A O     1 
ATOM   821   C  CB    . HIS A 1  107  ? 114.654 137.052 69.786  1.00 61.93  ? 107  HIS A CB    1 
ATOM   822   C  CG    . HIS A 1  107  ? 114.767 136.376 68.456  1.00 62.65  ? 107  HIS A CG    1 
ATOM   823   N  ND1   . HIS A 1  107  ? 115.554 135.263 68.252  1.00 62.30  ? 107  HIS A ND1   1 
ATOM   824   C  CD2   . HIS A 1  107  ? 114.209 136.667 67.258  1.00 61.64  ? 107  HIS A CD2   1 
ATOM   825   C  CE1   . HIS A 1  107  ? 115.467 134.891 66.988  1.00 57.51  ? 107  HIS A CE1   1 
ATOM   826   N  NE2   . HIS A 1  107  ? 114.658 135.727 66.362  1.00 57.72  ? 107  HIS A NE2   1 
ATOM   827   N  N     . PHE A 1  108  ? 115.031 136.937 72.730  1.00 55.37  ? 108  PHE A N     1 
ATOM   828   C  CA    . PHE A 1  108  ? 115.296 137.723 73.924  1.00 53.88  ? 108  PHE A CA    1 
ATOM   829   C  C     . PHE A 1  108  ? 115.350 139.203 73.565  1.00 52.93  ? 108  PHE A C     1 
ATOM   830   O  O     . PHE A 1  108  ? 115.793 139.585 72.478  1.00 51.96  ? 108  PHE A O     1 
ATOM   831   C  CB    . PHE A 1  108  ? 116.608 137.291 74.578  1.00 51.25  ? 108  PHE A CB    1 
ATOM   832   C  CG    . PHE A 1  108  ? 116.489 136.055 75.423  1.00 51.00  ? 108  PHE A CG    1 
ATOM   833   C  CD1   . PHE A 1  108  ? 115.249 135.601 75.839  1.00 51.11  ? 108  PHE A CD1   1 
ATOM   834   C  CD2   . PHE A 1  108  ? 117.619 135.352 75.808  1.00 51.55  ? 108  PHE A CD2   1 
ATOM   835   C  CE1   . PHE A 1  108  ? 115.138 134.465 76.618  1.00 51.84  ? 108  PHE A CE1   1 
ATOM   836   C  CE2   . PHE A 1  108  ? 117.515 134.217 76.588  1.00 53.96  ? 108  PHE A CE2   1 
ATOM   837   C  CZ    . PHE A 1  108  ? 116.272 133.772 76.993  1.00 54.61  ? 108  PHE A CZ    1 
ATOM   838   N  N     . ARG A 1  109  ? 114.888 140.043 74.491  1.00 53.83  ? 109  ARG A N     1 
ATOM   839   C  CA    . ARG A 1  109  ? 114.865 141.477 74.232  1.00 54.25  ? 109  ARG A CA    1 
ATOM   840   C  C     . ARG A 1  109  ? 116.257 142.090 74.138  1.00 54.04  ? 109  ARG A C     1 
ATOM   841   O  O     . ARG A 1  109  ? 116.366 143.287 73.845  1.00 54.37  ? 109  ARG A O     1 
ATOM   842   C  CB    . ARG A 1  109  ? 114.041 142.193 75.304  1.00 54.71  ? 109  ARG A CB    1 
ATOM   843   C  CG    . ARG A 1  109  ? 112.559 141.850 75.264  1.00 54.63  ? 109  ARG A CG    1 
ATOM   844   C  CD    . ARG A 1  109  ? 111.734 142.804 76.115  1.00 54.70  ? 109  ARG A CD    1 
ATOM   845   N  NE    . ARG A 1  109  ? 112.020 142.668 77.540  1.00 54.61  ? 109  ARG A NE    1 
ATOM   846   C  CZ    . ARG A 1  109  ? 111.348 141.870 78.364  1.00 54.82  ? 109  ARG A CZ    1 
ATOM   847   N  NH1   . ARG A 1  109  ? 110.346 141.132 77.906  1.00 55.63  ? 109  ARG A NH1   1 
ATOM   848   N  NH2   . ARG A 1  109  ? 111.677 141.811 79.647  1.00 56.22  ? 109  ARG A NH2   1 
ATOM   849   N  N     . LEU A 1  110  ? 117.312 141.313 74.368  1.00 57.12  ? 110  LEU A N     1 
ATOM   850   C  CA    . LEU A 1  110  ? 118.675 141.764 74.122  1.00 58.12  ? 110  LEU A CA    1 
ATOM   851   C  C     . LEU A 1  110  ? 118.954 141.700 72.621  1.00 58.80  ? 110  LEU A C     1 
ATOM   852   O  O     . LEU A 1  110  ? 118.076 141.391 71.811  1.00 59.36  ? 110  LEU A O     1 
ATOM   853   C  CB    . LEU A 1  110  ? 119.672 140.921 74.914  1.00 59.45  ? 110  LEU A CB    1 
ATOM   854   C  CG    . LEU A 1  110  ? 119.849 141.128 76.423  1.00 59.93  ? 110  LEU A CG    1 
ATOM   855   C  CD1   . LEU A 1  110  ? 120.147 142.585 76.742  1.00 58.17  ? 110  LEU A CD1   1 
ATOM   856   C  CD2   . LEU A 1  110  ? 118.647 140.621 77.213  1.00 58.42  ? 110  LEU A CD2   1 
ATOM   857   N  N     . LYS A 1  111  ? 120.189 141.989 72.232  1.00 58.20  ? 111  LYS A N     1 
ATOM   858   C  CA    . LYS A 1  111  ? 120.623 141.841 70.852  1.00 58.67  ? 111  LYS A CA    1 
ATOM   859   C  C     . LYS A 1  111  ? 121.388 140.534 70.692  1.00 59.82  ? 111  LYS A C     1 
ATOM   860   O  O     . LYS A 1  111  ? 121.960 140.008 71.651  1.00 60.77  ? 111  LYS A O     1 
ATOM   861   C  CB    . LYS A 1  111  ? 121.497 143.019 70.409  1.00 61.83  ? 111  LYS A CB    1 
ATOM   862   C  CG    . LYS A 1  111  ? 122.894 143.043 71.014  1.00 62.64  ? 111  LYS A CG    1 
ATOM   863   C  CD    . LYS A 1  111  ? 122.907 143.690 72.390  1.00 63.01  ? 111  LYS A CD    1 
ATOM   864   C  CE    . LYS A 1  111  ? 122.504 145.153 72.314  1.00 58.32  ? 111  LYS A CE    1 
ATOM   865   N  NZ    . LYS A 1  111  ? 122.499 145.797 73.657  1.00 57.75  ? 111  LYS A NZ    1 
ATOM   866   N  N     . SER A 1  112  ? 121.390 140.009 69.465  1.00 58.40  ? 112  SER A N     1 
ATOM   867   C  CA    . SER A 1  112  ? 122.094 138.761 69.194  1.00 57.77  ? 112  SER A CA    1 
ATOM   868   C  C     . SER A 1  112  ? 123.592 138.880 69.435  1.00 57.92  ? 112  SER A C     1 
ATOM   869   O  O     . SER A 1  112  ? 124.265 137.857 69.593  1.00 57.26  ? 112  SER A O     1 
ATOM   870   C  CB    . SER A 1  112  ? 121.832 138.308 67.757  1.00 56.99  ? 112  SER A CB    1 
ATOM   871   O  OG    . SER A 1  112  ? 122.497 137.088 67.479  1.00 56.28  ? 112  SER A OG    1 
ATOM   872   N  N     . VAL A 1  113  ? 124.128 140.101 69.465  1.00 56.89  ? 113  VAL A N     1 
ATOM   873   C  CA    . VAL A 1  113  ? 125.549 140.285 69.742  1.00 56.85  ? 113  VAL A CA    1 
ATOM   874   C  C     . VAL A 1  113  ? 125.859 139.918 71.187  1.00 57.60  ? 113  VAL A C     1 
ATOM   875   O  O     . VAL A 1  113  ? 126.787 139.150 71.465  1.00 57.73  ? 113  VAL A O     1 
ATOM   876   C  CB    . VAL A 1  113  ? 125.971 141.731 69.425  1.00 58.06  ? 113  VAL A CB    1 
ATOM   877   C  CG1   . VAL A 1  113  ? 127.488 141.858 69.443  1.00 56.32  ? 113  VAL A CG1   1 
ATOM   878   C  CG2   . VAL A 1  113  ? 125.400 142.164 68.086  1.00 56.04  ? 113  VAL A CG2   1 
ATOM   879   N  N     . GLU A 1  114  ? 125.086 140.461 72.131  1.00 55.00  ? 114  GLU A N     1 
ATOM   880   C  CA    . GLU A 1  114  ? 125.331 140.187 73.542  1.00 54.11  ? 114  GLU A CA    1 
ATOM   881   C  C     . GLU A 1  114  ? 124.802 138.821 73.962  1.00 54.85  ? 114  GLU A C     1 
ATOM   882   O  O     . GLU A 1  114  ? 125.381 138.187 74.851  1.00 55.06  ? 114  GLU A O     1 
ATOM   883   C  CB    . GLU A 1  114  ? 124.702 141.280 74.409  1.00 54.92  ? 114  GLU A CB    1 
ATOM   884   C  CG    . GLU A 1  114  ? 125.232 141.329 75.834  1.00 55.04  ? 114  GLU A CG    1 
ATOM   885   C  CD    . GLU A 1  114  ? 126.673 141.799 75.906  1.00 54.77  ? 114  GLU A CD    1 
ATOM   886   O  OE1   . GLU A 1  114  ? 127.131 142.470 74.958  1.00 52.46  ? 114  GLU A OE1   1 
ATOM   887   O  OE2   . GLU A 1  114  ? 127.349 141.497 76.912  1.00 51.44  ? 114  GLU A OE2   1 
ATOM   888   N  N     . VAL A 1  115  ? 123.711 138.358 73.346  1.00 52.07  ? 115  VAL A N     1 
ATOM   889   C  CA    . VAL A 1  115  ? 123.210 137.017 73.638  1.00 52.41  ? 115  VAL A CA    1 
ATOM   890   C  C     . VAL A 1  115  ? 124.234 135.971 73.220  1.00 52.92  ? 115  VAL A C     1 
ATOM   891   O  O     . VAL A 1  115  ? 124.553 135.048 73.979  1.00 53.00  ? 115  VAL A O     1 
ATOM   892   C  CB    . VAL A 1  115  ? 121.852 136.786 72.950  1.00 53.07  ? 115  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1  115  ? 121.439 135.327 73.068  1.00 52.61  ? 115  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1  115  ? 120.791 137.686 73.560  1.00 52.87  ? 115  VAL A CG2   1 
ATOM   895   N  N     . HIS A 1  116  ? 124.772 136.104 72.005  1.00 53.01  ? 116  HIS A N     1 
ATOM   896   C  CA    . HIS A 1  116  ? 125.839 135.212 71.571  1.00 53.25  ? 116  HIS A CA    1 
ATOM   897   C  C     . HIS A 1  116  ? 127.140 135.477 72.313  1.00 52.98  ? 116  HIS A C     1 
ATOM   898   O  O     . HIS A 1  116  ? 127.978 134.575 72.404  1.00 52.69  ? 116  HIS A O     1 
ATOM   899   C  CB    . HIS A 1  116  ? 126.059 135.342 70.063  1.00 52.73  ? 116  HIS A CB    1 
ATOM   900   C  CG    . HIS A 1  116  ? 127.022 134.342 69.502  1.00 52.54  ? 116  HIS A CG    1 
ATOM   901   N  ND1   . HIS A 1  116  ? 128.380 134.566 69.447  1.00 52.40  ? 116  HIS A ND1   1 
ATOM   902   C  CD2   . HIS A 1  116  ? 126.821 133.114 68.968  1.00 52.43  ? 116  HIS A CD2   1 
ATOM   903   C  CE1   . HIS A 1  116  ? 128.976 133.517 68.906  1.00 53.82  ? 116  HIS A CE1   1 
ATOM   904   N  NE2   . HIS A 1  116  ? 128.052 132.622 68.606  1.00 53.65  ? 116  HIS A NE2   1 
ATOM   905   N  N     . ARG A 1  117  ? 127.327 136.685 72.849  1.00 55.05  ? 117  ARG A N     1 
ATOM   906   C  CA    . ARG A 1  117  ? 128.515 136.967 73.650  1.00 56.32  ? 117  ARG A CA    1 
ATOM   907   C  C     . ARG A 1  117  ? 128.518 136.140 74.928  1.00 57.61  ? 117  ARG A C     1 
ATOM   908   O  O     . ARG A 1  117  ? 129.511 135.475 75.249  1.00 58.39  ? 117  ARG A O     1 
ATOM   909   C  CB    . ARG A 1  117  ? 128.588 138.459 73.976  1.00 58.50  ? 117  ARG A CB    1 
ATOM   910   C  CG    . ARG A 1  117  ? 129.593 138.829 75.063  1.00 57.93  ? 117  ARG A CG    1 
ATOM   911   C  CD    . ARG A 1  117  ? 131.010 138.959 74.522  1.00 57.38  ? 117  ARG A CD    1 
ATOM   912   N  NE    . ARG A 1  117  ? 131.602 137.667 74.187  1.00 57.08  ? 117  ARG A NE    1 
ATOM   913   C  CZ    . ARG A 1  117  ? 132.806 137.518 73.645  1.00 57.67  ? 117  ARG A CZ    1 
ATOM   914   N  NH1   . ARG A 1  117  ? 133.550 138.582 73.374  1.00 55.64  ? 117  ARG A NH1   1 
ATOM   915   N  NH2   . ARG A 1  117  ? 133.265 136.305 73.371  1.00 55.14  ? 117  ARG A NH2   1 
ATOM   916   N  N     . TYR A 1  118  ? 127.413 136.173 75.674  1.00 55.50  ? 118  TYR A N     1 
ATOM   917   C  CA    . TYR A 1  118  ? 127.306 135.346 76.871  1.00 55.71  ? 118  TYR A CA    1 
ATOM   918   C  C     . TYR A 1  118  ? 127.251 133.868 76.515  1.00 56.87  ? 118  TYR A C     1 
ATOM   919   O  O     . TYR A 1  118  ? 127.826 133.031 77.220  1.00 58.35  ? 118  TYR A O     1 
ATOM   920   C  CB    . TYR A 1  118  ? 126.075 135.755 77.677  1.00 59.40  ? 118  TYR A CB    1 
ATOM   921   C  CG    . TYR A 1  118  ? 126.147 137.164 78.220  1.00 60.03  ? 118  TYR A CG    1 
ATOM   922   C  CD1   . TYR A 1  118  ? 127.358 137.711 78.622  1.00 60.33  ? 118  TYR A CD1   1 
ATOM   923   C  CD2   . TYR A 1  118  ? 125.007 137.947 78.322  1.00 61.03  ? 118  TYR A CD2   1 
ATOM   924   C  CE1   . TYR A 1  118  ? 127.430 138.998 79.117  1.00 59.92  ? 118  TYR A CE1   1 
ATOM   925   C  CE2   . TYR A 1  118  ? 125.068 139.235 78.815  1.00 59.15  ? 118  TYR A CE2   1 
ATOM   926   C  CZ    . TYR A 1  118  ? 126.282 139.756 79.212  1.00 55.25  ? 118  TYR A CZ    1 
ATOM   927   O  OH    . TYR A 1  118  ? 126.349 141.040 79.703  1.00 54.04  ? 118  TYR A OH    1 
ATOM   928   N  N     . ALA A 1  119  ? 126.564 133.526 75.421  1.00 56.99  ? 119  ALA A N     1 
ATOM   929   C  CA    . ALA A 1  119  ? 126.495 132.135 74.994  1.00 58.84  ? 119  ALA A CA    1 
ATOM   930   C  C     . ALA A 1  119  ? 127.837 131.608 74.509  1.00 59.52  ? 119  ALA A C     1 
ATOM   931   O  O     . ALA A 1  119  ? 128.054 130.394 74.542  1.00 59.80  ? 119  ALA A O     1 
ATOM   932   C  CB    . ALA A 1  119  ? 125.446 131.970 73.894  1.00 60.88  ? 119  ALA A CB    1 
ATOM   933   N  N     . CYS A 1  120  ? 128.737 132.484 74.060  1.00 60.15  ? 120  CYS A N     1 
ATOM   934   C  CA    . CYS A 1  120  ? 130.054 132.063 73.597  1.00 60.61  ? 120  CYS A CA    1 
ATOM   935   C  C     . CYS A 1  120  ? 131.063 132.008 74.739  1.00 62.00  ? 120  CYS A C     1 
ATOM   936   O  O     . CYS A 1  120  ? 131.858 131.066 74.823  1.00 63.83  ? 120  CYS A O     1 
ATOM   937   C  CB    . CYS A 1  120  ? 130.554 133.004 72.497  1.00 59.40  ? 120  CYS A CB    1 
ATOM   938   S  SG    . CYS A 1  120  ? 131.711 132.258 71.334  1.00 58.63  ? 120  CYS A SG    1 
ATOM   939   N  N     . LYS A 1  121  ? 131.050 133.015 75.616  1.00 58.65  ? 121  LYS A N     1 
ATOM   940   C  CA    . LYS A 1  121  ? 131.895 132.974 76.805  1.00 57.91  ? 121  LYS A CA    1 
ATOM   941   C  C     . LYS A 1  121  ? 131.553 131.767 77.669  1.00 58.82  ? 121  LYS A C     1 
ATOM   942   O  O     . LYS A 1  121  ? 132.441 131.107 78.220  1.00 59.11  ? 121  LYS A O     1 
ATOM   943   C  CB    . LYS A 1  121  ? 131.743 134.271 77.602  1.00 59.24  ? 121  LYS A CB    1 
ATOM   944   C  CG    . LYS A 1  121  ? 132.480 134.278 78.932  1.00 59.38  ? 121  LYS A CG    1 
ATOM   945   C  CD    . LYS A 1  121  ? 132.170 135.536 79.727  1.00 59.38  ? 121  LYS A CD    1 
ATOM   946   C  CE    . LYS A 1  121  ? 132.861 135.522 81.081  1.00 56.07  ? 121  LYS A CE    1 
ATOM   947   N  NZ    . LYS A 1  121  ? 134.344 135.502 80.949  1.00 54.87  ? 121  LYS A NZ    1 
ATOM   948   N  N     . LEU A 1  122  ? 130.260 131.462 77.793  1.00 55.26  ? 122  LEU A N     1 
ATOM   949   C  CA    . LEU A 1  122  ? 129.852 130.257 78.506  1.00 54.93  ? 122  LEU A CA    1 
ATOM   950   C  C     . LEU A 1  122  ? 130.176 129.006 77.699  1.00 54.62  ? 122  LEU A C     1 
ATOM   951   O  O     . LEU A 1  122  ? 130.468 127.949 78.270  1.00 54.26  ? 122  LEU A O     1 
ATOM   952   C  CB    . LEU A 1  122  ? 128.362 130.322 78.839  1.00 54.41  ? 122  LEU A CB    1 
ATOM   953   C  CG    . LEU A 1  122  ? 127.974 130.893 80.207  1.00 53.94  ? 122  LEU A CG    1 
ATOM   954   C  CD1   . LEU A 1  122  ? 128.390 132.350 80.347  1.00 55.87  ? 122  LEU A CD1   1 
ATOM   955   C  CD2   . LEU A 1  122  ? 126.480 130.734 80.449  1.00 54.88  ? 122  LEU A CD2   1 
ATOM   956   N  N     . ARG A 1  123  ? 130.136 129.106 76.366  1.00 58.64  ? 123  ARG A N     1 
ATOM   957   C  CA    . ARG A 1  123  ? 130.522 127.981 75.518  1.00 61.01  ? 123  ARG A CA    1 
ATOM   958   C  C     . ARG A 1  123  ? 131.994 127.625 75.679  1.00 61.78  ? 123  ARG A C     1 
ATOM   959   O  O     . ARG A 1  123  ? 132.409 126.535 75.269  1.00 62.67  ? 123  ARG A O     1 
ATOM   960   C  CB    . ARG A 1  123  ? 130.216 128.299 74.052  1.00 63.44  ? 123  ARG A CB    1 
ATOM   961   C  CG    . ARG A 1  123  ? 130.277 127.106 73.109  1.00 64.73  ? 123  ARG A CG    1 
ATOM   962   C  CD    . ARG A 1  123  ? 129.264 126.041 73.497  1.00 66.39  ? 123  ARG A CD    1 
ATOM   963   N  NE    . ARG A 1  123  ? 127.891 126.532 73.413  1.00 66.93  ? 123  ARG A NE    1 
ATOM   964   C  CZ    . ARG A 1  123  ? 127.140 126.468 72.319  1.00 67.11  ? 123  ARG A CZ    1 
ATOM   965   N  NH1   . ARG A 1  123  ? 127.628 125.934 71.208  1.00 62.28  ? 123  ARG A NH1   1 
ATOM   966   N  NH2   . ARG A 1  123  ? 125.900 126.939 72.334  1.00 62.91  ? 123  ARG A NH2   1 
ATOM   967   N  N     . LEU A 1  124  ? 132.788 128.519 76.264  1.00 62.66  ? 124  LEU A N     1 
ATOM   968   C  CA    . LEU A 1  124  ? 134.192 128.265 76.551  1.00 62.52  ? 124  LEU A CA    1 
ATOM   969   C  C     . LEU A 1  124  ? 134.448 127.988 78.028  1.00 64.12  ? 124  LEU A C     1 
ATOM   970   O  O     . LEU A 1  124  ? 135.542 127.533 78.379  1.00 65.18  ? 124  LEU A O     1 
ATOM   971   C  CB    . LEU A 1  124  ? 135.037 129.461 76.082  1.00 66.16  ? 124  LEU A CB    1 
ATOM   972   C  CG    . LEU A 1  124  ? 136.564 129.441 76.178  1.00 65.13  ? 124  LEU A CG    1 
ATOM   973   C  CD1   . LEU A 1  124  ? 137.184 129.964 74.894  1.00 59.97  ? 124  LEU A CD1   1 
ATOM   974   C  CD2   . LEU A 1  124  ? 137.025 130.271 77.365  1.00 59.07  ? 124  LEU A CD2   1 
ATOM   975   N  N     . LEU A 1  125  ? 133.458 128.216 78.892  1.00 57.75  ? 125  LEU A N     1 
ATOM   976   C  CA    . LEU A 1  125  ? 133.658 128.158 80.334  1.00 56.41  ? 125  LEU A CA    1 
ATOM   977   C  C     . LEU A 1  125  ? 133.487 126.760 80.919  1.00 56.76  ? 125  LEU A C     1 
ATOM   978   O  O     . LEU A 1  125  ? 133.858 126.548 82.079  1.00 57.02  ? 125  LEU A O     1 
ATOM   979   C  CB    . LEU A 1  125  ? 132.695 129.129 81.025  1.00 57.19  ? 125  LEU A CB    1 
ATOM   980   C  CG    . LEU A 1  125  ? 132.988 129.538 82.471  1.00 57.07  ? 125  LEU A CG    1 
ATOM   981   C  CD1   . LEU A 1  125  ? 134.380 130.142 82.586  1.00 54.48  ? 125  LEU A CD1   1 
ATOM   982   C  CD2   . LEU A 1  125  ? 131.936 130.511 82.978  1.00 53.96  ? 125  LEU A CD2   1 
ATOM   983   N  N     . GLN A 1  126  ? 132.946 125.800 80.161  1.00 53.63  ? 126  GLN A N     1 
ATOM   984   C  CA    . GLN A 1  126  ? 132.734 124.468 80.722  1.00 53.64  ? 126  GLN A CA    1 
ATOM   985   C  C     . GLN A 1  126  ? 134.057 123.771 81.015  1.00 54.49  ? 126  GLN A C     1 
ATOM   986   O  O     . GLN A 1  126  ? 134.161 123.010 81.984  1.00 55.28  ? 126  GLN A O     1 
ATOM   987   C  CB    . GLN A 1  126  ? 131.871 123.617 79.785  1.00 55.95  ? 126  GLN A CB    1 
ATOM   988   C  CG    . GLN A 1  126  ? 132.479 123.330 78.423  1.00 56.56  ? 126  GLN A CG    1 
ATOM   989   C  CD    . GLN A 1  126  ? 132.274 124.464 77.446  1.00 55.94  ? 126  GLN A CD    1 
ATOM   990   O  OE1   . GLN A 1  126  ? 131.621 125.457 77.762  1.00 52.78  ? 126  GLN A OE1   1 
ATOM   991   N  NE2   . GLN A 1  126  ? 132.832 124.326 76.248  1.00 52.36  ? 126  GLN A NE2   1 
ATOM   992   N  N     . TYR A 1  127  ? 135.076 124.015 80.195  1.00 52.88  ? 127  TYR A N     1 
ATOM   993   C  CA    . TYR A 1  127  ? 136.397 123.466 80.450  1.00 53.34  ? 127  TYR A CA    1 
ATOM   994   C  C     . TYR A 1  127  ? 137.178 124.404 81.368  1.00 53.74  ? 127  TYR A C     1 
ATOM   995   O  O     . TYR A 1  127  ? 136.700 125.469 81.769  1.00 53.84  ? 127  TYR A O     1 
ATOM   996   C  CB    . TYR A 1  127  ? 137.140 123.231 79.137  1.00 53.41  ? 127  TYR A CB    1 
ATOM   997   C  CG    . TYR A 1  127  ? 136.446 122.278 78.191  1.00 53.45  ? 127  TYR A CG    1 
ATOM   998   C  CD1   . TYR A 1  127  ? 136.543 120.903 78.365  1.00 53.57  ? 127  TYR A CD1   1 
ATOM   999   C  CD2   . TYR A 1  127  ? 135.703 122.751 77.118  1.00 53.19  ? 127  TYR A CD2   1 
ATOM   1000  C  CE1   . TYR A 1  127  ? 135.913 120.028 77.501  1.00 53.89  ? 127  TYR A CE1   1 
ATOM   1001  C  CE2   . TYR A 1  127  ? 135.070 121.882 76.249  1.00 54.19  ? 127  TYR A CE2   1 
ATOM   1002  C  CZ    . TYR A 1  127  ? 135.178 120.522 76.445  1.00 53.36  ? 127  TYR A CZ    1 
ATOM   1003  O  OH    . TYR A 1  127  ? 134.549 119.654 75.582  1.00 52.86  ? 127  TYR A OH    1 
ATOM   1004  N  N     . GLY A 1  128  ? 138.400 124.005 81.708  1.00 54.16  ? 128  GLY A N     1 
ATOM   1005  C  CA    . GLY A 1  128  ? 139.243 124.832 82.549  1.00 55.00  ? 128  GLY A CA    1 
ATOM   1006  C  C     . GLY A 1  128  ? 139.939 125.925 81.766  1.00 55.86  ? 128  GLY A C     1 
ATOM   1007  O  O     . GLY A 1  128  ? 141.167 125.921 81.632  1.00 56.35  ? 128  GLY A O     1 
ATOM   1008  N  N     . LEU A 1  129  ? 139.161 126.869 81.245  1.00 56.79  ? 129  LEU A N     1 
ATOM   1009  C  CA    . LEU A 1  129  ? 139.664 127.969 80.432  1.00 57.77  ? 129  LEU A CA    1 
ATOM   1010  C  C     . LEU A 1  129  ? 139.260 129.314 81.022  1.00 58.09  ? 129  LEU A C     1 
ATOM   1011  O  O     . LEU A 1  129  ? 138.833 130.224 80.309  1.00 58.15  ? 129  LEU A O     1 
ATOM   1012  C  CB    . LEU A 1  129  ? 139.178 127.852 78.989  1.00 58.12  ? 129  LEU A CB    1 
ATOM   1013  C  CG    . LEU A 1  129  ? 139.985 126.980 78.023  1.00 57.99  ? 129  LEU A CG    1 
ATOM   1014  C  CD1   . LEU A 1  129  ? 141.449 127.401 78.015  1.00 57.82  ? 129  LEU A CD1   1 
ATOM   1015  C  CD2   . LEU A 1  129  ? 139.846 125.503 78.355  1.00 58.13  ? 129  LEU A CD2   1 
ATOM   1016  N  N     . ILE A 1  130  ? 139.386 129.451 82.345  1.00 58.62  ? 130  ILE A N     1 
ATOM   1017  C  CA    . ILE A 1  130  ? 139.083 130.719 82.997  1.00 59.20  ? 130  ILE A CA    1 
ATOM   1018  C  C     . ILE A 1  130  ? 140.029 131.818 82.533  1.00 60.22  ? 130  ILE A C     1 
ATOM   1019  O  O     . ILE A 1  130  ? 139.680 133.003 82.589  1.00 60.51  ? 130  ILE A O     1 
ATOM   1020  C  CB    . ILE A 1  130  ? 139.126 130.548 84.533  1.00 60.13  ? 130  ILE A CB    1 
ATOM   1021  C  CG1   . ILE A 1  130  ? 138.582 131.795 85.235  1.00 60.59  ? 130  ILE A CG1   1 
ATOM   1022  C  CG2   . ILE A 1  130  ? 140.540 130.235 85.003  1.00 58.61  ? 130  ILE A CG2   1 
ATOM   1023  C  CD1   . ILE A 1  130  ? 137.150 132.121 84.875  1.00 58.15  ? 130  ILE A CD1   1 
ATOM   1024  N  N     . ASP A 1  131  ? 141.221 131.452 82.056  1.00 57.93  ? 131  ASP A N     1 
ATOM   1025  C  CA    . ASP A 1  131  ? 142.143 132.446 81.516  1.00 57.11  ? 131  ASP A CA    1 
ATOM   1026  C  C     . ASP A 1  131  ? 141.608 133.034 80.215  1.00 58.47  ? 131  ASP A C     1 
ATOM   1027  O  O     . ASP A 1  131  ? 141.610 134.256 80.027  1.00 59.53  ? 131  ASP A O     1 
ATOM   1028  C  CB    . ASP A 1  131  ? 143.520 131.818 81.300  1.00 60.22  ? 131  ASP A CB    1 
ATOM   1029  C  CG    . ASP A 1  131  ? 144.029 131.094 82.530  1.00 60.05  ? 131  ASP A CG    1 
ATOM   1030  O  OD1   . ASP A 1  131  ? 143.639 131.480 83.652  1.00 54.93  ? 131  ASP A OD1   1 
ATOM   1031  O  OD2   . ASP A 1  131  ? 144.818 130.139 82.375  1.00 54.68  ? 131  ASP A OD2   1 
ATOM   1032  N  N     . GLU A 1  132  ? 141.143 132.177 79.306  1.00 53.28  ? 132  GLU A N     1 
ATOM   1033  C  CA    . GLU A 1  132  ? 140.584 132.627 78.038  1.00 52.35  ? 132  GLU A CA    1 
ATOM   1034  C  C     . GLU A 1  132  ? 139.156 133.139 78.167  1.00 52.18  ? 132  GLU A C     1 
ATOM   1035  O  O     . GLU A 1  132  ? 138.618 133.670 77.189  1.00 52.34  ? 132  GLU A O     1 
ATOM   1036  C  CB    . GLU A 1  132  ? 140.626 131.491 77.012  1.00 52.09  ? 132  GLU A CB    1 
ATOM   1037  C  CG    . GLU A 1  132  ? 142.025 130.973 76.708  1.00 51.67  ? 132  GLU A CG    1 
ATOM   1038  C  CD    . GLU A 1  132  ? 142.860 131.965 75.921  1.00 52.25  ? 132  GLU A CD    1 
ATOM   1039  O  OE1   . GLU A 1  132  ? 142.272 132.844 75.254  1.00 52.08  ? 132  GLU A OE1   1 
ATOM   1040  O  OE2   . GLU A 1  132  ? 144.104 131.866 75.970  1.00 52.22  ? 132  GLU A OE2   1 
ATOM   1041  N  N     . SER A 1  133  ? 138.531 132.991 79.337  1.00 52.39  ? 133  SER A N     1 
ATOM   1042  C  CA    . SER A 1  133  ? 137.166 133.472 79.519  1.00 53.25  ? 133  SER A CA    1 
ATOM   1043  C  C     . SER A 1  133  ? 137.099 134.989 79.385  1.00 53.30  ? 133  SER A C     1 
ATOM   1044  O  O     . SER A 1  133  ? 136.323 135.520 78.582  1.00 53.32  ? 133  SER A O     1 
ATOM   1045  C  CB    . SER A 1  133  ? 136.630 133.026 80.880  1.00 53.82  ? 133  SER A CB    1 
ATOM   1046  O  OG    . SER A 1  133  ? 137.404 133.569 81.934  1.00 54.08  ? 133  SER A OG    1 
ATOM   1047  N  N     . TYR A 1  134  ? 137.908 135.706 80.168  1.00 54.24  ? 134  TYR A N     1 
ATOM   1048  C  CA    . TYR A 1  134  ? 137.954 137.158 80.053  1.00 54.34  ? 134  TYR A CA    1 
ATOM   1049  C  C     . TYR A 1  134  ? 138.687 137.613 78.800  1.00 54.99  ? 134  TYR A C     1 
ATOM   1050  O  O     . TYR A 1  134  ? 138.519 138.765 78.384  1.00 55.50  ? 134  TYR A O     1 
ATOM   1051  C  CB    . TYR A 1  134  ? 138.606 137.768 81.294  1.00 55.54  ? 134  TYR A CB    1 
ATOM   1052  C  CG    . TYR A 1  134  ? 137.683 137.848 82.488  1.00 55.47  ? 134  TYR A CG    1 
ATOM   1053  C  CD1   . TYR A 1  134  ? 136.304 137.789 82.329  1.00 55.71  ? 134  TYR A CD1   1 
ATOM   1054  C  CD2   . TYR A 1  134  ? 138.187 137.985 83.775  1.00 55.53  ? 134  TYR A CD2   1 
ATOM   1055  C  CE1   . TYR A 1  134  ? 135.455 137.864 83.416  1.00 56.09  ? 134  TYR A CE1   1 
ATOM   1056  C  CE2   . TYR A 1  134  ? 137.345 138.061 84.868  1.00 55.86  ? 134  TYR A CE2   1 
ATOM   1057  C  CZ    . TYR A 1  134  ? 135.980 138.000 84.683  1.00 53.66  ? 134  TYR A CZ    1 
ATOM   1058  O  OH    . TYR A 1  134  ? 135.138 138.074 85.769  1.00 53.59  ? 134  TYR A OH    1 
ATOM   1059  N  N     . LYS A 1  135  ? 139.494 136.742 78.190  1.00 53.67  ? 135  LYS A N     1 
ATOM   1060  C  CA    . LYS A 1  135  ? 140.136 137.086 76.927  1.00 54.19  ? 135  LYS A CA    1 
ATOM   1061  C  C     . LYS A 1  135  ? 139.143 137.136 75.774  1.00 55.55  ? 135  LYS A C     1 
ATOM   1062  O  O     . LYS A 1  135  ? 139.420 137.786 74.761  1.00 56.34  ? 135  LYS A O     1 
ATOM   1063  C  CB    . LYS A 1  135  ? 141.257 136.094 76.613  1.00 56.86  ? 135  LYS A CB    1 
ATOM   1064  C  CG    . LYS A 1  135  ? 142.441 136.179 77.562  1.00 56.89  ? 135  LYS A CG    1 
ATOM   1065  C  CD    . LYS A 1  135  ? 143.557 135.235 77.145  1.00 56.81  ? 135  LYS A CD    1 
ATOM   1066  C  CE    . LYS A 1  135  ? 144.092 135.589 75.766  1.00 53.87  ? 135  LYS A CE    1 
ATOM   1067  N  NZ    . LYS A 1  135  ? 145.194 134.679 75.348  1.00 53.46  ? 135  LYS A NZ    1 
ATOM   1068  N  N     . LEU A 1  136  ? 137.998 136.464 75.906  1.00 54.56  ? 136  LEU A N     1 
ATOM   1069  C  CA    . LEU A 1  136  ? 136.969 136.536 74.874  1.00 55.65  ? 136  LEU A CA    1 
ATOM   1070  C  C     . LEU A 1  136  ? 136.290 137.898 74.849  1.00 56.07  ? 136  LEU A C     1 
ATOM   1071  O  O     . LEU A 1  136  ? 135.845 138.348 73.787  1.00 56.36  ? 136  LEU A O     1 
ATOM   1072  C  CB    . LEU A 1  136  ? 135.932 135.436 75.094  1.00 56.26  ? 136  LEU A CB    1 
ATOM   1073  C  CG    . LEU A 1  136  ? 136.139 134.114 74.357  1.00 56.36  ? 136  LEU A CG    1 
ATOM   1074  C  CD1   . LEU A 1  136  ? 135.132 133.081 74.831  1.00 56.58  ? 136  LEU A CD1   1 
ATOM   1075  C  CD2   . LEU A 1  136  ? 136.017 134.331 72.859  1.00 57.13  ? 136  LEU A CD2   1 
ATOM   1076  N  N     . ASP A 1  137  ? 136.203 138.568 76.000  1.00 57.77  ? 137  ASP A N     1 
ATOM   1077  C  CA    . ASP A 1  137  ? 135.448 139.813 76.090  1.00 58.99  ? 137  ASP A CA    1 
ATOM   1078  C  C     . ASP A 1  137  ? 136.194 140.979 75.449  1.00 59.28  ? 137  ASP A C     1 
ATOM   1079  O  O     . ASP A 1  137  ? 135.570 141.860 74.848  1.00 59.71  ? 137  ASP A O     1 
ATOM   1080  C  CB    . ASP A 1  137  ? 135.134 140.122 77.555  1.00 59.77  ? 137  ASP A CB    1 
ATOM   1081  C  CG    . ASP A 1  137  ? 133.948 141.057 77.717  1.00 60.29  ? 137  ASP A CG    1 
ATOM   1082  O  OD1   . ASP A 1  137  ? 133.517 141.664 76.715  1.00 59.91  ? 137  ASP A OD1   1 
ATOM   1083  O  OD2   . ASP A 1  137  ? 133.447 141.186 78.853  1.00 59.58  ? 137  ASP A OD2   1 
ATOM   1084  N  N     . GLU A 1  138  ? 137.519 141.000 75.556  1.00 61.27  ? 138  GLU A N     1 
ATOM   1085  C  CA    . GLU A 1  138  ? 138.308 142.151 75.116  1.00 62.12  ? 138  GLU A CA    1 
ATOM   1086  C  C     . GLU A 1  138  ? 138.657 142.077 73.631  1.00 62.32  ? 138  GLU A C     1 
ATOM   1087  O  O     . GLU A 1  138  ? 139.811 142.227 73.235  1.00 62.45  ? 138  GLU A O     1 
ATOM   1088  C  CB    . GLU A 1  138  ? 139.564 142.265 75.972  1.00 62.54  ? 138  GLU A CB    1 
ATOM   1089  C  CG    . GLU A 1  138  ? 140.191 140.927 76.356  1.00 62.87  ? 138  GLU A CG    1 
ATOM   1090  C  CD    . GLU A 1  138  ? 141.338 140.523 75.447  1.00 62.43  ? 138  GLU A CD    1 
ATOM   1091  O  OE1   . GLU A 1  138  ? 141.837 141.383 74.697  1.00 62.91  ? 138  GLU A OE1   1 
ATOM   1092  O  OE2   . GLU A 1  138  ? 141.750 139.346 75.484  1.00 63.02  ? 138  GLU A OE2   1 
ATOM   1093  N  N     . ILE A 1  139  ? 137.649 141.878 72.785  1.00 63.83  ? 139  ILE A N     1 
ATOM   1094  C  CA    . ILE A 1  139  ? 137.831 141.841 71.337  1.00 64.93  ? 139  ILE A CA    1 
ATOM   1095  C  C     . ILE A 1  139  ? 136.766 142.735 70.719  1.00 65.60  ? 139  ILE A C     1 
ATOM   1096  O  O     . ILE A 1  139  ? 135.587 142.361 70.669  1.00 66.24  ? 139  ILE A O     1 
ATOM   1097  C  CB    . ILE A 1  139  ? 137.741 140.418 70.767  1.00 66.28  ? 139  ILE A CB    1 
ATOM   1098  C  CG1   . ILE A 1  139  ? 138.682 139.469 71.512  1.00 65.56  ? 139  ILE A CG1   1 
ATOM   1099  C  CG2   . ILE A 1  139  ? 138.090 140.429 69.289  1.00 65.26  ? 139  ILE A CG2   1 
ATOM   1100  C  CD1   . ILE A 1  139  ? 140.151 139.724 71.247  1.00 64.40  ? 139  ILE A CD1   1 
ATOM   1101  N  N     . THR A 1  140  ? 137.173 143.914 70.247  1.00 67.43  ? 140  THR A N     1 
ATOM   1102  C  CA    . THR A 1  140  ? 136.251 144.843 69.595  1.00 69.84  ? 140  THR A CA    1 
ATOM   1103  C  C     . THR A 1  140  ? 137.037 145.582 68.514  1.00 70.81  ? 140  THR A C     1 
ATOM   1104  O  O     . THR A 1  140  ? 137.716 146.571 68.804  1.00 71.52  ? 140  THR A O     1 
ATOM   1105  C  CB    . THR A 1  140  ? 135.634 145.809 70.597  1.00 70.64  ? 140  THR A CB    1 
ATOM   1106  O  OG1   . THR A 1  140  ? 134.951 145.071 71.618  1.00 70.41  ? 140  THR A OG1   1 
ATOM   1107  C  CG2   . THR A 1  140  ? 134.642 146.733 69.903  1.00 71.21  ? 140  THR A CG2   1 
ATOM   1108  N  N     . LEU A 1  141  ? 136.942 145.094 67.279  1.00 69.49  ? 141  LEU A N     1 
ATOM   1109  C  CA    . LEU A 1  141  ? 137.648 145.699 66.160  1.00 68.34  ? 141  LEU A CA    1 
ATOM   1110  C  C     . LEU A 1  141  ? 136.824 145.519 64.893  1.00 66.57  ? 141  LEU A C     1 
ATOM   1111  O  O     . LEU A 1  141  ? 136.033 144.580 64.778  1.00 65.44  ? 141  LEU A O     1 
ATOM   1112  C  CB    . LEU A 1  141  ? 139.050 145.097 65.988  1.00 65.11  ? 141  LEU A CB    1 
ATOM   1113  C  CG    . LEU A 1  141  ? 139.208 143.574 66.064  1.00 65.28  ? 141  LEU A CG    1 
ATOM   1114  C  CD1   . LEU A 1  141  ? 138.918 142.904 64.725  1.00 68.80  ? 141  LEU A CD1   1 
ATOM   1115  C  CD2   . LEU A 1  141  ? 140.598 143.206 66.561  1.00 68.29  ? 141  LEU A CD2   1 
ATOM   1116  N  N     . GLY A 1  142  ? 137.020 146.430 63.946  1.00 69.83  ? 142  GLY A N     1 
ATOM   1117  C  CA    . GLY A 1  142  ? 136.306 146.383 62.683  1.00 70.07  ? 142  GLY A CA    1 
ATOM   1118  C  C     . GLY A 1  142  ? 137.055 147.051 61.547  1.00 70.10  ? 142  GLY A C     1 
ATOM   1119  O  O     . GLY A 1  142  ? 138.048 147.743 61.767  1.00 69.38  ? 142  GLY A O     1 
ATOM   1120  N  N     . ASP A 1  172  ? 120.815 150.320 63.245  1.00 81.58  ? 172  ASP A N     1 
ATOM   1121  C  CA    . ASP A 1  172  ? 121.635 151.493 63.529  1.00 81.63  ? 172  ASP A CA    1 
ATOM   1122  C  C     . ASP A 1  172  ? 123.004 151.377 62.868  1.00 81.83  ? 172  ASP A C     1 
ATOM   1123  O  O     . ASP A 1  172  ? 123.733 152.361 62.751  1.00 81.92  ? 172  ASP A O     1 
ATOM   1124  C  CB    . ASP A 1  172  ? 121.792 151.686 65.038  1.00 82.11  ? 172  ASP A CB    1 
ATOM   1125  C  CG    . ASP A 1  172  ? 122.446 150.495 65.712  1.00 81.80  ? 172  ASP A CG    1 
ATOM   1126  O  OD1   . ASP A 1  172  ? 122.303 149.366 65.198  1.00 81.46  ? 172  ASP A OD1   1 
ATOM   1127  O  OD2   . ASP A 1  172  ? 123.102 150.688 66.757  1.00 82.41  ? 172  ASP A OD2   1 
ATOM   1128  N  N     . ILE A 1  173  ? 123.348 150.163 62.436  1.00 79.63  ? 173  ILE A N     1 
ATOM   1129  C  CA    . ILE A 1  173  ? 124.634 149.902 61.801  1.00 77.81  ? 173  ILE A CA    1 
ATOM   1130  C  C     . ILE A 1  173  ? 124.471 148.675 60.916  1.00 77.28  ? 173  ILE A C     1 
ATOM   1131  O  O     . ILE A 1  173  ? 123.557 147.872 61.104  1.00 76.79  ? 173  ILE A O     1 
ATOM   1132  C  CB    . ILE A 1  173  ? 125.753 149.710 62.857  1.00 76.62  ? 173  ILE A CB    1 
ATOM   1133  C  CG1   . ILE A 1  173  ? 127.131 149.961 62.241  1.00 77.25  ? 173  ILE A CG1   1 
ATOM   1134  C  CG2   . ILE A 1  173  ? 125.681 148.319 63.472  1.00 76.59  ? 173  ILE A CG2   1 
ATOM   1135  C  CD1   . ILE A 1  173  ? 128.255 149.977 63.253  1.00 76.15  ? 173  ILE A CD1   1 
ATOM   1136  N  N     . SER A 1  174  ? 125.358 148.539 59.930  1.00 75.25  ? 174  SER A N     1 
ATOM   1137  C  CA    . SER A 1  174  ? 125.290 147.408 59.015  1.00 74.05  ? 174  SER A CA    1 
ATOM   1138  C  C     . SER A 1  174  ? 125.531 146.101 59.759  1.00 73.92  ? 174  SER A C     1 
ATOM   1139  O  O     . SER A 1  174  ? 126.378 146.020 60.652  1.00 73.26  ? 174  SER A O     1 
ATOM   1140  C  CB    . SER A 1  174  ? 126.317 147.573 57.893  1.00 72.84  ? 174  SER A CB    1 
ATOM   1141  O  OG    . SER A 1  174  ? 127.633 147.634 58.412  1.00 72.56  ? 174  SER A OG    1 
ATOM   1142  N  N     . SER A 1  175  ? 124.777 145.068 59.380  1.00 71.93  ? 175  SER A N     1 
ATOM   1143  C  CA    . SER A 1  175  ? 124.862 143.773 60.043  1.00 71.87  ? 175  SER A CA    1 
ATOM   1144  C  C     . SER A 1  175  ? 126.029 142.925 59.557  1.00 72.20  ? 175  SER A C     1 
ATOM   1145  O  O     . SER A 1  175  ? 126.317 141.892 60.172  1.00 72.03  ? 175  SER A O     1 
ATOM   1146  C  CB    . SER A 1  175  ? 123.554 142.999 59.853  1.00 71.24  ? 175  SER A CB    1 
ATOM   1147  O  OG    . SER A 1  175  ? 122.454 143.715 60.387  1.00 71.31  ? 175  SER A OG    1 
ATOM   1148  N  N     . THR A 1  176  ? 126.699 143.327 58.473  1.00 69.58  ? 176  THR A N     1 
ATOM   1149  C  CA    . THR A 1  176  ? 127.824 142.547 57.968  1.00 68.00  ? 176  THR A CA    1 
ATOM   1150  C  C     . THR A 1  176  ? 128.958 142.489 58.984  1.00 67.88  ? 176  THR A C     1 
ATOM   1151  O  O     . THR A 1  176  ? 129.566 141.432 59.189  1.00 68.00  ? 176  THR A O     1 
ATOM   1152  C  CB    . THR A 1  176  ? 128.320 143.132 56.645  1.00 67.67  ? 176  THR A CB    1 
ATOM   1153  O  OG1   . THR A 1  176  ? 127.245 143.156 55.698  1.00 66.72  ? 176  THR A OG1   1 
ATOM   1154  C  CG2   . THR A 1  176  ? 129.462 142.296 56.084  1.00 66.27  ? 176  THR A CG2   1 
ATOM   1155  N  N     . LEU A 1  177  ? 129.254 143.617 59.635  1.00 65.36  ? 177  LEU A N     1 
ATOM   1156  C  CA    . LEU A 1  177  ? 130.301 143.620 60.651  1.00 64.10  ? 177  LEU A CA    1 
ATOM   1157  C  C     . LEU A 1  177  ? 129.906 142.788 61.863  1.00 63.74  ? 177  LEU A C     1 
ATOM   1158  O  O     . LEU A 1  177  ? 130.780 142.292 62.582  1.00 63.08  ? 177  LEU A O     1 
ATOM   1159  C  CB    . LEU A 1  177  ? 130.634 145.055 61.064  1.00 62.82  ? 177  LEU A CB    1 
ATOM   1160  C  CG    . LEU A 1  177  ? 129.532 145.908 61.693  1.00 62.85  ? 177  LEU A CG    1 
ATOM   1161  C  CD1   . LEU A 1  177  ? 129.670 145.944 63.209  1.00 63.39  ? 177  LEU A CD1   1 
ATOM   1162  C  CD2   . LEU A 1  177  ? 129.558 147.313 61.114  1.00 63.47  ? 177  LEU A CD2   1 
ATOM   1163  N  N     . LEU A 1  178  ? 128.604 142.623 62.108  1.00 62.65  ? 178  LEU A N     1 
ATOM   1164  C  CA    . LEU A 1  178  ? 128.174 141.732 63.180  1.00 62.31  ? 178  LEU A CA    1 
ATOM   1165  C  C     . LEU A 1  178  ? 128.334 140.274 62.774  1.00 60.91  ? 178  LEU A C     1 
ATOM   1166  O  O     . LEU A 1  178  ? 128.569 139.408 63.624  1.00 60.21  ? 178  LEU A O     1 
ATOM   1167  C  CB    . LEU A 1  178  ? 126.725 142.023 63.574  1.00 59.97  ? 178  LEU A CB    1 
ATOM   1168  C  CG    . LEU A 1  178  ? 126.433 143.306 64.360  1.00 60.16  ? 178  LEU A CG    1 
ATOM   1169  C  CD1   . LEU A 1  178  ? 127.451 143.502 65.478  1.00 63.81  ? 178  LEU A CD1   1 
ATOM   1170  C  CD2   . LEU A 1  178  ? 126.354 144.530 63.463  1.00 64.35  ? 178  LEU A CD2   1 
ATOM   1171  N  N     . ASN A 1  179  ? 128.206 139.982 61.477  1.00 64.91  ? 179  ASN A N     1 
ATOM   1172  C  CA    . ASN A 1  179  ? 128.387 138.613 61.004  1.00 65.65  ? 179  ASN A CA    1 
ATOM   1173  C  C     . ASN A 1  179  ? 129.837 138.170 61.152  1.00 66.66  ? 179  ASN A C     1 
ATOM   1174  O  O     . ASN A 1  179  ? 130.113 137.046 61.591  1.00 66.84  ? 179  ASN A O     1 
ATOM   1175  C  CB    . ASN A 1  179  ? 127.931 138.496 59.548  1.00 66.76  ? 179  ASN A CB    1 
ATOM   1176  C  CG    . ASN A 1  179  ? 126.439 138.711 59.385  1.00 67.01  ? 179  ASN A CG    1 
ATOM   1177  O  OD1   . ASN A 1  179  ? 126.004 139.554 58.600  1.00 64.47  ? 179  ASN A OD1   1 
ATOM   1178  N  ND2   . ASN A 1  179  ? 125.647 137.948 60.128  1.00 64.00  ? 179  ASN A ND2   1 
ATOM   1179  N  N     . GLU A 1  180  ? 130.781 139.041 60.790  1.00 63.18  ? 180  GLU A N     1 
ATOM   1180  C  CA    . GLU A 1  180  ? 132.190 138.708 60.966  1.00 62.23  ? 180  GLU A CA    1 
ATOM   1181  C  C     . GLU A 1  180  ? 132.592 138.690 62.434  1.00 62.95  ? 180  GLU A C     1 
ATOM   1182  O  O     . GLU A 1  180  ? 133.582 138.038 62.784  1.00 63.49  ? 180  GLU A O     1 
ATOM   1183  C  CB    . GLU A 1  180  ? 133.071 139.683 60.178  1.00 64.17  ? 180  GLU A CB    1 
ATOM   1184  C  CG    . GLU A 1  180  ? 132.972 141.139 60.605  1.00 64.94  ? 180  GLU A CG    1 
ATOM   1185  C  CD    . GLU A 1  180  ? 133.934 141.496 61.722  1.00 64.15  ? 180  GLU A CD    1 
ATOM   1186  O  OE1   . GLU A 1  180  ? 134.881 140.718 61.967  1.00 60.43  ? 180  GLU A OE1   1 
ATOM   1187  O  OE2   . GLU A 1  180  ? 133.746 142.557 62.355  1.00 60.71  ? 180  GLU A OE2   1 
ATOM   1188  N  N     . LEU A 1  181  ? 131.854 139.391 63.297  1.00 58.22  ? 181  LEU A N     1 
ATOM   1189  C  CA    . LEU A 1  181  ? 132.083 139.261 64.732  1.00 56.94  ? 181  LEU A CA    1 
ATOM   1190  C  C     . LEU A 1  181  ? 131.699 137.871 65.221  1.00 57.25  ? 181  LEU A C     1 
ATOM   1191  O  O     . LEU A 1  181  ? 132.435 137.257 66.001  1.00 58.02  ? 181  LEU A O     1 
ATOM   1192  C  CB    . LEU A 1  181  ? 131.305 140.333 65.497  1.00 58.45  ? 181  LEU A CB    1 
ATOM   1193  C  CG    . LEU A 1  181  ? 131.879 141.751 65.507  1.00 58.07  ? 181  LEU A CG    1 
ATOM   1194  C  CD1   . LEU A 1  181  ? 131.002 142.678 66.336  1.00 55.60  ? 181  LEU A CD1   1 
ATOM   1195  C  CD2   . LEU A 1  181  ? 133.307 141.757 66.027  1.00 56.12  ? 181  LEU A CD2   1 
ATOM   1196  N  N     . LYS A 1  182  ? 130.551 137.359 64.768  1.00 56.57  ? 182  LYS A N     1 
ATOM   1197  C  CA    . LYS A 1  182  ? 130.141 136.007 65.140  1.00 57.78  ? 182  LYS A CA    1 
ATOM   1198  C  C     . LYS A 1  182  ? 131.125 134.974 64.606  1.00 57.42  ? 182  LYS A C     1 
ATOM   1199  O  O     . LYS A 1  182  ? 131.486 134.021 65.307  1.00 57.16  ? 182  LYS A O     1 
ATOM   1200  C  CB    . LYS A 1  182  ? 128.729 135.726 64.623  1.00 57.36  ? 182  LYS A CB    1 
ATOM   1201  C  CG    . LYS A 1  182  ? 127.671 136.684 65.141  1.00 57.40  ? 182  LYS A CG    1 
ATOM   1202  C  CD    . LYS A 1  182  ? 127.572 136.637 66.657  1.00 57.77  ? 182  LYS A CD    1 
ATOM   1203  C  CE    . LYS A 1  182  ? 126.493 137.579 67.164  1.00 59.56  ? 182  LYS A CE    1 
ATOM   1204  N  NZ    . LYS A 1  182  ? 126.757 138.990 66.769  1.00 59.95  ? 182  LYS A NZ    1 
ATOM   1205  N  N     . SER A 1  183  ? 131.565 135.144 63.356  1.00 60.81  ? 183  SER A N     1 
ATOM   1206  C  CA    . SER A 1  183  ? 132.585 134.258 62.807  1.00 61.14  ? 183  SER A CA    1 
ATOM   1207  C  C     . SER A 1  183  ? 133.897 134.385 63.567  1.00 61.71  ? 183  SER A C     1 
ATOM   1208  O  O     . SER A 1  183  ? 134.660 133.416 63.657  1.00 61.74  ? 183  SER A O     1 
ATOM   1209  C  CB    . SER A 1  183  ? 132.798 134.556 61.322  1.00 60.78  ? 183  SER A CB    1 
ATOM   1210  O  OG    . SER A 1  183  ? 133.783 133.703 60.767  1.00 60.08  ? 183  SER A OG    1 
ATOM   1211  N  N     . LYS A 1  184  ? 134.178 135.567 64.118  1.00 61.29  ? 184  LYS A N     1 
ATOM   1212  C  CA    . LYS A 1  184  ? 135.369 135.736 64.943  1.00 61.93  ? 184  LYS A CA    1 
ATOM   1213  C  C     . LYS A 1  184  ? 135.225 135.004 66.271  1.00 63.25  ? 184  LYS A C     1 
ATOM   1214  O  O     . LYS A 1  184  ? 136.194 134.421 66.773  1.00 64.45  ? 184  LYS A O     1 
ATOM   1215  C  CB    . LYS A 1  184  ? 135.643 137.225 65.164  1.00 65.01  ? 184  LYS A CB    1 
ATOM   1216  C  CG    . LYS A 1  184  ? 136.795 137.530 66.108  1.00 65.56  ? 184  LYS A CG    1 
ATOM   1217  C  CD    . LYS A 1  184  ? 136.291 137.902 67.493  1.00 65.52  ? 184  LYS A CD    1 
ATOM   1218  C  CE    . LYS A 1  184  ? 135.304 139.055 67.423  1.00 61.51  ? 184  LYS A CE    1 
ATOM   1219  N  NZ    . LYS A 1  184  ? 134.882 139.513 68.775  1.00 61.67  ? 184  LYS A NZ    1 
ATOM   1220  N  N     . ARG A 1  185  ? 134.026 135.026 66.857  1.00 60.94  ? 185  ARG A N     1 
ATOM   1221  C  CA    . ARG A 1  185  ? 133.787 134.281 68.088  1.00 60.53  ? 185  ARG A CA    1 
ATOM   1222  C  C     . ARG A 1  185  ? 133.968 132.785 67.861  1.00 59.72  ? 185  ARG A C     1 
ATOM   1223  O  O     . ARG A 1  185  ? 134.548 132.082 68.696  1.00 59.15  ? 185  ARG A O     1 
ATOM   1224  C  CB    . ARG A 1  185  ? 132.382 134.574 68.617  1.00 58.92  ? 185  ARG A CB    1 
ATOM   1225  C  CG    . ARG A 1  185  ? 132.090 136.045 68.857  1.00 58.94  ? 185  ARG A CG    1 
ATOM   1226  C  CD    . ARG A 1  185  ? 132.871 136.592 70.038  1.00 59.20  ? 185  ARG A CD    1 
ATOM   1227  N  NE    . ARG A 1  185  ? 132.703 138.037 70.171  1.00 59.31  ? 185  ARG A NE    1 
ATOM   1228  C  CZ    . ARG A 1  185  ? 131.659 138.619 70.753  1.00 59.49  ? 185  ARG A CZ    1 
ATOM   1229  N  NH1   . ARG A 1  185  ? 130.679 137.881 71.256  1.00 61.71  ? 185  ARG A NH1   1 
ATOM   1230  N  NH2   . ARG A 1  185  ? 131.592 139.941 70.828  1.00 60.92  ? 185  ARG A NH2   1 
ATOM   1231  N  N     . SER A 1  186  ? 133.474 132.282 66.728  1.00 64.18  ? 186  SER A N     1 
ATOM   1232  C  CA    . SER A 1  186  ? 133.600 130.859 66.429  1.00 66.25  ? 186  SER A CA    1 
ATOM   1233  C  C     . SER A 1  186  ? 135.052 130.480 66.161  1.00 67.91  ? 186  SER A C     1 
ATOM   1234  O  O     . SER A 1  186  ? 135.553 129.484 66.696  1.00 68.78  ? 186  SER A O     1 
ATOM   1235  C  CB    . SER A 1  186  ? 132.717 130.496 65.235  1.00 65.81  ? 186  SER A CB    1 
ATOM   1236  O  OG    . SER A 1  186  ? 132.820 129.118 64.924  1.00 65.01  ? 186  SER A OG    1 
ATOM   1237  N  N     . GLU A 1  187  ? 135.747 131.267 65.335  1.00 66.20  ? 187  GLU A N     1 
ATOM   1238  C  CA    . GLU A 1  187  ? 137.121 130.937 64.974  1.00 66.36  ? 187  GLU A CA    1 
ATOM   1239  C  C     . GLU A 1  187  ? 138.080 131.056 66.152  1.00 68.47  ? 187  GLU A C     1 
ATOM   1240  O  O     . GLU A 1  187  ? 139.151 130.438 66.125  1.00 69.54  ? 187  GLU A O     1 
ATOM   1241  C  CB    . GLU A 1  187  ? 137.596 131.831 63.825  1.00 70.54  ? 187  GLU A CB    1 
ATOM   1242  C  CG    . GLU A 1  187  ? 137.919 133.258 64.230  1.00 71.79  ? 187  GLU A CG    1 
ATOM   1243  C  CD    . GLU A 1  187  ? 138.311 134.126 63.050  1.00 70.04  ? 187  GLU A CD    1 
ATOM   1244  O  OE1   . GLU A 1  187  ? 138.281 133.626 61.907  1.00 64.77  ? 187  GLU A OE1   1 
ATOM   1245  O  OE2   . GLU A 1  187  ? 138.649 135.308 63.266  1.00 64.44  ? 187  GLU A OE2   1 
ATOM   1246  N  N     . TYR A 1  188  ? 137.729 131.829 67.179  1.00 63.81  ? 188  TYR A N     1 
ATOM   1247  C  CA    . TYR A 1  188  ? 138.582 131.968 68.353  1.00 63.53  ? 188  TYR A CA    1 
ATOM   1248  C  C     . TYR A 1  188  ? 138.303 130.881 69.386  1.00 64.28  ? 188  TYR A C     1 
ATOM   1249  O  O     . TYR A 1  188  ? 139.237 130.282 69.928  1.00 65.03  ? 188  TYR A O     1 
ATOM   1250  C  CB    . TYR A 1  188  ? 138.397 133.355 68.979  1.00 66.00  ? 188  TYR A CB    1 
ATOM   1251  C  CG    . TYR A 1  188  ? 139.369 133.661 70.098  1.00 66.65  ? 188  TYR A CG    1 
ATOM   1252  C  CD1   . TYR A 1  188  ? 140.599 134.249 69.834  1.00 66.42  ? 188  TYR A CD1   1 
ATOM   1253  C  CD2   . TYR A 1  188  ? 139.055 133.365 71.418  1.00 66.94  ? 188  TYR A CD2   1 
ATOM   1254  C  CE1   . TYR A 1  188  ? 141.490 134.531 70.852  1.00 65.58  ? 188  TYR A CE1   1 
ATOM   1255  C  CE2   . TYR A 1  188  ? 139.939 133.644 72.443  1.00 64.98  ? 188  TYR A CE2   1 
ATOM   1256  C  CZ    . TYR A 1  188  ? 141.155 134.227 72.155  1.00 62.59  ? 188  TYR A CZ    1 
ATOM   1257  O  OH    . TYR A 1  188  ? 142.037 134.505 73.174  1.00 61.92  ? 188  TYR A OH    1 
ATOM   1258  N  N     . VAL A 1  189  ? 137.025 130.620 69.671  1.00 62.46  ? 189  VAL A N     1 
ATOM   1259  C  CA    . VAL A 1  189  ? 136.675 129.597 70.650  1.00 62.77  ? 189  VAL A CA    1 
ATOM   1260  C  C     . VAL A 1  189  ? 137.039 128.211 70.132  1.00 62.59  ? 189  VAL A C     1 
ATOM   1261  O  O     . VAL A 1  189  ? 137.533 127.363 70.885  1.00 62.84  ? 189  VAL A O     1 
ATOM   1262  C  CB    . VAL A 1  189  ? 135.183 129.699 71.014  1.00 62.14  ? 189  VAL A CB    1 
ATOM   1263  C  CG1   . VAL A 1  189  ? 134.743 128.492 71.828  1.00 63.63  ? 189  VAL A CG1   1 
ATOM   1264  C  CG2   . VAL A 1  189  ? 134.927 130.977 71.786  1.00 62.42  ? 189  VAL A CG2   1 
ATOM   1265  N  N     . ASP A 1  190  ? 136.811 127.959 68.840  1.00 66.07  ? 190  ASP A N     1 
ATOM   1266  C  CA    . ASP A 1  190  ? 137.178 126.667 68.269  1.00 68.19  ? 190  ASP A CA    1 
ATOM   1267  C  C     . ASP A 1  190  ? 138.684 126.448 68.331  1.00 70.02  ? 190  ASP A C     1 
ATOM   1268  O  O     . ASP A 1  190  ? 139.146 125.318 68.522  1.00 71.17  ? 190  ASP A O     1 
ATOM   1269  C  CB    . ASP A 1  190  ? 136.680 126.563 66.828  1.00 71.34  ? 190  ASP A CB    1 
ATOM   1270  C  CG    . ASP A 1  190  ? 136.974 125.212 66.206  1.00 71.86  ? 190  ASP A CG    1 
ATOM   1271  O  OD1   . ASP A 1  190  ? 136.147 124.291 66.363  1.00 67.86  ? 190  ASP A OD1   1 
ATOM   1272  O  OD2   . ASP A 1  190  ? 138.034 125.073 65.559  1.00 67.50  ? 190  ASP A OD2   1 
ATOM   1273  N  N     . MET A 1  191  ? 139.466 127.518 68.174  1.00 68.20  ? 191  MET A N     1 
ATOM   1274  C  CA    . MET A 1  191  ? 140.917 127.400 68.267  1.00 68.49  ? 191  MET A CA    1 
ATOM   1275  C  C     . MET A 1  191  ? 141.376 127.248 69.712  1.00 69.96  ? 191  MET A C     1 
ATOM   1276  O  O     . MET A 1  191  ? 142.264 126.439 70.001  1.00 70.65  ? 191  MET A O     1 
ATOM   1277  C  CB    . MET A 1  191  ? 141.586 128.612 67.618  1.00 70.92  ? 191  MET A CB    1 
ATOM   1278  C  CG    . MET A 1  191  ? 143.105 128.565 67.631  1.00 70.94  ? 191  MET A CG    1 
ATOM   1279  S  SD    . MET A 1  191  ? 143.764 127.121 66.776  1.00 67.04  ? 191  MET A SD    1 
ATOM   1280  C  CE    . MET A 1  191  ? 143.105 127.372 65.129  1.00 66.91  ? 191  MET A CE    1 
ATOM   1281  N  N     . ALA A 1  192  ? 140.786 128.020 70.628  1.00 65.09  ? 192  ALA A N     1 
ATOM   1282  C  CA    . ALA A 1  192  ? 141.149 127.911 72.038  1.00 63.51  ? 192  ALA A CA    1 
ATOM   1283  C  C     . ALA A 1  192  ? 140.783 126.540 72.592  1.00 63.44  ? 192  ALA A C     1 
ATOM   1284  O  O     . ALA A 1  192  ? 141.577 125.910 73.301  1.00 61.84  ? 192  ALA A O     1 
ATOM   1285  C  CB    . ALA A 1  192  ? 140.468 129.019 72.842  1.00 60.59  ? 192  ALA A CB    1 
ATOM   1286  N  N     . ILE A 1  193  ? 139.574 126.061 72.282  1.00 61.09  ? 193  ILE A N     1 
ATOM   1287  C  CA    . ILE A 1  193  ? 139.168 124.728 72.715  1.00 60.99  ? 193  ILE A CA    1 
ATOM   1288  C  C     . ILE A 1  193  ? 140.036 123.663 72.060  1.00 61.50  ? 193  ILE A C     1 
ATOM   1289  O  O     . ILE A 1  193  ? 140.373 122.651 72.689  1.00 61.39  ? 193  ILE A O     1 
ATOM   1290  C  CB    . ILE A 1  193  ? 137.666 124.509 72.425  1.00 61.09  ? 193  ILE A CB    1 
ATOM   1291  C  CG1   . ILE A 1  193  ? 136.820 124.876 73.649  1.00 61.84  ? 193  ILE A CG1   1 
ATOM   1292  C  CG2   . ILE A 1  193  ? 137.385 123.074 71.994  1.00 60.69  ? 193  ILE A CG2   1 
ATOM   1293  C  CD1   . ILE A 1  193  ? 136.842 126.347 74.005  1.00 59.96  ? 193  ILE A CD1   1 
ATOM   1294  N  N     . ALA A 1  194  ? 140.427 123.874 70.799  1.00 60.85  ? 194  ALA A N     1 
ATOM   1295  C  CA    . ALA A 1  194  ? 141.307 122.920 70.132  1.00 60.68  ? 194  ALA A CA    1 
ATOM   1296  C  C     . ALA A 1  194  ? 142.634 122.783 70.867  1.00 60.76  ? 194  ALA A C     1 
ATOM   1297  O  O     . ALA A 1  194  ? 143.068 121.668 71.171  1.00 60.61  ? 194  ALA A O     1 
ATOM   1298  C  CB    . ALA A 1  194  ? 141.543 123.339 68.681  1.00 60.27  ? 194  ALA A CB    1 
ATOM   1299  N  N     . LYS A 1  195  ? 143.288 123.909 71.165  1.00 61.33  ? 195  LYS A N     1 
ATOM   1300  C  CA    . LYS A 1  195  ? 144.564 123.860 71.874  1.00 62.05  ? 195  LYS A CA    1 
ATOM   1301  C  C     . LYS A 1  195  ? 144.402 123.286 73.275  1.00 62.30  ? 195  LYS A C     1 
ATOM   1302  O  O     . LYS A 1  195  ? 145.272 122.549 73.754  1.00 62.63  ? 195  LYS A O     1 
ATOM   1303  C  CB    . LYS A 1  195  ? 145.183 125.257 71.936  1.00 62.65  ? 195  LYS A CB    1 
ATOM   1304  C  CG    . LYS A 1  195  ? 145.513 125.854 70.577  1.00 62.71  ? 195  LYS A CG    1 
ATOM   1305  C  CD    . LYS A 1  195  ? 146.119 127.249 70.696  1.00 62.50  ? 195  LYS A CD    1 
ATOM   1306  C  CE    . LYS A 1  195  ? 147.596 127.208 71.078  1.00 62.48  ? 195  LYS A CE    1 
ATOM   1307  N  NZ    . LYS A 1  195  ? 147.832 126.913 72.520  1.00 61.77  ? 195  LYS A NZ    1 
ATOM   1308  N  N     . ALA A 1  196  ? 143.300 123.617 73.951  1.00 63.48  ? 196  ALA A N     1 
ATOM   1309  C  CA    . ALA A 1  196  ? 143.057 123.081 75.286  1.00 64.30  ? 196  ALA A CA    1 
ATOM   1310  C  C     . ALA A 1  196  ? 142.900 121.567 75.247  1.00 64.50  ? 196  ALA A C     1 
ATOM   1311  O  O     . ALA A 1  196  ? 143.549 120.841 76.008  1.00 64.15  ? 196  ALA A O     1 
ATOM   1312  C  CB    . ALA A 1  196  ? 141.819 123.738 75.897  1.00 63.32  ? 196  ALA A CB    1 
ATOM   1313  N  N     . LEU A 1  197  ? 142.039 121.069 74.357  1.00 64.60  ? 197  LEU A N     1 
ATOM   1314  C  CA    . LEU A 1  197  ? 141.864 119.632 74.192  1.00 65.29  ? 197  LEU A CA    1 
ATOM   1315  C  C     . LEU A 1  197  ? 143.055 118.966 73.516  1.00 65.22  ? 197  LEU A C     1 
ATOM   1316  O  O     . LEU A 1  197  ? 143.074 117.735 73.411  1.00 65.30  ? 197  LEU A O     1 
ATOM   1317  C  CB    . LEU A 1  197  ? 140.591 119.344 73.390  1.00 65.50  ? 197  LEU A CB    1 
ATOM   1318  C  CG    . LEU A 1  197  ? 139.254 119.286 74.139  1.00 65.13  ? 197  LEU A CG    1 
ATOM   1319  C  CD1   . LEU A 1  197  ? 139.310 118.245 75.245  1.00 66.51  ? 197  LEU A CD1   1 
ATOM   1320  C  CD2   . LEU A 1  197  ? 138.844 120.643 74.695  1.00 66.96  ? 197  LEU A CD2   1 
ATOM   1321  N  N     . SER A 1  198  ? 144.044 119.738 73.060  1.00 67.66  ? 198  SER A N     1 
ATOM   1322  C  CA    . SER A 1  198  ? 145.181 119.154 72.358  1.00 68.79  ? 198  SER A CA    1 
ATOM   1323  C  C     . SER A 1  198  ? 146.312 118.797 73.316  1.00 69.00  ? 198  SER A C     1 
ATOM   1324  O  O     . SER A 1  198  ? 146.830 117.675 73.281  1.00 69.40  ? 198  SER A O     1 
ATOM   1325  C  CB    . SER A 1  198  ? 145.688 120.113 71.279  1.00 69.49  ? 198  SER A CB    1 
ATOM   1326  O  OG    . SER A 1  198  ? 146.797 119.565 70.586  1.00 69.66  ? 198  SER A OG    1 
ATOM   1327  N  N     . ASP A 1  199  ? 146.710 119.731 74.177  1.00 70.40  ? 199  ASP A N     1 
ATOM   1328  C  CA    . ASP A 1  199  ? 147.909 119.573 75.000  1.00 71.33  ? 199  ASP A CA    1 
ATOM   1329  C  C     . ASP A 1  199  ? 147.533 119.588 76.479  1.00 72.78  ? 199  ASP A C     1 
ATOM   1330  O  O     . ASP A 1  199  ? 147.616 120.621 77.148  1.00 73.69  ? 199  ASP A O     1 
ATOM   1331  C  CB    . ASP A 1  199  ? 148.927 120.676 74.666  1.00 74.35  ? 199  ASP A CB    1 
ATOM   1332  C  CG    . ASP A 1  199  ? 149.343 120.666 73.208  1.00 74.16  ? 199  ASP A CG    1 
ATOM   1333  O  OD1   . ASP A 1  199  ? 149.346 119.576 72.597  1.00 70.59  ? 199  ASP A OD1   1 
ATOM   1334  O  OD2   . ASP A 1  199  ? 149.665 121.747 72.672  1.00 70.93  ? 199  ASP A OD2   1 
ATOM   1335  N  N     . GLY A 1  200  ? 147.116 118.429 76.987  1.00 69.09  ? 200  GLY A N     1 
ATOM   1336  C  CA    . GLY A 1  200  ? 147.104 118.158 78.413  1.00 67.75  ? 200  GLY A CA    1 
ATOM   1337  C  C     . GLY A 1  200  ? 146.199 118.994 79.296  1.00 66.46  ? 200  GLY A C     1 
ATOM   1338  O  O     . GLY A 1  200  ? 146.117 118.741 80.502  1.00 66.33  ? 200  GLY A O     1 
ATOM   1339  N  N     . ARG A 1  201  ? 145.512 119.989 78.731  1.00 64.63  ? 201  ARG A N     1 
ATOM   1340  C  CA    . ARG A 1  201  ? 144.764 120.920 79.571  1.00 62.77  ? 201  ARG A CA    1 
ATOM   1341  C  C     . ARG A 1  201  ? 143.479 120.296 80.103  1.00 62.63  ? 201  ARG A C     1 
ATOM   1342  O  O     . ARG A 1  201  ? 143.198 120.370 81.304  1.00 62.82  ? 201  ARG A O     1 
ATOM   1343  C  CB    . ARG A 1  201  ? 144.459 122.204 78.797  1.00 63.46  ? 201  ARG A CB    1 
ATOM   1344  C  CG    . ARG A 1  201  ? 143.669 123.227 79.599  1.00 63.84  ? 201  ARG A CG    1 
ATOM   1345  C  CD    . ARG A 1  201  ? 143.699 124.604 78.951  1.00 64.34  ? 201  ARG A CD    1 
ATOM   1346  N  NE    . ARG A 1  201  ? 145.014 125.233 79.049  1.00 64.46  ? 201  ARG A NE    1 
ATOM   1347  C  CZ    . ARG A 1  201  ? 145.910 125.253 78.067  1.00 64.53  ? 201  ARG A CZ    1 
ATOM   1348  N  NH1   . ARG A 1  201  ? 147.081 125.849 78.250  1.00 61.46  ? 201  ARG A NH1   1 
ATOM   1349  N  NH2   . ARG A 1  201  ? 145.637 124.682 76.903  1.00 60.89  ? 201  ARG A NH2   1 
ATOM   1350  N  N     . THR A 1  202  ? 142.687 119.675 79.231  1.00 60.88  ? 202  THR A N     1 
ATOM   1351  C  CA    . THR A 1  202  ? 141.419 119.097 79.648  1.00 60.75  ? 202  THR A CA    1 
ATOM   1352  C  C     . THR A 1  202  ? 141.072 117.925 78.743  1.00 60.58  ? 202  THR A C     1 
ATOM   1353  O  O     . THR A 1  202  ? 141.561 117.816 77.615  1.00 59.88  ? 202  THR A O     1 
ATOM   1354  C  CB    . THR A 1  202  ? 140.290 120.136 79.627  1.00 60.88  ? 202  THR A CB    1 
ATOM   1355  O  OG1   . THR A 1  202  ? 139.051 119.506 79.980  1.00 61.48  ? 202  THR A OG1   1 
ATOM   1356  C  CG2   . THR A 1  202  ? 140.163 120.758 78.244  1.00 61.73  ? 202  THR A CG2   1 
ATOM   1357  N  N     . THR A 1  203  ? 140.220 117.043 79.258  1.00 62.09  ? 203  THR A N     1 
ATOM   1358  C  CA    . THR A 1  203  ? 139.739 115.887 78.522  1.00 62.14  ? 203  THR A CA    1 
ATOM   1359  C  C     . THR A 1  203  ? 138.385 116.201 77.887  1.00 62.35  ? 203  THR A C     1 
ATOM   1360  O  O     . THR A 1  203  ? 137.820 117.284 78.063  1.00 62.67  ? 203  THR A O     1 
ATOM   1361  C  CB    . THR A 1  203  ? 139.646 114.666 79.439  1.00 62.16  ? 203  THR A CB    1 
ATOM   1362  O  OG1   . THR A 1  203  ? 138.737 114.939 80.513  1.00 61.58  ? 203  THR A OG1   1 
ATOM   1363  C  CG2   . THR A 1  203  ? 141.013 114.326 80.013  1.00 61.41  ? 203  THR A CG2   1 
ATOM   1364  N  N     . GLU A 1  204  ? 137.860 115.231 77.133  1.00 61.17  ? 204  GLU A N     1 
ATOM   1365  C  CA    . GLU A 1  204  ? 136.579 115.428 76.465  1.00 61.16  ? 204  GLU A CA    1 
ATOM   1366  C  C     . GLU A 1  204  ? 135.428 115.505 77.460  1.00 61.46  ? 204  GLU A C     1 
ATOM   1367  O  O     . GLU A 1  204  ? 134.408 116.144 77.178  1.00 61.74  ? 204  GLU A O     1 
ATOM   1368  C  CB    . GLU A 1  204  ? 136.338 114.303 75.456  1.00 61.84  ? 204  GLU A CB    1 
ATOM   1369  C  CG    . GLU A 1  204  ? 135.133 114.516 74.552  1.00 62.06  ? 204  GLU A CG    1 
ATOM   1370  C  CD    . GLU A 1  204  ? 134.971 113.412 73.526  1.00 61.98  ? 204  GLU A CD    1 
ATOM   1371  O  OE1   . GLU A 1  204  ? 135.819 112.496 73.497  1.00 61.02  ? 204  GLU A OE1   1 
ATOM   1372  O  OE2   . GLU A 1  204  ? 133.994 113.459 72.749  1.00 60.47  ? 204  GLU A OE2   1 
ATOM   1373  N  N     . ARG A 1  205  ? 135.573 114.873 78.628  1.00 61.36  ? 205  ARG A N     1 
ATOM   1374  C  CA    . ARG A 1  205  ? 134.518 114.906 79.634  1.00 61.96  ? 205  ARG A CA    1 
ATOM   1375  C  C     . ARG A 1  205  ? 134.318 116.295 80.226  1.00 62.91  ? 205  ARG A C     1 
ATOM   1376  O  O     . ARG A 1  205  ? 133.239 116.580 80.755  1.00 64.03  ? 205  ARG A O     1 
ATOM   1377  C  CB    . ARG A 1  205  ? 134.825 113.908 80.751  1.00 65.64  ? 205  ARG A CB    1 
ATOM   1378  C  CG    . ARG A 1  205  ? 134.987 112.473 80.279  1.00 67.14  ? 205  ARG A CG    1 
ATOM   1379  C  CD    . ARG A 1  205  ? 135.322 111.535 81.432  1.00 67.97  ? 205  ARG A CD    1 
ATOM   1380  N  NE    . ARG A 1  205  ? 136.609 111.847 82.049  1.00 67.65  ? 205  ARG A NE    1 
ATOM   1381  C  CZ    . ARG A 1  205  ? 136.752 112.519 83.187  1.00 68.69  ? 205  ARG A CZ    1 
ATOM   1382  N  NH1   . ARG A 1  205  ? 135.683 112.954 83.842  1.00 61.45  ? 205  ARG A NH1   1 
ATOM   1383  N  NH2   . ARG A 1  205  ? 137.963 112.756 83.673  1.00 60.45  ? 205  ARG A NH2   1 
ATOM   1384  N  N     . GLY A 1  206  ? 135.326 117.161 80.150  1.00 61.23  ? 206  GLY A N     1 
ATOM   1385  C  CA    . GLY A 1  206  ? 135.219 118.493 80.708  1.00 60.86  ? 206  GLY A CA    1 
ATOM   1386  C  C     . GLY A 1  206  ? 135.599 118.556 82.172  1.00 60.53  ? 206  GLY A C     1 
ATOM   1387  O  O     . GLY A 1  206  ? 135.161 117.724 82.972  1.00 61.16  ? 206  GLY A O     1 
ATOM   1388  N  N     . SER A 1  207  ? 136.416 119.541 82.535  1.00 59.44  ? 207  SER A N     1 
ATOM   1389  C  CA    . SER A 1  207  ? 136.869 119.702 83.908  1.00 58.32  ? 207  SER A CA    1 
ATOM   1390  C  C     . SER A 1  207  ? 135.909 120.590 84.688  1.00 58.77  ? 207  SER A C     1 
ATOM   1391  O  O     . SER A 1  207  ? 135.321 121.531 84.148  1.00 58.86  ? 207  SER A O     1 
ATOM   1392  C  CB    . SER A 1  207  ? 138.277 120.298 83.945  1.00 56.48  ? 207  SER A CB    1 
ATOM   1393  O  OG    . SER A 1  207  ? 138.725 120.467 85.279  1.00 55.81  ? 207  SER A OG    1 
ATOM   1394  N  N     . PHE A 1  208  ? 135.755 120.280 85.974  1.00 54.82  ? 208  PHE A N     1 
ATOM   1395  C  CA    . PHE A 1  208  ? 134.869 121.027 86.857  1.00 53.69  ? 208  PHE A CA    1 
ATOM   1396  C  C     . PHE A 1  208  ? 135.530 121.140 88.222  1.00 54.19  ? 208  PHE A C     1 
ATOM   1397  O  O     . PHE A 1  208  ? 135.760 120.126 88.887  1.00 54.78  ? 208  PHE A O     1 
ATOM   1398  C  CB    . PHE A 1  208  ? 133.500 120.347 86.973  1.00 54.30  ? 208  PHE A CB    1 
ATOM   1399  C  CG    . PHE A 1  208  ? 132.487 121.149 87.741  1.00 54.41  ? 208  PHE A CG    1 
ATOM   1400  C  CD1   . PHE A 1  208  ? 131.735 122.125 87.109  1.00 54.77  ? 208  PHE A CD1   1 
ATOM   1401  C  CD2   . PHE A 1  208  ? 132.282 120.922 89.092  1.00 55.37  ? 208  PHE A CD2   1 
ATOM   1402  C  CE1   . PHE A 1  208  ? 130.801 122.863 87.811  1.00 55.62  ? 208  PHE A CE1   1 
ATOM   1403  C  CE2   . PHE A 1  208  ? 131.349 121.657 89.799  1.00 52.50  ? 208  PHE A CE2   1 
ATOM   1404  C  CZ    . PHE A 1  208  ? 130.608 122.628 89.158  1.00 51.59  ? 208  PHE A CZ    1 
ATOM   1405  N  N     . THR A 1  209  ? 135.832 122.365 88.632  1.00 52.17  ? 209  THR A N     1 
ATOM   1406  C  CA    . THR A 1  209  ? 136.485 122.643 89.903  1.00 52.03  ? 209  THR A CA    1 
ATOM   1407  C  C     . THR A 1  209  ? 135.564 123.501 90.773  1.00 52.81  ? 209  THR A C     1 
ATOM   1408  O  O     . THR A 1  209  ? 134.407 123.757 90.428  1.00 53.13  ? 209  THR A O     1 
ATOM   1409  C  CB    . THR A 1  209  ? 137.838 123.320 89.676  1.00 53.30  ? 209  THR A CB    1 
ATOM   1410  O  OG1   . THR A 1  209  ? 137.658 124.498 88.880  1.00 51.44  ? 209  THR A OG1   1 
ATOM   1411  C  CG2   . THR A 1  209  ? 138.794 122.374 88.963  1.00 51.14  ? 209  THR A CG2   1 
ATOM   1412  N  N     . ALA A 1  210  ? 136.093 123.947 91.912  1.00 51.83  ? 210  ALA A N     1 
ATOM   1413  C  CA    . ALA A 1  210  ? 135.337 124.742 92.870  1.00 52.63  ? 210  ALA A CA    1 
ATOM   1414  C  C     . ALA A 1  210  ? 135.378 126.236 92.562  1.00 52.89  ? 210  ALA A C     1 
ATOM   1415  O  O     . ALA A 1  210  ? 135.045 127.048 93.434  1.00 53.30  ? 210  ALA A O     1 
ATOM   1416  C  CB    . ALA A 1  210  ? 135.852 124.486 94.289  1.00 54.01  ? 210  ALA A CB    1 
ATOM   1417  N  N     . THR A 1  211  ? 135.774 126.616 91.348  1.00 53.42  ? 211  THR A N     1 
ATOM   1418  C  CA    . THR A 1  211  ? 135.804 128.022 90.968  1.00 53.55  ? 211  THR A CA    1 
ATOM   1419  C  C     . THR A 1  211  ? 134.991 128.263 89.701  1.00 54.56  ? 211  THR A C     1 
ATOM   1420  O  O     . THR A 1  211  ? 134.438 129.352 89.512  1.00 54.91  ? 211  THR A O     1 
ATOM   1421  C  CB    . THR A 1  211  ? 137.245 128.502 90.775  1.00 55.23  ? 211  THR A CB    1 
ATOM   1422  O  OG1   . THR A 1  211  ? 137.241 129.837 90.255  1.00 52.53  ? 211  THR A OG1   1 
ATOM   1423  C  CG2   . THR A 1  211  ? 137.990 127.589 89.816  1.00 51.57  ? 211  THR A CG2   1 
ATOM   1424  N  N     . VAL A 1  212  ? 134.915 127.257 88.826  1.00 52.95  ? 212  VAL A N     1 
ATOM   1425  C  CA    . VAL A 1  212  ? 134.136 127.409 87.601  1.00 54.07  ? 212  VAL A CA    1 
ATOM   1426  C  C     . VAL A 1  212  ? 132.650 127.497 87.917  1.00 55.60  ? 212  VAL A C     1 
ATOM   1427  O  O     . VAL A 1  212  ? 131.888 128.132 87.178  1.00 56.52  ? 212  VAL A O     1 
ATOM   1428  C  CB    . VAL A 1  212  ? 134.440 126.260 86.622  1.00 55.91  ? 212  VAL A CB    1 
ATOM   1429  C  CG1   . VAL A 1  212  ? 135.892 126.320 86.171  1.00 54.10  ? 212  VAL A CG1   1 
ATOM   1430  C  CG2   . VAL A 1  212  ? 134.133 124.914 87.262  1.00 54.32  ? 212  VAL A CG2   1 
ATOM   1431  N  N     . ASN A 1  213  ? 132.210 126.874 89.013  1.00 54.52  ? 213  ASN A N     1 
ATOM   1432  C  CA    . ASN A 1  213  ? 130.822 127.025 89.437  1.00 54.93  ? 213  ASN A CA    1 
ATOM   1433  C  C     . ASN A 1  213  ? 130.560 128.417 89.994  1.00 55.31  ? 213  ASN A C     1 
ATOM   1434  O  O     . ASN A 1  213  ? 129.456 128.948 89.832  1.00 55.86  ? 213  ASN A O     1 
ATOM   1435  C  CB    . ASN A 1  213  ? 130.470 125.955 90.470  1.00 55.98  ? 213  ASN A CB    1 
ATOM   1436  C  CG    . ASN A 1  213  ? 131.570 125.747 91.488  1.00 56.29  ? 213  ASN A CG    1 
ATOM   1437  O  OD1   . ASN A 1  213  ? 132.511 126.536 91.569  1.00 54.95  ? 213  ASN A OD1   1 
ATOM   1438  N  ND2   . ASN A 1  213  ? 131.460 124.681 92.272  1.00 54.78  ? 213  ASN A ND2   1 
ATOM   1439  N  N     . ASP A 1  214  ? 131.555 129.021 90.649  1.00 55.48  ? 214  ASP A N     1 
ATOM   1440  C  CA    . ASP A 1  214  ? 131.418 130.403 91.098  1.00 56.28  ? 214  ASP A CA    1 
ATOM   1441  C  C     . ASP A 1  214  ? 131.243 131.345 89.915  1.00 57.18  ? 214  ASP A C     1 
ATOM   1442  O  O     . ASP A 1  214  ? 130.415 132.262 89.951  1.00 58.14  ? 214  ASP A O     1 
ATOM   1443  C  CB    . ASP A 1  214  ? 132.634 130.808 91.932  1.00 59.10  ? 214  ASP A CB    1 
ATOM   1444  C  CG    . ASP A 1  214  ? 132.539 130.344 93.369  1.00 58.52  ? 214  ASP A CG    1 
ATOM   1445  O  OD1   . ASP A 1  214  ? 131.446 130.467 93.960  1.00 55.70  ? 214  ASP A OD1   1 
ATOM   1446  O  OD2   . ASP A 1  214  ? 133.555 129.856 93.908  1.00 55.01  ? 214  ASP A OD2   1 
ATOM   1447  N  N     . GLU A 1  215  ? 132.021 131.133 88.852  1.00 55.65  ? 215  GLU A N     1 
ATOM   1448  C  CA    . GLU A 1  215  ? 131.909 131.982 87.671  1.00 55.68  ? 215  GLU A CA    1 
ATOM   1449  C  C     . GLU A 1  215  ? 130.585 131.759 86.952  1.00 57.02  ? 215  GLU A C     1 
ATOM   1450  O  O     . GLU A 1  215  ? 129.941 132.720 86.515  1.00 58.02  ? 215  GLU A O     1 
ATOM   1451  C  CB    . GLU A 1  215  ? 133.085 131.725 86.729  1.00 58.55  ? 215  GLU A CB    1 
ATOM   1452  C  CG    . GLU A 1  215  ? 134.447 132.002 87.347  1.00 59.05  ? 215  GLU A CG    1 
ATOM   1453  C  CD    . GLU A 1  215  ? 134.657 133.468 87.675  1.00 58.92  ? 215  GLU A CD    1 
ATOM   1454  O  OE1   . GLU A 1  215  ? 134.039 134.325 87.009  1.00 54.77  ? 215  GLU A OE1   1 
ATOM   1455  O  OE2   . GLU A 1  215  ? 135.441 133.764 88.601  1.00 54.34  ? 215  GLU A OE2   1 
ATOM   1456  N  N     . ARG A 1  216  ? 130.159 130.500 86.821  1.00 54.89  ? 216  ARG A N     1 
ATOM   1457  C  CA    . ARG A 1  216  ? 128.893 130.218 86.149  1.00 55.18  ? 216  ARG A CA    1 
ATOM   1458  C  C     . ARG A 1  216  ? 127.710 130.738 86.956  1.00 53.81  ? 216  ARG A C     1 
ATOM   1459  O  O     . ARG A 1  216  ? 126.743 131.255 86.384  1.00 52.35  ? 216  ARG A O     1 
ATOM   1460  C  CB    . ARG A 1  216  ? 128.754 128.719 85.893  1.00 50.65  ? 216  ARG A CB    1 
ATOM   1461  C  CG    . ARG A 1  216  ? 129.709 128.177 84.840  1.00 49.34  ? 216  ARG A CG    1 
ATOM   1462  C  CD    . ARG A 1  216  ? 129.460 126.703 84.554  1.00 48.40  ? 216  ARG A CD    1 
ATOM   1463  N  NE    . ARG A 1  216  ? 128.177 126.476 83.892  1.00 48.21  ? 216  ARG A NE    1 
ATOM   1464  C  CZ    . ARG A 1  216  ? 127.075 126.066 84.513  1.00 48.57  ? 216  ARG A CZ    1 
ATOM   1465  N  NH1   . ARG A 1  216  ? 127.094 125.830 85.818  1.00 56.22  ? 216  ARG A NH1   1 
ATOM   1466  N  NH2   . ARG A 1  216  ? 125.954 125.889 83.827  1.00 56.19  ? 216  ARG A NH2   1 
ATOM   1467  N  N     . LYS A 1  217  ? 127.765 130.609 88.284  1.00 57.36  ? 217  LYS A N     1 
ATOM   1468  C  CA    . LYS A 1  217  ? 126.692 131.147 89.115  1.00 58.56  ? 217  LYS A CA    1 
ATOM   1469  C  C     . LYS A 1  217  ? 126.679 132.670 89.081  1.00 59.25  ? 217  LYS A C     1 
ATOM   1470  O  O     . LYS A 1  217  ? 125.608 133.288 89.120  1.00 60.25  ? 217  LYS A O     1 
ATOM   1471  C  CB    . LYS A 1  217  ? 126.827 130.641 90.552  1.00 61.58  ? 217  LYS A CB    1 
ATOM   1472  C  CG    . LYS A 1  217  ? 126.398 129.193 90.739  1.00 62.34  ? 217  LYS A CG    1 
ATOM   1473  C  CD    . LYS A 1  217  ? 126.567 128.748 92.182  1.00 62.31  ? 217  LYS A CD    1 
ATOM   1474  C  CE    . LYS A 1  217  ? 126.126 127.306 92.368  1.00 59.08  ? 217  LYS A CE    1 
ATOM   1475  N  NZ    . LYS A 1  217  ? 126.909 126.372 91.512  1.00 59.40  ? 217  LYS A NZ    1 
ATOM   1476  N  N     . LYS A 1  218  ? 127.857 133.294 89.008  1.00 59.78  ? 218  LYS A N     1 
ATOM   1477  C  CA    . LYS A 1  218  ? 127.910 134.747 88.881  1.00 60.78  ? 218  LYS A CA    1 
ATOM   1478  C  C     . LYS A 1  218  ? 127.385 135.196 87.523  1.00 62.64  ? 218  LYS A C     1 
ATOM   1479  O  O     . LYS A 1  218  ? 126.760 136.257 87.411  1.00 63.85  ? 218  LYS A O     1 
ATOM   1480  C  CB    . LYS A 1  218  ? 129.341 135.241 89.106  1.00 64.31  ? 218  LYS A CB    1 
ATOM   1481  C  CG    . LYS A 1  218  ? 129.484 136.756 89.207  1.00 64.63  ? 218  LYS A CG    1 
ATOM   1482  C  CD    . LYS A 1  218  ? 129.887 137.379 87.877  1.00 64.79  ? 218  LYS A CD    1 
ATOM   1483  C  CE    . LYS A 1  218  ? 130.011 138.890 87.990  1.00 59.26  ? 218  LYS A CE    1 
ATOM   1484  N  NZ    . LYS A 1  218  ? 130.395 139.513 86.694  1.00 58.15  ? 218  LYS A NZ    1 
ATOM   1485  N  N     . LEU A 1  219  ? 127.631 134.401 86.479  1.00 58.59  ? 219  LEU A N     1 
ATOM   1486  C  CA    . LEU A 1  219  ? 127.143 134.756 85.150  1.00 58.25  ? 219  LEU A CA    1 
ATOM   1487  C  C     . LEU A 1  219  ? 125.633 134.583 85.047  1.00 58.70  ? 219  LEU A C     1 
ATOM   1488  O  O     . LEU A 1  219  ? 124.946 135.431 84.464  1.00 59.17  ? 219  LEU A O     1 
ATOM   1489  C  CB    . LEU A 1  219  ? 127.856 133.919 84.086  1.00 59.73  ? 219  LEU A CB    1 
ATOM   1490  C  CG    . LEU A 1  219  ? 129.004 134.599 83.335  1.00 59.17  ? 219  LEU A CG    1 
ATOM   1491  C  CD1   . LEU A 1  219  ? 128.486 135.774 82.519  1.00 57.69  ? 219  LEU A CD1   1 
ATOM   1492  C  CD2   . LEU A 1  219  ? 130.096 135.052 84.291  1.00 57.83  ? 219  LEU A CD2   1 
ATOM   1493  N  N     . VAL A 1  220  ? 125.094 133.495 85.603  1.00 58.20  ? 220  VAL A N     1 
ATOM   1494  C  CA    . VAL A 1  220  ? 123.651 133.284 85.533  1.00 59.51  ? 220  VAL A CA    1 
ATOM   1495  C  C     . VAL A 1  220  ? 122.921 134.269 86.438  1.00 59.82  ? 220  VAL A C     1 
ATOM   1496  O  O     . VAL A 1  220  ? 121.786 134.666 86.146  1.00 59.97  ? 220  VAL A O     1 
ATOM   1497  C  CB    . VAL A 1  220  ? 123.297 131.821 85.866  1.00 60.19  ? 220  VAL A CB    1 
ATOM   1498  C  CG1   . VAL A 1  220  ? 123.556 131.512 87.332  1.00 60.82  ? 220  VAL A CG1   1 
ATOM   1499  C  CG2   . VAL A 1  220  ? 121.851 131.522 85.494  1.00 60.64  ? 220  VAL A CG2   1 
ATOM   1500  N  N     . HIS A 1  221  ? 123.548 134.688 87.542  1.00 62.96  ? 221  HIS A N     1 
ATOM   1501  C  CA    . HIS A 1  221  ? 122.971 135.757 88.349  1.00 65.09  ? 221  HIS A CA    1 
ATOM   1502  C  C     . HIS A 1  221  ? 123.017 137.089 87.615  1.00 64.35  ? 221  HIS A C     1 
ATOM   1503  O  O     . HIS A 1  221  ? 122.131 137.931 87.803  1.00 63.98  ? 221  HIS A O     1 
ATOM   1504  C  CB    . HIS A 1  221  ? 123.693 135.859 89.693  1.00 64.30  ? 221  HIS A CB    1 
ATOM   1505  C  CG    . HIS A 1  221  ? 123.413 134.716 90.618  1.00 64.39  ? 221  HIS A CG    1 
ATOM   1506  N  ND1   . HIS A 1  221  ? 124.028 134.582 91.844  1.00 63.98  ? 221  HIS A ND1   1 
ATOM   1507  C  CD2   . HIS A 1  221  ? 122.582 133.653 90.495  1.00 63.71  ? 221  HIS A CD2   1 
ATOM   1508  C  CE1   . HIS A 1  221  ? 123.590 133.486 92.437  1.00 67.70  ? 221  HIS A CE1   1 
ATOM   1509  N  NE2   . HIS A 1  221  ? 122.711 132.904 91.640  1.00 68.58  ? 221  HIS A NE2   1 
ATOM   1510  N  N     . GLU A 1  222  ? 124.038 137.297 86.780  1.00 69.49  ? 222  GLU A N     1 
ATOM   1511  C  CA    . GLU A 1  222  ? 124.059 138.476 85.921  1.00 70.85  ? 222  GLU A CA    1 
ATOM   1512  C  C     . GLU A 1  222  ? 122.952 138.408 84.878  1.00 73.09  ? 222  GLU A C     1 
ATOM   1513  O  O     . GLU A 1  222  ? 122.380 139.437 84.501  1.00 75.23  ? 222  GLU A O     1 
ATOM   1514  C  CB    . GLU A 1  222  ? 125.427 138.613 85.253  1.00 77.06  ? 222  GLU A CB    1 
ATOM   1515  C  CG    . GLU A 1  222  ? 125.562 139.823 84.341  1.00 77.43  ? 222  GLU A CG    1 
ATOM   1516  C  CD    . GLU A 1  222  ? 126.914 139.891 83.659  1.00 77.96  ? 222  GLU A CD    1 
ATOM   1517  O  OE1   . GLU A 1  222  ? 127.750 138.996 83.903  1.00 69.99  ? 222  GLU A OE1   1 
ATOM   1518  O  OE2   . GLU A 1  222  ? 127.141 140.840 82.878  1.00 68.89  ? 222  GLU A OE2   1 
ATOM   1519  N  N     . PHE A 1  223  ? 122.634 137.200 84.404  1.00 70.63  ? 223  PHE A N     1 
ATOM   1520  C  CA    . PHE A 1  223  ? 121.526 137.041 83.467  1.00 72.22  ? 223  PHE A CA    1 
ATOM   1521  C  C     . PHE A 1  223  ? 120.190 137.337 84.135  1.00 74.47  ? 223  PHE A C     1 
ATOM   1522  O  O     . PHE A 1  223  ? 119.237 137.742 83.460  1.00 77.69  ? 223  PHE A O     1 
ATOM   1523  C  CB    . PHE A 1  223  ? 121.524 135.628 82.880  1.00 78.22  ? 223  PHE A CB    1 
ATOM   1524  C  CG    . PHE A 1  223  ? 122.809 135.249 82.194  1.00 79.37  ? 223  PHE A CG    1 
ATOM   1525  C  CD1   . PHE A 1  223  ? 123.645 136.219 81.662  1.00 81.72  ? 223  PHE A CD1   1 
ATOM   1526  C  CD2   . PHE A 1  223  ? 123.178 133.919 82.079  1.00 82.52  ? 223  PHE A CD2   1 
ATOM   1527  C  CE1   . PHE A 1  223  ? 124.825 135.869 81.036  1.00 81.17  ? 223  PHE A CE1   1 
ATOM   1528  C  CE2   . PHE A 1  223  ? 124.358 133.563 81.452  1.00 71.82  ? 223  PHE A CE2   1 
ATOM   1529  C  CZ    . PHE A 1  223  ? 125.180 134.539 80.929  1.00 72.01  ? 223  PHE A CZ    1 
ATOM   1530  N  N     . HIS A 1  224  ? 120.097 137.135 85.451  1.00 72.54  ? 224  HIS A N     1 
ATOM   1531  C  CA    . HIS A 1  224  ? 118.902 137.514 86.192  1.00 73.74  ? 224  HIS A CA    1 
ATOM   1532  C  C     . HIS A 1  224  ? 118.858 139.005 86.499  1.00 75.67  ? 224  HIS A C     1 
ATOM   1533  O  O     . HIS A 1  224  ? 117.766 139.561 86.656  1.00 76.96  ? 224  HIS A O     1 
ATOM   1534  C  CB    . HIS A 1  224  ? 118.809 136.709 87.490  1.00 76.93  ? 224  HIS A CB    1 
ATOM   1535  C  CG    . HIS A 1  224  ? 118.537 135.251 87.279  1.00 76.86  ? 224  HIS A CG    1 
ATOM   1536  N  ND1   . HIS A 1  224  ? 119.412 134.419 86.613  1.00 77.24  ? 224  HIS A ND1   1 
ATOM   1537  C  CD2   . HIS A 1  224  ? 117.489 134.477 87.646  1.00 77.53  ? 224  HIS A CD2   1 
ATOM   1538  C  CE1   . HIS A 1  224  ? 118.913 133.197 86.579  1.00 72.14  ? 224  HIS A CE1   1 
ATOM   1539  N  NE2   . HIS A 1  224  ? 117.746 133.205 87.198  1.00 71.67  ? 224  HIS A NE2   1 
ATOM   1540  N  N     . LYS A 1  225  ? 120.017 139.659 86.589  1.00 70.56  ? 225  LYS A N     1 
ATOM   1541  C  CA    . LYS A 1  225  ? 120.105 141.107 86.723  1.00 69.45  ? 225  LYS A CA    1 
ATOM   1542  C  C     . LYS A 1  225  ? 120.278 141.793 85.372  1.00 69.79  ? 225  LYS A C     1 
ATOM   1543  O  O     . LYS A 1  225  ? 120.768 142.927 85.312  1.00 69.96  ? 225  LYS A O     1 
ATOM   1544  C  CB    . LYS A 1  225  ? 121.249 141.489 87.664  1.00 69.84  ? 225  LYS A CB    1 
ATOM   1545  C  CG    . LYS A 1  225  ? 120.880 141.504 89.146  1.00 70.03  ? 225  LYS A CG    1 
ATOM   1546  C  CD    . LYS A 1  225  ? 120.606 140.109 89.687  1.00 69.38  ? 225  LYS A CD    1 
ATOM   1547  C  CE    . LYS A 1  225  ? 120.250 140.146 91.165  1.00 67.78  ? 225  LYS A CE    1 
ATOM   1548  N  NZ    . LYS A 1  225  ? 119.982 138.785 91.705  1.00 68.16  ? 225  LYS A NZ    1 
ATOM   1549  N  N     . LYS A 1  226  ? 119.885 141.122 84.292  1.00 65.25  ? 226  LYS A N     1 
ATOM   1550  C  CA    . LYS A 1  226  ? 120.020 141.623 82.928  1.00 63.46  ? 226  LYS A CA    1 
ATOM   1551  C  C     . LYS A 1  226  ? 118.864 142.555 82.576  1.00 62.66  ? 226  LYS A C     1 
ATOM   1552  O  O     . LYS A 1  226  ? 118.186 143.074 83.468  1.00 62.22  ? 226  LYS A O     1 
ATOM   1553  C  CB    . LYS A 1  226  ? 120.106 140.456 81.939  1.00 61.38  ? 226  LYS A CB    1 
ATOM   1554  C  CG    . LYS A 1  226  ? 120.951 140.745 80.704  1.00 60.84  ? 226  LYS A CG    1 
ATOM   1555  C  CD    . LYS A 1  226  ? 122.301 141.330 81.086  1.00 60.53  ? 226  LYS A CD    1 
ATOM   1556  C  CE    . LYS A 1  226  ? 123.034 141.867 79.869  1.00 63.18  ? 226  LYS A CE    1 
ATOM   1557  N  NZ    . LYS A 1  226  ? 124.353 142.458 80.230  1.00 63.53  ? 226  LYS A NZ    1 
ATOM   1558  N  N     . LEU A 1  227  ? 118.656 142.779 81.275  1.00 62.86  ? 227  LEU A N     1 
ATOM   1559  C  CA    . LEU A 1  227  ? 117.678 143.707 80.711  1.00 62.70  ? 227  LEU A CA    1 
ATOM   1560  C  C     . LEU A 1  227  ? 116.330 143.694 81.428  1.00 63.46  ? 227  LEU A C     1 
ATOM   1561  O  O     . LEU A 1  227  ? 115.602 144.692 81.390  1.00 63.83  ? 227  LEU A O     1 
ATOM   1562  C  CB    . LEU A 1  227  ? 117.479 143.389 79.223  1.00 63.92  ? 227  LEU A CB    1 
ATOM   1563  C  CG    . LEU A 1  227  ? 116.444 144.131 78.367  1.00 63.97  ? 227  LEU A CG    1 
ATOM   1564  C  CD1   . LEU A 1  227  ? 116.902 144.175 76.922  1.00 61.98  ? 227  LEU A CD1   1 
ATOM   1565  C  CD2   . LEU A 1  227  ? 115.073 143.475 78.447  1.00 61.95  ? 227  LEU A CD2   1 
ATOM   1566  N  N     . LEU A 1  228  ? 115.985 142.573 82.067  1.00 60.75  ? 228  LEU A N     1 
ATOM   1567  C  CA    . LEU A 1  228  ? 114.727 142.411 82.793  1.00 60.33  ? 228  LEU A CA    1 
ATOM   1568  C  C     . LEU A 1  228  ? 114.374 143.632 83.638  1.00 59.49  ? 228  LEU A C     1 
ATOM   1569  O  O     . LEU A 1  228  ? 113.193 143.906 83.876  1.00 59.11  ? 228  LEU A O     1 
ATOM   1570  C  CB    . LEU A 1  228  ? 114.787 141.170 83.690  1.00 58.26  ? 228  LEU A CB    1 
ATOM   1571  C  CG    . LEU A 1  228  ? 114.723 139.774 83.063  1.00 59.58  ? 228  LEU A CG    1 
ATOM   1572  C  CD1   . LEU A 1  228  ? 116.016 139.404 82.349  1.00 61.01  ? 228  LEU A CD1   1 
ATOM   1573  C  CD2   . LEU A 1  228  ? 114.388 138.740 84.127  1.00 60.30  ? 228  LEU A CD2   1 
ATOM   1574  N  N     . SER A 1  229  ? 115.386 144.370 84.097  1.00 62.77  ? 229  SER A N     1 
ATOM   1575  C  CA    . SER A 1  229  ? 115.188 145.587 84.874  1.00 64.38  ? 229  SER A CA    1 
ATOM   1576  C  C     . SER A 1  229  ? 115.303 146.852 84.025  1.00 65.09  ? 229  SER A C     1 
ATOM   1577  O  O     . SER A 1  229  ? 115.613 147.924 84.555  1.00 65.57  ? 229  SER A O     1 
ATOM   1578  C  CB    . SER A 1  229  ? 116.178 145.638 86.037  1.00 64.93  ? 229  SER A CB    1 
ATOM   1579  O  OG    . SER A 1  229  ? 116.018 146.827 86.792  1.00 64.82  ? 229  SER A OG    1 
ATOM   1580  N  N     . ARG A 1  230  ? 115.063 146.753 82.719  1.00 65.72  ? 230  ARG A N     1 
ATOM   1581  C  CA    . ARG A 1  230  ? 115.051 147.934 81.860  1.00 66.64  ? 230  ARG A CA    1 
ATOM   1582  C  C     . ARG A 1  230  ? 114.022 147.712 80.753  1.00 67.45  ? 230  ARG A C     1 
ATOM   1583  O  O     . ARG A 1  230  ? 113.289 146.718 80.753  1.00 68.47  ? 230  ARG A O     1 
ATOM   1584  C  CB    . ARG A 1  230  ? 116.462 148.241 81.333  1.00 69.82  ? 230  ARG A CB    1 
ATOM   1585  C  CG    . ARG A 1  230  ? 116.997 147.314 80.254  1.00 71.34  ? 230  ARG A CG    1 
ATOM   1586  C  CD    . ARG A 1  230  ? 116.973 147.997 78.892  1.00 72.52  ? 230  ARG A CD    1 
ATOM   1587  N  NE    . ARG A 1  230  ? 117.615 147.195 77.857  1.00 72.66  ? 230  ARG A NE    1 
ATOM   1588  C  CZ    . ARG A 1  230  ? 118.904 147.273 77.542  1.00 72.72  ? 230  ARG A CZ    1 
ATOM   1589  N  NH1   . ARG A 1  230  ? 119.403 146.504 76.584  1.00 66.93  ? 230  ARG A NH1   1 
ATOM   1590  N  NH2   . ARG A 1  230  ? 119.696 148.120 78.186  1.00 66.53  ? 230  ARG A NH2   1 
ATOM   1591  N  N     . GLY A 1  231  ? 113.968 148.646 79.804  1.00 67.56  ? 231  GLY A N     1 
ATOM   1592  C  CA    . GLY A 1  231  ? 112.855 148.732 78.878  1.00 67.72  ? 231  GLY A CA    1 
ATOM   1593  C  C     . GLY A 1  231  ? 113.021 148.125 77.497  1.00 67.34  ? 231  GLY A C     1 
ATOM   1594  O  O     . GLY A 1  231  ? 112.926 146.906 77.328  1.00 66.57  ? 231  GLY A O     1 
ATOM   1595  N  N     . LYS A 1  232  ? 113.260 148.988 76.508  1.00 67.77  ? 232  LYS A N     1 
ATOM   1596  C  CA    . LYS A 1  232  ? 113.064 148.655 75.101  1.00 67.65  ? 232  LYS A CA    1 
ATOM   1597  C  C     . LYS A 1  232  ? 113.831 147.407 74.675  1.00 68.68  ? 232  LYS A C     1 
ATOM   1598  O  O     . LYS A 1  232  ? 114.896 147.083 75.208  1.00 69.05  ? 232  LYS A O     1 
ATOM   1599  C  CB    . LYS A 1  232  ? 113.482 149.835 74.221  1.00 68.69  ? 232  LYS A CB    1 
ATOM   1600  C  CG    . LYS A 1  232  ? 112.534 151.027 74.259  1.00 67.78  ? 232  LYS A CG    1 
ATOM   1601  C  CD    . LYS A 1  232  ? 111.245 150.745 73.498  1.00 67.39  ? 232  LYS A CD    1 
ATOM   1602  C  CE    . LYS A 1  232  ? 110.091 150.427 74.434  1.00 66.08  ? 232  LYS A CE    1 
ATOM   1603  N  NZ    . LYS A 1  232  ? 108.906 149.926 73.690  1.00 65.63  ? 232  LYS A NZ    1 
ATOM   1604  N  N     . CYS A 1  233  ? 113.265 146.708 73.692  1.00 64.94  ? 233  CYS A N     1 
ATOM   1605  C  CA    . CYS A 1  233  ? 113.894 145.554 73.065  1.00 64.46  ? 233  CYS A CA    1 
ATOM   1606  C  C     . CYS A 1  233  ? 114.697 146.009 71.854  1.00 64.56  ? 233  CYS A C     1 
ATOM   1607  O  O     . CYS A 1  233  ? 114.164 146.677 70.962  1.00 64.95  ? 233  CYS A O     1 
ATOM   1608  C  CB    . CYS A 1  233  ? 112.834 144.530 72.651  1.00 64.29  ? 233  CYS A CB    1 
ATOM   1609  S  SG    . CYS A 1  233  ? 113.402 143.247 71.507  1.00 63.59  ? 233  CYS A SG    1 
ATOM   1610  N  N     . ASP A 1  234  ? 115.982 145.646 71.825  1.00 65.21  ? 234  ASP A N     1 
ATOM   1611  C  CA    . ASP A 1  234  ? 116.867 146.113 70.763  1.00 65.61  ? 234  ASP A CA    1 
ATOM   1612  C  C     . ASP A 1  234  ? 116.591 145.443 69.424  1.00 66.60  ? 234  ASP A C     1 
ATOM   1613  O  O     . ASP A 1  234  ? 117.044 145.947 68.390  1.00 67.16  ? 234  ASP A O     1 
ATOM   1614  C  CB    . ASP A 1  234  ? 118.325 145.890 71.165  1.00 67.43  ? 234  ASP A CB    1 
ATOM   1615  C  CG    . ASP A 1  234  ? 118.710 146.661 72.411  1.00 66.99  ? 234  ASP A CG    1 
ATOM   1616  O  OD1   . ASP A 1  234  ? 118.177 147.773 72.612  1.00 64.07  ? 234  ASP A OD1   1 
ATOM   1617  O  OD2   . ASP A 1  234  ? 119.541 146.154 73.194  1.00 63.59  ? 234  ASP A OD2   1 
ATOM   1618  N  N     . ASN A 1  235  ? 115.863 144.327 69.410  1.00 62.42  ? 235  ASN A N     1 
ATOM   1619  C  CA    . ASN A 1  235  ? 115.575 143.630 68.162  1.00 61.32  ? 235  ASN A CA    1 
ATOM   1620  C  C     . ASN A 1  235  ? 114.269 144.090 67.527  1.00 60.68  ? 235  ASN A C     1 
ATOM   1621  O  O     . ASN A 1  235  ? 114.195 144.237 66.302  1.00 60.10  ? 235  ASN A O     1 
ATOM   1622  C  CB    . ASN A 1  235  ? 115.532 142.118 68.399  1.00 59.72  ? 235  ASN A CB    1 
ATOM   1623  C  CG    . ASN A 1  235  ? 116.874 141.558 68.828  1.00 59.88  ? 235  ASN A CG    1 
ATOM   1624  O  OD1   . ASN A 1  235  ? 117.925 142.068 68.440  1.00 60.90  ? 235  ASN A OD1   1 
ATOM   1625  N  ND2   . ASN A 1  235  ? 116.846 140.501 69.631  1.00 60.42  ? 235  ASN A ND2   1 
ATOM   1626  N  N     . CYS A 1  236  ? 113.236 144.321 68.335  1.00 61.04  ? 236  CYS A N     1 
ATOM   1627  C  CA    . CYS A 1  236  ? 111.935 144.761 67.837  1.00 61.29  ? 236  CYS A CA    1 
ATOM   1628  C  C     . CYS A 1  236  ? 111.439 145.884 68.738  1.00 61.69  ? 236  CYS A C     1 
ATOM   1629  O  O     . CYS A 1  236  ? 111.165 145.661 69.921  1.00 62.06  ? 236  CYS A O     1 
ATOM   1630  C  CB    . CYS A 1  236  ? 110.939 143.601 67.791  1.00 61.34  ? 236  CYS A CB    1 
ATOM   1631  S  SG    . CYS A 1  236  ? 110.870 142.599 69.295  1.00 61.24  ? 236  CYS A SG    1 
ATOM   1632  N  N     . GLY A 1  237  ? 111.329 147.087 68.180  1.00 61.72  ? 237  GLY A N     1 
ATOM   1633  C  CA    . GLY A 1  237  ? 111.002 148.266 68.960  1.00 62.13  ? 237  GLY A CA    1 
ATOM   1634  C  C     . GLY A 1  237  ? 109.526 148.517 69.190  1.00 62.76  ? 237  GLY A C     1 
ATOM   1635  O  O     . GLY A 1  237  ? 108.960 149.457 68.623  1.00 62.48  ? 237  GLY A O     1 
ATOM   1636  N  N     . MET A 1  238  ? 108.887 147.690 70.016  1.00 63.74  ? 238  MET A N     1 
ATOM   1637  C  CA    . MET A 1  238  ? 107.518 147.937 70.442  1.00 64.22  ? 238  MET A CA    1 
ATOM   1638  C  C     . MET A 1  238  ? 107.412 147.687 71.939  1.00 64.76  ? 238  MET A C     1 
ATOM   1639  O  O     . MET A 1  238  ? 108.289 147.070 72.551  1.00 65.36  ? 238  MET A O     1 
ATOM   1640  C  CB    . MET A 1  238  ? 106.505 147.066 69.685  1.00 66.27  ? 238  MET A CB    1 
ATOM   1641  C  CG    . MET A 1  238  ? 106.564 145.589 70.030  1.00 66.88  ? 238  MET A CG    1 
ATOM   1642  S  SD    . MET A 1  238  ? 107.962 144.758 69.263  1.00 64.01  ? 238  MET A SD    1 
ATOM   1643  C  CE    . MET A 1  238  ? 107.591 145.019 67.530  1.00 63.73  ? 238  MET A CE    1 
ATOM   1644  N  N     . PHE A 1  239  ? 106.321 148.174 72.524  1.00 64.04  ? 239  PHE A N     1 
ATOM   1645  C  CA    . PHE A 1  239  ? 106.081 148.037 73.955  1.00 64.58  ? 239  PHE A CA    1 
ATOM   1646  C  C     . PHE A 1  239  ? 105.403 146.703 74.237  1.00 66.42  ? 239  PHE A C     1 
ATOM   1647  O  O     . PHE A 1  239  ? 104.286 146.456 73.768  1.00 68.94  ? 239  PHE A O     1 
ATOM   1648  C  CB    . PHE A 1  239  ? 105.225 149.192 74.476  1.00 70.03  ? 239  PHE A CB    1 
ATOM   1649  C  CG    . PHE A 1  239  ? 106.018 150.396 74.897  1.00 70.95  ? 239  PHE A CG    1 
ATOM   1650  C  CD1   . PHE A 1  239  ? 106.662 150.422 76.125  1.00 71.71  ? 239  PHE A CD1   1 
ATOM   1651  C  CD2   . PHE A 1  239  ? 106.111 151.504 74.074  1.00 71.64  ? 239  PHE A CD2   1 
ATOM   1652  C  CE1   . PHE A 1  239  ? 107.389 151.529 76.518  1.00 70.69  ? 239  PHE A CE1   1 
ATOM   1653  C  CE2   . PHE A 1  239  ? 106.837 152.615 74.463  1.00 63.37  ? 239  PHE A CE2   1 
ATOM   1654  C  CZ    . PHE A 1  239  ? 107.477 152.626 75.686  1.00 63.21  ? 239  PHE A CZ    1 
ATOM   1655  N  N     . SER A 1  240  ? 106.079 145.846 75.000  1.00 61.96  ? 240  SER A N     1 
ATOM   1656  C  CA    . SER A 1  240  ? 105.510 144.576 75.428  1.00 60.83  ? 240  SER A CA    1 
ATOM   1657  C  C     . SER A 1  240  ? 104.989 144.702 76.850  1.00 60.56  ? 240  SER A C     1 
ATOM   1658  O  O     . SER A 1  240  ? 105.719 145.191 77.725  1.00 60.48  ? 240  SER A O     1 
ATOM   1659  C  CB    . SER A 1  240  ? 106.552 143.464 75.355  1.00 60.14  ? 240  SER A CB    1 
ATOM   1660  O  OG    . SER A 1  240  ? 107.660 143.748 76.192  1.00 59.89  ? 240  SER A OG    1 
ATOM   1661  N  N     . PRO A 1  241  ? 103.749 144.294 77.118  1.00 60.29  ? 241  PRO A N     1 
ATOM   1662  C  CA    . PRO A 1  241  ? 103.214 144.414 78.479  1.00 60.55  ? 241  PRO A CA    1 
ATOM   1663  C  C     . PRO A 1  241  ? 104.008 143.576 79.469  1.00 60.85  ? 241  PRO A C     1 
ATOM   1664  O  O     . PRO A 1  241  ? 104.606 142.556 79.119  1.00 60.91  ? 241  PRO A O     1 
ATOM   1665  C  CB    . PRO A 1  241  ? 101.774 143.906 78.342  1.00 60.64  ? 241  PRO A CB    1 
ATOM   1666  C  CG    . PRO A 1  241  ? 101.450 144.058 76.889  1.00 60.44  ? 241  PRO A CG    1 
ATOM   1667  C  CD    . PRO A 1  241  ? 102.738 143.806 76.165  1.00 60.62  ? 241  PRO A CD    1 
ATOM   1668  N  N     . LYS A 1  242  ? 104.006 144.022 80.723  1.00 60.02  ? 242  LYS A N     1 
ATOM   1669  C  CA    . LYS A 1  242  ? 104.753 143.361 81.784  1.00 59.73  ? 242  LYS A CA    1 
ATOM   1670  C  C     . LYS A 1  242  ? 103.880 142.313 82.461  1.00 59.52  ? 242  LYS A C     1 
ATOM   1671  O  O     . LYS A 1  242  ? 102.695 142.551 82.714  1.00 59.20  ? 242  LYS A O     1 
ATOM   1672  C  CB    . LYS A 1  242  ? 105.250 144.381 82.809  1.00 59.00  ? 242  LYS A CB    1 
ATOM   1673  C  CG    . LYS A 1  242  ? 106.142 145.464 82.223  1.00 58.82  ? 242  LYS A CG    1 
ATOM   1674  C  CD    . LYS A 1  242  ? 106.589 146.450 83.290  1.00 58.79  ? 242  LYS A CD    1 
ATOM   1675  C  CE    . LYS A 1  242  ? 107.402 145.761 84.373  1.00 59.87  ? 242  LYS A CE    1 
ATOM   1676  N  NZ    . LYS A 1  242  ? 108.635 145.131 83.825  1.00 59.18  ? 242  LYS A NZ    1 
ATOM   1677  N  N     . PHE A 1  243  ? 104.468 141.156 82.749  1.00 61.00  ? 243  PHE A N     1 
ATOM   1678  C  CA    . PHE A 1  243  ? 103.738 140.079 83.405  1.00 62.28  ? 243  PHE A CA    1 
ATOM   1679  C  C     . PHE A 1  243  ? 103.555 140.405 84.884  1.00 62.10  ? 243  PHE A C     1 
ATOM   1680  O  O     . PHE A 1  243  ? 104.535 140.512 85.630  1.00 61.73  ? 243  PHE A O     1 
ATOM   1681  C  CB    . PHE A 1  243  ? 104.479 138.756 83.227  1.00 61.88  ? 243  PHE A CB    1 
ATOM   1682  C  CG    . PHE A 1  243  ? 104.572 138.301 81.797  1.00 62.19  ? 243  PHE A CG    1 
ATOM   1683  C  CD1   . PHE A 1  243  ? 105.564 138.788 80.961  1.00 61.57  ? 243  PHE A CD1   1 
ATOM   1684  C  CD2   . PHE A 1  243  ? 103.665 137.386 81.288  1.00 61.93  ? 243  PHE A CD2   1 
ATOM   1685  C  CE1   . PHE A 1  243  ? 105.649 138.372 79.645  1.00 63.97  ? 243  PHE A CE1   1 
ATOM   1686  C  CE2   . PHE A 1  243  ? 103.747 136.964 79.972  1.00 61.39  ? 243  PHE A CE2   1 
ATOM   1687  C  CZ    . PHE A 1  243  ? 104.740 137.458 79.151  1.00 63.62  ? 243  PHE A CZ    1 
ATOM   1688  N  N     . ARG A 1  244  ? 102.303 140.561 85.307  1.00 66.33  ? 244  ARG A N     1 
ATOM   1689  C  CA    . ARG A 1  244  ? 101.983 140.923 86.684  1.00 68.27  ? 244  ARG A CA    1 
ATOM   1690  C  C     . ARG A 1  244  ? 101.806 139.654 87.508  1.00 69.26  ? 244  ARG A C     1 
ATOM   1691  O  O     . ARG A 1  244  ? 100.846 138.903 87.303  1.00 69.39  ? 244  ARG A O     1 
ATOM   1692  C  CB    . ARG A 1  244  ? 100.720 141.785 86.731  1.00 69.60  ? 244  ARG A CB    1 
ATOM   1693  C  CG    . ARG A 1  244  ? 100.687 142.808 87.863  1.00 70.53  ? 244  ARG A CG    1 
ATOM   1694  C  CD    . ARG A 1  244  ? 100.507 142.151 89.223  1.00 71.59  ? 244  ARG A CD    1 
ATOM   1695  N  NE    . ARG A 1  244  ? 100.436 143.129 90.304  1.00 72.76  ? 244  ARG A NE    1 
ATOM   1696  C  CZ    . ARG A 1  244  ? 100.247 142.814 91.582  1.00 71.12  ? 244  ARG A CZ    1 
ATOM   1697  N  NH1   . ARG A 1  244  ? 100.196 143.770 92.501  1.00 68.85  ? 244  ARG A NH1   1 
ATOM   1698  N  NH2   . ARG A 1  244  ? 100.109 141.546 91.941  1.00 68.85  ? 244  ARG A NH2   1 
ATOM   1699  N  N     . LYS A 1  245  ? 102.722 139.427 88.447  1.00 69.40  ? 245  LYS A N     1 
ATOM   1700  C  CA    . LYS A 1  245  ? 102.706 138.201 89.234  1.00 69.89  ? 245  LYS A CA    1 
ATOM   1701  C  C     . LYS A 1  245  ? 101.477 138.151 90.133  1.00 69.31  ? 245  LYS A C     1 
ATOM   1702  O  O     . LYS A 1  245  ? 101.237 139.065 90.928  1.00 69.63  ? 245  LYS A O     1 
ATOM   1703  C  CB    . LYS A 1  245  ? 103.972 138.094 90.085  1.00 70.16  ? 245  LYS A CB    1 
ATOM   1704  C  CG    . LYS A 1  245  ? 105.277 138.191 89.315  1.00 70.39  ? 245  LYS A CG    1 
ATOM   1705  C  CD    . LYS A 1  245  ? 105.810 139.616 89.299  1.00 70.63  ? 245  LYS A CD    1 
ATOM   1706  C  CE    . LYS A 1  245  ? 107.171 139.688 88.629  1.00 71.70  ? 245  LYS A CE    1 
ATOM   1707  N  NZ    . LYS A 1  245  ? 107.697 141.080 88.589  1.00 71.85  ? 245  LYS A NZ    1 
ATOM   1708  N  N     . ASP A 1  246  ? 100.695 137.078 90.004  1.00 74.48  ? 246  ASP A N     1 
ATOM   1709  C  CA    . ASP A 1  246  ? 99.633  136.815 90.964  1.00 76.62  ? 246  ASP A CA    1 
ATOM   1710  C  C     . ASP A 1  246  ? 100.170 136.197 92.247  1.00 78.47  ? 246  ASP A C     1 
ATOM   1711  O  O     . ASP A 1  246  ? 99.481  136.228 93.273  1.00 79.55  ? 246  ASP A O     1 
ATOM   1712  C  CB    . ASP A 1  246  ? 98.572  135.900 90.349  1.00 80.58  ? 246  ASP A CB    1 
ATOM   1713  C  CG    . ASP A 1  246  ? 97.314  135.813 91.194  1.00 79.13  ? 246  ASP A CG    1 
ATOM   1714  O  OD1   . ASP A 1  246  ? 96.414  136.659 91.010  1.00 75.35  ? 246  ASP A OD1   1 
ATOM   1715  O  OD2   . ASP A 1  246  ? 97.226  134.901 92.042  1.00 75.20  ? 246  ASP A OD2   1 
ATOM   1716  N  N     . GLY A 1  247  ? 101.381 135.644 92.211  1.00 73.32  ? 247  GLY A N     1 
ATOM   1717  C  CA    . GLY A 1  247  ? 102.012 135.124 93.404  1.00 71.87  ? 247  GLY A CA    1 
ATOM   1718  C  C     . GLY A 1  247  ? 101.508 133.766 93.841  1.00 70.30  ? 247  GLY A C     1 
ATOM   1719  O  O     . GLY A 1  247  ? 100.887 133.654 94.903  1.00 70.60  ? 247  GLY A O     1 
ATOM   1720  N  N     . PHE A 1  248  ? 102.080 132.693 93.287  1.00 67.95  ? 248  PHE A N     1 
ATOM   1721  C  CA    . PHE A 1  248  ? 101.697 131.323 93.700  1.00 66.70  ? 248  PHE A CA    1 
ATOM   1722  C  C     . PHE A 1  248  ? 100.527 130.761 92.911  1.00 67.62  ? 248  PHE A C     1 
ATOM   1723  O  O     . PHE A 1  248  ? 99.632  130.098 93.435  1.00 69.16  ? 248  PHE A O     1 
ATOM   1724  C  CB    . PHE A 1  248  ? 101.386 131.284 95.198  1.00 69.73  ? 248  PHE A CB    1 
ATOM   1725  C  CG    . PHE A 1  248  ? 102.564 131.616 96.070  1.00 71.47  ? 248  PHE A CG    1 
ATOM   1726  C  CD1   . PHE A 1  248  ? 103.416 130.619 96.514  1.00 72.76  ? 248  PHE A CD1   1 
ATOM   1727  C  CD2   . PHE A 1  248  ? 102.818 132.924 96.445  1.00 72.39  ? 248  PHE A CD2   1 
ATOM   1728  C  CE1   . PHE A 1  248  ? 104.500 130.920 97.316  1.00 70.90  ? 248  PHE A CE1   1 
ATOM   1729  C  CE2   . PHE A 1  248  ? 103.901 133.233 97.247  1.00 65.47  ? 248  PHE A CE2   1 
ATOM   1730  C  CZ    . PHE A 1  248  ? 104.743 132.229 97.683  1.00 65.99  ? 248  PHE A CZ    1 
ATOM   1731  N  N     . THR A 1  249  ? 100.584 131.061 91.628  1.00 63.42  ? 249  THR A N     1 
ATOM   1732  C  CA    . THR A 1  249  ? 99.577  130.760 90.627  1.00 61.68  ? 249  THR A CA    1 
ATOM   1733  C  C     . THR A 1  249  ? 98.941  131.882 89.836  1.00 61.91  ? 249  THR A C     1 
ATOM   1734  O  O     . THR A 1  249  ? 98.866  133.036 90.260  1.00 61.97  ? 249  THR A O     1 
ATOM   1735  C  CB    . THR A 1  249  ? 98.438  129.915 91.238  1.00 62.19  ? 249  THR A CB    1 
ATOM   1736  O  OG1   . THR A 1  249  ? 97.813  130.646 92.300  1.00 59.45  ? 249  THR A OG1   1 
ATOM   1737  C  CG2   . THR A 1  249  ? 98.981  128.603 91.782  1.00 58.40  ? 249  THR A CG2   1 
ATOM   1738  N  N     . LYS A 1  250  ? 98.478  131.478 88.661  1.00 58.22  ? 250  LYS A N     1 
ATOM   1739  C  CA    . LYS A 1  250  ? 97.786  132.330 87.718  1.00 57.83  ? 250  LYS A CA    1 
ATOM   1740  C  C     . LYS A 1  250  ? 98.539  133.554 87.208  1.00 59.10  ? 250  LYS A C     1 
ATOM   1741  O  O     . LYS A 1  250  ? 97.901  134.571 86.934  1.00 59.63  ? 250  LYS A O     1 
ATOM   1742  C  CB    . LYS A 1  250  ? 96.433  132.759 88.302  1.00 59.48  ? 250  LYS A CB    1 
ATOM   1743  C  CG    . LYS A 1  250  ? 95.491  133.400 87.294  1.00 59.13  ? 250  LYS A CG    1 
ATOM   1744  C  CD    . LYS A 1  250  ? 95.172  132.448 86.154  1.00 59.26  ? 250  LYS A CD    1 
ATOM   1745  C  CE    . LYS A 1  250  ? 94.229  133.088 85.148  1.00 55.81  ? 250  LYS A CE    1 
ATOM   1746  N  NZ    . LYS A 1  250  ? 92.934  133.479 85.771  1.00 55.67  ? 250  LYS A NZ    1 
ATOM   1747  N  N     . ILE A 1  251  ? 99.862  133.511 87.041  1.00 53.92  ? 251  ILE A N     1 
ATOM   1748  C  CA    . ILE A 1  251  ? 100.422 134.747 86.501  1.00 53.29  ? 251  ILE A CA    1 
ATOM   1749  C  C     . ILE A 1  251  ? 99.465  135.352 85.480  1.00 52.44  ? 251  ILE A C     1 
ATOM   1750  O  O     . ILE A 1  251  ? 98.950  134.648 84.604  1.00 52.57  ? 251  ILE A O     1 
ATOM   1751  C  CB    . ILE A 1  251  ? 101.804 134.478 85.876  1.00 52.83  ? 251  ILE A CB    1 
ATOM   1752  C  CG1   . ILE A 1  251  ? 102.257 135.653 85.008  1.00 52.06  ? 251  ILE A CG1   1 
ATOM   1753  C  CG2   . ILE A 1  251  ? 101.785 133.188 85.067  1.00 54.37  ? 251  ILE A CG2   1 
ATOM   1754  C  CD1   . ILE A 1  251  ? 102.717 136.845 85.794  1.00 54.64  ? 251  ILE A CD1   1 
ATOM   1755  N  N     . PHE A 1  252  ? 99.214  136.658 85.586  1.00 55.82  ? 252  PHE A N     1 
ATOM   1756  C  CA    . PHE A 1  252  ? 98.277  137.345 84.707  1.00 57.04  ? 252  PHE A CA    1 
ATOM   1757  C  C     . PHE A 1  252  ? 98.912  138.608 84.143  1.00 56.94  ? 252  PHE A C     1 
ATOM   1758  O  O     . PHE A 1  252  ? 99.701  139.274 84.818  1.00 56.86  ? 252  PHE A O     1 
ATOM   1759  C  CB    . PHE A 1  252  ? 96.972  137.692 85.446  1.00 56.91  ? 252  PHE A CB    1 
ATOM   1760  C  CG    . PHE A 1  252  ? 97.151  138.650 86.592  1.00 57.52  ? 252  PHE A CG    1 
ATOM   1761  C  CD1   . PHE A 1  252  ? 97.526  138.191 87.844  1.00 57.81  ? 252  PHE A CD1   1 
ATOM   1762  C  CD2   . PHE A 1  252  ? 96.928  140.006 86.421  1.00 57.88  ? 252  PHE A CD2   1 
ATOM   1763  C  CE1   . PHE A 1  252  ? 97.687  139.068 88.901  1.00 57.77  ? 252  PHE A CE1   1 
ATOM   1764  C  CE2   . PHE A 1  252  ? 97.087  140.888 87.474  1.00 57.45  ? 252  PHE A CE2   1 
ATOM   1765  C  CZ    . PHE A 1  252  ? 97.465  140.418 88.715  1.00 57.83  ? 252  PHE A CZ    1 
ATOM   1766  N  N     . GLU A 1  253  ? 98.559  138.931 82.902  1.00 58.62  ? 253  GLU A N     1 
ATOM   1767  C  CA    . GLU A 1  253  ? 99.088  140.105 82.224  1.00 59.38  ? 253  GLU A CA    1 
ATOM   1768  C  C     . GLU A 1  253  ? 98.434  141.375 82.764  1.00 60.02  ? 253  GLU A C     1 
ATOM   1769  O  O     . GLU A 1  253  ? 97.413  141.333 83.453  1.00 60.50  ? 253  GLU A O     1 
ATOM   1770  C  CB    . GLU A 1  253  ? 98.860  139.995 80.715  1.00 60.54  ? 253  GLU A CB    1 
ATOM   1771  C  CG    . GLU A 1  253  ? 99.819  140.816 79.869  1.00 60.59  ? 253  GLU A CG    1 
ATOM   1772  C  CD    . GLU A 1  253  ? 101.230 140.272 79.908  1.00 60.53  ? 253  GLU A CD    1 
ATOM   1773  O  OE1   . GLU A 1  253  ? 101.385 139.037 79.999  1.00 60.13  ? 253  GLU A OE1   1 
ATOM   1774  O  OE2   . GLU A 1  253  ? 102.184 141.076 79.854  1.00 59.85  ? 253  GLU A OE2   1 
ATOM   1775  N  N     . THR A 1  254  ? 99.040  142.514 82.445  1.00 61.55  ? 254  THR A N     1 
ATOM   1776  C  CA    . THR A 1  254  ? 98.510  143.823 82.797  1.00 62.65  ? 254  THR A CA    1 
ATOM   1777  C  C     . THR A 1  254  ? 98.160  144.596 81.528  1.00 62.66  ? 254  THR A C     1 
ATOM   1778  O  O     . THR A 1  254  ? 98.331  144.111 80.405  1.00 62.51  ? 254  THR A O     1 
ATOM   1779  C  CB    . THR A 1  254  ? 99.508  144.605 83.656  1.00 62.49  ? 254  THR A CB    1 
ATOM   1780  O  OG1   . THR A 1  254  ? 98.871  145.774 84.187  1.00 63.88  ? 254  THR A OG1   1 
ATOM   1781  C  CG2   . THR A 1  254  ? 100.708 145.030 82.825  1.00 63.80  ? 254  THR A CG2   1 
ATOM   1782  N  N     . ALA A 1  255  ? 97.664  145.816 81.717  1.00 65.48  ? 255  ALA A N     1 
ATOM   1783  C  CA    . ALA A 1  255  ? 97.274  146.672 80.608  1.00 66.88  ? 255  ALA A CA    1 
ATOM   1784  C  C     . ALA A 1  255  ? 98.447  147.564 80.205  1.00 67.24  ? 255  ALA A C     1 
ATOM   1785  O  O     . ALA A 1  255  ? 99.578  147.392 80.667  1.00 67.14  ? 255  ALA A O     1 
ATOM   1786  C  CB    . ALA A 1  255  ? 96.037  147.487 80.980  1.00 67.11  ? 255  ALA A CB    1 
ATOM   1787  N  N     . LEU A 1  256  ? 98.185  148.535 79.331  1.00 67.00  ? 256  LEU A N     1 
ATOM   1788  C  CA    . LEU A 1  256  ? 99.191  149.474 78.857  1.00 66.43  ? 256  LEU A CA    1 
ATOM   1789  C  C     . LEU A 1  256  ? 98.689  150.896 79.078  1.00 66.00  ? 256  LEU A C     1 
ATOM   1790  O  O     . LEU A 1  256  ? 97.566  151.119 79.538  1.00 65.69  ? 256  LEU A O     1 
ATOM   1791  C  CB    . LEU A 1  256  ? 99.524  149.228 77.378  1.00 65.88  ? 256  LEU A CB    1 
ATOM   1792  C  CG    . LEU A 1  256  ? 100.185 147.889 77.047  1.00 65.37  ? 256  LEU A CG    1 
ATOM   1793  C  CD1   . LEU A 1  256  ? 100.456 147.774 75.555  1.00 66.46  ? 256  LEU A CD1   1 
ATOM   1794  C  CD2   . LEU A 1  256  ? 101.469 147.713 77.844  1.00 66.67  ? 256  LEU A CD2   1 
ATOM   1795  N  N     . ASN A 1  257  ? 99.532  151.868 78.744  1.00 66.56  ? 257  ASN A N     1 
ATOM   1796  C  CA    . ASN A 1  257  ? 99.232  153.281 78.932  1.00 67.01  ? 257  ASN A CA    1 
ATOM   1797  C  C     . ASN A 1  257  ? 99.223  153.986 77.576  1.00 67.64  ? 257  ASN A C     1 
ATOM   1798  O  O     . ASN A 1  257  ? 99.352  153.358 76.522  1.00 68.45  ? 257  ASN A O     1 
ATOM   1799  C  CB    . ASN A 1  257  ? 100.240 153.924 79.891  1.00 69.12  ? 257  ASN A CB    1 
ATOM   1800  C  CG    . ASN A 1  257  ? 99.708  155.187 80.540  1.00 68.39  ? 257  ASN A CG    1 
ATOM   1801  O  OD1   . ASN A 1  257  ? 98.503  155.440 80.538  1.00 66.48  ? 257  ASN A OD1   1 
ATOM   1802  N  ND2   . ASN A 1  257  ? 100.607 155.989 81.100  1.00 66.23  ? 257  ASN A ND2   1 
ATOM   1803  N  N     . GLU A 1  258  ? 99.067  155.312 77.614  1.00 66.29  ? 258  GLU A N     1 
ATOM   1804  C  CA    . GLU A 1  258  ? 98.958  156.082 76.379  1.00 65.94  ? 258  GLU A CA    1 
ATOM   1805  C  C     . GLU A 1  258  ? 100.271 156.087 75.604  1.00 66.52  ? 258  GLU A C     1 
ATOM   1806  O  O     . GLU A 1  258  ? 100.266 156.034 74.369  1.00 67.07  ? 258  GLU A O     1 
ATOM   1807  C  CB    . GLU A 1  258  ? 98.497  157.509 76.687  1.00 66.91  ? 258  GLU A CB    1 
ATOM   1808  C  CG    . GLU A 1  258  ? 99.365  158.266 77.683  1.00 66.38  ? 258  GLU A CG    1 
ATOM   1809  C  CD    . GLU A 1  258  ? 100.480 159.048 77.016  1.00 66.89  ? 258  GLU A CD    1 
ATOM   1810  O  OE1   . GLU A 1  258  ? 100.465 159.166 75.772  1.00 65.37  ? 258  GLU A OE1   1 
ATOM   1811  O  OE2   . GLU A 1  258  ? 101.372 159.544 77.734  1.00 65.32  ? 258  GLU A OE2   1 
ATOM   1812  N  N     . LYS A 1  259  ? 101.406 156.146 76.304  1.00 64.74  ? 259  LYS A N     1 
ATOM   1813  C  CA    . LYS A 1  259  ? 102.689 156.130 75.613  1.00 64.31  ? 259  LYS A CA    1 
ATOM   1814  C  C     . LYS A 1  259  ? 103.050 154.747 75.084  1.00 64.18  ? 259  LYS A C     1 
ATOM   1815  O  O     . LYS A 1  259  ? 104.019 154.627 74.327  1.00 64.27  ? 259  LYS A O     1 
ATOM   1816  C  CB    . LYS A 1  259  ? 103.796 156.655 76.532  1.00 64.63  ? 259  LYS A CB    1 
ATOM   1817  C  CG    . LYS A 1  259  ? 104.042 155.830 77.783  1.00 65.10  ? 259  LYS A CG    1 
ATOM   1818  C  CD    . LYS A 1  259  ? 105.367 155.090 77.697  1.00 64.95  ? 259  LYS A CD    1 
ATOM   1819  C  CE    . LYS A 1  259  ? 105.738 154.466 79.033  1.00 63.89  ? 259  LYS A CE    1 
ATOM   1820  N  NZ    . LYS A 1  259  ? 107.042 153.751 78.970  1.00 63.24  ? 259  LYS A NZ    1 
ATOM   1821  N  N     . GLN A 1  260  ? 102.299 153.710 75.459  1.00 64.45  ? 260  GLN A N     1 
ATOM   1822  C  CA    . GLN A 1  260  ? 102.482 152.395 74.856  1.00 65.42  ? 260  GLN A CA    1 
ATOM   1823  C  C     . GLN A 1  260  ? 101.648 152.249 73.589  1.00 65.57  ? 260  GLN A C     1 
ATOM   1824  O  O     . GLN A 1  260  ? 102.130 151.734 72.574  1.00 65.28  ? 260  GLN A O     1 
ATOM   1825  C  CB    . GLN A 1  260  ? 102.121 151.293 75.856  1.00 64.47  ? 260  GLN A CB    1 
ATOM   1826  C  CG    . GLN A 1  260  ? 103.200 150.972 76.880  1.00 63.93  ? 260  GLN A CG    1 
ATOM   1827  C  CD    . GLN A 1  260  ? 103.256 151.968 78.020  1.00 64.02  ? 260  GLN A CD    1 
ATOM   1828  O  OE1   . GLN A 1  260  ? 102.597 153.006 77.987  1.00 66.04  ? 260  GLN A OE1   1 
ATOM   1829  N  NE2   . GLN A 1  260  ? 104.041 151.650 79.044  1.00 65.70  ? 260  GLN A NE2   1 
ATOM   1830  N  N     . ILE A 1  261  ? 100.391 152.699 73.631  1.00 67.61  ? 261  ILE A N     1 
ATOM   1831  C  CA    . ILE A 1  261  ? 99.516  152.547 72.472  1.00 69.22  ? 261  ILE A CA    1 
ATOM   1832  C  C     . ILE A 1  261  ? 99.927  153.492 71.351  1.00 70.25  ? 261  ILE A C     1 
ATOM   1833  O  O     . ILE A 1  261  ? 99.683  153.207 70.172  1.00 70.60  ? 261  ILE A O     1 
ATOM   1834  C  CB    . ILE A 1  261  ? 98.043  152.747 72.877  1.00 70.53  ? 261  ILE A CB    1 
ATOM   1835  C  CG1   . ILE A 1  261  ? 97.826  154.124 73.510  1.00 70.40  ? 261  ILE A CG1   1 
ATOM   1836  C  CG2   . ILE A 1  261  ? 97.600  151.646 73.831  1.00 69.94  ? 261  ILE A CG2   1 
ATOM   1837  C  CD1   . ILE A 1  261  ? 97.251  155.160 72.561  1.00 70.94  ? 261  ILE A CD1   1 
ATOM   1838  N  N     . THR A 1  262  ? 100.551 154.626 71.685  1.00 69.85  ? 262  THR A N     1 
ATOM   1839  C  CA    . THR A 1  262  ? 101.068 155.506 70.642  1.00 69.51  ? 262  THR A CA    1 
ATOM   1840  C  C     . THR A 1  262  ? 102.204 154.838 69.879  1.00 70.67  ? 262  THR A C     1 
ATOM   1841  O  O     . THR A 1  262  ? 102.322 155.002 68.660  1.00 71.31  ? 262  THR A O     1 
ATOM   1842  C  CB    . THR A 1  262  ? 101.532 156.834 71.242  1.00 70.94  ? 262  THR A CB    1 
ATOM   1843  O  OG1   . THR A 1  262  ? 102.342 156.583 72.397  1.00 67.97  ? 262  THR A OG1   1 
ATOM   1844  C  CG2   . THR A 1  262  ? 100.337 157.693 71.632  1.00 67.54  ? 262  THR A CG2   1 
ATOM   1845  N  N     . ASN A 1  263  ? 103.052 154.083 70.582  1.00 66.55  ? 263  ASN A N     1 
ATOM   1846  C  CA    . ASN A 1  263  ? 104.055 153.277 69.898  1.00 65.86  ? 263  ASN A CA    1 
ATOM   1847  C  C     . ASN A 1  263  ? 103.407 152.158 69.093  1.00 66.03  ? 263  ASN A C     1 
ATOM   1848  O  O     . ASN A 1  263  ? 103.943 151.748 68.058  1.00 66.47  ? 263  ASN A O     1 
ATOM   1849  C  CB    . ASN A 1  263  ? 105.049 152.704 70.908  1.00 66.82  ? 263  ASN A CB    1 
ATOM   1850  C  CG    . ASN A 1  263  ? 106.242 152.042 70.244  1.00 66.73  ? 263  ASN A CG    1 
ATOM   1851  O  OD1   . ASN A 1  263  ? 106.543 152.302 69.079  1.00 65.77  ? 263  ASN A OD1   1 
ATOM   1852  N  ND2   . ASN A 1  263  ? 106.931 151.184 70.986  1.00 65.12  ? 263  ASN A ND2   1 
ATOM   1853  N  N     . ASN A 1  264  ? 102.255 151.657 69.548  1.00 66.72  ? 264  ASN A N     1 
ATOM   1854  C  CA    . ASN A 1  264  ? 101.504 150.681 68.770  1.00 67.65  ? 264  ASN A CA    1 
ATOM   1855  C  C     . ASN A 1  264  ? 100.933 151.287 67.495  1.00 68.25  ? 264  ASN A C     1 
ATOM   1856  O  O     . ASN A 1  264  ? 100.666 150.552 66.538  1.00 68.69  ? 264  ASN A O     1 
ATOM   1857  C  CB    . ASN A 1  264  ? 100.379 150.087 69.621  1.00 68.84  ? 264  ASN A CB    1 
ATOM   1858  C  CG    . ASN A 1  264  ? 99.703  148.903 68.955  1.00 68.89  ? 264  ASN A CG    1 
ATOM   1859  O  OD1   . ASN A 1  264  ? 100.299 148.222 68.121  1.00 68.34  ? 264  ASN A OD1   1 
ATOM   1860  N  ND2   . ASN A 1  264  ? 98.452  148.651 69.325  1.00 67.56  ? 264  ASN A ND2   1 
ATOM   1861  N  N     . ARG A 1  265  ? 100.739 152.607 67.460  1.00 69.73  ? 265  ARG A N     1 
ATOM   1862  C  CA    . ARG A 1  265  ? 100.314 153.269 66.232  1.00 70.26  ? 265  ARG A CA    1 
ATOM   1863  C  C     . ARG A 1  265  ? 101.491 153.496 65.292  1.00 69.12  ? 265  ARG A C     1 
ATOM   1864  O  O     . ARG A 1  265  ? 101.380 153.276 64.081  1.00 68.75  ? 265  ARG A O     1 
ATOM   1865  C  CB    . ARG A 1  265  ? 99.629  154.598 66.557  1.00 68.75  ? 265  ARG A CB    1 
ATOM   1866  C  CG    . ARG A 1  265  ? 98.108  154.540 66.612  1.00 69.02  ? 265  ARG A CG    1 
ATOM   1867  C  CD    . ARG A 1  265  ? 97.614  153.740 67.805  1.00 69.20  ? 265  ARG A CD    1 
ATOM   1868  N  NE    . ARG A 1  265  ? 96.174  153.883 67.996  1.00 69.41  ? 265  ARG A NE    1 
ATOM   1869  C  CZ    . ARG A 1  265  ? 95.607  154.857 68.701  1.00 68.94  ? 265  ARG A CZ    1 
ATOM   1870  N  NH1   . ARG A 1  265  ? 94.287  154.909 68.822  1.00 71.86  ? 265  ARG A NH1   1 
ATOM   1871  N  NH2   . ARG A 1  265  ? 96.359  155.779 69.286  1.00 72.06  ? 265  ARG A NH2   1 
ATOM   1872  N  N     . VAL A 1  266  ? 102.629 153.937 65.835  1.00 73.22  ? 266  VAL A N     1 
ATOM   1873  C  CA    . VAL A 1  266  ? 103.793 154.247 65.010  1.00 73.90  ? 266  VAL A CA    1 
ATOM   1874  C  C     . VAL A 1  266  ? 104.529 153.005 64.535  1.00 73.47  ? 266  VAL A C     1 
ATOM   1875  O  O     . VAL A 1  266  ? 105.353 153.097 63.619  1.00 73.08  ? 266  VAL A O     1 
ATOM   1876  C  CB    . VAL A 1  266  ? 104.756 155.177 65.779  1.00 73.20  ? 266  VAL A CB    1 
ATOM   1877  C  CG1   . VAL A 1  266  ? 105.634 154.375 66.729  1.00 74.59  ? 266  VAL A CG1   1 
ATOM   1878  C  CG2   . VAL A 1  266  ? 105.598 156.004 64.815  1.00 74.91  ? 266  VAL A CG2   1 
ATOM   1879  N  N     . LYS A 1  267  ? 104.253 151.841 65.123  1.00 77.01  ? 267  LYS A N     1 
ATOM   1880  C  CA    . LYS A 1  267  ? 104.898 150.602 64.708  1.00 79.12  ? 267  LYS A CA    1 
ATOM   1881  C  C     . LYS A 1  267  ? 104.280 150.006 63.447  1.00 78.99  ? 267  LYS A C     1 
ATOM   1882  O  O     . LYS A 1  267  ? 104.651 148.891 63.063  1.00 78.66  ? 267  LYS A O     1 
ATOM   1883  C  CB    . LYS A 1  267  ? 104.850 149.572 65.840  1.00 78.48  ? 267  LYS A CB    1 
ATOM   1884  C  CG    . LYS A 1  267  ? 103.462 149.032 66.134  1.00 78.06  ? 267  LYS A CG    1 
ATOM   1885  C  CD    . LYS A 1  267  ? 103.504 147.937 67.187  1.00 77.46  ? 267  LYS A CD    1 
ATOM   1886  C  CE    . LYS A 1  267  ? 104.312 146.742 66.708  1.00 82.08  ? 267  LYS A CE    1 
ATOM   1887  N  NZ    . LYS A 1  267  ? 103.734 146.141 65.474  1.00 81.48  ? 267  LYS A NZ    1 
ATOM   1888  N  N     . GLY A 1  268  ? 103.357 150.714 62.804  1.00 86.38  ? 268  GLY A N     1 
ATOM   1889  C  CA    . GLY A 1  268  ? 102.702 150.214 61.612  1.00 90.56  ? 268  GLY A CA    1 
ATOM   1890  C  C     . GLY A 1  268  ? 103.624 150.068 60.419  1.00 94.55  ? 268  GLY A C     1 
ATOM   1891  O  O     . GLY A 1  268  ? 103.745 148.979 59.851  1.00 94.98  ? 268  GLY A O     1 
ATOM   1892  N  N     . PHE A 1  269  ? 104.283 151.161 60.029  1.00 99.03  ? 269  PHE A N     1 
ATOM   1893  C  CA    . PHE A 1  269  ? 105.137 151.146 58.846  1.00 101.87 ? 269  PHE A CA    1 
ATOM   1894  C  C     . PHE A 1  269  ? 106.462 150.427 59.068  1.00 106.60 ? 269  PHE A C     1 
ATOM   1895  O  O     . PHE A 1  269  ? 107.245 150.314 58.118  1.00 111.56 ? 269  PHE A O     1 
ATOM   1896  C  CB    . PHE A 1  269  ? 105.394 152.578 58.364  1.00 113.36 ? 269  PHE A CB    1 
ATOM   1897  C  CG    . PHE A 1  269  ? 105.984 153.482 59.412  1.00 114.45 ? 269  PHE A CG    1 
ATOM   1898  C  CD1   . PHE A 1  269  ? 105.166 154.224 60.248  1.00 115.62 ? 269  PHE A CD1   1 
ATOM   1899  C  CD2   . PHE A 1  269  ? 107.357 153.601 59.551  1.00 115.59 ? 269  PHE A CD2   1 
ATOM   1900  C  CE1   . PHE A 1  269  ? 105.705 155.059 61.209  1.00 114.34 ? 269  PHE A CE1   1 
ATOM   1901  C  CE2   . PHE A 1  269  ? 107.904 154.433 60.510  1.00 98.34  ? 269  PHE A CE2   1 
ATOM   1902  C  CZ    . PHE A 1  269  ? 107.076 155.163 61.339  1.00 97.62  ? 269  PHE A CZ    1 
ATOM   1903  N  N     . ILE A 1  270  ? 106.739 149.944 60.276  1.00 94.89  ? 270  ILE A N     1 
ATOM   1904  C  CA    . ILE A 1  270  ? 107.960 149.187 60.529  1.00 92.84  ? 270  ILE A CA    1 
ATOM   1905  C  C     . ILE A 1  270  ? 107.615 147.764 60.953  1.00 90.52  ? 270  ILE A C     1 
ATOM   1906  O  O     . ILE A 1  270  ? 106.443 147.404 61.061  1.00 88.43  ? 270  ILE A O     1 
ATOM   1907  C  CB    . ILE A 1  270  ? 108.846 149.881 61.586  1.00 87.54  ? 270  ILE A CB    1 
ATOM   1908  C  CG1   . ILE A 1  270  ? 108.045 150.185 62.856  1.00 89.68  ? 270  ILE A CG1   1 
ATOM   1909  C  CG2   . ILE A 1  270  ? 109.463 151.149 61.017  1.00 94.27  ? 270  ILE A CG2   1 
ATOM   1910  C  CD1   . ILE A 1  270  ? 108.224 149.162 63.962  1.00 94.07  ? 270  ILE A CD1   1 
ATOM   1911  N  N     . SER A 1  312  ? 94.856  143.128 83.512  1.00 64.17  ? 312  SER A N     1 
ATOM   1912  C  CA    . SER A 1  312  ? 94.564  142.048 84.448  1.00 64.51  ? 312  SER A CA    1 
ATOM   1913  C  C     . SER A 1  312  ? 93.780  140.932 83.765  1.00 64.78  ? 312  SER A C     1 
ATOM   1914  O  O     . SER A 1  312  ? 92.579  140.781 83.984  1.00 64.28  ? 312  SER A O     1 
ATOM   1915  C  CB    . SER A 1  312  ? 93.792  142.580 85.655  1.00 64.06  ? 312  SER A CB    1 
ATOM   1916  O  OG    . SER A 1  312  ? 94.549  143.555 86.351  1.00 64.38  ? 312  SER A OG    1 
ATOM   1917  N  N     . THR A 1  313  ? 94.470  140.150 82.937  1.00 62.93  ? 313  THR A N     1 
ATOM   1918  C  CA    . THR A 1  313  ? 93.864  139.052 82.198  1.00 62.41  ? 313  THR A CA    1 
ATOM   1919  C  C     . THR A 1  313  ? 94.635  137.768 82.462  1.00 63.45  ? 313  THR A C     1 
ATOM   1920  O  O     . THR A 1  313  ? 95.869  137.755 82.418  1.00 63.18  ? 313  THR A O     1 
ATOM   1921  C  CB    . THR A 1  313  ? 93.835  139.335 80.688  1.00 64.17  ? 313  THR A CB    1 
ATOM   1922  O  OG1   . THR A 1  313  ? 95.172  139.533 80.211  1.00 61.20  ? 313  THR A OG1   1 
ATOM   1923  C  CG2   . THR A 1  313  ? 93.006  140.575 80.391  1.00 60.58  ? 313  THR A CG2   1 
ATOM   1924  N  N     . TYR A 1  314  ? 93.901  136.692 82.731  1.00 60.73  ? 314  TYR A N     1 
ATOM   1925  C  CA    . TYR A 1  314  ? 94.524  135.403 82.991  1.00 60.34  ? 314  TYR A CA    1 
ATOM   1926  C  C     . TYR A 1  314  ? 95.214  134.873 81.739  1.00 61.84  ? 314  TYR A C     1 
ATOM   1927  O  O     . TYR A 1  314  ? 94.846  135.207 80.609  1.00 63.90  ? 314  TYR A O     1 
ATOM   1928  C  CB    . TYR A 1  314  ? 93.482  134.396 83.479  1.00 64.69  ? 314  TYR A CB    1 
ATOM   1929  C  CG    . TYR A 1  314  ? 92.799  134.791 84.769  1.00 66.10  ? 314  TYR A CG    1 
ATOM   1930  C  CD1   . TYR A 1  314  ? 93.339  134.440 85.999  1.00 66.84  ? 314  TYR A CD1   1 
ATOM   1931  C  CD2   . TYR A 1  314  ? 91.614  135.516 84.758  1.00 67.41  ? 314  TYR A CD2   1 
ATOM   1932  C  CE1   . TYR A 1  314  ? 92.720  134.799 87.181  1.00 66.62  ? 314  TYR A CE1   1 
ATOM   1933  C  CE2   . TYR A 1  314  ? 90.988  135.880 85.935  1.00 65.76  ? 314  TYR A CE2   1 
ATOM   1934  C  CZ    . TYR A 1  314  ? 91.544  135.519 87.144  1.00 58.90  ? 314  TYR A CZ    1 
ATOM   1935  O  OH    . TYR A 1  314  ? 90.924  135.879 88.318  1.00 58.89  ? 314  TYR A OH    1 
ATOM   1936  N  N     . ILE A 1  315  ? 96.226  134.037 81.952  1.00 58.22  ? 315  ILE A N     1 
ATOM   1937  C  CA    . ILE A 1  315  ? 97.020  133.459 80.872  1.00 58.65  ? 315  ILE A CA    1 
ATOM   1938  C  C     . ILE A 1  315  ? 96.839  131.949 80.912  1.00 58.88  ? 315  ILE A C     1 
ATOM   1939  O  O     . ILE A 1  315  ? 97.225  131.297 81.890  1.00 58.89  ? 315  ILE A O     1 
ATOM   1940  C  CB    . ILE A 1  315  ? 98.505  133.837 80.988  1.00 58.96  ? 315  ILE A CB    1 
ATOM   1941  C  CG1   . ILE A 1  315  ? 98.670  135.358 80.985  1.00 59.11  ? 315  ILE A CG1   1 
ATOM   1942  C  CG2   . ILE A 1  315  ? 99.300  133.211 79.855  1.00 58.98  ? 315  ILE A CG2   1 
ATOM   1943  C  CD1   . ILE A 1  315  ? 98.147  136.026 79.731  1.00 58.12  ? 315  ILE A CD1   1 
ATOM   1944  N  N     . LEU A 1  316  ? 96.259  131.396 79.850  1.00 60.50  ? 316  LEU A N     1 
ATOM   1945  C  CA    . LEU A 1  316  ? 96.033  129.962 79.775  1.00 62.00  ? 316  LEU A CA    1 
ATOM   1946  C  C     . LEU A 1  316  ? 97.356  129.223 79.571  1.00 62.42  ? 316  LEU A C     1 
ATOM   1947  O  O     . LEU A 1  316  ? 98.391  129.811 79.242  1.00 62.98  ? 316  LEU A O     1 
ATOM   1948  C  CB    . LEU A 1  316  ? 95.043  129.627 78.656  1.00 63.46  ? 316  LEU A CB    1 
ATOM   1949  C  CG    . LEU A 1  316  ? 95.400  129.869 77.185  1.00 63.47  ? 316  LEU A CG    1 
ATOM   1950  C  CD1   . LEU A 1  316  ? 94.429  129.110 76.298  1.00 63.01  ? 316  LEU A CD1   1 
ATOM   1951  C  CD2   . LEU A 1  316  ? 95.379  131.348 76.827  1.00 63.47  ? 316  LEU A CD2   1 
ATOM   1952  N  N     . SER A 1  317  ? 97.310  127.904 79.771  1.00 65.55  ? 317  SER A N     1 
ATOM   1953  C  CA    . SER A 1  317  ? 98.529  127.104 79.759  1.00 66.81  ? 317  SER A CA    1 
ATOM   1954  C  C     . SER A 1  317  ? 99.034  126.827 78.349  1.00 65.65  ? 317  SER A C     1 
ATOM   1955  O  O     . SER A 1  317  ? 100.249 126.723 78.144  1.00 65.10  ? 317  SER A O     1 
ATOM   1956  C  CB    . SER A 1  317  ? 98.295  125.783 80.494  1.00 70.10  ? 317  SER A CB    1 
ATOM   1957  O  OG    . SER A 1  317  ? 97.942  126.008 81.847  1.00 69.52  ? 317  SER A OG    1 
ATOM   1958  N  N     . THR A 1  318  ? 98.136  126.703 77.369  1.00 75.50  ? 318  THR A N     1 
ATOM   1959  C  CA    . THR A 1  318  ? 98.576  126.408 76.010  1.00 79.86  ? 318  THR A CA    1 
ATOM   1960  C  C     . THR A 1  318  ? 99.266  127.606 75.371  1.00 81.29  ? 318  THR A C     1 
ATOM   1961  O  O     . THR A 1  318  ? 100.094 127.432 74.469  1.00 80.95  ? 318  THR A O     1 
ATOM   1962  C  CB    . THR A 1  318  ? 97.395  125.959 75.151  1.00 81.75  ? 318  THR A CB    1 
ATOM   1963  O  OG1   . THR A 1  318  ? 96.476  127.047 74.988  1.00 81.07  ? 318  THR A OG1   1 
ATOM   1964  C  CG2   . THR A 1  318  ? 96.676  124.788 75.804  1.00 81.99  ? 318  THR A CG2   1 
ATOM   1965  N  N     . GLU A 1  319  ? 98.943  128.823 75.816  1.00 79.98  ? 319  GLU A N     1 
ATOM   1966  C  CA    . GLU A 1  319  ? 99.595  130.007 75.269  1.00 78.52  ? 319  GLU A CA    1 
ATOM   1967  C  C     . GLU A 1  319  ? 101.074 130.034 75.635  1.00 79.82  ? 319  GLU A C     1 
ATOM   1968  O  O     . GLU A 1  319  ? 101.939 130.127 74.758  1.00 81.52  ? 319  GLU A O     1 
ATOM   1969  C  CB    . GLU A 1  319  ? 98.893  131.273 75.762  1.00 82.67  ? 319  GLU A CB    1 
ATOM   1970  C  CG    . GLU A 1  319  ? 99.482  132.559 75.206  1.00 83.85  ? 319  GLU A CG    1 
ATOM   1971  C  CD    . GLU A 1  319  ? 98.751  133.794 75.695  1.00 82.42  ? 319  GLU A CD    1 
ATOM   1972  O  OE1   . GLU A 1  319  ? 97.808  133.649 76.501  1.00 75.87  ? 319  GLU A OE1   1 
ATOM   1973  O  OE2   . GLU A 1  319  ? 99.120  134.910 75.273  1.00 75.23  ? 319  GLU A OE2   1 
ATOM   1974  N  N     . VAL A 1  320  ? 101.384 129.951 76.932  1.00 72.71  ? 320  VAL A N     1 
ATOM   1975  C  CA    . VAL A 1  320  ? 102.777 129.881 77.354  1.00 70.65  ? 320  VAL A CA    1 
ATOM   1976  C  C     . VAL A 1  320  ? 103.427 128.583 76.903  1.00 69.60  ? 320  VAL A C     1 
ATOM   1977  O  O     . VAL A 1  320  ? 104.656 128.519 76.784  1.00 68.76  ? 320  VAL A O     1 
ATOM   1978  C  CB    . VAL A 1  320  ? 102.898 130.047 78.881  1.00 69.38  ? 320  VAL A CB    1 
ATOM   1979  C  CG1   . VAL A 1  320  ? 102.466 131.442 79.298  1.00 69.42  ? 320  VAL A CG1   1 
ATOM   1980  C  CG2   . VAL A 1  320  ? 102.073 128.991 79.600  1.00 69.53  ? 320  VAL A CG2   1 
ATOM   1981  N  N     . LYS A 1  321  ? 102.635 127.539 76.649  1.00 67.35  ? 321  LYS A N     1 
ATOM   1982  C  CA    . LYS A 1  321  ? 103.189 126.322 76.069  1.00 66.34  ? 321  LYS A CA    1 
ATOM   1983  C  C     . LYS A 1  321  ? 103.759 126.591 74.684  1.00 66.35  ? 321  LYS A C     1 
ATOM   1984  O  O     . LYS A 1  321  ? 104.884 126.183 74.379  1.00 66.76  ? 321  LYS A O     1 
ATOM   1985  C  CB    . LYS A 1  321  ? 102.123 125.228 76.009  1.00 66.73  ? 321  LYS A CB    1 
ATOM   1986  C  CG    . LYS A 1  321  ? 102.547 123.984 75.242  1.00 66.27  ? 321  LYS A CG    1 
ATOM   1987  C  CD    . LYS A 1  321  ? 103.737 123.298 75.895  1.00 65.71  ? 321  LYS A CD    1 
ATOM   1988  C  CE    . LYS A 1  321  ? 103.389 122.782 77.281  1.00 66.20  ? 321  LYS A CE    1 
ATOM   1989  N  NZ    . LYS A 1  321  ? 104.533 122.058 77.902  1.00 66.41  ? 321  LYS A NZ    1 
ATOM   1990  N  N     . ASN A 1  322  ? 103.003 127.293 73.835  1.00 66.15  ? 322  ASN A N     1 
ATOM   1991  C  CA    . ASN A 1  322  ? 103.493 127.611 72.498  1.00 66.56  ? 322  ASN A CA    1 
ATOM   1992  C  C     . ASN A 1  322  ? 104.615 128.640 72.549  1.00 67.20  ? 322  ASN A C     1 
ATOM   1993  O  O     . ASN A 1  322  ? 105.536 128.601 71.723  1.00 67.32  ? 322  ASN A O     1 
ATOM   1994  C  CB    . ASN A 1  322  ? 102.345 128.113 71.622  1.00 67.22  ? 322  ASN A CB    1 
ATOM   1995  C  CG    . ASN A 1  322  ? 101.300 127.047 71.361  1.00 67.54  ? 322  ASN A CG    1 
ATOM   1996  O  OD1   . ASN A 1  322  ? 100.114 127.247 71.622  1.00 65.69  ? 322  ASN A OD1   1 
ATOM   1997  N  ND2   . ASN A 1  322  ? 101.737 125.907 70.839  1.00 65.97  ? 322  ASN A ND2   1 
ATOM   1998  N  N     . ILE A 1  323  ? 104.555 129.571 73.504  1.00 63.76  ? 323  ILE A N     1 
ATOM   1999  C  CA    . ILE A 1  323  ? 105.599 130.589 73.623  1.00 61.82  ? 323  ILE A CA    1 
ATOM   2000  C  C     . ILE A 1  323  ? 106.935 129.938 73.960  1.00 60.38  ? 323  ILE A C     1 
ATOM   2001  O  O     . ILE A 1  323  ? 107.936 130.131 73.260  1.00 59.87  ? 323  ILE A O     1 
ATOM   2002  C  CB    . ILE A 1  323  ? 105.208 131.646 74.671  1.00 59.52  ? 323  ILE A CB    1 
ATOM   2003  C  CG1   . ILE A 1  323  ? 104.031 132.486 74.170  1.00 59.80  ? 323  ILE A CG1   1 
ATOM   2004  C  CG2   . ILE A 1  323  ? 106.398 132.534 75.002  1.00 61.08  ? 323  ILE A CG2   1 
ATOM   2005  C  CD1   . ILE A 1  323  ? 103.571 133.540 75.153  1.00 60.45  ? 323  ILE A CD1   1 
ATOM   2006  N  N     . LEU A 1  324  ? 106.966 129.151 75.038  1.00 60.78  ? 324  LEU A N     1 
ATOM   2007  C  CA    . LEU A 1  324  ? 108.207 128.492 75.431  1.00 60.92  ? 324  LEU A CA    1 
ATOM   2008  C  C     . LEU A 1  324  ? 108.625 127.429 74.423  1.00 60.33  ? 324  LEU A C     1 
ATOM   2009  O  O     . LEU A 1  324  ? 109.823 127.184 74.244  1.00 59.83  ? 324  LEU A O     1 
ATOM   2010  C  CB    . LEU A 1  324  ? 108.066 127.879 76.826  1.00 59.52  ? 324  LEU A CB    1 
ATOM   2011  C  CG    . LEU A 1  324  ? 108.322 128.793 78.030  1.00 59.89  ? 324  LEU A CG    1 
ATOM   2012  C  CD1   . LEU A 1  324  ? 109.672 129.485 77.903  1.00 61.11  ? 324  LEU A CD1   1 
ATOM   2013  C  CD2   . LEU A 1  324  ? 107.210 129.816 78.222  1.00 61.92  ? 324  LEU A CD2   1 
ATOM   2014  N  N     . ASP A 1  325  ? 107.662 126.789 73.754  1.00 60.76  ? 325  ASP A N     1 
ATOM   2015  C  CA    . ASP A 1  325  ? 108.005 125.781 72.755  1.00 60.74  ? 325  ASP A CA    1 
ATOM   2016  C  C     . ASP A 1  325  ? 108.683 126.403 71.542  1.00 61.10  ? 325  ASP A C     1 
ATOM   2017  O  O     . ASP A 1  325  ? 109.513 125.753 70.895  1.00 61.19  ? 325  ASP A O     1 
ATOM   2018  C  CB    . ASP A 1  325  ? 106.754 125.015 72.326  1.00 61.07  ? 325  ASP A CB    1 
ATOM   2019  C  CG    . ASP A 1  325  ? 107.053 123.913 71.333  1.00 61.52  ? 325  ASP A CG    1 
ATOM   2020  O  OD1   . ASP A 1  325  ? 107.387 122.792 71.770  1.00 60.31  ? 325  ASP A OD1   1 
ATOM   2021  O  OD2   . ASP A 1  325  ? 106.951 124.166 70.115  1.00 61.03  ? 325  ASP A OD2   1 
ATOM   2022  N  N     . THR A 1  326  ? 108.352 127.653 71.220  1.00 58.77  ? 326  THR A N     1 
ATOM   2023  C  CA    . THR A 1  326  ? 108.952 128.327 70.076  1.00 57.66  ? 326  THR A CA    1 
ATOM   2024  C  C     . THR A 1  326  ? 110.275 128.998 70.425  1.00 57.90  ? 326  THR A C     1 
ATOM   2025  O  O     . THR A 1  326  ? 111.238 128.893 69.659  1.00 57.50  ? 326  THR A O     1 
ATOM   2026  C  CB    . THR A 1  326  ? 107.984 129.363 69.500  1.00 58.33  ? 326  THR A CB    1 
ATOM   2027  O  OG1   . THR A 1  326  ? 107.463 130.177 70.558  1.00 55.92  ? 326  THR A OG1   1 
ATOM   2028  C  CG2   . THR A 1  326  ? 106.835 128.677 68.773  1.00 55.75  ? 326  THR A CG2   1 
ATOM   2029  N  N     . VAL A 1  327  ? 110.346 129.683 71.569  1.00 54.16  ? 327  VAL A N     1 
ATOM   2030  C  CA    . VAL A 1  327  ? 111.575 130.377 71.936  1.00 53.44  ? 327  VAL A CA    1 
ATOM   2031  C  C     . VAL A 1  327  ? 112.679 129.405 72.331  1.00 52.96  ? 327  VAL A C     1 
ATOM   2032  O  O     . VAL A 1  327  ? 113.862 129.758 72.262  1.00 53.24  ? 327  VAL A O     1 
ATOM   2033  C  CB    . VAL A 1  327  ? 111.315 131.390 73.068  1.00 52.63  ? 327  VAL A CB    1 
ATOM   2034  C  CG1   . VAL A 1  327  ? 110.215 132.361 72.667  1.00 53.77  ? 327  VAL A CG1   1 
ATOM   2035  C  CG2   . VAL A 1  327  ? 110.963 130.675 74.364  1.00 54.01  ? 327  VAL A CG2   1 
ATOM   2036  N  N     . PHE A 1  328  ? 112.330 128.186 72.748  1.00 54.46  ? 328  PHE A N     1 
ATOM   2037  C  CA    . PHE A 1  328  ? 113.357 127.195 73.054  1.00 55.08  ? 328  PHE A CA    1 
ATOM   2038  C  C     . PHE A 1  328  ? 114.019 126.687 71.780  1.00 54.17  ? 328  PHE A C     1 
ATOM   2039  O  O     . PHE A 1  328  ? 115.251 126.619 71.693  1.00 53.00  ? 328  PHE A O     1 
ATOM   2040  C  CB    . PHE A 1  328  ? 112.758 126.038 73.855  1.00 52.71  ? 328  PHE A CB    1 
ATOM   2041  C  CG    . PHE A 1  328  ? 112.555 126.347 75.313  1.00 52.06  ? 328  PHE A CG    1 
ATOM   2042  C  CD1   . PHE A 1  328  ? 112.968 127.560 75.843  1.00 51.59  ? 328  PHE A CD1   1 
ATOM   2043  C  CD2   . PHE A 1  328  ? 111.961 125.422 76.156  1.00 51.45  ? 328  PHE A CD2   1 
ATOM   2044  C  CE1   . PHE A 1  328  ? 112.787 127.845 77.183  1.00 51.83  ? 328  PHE A CE1   1 
ATOM   2045  C  CE2   . PHE A 1  328  ? 111.778 125.702 77.497  1.00 56.57  ? 328  PHE A CE2   1 
ATOM   2046  C  CZ    . PHE A 1  328  ? 112.192 126.915 78.011  1.00 55.62  ? 328  PHE A CZ    1 
ATOM   2047  N  N     . ARG A 1  329  ? 113.218 126.333 70.773  1.00 59.31  ? 329  ARG A N     1 
ATOM   2048  C  CA    . ARG A 1  329  ? 113.768 125.933 69.485  1.00 61.52  ? 329  ARG A CA    1 
ATOM   2049  C  C     . ARG A 1  329  ? 114.361 127.104 68.712  1.00 62.82  ? 329  ARG A C     1 
ATOM   2050  O  O     . ARG A 1  329  ? 115.057 126.876 67.717  1.00 63.66  ? 329  ARG A O     1 
ATOM   2051  C  CB    . ARG A 1  329  ? 112.695 125.254 68.631  1.00 64.54  ? 329  ARG A CB    1 
ATOM   2052  C  CG    . ARG A 1  329  ? 112.139 123.968 69.216  1.00 65.30  ? 329  ARG A CG    1 
ATOM   2053  C  CD    . ARG A 1  329  ? 111.388 123.175 68.157  1.00 65.78  ? 329  ARG A CD    1 
ATOM   2054  N  NE    . ARG A 1  329  ? 110.344 123.970 67.515  1.00 66.28  ? 329  ARG A NE    1 
ATOM   2055  C  CZ    . ARG A 1  329  ? 109.057 123.915 67.842  1.00 65.53  ? 329  ARG A CZ    1 
ATOM   2056  N  NH1   . ARG A 1  329  ? 108.651 123.097 68.802  1.00 62.01  ? 329  ARG A NH1   1 
ATOM   2057  N  NH2   . ARG A 1  329  ? 108.176 124.674 67.205  1.00 62.03  ? 329  ARG A NH2   1 
ATOM   2058  N  N     . LYS A 1  330  ? 114.105 128.339 69.140  1.00 62.21  ? 330  LYS A N     1 
ATOM   2059  C  CA    . LYS A 1  330  ? 114.633 129.513 68.460  1.00 62.03  ? 330  LYS A CA    1 
ATOM   2060  C  C     . LYS A 1  330  ? 115.944 129.994 69.064  1.00 62.46  ? 330  LYS A C     1 
ATOM   2061  O  O     . LYS A 1  330  ? 116.777 130.562 68.348  1.00 62.77  ? 330  LYS A O     1 
ATOM   2062  C  CB    . LYS A 1  330  ? 113.604 130.646 68.492  1.00 63.10  ? 330  LYS A CB    1 
ATOM   2063  C  CG    . LYS A 1  330  ? 113.694 131.614 67.326  1.00 63.46  ? 330  LYS A CG    1 
ATOM   2064  C  CD    . LYS A 1  330  ? 112.522 132.582 67.336  1.00 63.34  ? 330  LYS A CD    1 
ATOM   2065  C  CE    . LYS A 1  330  ? 112.435 133.361 66.034  1.00 61.03  ? 330  LYS A CE    1 
ATOM   2066  N  NZ    . LYS A 1  330  ? 111.305 134.331 66.044  1.00 61.21  ? 330  LYS A NZ    1 
ATOM   2067  N  N     . GLU A 1  331  ? 116.143 129.781 70.361  1.00 58.99  ? 331  GLU A N     1 
ATOM   2068  C  CA    . GLU A 1  331  ? 117.369 130.144 71.059  1.00 57.33  ? 331  GLU A CA    1 
ATOM   2069  C  C     . GLU A 1  331  ? 118.041 128.906 71.645  1.00 56.85  ? 331  GLU A C     1 
ATOM   2070  O  O     . GLU A 1  331  ? 118.530 128.917 72.776  1.00 56.84  ? 331  GLU A O     1 
ATOM   2071  C  CB    . GLU A 1  331  ? 117.092 131.175 72.150  1.00 56.91  ? 331  GLU A CB    1 
ATOM   2072  C  CG    . GLU A 1  331  ? 116.585 132.508 71.630  1.00 56.93  ? 331  GLU A CG    1 
ATOM   2073  C  CD    . GLU A 1  331  ? 116.268 133.483 72.746  1.00 56.83  ? 331  GLU A CD    1 
ATOM   2074  O  OE1   . GLU A 1  331  ? 116.227 133.052 73.916  1.00 56.49  ? 331  GLU A OE1   1 
ATOM   2075  O  OE2   . GLU A 1  331  ? 116.064 134.680 72.453  1.00 56.37  ? 331  GLU A OE2   1 
ATOM   2076  N  N     . GLN A 1  332  ? 118.063 127.817 70.872  1.00 56.31  ? 332  GLN A N     1 
ATOM   2077  C  CA    . GLN A 1  332  ? 118.657 126.576 71.357  1.00 56.37  ? 332  GLN A CA    1 
ATOM   2078  C  C     . GLN A 1  332  ? 120.168 126.695 71.515  1.00 57.03  ? 332  GLN A C     1 
ATOM   2079  O  O     . GLN A 1  332  ? 120.768 125.942 72.290  1.00 57.47  ? 332  GLN A O     1 
ATOM   2080  C  CB    . GLN A 1  332  ? 118.312 125.426 70.411  1.00 57.65  ? 332  GLN A CB    1 
ATOM   2081  C  CG    . GLN A 1  332  ? 118.527 124.041 71.003  1.00 57.36  ? 332  GLN A CG    1 
ATOM   2082  C  CD    . GLN A 1  332  ? 117.470 123.674 72.027  1.00 57.85  ? 332  GLN A CD    1 
ATOM   2083  O  OE1   . GLN A 1  332  ? 116.298 124.019 71.877  1.00 55.85  ? 332  GLN A OE1   1 
ATOM   2084  N  NE2   . GLN A 1  332  ? 117.881 122.974 73.076  1.00 55.89  ? 332  GLN A NE2   1 
ATOM   2085  N  N     . CYS A 1  333  ? 120.797 127.629 70.796  1.00 55.36  ? 333  CYS A N     1 
ATOM   2086  C  CA    . CYS A 1  333  ? 122.244 127.790 70.896  1.00 55.37  ? 333  CYS A CA    1 
ATOM   2087  C  C     . CYS A 1  333  ? 122.658 128.234 72.295  1.00 55.10  ? 333  CYS A C     1 
ATOM   2088  O  O     . CYS A 1  333  ? 123.672 127.769 72.827  1.00 55.36  ? 333  CYS A O     1 
ATOM   2089  C  CB    . CYS A 1  333  ? 122.734 128.791 69.849  1.00 55.87  ? 333  CYS A CB    1 
ATOM   2090  S  SG    . CYS A 1  333  ? 124.519 129.077 69.867  1.00 56.46  ? 333  CYS A SG    1 
ATOM   2091  N  N     . VAL A 1  334  ? 121.885 129.130 72.904  1.00 56.57  ? 334  VAL A N     1 
ATOM   2092  C  CA    . VAL A 1  334  ? 122.183 129.571 74.261  1.00 57.38  ? 334  VAL A CA    1 
ATOM   2093  C  C     . VAL A 1  334  ? 121.476 128.703 75.300  1.00 57.80  ? 334  VAL A C     1 
ATOM   2094  O  O     . VAL A 1  334  ? 121.969 128.556 76.423  1.00 57.88  ? 334  VAL A O     1 
ATOM   2095  C  CB    . VAL A 1  334  ? 121.814 131.058 74.426  1.00 58.09  ? 334  VAL A CB    1 
ATOM   2096  C  CG1   . VAL A 1  334  ? 120.321 131.274 74.215  1.00 57.56  ? 334  VAL A CG1   1 
ATOM   2097  C  CG2   . VAL A 1  334  ? 122.255 131.584 75.789  1.00 56.83  ? 334  VAL A CG2   1 
ATOM   2098  N  N     . LEU A 1  335  ? 120.338 128.101 74.942  1.00 58.45  ? 335  LEU A N     1 
ATOM   2099  C  CA    . LEU A 1  335  ? 119.601 127.282 75.898  1.00 59.25  ? 335  LEU A CA    1 
ATOM   2100  C  C     . LEU A 1  335  ? 120.316 125.965 76.173  1.00 59.93  ? 335  LEU A C     1 
ATOM   2101  O  O     . LEU A 1  335  ? 120.258 125.445 77.294  1.00 59.88  ? 335  LEU A O     1 
ATOM   2102  C  CB    . LEU A 1  335  ? 118.186 127.021 75.384  1.00 59.43  ? 335  LEU A CB    1 
ATOM   2103  C  CG    . LEU A 1  335  ? 117.231 126.357 76.376  1.00 59.61  ? 335  LEU A CG    1 
ATOM   2104  C  CD1   . LEU A 1  335  ? 116.835 127.335 77.472  1.00 60.06  ? 335  LEU A CD1   1 
ATOM   2105  C  CD2   . LEU A 1  335  ? 116.008 125.809 75.663  1.00 60.24  ? 335  LEU A CD2   1 
ATOM   2106  N  N     . GLN A 1  336  ? 120.992 125.409 75.163  1.00 61.59  ? 336  GLN A N     1 
ATOM   2107  C  CA    . GLN A 1  336  ? 121.623 124.103 75.323  1.00 63.09  ? 336  GLN A CA    1 
ATOM   2108  C  C     . GLN A 1  336  ? 122.716 124.121 76.384  1.00 63.96  ? 336  GLN A C     1 
ATOM   2109  O  O     . GLN A 1  336  ? 122.985 123.091 77.010  1.00 65.26  ? 336  GLN A O     1 
ATOM   2110  C  CB    . GLN A 1  336  ? 122.192 123.621 73.988  1.00 67.30  ? 336  GLN A CB    1 
ATOM   2111  C  CG    . GLN A 1  336  ? 121.248 122.729 73.198  1.00 68.44  ? 336  GLN A CG    1 
ATOM   2112  C  CD    . GLN A 1  336  ? 120.996 121.398 73.882  1.00 68.45  ? 336  GLN A CD    1 
ATOM   2113  O  OE1   . GLN A 1  336  ? 121.816 120.926 74.670  1.00 63.58  ? 336  GLN A OE1   1 
ATOM   2114  N  NE2   . GLN A 1  336  ? 119.857 120.785 73.582  1.00 64.56  ? 336  GLN A NE2   1 
ATOM   2115  N  N     . TYR A 1  337  ? 123.355 125.269 76.602  1.00 62.85  ? 337  TYR A N     1 
ATOM   2116  C  CA    . TYR A 1  337  ? 124.373 125.368 77.640  1.00 62.68  ? 337  TYR A CA    1 
ATOM   2117  C  C     . TYR A 1  337  ? 123.871 126.019 78.919  1.00 64.77  ? 337  TYR A C     1 
ATOM   2118  O  O     . TYR A 1  337  ? 124.364 125.687 80.001  1.00 68.46  ? 337  TYR A O     1 
ATOM   2119  C  CB    . TYR A 1  337  ? 125.595 126.143 77.134  1.00 70.50  ? 337  TYR A CB    1 
ATOM   2120  C  CG    . TYR A 1  337  ? 126.749 126.107 78.112  1.00 72.09  ? 337  TYR A CG    1 
ATOM   2121  C  CD1   . TYR A 1  337  ? 127.646 125.047 78.117  1.00 72.51  ? 337  TYR A CD1   1 
ATOM   2122  C  CD2   . TYR A 1  337  ? 126.929 127.122 79.043  1.00 73.15  ? 337  TYR A CD2   1 
ATOM   2123  C  CE1   . TYR A 1  337  ? 128.696 125.006 79.015  1.00 71.87  ? 337  TYR A CE1   1 
ATOM   2124  C  CE2   . TYR A 1  337  ? 127.972 127.086 79.945  1.00 70.60  ? 337  TYR A CE2   1 
ATOM   2125  C  CZ    . TYR A 1  337  ? 128.853 126.028 79.926  1.00 59.28  ? 337  TYR A CZ    1 
ATOM   2126  O  OH    . TYR A 1  337  ? 129.894 125.999 80.824  1.00 58.73  ? 337  TYR A OH    1 
ATOM   2127  N  N     . VAL A 1  338  ? 122.905 126.939 78.831  1.00 56.40  ? 338  VAL A N     1 
ATOM   2128  C  CA    . VAL A 1  338  ? 122.397 127.590 80.035  1.00 54.93  ? 338  VAL A CA    1 
ATOM   2129  C  C     . VAL A 1  338  ? 121.726 126.588 80.964  1.00 56.30  ? 338  VAL A C     1 
ATOM   2130  O  O     . VAL A 1  338  ? 121.554 126.867 82.155  1.00 57.33  ? 338  VAL A O     1 
ATOM   2131  C  CB    . VAL A 1  338  ? 121.433 128.739 79.665  1.00 56.10  ? 338  VAL A CB    1 
ATOM   2132  C  CG1   . VAL A 1  338  ? 120.039 128.205 79.377  1.00 51.81  ? 338  VAL A CG1   1 
ATOM   2133  C  CG2   . VAL A 1  338  ? 121.400 129.786 80.770  1.00 52.47  ? 338  VAL A CG2   1 
ATOM   2134  N  N     . PHE A 1  339  ? 121.348 125.419 80.449  1.00 50.56  ? 339  PHE A N     1 
ATOM   2135  C  CA    . PHE A 1  339  ? 120.784 124.335 81.245  1.00 49.49  ? 339  PHE A CA    1 
ATOM   2136  C  C     . PHE A 1  339  ? 121.696 123.111 81.235  1.00 48.75  ? 339  PHE A C     1 
ATOM   2137  O  O     . PHE A 1  339  ? 121.232 121.970 81.300  1.00 47.71  ? 339  PHE A O     1 
ATOM   2138  C  CB    . PHE A 1  339  ? 119.389 123.967 80.749  1.00 47.23  ? 339  PHE A CB    1 
ATOM   2139  C  CG    . PHE A 1  339  ? 118.339 124.998 81.063  1.00 46.88  ? 339  PHE A CG    1 
ATOM   2140  C  CD1   . PHE A 1  339  ? 118.554 125.946 82.049  1.00 47.02  ? 339  PHE A CD1   1 
ATOM   2141  C  CD2   . PHE A 1  339  ? 117.138 125.015 80.375  1.00 47.29  ? 339  PHE A CD2   1 
ATOM   2142  C  CE1   . PHE A 1  339  ? 117.591 126.894 82.341  1.00 47.34  ? 339  PHE A CE1   1 
ATOM   2143  C  CE2   . PHE A 1  339  ? 116.171 125.959 80.663  1.00 49.40  ? 339  PHE A CE2   1 
ATOM   2144  C  CZ    . PHE A 1  339  ? 116.399 126.901 81.647  1.00 49.22  ? 339  PHE A CZ    1 
ATOM   2145  N  N     . HIS A 1  340  ? 123.006 123.335 81.149  1.00 49.52  ? 340  HIS A N     1 
ATOM   2146  C  CA    . HIS A 1  340  ? 123.979 122.252 81.137  1.00 49.97  ? 340  HIS A CA    1 
ATOM   2147  C  C     . HIS A 1  340  ? 125.273 122.731 81.780  1.00 49.98  ? 340  HIS A C     1 
ATOM   2148  O  O     . HIS A 1  340  ? 125.733 123.844 81.513  1.00 50.20  ? 340  HIS A O     1 
ATOM   2149  C  CB    . HIS A 1  340  ? 124.258 121.753 79.714  1.00 50.65  ? 340  HIS A CB    1 
ATOM   2150  C  CG    . HIS A 1  340  ? 123.158 120.914 79.139  1.00 50.89  ? 340  HIS A CG    1 
ATOM   2151  N  ND1   . HIS A 1  340  ? 122.026 121.457 78.570  1.00 50.72  ? 340  HIS A ND1   1 
ATOM   2152  C  CD2   . HIS A 1  340  ? 123.019 119.571 79.044  1.00 50.37  ? 340  HIS A CD2   1 
ATOM   2153  C  CE1   . HIS A 1  340  ? 121.236 120.485 78.150  1.00 50.11  ? 340  HIS A CE1   1 
ATOM   2154  N  NE2   . HIS A 1  340  ? 121.816 119.330 78.426  1.00 50.19  ? 340  HIS A NE2   1 
ATOM   2155  N  N     . SER A 1  341  ? 125.853 121.882 82.627  1.00 50.18  ? 341  SER A N     1 
ATOM   2156  C  CA    . SER A 1  341  ? 127.119 122.186 83.283  1.00 50.02  ? 341  SER A CA    1 
ATOM   2157  C  C     . SER A 1  341  ? 128.314 121.523 82.618  1.00 49.81  ? 341  SER A C     1 
ATOM   2158  O  O     . SER A 1  341  ? 129.415 122.082 82.649  1.00 49.42  ? 341  SER A O     1 
ATOM   2159  C  CB    . SER A 1  341  ? 127.068 121.763 84.755  1.00 50.82  ? 341  SER A CB    1 
ATOM   2160  O  OG    . SER A 1  341  ? 128.294 122.045 85.408  1.00 50.51  ? 341  SER A OG    1 
ATOM   2161  N  N     . ARG A 1  342  ? 128.123 120.355 82.021  1.00 53.45  ? 342  ARG A N     1 
ATOM   2162  C  CA    . ARG A 1  342  ? 129.170 119.607 81.347  1.00 56.23  ? 342  ARG A CA    1 
ATOM   2163  C  C     . ARG A 1  342  ? 128.952 119.624 79.839  1.00 57.24  ? 342  ARG A C     1 
ATOM   2164  O  O     . ARG A 1  342  ? 127.832 119.845 79.366  1.00 57.55  ? 342  ARG A O     1 
ATOM   2165  C  CB    . ARG A 1  342  ? 129.203 118.153 81.844  1.00 57.84  ? 342  ARG A CB    1 
ATOM   2166  C  CG    . ARG A 1  342  ? 130.092 117.914 83.058  1.00 58.05  ? 342  ARG A CG    1 
ATOM   2167  C  CD    . ARG A 1  342  ? 129.541 118.572 84.312  1.00 58.50  ? 342  ARG A CD    1 
ATOM   2168  N  NE    . ARG A 1  342  ? 130.328 118.232 85.493  1.00 58.63  ? 342  ARG A NE    1 
ATOM   2169  C  CZ    . ARG A 1  342  ? 130.073 118.683 86.718  1.00 58.63  ? 342  ARG A CZ    1 
ATOM   2170  N  NH1   . ARG A 1  342  ? 130.842 118.319 87.734  1.00 57.05  ? 342  ARG A NH1   1 
ATOM   2171  N  NH2   . ARG A 1  342  ? 129.047 119.499 86.925  1.00 56.91  ? 342  ARG A NH2   1 
ATOM   2172  N  N     . PRO A 1  343  ? 130.006 119.409 79.050  1.00 57.57  ? 343  PRO A N     1 
ATOM   2173  C  CA    . PRO A 1  343  ? 129.824 119.305 77.593  1.00 57.44  ? 343  PRO A CA    1 
ATOM   2174  C  C     . PRO A 1  343  ? 128.913 118.138 77.246  1.00 57.87  ? 343  PRO A C     1 
ATOM   2175  O  O     . PRO A 1  343  ? 129.238 116.974 77.497  1.00 57.76  ? 343  PRO A O     1 
ATOM   2176  C  CB    . PRO A 1  343  ? 131.251 119.097 77.071  1.00 57.71  ? 343  PRO A CB    1 
ATOM   2177  C  CG    . PRO A 1  343  ? 132.035 118.621 78.254  1.00 56.95  ? 343  PRO A CG    1 
ATOM   2178  C  CD    . PRO A 1  343  ? 131.424 119.306 79.434  1.00 56.45  ? 343  PRO A CD    1 
ATOM   2179  N  N     . ASN A 1  344  ? 127.763 118.460 76.663  1.00 56.78  ? 344  ASN A N     1 
ATOM   2180  C  CA    . ASN A 1  344  ? 126.724 117.471 76.383  1.00 56.75  ? 344  ASN A CA    1 
ATOM   2181  C  C     . ASN A 1  344  ? 127.167 116.597 75.217  1.00 56.57  ? 344  ASN A C     1 
ATOM   2182  O  O     . ASN A 1  344  ? 127.030 116.974 74.050  1.00 56.63  ? 344  ASN A O     1 
ATOM   2183  C  CB    . ASN A 1  344  ? 125.402 118.169 76.085  1.00 56.67  ? 344  ASN A CB    1 
ATOM   2184  C  CG    . ASN A 1  344  ? 124.226 117.213 76.078  1.00 56.67  ? 344  ASN A CG    1 
ATOM   2185  O  OD1   . ASN A 1  344  ? 124.357 116.044 76.441  1.00 57.06  ? 344  ASN A OD1   1 
ATOM   2186  N  ND2   . ASN A 1  344  ? 123.064 117.711 75.674  1.00 57.06  ? 344  ASN A ND2   1 
ATOM   2187  N  N     . LEU A 1  345  ? 127.706 115.418 75.532  1.00 57.85  ? 345  LEU A N     1 
ATOM   2188  C  CA    . LEU A 1  345  ? 128.157 114.505 74.486  1.00 58.84  ? 345  LEU A CA    1 
ATOM   2189  C  C     . LEU A 1  345  ? 126.980 113.888 73.743  1.00 59.91  ? 345  LEU A C     1 
ATOM   2190  O  O     . LEU A 1  345  ? 127.013 113.762 72.512  1.00 60.78  ? 345  LEU A O     1 
ATOM   2191  C  CB    . LEU A 1  345  ? 129.043 113.415 75.089  1.00 60.68  ? 345  LEU A CB    1 
ATOM   2192  C  CG    . LEU A 1  345  ? 130.297 113.886 75.826  1.00 61.46  ? 345  LEU A CG    1 
ATOM   2193  C  CD1   . LEU A 1  345  ? 131.059 112.702 76.403  1.00 58.24  ? 345  LEU A CD1   1 
ATOM   2194  C  CD2   . LEU A 1  345  ? 131.188 114.703 74.903  1.00 58.37  ? 345  LEU A CD2   1 
ATOM   2195  N  N     . SER A 1  346  ? 125.931 113.496 74.470  1.00 57.27  ? 346  SER A N     1 
ATOM   2196  C  CA    . SER A 1  346  ? 124.765 112.889 73.837  1.00 56.65  ? 346  SER A CA    1 
ATOM   2197  C  C     . SER A 1  346  ? 123.991 113.877 72.974  1.00 56.71  ? 346  SER A C     1 
ATOM   2198  O  O     . SER A 1  346  ? 123.224 113.448 72.104  1.00 56.88  ? 346  SER A O     1 
ATOM   2199  C  CB    . SER A 1  346  ? 123.840 112.294 74.899  1.00 56.10  ? 346  SER A CB    1 
ATOM   2200  O  OG    . SER A 1  346  ? 124.508 111.301 75.658  1.00 55.58  ? 346  SER A OG    1 
ATOM   2201  N  N     . ARG A 1  347  ? 124.175 115.180 73.194  1.00 56.19  ? 347  ARG A N     1 
ATOM   2202  C  CA    . ARG A 1  347  ? 123.504 116.231 72.428  1.00 56.28  ? 347  ARG A CA    1 
ATOM   2203  C  C     . ARG A 1  347  ? 121.982 116.077 72.505  1.00 55.85  ? 347  ARG A C     1 
ATOM   2204  O  O     . ARG A 1  347  ? 121.293 115.861 71.506  1.00 55.22  ? 347  ARG A O     1 
ATOM   2205  C  CB    . ARG A 1  347  ? 123.994 116.247 70.974  1.00 54.87  ? 347  ARG A CB    1 
ATOM   2206  C  CG    . ARG A 1  347  ? 123.644 117.514 70.208  1.00 54.51  ? 347  ARG A CG    1 
ATOM   2207  C  CD    . ARG A 1  347  ? 124.196 117.473 68.793  1.00 54.06  ? 347  ARG A CD    1 
ATOM   2208  N  NE    . ARG A 1  347  ? 123.668 116.345 68.031  1.00 53.94  ? 347  ARG A NE    1 
ATOM   2209  C  CZ    . ARG A 1  347  ? 124.000 116.071 66.774  1.00 54.00  ? 347  ARG A CZ    1 
ATOM   2210  N  NH1   . ARG A 1  347  ? 124.865 116.844 66.132  1.00 57.21  ? 347  ARG A NH1   1 
ATOM   2211  N  NH2   . ARG A 1  347  ? 123.469 115.023 66.159  1.00 57.26  ? 347  ARG A NH2   1 
ATOM   2212  N  N     . LYS A 1  348  ? 121.470 116.181 73.728  1.00 58.87  ? 348  LYS A N     1 
ATOM   2213  C  CA    . LYS A 1  348  ? 120.039 116.102 73.964  1.00 60.35  ? 348  LYS A CA    1 
ATOM   2214  C  C     . LYS A 1  348  ? 119.354 117.393 73.524  1.00 61.63  ? 348  LYS A C     1 
ATOM   2215  O  O     . LYS A 1  348  ? 119.990 118.423 73.289  1.00 62.48  ? 348  LYS A O     1 
ATOM   2216  C  CB    . LYS A 1  348  ? 119.754 115.820 75.438  1.00 62.71  ? 348  LYS A CB    1 
ATOM   2217  C  CG    . LYS A 1  348  ? 120.280 114.481 75.927  1.00 62.51  ? 348  LYS A CG    1 
ATOM   2218  C  CD    . LYS A 1  348  ? 119.646 113.329 75.167  1.00 62.44  ? 348  LYS A CD    1 
ATOM   2219  C  CE    . LYS A 1  348  ? 120.159 111.987 75.665  1.00 60.00  ? 348  LYS A CE    1 
ATOM   2220  N  NZ    . LYS A 1  348  ? 119.542 110.850 74.930  1.00 59.87  ? 348  LYS A NZ    1 
ATOM   2221  N  N     . LEU A 1  349  ? 118.030 117.328 73.412  1.00 60.08  ? 349  LEU A N     1 
ATOM   2222  C  CA    . LEU A 1  349  ? 117.211 118.459 72.982  1.00 59.84  ? 349  LEU A CA    1 
ATOM   2223  C  C     . LEU A 1  349  ? 116.177 118.741 74.068  1.00 60.65  ? 349  LEU A C     1 
ATOM   2224  O  O     . LEU A 1  349  ? 115.130 118.087 74.122  1.00 61.10  ? 349  LEU A O     1 
ATOM   2225  C  CB    . LEU A 1  349  ? 116.544 118.172 71.640  1.00 60.94  ? 349  LEU A CB    1 
ATOM   2226  C  CG    . LEU A 1  349  ? 115.740 119.317 71.020  1.00 61.79  ? 349  LEU A CG    1 
ATOM   2227  C  CD1   . LEU A 1  349  ? 116.647 120.493 70.691  1.00 59.53  ? 349  LEU A CD1   1 
ATOM   2228  C  CD2   . LEU A 1  349  ? 114.995 118.845 69.782  1.00 59.96  ? 349  LEU A CD2   1 
ATOM   2229  N  N     . VAL A 1  350  ? 116.475 119.709 74.936  1.00 59.12  ? 350  VAL A N     1 
ATOM   2230  C  CA    . VAL A 1  350  ? 115.527 120.095 75.973  1.00 59.66  ? 350  VAL A CA    1 
ATOM   2231  C  C     . VAL A 1  350  ? 114.312 120.761 75.336  1.00 58.79  ? 350  VAL A C     1 
ATOM   2232  O  O     . VAL A 1  350  ? 114.416 121.471 74.327  1.00 58.80  ? 350  VAL A O     1 
ATOM   2233  C  CB    . VAL A 1  350  ? 116.195 121.020 77.007  1.00 58.51  ? 350  VAL A CB    1 
ATOM   2234  C  CG1   . VAL A 1  350  ? 117.248 120.258 77.797  1.00 60.99  ? 350  VAL A CG1   1 
ATOM   2235  C  CG2   . VAL A 1  350  ? 116.811 122.229 76.322  1.00 61.74  ? 350  VAL A CG2   1 
ATOM   2236  N  N     . LYS A 1  351  ? 113.144 120.523 75.928  1.00 62.34  ? 351  LYS A N     1 
ATOM   2237  C  CA    . LYS A 1  351  ? 111.889 121.038 75.405  1.00 63.64  ? 351  LYS A CA    1 
ATOM   2238  C  C     . LYS A 1  351  ? 111.146 121.790 76.499  1.00 63.82  ? 351  LYS A C     1 
ATOM   2239  O  O     . LYS A 1  351  ? 111.545 121.791 77.667  1.00 64.19  ? 351  LYS A O     1 
ATOM   2240  C  CB    . LYS A 1  351  ? 111.009 119.910 74.848  1.00 65.04  ? 351  LYS A CB    1 
ATOM   2241  C  CG    . LYS A 1  351  ? 111.651 119.125 73.712  1.00 65.38  ? 351  LYS A CG    1 
ATOM   2242  C  CD    . LYS A 1  351  ? 110.742 118.019 73.192  1.00 65.52  ? 351  LYS A CD    1 
ATOM   2243  C  CE    . LYS A 1  351  ? 109.726 118.535 72.179  1.00 64.72  ? 351  LYS A CE    1 
ATOM   2244  N  NZ    . LYS A 1  351  ? 108.639 119.351 72.791  1.00 64.62  ? 351  LYS A NZ    1 
ATOM   2245  N  N     . ALA A 1  352  ? 110.045 122.435 76.101  1.00 65.40  ? 352  ALA A N     1 
ATOM   2246  C  CA    . ALA A 1  352  ? 109.244 123.190 77.057  1.00 65.07  ? 352  ALA A CA    1 
ATOM   2247  C  C     . ALA A 1  352  ? 108.564 122.274 78.066  1.00 64.86  ? 352  ALA A C     1 
ATOM   2248  O  O     . ALA A 1  352  ? 108.226 122.712 79.172  1.00 64.70  ? 352  ALA A O     1 
ATOM   2249  C  CB    . ALA A 1  352  ? 108.205 124.037 76.322  1.00 64.65  ? 352  ALA A CB    1 
ATOM   2250  N  N     . ASP A 1  353  ? 108.361 121.004 77.711  1.00 64.17  ? 353  ASP A N     1 
ATOM   2251  C  CA    . ASP A 1  353  ? 107.734 120.053 78.621  1.00 63.36  ? 353  ASP A CA    1 
ATOM   2252  C  C     . ASP A 1  353  ? 108.605 119.725 79.827  1.00 64.05  ? 353  ASP A C     1 
ATOM   2253  O  O     . ASP A 1  353  ? 108.128 119.049 80.745  1.00 64.42  ? 353  ASP A O     1 
ATOM   2254  C  CB    . ASP A 1  353  ? 107.384 118.767 77.871  1.00 63.56  ? 353  ASP A CB    1 
ATOM   2255  C  CG    . ASP A 1  353  ? 106.416 119.007 76.728  1.00 65.02  ? 353  ASP A CG    1 
ATOM   2256  O  OD1   . ASP A 1  353  ? 105.601 119.948 76.824  1.00 61.39  ? 353  ASP A OD1   1 
ATOM   2257  O  OD2   . ASP A 1  353  ? 106.473 118.256 75.731  1.00 60.88  ? 353  ASP A OD2   1 
ATOM   2258  N  N     . SER A 1  354  ? 109.860 120.180 79.850  1.00 59.21  ? 354  SER A N     1 
ATOM   2259  C  CA    . SER A 1  354  ? 110.717 119.957 81.007  1.00 57.84  ? 354  SER A CA    1 
ATOM   2260  C  C     . SER A 1  354  ? 110.294 120.794 82.207  1.00 57.85  ? 354  SER A C     1 
ATOM   2261  O  O     . SER A 1  354  ? 110.689 120.481 83.335  1.00 57.80  ? 354  SER A O     1 
ATOM   2262  C  CB    . SER A 1  354  ? 112.173 120.260 80.650  1.00 56.56  ? 354  SER A CB    1 
ATOM   2263  O  OG    . SER A 1  354  ? 112.331 121.613 80.255  1.00 55.84  ? 354  SER A OG    1 
ATOM   2264  N  N     . PHE A 1  355  ? 109.504 121.847 81.991  1.00 56.37  ? 355  PHE A N     1 
ATOM   2265  C  CA    . PHE A 1  355  ? 109.033 122.698 83.074  1.00 56.88  ? 355  PHE A CA    1 
ATOM   2266  C  C     . PHE A 1  355  ? 107.532 122.624 83.299  1.00 57.11  ? 355  PHE A C     1 
ATOM   2267  O  O     . PHE A 1  355  ? 107.068 123.014 84.375  1.00 57.52  ? 355  PHE A O     1 
ATOM   2268  C  CB    . PHE A 1  355  ? 109.427 124.159 82.812  1.00 58.07  ? 355  PHE A CB    1 
ATOM   2269  C  CG    . PHE A 1  355  ? 110.911 124.391 82.783  1.00 58.65  ? 355  PHE A CG    1 
ATOM   2270  C  CD1   . PHE A 1  355  ? 111.759 123.630 83.571  1.00 58.73  ? 355  PHE A CD1   1 
ATOM   2271  C  CD2   . PHE A 1  355  ? 111.458 125.363 81.963  1.00 58.39  ? 355  PHE A CD2   1 
ATOM   2272  C  CE1   . PHE A 1  355  ? 113.124 123.839 83.546  1.00 57.86  ? 355  PHE A CE1   1 
ATOM   2273  C  CE2   . PHE A 1  355  ? 112.823 125.576 81.932  1.00 57.09  ? 355  PHE A CE2   1 
ATOM   2274  C  CZ    . PHE A 1  355  ? 113.657 124.813 82.726  1.00 56.26  ? 355  PHE A CZ    1 
ATOM   2275  N  N     . PHE A 1  356  ? 106.769 122.139 82.326  1.00 58.09  ? 356  PHE A N     1 
ATOM   2276  C  CA    . PHE A 1  356  ? 105.331 121.961 82.467  1.00 58.79  ? 356  PHE A CA    1 
ATOM   2277  C  C     . PHE A 1  356  ? 105.027 120.492 82.723  1.00 58.45  ? 356  PHE A C     1 
ATOM   2278  O  O     . PHE A 1  356  ? 105.541 119.615 82.019  1.00 57.29  ? 356  PHE A O     1 
ATOM   2279  C  CB    . PHE A 1  356  ? 104.589 122.449 81.221  1.00 56.73  ? 356  PHE A CB    1 
ATOM   2280  C  CG    . PHE A 1  356  ? 104.776 123.914 80.938  1.00 56.52  ? 356  PHE A CG    1 
ATOM   2281  C  CD1   . PHE A 1  356  ? 103.979 124.861 81.559  1.00 56.61  ? 356  PHE A CD1   1 
ATOM   2282  C  CD2   . PHE A 1  356  ? 105.745 124.342 80.046  1.00 56.75  ? 356  PHE A CD2   1 
ATOM   2283  C  CE1   . PHE A 1  356  ? 104.149 126.208 81.299  1.00 57.02  ? 356  PHE A CE1   1 
ATOM   2284  C  CE2   . PHE A 1  356  ? 105.919 125.687 79.782  1.00 59.79  ? 356  PHE A CE2   1 
ATOM   2285  C  CZ    . PHE A 1  356  ? 105.120 126.621 80.409  1.00 59.50  ? 356  PHE A CZ    1 
ATOM   2286  N  N     . MET A 1  357  ? 104.195 120.228 83.726  1.00 60.70  ? 357  MET A N     1 
ATOM   2287  C  CA    . MET A 1  357  ? 103.865 118.865 84.125  1.00 61.17  ? 357  MET A CA    1 
ATOM   2288  C  C     . MET A 1  357  ? 102.582 118.427 83.431  1.00 62.03  ? 357  MET A C     1 
ATOM   2289  O  O     . MET A 1  357  ? 101.517 119.015 83.650  1.00 62.83  ? 357  MET A O     1 
ATOM   2290  C  CB    . MET A 1  357  ? 103.715 118.769 85.643  1.00 63.36  ? 357  MET A CB    1 
ATOM   2291  C  CG    . MET A 1  357  ? 104.991 119.055 86.426  1.00 63.75  ? 357  MET A CG    1 
ATOM   2292  S  SD    . MET A 1  357  ? 106.286 117.822 86.177  1.00 60.82  ? 357  MET A SD    1 
ATOM   2293  C  CE    . MET A 1  357  ? 107.343 118.654 84.992  1.00 60.39  ? 357  MET A CE    1 
ATOM   2294  N  N     . ASP A 1  358  ? 102.685 117.394 82.594  1.00 61.01  ? 358  ASP A N     1 
ATOM   2295  C  CA    . ASP A 1  358  ? 101.517 116.833 81.928  1.00 61.20  ? 358  ASP A CA    1 
ATOM   2296  C  C     . ASP A 1  358  ? 100.881 115.702 82.722  1.00 62.43  ? 358  ASP A C     1 
ATOM   2297  O  O     . ASP A 1  358  ? 99.659  115.520 82.658  1.00 63.36  ? 358  ASP A O     1 
ATOM   2298  C  CB    . ASP A 1  358  ? 101.895 116.325 80.534  1.00 64.10  ? 358  ASP A CB    1 
ATOM   2299  C  CG    . ASP A 1  358  ? 102.398 117.431 79.628  1.00 63.39  ? 358  ASP A CG    1 
ATOM   2300  O  OD1   . ASP A 1  358  ? 101.956 118.586 79.797  1.00 60.24  ? 358  ASP A OD1   1 
ATOM   2301  O  OD2   . ASP A 1  358  ? 103.234 117.144 78.746  1.00 59.86  ? 358  ASP A OD2   1 
ATOM   2302  N  N     . VAL A 1  359  ? 101.679 114.935 83.466  1.00 60.40  ? 359  VAL A N     1 
ATOM   2303  C  CA    . VAL A 1  359  ? 101.184 113.836 84.282  1.00 61.01  ? 359  VAL A CA    1 
ATOM   2304  C  C     . VAL A 1  359  ? 101.778 113.958 85.679  1.00 61.61  ? 359  VAL A C     1 
ATOM   2305  O  O     . VAL A 1  359  ? 102.768 114.658 85.903  1.00 62.05  ? 359  VAL A O     1 
ATOM   2306  C  CB    . VAL A 1  359  ? 101.516 112.454 83.679  1.00 60.86  ? 359  VAL A CB    1 
ATOM   2307  C  CG1   . VAL A 1  359  ? 100.934 112.322 82.279  1.00 60.53  ? 359  VAL A CG1   1 
ATOM   2308  C  CG2   . VAL A 1  359  ? 103.021 112.230 83.664  1.00 60.67  ? 359  VAL A CG2   1 
ATOM   2309  N  N     . LEU A 1  360  ? 101.153 113.260 86.623  1.00 59.36  ? 360  LEU A N     1 
ATOM   2310  C  CA    . LEU A 1  360  ? 101.608 113.207 88.011  1.00 57.91  ? 360  LEU A CA    1 
ATOM   2311  C  C     . LEU A 1  360  ? 101.843 111.743 88.365  1.00 57.36  ? 360  LEU A C     1 
ATOM   2312  O  O     . LEU A 1  360  ? 100.893 111.006 88.647  1.00 57.17  ? 360  LEU A O     1 
ATOM   2313  C  CB    . LEU A 1  360  ? 100.593 113.851 88.950  1.00 56.90  ? 360  LEU A CB    1 
ATOM   2314  C  CG    . LEU A 1  360  ? 100.282 115.331 88.724  1.00 57.35  ? 360  LEU A CG    1 
ATOM   2315  C  CD1   . LEU A 1  360  ? 99.225  115.801 89.709  1.00 57.73  ? 360  LEU A CD1   1 
ATOM   2316  C  CD2   . LEU A 1  360  ? 101.545 116.170 88.843  1.00 58.39  ? 360  LEU A CD2   1 
ATOM   2317  N  N     . VAL A 1  361  ? 103.109 111.321 88.344  1.00 57.24  ? 361  VAL A N     1 
ATOM   2318  C  CA    . VAL A 1  361  ? 103.438 109.938 88.659  1.00 57.26  ? 361  VAL A CA    1 
ATOM   2319  C  C     . VAL A 1  361  ? 103.163 109.667 90.132  1.00 58.02  ? 361  VAL A C     1 
ATOM   2320  O  O     . VAL A 1  361  ? 103.473 110.486 91.008  1.00 58.55  ? 361  VAL A O     1 
ATOM   2321  C  CB    . VAL A 1  361  ? 104.901 109.635 88.293  1.00 58.19  ? 361  VAL A CB    1 
ATOM   2322  C  CG1   . VAL A 1  361  ? 105.063 109.570 86.783  1.00 56.93  ? 361  VAL A CG1   1 
ATOM   2323  C  CG2   . VAL A 1  361  ? 105.824 110.687 88.877  1.00 56.29  ? 361  VAL A CG2   1 
ATOM   2324  N  N     . VAL A 1  362  ? 102.565 108.512 90.411  1.00 54.37  ? 362  VAL A N     1 
ATOM   2325  C  CA    . VAL A 1  362  ? 102.175 108.149 91.771  1.00 53.01  ? 362  VAL A CA    1 
ATOM   2326  C  C     . VAL A 1  362  ? 103.153 107.120 92.325  1.00 53.63  ? 362  VAL A C     1 
ATOM   2327  O  O     . VAL A 1  362  ? 103.623 106.245 91.582  1.00 53.95  ? 362  VAL A O     1 
ATOM   2328  C  CB    . VAL A 1  362  ? 100.730 107.623 91.812  1.00 53.77  ? 362  VAL A CB    1 
ATOM   2329  C  CG1   . VAL A 1  362  ? 99.755  108.736 91.464  1.00 50.66  ? 362  VAL A CG1   1 
ATOM   2330  C  CG2   . VAL A 1  362  ? 100.558 106.450 90.858  1.00 50.96  ? 362  VAL A CG2   1 
ATOM   2331  N  N     . PRO A 1  363  ? 103.500 107.194 93.606  1.00 49.19  ? 363  PRO A N     1 
ATOM   2332  C  CA    . PRO A 1  363  ? 104.380 106.181 94.201  1.00 48.40  ? 363  PRO A CA    1 
ATOM   2333  C  C     . PRO A 1  363  ? 103.686 104.832 94.259  1.00 48.86  ? 363  PRO A C     1 
ATOM   2334  O  O     . PRO A 1  363  ? 102.450 104.758 94.187  1.00 49.14  ? 363  PRO A O     1 
ATOM   2335  C  CB    . PRO A 1  363  ? 104.649 106.731 95.612  1.00 49.20  ? 363  PRO A CB    1 
ATOM   2336  C  CG    . PRO A 1  363  ? 104.328 108.190 95.528  1.00 48.16  ? 363  PRO A CG    1 
ATOM   2337  C  CD    . PRO A 1  363  ? 103.207 108.290 94.543  1.00 47.63  ? 363  PRO A CD    1 
ATOM   2338  N  N     . PRO A 1  364  ? 104.445 103.742 94.376  1.00 49.48  ? 364  PRO A N     1 
ATOM   2339  C  CA    . PRO A 1  364  ? 103.818 102.419 94.469  1.00 50.81  ? 364  PRO A CA    1 
ATOM   2340  C  C     . PRO A 1  364  ? 102.951 102.297 95.713  1.00 50.55  ? 364  PRO A C     1 
ATOM   2341  O  O     . PRO A 1  364  ? 103.179 102.965 96.726  1.00 50.51  ? 364  PRO A O     1 
ATOM   2342  C  CB    . PRO A 1  364  ? 105.014 101.461 94.525  1.00 49.98  ? 364  PRO A CB    1 
ATOM   2343  C  CG    . PRO A 1  364  ? 106.144 102.226 93.916  1.00 52.87  ? 364  PRO A CG    1 
ATOM   2344  C  CD    . PRO A 1  364  ? 105.913 103.655 94.306  1.00 53.55  ? 364  PRO A CD    1 
ATOM   2345  N  N     . THR A 1  365  ? 101.940 101.430 95.622  1.00 55.65  ? 365  THR A N     1 
ATOM   2346  C  CA    . THR A 1  365  ? 101.031 101.228 96.747  1.00 58.20  ? 365  THR A CA    1 
ATOM   2347  C  C     . THR A 1  365  ? 101.756 100.643 97.954  1.00 59.72  ? 365  THR A C     1 
ATOM   2348  O  O     . THR A 1  365  ? 101.379 100.920 99.099  1.00 59.67  ? 365  THR A O     1 
ATOM   2349  C  CB    . THR A 1  365  ? 99.874  100.320 96.328  1.00 60.70  ? 365  THR A CB    1 
ATOM   2350  O  OG1   . THR A 1  365  ? 99.299  100.810 95.110  1.00 58.81  ? 365  THR A OG1   1 
ATOM   2351  C  CG2   . THR A 1  365  ? 98.799  100.291 97.404  1.00 59.56  ? 365  THR A CG2   1 
ATOM   2352  N  N     . ARG A 1  366  ? 102.799 99.842  97.719  1.00 58.42  ? 366  ARG A N     1 
ATOM   2353  C  CA    . ARG A 1  366  ? 103.579 99.296  98.824  1.00 58.27  ? 366  ARG A CA    1 
ATOM   2354  C  C     . ARG A 1  366  ? 104.258 100.399 99.626  1.00 60.43  ? 366  ARG A C     1 
ATOM   2355  O  O     . ARG A 1  366  ? 104.441 100.261 100.841 1.00 62.34  ? 366  ARG A O     1 
ATOM   2356  C  CB    . ARG A 1  366  ? 104.608 98.300  98.283  1.00 64.20  ? 366  ARG A CB    1 
ATOM   2357  C  CG    . ARG A 1  366  ? 105.532 97.692  99.327  1.00 67.00  ? 366  ARG A CG    1 
ATOM   2358  C  CD    . ARG A 1  366  ? 106.931 98.268  99.203  1.00 70.18  ? 366  ARG A CD    1 
ATOM   2359  N  NE    . ARG A 1  366  ? 107.260 98.562  97.811  1.00 71.47  ? 366  ARG A NE    1 
ATOM   2360  C  CZ    . ARG A 1  366  ? 108.450 98.981  97.395  1.00 71.10  ? 366  ARG A CZ    1 
ATOM   2361  N  NH1   . ARG A 1  366  ? 109.437 99.150  98.263  1.00 55.16  ? 366  ARG A NH1   1 
ATOM   2362  N  NH2   . ARG A 1  366  ? 108.653 99.226  96.108  1.00 54.28  ? 366  ARG A NH2   1 
ATOM   2363  N  N     . PHE A 1  367  ? 104.626 101.501 98.973  1.00 52.76  ? 367  PHE A N     1 
ATOM   2364  C  CA    . PHE A 1  367  ? 105.158 102.669 99.661  1.00 51.33  ? 367  PHE A CA    1 
ATOM   2365  C  C     . PHE A 1  367  ? 104.070 103.602 100.173 1.00 50.33  ? 367  PHE A C     1 
ATOM   2366  O  O     . PHE A 1  367  ? 104.383 104.559 100.889 1.00 49.07  ? 367  PHE A O     1 
ATOM   2367  C  CB    . PHE A 1  367  ? 106.099 103.449 98.735  1.00 49.23  ? 367  PHE A CB    1 
ATOM   2368  C  CG    . PHE A 1  367  ? 107.530 102.999 98.805  1.00 48.97  ? 367  PHE A CG    1 
ATOM   2369  C  CD1   . PHE A 1  367  ? 108.032 102.419 99.959  1.00 48.08  ? 367  PHE A CD1   1 
ATOM   2370  C  CD2   . PHE A 1  367  ? 108.375 103.161 97.720  1.00 47.42  ? 367  PHE A CD2   1 
ATOM   2371  C  CE1   . PHE A 1  367  ? 109.350 102.007 100.027 1.00 47.84  ? 367  PHE A CE1   1 
ATOM   2372  C  CE2   . PHE A 1  367  ? 109.693 102.751 97.782  1.00 51.55  ? 367  PHE A CE2   1 
ATOM   2373  C  CZ    . PHE A 1  367  ? 110.181 102.174 98.937  1.00 51.71  ? 367  PHE A CZ    1 
ATOM   2374  N  N     . ARG A 1  368  ? 102.812 103.349 99.826  1.00 51.96  ? 368  ARG A N     1 
ATOM   2375  C  CA    . ARG A 1  368  ? 101.678 104.155 100.261 1.00 52.27  ? 368  ARG A CA    1 
ATOM   2376  C  C     . ARG A 1  368  ? 100.708 103.316 101.083 1.00 51.83  ? 368  ARG A C     1 
ATOM   2377  O  O     . ARG A 1  368  ? 99.488  103.397 100.919 1.00 51.85  ? 368  ARG A O     1 
ATOM   2378  C  CB    . ARG A 1  368  ? 100.978 104.792 99.062  1.00 51.71  ? 368  ARG A CB    1 
ATOM   2379  C  CG    . ARG A 1  368  ? 101.873 105.733 98.268  1.00 51.04  ? 368  ARG A CG    1 
ATOM   2380  C  CD    . ARG A 1  368  ? 101.223 106.197 96.972  1.00 50.51  ? 368  ARG A CD    1 
ATOM   2381  N  NE    . ARG A 1  368  ? 100.891 105.082 96.090  1.00 50.59  ? 368  ARG A NE    1 
ATOM   2382  C  CZ    . ARG A 1  368  ? 99.654  104.746 95.743  1.00 50.25  ? 368  ARG A CZ    1 
ATOM   2383  N  NH1   . ARG A 1  368  ? 98.624  105.450 96.192  1.00 53.41  ? 368  ARG A NH1   1 
ATOM   2384  N  NH2   . ARG A 1  368  ? 99.444  103.715 94.937  1.00 53.49  ? 368  ARG A NH2   1 
ATOM   2385  N  N     . LEU A 1  369  ? 101.251 102.494 101.974 1.00 54.81  ? 369  LEU A N     1 
ATOM   2386  C  CA    . LEU A 1  369  ? 100.424 101.634 102.813 1.00 55.71  ? 369  LEU A CA    1 
ATOM   2387  C  C     . LEU A 1  369  ? 99.617  102.487 103.787 1.00 55.96  ? 369  LEU A C     1 
ATOM   2388  O  O     . LEU A 1  369  ? 100.174 103.396 104.415 1.00 56.37  ? 369  LEU A O     1 
ATOM   2389  C  CB    . LEU A 1  369  ? 101.308 100.639 103.568 1.00 56.67  ? 369  LEU A CB    1 
ATOM   2390  C  CG    . LEU A 1  369  ? 100.731 99.329  104.123 1.00 56.27  ? 369  LEU A CG    1 
ATOM   2391  C  CD1   . LEU A 1  369  ? 99.877  99.548  105.367 1.00 56.73  ? 369  LEU A CD1   1 
ATOM   2392  C  CD2   . LEU A 1  369  ? 99.947  98.585  103.049 1.00 56.64  ? 369  LEU A CD2   1 
ATOM   2393  N  N     . PRO A 1  370  ? 98.314  102.237 103.935 1.00 57.72  ? 370  PRO A N     1 
ATOM   2394  C  CA    . PRO A 1  370  ? 97.504  103.026 104.878 1.00 58.46  ? 370  PRO A CA    1 
ATOM   2395  C  C     . PRO A 1  370  ? 97.955  102.797 106.312 1.00 58.64  ? 370  PRO A C     1 
ATOM   2396  O  O     . PRO A 1  370  ? 97.840  101.692 106.846 1.00 58.42  ? 370  PRO A O     1 
ATOM   2397  C  CB    . PRO A 1  370  ? 96.080  102.507 104.641 1.00 57.92  ? 370  PRO A CB    1 
ATOM   2398  C  CG    . PRO A 1  370  ? 96.261  101.153 104.032 1.00 59.14  ? 370  PRO A CG    1 
ATOM   2399  C  CD    . PRO A 1  370  ? 97.505  101.252 103.200 1.00 58.92  ? 370  PRO A CD    1 
ATOM   2400  N  N     . SER A 1  371  ? 98.472  103.853 106.936 1.00 60.97  ? 371  SER A N     1 
ATOM   2401  C  CA    . SER A 1  371  ? 98.943  103.769 108.309 1.00 60.14  ? 371  SER A CA    1 
ATOM   2402  C  C     . SER A 1  371  ? 97.773  103.823 109.283 1.00 59.23  ? 371  SER A C     1 
ATOM   2403  O  O     . SER A 1  371  ? 96.743  104.450 109.020 1.00 60.19  ? 371  SER A O     1 
ATOM   2404  C  CB    . SER A 1  371  ? 99.926  104.901 108.609 1.00 62.60  ? 371  SER A CB    1 
ATOM   2405  O  OG    . SER A 1  371  ? 100.377 104.842 109.951 1.00 62.33  ? 371  SER A OG    1 
ATOM   2406  N  N     . LYS A 1  372  ? 97.944  103.154 110.422 1.00 65.10  ? 372  LYS A N     1 
ATOM   2407  C  CA    . LYS A 1  372  ? 96.931  103.102 111.464 1.00 66.65  ? 372  LYS A CA    1 
ATOM   2408  C  C     . LYS A 1  372  ? 97.580  103.358 112.816 1.00 67.13  ? 372  LYS A C     1 
ATOM   2409  O  O     . LYS A 1  372  ? 98.696  102.898 113.075 1.00 67.46  ? 372  LYS A O     1 
ATOM   2410  C  CB    . LYS A 1  372  ? 96.210  101.748 111.480 1.00 67.83  ? 372  LYS A CB    1 
ATOM   2411  C  CG    . LYS A 1  372  ? 95.419  101.446 110.218 1.00 67.73  ? 372  LYS A CG    1 
ATOM   2412  C  CD    . LYS A 1  372  ? 94.730  100.094 110.309 1.00 67.77  ? 372  LYS A CD    1 
ATOM   2413  C  CE    . LYS A 1  372  ? 93.770  100.042 111.486 1.00 67.97  ? 372  LYS A CE    1 
ATOM   2414  N  NZ    . LYS A 1  372  ? 93.089  98.722  111.589 1.00 68.32  ? 372  LYS A NZ    1 
ATOM   2415  N  N     . LEU A 1  373  ? 96.875  104.094 113.674 1.00 69.63  ? 373  LEU A N     1 
ATOM   2416  C  CA    . LEU A 1  373  ? 97.361  104.415 115.016 1.00 71.31  ? 373  LEU A CA    1 
ATOM   2417  C  C     . LEU A 1  373  ? 96.167  104.377 115.964 1.00 72.16  ? 373  LEU A C     1 
ATOM   2418  O  O     . LEU A 1  373  ? 95.435  105.362 116.090 1.00 72.62  ? 373  LEU A O     1 
ATOM   2419  C  CB    . LEU A 1  373  ? 98.053  105.773 115.045 1.00 72.82  ? 373  LEU A CB    1 
ATOM   2420  C  CG    . LEU A 1  373  ? 98.645  106.206 116.388 1.00 72.41  ? 373  LEU A CG    1 
ATOM   2421  C  CD1   . LEU A 1  373  ? 99.696  105.212 116.858 1.00 71.99  ? 373  LEU A CD1   1 
ATOM   2422  C  CD2   . LEU A 1  373  ? 99.232  107.606 116.291 1.00 72.36  ? 373  LEU A CD2   1 
ATOM   2423  N  N     . GLY A 1  374  ? 95.977  103.239 116.627 1.00 72.94  ? 374  GLY A N     1 
ATOM   2424  C  CA    . GLY A 1  374  ? 94.882  103.083 117.564 1.00 74.06  ? 374  GLY A CA    1 
ATOM   2425  C  C     . GLY A 1  374  ? 93.542  102.855 116.896 1.00 75.25  ? 374  GLY A C     1 
ATOM   2426  O  O     . GLY A 1  374  ? 93.341  101.841 116.222 1.00 75.96  ? 374  GLY A O     1 
ATOM   2427  N  N     . GLU A 1  375  ? 92.616  103.796 117.078 1.00 76.09  ? 375  GLU A N     1 
ATOM   2428  C  CA    . GLU A 1  375  ? 91.275  103.673 116.518 1.00 77.08  ? 375  GLU A CA    1 
ATOM   2429  C  C     . GLU A 1  375  ? 91.176  104.236 115.106 1.00 79.01  ? 375  GLU A C     1 
ATOM   2430  O  O     . GLU A 1  375  ? 90.499  103.652 114.254 1.00 81.00  ? 375  GLU A O     1 
ATOM   2431  C  CB    . GLU A 1  375  ? 90.262  104.373 117.430 1.00 82.36  ? 375  GLU A CB    1 
ATOM   2432  C  CG    . GLU A 1  375  ? 88.835  104.378 116.898 1.00 83.02  ? 375  GLU A CG    1 
ATOM   2433  C  CD    . GLU A 1  375  ? 88.227  102.989 116.827 1.00 83.31  ? 375  GLU A CD    1 
ATOM   2434  O  OE1   . GLU A 1  375  ? 88.669  102.101 117.586 1.00 76.04  ? 375  GLU A OE1   1 
ATOM   2435  O  OE2   . GLU A 1  375  ? 87.306  102.785 116.009 1.00 75.16  ? 375  GLU A OE2   1 
ATOM   2436  N  N     . GLU A 1  376  ? 91.841  105.358 114.840 1.00 75.66  ? 376  GLU A N     1 
ATOM   2437  C  CA    . GLU A 1  376  ? 91.744  105.995 113.533 1.00 75.41  ? 376  GLU A CA    1 
ATOM   2438  C  C     . GLU A 1  376  ? 92.411  105.136 112.464 1.00 74.82  ? 376  GLU A C     1 
ATOM   2439  O  O     . GLU A 1  376  ? 93.552  104.692 112.626 1.00 74.28  ? 376  GLU A O     1 
ATOM   2440  C  CB    . GLU A 1  376  ? 92.377  107.387 113.572 1.00 73.86  ? 376  GLU A CB    1 
ATOM   2441  C  CG    . GLU A 1  376  ? 93.792  107.423 114.133 1.00 74.63  ? 376  GLU A CG    1 
ATOM   2442  C  CD    . GLU A 1  376  ? 94.417  108.801 114.047 1.00 73.17  ? 376  GLU A CD    1 
ATOM   2443  O  OE1   . GLU A 1  376  ? 93.738  109.736 113.574 1.00 75.68  ? 376  GLU A OE1   1 
ATOM   2444  O  OE2   . GLU A 1  376  ? 95.589  108.949 114.453 1.00 76.41  ? 376  GLU A OE2   1 
ATOM   2445  N  N     . VAL A 1  377  ? 91.687  104.892 111.375 1.00 75.25  ? 377  VAL A N     1 
ATOM   2446  C  CA    . VAL A 1  377  ? 92.201  104.165 110.221 1.00 74.91  ? 377  VAL A CA    1 
ATOM   2447  C  C     . VAL A 1  377  ? 92.017  105.040 108.989 1.00 75.63  ? 377  VAL A C     1 
ATOM   2448  O  O     . VAL A 1  377  ? 90.907  105.511 108.714 1.00 76.14  ? 377  VAL A O     1 
ATOM   2449  C  CB    . VAL A 1  377  ? 91.506  102.799 110.049 1.00 75.64  ? 377  VAL A CB    1 
ATOM   2450  C  CG1   . VAL A 1  377  ? 89.992  102.938 110.159 1.00 73.99  ? 377  VAL A CG1   1 
ATOM   2451  C  CG2   . VAL A 1  377  ? 91.896  102.168 108.719 1.00 74.67  ? 377  VAL A CG2   1 
ATOM   2452  N  N     . HIS A 1  378  ? 93.106  105.274 108.262 1.00 72.64  ? 378  HIS A N     1 
ATOM   2453  C  CA    . HIS A 1  378  ? 93.063  106.143 107.096 1.00 71.84  ? 378  HIS A CA    1 
ATOM   2454  C  C     . HIS A 1  378  ? 94.203  105.777 106.160 1.00 73.38  ? 378  HIS A C     1 
ATOM   2455  O  O     . HIS A 1  378  ? 95.200  105.176 106.569 1.00 74.92  ? 378  HIS A O     1 
ATOM   2456  C  CB    . HIS A 1  378  ? 93.144  107.621 107.496 1.00 75.20  ? 378  HIS A CB    1 
ATOM   2457  C  CG    . HIS A 1  378  ? 94.372  107.967 108.279 1.00 75.15  ? 378  HIS A CG    1 
ATOM   2458  N  ND1   . HIS A 1  378  ? 94.458  107.794 109.644 1.00 75.70  ? 378  HIS A ND1   1 
ATOM   2459  C  CD2   . HIS A 1  378  ? 95.564  108.478 107.890 1.00 75.89  ? 378  HIS A CD2   1 
ATOM   2460  C  CE1   . HIS A 1  378  ? 95.649  108.183 110.062 1.00 69.40  ? 378  HIS A CE1   1 
ATOM   2461  N  NE2   . HIS A 1  378  ? 96.340  108.602 109.017 1.00 69.22  ? 378  HIS A NE2   1 
ATOM   2462  N  N     . GLU A 1  379  ? 94.039  106.150 104.894 1.00 66.92  ? 379  GLU A N     1 
ATOM   2463  C  CA    . GLU A 1  379  ? 95.050  105.906 103.878 1.00 65.41  ? 379  GLU A CA    1 
ATOM   2464  C  C     . GLU A 1  379  ? 96.209  106.889 104.040 1.00 66.95  ? 379  GLU A C     1 
ATOM   2465  O  O     . GLU A 1  379  ? 96.242  107.713 104.957 1.00 68.68  ? 379  GLU A O     1 
ATOM   2466  C  CB    . GLU A 1  379  ? 94.428  105.995 102.487 1.00 69.17  ? 379  GLU A CB    1 
ATOM   2467  C  CG    . GLU A 1  379  ? 93.560  107.225 102.274 1.00 68.67  ? 379  GLU A CG    1 
ATOM   2468  C  CD    . GLU A 1  379  ? 92.813  107.190 100.956 1.00 69.79  ? 379  GLU A CD    1 
ATOM   2469  O  OE1   . GLU A 1  379  ? 93.087  106.284 100.140 1.00 62.46  ? 379  GLU A OE1   1 
ATOM   2470  O  OE2   . GLU A 1  379  ? 91.952  108.066 100.736 1.00 61.64  ? 379  GLU A OE2   1 
ATOM   2471  N  N     . ASN A 1  380  ? 97.179  106.797 103.133 1.00 59.75  ? 380  ASN A N     1 
ATOM   2472  C  CA    . ASN A 1  380  ? 98.347  107.662 103.192 1.00 58.00  ? 380  ASN A CA    1 
ATOM   2473  C  C     . ASN A 1  380  ? 97.951  109.115 102.935 1.00 58.04  ? 380  ASN A C     1 
ATOM   2474  O  O     . ASN A 1  380  ? 96.888  109.412 102.381 1.00 58.18  ? 380  ASN A O     1 
ATOM   2475  C  CB    . ASN A 1  380  ? 99.400  107.207 102.180 1.00 58.61  ? 380  ASN A CB    1 
ATOM   2476  C  CG    . ASN A 1  380  ? 100.752 107.855 102.411 1.00 57.99  ? 380  ASN A CG    1 
ATOM   2477  O  OD1   . ASN A 1  380  ? 101.018 108.397 103.482 1.00 56.62  ? 380  ASN A OD1   1 
ATOM   2478  N  ND2   . ASN A 1  380  ? 101.614 107.799 101.402 1.00 56.51  ? 380  ASN A ND2   1 
ATOM   2479  N  N     . SER A 1  381  ? 98.829  110.029 103.357 1.00 55.33  ? 381  SER A N     1 
ATOM   2480  C  CA    . SER A 1  381  ? 98.542  111.454 103.220 1.00 54.48  ? 381  SER A CA    1 
ATOM   2481  C  C     . SER A 1  381  ? 98.427  111.861 101.756 1.00 54.65  ? 381  SER A C     1 
ATOM   2482  O  O     . SER A 1  381  ? 97.540  112.641 101.389 1.00 54.50  ? 381  SER A O     1 
ATOM   2483  C  CB    . SER A 1  381  ? 99.625  112.275 103.921 1.00 53.28  ? 381  SER A CB    1 
ATOM   2484  O  OG    . SER A 1  381  ? 100.900 112.027 103.353 1.00 53.36  ? 381  SER A OG    1 
ATOM   2485  N  N     . GLN A 1  382  ? 99.313  111.344 100.903 1.00 51.71  ? 382  GLN A N     1 
ATOM   2486  C  CA    . GLN A 1  382  ? 99.276  111.699 99.489  1.00 50.61  ? 382  GLN A CA    1 
ATOM   2487  C  C     . GLN A 1  382  ? 97.989  111.253 98.811  1.00 50.16  ? 382  GLN A C     1 
ATOM   2488  O  O     . GLN A 1  382  ? 97.611  111.830 97.787  1.00 50.07  ? 382  GLN A O     1 
ATOM   2489  C  CB    . GLN A 1  382  ? 100.480 111.099 98.762  1.00 50.14  ? 382  GLN A CB    1 
ATOM   2490  C  CG    . GLN A 1  382  ? 101.822 111.600 99.265  1.00 50.32  ? 382  GLN A CG    1 
ATOM   2491  C  CD    . GLN A 1  382  ? 102.985 111.048 98.465  1.00 50.36  ? 382  GLN A CD    1 
ATOM   2492  O  OE1   . GLN A 1  382  ? 102.795 110.282 97.522  1.00 50.23  ? 382  GLN A OE1   1 
ATOM   2493  N  NE2   . GLN A 1  382  ? 104.199 111.437 98.840  1.00 50.11  ? 382  GLN A NE2   1 
ATOM   2494  N  N     . ASN A 1  383  ? 97.303  110.247 99.360  1.00 50.18  ? 383  ASN A N     1 
ATOM   2495  C  CA    . ASN A 1  383  ? 96.065  109.774 98.753  1.00 50.45  ? 383  ASN A CA    1 
ATOM   2496  C  C     . ASN A 1  383  ? 94.949  110.805 98.823  1.00 50.38  ? 383  ASN A C     1 
ATOM   2497  O  O     . ASN A 1  383  ? 94.026  110.753 98.004  1.00 50.60  ? 383  ASN A O     1 
ATOM   2498  C  CB    . ASN A 1  383  ? 95.609  108.476 99.421  1.00 50.84  ? 383  ASN A CB    1 
ATOM   2499  C  CG    . ASN A 1  383  ? 96.651  107.381 99.340  1.00 50.79  ? 383  ASN A CG    1 
ATOM   2500  O  OD1   . ASN A 1  383  ? 96.886  106.660 100.309 1.00 51.09  ? 383  ASN A OD1   1 
ATOM   2501  N  ND2   . ASN A 1  383  ? 97.288  107.254 98.183  1.00 51.63  ? 383  ASN A ND2   1 
ATOM   2502  N  N     . GLN A 1  384  ? 95.006  111.738 99.776  1.00 51.93  ? 384  GLN A N     1 
ATOM   2503  C  CA    . GLN A 1  384  ? 93.964  112.755 99.874  1.00 52.88  ? 384  GLN A CA    1 
ATOM   2504  C  C     . GLN A 1  384  ? 94.111  113.795 98.771  1.00 53.25  ? 384  GLN A C     1 
ATOM   2505  O  O     . GLN A 1  384  ? 93.142  114.116 98.074  1.00 53.63  ? 384  GLN A O     1 
ATOM   2506  C  CB    . GLN A 1  384  ? 94.002  113.414 101.255 1.00 53.95  ? 384  GLN A CB    1 
ATOM   2507  C  CG    . GLN A 1  384  ? 92.798  114.296 101.573 1.00 54.10  ? 384  GLN A CG    1 
ATOM   2508  C  CD    . GLN A 1  384  ? 92.937  115.708 101.035 1.00 54.04  ? 384  GLN A CD    1 
ATOM   2509  O  OE1   . GLN A 1  384  ? 94.039  116.162 100.725 1.00 53.28  ? 384  GLN A OE1   1 
ATOM   2510  N  NE2   . GLN A 1  384  ? 91.816  116.410 100.920 1.00 53.62  ? 384  GLN A NE2   1 
ATOM   2511  N  N     . LEU A 1  385  ? 95.319  114.338 98.604  1.00 53.10  ? 385  LEU A N     1 
ATOM   2512  C  CA    . LEU A 1  385  ? 95.553  115.315 97.544  1.00 52.90  ? 385  LEU A CA    1 
ATOM   2513  C  C     . LEU A 1  385  ? 95.364  114.684 96.171  1.00 53.00  ? 385  LEU A C     1 
ATOM   2514  O  O     . LEU A 1  385  ? 94.768  115.289 95.272  1.00 52.96  ? 385  LEU A O     1 
ATOM   2515  C  CB    . LEU A 1  385  ? 96.954  115.915 97.675  1.00 52.92  ? 385  LEU A CB    1 
ATOM   2516  C  CG    . LEU A 1  385  ? 97.206  116.946 98.780  1.00 52.97  ? 385  LEU A CG    1 
ATOM   2517  C  CD1   . LEU A 1  385  ? 96.097  117.991 98.811  1.00 51.92  ? 385  LEU A CD1   1 
ATOM   2518  C  CD2   . LEU A 1  385  ? 97.378  116.289 100.144 1.00 52.35  ? 385  LEU A CD2   1 
ATOM   2519  N  N     . LEU A 1  386  ? 95.869  113.460 95.989  1.00 52.30  ? 386  LEU A N     1 
ATOM   2520  C  CA    . LEU A 1  386  ? 95.702  112.776 94.710  1.00 52.85  ? 386  LEU A CA    1 
ATOM   2521  C  C     . LEU A 1  386  ? 94.232  112.508 94.414  1.00 52.92  ? 386  LEU A C     1 
ATOM   2522  O  O     . LEU A 1  386  ? 93.787  112.651 93.270  1.00 52.87  ? 386  LEU A O     1 
ATOM   2523  C  CB    . LEU A 1  386  ? 96.501  111.472 94.700  1.00 52.71  ? 386  LEU A CB    1 
ATOM   2524  C  CG    . LEU A 1  386  ? 98.023  111.608 94.612  1.00 52.86  ? 386  LEU A CG    1 
ATOM   2525  C  CD1   . LEU A 1  386  ? 98.688  110.243 94.681  1.00 54.00  ? 386  LEU A CD1   1 
ATOM   2526  C  CD2   . LEU A 1  386  ? 98.425  112.340 93.339  1.00 53.67  ? 386  LEU A CD2   1 
ATOM   2527  N  N     . SER A 1  387  ? 93.459  112.123 95.435  1.00 54.92  ? 387  SER A N     1 
ATOM   2528  C  CA    . SER A 1  387  ? 92.027  111.922 95.234  1.00 56.14  ? 387  SER A CA    1 
ATOM   2529  C  C     . SER A 1  387  ? 91.342  113.224 94.846  1.00 56.47  ? 387  SER A C     1 
ATOM   2530  O  O     . SER A 1  387  ? 90.441  113.231 93.999  1.00 56.68  ? 387  SER A O     1 
ATOM   2531  C  CB    . SER A 1  387  ? 91.390  111.338 96.494  1.00 56.92  ? 387  SER A CB    1 
ATOM   2532  O  OG    . SER A 1  387  ? 91.500  112.238 97.583  1.00 58.22  ? 387  SER A OG    1 
ATOM   2533  N  N     . LYS A 1  388  ? 91.754  114.338 95.457  1.00 56.85  ? 388  LYS A N     1 
ATOM   2534  C  CA    . LYS A 1  388  ? 91.207  115.634 95.071  1.00 57.21  ? 388  LYS A CA    1 
ATOM   2535  C  C     . LYS A 1  388  ? 91.559  115.967 93.628  1.00 58.39  ? 388  LYS A C     1 
ATOM   2536  O  O     . LYS A 1  388  ? 90.736  116.525 92.893  1.00 59.65  ? 388  LYS A O     1 
ATOM   2537  C  CB    . LYS A 1  388  ? 91.717  116.726 96.014  1.00 60.44  ? 388  LYS A CB    1 
ATOM   2538  C  CG    . LYS A 1  388  ? 91.166  118.110 95.708  1.00 60.90  ? 388  LYS A CG    1 
ATOM   2539  C  CD    . LYS A 1  388  ? 89.650  118.136 95.822  1.00 61.17  ? 388  LYS A CD    1 
ATOM   2540  C  CE    . LYS A 1  388  ? 89.096  119.523 95.541  1.00 56.43  ? 388  LYS A CE    1 
ATOM   2541  N  NZ    . LYS A 1  388  ? 89.419  119.985 94.163  1.00 55.69  ? 388  LYS A NZ    1 
ATOM   2542  N  N     . VAL A 1  389  ? 92.778  115.628 93.202  1.00 56.35  ? 389  VAL A N     1 
ATOM   2543  C  CA    . VAL A 1  389  ? 93.142  115.817 91.803  1.00 56.48  ? 389  VAL A CA    1 
ATOM   2544  C  C     . VAL A 1  389  ? 92.320  114.899 90.909  1.00 56.55  ? 389  VAL A C     1 
ATOM   2545  O  O     . VAL A 1  389  ? 91.929  115.288 89.804  1.00 56.76  ? 389  VAL A O     1 
ATOM   2546  C  CB    . VAL A 1  389  ? 94.654  115.599 91.605  1.00 56.18  ? 389  VAL A CB    1 
ATOM   2547  C  CG1   . VAL A 1  389  ? 95.030  115.735 90.138  1.00 55.93  ? 389  VAL A CG1   1 
ATOM   2548  C  CG2   . VAL A 1  389  ? 95.446  116.588 92.445  1.00 56.35  ? 389  VAL A CG2   1 
ATOM   2549  N  N     . LEU A 1  390  ? 92.020  113.683 91.374  1.00 56.43  ? 390  LEU A N     1 
ATOM   2550  C  CA    . LEU A 1  390  ? 91.245  112.749 90.562  1.00 56.09  ? 390  LEU A CA    1 
ATOM   2551  C  C     . LEU A 1  390  ? 89.814  113.239 90.360  1.00 55.96  ? 390  LEU A C     1 
ATOM   2552  O  O     . LEU A 1  390  ? 89.315  113.272 89.230  1.00 55.29  ? 390  LEU A O     1 
ATOM   2553  C  CB    . LEU A 1  390  ? 91.251  111.360 91.203  1.00 55.28  ? 390  LEU A CB    1 
ATOM   2554  C  CG    . LEU A 1  390  ? 92.187  110.313 90.592  1.00 54.57  ? 390  LEU A CG    1 
ATOM   2555  C  CD1   . LEU A 1  390  ? 91.892  110.131 89.112  1.00 55.85  ? 390  LEU A CD1   1 
ATOM   2556  C  CD2   . LEU A 1  390  ? 93.647  110.674 90.807  1.00 55.36  ? 390  LEU A CD2   1 
ATOM   2557  N  N     . THR A 1  391  ? 89.137  113.624 91.446  1.00 56.23  ? 391  THR A N     1 
ATOM   2558  C  CA    . THR A 1  391  ? 87.742  114.041 91.325  1.00 56.87  ? 391  THR A CA    1 
ATOM   2559  C  C     . THR A 1  391  ? 87.622  115.383 90.613  1.00 56.76  ? 391  THR A C     1 
ATOM   2560  O  O     . THR A 1  391  ? 86.629  115.637 89.921  1.00 56.80  ? 391  THR A O     1 
ATOM   2561  C  CB    . THR A 1  391  ? 87.080  114.099 92.704  1.00 56.65  ? 391  THR A CB    1 
ATOM   2562  O  OG1   . THR A 1  391  ? 85.729  114.562 92.567  1.00 57.98  ? 391  THR A OG1   1 
ATOM   2563  C  CG2   . THR A 1  391  ? 87.836  115.037 93.633  1.00 59.54  ? 391  THR A CG2   1 
ATOM   2564  N  N     . THR A 1  392  ? 88.620  116.256 90.766  1.00 57.93  ? 392  THR A N     1 
ATOM   2565  C  CA    . THR A 1  392  ? 88.581  117.535 90.068  1.00 57.93  ? 392  THR A CA    1 
ATOM   2566  C  C     . THR A 1  392  ? 89.010  117.389 88.614  1.00 57.77  ? 392  THR A C     1 
ATOM   2567  O  O     . THR A 1  392  ? 88.531  118.133 87.751  1.00 58.02  ? 392  THR A O     1 
ATOM   2568  C  CB    . THR A 1  392  ? 89.461  118.560 90.786  1.00 57.67  ? 392  THR A CB    1 
ATOM   2569  O  OG1   . THR A 1  392  ? 89.258  118.456 92.200  1.00 57.88  ? 392  THR A OG1   1 
ATOM   2570  C  CG2   . THR A 1  392  ? 89.104  119.971 90.341  1.00 57.11  ? 392  THR A CG2   1 
ATOM   2571  N  N     . SER A 1  393  ? 89.904  116.439 88.321  1.00 58.34  ? 393  SER A N     1 
ATOM   2572  C  CA    . SER A 1  393  ? 90.268  116.186 86.932  1.00 58.82  ? 393  SER A CA    1 
ATOM   2573  C  C     . SER A 1  393  ? 89.096  115.625 86.143  1.00 58.28  ? 393  SER A C     1 
ATOM   2574  O  O     . SER A 1  393  ? 88.952  115.929 84.956  1.00 58.06  ? 393  SER A O     1 
ATOM   2575  C  CB    . SER A 1  393  ? 91.459  115.230 86.848  1.00 59.34  ? 393  SER A CB    1 
ATOM   2576  O  OG    . SER A 1  393  ? 91.815  114.973 85.501  1.00 60.00  ? 393  SER A OG    1 
ATOM   2577  N  N     . LEU A 1  394  ? 88.253  114.807 86.778  1.00 59.17  ? 394  LEU A N     1 
ATOM   2578  C  CA    . LEU A 1  394  ? 87.064  114.303 86.101  1.00 58.86  ? 394  LEU A CA    1 
ATOM   2579  C  C     . LEU A 1  394  ? 85.977  115.363 86.001  1.00 59.12  ? 394  LEU A C     1 
ATOM   2580  O  O     . LEU A 1  394  ? 85.149  115.311 85.083  1.00 59.23  ? 394  LEU A O     1 
ATOM   2581  C  CB    . LEU A 1  394  ? 86.529  113.062 86.817  1.00 58.99  ? 394  LEU A CB    1 
ATOM   2582  C  CG    . LEU A 1  394  ? 87.028  111.717 86.279  1.00 59.30  ? 394  LEU A CG    1 
ATOM   2583  C  CD1   . LEU A 1  394  ? 88.528  111.559 86.488  1.00 58.30  ? 394  LEU A CD1   1 
ATOM   2584  C  CD2   . LEU A 1  394  ? 86.266  110.562 86.910  1.00 58.04  ? 394  LEU A CD2   1 
ATOM   2585  N  N     . LEU A 1  395  ? 85.956  116.324 86.927  1.00 58.30  ? 395  LEU A N     1 
ATOM   2586  C  CA    . LEU A 1  395  ? 85.020  117.438 86.821  1.00 58.82  ? 395  LEU A CA    1 
ATOM   2587  C  C     . LEU A 1  395  ? 85.374  118.324 85.633  1.00 58.83  ? 395  LEU A C     1 
ATOM   2588  O  O     . LEU A 1  395  ? 84.504  118.699 84.837  1.00 59.39  ? 395  LEU A O     1 
ATOM   2589  C  CB    . LEU A 1  395  ? 85.012  118.240 88.126  1.00 59.59  ? 395  LEU A CB    1 
ATOM   2590  C  CG    . LEU A 1  395  ? 83.938  119.317 88.311  1.00 59.44  ? 395  LEU A CG    1 
ATOM   2591  C  CD1   . LEU A 1  395  ? 83.534  119.409 89.773  1.00 59.71  ? 395  LEU A CD1   1 
ATOM   2592  C  CD2   . LEU A 1  395  ? 84.419  120.674 87.813  1.00 60.01  ? 395  LEU A CD2   1 
ATOM   2593  N  N     . ILE A 1  396  ? 86.657  118.670 85.496  1.00 60.57  ? 396  ILE A N     1 
ATOM   2594  C  CA    . ILE A 1  396  ? 87.104  119.444 84.346  1.00 61.43  ? 396  ILE A CA    1 
ATOM   2595  C  C     . ILE A 1  396  ? 87.142  118.584 83.090  1.00 61.62  ? 396  ILE A C     1 
ATOM   2596  O  O     . ILE A 1  396  ? 87.085  119.112 81.974  1.00 62.06  ? 396  ILE A O     1 
ATOM   2597  C  CB    . ILE A 1  396  ? 88.480  120.085 84.639  1.00 62.05  ? 396  ILE A CB    1 
ATOM   2598  C  CG1   . ILE A 1  396  ? 88.832  121.131 83.580  1.00 61.40  ? 396  ILE A CG1   1 
ATOM   2599  C  CG2   . ILE A 1  396  ? 89.565  119.027 84.714  1.00 61.62  ? 396  ILE A CG2   1 
ATOM   2600  C  CD1   . ILE A 1  396  ? 90.185  121.770 83.791  1.00 61.66  ? 396  ILE A CD1   1 
ATOM   2601  N  N     . ARG A 1  397  ? 87.228  117.261 83.245  1.00 62.12  ? 397  ARG A N     1 
ATOM   2602  C  CA    . ARG A 1  397  ? 87.149  116.366 82.094  1.00 62.91  ? 397  ARG A CA    1 
ATOM   2603  C  C     . ARG A 1  397  ? 85.766  116.427 81.459  1.00 63.74  ? 397  ARG A C     1 
ATOM   2604  O  O     . ARG A 1  397  ? 85.625  116.738 80.271  1.00 64.87  ? 397  ARG A O     1 
ATOM   2605  C  CB    . ARG A 1  397  ? 87.493  114.936 82.519  1.00 65.83  ? 397  ARG A CB    1 
ATOM   2606  C  CG    . ARG A 1  397  ? 87.375  113.882 81.430  1.00 66.68  ? 397  ARG A CG    1 
ATOM   2607  C  CD    . ARG A 1  397  ? 86.015  113.197 81.453  1.00 67.42  ? 397  ARG A CD    1 
ATOM   2608  N  NE    . ARG A 1  397  ? 85.704  112.621 82.758  1.00 67.80  ? 397  ARG A NE    1 
ATOM   2609  C  CZ    . ARG A 1  397  ? 84.564  111.999 83.044  1.00 67.32  ? 397  ARG A CZ    1 
ATOM   2610  N  NH1   . ARG A 1  397  ? 84.361  111.505 84.257  1.00 63.19  ? 397  ARG A NH1   1 
ATOM   2611  N  NH2   . ARG A 1  397  ? 83.627  111.872 82.115  1.00 62.84  ? 397  ARG A NH2   1 
ATOM   2612  N  N     . ASP A 1  398  ? 84.728  116.129 82.241  1.00 64.33  ? 398  ASP A N     1 
ATOM   2613  C  CA    . ASP A 1  398  ? 83.358  116.171 81.747  1.00 65.55  ? 398  ASP A CA    1 
ATOM   2614  C  C     . ASP A 1  398  ? 82.866  117.591 81.496  1.00 66.60  ? 398  ASP A C     1 
ATOM   2615  O  O     . ASP A 1  398  ? 81.738  117.763 81.023  1.00 67.01  ? 398  ASP A O     1 
ATOM   2616  C  CB    . ASP A 1  398  ? 82.431  115.460 82.737  1.00 67.43  ? 398  ASP A CB    1 
ATOM   2617  C  CG    . ASP A 1  398  ? 81.101  115.073 82.118  1.00 67.01  ? 398  ASP A CG    1 
ATOM   2618  O  OD1   . ASP A 1  398  ? 81.054  114.863 80.888  1.00 65.69  ? 398  ASP A OD1   1 
ATOM   2619  O  OD2   . ASP A 1  398  ? 80.103  114.977 82.864  1.00 66.11  ? 398  ASP A OD2   1 
ATOM   2620  N  N     . LEU A 1  399  ? 83.682  118.604 81.796  1.00 65.92  ? 399  LEU A N     1 
ATOM   2621  C  CA    . LEU A 1  399  ? 83.270  119.985 81.574  1.00 66.69  ? 399  LEU A CA    1 
ATOM   2622  C  C     . LEU A 1  399  ? 83.150  120.285 80.084  1.00 66.34  ? 399  LEU A C     1 
ATOM   2623  O  O     . LEU A 1  399  ? 82.140  120.833 79.628  1.00 66.29  ? 399  LEU A O     1 
ATOM   2624  C  CB    . LEU A 1  399  ? 84.264  120.936 82.244  1.00 67.10  ? 399  LEU A CB    1 
ATOM   2625  C  CG    . LEU A 1  399  ? 83.807  122.341 82.655  1.00 65.57  ? 399  LEU A CG    1 
ATOM   2626  C  CD1   . LEU A 1  399  ? 83.513  123.245 81.461  1.00 67.90  ? 399  LEU A CD1   1 
ATOM   2627  C  CD2   . LEU A 1  399  ? 82.600  122.252 83.574  1.00 68.32  ? 399  LEU A CD2   1 
ATOM   2628  N  N     . ASN A 1  400  ? 84.178  119.932 79.308  1.00 70.49  ? 400  ASN A N     1 
ATOM   2629  C  CA    . ASN A 1  400  ? 84.187  120.234 77.883  1.00 72.46  ? 400  ASN A CA    1 
ATOM   2630  C  C     . ASN A 1  400  ? 83.142  119.450 77.099  1.00 73.92  ? 400  ASN A C     1 
ATOM   2631  O  O     . ASN A 1  400  ? 82.894  119.781 75.934  1.00 75.60  ? 400  ASN A O     1 
ATOM   2632  C  CB    . ASN A 1  400  ? 85.582  119.979 77.299  1.00 76.40  ? 400  ASN A CB    1 
ATOM   2633  C  CG    . ASN A 1  400  ? 86.080  118.564 77.552  1.00 76.29  ? 400  ASN A CG    1 
ATOM   2634  O  OD1   . ASN A 1  400  ? 85.296  117.628 77.700  1.00 73.10  ? 400  ASN A OD1   1 
ATOM   2635  N  ND2   . ASN A 1  400  ? 87.397  118.406 77.601  1.00 72.94  ? 400  ASN A ND2   1 
ATOM   2636  N  N     . ASP A 1  401  ? 82.532  118.425 77.699  1.00 73.99  ? 401  ASP A N     1 
ATOM   2637  C  CA    . ASP A 1  401  ? 81.485  117.683 77.005  1.00 74.75  ? 401  ASP A CA    1 
ATOM   2638  C  C     . ASP A 1  401  ? 80.246  118.542 76.783  1.00 74.85  ? 401  ASP A C     1 
ATOM   2639  O  O     . ASP A 1  401  ? 79.564  118.389 75.764  1.00 74.92  ? 401  ASP A O     1 
ATOM   2640  C  CB    . ASP A 1  401  ? 81.125  116.421 77.788  1.00 74.67  ? 401  ASP A CB    1 
ATOM   2641  C  CG    . ASP A 1  401  ? 80.132  115.542 77.053  1.00 74.94  ? 401  ASP A CG    1 
ATOM   2642  O  OD1   . ASP A 1  401  ? 80.145  115.544 75.804  1.00 75.50  ? 401  ASP A OD1   1 
ATOM   2643  O  OD2   . ASP A 1  401  ? 79.339  114.849 77.724  1.00 75.57  ? 401  ASP A OD2   1 
ATOM   2644  N  N     . ASP A 1  402  ? 79.941  119.441 77.722  1.00 76.32  ? 402  ASP A N     1 
ATOM   2645  C  CA    . ASP A 1  402  ? 78.812  120.348 77.537  1.00 77.30  ? 402  ASP A CA    1 
ATOM   2646  C  C     . ASP A 1  402  ? 79.051  121.290 76.364  1.00 77.77  ? 402  ASP A C     1 
ATOM   2647  O  O     . ASP A 1  402  ? 78.140  121.545 75.567  1.00 78.79  ? 402  ASP A O     1 
ATOM   2648  C  CB    . ASP A 1  402  ? 78.559  121.137 78.821  1.00 79.76  ? 402  ASP A CB    1 
ATOM   2649  C  CG    . ASP A 1  402  ? 77.342  122.037 78.721  1.00 78.94  ? 402  ASP A CG    1 
ATOM   2650  O  OD1   . ASP A 1  402  ? 76.405  121.692 77.971  1.00 77.29  ? 402  ASP A OD1   1 
ATOM   2651  O  OD2   . ASP A 1  402  ? 77.322  123.088 79.395  1.00 77.53  ? 402  ASP A OD2   1 
ATOM   2652  N  N     . LEU A 1  403  ? 80.272  121.816 76.241  1.00 76.77  ? 403  LEU A N     1 
ATOM   2653  C  CA    . LEU A 1  403  ? 80.592  122.675 75.107  1.00 76.67  ? 403  LEU A CA    1 
ATOM   2654  C  C     . LEU A 1  403  ? 80.685  121.883 73.810  1.00 76.60  ? 403  LEU A C     1 
ATOM   2655  O  O     . LEU A 1  403  ? 80.371  122.412 72.739  1.00 76.11  ? 403  LEU A O     1 
ATOM   2656  C  CB    . LEU A 1  403  ? 81.899  123.425 75.364  1.00 75.79  ? 403  LEU A CB    1 
ATOM   2657  C  CG    . LEU A 1  403  ? 81.904  124.403 76.540  1.00 76.33  ? 403  LEU A CG    1 
ATOM   2658  C  CD1   . LEU A 1  403  ? 83.244  125.111 76.637  1.00 76.54  ? 403  LEU A CD1   1 
ATOM   2659  C  CD2   . LEU A 1  403  ? 80.770  125.407 76.405  1.00 77.08  ? 403  LEU A CD2   1 
ATOM   2660  N  N     . SER A 1  404  ? 81.116  120.620 73.885  1.00 78.27  ? 404  SER A N     1 
ATOM   2661  C  CA    . SER A 1  404  ? 81.172  119.789 72.688  1.00 79.65  ? 404  SER A CA    1 
ATOM   2662  C  C     . SER A 1  404  ? 79.778  119.465 72.166  1.00 79.33  ? 404  SER A C     1 
ATOM   2663  O  O     . SER A 1  404  ? 79.590  119.324 70.953  1.00 79.59  ? 404  SER A O     1 
ATOM   2664  C  CB    . SER A 1  404  ? 81.945  118.502 72.977  1.00 81.42  ? 404  SER A CB    1 
ATOM   2665  O  OG    . SER A 1  404  ? 82.018  117.681 71.824  1.00 81.87  ? 404  SER A OG    1 
ATOM   2666  N  N     . LYS A 1  405  ? 78.799  119.344 73.056  1.00 82.51  ? 405  LYS A N     1 
ATOM   2667  C  CA    . LYS A 1  405  ? 77.412  119.095 72.664  1.00 83.02  ? 405  LYS A CA    1 
ATOM   2668  C  C     . LYS A 1  405  ? 76.631  120.406 72.614  1.00 82.53  ? 405  LYS A C     1 
ATOM   2669  O  O     . LYS A 1  405  ? 75.682  120.635 73.364  1.00 81.63  ? 405  LYS A O     1 
ATOM   2670  C  CB    . LYS A 1  405  ? 76.744  118.116 73.631  1.00 81.49  ? 405  LYS A CB    1 
ATOM   2671  C  CG    . LYS A 1  405  ? 77.309  116.704 73.575  1.00 81.27  ? 405  LYS A CG    1 
ATOM   2672  C  CD    . LYS A 1  405  ? 76.618  115.793 74.574  1.00 81.17  ? 405  LYS A CD    1 
ATOM   2673  C  CE    . LYS A 1  405  ? 77.165  114.377 74.501  1.00 83.70  ? 405  LYS A CE    1 
ATOM   2674  N  NZ    . LYS A 1  405  ? 76.514  113.478 75.493  1.00 83.47  ? 405  LYS A NZ    1 
ATOM   2675  N  N     . LEU A 1  406  ? 77.053  121.277 71.703  1.00 83.90  ? 406  LEU A N     1 
ATOM   2676  C  CA    . LEU A 1  406  ? 76.428  122.585 71.545  1.00 83.56  ? 406  LEU A CA    1 
ATOM   2677  C  C     . LEU A 1  406  ? 75.491  122.599 70.340  1.00 83.00  ? 406  LEU A C     1 
ATOM   2678  O  O     . LEU A 1  406  ? 74.780  123.576 70.107  1.00 82.35  ? 406  LEU A O     1 
ATOM   2679  C  CB    . LEU A 1  406  ? 77.487  123.683 71.398  1.00 82.26  ? 406  LEU A CB    1 
ATOM   2680  C  CG    . LEU A 1  406  ? 78.159  123.878 70.033  1.00 82.07  ? 406  LEU A CG    1 
ATOM   2681  C  CD1   . LEU A 1  406  ? 78.936  125.186 70.013  1.00 83.83  ? 406  LEU A CD1   1 
ATOM   2682  C  CD2   . LEU A 1  406  ? 79.072  122.714 69.677  1.00 83.54  ? 406  LEU A CD2   1 
ATOM   2683  N  N     . ARG A 1  417  ? 78.276  132.947 78.944  1.00 73.24  ? 417  ARG A N     1 
ATOM   2684  C  CA    . ARG A 1  417  ? 77.750  131.786 79.653  1.00 73.50  ? 417  ARG A CA    1 
ATOM   2685  C  C     . ARG A 1  417  ? 78.528  131.530 80.938  1.00 73.66  ? 417  ARG A C     1 
ATOM   2686  O  O     . ARG A 1  417  ? 79.705  131.876 81.045  1.00 74.08  ? 417  ARG A O     1 
ATOM   2687  C  CB    . ARG A 1  417  ? 77.784  130.542 78.758  1.00 74.57  ? 417  ARG A CB    1 
ATOM   2688  C  CG    . ARG A 1  417  ? 79.171  130.148 78.266  1.00 75.13  ? 417  ARG A CG    1 
ATOM   2689  C  CD    . ARG A 1  417  ? 79.496  130.778 76.920  1.00 75.33  ? 417  ARG A CD    1 
ATOM   2690  N  NE    . ARG A 1  417  ? 78.525  130.402 75.894  1.00 75.30  ? 417  ARG A NE    1 
ATOM   2691  C  CZ    . ARG A 1  417  ? 78.630  129.322 75.127  1.00 75.36  ? 417  ARG A CZ    1 
ATOM   2692  N  NH1   . ARG A 1  417  ? 79.663  128.504 75.267  1.00 73.03  ? 417  ARG A NH1   1 
ATOM   2693  N  NH2   . ARG A 1  417  ? 77.698  129.059 74.220  1.00 72.60  ? 417  ARG A NH2   1 
ATOM   2694  N  N     . VAL A 1  418  ? 77.858  130.918 81.918  1.00 72.03  ? 418  VAL A N     1 
ATOM   2695  C  CA    . VAL A 1  418  ? 78.500  130.634 83.197  1.00 70.82  ? 418  VAL A CA    1 
ATOM   2696  C  C     . VAL A 1  418  ? 79.409  129.415 83.121  1.00 71.15  ? 418  VAL A C     1 
ATOM   2697  O  O     . VAL A 1  418  ? 80.339  129.292 83.929  1.00 71.53  ? 418  VAL A O     1 
ATOM   2698  C  CB    . VAL A 1  418  ? 77.441  130.443 84.296  1.00 71.23  ? 418  VAL A CB    1 
ATOM   2699  C  CG1   . VAL A 1  418  ? 78.074  130.534 85.679  1.00 69.67  ? 418  VAL A CG1   1 
ATOM   2700  C  CG2   . VAL A 1  418  ? 76.329  131.471 84.146  1.00 69.45  ? 418  VAL A CG2   1 
ATOM   2701  N  N     . ILE A 1  419  ? 79.178  128.513 82.163  1.00 69.26  ? 419  ILE A N     1 
ATOM   2702  C  CA    . ILE A 1  419  ? 80.017  127.324 82.046  1.00 69.59  ? 419  ILE A CA    1 
ATOM   2703  C  C     . ILE A 1  419  ? 81.433  127.704 81.633  1.00 70.21  ? 419  ILE A C     1 
ATOM   2704  O  O     . ILE A 1  419  ? 82.385  126.957 81.888  1.00 70.16  ? 419  ILE A O     1 
ATOM   2705  C  CB    . ILE A 1  419  ? 79.385  126.316 81.065  1.00 70.06  ? 419  ILE A CB    1 
ATOM   2706  C  CG1   . ILE A 1  419  ? 80.017  124.933 81.231  1.00 70.42  ? 419  ILE A CG1   1 
ATOM   2707  C  CG2   . ILE A 1  419  ? 79.520  126.796 79.629  1.00 69.87  ? 419  ILE A CG2   1 
ATOM   2708  C  CD1   . ILE A 1  419  ? 79.749  124.301 82.578  1.00 69.39  ? 419  ILE A CD1   1 
ATOM   2709  N  N     . PHE A 1  420  ? 81.602  128.868 81.000  1.00 71.07  ? 420  PHE A N     1 
ATOM   2710  C  CA    . PHE A 1  420  ? 82.945  129.347 80.694  1.00 72.53  ? 420  PHE A CA    1 
ATOM   2711  C  C     . PHE A 1  420  ? 83.642  129.853 81.949  1.00 75.22  ? 420  PHE A C     1 
ATOM   2712  O  O     . PHE A 1  420  ? 84.851  129.658 82.120  1.00 78.25  ? 420  PHE A O     1 
ATOM   2713  C  CB    . PHE A 1  420  ? 82.891  130.443 79.630  1.00 79.51  ? 420  PHE A CB    1 
ATOM   2714  C  CG    . PHE A 1  420  ? 84.245  130.934 79.198  1.00 80.62  ? 420  PHE A CG    1 
ATOM   2715  C  CD1   . PHE A 1  420  ? 84.978  130.236 78.253  1.00 81.60  ? 420  PHE A CD1   1 
ATOM   2716  C  CD2   . PHE A 1  420  ? 84.783  132.091 79.737  1.00 81.53  ? 420  PHE A CD2   1 
ATOM   2717  C  CE1   . PHE A 1  420  ? 86.224  130.682 77.854  1.00 80.13  ? 420  PHE A CE1   1 
ATOM   2718  C  CE2   . PHE A 1  420  ? 86.028  132.542 79.340  1.00 71.09  ? 420  PHE A CE2   1 
ATOM   2719  C  CZ    . PHE A 1  420  ? 86.750  131.837 78.398  1.00 70.81  ? 420  PHE A CZ    1 
ATOM   2720  N  N     . SER A 1  421  ? 82.895  130.511 82.840  1.00 69.74  ? 421  SER A N     1 
ATOM   2721  C  CA    . SER A 1  421  ? 83.462  130.897 84.126  1.00 68.14  ? 421  SER A CA    1 
ATOM   2722  C  C     . SER A 1  421  ? 83.754  129.677 84.987  1.00 67.42  ? 421  SER A C     1 
ATOM   2723  O  O     . SER A 1  421  ? 84.604  129.739 85.883  1.00 66.29  ? 421  SER A O     1 
ATOM   2724  C  CB    . SER A 1  421  ? 82.516  131.850 84.856  1.00 67.68  ? 421  SER A CB    1 
ATOM   2725  O  OG    . SER A 1  421  ? 83.041  132.219 86.119  1.00 66.78  ? 421  SER A OG    1 
ATOM   2726  N  N     . ARG A 1  422  ? 83.065  128.562 84.734  1.00 68.67  ? 422  ARG A N     1 
ATOM   2727  C  CA    . ARG A 1  422  ? 83.311  127.342 85.489  1.00 70.22  ? 422  ARG A CA    1 
ATOM   2728  C  C     . ARG A 1  422  ? 84.472  126.531 84.929  1.00 73.13  ? 422  ARG A C     1 
ATOM   2729  O  O     . ARG A 1  422  ? 85.028  125.698 85.651  1.00 75.54  ? 422  ARG A O     1 
ATOM   2730  C  CB    . ARG A 1  422  ? 82.045  126.481 85.535  1.00 77.52  ? 422  ARG A CB    1 
ATOM   2731  C  CG    . ARG A 1  422  ? 82.019  125.486 86.689  1.00 79.59  ? 422  ARG A CG    1 
ATOM   2732  C  CD    . ARG A 1  422  ? 80.606  125.011 86.995  1.00 80.93  ? 422  ARG A CD    1 
ATOM   2733  N  NE    . ARG A 1  422  ? 80.096  124.080 85.991  1.00 80.74  ? 422  ARG A NE    1 
ATOM   2734  C  CZ    . ARG A 1  422  ? 80.170  122.757 86.095  1.00 81.64  ? 422  ARG A CZ    1 
ATOM   2735  N  NH1   . ARG A 1  422  ? 80.734  122.204 87.159  1.00 68.74  ? 422  ARG A NH1   1 
ATOM   2736  N  NH2   . ARG A 1  422  ? 79.677  121.987 85.135  1.00 69.07  ? 422  ARG A NH2   1 
ATOM   2737  N  N     . LEU A 1  423  ? 84.852  126.751 83.669  1.00 66.82  ? 423  LEU A N     1 
ATOM   2738  C  CA    . LEU A 1  423  ? 86.047  126.113 83.130  1.00 65.69  ? 423  LEU A CA    1 
ATOM   2739  C  C     . LEU A 1  423  ? 87.308  126.909 83.432  1.00 67.19  ? 423  LEU A C     1 
ATOM   2740  O  O     . LEU A 1  423  ? 88.372  126.314 83.641  1.00 68.56  ? 423  LEU A O     1 
ATOM   2741  C  CB    . LEU A 1  423  ? 85.910  125.893 81.616  1.00 68.94  ? 423  LEU A CB    1 
ATOM   2742  C  CG    . LEU A 1  423  ? 85.932  127.048 80.608  1.00 69.56  ? 423  LEU A CG    1 
ATOM   2743  C  CD1   . LEU A 1  423  ? 87.349  127.403 80.169  1.00 63.70  ? 423  LEU A CD1   1 
ATOM   2744  C  CD2   . LEU A 1  423  ? 85.076  126.701 79.401  1.00 63.59  ? 423  LEU A CD2   1 
ATOM   2745  N  N     . MET A 1  424  ? 87.215  128.240 83.453  1.00 61.80  ? 424  MET A N     1 
ATOM   2746  C  CA    . MET A 1  424  ? 88.331  129.048 83.931  1.00 60.42  ? 424  MET A CA    1 
ATOM   2747  C  C     . MET A 1  424  ? 88.547  128.830 85.422  1.00 60.36  ? 424  MET A C     1 
ATOM   2748  O  O     . MET A 1  424  ? 89.688  128.754 85.893  1.00 60.15  ? 424  MET A O     1 
ATOM   2749  C  CB    . MET A 1  424  ? 88.083  130.525 83.626  1.00 59.51  ? 424  MET A CB    1 
ATOM   2750  C  CG    . MET A 1  424  ? 89.211  131.445 84.065  1.00 59.75  ? 424  MET A CG    1 
ATOM   2751  S  SD    . MET A 1  424  ? 88.888  133.177 83.684  1.00 59.20  ? 424  MET A SD    1 
ATOM   2752  C  CE    . MET A 1  424  ? 87.393  133.458 84.628  1.00 58.77  ? 424  MET A CE    1 
ATOM   2753  N  N     . ASN A 1  425  ? 87.455  128.724 86.183  1.00 58.52  ? 425  ASN A N     1 
ATOM   2754  C  CA    . ASN A 1  425  ? 87.569  128.334 87.583  1.00 58.45  ? 425  ASN A CA    1 
ATOM   2755  C  C     . ASN A 1  425  ? 88.044  126.893 87.712  1.00 59.19  ? 425  ASN A C     1 
ATOM   2756  O  O     . ASN A 1  425  ? 88.731  126.551 88.680  1.00 59.86  ? 425  ASN A O     1 
ATOM   2757  C  CB    . ASN A 1  425  ? 86.232  128.524 88.299  1.00 60.19  ? 425  ASN A CB    1 
ATOM   2758  C  CG    . ASN A 1  425  ? 86.339  128.328 89.799  1.00 60.24  ? 425  ASN A CG    1 
ATOM   2759  O  OD1   . ASN A 1  425  ? 87.418  128.451 90.378  1.00 58.46  ? 425  ASN A OD1   1 
ATOM   2760  N  ND2   . ASN A 1  425  ? 85.214  128.024 90.437  1.00 58.02  ? 425  ASN A ND2   1 
ATOM   2761  N  N     . ALA A 1  426  ? 87.690  126.038 86.749  1.00 59.23  ? 426  ALA A N     1 
ATOM   2762  C  CA    . ALA A 1  426  ? 88.237  124.686 86.737  1.00 59.89  ? 426  ALA A CA    1 
ATOM   2763  C  C     . ALA A 1  426  ? 89.735  124.698 86.475  1.00 60.36  ? 426  ALA A C     1 
ATOM   2764  O  O     . ALA A 1  426  ? 90.465  123.868 87.026  1.00 59.93  ? 426  ALA A O     1 
ATOM   2765  C  CB    . ALA A 1  426  ? 87.524  123.829 85.692  1.00 59.92  ? 426  ALA A CB    1 
ATOM   2766  N  N     . PHE A 1  427  ? 90.211  125.628 85.644  1.00 59.82  ? 427  PHE A N     1 
ATOM   2767  C  CA    . PHE A 1  427  ? 91.646  125.749 85.410  1.00 59.31  ? 427  PHE A CA    1 
ATOM   2768  C  C     . PHE A 1  427  ? 92.367  126.213 86.668  1.00 59.71  ? 427  PHE A C     1 
ATOM   2769  O  O     . PHE A 1  427  ? 93.428  125.684 87.018  1.00 60.31  ? 427  PHE A O     1 
ATOM   2770  C  CB    . PHE A 1  427  ? 91.912  126.714 84.253  1.00 60.41  ? 427  PHE A CB    1 
ATOM   2771  C  CG    . PHE A 1  427  ? 91.553  126.160 82.904  1.00 61.29  ? 427  PHE A CG    1 
ATOM   2772  C  CD1   . PHE A 1  427  ? 91.590  124.796 82.668  1.00 62.14  ? 427  PHE A CD1   1 
ATOM   2773  C  CD2   . PHE A 1  427  ? 91.184  127.005 81.871  1.00 62.04  ? 427  PHE A CD2   1 
ATOM   2774  C  CE1   . PHE A 1  427  ? 91.262  124.284 81.427  1.00 61.17  ? 427  PHE A CE1   1 
ATOM   2775  C  CE2   . PHE A 1  427  ? 90.856  126.499 80.627  1.00 58.74  ? 427  PHE A CE2   1 
ATOM   2776  C  CZ    . PHE A 1  427  ? 90.894  125.137 80.405  1.00 58.07  ? 427  PHE A CZ    1 
ATOM   2777  N  N     . VAL A 1  428  ? 91.790  127.202 87.342  1.00 59.17  ? 428  VAL A N     1 
ATOM   2778  C  CA    . VAL A 1  428  ? 92.378  127.753 88.557  1.00 59.68  ? 428  VAL A CA    1 
ATOM   2779  C  C     . VAL A 1  428  ? 92.334  126.770 89.723  1.00 61.76  ? 428  VAL A C     1 
ATOM   2780  O  O     . VAL A 1  428  ? 93.214  126.780 90.584  1.00 62.33  ? 428  VAL A O     1 
ATOM   2781  C  CB    . VAL A 1  428  ? 91.678  129.059 88.978  1.00 62.41  ? 428  VAL A CB    1 
ATOM   2782  C  CG1   . VAL A 1  428  ? 90.412  128.753 89.765  1.00 57.61  ? 428  VAL A CG1   1 
ATOM   2783  C  CG2   . VAL A 1  428  ? 92.623  129.929 89.792  1.00 58.45  ? 428  VAL A CG2   1 
ATOM   2784  N  N     . THR A 1  429  ? 91.311  125.922 89.750  1.00 58.56  ? 429  THR A N     1 
ATOM   2785  C  CA    . THR A 1  429  ? 91.171  124.947 90.826  1.00 59.36  ? 429  THR A CA    1 
ATOM   2786  C  C     . THR A 1  429  ? 91.942  123.664 90.557  1.00 59.52  ? 429  THR A C     1 
ATOM   2787  O  O     . THR A 1  429  ? 92.479  123.068 91.498  1.00 59.90  ? 429  THR A O     1 
ATOM   2788  C  CB    . THR A 1  429  ? 89.696  124.613 91.067  1.00 59.45  ? 429  THR A CB    1 
ATOM   2789  O  OG1   . THR A 1  429  ? 89.049  124.349 89.816  1.00 60.55  ? 429  THR A OG1   1 
ATOM   2790  C  CG2   . THR A 1  429  ? 88.992  125.765 91.773  1.00 60.84  ? 429  THR A CG2   1 
ATOM   2791  N  N     . ILE A 1  430  ? 92.002  123.215 89.300  1.00 61.99  ? 430  ILE A N     1 
ATOM   2792  C  CA    . ILE A 1  430  ? 92.896  122.115 88.950  1.00 63.17  ? 430  ILE A CA    1 
ATOM   2793  C  C     . ILE A 1  430  ? 94.334  122.493 89.275  1.00 65.02  ? 430  ILE A C     1 
ATOM   2794  O  O     . ILE A 1  430  ? 95.084  121.708 89.868  1.00 65.96  ? 430  ILE A O     1 
ATOM   2795  C  CB    . ILE A 1  430  ? 92.732  121.731 87.467  1.00 66.32  ? 430  ILE A CB    1 
ATOM   2796  C  CG1   . ILE A 1  430  ? 91.533  120.801 87.287  1.00 65.60  ? 430  ILE A CG1   1 
ATOM   2797  C  CG2   . ILE A 1  430  ? 93.998  121.075 86.933  1.00 62.81  ? 430  ILE A CG2   1 
ATOM   2798  C  CD1   . ILE A 1  430  ? 91.739  119.431 87.891  1.00 61.25  ? 430  ILE A CD1   1 
ATOM   2799  N  N     . GLN A 1  431  ? 94.734  123.708 88.895  1.00 64.61  ? 431  GLN A N     1 
ATOM   2800  C  CA    . GLN A 1  431  ? 96.039  124.222 89.293  1.00 66.44  ? 431  GLN A CA    1 
ATOM   2801  C  C     . GLN A 1  431  ? 96.161  124.274 90.810  1.00 67.18  ? 431  GLN A C     1 
ATOM   2802  O  O     . GLN A 1  431  ? 97.133  123.774 91.383  1.00 67.26  ? 431  GLN A O     1 
ATOM   2803  C  CB    . GLN A 1  431  ? 96.264  125.607 88.682  1.00 67.43  ? 431  GLN A CB    1 
ATOM   2804  C  CG    . GLN A 1  431  ? 97.556  126.279 89.121  1.00 67.01  ? 431  GLN A CG    1 
ATOM   2805  C  CD    . GLN A 1  431  ? 98.789  125.501 88.708  1.00 67.75  ? 431  GLN A CD    1 
ATOM   2806  O  OE1   . GLN A 1  431  ? 99.675  125.241 89.522  1.00 66.74  ? 431  GLN A OE1   1 
ATOM   2807  N  NE2   . GLN A 1  431  ? 98.853  125.126 87.435  1.00 66.21  ? 431  GLN A NE2   1 
ATOM   2808  N  N     . ASN A 1  432  ? 95.162  124.856 91.480  1.00 67.64  ? 432  ASN A N     1 
ATOM   2809  C  CA    . ASN A 1  432  ? 95.165  124.967 92.936  1.00 68.34  ? 432  ASN A CA    1 
ATOM   2810  C  C     . ASN A 1  432  ? 95.116  123.616 93.639  1.00 69.94  ? 432  ASN A C     1 
ATOM   2811  O  O     . ASN A 1  432  ? 95.272  123.575 94.864  1.00 70.95  ? 432  ASN A O     1 
ATOM   2812  C  CB    . ASN A 1  432  ? 93.990  125.830 93.400  1.00 70.78  ? 432  ASN A CB    1 
ATOM   2813  C  CG    . ASN A 1  432  ? 94.176  126.367 94.806  1.00 71.53  ? 432  ASN A CG    1 
ATOM   2814  O  OD1   . ASN A 1  432  ? 95.294  126.429 95.315  1.00 67.77  ? 432  ASN A OD1   1 
ATOM   2815  N  ND2   . ASN A 1  432  ? 93.077  126.760 95.439  1.00 66.71  ? 432  ASN A ND2   1 
ATOM   2816  N  N     . ASP A 1  433  ? 94.903  122.521 92.913  1.00 68.55  ? 433  ASP A N     1 
ATOM   2817  C  CA    . ASP A 1  433  ? 94.933  121.182 93.489  1.00 69.27  ? 433  ASP A CA    1 
ATOM   2818  C  C     . ASP A 1  433  ? 96.262  120.475 93.270  1.00 71.11  ? 433  ASP A C     1 
ATOM   2819  O  O     . ASP A 1  433  ? 96.743  119.779 94.170  1.00 71.96  ? 433  ASP A O     1 
ATOM   2820  C  CB    . ASP A 1  433  ? 93.801  120.326 92.910  1.00 72.90  ? 433  ASP A CB    1 
ATOM   2821  C  CG    . ASP A 1  433  ? 92.440  120.723 93.443  1.00 71.55  ? 433  ASP A CG    1 
ATOM   2822  O  OD1   . ASP A 1  433  ? 92.369  121.213 94.590  1.00 67.05  ? 433  ASP A OD1   1 
ATOM   2823  O  OD2   . ASP A 1  433  ? 91.440  120.544 92.717  1.00 66.87  ? 433  ASP A OD2   1 
ATOM   2824  N  N     . VAL A 1  434  ? 96.870  120.638 92.094  1.00 64.42  ? 434  VAL A N     1 
ATOM   2825  C  CA    . VAL A 1  434  ? 98.154  119.999 91.832  1.00 62.18  ? 434  VAL A CA    1 
ATOM   2826  C  C     . VAL A 1  434  ? 99.278  120.733 92.553  1.00 62.42  ? 434  VAL A C     1 
ATOM   2827  O  O     . VAL A 1  434  ? 100.194 120.106 93.100  1.00 62.64  ? 434  VAL A O     1 
ATOM   2828  C  CB    . VAL A 1  434  ? 98.403  119.901 90.315  1.00 61.97  ? 434  VAL A CB    1 
ATOM   2829  C  CG1   . VAL A 1  434  ? 98.213  121.251 89.655  1.00 60.21  ? 434  VAL A CG1   1 
ATOM   2830  C  CG2   . VAL A 1  434  ? 99.800  119.366 90.036  1.00 58.87  ? 434  VAL A CG2   1 
ATOM   2831  N  N     . ASN A 1  435  ? 99.229  122.069 92.581  1.00 59.78  ? 435  ASN A N     1 
ATOM   2832  C  CA    . ASN A 1  435  ? 100.234 122.808 93.337  1.00 59.83  ? 435  ASN A CA    1 
ATOM   2833  C  C     . ASN A 1  435  ? 100.023 122.673 94.840  1.00 60.04  ? 435  ASN A C     1 
ATOM   2834  O  O     . ASN A 1  435  ? 100.978 122.846 95.606  1.00 59.74  ? 435  ASN A O     1 
ATOM   2835  C  CB    . ASN A 1  435  ? 100.254 124.284 92.918  1.00 59.42  ? 435  ASN A CB    1 
ATOM   2836  C  CG    . ASN A 1  435  ? 98.955  125.018 93.223  1.00 59.31  ? 435  ASN A CG    1 
ATOM   2837  O  OD1   . ASN A 1  435  ? 98.130  124.564 94.015  1.00 59.57  ? 435  ASN A OD1   1 
ATOM   2838  N  ND2   . ASN A 1  435  ? 98.771  126.167 92.583  1.00 59.35  ? 435  ASN A ND2   1 
ATOM   2839  N  N     . ALA A 1  436  ? 98.797  122.376 95.276  1.00 59.20  ? 436  ALA A N     1 
ATOM   2840  C  CA    . ALA A 1  436  ? 98.569  122.022 96.670  1.00 58.54  ? 436  ALA A CA    1 
ATOM   2841  C  C     . ALA A 1  436  ? 99.151  120.656 96.999  1.00 59.21  ? 436  ALA A C     1 
ATOM   2842  O  O     . ALA A 1  436  ? 99.559  120.416 98.141  1.00 56.64  ? 436  ALA A O     1 
ATOM   2843  C  CB    . ALA A 1  436  ? 97.075  122.048 96.991  1.00 56.04  ? 436  ALA A CB    1 
ATOM   2844  N  N     . PHE A 1  437  ? 99.192  119.752 96.017  1.00 55.05  ? 437  PHE A N     1 
ATOM   2845  C  CA    . PHE A 1  437  ? 99.871  118.477 96.210  1.00 53.90  ? 437  PHE A CA    1 
ATOM   2846  C  C     . PHE A 1  437  ? 101.383 118.656 96.256  1.00 53.21  ? 437  PHE A C     1 
ATOM   2847  O  O     . PHE A 1  437  ? 102.083 117.848 96.877  1.00 52.21  ? 437  PHE A O     1 
ATOM   2848  C  CB    . PHE A 1  437  ? 99.477  117.504 95.097  1.00 52.02  ? 437  PHE A CB    1 
ATOM   2849  C  CG    . PHE A 1  437  ? 100.271 116.227 95.092  1.00 51.67  ? 437  PHE A CG    1 
ATOM   2850  C  CD1   . PHE A 1  437  ? 99.992  115.217 95.998  1.00 51.06  ? 437  PHE A CD1   1 
ATOM   2851  C  CD2   . PHE A 1  437  ? 101.291 116.035 94.176  1.00 51.16  ? 437  PHE A CD2   1 
ATOM   2852  C  CE1   . PHE A 1  437  ? 100.720 114.043 95.994  1.00 51.65  ? 437  PHE A CE1   1 
ATOM   2853  C  CE2   . PHE A 1  437  ? 102.023 114.863 94.166  1.00 54.32  ? 437  PHE A CE2   1 
ATOM   2854  C  CZ    . PHE A 1  437  ? 101.737 113.865 95.077  1.00 53.54  ? 437  PHE A CZ    1 
ATOM   2855  N  N     . ILE A 1  438  ? 101.903 119.706 95.614  1.00 56.38  ? 438  ILE A N     1 
ATOM   2856  C  CA    . ILE A 1  438  ? 103.342 119.951 95.578  1.00 58.56  ? 438  ILE A CA    1 
ATOM   2857  C  C     . ILE A 1  438  ? 103.788 121.005 96.584  1.00 58.76  ? 438  ILE A C     1 
ATOM   2858  O  O     . ILE A 1  438  ? 105.000 121.138 96.825  1.00 58.52  ? 438  ILE A O     1 
ATOM   2859  C  CB    . ILE A 1  438  ? 103.800 120.353 94.157  1.00 58.15  ? 438  ILE A CB    1 
ATOM   2860  C  CG1   . ILE A 1  438  ? 105.245 119.915 93.909  1.00 58.71  ? 438  ILE A CG1   1 
ATOM   2861  C  CG2   . ILE A 1  438  ? 103.663 121.851 93.953  1.00 60.52  ? 438  ILE A CG2   1 
ATOM   2862  C  CD1   . ILE A 1  438  ? 105.436 118.415 93.900  1.00 60.73  ? 438  ILE A CD1   1 
ATOM   2863  N  N     . ASP A 1  439  ? 102.861 121.746 97.187  1.00 62.49  ? 439  ASP A N     1 
ATOM   2864  C  CA    . ASP A 1  439  ? 103.218 122.802 98.123  1.00 63.99  ? 439  ASP A CA    1 
ATOM   2865  C  C     . ASP A 1  439  ? 102.029 123.083 99.031  1.00 63.70  ? 439  ASP A C     1 
ATOM   2866  O  O     . ASP A 1  439  ? 100.877 122.874 98.646  1.00 62.75  ? 439  ASP A O     1 
ATOM   2867  C  CB    . ASP A 1  439  ? 103.648 124.077 97.388  1.00 62.60  ? 439  ASP A CB    1 
ATOM   2868  C  CG    . ASP A 1  439  ? 104.172 125.146 98.326  1.00 61.74  ? 439  ASP A CG    1 
ATOM   2869  O  OD1   . ASP A 1  439  ? 105.387 125.146 98.610  1.00 65.57  ? 439  ASP A OD1   1 
ATOM   2870  O  OD2   . ASP A 1  439  ? 103.366 125.986 98.778  1.00 65.92  ? 439  ASP A OD2   1 
ATOM   2871  N  N     . SER A 1  440  ? 102.321 123.562 100.239 1.00 66.78  ? 440  SER A N     1 
ATOM   2872  C  CA    . SER A 1  440  ? 101.299 123.824 101.243 1.00 68.14  ? 440  SER A CA    1 
ATOM   2873  C  C     . SER A 1  440  ? 101.278 125.256 101.751 1.00 67.58  ? 440  SER A C     1 
ATOM   2874  O  O     . SER A 1  440  ? 100.221 125.723 102.182 1.00 67.94  ? 440  SER A O     1 
ATOM   2875  C  CB    . SER A 1  440  ? 101.474 122.880 102.443 1.00 69.60  ? 440  SER A CB    1 
ATOM   2876  O  OG    . SER A 1  440  ? 100.507 123.143 103.444 1.00 69.98  ? 440  SER A OG    1 
ATOM   2877  N  N     . THR A 1  441  ? 102.404 125.966 101.714 1.00 71.07  ? 441  THR A N     1 
ATOM   2878  C  CA    . THR A 1  441  ? 102.476 127.341 102.192 1.00 72.69  ? 441  THR A CA    1 
ATOM   2879  C  C     . THR A 1  441  ? 101.905 128.347 101.198 1.00 72.92  ? 441  THR A C     1 
ATOM   2880  O  O     . THR A 1  441  ? 102.095 129.554 101.381 1.00 72.87  ? 441  THR A O     1 
ATOM   2881  C  CB    . THR A 1  441  ? 103.926 127.712 102.522 1.00 73.01  ? 441  THR A CB    1 
ATOM   2882  O  OG1   . THR A 1  441  ? 103.982 129.066 102.984 1.00 74.36  ? 441  THR A OG1   1 
ATOM   2883  C  CG2   . THR A 1  441  ? 104.807 127.563 101.291 1.00 75.34  ? 441  THR A CG2   1 
ATOM   2884  N  N     . LYS A 1  442  ? 101.214 127.881 100.160 1.00 75.97  ? 442  LYS A N     1 
ATOM   2885  C  CA    . LYS A 1  442  ? 100.671 128.740 99.116  1.00 78.13  ? 442  LYS A CA    1 
ATOM   2886  C  C     . LYS A 1  442  ? 99.152  128.721 99.069  1.00 78.42  ? 442  LYS A C     1 
ATOM   2887  O  O     . LYS A 1  442  ? 98.527  129.785 98.980  1.00 79.19  ? 442  LYS A O     1 
ATOM   2888  C  CB    . LYS A 1  442  ? 101.247 128.317 97.755  1.00 79.12  ? 442  LYS A CB    1 
ATOM   2889  C  CG    . LYS A 1  442  ? 100.307 128.522 96.580  1.00 78.47  ? 442  LYS A CG    1 
ATOM   2890  C  CD    . LYS A 1  442  ? 100.743 127.678 95.397  1.00 77.67  ? 442  LYS A CD    1 
ATOM   2891  C  CE    . LYS A 1  442  ? 100.925 126.227 95.810  1.00 79.70  ? 442  LYS A CE    1 
ATOM   2892  N  NZ    . LYS A 1  442  ? 99.659  125.635 96.325  1.00 80.98  ? 442  LYS A NZ    1 
ATOM   2893  N  N     . ALA A 1  443  ? 98.540  127.543 99.131  1.00 79.88  ? 443  ALA A N     1 
ATOM   2894  C  CA    . ALA A 1  443  ? 97.097  127.413 98.983  1.00 80.79  ? 443  ALA A CA    1 
ATOM   2895  C  C     . ALA A 1  443  ? 96.405  127.708 100.313 1.00 80.44  ? 443  ALA A C     1 
ATOM   2896  O  O     . ALA A 1  443  ? 97.003  128.246 101.250 1.00 82.16  ? 443  ALA A O     1 
ATOM   2897  C  CB    . ALA A 1  443  ? 96.745  126.026 98.451  1.00 81.70  ? 443  ALA A CB    1 
ATOM   2898  N  N     . GLN A 1  444  ? 95.162  127.253 100.295 1.00 84.73  ? 444  GLN A N     1 
ATOM   2899  C  CA    . GLN A 1  444  ? 94.150  127.553 101.243 1.00 86.78  ? 444  GLN A CA    1 
ATOM   2900  C  C     . GLN A 1  444  ? 94.582  127.551 102.665 1.00 86.01  ? 444  GLN A C     1 
ATOM   2901  O  O     . GLN A 1  444  ? 95.111  126.599 103.238 1.00 84.82  ? 444  GLN A O     1 
ATOM   2902  C  CB    . GLN A 1  444  ? 92.970  126.589 101.070 1.00 83.93  ? 444  GLN A CB    1 
ATOM   2903  C  CG    . GLN A 1  444  ? 91.826  126.826 102.043 1.00 84.25  ? 444  GLN A CG    1 
ATOM   2904  C  CD    . GLN A 1  444  ? 90.679  125.856 101.840 1.00 83.16  ? 444  GLN A CD    1 
ATOM   2905  O  OE1   . GLN A 1  444  ? 90.728  124.993 100.964 1.00 89.49  ? 444  GLN A OE1   1 
ATOM   2906  N  NE2   . GLN A 1  444  ? 89.636  125.995 102.651 1.00 88.93  ? 444  GLN A NE2   1 
ATOM   2907  N  N     . GLY A 1  445  ? 94.297  128.724 103.191 1.00 93.52  ? 445  GLY A N     1 
ATOM   2908  C  CA    . GLY A 1  445  ? 94.502  129.120 104.580 1.00 96.58  ? 445  GLY A CA    1 
ATOM   2909  C  C     . GLY A 1  445  ? 93.285  128.673 104.957 1.00 100.13 ? 445  GLY A C     1 
ATOM   2910  O  O     . GLY A 1  445  ? 92.548  129.635 105.181 1.00 100.89 ? 445  GLY A O     1 
ATOM   2911  N  N     . ARG A 1  446  ? 93.055  127.448 105.422 1.00 103.13 ? 446  ARG A N     1 
ATOM   2912  C  CA    . ARG A 1  446  ? 91.870  127.106 106.191 1.00 105.30 ? 446  ARG A CA    1 
ATOM   2913  C  C     . ARG A 1  446  ? 91.949  127.732 107.587 1.00 105.56 ? 446  ARG A C     1 
ATOM   2914  O  O     . ARG A 1  446  ? 92.917  128.408 107.948 1.00 106.71 ? 446  ARG A O     1 
ATOM   2915  C  CB    . ARG A 1  446  ? 91.727  125.584 106.259 1.00 107.63 ? 446  ARG A CB    1 
ATOM   2916  C  CG    . ARG A 1  446  ? 90.341  125.057 106.617 1.00 107.81 ? 446  ARG A CG    1 
ATOM   2917  C  CD    . ARG A 1  446  ? 89.277  125.558 105.657 1.00 106.78 ? 446  ARG A CD    1 
ATOM   2918  N  NE    . ARG A 1  446  ? 87.978  124.948 105.930 1.00 106.14 ? 446  ARG A NE    1 
ATOM   2919  C  CZ    . ARG A 1  446  ? 87.119  125.396 106.839 1.00 106.77 ? 446  ARG A CZ    1 
ATOM   2920  N  NH1   . ARG A 1  446  ? 87.418  126.462 107.569 1.00 106.24 ? 446  ARG A NH1   1 
ATOM   2921  N  NH2   . ARG A 1  446  ? 85.960  124.777 107.019 1.00 107.39 ? 446  ARG A NH2   1 
ATOM   2922  N  N     . THR A 1  447  ? 90.910  127.496 108.383 1.00 104.71 ? 447  THR A N     1 
ATOM   2923  C  CA    . THR A 1  447  ? 90.850  127.966 109.761 1.00 102.54 ? 447  THR A CA    1 
ATOM   2924  C  C     . THR A 1  447  ? 91.756  127.067 110.610 1.00 102.12 ? 447  THR A C     1 
ATOM   2925  O  O     . THR A 1  447  ? 92.549  126.282 110.083 1.00 102.98 ? 447  THR A O     1 
ATOM   2926  C  CB    . THR A 1  447  ? 89.399  127.987 110.241 1.00 101.68 ? 447  THR A CB    1 
ATOM   2927  O  OG1   . THR A 1  447  ? 88.554  128.406 109.163 1.00 101.01 ? 447  THR A OG1   1 
ATOM   2928  C  CG2   . THR A 1  447  ? 89.219  128.979 111.387 1.00 101.43 ? 447  THR A CG2   1 
ATOM   2929  N  N     . SER A 1  448  ? 91.673  127.202 111.935 1.00 96.05  ? 448  SER A N     1 
ATOM   2930  C  CA    . SER A 1  448  ? 92.505  126.435 112.858 1.00 96.33  ? 448  SER A CA    1 
ATOM   2931  C  C     . SER A 1  448  ? 92.535  124.959 112.485 1.00 96.95  ? 448  SER A C     1 
ATOM   2932  O  O     . SER A 1  448  ? 91.503  124.281 112.495 1.00 98.28  ? 448  SER A O     1 
ATOM   2933  C  CB    . SER A 1  448  ? 91.986  126.613 114.286 1.00 93.65  ? 448  SER A CB    1 
ATOM   2934  O  OG    . SER A 1  448  ? 92.017  127.975 114.675 1.00 93.11  ? 448  SER A OG    1 
ATOM   2935  N  N     . GLY A 1  449  ? 93.728  124.470 112.155 1.00 90.53  ? 449  GLY A N     1 
ATOM   2936  C  CA    . GLY A 1  449  ? 93.578  123.073 111.391 1.00 89.32  ? 449  GLY A CA    1 
ATOM   2937  C  C     . GLY A 1  449  ? 94.288  122.629 112.665 1.00 89.63  ? 449  GLY A C     1 
ATOM   2938  O  O     . GLY A 1  449  ? 93.858  121.687 113.331 1.00 91.66  ? 449  GLY A O     1 
ATOM   2939  N  N     . LYS A 1  450  ? 95.384  123.280 112.967 1.00 83.28  ? 450  LYS A N     1 
ATOM   2940  C  CA    . LYS A 1  450  ? 96.180  122.810 114.049 1.00 82.94  ? 450  LYS A CA    1 
ATOM   2941  C  C     . LYS A 1  450  ? 97.270  122.268 113.156 1.00 82.56  ? 450  LYS A C     1 
ATOM   2942  O  O     . LYS A 1  450  ? 98.446  122.341 113.514 1.00 86.29  ? 450  LYS A O     1 
ATOM   2943  C  CB    . LYS A 1  450  ? 95.479  121.678 114.792 1.00 82.14  ? 450  LYS A CB    1 
ATOM   2944  C  CG    . LYS A 1  450  ? 94.147  122.073 115.409 1.00 81.80  ? 450  LYS A CG    1 
ATOM   2945  C  CD    . LYS A 1  450  ? 94.330  123.128 116.488 1.00 81.49  ? 450  LYS A CD    1 
ATOM   2946  C  CE    . LYS A 1  450  ? 93.008  123.469 117.157 1.00 79.60  ? 450  LYS A CE    1 
ATOM   2947  N  NZ    . LYS A 1  450  ? 93.168  124.519 118.200 1.00 78.51  ? 450  LYS A NZ    1 
ATOM   2948  N  N     . VAL A 1  451  ? 96.915  121.718 111.981 1.00 76.05  ? 451  VAL A N     1 
ATOM   2949  C  CA    . VAL A 1  451  ? 98.053  121.326 111.151 1.00 73.35  ? 451  VAL A CA    1 
ATOM   2950  C  C     . VAL A 1  451  ? 97.567  120.914 109.766 1.00 74.01  ? 451  VAL A C     1 
ATOM   2951  O  O     . VAL A 1  451  ? 96.586  120.165 109.648 1.00 73.79  ? 451  VAL A O     1 
ATOM   2952  C  CB    . VAL A 1  451  ? 98.862  120.202 111.824 1.00 74.15  ? 451  VAL A CB    1 
ATOM   2953  C  CG1   . VAL A 1  451  ? 97.956  119.045 112.222 1.00 70.44  ? 451  VAL A CG1   1 
ATOM   2954  C  CG2   . VAL A 1  451  ? 99.983  119.725 110.912 1.00 69.96  ? 451  VAL A CG2   1 
ATOM   2955  N  N     . PRO A 1  452  ? 98.204  121.391 108.691 1.00 67.88  ? 452  PRO A N     1 
ATOM   2956  C  CA    . PRO A 1  452  ? 97.826  120.934 107.346 1.00 66.68  ? 452  PRO A CA    1 
ATOM   2957  C  C     . PRO A 1  452  ? 98.316  119.524 107.062 1.00 66.54  ? 452  PRO A C     1 
ATOM   2958  O  O     . PRO A 1  452  ? 98.889  118.870 107.939 1.00 66.81  ? 452  PRO A O     1 
ATOM   2959  C  CB    . PRO A 1  452  ? 98.498  121.962 106.426 1.00 67.23  ? 452  PRO A CB    1 
ATOM   2960  C  CG    . PRO A 1  452  ? 99.671  122.444 107.210 1.00 65.99  ? 452  PRO A CG    1 
ATOM   2961  C  CD    . PRO A 1  452  ? 99.230  122.448 108.649 1.00 66.64  ? 452  PRO A CD    1 
ATOM   2962  N  N     . ILE A 1  453  ? 98.101  119.045 105.846 1.00 63.93  ? 453  ILE A N     1 
ATOM   2963  C  CA    . ILE A 1  453  ? 98.457  117.683 105.453 1.00 62.34  ? 453  ILE A CA    1 
ATOM   2964  C  C     . ILE A 1  453  ? 99.774  117.726 104.686 1.00 63.17  ? 453  ILE A C     1 
ATOM   2965  O  O     . ILE A 1  453  ? 99.906  118.533 103.754 1.00 63.11  ? 453  ILE A O     1 
ATOM   2966  C  CB    . ILE A 1  453  ? 97.343  117.029 104.613 1.00 63.11  ? 453  ILE A CB    1 
ATOM   2967  C  CG1   . ILE A 1  453  ? 97.799  115.675 104.066 1.00 63.75  ? 453  ILE A CG1   1 
ATOM   2968  C  CG2   . ILE A 1  453  ? 96.876  117.959 103.496 1.00 60.13  ? 453  ILE A CG2   1 
ATOM   2969  C  CD1   . ILE A 1  453  ? 96.673  114.857 103.481 1.00 59.16  ? 453  ILE A CD1   1 
ATOM   2970  N  N     . PRO A 1  454  ? 100.763 116.907 105.046 1.00 59.38  ? 454  PRO A N     1 
ATOM   2971  C  CA    . PRO A 1  454  ? 102.064 116.935 104.362 1.00 59.46  ? 454  PRO A CA    1 
ATOM   2972  C  C     . PRO A 1  454  ? 102.012 116.208 103.026 1.00 59.92  ? 454  PRO A C     1 
ATOM   2973  O  O     . PRO A 1  454  ? 101.921 114.979 102.973 1.00 60.16  ? 454  PRO A O     1 
ATOM   2974  C  CB    . PRO A 1  454  ? 102.994 116.233 105.361 1.00 59.80  ? 454  PRO A CB    1 
ATOM   2975  C  CG    . PRO A 1  454  ? 102.097 115.310 106.113 1.00 59.76  ? 454  PRO A CG    1 
ATOM   2976  C  CD    . PRO A 1  454  ? 100.764 116.000 106.208 1.00 59.65  ? 454  PRO A CD    1 
ATOM   2977  N  N     . GLY A 1  455  ? 102.068 116.974 101.938 1.00 60.74  ? 455  GLY A N     1 
ATOM   2978  C  CA    . GLY A 1  455  ? 101.975 116.374 100.621 1.00 61.83  ? 455  GLY A CA    1 
ATOM   2979  C  C     . GLY A 1  455  ? 103.234 115.706 100.105 1.00 62.24  ? 455  GLY A C     1 
ATOM   2980  O  O     . GLY A 1  455  ? 103.262 114.481 99.955  1.00 62.76  ? 455  GLY A O     1 
ATOM   2981  N  N     . VAL A 1  456  ? 104.284 116.482 99.827  1.00 62.37  ? 456  VAL A N     1 
ATOM   2982  C  CA    . VAL A 1  456  ? 105.513 115.904 99.291  1.00 62.86  ? 456  VAL A CA    1 
ATOM   2983  C  C     . VAL A 1  456  ? 106.753 116.374 100.045 1.00 62.87  ? 456  VAL A C     1 
ATOM   2984  O  O     . VAL A 1  456  ? 107.511 115.555 100.580 1.00 63.49  ? 456  VAL A O     1 
ATOM   2985  C  CB    . VAL A 1  456  ? 105.649 116.201 97.785  1.00 62.21  ? 456  VAL A CB    1 
ATOM   2986  C  CG1   . VAL A 1  456  ? 104.800 115.232 96.977  1.00 63.11  ? 456  VAL A CG1   1 
ATOM   2987  C  CG2   . VAL A 1  456  ? 105.245 117.632 97.484  1.00 63.50  ? 456  VAL A CG2   1 
ATOM   2988  N  N     . LYS A 1  457  ? 106.971 117.690 100.097 1.00 62.59  ? 457  LYS A N     1 
ATOM   2989  C  CA    . LYS A 1  457  ? 108.261 118.217 100.526 1.00 61.87  ? 457  LYS A CA    1 
ATOM   2990  C  C     . LYS A 1  457  ? 108.330 118.483 102.024 1.00 62.53  ? 457  LYS A C     1 
ATOM   2991  O  O     . LYS A 1  457  ? 109.424 118.452 102.598 1.00 62.95  ? 457  LYS A O     1 
ATOM   2992  C  CB    . LYS A 1  457  ? 108.600 119.497 99.750  1.00 62.85  ? 457  LYS A CB    1 
ATOM   2993  C  CG    . LYS A 1  457  ? 108.168 120.801 100.407 1.00 62.89  ? 457  LYS A CG    1 
ATOM   2994  C  CD    . LYS A 1  457  ? 106.664 120.993 100.365 1.00 62.49  ? 457  LYS A CD    1 
ATOM   2995  C  CE    . LYS A 1  457  ? 106.265 122.285 101.055 1.00 60.29  ? 457  LYS A CE    1 
ATOM   2996  N  NZ    . LYS A 1  457  ? 104.793 122.386 101.226 1.00 59.04  ? 457  LYS A NZ    1 
ATOM   2997  N  N     . GLN A 1  458  ? 107.196 118.745 102.671 1.00 59.99  ? 458  GLN A N     1 
ATOM   2998  C  CA    . GLN A 1  458  ? 107.169 118.839 104.123 1.00 60.22  ? 458  GLN A CA    1 
ATOM   2999  C  C     . GLN A 1  458  ? 106.999 117.477 104.780 1.00 61.43  ? 458  GLN A C     1 
ATOM   3000  O  O     . GLN A 1  458  ? 107.106 117.378 106.007 1.00 62.66  ? 458  GLN A O     1 
ATOM   3001  C  CB    . GLN A 1  458  ? 106.057 119.792 104.578 1.00 62.95  ? 458  GLN A CB    1 
ATOM   3002  C  CG    . GLN A 1  458  ? 104.641 119.292 104.359 1.00 62.52  ? 458  GLN A CG    1 
ATOM   3003  C  CD    . GLN A 1  458  ? 104.189 119.359 102.908 1.00 63.22  ? 458  GLN A CD    1 
ATOM   3004  O  OE1   . GLN A 1  458  ? 104.871 118.877 102.005 1.00 59.58  ? 458  GLN A OE1   1 
ATOM   3005  N  NE2   . GLN A 1  458  ? 103.026 119.958 102.684 1.00 59.04  ? 458  GLN A NE2   1 
ATOM   3006  N  N     . ALA A 1  459  ? 106.729 116.436 103.993 1.00 59.84  ? 459  ALA A N     1 
ATOM   3007  C  CA    . ALA A 1  459  ? 106.916 115.064 104.441 1.00 60.22  ? 459  ALA A CA    1 
ATOM   3008  C  C     . ALA A 1  459  ? 108.336 114.583 104.189 1.00 61.09  ? 459  ALA A C     1 
ATOM   3009  O  O     . ALA A 1  459  ? 108.853 113.760 104.952 1.00 59.77  ? 459  ALA A O     1 
ATOM   3010  C  CB    . ALA A 1  459  ? 105.921 114.133 103.741 1.00 59.76  ? 459  ALA A CB    1 
ATOM   3011  N  N     . LEU A 1  460  ? 108.974 115.087 103.129 1.00 59.79  ? 460  LEU A N     1 
ATOM   3012  C  CA    . LEU A 1  460  ? 110.401 114.893 102.915 1.00 60.56  ? 460  LEU A CA    1 
ATOM   3013  C  C     . LEU A 1  460  ? 111.242 115.763 103.841 1.00 60.39  ? 460  LEU A C     1 
ATOM   3014  O  O     . LEU A 1  460  ? 112.451 115.535 103.956 1.00 60.52  ? 460  LEU A O     1 
ATOM   3015  C  CB    . LEU A 1  460  ? 110.742 115.181 101.447 1.00 60.38  ? 460  LEU A CB    1 
ATOM   3016  C  CG    . LEU A 1  460  ? 112.158 114.932 100.922 1.00 60.79  ? 460  LEU A CG    1 
ATOM   3017  C  CD1   . LEU A 1  460  ? 112.116 114.225 99.579  1.00 62.26  ? 460  LEU A CD1   1 
ATOM   3018  C  CD2   . LEU A 1  460  ? 112.916 116.243 100.808 1.00 62.39  ? 460  LEU A CD2   1 
ATOM   3019  N  N     . GLU A 1  461  ? 110.626 116.744 104.506 1.00 64.60  ? 461  GLU A N     1 
ATOM   3020  C  CA    . GLU A 1  461  ? 111.282 117.573 105.522 1.00 66.96  ? 461  GLU A CA    1 
ATOM   3021  C  C     . GLU A 1  461  ? 110.251 117.812 106.623 1.00 64.90  ? 461  GLU A C     1 
ATOM   3022  O  O     . GLU A 1  461  ? 109.460 118.757 106.546 1.00 63.26  ? 461  GLU A O     1 
ATOM   3023  C  CB    . GLU A 1  461  ? 111.791 118.886 104.939 1.00 62.53  ? 461  GLU A CB    1 
ATOM   3024  C  CG    . GLU A 1  461  ? 113.074 118.780 104.138 1.00 62.93  ? 461  GLU A CG    1 
ATOM   3025  C  CD    . GLU A 1  461  ? 113.563 120.134 103.662 1.00 62.23  ? 461  GLU A CD    1 
ATOM   3026  O  OE1   . GLU A 1  461  ? 112.737 121.069 103.584 1.00 71.29  ? 461  GLU A OE1   1 
ATOM   3027  O  OE2   . GLU A 1  461  ? 114.771 120.269 103.378 1.00 73.28  ? 461  GLU A OE2   1 
ATOM   3028  N  N     . LYS A 1  462  ? 110.266 116.958 107.648 1.00 74.31  ? 462  LYS A N     1 
ATOM   3029  C  CA    . LYS A 1  462  ? 109.295 117.099 108.728 1.00 76.07  ? 462  LYS A CA    1 
ATOM   3030  C  C     . LYS A 1  462  ? 109.566 118.373 109.515 1.00 75.07  ? 462  LYS A C     1 
ATOM   3031  O  O     . LYS A 1  462  ? 108.758 119.308 109.486 1.00 73.94  ? 462  LYS A O     1 
ATOM   3032  C  CB    . LYS A 1  462  ? 109.330 115.874 109.649 1.00 73.70  ? 462  LYS A CB    1 
ATOM   3033  C  CG    . LYS A 1  462  ? 110.730 115.350 109.941 1.00 73.57  ? 462  LYS A CG    1 
ATOM   3034  C  CD    . LYS A 1  462  ? 110.766 114.485 111.188 1.00 73.37  ? 462  LYS A CD    1 
ATOM   3035  C  CE    . LYS A 1  462  ? 112.187 114.040 111.499 1.00 78.58  ? 462  LYS A CE    1 
ATOM   3036  N  NZ    . LYS A 1  462  ? 113.118 115.190 111.660 1.00 79.35  ? 462  LYS A NZ    1 
ATOM   3037  N  N     . LYS A 1  463  ? 110.690 118.425 110.221 1.00 79.49  ? 463  LYS A N     1 
ATOM   3038  C  CA    . LYS A 1  463  ? 111.214 119.680 110.754 1.00 79.42  ? 463  LYS A CA    1 
ATOM   3039  C  C     . LYS A 1  463  ? 112.388 120.169 109.906 1.00 79.50  ? 463  LYS A C     1 
ATOM   3040  O  O     . LYS A 1  463  ? 113.516 120.309 110.385 1.00 78.85  ? 463  LYS A O     1 
ATOM   3041  C  CB    . LYS A 1  463  ? 111.601 119.515 112.223 1.00 78.74  ? 463  LYS A CB    1 
ATOM   3042  C  CG    . LYS A 1  463  ? 112.495 118.323 112.530 1.00 78.08  ? 463  LYS A CG    1 
ATOM   3043  C  CD    . LYS A 1  463  ? 112.685 118.165 114.031 1.00 77.49  ? 463  LYS A CD    1 
ATOM   3044  C  CE    . LYS A 1  463  ? 113.771 117.153 114.356 1.00 77.58  ? 463  LYS A CE    1 
ATOM   3045  N  NZ    . LYS A 1  463  ? 115.119 117.645 113.963 1.00 77.76  ? 463  LYS A NZ    1 
ATOM   3046  N  N     . GLU A 1  464  ? 112.099 120.434 108.629 1.00 74.82  ? 464  GLU A N     1 
ATOM   3047  C  CA    . GLU A 1  464  ? 113.038 121.036 107.673 1.00 73.02  ? 464  GLU A CA    1 
ATOM   3048  C  C     . GLU A 1  464  ? 114.420 120.376 107.759 1.00 74.39  ? 464  GLU A C     1 
ATOM   3049  O  O     . GLU A 1  464  ? 115.401 120.965 108.216 1.00 75.52  ? 464  GLU A O     1 
ATOM   3050  C  CB    . GLU A 1  464  ? 113.122 122.566 107.827 1.00 75.96  ? 464  GLU A CB    1 
ATOM   3051  C  CG    . GLU A 1  464  ? 113.380 123.139 109.219 1.00 75.08  ? 464  GLU A CG    1 
ATOM   3052  C  CD    . GLU A 1  464  ? 112.103 123.357 110.008 1.00 76.85  ? 464  GLU A CD    1 
ATOM   3053  O  OE1   . GLU A 1  464  ? 111.016 123.032 109.487 1.00 71.57  ? 464  GLU A OE1   1 
ATOM   3054  O  OE2   . GLU A 1  464  ? 112.187 123.854 111.152 1.00 71.12  ? 464  GLU A OE2   1 
ATOM   3055  N  N     . GLY A 1  465  ? 114.478 119.124 107.300 1.00 71.09  ? 465  GLY A N     1 
ATOM   3056  C  CA    . GLY A 1  465  ? 115.658 118.319 107.556 1.00 71.73  ? 465  GLY A CA    1 
ATOM   3057  C  C     . GLY A 1  465  ? 115.431 116.845 107.836 1.00 71.56  ? 465  GLY A C     1 
ATOM   3058  O  O     . GLY A 1  465  ? 116.341 116.166 108.326 1.00 71.12  ? 465  GLY A O     1 
ATOM   3059  N  N     . LEU A 1  466  ? 114.224 116.346 107.557 1.00 71.19  ? 466  LEU A N     1 
ATOM   3060  C  CA    . LEU A 1  466  ? 113.888 114.925 107.664 1.00 70.41  ? 466  LEU A CA    1 
ATOM   3061  C  C     . LEU A 1  466  ? 114.974 114.016 107.091 1.00 70.53  ? 466  LEU A C     1 
ATOM   3062  O  O     . LEU A 1  466  ? 115.104 112.863 107.518 1.00 70.04  ? 466  LEU A O     1 
ATOM   3063  C  CB    . LEU A 1  466  ? 112.549 114.652 106.965 1.00 69.21  ? 466  LEU A CB    1 
ATOM   3064  C  CG    . LEU A 1  466  ? 111.891 113.265 106.873 1.00 70.18  ? 466  LEU A CG    1 
ATOM   3065  C  CD1   . LEU A 1  466  ? 112.416 112.448 105.691 1.00 68.88  ? 466  LEU A CD1   1 
ATOM   3066  C  CD2   . LEU A 1  466  ? 112.023 112.484 108.173 1.00 68.75  ? 466  LEU A CD2   1 
ATOM   3067  N  N     . PHE A 1  467  ? 115.746 114.514 106.118 1.00 66.34  ? 467  PHE A N     1 
ATOM   3068  C  CA    . PHE A 1  467  ? 116.889 113.768 105.597 1.00 64.97  ? 467  PHE A CA    1 
ATOM   3069  C  C     . PHE A 1  467  ? 117.795 113.234 106.700 1.00 65.00  ? 467  PHE A C     1 
ATOM   3070  O  O     . PHE A 1  467  ? 118.486 112.231 106.493 1.00 65.76  ? 467  PHE A O     1 
ATOM   3071  C  CB    . PHE A 1  467  ? 117.713 114.648 104.652 1.00 66.34  ? 467  PHE A CB    1 
ATOM   3072  C  CG    . PHE A 1  467  ? 117.183 114.701 103.246 1.00 67.13  ? 467  PHE A CG    1 
ATOM   3073  C  CD1   . PHE A 1  467  ? 116.081 113.953 102.875 1.00 66.87  ? 467  PHE A CD1   1 
ATOM   3074  C  CD2   . PHE A 1  467  ? 117.801 115.492 102.292 1.00 66.53  ? 467  PHE A CD2   1 
ATOM   3075  C  CE1   . PHE A 1  467  ? 115.598 113.997 101.581 1.00 66.24  ? 467  PHE A CE1   1 
ATOM   3076  C  CE2   . PHE A 1  467  ? 117.324 115.541 100.995 1.00 64.43  ? 467  PHE A CE2   1 
ATOM   3077  C  CZ    . PHE A 1  467  ? 116.220 114.793 100.639 1.00 64.53  ? 467  PHE A CZ    1 
ATOM   3078  N  N     . ARG A 1  468  ? 117.810 113.878 107.868 1.00 63.13  ? 468  ARG A N     1 
ATOM   3079  C  CA    . ARG A 1  468  ? 118.624 113.395 108.976 1.00 61.83  ? 468  ARG A CA    1 
ATOM   3080  C  C     . ARG A 1  468  ? 118.038 112.143 109.620 1.00 62.67  ? 468  ARG A C     1 
ATOM   3081  O  O     . ARG A 1  468  ? 118.785 111.347 110.201 1.00 63.02  ? 468  ARG A O     1 
ATOM   3082  C  CB    . ARG A 1  468  ? 118.786 114.499 110.021 1.00 63.25  ? 468  ARG A CB    1 
ATOM   3083  C  CG    . ARG A 1  468  ? 119.494 115.739 109.500 1.00 63.19  ? 468  ARG A CG    1 
ATOM   3084  C  CD    . ARG A 1  468  ? 119.328 116.922 110.442 1.00 63.59  ? 468  ARG A CD    1 
ATOM   3085  N  NE    . ARG A 1  468  ? 117.994 117.509 110.354 1.00 63.49  ? 468  ARG A NE    1 
ATOM   3086  C  CZ    . ARG A 1  468  ? 116.994 117.232 111.187 1.00 64.06  ? 468  ARG A CZ    1 
ATOM   3087  N  NH1   . ARG A 1  468  ? 115.815 117.815 111.025 1.00 59.59  ? 468  ARG A NH1   1 
ATOM   3088  N  NH2   . ARG A 1  468  ? 117.174 116.373 112.180 1.00 59.62  ? 468  ARG A NH2   1 
ATOM   3089  N  N     . LYS A 1  469  ? 116.720 111.951 109.532 1.00 57.16  ? 469  LYS A N     1 
ATOM   3090  C  CA    . LYS A 1  469  ? 116.103 110.788 110.164 1.00 55.72  ? 469  LYS A CA    1 
ATOM   3091  C  C     . LYS A 1  469  ? 116.421 109.503 109.408 1.00 55.62  ? 469  LYS A C     1 
ATOM   3092  O  O     . LYS A 1  469  ? 116.680 108.464 110.025 1.00 56.34  ? 469  LYS A O     1 
ATOM   3093  C  CB    . LYS A 1  469  ? 114.590 110.981 110.275 1.00 56.58  ? 469  LYS A CB    1 
ATOM   3094  C  CG    . LYS A 1  469  ? 113.840 109.715 110.676 1.00 56.87  ? 469  LYS A CG    1 
ATOM   3095  C  CD    . LYS A 1  469  ? 112.346 109.955 110.829 1.00 57.43  ? 469  LYS A CD    1 
ATOM   3096  C  CE    . LYS A 1  469  ? 112.017 110.569 112.178 1.00 54.96  ? 469  LYS A CE    1 
ATOM   3097  N  NZ    . LYS A 1  469  ? 112.416 109.682 113.306 1.00 55.11  ? 469  LYS A NZ    1 
ATOM   3098  N  N     . HIS A 1  470  ? 116.396 109.546 108.077 1.00 53.89  ? 470  HIS A N     1 
ATOM   3099  C  CA    . HIS A 1  470  ? 116.634 108.357 107.268 1.00 52.91  ? 470  HIS A CA    1 
ATOM   3100  C  C     . HIS A 1  470  ? 117.868 108.472 106.386 1.00 52.46  ? 470  HIS A C     1 
ATOM   3101  O  O     . HIS A 1  470  ? 118.720 107.577 106.406 1.00 51.65  ? 470  HIS A O     1 
ATOM   3102  C  CB    . HIS A 1  470  ? 115.402 108.049 106.401 1.00 51.52  ? 470  HIS A CB    1 
ATOM   3103  C  CG    . HIS A 1  470  ? 114.246 107.490 107.171 1.00 51.28  ? 470  HIS A CG    1 
ATOM   3104  N  ND1   . HIS A 1  470  ? 113.248 108.282 107.698 1.00 51.19  ? 470  HIS A ND1   1 
ATOM   3105  C  CD2   . HIS A 1  470  ? 113.930 106.216 107.505 1.00 51.21  ? 470  HIS A CD2   1 
ATOM   3106  C  CE1   . HIS A 1  470  ? 112.367 107.520 108.321 1.00 52.28  ? 470  HIS A CE1   1 
ATOM   3107  N  NE2   . HIS A 1  470  ? 112.758 106.263 108.220 1.00 52.02  ? 470  HIS A NE2   1 
ATOM   3108  N  N     . MET A 1  471  ? 117.992 109.551 105.610 1.00 51.79  ? 471  MET A N     1 
ATOM   3109  C  CA    . MET A 1  471  ? 119.071 109.637 104.628 1.00 51.57  ? 471  MET A CA    1 
ATOM   3110  C  C     . MET A 1  471  ? 120.443 109.725 105.286 1.00 51.96  ? 471  MET A C     1 
ATOM   3111  O  O     . MET A 1  471  ? 121.442 109.309 104.687 1.00 52.17  ? 471  MET A O     1 
ATOM   3112  C  CB    . MET A 1  471  ? 118.848 110.839 103.709 1.00 52.31  ? 471  MET A CB    1 
ATOM   3113  C  CG    . MET A 1  471  ? 118.117 110.517 102.414 1.00 52.28  ? 471  MET A CG    1 
ATOM   3114  S  SD    . MET A 1  471  ? 116.636 109.515 102.643 1.00 51.16  ? 471  MET A SD    1 
ATOM   3115  C  CE    . MET A 1  471  ? 115.604 110.608 103.615 1.00 51.40  ? 471  MET A CE    1 
ATOM   3116  N  N     . MET A 1  472  ? 120.519 110.253 106.506 1.00 50.74  ? 472  MET A N     1 
ATOM   3117  C  CA    . MET A 1  472  ? 121.798 110.457 107.180 1.00 50.90  ? 472  MET A CA    1 
ATOM   3118  C  C     . MET A 1  472  ? 122.124 109.356 108.182 1.00 51.00  ? 472  MET A C     1 
ATOM   3119  O  O     . MET A 1  472  ? 123.219 108.787 108.140 1.00 51.05  ? 472  MET A O     1 
ATOM   3120  C  CB    . MET A 1  472  ? 121.810 111.823 107.875 1.00 50.93  ? 472  MET A CB    1 
ATOM   3121  C  CG    . MET A 1  472  ? 121.743 113.008 106.919 1.00 51.54  ? 472  MET A CG    1 
ATOM   3122  S  SD    . MET A 1  472  ? 123.142 113.088 105.781 1.00 50.78  ? 472  MET A SD    1 
ATOM   3123  C  CE    . MET A 1  472  ? 122.413 112.449 104.272 1.00 50.60  ? 472  MET A CE    1 
ATOM   3124  N  N     . GLY A 1  473  ? 121.200 109.042 109.085 1.00 50.74  ? 473  GLY A N     1 
ATOM   3125  C  CA    . GLY A 1  473  ? 121.432 107.990 110.056 1.00 50.59  ? 473  GLY A CA    1 
ATOM   3126  C  C     . GLY A 1  473  ? 120.227 107.096 110.247 1.00 50.72  ? 473  GLY A C     1 
ATOM   3127  O  O     . GLY A 1  473  ? 119.150 107.566 110.621 1.00 50.24  ? 473  GLY A O     1 
ATOM   3128  N  N     . LYS A 1  474  ? 120.400 105.800 110.011 1.00 51.70  ? 474  LYS A N     1 
ATOM   3129  C  CA    . LYS A 1  474  ? 119.298 104.852 110.041 1.00 52.56  ? 474  LYS A CA    1 
ATOM   3130  C  C     . LYS A 1  474  ? 119.054 104.343 111.459 1.00 53.55  ? 474  LYS A C     1 
ATOM   3131  O  O     . LYS A 1  474  ? 119.851 104.556 112.376 1.00 54.17  ? 474  LYS A O     1 
ATOM   3132  C  CB    . LYS A 1  474  ? 119.573 103.673 109.103 1.00 54.70  ? 474  LYS A CB    1 
ATOM   3133  C  CG    . LYS A 1  474  ? 119.274 103.925 107.628 1.00 55.06  ? 474  LYS A CG    1 
ATOM   3134  C  CD    . LYS A 1  474  ? 120.273 104.877 106.996 1.00 55.29  ? 474  LYS A CD    1 
ATOM   3135  C  CE    . LYS A 1  474  ? 120.140 104.914 105.483 1.00 52.04  ? 474  LYS A CE    1 
ATOM   3136  N  NZ    . LYS A 1  474  ? 120.534 103.622 104.861 1.00 52.51  ? 474  LYS A NZ    1 
ATOM   3137  N  N     . ARG A 1  475  ? 117.926 103.659 111.629 1.00 51.49  ? 475  ARG A N     1 
ATOM   3138  C  CA    . ARG A 1  475  ? 117.626 102.946 112.868 1.00 50.80  ? 475  ARG A CA    1 
ATOM   3139  C  C     . ARG A 1  475  ? 118.425 101.651 112.845 1.00 51.53  ? 475  ARG A C     1 
ATOM   3140  O  O     . ARG A 1  475  ? 118.038 100.678 112.193 1.00 52.11  ? 475  ARG A O     1 
ATOM   3141  C  CB    . ARG A 1  475  ? 116.129 102.690 112.994 1.00 52.36  ? 475  ARG A CB    1 
ATOM   3142  C  CG    . ARG A 1  475  ? 115.703 102.120 114.337 1.00 52.68  ? 475  ARG A CG    1 
ATOM   3143  C  CD    . ARG A 1  475  ? 115.979 103.098 115.464 1.00 52.75  ? 475  ARG A CD    1 
ATOM   3144  N  NE    . ARG A 1  475  ? 115.119 104.277 115.401 1.00 52.81  ? 475  ARG A NE    1 
ATOM   3145  C  CZ    . ARG A 1  475  ? 114.086 104.489 116.207 1.00 52.50  ? 475  ARG A CZ    1 
ATOM   3146  N  NH1   . ARG A 1  475  ? 113.784 103.603 117.147 1.00 49.52  ? 475  ARG A NH1   1 
ATOM   3147  N  NH2   . ARG A 1  475  ? 113.357 105.589 116.080 1.00 49.83  ? 475  ARG A NH2   1 
ATOM   3148  N  N     . VAL A 1  476  ? 119.548 101.635 113.555 1.00 48.42  ? 476  VAL A N     1 
ATOM   3149  C  CA    . VAL A 1  476  ? 120.525 100.562 113.419 1.00 48.11  ? 476  VAL A CA    1 
ATOM   3150  C  C     . VAL A 1  476  ? 120.091 99.361  114.247 1.00 49.11  ? 476  VAL A C     1 
ATOM   3151  O  O     . VAL A 1  476  ? 119.740 99.494  115.426 1.00 49.46  ? 476  VAL A O     1 
ATOM   3152  C  CB    . VAL A 1  476  ? 121.922 101.050 113.833 1.00 49.66  ? 476  VAL A CB    1 
ATOM   3153  C  CG1   . VAL A 1  476  ? 122.923 99.908  113.799 1.00 47.58  ? 476  VAL A CG1   1 
ATOM   3154  C  CG2   . VAL A 1  476  ? 122.369 102.181 112.925 1.00 47.67  ? 476  VAL A CG2   1 
ATOM   3155  N  N     . ASN A 1  477  ? 120.115 98.183  113.628 1.00 47.65  ? 477  ASN A N     1 
ATOM   3156  C  CA    . ASN A 1  477  ? 119.824 96.936  114.313 1.00 48.57  ? 477  ASN A CA    1 
ATOM   3157  C  C     . ASN A 1  477  ? 121.025 96.508  115.157 1.00 49.58  ? 477  ASN A C     1 
ATOM   3158  O  O     . ASN A 1  477  ? 122.099 97.115  115.111 1.00 50.82  ? 477  ASN A O     1 
ATOM   3159  C  CB    . ASN A 1  477  ? 119.455 95.851  113.300 1.00 51.26  ? 477  ASN A CB    1 
ATOM   3160  C  CG    . ASN A 1  477  ? 118.716 94.685  113.931 1.00 51.40  ? 477  ASN A CG    1 
ATOM   3161  O  OD1   . ASN A 1  477  ? 118.217 94.785  115.052 1.00 48.78  ? 477  ASN A OD1   1 
ATOM   3162  N  ND2   . ASN A 1  477  ? 118.641 93.572  113.211 1.00 48.35  ? 477  ASN A ND2   1 
ATOM   3163  N  N     . TYR A 1  478  ? 120.830 95.446  115.940 1.00 49.56  ? 478  TYR A N     1 
ATOM   3164  C  CA    . TYR A 1  478  ? 121.854 94.916  116.843 1.00 49.29  ? 478  TYR A CA    1 
ATOM   3165  C  C     . TYR A 1  478  ? 122.319 95.992  117.827 1.00 47.75  ? 478  TYR A C     1 
ATOM   3166  O  O     . TYR A 1  478  ? 123.489 96.379  117.871 1.00 46.70  ? 478  TYR A O     1 
ATOM   3167  C  CB    . TYR A 1  478  ? 123.030 94.325  116.058 1.00 46.52  ? 478  TYR A CB    1 
ATOM   3168  C  CG    . TYR A 1  478  ? 122.654 93.136  115.201 1.00 46.88  ? 478  TYR A CG    1 
ATOM   3169  C  CD1   . TYR A 1  478  ? 122.654 91.849  115.725 1.00 47.14  ? 478  TYR A CD1   1 
ATOM   3170  C  CD2   . TYR A 1  478  ? 122.300 93.300  113.868 1.00 47.59  ? 478  TYR A CD2   1 
ATOM   3171  C  CE1   . TYR A 1  478  ? 122.313 90.760  114.946 1.00 46.86  ? 478  TYR A CE1   1 
ATOM   3172  C  CE2   . TYR A 1  478  ? 121.956 92.216  113.081 1.00 46.42  ? 478  TYR A CE2   1 
ATOM   3173  C  CZ    . TYR A 1  478  ? 121.964 90.949  113.625 1.00 50.17  ? 478  TYR A CZ    1 
ATOM   3174  O  OH    . TYR A 1  478  ? 121.623 89.868  112.846 1.00 50.04  ? 478  TYR A OH    1 
ATOM   3175  N  N     . ALA A 1  479  ? 121.368 96.471  118.624 1.00 50.72  ? 479  ALA A N     1 
ATOM   3176  C  CA    . ALA A 1  479  ? 121.605 97.529  119.592 1.00 50.43  ? 479  ALA A CA    1 
ATOM   3177  C  C     . ALA A 1  479  ? 121.292 97.038  121.000 1.00 49.84  ? 479  ALA A C     1 
ATOM   3178  O  O     . ALA A 1  479  ? 120.602 96.034  121.194 1.00 50.90  ? 479  ALA A O     1 
ATOM   3179  C  CB    . ALA A 1  479  ? 120.763 98.771  119.274 1.00 51.82  ? 479  ALA A CB    1 
ATOM   3180  N  N     . ALA A 1  480  ? 121.813 97.767  121.984 1.00 51.13  ? 480  ALA A N     1 
ATOM   3181  C  CA    . ALA A 1  480  ? 121.587 97.449  123.391 1.00 51.64  ? 480  ALA A CA    1 
ATOM   3182  C  C     . ALA A 1  480  ? 121.748 98.724  124.202 1.00 52.16  ? 480  ALA A C     1 
ATOM   3183  O  O     . ALA A 1  480  ? 122.811 99.351  124.165 1.00 51.88  ? 480  ALA A O     1 
ATOM   3184  C  CB    . ALA A 1  480  ? 122.559 96.372  123.877 1.00 51.61  ? 480  ALA A CB    1 
ATOM   3185  N  N     . ARG A 1  481  ? 120.699 99.106  124.928 1.00 52.90  ? 481  ARG A N     1 
ATOM   3186  C  CA    . ARG A 1  481  ? 120.702 100.341 125.702 1.00 53.92  ? 481  ARG A CA    1 
ATOM   3187  C  C     . ARG A 1  481  ? 120.119 100.073 127.082 1.00 53.96  ? 481  ARG A C     1 
ATOM   3188  O  O     . ARG A 1  481  ? 118.995 99.578  127.198 1.00 54.49  ? 481  ARG A O     1 
ATOM   3189  C  CB    . ARG A 1  481  ? 119.902 101.437 124.989 1.00 55.35  ? 481  ARG A CB    1 
ATOM   3190  C  CG    . ARG A 1  481  ? 120.006 102.812 125.629 1.00 56.36  ? 481  ARG A CG    1 
ATOM   3191  C  CD    . ARG A 1  481  ? 119.260 103.854 124.808 1.00 57.38  ? 481  ARG A CD    1 
ATOM   3192  N  NE    . ARG A 1  481  ? 119.237 105.163 125.456 1.00 57.53  ? 481  ARG A NE    1 
ATOM   3193  C  CZ    . ARG A 1  481  ? 120.046 106.169 125.140 1.00 57.79  ? 481  ARG A CZ    1 
ATOM   3194  N  NH1   . ARG A 1  481  ? 119.953 107.324 125.784 1.00 54.62  ? 481  ARG A NH1   1 
ATOM   3195  N  NH2   . ARG A 1  481  ? 120.946 106.022 124.179 1.00 55.88  ? 481  ARG A NH2   1 
ATOM   3196  N  N     . SER A 1  482  ? 120.886 100.401 128.117 1.00 54.08  ? 482  SER A N     1 
ATOM   3197  C  CA    . SER A 1  482  ? 120.463 100.227 129.503 1.00 53.37  ? 482  SER A CA    1 
ATOM   3198  C  C     . SER A 1  482  ? 121.378 101.073 130.380 1.00 54.10  ? 482  SER A C     1 
ATOM   3199  O  O     . SER A 1  482  ? 122.327 101.700 129.897 1.00 53.69  ? 482  SER A O     1 
ATOM   3200  C  CB    . SER A 1  482  ? 120.491 98.755  129.919 1.00 51.56  ? 482  SER A CB    1 
ATOM   3201  O  OG    . SER A 1  482  ? 121.803 98.226  129.836 1.00 51.09  ? 482  SER A OG    1 
ATOM   3202  N  N     . VAL A 1  483  ? 121.088 101.082 131.684 1.00 50.36  ? 483  VAL A N     1 
ATOM   3203  C  CA    . VAL A 1  483  ? 121.890 101.866 132.619 1.00 49.59  ? 483  VAL A CA    1 
ATOM   3204  C  C     . VAL A 1  483  ? 123.273 101.235 132.776 1.00 49.68  ? 483  VAL A C     1 
ATOM   3205  O  O     . VAL A 1  483  ? 123.499 100.061 132.458 1.00 49.76  ? 483  VAL A O     1 
ATOM   3206  C  CB    . VAL A 1  483  ? 121.171 101.992 133.973 1.00 49.59  ? 483  VAL A CB    1 
ATOM   3207  C  CG1   . VAL A 1  483  ? 121.703 103.181 134.766 1.00 49.21  ? 483  VAL A CG1   1 
ATOM   3208  C  CG2   . VAL A 1  483  ? 119.675 102.129 133.762 1.00 49.35  ? 483  VAL A CG2   1 
ATOM   3209  N  N     . ILE A 1  484  ? 124.210 102.034 133.278 1.00 49.11  ? 484  ILE A N     1 
ATOM   3210  C  CA    . ILE A 1  484  ? 125.601 101.629 133.391 1.00 49.00  ? 484  ILE A CA    1 
ATOM   3211  C  C     . ILE A 1  484  ? 125.967 101.488 134.867 1.00 50.12  ? 484  ILE A C     1 
ATOM   3212  O  O     . ILE A 1  484  ? 125.192 101.824 135.762 1.00 50.51  ? 484  ILE A O     1 
ATOM   3213  C  CB    . ILE A 1  484  ? 126.546 102.617 132.681 1.00 51.09  ? 484  ILE A CB    1 
ATOM   3214  C  CG1   . ILE A 1  484  ? 126.529 103.972 133.391 1.00 50.97  ? 484  ILE A CG1   1 
ATOM   3215  C  CG2   . ILE A 1  484  ? 126.142 102.778 131.226 1.00 47.90  ? 484  ILE A CG2   1 
ATOM   3216  C  CD1   . ILE A 1  484  ? 127.442 105.003 132.767 1.00 48.27  ? 484  ILE A CD1   1 
ATOM   3217  N  N     . SER A 1  485  ? 127.180 100.980 135.113 1.00 46.75  ? 485  SER A N     1 
ATOM   3218  C  CA    . SER A 1  485  ? 127.689 100.777 136.462 1.00 45.86  ? 485  SER A CA    1 
ATOM   3219  C  C     . SER A 1  485  ? 129.195 100.607 136.389 1.00 45.83  ? 485  SER A C     1 
ATOM   3220  O  O     . SER A 1  485  ? 129.688 100.017 135.419 1.00 45.65  ? 485  SER A O     1 
ATOM   3221  C  CB    . SER A 1  485  ? 127.049 99.551  137.122 1.00 44.87  ? 485  SER A CB    1 
ATOM   3222  O  OG    . SER A 1  485  ? 127.561 99.348  138.427 1.00 45.62  ? 485  SER A OG    1 
ATOM   3223  N  N     . PRO A 1  486  ? 129.948 101.104 137.365 1.00 43.64  ? 486  PRO A N     1 
ATOM   3224  C  CA    . PRO A 1  486  ? 131.404 100.947 137.329 1.00 43.73  ? 486  PRO A CA    1 
ATOM   3225  C  C     . PRO A 1  486  ? 131.855 99.642  137.971 1.00 43.47  ? 486  PRO A C     1 
ATOM   3226  O  O     . PRO A 1  486  ? 131.199 99.086  138.853 1.00 43.36  ? 486  PRO A O     1 
ATOM   3227  C  CB    . PRO A 1  486  ? 131.900 102.152 138.133 1.00 43.15  ? 486  PRO A CB    1 
ATOM   3228  C  CG    . PRO A 1  486  ? 130.813 102.375 139.135 1.00 44.43  ? 486  PRO A CG    1 
ATOM   3229  C  CD    . PRO A 1  486  ? 129.515 101.987 138.461 1.00 44.76  ? 486  PRO A CD    1 
ATOM   3230  N  N     . ASP A 1  487  ? 133.009 99.156  137.503 1.00 45.54  ? 487  ASP A N     1 
ATOM   3231  C  CA    . ASP A 1  487  ? 133.637 97.962  138.062 1.00 46.45  ? 487  ASP A CA    1 
ATOM   3232  C  C     . ASP A 1  487  ? 135.135 98.173  138.233 1.00 46.91  ? 487  ASP A C     1 
ATOM   3233  O  O     . ASP A 1  487  ? 135.767 98.786  137.358 1.00 47.22  ? 487  ASP A O     1 
ATOM   3234  C  CB    . ASP A 1  487  ? 133.405 96.722  137.200 1.00 47.37  ? 487  ASP A CB    1 
ATOM   3235  C  CG    . ASP A 1  487  ? 132.077 96.054  137.478 1.00 47.38  ? 487  ASP A CG    1 
ATOM   3236  O  OD1   . ASP A 1  487  ? 131.489 96.309  138.549 1.00 46.88  ? 487  ASP A OD1   1 
ATOM   3237  O  OD2   . ASP A 1  487  ? 131.643 95.244  136.637 1.00 47.20  ? 487  ASP A OD2   1 
ATOM   3238  N  N     . PRO A 1  488  ? 135.719 97.687  139.326 1.00 47.39  ? 488  PRO A N     1 
ATOM   3239  C  CA    . PRO A 1  488  ? 137.182 97.647  139.430 1.00 47.78  ? 488  PRO A CA    1 
ATOM   3240  C  C     . PRO A 1  488  ? 137.741 96.373  138.821 1.00 47.96  ? 488  PRO A C     1 
ATOM   3241  O  O     . PRO A 1  488  ? 136.993 95.583  138.237 1.00 48.07  ? 488  PRO A O     1 
ATOM   3242  C  CB    . PRO A 1  488  ? 137.418 97.706  140.943 1.00 47.79  ? 488  PRO A CB    1 
ATOM   3243  C  CG    . PRO A 1  488  ? 136.232 96.992  141.508 1.00 49.05  ? 488  PRO A CG    1 
ATOM   3244  C  CD    . PRO A 1  488  ? 135.067 97.287  140.586 1.00 48.60  ? 488  PRO A CD    1 
ATOM   3245  N  N     . ASN A 1  489  ? 139.055 96.171  138.943 1.00 51.86  ? 489  ASN A N     1 
ATOM   3246  C  CA    . ASN A 1  489  ? 139.723 94.957  138.470 1.00 54.74  ? 489  ASN A CA    1 
ATOM   3247  C  C     . ASN A 1  489  ? 139.559 94.773  136.962 1.00 56.26  ? 489  ASN A C     1 
ATOM   3248  O  O     . ASN A 1  489  ? 139.520 93.647  136.459 1.00 57.47  ? 489  ASN A O     1 
ATOM   3249  C  CB    . ASN A 1  489  ? 139.225 93.720  139.226 1.00 57.46  ? 489  ASN A CB    1 
ATOM   3250  C  CG    . ASN A 1  489  ? 140.188 92.551  139.138 1.00 57.90  ? 489  ASN A CG    1 
ATOM   3251  O  OD1   . ASN A 1  489  ? 141.296 92.681  138.618 1.00 55.34  ? 489  ASN A OD1   1 
ATOM   3252  N  ND2   . ASN A 1  489  ? 139.770 91.403  139.653 1.00 54.98  ? 489  ASN A ND2   1 
ATOM   3253  N  N     . ILE A 1  490  ? 139.460 95.881  136.232 1.00 56.44  ? 490  ILE A N     1 
ATOM   3254  C  CA    . ILE A 1  490  ? 139.341 95.878  134.780 1.00 56.92  ? 490  ILE A CA    1 
ATOM   3255  C  C     . ILE A 1  490  ? 140.489 96.700  134.214 1.00 56.75  ? 490  ILE A C     1 
ATOM   3256  O  O     . ILE A 1  490  ? 140.713 97.837  134.645 1.00 55.92  ? 490  ILE A O     1 
ATOM   3257  C  CB    . ILE A 1  490  ? 137.982 96.441  134.323 1.00 55.33  ? 490  ILE A CB    1 
ATOM   3258  C  CG1   . ILE A 1  490  ? 136.849 95.490  134.718 1.00 57.02  ? 490  ILE A CG1   1 
ATOM   3259  C  CG2   . ILE A 1  490  ? 137.984 96.700  132.826 1.00 57.85  ? 490  ILE A CG2   1 
ATOM   3260  C  CD1   . ILE A 1  490  ? 136.982 94.102  134.131 1.00 58.52  ? 490  ILE A CD1   1 
ATOM   3261  N  N     . GLU A 1  491  ? 141.215 96.128  133.258 1.00 57.94  ? 491  GLU A N     1 
ATOM   3262  C  CA    . GLU A 1  491  ? 142.397 96.795  132.709 1.00 58.22  ? 491  GLU A CA    1 
ATOM   3263  C  C     . GLU A 1  491  ? 142.040 97.737  131.559 1.00 59.31  ? 491  GLU A C     1 
ATOM   3264  O  O     . GLU A 1  491  ? 142.564 97.651  130.449 1.00 60.22  ? 491  GLU A O     1 
ATOM   3265  C  CB    . GLU A 1  491  ? 143.439 95.758  132.298 1.00 61.21  ? 491  GLU A CB    1 
ATOM   3266  C  CG    . GLU A 1  491  ? 142.988 94.677  131.327 1.00 61.64  ? 491  GLU A CG    1 
ATOM   3267  C  CD    . GLU A 1  491  ? 143.599 94.839  129.949 1.00 61.70  ? 491  GLU A CD    1 
ATOM   3268  O  OE1   . GLU A 1  491  ? 144.509 95.681  129.796 1.00 57.39  ? 491  GLU A OE1   1 
ATOM   3269  O  OE2   . GLU A 1  491  ? 143.189 94.108  129.024 1.00 57.50  ? 491  GLU A OE2   1 
ATOM   3270  N  N     . THR A 1  492  ? 141.118 98.656  131.848 1.00 56.42  ? 492  THR A N     1 
ATOM   3271  C  CA    . THR A 1  492  ? 140.776 99.842  131.064 1.00 55.64  ? 492  THR A CA    1 
ATOM   3272  C  C     . THR A 1  492  ? 140.095 99.519  129.734 1.00 55.87  ? 492  THR A C     1 
ATOM   3273  O  O     . THR A 1  492  ? 139.690 100.446 129.023 1.00 56.40  ? 492  THR A O     1 
ATOM   3274  C  CB    . THR A 1  492  ? 142.011 100.722 130.800 1.00 55.47  ? 492  THR A CB    1 
ATOM   3275  O  OG1   . THR A 1  492  ? 142.848 100.722 131.963 1.00 54.67  ? 492  THR A OG1   1 
ATOM   3276  C  CG2   . THR A 1  492  ? 141.608 102.167 130.518 1.00 53.89  ? 492  THR A CG2   1 
ATOM   3277  N  N     . ASN A 1  493  ? 139.920 98.245  129.380 1.00 54.75  ? 493  ASN A N     1 
ATOM   3278  C  CA    . ASN A 1  493  ? 139.314 97.926  128.095 1.00 55.41  ? 493  ASN A CA    1 
ATOM   3279  C  C     . ASN A 1  493  ? 138.295 96.795  128.132 1.00 55.49  ? 493  ASN A C     1 
ATOM   3280  O  O     . ASN A 1  493  ? 137.793 96.420  127.069 1.00 55.50  ? 493  ASN A O     1 
ATOM   3281  C  CB    . ASN A 1  493  ? 140.404 97.593  127.061 1.00 55.42  ? 493  ASN A CB    1 
ATOM   3282  C  CG    . ASN A 1  493  ? 141.412 96.592  127.579 1.00 55.73  ? 493  ASN A CG    1 
ATOM   3283  O  OD1   . ASN A 1  493  ? 141.108 95.789  128.458 1.00 56.34  ? 493  ASN A OD1   1 
ATOM   3284  N  ND2   . ASN A 1  493  ? 142.625 96.637  127.038 1.00 56.69  ? 493  ASN A ND2   1 
ATOM   3285  N  N     . GLU A 1  494  ? 137.969 96.241  129.295 1.00 57.07  ? 494  GLU A N     1 
ATOM   3286  C  CA    . GLU A 1  494  ? 136.925 95.228  129.371 1.00 57.44  ? 494  GLU A CA    1 
ATOM   3287  C  C     . GLU A 1  494  ? 135.578 95.873  129.669 1.00 58.94  ? 494  GLU A C     1 
ATOM   3288  O  O     . GLU A 1  494  ? 135.484 96.850  130.417 1.00 59.53  ? 494  GLU A O     1 
ATOM   3289  C  CB    . GLU A 1  494  ? 137.243 94.175  130.434 1.00 59.82  ? 494  GLU A CB    1 
ATOM   3290  C  CG    . GLU A 1  494  ? 138.307 93.172  130.027 1.00 59.70  ? 494  GLU A CG    1 
ATOM   3291  C  CD    . GLU A 1  494  ? 139.710 93.697  130.230 1.00 60.41  ? 494  GLU A CD    1 
ATOM   3292  O  OE1   . GLU A 1  494  ? 139.853 94.811  130.776 1.00 55.42  ? 494  GLU A OE1   1 
ATOM   3293  O  OE2   . GLU A 1  494  ? 140.668 92.997  129.842 1.00 55.59  ? 494  GLU A OE2   1 
ATOM   3294  N  N     . ILE A 1  495  ? 134.531 95.312  129.072 1.00 53.12  ? 495  ILE A N     1 
ATOM   3295  C  CA    . ILE A 1  495  ? 133.163 95.785  129.246 1.00 52.08  ? 495  ILE A CA    1 
ATOM   3296  C  C     . ILE A 1  495  ? 132.332 94.609  129.739 1.00 53.23  ? 495  ILE A C     1 
ATOM   3297  O  O     . ILE A 1  495  ? 132.073 93.666  128.982 1.00 53.66  ? 495  ILE A O     1 
ATOM   3298  C  CB    . ILE A 1  495  ? 132.575 96.360  127.951 1.00 54.08  ? 495  ILE A CB    1 
ATOM   3299  C  CG1   . ILE A 1  495  ? 133.378 97.579  127.492 1.00 53.87  ? 495  ILE A CG1   1 
ATOM   3300  C  CG2   . ILE A 1  495  ? 131.110 96.720  128.146 1.00 50.65  ? 495  ILE A CG2   1 
ATOM   3301  C  CD1   . ILE A 1  495  ? 132.907 98.156  126.176 1.00 49.67  ? 495  ILE A CD1   1 
ATOM   3302  N  N     . GLY A 1  496  ? 131.916 94.660  131.001 1.00 50.50  ? 496  GLY A N     1 
ATOM   3303  C  CA    . GLY A 1  496  ? 131.094 93.602  131.552 1.00 50.61  ? 496  GLY A CA    1 
ATOM   3304  C  C     . GLY A 1  496  ? 129.673 93.647  131.034 1.00 50.27  ? 496  GLY A C     1 
ATOM   3305  O  O     . GLY A 1  496  ? 128.938 94.602  131.300 1.00 50.56  ? 496  GLY A O     1 
ATOM   3306  N  N     . VAL A 1  497  ? 129.274 92.621  130.290 1.00 49.65  ? 497  VAL A N     1 
ATOM   3307  C  CA    . VAL A 1  497  ? 127.936 92.568  129.707 1.00 49.46  ? 497  VAL A CA    1 
ATOM   3308  C  C     . VAL A 1  497  ? 127.168 91.402  130.319 1.00 49.53  ? 497  VAL A C     1 
ATOM   3309  O  O     . VAL A 1  497  ? 127.750 90.335  130.568 1.00 49.53  ? 497  VAL A O     1 
ATOM   3310  C  CB    . VAL A 1  497  ? 127.999 92.466  128.174 1.00 49.87  ? 497  VAL A CB    1 
ATOM   3311  C  CG1   . VAL A 1  497  ? 128.608 93.728  127.591 1.00 50.04  ? 497  VAL A CG1   1 
ATOM   3312  C  CG2   . VAL A 1  497  ? 128.800 91.247  127.749 1.00 50.43  ? 497  VAL A CG2   1 
ATOM   3313  N  N     . PRO A 1  498  ? 125.878 91.562  130.594 1.00 50.34  ? 498  PRO A N     1 
ATOM   3314  C  CA    . PRO A 1  498  ? 125.109 90.486  131.225 1.00 51.15  ? 498  PRO A CA    1 
ATOM   3315  C  C     . PRO A 1  498  ? 124.751 89.409  130.217 1.00 50.66  ? 498  PRO A C     1 
ATOM   3316  O  O     . PRO A 1  498  ? 124.716 89.667  129.004 1.00 50.28  ? 498  PRO A O     1 
ATOM   3317  C  CB    . PRO A 1  498  ? 123.851 91.204  131.741 1.00 49.93  ? 498  PRO A CB    1 
ATOM   3318  C  CG    . PRO A 1  498  ? 124.155 92.677  131.634 1.00 52.19  ? 498  PRO A CG    1 
ATOM   3319  C  CD    . PRO A 1  498  ? 125.102 92.805  130.495 1.00 53.15  ? 498  PRO A CD    1 
ATOM   3320  N  N     . PRO A 1  499  ? 124.481 88.185  130.679 1.00 52.31  ? 499  PRO A N     1 
ATOM   3321  C  CA    . PRO A 1  499  ? 124.059 87.127  129.747 1.00 52.49  ? 499  PRO A CA    1 
ATOM   3322  C  C     . PRO A 1  499  ? 122.720 87.400  129.087 1.00 52.18  ? 499  PRO A C     1 
ATOM   3323  O  O     . PRO A 1  499  ? 122.462 86.864  128.003 1.00 51.90  ? 499  PRO A O     1 
ATOM   3324  C  CB    . PRO A 1  499  ? 123.998 85.876  130.636 1.00 51.89  ? 499  PRO A CB    1 
ATOM   3325  C  CG    . PRO A 1  499  ? 124.851 86.201  131.818 1.00 52.60  ? 499  PRO A CG    1 
ATOM   3326  C  CD    . PRO A 1  499  ? 124.683 87.671  132.043 1.00 52.95  ? 499  PRO A CD    1 
ATOM   3327  N  N     . VAL A 1  500  ? 121.856 88.208  129.708 1.00 51.72  ? 500  VAL A N     1 
ATOM   3328  C  CA    . VAL A 1  500  ? 120.570 88.524  129.096 1.00 50.69  ? 500  VAL A CA    1 
ATOM   3329  C  C     . VAL A 1  500  ? 120.763 89.343  127.825 1.00 50.72  ? 500  VAL A C     1 
ATOM   3330  O  O     . VAL A 1  500  ? 119.975 89.227  126.878 1.00 51.09  ? 500  VAL A O     1 
ATOM   3331  C  CB    . VAL A 1  500  ? 119.662 89.248  130.106 1.00 50.49  ? 500  VAL A CB    1 
ATOM   3332  C  CG1   . VAL A 1  500  ? 119.141 88.266  131.144 1.00 49.18  ? 500  VAL A CG1   1 
ATOM   3333  C  CG2   . VAL A 1  500  ? 120.418 90.380  130.781 1.00 49.58  ? 500  VAL A CG2   1 
ATOM   3334  N  N     . PHE A 1  501  ? 121.800 90.180  127.779 1.00 49.17  ? 501  PHE A N     1 
ATOM   3335  C  CA    . PHE A 1  501  ? 122.142 90.873  126.543 1.00 49.45  ? 501  PHE A CA    1 
ATOM   3336  C  C     . PHE A 1  501  ? 123.017 90.016  125.639 1.00 49.57  ? 501  PHE A C     1 
ATOM   3337  O  O     . PHE A 1  501  ? 123.014 90.207  124.418 1.00 50.63  ? 501  PHE A O     1 
ATOM   3338  C  CB    . PHE A 1  501  ? 122.848 92.195  126.853 1.00 51.74  ? 501  PHE A CB    1 
ATOM   3339  C  CG    . PHE A 1  501  ? 121.918 93.297  127.267 1.00 52.56  ? 501  PHE A CG    1 
ATOM   3340  C  CD1   . PHE A 1  501  ? 120.552 93.175  127.083 1.00 52.48  ? 501  PHE A CD1   1 
ATOM   3341  C  CD2   . PHE A 1  501  ? 122.410 94.459  127.834 1.00 52.15  ? 501  PHE A CD2   1 
ATOM   3342  C  CE1   . PHE A 1  501  ? 119.693 94.192  127.458 1.00 51.47  ? 501  PHE A CE1   1 
ATOM   3343  C  CE2   . PHE A 1  501  ? 121.557 95.478  128.214 1.00 49.58  ? 501  PHE A CE2   1 
ATOM   3344  C  CZ    . PHE A 1  501  ? 120.197 95.343  128.026 1.00 50.65  ? 501  PHE A CZ    1 
ATOM   3345  N  N     . ALA A 1  502  ? 123.768 89.076  126.217 1.00 48.66  ? 502  ALA A N     1 
ATOM   3346  C  CA    . ALA A 1  502  ? 124.641 88.226  125.417 1.00 47.91  ? 502  ALA A CA    1 
ATOM   3347  C  C     . ALA A 1  502  ? 123.852 87.213  124.598 1.00 47.53  ? 502  ALA A C     1 
ATOM   3348  O  O     . ALA A 1  502  ? 124.252 86.881  123.477 1.00 48.27  ? 502  ALA A O     1 
ATOM   3349  C  CB    . ALA A 1  502  ? 125.645 87.510  126.321 1.00 48.24  ? 502  ALA A CB    1 
ATOM   3350  N  N     . VAL A 1  503  ? 122.736 86.714  125.135 1.00 49.43  ? 503  VAL A N     1 
ATOM   3351  C  CA    . VAL A 1  503  ? 121.974 85.687  124.431 1.00 50.78  ? 503  VAL A CA    1 
ATOM   3352  C  C     . VAL A 1  503  ? 121.273 86.269  123.208 1.00 52.28  ? 503  VAL A C     1 
ATOM   3353  O  O     . VAL A 1  503  ? 121.098 85.576  122.198 1.00 52.52  ? 503  VAL A O     1 
ATOM   3354  C  CB    . VAL A 1  503  ? 120.978 85.012  125.395 1.00 52.91  ? 503  VAL A CB    1 
ATOM   3355  C  CG1   . VAL A 1  503  ? 120.004 86.032  125.973 1.00 50.75  ? 503  VAL A CG1   1 
ATOM   3356  C  CG2   . VAL A 1  503  ? 120.232 83.881  124.700 1.00 50.51  ? 503  VAL A CG2   1 
ATOM   3357  N  N     . LYS A 1  504  ? 120.879 87.542  123.262 1.00 51.94  ? 504  LYS A N     1 
ATOM   3358  C  CA    . LYS A 1  504  ? 120.177 88.151  122.137 1.00 53.36  ? 504  LYS A CA    1 
ATOM   3359  C  C     . LYS A 1  504  ? 121.145 88.549  121.029 1.00 54.66  ? 504  LYS A C     1 
ATOM   3360  O  O     . LYS A 1  504  ? 121.000 88.118  119.879 1.00 55.51  ? 504  LYS A O     1 
ATOM   3361  C  CB    . LYS A 1  504  ? 119.370 89.361  122.615 1.00 55.98  ? 504  LYS A CB    1 
ATOM   3362  C  CG    . LYS A 1  504  ? 118.241 89.010  123.571 1.00 56.55  ? 504  LYS A CG    1 
ATOM   3363  C  CD    . LYS A 1  504  ? 117.272 88.025  122.936 1.00 56.52  ? 504  LYS A CD    1 
ATOM   3364  C  CE    . LYS A 1  504  ? 116.157 87.646  123.898 1.00 53.29  ? 504  LYS A CE    1 
ATOM   3365  N  NZ    . LYS A 1  504  ? 115.212 86.668  123.291 1.00 53.80  ? 504  LYS A NZ    1 
ATOM   3366  N  N     . LEU A 1  505  ? 122.138 89.372  121.357 1.00 52.63  ? 505  LEU A N     1 
ATOM   3367  C  CA    . LEU A 1  505  ? 123.121 89.790  120.366 1.00 51.89  ? 505  LEU A CA    1 
ATOM   3368  C  C     . LEU A 1  505  ? 123.927 88.593  119.878 1.00 52.19  ? 505  LEU A C     1 
ATOM   3369  O  O     . LEU A 1  505  ? 124.322 87.726  120.661 1.00 52.29  ? 505  LEU A O     1 
ATOM   3370  C  CB    . LEU A 1  505  ? 124.051 90.850  120.957 1.00 52.64  ? 505  LEU A CB    1 
ATOM   3371  C  CG    . LEU A 1  505  ? 123.386 92.156  121.396 1.00 52.05  ? 505  LEU A CG    1 
ATOM   3372  C  CD1   . LEU A 1  505  ? 124.414 93.119  121.967 1.00 50.83  ? 505  LEU A CD1   1 
ATOM   3373  C  CD2   . LEU A 1  505  ? 122.636 92.793  120.236 1.00 49.94  ? 505  LEU A CD2   1 
ATOM   3374  N  N     . THR A 1  506  ? 124.170 88.548  118.569 1.00 50.95  ? 506  THR A N     1 
ATOM   3375  C  CA    . THR A 1  506  ? 124.855 87.425  117.946 1.00 51.43  ? 506  THR A CA    1 
ATOM   3376  C  C     . THR A 1  506  ? 125.862 87.950  116.929 1.00 51.59  ? 506  THR A C     1 
ATOM   3377  O  O     . THR A 1  506  ? 126.023 89.161  116.749 1.00 52.13  ? 506  THR A O     1 
ATOM   3378  C  CB    . THR A 1  506  ? 123.859 86.464  117.288 1.00 51.42  ? 506  THR A CB    1 
ATOM   3379  O  OG1   . THR A 1  506  ? 124.566 85.340  116.751 1.00 52.60  ? 506  THR A OG1   1 
ATOM   3380  C  CG2   . THR A 1  506  ? 123.102 87.164  116.168 1.00 52.09  ? 506  THR A CG2   1 
ATOM   3381  N  N     . TYR A 1  507  ? 126.546 87.019  116.256 1.00 54.57  ? 507  TYR A N     1 
ATOM   3382  C  CA    . TYR A 1  507  ? 127.591 87.364  115.301 1.00 55.96  ? 507  TYR A CA    1 
ATOM   3383  C  C     . TYR A 1  507  ? 127.787 86.206  114.339 1.00 57.73  ? 507  TYR A C     1 
ATOM   3384  O  O     . TYR A 1  507  ? 127.867 85.055  114.788 1.00 59.72  ? 507  TYR A O     1 
ATOM   3385  C  CB    . TYR A 1  507  ? 128.906 87.686  116.018 1.00 61.25  ? 507  TYR A CB    1 
ATOM   3386  C  CG    . TYR A 1  507  ? 130.024 88.114  115.096 1.00 62.18  ? 507  TYR A CG    1 
ATOM   3387  C  CD1   . TYR A 1  507  ? 130.039 89.383  114.532 1.00 62.15  ? 507  TYR A CD1   1 
ATOM   3388  C  CD2   . TYR A 1  507  ? 131.072 87.253  114.797 1.00 62.11  ? 507  TYR A CD2   1 
ATOM   3389  C  CE1   . TYR A 1  507  ? 131.060 89.779  113.691 1.00 61.52  ? 507  TYR A CE1   1 
ATOM   3390  C  CE2   . TYR A 1  507  ? 132.098 87.640  113.957 1.00 60.45  ? 507  TYR A CE2   1 
ATOM   3391  C  CZ    . TYR A 1  507  ? 132.087 88.903  113.407 1.00 54.92  ? 507  TYR A CZ    1 
ATOM   3392  O  OH    . TYR A 1  507  ? 133.107 89.292  112.570 1.00 54.64  ? 507  TYR A OH    1 
ATOM   3393  N  N     . PRO A 1  508  ? 127.870 86.458  113.036 1.00 53.75  ? 508  PRO A N     1 
ATOM   3394  C  CA    . PRO A 1  508  ? 128.046 85.363  112.078 1.00 52.47  ? 508  PRO A CA    1 
ATOM   3395  C  C     . PRO A 1  508  ? 129.490 84.898  111.992 1.00 53.51  ? 508  PRO A C     1 
ATOM   3396  O  O     . PRO A 1  508  ? 130.435 85.671  112.162 1.00 54.18  ? 508  PRO A O     1 
ATOM   3397  C  CB    . PRO A 1  508  ? 127.591 85.985  110.753 1.00 54.20  ? 508  PRO A CB    1 
ATOM   3398  C  CG    . PRO A 1  508  ? 127.917 87.431  110.907 1.00 50.80  ? 508  PRO A CG    1 
ATOM   3399  C  CD    . PRO A 1  508  ? 127.701 87.760  112.365 1.00 50.50  ? 508  PRO A CD    1 
ATOM   3400  N  N     . GLU A 1  509  ? 129.649 83.604  111.712 1.00 50.29  ? 509  GLU A N     1 
ATOM   3401  C  CA    . GLU A 1  509  ? 130.971 83.004  111.585 1.00 50.58  ? 509  GLU A CA    1 
ATOM   3402  C  C     . GLU A 1  509  ? 130.902 81.800  110.652 1.00 50.86  ? 509  GLU A C     1 
ATOM   3403  O  O     . GLU A 1  509  ? 130.151 80.852  110.915 1.00 50.90  ? 509  GLU A O     1 
ATOM   3404  C  CB    . GLU A 1  509  ? 131.510 82.605  112.961 1.00 51.02  ? 509  GLU A CB    1 
ATOM   3405  C  CG    . GLU A 1  509  ? 133.018 82.404  113.018 1.00 51.19  ? 509  GLU A CG    1 
ATOM   3406  C  CD    . GLU A 1  509  ? 133.442 81.017  112.586 1.00 51.42  ? 509  GLU A CD    1 
ATOM   3407  O  OE1   . GLU A 1  509  ? 132.655 80.067  112.777 1.00 51.03  ? 509  GLU A OE1   1 
ATOM   3408  O  OE2   . GLU A 1  509  ? 134.565 80.875  112.054 1.00 51.62  ? 509  GLU A OE2   1 
ATOM   3409  N  N     . PRO A 1  510  ? 131.661 81.799  109.556 1.00 51.63  ? 510  PRO A N     1 
ATOM   3410  C  CA    . PRO A 1  510  ? 131.574 80.691  108.599 1.00 52.09  ? 510  PRO A CA    1 
ATOM   3411  C  C     . PRO A 1  510  ? 132.152 79.403  109.164 1.00 52.50  ? 510  PRO A C     1 
ATOM   3412  O  O     . PRO A 1  510  ? 133.011 79.414  110.050 1.00 52.35  ? 510  PRO A O     1 
ATOM   3413  C  CB    . PRO A 1  510  ? 132.396 81.190  107.406 1.00 51.91  ? 510  PRO A CB    1 
ATOM   3414  C  CG    . PRO A 1  510  ? 133.365 82.155  108.004 1.00 52.32  ? 510  PRO A CG    1 
ATOM   3415  C  CD    . PRO A 1  510  ? 132.633 82.822  109.136 1.00 51.75  ? 510  PRO A CD    1 
ATOM   3416  N  N     . VAL A 1  511  ? 131.674 78.282  108.631 1.00 53.72  ? 511  VAL A N     1 
ATOM   3417  C  CA    . VAL A 1  511  ? 132.077 76.964  109.109 1.00 55.24  ? 511  VAL A CA    1 
ATOM   3418  C  C     . VAL A 1  511  ? 133.244 76.455  108.275 1.00 55.88  ? 511  VAL A C     1 
ATOM   3419  O  O     . VAL A 1  511  ? 133.275 76.613  107.047 1.00 55.84  ? 511  VAL A O     1 
ATOM   3420  C  CB    . VAL A 1  511  ? 130.889 75.979  109.080 1.00 56.02  ? 511  VAL A CB    1 
ATOM   3421  C  CG1   . VAL A 1  511  ? 129.728 76.527  109.894 1.00 56.04  ? 511  VAL A CG1   1 
ATOM   3422  C  CG2   . VAL A 1  511  ? 130.449 75.686  107.652 1.00 56.60  ? 511  VAL A CG2   1 
ATOM   3423  N  N     . THR A 1  512  ? 134.230 75.876  108.954 1.00 56.78  ? 512  THR A N     1 
ATOM   3424  C  CA    . THR A 1  512  ? 135.382 75.251  108.315 1.00 57.72  ? 512  THR A CA    1 
ATOM   3425  C  C     . THR A 1  512  ? 135.991 74.288  109.330 1.00 57.88  ? 512  THR A C     1 
ATOM   3426  O  O     . THR A 1  512  ? 135.446 74.078  110.417 1.00 57.61  ? 512  THR A O     1 
ATOM   3427  C  CB    . THR A 1  512  ? 136.410 76.292  107.842 1.00 58.35  ? 512  THR A CB    1 
ATOM   3428  O  OG1   . THR A 1  512  ? 135.746 77.496  107.443 1.00 59.12  ? 512  THR A OG1   1 
ATOM   3429  C  CG2   . THR A 1  512  ? 137.201 75.767  106.645 1.00 59.53  ? 512  THR A CG2   1 
ATOM   3430  N  N     . ALA A 1  513  ? 137.131 73.701  108.968 1.00 60.57  ? 513  ALA A N     1 
ATOM   3431  C  CA    . ALA A 1  513  ? 137.916 72.906  109.911 1.00 61.43  ? 513  ALA A CA    1 
ATOM   3432  C  C     . ALA A 1  513  ? 138.691 73.769  110.897 1.00 61.73  ? 513  ALA A C     1 
ATOM   3433  O  O     . ALA A 1  513  ? 139.498 73.250  111.682 1.00 61.48  ? 513  ALA A O     1 
ATOM   3434  C  CB    . ALA A 1  513  ? 138.875 71.987  109.153 1.00 61.17  ? 513  ALA A CB    1 
ATOM   3435  N  N     . TYR A 1  514  ? 138.442 75.079  110.856 1.00 61.66  ? 514  TYR A N     1 
ATOM   3436  C  CA    . TYR A 1  514  ? 139.170 76.028  111.688 1.00 62.00  ? 514  TYR A CA    1 
ATOM   3437  C  C     . TYR A 1  514  ? 138.604 76.115  113.099 1.00 62.93  ? 514  TYR A C     1 
ATOM   3438  O  O     . TYR A 1  514  ? 139.353 76.376  114.047 1.00 64.30  ? 514  TYR A O     1 
ATOM   3439  C  CB    . TYR A 1  514  ? 139.152 77.405  111.020 1.00 65.38  ? 514  TYR A CB    1 
ATOM   3440  C  CG    . TYR A 1  514  ? 139.891 78.483  111.775 1.00 66.39  ? 514  TYR A CG    1 
ATOM   3441  C  CD1   . TYR A 1  514  ? 141.278 78.491  111.832 1.00 66.60  ? 514  TYR A CD1   1 
ATOM   3442  C  CD2   . TYR A 1  514  ? 139.204 79.506  112.413 1.00 67.38  ? 514  TYR A CD2   1 
ATOM   3443  C  CE1   . TYR A 1  514  ? 141.958 79.478  112.514 1.00 65.66  ? 514  TYR A CE1   1 
ATOM   3444  C  CE2   . TYR A 1  514  ? 139.874 80.499  113.098 1.00 64.83  ? 514  TYR A CE2   1 
ATOM   3445  C  CZ    . TYR A 1  514  ? 141.251 80.480  113.145 1.00 61.94  ? 514  TYR A CZ    1 
ATOM   3446  O  OH    . TYR A 1  514  ? 141.926 81.468  113.825 1.00 62.00  ? 514  TYR A OH    1 
ATOM   3447  N  N     . ASN A 1  515  ? 137.300 75.902  113.264 1.00 61.53  ? 515  ASN A N     1 
ATOM   3448  C  CA    . ASN A 1  515  ? 136.637 75.972  114.562 1.00 60.99  ? 515  ASN A CA    1 
ATOM   3449  C  C     . ASN A 1  515  ? 135.744 74.755  114.770 1.00 61.32  ? 515  ASN A C     1 
ATOM   3450  O  O     . ASN A 1  515  ? 134.601 74.861  115.215 1.00 62.14  ? 515  ASN A O     1 
ATOM   3451  C  CB    . ASN A 1  515  ? 135.827 77.258  114.695 1.00 62.02  ? 515  ASN A CB    1 
ATOM   3452  C  CG    . ASN A 1  515  ? 136.686 78.504  114.596 1.00 62.84  ? 515  ASN A CG    1 
ATOM   3453  O  OD1   . ASN A 1  515  ? 136.386 79.420  113.831 1.00 59.83  ? 515  ASN A OD1   1 
ATOM   3454  N  ND2   . ASN A 1  515  ? 137.761 78.543  115.372 1.00 59.10  ? 515  ASN A ND2   1 
ATOM   3455  N  N     . ILE A 1  516  ? 136.262 73.568  114.454 1.00 59.58  ? 516  ILE A N     1 
ATOM   3456  C  CA    . ILE A 1  516  ? 135.453 72.357  114.569 1.00 59.18  ? 516  ILE A CA    1 
ATOM   3457  C  C     . ILE A 1  516  ? 135.224 71.979  116.028 1.00 59.39  ? 516  ILE A C     1 
ATOM   3458  O  O     . ILE A 1  516  ? 134.294 71.229  116.345 1.00 59.57  ? 516  ILE A O     1 
ATOM   3459  C  CB    . ILE A 1  516  ? 136.096 71.205  113.774 1.00 59.65  ? 516  ILE A CB    1 
ATOM   3460  C  CG1   . ILE A 1  516  ? 137.611 71.150  114.008 1.00 59.34  ? 516  ILE A CG1   1 
ATOM   3461  C  CG2   . ILE A 1  516  ? 135.765 71.327  112.295 1.00 58.88  ? 516  ILE A CG2   1 
ATOM   3462  C  CD1   . ILE A 1  516  ? 138.032 70.360  115.234 1.00 58.54  ? 516  ILE A CD1   1 
ATOM   3463  N  N     . ALA A 1  517  ? 136.061 72.482  116.938 1.00 59.26  ? 517  ALA A N     1 
ATOM   3464  C  CA    . ALA A 1  517  ? 135.926 72.109  118.342 1.00 59.90  ? 517  ALA A CA    1 
ATOM   3465  C  C     . ALA A 1  517  ? 135.110 73.136  119.116 1.00 60.53  ? 517  ALA A C     1 
ATOM   3466  O  O     . ALA A 1  517  ? 134.316 72.774  119.993 1.00 59.78  ? 517  ALA A O     1 
ATOM   3467  C  CB    . ALA A 1  517  ? 137.306 71.932  118.974 1.00 60.13  ? 517  ALA A CB    1 
ATOM   3468  N  N     . GLU A 1  518  ? 135.294 74.422  118.813 1.00 58.95  ? 518  GLU A N     1 
ATOM   3469  C  CA    . GLU A 1  518  ? 134.578 75.465  119.539 1.00 58.19  ? 518  GLU A CA    1 
ATOM   3470  C  C     . GLU A 1  518  ? 133.172 75.675  118.986 1.00 58.78  ? 518  GLU A C     1 
ATOM   3471  O  O     . GLU A 1  518  ? 132.232 75.912  119.752 1.00 59.65  ? 518  GLU A O     1 
ATOM   3472  C  CB    . GLU A 1  518  ? 135.371 76.772  119.495 1.00 60.41  ? 518  GLU A CB    1 
ATOM   3473  C  CG    . GLU A 1  518  ? 134.722 77.927  120.244 1.00 61.22  ? 518  GLU A CG    1 
ATOM   3474  C  CD    . GLU A 1  518  ? 134.696 77.717  121.746 1.00 60.55  ? 518  GLU A CD    1 
ATOM   3475  O  OE1   . GLU A 1  518  ? 135.508 76.914  122.254 1.00 56.49  ? 518  GLU A OE1   1 
ATOM   3476  O  OE2   . GLU A 1  518  ? 133.860 78.355  122.421 1.00 55.73  ? 518  GLU A OE2   1 
ATOM   3477  N  N     . LEU A 1  519  ? 133.009 75.590  117.664 1.00 55.48  ? 519  LEU A N     1 
ATOM   3478  C  CA    . LEU A 1  519  ? 131.696 75.821  117.072 1.00 55.06  ? 519  LEU A CA    1 
ATOM   3479  C  C     . LEU A 1  519  ? 130.733 74.686  117.399 1.00 55.43  ? 519  LEU A C     1 
ATOM   3480  O  O     . LEU A 1  519  ? 129.534 74.920  117.588 1.00 55.57  ? 519  LEU A O     1 
ATOM   3481  C  CB    . LEU A 1  519  ? 131.823 75.999  115.560 1.00 55.45  ? 519  LEU A CB    1 
ATOM   3482  C  CG    . LEU A 1  519  ? 130.680 76.710  114.837 1.00 55.60  ? 519  LEU A CG    1 
ATOM   3483  C  CD1   . LEU A 1  519  ? 130.507 78.113  115.391 1.00 54.60  ? 519  LEU A CD1   1 
ATOM   3484  C  CD2   . LEU A 1  519  ? 130.950 76.748  113.344 1.00 54.02  ? 519  LEU A CD2   1 
ATOM   3485  N  N     . ARG A 1  520  ? 131.235 73.449  117.467 1.00 55.45  ? 520  ARG A N     1 
ATOM   3486  C  CA    . ARG A 1  520  ? 130.376 72.336  117.851 1.00 56.29  ? 520  ARG A CA    1 
ATOM   3487  C  C     . ARG A 1  520  ? 129.887 72.480  119.286 1.00 57.45  ? 520  ARG A C     1 
ATOM   3488  O  O     . ARG A 1  520  ? 128.826 71.952  119.635 1.00 58.19  ? 520  ARG A O     1 
ATOM   3489  C  CB    . ARG A 1  520  ? 131.106 71.003  117.664 1.00 58.70  ? 520  ARG A CB    1 
ATOM   3490  C  CG    . ARG A 1  520  ? 132.123 70.673  118.745 1.00 59.32  ? 520  ARG A CG    1 
ATOM   3491  C  CD    . ARG A 1  520  ? 132.763 69.316  118.502 1.00 59.98  ? 520  ARG A CD    1 
ATOM   3492  N  NE    . ARG A 1  520  ? 131.774 68.243  118.463 1.00 60.56  ? 520  ARG A NE    1 
ATOM   3493  C  CZ    . ARG A 1  520  ? 132.062 66.968  118.220 1.00 59.77  ? 520  ARG A CZ    1 
ATOM   3494  N  NH1   . ARG A 1  520  ? 133.315 66.602  117.993 1.00 56.51  ? 520  ARG A NH1   1 
ATOM   3495  N  NH2   . ARG A 1  520  ? 131.097 66.060  118.203 1.00 55.88  ? 520  ARG A NH2   1 
ATOM   3496  N  N     . GLN A 1  521  ? 130.642 73.190  120.128 1.00 57.66  ? 521  GLN A N     1 
ATOM   3497  C  CA    . GLN A 1  521  ? 130.189 73.468  121.486 1.00 58.66  ? 521  GLN A CA    1 
ATOM   3498  C  C     . GLN A 1  521  ? 129.121 74.554  121.494 1.00 59.16  ? 521  GLN A C     1 
ATOM   3499  O  O     . GLN A 1  521  ? 128.117 74.442  122.207 1.00 59.30  ? 521  GLN A O     1 
ATOM   3500  C  CB    . GLN A 1  521  ? 131.377 73.874  122.362 1.00 59.80  ? 521  GLN A CB    1 
ATOM   3501  C  CG    . GLN A 1  521  ? 131.019 74.130  123.817 1.00 59.90  ? 521  GLN A CG    1 
ATOM   3502  C  CD    . GLN A 1  521  ? 130.595 72.870  124.544 1.00 60.31  ? 521  GLN A CD    1 
ATOM   3503  O  OE1   . GLN A 1  521  ? 129.420 72.691  124.866 1.00 59.43  ? 521  GLN A OE1   1 
ATOM   3504  N  NE2   . GLN A 1  521  ? 131.552 71.989  124.809 1.00 59.48  ? 521  GLN A NE2   1 
ATOM   3505  N  N     . ALA A 1  522  ? 129.321 75.612  120.704 1.00 61.00  ? 522  ALA A N     1 
ATOM   3506  C  CA    . ALA A 1  522  ? 128.336 76.686  120.636 1.00 62.43  ? 522  ALA A CA    1 
ATOM   3507  C  C     . ALA A 1  522  ? 127.012 76.201  120.059 1.00 63.20  ? 522  ALA A C     1 
ATOM   3508  O  O     . ALA A 1  522  ? 125.952 76.728  120.411 1.00 62.49  ? 522  ALA A O     1 
ATOM   3509  C  CB    . ALA A 1  522  ? 128.882 77.848  119.807 1.00 61.23  ? 522  ALA A CB    1 
ATOM   3510  N  N     . VAL A 1  523  ? 127.050 75.202  119.176 1.00 62.77  ? 523  VAL A N     1 
ATOM   3511  C  CA    . VAL A 1  523  ? 125.818 74.674  118.602 1.00 62.59  ? 523  VAL A CA    1 
ATOM   3512  C  C     . VAL A 1  523  ? 125.176 73.660  119.541 1.00 64.18  ? 523  VAL A C     1 
ATOM   3513  O  O     . VAL A 1  523  ? 123.948 73.619  119.682 1.00 64.35  ? 523  VAL A O     1 
ATOM   3514  C  CB    . VAL A 1  523  ? 126.096 74.071  117.213 1.00 65.17  ? 523  VAL A CB    1 
ATOM   3515  C  CG1   . VAL A 1  523  ? 124.845 73.414  116.652 1.00 60.38  ? 523  VAL A CG1   1 
ATOM   3516  C  CG2   . VAL A 1  523  ? 126.603 75.146  116.263 1.00 59.98  ? 523  VAL A CG2   1 
ATOM   3517  N  N     . ILE A 1  524  ? 125.987 72.834  120.209 1.00 57.79  ? 524  ILE A N     1 
ATOM   3518  C  CA    . ILE A 1  524  ? 125.439 71.817  121.100 1.00 56.15  ? 524  ILE A CA    1 
ATOM   3519  C  C     . ILE A 1  524  ? 124.851 72.430  122.365 1.00 57.05  ? 524  ILE A C     1 
ATOM   3520  O  O     . ILE A 1  524  ? 124.052 71.780  123.048 1.00 57.98  ? 524  ILE A O     1 
ATOM   3521  C  CB    . ILE A 1  524  ? 126.513 70.768  121.448 1.00 58.16  ? 524  ILE A CB    1 
ATOM   3522  C  CG1   . ILE A 1  524  ? 125.861 69.436  121.825 1.00 57.18  ? 524  ILE A CG1   1 
ATOM   3523  C  CG2   . ILE A 1  524  ? 127.407 71.259  122.577 1.00 54.39  ? 524  ILE A CG2   1 
ATOM   3524  C  CD1   . ILE A 1  524  ? 126.855 68.341  122.146 1.00 53.06  ? 524  ILE A CD1   1 
ATOM   3525  N  N     . ASN A 1  525  ? 125.219 73.669  122.697 1.00 54.40  ? 525  ASN A N     1 
ATOM   3526  C  CA    . ASN A 1  525  ? 124.630 74.331  123.858 1.00 54.91  ? 525  ASN A CA    1 
ATOM   3527  C  C     . ASN A 1  525  ? 123.279 74.946  123.509 1.00 55.52  ? 525  ASN A C     1 
ATOM   3528  O  O     . ASN A 1  525  ? 122.269 74.664  124.161 1.00 55.40  ? 525  ASN A O     1 
ATOM   3529  C  CB    . ASN A 1  525  ? 125.585 75.397  124.402 1.00 55.76  ? 525  ASN A CB    1 
ATOM   3530  C  CG    . ASN A 1  525  ? 126.773 74.801  125.134 1.00 55.11  ? 525  ASN A CG    1 
ATOM   3531  O  OD1   . ASN A 1  525  ? 127.920 75.167  124.882 1.00 54.84  ? 525  ASN A OD1   1 
ATOM   3532  N  ND2   . ASN A 1  525  ? 126.500 73.876  126.047 1.00 55.62  ? 525  ASN A ND2   1 
ATOM   3533  N  N     . GLY A 1  526  ? 123.246 75.791  122.483 1.00 53.80  ? 526  GLY A N     1 
ATOM   3534  C  CA    . GLY A 1  526  ? 122.017 76.405  122.042 1.00 52.49  ? 526  GLY A CA    1 
ATOM   3535  C  C     . GLY A 1  526  ? 121.768 77.744  122.705 1.00 51.71  ? 526  GLY A C     1 
ATOM   3536  O  O     . GLY A 1  526  ? 122.566 78.222  123.517 1.00 50.98  ? 526  GLY A O     1 
ATOM   3537  N  N     . PRO A 1  527  ? 120.639 78.377  122.371 1.00 52.18  ? 527  PRO A N     1 
ATOM   3538  C  CA    . PRO A 1  527  ? 120.313 79.680  122.969 1.00 52.76  ? 527  PRO A CA    1 
ATOM   3539  C  C     . PRO A 1  527  ? 119.889 79.606  124.427 1.00 52.49  ? 527  PRO A C     1 
ATOM   3540  O  O     . PRO A 1  527  ? 119.635 80.656  125.031 1.00 52.66  ? 527  PRO A O     1 
ATOM   3541  C  CB    . PRO A 1  527  ? 119.164 80.185  122.086 1.00 52.52  ? 527  PRO A CB    1 
ATOM   3542  C  CG    . PRO A 1  527  ? 118.512 78.942  121.590 1.00 53.63  ? 527  PRO A CG    1 
ATOM   3543  C  CD    . PRO A 1  527  ? 119.621 77.942  121.399 1.00 53.40  ? 527  PRO A CD    1 
ATOM   3544  N  N     . ASP A 1  528  ? 119.800 78.412  125.013 1.00 55.55  ? 528  ASP A N     1 
ATOM   3545  C  CA    . ASP A 1  528  ? 119.378 78.295  126.404 1.00 57.53  ? 528  ASP A CA    1 
ATOM   3546  C  C     . ASP A 1  528  ? 120.489 78.704  127.365 1.00 59.39  ? 528  ASP A C     1 
ATOM   3547  O  O     . ASP A 1  528  ? 120.231 79.397  128.356 1.00 60.57  ? 528  ASP A O     1 
ATOM   3548  C  CB    . ASP A 1  528  ? 118.920 76.866  126.696 1.00 61.42  ? 528  ASP A CB    1 
ATOM   3549  C  CG    . ASP A 1  528  ? 118.376 76.704  128.102 1.00 60.84  ? 528  ASP A CG    1 
ATOM   3550  O  OD1   . ASP A 1  528  ? 117.831 77.686  128.648 1.00 57.14  ? 528  ASP A OD1   1 
ATOM   3551  O  OD2   . ASP A 1  528  ? 118.496 75.594  128.662 1.00 56.34  ? 528  ASP A OD2   1 
ATOM   3552  N  N     . LYS A 1  529  ? 121.724 78.289  127.093 1.00 57.72  ? 529  LYS A N     1 
ATOM   3553  C  CA    . LYS A 1  529  ? 122.853 78.576  127.965 1.00 58.42  ? 529  LYS A CA    1 
ATOM   3554  C  C     . LYS A 1  529  ? 124.046 79.038  127.140 1.00 59.68  ? 529  LYS A C     1 
ATOM   3555  O  O     . LYS A 1  529  ? 124.246 78.598  126.004 1.00 60.66  ? 529  LYS A O     1 
ATOM   3556  C  CB    . LYS A 1  529  ? 123.240 77.348  128.804 1.00 61.80  ? 529  LYS A CB    1 
ATOM   3557  C  CG    . LYS A 1  529  ? 123.561 76.108  127.985 1.00 62.55  ? 529  LYS A CG    1 
ATOM   3558  C  CD    . LYS A 1  529  ? 123.878 74.922  128.881 1.00 62.74  ? 529  LYS A CD    1 
ATOM   3559  C  CE    . LYS A 1  529  ? 125.081 75.203  129.767 1.00 57.60  ? 529  LYS A CE    1 
ATOM   3560  N  NZ    . LYS A 1  529  ? 126.306 75.481  128.967 1.00 57.91  ? 529  LYS A NZ    1 
ATOM   3561  N  N     . TRP A 1  530  ? 124.846 79.949  127.736 1.00 55.95  ? 530  TRP A N     1 
ATOM   3562  C  CA    . TRP A 1  530  ? 126.060 80.551  127.196 1.00 53.95  ? 530  TRP A CA    1 
ATOM   3563  C  C     . TRP A 1  530  ? 127.271 79.676  127.510 1.00 53.65  ? 530  TRP A C     1 
ATOM   3564  O  O     . TRP A 1  530  ? 127.377 79.140  128.618 1.00 53.16  ? 530  TRP A O     1 
ATOM   3565  C  CB    . TRP A 1  530  ? 126.271 81.946  127.778 1.00 53.04  ? 530  TRP A CB    1 
ATOM   3566  C  CG    . TRP A 1  530  ? 127.556 82.595  127.360 1.00 53.12  ? 530  TRP A CG    1 
ATOM   3567  C  CD1   . TRP A 1  530  ? 127.760 83.372  126.257 1.00 53.65  ? 530  TRP A CD1   1 
ATOM   3568  C  CD2   . TRP A 1  530  ? 128.816 82.523  128.038 1.00 53.55  ? 530  TRP A CD2   1 
ATOM   3569  N  NE1   . TRP A 1  530  ? 129.069 83.787  126.207 1.00 54.44  ? 530  TRP A NE1   1 
ATOM   3570  C  CE2   . TRP A 1  530  ? 129.738 83.280  127.288 1.00 55.24  ? 530  TRP A CE2   1 
ATOM   3571  C  CE3   . TRP A 1  530  ? 129.254 81.891  129.207 1.00 55.56  ? 530  TRP A CE3   1 
ATOM   3572  C  CZ2   . TRP A 1  530  ? 131.071 83.422  127.669 1.00 54.85  ? 530  TRP A CZ2   1 
ATOM   3573  C  CZ3   . TRP A 1  530  ? 130.577 82.034  129.582 1.00 52.13  ? 530  TRP A CZ3   1 
ATOM   3574  C  CH2   . TRP A 1  530  ? 131.469 82.793  128.815 1.00 51.78  ? 530  TRP A CH2   1 
ATOM   3575  N  N     . PRO A 1  531  ? 128.207 79.507  126.561 1.00 50.67  ? 531  PRO A N     1 
ATOM   3576  C  CA    . PRO A 1  531  ? 128.153 80.054  125.201 1.00 50.39  ? 531  PRO A CA    1 
ATOM   3577  C  C     . PRO A 1  531  ? 127.338 79.191  124.241 1.00 50.56  ? 531  PRO A C     1 
ATOM   3578  O  O     . PRO A 1  531  ? 127.554 77.982  124.158 1.00 50.40  ? 531  PRO A O     1 
ATOM   3579  C  CB    . PRO A 1  531  ? 129.625 80.088  124.786 1.00 50.34  ? 531  PRO A CB    1 
ATOM   3580  C  CG    . PRO A 1  531  ? 130.236 78.951  125.526 1.00 49.87  ? 531  PRO A CG    1 
ATOM   3581  C  CD    . PRO A 1  531  ? 129.495 78.843  126.836 1.00 50.43  ? 531  PRO A CD    1 
ATOM   3582  N  N     . GLY A 1  532  ? 126.407 79.814  123.523 1.00 48.84  ? 532  GLY A N     1 
ATOM   3583  C  CA    . GLY A 1  532  ? 125.562 79.090  122.595 1.00 48.13  ? 532  GLY A CA    1 
ATOM   3584  C  C     . GLY A 1  532  ? 125.442 79.744  121.235 1.00 47.85  ? 532  GLY A C     1 
ATOM   3585  O  O     . GLY A 1  532  ? 126.171 80.691  120.923 1.00 47.59  ? 532  GLY A O     1 
ATOM   3586  N  N     . ALA A 1  533  ? 124.521 79.243  120.415 1.00 48.32  ? 533  ALA A N     1 
ATOM   3587  C  CA    . ALA A 1  533  ? 124.263 79.784  119.090 1.00 48.99  ? 533  ALA A CA    1 
ATOM   3588  C  C     . ALA A 1  533  ? 122.762 79.933  118.889 1.00 48.90  ? 533  ALA A C     1 
ATOM   3589  O  O     . ALA A 1  533  ? 121.970 79.131  119.390 1.00 49.36  ? 533  ALA A O     1 
ATOM   3590  C  CB    . ALA A 1  533  ? 124.853 78.891  117.989 1.00 49.76  ? 533  ALA A CB    1 
ATOM   3591  N  N     . THR A 1  534  ? 122.376 80.973  118.149 1.00 49.63  ? 534  THR A N     1 
ATOM   3592  C  CA    . THR A 1  534  ? 120.963 81.285  117.952 1.00 50.28  ? 534  THR A CA    1 
ATOM   3593  C  C     . THR A 1  534  ? 120.413 80.672  116.666 1.00 51.06  ? 534  THR A C     1 
ATOM   3594  O  O     . THR A 1  534  ? 119.453 79.895  116.702 1.00 51.80  ? 534  THR A O     1 
ATOM   3595  C  CB    . THR A 1  534  ? 120.753 82.804  117.943 1.00 51.35  ? 534  THR A CB    1 
ATOM   3596  O  OG1   . THR A 1  534  ? 121.684 83.413  117.038 1.00 50.49  ? 534  THR A OG1   1 
ATOM   3597  C  CG2   . THR A 1  534  ? 120.948 83.381  119.336 1.00 50.66  ? 534  THR A CG2   1 
ATOM   3598  N  N     . GLN A 1  535  ? 121.011 81.010  115.526 1.00 50.88  ? 535  GLN A N     1 
ATOM   3599  C  CA    . GLN A 1  535  ? 120.497 80.597  114.229 1.00 51.11  ? 535  GLN A CA    1 
ATOM   3600  C  C     . GLN A 1  535  ? 121.599 79.941  113.409 1.00 51.05  ? 535  GLN A C     1 
ATOM   3601  O  O     . GLN A 1  535  ? 122.780 80.268  113.548 1.00 50.98  ? 535  GLN A O     1 
ATOM   3602  C  CB    . GLN A 1  535  ? 119.914 81.788  113.455 1.00 50.84  ? 535  GLN A CB    1 
ATOM   3603  C  CG    . GLN A 1  535  ? 118.767 82.488  114.163 1.00 50.80  ? 535  GLN A CG    1 
ATOM   3604  C  CD    . GLN A 1  535  ? 118.325 83.751  113.450 1.00 51.06  ? 535  GLN A CD    1 
ATOM   3605  O  OE1   . GLN A 1  535  ? 118.976 84.206  112.509 1.00 51.49  ? 535  GLN A OE1   1 
ATOM   3606  N  NE2   . GLN A 1  535  ? 117.214 84.325  113.895 1.00 51.86  ? 535  GLN A NE2   1 
ATOM   3607  N  N     . ILE A 1  536  ? 121.191 79.009  112.551 1.00 52.11  ? 536  ILE A N     1 
ATOM   3608  C  CA    . ILE A 1  536  ? 122.087 78.313  111.637 1.00 52.87  ? 536  ILE A CA    1 
ATOM   3609  C  C     . ILE A 1  536  ? 121.575 78.535  110.221 1.00 52.94  ? 536  ILE A C     1 
ATOM   3610  O  O     . ILE A 1  536  ? 120.375 78.386  109.961 1.00 53.55  ? 536  ILE A O     1 
ATOM   3611  C  CB    . ILE A 1  536  ? 122.171 76.809  111.955 1.00 53.83  ? 536  ILE A CB    1 
ATOM   3612  C  CG1   . ILE A 1  536  ? 122.545 76.588  113.422 1.00 52.63  ? 536  ILE A CG1   1 
ATOM   3613  C  CG2   . ILE A 1  536  ? 123.175 76.123  111.041 1.00 53.88  ? 536  ILE A CG2   1 
ATOM   3614  C  CD1   . ILE A 1  536  ? 123.897 77.138  113.796 1.00 53.85  ? 536  ILE A CD1   1 
ATOM   3615  N  N     . GLN A 1  537  ? 122.474 78.897  109.312 1.00 55.03  ? 537  GLN A N     1 
ATOM   3616  C  CA    . GLN A 1  537  ? 122.128 79.092  107.914 1.00 55.74  ? 537  GLN A CA    1 
ATOM   3617  C  C     . GLN A 1  537  ? 122.935 78.138  107.043 1.00 56.15  ? 537  GLN A C     1 
ATOM   3618  O  O     . GLN A 1  537  ? 124.064 77.768  107.378 1.00 56.26  ? 537  GLN A O     1 
ATOM   3619  C  CB    . GLN A 1  537  ? 122.365 80.545  107.481 1.00 56.51  ? 537  GLN A CB    1 
ATOM   3620  C  CG    . GLN A 1  537  ? 123.822 80.925  107.290 1.00 56.79  ? 537  GLN A CG    1 
ATOM   3621  C  CD    . GLN A 1  537  ? 124.232 80.930  105.831 1.00 56.50  ? 537  GLN A CD    1 
ATOM   3622  O  OE1   . GLN A 1  537  ? 123.448 81.297  104.956 1.00 55.49  ? 537  GLN A OE1   1 
ATOM   3623  N  NE2   . GLN A 1  537  ? 125.463 80.514  105.561 1.00 55.09  ? 537  GLN A NE2   1 
ATOM   3624  N  N     . ASN A 1  538  ? 122.339 77.732  105.926 1.00 55.10  ? 538  ASN A N     1 
ATOM   3625  C  CA    . ASN A 1  538  ? 122.947 76.770  105.022 1.00 54.37  ? 538  ASN A CA    1 
ATOM   3626  C  C     . ASN A 1  538  ? 123.578 77.486  103.830 1.00 54.15  ? 538  ASN A C     1 
ATOM   3627  O  O     . ASN A 1  538  ? 123.573 78.716  103.729 1.00 54.03  ? 538  ASN A O     1 
ATOM   3628  C  CB    . ASN A 1  538  ? 121.910 75.741  104.566 1.00 52.96  ? 538  ASN A CB    1 
ATOM   3629  C  CG    . ASN A 1  538  ? 121.365 74.915  105.714 1.00 54.64  ? 538  ASN A CG    1 
ATOM   3630  O  OD1   . ASN A 1  538  ? 122.064 74.656  106.694 1.00 54.32  ? 538  ASN A OD1   1 
ATOM   3631  N  ND2   . ASN A 1  538  ? 120.110 74.496  105.599 1.00 54.22  ? 538  ASN A ND2   1 
ATOM   3632  N  N     . GLU A 1  539  ? 124.135 76.693  102.912 1.00 54.56  ? 539  GLU A N     1 
ATOM   3633  C  CA    . GLU A 1  539  ? 124.804 77.260  101.745 1.00 54.98  ? 539  GLU A CA    1 
ATOM   3634  C  C     . GLU A 1  539  ? 123.822 77.939  100.800 1.00 55.10  ? 539  GLU A C     1 
ATOM   3635  O  O     . GLU A 1  539  ? 124.170 78.939  100.162 1.00 55.60  ? 539  GLU A O     1 
ATOM   3636  C  CB    . GLU A 1  539  ? 125.583 76.173  101.002 1.00 56.08  ? 539  GLU A CB    1 
ATOM   3637  C  CG    . GLU A 1  539  ? 126.752 75.581  101.778 1.00 56.35  ? 539  GLU A CG    1 
ATOM   3638  C  CD    . GLU A 1  539  ? 126.326 74.510  102.766 1.00 56.31  ? 539  GLU A CD    1 
ATOM   3639  O  OE1   . GLU A 1  539  ? 125.112 74.231  102.861 1.00 55.39  ? 539  GLU A OE1   1 
ATOM   3640  O  OE2   . GLU A 1  539  ? 127.208 73.943  103.444 1.00 55.60  ? 539  GLU A OE2   1 
ATOM   3641  N  N     . ASP A 1  540  ? 122.598 77.420  100.695 1.00 55.71  ? 540  ASP A N     1 
ATOM   3642  C  CA    . ASP A 1  540  ? 121.609 77.979  99.778  1.00 55.64  ? 540  ASP A CA    1 
ATOM   3643  C  C     . ASP A 1  540  ? 121.016 79.294  100.266 1.00 55.26  ? 540  ASP A C     1 
ATOM   3644  O  O     . ASP A 1  540  ? 120.201 79.884  99.547  1.00 54.86  ? 540  ASP A O     1 
ATOM   3645  C  CB    . ASP A 1  540  ? 120.487 76.966  99.538  1.00 54.72  ? 540  ASP A CB    1 
ATOM   3646  C  CG    . ASP A 1  540  ? 119.733 76.620  100.806 1.00 54.80  ? 540  ASP A CG    1 
ATOM   3647  O  OD1   . ASP A 1  540  ? 120.328 76.716  101.900 1.00 56.28  ? 540  ASP A OD1   1 
ATOM   3648  O  OD2   . ASP A 1  540  ? 118.543 76.252  100.710 1.00 55.78  ? 540  ASP A OD2   1 
ATOM   3649  N  N     . GLY A 1  541  ? 121.394 79.766  101.451 1.00 57.98  ? 541  GLY A N     1 
ATOM   3650  C  CA    . GLY A 1  541  ? 120.866 81.011  101.966 1.00 59.37  ? 541  GLY A CA    1 
ATOM   3651  C  C     . GLY A 1  541  ? 119.557 80.894  102.708 1.00 60.55  ? 541  GLY A C     1 
ATOM   3652  O  O     . GLY A 1  541  ? 118.772 81.849  102.712 1.00 60.79  ? 541  GLY A O     1 
ATOM   3653  N  N     . SER A 1  542  ? 119.292 79.755  103.337 1.00 61.12  ? 542  SER A N     1 
ATOM   3654  C  CA    . SER A 1  542  ? 118.071 79.541  104.096 1.00 61.22  ? 542  SER A CA    1 
ATOM   3655  C  C     . SER A 1  542  ? 118.321 79.770  105.582 1.00 61.04  ? 542  SER A C     1 
ATOM   3656  O  O     . SER A 1  542  ? 119.448 79.668  106.072 1.00 60.76  ? 542  SER A O     1 
ATOM   3657  C  CB    . SER A 1  542  ? 117.530 78.128  103.866 1.00 61.38  ? 542  SER A CB    1 
ATOM   3658  O  OG    . SER A 1  542  ? 118.472 77.148  104.268 1.00 60.19  ? 542  SER A OG    1 
ATOM   3659  N  N     . LEU A 1  543  ? 117.245 80.085  106.298 1.00 62.96  ? 543  LEU A N     1 
ATOM   3660  C  CA    . LEU A 1  543  ? 117.306 80.359  107.726 1.00 64.02  ? 543  LEU A CA    1 
ATOM   3661  C  C     . LEU A 1  543  ? 116.764 79.167  108.504 1.00 64.74  ? 543  LEU A C     1 
ATOM   3662  O  O     . LEU A 1  543  ? 115.684 78.654  108.191 1.00 64.54  ? 543  LEU A O     1 
ATOM   3663  C  CB    . LEU A 1  543  ? 116.512 81.620  108.072 1.00 64.71  ? 543  LEU A CB    1 
ATOM   3664  C  CG    . LEU A 1  543  ? 116.515 82.041  109.542 1.00 63.99  ? 543  LEU A CG    1 
ATOM   3665  C  CD1   . LEU A 1  543  ? 117.932 82.319  110.017 1.00 64.04  ? 543  LEU A CD1   1 
ATOM   3666  C  CD2   . LEU A 1  543  ? 115.624 83.256  109.756 1.00 63.50  ? 543  LEU A CD2   1 
ATOM   3667  N  N     . VAL A 1  544  ? 117.515 78.730  109.513 1.00 62.23  ? 544  VAL A N     1 
ATOM   3668  C  CA    . VAL A 1  544  ? 117.109 77.642  110.395 1.00 61.36  ? 544  VAL A CA    1 
ATOM   3669  C  C     . VAL A 1  544  ? 117.224 78.138  111.828 1.00 60.64  ? 544  VAL A C     1 
ATOM   3670  O  O     . VAL A 1  544  ? 118.313 78.523  112.270 1.00 60.33  ? 544  VAL A O     1 
ATOM   3671  C  CB    . VAL A 1  544  ? 117.959 76.377  110.189 1.00 60.63  ? 544  VAL A CB    1 
ATOM   3672  C  CG1   . VAL A 1  544  ? 117.544 75.293  111.173 1.00 61.66  ? 544  VAL A CG1   1 
ATOM   3673  C  CG2   . VAL A 1  544  ? 117.841 75.879  108.756 1.00 61.67  ? 544  VAL A CG2   1 
ATOM   3674  N  N     . SER A 1  545  ? 116.108 78.130  112.549 1.00 61.65  ? 545  SER A N     1 
ATOM   3675  C  CA    . SER A 1  545  ? 116.077 78.595  113.926 1.00 61.19  ? 545  SER A CA    1 
ATOM   3676  C  C     . SER A 1  545  ? 116.363 77.446  114.887 1.00 61.36  ? 545  SER A C     1 
ATOM   3677  O  O     . SER A 1  545  ? 116.269 76.267  114.535 1.00 61.11  ? 545  SER A O     1 
ATOM   3678  C  CB    . SER A 1  545  ? 114.722 79.226  114.250 1.00 59.26  ? 545  SER A CB    1 
ATOM   3679  O  OG    . SER A 1  545  ? 114.682 79.690  115.589 1.00 58.23  ? 545  SER A OG    1 
ATOM   3680  N  N     . LEU A 1  546  ? 116.719 77.808  116.121 1.00 57.58  ? 546  LEU A N     1 
ATOM   3681  C  CA    . LEU A 1  546  ? 117.019 76.830  117.156 1.00 56.36  ? 546  LEU A CA    1 
ATOM   3682  C  C     . LEU A 1  546  ? 116.275 77.078  118.459 1.00 56.83  ? 546  LEU A C     1 
ATOM   3683  O  O     . LEU A 1  546  ? 116.419 76.282  119.393 1.00 57.59  ? 546  LEU A O     1 
ATOM   3684  C  CB    . LEU A 1  546  ? 118.529 76.794  117.439 1.00 58.08  ? 546  LEU A CB    1 
ATOM   3685  C  CG    . LEU A 1  546  ? 119.422 76.270  116.313 1.00 58.21  ? 546  LEU A CG    1 
ATOM   3686  C  CD1   . LEU A 1  546  ? 120.882 76.277  116.737 1.00 55.70  ? 546  LEU A CD1   1 
ATOM   3687  C  CD2   . LEU A 1  546  ? 118.988 74.873  115.897 1.00 55.38  ? 546  LEU A CD2   1 
ATOM   3688  N  N     . ILE A 1  547  ? 115.487 78.152  118.554 1.00 56.16  ? 547  ILE A N     1 
ATOM   3689  C  CA    . ILE A 1  547  ? 114.736 78.433  119.773 1.00 57.03  ? 547  ILE A CA    1 
ATOM   3690  C  C     . ILE A 1  547  ? 113.574 77.477  119.984 1.00 57.94  ? 547  ILE A C     1 
ATOM   3691  O  O     . ILE A 1  547  ? 113.023 77.422  121.089 1.00 58.52  ? 547  ILE A O     1 
ATOM   3692  C  CB    . ILE A 1  547  ? 114.214 79.884  119.765 1.00 58.55  ? 547  ILE A CB    1 
ATOM   3693  C  CG1   . ILE A 1  547  ? 113.295 80.115  118.564 1.00 57.90  ? 547  ILE A CG1   1 
ATOM   3694  C  CG2   . ILE A 1  547  ? 115.373 80.868  119.753 1.00 57.27  ? 547  ILE A CG2   1 
ATOM   3695  C  CD1   . ILE A 1  547  ? 112.737 81.519  118.482 1.00 56.84  ? 547  ILE A CD1   1 
ATOM   3696  N  N     . GLY A 1  548  ? 113.188 76.721  118.959 1.00 58.38  ? 548  GLY A N     1 
ATOM   3697  C  CA    . GLY A 1  548  ? 112.089 75.785  119.083 1.00 59.70  ? 548  GLY A CA    1 
ATOM   3698  C  C     . GLY A 1  548  ? 112.479 74.358  118.755 1.00 61.11  ? 548  GLY A C     1 
ATOM   3699  O  O     . GLY A 1  548  ? 111.644 73.566  118.305 1.00 61.18  ? 548  GLY A O     1 
ATOM   3700  N  N     . MET A 1  549  ? 113.746 74.018  118.977 1.00 62.86  ? 549  MET A N     1 
ATOM   3701  C  CA    . MET A 1  549  ? 114.257 72.677  118.731 1.00 64.11  ? 549  MET A CA    1 
ATOM   3702  C  C     . MET A 1  549  ? 115.001 72.194  119.968 1.00 66.06  ? 549  MET A C     1 
ATOM   3703  O  O     . MET A 1  549  ? 115.773 72.946  120.571 1.00 67.52  ? 549  MET A O     1 
ATOM   3704  C  CB    . MET A 1  549  ? 115.183 72.647  117.504 1.00 69.21  ? 549  MET A CB    1 
ATOM   3705  C  CG    . MET A 1  549  ? 114.567 73.261  116.254 1.00 69.37  ? 549  MET A CG    1 
ATOM   3706  S  SD    . MET A 1  549  ? 115.631 73.176  114.799 1.00 63.02  ? 549  MET A SD    1 
ATOM   3707  C  CE    . MET A 1  549  ? 115.477 71.449  114.355 1.00 62.96  ? 549  MET A CE    1 
ATOM   3708  N  N     . SER A 1  550  ? 114.766 70.939  120.340 1.00 62.10  ? 550  SER A N     1 
ATOM   3709  C  CA    . SER A 1  550  ? 115.318 70.393  121.570 1.00 61.49  ? 550  SER A CA    1 
ATOM   3710  C  C     . SER A 1  550  ? 116.791 70.033  121.388 1.00 61.71  ? 550  SER A C     1 
ATOM   3711  O  O     . SER A 1  550  ? 117.395 70.266  120.336 1.00 61.81  ? 550  SER A O     1 
ATOM   3712  C  CB    . SER A 1  550  ? 114.509 69.178  122.021 1.00 60.93  ? 550  SER A CB    1 
ATOM   3713  O  OG    . SER A 1  550  ? 114.556 68.144  121.054 1.00 60.72  ? 550  SER A OG    1 
ATOM   3714  N  N     . VAL A 1  551  ? 117.378 69.447  122.434 1.00 60.55  ? 551  VAL A N     1 
ATOM   3715  C  CA    . VAL A 1  551  ? 118.801 69.123  122.405 1.00 60.38  ? 551  VAL A CA    1 
ATOM   3716  C  C     . VAL A 1  551  ? 119.077 67.963  121.455 1.00 60.21  ? 551  VAL A C     1 
ATOM   3717  O  O     . VAL A 1  551  ? 120.187 67.839  120.924 1.00 60.20  ? 551  VAL A O     1 
ATOM   3718  C  CB    . VAL A 1  551  ? 119.307 68.830  123.832 1.00 60.36  ? 551  VAL A CB    1 
ATOM   3719  C  CG1   . VAL A 1  551  ? 118.722 67.526  124.359 1.00 60.71  ? 551  VAL A CG1   1 
ATOM   3720  C  CG2   . VAL A 1  551  ? 120.830 68.806  123.872 1.00 60.49  ? 551  VAL A CG2   1 
ATOM   3721  N  N     . GLU A 1  552  ? 118.083 67.103  121.217 1.00 61.80  ? 552  GLU A N     1 
ATOM   3722  C  CA    . GLU A 1  552  ? 118.265 66.023  120.252 1.00 63.10  ? 552  GLU A CA    1 
ATOM   3723  C  C     . GLU A 1  552  ? 118.426 66.573  118.841 1.00 64.33  ? 552  GLU A C     1 
ATOM   3724  O  O     . GLU A 1  552  ? 119.276 66.100  118.077 1.00 65.16  ? 552  GLU A O     1 
ATOM   3725  C  CB    . GLU A 1  552  ? 117.089 65.048  120.321 1.00 65.47  ? 552  GLU A CB    1 
ATOM   3726  C  CG    . GLU A 1  552  ? 117.178 63.896  119.329 1.00 65.54  ? 552  GLU A CG    1 
ATOM   3727  C  CD    . GLU A 1  552  ? 118.349 62.970  119.603 1.00 65.71  ? 552  GLU A CD    1 
ATOM   3728  O  OE1   . GLU A 1  552  ? 118.789 62.888  120.770 1.00 63.21  ? 552  GLU A OE1   1 
ATOM   3729  O  OE2   . GLU A 1  552  ? 118.832 62.324  118.649 1.00 62.41  ? 552  GLU A OE2   1 
ATOM   3730  N  N     . GLN A 1  553  ? 117.619 67.573  118.478 1.00 64.07  ? 553  GLN A N     1 
ATOM   3731  C  CA    . GLN A 1  553  ? 117.815 68.249  117.202 1.00 64.51  ? 553  GLN A CA    1 
ATOM   3732  C  C     . GLN A 1  553  ? 119.126 69.024  117.184 1.00 63.94  ? 553  GLN A C     1 
ATOM   3733  O  O     . GLN A 1  553  ? 119.736 69.189  116.122 1.00 63.92  ? 553  GLN A O     1 
ATOM   3734  C  CB    . GLN A 1  553  ? 116.640 69.183  116.911 1.00 63.67  ? 553  GLN A CB    1 
ATOM   3735  C  CG    . GLN A 1  553  ? 115.344 68.474  116.536 1.00 63.62  ? 553  GLN A CG    1 
ATOM   3736  C  CD    . GLN A 1  553  ? 114.656 67.827  117.723 1.00 63.48  ? 553  GLN A CD    1 
ATOM   3737  O  OE1   . GLN A 1  553  ? 115.045 68.038  118.871 1.00 65.52  ? 553  GLN A OE1   1 
ATOM   3738  N  NE2   . GLN A 1  553  ? 113.626 67.034  117.450 1.00 65.73  ? 553  GLN A NE2   1 
ATOM   3739  N  N     . ARG A 1  554  ? 119.572 69.507  118.347 1.00 66.64  ? 554  ARG A N     1 
ATOM   3740  C  CA    . ARG A 1  554  ? 120.879 70.144  118.435 1.00 67.17  ? 554  ARG A CA    1 
ATOM   3741  C  C     . ARG A 1  554  ? 122.015 69.155  118.212 1.00 67.50  ? 554  ARG A C     1 
ATOM   3742  O  O     . ARG A 1  554  ? 123.108 69.569  117.815 1.00 67.20  ? 554  ARG A O     1 
ATOM   3743  C  CB    . ARG A 1  554  ? 121.046 70.828  119.793 1.00 67.07  ? 554  ARG A CB    1 
ATOM   3744  C  CG    . ARG A 1  554  ? 120.093 71.989  120.028 1.00 66.88  ? 554  ARG A CG    1 
ATOM   3745  C  CD    . ARG A 1  554  ? 120.262 72.565  121.425 1.00 66.83  ? 554  ARG A CD    1 
ATOM   3746  N  NE    . ARG A 1  554  ? 119.312 73.643  121.691 1.00 67.33  ? 554  ARG A NE    1 
ATOM   3747  C  CZ    . ARG A 1  554  ? 119.219 74.287  122.849 1.00 66.76  ? 554  ARG A CZ    1 
ATOM   3748  N  NH1   . ARG A 1  554  ? 120.018 73.963  123.856 1.00 66.75  ? 554  ARG A NH1   1 
ATOM   3749  N  NH2   . ARG A 1  554  ? 118.325 75.254  123.002 1.00 67.06  ? 554  ARG A NH2   1 
ATOM   3750  N  N     . LYS A 1  555  ? 121.782 67.863  118.457 1.00 66.08  ? 555  LYS A N     1 
ATOM   3751  C  CA    . LYS A 1  555  ? 122.801 66.855  118.185 1.00 66.02  ? 555  LYS A CA    1 
ATOM   3752  C  C     . LYS A 1  555  ? 122.802 66.457  116.714 1.00 67.52  ? 555  LYS A C     1 
ATOM   3753  O  O     . LYS A 1  555  ? 123.867 66.300  116.107 1.00 68.44  ? 555  LYS A O     1 
ATOM   3754  C  CB    . LYS A 1  555  ? 122.582 65.626  119.068 1.00 68.66  ? 555  LYS A CB    1 
ATOM   3755  C  CG    . LYS A 1  555  ? 122.787 65.869  120.553 1.00 68.39  ? 555  LYS A CG    1 
ATOM   3756  C  CD    . LYS A 1  555  ? 122.683 64.568  121.334 1.00 68.18  ? 555  LYS A CD    1 
ATOM   3757  C  CE    . LYS A 1  555  ? 122.855 64.797  122.826 1.00 65.13  ? 555  LYS A CE    1 
ATOM   3758  N  NZ    . LYS A 1  555  ? 121.759 65.631  123.389 1.00 63.92  ? 555  LYS A NZ    1 
ATOM   3759  N  N     . ALA A 1  556  ? 121.614 66.287  116.127 1.00 65.88  ? 556  ALA A N     1 
ATOM   3760  C  CA    . ALA A 1  556  ? 121.534 65.940  114.713 1.00 66.92  ? 556  ALA A CA    1 
ATOM   3761  C  C     . ALA A 1  556  ? 122.056 67.073  113.839 1.00 67.25  ? 556  ALA A C     1 
ATOM   3762  O  O     . ALA A 1  556  ? 122.543 66.837  112.727 1.00 66.97  ? 556  ALA A O     1 
ATOM   3763  C  CB    . ALA A 1  556  ? 120.093 65.592  114.338 1.00 67.36  ? 556  ALA A CB    1 
ATOM   3764  N  N     . LEU A 1  557  ? 121.966 68.311  114.327 1.00 66.05  ? 557  LEU A N     1 
ATOM   3765  C  CA    . LEU A 1  557  ? 122.524 69.441  113.596 1.00 64.77  ? 557  LEU A CA    1 
ATOM   3766  C  C     . LEU A 1  557  ? 123.995 69.659  113.927 1.00 63.58  ? 557  LEU A C     1 
ATOM   3767  O  O     . LEU A 1  557  ? 124.740 70.191  113.097 1.00 63.08  ? 557  LEU A O     1 
ATOM   3768  C  CB    . LEU A 1  557  ? 121.717 70.708  113.891 1.00 63.10  ? 557  LEU A CB    1 
ATOM   3769  C  CG    . LEU A 1  557  ? 122.041 71.946  113.052 1.00 63.10  ? 557  LEU A CG    1 
ATOM   3770  C  CD1   . LEU A 1  557  ? 121.836 71.658  111.572 1.00 64.77  ? 557  LEU A CD1   1 
ATOM   3771  C  CD2   . LEU A 1  557  ? 121.194 73.128  113.492 1.00 64.85  ? 557  LEU A CD2   1 
ATOM   3772  N  N     . ALA A 1  558  ? 124.431 69.254  115.124 1.00 65.21  ? 558  ALA A N     1 
ATOM   3773  C  CA    . ALA A 1  558  ? 125.845 69.364  115.469 1.00 65.79  ? 558  ALA A CA    1 
ATOM   3774  C  C     . ALA A 1  558  ? 126.702 68.431  114.626 1.00 65.92  ? 558  ALA A C     1 
ATOM   3775  O  O     . ALA A 1  558  ? 127.867 68.739  114.351 1.00 65.99  ? 558  ALA A O     1 
ATOM   3776  C  CB    . ALA A 1  558  ? 126.057 69.072  116.954 1.00 65.92  ? 558  ALA A CB    1 
ATOM   3777  N  N     . ASN A 1  559  ? 126.150 67.292  114.210 1.00 66.60  ? 559  ASN A N     1 
ATOM   3778  C  CA    . ASN A 1  559  ? 126.843 66.365  113.327 1.00 67.49  ? 559  ASN A CA    1 
ATOM   3779  C  C     . ASN A 1  559  ? 126.670 66.726  111.855 1.00 69.03  ? 559  ASN A C     1 
ATOM   3780  O  O     . ASN A 1  559  ? 126.926 65.887  110.984 1.00 70.03  ? 559  ASN A O     1 
ATOM   3781  C  CB    . ASN A 1  559  ? 126.358 64.934  113.578 1.00 70.34  ? 559  ASN A CB    1 
ATOM   3782  C  CG    . ASN A 1  559  ? 126.644 64.462  114.990 1.00 70.28  ? 559  ASN A CG    1 
ATOM   3783  O  OD1   . ASN A 1  559  ? 125.730 64.113  115.739 1.00 66.80  ? 559  ASN A OD1   1 
ATOM   3784  N  ND2   . ASN A 1  559  ? 127.919 64.449  115.363 1.00 66.67  ? 559  ASN A ND2   1 
ATOM   3785  N  N     . GLN A 1  560  ? 126.244 67.957  111.563 1.00 66.53  ? 560  GLN A N     1 
ATOM   3786  C  CA    . GLN A 1  560  ? 126.027 68.405  110.195 1.00 66.57  ? 560  GLN A CA    1 
ATOM   3787  C  C     . GLN A 1  560  ? 126.669 69.763  109.923 1.00 66.50  ? 560  GLN A C     1 
ATOM   3788  O  O     . GLN A 1  560  ? 126.486 70.315  108.831 1.00 66.47  ? 560  GLN A O     1 
ATOM   3789  C  CB    . GLN A 1  560  ? 124.524 68.462  109.885 1.00 67.01  ? 560  GLN A CB    1 
ATOM   3790  C  CG    . GLN A 1  560  ? 124.172 68.290  108.415 1.00 67.44  ? 560  GLN A CG    1 
ATOM   3791  C  CD    . GLN A 1  560  ? 124.582 66.936  107.872 1.00 67.39  ? 560  GLN A CD    1 
ATOM   3792  O  OE1   . GLN A 1  560  ? 125.356 66.844  106.919 1.00 66.52  ? 560  GLN A OE1   1 
ATOM   3793  N  NE2   . GLN A 1  560  ? 124.063 65.874  108.478 1.00 65.82  ? 560  GLN A NE2   1 
ATOM   3794  N  N     . LEU A 1  561  ? 127.418 70.315  110.882 1.00 67.29  ? 561  LEU A N     1 
ATOM   3795  C  CA    . LEU A 1  561  ? 128.025 71.627  110.678 1.00 68.17  ? 561  LEU A CA    1 
ATOM   3796  C  C     . LEU A 1  561  ? 129.147 71.578  109.648 1.00 69.82  ? 561  LEU A C     1 
ATOM   3797  O  O     . LEU A 1  561  ? 129.396 72.575  108.961 1.00 71.43  ? 561  LEU A O     1 
ATOM   3798  C  CB    . LEU A 1  561  ? 128.536 72.184  112.010 1.00 71.72  ? 561  LEU A CB    1 
ATOM   3799  C  CG    . LEU A 1  561  ? 129.475 71.334  112.875 1.00 72.14  ? 561  LEU A CG    1 
ATOM   3800  C  CD1   . LEU A 1  561  ? 130.936 71.517  112.481 1.00 68.48  ? 561  LEU A CD1   1 
ATOM   3801  C  CD2   . LEU A 1  561  ? 129.276 71.663  114.346 1.00 68.01  ? 561  LEU A CD2   1 
ATOM   3802  N  N     . LEU A 1  562  ? 129.828 70.442  109.526 1.00 69.64  ? 562  LEU A N     1 
ATOM   3803  C  CA    . LEU A 1  562  ? 130.913 70.265  108.565 1.00 70.81  ? 562  LEU A CA    1 
ATOM   3804  C  C     . LEU A 1  562  ? 130.453 69.242  107.531 1.00 70.61  ? 562  LEU A C     1 
ATOM   3805  O  O     . LEU A 1  562  ? 130.487 68.034  107.779 1.00 70.62  ? 562  LEU A O     1 
ATOM   3806  C  CB    . LEU A 1  562  ? 132.197 69.824  109.261 1.00 70.42  ? 562  LEU A CB    1 
ATOM   3807  C  CG    . LEU A 1  562  ? 133.434 69.704  108.369 1.00 71.04  ? 562  LEU A CG    1 
ATOM   3808  C  CD1   . LEU A 1  562  ? 133.672 70.996  107.601 1.00 72.49  ? 562  LEU A CD1   1 
ATOM   3809  C  CD2   . LEU A 1  562  ? 134.658 69.333  109.193 1.00 72.70  ? 562  LEU A CD2   1 
ATOM   3810  N  N     . THR A 1  563  ? 130.026 69.734  106.371 1.00 75.40  ? 563  THR A N     1 
ATOM   3811  C  CA    . THR A 1  563  ? 129.500 68.893  105.303 1.00 77.58  ? 563  THR A CA    1 
ATOM   3812  C  C     . THR A 1  563  ? 129.621 69.629  103.974 1.00 78.97  ? 563  THR A C     1 
ATOM   3813  O  O     . THR A 1  563  ? 129.274 70.814  103.890 1.00 79.87  ? 563  THR A O     1 
ATOM   3814  C  CB    . THR A 1  563  ? 128.040 68.517  105.579 1.00 79.55  ? 563  THR A CB    1 
ATOM   3815  O  OG1   . THR A 1  563  ? 127.966 67.705  106.757 1.00 77.93  ? 563  THR A OG1   1 
ATOM   3816  C  CG2   . THR A 1  563  ? 127.442 67.754  104.406 1.00 77.84  ? 563  THR A CG2   1 
ATOM   3817  N  N     . PRO A 1  564  ? 130.122 68.977  102.924 1.00 77.85  ? 564  PRO A N     1 
ATOM   3818  C  CA    . PRO A 1  564  ? 130.206 69.640  101.618 1.00 78.06  ? 564  PRO A CA    1 
ATOM   3819  C  C     . PRO A 1  564  ? 128.831 70.044  101.106 1.00 77.50  ? 564  PRO A C     1 
ATOM   3820  O  O     . PRO A 1  564  ? 127.800 69.495  101.501 1.00 76.98  ? 564  PRO A O     1 
ATOM   3821  C  CB    . PRO A 1  564  ? 130.851 68.577  100.717 1.00 77.13  ? 564  PRO A CB    1 
ATOM   3822  C  CG    . PRO A 1  564  ? 130.624 67.278  101.427 1.00 78.48  ? 564  PRO A CG    1 
ATOM   3823  C  CD    . PRO A 1  564  ? 130.666 67.610  102.886 1.00 79.08  ? 564  PRO A CD    1 
ATOM   3824  N  N     . SER A 1  565  ? 128.831 71.024  100.207 1.00 78.08  ? 565  SER A N     1 
ATOM   3825  C  CA    . SER A 1  565  ? 127.589 71.593  99.704  1.00 77.96  ? 565  SER A CA    1 
ATOM   3826  C  C     . SER A 1  565  ? 126.863 70.585  98.811  1.00 77.96  ? 565  SER A C     1 
ATOM   3827  O  O     . SER A 1  565  ? 127.360 69.495  98.514  1.00 77.82  ? 565  SER A O     1 
ATOM   3828  C  CB    . SER A 1  565  ? 127.870 72.889  98.949  1.00 78.09  ? 565  SER A CB    1 
ATOM   3829  O  OG    . SER A 1  565  ? 128.719 72.660  97.839  1.00 77.92  ? 565  SER A OG    1 
ATOM   3830  N  N     . SER A 1  566  ? 125.663 70.969  98.374  1.00 77.89  ? 566  SER A N     1 
ATOM   3831  C  CA    . SER A 1  566  ? 124.854 70.088  97.539  1.00 77.23  ? 566  SER A CA    1 
ATOM   3832  C  C     . SER A 1  566  ? 125.444 69.965  96.139  1.00 78.07  ? 566  SER A C     1 
ATOM   3833  O  O     . SER A 1  566  ? 125.755 68.862  95.675  1.00 77.34  ? 566  SER A O     1 
ATOM   3834  C  CB    . SER A 1  566  ? 123.415 70.602  97.478  1.00 74.90  ? 566  SER A CB    1 
ATOM   3835  O  OG    . SER A 1  566  ? 123.364 71.915  96.945  1.00 73.93  ? 566  SER A OG    1 
ATOM   3836  N  N     . ASN A 1  567  ? 125.606 71.092  95.450  1.00 73.03  ? 567  ASN A N     1 
ATOM   3837  C  CA    . ASN A 1  567  ? 126.128 71.108  94.093  1.00 72.07  ? 567  ASN A CA    1 
ATOM   3838  C  C     . ASN A 1  567  ? 127.328 72.041  94.018  1.00 73.18  ? 567  ASN A C     1 
ATOM   3839  O  O     . ASN A 1  567  ? 127.610 72.805  94.945  1.00 74.64  ? 567  ASN A O     1 
ATOM   3840  C  CB    . ASN A 1  567  ? 125.058 71.549  93.084  1.00 75.26  ? 567  ASN A CB    1 
ATOM   3841  C  CG    . ASN A 1  567  ? 123.828 70.662  93.115  1.00 75.53  ? 567  ASN A CG    1 
ATOM   3842  O  OD1   . ASN A 1  567  ? 123.920 69.462  93.371  1.00 70.56  ? 567  ASN A OD1   1 
ATOM   3843  N  ND2   . ASN A 1  567  ? 122.667 71.252  92.855  1.00 70.51  ? 567  ASN A ND2   1 
ATOM   3844  N  N     . VAL A 1  568  ? 128.039 71.968  92.889  1.00 69.40  ? 568  VAL A N     1 
ATOM   3845  C  CA    . VAL A 1  568  ? 129.197 72.826  92.673  1.00 68.90  ? 568  VAL A CA    1 
ATOM   3846  C  C     . VAL A 1  568  ? 128.794 74.284  92.523  1.00 70.07  ? 568  VAL A C     1 
ATOM   3847  O  O     . VAL A 1  568  ? 129.647 75.175  92.607  1.00 70.81  ? 568  VAL A O     1 
ATOM   3848  C  CB    . VAL A 1  568  ? 129.997 72.349  91.444  1.00 70.24  ? 568  VAL A CB    1 
ATOM   3849  C  CG1   . VAL A 1  568  ? 130.536 70.946  91.674  1.00 67.67  ? 568  VAL A CG1   1 
ATOM   3850  C  CG2   . VAL A 1  568  ? 129.129 72.397  90.196  1.00 67.69  ? 568  VAL A CG2   1 
ATOM   3851  N  N     . SER A 1  569  ? 127.505 74.554  92.299  1.00 66.75  ? 569  SER A N     1 
ATOM   3852  C  CA    . SER A 1  569  ? 127.030 75.929  92.204  1.00 66.23  ? 569  SER A CA    1 
ATOM   3853  C  C     . SER A 1  569  ? 127.203 76.692  93.510  1.00 66.00  ? 569  SER A C     1 
ATOM   3854  O  O     . SER A 1  569  ? 127.183 77.927  93.503  1.00 65.67  ? 569  SER A O     1 
ATOM   3855  C  CB    . SER A 1  569  ? 125.560 75.946  91.780  1.00 65.68  ? 569  SER A CB    1 
ATOM   3856  O  OG    . SER A 1  569  ? 125.045 77.266  91.768  1.00 65.13  ? 569  SER A OG    1 
ATOM   3857  N  N     . THR A 1  570  ? 127.366 75.987  94.632  1.00 65.16  ? 570  THR A N     1 
ATOM   3858  C  CA    . THR A 1  570  ? 127.621 76.613  95.924  1.00 64.53  ? 570  THR A CA    1 
ATOM   3859  C  C     . THR A 1  570  ? 128.791 75.931  96.626  1.00 64.62  ? 570  THR A C     1 
ATOM   3860  O  O     . THR A 1  570  ? 128.818 75.829  97.855  1.00 64.35  ? 570  THR A O     1 
ATOM   3861  C  CB    . THR A 1  570  ? 126.370 76.587  96.802  1.00 64.71  ? 570  THR A CB    1 
ATOM   3862  O  OG1   . THR A 1  570  ? 125.206 76.705  95.975  1.00 64.06  ? 570  THR A OG1   1 
ATOM   3863  C  CG2   . THR A 1  570  ? 126.383 77.751  97.785  1.00 64.42  ? 570  THR A CG2   1 
ATOM   3864  N  N     . HIS A 1  571  ? 129.769 75.454  95.851  1.00 63.12  ? 571  HIS A N     1 
ATOM   3865  C  CA    . HIS A 1  571  ? 130.910 74.753  96.427  1.00 62.73  ? 571  HIS A CA    1 
ATOM   3866  C  C     . HIS A 1  571  ? 131.895 75.699  97.099  1.00 62.46  ? 571  HIS A C     1 
ATOM   3867  O  O     . HIS A 1  571  ? 132.635 75.272  97.992  1.00 62.39  ? 571  HIS A O     1 
ATOM   3868  C  CB    . HIS A 1  571  ? 131.622 73.940  95.343  1.00 62.30  ? 571  HIS A CB    1 
ATOM   3869  C  CG    . HIS A 1  571  ? 132.780 73.139  95.850  1.00 62.10  ? 571  HIS A CG    1 
ATOM   3870  N  ND1   . HIS A 1  571  ? 132.636 72.114  96.760  1.00 61.83  ? 571  HIS A ND1   1 
ATOM   3871  C  CD2   . HIS A 1  571  ? 134.105 73.210  95.572  1.00 62.05  ? 571  HIS A CD2   1 
ATOM   3872  C  CE1   . HIS A 1  571  ? 133.820 71.589  97.022  1.00 62.55  ? 571  HIS A CE1   1 
ATOM   3873  N  NE2   . HIS A 1  571  ? 134.728 72.237  96.314  1.00 63.33  ? 571  HIS A NE2   1 
ATOM   3874  N  N     . THR A 1  572  ? 131.920 76.972  96.699  1.00 61.66  ? 572  THR A N     1 
ATOM   3875  C  CA    . THR A 1  572  ? 132.873 77.912  97.278  1.00 61.15  ? 572  THR A CA    1 
ATOM   3876  C  C     . THR A 1  572  ? 132.410 78.417  98.641  1.00 62.68  ? 572  THR A C     1 
ATOM   3877  O  O     . THR A 1  572  ? 133.236 78.647  99.532  1.00 63.12  ? 572  THR A O     1 
ATOM   3878  C  CB    . THR A 1  572  ? 133.097 79.088  96.326  1.00 63.30  ? 572  THR A CB    1 
ATOM   3879  O  OG1   . THR A 1  572  ? 131.846 79.726  96.046  1.00 59.31  ? 572  THR A OG1   1 
ATOM   3880  C  CG2   . THR A 1  572  ? 133.718 78.605  95.023  1.00 58.27  ? 572  THR A CG2   1 
ATOM   3881  N  N     . LEU A 1  573  ? 131.104 78.594  98.823  1.00 58.84  ? 573  LEU A N     1 
ATOM   3882  C  CA    . LEU A 1  573  ? 130.574 79.097  100.081 1.00 59.04  ? 573  LEU A CA    1 
ATOM   3883  C  C     . LEU A 1  573  ? 130.410 77.957  101.085 1.00 59.22  ? 573  LEU A C     1 
ATOM   3884  O  O     . LEU A 1  573  ? 130.632 76.781  100.780 1.00 59.08  ? 573  LEU A O     1 
ATOM   3885  C  CB    . LEU A 1  573  ? 129.248 79.820  99.853  1.00 59.33  ? 573  LEU A CB    1 
ATOM   3886  C  CG    . LEU A 1  573  ? 129.296 81.255  99.318  1.00 58.78  ? 573  LEU A CG    1 
ATOM   3887  C  CD1   . LEU A 1  573  ? 130.289 82.095  100.112 1.00 58.44  ? 573  LEU A CD1   1 
ATOM   3888  C  CD2   . LEU A 1  573  ? 129.610 81.299  97.829  1.00 58.70  ? 573  LEU A CD2   1 
ATOM   3889  N  N     . ASN A 1  574  ? 130.012 78.314  102.304 1.00 58.77  ? 574  ASN A N     1 
ATOM   3890  C  CA    . ASN A 1  574  ? 129.793 77.346  103.368 1.00 59.09  ? 574  ASN A CA    1 
ATOM   3891  C  C     . ASN A 1  574  ? 128.748 77.904  104.326 1.00 58.91  ? 574  ASN A C     1 
ATOM   3892  O  O     . ASN A 1  574  ? 128.261 79.026  104.162 1.00 58.84  ? 574  ASN A O     1 
ATOM   3893  C  CB    . ASN A 1  574  ? 131.104 77.013  104.089 1.00 58.78  ? 574  ASN A CB    1 
ATOM   3894  C  CG    . ASN A 1  574  ? 131.884 78.252  104.488 1.00 58.85  ? 574  ASN A CG    1 
ATOM   3895  O  OD1   . ASN A 1  574  ? 131.366 79.368  104.453 1.00 60.21  ? 574  ASN A OD1   1 
ATOM   3896  N  ND2   . ASN A 1  574  ? 133.141 78.060  104.871 1.00 61.17  ? 574  ASN A ND2   1 
ATOM   3897  N  N     . LYS A 1  575  ? 128.402 77.105  105.332 1.00 61.08  ? 575  LYS A N     1 
ATOM   3898  C  CA    . LYS A 1  575  ? 127.421 77.527  106.319 1.00 62.00  ? 575  LYS A CA    1 
ATOM   3899  C  C     . LYS A 1  575  ? 128.009 78.595  107.239 1.00 63.09  ? 575  LYS A C     1 
ATOM   3900  O  O     . LYS A 1  575  ? 129.226 78.711  107.411 1.00 64.07  ? 575  LYS A O     1 
ATOM   3901  C  CB    . LYS A 1  575  ? 126.940 76.333  107.145 1.00 65.09  ? 575  LYS A CB    1 
ATOM   3902  C  CG    . LYS A 1  575  ? 126.343 75.205  106.323 1.00 66.08  ? 575  LYS A CG    1 
ATOM   3903  C  CD    . LYS A 1  575  ? 125.945 74.033  107.207 1.00 66.52  ? 575  LYS A CD    1 
ATOM   3904  C  CE    . LYS A 1  575  ? 125.394 72.881  106.383 1.00 61.39  ? 575  LYS A CE    1 
ATOM   3905  N  NZ    . LYS A 1  575  ? 124.180 73.276  105.618 1.00 61.23  ? 575  LYS A NZ    1 
ATOM   3906  N  N     . LYS A 1  576  ? 127.118 79.387  107.835 1.00 60.24  ? 576  LYS A N     1 
ATOM   3907  C  CA    . LYS A 1  576  ? 127.494 80.424  108.786 1.00 59.56  ? 576  LYS A CA    1 
ATOM   3908  C  C     . LYS A 1  576  ? 126.695 80.230  110.066 1.00 59.83  ? 576  LYS A C     1 
ATOM   3909  O  O     . LYS A 1  576  ? 125.462 80.161  110.027 1.00 59.87  ? 576  LYS A O     1 
ATOM   3910  C  CB    . LYS A 1  576  ? 127.249 81.830  108.218 1.00 59.71  ? 576  LYS A CB    1 
ATOM   3911  C  CG    . LYS A 1  576  ? 128.402 82.399  107.397 1.00 59.72  ? 576  LYS A CG    1 
ATOM   3912  C  CD    . LYS A 1  576  ? 128.510 81.744  106.029 1.00 59.24  ? 576  LYS A CD    1 
ATOM   3913  C  CE    . LYS A 1  576  ? 129.651 82.338  105.219 1.00 58.28  ? 576  LYS A CE    1 
ATOM   3914  N  NZ    . LYS A 1  576  ? 129.777 81.694  103.883 1.00 57.66  ? 576  LYS A NZ    1 
ATOM   3915  N  N     . VAL A 1  577  ? 127.396 80.141  111.192 1.00 56.75  ? 577  VAL A N     1 
ATOM   3916  C  CA    . VAL A 1  577  ? 126.778 79.935  112.496 1.00 54.99  ? 577  VAL A CA    1 
ATOM   3917  C  C     . VAL A 1  577  ? 126.743 81.264  113.236 1.00 54.18  ? 577  VAL A C     1 
ATOM   3918  O  O     . VAL A 1  577  ? 127.753 81.975  113.300 1.00 53.80  ? 577  VAL A O     1 
ATOM   3919  C  CB    . VAL A 1  577  ? 127.533 78.870  113.310 1.00 53.98  ? 577  VAL A CB    1 
ATOM   3920  C  CG1   . VAL A 1  577  ? 126.990 78.798  114.729 1.00 54.27  ? 577  VAL A CG1   1 
ATOM   3921  C  CG2   . VAL A 1  577  ? 127.429 77.516  112.627 1.00 54.42  ? 577  VAL A CG2   1 
ATOM   3922  N  N     . TYR A 1  578  ? 125.582 81.599  113.794 1.00 53.57  ? 578  TYR A N     1 
ATOM   3923  C  CA    . TYR A 1  578  ? 125.391 82.832  114.548 1.00 53.42  ? 578  TYR A CA    1 
ATOM   3924  C  C     . TYR A 1  578  ? 125.577 82.523  116.030 1.00 53.32  ? 578  TYR A C     1 
ATOM   3925  O  O     . TYR A 1  578  ? 124.670 81.989  116.677 1.00 52.96  ? 578  TYR A O     1 
ATOM   3926  C  CB    . TYR A 1  578  ? 124.010 83.429  114.281 1.00 52.67  ? 578  TYR A CB    1 
ATOM   3927  C  CG    . TYR A 1  578  ? 123.740 83.788  112.834 1.00 52.93  ? 578  TYR A CG    1 
ATOM   3928  C  CD1   . TYR A 1  578  ? 124.780 83.941  111.924 1.00 53.21  ? 578  TYR A CD1   1 
ATOM   3929  C  CD2   . TYR A 1  578  ? 122.443 83.980  112.380 1.00 53.15  ? 578  TYR A CD2   1 
ATOM   3930  C  CE1   . TYR A 1  578  ? 124.532 84.269  110.604 1.00 53.48  ? 578  TYR A CE1   1 
ATOM   3931  C  CE2   . TYR A 1  578  ? 122.185 84.308  111.062 1.00 53.21  ? 578  TYR A CE2   1 
ATOM   3932  C  CZ    . TYR A 1  578  ? 123.233 84.453  110.179 1.00 53.94  ? 578  TYR A CZ    1 
ATOM   3933  O  OH    . TYR A 1  578  ? 122.982 84.780  108.866 1.00 54.12  ? 578  TYR A OH    1 
ATOM   3934  N  N     . ARG A 1  579  ? 126.747 82.857  116.565 1.00 54.49  ? 579  ARG A N     1 
ATOM   3935  C  CA    . ARG A 1  579  ? 127.063 82.621  117.966 1.00 55.07  ? 579  ARG A CA    1 
ATOM   3936  C  C     . ARG A 1  579  ? 126.837 83.888  118.783 1.00 55.32  ? 579  ARG A C     1 
ATOM   3937  O  O     . ARG A 1  579  ? 126.875 85.005  118.265 1.00 55.28  ? 579  ARG A O     1 
ATOM   3938  C  CB    . ARG A 1  579  ? 128.508 82.139  118.121 1.00 54.92  ? 579  ARG A CB    1 
ATOM   3939  C  CG    . ARG A 1  579  ? 129.556 83.119  117.625 1.00 54.51  ? 579  ARG A CG    1 
ATOM   3940  C  CD    . ARG A 1  579  ? 130.918 82.453  117.579 1.00 54.58  ? 579  ARG A CD    1 
ATOM   3941  N  NE    . ARG A 1  579  ? 131.194 81.718  118.809 1.00 54.84  ? 579  ARG A NE    1 
ATOM   3942  C  CZ    . ARG A 1  579  ? 132.200 80.863  118.960 1.00 54.63  ? 579  ARG A CZ    1 
ATOM   3943  N  NH1   . ARG A 1  579  ? 133.034 80.632  117.956 1.00 54.94  ? 579  ARG A NH1   1 
ATOM   3944  N  NH2   . ARG A 1  579  ? 132.373 80.240  120.117 1.00 54.16  ? 579  ARG A NH2   1 
ATOM   3945  N  N     . HIS A 1  580  ? 126.609 83.697  120.084 1.00 55.72  ? 580  HIS A N     1 
ATOM   3946  C  CA    . HIS A 1  580  ? 126.147 84.789  120.935 1.00 56.43  ? 580  HIS A CA    1 
ATOM   3947  C  C     . HIS A 1  580  ? 127.231 85.829  121.190 1.00 57.40  ? 580  HIS A C     1 
ATOM   3948  O  O     . HIS A 1  580  ? 127.118 86.971  120.733 1.00 58.16  ? 580  HIS A O     1 
ATOM   3949  C  CB    . HIS A 1  580  ? 125.649 84.240  122.275 1.00 58.73  ? 580  HIS A CB    1 
ATOM   3950  C  CG    . HIS A 1  580  ? 124.564 83.216  122.151 1.00 59.79  ? 580  HIS A CG    1 
ATOM   3951  N  ND1   . HIS A 1  580  ? 124.098 82.496  123.229 1.00 59.64  ? 580  HIS A ND1   1 
ATOM   3952  C  CD2   . HIS A 1  580  ? 123.853 82.793  121.079 1.00 59.00  ? 580  HIS A CD2   1 
ATOM   3953  C  CE1   . HIS A 1  580  ? 123.147 81.671  122.827 1.00 56.00  ? 580  HIS A CE1   1 
ATOM   3954  N  NE2   . HIS A 1  580  ? 122.980 81.832  121.527 1.00 56.27  ? 580  HIS A NE2   1 
ATOM   3955  N  N     . ILE A 1  581  ? 128.285 85.441  121.905 1.00 54.73  ? 581  ILE A N     1 
ATOM   3956  C  CA    . ILE A 1  581  ? 129.340 86.372  122.291 1.00 53.43  ? 581  ILE A CA    1 
ATOM   3957  C  C     . ILE A 1  581  ? 130.513 85.564  122.819 1.00 52.64  ? 581  ILE A C     1 
ATOM   3958  O  O     . ILE A 1  581  ? 130.345 84.421  123.257 1.00 51.61  ? 581  ILE A O     1 
ATOM   3959  C  CB    . ILE A 1  581  ? 128.814 87.385  123.345 1.00 51.44  ? 581  ILE A CB    1 
ATOM   3960  C  CG1   . ILE A 1  581  ? 129.667 88.655  123.342 1.00 53.24  ? 581  ILE A CG1   1 
ATOM   3961  C  CG2   . ILE A 1  581  ? 128.802 86.763  124.729 1.00 53.61  ? 581  ILE A CG2   1 
ATOM   3962  C  CD1   . ILE A 1  581  ? 129.152 89.734  124.270 1.00 53.06  ? 581  ILE A CD1   1 
ATOM   3963  N  N     . LYS A 1  582  ? 131.707 86.149  122.762 1.00 55.26  ? 582  LYS A N     1 
ATOM   3964  C  CA    . LYS A 1  582  ? 132.908 85.561  123.335 1.00 56.66  ? 582  LYS A CA    1 
ATOM   3965  C  C     . LYS A 1  582  ? 133.660 86.630  124.117 1.00 57.98  ? 582  LYS A C     1 
ATOM   3966  O  O     . LYS A 1  582  ? 133.234 87.787  124.202 1.00 58.62  ? 582  LYS A O     1 
ATOM   3967  C  CB    . LYS A 1  582  ? 133.804 84.949  122.251 1.00 59.27  ? 582  LYS A CB    1 
ATOM   3968  C  CG    . LYS A 1  582  ? 133.197 83.753  121.539 1.00 60.04  ? 582  LYS A CG    1 
ATOM   3969  C  CD    . LYS A 1  582  ? 134.143 83.215  120.480 1.00 60.27  ? 582  LYS A CD    1 
ATOM   3970  C  CE    . LYS A 1  582  ? 134.420 84.254  119.406 1.00 56.67  ? 582  LYS A CE    1 
ATOM   3971  N  NZ    . LYS A 1  582  ? 135.322 83.727  118.345 1.00 57.08  ? 582  LYS A NZ    1 
ATOM   3972  N  N     . ASN A 1  583  ? 134.790 86.235  124.702 1.00 56.05  ? 583  ASN A N     1 
ATOM   3973  C  CA    . ASN A 1  583  ? 135.679 87.156  125.394 1.00 55.99  ? 583  ASN A CA    1 
ATOM   3974  C  C     . ASN A 1  583  ? 136.823 87.632  124.505 1.00 56.41  ? 583  ASN A C     1 
ATOM   3975  O  O     . ASN A 1  583  ? 137.809 88.180  125.010 1.00 56.87  ? 583  ASN A O     1 
ATOM   3976  C  CB    . ASN A 1  583  ? 136.228 86.507  126.668 1.00 56.98  ? 583  ASN A CB    1 
ATOM   3977  C  CG    . ASN A 1  583  ? 136.798 85.124  126.421 1.00 57.12  ? 583  ASN A CG    1 
ATOM   3978  O  OD1   . ASN A 1  583  ? 137.016 84.722  125.278 1.00 55.65  ? 583  ASN A OD1   1 
ATOM   3979  N  ND2   . ASN A 1  583  ? 137.043 84.386  127.497 1.00 56.00  ? 583  ASN A ND2   1 
ATOM   3980  N  N     . ARG A 1  584  ? 136.707 87.432  123.195 1.00 54.74  ? 584  ARG A N     1 
ATOM   3981  C  CA    . ARG A 1  584  ? 137.744 87.810  122.245 1.00 53.99  ? 584  ARG A CA    1 
ATOM   3982  C  C     . ARG A 1  584  ? 137.279 88.801  121.189 1.00 55.29  ? 584  ARG A C     1 
ATOM   3983  O  O     . ARG A 1  584  ? 138.109 89.539  120.653 1.00 56.64  ? 584  ARG A O     1 
ATOM   3984  C  CB    . ARG A 1  584  ? 138.301 86.561  121.543 1.00 57.95  ? 584  ARG A CB    1 
ATOM   3985  C  CG    . ARG A 1  584  ? 138.907 85.541  122.495 1.00 59.02  ? 584  ARG A CG    1 
ATOM   3986  C  CD    . ARG A 1  584  ? 139.323 84.272  121.767 1.00 60.33  ? 584  ARG A CD    1 
ATOM   3987  N  NE    . ARG A 1  584  ? 138.178 83.563  121.201 1.00 60.96  ? 584  ARG A NE    1 
ATOM   3988  C  CZ    . ARG A 1  584  ? 138.265 82.410  120.547 1.00 60.45  ? 584  ARG A CZ    1 
ATOM   3989  N  NH1   . ARG A 1  584  ? 139.445 81.830  120.374 1.00 51.91  ? 584  ARG A NH1   1 
ATOM   3990  N  NH2   . ARG A 1  584  ? 137.172 81.834  120.065 1.00 51.63  ? 584  ARG A NH2   1 
ATOM   3991  N  N     . ASP A 1  585  ? 135.986 88.839  120.877 1.00 50.13  ? 585  ASP A N     1 
ATOM   3992  C  CA    . ASP A 1  585  ? 135.479 89.762  119.875 1.00 49.24  ? 585  ASP A CA    1 
ATOM   3993  C  C     . ASP A 1  585  ? 135.502 91.196  120.406 1.00 49.73  ? 585  ASP A C     1 
ATOM   3994  O  O     . ASP A 1  585  ? 135.778 91.453  121.581 1.00 50.09  ? 585  ASP A O     1 
ATOM   3995  C  CB    . ASP A 1  585  ? 134.062 89.371  119.455 1.00 50.51  ? 585  ASP A CB    1 
ATOM   3996  C  CG    . ASP A 1  585  ? 133.089 89.373  120.617 1.00 50.45  ? 585  ASP A CG    1 
ATOM   3997  O  OD1   . ASP A 1  585  ? 133.536 89.209  121.770 1.00 47.90  ? 585  ASP A OD1   1 
ATOM   3998  O  OD2   . ASP A 1  585  ? 131.874 89.538  120.376 1.00 47.78  ? 585  ASP A OD2   1 
ATOM   3999  N  N     . VAL A 1  586  ? 135.204 92.138  119.516 1.00 46.58  ? 586  VAL A N     1 
ATOM   4000  C  CA    . VAL A 1  586  ? 135.217 93.561  119.830 1.00 45.63  ? 586  VAL A CA    1 
ATOM   4001  C  C     . VAL A 1  586  ? 133.786 94.079  119.812 1.00 46.14  ? 586  VAL A C     1 
ATOM   4002  O  O     . VAL A 1  586  ? 132.970 93.650  118.989 1.00 46.49  ? 586  VAL A O     1 
ATOM   4003  C  CB    . VAL A 1  586  ? 136.101 94.347  118.840 1.00 46.61  ? 586  VAL A CB    1 
ATOM   4004  C  CG1   . VAL A 1  586  ? 136.365 95.751  119.357 1.00 44.39  ? 586  VAL A CG1   1 
ATOM   4005  C  CG2   . VAL A 1  586  ? 137.407 93.606  118.593 1.00 43.69  ? 586  VAL A CG2   1 
ATOM   4006  N  N     . VAL A 1  587  ? 133.484 95.003  120.723 1.00 44.25  ? 587  VAL A N     1 
ATOM   4007  C  CA    . VAL A 1  587  ? 132.157 95.592  120.849 1.00 44.49  ? 587  VAL A CA    1 
ATOM   4008  C  C     . VAL A 1  587  ? 132.300 97.107  120.904 1.00 45.13  ? 587  VAL A C     1 
ATOM   4009  O  O     . VAL A 1  587  ? 133.212 97.631  121.553 1.00 45.19  ? 587  VAL A O     1 
ATOM   4010  C  CB    . VAL A 1  587  ? 131.416 95.061  122.097 1.00 45.78  ? 587  VAL A CB    1 
ATOM   4011  C  CG1   . VAL A 1  587  ? 130.084 95.773  122.283 1.00 44.59  ? 587  VAL A CG1   1 
ATOM   4012  C  CG2   . VAL A 1  587  ? 131.202 93.559  121.984 1.00 44.25  ? 587  VAL A CG2   1 
ATOM   4013  N  N     . LEU A 1  588  ? 131.399 97.806  120.221 1.00 45.86  ? 588  LEU A N     1 
ATOM   4014  C  CA    . LEU A 1  588  ? 131.426 99.258  120.140 1.00 47.58  ? 588  LEU A CA    1 
ATOM   4015  C  C     . LEU A 1  588  ? 130.548 99.868  121.228 1.00 48.81  ? 588  LEU A C     1 
ATOM   4016  O  O     . LEU A 1  588  ? 129.550 99.280  121.653 1.00 50.08  ? 588  LEU A O     1 
ATOM   4017  C  CB    . LEU A 1  588  ? 130.959 99.714  118.754 1.00 50.61  ? 588  LEU A CB    1 
ATOM   4018  C  CG    . LEU A 1  588  ? 131.061 101.180 118.315 1.00 50.36  ? 588  LEU A CG    1 
ATOM   4019  C  CD1   . LEU A 1  588  ? 129.843 101.985 118.758 1.00 48.43  ? 588  LEU A CD1   1 
ATOM   4020  C  CD2   . LEU A 1  588  ? 132.351 101.815 118.818 1.00 47.98  ? 588  LEU A CD2   1 
ATOM   4021  N  N     . MET A 1  589  ? 130.936 101.059 121.681 1.00 47.79  ? 589  MET A N     1 
ATOM   4022  C  CA    . MET A 1  589  ? 130.176 101.794 122.682 1.00 47.13  ? 589  MET A CA    1 
ATOM   4023  C  C     . MET A 1  589  ? 130.121 103.268 122.310 1.00 48.08  ? 589  MET A C     1 
ATOM   4024  O  O     . MET A 1  589  ? 131.078 103.814 121.756 1.00 49.13  ? 589  MET A O     1 
ATOM   4025  C  CB    . MET A 1  589  ? 130.783 101.633 124.082 1.00 50.06  ? 589  MET A CB    1 
ATOM   4026  C  CG    . MET A 1  589  ? 130.021 100.669 124.975 1.00 50.57  ? 589  MET A CG    1 
ATOM   4027  S  SD    . MET A 1  589  ? 130.499 100.801 126.708 1.00 45.73  ? 589  MET A SD    1 
ATOM   4028  C  CE    . MET A 1  589  ? 129.243 99.786  127.480 1.00 45.64  ? 589  MET A CE    1 
ATOM   4029  N  N     . ASN A 1  590  ? 128.991 103.902 122.617 1.00 44.70  ? 590  ASN A N     1 
ATOM   4030  C  CA    . ASN A 1  590  ? 128.797 105.321 122.362 1.00 44.26  ? 590  ASN A CA    1 
ATOM   4031  C  C     . ASN A 1  590  ? 127.966 105.920 123.487 1.00 43.65  ? 590  ASN A C     1 
ATOM   4032  O  O     . ASN A 1  590  ? 127.075 105.266 124.036 1.00 42.96  ? 590  ASN A O     1 
ATOM   4033  C  CB    . ASN A 1  590  ? 128.112 105.566 121.010 1.00 42.86  ? 590  ASN A CB    1 
ATOM   4034  C  CG    . ASN A 1  590  ? 127.874 107.039 120.736 1.00 42.72  ? 590  ASN A CG    1 
ATOM   4035  O  OD1   . ASN A 1  590  ? 128.585 107.903 121.249 1.00 44.59  ? 590  ASN A OD1   1 
ATOM   4036  N  ND2   . ASN A 1  590  ? 126.867 107.333 119.920 1.00 45.70  ? 590  ASN A ND2   1 
ATOM   4037  N  N     . ARG A 1  591  ? 128.266 107.171 123.824 1.00 44.58  ? 591  ARG A N     1 
ATOM   4038  C  CA    . ARG A 1  591  ? 127.566 107.894 124.874 1.00 45.09  ? 591  ARG A CA    1 
ATOM   4039  C  C     . ARG A 1  591  ? 126.874 109.111 124.274 1.00 46.19  ? 591  ARG A C     1 
ATOM   4040  O  O     . ARG A 1  591  ? 127.479 109.865 123.505 1.00 47.28  ? 591  ARG A O     1 
ATOM   4041  C  CB    . ARG A 1  591  ? 128.530 108.323 125.989 1.00 48.31  ? 591  ARG A CB    1 
ATOM   4042  C  CG    . ARG A 1  591  ? 127.858 108.684 127.310 1.00 48.92  ? 591  ARG A CG    1 
ATOM   4043  C  CD    . ARG A 1  591  ? 127.474 110.155 127.375 1.00 49.42  ? 591  ARG A CD    1 
ATOM   4044  N  NE    . ARG A 1  591  ? 126.802 110.489 128.627 1.00 49.47  ? 591  ARG A NE    1 
ATOM   4045  C  CZ    . ARG A 1  591  ? 126.369 111.705 128.942 1.00 49.60  ? 591  ARG A CZ    1 
ATOM   4046  N  NH1   . ARG A 1  591  ? 125.768 111.917 130.105 1.00 45.33  ? 591  ARG A NH1   1 
ATOM   4047  N  NH2   . ARG A 1  591  ? 126.538 112.711 128.095 1.00 45.68  ? 591  ARG A NH2   1 
ATOM   4048  N  N     . GLN A 1  592  ? 125.592 109.296 124.632 1.00 47.05  ? 592  GLN A N     1 
ATOM   4049  C  CA    . GLN A 1  592  ? 124.811 110.416 124.129 1.00 49.08  ? 592  GLN A CA    1 
ATOM   4050  C  C     . GLN A 1  592  ? 124.668 111.496 125.194 1.00 50.25  ? 592  GLN A C     1 
ATOM   4051  O  O     . GLN A 1  592  ? 124.429 111.184 126.366 1.00 50.77  ? 592  GLN A O     1 
ATOM   4052  C  CB    . GLN A 1  592  ? 123.420 109.955 123.690 1.00 51.10  ? 592  GLN A CB    1 
ATOM   4053  C  CG    . GLN A 1  592  ? 123.427 108.970 122.532 1.00 51.19  ? 592  GLN A CG    1 
ATOM   4054  C  CD    . GLN A 1  592  ? 122.030 108.553 122.115 1.00 51.38  ? 592  GLN A CD    1 
ATOM   4055  O  OE1   . GLN A 1  592  ? 121.047 108.887 122.776 1.00 49.69  ? 592  GLN A OE1   1 
ATOM   4056  N  NE2   . GLN A 1  592  ? 121.937 107.821 121.012 1.00 50.88  ? 592  GLN A NE2   1 
ATOM   4057  N  N     . PRO A 1  593  ? 124.809 112.778 124.822 1.00 49.14  ? 593  PRO A N     1 
ATOM   4058  C  CA    . PRO A 1  593  ? 125.141 113.202 123.457 1.00 48.57  ? 593  PRO A CA    1 
ATOM   4059  C  C     . PRO A 1  593  ? 126.645 113.253 123.195 1.00 49.07  ? 593  PRO A C     1 
ATOM   4060  O  O     . PRO A 1  593  ? 127.390 113.857 123.967 1.00 49.33  ? 593  PRO A O     1 
ATOM   4061  C  CB    . PRO A 1  593  ? 124.529 114.600 123.377 1.00 49.32  ? 593  PRO A CB    1 
ATOM   4062  C  CG    . PRO A 1  593  ? 124.618 115.116 124.772 1.00 48.20  ? 593  PRO A CG    1 
ATOM   4063  C  CD    . PRO A 1  593  ? 124.476 113.923 125.689 1.00 47.65  ? 593  PRO A CD    1 
ATOM   4064  N  N     . THR A 1  594  ? 127.085 112.614 122.113 1.00 48.90  ? 594  THR A N     1 
ATOM   4065  C  CA    . THR A 1  594  ? 128.488 112.656 121.728 1.00 49.73  ? 594  THR A CA    1 
ATOM   4066  C  C     . THR A 1  594  ? 128.810 114.004 121.094 1.00 49.66  ? 594  THR A C     1 
ATOM   4067  O  O     . THR A 1  594  ? 128.069 114.490 120.234 1.00 49.09  ? 594  THR A O     1 
ATOM   4068  C  CB    . THR A 1  594  ? 128.817 111.516 120.762 1.00 49.55  ? 594  THR A CB    1 
ATOM   4069  O  OG1   . THR A 1  594  ? 130.097 111.748 120.160 1.00 50.64  ? 594  THR A OG1   1 
ATOM   4070  C  CG2   . THR A 1  594  ? 127.754 111.401 119.675 1.00 51.08  ? 594  THR A CG2   1 
ATOM   4071  N  N     . LEU A 1  595  ? 129.912 114.614 121.530 1.00 51.59  ? 595  LEU A N     1 
ATOM   4072  C  CA    . LEU A 1  595  ? 130.292 115.928 121.030 1.00 51.96  ? 595  LEU A CA    1 
ATOM   4073  C  C     . LEU A 1  595  ? 131.771 116.060 120.698 1.00 52.66  ? 595  LEU A C     1 
ATOM   4074  O  O     . LEU A 1  595  ? 132.204 117.162 120.349 1.00 53.01  ? 595  LEU A O     1 
ATOM   4075  C  CB    . LEU A 1  595  ? 129.909 117.019 122.046 1.00 52.99  ? 595  LEU A CB    1 
ATOM   4076  C  CG    . LEU A 1  595  ? 128.415 117.263 122.277 1.00 52.89  ? 595  LEU A CG    1 
ATOM   4077  C  CD1   . LEU A 1  595  ? 128.206 118.314 123.356 1.00 51.17  ? 595  LEU A CD1   1 
ATOM   4078  C  CD2   . LEU A 1  595  ? 127.733 117.677 120.983 1.00 51.09  ? 595  LEU A CD2   1 
ATOM   4079  N  N     . HIS A 1  596  ? 132.557 114.991 120.789 1.00 50.48  ? 596  HIS A N     1 
ATOM   4080  C  CA    . HIS A 1  596  ? 133.985 115.073 120.517 1.00 50.23  ? 596  HIS A CA    1 
ATOM   4081  C  C     . HIS A 1  596  ? 134.469 113.718 120.012 1.00 50.75  ? 596  HIS A C     1 
ATOM   4082  O  O     . HIS A 1  596  ? 133.674 112.819 119.723 1.00 51.91  ? 596  HIS A O     1 
ATOM   4083  C  CB    . HIS A 1  596  ? 134.745 115.541 121.764 1.00 52.55  ? 596  HIS A CB    1 
ATOM   4084  C  CG    . HIS A 1  596  ? 134.500 114.695 122.974 1.00 53.36  ? 596  HIS A CG    1 
ATOM   4085  N  ND1   . HIS A 1  596  ? 135.322 113.648 123.329 1.00 53.63  ? 596  HIS A ND1   1 
ATOM   4086  C  CD2   . HIS A 1  596  ? 133.523 114.741 123.911 1.00 53.03  ? 596  HIS A CD2   1 
ATOM   4087  C  CE1   . HIS A 1  596  ? 134.864 113.086 124.433 1.00 49.73  ? 596  HIS A CE1   1 
ATOM   4088  N  NE2   . HIS A 1  596  ? 133.773 113.730 124.807 1.00 49.26  ? 596  HIS A NE2   1 
ATOM   4089  N  N     . LYS A 1  597  ? 135.792 113.577 119.909 1.00 50.59  ? 597  LYS A N     1 
ATOM   4090  C  CA    . LYS A 1  597  ? 136.388 112.371 119.343 1.00 51.91  ? 597  LYS A CA    1 
ATOM   4091  C  C     . LYS A 1  597  ? 136.427 111.221 120.342 1.00 53.31  ? 597  LYS A C     1 
ATOM   4092  O  O     . LYS A 1  597  ? 136.278 110.060 119.947 1.00 54.90  ? 597  LYS A O     1 
ATOM   4093  C  CB    . LYS A 1  597  ? 137.798 112.686 118.834 1.00 56.27  ? 597  LYS A CB    1 
ATOM   4094  C  CG    . LYS A 1  597  ? 138.484 111.558 118.078 1.00 57.48  ? 597  LYS A CG    1 
ATOM   4095  C  CD    . LYS A 1  597  ? 139.502 110.839 118.949 1.00 57.73  ? 597  LYS A CD    1 
ATOM   4096  C  CE    . LYS A 1  597  ? 140.506 110.070 118.105 1.00 52.15  ? 597  LYS A CE    1 
ATOM   4097  N  NZ    . LYS A 1  597  ? 139.842 109.117 117.176 1.00 52.31  ? 597  LYS A NZ    1 
ATOM   4098  N  N     . ALA A 1  598  ? 136.618 111.516 121.625 1.00 52.28  ? 598  ALA A N     1 
ATOM   4099  C  CA    . ALA A 1  598  ? 136.727 110.487 122.651 1.00 52.01  ? 598  ALA A CA    1 
ATOM   4100  C  C     . ALA A 1  598  ? 135.378 110.035 123.193 1.00 52.36  ? 598  ALA A C     1 
ATOM   4101  O  O     . ALA A 1  598  ? 135.342 109.212 124.114 1.00 51.49  ? 598  ALA A O     1 
ATOM   4102  C  CB    . ALA A 1  598  ? 137.605 110.985 123.805 1.00 51.28  ? 598  ALA A CB    1 
ATOM   4103  N  N     . SER A 1  599  ? 134.272 110.548 122.654 1.00 50.60  ? 599  SER A N     1 
ATOM   4104  C  CA    . SER A 1  599  ? 132.937 110.129 123.056 1.00 49.21  ? 599  SER A CA    1 
ATOM   4105  C  C     . SER A 1  599  ? 132.412 108.973 122.212 1.00 48.79  ? 599  SER A C     1 
ATOM   4106  O  O     . SER A 1  599  ? 131.201 108.725 122.197 1.00 49.03  ? 599  SER A O     1 
ATOM   4107  C  CB    . SER A 1  599  ? 131.970 111.314 122.992 1.00 48.23  ? 599  SER A CB    1 
ATOM   4108  O  OG    . SER A 1  599  ? 130.688 110.949 123.472 1.00 47.62  ? 599  SER A OG    1 
ATOM   4109  N  N     . MET A 1  600  ? 133.298 108.266 121.512 1.00 47.79  ? 600  MET A N     1 
ATOM   4110  C  CA    . MET A 1  600  ? 132.911 107.161 120.637 1.00 47.45  ? 600  MET A CA    1 
ATOM   4111  C  C     . MET A 1  600  ? 134.085 106.186 120.623 1.00 47.80  ? 600  MET A C     1 
ATOM   4112  O  O     . MET A 1  600  ? 135.062 106.401 119.901 1.00 47.85  ? 600  MET A O     1 
ATOM   4113  C  CB    . MET A 1  600  ? 132.573 107.669 119.241 1.00 47.83  ? 600  MET A CB    1 
ATOM   4114  C  CG    . MET A 1  600  ? 132.457 106.598 118.169 1.00 48.05  ? 600  MET A CG    1 
ATOM   4115  S  SD    . MET A 1  600  ? 131.000 105.554 118.336 1.00 46.90  ? 600  MET A SD    1 
ATOM   4116  C  CE    . MET A 1  600  ? 131.070 104.669 116.781 1.00 47.00  ? 600  MET A CE    1 
ATOM   4117  N  N     . MET A 1  601  ? 133.990 105.131 121.428 1.00 46.98  ? 601  MET A N     1 
ATOM   4118  C  CA    . MET A 1  601  ? 135.110 104.226 121.642 1.00 47.37  ? 601  MET A CA    1 
ATOM   4119  C  C     . MET A 1  601  ? 134.622 102.785 121.636 1.00 47.72  ? 601  MET A C     1 
ATOM   4120  O  O     . MET A 1  601  ? 133.490 102.493 122.031 1.00 47.66  ? 601  MET A O     1 
ATOM   4121  C  CB    . MET A 1  601  ? 135.829 104.527 122.965 1.00 47.87  ? 601  MET A CB    1 
ATOM   4122  C  CG    . MET A 1  601  ? 136.400 105.936 123.061 1.00 48.34  ? 601  MET A CG    1 
ATOM   4123  S  SD    . MET A 1  601  ? 136.952 106.365 124.722 1.00 47.51  ? 601  MET A SD    1 
ATOM   4124  C  CE    . MET A 1  601  ? 138.203 105.116 124.999 1.00 48.19  ? 601  MET A CE    1 
ATOM   4125  N  N     . GLY A 1  602  ? 135.496 101.885 121.194 1.00 47.17  ? 602  GLY A N     1 
ATOM   4126  C  CA    . GLY A 1  602  ? 135.201 100.466 121.178 1.00 47.27  ? 602  GLY A CA    1 
ATOM   4127  C  C     . GLY A 1  602  ? 136.211 99.701  122.010 1.00 47.53  ? 602  GLY A C     1 
ATOM   4128  O  O     . GLY A 1  602  ? 137.385 100.068 122.084 1.00 47.56  ? 602  GLY A O     1 
ATOM   4129  N  N     . HIS A 1  603  ? 135.743 98.626  122.640 1.00 48.45  ? 603  HIS A N     1 
ATOM   4130  C  CA    . HIS A 1  603  ? 136.566 97.830  123.541 1.00 49.69  ? 603  HIS A CA    1 
ATOM   4131  C  C     . HIS A 1  603  ? 136.198 96.363  123.355 1.00 51.14  ? 603  HIS A C     1 
ATOM   4132  O  O     . HIS A 1  603  ? 135.392 96.008  122.488 1.00 52.57  ? 603  HIS A O     1 
ATOM   4133  C  CB    . HIS A 1  603  ? 136.373 98.281  124.997 1.00 53.95  ? 603  HIS A CB    1 
ATOM   4134  C  CG    . HIS A 1  603  ? 136.393 99.767  125.184 1.00 54.66  ? 603  HIS A CG    1 
ATOM   4135  N  ND1   . HIS A 1  603  ? 137.544 100.464 125.481 1.00 54.32  ? 603  HIS A ND1   1 
ATOM   4136  C  CD2   . HIS A 1  603  ? 135.402 100.687 125.120 1.00 53.22  ? 603  HIS A CD2   1 
ATOM   4137  C  CE1   . HIS A 1  603  ? 137.260 101.750 125.590 1.00 49.40  ? 603  HIS A CE1   1 
ATOM   4138  N  NE2   . HIS A 1  603  ? 135.967 101.912 125.375 1.00 49.80  ? 603  HIS A NE2   1 
ATOM   4139  N  N     . LYS A 1  604  ? 136.795 95.501  124.173 1.00 49.05  ? 604  LYS A N     1 
ATOM   4140  C  CA    . LYS A 1  604  ? 136.423 94.096  124.240 1.00 49.16  ? 604  LYS A CA    1 
ATOM   4141  C  C     . LYS A 1  604  ? 135.586 93.855  125.489 1.00 49.60  ? 604  LYS A C     1 
ATOM   4142  O  O     . LYS A 1  604  ? 135.668 94.605  126.465 1.00 50.12  ? 604  LYS A O     1 
ATOM   4143  C  CB    . LYS A 1  604  ? 137.656 93.182  124.243 1.00 50.52  ? 604  LYS A CB    1 
ATOM   4144  C  CG    . LYS A 1  604  ? 138.476 93.208  125.527 1.00 50.98  ? 604  LYS A CG    1 
ATOM   4145  C  CD    . LYS A 1  604  ? 139.526 94.309  125.507 1.00 51.31  ? 604  LYS A CD    1 
ATOM   4146  C  CE    . LYS A 1  604  ? 140.606 94.028  124.476 1.00 49.19  ? 604  LYS A CE    1 
ATOM   4147  N  NZ    . LYS A 1  604  ? 141.656 95.084  124.475 1.00 48.84  ? 604  LYS A NZ    1 
ATOM   4148  N  N     . VAL A 1  605  ? 134.773 92.806  125.450 1.00 49.98  ? 605  VAL A N     1 
ATOM   4149  C  CA    . VAL A 1  605  ? 133.819 92.528  126.517 1.00 51.01  ? 605  VAL A CA    1 
ATOM   4150  C  C     . VAL A 1  605  ? 134.276 91.319  127.319 1.00 51.35  ? 605  VAL A C     1 
ATOM   4151  O  O     . VAL A 1  605  ? 134.993 90.442  126.823 1.00 51.74  ? 605  VAL A O     1 
ATOM   4152  C  CB    . VAL A 1  605  ? 132.398 92.312  125.957 1.00 51.14  ? 605  VAL A CB    1 
ATOM   4153  C  CG1   . VAL A 1  605  ? 131.790 93.639  125.538 1.00 51.59  ? 605  VAL A CG1   1 
ATOM   4154  C  CG2   . VAL A 1  605  ? 132.433 91.342  124.787 1.00 50.94  ? 605  VAL A CG2   1 
ATOM   4155  N  N     . ARG A 1  606  ? 133.852 91.280  128.582 1.00 52.18  ? 606  ARG A N     1 
ATOM   4156  C  CA    . ARG A 1  606  ? 134.106 90.150  129.478 1.00 52.01  ? 606  ARG A CA    1 
ATOM   4157  C  C     . ARG A 1  606  ? 132.812 89.914  130.251 1.00 52.44  ? 606  ARG A C     1 
ATOM   4158  O  O     . ARG A 1  606  ? 132.483 90.674  131.167 1.00 53.05  ? 606  ARG A O     1 
ATOM   4159  C  CB    . ARG A 1  606  ? 135.282 90.429  130.407 1.00 53.44  ? 606  ARG A CB    1 
ATOM   4160  C  CG    . ARG A 1  606  ? 135.735 89.234  131.238 1.00 53.87  ? 606  ARG A CG    1 
ATOM   4161  C  CD    . ARG A 1  606  ? 135.099 89.232  132.621 1.00 54.17  ? 606  ARG A CD    1 
ATOM   4162  N  NE    . ARG A 1  606  ? 135.536 88.091  133.420 1.00 54.29  ? 606  ARG A NE    1 
ATOM   4163  C  CZ    . ARG A 1  606  ? 136.608 88.096  134.207 1.00 54.27  ? 606  ARG A CZ    1 
ATOM   4164  N  NH1   . ARG A 1  606  ? 136.930 87.012  134.899 1.00 51.62  ? 606  ARG A NH1   1 
ATOM   4165  N  NH2   . ARG A 1  606  ? 137.359 89.185  134.301 1.00 51.96  ? 606  ARG A NH2   1 
ATOM   4166  N  N     . VAL A 1  607  ? 132.082 88.862  129.877 1.00 51.16  ? 607  VAL A N     1 
ATOM   4167  C  CA    . VAL A 1  607  ? 130.757 88.629  130.436 1.00 51.19  ? 607  VAL A CA    1 
ATOM   4168  C  C     . VAL A 1  607  ? 130.861 88.272  131.915 1.00 51.04  ? 607  VAL A C     1 
ATOM   4169  O  O     . VAL A 1  607  ? 131.898 87.798  132.399 1.00 51.21  ? 607  VAL A O     1 
ATOM   4170  C  CB    . VAL A 1  607  ? 130.026 87.524  129.652 1.00 51.30  ? 607  VAL A CB    1 
ATOM   4171  C  CG1   . VAL A 1  607  ? 130.017 87.843  128.165 1.00 51.92  ? 607  VAL A CG1   1 
ATOM   4172  C  CG2   . VAL A 1  607  ? 130.672 86.172  129.909 1.00 52.71  ? 607  VAL A CG2   1 
ATOM   4173  N  N     . LEU A 1  608  ? 129.771 88.510  132.643 1.00 51.96  ? 608  LEU A N     1 
ATOM   4174  C  CA    . LEU A 1  608  ? 129.670 88.123  134.045 1.00 52.01  ? 608  LEU A CA    1 
ATOM   4175  C  C     . LEU A 1  608  ? 128.237 87.694  134.346 1.00 52.14  ? 608  LEU A C     1 
ATOM   4176  O  O     . LEU A 1  608  ? 127.310 88.512  134.282 1.00 52.38  ? 608  LEU A O     1 
ATOM   4177  C  CB    . LEU A 1  608  ? 130.125 89.261  134.970 1.00 52.48  ? 608  LEU A CB    1 
ATOM   4178  C  CG    . LEU A 1  608  ? 129.360 90.582  135.135 1.00 52.31  ? 608  LEU A CG    1 
ATOM   4179  C  CD1   . LEU A 1  608  ? 129.935 91.380  136.297 1.00 52.26  ? 608  LEU A CD1   1 
ATOM   4180  C  CD2   . LEU A 1  608  ? 129.371 91.418  133.864 1.00 52.17  ? 608  LEU A CD2   1 
ATOM   4181  N  N     . PRO A 1  609  ? 128.007 86.399  134.646 1.00 53.42  ? 609  PRO A N     1 
ATOM   4182  C  CA    . PRO A 1  609  ? 126.644 85.910  134.930 1.00 53.98  ? 609  PRO A CA    1 
ATOM   4183  C  C     . PRO A 1  609  ? 126.190 86.237  136.350 1.00 54.55  ? 609  PRO A C     1 
ATOM   4184  O  O     . PRO A 1  609  ? 125.908 85.355  137.164 1.00 54.67  ? 609  PRO A O     1 
ATOM   4185  C  CB    . PRO A 1  609  ? 126.779 84.397  134.692 1.00 54.07  ? 609  PRO A CB    1 
ATOM   4186  C  CG    . PRO A 1  609  ? 128.117 84.192  134.021 1.00 53.63  ? 609  PRO A CG    1 
ATOM   4187  C  CD    . PRO A 1  609  ? 128.971 85.296  134.524 1.00 54.29  ? 609  PRO A CD    1 
ATOM   4188  N  N     . ASN A 1  610  ? 126.117 87.531  136.659 1.00 52.79  ? 610  ASN A N     1 
ATOM   4189  C  CA    . ASN A 1  610  ? 125.776 87.971  138.006 1.00 52.40  ? 610  ASN A CA    1 
ATOM   4190  C  C     . ASN A 1  610  ? 124.488 88.774  138.072 1.00 52.71  ? 610  ASN A C     1 
ATOM   4191  O  O     . ASN A 1  610  ? 123.588 88.422  138.843 1.00 53.25  ? 610  ASN A O     1 
ATOM   4192  C  CB    . ASN A 1  610  ? 126.936 88.788  138.598 1.00 53.38  ? 610  ASN A CB    1 
ATOM   4193  C  CG    . ASN A 1  610  ? 128.184 87.955  138.809 1.00 53.80  ? 610  ASN A CG    1 
ATOM   4194  O  OD1   . ASN A 1  610  ? 128.289 87.213  139.785 1.00 52.15  ? 610  ASN A OD1   1 
ATOM   4195  N  ND2   . ASN A 1  610  ? 129.138 88.075  137.895 1.00 52.44  ? 610  ASN A ND2   1 
ATOM   4196  N  N     . GLU A 1  611  ? 124.362 89.840  137.286 1.00 52.21  ? 611  GLU A N     1 
ATOM   4197  C  CA    . GLU A 1  611  ? 123.247 90.767  137.450 1.00 52.76  ? 611  GLU A CA    1 
ATOM   4198  C  C     . GLU A 1  611  ? 122.845 91.323  136.087 1.00 54.32  ? 611  GLU A C     1 
ATOM   4199  O  O     . GLU A 1  611  ? 123.265 90.820  135.040 1.00 55.96  ? 611  GLU A O     1 
ATOM   4200  C  CB    . GLU A 1  611  ? 123.610 91.857  138.466 1.00 56.93  ? 611  GLU A CB    1 
ATOM   4201  C  CG    . GLU A 1  611  ? 123.329 91.449  139.910 1.00 57.61  ? 611  GLU A CG    1 
ATOM   4202  C  CD    . GLU A 1  611  ? 124.038 92.321  140.927 1.00 57.28  ? 611  GLU A CD    1 
ATOM   4203  O  OE1   . GLU A 1  611  ? 125.093 92.896  140.590 1.00 51.72  ? 611  GLU A OE1   1 
ATOM   4204  O  OE2   . GLU A 1  611  ? 123.541 92.426  142.068 1.00 51.46  ? 611  GLU A OE2   1 
ATOM   4205  N  N     . LYS A 1  612  ? 122.021 92.373  136.106 1.00 51.38  ? 612  LYS A N     1 
ATOM   4206  C  CA    . LYS A 1  612  ? 121.202 92.758  134.963 1.00 51.35  ? 612  LYS A CA    1 
ATOM   4207  C  C     . LYS A 1  612  ? 121.764 93.905  134.131 1.00 51.94  ? 612  LYS A C     1 
ATOM   4208  O  O     . LYS A 1  612  ? 121.575 93.910  132.911 1.00 52.77  ? 612  LYS A O     1 
ATOM   4209  C  CB    . LYS A 1  612  ? 119.797 93.142  135.445 1.00 53.75  ? 612  LYS A CB    1 
ATOM   4210  C  CG    . LYS A 1  612  ? 118.755 93.277  134.346 1.00 54.50  ? 612  LYS A CG    1 
ATOM   4211  C  CD    . LYS A 1  612  ? 118.466 91.938  133.688 1.00 54.79  ? 612  LYS A CD    1 
ATOM   4212  C  CE    . LYS A 1  612  ? 116.970 91.728  133.503 1.00 50.52  ? 612  LYS A CE    1 
ATOM   4213  N  NZ    . LYS A 1  612  ? 116.310 92.898  132.861 1.00 50.05  ? 612  LYS A NZ    1 
ATOM   4214  N  N     . THR A 1  613  ? 122.432 94.881  134.739 1.00 50.74  ? 613  THR A N     1 
ATOM   4215  C  CA    . THR A 1  613  ? 122.820 96.093  134.029 1.00 50.85  ? 613  THR A CA    1 
ATOM   4216  C  C     . THR A 1  613  ? 124.243 95.987  133.485 1.00 51.63  ? 613  THR A C     1 
ATOM   4217  O  O     . THR A 1  613  ? 124.975 95.031  133.750 1.00 51.55  ? 613  THR A O     1 
ATOM   4218  C  CB    . THR A 1  613  ? 122.689 97.320  134.938 1.00 52.13  ? 613  THR A CB    1 
ATOM   4219  O  OG1   . THR A 1  613  ? 122.659 98.506  134.135 1.00 50.94  ? 613  THR A OG1   1 
ATOM   4220  C  CG2   . THR A 1  613  ? 123.865 97.406  135.894 1.00 50.75  ? 613  THR A CG2   1 
ATOM   4221  N  N     . LEU A 1  614  ? 124.626 97.000  132.709 1.00 51.47  ? 614  LEU A N     1 
ATOM   4222  C  CA    . LEU A 1  614  ? 125.935 97.037  132.076 1.00 52.08  ? 614  LEU A CA    1 
ATOM   4223  C  C     . LEU A 1  614  ? 127.026 97.362  133.095 1.00 52.52  ? 614  LEU A C     1 
ATOM   4224  O  O     . LEU A 1  614  ? 126.761 97.710  134.251 1.00 53.38  ? 614  LEU A O     1 
ATOM   4225  C  CB    . LEU A 1  614  ? 125.956 98.068  130.948 1.00 53.80  ? 614  LEU A CB    1 
ATOM   4226  C  CG    . LEU A 1  614  ? 125.948 97.533  129.516 1.00 53.84  ? 614  LEU A CG    1 
ATOM   4227  C  CD1   . LEU A 1  614  ? 127.213 96.738  129.237 1.00 52.02  ? 614  LEU A CD1   1 
ATOM   4228  C  CD2   . LEU A 1  614  ? 124.716 96.683  129.275 1.00 51.89  ? 614  LEU A CD2   1 
ATOM   4229  N  N     . ARG A 1  615  ? 128.274 97.251  132.644 1.00 52.06  ? 615  ARG A N     1 
ATOM   4230  C  CA    . ARG A 1  615  ? 129.443 97.531  133.462 1.00 52.70  ? 615  ARG A CA    1 
ATOM   4231  C  C     . ARG A 1  615  ? 130.394 98.439  132.696 1.00 52.91  ? 615  ARG A C     1 
ATOM   4232  O  O     . ARG A 1  615  ? 130.588 98.270  131.489 1.00 52.84  ? 615  ARG A O     1 
ATOM   4233  C  CB    . ARG A 1  615  ? 130.167 96.240  133.864 1.00 52.72  ? 615  ARG A CB    1 
ATOM   4234  C  CG    . ARG A 1  615  ? 129.283 95.203  134.542 1.00 52.37  ? 615  ARG A CG    1 
ATOM   4235  C  CD    . ARG A 1  615  ? 128.696 95.730  135.842 1.00 52.20  ? 615  ARG A CD    1 
ATOM   4236  N  NE    . ARG A 1  615  ? 128.200 94.649  136.688 1.00 52.07  ? 615  ARG A NE    1 
ATOM   4237  C  CZ    . ARG A 1  615  ? 126.967 94.158  136.628 1.00 52.27  ? 615  ARG A CZ    1 
ATOM   4238  N  NH1   . ARG A 1  615  ? 126.605 93.172  137.437 1.00 53.18  ? 615  ARG A NH1   1 
ATOM   4239  N  NH2   . ARG A 1  615  ? 126.095 94.654  135.763 1.00 53.47  ? 615  ARG A NH2   1 
ATOM   4240  N  N     . LEU A 1  616  ? 130.989 99.399  133.405 1.00 53.73  ? 616  LEU A N     1 
ATOM   4241  C  CA    . LEU A 1  616  ? 131.926 100.336 132.793 1.00 53.56  ? 616  LEU A CA    1 
ATOM   4242  C  C     . LEU A 1  616  ? 133.252 100.355 133.544 1.00 53.21  ? 616  LEU A C     1 
ATOM   4243  O  O     . LEU A 1  616  ? 133.465 99.558  134.463 1.00 53.36  ? 616  LEU A O     1 
ATOM   4244  C  CB    . LEU A 1  616  ? 131.326 101.743 132.745 1.00 53.33  ? 616  LEU A CB    1 
ATOM   4245  C  CG    . LEU A 1  616  ? 130.742 102.203 131.407 1.00 53.91  ? 616  LEU A CG    1 
ATOM   4246  C  CD1   . LEU A 1  616  ? 131.812 102.200 130.326 1.00 54.22  ? 616  LEU A CD1   1 
ATOM   4247  C  CD2   . LEU A 1  616  ? 129.560 101.340 130.997 1.00 54.36  ? 616  LEU A CD2   1 
ATOM   4248  N  N     . HIS A 1  617  ? 134.147 101.261 133.158 1.00 55.06  ? 617  HIS A N     1 
ATOM   4249  C  CA    . HIS A 1  617  ? 135.460 101.383 133.772 1.00 55.93  ? 617  HIS A CA    1 
ATOM   4250  C  C     . HIS A 1  617  ? 135.607 102.757 134.416 1.00 55.74  ? 617  HIS A C     1 
ATOM   4251  O  O     . HIS A 1  617  ? 134.833 103.680 134.148 1.00 54.81  ? 617  HIS A O     1 
ATOM   4252  C  CB    . HIS A 1  617  ? 136.579 101.154 132.744 1.00 54.63  ? 617  HIS A CB    1 
ATOM   4253  C  CG    . HIS A 1  617  ? 137.938 100.997 133.353 1.00 54.44  ? 617  HIS A CG    1 
ATOM   4254  N  ND1   . HIS A 1  617  ? 138.864 102.017 133.381 1.00 54.30  ? 617  HIS A ND1   1 
ATOM   4255  C  CD2   . HIS A 1  617  ? 138.524 99.942  133.965 1.00 54.23  ? 617  HIS A CD2   1 
ATOM   4256  C  CE1   . HIS A 1  617  ? 139.963 101.596 133.980 1.00 56.73  ? 617  HIS A CE1   1 
ATOM   4257  N  NE2   . HIS A 1  617  ? 139.783 100.340 134.344 1.00 57.08  ? 617  HIS A NE2   1 
ATOM   4258  N  N     . TYR A 1  618  ? 136.621 102.879 135.275 1.00 56.27  ? 618  TYR A N     1 
ATOM   4259  C  CA    . TYR A 1  618  ? 136.836 104.122 136.007 1.00 56.05  ? 618  TYR A CA    1 
ATOM   4260  C  C     . TYR A 1  618  ? 137.426 105.213 135.124 1.00 56.69  ? 618  TYR A C     1 
ATOM   4261  O  O     . TYR A 1  618  ? 137.154 106.399 135.344 1.00 57.66  ? 618  TYR A O     1 
ATOM   4262  C  CB    . TYR A 1  618  ? 137.747 103.866 137.206 1.00 58.42  ? 618  TYR A CB    1 
ATOM   4263  C  CG    . TYR A 1  618  ? 137.150 102.942 138.242 1.00 58.76  ? 618  TYR A CG    1 
ATOM   4264  C  CD1   . TYR A 1  618  ? 135.780 102.917 138.470 1.00 58.45  ? 618  TYR A CD1   1 
ATOM   4265  C  CD2   . TYR A 1  618  ? 137.956 102.098 138.996 1.00 57.68  ? 618  TYR A CD2   1 
ATOM   4266  C  CE1   . TYR A 1  618  ? 135.229 102.077 139.418 1.00 58.59  ? 618  TYR A CE1   1 
ATOM   4267  C  CE2   . TYR A 1  618  ? 137.414 101.255 139.947 1.00 58.30  ? 618  TYR A CE2   1 
ATOM   4268  C  CZ    . TYR A 1  618  ? 136.051 101.249 140.152 1.00 55.48  ? 618  TYR A CZ    1 
ATOM   4269  O  OH    . TYR A 1  618  ? 135.505 100.412 141.098 1.00 55.63  ? 618  TYR A OH    1 
ATOM   4270  N  N     . ALA A 1  619  ? 138.232 104.842 134.131 1.00 54.86  ? 619  ALA A N     1 
ATOM   4271  C  CA    . ALA A 1  619  ? 138.881 105.821 133.270 1.00 54.77  ? 619  ALA A CA    1 
ATOM   4272  C  C     . ALA A 1  619  ? 138.064 106.170 132.036 1.00 55.10  ? 619  ALA A C     1 
ATOM   4273  O  O     . ALA A 1  619  ? 138.316 107.211 131.418 1.00 53.62  ? 619  ALA A O     1 
ATOM   4274  C  CB    . ALA A 1  619  ? 140.259 105.313 132.835 1.00 52.98  ? 619  ALA A CB    1 
ATOM   4275  N  N     . ASN A 1  620  ? 137.096 105.332 131.661 1.00 52.61  ? 620  ASN A N     1 
ATOM   4276  C  CA    . ASN A 1  620  ? 136.305 105.598 130.467 1.00 52.10  ? 620  ASN A CA    1 
ATOM   4277  C  C     . ASN A 1  620  ? 135.283 106.707 130.690 1.00 52.67  ? 620  ASN A C     1 
ATOM   4278  O  O     . ASN A 1  620  ? 134.964 107.446 129.752 1.00 53.52  ? 620  ASN A O     1 
ATOM   4279  C  CB    . ASN A 1  620  ? 135.604 104.319 130.006 1.00 53.95  ? 620  ASN A CB    1 
ATOM   4280  C  CG    . ASN A 1  620  ? 135.042 104.434 128.603 1.00 54.13  ? 620  ASN A CG    1 
ATOM   4281  O  OD1   . ASN A 1  620  ? 135.383 105.352 127.856 1.00 51.54  ? 620  ASN A OD1   1 
ATOM   4282  N  ND2   . ASN A 1  620  ? 134.177 103.496 128.235 1.00 51.64  ? 620  ASN A ND2   1 
ATOM   4283  N  N     . THR A 1  621  ? 134.763 106.839 131.913 1.00 51.63  ? 621  THR A N     1 
ATOM   4284  C  CA    . THR A 1  621  ? 133.803 107.899 132.199 1.00 52.38  ? 621  THR A CA    1 
ATOM   4285  C  C     . THR A 1  621  ? 134.435 109.283 132.150 1.00 52.63  ? 621  THR A C     1 
ATOM   4286  O  O     . THR A 1  621  ? 133.721 110.268 131.935 1.00 52.45  ? 621  THR A O     1 
ATOM   4287  C  CB    . THR A 1  621  ? 133.150 107.672 133.566 1.00 52.59  ? 621  THR A CB    1 
ATOM   4288  O  OG1   . THR A 1  621  ? 132.236 108.739 133.844 1.00 52.59  ? 621  THR A OG1   1 
ATOM   4289  C  CG2   . THR A 1  621  ? 134.204 107.616 134.662 1.00 52.76  ? 621  THR A CG2   1 
ATOM   4290  N  N     . GLY A 1  622  ? 135.751 109.381 132.346 1.00 52.81  ? 622  GLY A N     1 
ATOM   4291  C  CA    . GLY A 1  622  ? 136.411 110.669 132.221 1.00 53.29  ? 622  GLY A CA    1 
ATOM   4292  C  C     . GLY A 1  622  ? 136.440 111.170 130.790 1.00 52.99  ? 622  GLY A C     1 
ATOM   4293  O  O     . GLY A 1  622  ? 136.341 112.374 130.541 1.00 52.25  ? 622  GLY A O     1 
ATOM   4294  N  N     . ALA A 1  623  ? 136.576 110.253 129.830 1.00 52.52  ? 623  ALA A N     1 
ATOM   4295  C  CA    . ALA A 1  623  ? 136.560 110.640 128.424 1.00 51.84  ? 623  ALA A CA    1 
ATOM   4296  C  C     . ALA A 1  623  ? 135.140 110.878 127.927 1.00 52.47  ? 623  ALA A C     1 
ATOM   4297  O  O     . ALA A 1  623  ? 134.898 111.814 127.158 1.00 50.44  ? 623  ALA A O     1 
ATOM   4298  C  CB    . ALA A 1  623  ? 137.251 109.572 127.576 1.00 49.65  ? 623  ALA A CB    1 
ATOM   4299  N  N     . TYR A 1  624  ? 134.189 110.047 128.358 1.00 49.65  ? 624  TYR A N     1 
ATOM   4300  C  CA    . TYR A 1  624  ? 132.797 110.222 127.963 1.00 49.08  ? 624  TYR A CA    1 
ATOM   4301  C  C     . TYR A 1  624  ? 132.129 111.400 128.657 1.00 48.12  ? 624  TYR A C     1 
ATOM   4302  O  O     . TYR A 1  624  ? 131.041 111.806 128.231 1.00 47.42  ? 624  TYR A O     1 
ATOM   4303  C  CB    . TYR A 1  624  ? 131.999 108.948 128.250 1.00 47.75  ? 624  TYR A CB    1 
ATOM   4304  C  CG    . TYR A 1  624  ? 132.280 107.807 127.299 1.00 47.95  ? 624  TYR A CG    1 
ATOM   4305  C  CD1   . TYR A 1  624  ? 132.943 108.022 126.099 1.00 47.30  ? 624  TYR A CD1   1 
ATOM   4306  C  CD2   . TYR A 1  624  ? 131.872 106.514 127.599 1.00 47.42  ? 624  TYR A CD2   1 
ATOM   4307  C  CE1   . TYR A 1  624  ? 133.198 106.980 125.226 1.00 46.94  ? 624  TYR A CE1   1 
ATOM   4308  C  CE2   . TYR A 1  624  ? 132.121 105.467 126.734 1.00 47.13  ? 624  TYR A CE2   1 
ATOM   4309  C  CZ    . TYR A 1  624  ? 132.784 105.704 125.550 1.00 49.86  ? 624  TYR A CZ    1 
ATOM   4310  O  OH    . TYR A 1  624  ? 133.034 104.663 124.686 1.00 49.53  ? 624  TYR A OH    1 
ATOM   4311  N  N     . ASN A 1  625  ? 132.745 111.949 129.707 1.00 51.13  ? 625  ASN A N     1 
ATOM   4312  C  CA    . ASN A 1  625  ? 132.165 113.036 130.498 1.00 52.24  ? 625  ASN A CA    1 
ATOM   4313  C  C     . ASN A 1  625  ? 130.801 112.648 131.063 1.00 53.57  ? 625  ASN A C     1 
ATOM   4314  O  O     . ASN A 1  625  ? 129.913 113.490 131.219 1.00 54.11  ? 625  ASN A O     1 
ATOM   4315  C  CB    . ASN A 1  625  ? 132.068 114.330 129.682 1.00 53.42  ? 625  ASN A CB    1 
ATOM   4316  C  CG    . ASN A 1  625  ? 131.897 115.561 130.553 1.00 54.64  ? 625  ASN A CG    1 
ATOM   4317  O  OD1   . ASN A 1  625  ? 132.166 115.528 131.755 1.00 51.73  ? 625  ASN A OD1   1 
ATOM   4318  N  ND2   . ASN A 1  625  ? 131.447 116.655 129.950 1.00 50.89  ? 625  ASN A ND2   1 
ATOM   4319  N  N     . ALA A 1  626  ? 130.626 111.367 131.370 1.00 52.45  ? 626  ALA A N     1 
ATOM   4320  C  CA    . ALA A 1  626  ? 129.385 110.850 131.922 1.00 53.26  ? 626  ALA A CA    1 
ATOM   4321  C  C     . ALA A 1  626  ? 129.534 110.586 133.415 1.00 53.42  ? 626  ALA A C     1 
ATOM   4322  O  O     . ALA A 1  626  ? 130.639 110.404 133.933 1.00 53.32  ? 626  ALA A O     1 
ATOM   4323  C  CB    . ALA A 1  626  ? 128.963 109.566 131.202 1.00 53.43  ? 626  ALA A CB    1 
ATOM   4324  N  N     . ASP A 1  627  ? 128.401 110.571 134.104 1.00 53.05  ? 627  ASP A N     1 
ATOM   4325  C  CA    . ASP A 1  627  ? 128.343 110.337 135.540 1.00 52.61  ? 627  ASP A CA    1 
ATOM   4326  C  C     . ASP A 1  627  ? 127.512 109.088 135.820 1.00 52.19  ? 627  ASP A C     1 
ATOM   4327  O  O     . ASP A 1  627  ? 127.076 108.384 134.907 1.00 52.33  ? 627  ASP A O     1 
ATOM   4328  C  CB    . ASP A 1  627  ? 127.767 111.556 136.265 1.00 52.47  ? 627  ASP A CB    1 
ATOM   4329  C  CG    . ASP A 1  627  ? 128.582 112.814 136.028 1.00 52.64  ? 627  ASP A CG    1 
ATOM   4330  O  OD1   . ASP A 1  627  ? 129.811 112.700 135.841 1.00 52.67  ? 627  ASP A OD1   1 
ATOM   4331  O  OD2   . ASP A 1  627  ? 127.992 113.914 136.028 1.00 53.51  ? 627  ASP A OD2   1 
ATOM   4332  N  N     . PHE A 1  628  ? 127.298 108.818 137.107 1.00 51.85  ? 628  PHE A N     1 
ATOM   4333  C  CA    . PHE A 1  628  ? 126.499 107.682 137.552 1.00 50.82  ? 628  PHE A CA    1 
ATOM   4334  C  C     . PHE A 1  628  ? 125.220 108.133 138.251 1.00 49.93  ? 628  PHE A C     1 
ATOM   4335  O  O     . PHE A 1  628  ? 124.706 107.438 139.131 1.00 49.04  ? 628  PHE A O     1 
ATOM   4336  C  CB    . PHE A 1  628  ? 127.320 106.775 138.465 1.00 48.57  ? 628  PHE A CB    1 
ATOM   4337  C  CG    . PHE A 1  628  ? 128.603 106.297 137.848 1.00 48.67  ? 628  PHE A CG    1 
ATOM   4338  C  CD1   . PHE A 1  628  ? 128.600 105.261 136.928 1.00 49.09  ? 628  PHE A CD1   1 
ATOM   4339  C  CD2   . PHE A 1  628  ? 129.811 106.883 138.187 1.00 49.38  ? 628  PHE A CD2   1 
ATOM   4340  C  CE1   . PHE A 1  628  ? 129.779 104.820 136.357 1.00 49.13  ? 628  PHE A CE1   1 
ATOM   4341  C  CE2   . PHE A 1  628  ? 130.994 106.445 137.621 1.00 51.00  ? 628  PHE A CE2   1 
ATOM   4342  C  CZ    . PHE A 1  628  ? 130.977 105.412 136.705 1.00 50.62  ? 628  PHE A CZ    1 
ATOM   4343  N  N     . ASP A 1  629  ? 124.697 109.298 137.865 1.00 51.87  ? 629  ASP A N     1 
ATOM   4344  C  CA    . ASP A 1  629  ? 123.466 109.839 138.428 1.00 53.02  ? 629  ASP A CA    1 
ATOM   4345  C  C     . ASP A 1  629  ? 122.249 109.537 137.564 1.00 54.26  ? 629  ASP A C     1 
ATOM   4346  O  O     . ASP A 1  629  ? 121.301 110.335 137.530 1.00 54.74  ? 629  ASP A O     1 
ATOM   4347  C  CB    . ASP A 1  629  ? 123.609 111.346 138.643 1.00 54.26  ? 629  ASP A CB    1 
ATOM   4348  C  CG    . ASP A 1  629  ? 123.931 112.089 137.364 1.00 55.43  ? 629  ASP A CG    1 
ATOM   4349  O  OD1   . ASP A 1  629  ? 124.461 111.460 136.425 1.00 52.98  ? 629  ASP A OD1   1 
ATOM   4350  O  OD2   . ASP A 1  629  ? 123.659 113.305 137.303 1.00 53.45  ? 629  ASP A OD2   1 
ATOM   4351  N  N     . GLY A 1  630  ? 122.248 108.404 136.867 1.00 52.82  ? 630  GLY A N     1 
ATOM   4352  C  CA    . GLY A 1  630  ? 121.194 108.061 135.935 1.00 52.93  ? 630  GLY A CA    1 
ATOM   4353  C  C     . GLY A 1  630  ? 121.615 108.077 134.484 1.00 53.06  ? 630  GLY A C     1 
ATOM   4354  O  O     . GLY A 1  630  ? 120.793 107.756 133.615 1.00 53.26  ? 630  GLY A O     1 
ATOM   4355  N  N     . ASP A 1  631  ? 122.862 108.435 134.189 1.00 53.07  ? 631  ASP A N     1 
ATOM   4356  C  CA    . ASP A 1  631  ? 123.336 108.444 132.814 1.00 53.01  ? 631  ASP A CA    1 
ATOM   4357  C  C     . ASP A 1  631  ? 123.468 107.021 132.289 1.00 53.37  ? 631  ASP A C     1 
ATOM   4358  O  O     . ASP A 1  631  ? 123.895 106.113 133.007 1.00 53.29  ? 631  ASP A O     1 
ATOM   4359  C  CB    . ASP A 1  631  ? 124.681 109.163 132.717 1.00 53.42  ? 631  ASP A CB    1 
ATOM   4360  C  CG    . ASP A 1  631  ? 124.623 110.578 133.249 1.00 53.11  ? 631  ASP A CG    1 
ATOM   4361  O  OD1   . ASP A 1  631  ? 123.518 111.151 133.276 1.00 52.39  ? 631  ASP A OD1   1 
ATOM   4362  O  OD2   . ASP A 1  631  ? 125.681 111.116 133.637 1.00 51.74  ? 631  ASP A OD2   1 
ATOM   4363  N  N     . GLU A 1  632  ? 123.098 106.832 131.026 1.00 52.28  ? 632  GLU A N     1 
ATOM   4364  C  CA    . GLU A 1  632  ? 123.181 105.532 130.382 1.00 52.22  ? 632  GLU A CA    1 
ATOM   4365  C  C     . GLU A 1  632  ? 123.681 105.708 128.958 1.00 53.33  ? 632  GLU A C     1 
ATOM   4366  O  O     . GLU A 1  632  ? 123.249 106.620 128.247 1.00 54.47  ? 632  GLU A O     1 
ATOM   4367  C  CB    . GLU A 1  632  ? 121.821 104.817 130.398 1.00 54.97  ? 632  GLU A CB    1 
ATOM   4368  C  CG    . GLU A 1  632  ? 120.630 105.706 130.076 1.00 55.29  ? 632  GLU A CG    1 
ATOM   4369  C  CD    . GLU A 1  632  ? 120.351 105.799 128.590 1.00 55.15  ? 632  GLU A CD    1 
ATOM   4370  O  OE1   . GLU A 1  632  ? 120.921 104.992 127.828 1.00 50.92  ? 632  GLU A OE1   1 
ATOM   4371  O  OE2   . GLU A 1  632  ? 119.561 106.677 128.185 1.00 50.77  ? 632  GLU A OE2   1 
ATOM   4372  N  N     . MET A 1  633  ? 124.604 104.842 128.554 1.00 49.37  ? 633  MET A N     1 
ATOM   4373  C  CA    . MET A 1  633  ? 125.191 104.869 127.224 1.00 48.14  ? 633  MET A CA    1 
ATOM   4374  C  C     . MET A 1  633  ? 124.662 103.695 126.405 1.00 48.01  ? 633  MET A C     1 
ATOM   4375  O  O     . MET A 1  633  ? 123.815 102.919 126.855 1.00 47.44  ? 633  MET A O     1 
ATOM   4376  C  CB    . MET A 1  633  ? 126.719 104.847 127.309 1.00 47.55  ? 633  MET A CB    1 
ATOM   4377  C  CG    . MET A 1  633  ? 127.294 103.570 127.891 1.00 47.51  ? 633  MET A CG    1 
ATOM   4378  S  SD    . MET A 1  633  ? 129.067 103.694 128.193 1.00 46.85  ? 633  MET A SD    1 
ATOM   4379  C  CE    . MET A 1  633  ? 129.112 105.022 129.393 1.00 46.75  ? 633  MET A CE    1 
ATOM   4380  N  N     . ASN A 1  634  ? 125.174 103.572 125.186 1.00 45.69  ? 634  ASN A N     1 
ATOM   4381  C  CA    . ASN A 1  634  ? 124.715 102.571 124.237 1.00 44.60  ? 634  ASN A CA    1 
ATOM   4382  C  C     . ASN A 1  634  ? 125.747 101.461 124.089 1.00 44.65  ? 634  ASN A C     1 
ATOM   4383  O  O     . ASN A 1  634  ? 126.924 101.621 124.424 1.00 44.93  ? 634  ASN A O     1 
ATOM   4384  C  CB    . ASN A 1  634  ? 124.435 103.207 122.872 1.00 45.16  ? 634  ASN A CB    1 
ATOM   4385  C  CG    . ASN A 1  634  ? 123.612 104.474 122.980 1.00 45.08  ? 634  ASN A CG    1 
ATOM   4386  O  OD1   . ASN A 1  634  ? 122.762 104.602 123.861 1.00 43.87  ? 634  ASN A OD1   1 
ATOM   4387  N  ND2   . ASN A 1  634  ? 123.863 105.421 122.084 1.00 43.18  ? 634  ASN A ND2   1 
ATOM   4388  N  N     . MET A 1  635  ? 125.283 100.322 123.577 1.00 44.26  ? 635  MET A N     1 
ATOM   4389  C  CA    . MET A 1  635  ? 126.134 99.166  123.298 1.00 44.94  ? 635  MET A CA    1 
ATOM   4390  C  C     . MET A 1  635  ? 125.827 98.692  121.881 1.00 45.12  ? 635  MET A C     1 
ATOM   4391  O  O     . MET A 1  635  ? 124.815 98.026  121.647 1.00 44.88  ? 635  MET A O     1 
ATOM   4392  C  CB    . MET A 1  635  ? 125.912 98.051  124.315 1.00 44.97  ? 635  MET A CB    1 
ATOM   4393  C  CG    . MET A 1  635  ? 126.668 96.772  123.991 1.00 45.02  ? 635  MET A CG    1 
ATOM   4394  S  SD    . MET A 1  635  ? 126.264 95.403  125.089 1.00 45.64  ? 635  MET A SD    1 
ATOM   4395  C  CE    . MET A 1  635  ? 127.146 94.066  124.286 1.00 45.47  ? 635  MET A CE    1 
ATOM   4396  N  N     . HIS A 1  636  ? 126.698 99.039  120.939 1.00 46.55  ? 636  HIS A N     1 
ATOM   4397  C  CA    . HIS A 1  636  ? 126.544 98.645  119.546 1.00 46.59  ? 636  HIS A CA    1 
ATOM   4398  C  C     . HIS A 1  636  ? 127.510 97.515  119.222 1.00 46.37  ? 636  HIS A C     1 
ATOM   4399  O  O     . HIS A 1  636  ? 128.636 97.480  119.728 1.00 46.26  ? 636  HIS A O     1 
ATOM   4400  C  CB    . HIS A 1  636  ? 126.786 99.837  118.620 1.00 46.16  ? 636  HIS A CB    1 
ATOM   4401  C  CG    . HIS A 1  636  ? 126.037 101.069 119.021 1.00 46.67  ? 636  HIS A CG    1 
ATOM   4402  N  ND1   . HIS A 1  636  ? 124.670 101.186 118.888 1.00 46.72  ? 636  HIS A ND1   1 
ATOM   4403  C  CD2   . HIS A 1  636  ? 126.464 102.236 119.561 1.00 46.67  ? 636  HIS A CD2   1 
ATOM   4404  C  CE1   . HIS A 1  636  ? 124.287 102.372 119.326 1.00 46.37  ? 636  HIS A CE1   1 
ATOM   4405  N  NE2   . HIS A 1  636  ? 125.357 103.029 119.738 1.00 46.33  ? 636  HIS A NE2   1 
ATOM   4406  N  N     . PHE A 1  637  ? 127.067 96.589  118.376 1.00 46.25  ? 637  PHE A N     1 
ATOM   4407  C  CA    . PHE A 1  637  ? 127.834 95.396  118.075 1.00 46.52  ? 637  PHE A CA    1 
ATOM   4408  C  C     . PHE A 1  637  ? 128.178 95.350  116.592 1.00 45.94  ? 637  PHE A C     1 
ATOM   4409  O  O     . PHE A 1  637  ? 127.278 95.469  115.748 1.00 45.25  ? 637  PHE A O     1 
ATOM   4410  C  CB    . PHE A 1  637  ? 127.050 94.135  118.471 1.00 45.05  ? 637  PHE A CB    1 
ATOM   4411  C  CG    . PHE A 1  637  ? 127.879 92.885  118.487 1.00 45.06  ? 637  PHE A CG    1 
ATOM   4412  C  CD1   . PHE A 1  637  ? 128.678 92.583  119.576 1.00 45.32  ? 637  PHE A CD1   1 
ATOM   4413  C  CD2   . PHE A 1  637  ? 127.859 92.011  117.415 1.00 45.34  ? 637  PHE A CD2   1 
ATOM   4414  C  CE1   . PHE A 1  637  ? 129.443 91.433  119.595 1.00 45.24  ? 637  PHE A CE1   1 
ATOM   4415  C  CE2   . PHE A 1  637  ? 128.622 90.862  117.426 1.00 47.77  ? 637  PHE A CE2   1 
ATOM   4416  C  CZ    . PHE A 1  637  ? 129.415 90.571  118.518 1.00 46.97  ? 637  PHE A CZ    1 
ATOM   4417  N  N     . PRO A 1  638  ? 129.448 95.183  116.233 1.00 50.29  ? 638  PRO A N     1 
ATOM   4418  C  CA    . PRO A 1  638  ? 129.813 95.097  114.818 1.00 51.05  ? 638  PRO A CA    1 
ATOM   4419  C  C     . PRO A 1  638  ? 129.521 93.722  114.240 1.00 51.67  ? 638  PRO A C     1 
ATOM   4420  O  O     . PRO A 1  638  ? 129.584 92.700  114.926 1.00 51.98  ? 638  PRO A O     1 
ATOM   4421  C  CB    . PRO A 1  638  ? 131.319 95.381  114.830 1.00 51.81  ? 638  PRO A CB    1 
ATOM   4422  C  CG    . PRO A 1  638  ? 131.767 94.884  116.162 1.00 51.47  ? 638  PRO A CG    1 
ATOM   4423  C  CD    . PRO A 1  638  ? 130.629 95.152  117.115 1.00 51.22  ? 638  PRO A CD    1 
ATOM   4424  N  N     . GLN A 1  639  ? 129.202 93.711  112.946 1.00 52.48  ? 639  GLN A N     1 
ATOM   4425  C  CA    . GLN A 1  639  ? 128.833 92.489  112.242 1.00 53.45  ? 639  GLN A CA    1 
ATOM   4426  C  C     . GLN A 1  639  ? 129.918 92.001  111.291 1.00 53.48  ? 639  GLN A C     1 
ATOM   4427  O  O     . GLN A 1  639  ? 129.667 91.085  110.500 1.00 53.54  ? 639  GLN A O     1 
ATOM   4428  C  CB    . GLN A 1  639  ? 127.524 92.700  111.477 1.00 53.45  ? 639  GLN A CB    1 
ATOM   4429  C  CG    . GLN A 1  639  ? 126.333 92.999  112.368 1.00 53.09  ? 639  GLN A CG    1 
ATOM   4430  C  CD    . GLN A 1  639  ? 126.021 91.862  113.320 1.00 53.66  ? 639  GLN A CD    1 
ATOM   4431  O  OE1   . GLN A 1  639  ? 126.149 90.689  112.968 1.00 54.66  ? 639  GLN A OE1   1 
ATOM   4432  N  NE2   . GLN A 1  639  ? 125.617 92.203  114.537 1.00 54.11  ? 639  GLN A NE2   1 
ATOM   4433  N  N     . ASN A 1  640  ? 131.115 92.580  111.348 1.00 57.25  ? 640  ASN A N     1 
ATOM   4434  C  CA    . ASN A 1  640  ? 132.197 92.201  110.452 1.00 59.17  ? 640  ASN A CA    1 
ATOM   4435  C  C     . ASN A 1  640  ? 133.505 92.135  111.223 1.00 59.86  ? 640  ASN A C     1 
ATOM   4436  O  O     . ASN A 1  640  ? 133.764 92.967  112.098 1.00 60.02  ? 640  ASN A O     1 
ATOM   4437  C  CB    . ASN A 1  640  ? 132.331 93.191  109.288 1.00 60.24  ? 640  ASN A CB    1 
ATOM   4438  C  CG    . ASN A 1  640  ? 131.144 93.152  108.349 1.00 60.38  ? 640  ASN A CG    1 
ATOM   4439  O  OD1   . ASN A 1  640  ? 130.637 92.081  108.013 1.00 60.38  ? 640  ASN A OD1   1 
ATOM   4440  N  ND2   . ASN A 1  640  ? 130.690 94.323  107.921 1.00 61.70  ? 640  ASN A ND2   1 
ATOM   4441  N  N     . GLU A 1  641  ? 134.328 91.135  110.894 1.00 60.29  ? 641  GLU A N     1 
ATOM   4442  C  CA    . GLU A 1  641  ? 135.655 91.033  111.490 1.00 60.54  ? 641  GLU A CA    1 
ATOM   4443  C  C     . GLU A 1  641  ? 136.551 92.199  111.096 1.00 60.52  ? 641  GLU A C     1 
ATOM   4444  O  O     . GLU A 1  641  ? 137.479 92.531  111.842 1.00 59.92  ? 641  GLU A O     1 
ATOM   4445  C  CB    . GLU A 1  641  ? 136.303 89.703  111.101 1.00 59.00  ? 641  GLU A CB    1 
ATOM   4446  C  CG    . GLU A 1  641  ? 135.958 89.222  109.698 1.00 58.34  ? 641  GLU A CG    1 
ATOM   4447  C  CD    . GLU A 1  641  ? 136.554 90.093  108.613 1.00 58.36  ? 641  GLU A CD    1 
ATOM   4448  O  OE1   . GLU A 1  641  ? 137.695 90.567  108.787 1.00 60.58  ? 641  GLU A OE1   1 
ATOM   4449  O  OE2   . GLU A 1  641  ? 135.874 90.316  107.590 1.00 60.42  ? 641  GLU A OE2   1 
ATOM   4450  N  N     . ASN A 1  642  ? 136.302 92.820  109.940 1.00 60.40  ? 642  ASN A N     1 
ATOM   4451  C  CA    . ASN A 1  642  ? 137.046 94.021  109.578 1.00 60.99  ? 642  ASN A CA    1 
ATOM   4452  C  C     . ASN A 1  642  ? 136.694 95.175  110.506 1.00 61.54  ? 642  ASN A C     1 
ATOM   4453  O  O     . ASN A 1  642  ? 137.569 95.957  110.896 1.00 62.14  ? 642  ASN A O     1 
ATOM   4454  C  CB    . ASN A 1  642  ? 136.770 94.396  108.122 1.00 62.71  ? 642  ASN A CB    1 
ATOM   4455  C  CG    . ASN A 1  642  ? 137.611 95.566  107.653 1.00 62.22  ? 642  ASN A CG    1 
ATOM   4456  O  OD1   . ASN A 1  642  ? 138.664 95.858  108.219 1.00 60.68  ? 642  ASN A OD1   1 
ATOM   4457  N  ND2   . ASN A 1  642  ? 137.148 96.246  106.611 1.00 61.18  ? 642  ASN A ND2   1 
ATOM   4458  N  N     . ALA A 1  643  ? 135.414 95.300  110.867 1.00 60.11  ? 643  ALA A N     1 
ATOM   4459  C  CA    . ALA A 1  643  ? 135.031 96.257  111.897 1.00 60.23  ? 643  ALA A CA    1 
ATOM   4460  C  C     . ALA A 1  643  ? 135.661 95.904  113.235 1.00 60.27  ? 643  ALA A C     1 
ATOM   4461  O  O     . ALA A 1  643  ? 136.007 96.798  114.013 1.00 60.59  ? 643  ALA A O     1 
ATOM   4462  C  CB    . ALA A 1  643  ? 133.509 96.321  112.019 1.00 60.43  ? 643  ALA A CB    1 
ATOM   4463  N  N     . ARG A 1  644  ? 135.820 94.608  113.519 1.00 60.70  ? 644  ARG A N     1 
ATOM   4464  C  CA    . ARG A 1  644  ? 136.542 94.198  114.718 1.00 60.60  ? 644  ARG A CA    1 
ATOM   4465  C  C     . ARG A 1  644  ? 138.017 94.567  114.635 1.00 60.23  ? 644  ARG A C     1 
ATOM   4466  O  O     . ARG A 1  644  ? 138.642 94.847  115.662 1.00 59.88  ? 644  ARG A O     1 
ATOM   4467  C  CB    . ARG A 1  644  ? 136.389 92.692  114.937 1.00 60.07  ? 644  ARG A CB    1 
ATOM   4468  C  CG    . ARG A 1  644  ? 134.965 92.235  115.204 1.00 59.35  ? 644  ARG A CG    1 
ATOM   4469  C  CD    . ARG A 1  644  ? 134.869 90.715  115.274 1.00 57.18  ? 644  ARG A CD    1 
ATOM   4470  N  NE    . ARG A 1  644  ? 135.695 90.147  116.338 1.00 56.61  ? 644  ARG A NE    1 
ATOM   4471  C  CZ    . ARG A 1  644  ? 136.874 89.563  116.141 1.00 56.12  ? 644  ARG A CZ    1 
ATOM   4472  N  NH1   . ARG A 1  644  ? 137.372 89.467  114.916 1.00 59.92  ? 644  ARG A NH1   1 
ATOM   4473  N  NH2   . ARG A 1  644  ? 137.554 89.077  117.170 1.00 60.38  ? 644  ARG A NH2   1 
ATOM   4474  N  N     . ALA A 1  645  ? 138.585 94.573  113.427 1.00 58.16  ? 645  ALA A N     1 
ATOM   4475  C  CA    . ALA A 1  645  ? 139.995 94.913  113.271 1.00 57.05  ? 645  ALA A CA    1 
ATOM   4476  C  C     . ALA A 1  645  ? 140.232 96.400  113.508 1.00 56.92  ? 645  ALA A C     1 
ATOM   4477  O  O     . ALA A 1  645  ? 141.130 96.782  114.268 1.00 56.44  ? 645  ALA A O     1 
ATOM   4478  C  CB    . ALA A 1  645  ? 140.482 94.503  111.880 1.00 56.82  ? 645  ALA A CB    1 
ATOM   4479  N  N     . GLU A 1  646  ? 139.436 97.256  112.864 1.00 55.51  ? 646  GLU A N     1 
ATOM   4480  C  CA    . GLU A 1  646  ? 139.612 98.694  113.037 1.00 55.15  ? 646  GLU A CA    1 
ATOM   4481  C  C     . GLU A 1  646  ? 139.172 99.154  114.421 1.00 55.65  ? 646  GLU A C     1 
ATOM   4482  O  O     . GLU A 1  646  ? 139.628 100.199 114.896 1.00 56.28  ? 646  GLU A O     1 
ATOM   4483  C  CB    . GLU A 1  646  ? 138.853 99.453  111.946 1.00 56.42  ? 646  GLU A CB    1 
ATOM   4484  C  CG    . GLU A 1  646  ? 137.372 99.119  111.846 1.00 57.18  ? 646  GLU A CG    1 
ATOM   4485  C  CD    . GLU A 1  646  ? 136.523 99.903  112.828 1.00 55.98  ? 646  GLU A CD    1 
ATOM   4486  O  OE1   . GLU A 1  646  ? 136.968 100.983 113.272 1.00 54.32  ? 646  GLU A OE1   1 
ATOM   4487  O  OE2   . GLU A 1  646  ? 135.413 99.438  113.159 1.00 54.40  ? 646  GLU A OE2   1 
ATOM   4488  N  N     . ALA A 1  647  ? 138.295 98.397  115.082 1.00 53.72  ? 647  ALA A N     1 
ATOM   4489  C  CA    . ALA A 1  647  ? 137.906 98.730  116.447 1.00 53.99  ? 647  ALA A CA    1 
ATOM   4490  C  C     . ALA A 1  647  ? 138.854 98.152  117.487 1.00 54.37  ? 647  ALA A C     1 
ATOM   4491  O  O     . ALA A 1  647  ? 138.728 98.486  118.670 1.00 53.61  ? 647  ALA A O     1 
ATOM   4492  C  CB    . ALA A 1  647  ? 136.480 98.253  116.727 1.00 53.78  ? 647  ALA A CB    1 
ATOM   4493  N  N     . LEU A 1  648  ? 139.790 97.295  117.080 1.00 53.53  ? 648  LEU A N     1 
ATOM   4494  C  CA    . LEU A 1  648  ? 140.804 96.761  117.978 1.00 54.01  ? 648  LEU A CA    1 
ATOM   4495  C  C     . LEU A 1  648  ? 142.146 97.464  117.841 1.00 54.25  ? 648  LEU A C     1 
ATOM   4496  O  O     . LEU A 1  648  ? 142.922 97.490  118.801 1.00 54.30  ? 648  LEU A O     1 
ATOM   4497  C  CB    . LEU A 1  648  ? 140.988 95.257  117.731 1.00 54.11  ? 648  LEU A CB    1 
ATOM   4498  C  CG    . LEU A 1  648  ? 141.866 94.444  118.687 1.00 54.15  ? 648  LEU A CG    1 
ATOM   4499  C  CD1   . LEU A 1  648  ? 141.232 93.089  118.956 1.00 54.21  ? 648  LEU A CD1   1 
ATOM   4500  C  CD2   . LEU A 1  648  ? 143.268 94.268  118.123 1.00 54.71  ? 648  LEU A CD2   1 
ATOM   4501  N  N     . ASN A 1  649  ? 142.433 98.040  116.675 1.00 53.81  ? 649  ASN A N     1 
ATOM   4502  C  CA    . ASN A 1  649  ? 143.686 98.741  116.422 1.00 53.46  ? 649  ASN A CA    1 
ATOM   4503  C  C     . ASN A 1  649  ? 143.525 100.250 116.350 1.00 53.58  ? 649  ASN A C     1 
ATOM   4504  O  O     . ASN A 1  649  ? 144.385 100.980 116.847 1.00 54.31  ? 649  ASN A O     1 
ATOM   4505  C  CB    . ASN A 1  649  ? 144.315 98.237  115.117 1.00 55.13  ? 649  ASN A CB    1 
ATOM   4506  C  CG    . ASN A 1  649  ? 145.827 98.395  115.093 1.00 54.64  ? 649  ASN A CG    1 
ATOM   4507  O  OD1   . ASN A 1  649  ? 146.526 97.651  114.405 1.00 52.90  ? 649  ASN A OD1   1 
ATOM   4508  N  ND2   . ASN A 1  649  ? 146.341 99.361  115.848 1.00 53.57  ? 649  ASN A ND2   1 
ATOM   4509  N  N     . LEU A 1  650  ? 142.445 100.742 115.741 1.00 51.87  ? 650  LEU A N     1 
ATOM   4510  C  CA    . LEU A 1  650  ? 142.227 102.177 115.577 1.00 51.37  ? 650  LEU A CA    1 
ATOM   4511  C  C     . LEU A 1  650  ? 141.293 102.738 116.643 1.00 51.35  ? 650  LEU A C     1 
ATOM   4512  O  O     . LEU A 1  650  ? 141.656 103.674 117.361 1.00 51.81  ? 650  LEU A O     1 
ATOM   4513  C  CB    . LEU A 1  650  ? 141.674 102.466 114.174 1.00 52.34  ? 650  LEU A CB    1 
ATOM   4514  C  CG    . LEU A 1  650  ? 141.301 103.919 113.875 1.00 51.70  ? 650  LEU A CG    1 
ATOM   4515  C  CD1   . LEU A 1  650  ? 142.528 104.815 113.937 1.00 50.81  ? 650  LEU A CD1   1 
ATOM   4516  C  CD2   . LEU A 1  650  ? 140.613 104.028 112.524 1.00 51.13  ? 650  LEU A CD2   1 
ATOM   4517  N  N     . ALA A 1  651  ? 140.088 102.183 116.759 1.00 49.96  ? 651  ALA A N     1 
ATOM   4518  C  CA    . ALA A 1  651  ? 139.109 102.653 117.733 1.00 49.14  ? 651  ALA A CA    1 
ATOM   4519  C  C     . ALA A 1  651  ? 139.365 102.122 119.138 1.00 49.32  ? 651  ALA A C     1 
ATOM   4520  O  O     . ALA A 1  651  ? 138.518 102.313 120.018 1.00 48.89  ? 651  ALA A O     1 
ATOM   4521  C  CB    . ALA A 1  651  ? 137.695 102.274 117.284 1.00 47.83  ? 651  ALA A CB    1 
ATOM   4522  N  N     . ASN A 1  652  ? 140.498 101.466 119.369 1.00 49.85  ? 652  ASN A N     1 
ATOM   4523  C  CA    . ASN A 1  652  ? 140.825 100.967 120.694 1.00 50.87  ? 652  ASN A CA    1 
ATOM   4524  C  C     . ASN A 1  652  ? 141.105 102.131 121.646 1.00 50.75  ? 652  ASN A C     1 
ATOM   4525  O  O     . ASN A 1  652  ? 141.426 103.247 121.231 1.00 50.82  ? 652  ASN A O     1 
ATOM   4526  C  CB    . ASN A 1  652  ? 142.028 100.026 120.628 1.00 51.04  ? 652  ASN A CB    1 
ATOM   4527  C  CG    . ASN A 1  652  ? 142.252 99.269  121.923 1.00 50.92  ? 652  ASN A CG    1 
ATOM   4528  O  OD1   . ASN A 1  652  ? 141.358 99.177  122.765 1.00 51.30  ? 652  ASN A OD1   1 
ATOM   4529  N  ND2   . ASN A 1  652  ? 143.450 98.721  122.089 1.00 51.83  ? 652  ASN A ND2   1 
ATOM   4530  N  N     . THR A 1  653  ? 140.977 101.850 122.945 1.00 51.28  ? 653  THR A N     1 
ATOM   4531  C  CA    . THR A 1  653  ? 141.103 102.905 123.948 1.00 51.37  ? 653  THR A CA    1 
ATOM   4532  C  C     . THR A 1  653  ? 142.527 103.444 124.025 1.00 51.78  ? 653  THR A C     1 
ATOM   4533  O  O     . THR A 1  653  ? 142.731 104.622 124.343 1.00 52.20  ? 653  THR A O     1 
ATOM   4534  C  CB    . THR A 1  653  ? 140.655 102.386 125.316 1.00 51.79  ? 653  THR A CB    1 
ATOM   4535  O  OG1   . THR A 1  653  ? 140.963 103.358 126.323 1.00 51.56  ? 653  THR A OG1   1 
ATOM   4536  C  CG2   . THR A 1  653  ? 141.350 101.072 125.650 1.00 52.25  ? 653  THR A CG2   1 
ATOM   4537  N  N     . ASP A 1  654  ? 143.527 102.604 123.743 1.00 50.88  ? 654  ASP A N     1 
ATOM   4538  C  CA    . ASP A 1  654  ? 144.913 103.043 123.864 1.00 50.14  ? 654  ASP A CA    1 
ATOM   4539  C  C     . ASP A 1  654  ? 145.253 104.090 122.810 1.00 50.28  ? 654  ASP A C     1 
ATOM   4540  O  O     . ASP A 1  654  ? 145.982 105.051 123.084 1.00 50.31  ? 654  ASP A O     1 
ATOM   4541  C  CB    . ASP A 1  654  ? 145.857 101.842 123.765 1.00 49.87  ? 654  ASP A CB    1 
ATOM   4542  C  CG    . ASP A 1  654  ? 145.734 101.109 122.444 1.00 50.80  ? 654  ASP A CG    1 
ATOM   4543  O  OD1   . ASP A 1  654  ? 144.699 101.271 121.767 1.00 49.10  ? 654  ASP A OD1   1 
ATOM   4544  O  OD2   . ASP A 1  654  ? 146.675 100.371 122.083 1.00 48.82  ? 654  ASP A OD2   1 
ATOM   4545  N  N     . SER A 1  655  ? 144.729 103.923 121.593 1.00 48.34  ? 655  SER A N     1 
ATOM   4546  C  CA    . SER A 1  655  ? 144.969 104.904 120.542 1.00 48.03  ? 655  SER A CA    1 
ATOM   4547  C  C     . SER A 1  655  ? 144.224 106.207 120.794 1.00 48.59  ? 655  SER A C     1 
ATOM   4548  O  O     . SER A 1  655  ? 144.545 107.224 120.169 1.00 48.82  ? 655  SER A O     1 
ATOM   4549  C  CB    . SER A 1  655  ? 144.568 104.328 119.183 1.00 47.33  ? 655  SER A CB    1 
ATOM   4550  O  OG    . SER A 1  655  ? 145.334 103.176 118.872 1.00 47.28  ? 655  SER A OG    1 
ATOM   4551  N  N     . GLN A 1  656  ? 143.239 106.201 121.694 1.00 47.15  ? 656  GLN A N     1 
ATOM   4552  C  CA    . GLN A 1  656  ? 142.500 107.402 122.063 1.00 47.32  ? 656  GLN A CA    1 
ATOM   4553  C  C     . GLN A 1  656  ? 142.879 107.907 123.450 1.00 48.29  ? 656  GLN A C     1 
ATOM   4554  O  O     . GLN A 1  656  ? 142.078 108.585 124.102 1.00 49.27  ? 656  GLN A O     1 
ATOM   4555  C  CB    . GLN A 1  656  ? 140.994 107.145 121.984 1.00 49.99  ? 656  GLN A CB    1 
ATOM   4556  C  CG    . GLN A 1  656  ? 140.399 107.331 120.596 1.00 50.66  ? 656  GLN A CG    1 
ATOM   4557  C  CD    . GLN A 1  656  ? 140.979 106.376 119.572 1.00 50.36  ? 656  GLN A CD    1 
ATOM   4558  O  OE1   . GLN A 1  656  ? 141.434 106.793 118.506 1.00 46.86  ? 656  GLN A OE1   1 
ATOM   4559  N  NE2   . GLN A 1  656  ? 140.961 105.087 119.888 1.00 46.74  ? 656  GLN A NE2   1 
ATOM   4560  N  N     . TYR A 1  657  ? 144.088 107.584 123.917 1.00 46.30  ? 657  TYR A N     1 
ATOM   4561  C  CA    . TYR A 1  657  ? 144.541 108.085 125.210 1.00 45.56  ? 657  TYR A CA    1 
ATOM   4562  C  C     . TYR A 1  657  ? 144.740 109.596 125.189 1.00 44.17  ? 657  TYR A C     1 
ATOM   4563  O  O     . TYR A 1  657  ? 144.598 110.254 126.226 1.00 42.76  ? 657  TYR A O     1 
ATOM   4564  C  CB    . TYR A 1  657  ? 145.837 107.380 125.619 1.00 42.35  ? 657  TYR A CB    1 
ATOM   4565  C  CG    . TYR A 1  657  ? 146.598 108.074 126.727 1.00 41.77  ? 657  TYR A CG    1 
ATOM   4566  C  CD1   . TYR A 1  657  ? 146.197 107.957 128.050 1.00 41.50  ? 657  TYR A CD1   1 
ATOM   4567  C  CD2   . TYR A 1  657  ? 147.722 108.841 126.447 1.00 41.15  ? 657  TYR A CD2   1 
ATOM   4568  C  CE1   . TYR A 1  657  ? 146.891 108.590 129.065 1.00 41.83  ? 657  TYR A CE1   1 
ATOM   4569  C  CE2   . TYR A 1  657  ? 148.421 109.478 127.453 1.00 42.00  ? 657  TYR A CE2   1 
ATOM   4570  C  CZ    . TYR A 1  657  ? 148.003 109.348 128.760 1.00 46.19  ? 657  TYR A CZ    1 
ATOM   4571  O  OH    . TYR A 1  657  ? 148.699 109.981 129.764 1.00 46.59  ? 657  TYR A OH    1 
ATOM   4572  N  N     . LEU A 1  658  ? 145.056 110.160 124.027 1.00 46.90  ? 658  LEU A N     1 
ATOM   4573  C  CA    . LEU A 1  658  ? 145.302 111.588 123.877 1.00 47.68  ? 658  LEU A CA    1 
ATOM   4574  C  C     . LEU A 1  658  ? 144.267 112.156 122.918 1.00 48.33  ? 658  LEU A C     1 
ATOM   4575  O  O     . LEU A 1  658  ? 144.197 111.737 121.757 1.00 49.26  ? 658  LEU A O     1 
ATOM   4576  C  CB    . LEU A 1  658  ? 146.724 111.844 123.368 1.00 49.88  ? 658  LEU A CB    1 
ATOM   4577  C  CG    . LEU A 1  658  ? 147.340 113.237 123.530 1.00 49.15  ? 658  LEU A CG    1 
ATOM   4578  C  CD1   . LEU A 1  658  ? 146.860 114.200 122.453 1.00 48.22  ? 658  LEU A CD1   1 
ATOM   4579  C  CD2   . LEU A 1  658  ? 147.046 113.790 124.913 1.00 48.10  ? 658  LEU A CD2   1 
ATOM   4580  N  N     . THR A 1  659  ? 143.467 113.108 123.400 1.00 48.84  ? 659  THR A N     1 
ATOM   4581  C  CA    . THR A 1  659  ? 142.471 113.721 122.533 1.00 49.04  ? 659  THR A CA    1 
ATOM   4582  C  C     . THR A 1  659  ? 143.131 114.760 121.628 1.00 48.98  ? 659  THR A C     1 
ATOM   4583  O  O     . THR A 1  659  ? 143.952 115.558 122.090 1.00 48.41  ? 659  THR A O     1 
ATOM   4584  C  CB    . THR A 1  659  ? 141.357 114.372 123.355 1.00 49.17  ? 659  THR A CB    1 
ATOM   4585  O  OG1   . THR A 1  659  ? 140.535 115.178 122.501 1.00 48.89  ? 659  THR A OG1   1 
ATOM   4586  C  CG2   . THR A 1  659  ? 141.934 115.235 124.469 1.00 48.78  ? 659  THR A CG2   1 
ATOM   4587  N  N     . PRO A 1  660  ? 142.797 114.771 120.334 1.00 49.24  ? 660  PRO A N     1 
ATOM   4588  C  CA    . PRO A 1  660  ? 143.444 115.671 119.370 1.00 49.37  ? 660  PRO A CA    1 
ATOM   4589  C  C     . PRO A 1  660  ? 142.888 117.095 119.382 1.00 50.46  ? 660  PRO A C     1 
ATOM   4590  O  O     . PRO A 1  660  ? 142.486 117.635 118.350 1.00 50.40  ? 660  PRO A O     1 
ATOM   4591  C  CB    . PRO A 1  660  ? 143.180 114.974 118.032 1.00 49.80  ? 660  PRO A CB    1 
ATOM   4592  C  CG    . PRO A 1  660  ? 141.868 114.297 118.236 1.00 48.33  ? 660  PRO A CG    1 
ATOM   4593  C  CD    . PRO A 1  660  ? 141.843 113.856 119.680 1.00 47.69  ? 660  PRO A CD    1 
ATOM   4594  N  N     . THR A 1  661  ? 142.866 117.710 120.565 1.00 48.56  ? 661  THR A N     1 
ATOM   4595  C  CA    . THR A 1  661  ? 142.420 119.092 120.708 1.00 49.25  ? 661  THR A CA    1 
ATOM   4596  C  C     . THR A 1  661  ? 143.543 120.003 121.186 1.00 49.37  ? 661  THR A C     1 
ATOM   4597  O  O     . THR A 1  661  ? 143.839 121.006 120.528 1.00 49.63  ? 661  THR A O     1 
ATOM   4598  C  CB    . THR A 1  661  ? 141.226 119.168 121.668 1.00 49.09  ? 661  THR A CB    1 
ATOM   4599  O  OG1   . THR A 1  661  ? 140.143 118.385 121.150 1.00 49.66  ? 661  THR A OG1   1 
ATOM   4600  C  CG2   . THR A 1  661  ? 140.768 120.608 121.839 1.00 50.25  ? 661  THR A CG2   1 
ATOM   4601  N  N     . SER A 1  662  ? 144.180 119.685 122.313 1.00 49.45  ? 662  SER A N     1 
ATOM   4602  C  CA    . SER A 1  662  ? 145.281 120.491 122.820 1.00 49.14  ? 662  SER A CA    1 
ATOM   4603  C  C     . SER A 1  662  ? 146.433 119.668 123.377 1.00 49.45  ? 662  SER A C     1 
ATOM   4604  O  O     . SER A 1  662  ? 147.414 120.256 123.843 1.00 49.71  ? 662  SER A O     1 
ATOM   4605  C  CB    . SER A 1  662  ? 144.782 121.457 123.905 1.00 48.45  ? 662  SER A CB    1 
ATOM   4606  O  OG    . SER A 1  662  ? 145.856 122.195 124.461 1.00 48.23  ? 662  SER A OG    1 
ATOM   4607  N  N     . GLY A 1  663  ? 146.353 118.341 123.347 1.00 48.34  ? 663  GLY A N     1 
ATOM   4608  C  CA    . GLY A 1  663  ? 147.375 117.514 123.951 1.00 48.84  ? 663  GLY A CA    1 
ATOM   4609  C  C     . GLY A 1  663  ? 147.181 117.248 125.425 1.00 49.92  ? 663  GLY A C     1 
ATOM   4610  O  O     . GLY A 1  663  ? 148.165 117.025 126.138 1.00 50.51  ? 663  GLY A O     1 
ATOM   4611  N  N     . SER A 1  664  ? 145.938 117.264 125.908 1.00 50.93  ? 664  SER A N     1 
ATOM   4612  C  CA    . SER A 1  664  ? 145.654 117.003 127.311 1.00 51.70  ? 664  SER A CA    1 
ATOM   4613  C  C     . SER A 1  664  ? 145.104 115.594 127.452 1.00 51.88  ? 664  SER A C     1 
ATOM   4614  O  O     . SER A 1  664  ? 143.973 115.335 127.011 1.00 51.94  ? 664  SER A O     1 
ATOM   4615  C  CB    . SER A 1  664  ? 144.658 118.023 127.858 1.00 51.57  ? 664  SER A CB    1 
ATOM   4616  O  OG    . SER A 1  664  ? 144.372 117.776 129.224 1.00 52.02  ? 664  SER A OG    1 
ATOM   4617  N  N     . PRO A 1  665  ? 145.847 114.656 128.044 1.00 51.36  ? 665  PRO A N     1 
ATOM   4618  C  CA    . PRO A 1  665  ? 145.347 113.279 128.163 1.00 51.62  ? 665  PRO A CA    1 
ATOM   4619  C  C     . PRO A 1  665  ? 144.115 113.173 129.047 1.00 51.86  ? 665  PRO A C     1 
ATOM   4620  O  O     . PRO A 1  665  ? 144.184 113.421 130.255 1.00 51.75  ? 665  PRO A O     1 
ATOM   4621  C  CB    . PRO A 1  665  ? 146.535 112.523 128.775 1.00 51.33  ? 665  PRO A CB    1 
ATOM   4622  C  CG    . PRO A 1  665  ? 147.729 113.385 128.506 1.00 51.83  ? 665  PRO A CG    1 
ATOM   4623  C  CD    . PRO A 1  665  ? 147.223 114.791 128.547 1.00 51.94  ? 665  PRO A CD    1 
ATOM   4624  N  N     . VAL A 1  666  ? 142.982 112.805 128.455 1.00 52.23  ? 666  VAL A N     1 
ATOM   4625  C  CA    . VAL A 1  666  ? 141.740 112.607 129.221 1.00 52.87  ? 666  VAL A CA    1 
ATOM   4626  C  C     . VAL A 1  666  ? 141.716 111.134 129.613 1.00 53.29  ? 666  VAL A C     1 
ATOM   4627  O  O     . VAL A 1  666  ? 141.109 110.280 128.962 1.00 53.42  ? 666  VAL A O     1 
ATOM   4628  C  CB    . VAL A 1  666  ? 140.499 113.043 128.436 1.00 53.44  ? 666  VAL A CB    1 
ATOM   4629  C  CG1   . VAL A 1  666  ? 140.332 114.552 128.517 1.00 53.43  ? 666  VAL A CG1   1 
ATOM   4630  C  CG2   . VAL A 1  666  ? 140.607 112.610 126.979 1.00 52.36  ? 666  VAL A CG2   1 
ATOM   4631  N  N     . ARG A 1  667  ? 142.385 110.832 130.723 1.00 55.91  ? 667  ARG A N     1 
ATOM   4632  C  CA    . ARG A 1  667  ? 142.515 109.470 131.225 1.00 58.51  ? 667  ARG A CA    1 
ATOM   4633  C  C     . ARG A 1  667  ? 143.135 109.530 132.612 1.00 60.76  ? 667  ARG A C     1 
ATOM   4634  O  O     . ARG A 1  667  ? 143.883 110.460 132.928 1.00 63.12  ? 667  ARG A O     1 
ATOM   4635  C  CB    . ARG A 1  667  ? 143.373 108.605 130.287 1.00 64.87  ? 667  ARG A CB    1 
ATOM   4636  C  CG    . ARG A 1  667  ? 143.286 107.106 130.542 1.00 66.91  ? 667  ARG A CG    1 
ATOM   4637  C  CD    . ARG A 1  667  ? 144.493 106.597 131.314 1.00 68.28  ? 667  ARG A CD    1 
ATOM   4638  N  NE    . ARG A 1  667  ? 144.427 105.156 131.539 1.00 67.88  ? 667  ARG A NE    1 
ATOM   4639  C  CZ    . ARG A 1  667  ? 143.955 104.593 132.647 1.00 69.75  ? 667  ARG A CZ    1 
ATOM   4640  N  NH1   . ARG A 1  667  ? 143.508 105.350 133.639 1.00 58.77  ? 667  ARG A NH1   1 
ATOM   4641  N  NH2   . ARG A 1  667  ? 143.931 103.272 132.764 1.00 59.62  ? 667  ARG A NH2   1 
ATOM   4642  N  N     . GLY A 1  668  ? 142.816 108.532 133.433 1.00 57.96  ? 668  GLY A N     1 
ATOM   4643  C  CA    . GLY A 1  668  ? 143.337 108.481 134.784 1.00 56.57  ? 668  GLY A CA    1 
ATOM   4644  C  C     . GLY A 1  668  ? 142.256 108.538 135.844 1.00 54.95  ? 668  GLY A C     1 
ATOM   4645  O  O     . GLY A 1  668  ? 141.245 109.225 135.671 1.00 55.72  ? 668  GLY A O     1 
ATOM   4646  N  N     . LEU A 1  669  ? 142.457 107.811 136.941 1.00 52.30  ? 669  LEU A N     1 
ATOM   4647  C  CA    . LEU A 1  669  ? 141.494 107.811 138.031 1.00 51.22  ? 669  LEU A CA    1 
ATOM   4648  C  C     . LEU A 1  669  ? 141.374 109.210 138.631 1.00 50.89  ? 669  LEU A C     1 
ATOM   4649  O  O     . LEU A 1  669  ? 142.306 110.018 138.586 1.00 50.79  ? 669  LEU A O     1 
ATOM   4650  C  CB    . LEU A 1  669  ? 141.896 106.790 139.095 1.00 50.76  ? 669  LEU A CB    1 
ATOM   4651  C  CG    . LEU A 1  669  ? 142.106 105.371 138.551 1.00 50.94  ? 669  LEU A CG    1 
ATOM   4652  C  CD1   . LEU A 1  669  ? 143.584 105.078 138.314 1.00 50.97  ? 669  LEU A CD1   1 
ATOM   4653  C  CD2   . LEU A 1  669  ? 141.483 104.326 139.461 1.00 50.81  ? 669  LEU A CD2   1 
ATOM   4654  N  N     . ILE A 1  670  ? 140.205 109.492 139.201 1.00 50.36  ? 670  ILE A N     1 
ATOM   4655  C  CA    . ILE A 1  670  ? 139.777 110.861 139.487 1.00 50.32  ? 670  ILE A CA    1 
ATOM   4656  C  C     . ILE A 1  670  ? 139.938 111.223 140.966 1.00 49.82  ? 670  ILE A C     1 
ATOM   4657  O  O     . ILE A 1  670  ? 140.683 112.143 141.306 1.00 49.62  ? 670  ILE A O     1 
ATOM   4658  C  CB    . ILE A 1  670  ? 138.331 111.104 138.996 1.00 49.93  ? 670  ILE A CB    1 
ATOM   4659  C  CG1   . ILE A 1  670  ? 137.505 109.811 139.030 1.00 49.91  ? 670  ILE A CG1   1 
ATOM   4660  C  CG2   . ILE A 1  670  ? 138.338 111.700 137.596 1.00 51.26  ? 670  ILE A CG2   1 
ATOM   4661  C  CD1   . ILE A 1  670  ? 136.682 109.604 140.280 1.00 51.87  ? 670  ILE A CD1   1 
ATOM   4662  N  N     . GLN A 1  671  ? 139.233 110.526 141.856 1.00 51.79  ? 671  GLN A N     1 
ATOM   4663  C  CA    . GLN A 1  671  ? 139.113 110.993 143.233 1.00 52.35  ? 671  GLN A CA    1 
ATOM   4664  C  C     . GLN A 1  671  ? 139.651 110.021 144.271 1.00 52.23  ? 671  GLN A C     1 
ATOM   4665  O  O     . GLN A 1  671  ? 140.491 110.408 145.092 1.00 52.18  ? 671  GLN A O     1 
ATOM   4666  C  CB    . GLN A 1  671  ? 137.641 111.312 143.538 1.00 51.78  ? 671  GLN A CB    1 
ATOM   4667  C  CG    . GLN A 1  671  ? 137.026 112.322 142.588 1.00 51.21  ? 671  GLN A CG    1 
ATOM   4668  C  CD    . GLN A 1  671  ? 135.514 112.314 142.638 1.00 51.81  ? 671  GLN A CD    1 
ATOM   4669  O  OE1   . GLN A 1  671  ? 134.920 111.913 143.638 1.00 52.30  ? 671  GLN A OE1   1 
ATOM   4670  N  NE2   . GLN A 1  671  ? 134.884 112.748 141.555 1.00 52.74  ? 671  GLN A NE2   1 
ATOM   4671  N  N     . ASP A 1  672  ? 139.188 108.770 144.272 1.00 51.57  ? 672  ASP A N     1 
ATOM   4672  C  CA    . ASP A 1  672  ? 139.423 107.907 145.426 1.00 51.32  ? 672  ASP A CA    1 
ATOM   4673  C  C     . ASP A 1  672  ? 140.822 107.302 145.425 1.00 51.01  ? 672  ASP A C     1 
ATOM   4674  O  O     . ASP A 1  672  ? 141.488 107.277 146.466 1.00 50.99  ? 672  ASP A O     1 
ATOM   4675  C  CB    . ASP A 1  672  ? 138.362 106.806 145.481 1.00 50.58  ? 672  ASP A CB    1 
ATOM   4676  C  CG    . ASP A 1  672  ? 138.350 105.952 144.234 1.00 51.15  ? 672  ASP A CG    1 
ATOM   4677  O  OD1   . ASP A 1  672  ? 138.906 106.398 143.210 1.00 51.07  ? 672  ASP A OD1   1 
ATOM   4678  O  OD2   . ASP A 1  672  ? 137.787 104.838 144.277 1.00 51.31  ? 672  ASP A OD2   1 
ATOM   4679  N  N     . HIS A 1  673  ? 141.286 106.807 144.276 1.00 50.21  ? 673  HIS A N     1 
ATOM   4680  C  CA    . HIS A 1  673  ? 142.588 106.152 144.230 1.00 49.70  ? 673  HIS A CA    1 
ATOM   4681  C  C     . HIS A 1  673  ? 143.740 107.136 144.383 1.00 49.88  ? 673  HIS A C     1 
ATOM   4682  O  O     . HIS A 1  673  ? 144.835 106.730 144.785 1.00 50.16  ? 673  HIS A O     1 
ATOM   4683  C  CB    . HIS A 1  673  ? 142.732 105.364 142.928 1.00 50.27  ? 673  HIS A CB    1 
ATOM   4684  C  CG    . HIS A 1  673  ? 141.818 104.182 142.838 1.00 50.89  ? 673  HIS A CG    1 
ATOM   4685  N  ND1   . HIS A 1  673  ? 140.460 104.305 142.633 1.00 50.82  ? 673  HIS A ND1   1 
ATOM   4686  C  CD2   . HIS A 1  673  ? 142.064 102.854 142.927 1.00 50.48  ? 673  HIS A CD2   1 
ATOM   4687  C  CE1   . HIS A 1  673  ? 139.911 103.105 142.598 1.00 48.92  ? 673  HIS A CE1   1 
ATOM   4688  N  NE2   . HIS A 1  673  ? 140.864 102.206 142.774 1.00 49.29  ? 673  HIS A NE2   1 
ATOM   4689  N  N     . ILE A 1  674  ? 143.519 108.412 144.079 1.00 47.84  ? 674  ILE A N     1 
ATOM   4690  C  CA    . ILE A 1  674  ? 144.547 109.426 144.288 1.00 47.36  ? 674  ILE A CA    1 
ATOM   4691  C  C     . ILE A 1  674  ? 144.497 109.978 145.709 1.00 47.73  ? 674  ILE A C     1 
ATOM   4692  O  O     . ILE A 1  674  ? 145.540 110.235 146.315 1.00 48.35  ? 674  ILE A O     1 
ATOM   4693  C  CB    . ILE A 1  674  ? 144.403 110.543 143.235 1.00 48.35  ? 674  ILE A CB    1 
ATOM   4694  C  CG1   . ILE A 1  674  ? 145.330 111.716 143.557 1.00 47.52  ? 674  ILE A CG1   1 
ATOM   4695  C  CG2   . ILE A 1  674  ? 142.963 111.002 143.137 1.00 46.24  ? 674  ILE A CG2   1 
ATOM   4696  C  CD1   . ILE A 1  674  ? 145.177 112.882 142.611 1.00 46.66  ? 674  ILE A CD1   1 
ATOM   4697  N  N     . SER A 1  675  ? 143.294 110.158 146.262 1.00 45.08  ? 675  SER A N     1 
ATOM   4698  C  CA    . SER A 1  675  ? 143.180 110.600 147.648 1.00 45.00  ? 675  SER A CA    1 
ATOM   4699  C  C     . SER A 1  675  ? 143.776 109.572 148.600 1.00 45.23  ? 675  SER A C     1 
ATOM   4700  O  O     . SER A 1  675  ? 144.379 109.931 149.618 1.00 45.46  ? 675  SER A O     1 
ATOM   4701  C  CB    . SER A 1  675  ? 141.716 110.872 147.996 1.00 45.41  ? 675  SER A CB    1 
ATOM   4702  O  OG    . SER A 1  675  ? 141.585 111.329 149.330 1.00 46.08  ? 675  SER A OG    1 
ATOM   4703  N  N     . ALA A 1  676  ? 143.615 108.285 148.285 1.00 45.78  ? 676  ALA A N     1 
ATOM   4704  C  CA    . ALA A 1  676  ? 144.307 107.245 149.035 1.00 46.33  ? 676  ALA A CA    1 
ATOM   4705  C  C     . ALA A 1  676  ? 145.761 107.121 148.606 1.00 46.53  ? 676  ALA A C     1 
ATOM   4706  O  O     . ALA A 1  676  ? 146.599 106.666 149.392 1.00 46.19  ? 676  ALA A O     1 
ATOM   4707  C  CB    . ALA A 1  676  ? 143.592 105.905 148.865 1.00 46.29  ? 676  ALA A CB    1 
ATOM   4708  N  N     . GLY A 1  677  ? 146.072 107.510 147.367 1.00 45.69  ? 677  GLY A N     1 
ATOM   4709  C  CA    . GLY A 1  677  ? 147.454 107.496 146.917 1.00 45.03  ? 677  GLY A CA    1 
ATOM   4710  C  C     . GLY A 1  677  ? 148.345 108.410 147.735 1.00 44.82  ? 677  GLY A C     1 
ATOM   4711  O  O     . GLY A 1  677  ? 149.491 108.066 148.038 1.00 44.43  ? 677  GLY A O     1 
ATOM   4712  N  N     . VAL A 1  678  ? 147.837 109.592 148.093 1.00 45.67  ? 678  VAL A N     1 
ATOM   4713  C  CA    . VAL A 1  678  ? 148.613 110.528 148.904 1.00 46.64  ? 678  VAL A CA    1 
ATOM   4714  C  C     . VAL A 1  678  ? 148.990 109.894 150.237 1.00 47.38  ? 678  VAL A C     1 
ATOM   4715  O  O     . VAL A 1  678  ? 150.111 110.070 150.730 1.00 47.71  ? 678  VAL A O     1 
ATOM   4716  C  CB    . VAL A 1  678  ? 147.831 111.841 149.100 1.00 47.42  ? 678  VAL A CB    1 
ATOM   4717  C  CG1   . VAL A 1  678  ? 148.634 112.820 149.942 1.00 46.78  ? 678  VAL A CG1   1 
ATOM   4718  C  CG2   . VAL A 1  678  ? 147.477 112.453 147.754 1.00 47.14  ? 678  VAL A CG2   1 
ATOM   4719  N  N     . TRP A 1  679  ? 148.066 109.139 150.837 1.00 46.98  ? 679  TRP A N     1 
ATOM   4720  C  CA    . TRP A 1  679  ? 148.381 108.438 152.077 1.00 47.52  ? 679  TRP A CA    1 
ATOM   4721  C  C     . TRP A 1  679  ? 149.257 107.217 151.827 1.00 47.38  ? 679  TRP A C     1 
ATOM   4722  O  O     . TRP A 1  679  ? 149.994 106.791 152.722 1.00 47.51  ? 679  TRP A O     1 
ATOM   4723  C  CB    . TRP A 1  679  ? 147.094 108.027 152.792 1.00 47.71  ? 679  TRP A CB    1 
ATOM   4724  C  CG    . TRP A 1  679  ? 146.288 109.185 153.295 1.00 48.16  ? 679  TRP A CG    1 
ATOM   4725  C  CD1   . TRP A 1  679  ? 145.316 109.864 152.619 1.00 48.57  ? 679  TRP A CD1   1 
ATOM   4726  C  CD2   . TRP A 1  679  ? 146.382 109.799 154.586 1.00 48.25  ? 679  TRP A CD2   1 
ATOM   4727  N  NE1   . TRP A 1  679  ? 144.801 110.864 153.408 1.00 48.78  ? 679  TRP A NE1   1 
ATOM   4728  C  CE2   . TRP A 1  679  ? 145.439 110.844 154.621 1.00 48.90  ? 679  TRP A CE2   1 
ATOM   4729  C  CE3   . TRP A 1  679  ? 147.174 109.566 155.715 1.00 49.27  ? 679  TRP A CE3   1 
ATOM   4730  C  CZ2   . TRP A 1  679  ? 145.264 111.656 155.741 1.00 49.18  ? 679  TRP A CZ2   1 
ATOM   4731  C  CZ3   . TRP A 1  679  ? 146.999 110.372 156.826 1.00 48.11  ? 679  TRP A CZ3   1 
ATOM   4732  C  CH2   . TRP A 1  679  ? 146.052 111.404 156.830 1.00 48.43  ? 679  TRP A CH2   1 
ATOM   4733  N  N     . LEU A 1  680  ? 149.189 106.644 150.624 1.00 48.48  ? 680  LEU A N     1 
ATOM   4734  C  CA    . LEU A 1  680  ? 149.980 105.457 150.313 1.00 48.89  ? 680  LEU A CA    1 
ATOM   4735  C  C     . LEU A 1  680  ? 151.459 105.804 150.184 1.00 49.56  ? 680  LEU A C     1 
ATOM   4736  O  O     . LEU A 1  680  ? 152.305 105.258 150.902 1.00 50.02  ? 680  LEU A O     1 
ATOM   4737  C  CB    . LEU A 1  680  ? 149.451 104.804 149.031 1.00 50.25  ? 680  LEU A CB    1 
ATOM   4738  C  CG    . LEU A 1  680  ? 150.033 103.472 148.540 1.00 49.90  ? 680  LEU A CG    1 
ATOM   4739  C  CD1   . LEU A 1  680  ? 151.240 103.676 147.628 1.00 48.77  ? 680  LEU A CD1   1 
ATOM   4740  C  CD2   . LEU A 1  680  ? 150.389 102.565 149.711 1.00 48.38  ? 680  LEU A CD2   1 
ATOM   4741  N  N     . THR A 1  681  ? 151.789 106.712 149.268 1.00 49.54  ? 681  THR A N     1 
ATOM   4742  C  CA    . THR A 1  681  ? 153.176 107.060 148.986 1.00 50.34  ? 681  THR A CA    1 
ATOM   4743  C  C     . THR A 1  681  ? 153.778 108.016 150.010 1.00 50.25  ? 681  THR A C     1 
ATOM   4744  O  O     . THR A 1  681  ? 154.957 108.365 149.882 1.00 49.97  ? 681  THR A O     1 
ATOM   4745  C  CB    . THR A 1  681  ? 153.287 107.679 147.591 1.00 50.46  ? 681  THR A CB    1 
ATOM   4746  O  OG1   . THR A 1  681  ? 154.668 107.891 147.268 1.00 51.78  ? 681  THR A OG1   1 
ATOM   4747  C  CG2   . THR A 1  681  ? 152.556 109.008 147.547 1.00 52.00  ? 681  THR A CG2   1 
ATOM   4748  N  N     . SER A 1  682  ? 153.010 108.448 151.006 1.00 53.64  ? 682  SER A N     1 
ATOM   4749  C  CA    . SER A 1  682  ? 153.529 109.373 152.003 1.00 55.08  ? 682  SER A CA    1 
ATOM   4750  C  C     . SER A 1  682  ? 154.596 108.700 152.861 1.00 55.18  ? 682  SER A C     1 
ATOM   4751  O  O     . SER A 1  682  ? 154.699 107.472 152.932 1.00 55.02  ? 682  SER A O     1 
ATOM   4752  C  CB    . SER A 1  682  ? 152.400 109.896 152.891 1.00 56.37  ? 682  SER A CB    1 
ATOM   4753  O  OG    . SER A 1  682  ? 152.895 110.806 153.859 1.00 56.46  ? 682  SER A OG    1 
ATOM   4754  N  N     . LYS A 1  683  ? 155.401 109.534 153.524 1.00 57.96  ? 683  LYS A N     1 
ATOM   4755  C  CA    . LYS A 1  683  ? 156.440 109.009 154.403 1.00 59.36  ? 683  LYS A CA    1 
ATOM   4756  C  C     . LYS A 1  683  ? 155.850 108.390 155.663 1.00 60.36  ? 683  LYS A C     1 
ATOM   4757  O  O     . LYS A 1  683  ? 156.469 107.504 156.264 1.00 60.99  ? 683  LYS A O     1 
ATOM   4758  C  CB    . LYS A 1  683  ? 157.432 110.115 154.764 1.00 61.34  ? 683  LYS A CB    1 
ATOM   4759  C  CG    . LYS A 1  683  ? 158.190 110.678 153.572 1.00 61.35  ? 683  LYS A CG    1 
ATOM   4760  C  CD    . LYS A 1  683  ? 159.211 111.719 154.002 1.00 61.35  ? 683  LYS A CD    1 
ATOM   4761  C  CE    . LYS A 1  683  ? 158.542 112.913 154.660 1.00 59.64  ? 683  LYS A CE    1 
ATOM   4762  N  NZ    . LYS A 1  683  ? 159.532 113.945 155.075 1.00 59.34  ? 683  LYS A NZ    1 
ATOM   4763  N  N     . ASP A 1  684  ? 154.665 108.836 156.079 1.00 60.17  ? 684  ASP A N     1 
ATOM   4764  C  CA    . ASP A 1  684  ? 154.000 108.262 157.241 1.00 60.55  ? 684  ASP A CA    1 
ATOM   4765  C  C     . ASP A 1  684  ? 153.214 107.015 156.851 1.00 61.55  ? 684  ASP A C     1 
ATOM   4766  O  O     . ASP A 1  684  ? 152.012 106.922 157.119 1.00 62.19  ? 684  ASP A O     1 
ATOM   4767  C  CB    . ASP A 1  684  ? 153.072 109.288 157.895 1.00 62.35  ? 684  ASP A CB    1 
ATOM   4768  C  CG    . ASP A 1  684  ? 153.819 110.495 158.425 1.00 62.57  ? 684  ASP A CG    1 
ATOM   4769  O  OD1   . ASP A 1  684  ? 155.024 110.366 158.727 1.00 59.49  ? 684  ASP A OD1   1 
ATOM   4770  O  OD2   . ASP A 1  684  ? 153.199 111.574 158.543 1.00 59.30  ? 684  ASP A OD2   1 
ATOM   4771  N  N     . SER A 1  685  ? 153.887 106.054 156.221 1.00 58.84  ? 685  SER A N     1 
ATOM   4772  C  CA    . SER A 1  685  ? 153.240 104.807 155.818 1.00 59.01  ? 685  SER A CA    1 
ATOM   4773  C  C     . SER A 1  685  ? 154.321 103.742 155.703 1.00 59.79  ? 685  SER A C     1 
ATOM   4774  O  O     . SER A 1  685  ? 155.105 103.759 154.749 1.00 60.48  ? 685  SER A O     1 
ATOM   4775  C  CB    . SER A 1  685  ? 152.490 104.980 154.502 1.00 58.38  ? 685  SER A CB    1 
ATOM   4776  O  OG    . SER A 1  685  ? 151.866 103.771 154.108 1.00 58.67  ? 685  SER A OG    1 
ATOM   4777  N  N     . PHE A 1  686  ? 154.358 102.824 156.664 1.00 58.01  ? 686  PHE A N     1 
ATOM   4778  C  CA    . PHE A 1  686  ? 155.351 101.759 156.705 1.00 58.00  ? 686  PHE A CA    1 
ATOM   4779  C  C     . PHE A 1  686  ? 154.644 100.413 156.732 1.00 59.09  ? 686  PHE A C     1 
ATOM   4780  O  O     . PHE A 1  686  ? 153.798 100.167 157.598 1.00 60.39  ? 686  PHE A O     1 
ATOM   4781  C  CB    . PHE A 1  686  ? 156.267 101.911 157.923 1.00 61.17  ? 686  PHE A CB    1 
ATOM   4782  C  CG    . PHE A 1  686  ? 157.204 103.082 157.832 1.00 61.48  ? 686  PHE A CG    1 
ATOM   4783  C  CD1   . PHE A 1  686  ? 157.661 103.527 156.601 1.00 61.55  ? 686  PHE A CD1   1 
ATOM   4784  C  CD2   . PHE A 1  686  ? 157.626 103.742 158.975 1.00 61.22  ? 686  PHE A CD2   1 
ATOM   4785  C  CE1   . PHE A 1  686  ? 158.522 104.604 156.513 1.00 60.77  ? 686  PHE A CE1   1 
ATOM   4786  C  CE2   . PHE A 1  686  ? 158.487 104.820 158.892 1.00 56.61  ? 686  PHE A CE2   1 
ATOM   4787  C  CZ    . PHE A 1  686  ? 158.935 105.251 157.659 1.00 57.17  ? 686  PHE A CZ    1 
ATOM   4788  N  N     . PHE A 1  687  ? 154.995 99.548  155.787 1.00 54.70  ? 687  PHE A N     1 
ATOM   4789  C  CA    . PHE A 1  687  ? 154.380 98.239  155.631 1.00 53.49  ? 687  PHE A CA    1 
ATOM   4790  C  C     . PHE A 1  687  ? 155.378 97.145  156.000 1.00 53.75  ? 687  PHE A C     1 
ATOM   4791  O  O     . PHE A 1  687  ? 156.558 97.401  156.254 1.00 53.93  ? 687  PHE A O     1 
ATOM   4792  C  CB    . PHE A 1  687  ? 153.870 98.055  154.200 1.00 54.44  ? 687  PHE A CB    1 
ATOM   4793  C  CG    . PHE A 1  687  ? 152.777 99.013  153.816 1.00 54.42  ? 687  PHE A CG    1 
ATOM   4794  C  CD1   . PHE A 1  687  ? 151.947 99.562  154.779 1.00 54.43  ? 687  PHE A CD1   1 
ATOM   4795  C  CD2   . PHE A 1  687  ? 152.583 99.363  152.491 1.00 54.01  ? 687  PHE A CD2   1 
ATOM   4796  C  CE1   . PHE A 1  687  ? 150.942 100.444 154.427 1.00 53.54  ? 687  PHE A CE1   1 
ATOM   4797  C  CE2   . PHE A 1  687  ? 151.580 100.243 152.133 1.00 51.84  ? 687  PHE A CE2   1 
ATOM   4798  C  CZ    . PHE A 1  687  ? 150.759 100.784 153.101 1.00 51.74  ? 687  PHE A CZ    1 
ATOM   4799  N  N     . THR A 1  688  ? 154.888 95.910  156.025 1.00 50.24  ? 688  THR A N     1 
ATOM   4800  C  CA    . THR A 1  688  ? 155.689 94.736  156.334 1.00 49.48  ? 688  THR A CA    1 
ATOM   4801  C  C     . THR A 1  688  ? 155.855 93.879  155.082 1.00 49.20  ? 688  THR A C     1 
ATOM   4802  O  O     . THR A 1  688  ? 155.403 94.233  153.988 1.00 49.07  ? 688  THR A O     1 
ATOM   4803  C  CB    . THR A 1  688  ? 155.053 93.931  157.470 1.00 49.31  ? 688  THR A CB    1 
ATOM   4804  O  OG1   . THR A 1  688  ? 155.885 92.807  157.785 1.00 49.52  ? 688  THR A OG1   1 
ATOM   4805  C  CG2   . THR A 1  688  ? 153.674 93.434  157.063 1.00 50.06  ? 688  THR A CG2   1 
ATOM   4806  N  N     . ARG A 1  689  ? 156.524 92.737  155.254 1.00 49.53  ? 689  ARG A N     1 
ATOM   4807  C  CA    . ARG A 1  689  ? 156.734 91.824  154.134 1.00 49.80  ? 689  ARG A CA    1 
ATOM   4808  C  C     . ARG A 1  689  ? 155.411 91.281  153.610 1.00 49.64  ? 689  ARG A C     1 
ATOM   4809  O  O     . ARG A 1  689  ? 155.261 91.044  152.404 1.00 49.87  ? 689  ARG A O     1 
ATOM   4810  C  CB    . ARG A 1  689  ? 157.658 90.681  154.559 1.00 49.86  ? 689  ARG A CB    1 
ATOM   4811  C  CG    . ARG A 1  689  ? 157.996 89.698  153.450 1.00 50.11  ? 689  ARG A CG    1 
ATOM   4812  C  CD    . ARG A 1  689  ? 159.056 88.705  153.904 1.00 50.53  ? 689  ARG A CD    1 
ATOM   4813  N  NE    . ARG A 1  689  ? 159.358 87.712  152.878 1.00 50.84  ? 689  ARG A NE    1 
ATOM   4814  C  CZ    . ARG A 1  689  ? 158.809 86.503  152.823 1.00 50.68  ? 689  ARG A CZ    1 
ATOM   4815  N  NH1   . ARG A 1  689  ? 157.924 86.132  153.739 1.00 50.35  ? 689  ARG A NH1   1 
ATOM   4816  N  NH2   . ARG A 1  689  ? 159.144 85.663  151.853 1.00 50.20  ? 689  ARG A NH2   1 
ATOM   4817  N  N     . GLU A 1  690  ? 154.438 91.077  154.500 1.00 51.10  ? 690  GLU A N     1 
ATOM   4818  C  CA    . GLU A 1  690  ? 153.129 90.592  154.075 1.00 51.60  ? 690  GLU A CA    1 
ATOM   4819  C  C     . GLU A 1  690  ? 152.441 91.602  153.168 1.00 51.96  ? 690  GLU A C     1 
ATOM   4820  O  O     . GLU A 1  690  ? 151.892 91.243  152.120 1.00 51.95  ? 690  GLU A O     1 
ATOM   4821  C  CB    . GLU A 1  690  ? 152.264 90.286  155.297 1.00 51.94  ? 690  GLU A CB    1 
ATOM   4822  C  CG    . GLU A 1  690  ? 152.945 89.384  156.302 1.00 52.37  ? 690  GLU A CG    1 
ATOM   4823  C  CD    . GLU A 1  690  ? 153.467 88.114  155.667 1.00 51.80  ? 690  GLU A CD    1 
ATOM   4824  O  OE1   . GLU A 1  690  ? 152.737 87.514  154.850 1.00 51.71  ? 690  GLU A OE1   1 
ATOM   4825  O  OE2   . GLU A 1  690  ? 154.613 87.724  155.972 1.00 51.96  ? 690  GLU A OE2   1 
ATOM   4826  N  N     . GLN A 1  691  ? 152.456 92.877  153.560 1.00 51.60  ? 691  GLN A N     1 
ATOM   4827  C  CA    . GLN A 1  691  ? 151.876 93.909  152.712 1.00 51.58  ? 691  GLN A CA    1 
ATOM   4828  C  C     . GLN A 1  691  ? 152.678 94.094  151.431 1.00 52.13  ? 691  GLN A C     1 
ATOM   4829  O  O     . GLN A 1  691  ? 152.094 94.312  150.366 1.00 52.70  ? 691  GLN A O     1 
ATOM   4830  C  CB    . GLN A 1  691  ? 151.782 95.229  153.478 1.00 53.59  ? 691  GLN A CB    1 
ATOM   4831  C  CG    . GLN A 1  691  ? 151.207 95.092  154.880 1.00 54.30  ? 691  GLN A CG    1 
ATOM   4832  C  CD    . GLN A 1  691  ? 149.826 94.467  154.889 1.00 54.02  ? 691  GLN A CD    1 
ATOM   4833  O  OE1   . GLN A 1  691  ? 149.670 93.282  155.182 1.00 51.06  ? 691  GLN A OE1   1 
ATOM   4834  N  NE2   . GLN A 1  691  ? 148.812 95.265  154.572 1.00 50.51  ? 691  GLN A NE2   1 
ATOM   4835  N  N     . TYR A 1  692  ? 154.008 93.996  151.507 1.00 51.37  ? 692  TYR A N     1 
ATOM   4836  C  CA    . TYR A 1  692  ? 154.830 94.176  150.314 1.00 51.42  ? 692  TYR A CA    1 
ATOM   4837  C  C     . TYR A 1  692  ? 154.541 93.115  149.257 1.00 51.21  ? 692  TYR A C     1 
ATOM   4838  O  O     . TYR A 1  692  ? 154.663 93.391  148.058 1.00 50.38  ? 692  TYR A O     1 
ATOM   4839  C  CB    . TYR A 1  692  ? 156.312 94.158  150.690 1.00 49.66  ? 692  TYR A CB    1 
ATOM   4840  C  CG    . TYR A 1  692  ? 157.248 94.197  149.503 1.00 49.34  ? 692  TYR A CG    1 
ATOM   4841  C  CD1   . TYR A 1  692  ? 157.458 95.376  148.799 1.00 49.63  ? 692  TYR A CD1   1 
ATOM   4842  C  CD2   . TYR A 1  692  ? 157.925 93.058  149.088 1.00 49.52  ? 692  TYR A CD2   1 
ATOM   4843  C  CE1   . TYR A 1  692  ? 158.313 95.418  147.714 1.00 50.16  ? 692  TYR A CE1   1 
ATOM   4844  C  CE2   . TYR A 1  692  ? 158.782 93.090  148.004 1.00 50.39  ? 692  TYR A CE2   1 
ATOM   4845  C  CZ    . TYR A 1  692  ? 158.973 94.273  147.321 1.00 51.49  ? 692  TYR A CZ    1 
ATOM   4846  O  OH    . TYR A 1  692  ? 159.825 94.310  146.242 1.00 51.99  ? 692  TYR A OH    1 
ATOM   4847  N  N     . GLN A 1  693  ? 154.155 91.910  149.674 1.00 51.65  ? 693  GLN A N     1 
ATOM   4848  C  CA    . GLN A 1  693  ? 153.870 90.831  148.733 1.00 52.30  ? 693  GLN A CA    1 
ATOM   4849  C  C     . GLN A 1  693  ? 152.415 90.852  148.271 1.00 53.07  ? 693  GLN A C     1 
ATOM   4850  O  O     . GLN A 1  693  ? 152.135 90.740  147.073 1.00 53.86  ? 693  GLN A O     1 
ATOM   4851  C  CB    . GLN A 1  693  ? 154.214 89.478  149.367 1.00 54.52  ? 693  GLN A CB    1 
ATOM   4852  C  CG    . GLN A 1  693  ? 155.693 89.286  149.657 1.00 54.27  ? 693  GLN A CG    1 
ATOM   4853  C  CD    . GLN A 1  693  ? 156.010 87.898  150.174 1.00 54.97  ? 693  GLN A CD    1 
ATOM   4854  O  OE1   . GLN A 1  693  ? 155.110 87.119  150.485 1.00 52.31  ? 693  GLN A OE1   1 
ATOM   4855  N  NE2   . GLN A 1  693  ? 157.296 87.579  150.264 1.00 52.53  ? 693  GLN A NE2   1 
ATOM   4856  N  N     . GLN A 1  694  ? 151.479 90.994  149.213 1.00 51.93  ? 694  GLN A N     1 
ATOM   4857  C  CA    . GLN A 1  694  ? 150.064 90.932  148.862 1.00 51.41  ? 694  GLN A CA    1 
ATOM   4858  C  C     . GLN A 1  694  ? 149.614 92.173  148.101 1.00 52.11  ? 694  GLN A C     1 
ATOM   4859  O  O     . GLN A 1  694  ? 148.727 92.085  147.244 1.00 52.81  ? 694  GLN A O     1 
ATOM   4860  C  CB    . GLN A 1  694  ? 149.223 90.738  150.126 1.00 53.55  ? 694  GLN A CB    1 
ATOM   4861  C  CG    . GLN A 1  694  ? 147.743 90.474  149.874 1.00 53.75  ? 694  GLN A CG    1 
ATOM   4862  C  CD    . GLN A 1  694  ? 146.922 91.747  149.795 1.00 54.04  ? 694  GLN A CD    1 
ATOM   4863  O  OE1   . GLN A 1  694  ? 147.389 92.824  150.162 1.00 49.76  ? 694  GLN A OE1   1 
ATOM   4864  N  NE2   . GLN A 1  694  ? 145.690 91.627  149.313 1.00 49.71  ? 694  GLN A NE2   1 
ATOM   4865  N  N     . TYR A 1  695  ? 150.209 93.334  148.392 1.00 47.94  ? 695  TYR A N     1 
ATOM   4866  C  CA    . TYR A 1  695  ? 149.810 94.556  147.701 1.00 46.91  ? 695  TYR A CA    1 
ATOM   4867  C  C     . TYR A 1  695  ? 150.187 94.525  146.227 1.00 45.74  ? 695  TYR A C     1 
ATOM   4868  O  O     . TYR A 1  695  ? 149.454 95.066  145.392 1.00 44.11  ? 695  TYR A O     1 
ATOM   4869  C  CB    . TYR A 1  695  ? 150.439 95.779  148.366 1.00 43.17  ? 695  TYR A CB    1 
ATOM   4870  C  CG    . TYR A 1  695  ? 149.562 96.453  149.396 1.00 42.76  ? 695  TYR A CG    1 
ATOM   4871  C  CD1   . TYR A 1  695  ? 149.402 95.910  150.664 1.00 42.66  ? 695  TYR A CD1   1 
ATOM   4872  C  CD2   . TYR A 1  695  ? 148.896 97.632  149.100 1.00 42.54  ? 695  TYR A CD2   1 
ATOM   4873  C  CE1   . TYR A 1  695  ? 148.601 96.525  151.608 1.00 43.38  ? 695  TYR A CE1   1 
ATOM   4874  C  CE2   . TYR A 1  695  ? 148.097 98.254  150.035 1.00 42.71  ? 695  TYR A CE2   1 
ATOM   4875  C  CZ    . TYR A 1  695  ? 147.951 97.697  151.286 1.00 47.76  ? 695  TYR A CZ    1 
ATOM   4876  O  OH    . TYR A 1  695  ? 147.152 98.316  152.220 1.00 48.04  ? 695  TYR A OH    1 
ATOM   4877  N  N     . ILE A 1  696  ? 151.315 93.909  145.885 1.00 49.07  ? 696  ILE A N     1 
ATOM   4878  C  CA    . ILE A 1  696  ? 151.761 93.921  144.498 1.00 50.56  ? 696  ILE A CA    1 
ATOM   4879  C  C     . ILE A 1  696  ? 151.224 92.726  143.712 1.00 51.71  ? 696  ILE A C     1 
ATOM   4880  O  O     . ILE A 1  696  ? 150.977 92.845  142.508 1.00 51.53  ? 696  ILE A O     1 
ATOM   4881  C  CB    . ILE A 1  696  ? 153.298 93.995  144.425 1.00 51.12  ? 696  ILE A CB    1 
ATOM   4882  C  CG1   . ILE A 1  696  ? 153.940 92.706  144.944 1.00 52.64  ? 696  ILE A CG1   1 
ATOM   4883  C  CG2   . ILE A 1  696  ? 153.806 95.195  145.209 1.00 51.14  ? 696  ILE A CG2   1 
ATOM   4884  C  CD1   . ILE A 1  696  ? 154.581 91.870  143.855 1.00 51.18  ? 696  ILE A CD1   1 
ATOM   4885  N  N     . TYR A 1  697  ? 151.024 91.575  144.361 1.00 51.84  ? 697  TYR A N     1 
ATOM   4886  C  CA    . TYR A 1  697  ? 150.447 90.440  143.648 1.00 52.40  ? 697  TYR A CA    1 
ATOM   4887  C  C     . TYR A 1  697  ? 148.950 90.615  143.436 1.00 52.51  ? 697  TYR A C     1 
ATOM   4888  O  O     . TYR A 1  697  ? 148.420 90.197  142.400 1.00 52.54  ? 697  TYR A O     1 
ATOM   4889  C  CB    . TYR A 1  697  ? 150.718 89.134  144.390 1.00 52.76  ? 697  TYR A CB    1 
ATOM   4890  C  CG    . TYR A 1  697  ? 149.919 87.981  143.829 1.00 53.57  ? 697  TYR A CG    1 
ATOM   4891  C  CD1   . TYR A 1  697  ? 150.163 87.503  142.550 1.00 54.02  ? 697  TYR A CD1   1 
ATOM   4892  C  CD2   . TYR A 1  697  ? 148.907 87.385  144.569 1.00 55.22  ? 697  TYR A CD2   1 
ATOM   4893  C  CE1   . TYR A 1  697  ? 149.428 86.459  142.025 1.00 53.40  ? 697  TYR A CE1   1 
ATOM   4894  C  CE2   . TYR A 1  697  ? 148.168 86.338  144.053 1.00 52.72  ? 697  TYR A CE2   1 
ATOM   4895  C  CZ    . TYR A 1  697  ? 148.433 85.880  142.781 1.00 51.83  ? 697  TYR A CZ    1 
ATOM   4896  O  OH    . TYR A 1  697  ? 147.700 84.836  142.264 1.00 52.15  ? 697  TYR A OH    1 
ATOM   4897  N  N     . GLY A 1  698  ? 148.253 91.225  144.397 1.00 51.00  ? 698  GLY A N     1 
ATOM   4898  C  CA    . GLY A 1  698  ? 146.838 91.512  144.237 1.00 50.52  ? 698  GLY A CA    1 
ATOM   4899  C  C     . GLY A 1  698  ? 146.515 92.417  143.066 1.00 50.22  ? 698  GLY A C     1 
ATOM   4900  O  O     . GLY A 1  698  ? 145.335 92.578  142.735 1.00 50.48  ? 698  GLY A O     1 
ATOM   4901  N  N     . CYS A 1  699  ? 147.530 93.010  142.435 1.00 49.78  ? 699  CYS A N     1 
ATOM   4902  C  CA    . CYS A 1  699  ? 147.342 93.877  141.284 1.00 49.72  ? 699  CYS A CA    1 
ATOM   4903  C  C     . CYS A 1  699  ? 148.093 93.422  140.044 1.00 49.84  ? 699  CYS A C     1 
ATOM   4904  O  O     . CYS A 1  699  ? 147.732 93.846  138.941 1.00 49.89  ? 699  CYS A O     1 
ATOM   4905  C  CB    . CYS A 1  699  ? 147.774 95.311  141.623 1.00 49.49  ? 699  CYS A CB    1 
ATOM   4906  S  SG    . CYS A 1  699  ? 147.296 95.821  143.284 1.00 49.75  ? 699  CYS A SG    1 
ATOM   4907  N  N     . ILE A 1  700  ? 149.117 92.582  140.184 1.00 49.60  ? 700  ILE A N     1 
ATOM   4908  C  CA    . ILE A 1  700  ? 149.845 92.056  139.035 1.00 50.43  ? 700  ILE A CA    1 
ATOM   4909  C  C     . ILE A 1  700  ? 149.118 90.824  138.513 1.00 50.61  ? 700  ILE A C     1 
ATOM   4910  O  O     . ILE A 1  700  ? 148.684 90.794  137.356 1.00 50.37  ? 700  ILE A O     1 
ATOM   4911  C  CB    . ILE A 1  700  ? 151.307 91.732  139.391 1.00 50.38  ? 700  ILE A CB    1 
ATOM   4912  C  CG1   . ILE A 1  700  ? 152.115 93.020  139.555 1.00 51.07  ? 700  ILE A CG1   1 
ATOM   4913  C  CG2   . ILE A 1  700  ? 151.928 90.841  138.328 1.00 51.99  ? 700  ILE A CG2   1 
ATOM   4914  C  CD1   . ILE A 1  700  ? 152.180 93.862  138.301 1.00 52.11  ? 700  ILE A CD1   1 
ATOM   4915  N  N     . ARG A 1  701  ? 148.968 89.811  139.372 1.00 54.14  ? 701  ARG A N     1 
ATOM   4916  C  CA    . ARG A 1  701  ? 148.291 88.563  139.037 1.00 55.65  ? 701  ARG A CA    1 
ATOM   4917  C  C     . ARG A 1  701  ? 148.863 87.967  137.756 1.00 57.09  ? 701  ARG A C     1 
ATOM   4918  O  O     . ARG A 1  701  ? 148.212 88.015  136.704 1.00 58.19  ? 701  ARG A O     1 
ATOM   4919  C  CB    . ARG A 1  701  ? 146.786 88.800  138.898 1.00 59.06  ? 701  ARG A CB    1 
ATOM   4920  C  CG    . ARG A 1  701  ? 145.939 87.544  138.972 1.00 60.14  ? 701  ARG A CG    1 
ATOM   4921  C  CD    . ARG A 1  701  ? 144.475 87.875  138.751 1.00 61.40  ? 701  ARG A CD    1 
ATOM   4922  N  NE    . ARG A 1  701  ? 143.979 88.823  139.743 1.00 61.86  ? 701  ARG A NE    1 
ATOM   4923  C  CZ    . ARG A 1  701  ? 142.849 89.513  139.618 1.00 61.79  ? 701  ARG A CZ    1 
ATOM   4924  N  NH1   . ARG A 1  701  ? 142.475 90.354  140.571 1.00 55.40  ? 701  ARG A NH1   1 
ATOM   4925  N  NH2   . ARG A 1  701  ? 142.100 89.367  138.534 1.00 55.41  ? 701  ARG A NH2   1 
ATOM   4926  N  N     . PRO A 1  702  ? 150.079 87.413  137.798 1.00 55.20  ? 702  PRO A N     1 
ATOM   4927  C  CA    . PRO A 1  702  ? 150.720 86.933  136.559 1.00 55.48  ? 702  PRO A CA    1 
ATOM   4928  C  C     . PRO A 1  702  ? 149.954 85.834  135.837 1.00 55.03  ? 702  PRO A C     1 
ATOM   4929  O  O     . PRO A 1  702  ? 150.308 85.520  134.693 1.00 54.99  ? 702  PRO A O     1 
ATOM   4930  C  CB    . PRO A 1  702  ? 152.085 86.422  137.044 1.00 55.06  ? 702  PRO A CB    1 
ATOM   4931  C  CG    . PRO A 1  702  ? 152.316 87.119  138.346 1.00 56.70  ? 702  PRO A CG    1 
ATOM   4932  C  CD    . PRO A 1  702  ? 150.960 87.262  138.968 1.00 56.80  ? 702  PRO A CD    1 
ATOM   4933  N  N     . GLU A 1  703  ? 148.929 85.238  136.453 1.00 58.55  ? 703  GLU A N     1 
ATOM   4934  C  CA    . GLU A 1  703  ? 148.151 84.225  135.750 1.00 60.37  ? 703  GLU A CA    1 
ATOM   4935  C  C     . GLU A 1  703  ? 147.359 84.831  134.597 1.00 62.07  ? 703  GLU A C     1 
ATOM   4936  O  O     . GLU A 1  703  ? 147.204 84.191  133.551 1.00 63.70  ? 703  GLU A O     1 
ATOM   4937  C  CB    . GLU A 1  703  ? 147.232 83.490  136.728 1.00 64.78  ? 703  GLU A CB    1 
ATOM   4938  C  CG    . GLU A 1  703  ? 146.172 84.348  137.396 1.00 65.46  ? 703  GLU A CG    1 
ATOM   4939  C  CD    . GLU A 1  703  ? 144.860 84.358  136.634 1.00 64.90  ? 703  GLU A CD    1 
ATOM   4940  O  OE1   . GLU A 1  703  ? 144.740 83.612  135.640 1.00 60.17  ? 703  GLU A OE1   1 
ATOM   4941  O  OE2   . GLU A 1  703  ? 143.946 85.110  137.034 1.00 60.25  ? 703  GLU A OE2   1 
ATOM   4942  N  N     . ASP A 1  704  ? 146.853 86.055  134.765 1.00 59.78  ? 704  ASP A N     1 
ATOM   4943  C  CA    . ASP A 1  704  ? 146.324 86.808  133.636 1.00 59.56  ? 704  ASP A CA    1 
ATOM   4944  C  C     . ASP A 1  704  ? 147.436 87.389  132.775 1.00 59.36  ? 704  ASP A C     1 
ATOM   4945  O  O     . ASP A 1  704  ? 147.209 87.674  131.594 1.00 59.52  ? 704  ASP A O     1 
ATOM   4946  C  CB    . ASP A 1  704  ? 145.409 87.933  134.126 1.00 59.52  ? 704  ASP A CB    1 
ATOM   4947  C  CG    . ASP A 1  704  ? 144.137 87.414  134.765 1.00 60.10  ? 704  ASP A CG    1 
ATOM   4948  O  OD1   . ASP A 1  704  ? 143.705 86.297  134.410 1.00 59.70  ? 704  ASP A OD1   1 
ATOM   4949  O  OD2   . ASP A 1  704  ? 143.568 88.123  135.620 1.00 59.69  ? 704  ASP A OD2   1 
ATOM   4950  N  N     . GLY A 1  705  ? 148.623 87.569  133.347 1.00 59.94  ? 705  GLY A N     1 
ATOM   4951  C  CA    . GLY A 1  705  ? 149.794 88.026  132.630 1.00 60.05  ? 705  GLY A CA    1 
ATOM   4952  C  C     . GLY A 1  705  ? 150.096 89.494  132.835 1.00 60.05  ? 705  GLY A C     1 
ATOM   4953  O  O     . GLY A 1  705  ? 149.460 90.365  132.232 1.00 59.98  ? 705  GLY A O     1 
ATOM   4954  N  N     . HIS A 1  706  ? 151.077 89.777  133.692 1.00 59.87  ? 706  HIS A N     1 
ATOM   4955  C  CA    . HIS A 1  706  ? 151.623 91.118  133.827 1.00 59.77  ? 706  HIS A CA    1 
ATOM   4956  C  C     . HIS A 1  706  ? 153.133 91.122  134.009 1.00 59.64  ? 706  HIS A C     1 
ATOM   4957  O  O     . HIS A 1  706  ? 153.722 92.203  134.102 1.00 59.25  ? 706  HIS A O     1 
ATOM   4958  C  CB    . HIS A 1  706  ? 150.960 91.860  134.999 1.00 59.01  ? 706  HIS A CB    1 
ATOM   4959  C  CG    . HIS A 1  706  ? 149.509 92.157  134.780 1.00 58.71  ? 706  HIS A CG    1 
ATOM   4960  N  ND1   . HIS A 1  706  ? 148.521 91.211  134.948 1.00 58.81  ? 706  HIS A ND1   1 
ATOM   4961  C  CD2   . HIS A 1  706  ? 148.879 93.294  134.400 1.00 59.00  ? 706  HIS A CD2   1 
ATOM   4962  C  CE1   . HIS A 1  706  ? 147.345 91.752  134.684 1.00 60.22  ? 706  HIS A CE1   1 
ATOM   4963  N  NE2   . HIS A 1  706  ? 147.535 93.015  134.348 1.00 60.00  ? 706  HIS A NE2   1 
ATOM   4964  N  N     . THR A 1  707  ? 153.775 89.958  134.062 1.00 61.32  ? 707  THR A N     1 
ATOM   4965  C  CA    . THR A 1  707  ? 155.224 89.863  134.095 1.00 62.56  ? 707  THR A CA    1 
ATOM   4966  C  C     . THR A 1  707  ? 155.757 89.681  132.678 1.00 62.65  ? 707  THR A C     1 
ATOM   4967  O  O     . THR A 1  707  ? 155.005 89.461  131.726 1.00 61.76  ? 707  THR A O     1 
ATOM   4968  C  CB    . THR A 1  707  ? 155.673 88.707  134.988 1.00 62.74  ? 707  THR A CB    1 
ATOM   4969  O  OG1   . THR A 1  707  ? 157.104 88.628  134.981 1.00 63.77  ? 707  THR A OG1   1 
ATOM   4970  C  CG2   . THR A 1  707  ? 155.094 87.391  134.489 1.00 63.25  ? 707  THR A CG2   1 
ATOM   4971  N  N     . THR A 1  708  ? 157.077 89.777  132.538 1.00 65.81  ? 708  THR A N     1 
ATOM   4972  C  CA    . THR A 1  708  ? 157.647 89.794  131.198 1.00 67.78  ? 708  THR A CA    1 
ATOM   4973  C  C     . THR A 1  708  ? 158.764 88.778  130.989 1.00 67.96  ? 708  THR A C     1 
ATOM   4974  O  O     . THR A 1  708  ? 158.929 88.274  129.873 1.00 68.02  ? 708  THR A O     1 
ATOM   4975  C  CB    . THR A 1  708  ? 158.153 91.200  130.874 1.00 67.75  ? 708  THR A CB    1 
ATOM   4976  O  OG1   . THR A 1  708  ? 158.917 91.172  129.661 1.00 69.53  ? 708  THR A OG1   1 
ATOM   4977  C  CG2   . THR A 1  708  ? 159.008 91.734  132.014 1.00 69.85  ? 708  THR A CG2   1 
ATOM   4978  N  N     . ARG A 1  709  ? 159.541 88.457  132.027 1.00 71.60  ? 709  ARG A N     1 
ATOM   4979  C  CA    . ARG A 1  709  ? 160.652 87.526  131.847 1.00 73.95  ? 709  ARG A CA    1 
ATOM   4980  C  C     . ARG A 1  709  ? 160.321 86.118  132.339 1.00 73.84  ? 709  ARG A C     1 
ATOM   4981  O  O     . ARG A 1  709  ? 160.277 85.180  131.538 1.00 73.15  ? 709  ARG A O     1 
ATOM   4982  C  CB    . ARG A 1  709  ? 161.925 88.078  132.525 1.00 71.80  ? 709  ARG A CB    1 
ATOM   4983  C  CG    . ARG A 1  709  ? 161.876 88.314  134.044 1.00 70.69  ? 709  ARG A CG    1 
ATOM   4984  C  CD    . ARG A 1  709  ? 161.171 89.604  134.440 1.00 69.37  ? 709  ARG A CD    1 
ATOM   4985  N  NE    . ARG A 1  709  ? 161.937 90.793  134.079 1.00 69.16  ? 709  ARG A NE    1 
ATOM   4986  C  CZ    . ARG A 1  709  ? 161.569 92.035  134.374 1.00 68.98  ? 709  ARG A CZ    1 
ATOM   4987  N  NH1   . ARG A 1  709  ? 160.442 92.253  135.038 1.00 75.74  ? 709  ARG A NH1   1 
ATOM   4988  N  NH2   . ARG A 1  709  ? 162.327 93.059  134.008 1.00 77.26  ? 709  ARG A NH2   1 
ATOM   4989  N  N     . SER A 1  710  ? 160.088 85.946  133.635 1.00 75.10  ? 710  SER A N     1 
ATOM   4990  C  CA    . SER A 1  710  ? 159.526 84.711  134.174 1.00 74.26  ? 710  SER A CA    1 
ATOM   4991  C  C     . SER A 1  710  ? 158.394 84.958  135.157 1.00 74.52  ? 710  SER A C     1 
ATOM   4992  O  O     . SER A 1  710  ? 157.392 84.236  135.129 1.00 74.55  ? 710  SER A O     1 
ATOM   4993  C  CB    . SER A 1  710  ? 160.629 83.880  134.849 1.00 72.32  ? 710  SER A CB    1 
ATOM   4994  O  OG    . SER A 1  710  ? 161.651 83.542  133.927 1.00 72.13  ? 710  SER A OG    1 
ATOM   4995  N  N     . LYS A 1  711  ? 158.524 85.974  136.012 1.00 70.26  ? 711  LYS A N     1 
ATOM   4996  C  CA    . LYS A 1  711  ? 157.596 86.259  137.100 1.00 68.64  ? 711  LYS A CA    1 
ATOM   4997  C  C     . LYS A 1  711  ? 158.030 87.534  137.812 1.00 69.20  ? 711  LYS A C     1 
ATOM   4998  O  O     . LYS A 1  711  ? 159.079 88.101  137.490 1.00 69.20  ? 711  LYS A O     1 
ATOM   4999  C  CB    . LYS A 1  711  ? 157.516 85.084  138.082 1.00 68.94  ? 711  LYS A CB    1 
ATOM   5000  C  CG    . LYS A 1  711  ? 158.852 84.425  138.426 1.00 68.63  ? 711  LYS A CG    1 
ATOM   5001  C  CD    . LYS A 1  711  ? 159.559 85.119  139.577 1.00 68.61  ? 711  LYS A CD    1 
ATOM   5002  C  CE    . LYS A 1  711  ? 160.869 84.428  139.921 1.00 66.04  ? 711  LYS A CE    1 
ATOM   5003  N  NZ    . LYS A 1  711  ? 161.562 85.091  141.060 1.00 65.82  ? 711  LYS A NZ    1 
ATOM   5004  N  N     . ILE A 1  712  ? 157.235 87.997  138.778 1.00 63.00  ? 712  ILE A N     1 
ATOM   5005  C  CA    . ILE A 1  712  ? 157.582 89.209  139.509 1.00 60.88  ? 712  ILE A CA    1 
ATOM   5006  C  C     . ILE A 1  712  ? 158.762 88.937  140.434 1.00 60.65  ? 712  ILE A C     1 
ATOM   5007  O  O     . ILE A 1  712  ? 158.897 87.843  140.999 1.00 60.50  ? 712  ILE A O     1 
ATOM   5008  C  CB    . ILE A 1  712  ? 156.362 89.738  140.283 1.00 60.88  ? 712  ILE A CB    1 
ATOM   5009  C  CG1   . ILE A 1  712  ? 155.687 88.622  141.089 1.00 60.91  ? 712  ILE A CG1   1 
ATOM   5010  C  CG2   . ILE A 1  712  ? 155.371 90.383  139.330 1.00 59.60  ? 712  ILE A CG2   1 
ATOM   5011  C  CD1   . ILE A 1  712  ? 156.189 88.479  142.513 1.00 58.71  ? 712  ILE A CD1   1 
ATOM   5012  N  N     . VAL A 1  713  ? 159.626 89.935  140.591 1.00 59.15  ? 713  VAL A N     1 
ATOM   5013  C  CA    . VAL A 1  713  ? 160.812 89.816  141.424 1.00 59.10  ? 713  VAL A CA    1 
ATOM   5014  C  C     . VAL A 1  713  ? 160.686 90.772  142.607 1.00 60.19  ? 713  VAL A C     1 
ATOM   5015  O  O     . VAL A 1  713  ? 159.843 91.669  142.627 1.00 60.59  ? 713  VAL A O     1 
ATOM   5016  C  CB    . VAL A 1  713  ? 162.108 90.081  140.630 1.00 60.16  ? 713  VAL A CB    1 
ATOM   5017  C  CG1   . VAL A 1  713  ? 162.207 89.135  139.443 1.00 57.67  ? 713  VAL A CG1   1 
ATOM   5018  C  CG2   . VAL A 1  713  ? 162.167 91.531  140.175 1.00 56.82  ? 713  VAL A CG2   1 
ATOM   5019  N  N     . THR A 1  714  ? 161.543 90.568  143.604 1.00 56.96  ? 714  THR A N     1 
ATOM   5020  C  CA    . THR A 1  714  ? 161.553 91.378  144.810 1.00 56.78  ? 714  THR A CA    1 
ATOM   5021  C  C     . THR A 1  714  ? 162.857 92.159  144.904 1.00 56.57  ? 714  THR A C     1 
ATOM   5022  O  O     . THR A 1  714  ? 163.880 91.779  144.329 1.00 56.61  ? 714  THR A O     1 
ATOM   5023  C  CB    . THR A 1  714  ? 161.374 90.513  146.067 1.00 56.42  ? 714  THR A CB    1 
ATOM   5024  O  OG1   . THR A 1  714  ? 162.440 89.558  146.148 1.00 57.17  ? 714  THR A OG1   1 
ATOM   5025  C  CG2   . THR A 1  714  ? 160.043 89.777  146.021 1.00 57.11  ? 714  THR A CG2   1 
ATOM   5026  N  N     . LEU A 1  715  ? 162.805 93.262  145.641 1.00 57.54  ? 715  LEU A N     1 
ATOM   5027  C  CA    . LEU A 1  715  ? 163.933 94.150  145.856 1.00 57.65  ? 715  LEU A CA    1 
ATOM   5028  C  C     . LEU A 1  715  ? 164.246 94.244  147.344 1.00 57.89  ? 715  LEU A C     1 
ATOM   5029  O  O     . LEU A 1  715  ? 163.382 93.971  148.186 1.00 58.60  ? 715  LEU A O     1 
ATOM   5030  C  CB    . LEU A 1  715  ? 163.647 95.552  145.295 1.00 58.79  ? 715  LEU A CB    1 
ATOM   5031  C  CG    . LEU A 1  715  ? 163.639 95.739  143.774 1.00 58.93  ? 715  LEU A CG    1 
ATOM   5032  C  CD1   . LEU A 1  715  ? 162.347 95.234  143.145 1.00 56.83  ? 715  LEU A CD1   1 
ATOM   5033  C  CD2   . LEU A 1  715  ? 163.877 97.200  143.415 1.00 57.26  ? 715  LEU A CD2   1 
ATOM   5034  N  N     . PRO A 1  716  ? 165.479 94.610  147.706 1.00 57.40  ? 716  PRO A N     1 
ATOM   5035  C  CA    . PRO A 1  716  ? 165.806 94.755  149.124 1.00 57.08  ? 716  PRO A CA    1 
ATOM   5036  C  C     . PRO A 1  716  ? 164.989 95.864  149.759 1.00 57.62  ? 716  PRO A C     1 
ATOM   5037  O  O     . PRO A 1  716  ? 164.639 96.857  149.096 1.00 57.89  ? 716  PRO A O     1 
ATOM   5038  C  CB    . PRO A 1  716  ? 167.306 95.102  149.107 1.00 57.91  ? 716  PRO A CB    1 
ATOM   5039  C  CG    . PRO A 1  716  ? 167.803 94.559  147.814 1.00 56.02  ? 716  PRO A CG    1 
ATOM   5040  C  CD    . PRO A 1  716  ? 166.670 94.741  146.849 1.00 55.28  ? 716  PRO A CD    1 
ATOM   5041  N  N     . PRO A 1  717  ? 164.659 95.744  151.039 1.00 55.84  ? 717  PRO A N     1 
ATOM   5042  C  CA    . PRO A 1  717  ? 163.852 96.763  151.714 1.00 55.45  ? 717  PRO A CA    1 
ATOM   5043  C  C     . PRO A 1  717  ? 164.700 97.972  152.094 1.00 55.89  ? 717  PRO A C     1 
ATOM   5044  O  O     . PRO A 1  717  ? 165.889 98.055  151.795 1.00 56.36  ? 717  PRO A O     1 
ATOM   5045  C  CB    . PRO A 1  717  ? 163.335 96.027  152.951 1.00 56.27  ? 717  PRO A CB    1 
ATOM   5046  C  CG    . PRO A 1  717  ? 164.409 95.042  153.256 1.00 55.02  ? 717  PRO A CG    1 
ATOM   5047  C  CD    . PRO A 1  717  ? 164.962 94.604  151.923 1.00 55.32  ? 717  PRO A CD    1 
ATOM   5048  N  N     . THR A 1  718  ? 164.057 98.921  152.775 1.00 54.92  ? 718  THR A N     1 
ATOM   5049  C  CA    . THR A 1  718  ? 164.716 100.152 153.193 1.00 55.53  ? 718  THR A CA    1 
ATOM   5050  C  C     . THR A 1  718  ? 165.402 100.013 154.548 1.00 56.35  ? 718  THR A C     1 
ATOM   5051  O  O     . THR A 1  718  ? 166.537 100.472 154.716 1.00 56.15  ? 718  THR A O     1 
ATOM   5052  C  CB    . THR A 1  718  ? 163.702 101.300 153.242 1.00 57.15  ? 718  THR A CB    1 
ATOM   5053  O  OG1   . THR A 1  718  ? 163.089 101.454 151.955 1.00 55.26  ? 718  THR A OG1   1 
ATOM   5054  C  CG2   . THR A 1  718  ? 164.385 102.604 153.629 1.00 55.31  ? 718  THR A CG2   1 
ATOM   5055  N  N     . ILE A 1  719  ? 164.741 99.381  155.515 1.00 54.95  ? 719  ILE A N     1 
ATOM   5056  C  CA    . ILE A 1  719  ? 165.258 99.239  156.870 1.00 55.00  ? 719  ILE A CA    1 
ATOM   5057  C  C     . ILE A 1  719  ? 165.450 97.759  157.165 1.00 55.12  ? 719  ILE A C     1 
ATOM   5058  O  O     . ILE A 1  719  ? 164.592 96.933  156.834 1.00 54.70  ? 719  ILE A O     1 
ATOM   5059  C  CB    . ILE A 1  719  ? 164.316 99.888  157.906 1.00 54.26  ? 719  ILE A CB    1 
ATOM   5060  C  CG1   . ILE A 1  719  ? 163.984 101.324 157.495 1.00 55.74  ? 719  ILE A CG1   1 
ATOM   5061  C  CG2   . ILE A 1  719  ? 164.943 99.863  159.291 1.00 55.41  ? 719  ILE A CG2   1 
ATOM   5062  C  CD1   . ILE A 1  719  ? 163.006 102.014 158.418 1.00 55.59  ? 719  ILE A CD1   1 
ATOM   5063  N  N     . PHE A 1  720  ? 166.581 97.426  157.791 1.00 56.69  ? 720  PHE A N     1 
ATOM   5064  C  CA    . PHE A 1  720  ? 166.918 96.044  158.120 1.00 58.19  ? 720  PHE A CA    1 
ATOM   5065  C  C     . PHE A 1  720  ? 166.597 95.706  159.573 1.00 58.69  ? 720  PHE A C     1 
ATOM   5066  O  O     . PHE A 1  720  ? 165.858 94.754  159.844 1.00 59.11  ? 720  PHE A O     1 
ATOM   5067  C  CB    . PHE A 1  720  ? 168.403 95.783  157.830 1.00 59.30  ? 720  PHE A CB    1 
ATOM   5068  C  CG    . PHE A 1  720  ? 168.738 95.738  156.366 1.00 59.72  ? 720  PHE A CG    1 
ATOM   5069  C  CD1   . PHE A 1  720  ? 169.037 96.900  155.674 1.00 59.88  ? 720  PHE A CD1   1 
ATOM   5070  C  CD2   . PHE A 1  720  ? 168.756 94.534  155.684 1.00 59.91  ? 720  PHE A CD2   1 
ATOM   5071  C  CE1   . PHE A 1  720  ? 169.346 96.860  154.329 1.00 58.98  ? 720  PHE A CE1   1 
ATOM   5072  C  CE2   . PHE A 1  720  ? 169.066 94.488  154.338 1.00 59.59  ? 720  PHE A CE2   1 
ATOM   5073  C  CZ    . PHE A 1  720  ? 169.361 95.653  153.659 1.00 59.31  ? 720  PHE A CZ    1 
ATOM   5074  N  N     . LYS A 1  721  ? 167.143 96.472  160.517 1.00 59.69  ? 721  LYS A N     1 
ATOM   5075  C  CA    . LYS A 1  721  ? 166.970 96.205  161.934 1.00 60.36  ? 721  LYS A CA    1 
ATOM   5076  C  C     . LYS A 1  721  ? 165.996 97.201  162.558 1.00 60.28  ? 721  LYS A C     1 
ATOM   5077  O  O     . LYS A 1  721  ? 165.902 98.347  162.109 1.00 60.12  ? 721  LYS A O     1 
ATOM   5078  C  CB    . LYS A 1  721  ? 168.313 96.276  162.674 1.00 59.88  ? 721  LYS A CB    1 
ATOM   5079  C  CG    . LYS A 1  721  ? 169.354 95.297  162.157 1.00 59.70  ? 721  LYS A CG    1 
ATOM   5080  C  CD    . LYS A 1  721  ? 170.596 95.298  163.033 1.00 59.70  ? 721  LYS A CD    1 
ATOM   5081  C  CE    . LYS A 1  721  ? 170.270 94.844  164.447 1.00 60.98  ? 721  LYS A CE    1 
ATOM   5082  N  NZ    . LYS A 1  721  ? 171.482 94.788  165.308 1.00 60.49  ? 721  LYS A NZ    1 
ATOM   5083  N  N     . PRO A 1  722  ? 165.247 96.799  163.601 1.00 62.87  ? 722  PRO A N     1 
ATOM   5084  C  CA    . PRO A 1  722  ? 165.244 95.469  164.229 1.00 64.01  ? 722  PRO A CA    1 
ATOM   5085  C  C     . PRO A 1  722  ? 164.520 94.412  163.400 1.00 64.28  ? 722  PRO A C     1 
ATOM   5086  O  O     . PRO A 1  722  ? 164.865 93.232  163.472 1.00 63.87  ? 722  PRO A O     1 
ATOM   5087  C  CB    . PRO A 1  722  ? 164.503 95.706  165.555 1.00 63.15  ? 722  PRO A CB    1 
ATOM   5088  C  CG    . PRO A 1  722  ? 164.468 97.195  165.737 1.00 64.37  ? 722  PRO A CG    1 
ATOM   5089  C  CD    . PRO A 1  722  ? 164.419 97.752  164.355 1.00 64.01  ? 722  PRO A CD    1 
ATOM   5090  N  N     . TYR A 1  723  ? 163.532 94.833  162.623 1.00 64.43  ? 723  TYR A N     1 
ATOM   5091  C  CA    . TYR A 1  723  ? 162.759 93.946  161.771 1.00 63.56  ? 723  TYR A CA    1 
ATOM   5092  C  C     . TYR A 1  723  ? 162.560 94.620  160.424 1.00 64.99  ? 723  TYR A C     1 
ATOM   5093  O  O     . TYR A 1  723  ? 162.625 95.850  160.324 1.00 66.92  ? 723  TYR A O     1 
ATOM   5094  C  CB    . TYR A 1  723  ? 161.404 93.593  162.404 1.00 67.99  ? 723  TYR A CB    1 
ATOM   5095  C  CG    . TYR A 1  723  ? 160.536 94.783  162.750 1.00 68.81  ? 723  TYR A CG    1 
ATOM   5096  C  CD1   . TYR A 1  723  ? 160.648 95.413  163.983 1.00 69.21  ? 723  TYR A CD1   1 
ATOM   5097  C  CD2   . TYR A 1  723  ? 159.595 95.266  161.850 1.00 69.12  ? 723  TYR A CD2   1 
ATOM   5098  C  CE1   . TYR A 1  723  ? 159.853 96.496  164.306 1.00 68.05  ? 723  TYR A CE1   1 
ATOM   5099  C  CE2   . TYR A 1  723  ? 158.797 96.349  162.164 1.00 68.91  ? 723  TYR A CE2   1 
ATOM   5100  C  CZ    . TYR A 1  723  ? 158.930 96.960  163.393 1.00 60.71  ? 723  TYR A CZ    1 
ATOM   5101  O  OH    . TYR A 1  723  ? 158.135 98.038  163.709 1.00 60.75  ? 723  TYR A OH    1 
ATOM   5102  N  N     . PRO A 1  724  ? 162.334 93.839  159.365 1.00 57.41  ? 724  PRO A N     1 
ATOM   5103  C  CA    . PRO A 1  724  ? 162.178 94.435  158.032 1.00 56.02  ? 724  PRO A CA    1 
ATOM   5104  C  C     . PRO A 1  724  ? 160.997 95.393  157.970 1.00 56.11  ? 724  PRO A C     1 
ATOM   5105  O  O     . PRO A 1  724  ? 160.002 95.242  158.683 1.00 56.38  ? 724  PRO A O     1 
ATOM   5106  C  CB    . PRO A 1  724  ? 161.958 93.221  157.123 1.00 56.70  ? 724  PRO A CB    1 
ATOM   5107  C  CG    . PRO A 1  724  ? 162.588 92.086  157.855 1.00 54.87  ? 724  PRO A CG    1 
ATOM   5108  C  CD    . PRO A 1  724  ? 162.358 92.367  159.310 1.00 54.25  ? 724  PRO A CD    1 
ATOM   5109  N  N     . LEU A 1  725  ? 161.122 96.390  157.097 1.00 54.86  ? 725  LEU A N     1 
ATOM   5110  C  CA    . LEU A 1  725  ? 160.093 97.404  156.929 1.00 55.33  ? 725  LEU A CA    1 
ATOM   5111  C  C     . LEU A 1  725  ? 160.069 97.834  155.470 1.00 55.92  ? 725  LEU A C     1 
ATOM   5112  O  O     . LEU A 1  725  ? 161.058 97.694  154.745 1.00 56.13  ? 725  LEU A O     1 
ATOM   5113  C  CB    . LEU A 1  725  ? 160.337 98.606  157.850 1.00 56.02  ? 725  LEU A CB    1 
ATOM   5114  C  CG    . LEU A 1  725  ? 159.149 99.524  158.143 1.00 56.44  ? 725  LEU A CG    1 
ATOM   5115  C  CD1   . LEU A 1  725  ? 158.040 98.755  158.844 1.00 55.30  ? 725  LEU A CD1   1 
ATOM   5116  C  CD2   . LEU A 1  725  ? 159.591 100.712 158.979 1.00 55.50  ? 725  LEU A CD2   1 
ATOM   5117  N  N     . TRP A 1  726  ? 158.922 98.361  155.043 1.00 54.52  ? 726  TRP A N     1 
ATOM   5118  C  CA    . TRP A 1  726  ? 158.725 98.761  153.658 1.00 53.49  ? 726  TRP A CA    1 
ATOM   5119  C  C     . TRP A 1  726  ? 157.994 100.095 153.617 1.00 52.97  ? 726  TRP A C     1 
ATOM   5120  O  O     . TRP A 1  726  ? 157.505 100.594 154.634 1.00 52.53  ? 726  TRP A O     1 
ATOM   5121  C  CB    . TRP A 1  726  ? 157.948 97.696  152.873 1.00 52.70  ? 726  TRP A CB    1 
ATOM   5122  C  CG    . TRP A 1  726  ? 158.604 96.350  152.885 1.00 52.69  ? 726  TRP A CG    1 
ATOM   5123  C  CD1   . TRP A 1  726  ? 158.445 95.372  153.821 1.00 52.84  ? 726  TRP A CD1   1 
ATOM   5124  C  CD2   . TRP A 1  726  ? 159.523 95.835  151.916 1.00 52.45  ? 726  TRP A CD2   1 
ATOM   5125  N  NE1   . TRP A 1  726  ? 159.208 94.277  153.495 1.00 53.08  ? 726  TRP A NE1   1 
ATOM   5126  C  CE2   . TRP A 1  726  ? 159.880 94.536  152.330 1.00 54.01  ? 726  TRP A CE2   1 
ATOM   5127  C  CE3   . TRP A 1  726  ? 160.081 96.345  150.740 1.00 54.19  ? 726  TRP A CE3   1 
ATOM   5128  C  CZ2   . TRP A 1  726  ? 160.767 93.740  151.609 1.00 53.72  ? 726  TRP A CZ2   1 
ATOM   5129  C  CZ3   . TRP A 1  726  ? 160.960 95.553  150.025 1.00 52.79  ? 726  TRP A CZ3   1 
ATOM   5130  C  CH2   . TRP A 1  726  ? 161.295 94.265  150.463 1.00 52.62  ? 726  TRP A CH2   1 
ATOM   5131  N  N     . THR A 1  727  ? 157.927 100.673 152.420 1.00 52.12  ? 727  THR A N     1 
ATOM   5132  C  CA    . THR A 1  727  ? 157.271 101.954 152.204 1.00 51.92  ? 727  THR A CA    1 
ATOM   5133  C  C     . THR A 1  727  ? 156.566 101.924 150.856 1.00 51.98  ? 727  THR A C     1 
ATOM   5134  O  O     . THR A 1  727  ? 156.955 101.176 149.954 1.00 52.18  ? 727  THR A O     1 
ATOM   5135  C  CB    . THR A 1  727  ? 158.276 103.118 152.254 1.00 52.05  ? 727  THR A CB    1 
ATOM   5136  O  OG1   . THR A 1  727  ? 159.192 102.913 153.336 1.00 52.14  ? 727  THR A OG1   1 
ATOM   5137  C  CG2   . THR A 1  727  ? 157.558 104.444 152.466 1.00 52.30  ? 727  THR A CG2   1 
ATOM   5138  N  N     . GLY A 1  728  ? 155.510 102.734 150.734 1.00 52.69  ? 728  GLY A N     1 
ATOM   5139  C  CA    . GLY A 1  728  ? 154.794 102.833 149.472 1.00 52.94  ? 728  GLY A CA    1 
ATOM   5140  C  C     . GLY A 1  728  ? 155.685 103.177 148.295 1.00 52.57  ? 728  GLY A C     1 
ATOM   5141  O  O     . GLY A 1  728  ? 155.375 102.826 147.152 1.00 52.37  ? 728  GLY A O     1 
ATOM   5142  N  N     . LYS A 1  729  ? 156.795 103.876 148.550 1.00 52.68  ? 729  LYS A N     1 
ATOM   5143  C  CA    . LYS A 1  729  ? 157.761 104.147 147.489 1.00 53.34  ? 729  LYS A CA    1 
ATOM   5144  C  C     . LYS A 1  729  ? 158.317 102.855 146.909 1.00 54.64  ? 729  LYS A C     1 
ATOM   5145  O  O     . LYS A 1  729  ? 158.477 102.730 145.689 1.00 55.45  ? 729  LYS A O     1 
ATOM   5146  C  CB    . LYS A 1  729  ? 158.893 105.022 148.022 1.00 56.04  ? 729  LYS A CB    1 
ATOM   5147  C  CG    . LYS A 1  729  ? 158.454 106.389 148.511 1.00 56.35  ? 729  LYS A CG    1 
ATOM   5148  C  CD    . LYS A 1  729  ? 158.008 107.262 147.356 1.00 56.73  ? 729  LYS A CD    1 
ATOM   5149  C  CE    . LYS A 1  729  ? 157.756 108.689 147.808 1.00 53.11  ? 729  LYS A CE    1 
ATOM   5150  N  NZ    . LYS A 1  729  ? 157.356 109.558 146.669 1.00 52.93  ? 729  LYS A NZ    1 
ATOM   5151  N  N     . GLN A 1  730  ? 158.626 101.882 147.769 1.00 53.69  ? 730  GLN A N     1 
ATOM   5152  C  CA    . GLN A 1  730  ? 159.112 100.597 147.280 1.00 54.66  ? 730  GLN A CA    1 
ATOM   5153  C  C     . GLN A 1  730  ? 158.003 99.804  146.601 1.00 55.03  ? 730  GLN A C     1 
ATOM   5154  O  O     . GLN A 1  730  ? 158.284 98.965  145.738 1.00 55.21  ? 730  GLN A O     1 
ATOM   5155  C  CB    . GLN A 1  730  ? 159.717 99.792  148.431 1.00 54.72  ? 730  GLN A CB    1 
ATOM   5156  C  CG    . GLN A 1  730  ? 160.618 98.654  147.983 1.00 54.46  ? 730  GLN A CG    1 
ATOM   5157  C  CD    . GLN A 1  730  ? 161.835 99.142  147.224 1.00 54.36  ? 730  GLN A CD    1 
ATOM   5158  O  OE1   . GLN A 1  730  ? 162.407 100.184 147.547 1.00 55.15  ? 730  GLN A OE1   1 
ATOM   5159  N  NE2   . GLN A 1  730  ? 162.236 98.394  146.203 1.00 55.52  ? 730  GLN A NE2   1 
ATOM   5160  N  N     . ILE A 1  731  ? 156.747 100.055 146.972 1.00 54.83  ? 731  ILE A N     1 
ATOM   5161  C  CA    . ILE A 1  731  ? 155.625 99.359  146.346 1.00 54.29  ? 731  ILE A CA    1 
ATOM   5162  C  C     . ILE A 1  731  ? 155.484 99.786  144.889 1.00 54.07  ? 731  ILE A C     1 
ATOM   5163  O  O     . ILE A 1  731  ? 155.421 98.950  143.982 1.00 54.12  ? 731  ILE A O     1 
ATOM   5164  C  CB    . ILE A 1  731  ? 154.327 99.611  147.132 1.00 54.03  ? 731  ILE A CB    1 
ATOM   5165  C  CG1   . ILE A 1  731  ? 154.454 99.078  148.560 1.00 53.93  ? 731  ILE A CG1   1 
ATOM   5166  C  CG2   . ILE A 1  731  ? 153.143 98.973  146.422 1.00 54.19  ? 731  ILE A CG2   1 
ATOM   5167  C  CD1   . ILE A 1  731  ? 154.644 97.580  148.636 1.00 54.09  ? 731  ILE A CD1   1 
ATOM   5168  N  N     . ILE A 1  732  ? 155.429 101.099 144.648 1.00 54.01  ? 732  ILE A N     1 
ATOM   5169  C  CA    . ILE A 1  732  ? 155.320 101.594 143.278 1.00 53.88  ? 732  ILE A CA    1 
ATOM   5170  C  C     . ILE A 1  732  ? 156.602 101.314 142.504 1.00 54.13  ? 732  ILE A C     1 
ATOM   5171  O  O     . ILE A 1  732  ? 156.578 101.172 141.275 1.00 54.33  ? 732  ILE A O     1 
ATOM   5172  C  CB    . ILE A 1  732  ? 154.961 103.095 143.279 1.00 54.21  ? 732  ILE A CB    1 
ATOM   5173  C  CG1   . ILE A 1  732  ? 154.734 103.601 141.852 1.00 54.30  ? 732  ILE A CG1   1 
ATOM   5174  C  CG2   . ILE A 1  732  ? 156.041 103.910 143.974 1.00 53.69  ? 732  ILE A CG2   1 
ATOM   5175  C  CD1   . ILE A 1  732  ? 154.351 105.063 141.775 1.00 53.42  ? 732  ILE A CD1   1 
ATOM   5176  N  N     . THR A 1  733  ? 157.734 101.211 143.203 1.00 54.77  ? 733  THR A N     1 
ATOM   5177  C  CA    . THR A 1  733  ? 158.994 100.907 142.533 1.00 56.33  ? 733  THR A CA    1 
ATOM   5178  C  C     . THR A 1  733  ? 159.018 99.467  142.036 1.00 58.14  ? 733  THR A C     1 
ATOM   5179  O  O     . THR A 1  733  ? 159.385 99.203  140.885 1.00 59.32  ? 733  THR A O     1 
ATOM   5180  C  CB    . THR A 1  733  ? 160.169 101.167 143.479 1.00 58.43  ? 733  THR A CB    1 
ATOM   5181  O  OG1   . THR A 1  733  ? 160.278 102.572 143.734 1.00 55.35  ? 733  THR A OG1   1 
ATOM   5182  C  CG2   . THR A 1  733  ? 161.469 100.659 142.873 1.00 55.29  ? 733  THR A CG2   1 
ATOM   5183  N  N     . THR A 1  734  ? 158.623 98.519  142.888 1.00 54.62  ? 734  THR A N     1 
ATOM   5184  C  CA    . THR A 1  734  ? 158.690 97.113  142.505 1.00 54.42  ? 734  THR A CA    1 
ATOM   5185  C  C     . THR A 1  734  ? 157.597 96.733  141.514 1.00 55.00  ? 734  THR A C     1 
ATOM   5186  O  O     . THR A 1  734  ? 157.777 95.788  140.739 1.00 55.54  ? 734  THR A O     1 
ATOM   5187  C  CB    . THR A 1  734  ? 158.619 96.215  143.744 1.00 55.12  ? 734  THR A CB    1 
ATOM   5188  O  OG1   . THR A 1  734  ? 158.925 94.864  143.375 1.00 53.52  ? 734  THR A OG1   1 
ATOM   5189  C  CG2   . THR A 1  734  ? 157.234 96.259  144.373 1.00 53.31  ? 734  THR A CG2   1 
ATOM   5190  N  N     . VAL A 1  735  ? 156.467 97.444  141.513 1.00 53.12  ? 735  VAL A N     1 
ATOM   5191  C  CA    . VAL A 1  735  ? 155.428 97.141  140.535 1.00 53.38  ? 735  VAL A CA    1 
ATOM   5192  C  C     . VAL A 1  735  ? 155.762 97.767  139.185 1.00 54.35  ? 735  VAL A C     1 
ATOM   5193  O  O     . VAL A 1  735  ? 155.377 97.234  138.137 1.00 54.73  ? 735  VAL A O     1 
ATOM   5194  C  CB    . VAL A 1  735  ? 154.046 97.591  141.047 1.00 54.74  ? 735  VAL A CB    1 
ATOM   5195  C  CG1   . VAL A 1  735  ? 153.935 99.107  141.064 1.00 52.72  ? 735  VAL A CG1   1 
ATOM   5196  C  CG2   . VAL A 1  735  ? 152.937 96.976  140.204 1.00 52.59  ? 735  VAL A CG2   1 
ATOM   5197  N  N     . LEU A 1  736  ? 156.486 98.890  139.179 1.00 52.04  ? 736  LEU A N     1 
ATOM   5198  C  CA    . LEU A 1  736  ? 156.914 99.485  137.919 1.00 51.23  ? 736  LEU A CA    1 
ATOM   5199  C  C     . LEU A 1  736  ? 158.069 98.699  137.312 1.00 50.83  ? 736  LEU A C     1 
ATOM   5200  O  O     . LEU A 1  736  ? 158.177 98.588  136.086 1.00 50.53  ? 736  LEU A O     1 
ATOM   5201  C  CB    . LEU A 1  736  ? 157.302 100.950 138.137 1.00 50.75  ? 736  LEU A CB    1 
ATOM   5202  C  CG    . LEU A 1  736  ? 157.403 101.883 136.925 1.00 50.49  ? 736  LEU A CG    1 
ATOM   5203  C  CD1   . LEU A 1  736  ? 158.770 101.806 136.255 1.00 51.11  ? 736  LEU A CD1   1 
ATOM   5204  C  CD2   . LEU A 1  736  ? 156.297 101.579 135.925 1.00 51.12  ? 736  LEU A CD2   1 
ATOM   5205  N  N     . LEU A 1  737  ? 158.942 98.144  138.157 1.00 51.22  ? 737  LEU A N     1 
ATOM   5206  C  CA    . LEU A 1  737  ? 160.050 97.342  137.651 1.00 51.60  ? 737  LEU A CA    1 
ATOM   5207  C  C     . LEU A 1  737  ? 159.574 95.968  137.194 1.00 52.94  ? 737  LEU A C     1 
ATOM   5208  O  O     . LEU A 1  737  ? 160.098 95.415  136.221 1.00 54.10  ? 737  LEU A O     1 
ATOM   5209  C  CB    . LEU A 1  737  ? 161.133 97.210  138.723 1.00 54.44  ? 737  LEU A CB    1 
ATOM   5210  C  CG    . LEU A 1  737  ? 162.412 96.473  138.319 1.00 54.43  ? 737  LEU A CG    1 
ATOM   5211  C  CD1   . LEU A 1  737  ? 163.076 97.158  137.135 1.00 50.80  ? 737  LEU A CD1   1 
ATOM   5212  C  CD2   . LEU A 1  737  ? 163.370 96.379  139.495 1.00 51.14  ? 737  LEU A CD2   1 
ATOM   5213  N  N     . ASN A 1  738  ? 158.580 95.400  137.883 1.00 51.32  ? 738  ASN A N     1 
ATOM   5214  C  CA    . ASN A 1  738  ? 158.048 94.103  137.477 1.00 51.89  ? 738  ASN A CA    1 
ATOM   5215  C  C     . ASN A 1  738  ? 157.254 94.202  136.181 1.00 51.78  ? 738  ASN A C     1 
ATOM   5216  O  O     . ASN A 1  738  ? 157.214 93.240  135.406 1.00 51.78  ? 738  ASN A O     1 
ATOM   5217  C  CB    . ASN A 1  738  ? 157.178 93.515  138.587 1.00 51.56  ? 738  ASN A CB    1 
ATOM   5218  C  CG    . ASN A 1  738  ? 157.996 92.945  139.729 1.00 51.95  ? 738  ASN A CG    1 
ATOM   5219  O  OD1   . ASN A 1  738  ? 159.086 92.414  139.521 1.00 52.97  ? 738  ASN A OD1   1 
ATOM   5220  N  ND2   . ASN A 1  738  ? 157.474 93.054  140.945 1.00 52.81  ? 738  ASN A ND2   1 
ATOM   5221  N  N     . VAL A 1  739  ? 156.618 95.346  135.929 1.00 55.01  ? 739  VAL A N     1 
ATOM   5222  C  CA    . VAL A 1  739  ? 155.879 95.534  134.686 1.00 56.71  ? 739  VAL A CA    1 
ATOM   5223  C  C     . VAL A 1  739  ? 156.779 96.017  133.551 1.00 56.53  ? 739  VAL A C     1 
ATOM   5224  O  O     . VAL A 1  739  ? 156.397 95.903  132.377 1.00 57.05  ? 739  VAL A O     1 
ATOM   5225  C  CB    . VAL A 1  739  ? 154.707 96.514  134.896 1.00 56.06  ? 739  VAL A CB    1 
ATOM   5226  C  CG1   . VAL A 1  739  ? 155.206 97.951  134.939 1.00 58.22  ? 739  VAL A CG1   1 
ATOM   5227  C  CG2   . VAL A 1  739  ? 153.644 96.329  133.820 1.00 58.85  ? 739  VAL A CG2   1 
ATOM   5228  N  N     . THR A 1  740  ? 157.961 96.536  133.864 1.00 61.91  ? 740  THR A N     1 
ATOM   5229  C  CA    . THR A 1  740  ? 158.891 96.988  132.836 1.00 64.05  ? 740  THR A CA    1 
ATOM   5230  C  C     . THR A 1  740  ? 159.551 95.785  132.169 1.00 66.20  ? 740  THR A C     1 
ATOM   5231  O  O     . THR A 1  740  ? 160.029 94.883  132.865 1.00 66.72  ? 740  THR A O     1 
ATOM   5232  C  CB    . THR A 1  740  ? 159.956 97.901  133.442 1.00 67.41  ? 740  THR A CB    1 
ATOM   5233  O  OG1   . THR A 1  740  ? 159.341 99.105  133.918 1.00 63.82  ? 740  THR A OG1   1 
ATOM   5234  C  CG2   . THR A 1  740  ? 161.021 98.253  132.412 1.00 64.07  ? 740  THR A CG2   1 
ATOM   5235  N  N     . PRO A 1  741  ? 159.594 95.732  130.840 1.00 63.00  ? 741  PRO A N     1 
ATOM   5236  C  CA    . PRO A 1  741  ? 160.254 94.613  130.158 1.00 62.97  ? 741  PRO A CA    1 
ATOM   5237  C  C     . PRO A 1  741  ? 161.755 94.650  130.378 1.00 62.65  ? 741  PRO A C     1 
ATOM   5238  O  O     . PRO A 1  741  ? 162.325 95.718  130.649 1.00 62.54  ? 741  PRO A O     1 
ATOM   5239  C  CB    . PRO A 1  741  ? 159.899 94.842  128.680 1.00 62.51  ? 741  PRO A CB    1 
ATOM   5240  C  CG    . PRO A 1  741  ? 159.615 96.304  128.584 1.00 63.59  ? 741  PRO A CG    1 
ATOM   5241  C  CD    . PRO A 1  741  ? 158.981 96.677  129.891 1.00 62.64  ? 741  PRO A CD    1 
ATOM   5242  N  N     . PRO A 1  742  ? 162.432 93.508  130.278 1.00 65.67  ? 742  PRO A N     1 
ATOM   5243  C  CA    . PRO A 1  742  ? 163.880 93.481  130.508 1.00 66.47  ? 742  PRO A CA    1 
ATOM   5244  C  C     . PRO A 1  742  ? 164.631 94.140  129.362 1.00 66.59  ? 742  PRO A C     1 
ATOM   5245  O  O     . PRO A 1  742  ? 164.070 94.482  128.319 1.00 66.67  ? 742  PRO A O     1 
ATOM   5246  C  CB    . PRO A 1  742  ? 164.206 91.986  130.602 1.00 66.49  ? 742  PRO A CB    1 
ATOM   5247  C  CG    . PRO A 1  742  ? 162.875 91.286  130.719 1.00 66.99  ? 742  PRO A CG    1 
ATOM   5248  C  CD    . PRO A 1  742  ? 161.903 92.164  130.003 1.00 67.05  ? 742  PRO A CD    1 
ATOM   5249  N  N     . ASP A 1  743  ? 165.936 94.318  129.581 1.00 67.37  ? 743  ASP A N     1 
ATOM   5250  C  CA    . ASP A 1  743  ? 166.830 94.956  128.613 1.00 67.24  ? 743  ASP A CA    1 
ATOM   5251  C  C     . ASP A 1  743  ? 166.352 96.359  128.245 1.00 67.44  ? 743  ASP A C     1 
ATOM   5252  O  O     . ASP A 1  743  ? 166.659 96.869  127.165 1.00 67.25  ? 743  ASP A O     1 
ATOM   5253  C  CB    . ASP A 1  743  ? 166.992 94.098  127.354 1.00 67.21  ? 743  ASP A CB    1 
ATOM   5254  C  CG    . ASP A 1  743  ? 167.479 92.696  127.664 1.00 66.85  ? 743  ASP A CG    1 
ATOM   5255  O  OD1   . ASP A 1  743  ? 168.209 92.527  128.663 1.00 65.95  ? 743  ASP A OD1   1 
ATOM   5256  O  OD2   . ASP A 1  743  ? 167.130 91.765  126.909 1.00 66.11  ? 743  ASP A OD2   1 
ATOM   5257  N  N     . MET A 1  744  ? 165.599 96.990  129.143 1.00 64.02  ? 744  MET A N     1 
ATOM   5258  C  CA    . MET A 1  744  ? 165.035 98.315  128.909 1.00 62.75  ? 744  MET A CA    1 
ATOM   5259  C  C     . MET A 1  744  ? 165.502 99.236  130.028 1.00 63.59  ? 744  MET A C     1 
ATOM   5260  O  O     . MET A 1  744  ? 165.230 98.951  131.212 1.00 64.28  ? 744  MET A O     1 
ATOM   5261  C  CB    . MET A 1  744  ? 163.507 98.257  128.846 1.00 64.51  ? 744  MET A CB    1 
ATOM   5262  C  CG    . MET A 1  744  ? 162.836 99.600  128.606 1.00 63.62  ? 744  MET A CG    1 
ATOM   5263  S  SD    . MET A 1  744  ? 163.242 100.307 126.999 1.00 61.09  ? 744  MET A SD    1 
ATOM   5264  C  CE    . MET A 1  744  ? 162.199 101.762 127.002 1.00 60.97  ? 744  MET A CE    1 
ATOM   5265  N  N     . PRO A 1  745  ? 166.205 100.324 129.720 1.00 59.51  ? 745  PRO A N     1 
ATOM   5266  C  CA    . PRO A 1  745  ? 166.622 101.251 130.776 1.00 58.84  ? 745  PRO A CA    1 
ATOM   5267  C  C     . PRO A 1  745  ? 165.420 101.878 131.463 1.00 59.29  ? 745  PRO A C     1 
ATOM   5268  O  O     . PRO A 1  745  ? 164.365 102.082 130.858 1.00 59.41  ? 745  PRO A O     1 
ATOM   5269  C  CB    . PRO A 1  745  ? 167.449 102.301 130.024 1.00 59.31  ? 745  PRO A CB    1 
ATOM   5270  C  CG    . PRO A 1  745  ? 167.871 101.622 128.760 1.00 57.81  ? 745  PRO A CG    1 
ATOM   5271  C  CD    . PRO A 1  745  ? 166.740 100.707 128.403 1.00 57.01  ? 745  PRO A CD    1 
ATOM   5272  N  N     . GLY A 1  746  ? 165.589 102.181 132.745 1.00 57.06  ? 746  GLY A N     1 
ATOM   5273  C  CA    . GLY A 1  746  ? 164.522 102.758 133.531 1.00 56.28  ? 746  GLY A CA    1 
ATOM   5274  C  C     . GLY A 1  746  ? 164.164 104.162 133.079 1.00 55.06  ? 746  GLY A C     1 
ATOM   5275  O  O     . GLY A 1  746  ? 164.756 104.741 132.167 1.00 54.80  ? 746  GLY A O     1 
ATOM   5276  N  N     . ILE A 1  747  ? 163.164 104.719 133.749 1.00 53.68  ? 747  ILE A N     1 
ATOM   5277  C  CA    . ILE A 1  747  ? 162.668 106.057 133.450 1.00 52.79  ? 747  ILE A CA    1 
ATOM   5278  C  C     . ILE A 1  747  ? 163.261 107.047 134.440 1.00 53.20  ? 747  ILE A C     1 
ATOM   5279  O  O     . ILE A 1  747  ? 163.515 106.724 135.607 1.00 53.65  ? 747  ILE A O     1 
ATOM   5280  C  CB    . ILE A 1  747  ? 161.124 106.094 133.455 1.00 54.10  ? 747  ILE A CB    1 
ATOM   5281  C  CG1   . ILE A 1  747  ? 160.554 105.225 134.582 1.00 53.55  ? 747  ILE A CG1   1 
ATOM   5282  C  CG2   . ILE A 1  747  ? 160.580 105.651 132.107 1.00 51.94  ? 747  ILE A CG2   1 
ATOM   5283  C  CD1   . ILE A 1  747  ? 160.440 105.915 135.920 1.00 51.49  ? 747  ILE A CD1   1 
ATOM   5284  N  N     . ASN A 1  748  ? 163.501 108.266 133.962 1.00 51.57  ? 748  ASN A N     1 
ATOM   5285  C  CA    . ASN A 1  748  ? 164.112 109.322 134.766 1.00 51.69  ? 748  ASN A CA    1 
ATOM   5286  C  C     . ASN A 1  748  ? 163.385 110.624 134.463 1.00 52.62  ? 748  ASN A C     1 
ATOM   5287  O  O     . ASN A 1  748  ? 163.580 111.210 133.393 1.00 53.18  ? 748  ASN A O     1 
ATOM   5288  C  CB    . ASN A 1  748  ? 165.607 109.450 134.464 1.00 53.28  ? 748  ASN A CB    1 
ATOM   5289  C  CG    . ASN A 1  748  ? 166.364 108.161 134.704 1.00 53.40  ? 748  ASN A CG    1 
ATOM   5290  O  OD1   . ASN A 1  748  ? 166.772 107.482 133.762 1.00 50.32  ? 748  ASN A OD1   1 
ATOM   5291  N  ND2   . ASN A 1  748  ? 166.566 107.821 135.971 1.00 49.57  ? 748  ASN A ND2   1 
ATOM   5292  N  N     . LEU A 1  749  ? 162.551 111.076 135.396 1.00 50.11  ? 749  LEU A N     1 
ATOM   5293  C  CA    . LEU A 1  749  ? 161.767 112.291 135.222 1.00 50.31  ? 749  LEU A CA    1 
ATOM   5294  C  C     . LEU A 1  749  ? 162.011 113.240 136.385 1.00 50.90  ? 749  LEU A C     1 
ATOM   5295  O  O     . LEU A 1  749  ? 162.183 112.806 137.527 1.00 52.01  ? 749  LEU A O     1 
ATOM   5296  C  CB    . LEU A 1  749  ? 160.266 111.986 135.115 1.00 52.99  ? 749  LEU A CB    1 
ATOM   5297  C  CG    . LEU A 1  749  ? 159.716 111.498 133.772 1.00 51.74  ? 749  LEU A CG    1 
ATOM   5298  C  CD1   . LEU A 1  749  ? 160.171 112.421 132.653 1.00 50.64  ? 749  LEU A CD1   1 
ATOM   5299  C  CD2   . LEU A 1  749  ? 160.107 110.054 133.486 1.00 50.74  ? 749  LEU A CD2   1 
ATOM   5300  N  N     . ILE A 1  750  ? 162.026 114.535 136.082 1.00 52.10  ? 750  ILE A N     1 
ATOM   5301  C  CA    . ILE A 1  750  ? 162.129 115.594 137.082 1.00 53.38  ? 750  ILE A CA    1 
ATOM   5302  C  C     . ILE A 1  750  ? 161.030 116.595 136.747 1.00 54.68  ? 750  ILE A C     1 
ATOM   5303  O  O     . ILE A 1  750  ? 161.157 117.371 135.793 1.00 55.59  ? 750  ILE A O     1 
ATOM   5304  C  CB    . ILE A 1  750  ? 163.507 116.266 137.100 1.00 55.96  ? 750  ILE A CB    1 
ATOM   5305  C  CG1   . ILE A 1  750  ? 164.592 115.281 137.544 1.00 54.78  ? 750  ILE A CG1   1 
ATOM   5306  C  CG2   . ILE A 1  750  ? 163.495 117.484 138.015 1.00 52.82  ? 750  ILE A CG2   1 
ATOM   5307  C  CD1   . ILE A 1  750  ? 165.249 114.522 136.408 1.00 52.70  ? 750  ILE A CD1   1 
ATOM   5308  N  N     . SER A 1  751  ? 159.948 116.580 137.522 1.00 52.40  ? 751  SER A N     1 
ATOM   5309  C  CA    . SER A 1  751  ? 158.789 117.426 137.272 1.00 52.06  ? 751  SER A CA    1 
ATOM   5310  C  C     . SER A 1  751  ? 158.340 118.067 138.579 1.00 51.74  ? 751  SER A C     1 
ATOM   5311  O  O     . SER A 1  751  ? 158.990 117.938 139.620 1.00 51.63  ? 751  SER A O     1 
ATOM   5312  C  CB    . SER A 1  751  ? 157.648 116.623 136.633 1.00 52.39  ? 751  SER A CB    1 
ATOM   5313  O  OG    . SER A 1  751  ? 156.512 117.441 136.410 1.00 52.38  ? 751  SER A OG    1 
ATOM   5314  N  N     . LYS A 1  752  ? 157.210 118.765 138.517 1.00 53.47  ? 752  LYS A N     1 
ATOM   5315  C  CA    . LYS A 1  752  ? 156.636 119.461 139.658 1.00 54.71  ? 752  LYS A CA    1 
ATOM   5316  C  C     . LYS A 1  752  ? 155.277 118.860 140.002 1.00 54.91  ? 752  LYS A C     1 
ATOM   5317  O  O     . LYS A 1  752  ? 154.839 117.868 139.413 1.00 55.05  ? 752  LYS A O     1 
ATOM   5318  C  CB    . LYS A 1  752  ? 156.521 120.959 139.370 1.00 55.44  ? 752  LYS A CB    1 
ATOM   5319  C  CG    . LYS A 1  752  ? 157.850 121.649 139.118 1.00 55.78  ? 752  LYS A CG    1 
ATOM   5320  C  CD    . LYS A 1  752  ? 158.760 121.551 140.332 1.00 55.79  ? 752  LYS A CD    1 
ATOM   5321  C  CE    . LYS A 1  752  ? 160.081 122.263 140.090 1.00 55.63  ? 752  LYS A CE    1 
ATOM   5322  N  NZ    . LYS A 1  752  ? 159.885 123.710 139.799 1.00 54.74  ? 752  LYS A NZ    1 
ATOM   5323  N  N     . ASN A 1  753  ? 154.607 119.478 140.968 1.00 57.37  ? 753  ASN A N     1 
ATOM   5324  C  CA    . ASN A 1  753  ? 153.321 118.996 141.456 1.00 58.71  ? 753  ASN A CA    1 
ATOM   5325  C  C     . ASN A 1  753  ? 152.628 120.157 142.165 1.00 57.86  ? 753  ASN A C     1 
ATOM   5326  O  O     . ASN A 1  753  ? 153.118 121.293 142.157 1.00 57.40  ? 753  ASN A O     1 
ATOM   5327  C  CB    . ASN A 1  753  ? 153.517 117.782 142.372 1.00 57.39  ? 753  ASN A CB    1 
ATOM   5328  C  CG    . ASN A 1  753  ? 152.377 116.781 142.282 1.00 57.56  ? 753  ASN A CG    1 
ATOM   5329  O  OD1   . ASN A 1  753  ? 152.547 115.607 142.610 1.00 60.89  ? 753  ASN A OD1   1 
ATOM   5330  N  ND2   . ASN A 1  753  ? 151.215 117.235 141.829 1.00 61.41  ? 753  ASN A ND2   1 
ATOM   5331  N  N     . LYS A 1  754  ? 151.484 119.874 142.782 1.00 62.60  ? 754  LYS A N     1 
ATOM   5332  C  CA    . LYS A 1  754  ? 150.730 120.848 143.565 1.00 64.24  ? 754  LYS A CA    1 
ATOM   5333  C  C     . LYS A 1  754  ? 150.812 120.512 145.052 1.00 64.08  ? 754  LYS A C     1 
ATOM   5334  O  O     . LYS A 1  754  ? 149.838 120.639 145.796 1.00 64.53  ? 754  LYS A O     1 
ATOM   5335  C  CB    . LYS A 1  754  ? 149.277 120.908 143.100 1.00 64.71  ? 754  LYS A CB    1 
ATOM   5336  C  CG    . LYS A 1  754  ? 148.557 122.204 143.445 1.00 64.48  ? 754  LYS A CG    1 
ATOM   5337  C  CD    . LYS A 1  754  ? 147.077 121.965 143.694 1.00 64.40  ? 754  LYS A CD    1 
ATOM   5338  C  CE    . LYS A 1  754  ? 146.370 123.252 144.087 1.00 65.46  ? 754  LYS A CE    1 
ATOM   5339  N  NZ    . LYS A 1  754  ? 144.926 123.026 144.377 1.00 65.39  ? 754  LYS A NZ    1 
ATOM   5340  N  N     . ILE A 1  755  ? 151.986 120.071 145.495 1.00 66.75  ? 755  ILE A N     1 
ATOM   5341  C  CA    . ILE A 1  755  ? 152.160 119.600 146.865 1.00 67.11  ? 755  ILE A CA    1 
ATOM   5342  C  C     . ILE A 1  755  ? 152.421 120.752 147.827 1.00 68.63  ? 755  ILE A C     1 
ATOM   5343  O  O     . ILE A 1  755  ? 151.966 120.713 148.974 1.00 69.62  ? 755  ILE A O     1 
ATOM   5344  C  CB    . ILE A 1  755  ? 153.290 118.553 146.908 1.00 70.56  ? 755  ILE A CB    1 
ATOM   5345  C  CG1   . ILE A 1  755  ? 152.984 117.418 145.929 1.00 68.84  ? 755  ILE A CG1   1 
ATOM   5346  C  CG2   . ILE A 1  755  ? 153.465 118.004 148.315 1.00 65.96  ? 755  ILE A CG2   1 
ATOM   5347  C  CD1   . ILE A 1  755  ? 154.110 116.431 145.761 1.00 66.60  ? 755  ILE A CD1   1 
ATOM   5348  N  N     . LYS A 1  756  ? 153.148 121.778 147.376 1.00 63.99  ? 756  LYS A N     1 
ATOM   5349  C  CA    . LYS A 1  756  ? 153.456 122.989 148.149 1.00 62.38  ? 756  LYS A CA    1 
ATOM   5350  C  C     . LYS A 1  756  ? 153.905 122.632 149.571 1.00 63.05  ? 756  LYS A C     1 
ATOM   5351  O  O     . LYS A 1  756  ? 153.222 122.882 150.564 1.00 63.97  ? 756  LYS A O     1 
ATOM   5352  C  CB    . LYS A 1  756  ? 152.293 123.997 148.138 1.00 64.89  ? 756  LYS A CB    1 
ATOM   5353  C  CG    . LYS A 1  756  ? 150.911 123.508 148.550 1.00 65.54  ? 756  LYS A CG    1 
ATOM   5354  C  CD    . LYS A 1  756  ? 149.879 124.614 148.400 1.00 65.33  ? 756  LYS A CD    1 
ATOM   5355  C  CE    . LYS A 1  756  ? 149.852 125.159 146.981 1.00 60.36  ? 756  LYS A CE    1 
ATOM   5356  N  NZ    . LYS A 1  756  ? 149.519 124.103 145.988 1.00 60.51  ? 756  LYS A NZ    1 
ATOM   5357  N  N     . ASN A 1  757  ? 155.094 122.023 149.620 1.00 58.27  ? 757  ASN A N     1 
ATOM   5358  C  CA    . ASN A 1  757  ? 155.680 121.413 150.812 1.00 57.18  ? 757  ASN A CA    1 
ATOM   5359  C  C     . ASN A 1  757  ? 155.513 122.231 152.088 1.00 57.40  ? 757  ASN A C     1 
ATOM   5360  O  O     . ASN A 1  757  ? 155.528 121.667 153.188 1.00 57.32  ? 757  ASN A O     1 
ATOM   5361  C  CB    . ASN A 1  757  ? 157.170 121.152 150.586 1.00 56.67  ? 757  ASN A CB    1 
ATOM   5362  C  CG    . ASN A 1  757  ? 157.430 120.196 149.441 1.00 57.28  ? 757  ASN A CG    1 
ATOM   5363  O  OD1   . ASN A 1  757  ? 156.565 119.402 149.069 1.00 55.83  ? 757  ASN A OD1   1 
ATOM   5364  N  ND2   . ASN A 1  757  ? 158.631 120.263 148.878 1.00 55.55  ? 757  ASN A ND2   1 
ATOM   5365  N  N     . GLU A 1  758  ? 155.385 123.557 151.961 1.00 54.94  ? 758  GLU A N     1 
ATOM   5366  C  CA    . GLU A 1  758  ? 155.158 124.405 153.129 1.00 54.68  ? 758  GLU A CA    1 
ATOM   5367  C  C     . GLU A 1  758  ? 153.986 123.918 153.973 1.00 55.74  ? 758  GLU A C     1 
ATOM   5368  O  O     . GLU A 1  758  ? 153.949 124.163 155.185 1.00 56.48  ? 758  GLU A O     1 
ATOM   5369  C  CB    . GLU A 1  758  ? 154.922 125.854 152.692 1.00 56.34  ? 758  GLU A CB    1 
ATOM   5370  C  CG    . GLU A 1  758  ? 156.150 126.556 152.126 1.00 56.40  ? 758  GLU A CG    1 
ATOM   5371  C  CD    . GLU A 1  758  ? 156.474 126.134 150.705 1.00 55.95  ? 758  GLU A CD    1 
ATOM   5372  O  OE1   . GLU A 1  758  ? 155.635 125.454 150.078 1.00 53.03  ? 758  GLU A OE1   1 
ATOM   5373  O  OE2   . GLU A 1  758  ? 157.568 126.485 150.216 1.00 53.05  ? 758  GLU A OE2   1 
ATOM   5374  N  N     . TYR A 1  759  ? 153.020 123.231 153.357 1.00 51.26  ? 759  TYR A N     1 
ATOM   5375  C  CA    . TYR A 1  759  ? 151.936 122.621 154.120 1.00 50.01  ? 759  TYR A CA    1 
ATOM   5376  C  C     . TYR A 1  759  ? 152.469 121.554 155.070 1.00 49.34  ? 759  TYR A C     1 
ATOM   5377  O  O     . TYR A 1  759  ? 152.030 121.454 156.221 1.00 48.87  ? 759  TYR A O     1 
ATOM   5378  C  CB    . TYR A 1  759  ? 150.895 122.028 153.171 1.00 48.43  ? 759  TYR A CB    1 
ATOM   5379  C  CG    . TYR A 1  759  ? 149.745 122.958 152.860 1.00 48.24  ? 759  TYR A CG    1 
ATOM   5380  C  CD1   . TYR A 1  759  ? 149.911 124.041 152.008 1.00 48.68  ? 759  TYR A CD1   1 
ATOM   5381  C  CD2   . TYR A 1  759  ? 148.493 122.756 153.426 1.00 48.37  ? 759  TYR A CD2   1 
ATOM   5382  C  CE1   . TYR A 1  759  ? 148.862 124.894 151.725 1.00 48.87  ? 759  TYR A CE1   1 
ATOM   5383  C  CE2   . TYR A 1  759  ? 147.437 123.603 153.147 1.00 48.77  ? 759  TYR A CE2   1 
ATOM   5384  C  CZ    . TYR A 1  759  ? 147.628 124.671 152.296 1.00 49.75  ? 759  TYR A CZ    1 
ATOM   5385  O  OH    . TYR A 1  759  ? 146.580 125.517 152.016 1.00 49.68  ? 759  TYR A OH    1 
ATOM   5386  N  N     . TRP A 1  760  ? 153.419 120.742 154.601 1.00 50.29  ? 760  TRP A N     1 
ATOM   5387  C  CA    . TRP A 1  760  ? 154.029 119.723 155.446 1.00 51.51  ? 760  TRP A CA    1 
ATOM   5388  C  C     . TRP A 1  760  ? 154.936 120.310 156.520 1.00 51.32  ? 760  TRP A C     1 
ATOM   5389  O  O     . TRP A 1  760  ? 155.352 119.576 157.423 1.00 51.08  ? 760  TRP A O     1 
ATOM   5390  C  CB    . TRP A 1  760  ? 154.826 118.735 154.593 1.00 51.05  ? 760  TRP A CB    1 
ATOM   5391  C  CG    . TRP A 1  760  ? 154.012 118.017 153.558 1.00 50.95  ? 760  TRP A CG    1 
ATOM   5392  C  CD1   . TRP A 1  760  ? 153.741 118.441 152.289 1.00 50.96  ? 760  TRP A CD1   1 
ATOM   5393  C  CD2   . TRP A 1  760  ? 153.370 116.744 153.700 1.00 51.08  ? 760  TRP A CD2   1 
ATOM   5394  N  NE1   . TRP A 1  760  ? 152.967 117.514 151.635 1.00 51.40  ? 760  TRP A NE1   1 
ATOM   5395  C  CE2   . TRP A 1  760  ? 152.726 116.461 152.479 1.00 51.59  ? 760  TRP A CE2   1 
ATOM   5396  C  CE3   . TRP A 1  760  ? 153.274 115.817 154.743 1.00 51.28  ? 760  TRP A CE3   1 
ATOM   5397  C  CZ2   . TRP A 1  760  ? 151.998 115.292 152.272 1.00 51.08  ? 760  TRP A CZ2   1 
ATOM   5398  C  CZ3   . TRP A 1  760  ? 152.552 114.655 154.534 1.00 53.10  ? 760  TRP A CZ3   1 
ATOM   5399  C  CH2   . TRP A 1  760  ? 151.923 114.404 153.309 1.00 53.52  ? 760  TRP A CH2   1 
ATOM   5400  N  N     . GLY A 1  761  ? 155.249 121.602 156.447 1.00 54.68  ? 761  GLY A N     1 
ATOM   5401  C  CA    . GLY A 1  761  ? 156.119 122.231 157.419 1.00 55.79  ? 761  GLY A CA    1 
ATOM   5402  C  C     . GLY A 1  761  ? 157.381 122.798 156.803 1.00 57.15  ? 761  GLY A C     1 
ATOM   5403  O  O     . GLY A 1  761  ? 157.318 123.713 155.976 1.00 57.11  ? 761  GLY A O     1 
ATOM   5404  N  N     . LYS A 1  762  ? 158.535 122.263 157.196 1.00 59.00  ? 762  LYS A N     1 
ATOM   5405  C  CA    . LYS A 1  762  ? 159.820 122.706 156.665 1.00 60.56  ? 762  LYS A CA    1 
ATOM   5406  C  C     . LYS A 1  762  ? 160.668 121.484 156.350 1.00 61.72  ? 762  LYS A C     1 
ATOM   5407  O  O     . LYS A 1  762  ? 160.974 120.690 157.245 1.00 62.55  ? 762  LYS A O     1 
ATOM   5408  C  CB    . LYS A 1  762  ? 160.541 123.632 157.652 1.00 63.23  ? 762  LYS A CB    1 
ATOM   5409  C  CG    . LYS A 1  762  ? 160.516 123.157 159.097 1.00 63.62  ? 762  LYS A CG    1 
ATOM   5410  C  CD    . LYS A 1  762  ? 161.292 124.102 160.001 1.00 63.67  ? 762  LYS A CD    1 
ATOM   5411  C  CE    . LYS A 1  762  ? 162.749 124.197 159.579 1.00 60.86  ? 762  LYS A CE    1 
ATOM   5412  N  NZ    . LYS A 1  762  ? 163.428 122.873 159.628 1.00 60.79  ? 762  LYS A NZ    1 
ATOM   5413  N  N     . GLY A 1  763  ? 161.043 121.337 155.081 1.00 61.37  ? 763  GLY A N     1 
ATOM   5414  C  CA    . GLY A 1  763  ? 162.121 120.251 154.791 1.00 61.85  ? 763  GLY A CA    1 
ATOM   5415  C  C     . GLY A 1  763  ? 161.008 119.283 154.406 1.00 62.35  ? 763  GLY A C     1 
ATOM   5416  O  O     . GLY A 1  763  ? 160.977 118.142 154.868 1.00 61.97  ? 763  GLY A O     1 
ATOM   5417  N  N     . SER A 1  764  ? 160.081 119.730 153.577 1.00 62.80  ? 764  SER A N     1 
ATOM   5418  C  CA    . SER A 1  764  ? 159.021 118.873 153.079 1.00 62.75  ? 764  SER A CA    1 
ATOM   5419  C  C     . SER A 1  764  ? 159.516 119.006 151.673 1.00 63.17  ? 764  SER A C     1 
ATOM   5420  O  O     . SER A 1  764  ? 158.838 119.553 150.804 1.00 63.30  ? 764  SER A O     1 
ATOM   5421  C  CB    . SER A 1  764  ? 157.660 119.538 153.238 1.00 61.70  ? 764  SER A CB    1 
ATOM   5422  O  OG    . SER A 1  764  ? 157.796 120.887 153.648 1.00 60.79  ? 764  SER A OG    1 
ATOM   5423  N  N     . LEU A 1  765  ? 160.742 118.536 151.462 1.00 61.59  ? 765  LEU A N     1 
ATOM   5424  C  CA    . LEU A 1  765  ? 161.380 118.753 150.168 1.00 61.73  ? 765  LEU A CA    1 
ATOM   5425  C  C     . LEU A 1  765  ? 160.915 117.707 149.167 1.00 63.93  ? 765  LEU A C     1 
ATOM   5426  O  O     . LEU A 1  765  ? 161.705 117.173 148.383 1.00 65.71  ? 765  LEU A O     1 
ATOM   5427  C  CB    . LEU A 1  765  ? 162.904 118.737 150.287 1.00 66.52  ? 765  LEU A CB    1 
ATOM   5428  C  CG    . LEU A 1  765  ? 163.656 120.072 150.296 1.00 65.90  ? 765  LEU A CG    1 
ATOM   5429  C  CD1   . LEU A 1  765  ? 163.433 120.817 148.987 1.00 59.66  ? 765  LEU A CD1   1 
ATOM   5430  C  CD2   . LEU A 1  765  ? 163.265 120.938 151.478 1.00 60.19  ? 765  LEU A CD2   1 
ATOM   5431  N  N     . GLU A 1  766  ? 159.621 117.396 149.178 1.00 59.08  ? 766  GLU A N     1 
ATOM   5432  C  CA    . GLU A 1  766  ? 159.055 116.346 148.342 1.00 58.38  ? 766  GLU A CA    1 
ATOM   5433  C  C     . GLU A 1  766  ? 158.010 116.901 147.380 1.00 58.80  ? 766  GLU A C     1 
ATOM   5434  O  O     . GLU A 1  766  ? 156.971 116.283 147.141 1.00 59.68  ? 766  GLU A O     1 
ATOM   5435  C  CB    . GLU A 1  766  ? 158.452 115.232 149.194 1.00 59.91  ? 766  GLU A CB    1 
ATOM   5436  C  CG    . GLU A 1  766  ? 159.394 114.646 150.237 1.00 60.28  ? 766  GLU A CG    1 
ATOM   5437  C  CD    . GLU A 1  766  ? 159.381 115.425 151.538 1.00 60.41  ? 766  GLU A CD    1 
ATOM   5438  O  OE1   . GLU A 1  766  ? 158.528 116.325 151.682 1.00 57.03  ? 766  GLU A OE1   1 
ATOM   5439  O  OE2   . GLU A 1  766  ? 160.224 115.137 152.413 1.00 56.29  ? 766  GLU A OE2   1 
ATOM   5440  N  N     . ASN A 1  767  ? 158.272 118.077 146.811 1.00 56.05  ? 767  ASN A N     1 
ATOM   5441  C  CA    . ASN A 1  767  ? 157.388 118.635 145.795 1.00 55.05  ? 767  ASN A CA    1 
ATOM   5442  C  C     . ASN A 1  767  ? 157.814 118.214 144.394 1.00 54.03  ? 767  ASN A C     1 
ATOM   5443  O  O     . ASN A 1  767  ? 156.982 117.780 143.590 1.00 53.52  ? 767  ASN A O     1 
ATOM   5444  C  CB    . ASN A 1  767  ? 157.349 120.162 145.902 1.00 53.05  ? 767  ASN A CB    1 
ATOM   5445  C  CG    . ASN A 1  767  ? 156.331 120.787 144.966 1.00 53.67  ? 767  ASN A CG    1 
ATOM   5446  O  OD1   . ASN A 1  767  ? 155.392 120.127 144.520 1.00 55.42  ? 767  ASN A OD1   1 
ATOM   5447  N  ND2   . ASN A 1  767  ? 156.513 122.067 144.664 1.00 55.68  ? 767  ASN A ND2   1 
ATOM   5448  N  N     . GLU A 1  768  ? 159.103 118.336 144.090 1.00 55.53  ? 768  GLU A N     1 
ATOM   5449  C  CA    . GLU A 1  768  ? 159.632 117.890 142.810 1.00 55.41  ? 768  GLU A CA    1 
ATOM   5450  C  C     . GLU A 1  768  ? 159.740 116.371 142.796 1.00 56.64  ? 768  GLU A C     1 
ATOM   5451  O  O     . GLU A 1  768  ? 160.371 115.776 143.675 1.00 57.76  ? 768  GLU A O     1 
ATOM   5452  C  CB    . GLU A 1  768  ? 160.995 118.531 142.546 1.00 58.49  ? 768  GLU A CB    1 
ATOM   5453  C  CG    . GLU A 1  768  ? 161.778 117.914 141.395 1.00 58.99  ? 768  GLU A CG    1 
ATOM   5454  C  CD    . GLU A 1  768  ? 162.753 116.846 141.855 1.00 58.76  ? 768  GLU A CD    1 
ATOM   5455  O  OE1   . GLU A 1  768  ? 163.012 116.762 143.074 1.00 53.70  ? 768  GLU A OE1   1 
ATOM   5456  O  OE2   . GLU A 1  768  ? 163.261 116.092 140.999 1.00 53.20  ? 768  GLU A OE2   1 
ATOM   5457  N  N     . VAL A 1  769  ? 159.122 115.747 141.803 1.00 52.77  ? 769  VAL A N     1 
ATOM   5458  C  CA    . VAL A 1  769  ? 159.151 114.296 141.659 1.00 52.61  ? 769  VAL A CA    1 
ATOM   5459  C  C     . VAL A 1  769  ? 160.397 113.903 140.880 1.00 52.61  ? 769  VAL A C     1 
ATOM   5460  O  O     . VAL A 1  769  ? 160.798 114.585 139.928 1.00 52.94  ? 769  VAL A O     1 
ATOM   5461  C  CB    . VAL A 1  769  ? 157.869 113.785 140.973 1.00 52.79  ? 769  VAL A CB    1 
ATOM   5462  C  CG1   . VAL A 1  769  ? 156.679 113.940 141.907 1.00 54.01  ? 769  VAL A CG1   1 
ATOM   5463  C  CG2   . VAL A 1  769  ? 157.626 114.529 139.671 1.00 53.38  ? 769  VAL A CG2   1 
ATOM   5464  N  N     . LEU A 1  770  ? 161.020 112.800 141.289 1.00 54.39  ? 770  LEU A N     1 
ATOM   5465  C  CA    . LEU A 1  770  ? 162.274 112.354 140.703 1.00 55.43  ? 770  LEU A CA    1 
ATOM   5466  C  C     . LEU A 1  770  ? 162.252 110.843 140.531 1.00 55.70  ? 770  LEU A C     1 
ATOM   5467  O  O     . LEU A 1  770  ? 161.759 110.118 141.401 1.00 56.02  ? 770  LEU A O     1 
ATOM   5468  C  CB    . LEU A 1  770  ? 163.470 112.770 141.571 1.00 56.23  ? 770  LEU A CB    1 
ATOM   5469  C  CG    . LEU A 1  770  ? 164.827 112.137 141.263 1.00 56.16  ? 770  LEU A CG    1 
ATOM   5470  C  CD1   . LEU A 1  770  ? 165.328 112.557 139.890 1.00 56.64  ? 770  LEU A CD1   1 
ATOM   5471  C  CD2   . LEU A 1  770  ? 165.831 112.504 142.338 1.00 56.04  ? 770  LEU A CD2   1 
ATOM   5472  N  N     . PHE A 1  771  ? 162.791 110.377 139.407 1.00 56.93  ? 771  PHE A N     1 
ATOM   5473  C  CA    . PHE A 1  771  ? 162.892 108.958 139.105 1.00 57.83  ? 771  PHE A CA    1 
ATOM   5474  C  C     . PHE A 1  771  ? 164.352 108.584 138.882 1.00 59.89  ? 771  PHE A C     1 
ATOM   5475  O  O     . PHE A 1  771  ? 165.154 109.398 138.414 1.00 62.56  ? 771  PHE A O     1 
ATOM   5476  C  CB    . PHE A 1  771  ? 162.063 108.593 137.868 1.00 63.14  ? 771  PHE A CB    1 
ATOM   5477  C  CG    . PHE A 1  771  ? 160.581 108.708 138.077 1.00 64.44  ? 771  PHE A CG    1 
ATOM   5478  C  CD1   . PHE A 1  771  ? 160.010 108.359 139.290 1.00 65.55  ? 771  PHE A CD1   1 
ATOM   5479  C  CD2   . PHE A 1  771  ? 159.758 109.166 137.063 1.00 65.86  ? 771  PHE A CD2   1 
ATOM   5480  C  CE1   . PHE A 1  771  ? 158.645 108.463 139.483 1.00 64.98  ? 771  PHE A CE1   1 
ATOM   5481  C  CE2   . PHE A 1  771  ? 158.394 109.275 137.252 1.00 57.23  ? 771  PHE A CE2   1 
ATOM   5482  C  CZ    . PHE A 1  771  ? 157.837 108.922 138.464 1.00 56.51  ? 771  PHE A CZ    1 
ATOM   5483  N  N     . LYS A 1  772  ? 164.691 107.340 139.224 1.00 58.35  ? 772  LYS A N     1 
ATOM   5484  C  CA    . LYS A 1  772  ? 166.068 106.863 139.101 1.00 59.64  ? 772  LYS A CA    1 
ATOM   5485  C  C     . LYS A 1  772  ? 166.024 105.409 138.638 1.00 59.96  ? 772  LYS A C     1 
ATOM   5486  O  O     . LYS A 1  772  ? 165.850 104.501 139.458 1.00 59.51  ? 772  LYS A O     1 
ATOM   5487  C  CB    . LYS A 1  772  ? 166.820 107.009 140.417 1.00 59.45  ? 772  LYS A CB    1 
ATOM   5488  C  CG    . LYS A 1  772  ? 168.276 106.578 140.350 1.00 59.45  ? 772  LYS A CG    1 
ATOM   5489  C  CD    . LYS A 1  772  ? 169.045 107.389 139.319 1.00 59.63  ? 772  LYS A CD    1 
ATOM   5490  C  CE    . LYS A 1  772  ? 170.497 106.949 139.240 1.00 60.44  ? 772  LYS A CE    1 
ATOM   5491  N  NZ    . LYS A 1  772  ? 171.202 107.123 140.540 1.00 60.75  ? 772  LYS A NZ    1 
ATOM   5492  N  N     . ASP A 1  773  ? 166.182 105.204 137.329 1.00 61.18  ? 773  ASP A N     1 
ATOM   5493  C  CA    . ASP A 1  773  ? 166.227 103.871 136.725 1.00 62.01  ? 773  ASP A CA    1 
ATOM   5494  C  C     . ASP A 1  773  ? 164.964 103.074 137.053 1.00 62.78  ? 773  ASP A C     1 
ATOM   5495  O  O     . ASP A 1  773  ? 165.019 101.915 137.468 1.00 63.57  ? 773  ASP A O     1 
ATOM   5496  C  CB    . ASP A 1  773  ? 167.487 103.115 137.160 1.00 63.82  ? 773  ASP A CB    1 
ATOM   5497  C  CG    . ASP A 1  773  ? 167.866 102.005 136.196 1.00 64.33  ? 773  ASP A CG    1 
ATOM   5498  O  OD1   . ASP A 1  773  ? 166.994 101.551 135.425 1.00 61.65  ? 773  ASP A OD1   1 
ATOM   5499  O  OD2   . ASP A 1  773  ? 169.043 101.584 136.210 1.00 61.24  ? 773  ASP A OD2   1 
ATOM   5500  N  N     . GLY A 1  774  ? 163.813 103.714 136.866 1.00 61.58  ? 774  GLY A N     1 
ATOM   5501  C  CA    . GLY A 1  774  ? 162.542 103.063 137.115 1.00 61.55  ? 774  GLY A CA    1 
ATOM   5502  C  C     . GLY A 1  774  ? 162.234 102.911 138.590 1.00 61.14  ? 774  GLY A C     1 
ATOM   5503  O  O     . GLY A 1  774  ? 161.942 101.806 139.059 1.00 60.95  ? 774  GLY A O     1 
ATOM   5504  N  N     . ALA A 1  775  ? 162.298 104.014 139.333 1.00 60.54  ? 775  ALA A N     1 
ATOM   5505  C  CA    . ALA A 1  775  ? 162.061 103.979 140.770 1.00 59.73  ? 775  ALA A CA    1 
ATOM   5506  C  C     . ALA A 1  775  ? 161.668 105.370 141.240 1.00 59.38  ? 775  ALA A C     1 
ATOM   5507  O  O     . ALA A 1  775  ? 162.369 106.344 140.947 1.00 58.97  ? 775  ALA A O     1 
ATOM   5508  C  CB    . ALA A 1  775  ? 163.304 103.493 141.523 1.00 59.37  ? 775  ALA A CB    1 
ATOM   5509  N  N     . LEU A 1  776  ? 160.557 105.459 141.967 1.00 57.84  ? 776  LEU A N     1 
ATOM   5510  C  CA    . LEU A 1  776  ? 160.112 106.730 142.528 1.00 57.15  ? 776  LEU A CA    1 
ATOM   5511  C  C     . LEU A 1  776  ? 161.017 107.103 143.696 1.00 57.35  ? 776  LEU A C     1 
ATOM   5512  O  O     . LEU A 1  776  ? 161.010 106.436 144.735 1.00 57.66  ? 776  LEU A O     1 
ATOM   5513  C  CB    . LEU A 1  776  ? 158.654 106.634 142.967 1.00 57.63  ? 776  LEU A CB    1 
ATOM   5514  C  CG    . LEU A 1  776  ? 158.062 107.839 143.703 1.00 58.32  ? 776  LEU A CG    1 
ATOM   5515  C  CD1   . LEU A 1  776  ? 158.271 109.122 142.915 1.00 56.17  ? 776  LEU A CD1   1 
ATOM   5516  C  CD2   . LEU A 1  776  ? 156.583 107.616 143.980 1.00 56.43  ? 776  LEU A CD2   1 
ATOM   5517  N  N     . LEU A 1  777  ? 161.797 108.168 143.527 1.00 56.10  ? 777  LEU A N     1 
ATOM   5518  C  CA    . LEU A 1  777  ? 162.784 108.566 144.523 1.00 55.69  ? 777  LEU A CA    1 
ATOM   5519  C  C     . LEU A 1  777  ? 162.199 109.528 145.552 1.00 56.65  ? 777  LEU A C     1 
ATOM   5520  O  O     . LEU A 1  777  ? 162.345 109.313 146.759 1.00 57.59  ? 777  LEU A O     1 
ATOM   5521  C  CB    . LEU A 1  777  ? 163.999 109.192 143.828 1.00 58.16  ? 777  LEU A CB    1 
ATOM   5522  C  CG    . LEU A 1  777  ? 165.319 109.309 144.601 1.00 57.72  ? 777  LEU A CG    1 
ATOM   5523  C  CD1   . LEU A 1  777  ? 165.357 110.550 145.485 1.00 54.71  ? 777  LEU A CD1   1 
ATOM   5524  C  CD2   . LEU A 1  777  ? 165.569 108.052 145.423 1.00 54.68  ? 777  LEU A CD2   1 
ATOM   5525  N  N     . CYS A 1  778  ? 161.539 110.590 145.095 1.00 54.15  ? 778  CYS A N     1 
ATOM   5526  C  CA    . CYS A 1  778  ? 161.019 111.607 145.995 1.00 54.37  ? 778  CYS A CA    1 
ATOM   5527  C  C     . CYS A 1  778  ? 159.766 112.220 145.388 1.00 54.75  ? 778  CYS A C     1 
ATOM   5528  O  O     . CYS A 1  778  ? 159.609 112.265 144.165 1.00 55.71  ? 778  CYS A O     1 
ATOM   5529  C  CB    . CYS A 1  778  ? 162.067 112.691 146.272 1.00 54.72  ? 778  CYS A CB    1 
ATOM   5530  S  SG    . CYS A 1  778  ? 161.544 113.968 147.431 1.00 55.02  ? 778  CYS A SG    1 
ATOM   5531  N  N     . GLY A 1  779  ? 158.876 112.687 146.254 1.00 54.68  ? 779  GLY A N     1 
ATOM   5532  C  CA    . GLY A 1  779  ? 157.631 113.302 145.846 1.00 54.12  ? 779  GLY A CA    1 
ATOM   5533  C  C     . GLY A 1  779  ? 156.430 112.596 146.447 1.00 53.37  ? 779  GLY A C     1 
ATOM   5534  O  O     . GLY A 1  779  ? 156.550 111.654 147.230 1.00 53.52  ? 779  GLY A O     1 
ATOM   5535  N  N     . ILE A 1  780  ? 155.252 113.084 146.065 1.00 52.47  ? 780  ILE A N     1 
ATOM   5536  C  CA    . ILE A 1  780  ? 153.982 112.494 146.472 1.00 52.13  ? 780  ILE A CA    1 
ATOM   5537  C  C     . ILE A 1  780  ? 153.120 112.312 145.231 1.00 53.68  ? 780  ILE A C     1 
ATOM   5538  O  O     . ILE A 1  780  ? 152.989 113.235 144.419 1.00 54.49  ? 780  ILE A O     1 
ATOM   5539  C  CB    . ILE A 1  780  ? 153.248 113.357 147.518 1.00 54.78  ? 780  ILE A CB    1 
ATOM   5540  C  CG1   . ILE A 1  780  ? 154.013 113.372 148.844 1.00 54.24  ? 780  ILE A CG1   1 
ATOM   5541  C  CG2   . ILE A 1  780  ? 151.829 112.852 147.734 1.00 50.65  ? 780  ILE A CG2   1 
ATOM   5542  C  CD1   . ILE A 1  780  ? 154.905 114.577 149.021 1.00 50.23  ? 780  ILE A CD1   1 
ATOM   5543  N  N     . LEU A 1  781  ? 152.547 111.120 145.082 1.00 50.15  ? 781  LEU A N     1 
ATOM   5544  C  CA    . LEU A 1  781  ? 151.623 110.848 143.990 1.00 50.40  ? 781  LEU A CA    1 
ATOM   5545  C  C     . LEU A 1  781  ? 150.432 111.796 144.066 1.00 50.86  ? 781  LEU A C     1 
ATOM   5546  O  O     . LEU A 1  781  ? 149.833 111.974 145.131 1.00 51.15  ? 781  LEU A O     1 
ATOM   5547  C  CB    . LEU A 1  781  ? 151.163 109.389 144.055 1.00 51.05  ? 781  LEU A CB    1 
ATOM   5548  C  CG    . LEU A 1  781  ? 150.330 108.778 142.923 1.00 51.31  ? 781  LEU A CG    1 
ATOM   5549  C  CD1   . LEU A 1  781  ? 148.841 109.048 143.105 1.00 50.80  ? 781  LEU A CD1   1 
ATOM   5550  C  CD2   . LEU A 1  781  ? 150.814 109.282 141.576 1.00 51.38  ? 781  LEU A CD2   1 
ATOM   5551  N  N     . ASP A 1  782  ? 150.086 112.403 142.935 1.00 51.35  ? 782  ASP A N     1 
ATOM   5552  C  CA    . ASP A 1  782  ? 149.015 113.391 142.897 1.00 51.91  ? 782  ASP A CA    1 
ATOM   5553  C  C     . ASP A 1  782  ? 148.489 113.487 141.467 1.00 52.61  ? 782  ASP A C     1 
ATOM   5554  O  O     . ASP A 1  782  ? 148.813 112.658 140.610 1.00 52.80  ? 782  ASP A O     1 
ATOM   5555  C  CB    . ASP A 1  782  ? 149.504 114.743 143.426 1.00 52.55  ? 782  ASP A CB    1 
ATOM   5556  C  CG    . ASP A 1  782  ? 148.385 115.573 144.017 1.00 53.19  ? 782  ASP A CG    1 
ATOM   5557  O  OD1   . ASP A 1  782  ? 147.209 115.268 143.729 1.00 51.55  ? 782  ASP A OD1   1 
ATOM   5558  O  OD2   . ASP A 1  782  ? 148.679 116.529 144.767 1.00 51.76  ? 782  ASP A OD2   1 
ATOM   5559  N  N     . LYS A 1  783  ? 147.669 114.510 141.213 1.00 50.85  ? 783  LYS A N     1 
ATOM   5560  C  CA    . LYS A 1  783  ? 147.014 114.646 139.914 1.00 50.38  ? 783  LYS A CA    1 
ATOM   5561  C  C     . LYS A 1  783  ? 148.011 115.031 138.827 1.00 51.03  ? 783  LYS A C     1 
ATOM   5562  O  O     . LYS A 1  783  ? 147.954 114.511 137.707 1.00 51.62  ? 783  LYS A O     1 
ATOM   5563  C  CB    . LYS A 1  783  ? 145.889 115.677 140.002 1.00 52.51  ? 783  LYS A CB    1 
ATOM   5564  C  CG    . LYS A 1  783  ? 145.118 115.873 138.706 1.00 53.42  ? 783  LYS A CG    1 
ATOM   5565  C  CD    . LYS A 1  783  ? 144.153 114.727 138.456 1.00 54.18  ? 783  LYS A CD    1 
ATOM   5566  C  CE    . LYS A 1  783  ? 143.083 114.664 139.534 1.00 49.59  ? 783  LYS A CE    1 
ATOM   5567  N  NZ    . LYS A 1  783  ? 142.094 113.580 139.276 1.00 49.09  ? 783  LYS A NZ    1 
ATOM   5568  N  N     . SER A 1  784  ? 148.925 115.955 139.133 1.00 49.71  ? 784  SER A N     1 
ATOM   5569  C  CA    . SER A 1  784  ? 149.919 116.352 138.143 1.00 50.11  ? 784  SER A CA    1 
ATOM   5570  C  C     . SER A 1  784  ? 150.873 115.210 137.820 1.00 50.60  ? 784  SER A C     1 
ATOM   5571  O  O     . SER A 1  784  ? 151.384 115.127 136.698 1.00 50.80  ? 784  SER A O     1 
ATOM   5572  C  CB    . SER A 1  784  ? 150.696 117.575 138.632 1.00 50.18  ? 784  SER A CB    1 
ATOM   5573  O  OG    . SER A 1  784  ? 151.647 117.994 137.669 1.00 50.36  ? 784  SER A OG    1 
ATOM   5574  N  N     . GLN A 1  785  ? 151.125 114.324 138.787 1.00 50.50  ? 785  GLN A N     1 
ATOM   5575  C  CA    . GLN A 1  785  ? 151.934 113.143 138.511 1.00 50.93  ? 785  GLN A CA    1 
ATOM   5576  C  C     . GLN A 1  785  ? 151.201 112.187 137.577 1.00 51.95  ? 785  GLN A C     1 
ATOM   5577  O  O     . GLN A 1  785  ? 151.779 111.683 136.607 1.00 52.84  ? 785  GLN A O     1 
ATOM   5578  C  CB    . GLN A 1  785  ? 152.312 112.445 139.817 1.00 53.58  ? 785  GLN A CB    1 
ATOM   5579  C  CG    . GLN A 1  785  ? 153.161 111.194 139.635 1.00 53.72  ? 785  GLN A CG    1 
ATOM   5580  C  CD    . GLN A 1  785  ? 154.511 111.480 139.003 1.00 54.32  ? 785  GLN A CD    1 
ATOM   5581  O  OE1   . GLN A 1  785  ? 154.629 111.591 137.783 1.00 50.24  ? 785  GLN A OE1   1 
ATOM   5582  N  NE2   . GLN A 1  785  ? 155.539 111.593 139.834 1.00 49.94  ? 785  GLN A NE2   1 
ATOM   5583  N  N     . TYR A 1  786  ? 149.925 111.926 137.853 1.00 50.02  ? 786  TYR A N     1 
ATOM   5584  C  CA    . TYR A 1  786  ? 149.093 111.139 136.951 1.00 49.97  ? 786  TYR A CA    1 
ATOM   5585  C  C     . TYR A 1  786  ? 147.651 111.601 137.101 1.00 49.52  ? 786  TYR A C     1 
ATOM   5586  O  O     . TYR A 1  786  ? 147.162 111.765 138.223 1.00 49.21  ? 786  TYR A O     1 
ATOM   5587  C  CB    . TYR A 1  786  ? 149.225 109.634 137.232 1.00 48.96  ? 786  TYR A CB    1 
ATOM   5588  C  CG    . TYR A 1  786  ? 148.088 109.023 138.024 1.00 49.45  ? 786  TYR A CG    1 
ATOM   5589  C  CD1   . TYR A 1  786  ? 148.081 109.064 139.411 1.00 51.18  ? 786  TYR A CD1   1 
ATOM   5590  C  CD2   . TYR A 1  786  ? 147.026 108.394 137.383 1.00 50.44  ? 786  TYR A CD2   1 
ATOM   5591  C  CE1   . TYR A 1  786  ? 147.047 108.506 140.138 1.00 49.65  ? 786  TYR A CE1   1 
ATOM   5592  C  CE2   . TYR A 1  786  ? 145.987 107.834 138.103 1.00 50.40  ? 786  TYR A CE2   1 
ATOM   5593  C  CZ    . TYR A 1  786  ? 146.005 107.892 139.480 1.00 50.34  ? 786  TYR A CZ    1 
ATOM   5594  O  OH    . TYR A 1  786  ? 144.977 107.336 140.205 1.00 50.48  ? 786  TYR A OH    1 
ATOM   5595  N  N     . GLY A 1  787  ? 146.991 111.844 135.972 1.00 50.97  ? 787  GLY A N     1 
ATOM   5596  C  CA    . GLY A 1  787  ? 145.616 112.299 135.983 1.00 51.71  ? 787  GLY A CA    1 
ATOM   5597  C  C     . GLY A 1  787  ? 145.255 113.103 134.753 1.00 53.04  ? 787  GLY A C     1 
ATOM   5598  O  O     . GLY A 1  787  ? 145.663 112.762 133.638 1.00 52.41  ? 787  GLY A O     1 
ATOM   5599  N  N     . ALA A 1  788  ? 144.492 114.176 134.943 1.00 55.85  ? 788  ALA A N     1 
ATOM   5600  C  CA    . ALA A 1  788  ? 144.124 115.072 133.847 1.00 58.29  ? 788  ALA A CA    1 
ATOM   5601  C  C     . ALA A 1  788  ? 145.121 116.229 133.748 1.00 58.87  ? 788  ALA A C     1 
ATOM   5602  O  O     . ALA A 1  788  ? 144.772 117.408 133.816 1.00 60.09  ? 788  ALA A O     1 
ATOM   5603  C  CB    . ALA A 1  788  ? 142.699 115.580 134.034 1.00 60.53  ? 788  ALA A CB    1 
ATOM   5604  N  N     . SER A 1  789  ? 146.390 115.863 133.583 1.00 61.30  ? 789  SER A N     1 
ATOM   5605  C  CA    . SER A 1  789  ? 147.475 116.833 133.519 1.00 62.32  ? 789  SER A CA    1 
ATOM   5606  C  C     . SER A 1  789  ? 148.426 116.420 132.400 1.00 63.46  ? 789  SER A C     1 
ATOM   5607  O  O     . SER A 1  789  ? 148.143 115.503 131.623 1.00 64.46  ? 789  SER A O     1 
ATOM   5608  C  CB    . SER A 1  789  ? 148.186 116.941 134.875 1.00 61.73  ? 789  SER A CB    1 
ATOM   5609  O  OG    . SER A 1  789  ? 149.269 117.853 134.812 1.00 60.90  ? 789  SER A OG    1 
ATOM   5610  N  N     . LYS A 1  790  ? 149.565 117.104 132.322 1.00 61.86  ? 790  LYS A N     1 
ATOM   5611  C  CA    . LYS A 1  790  ? 150.554 116.877 131.281 1.00 61.95  ? 790  LYS A CA    1 
ATOM   5612  C  C     . LYS A 1  790  ? 151.919 116.656 131.918 1.00 64.42  ? 790  LYS A C     1 
ATOM   5613  O  O     . LYS A 1  790  ? 152.193 117.144 133.018 1.00 66.70  ? 790  LYS A O     1 
ATOM   5614  C  CB    . LYS A 1  790  ? 150.608 118.062 130.301 1.00 67.91  ? 790  LYS A CB    1 
ATOM   5615  C  CG    . LYS A 1  790  ? 151.377 117.800 129.016 1.00 68.98  ? 790  LYS A CG    1 
ATOM   5616  C  CD    . LYS A 1  790  ? 150.751 116.673 128.212 1.00 69.23  ? 790  LYS A CD    1 
ATOM   5617  C  CE    . LYS A 1  790  ? 151.333 116.609 126.809 1.00 59.30  ? 790  LYS A CE    1 
ATOM   5618  N  NZ    . LYS A 1  790  ? 152.815 116.488 126.825 1.00 58.53  ? 790  LYS A NZ    1 
ATOM   5619  N  N     . TYR A 1  791  ? 152.770 115.905 131.213 1.00 57.41  ? 791  TYR A N     1 
ATOM   5620  C  CA    . TYR A 1  791  ? 154.142 115.632 131.647 1.00 56.53  ? 791  TYR A CA    1 
ATOM   5621  C  C     . TYR A 1  791  ? 154.166 114.903 132.991 1.00 56.65  ? 791  TYR A C     1 
ATOM   5622  O  O     . TYR A 1  791  ? 154.805 115.338 133.952 1.00 56.68  ? 791  TYR A O     1 
ATOM   5623  C  CB    . TYR A 1  791  ? 154.970 116.920 131.703 1.00 56.52  ? 791  TYR A CB    1 
ATOM   5624  C  CG    . TYR A 1  791  ? 155.247 117.529 130.349 1.00 56.68  ? 791  TYR A CG    1 
ATOM   5625  C  CD1   . TYR A 1  791  ? 155.454 116.727 129.234 1.00 57.02  ? 791  TYR A CD1   1 
ATOM   5626  C  CD2   . TYR A 1  791  ? 155.297 118.907 130.183 1.00 57.72  ? 791  TYR A CD2   1 
ATOM   5627  C  CE1   . TYR A 1  791  ? 155.708 117.279 127.994 1.00 57.07  ? 791  TYR A CE1   1 
ATOM   5628  C  CE2   . TYR A 1  791  ? 155.549 119.468 128.946 1.00 56.87  ? 791  TYR A CE2   1 
ATOM   5629  C  CZ    . TYR A 1  791  ? 155.753 118.651 127.855 1.00 55.87  ? 791  TYR A CZ    1 
ATOM   5630  O  OH    . TYR A 1  791  ? 156.005 119.205 126.620 1.00 55.45  ? 791  TYR A OH    1 
ATOM   5631  N  N     . GLY A 1  792  ? 153.458 113.779 133.051 1.00 55.64  ? 792  GLY A N     1 
ATOM   5632  C  CA    . GLY A 1  792  ? 153.429 112.967 134.251 1.00 55.32  ? 792  GLY A CA    1 
ATOM   5633  C  C     . GLY A 1  792  ? 154.040 111.595 134.049 1.00 54.49  ? 792  GLY A C     1 
ATOM   5634  O  O     . GLY A 1  792  ? 154.645 111.330 133.006 1.00 54.29  ? 792  GLY A O     1 
ATOM   5635  N  N     . ILE A 1  793  ? 153.891 110.713 135.040 1.00 53.90  ? 793  ILE A N     1 
ATOM   5636  C  CA    . ILE A 1  793  ? 154.426 109.362 134.909 1.00 53.96  ? 793  ILE A CA    1 
ATOM   5637  C  C     . ILE A 1  793  ? 153.660 108.584 133.845 1.00 54.17  ? 793  ILE A C     1 
ATOM   5638  O  O     . ILE A 1  793  ? 154.255 107.858 133.040 1.00 54.34  ? 793  ILE A O     1 
ATOM   5639  C  CB    . ILE A 1  793  ? 154.410 108.639 136.270 1.00 54.55  ? 793  ILE A CB    1 
ATOM   5640  C  CG1   . ILE A 1  793  ? 154.818 107.172 136.110 1.00 54.40  ? 793  ILE A CG1   1 
ATOM   5641  C  CG2   . ILE A 1  793  ? 153.043 108.746 136.932 1.00 53.71  ? 793  ILE A CG2   1 
ATOM   5642  C  CD1   . ILE A 1  793  ? 156.233 106.979 135.612 1.00 53.58  ? 793  ILE A CD1   1 
ATOM   5643  N  N     . VAL A 1  794  ? 152.333 108.728 133.817 1.00 53.40  ? 794  VAL A N     1 
ATOM   5644  C  CA    . VAL A 1  794  ? 151.528 108.029 132.819 1.00 53.25  ? 794  VAL A CA    1 
ATOM   5645  C  C     . VAL A 1  794  ? 151.874 108.517 131.417 1.00 53.37  ? 794  VAL A C     1 
ATOM   5646  O  O     . VAL A 1  794  ? 151.995 107.721 130.478 1.00 53.38  ? 794  VAL A O     1 
ATOM   5647  C  CB    . VAL A 1  794  ? 150.028 108.194 133.131 1.00 53.64  ? 794  VAL A CB    1 
ATOM   5648  C  CG1   . VAL A 1  794  ? 149.695 109.650 133.431 1.00 53.45  ? 794  VAL A CG1   1 
ATOM   5649  C  CG2   . VAL A 1  794  ? 149.181 107.670 131.980 1.00 54.24  ? 794  VAL A CG2   1 
ATOM   5650  N  N     . HIS A 1  795  ? 152.049 109.830 131.257 1.00 53.67  ? 795  HIS A N     1 
ATOM   5651  C  CA    . HIS A 1  795  ? 152.382 110.372 129.944 1.00 54.54  ? 795  HIS A CA    1 
ATOM   5652  C  C     . HIS A 1  795  ? 153.817 110.043 129.548 1.00 55.66  ? 795  HIS A C     1 
ATOM   5653  O  O     . HIS A 1  795  ? 154.112 109.910 128.356 1.00 57.12  ? 795  HIS A O     1 
ATOM   5654  C  CB    . HIS A 1  795  ? 152.157 111.882 129.928 1.00 58.21  ? 795  HIS A CB    1 
ATOM   5655  C  CG    . HIS A 1  795  ? 152.097 112.466 128.551 1.00 58.73  ? 795  HIS A CG    1 
ATOM   5656  N  ND1   . HIS A 1  795  ? 153.218 112.907 127.881 1.00 58.16  ? 795  HIS A ND1   1 
ATOM   5657  C  CD2   . HIS A 1  795  ? 151.052 112.676 127.717 1.00 57.62  ? 795  HIS A CD2   1 
ATOM   5658  C  CE1   . HIS A 1  795  ? 152.865 113.366 126.694 1.00 54.22  ? 795  HIS A CE1   1 
ATOM   5659  N  NE2   . HIS A 1  795  ? 151.556 113.237 126.569 1.00 53.66  ? 795  HIS A NE2   1 
ATOM   5660  N  N     . SER A 1  796  ? 154.716 109.912 130.526 1.00 54.56  ? 796  SER A N     1 
ATOM   5661  C  CA    . SER A 1  796  ? 156.094 109.540 130.215 1.00 55.17  ? 796  SER A CA    1 
ATOM   5662  C  C     . SER A 1  796  ? 156.175 108.093 129.749 1.00 55.70  ? 796  SER A C     1 
ATOM   5663  O  O     . SER A 1  796  ? 156.839 107.786 128.751 1.00 55.91  ? 796  SER A O     1 
ATOM   5664  C  CB    . SER A 1  796  ? 156.988 109.769 131.433 1.00 55.09  ? 796  SER A CB    1 
ATOM   5665  O  OG    . SER A 1  796  ? 156.979 111.131 131.824 1.00 55.59  ? 796  SER A OG    1 
ATOM   5666  N  N     . LEU A 1  797  ? 155.504 107.184 130.462 1.00 54.52  ? 797  LEU A N     1 
ATOM   5667  C  CA    . LEU A 1  797  ? 155.476 105.786 130.051 1.00 54.15  ? 797  LEU A CA    1 
ATOM   5668  C  C     . LEU A 1  797  ? 154.704 105.582 128.755 1.00 54.05  ? 797  LEU A C     1 
ATOM   5669  O  O     . LEU A 1  797  ? 154.880 104.551 128.100 1.00 54.12  ? 797  LEU A O     1 
ATOM   5670  C  CB    . LEU A 1  797  ? 154.872 104.922 131.160 1.00 54.19  ? 797  LEU A CB    1 
ATOM   5671  C  CG    . LEU A 1  797  ? 155.561 104.998 132.524 1.00 54.37  ? 797  LEU A CG    1 
ATOM   5672  C  CD1   . LEU A 1  797  ? 154.915 104.043 133.515 1.00 53.81  ? 797  LEU A CD1   1 
ATOM   5673  C  CD2   . LEU A 1  797  ? 157.050 104.722 132.398 1.00 54.14  ? 797  LEU A CD2   1 
ATOM   5674  N  N     . HIS A 1  798  ? 153.853 106.538 128.373 1.00 54.68  ? 798  HIS A N     1 
ATOM   5675  C  CA    . HIS A 1  798  ? 153.127 106.422 127.113 1.00 55.27  ? 798  HIS A CA    1 
ATOM   5676  C  C     . HIS A 1  798  ? 154.068 106.544 125.920 1.00 56.04  ? 798  HIS A C     1 
ATOM   5677  O  O     . HIS A 1  798  ? 153.823 105.951 124.864 1.00 56.79  ? 798  HIS A O     1 
ATOM   5678  C  CB    . HIS A 1  798  ? 152.029 107.483 127.044 1.00 57.13  ? 798  HIS A CB    1 
ATOM   5679  C  CG    . HIS A 1  798  ? 151.322 107.535 125.725 1.00 57.47  ? 798  HIS A CG    1 
ATOM   5680  N  ND1   . HIS A 1  798  ? 150.476 106.536 125.294 1.00 57.71  ? 798  HIS A ND1   1 
ATOM   5681  C  CD2   . HIS A 1  798  ? 151.335 108.466 124.742 1.00 57.29  ? 798  HIS A CD2   1 
ATOM   5682  C  CE1   . HIS A 1  798  ? 149.998 106.850 124.103 1.00 55.03  ? 798  HIS A CE1   1 
ATOM   5683  N  NE2   . HIS A 1  798  ? 150.505 108.017 123.746 1.00 55.25  ? 798  HIS A NE2   1 
ATOM   5684  N  N     . GLU A 1  799  ? 155.148 107.309 126.069 1.00 54.66  ? 799  GLU A N     1 
ATOM   5685  C  CA    . GLU A 1  799  ? 156.091 107.517 124.976 1.00 54.25  ? 799  GLU A CA    1 
ATOM   5686  C  C     . GLU A 1  799  ? 157.279 106.565 125.033 1.00 54.17  ? 799  GLU A C     1 
ATOM   5687  O  O     . GLU A 1  799  ? 157.735 106.087 123.990 1.00 54.19  ? 799  GLU A O     1 
ATOM   5688  C  CB    . GLU A 1  799  ? 156.585 108.967 124.977 1.00 54.22  ? 799  GLU A CB    1 
ATOM   5689  C  CG    . GLU A 1  799  ? 155.858 109.879 123.996 1.00 53.74  ? 799  GLU A CG    1 
ATOM   5690  C  CD    . GLU A 1  799  ? 154.405 110.113 124.366 1.00 54.78  ? 799  GLU A CD    1 
ATOM   5691  O  OE1   . GLU A 1  799  ? 154.042 109.904 125.541 1.00 53.53  ? 799  GLU A OE1   1 
ATOM   5692  O  OE2   . GLU A 1  799  ? 153.623 110.510 123.476 1.00 53.36  ? 799  GLU A OE2   1 
ATOM   5693  N  N     . VAL A 1  800  ? 157.794 106.276 126.230 1.00 53.10  ? 800  VAL A N     1 
ATOM   5694  C  CA    . VAL A 1  800  ? 158.962 105.406 126.325 1.00 53.27  ? 800  VAL A CA    1 
ATOM   5695  C  C     . VAL A 1  800  ? 158.573 103.938 126.184 1.00 52.75  ? 800  VAL A C     1 
ATOM   5696  O  O     . VAL A 1  800  ? 159.406 103.109 125.803 1.00 52.49  ? 800  VAL A O     1 
ATOM   5697  C  CB    . VAL A 1  800  ? 159.721 105.658 127.639 1.00 52.60  ? 800  VAL A CB    1 
ATOM   5698  C  CG1   . VAL A 1  800  ? 160.114 107.121 127.753 1.00 54.62  ? 800  VAL A CG1   1 
ATOM   5699  C  CG2   . VAL A 1  800  ? 158.883 105.229 128.834 1.00 54.38  ? 800  VAL A CG2   1 
ATOM   5700  N  N     . TYR A 1  801  ? 157.322 103.589 126.481 1.00 55.66  ? 801  TYR A N     1 
ATOM   5701  C  CA    . TYR A 1  801  ? 156.852 102.211 126.396 1.00 57.22  ? 801  TYR A CA    1 
ATOM   5702  C  C     . TYR A 1  801  ? 155.779 102.018 125.337 1.00 58.23  ? 801  TYR A C     1 
ATOM   5703  O  O     . TYR A 1  801  ? 155.858 101.076 124.542 1.00 59.11  ? 801  TYR A O     1 
ATOM   5704  C  CB    . TYR A 1  801  ? 156.322 101.747 127.761 1.00 59.39  ? 801  TYR A CB    1 
ATOM   5705  C  CG    . TYR A 1  801  ? 157.377 101.647 128.844 1.00 59.43  ? 801  TYR A CG    1 
ATOM   5706  C  CD1   . TYR A 1  801  ? 158.724 101.546 128.523 1.00 59.20  ? 801  TYR A CD1   1 
ATOM   5707  C  CD2   . TYR A 1  801  ? 157.021 101.650 130.187 1.00 59.06  ? 801  TYR A CD2   1 
ATOM   5708  C  CE1   . TYR A 1  801  ? 159.688 101.454 129.509 1.00 59.23  ? 801  TYR A CE1   1 
ATOM   5709  C  CE2   . TYR A 1  801  ? 157.979 101.557 131.179 1.00 59.41  ? 801  TYR A CE2   1 
ATOM   5710  C  CZ    . TYR A 1  801  ? 159.310 101.460 130.835 1.00 57.62  ? 801  TYR A CZ    1 
ATOM   5711  O  OH    . TYR A 1  801  ? 160.266 101.369 131.820 1.00 57.59  ? 801  TYR A OH    1 
ATOM   5712  N  N     . GLY A 1  802  ? 154.772 102.888 125.301 1.00 58.42  ? 802  GLY A N     1 
ATOM   5713  C  CA    . GLY A 1  802  ? 153.710 102.782 124.330 1.00 59.08  ? 802  GLY A CA    1 
ATOM   5714  C  C     . GLY A 1  802  ? 152.338 102.957 124.947 1.00 59.41  ? 802  GLY A C     1 
ATOM   5715  O  O     . GLY A 1  802  ? 152.186 103.027 126.172 1.00 60.05  ? 802  GLY A O     1 
ATOM   5716  N  N     . PRO A 1  803  ? 151.304 103.032 124.104 1.00 59.24  ? 803  PRO A N     1 
ATOM   5717  C  CA    . PRO A 1  803  ? 149.947 103.210 124.645 1.00 59.63  ? 803  PRO A CA    1 
ATOM   5718  C  C     . PRO A 1  803  ? 149.418 101.976 125.351 1.00 59.65  ? 803  PRO A C     1 
ATOM   5719  O  O     . PRO A 1  803  ? 148.740 102.101 126.379 1.00 59.44  ? 803  PRO A O     1 
ATOM   5720  C  CB    . PRO A 1  803  ? 149.121 103.557 123.398 1.00 59.15  ? 803  PRO A CB    1 
ATOM   5721  C  CG    . PRO A 1  803  ? 149.862 102.914 122.273 1.00 60.25  ? 803  PRO A CG    1 
ATOM   5722  C  CD    . PRO A 1  803  ? 151.321 103.005 122.631 1.00 61.07  ? 803  PRO A CD    1 
ATOM   5723  N  N     . GLU A 1  804  ? 149.703 100.782 124.825 1.00 59.72  ? 804  GLU A N     1 
ATOM   5724  C  CA    . GLU A 1  804  ? 149.245 99.557  125.473 1.00 59.41  ? 804  GLU A CA    1 
ATOM   5725  C  C     . GLU A 1  804  ? 149.895 99.389  126.840 1.00 60.28  ? 804  GLU A C     1 
ATOM   5726  O  O     . GLU A 1  804  ? 149.234 99.006  127.813 1.00 61.20  ? 804  GLU A O     1 
ATOM   5727  C  CB    . GLU A 1  804  ? 149.537 98.352  124.575 1.00 61.88  ? 804  GLU A CB    1 
ATOM   5728  C  CG    . GLU A 1  804  ? 148.992 97.025  125.094 1.00 62.22  ? 804  GLU A CG    1 
ATOM   5729  C  CD    . GLU A 1  804  ? 149.960 96.306  126.016 1.00 62.24  ? 804  GLU A CD    1 
ATOM   5730  O  OE1   . GLU A 1  804  ? 151.151 96.684  126.042 1.00 57.31  ? 804  GLU A OE1   1 
ATOM   5731  O  OE2   . GLU A 1  804  ? 149.530 95.366  126.715 1.00 57.05  ? 804  GLU A OE2   1 
ATOM   5732  N  N     . VAL A 1  805  ? 151.196 99.671  126.933 1.00 54.77  ? 805  VAL A N     1 
ATOM   5733  C  CA    . VAL A 1  805  ? 151.880 99.565  128.216 1.00 53.27  ? 805  VAL A CA    1 
ATOM   5734  C  C     . VAL A 1  805  ? 151.433 100.677 129.156 1.00 53.36  ? 805  VAL A C     1 
ATOM   5735  O  O     . VAL A 1  805  ? 151.386 100.484 130.377 1.00 53.72  ? 805  VAL A O     1 
ATOM   5736  C  CB    . VAL A 1  805  ? 153.406 99.578  128.009 1.00 53.32  ? 805  VAL A CB    1 
ATOM   5737  C  CG1   . VAL A 1  805  ? 154.125 99.225  129.304 1.00 52.62  ? 805  VAL A CG1   1 
ATOM   5738  C  CG2   . VAL A 1  805  ? 153.798 98.617  126.896 1.00 52.31  ? 805  VAL A CG2   1 
ATOM   5739  N  N     . ALA A 1  806  ? 151.089 101.847 128.614 1.00 52.59  ? 806  ALA A N     1 
ATOM   5740  C  CA    . ALA A 1  806  ? 150.590 102.933 129.452 1.00 52.63  ? 806  ALA A CA    1 
ATOM   5741  C  C     . ALA A 1  806  ? 149.250 102.569 130.076 1.00 52.32  ? 806  ALA A C     1 
ATOM   5742  O  O     . ALA A 1  806  ? 149.008 102.840 131.258 1.00 52.89  ? 806  ALA A O     1 
ATOM   5743  C  CB    . ALA A 1  806  ? 150.474 104.220 128.634 1.00 53.18  ? 806  ALA A CB    1 
ATOM   5744  N  N     . ALA A 1  807  ? 148.361 101.954 129.293 1.00 53.16  ? 807  ALA A N     1 
ATOM   5745  C  CA    . ALA A 1  807  ? 147.107 101.461 129.848 1.00 53.48  ? 807  ALA A CA    1 
ATOM   5746  C  C     . ALA A 1  807  ? 147.321 100.261 130.758 1.00 53.64  ? 807  ALA A C     1 
ATOM   5747  O  O     . ALA A 1  807  ? 146.473 99.985  131.613 1.00 53.34  ? 807  ALA A O     1 
ATOM   5748  C  CB    . ALA A 1  807  ? 146.138 101.099 128.721 1.00 53.50  ? 807  ALA A CB    1 
ATOM   5749  N  N     . LYS A 1  808  ? 148.436 99.546  130.595 1.00 52.73  ? 808  LYS A N     1 
ATOM   5750  C  CA    . LYS A 1  808  ? 148.729 98.404  131.454 1.00 52.47  ? 808  LYS A CA    1 
ATOM   5751  C  C     . LYS A 1  808  ? 149.278 98.853  132.803 1.00 53.50  ? 808  LYS A C     1 
ATOM   5752  O  O     . LYS A 1  808  ? 148.851 98.356  133.851 1.00 54.71  ? 808  LYS A O     1 
ATOM   5753  C  CB    . LYS A 1  808  ? 149.714 97.463  130.759 1.00 55.40  ? 808  LYS A CB    1 
ATOM   5754  C  CG    . LYS A 1  808  ? 149.926 96.142  131.480 1.00 55.35  ? 808  LYS A CG    1 
ATOM   5755  C  CD    . LYS A 1  808  ? 150.919 95.264  130.734 1.00 55.13  ? 808  LYS A CD    1 
ATOM   5756  C  CE    . LYS A 1  808  ? 151.041 93.895  131.381 1.00 51.82  ? 808  LYS A CE    1 
ATOM   5757  N  NZ    . LYS A 1  808  ? 149.754 93.146  131.341 1.00 51.37  ? 808  LYS A NZ    1 
ATOM   5758  N  N     . VAL A 1  809  ? 150.231 99.789  132.796 1.00 51.89  ? 809  VAL A N     1 
ATOM   5759  C  CA    . VAL A 1  809  ? 150.773 100.291 134.055 1.00 52.28  ? 809  VAL A CA    1 
ATOM   5760  C  C     . VAL A 1  809  ? 149.716 101.074 134.820 1.00 53.03  ? 809  VAL A C     1 
ATOM   5761  O  O     . VAL A 1  809  ? 149.734 101.105 136.056 1.00 53.37  ? 809  VAL A O     1 
ATOM   5762  C  CB    . VAL A 1  809  ? 152.037 101.137 133.806 1.00 53.46  ? 809  VAL A CB    1 
ATOM   5763  C  CG1   . VAL A 1  809  ? 153.103 100.306 133.110 1.00 52.51  ? 809  VAL A CG1   1 
ATOM   5764  C  CG2   . VAL A 1  809  ? 151.707 102.380 132.993 1.00 52.09  ? 809  VAL A CG2   1 
ATOM   5765  N  N     . LEU A 1  810  ? 148.784 101.716 134.114 1.00 51.32  ? 810  LEU A N     1 
ATOM   5766  C  CA    . LEU A 1  810  ? 147.660 102.375 134.765 1.00 50.54  ? 810  LEU A CA    1 
ATOM   5767  C  C     . LEU A 1  810  ? 146.552 101.403 135.140 1.00 49.97  ? 810  LEU A C     1 
ATOM   5768  O  O     . LEU A 1  810  ? 145.649 101.779 135.895 1.00 50.40  ? 810  LEU A O     1 
ATOM   5769  C  CB    . LEU A 1  810  ? 147.100 103.477 133.863 1.00 50.88  ? 810  LEU A CB    1 
ATOM   5770  C  CG    . LEU A 1  810  ? 147.530 104.901 134.220 1.00 50.59  ? 810  LEU A CG    1 
ATOM   5771  C  CD1   . LEU A 1  810  ? 146.798 105.377 135.462 1.00 50.22  ? 810  LEU A CD1   1 
ATOM   5772  C  CD2   . LEU A 1  810  ? 149.033 104.964 134.432 1.00 50.76  ? 810  LEU A CD2   1 
ATOM   5773  N  N     . SER A 1  811  ? 146.599 100.170 134.632 1.00 51.98  ? 811  SER A N     1 
ATOM   5774  C  CA    . SER A 1  811  ? 145.657 99.147  135.062 1.00 53.02  ? 811  SER A CA    1 
ATOM   5775  C  C     . SER A 1  811  ? 146.061 98.569  136.412 1.00 54.07  ? 811  SER A C     1 
ATOM   5776  O  O     . SER A 1  811  ? 145.228 98.434  137.314 1.00 54.63  ? 811  SER A O     1 
ATOM   5777  C  CB    . SER A 1  811  ? 145.565 98.043  134.010 1.00 52.73  ? 811  SER A CB    1 
ATOM   5778  O  OG    . SER A 1  811  ? 145.141 98.563  132.762 1.00 53.15  ? 811  SER A OG    1 
ATOM   5779  N  N     . VAL A 1  812  ? 147.342 98.225  136.566 1.00 51.99  ? 812  VAL A N     1 
ATOM   5780  C  CA    . VAL A 1  812  ? 147.829 97.764  137.860 1.00 51.67  ? 812  VAL A CA    1 
ATOM   5781  C  C     . VAL A 1  812  ? 147.871 98.918  138.855 1.00 52.49  ? 812  VAL A C     1 
ATOM   5782  O  O     . VAL A 1  812  ? 147.738 98.707  140.066 1.00 53.23  ? 812  VAL A O     1 
ATOM   5783  C  CB    . VAL A 1  812  ? 149.206 97.091  137.709 1.00 52.77  ? 812  VAL A CB    1 
ATOM   5784  C  CG1   . VAL A 1  812  ? 149.099 95.862  136.822 1.00 51.40  ? 812  VAL A CG1   1 
ATOM   5785  C  CG2   . VAL A 1  812  ? 150.223 98.070  137.141 1.00 51.44  ? 812  VAL A CG2   1 
ATOM   5786  N  N     . LEU A 1  813  ? 148.049 100.148 138.367 1.00 51.67  ? 813  LEU A N     1 
ATOM   5787  C  CA    . LEU A 1  813  ? 147.961 101.311 139.245 1.00 51.84  ? 813  LEU A CA    1 
ATOM   5788  C  C     . LEU A 1  813  ? 146.516 101.574 139.648 1.00 52.41  ? 813  LEU A C     1 
ATOM   5789  O  O     . LEU A 1  813  ? 146.240 101.931 140.799 1.00 52.82  ? 813  LEU A O     1 
ATOM   5790  C  CB    . LEU A 1  813  ? 148.568 102.533 138.554 1.00 52.69  ? 813  LEU A CB    1 
ATOM   5791  C  CG    . LEU A 1  813  ? 148.953 103.765 139.381 1.00 53.33  ? 813  LEU A CG    1 
ATOM   5792  C  CD1   . LEU A 1  813  ? 147.762 104.686 139.616 1.00 51.00  ? 813  LEU A CD1   1 
ATOM   5793  C  CD2   . LEU A 1  813  ? 149.585 103.345 140.701 1.00 50.98  ? 813  LEU A CD2   1 
ATOM   5794  N  N     . GLY A 1  814  ? 145.582 101.412 138.707 1.00 50.05  ? 814  GLY A N     1 
ATOM   5795  C  CA    . GLY A 1  814  ? 144.174 101.510 139.051 1.00 49.33  ? 814  GLY A CA    1 
ATOM   5796  C  C     . GLY A 1  814  ? 143.750 100.464 140.063 1.00 49.06  ? 814  GLY A C     1 
ATOM   5797  O  O     . GLY A 1  814  ? 142.973 100.747 140.978 1.00 48.55  ? 814  GLY A O     1 
ATOM   5798  N  N     . ARG A 1  815  ? 144.251 99.239  139.913 1.00 49.50  ? 815  ARG A N     1 
ATOM   5799  C  CA    . ARG A 1  815  ? 143.954 98.167  140.853 1.00 49.69  ? 815  ARG A CA    1 
ATOM   5800  C  C     . ARG A 1  815  ? 144.819 98.220  142.105 1.00 50.25  ? 815  ARG A C     1 
ATOM   5801  O  O     . ARG A 1  815  ? 144.621 97.399  143.007 1.00 50.71  ? 815  ARG A O     1 
ATOM   5802  C  CB    . ARG A 1  815  ? 144.120 96.807  140.171 1.00 50.68  ? 815  ARG A CB    1 
ATOM   5803  C  CG    . ARG A 1  815  ? 143.183 96.585  138.996 1.00 50.18  ? 815  ARG A CG    1 
ATOM   5804  C  CD    . ARG A 1  815  ? 143.330 95.184  138.429 1.00 50.04  ? 815  ARG A CD    1 
ATOM   5805  N  NE    . ARG A 1  815  ? 144.689 94.909  137.976 1.00 49.65  ? 815  ARG A NE    1 
ATOM   5806  C  CZ    . ARG A 1  815  ? 145.078 93.754  137.445 1.00 50.55  ? 815  ARG A CZ    1 
ATOM   5807  N  NH1   . ARG A 1  815  ? 144.209 92.762  137.300 1.00 49.08  ? 815  ARG A NH1   1 
ATOM   5808  N  NH2   . ARG A 1  815  ? 146.336 93.590  137.061 1.00 49.16  ? 815  ARG A NH2   1 
ATOM   5809  N  N     . LEU A 1  816  ? 145.763 99.160  142.186 1.00 48.21  ? 816  LEU A N     1 
ATOM   5810  C  CA    . LEU A 1  816  ? 146.633 99.241  143.355 1.00 47.26  ? 816  LEU A CA    1 
ATOM   5811  C  C     . LEU A 1  816  ? 145.890 99.824  144.549 1.00 47.55  ? 816  LEU A C     1 
ATOM   5812  O  O     . LEU A 1  816  ? 145.839 99.216  145.624 1.00 47.77  ? 816  LEU A O     1 
ATOM   5813  C  CB    . LEU A 1  816  ? 147.876 100.074 143.022 1.00 47.86  ? 816  LEU A CB    1 
ATOM   5814  C  CG    . LEU A 1  816  ? 149.094 100.016 143.954 1.00 47.70  ? 816  LEU A CG    1 
ATOM   5815  C  CD1   . LEU A 1  816  ? 148.950 100.944 145.157 1.00 46.87  ? 816  LEU A CD1   1 
ATOM   5816  C  CD2   . LEU A 1  816  ? 149.354 98.586  144.410 1.00 46.66  ? 816  LEU A CD2   1 
ATOM   5817  N  N     . PHE A 1  817  ? 145.303 101.007 144.379 1.00 46.19  ? 817  PHE A N     1 
ATOM   5818  C  CA    . PHE A 1  817  ? 144.678 101.712 145.489 1.00 45.96  ? 817  PHE A CA    1 
ATOM   5819  C  C     . PHE A 1  817  ? 143.286 101.195 145.826 1.00 45.98  ? 817  PHE A C     1 
ATOM   5820  O  O     . PHE A 1  817  ? 142.684 101.689 146.784 1.00 45.83  ? 817  PHE A O     1 
ATOM   5821  C  CB    . PHE A 1  817  ? 144.622 103.210 145.191 1.00 46.04  ? 817  PHE A CB    1 
ATOM   5822  C  CG    . PHE A 1  817  ? 145.945 103.795 144.796 1.00 46.23  ? 817  PHE A CG    1 
ATOM   5823  C  CD1   . PHE A 1  817  ? 146.956 103.947 145.730 1.00 46.03  ? 817  PHE A CD1   1 
ATOM   5824  C  CD2   . PHE A 1  817  ? 146.181 104.191 143.490 1.00 45.67  ? 817  PHE A CD2   1 
ATOM   5825  C  CE1   . PHE A 1  817  ? 148.178 104.482 145.369 1.00 45.71  ? 817  PHE A CE1   1 
ATOM   5826  C  CE2   . PHE A 1  817  ? 147.400 104.730 143.125 1.00 45.26  ? 817  PHE A CE2   1 
ATOM   5827  C  CZ    . PHE A 1  817  ? 148.399 104.874 144.065 1.00 44.85  ? 817  PHE A CZ    1 
ATOM   5828  N  N     . THR A 1  818  ? 142.755 100.228 145.075 1.00 44.76  ? 818  THR A N     1 
ATOM   5829  C  CA    . THR A 1  818  ? 141.516 99.585  145.498 1.00 44.60  ? 818  THR A CA    1 
ATOM   5830  C  C     . THR A 1  818  ? 141.787 98.431  146.454 1.00 44.59  ? 818  THR A C     1 
ATOM   5831  O  O     . THR A 1  818  ? 140.957 98.142  147.323 1.00 44.14  ? 818  THR A O     1 
ATOM   5832  C  CB    . THR A 1  818  ? 140.712 99.101  144.288 1.00 45.15  ? 818  THR A CB    1 
ATOM   5833  O  OG1   . THR A 1  818  ? 139.494 98.491  144.735 1.00 44.78  ? 818  THR A OG1   1 
ATOM   5834  C  CG2   . THR A 1  818  ? 141.503 98.092  143.475 1.00 45.42  ? 818  THR A CG2   1 
ATOM   5835  N  N     . ASN A 1  819  ? 142.936 97.765  146.312 1.00 44.48  ? 819  ASN A N     1 
ATOM   5836  C  CA    . ASN A 1  819  ? 143.373 96.824  147.337 1.00 43.84  ? 819  ASN A CA    1 
ATOM   5837  C  C     . ASN A 1  819  ? 143.932 97.565  148.543 1.00 43.41  ? 819  ASN A C     1 
ATOM   5838  O  O     . ASN A 1  819  ? 143.888 97.059  149.671 1.00 43.10  ? 819  ASN A O     1 
ATOM   5839  C  CB    . ASN A 1  819  ? 144.413 95.863  146.764 1.00 42.85  ? 819  ASN A CB    1 
ATOM   5840  C  CG    . ASN A 1  819  ? 143.861 95.010  145.639 1.00 43.37  ? 819  ASN A CG    1 
ATOM   5841  O  OD1   . ASN A 1  819  ? 142.678 94.670  145.625 1.00 44.13  ? 819  ASN A OD1   1 
ATOM   5842  N  ND2   . ASN A 1  819  ? 144.718 94.660  144.687 1.00 44.27  ? 819  ASN A ND2   1 
ATOM   5843  N  N     . TYR A 1  820  ? 144.468 98.767  148.322 1.00 44.62  ? 820  TYR A N     1 
ATOM   5844  C  CA    . TYR A 1  820  ? 144.896 99.602  149.438 1.00 44.76  ? 820  TYR A CA    1 
ATOM   5845  C  C     . TYR A 1  820  ? 143.697 100.157 150.195 1.00 44.42  ? 820  TYR A C     1 
ATOM   5846  O  O     . TYR A 1  820  ? 143.724 100.260 151.427 1.00 43.62  ? 820  TYR A O     1 
ATOM   5847  C  CB    . TYR A 1  820  ? 145.789 100.737 148.933 1.00 43.28  ? 820  TYR A CB    1 
ATOM   5848  C  CG    . TYR A 1  820  ? 146.183 101.736 149.998 1.00 43.23  ? 820  TYR A CG    1 
ATOM   5849  C  CD1   . TYR A 1  820  ? 147.176 101.441 150.923 1.00 43.23  ? 820  TYR A CD1   1 
ATOM   5850  C  CD2   . TYR A 1  820  ? 145.566 102.979 150.073 1.00 43.31  ? 820  TYR A CD2   1 
ATOM   5851  C  CE1   . TYR A 1  820  ? 147.539 102.352 151.897 1.00 43.44  ? 820  TYR A CE1   1 
ATOM   5852  C  CE2   . TYR A 1  820  ? 145.924 103.897 151.043 1.00 43.44  ? 820  TYR A CE2   1 
ATOM   5853  C  CZ    . TYR A 1  820  ? 146.911 103.578 151.952 1.00 45.40  ? 820  TYR A CZ    1 
ATOM   5854  O  OH    . TYR A 1  820  ? 147.270 104.489 152.919 1.00 45.45  ? 820  TYR A OH    1 
ATOM   5855  N  N     . ILE A 1  821  ? 142.631 100.514 149.474 1.00 46.92  ? 821  ILE A N     1 
ATOM   5856  C  CA    . ILE A 1  821  ? 141.448 101.067 150.123 1.00 48.84  ? 821  ILE A CA    1 
ATOM   5857  C  C     . ILE A 1  821  ? 140.606 99.987  150.792 1.00 49.97  ? 821  ILE A C     1 
ATOM   5858  O  O     . ILE A 1  821  ? 139.779 100.306 151.655 1.00 50.32  ? 821  ILE A O     1 
ATOM   5859  C  CB    . ILE A 1  821  ? 140.596 101.862 149.117 1.00 50.42  ? 821  ILE A CB    1 
ATOM   5860  C  CG1   . ILE A 1  821  ? 139.877 103.015 149.818 1.00 50.71  ? 821  ILE A CG1   1 
ATOM   5861  C  CG2   . ILE A 1  821  ? 139.596 100.957 148.410 1.00 49.59  ? 821  ILE A CG2   1 
ATOM   5862  C  CD1   . ILE A 1  821  ? 140.812 104.066 150.370 1.00 49.36  ? 821  ILE A CD1   1 
ATOM   5863  N  N     . THR A 1  822  ? 140.793 98.719  150.423 1.00 51.10  ? 822  THR A N     1 
ATOM   5864  C  CA    . THR A 1  822  ? 140.097 97.624  151.086 1.00 52.28  ? 822  THR A CA    1 
ATOM   5865  C  C     . THR A 1  822  ? 140.875 97.069  152.272 1.00 53.13  ? 822  THR A C     1 
ATOM   5866  O  O     . THR A 1  822  ? 140.320 96.281  153.044 1.00 52.83  ? 822  THR A O     1 
ATOM   5867  C  CB    . THR A 1  822  ? 139.797 96.494  150.092 1.00 53.36  ? 822  THR A CB    1 
ATOM   5868  O  OG1   . THR A 1  822  ? 138.729 95.683  150.598 1.00 52.11  ? 822  THR A OG1   1 
ATOM   5869  C  CG2   . THR A 1  822  ? 141.024 95.622  149.883 1.00 52.60  ? 822  THR A CG2   1 
ATOM   5870  N  N     . ALA A 1  823  ? 142.140 97.456  152.430 1.00 51.16  ? 823  ALA A N     1 
ATOM   5871  C  CA    . ALA A 1  823  ? 142.905 97.144  153.631 1.00 50.20  ? 823  ALA A CA    1 
ATOM   5872  C  C     . ALA A 1  823  ? 142.793 98.265  154.658 1.00 50.73  ? 823  ALA A C     1 
ATOM   5873  O  O     . ALA A 1  823  ? 142.418 98.025  155.809 1.00 48.69  ? 823  ALA A O     1 
ATOM   5874  C  CB    . ALA A 1  823  ? 144.371 96.887  153.273 1.00 48.20  ? 823  ALA A CB    1 
ATOM   5875  N  N     . THR A 1  824  ? 143.115 99.491  154.252 1.00 47.72  ? 824  THR A N     1 
ATOM   5876  C  CA    . THR A 1  824  ? 142.891 100.685 155.060 1.00 47.00  ? 824  THR A CA    1 
ATOM   5877  C  C     . THR A 1  824  ? 142.184 101.716 154.193 1.00 48.00  ? 824  THR A C     1 
ATOM   5878  O  O     . THR A 1  824  ? 142.717 102.139 153.161 1.00 47.98  ? 824  THR A O     1 
ATOM   5879  C  CB    . THR A 1  824  ? 144.205 101.235 155.629 1.00 48.70  ? 824  THR A CB    1 
ATOM   5880  O  OG1   . THR A 1  824  ? 143.979 102.524 156.215 1.00 45.84  ? 824  THR A OG1   1 
ATOM   5881  C  CG2   . THR A 1  824  ? 145.290 101.327 154.556 1.00 45.96  ? 824  THR A CG2   1 
ATOM   5882  N  N     . ALA A 1  825  ? 140.981 102.111 154.601 1.00 45.08  ? 825  ALA A N     1 
ATOM   5883  C  CA    . ALA A 1  825  ? 140.123 102.918 153.751 1.00 44.78  ? 825  ALA A CA    1 
ATOM   5884  C  C     . ALA A 1  825  ? 140.284 104.407 154.058 1.00 45.55  ? 825  ALA A C     1 
ATOM   5885  O  O     . ALA A 1  825  ? 141.007 104.813 154.969 1.00 43.53  ? 825  ALA A O     1 
ATOM   5886  C  CB    . ALA A 1  825  ? 138.668 102.477 153.901 1.00 43.07  ? 825  ALA A CB    1 
ATOM   5887  N  N     . PHE A 1  826  ? 139.591 105.230 153.273 1.00 42.77  ? 826  PHE A N     1 
ATOM   5888  C  CA    . PHE A 1  826  ? 139.625 106.680 153.392 1.00 42.48  ? 826  PHE A CA    1 
ATOM   5889  C  C     . PHE A 1  826  ? 138.223 107.181 153.703 1.00 42.94  ? 826  PHE A C     1 
ATOM   5890  O  O     . PHE A 1  826  ? 137.239 106.656 153.174 1.00 43.20  ? 826  PHE A O     1 
ATOM   5891  C  CB    . PHE A 1  826  ? 140.155 107.324 152.103 1.00 43.44  ? 826  PHE A CB    1 
ATOM   5892  C  CG    . PHE A 1  826  ? 140.196 108.824 152.141 1.00 43.41  ? 826  PHE A CG    1 
ATOM   5893  C  CD1   . PHE A 1  826  ? 141.267 109.487 152.717 1.00 43.17  ? 826  PHE A CD1   1 
ATOM   5894  C  CD2   . PHE A 1  826  ? 139.172 109.574 151.584 1.00 43.35  ? 826  PHE A CD2   1 
ATOM   5895  C  CE1   . PHE A 1  826  ? 141.310 110.868 152.748 1.00 42.02  ? 826  PHE A CE1   1 
ATOM   5896  C  CE2   . PHE A 1  826  ? 139.209 110.954 151.611 1.00 43.23  ? 826  PHE A CE2   1 
ATOM   5897  C  CZ    . PHE A 1  826  ? 140.280 111.602 152.193 1.00 42.01  ? 826  PHE A CZ    1 
ATOM   5898  N  N     . THR A 1  827  ? 138.132 108.196 154.559 1.00 41.66  ? 827  THR A N     1 
ATOM   5899  C  CA    . THR A 1  827  ? 136.837 108.663 155.029 1.00 41.48  ? 827  THR A CA    1 
ATOM   5900  C  C     . THR A 1  827  ? 136.924 110.119 155.458 1.00 42.11  ? 827  THR A C     1 
ATOM   5901  O  O     . THR A 1  827  ? 137.955 110.579 155.954 1.00 42.05  ? 827  THR A O     1 
ATOM   5902  C  CB    . THR A 1  827  ? 136.334 107.816 156.203 1.00 42.70  ? 827  THR A CB    1 
ATOM   5903  O  OG1   . THR A 1  827  ? 135.150 108.409 156.751 1.00 40.67  ? 827  THR A OG1   1 
ATOM   5904  C  CG2   . THR A 1  827  ? 137.404 107.728 157.280 1.00 40.45  ? 827  THR A CG2   1 
ATOM   5905  N  N     . CYS A 1  828  ? 135.820 110.836 155.264 1.00 40.43  ? 828  CYS A N     1 
ATOM   5906  C  CA    . CYS A 1  828  ? 135.658 112.185 155.783 1.00 40.60  ? 828  CYS A CA    1 
ATOM   5907  C  C     . CYS A 1  828  ? 134.972 112.109 157.148 1.00 40.46  ? 828  CYS A C     1 
ATOM   5908  O  O     . CYS A 1  828  ? 134.851 111.038 157.747 1.00 40.07  ? 828  CYS A O     1 
ATOM   5909  C  CB    . CYS A 1  828  ? 134.881 113.046 154.792 1.00 41.46  ? 828  CYS A CB    1 
ATOM   5910  S  SG    . CYS A 1  828  ? 134.661 114.766 155.308 1.00 41.68  ? 828  CYS A SG    1 
ATOM   5911  N  N     . GLY A 1  829  ? 134.517 113.247 157.656 1.00 42.62  ? 829  GLY A N     1 
ATOM   5912  C  CA    . GLY A 1  829  ? 133.840 113.262 158.938 1.00 43.54  ? 829  GLY A CA    1 
ATOM   5913  C  C     . GLY A 1  829  ? 133.506 114.675 159.354 1.00 44.10  ? 829  GLY A C     1 
ATOM   5914  O  O     . GLY A 1  829  ? 133.893 115.653 158.708 1.00 43.96  ? 829  GLY A O     1 
ATOM   5915  N  N     . MET A 1  830  ? 132.765 114.764 160.461 1.00 45.28  ? 830  MET A N     1 
ATOM   5916  C  CA    . MET A 1  830  ? 132.376 116.069 160.986 1.00 46.33  ? 830  MET A CA    1 
ATOM   5917  C  C     . MET A 1  830  ? 133.580 116.840 161.513 1.00 46.82  ? 830  MET A C     1 
ATOM   5918  O  O     . MET A 1  830  ? 133.537 118.073 161.602 1.00 46.56  ? 830  MET A O     1 
ATOM   5919  C  CB    . MET A 1  830  ? 131.323 115.901 162.083 1.00 45.77  ? 830  MET A CB    1 
ATOM   5920  C  CG    . MET A 1  830  ? 130.607 117.188 162.463 1.00 45.84  ? 830  MET A CG    1 
ATOM   5921  S  SD    . MET A 1  830  ? 129.734 117.927 161.068 1.00 46.87  ? 830  MET A SD    1 
ATOM   5922  C  CE    . MET A 1  830  ? 129.049 119.394 161.832 1.00 46.99  ? 830  MET A CE    1 
ATOM   5923  N  N     . ASP A 1  831  ? 134.660 116.136 161.864 1.00 47.99  ? 831  ASP A N     1 
ATOM   5924  C  CA    . ASP A 1  831  ? 135.885 116.804 162.288 1.00 49.08  ? 831  ASP A CA    1 
ATOM   5925  C  C     . ASP A 1  831  ? 136.486 117.659 161.179 1.00 49.86  ? 831  ASP A C     1 
ATOM   5926  O  O     . ASP A 1  831  ? 137.304 118.540 161.465 1.00 49.98  ? 831  ASP A O     1 
ATOM   5927  C  CB    . ASP A 1  831  ? 136.906 115.770 162.764 1.00 49.75  ? 831  ASP A CB    1 
ATOM   5928  C  CG    . ASP A 1  831  ? 137.196 114.713 161.717 1.00 50.13  ? 831  ASP A CG    1 
ATOM   5929  O  OD1   . ASP A 1  831  ? 136.321 114.467 160.861 1.00 49.30  ? 831  ASP A OD1   1 
ATOM   5930  O  OD2   . ASP A 1  831  ? 138.298 114.125 161.752 1.00 49.19  ? 831  ASP A OD2   1 
ATOM   5931  N  N     . ASP A 1  832  ? 136.104 117.409 159.923 1.00 50.23  ? 832  ASP A N     1 
ATOM   5932  C  CA    . ASP A 1  832  ? 136.537 118.267 158.825 1.00 51.44  ? 832  ASP A CA    1 
ATOM   5933  C  C     . ASP A 1  832  ? 136.054 119.699 159.018 1.00 52.46  ? 832  ASP A C     1 
ATOM   5934  O  O     . ASP A 1  832  ? 136.809 120.653 158.801 1.00 52.82  ? 832  ASP A O     1 
ATOM   5935  C  CB    . ASP A 1  832  ? 136.029 117.701 157.499 1.00 53.14  ? 832  ASP A CB    1 
ATOM   5936  C  CG    . ASP A 1  832  ? 136.036 118.727 156.382 1.00 52.97  ? 832  ASP A CG    1 
ATOM   5937  O  OD1   . ASP A 1  832  ? 137.046 119.442 156.225 1.00 51.87  ? 832  ASP A OD1   1 
ATOM   5938  O  OD2   . ASP A 1  832  ? 135.023 118.819 155.654 1.00 51.57  ? 832  ASP A OD2   1 
ATOM   5939  N  N     . LEU A 1  833  ? 134.798 119.868 159.433 1.00 53.39  ? 833  LEU A N     1 
ATOM   5940  C  CA    . LEU A 1  833  ? 134.208 121.194 159.563 1.00 54.65  ? 833  LEU A CA    1 
ATOM   5941  C  C     . LEU A 1  833  ? 134.568 121.887 160.871 1.00 55.98  ? 833  LEU A C     1 
ATOM   5942  O  O     . LEU A 1  833  ? 134.373 123.101 160.979 1.00 56.71  ? 833  LEU A O     1 
ATOM   5943  C  CB    . LEU A 1  833  ? 132.682 121.106 159.440 1.00 56.95  ? 833  LEU A CB    1 
ATOM   5944  C  CG    . LEU A 1  833  ? 132.075 120.820 158.061 1.00 56.98  ? 833  LEU A CG    1 
ATOM   5945  C  CD1   . LEU A 1  833  ? 132.723 121.690 156.993 1.00 54.56  ? 833  LEU A CD1   1 
ATOM   5946  C  CD2   . LEU A 1  833  ? 132.156 119.343 157.691 1.00 53.84  ? 833  LEU A CD2   1 
ATOM   5947  N  N     . ARG A 1  834  ? 135.085 121.158 161.855 1.00 55.44  ? 834  ARG A N     1 
ATOM   5948  C  CA    . ARG A 1  834  ? 135.415 121.753 163.143 1.00 56.22  ? 834  ARG A CA    1 
ATOM   5949  C  C     . ARG A 1  834  ? 136.699 122.566 163.055 1.00 56.05  ? 834  ARG A C     1 
ATOM   5950  O  O     . ARG A 1  834  ? 137.684 122.141 162.443 1.00 55.72  ? 834  ARG A O     1 
ATOM   5951  C  CB    . ARG A 1  834  ? 135.557 120.671 164.213 1.00 55.25  ? 834  ARG A CB    1 
ATOM   5952  C  CG    . ARG A 1  834  ? 134.242 120.038 164.631 1.00 55.26  ? 834  ARG A CG    1 
ATOM   5953  C  CD    . ARG A 1  834  ? 134.440 119.059 165.776 1.00 55.02  ? 834  ARG A CD    1 
ATOM   5954  N  NE    . ARG A 1  834  ? 133.168 118.551 166.281 1.00 55.05  ? 834  ARG A NE    1 
ATOM   5955  C  CZ    . ARG A 1  834  ? 132.548 117.479 165.798 1.00 54.64  ? 834  ARG A CZ    1 
ATOM   5956  N  NH1   . ARG A 1  834  ? 131.392 117.090 166.319 1.00 57.07  ? 834  ARG A NH1   1 
ATOM   5957  N  NH2   . ARG A 1  834  ? 133.083 116.799 164.795 1.00 57.20  ? 834  ARG A NH2   1 
ATOM   5958  N  N     . LEU A 1  835  ? 136.680 123.745 163.671 1.00 57.97  ? 835  LEU A N     1 
ATOM   5959  C  CA    . LEU A 1  835  ? 137.842 124.617 163.744 1.00 58.07  ? 835  LEU A CA    1 
ATOM   5960  C  C     . LEU A 1  835  ? 138.070 125.026 165.193 1.00 57.68  ? 835  LEU A C     1 
ATOM   5961  O  O     . LEU A 1  835  ? 137.180 124.917 166.041 1.00 57.59  ? 835  LEU A O     1 
ATOM   5962  C  CB    . LEU A 1  835  ? 137.682 125.862 162.855 1.00 57.42  ? 835  LEU A CB    1 
ATOM   5963  C  CG    . LEU A 1  835  ? 136.760 127.004 163.296 1.00 57.55  ? 835  LEU A CG    1 
ATOM   5964  C  CD1   . LEU A 1  835  ? 136.978 128.214 162.402 1.00 59.63  ? 835  LEU A CD1   1 
ATOM   5965  C  CD2   . LEU A 1  835  ? 135.294 126.593 163.281 1.00 58.61  ? 835  LEU A CD2   1 
ATOM   5966  N  N     . THR A 1  836  ? 139.282 125.501 165.470 1.00 58.15  ? 836  THR A N     1 
ATOM   5967  C  CA    . THR A 1  836  ? 139.659 125.846 166.833 1.00 58.10  ? 836  THR A CA    1 
ATOM   5968  C  C     . THR A 1  836  ? 138.983 127.137 167.280 1.00 57.73  ? 836  THR A C     1 
ATOM   5969  O  O     . THR A 1  836  ? 138.696 128.029 166.477 1.00 57.90  ? 836  THR A O     1 
ATOM   5970  C  CB    . THR A 1  836  ? 141.176 125.995 166.950 1.00 57.52  ? 836  THR A CB    1 
ATOM   5971  O  OG1   . THR A 1  836  ? 141.649 126.902 165.946 1.00 59.05  ? 836  THR A OG1   1 
ATOM   5972  C  CG2   . THR A 1  836  ? 141.862 124.649 166.780 1.00 58.75  ? 836  THR A CG2   1 
ATOM   5973  N  N     . ALA A 1  837  ? 138.728 127.228 168.589 1.00 60.46  ? 837  ALA A N     1 
ATOM   5974  C  CA    . ALA A 1  837  ? 138.202 128.460 169.164 1.00 61.20  ? 837  ALA A CA    1 
ATOM   5975  C  C     . ALA A 1  837  ? 139.189 129.612 169.041 1.00 61.75  ? 837  ALA A C     1 
ATOM   5976  O  O     . ALA A 1  837  ? 138.779 130.776 169.094 1.00 60.48  ? 837  ALA A O     1 
ATOM   5977  C  CB    . ALA A 1  837  ? 137.831 128.241 170.632 1.00 60.05  ? 837  ALA A CB    1 
ATOM   5978  N  N     . GLU A 1  838  ? 140.481 129.314 168.896 1.00 59.93  ? 838  GLU A N     1 
ATOM   5979  C  CA    . GLU A 1  838  ? 141.465 130.342 168.590 1.00 59.35  ? 838  GLU A CA    1 
ATOM   5980  C  C     . GLU A 1  838  ? 141.482 130.688 167.107 1.00 59.74  ? 838  GLU A C     1 
ATOM   5981  O  O     . GLU A 1  838  ? 141.964 131.765 166.737 1.00 59.53  ? 838  GLU A O     1 
ATOM   5982  C  CB    . GLU A 1  838  ? 142.854 129.884 169.048 1.00 59.00  ? 838  GLU A CB    1 
ATOM   5983  C  CG    . GLU A 1  838  ? 143.897 130.988 169.144 1.00 58.27  ? 838  GLU A CG    1 
ATOM   5984  C  CD    . GLU A 1  838  ? 144.700 131.151 167.868 1.00 58.80  ? 838  GLU A CD    1 
ATOM   5985  O  OE1   . GLU A 1  838  ? 144.565 130.300 166.964 1.00 58.17  ? 838  GLU A OE1   1 
ATOM   5986  O  OE2   . GLU A 1  838  ? 145.467 132.133 167.770 1.00 58.13  ? 838  GLU A OE2   1 
ATOM   5987  N  N     . GLY A 1  839  ? 140.950 129.811 166.257 1.00 57.17  ? 839  GLY A N     1 
ATOM   5988  C  CA    . GLY A 1  839  ? 140.913 130.047 164.828 1.00 57.04  ? 839  GLY A CA    1 
ATOM   5989  C  C     . GLY A 1  839  ? 139.759 130.925 164.393 1.00 57.14  ? 839  GLY A C     1 
ATOM   5990  O  O     . GLY A 1  839  ? 139.953 131.881 163.636 1.00 57.13  ? 839  GLY A O     1 
ATOM   5991  N  N     . ASN A 1  840  ? 138.547 130.611 164.858 1.00 57.33  ? 840  ASN A N     1 
ATOM   5992  C  CA    . ASN A 1  840  ? 137.381 131.414 164.507 1.00 57.72  ? 840  ASN A CA    1 
ATOM   5993  C  C     . ASN A 1  840  ? 137.412 132.807 165.126 1.00 58.17  ? 840  ASN A C     1 
ATOM   5994  O  O     . ASN A 1  840  ? 136.531 133.617 164.822 1.00 58.55  ? 840  ASN A O     1 
ATOM   5995  C  CB    . ASN A 1  840  ? 136.093 130.690 164.912 1.00 58.65  ? 840  ASN A CB    1 
ATOM   5996  C  CG    . ASN A 1  840  ? 136.084 130.267 166.369 1.00 58.89  ? 840  ASN A CG    1 
ATOM   5997  O  OD1   . ASN A 1  840  ? 136.811 130.818 167.195 1.00 57.86  ? 840  ASN A OD1   1 
ATOM   5998  N  ND2   . ASN A 1  840  ? 135.255 129.281 166.692 1.00 57.48  ? 840  ASN A ND2   1 
ATOM   5999  N  N     . LYS A 1  841  ? 138.389 133.098 165.988 1.00 58.57  ? 841  LYS A N     1 
ATOM   6000  C  CA    . LYS A 1  841  ? 138.523 134.449 166.524 1.00 59.45  ? 841  LYS A CA    1 
ATOM   6001  C  C     . LYS A 1  841  ? 138.812 135.447 165.411 1.00 60.03  ? 841  LYS A C     1 
ATOM   6002  O  O     . LYS A 1  841  ? 138.290 136.568 165.421 1.00 60.69  ? 841  LYS A O     1 
ATOM   6003  C  CB    . LYS A 1  841  ? 139.622 134.484 167.588 1.00 60.91  ? 841  LYS A CB    1 
ATOM   6004  C  CG    . LYS A 1  841  ? 139.706 135.788 168.374 1.00 60.91  ? 841  LYS A CG    1 
ATOM   6005  C  CD    . LYS A 1  841  ? 140.752 136.733 167.797 1.00 60.88  ? 841  LYS A CD    1 
ATOM   6006  C  CE    . LYS A 1  841  ? 142.134 136.103 167.810 1.00 59.26  ? 841  LYS A CE    1 
ATOM   6007  N  NZ    . LYS A 1  841  ? 143.166 137.014 167.244 1.00 59.94  ? 841  LYS A NZ    1 
ATOM   6008  N  N     . TRP A 1  842  ? 139.643 135.059 164.440 1.00 58.32  ? 842  TRP A N     1 
ATOM   6009  C  CA    . TRP A 1  842  ? 139.855 135.910 163.275 1.00 57.66  ? 842  TRP A CA    1 
ATOM   6010  C  C     . TRP A 1  842  ? 138.621 135.950 162.388 1.00 58.26  ? 842  TRP A C     1 
ATOM   6011  O  O     . TRP A 1  842  ? 138.374 136.958 161.716 1.00 58.68  ? 842  TRP A O     1 
ATOM   6012  C  CB    . TRP A 1  842  ? 141.067 135.428 162.476 1.00 58.92  ? 842  TRP A CB    1 
ATOM   6013  C  CG    . TRP A 1  842  ? 142.339 135.407 163.264 1.00 59.57  ? 842  TRP A CG    1 
ATOM   6014  C  CD1   . TRP A 1  842  ? 143.016 136.483 163.758 1.00 59.72  ? 842  TRP A CD1   1 
ATOM   6015  C  CD2   . TRP A 1  842  ? 143.097 134.250 163.638 1.00 59.01  ? 842  TRP A CD2   1 
ATOM   6016  N  NE1   . TRP A 1  842  ? 144.144 136.068 164.423 1.00 58.43  ? 842  TRP A NE1   1 
ATOM   6017  C  CE2   . TRP A 1  842  ? 144.216 134.701 164.362 1.00 58.18  ? 842  TRP A CE2   1 
ATOM   6018  C  CE3   . TRP A 1  842  ? 142.935 132.877 163.432 1.00 58.70  ? 842  TRP A CE3   1 
ATOM   6019  C  CZ2   . TRP A 1  842  ? 145.171 133.829 164.883 1.00 59.67  ? 842  TRP A CZ2   1 
ATOM   6020  C  CZ3   . TRP A 1  842  ? 143.882 132.012 163.949 1.00 56.68  ? 842  TRP A CZ3   1 
ATOM   6021  C  CH2   . TRP A 1  842  ? 144.986 132.491 164.666 1.00 55.78  ? 842  TRP A CH2   1 
ATOM   6022  N  N     . ARG A 1  843  ? 137.837 134.870 162.368 1.00 56.30  ? 843  ARG A N     1 
ATOM   6023  C  CA    . ARG A 1  843  ? 136.586 134.876 161.617 1.00 56.30  ? 843  ARG A CA    1 
ATOM   6024  C  C     . ARG A 1  843  ? 135.617 135.906 162.183 1.00 56.61  ? 843  ARG A C     1 
ATOM   6025  O  O     . ARG A 1  843  ? 134.969 136.642 161.434 1.00 56.66  ? 843  ARG A O     1 
ATOM   6026  C  CB    . ARG A 1  843  ? 135.960 133.480 161.627 1.00 56.15  ? 843  ARG A CB    1 
ATOM   6027  C  CG    . ARG A 1  843  ? 134.500 133.451 161.197 1.00 55.63  ? 843  ARG A CG    1 
ATOM   6028  C  CD    . ARG A 1  843  ? 134.337 133.811 159.728 1.00 55.11  ? 843  ARG A CD    1 
ATOM   6029  N  NE    . ARG A 1  843  ? 132.930 133.931 159.352 1.00 54.81  ? 843  ARG A NE    1 
ATOM   6030  C  CZ    . ARG A 1  843  ? 132.164 132.910 158.982 1.00 55.11  ? 843  ARG A CZ    1 
ATOM   6031  N  NH1   . ARG A 1  843  ? 132.667 131.683 158.940 1.00 56.31  ? 843  ARG A NH1   1 
ATOM   6032  N  NH2   . ARG A 1  843  ? 130.895 133.112 158.657 1.00 56.31  ? 843  ARG A NH2   1 
ATOM   6033  N  N     . THR A 1  844  ? 135.510 135.976 163.510 1.00 56.98  ? 844  THR A N     1 
ATOM   6034  C  CA    . THR A 1  844  ? 134.584 136.923 164.124 1.00 57.79  ? 844  THR A CA    1 
ATOM   6035  C  C     . THR A 1  844  ? 135.129 138.345 164.068 1.00 58.54  ? 844  THR A C     1 
ATOM   6036  O  O     . THR A 1  844  ? 134.397 139.289 163.749 1.00 58.67  ? 844  THR A O     1 
ATOM   6037  C  CB    . THR A 1  844  ? 134.295 136.515 165.569 1.00 58.56  ? 844  THR A CB    1 
ATOM   6038  O  OG1   . THR A 1  844  ? 135.517 136.495 166.317 1.00 57.68  ? 844  THR A OG1   1 
ATOM   6039  C  CG2   . THR A 1  844  ? 133.653 135.136 165.615 1.00 57.23  ? 844  THR A CG2   1 
ATOM   6040  N  N     . ASP A 1  845  ? 136.418 138.518 164.369 1.00 58.19  ? 845  ASP A N     1 
ATOM   6041  C  CA    . ASP A 1  845  ? 136.990 139.859 164.452 1.00 58.71  ? 845  ASP A CA    1 
ATOM   6042  C  C     . ASP A 1  845  ? 137.033 140.529 163.084 1.00 59.59  ? 845  ASP A C     1 
ATOM   6043  O  O     . ASP A 1  845  ? 136.628 141.688 162.934 1.00 59.83  ? 845  ASP A O     1 
ATOM   6044  C  CB    . ASP A 1  845  ? 138.390 139.791 165.067 1.00 59.81  ? 845  ASP A CB    1 
ATOM   6045  C  CG    . ASP A 1  845  ? 138.863 141.132 165.603 1.00 59.95  ? 845  ASP A CG    1 
ATOM   6046  O  OD1   . ASP A 1  845  ? 138.292 142.173 165.218 1.00 58.30  ? 845  ASP A OD1   1 
ATOM   6047  O  OD2   . ASP A 1  845  ? 139.812 141.142 166.415 1.00 58.15  ? 845  ASP A OD2   1 
ATOM   6048  N  N     . ILE A 1  846  ? 137.522 139.814 162.069 1.00 58.00  ? 846  ILE A N     1 
ATOM   6049  C  CA    . ILE A 1  846  ? 137.667 140.413 160.746 1.00 57.96  ? 846  ILE A CA    1 
ATOM   6050  C  C     . ILE A 1  846  ? 136.302 140.627 160.100 1.00 58.07  ? 846  ILE A C     1 
ATOM   6051  O  O     . ILE A 1  846  ? 136.077 141.629 159.412 1.00 58.22  ? 846  ILE A O     1 
ATOM   6052  C  CB    . ILE A 1  846  ? 138.596 139.552 159.866 1.00 58.36  ? 846  ILE A CB    1 
ATOM   6053  C  CG1   . ILE A 1  846  ? 140.068 139.875 160.150 1.00 58.30  ? 846  ILE A CG1   1 
ATOM   6054  C  CG2   . ILE A 1  846  ? 138.295 139.753 158.388 1.00 57.99  ? 846  ILE A CG2   1 
ATOM   6055  C  CD1   . ILE A 1  846  ? 140.613 139.283 161.436 1.00 57.32  ? 846  ILE A CD1   1 
ATOM   6056  N  N     . LEU A 1  847  ? 135.361 139.708 160.326 1.00 58.94  ? 847  LEU A N     1 
ATOM   6057  C  CA    . LEU A 1  847  ? 134.031 139.863 159.746 1.00 59.77  ? 847  LEU A CA    1 
ATOM   6058  C  C     . LEU A 1  847  ? 133.199 140.934 160.441 1.00 60.34  ? 847  LEU A C     1 
ATOM   6059  O  O     . LEU A 1  847  ? 132.110 141.252 159.952 1.00 60.80  ? 847  LEU A O     1 
ATOM   6060  C  CB    . LEU A 1  847  ? 133.276 138.532 159.774 1.00 60.83  ? 847  LEU A CB    1 
ATOM   6061  C  CG    . LEU A 1  847  ? 133.376 137.629 158.539 1.00 60.93  ? 847  LEU A CG    1 
ATOM   6062  C  CD1   . LEU A 1  847  ? 132.745 138.301 157.332 1.00 60.35  ? 847  LEU A CD1   1 
ATOM   6063  C  CD2   . LEU A 1  847  ? 134.818 137.239 158.243 1.00 60.43  ? 847  LEU A CD2   1 
ATOM   6064  N  N     . LYS A 1  848  ? 133.668 141.489 161.560 1.00 61.51  ? 848  LYS A N     1 
ATOM   6065  C  CA    . LYS A 1  848  ? 132.964 142.589 162.208 1.00 62.50  ? 848  LYS A CA    1 
ATOM   6066  C  C     . LYS A 1  848  ? 133.302 143.942 161.599 1.00 63.50  ? 848  LYS A C     1 
ATOM   6067  O  O     . LYS A 1  848  ? 132.425 144.809 161.513 1.00 64.15  ? 848  LYS A O     1 
ATOM   6068  C  CB    . LYS A 1  848  ? 133.274 142.615 163.708 1.00 64.57  ? 848  LYS A CB    1 
ATOM   6069  C  CG    . LYS A 1  848  ? 132.454 141.635 164.533 1.00 64.81  ? 848  LYS A CG    1 
ATOM   6070  C  CD    . LYS A 1  848  ? 132.708 141.786 166.031 1.00 64.95  ? 848  LYS A CD    1 
ATOM   6071  C  CE    . LYS A 1  848  ? 134.069 141.239 166.449 1.00 62.11  ? 848  LYS A CE    1 
ATOM   6072  N  NZ    . LYS A 1  848  ? 135.189 142.195 166.215 1.00 61.89  ? 848  LYS A NZ    1 
ATOM   6073  N  N     . THR A 1  849  ? 134.548 144.142 161.174 1.00 61.90  ? 849  THR A N     1 
ATOM   6074  C  CA    . THR A 1  849  ? 134.960 145.391 160.546 1.00 61.90  ? 849  THR A CA    1 
ATOM   6075  C  C     . THR A 1  849  ? 134.644 145.436 159.056 1.00 62.33  ? 849  THR A C     1 
ATOM   6076  O  O     . THR A 1  849  ? 135.163 146.310 158.353 1.00 62.71  ? 849  THR A O     1 
ATOM   6077  C  CB    . THR A 1  849  ? 136.459 145.626 160.763 1.00 62.51  ? 849  THR A CB    1 
ATOM   6078  O  OG1   . THR A 1  849  ? 136.843 146.867 160.158 1.00 61.08  ? 849  THR A OG1   1 
ATOM   6079  C  CG2   . THR A 1  849  ? 137.274 144.498 160.150 1.00 61.17  ? 849  THR A CG2   1 
ATOM   6080  N  N     . SER A 1  850  ? 133.807 144.522 158.561 1.00 60.09  ? 850  SER A N     1 
ATOM   6081  C  CA    . SER A 1  850  ? 133.411 144.492 157.158 1.00 59.70  ? 850  SER A CA    1 
ATOM   6082  C  C     . SER A 1  850  ? 131.987 144.994 156.952 1.00 59.66  ? 850  SER A C     1 
ATOM   6083  O  O     . SER A 1  850  ? 131.394 144.750 155.896 1.00 59.53  ? 850  SER A O     1 
ATOM   6084  C  CB    . SER A 1  850  ? 133.563 143.077 156.596 1.00 59.55  ? 850  SER A CB    1 
ATOM   6085  O  OG    . SER A 1  850  ? 133.177 143.026 155.234 1.00 59.01  ? 850  SER A OG    1 
ATOM   6086  N  N     . VAL A 1  851  ? 131.427 145.692 157.940 1.00 60.08  ? 851  VAL A N     1 
ATOM   6087  C  CA    . VAL A 1  851  ? 130.080 146.236 157.822 1.00 60.94  ? 851  VAL A CA    1 
ATOM   6088  C  C     . VAL A 1  851  ? 130.075 147.706 157.417 1.00 61.23  ? 851  VAL A C     1 
ATOM   6089  O  O     . VAL A 1  851  ? 129.045 148.197 156.928 1.00 61.18  ? 851  VAL A O     1 
ATOM   6090  C  CB    . VAL A 1  851  ? 129.292 146.047 159.136 1.00 61.21  ? 851  VAL A CB    1 
ATOM   6091  C  CG1   . VAL A 1  851  ? 129.151 144.567 159.460 1.00 61.45  ? 851  VAL A CG1   1 
ATOM   6092  C  CG2   . VAL A 1  851  ? 129.976 146.786 160.277 1.00 61.27  ? 851  VAL A CG2   1 
ATOM   6093  N  N     . ASP A 1  852  ? 131.184 148.422 157.604 1.00 61.38  ? 852  ASP A N     1 
ATOM   6094  C  CA    . ASP A 1  852  ? 131.273 149.816 157.192 1.00 61.54  ? 852  ASP A CA    1 
ATOM   6095  C  C     . ASP A 1  852  ? 131.811 149.973 155.777 1.00 62.25  ? 852  ASP A C     1 
ATOM   6096  O  O     . ASP A 1  852  ? 131.562 151.003 155.139 1.00 62.45  ? 852  ASP A O     1 
ATOM   6097  C  CB    . ASP A 1  852  ? 132.158 150.600 158.165 1.00 62.36  ? 852  ASP A CB    1 
ATOM   6098  C  CG    . ASP A 1  852  ? 133.570 150.056 158.236 1.00 62.80  ? 852  ASP A CG    1 
ATOM   6099  O  OD1   . ASP A 1  852  ? 133.755 148.843 157.998 1.00 61.01  ? 852  ASP A OD1   1 
ATOM   6100  O  OD2   . ASP A 1  852  ? 134.498 150.840 158.529 1.00 61.54  ? 852  ASP A OD2   1 
ATOM   6101  N  N     . THR A 1  853  ? 132.545 148.977 155.276 1.00 60.44  ? 853  THR A N     1 
ATOM   6102  C  CA    . THR A 1  853  ? 133.065 149.051 153.915 1.00 60.56  ? 853  THR A CA    1 
ATOM   6103  C  C     . THR A 1  853  ? 131.943 148.994 152.885 1.00 62.44  ? 853  THR A C     1 
ATOM   6104  O  O     . THR A 1  853  ? 132.068 149.577 151.802 1.00 64.04  ? 853  THR A O     1 
ATOM   6105  C  CB    . THR A 1  853  ? 134.069 147.923 153.674 1.00 62.95  ? 853  THR A CB    1 
ATOM   6106  O  OG1   . THR A 1  853  ? 134.957 147.825 154.794 1.00 58.74  ? 853  THR A OG1   1 
ATOM   6107  C  CG2   . THR A 1  853  ? 134.885 148.192 152.418 1.00 58.82  ? 853  THR A CG2   1 
ATOM   6108  N  N     . GLY A 1  854  ? 130.848 148.299 153.200 1.00 57.27  ? 854  GLY A N     1 
ATOM   6109  C  CA    . GLY A 1  854  ? 129.707 148.286 152.299 1.00 56.89  ? 854  GLY A CA    1 
ATOM   6110  C  C     . GLY A 1  854  ? 129.123 149.668 152.080 1.00 56.49  ? 854  GLY A C     1 
ATOM   6111  O  O     . GLY A 1  854  ? 128.786 150.040 150.953 1.00 55.79  ? 854  GLY A O     1 
ATOM   6112  N  N     . ARG A 1  855  ? 128.994 150.448 153.156 1.00 56.65  ? 855  ARG A N     1 
ATOM   6113  C  CA    . ARG A 1  855  ? 128.569 151.835 153.009 1.00 56.98  ? 855  ARG A CA    1 
ATOM   6114  C  C     . ARG A 1  855  ? 129.652 152.676 152.347 1.00 56.88  ? 855  ARG A C     1 
ATOM   6115  O  O     . ARG A 1  855  ? 129.342 153.631 151.626 1.00 56.90  ? 855  ARG A O     1 
ATOM   6116  C  CB    . ARG A 1  855  ? 128.195 152.419 154.372 1.00 57.09  ? 855  ARG A CB    1 
ATOM   6117  C  CG    . ARG A 1  855  ? 127.666 153.842 154.320 1.00 57.35  ? 855  ARG A CG    1 
ATOM   6118  C  CD    . ARG A 1  855  ? 127.372 154.373 155.714 1.00 57.35  ? 855  ARG A CD    1 
ATOM   6119  N  NE    . ARG A 1  855  ? 128.556 154.350 156.567 1.00 57.30  ? 855  ARG A NE    1 
ATOM   6120  C  CZ    . ARG A 1  855  ? 129.438 155.341 156.648 1.00 57.36  ? 855  ARG A CZ    1 
ATOM   6121  N  NH1   . ARG A 1  855  ? 129.272 156.440 155.925 1.00 57.78  ? 855  ARG A NH1   1 
ATOM   6122  N  NH2   . ARG A 1  855  ? 130.487 155.233 157.452 1.00 57.07  ? 855  ARG A NH2   1 
ATOM   6123  N  N     . GLU A 1  856  ? 130.923 152.331 152.572 1.00 60.32  ? 856  GLU A N     1 
ATOM   6124  C  CA    . GLU A 1  856  ? 132.019 153.025 151.907 1.00 62.70  ? 856  GLU A CA    1 
ATOM   6125  C  C     . GLU A 1  856  ? 132.021 152.783 150.404 1.00 64.86  ? 856  GLU A C     1 
ATOM   6126  O  O     . GLU A 1  856  ? 132.560 153.606 149.657 1.00 66.63  ? 856  GLU A O     1 
ATOM   6127  C  CB    . GLU A 1  856  ? 133.356 152.589 152.514 1.00 67.90  ? 856  GLU A CB    1 
ATOM   6128  C  CG    . GLU A 1  856  ? 134.547 153.449 152.113 1.00 68.12  ? 856  GLU A CG    1 
ATOM   6129  C  CD    . GLU A 1  856  ? 134.479 154.851 152.685 1.00 68.81  ? 856  GLU A CD    1 
ATOM   6130  O  OE1   . GLU A 1  856  ? 133.790 155.048 153.709 1.00 63.15  ? 856  GLU A OE1   1 
ATOM   6131  O  OE2   . GLU A 1  856  ? 135.116 155.760 152.112 1.00 62.59  ? 856  GLU A OE2   1 
ATOM   6132  N  N     . ALA A 1  857  ? 131.427 151.680 149.946 1.00 65.10  ? 857  ALA A N     1 
ATOM   6133  C  CA    . ALA A 1  857  ? 131.328 151.421 148.513 1.00 66.72  ? 857  ALA A CA    1 
ATOM   6134  C  C     . ALA A 1  857  ? 130.414 152.438 147.840 1.00 67.68  ? 857  ALA A C     1 
ATOM   6135  O  O     . ALA A 1  857  ? 130.808 153.105 146.876 1.00 66.67  ? 857  ALA A O     1 
ATOM   6136  C  CB    . ALA A 1  857  ? 130.823 149.998 148.271 1.00 66.78  ? 857  ALA A CB    1 
ATOM   6137  N  N     . ALA A 1  858  ? 129.181 152.563 148.335 1.00 66.66  ? 858  ALA A N     1 
ATOM   6138  C  CA    . ALA A 1  858  ? 128.266 153.564 147.795 1.00 66.99  ? 858  ALA A CA    1 
ATOM   6139  C  C     . ALA A 1  858  ? 128.792 154.973 148.036 1.00 67.87  ? 858  ALA A C     1 
ATOM   6140  O  O     . ALA A 1  858  ? 128.578 155.872 147.215 1.00 66.54  ? 858  ALA A O     1 
ATOM   6141  C  CB    . ALA A 1  858  ? 126.878 153.395 148.411 1.00 65.75  ? 858  ALA A CB    1 
ATOM   6142  N  N     . ALA A 1  859  ? 129.483 155.185 149.158 1.00 66.91  ? 859  ALA A N     1 
ATOM   6143  C  CA    . ALA A 1  859  ? 130.071 156.492 149.431 1.00 67.61  ? 859  ALA A CA    1 
ATOM   6144  C  C     . ALA A 1  859  ? 131.202 156.813 148.463 1.00 68.68  ? 859  ALA A C     1 
ATOM   6145  O  O     . ALA A 1  859  ? 131.430 157.985 148.144 1.00 67.25  ? 859  ALA A O     1 
ATOM   6146  C  CB    . ALA A 1  859  ? 130.570 156.555 150.873 1.00 66.31  ? 859  ALA A CB    1 
ATOM   6147  N  N     . GLU A 1  860  ? 131.918 155.795 147.984 1.00 68.06  ? 860  GLU A N     1 
ATOM   6148  C  CA    . GLU A 1  860  ? 133.011 156.034 147.048 1.00 69.06  ? 860  GLU A CA    1 
ATOM   6149  C  C     . GLU A 1  860  ? 132.489 156.358 145.653 1.00 70.17  ? 860  GLU A C     1 
ATOM   6150  O  O     . GLU A 1  860  ? 133.055 157.210 144.959 1.00 70.77  ? 860  GLU A O     1 
ATOM   6151  C  CB    . GLU A 1  860  ? 133.942 154.820 147.009 1.00 71.15  ? 860  GLU A CB    1 
ATOM   6152  C  CG    . GLU A 1  860  ? 135.275 155.059 146.311 1.00 71.39  ? 860  GLU A CG    1 
ATOM   6153  C  CD    . GLU A 1  860  ? 135.197 154.876 144.807 1.00 71.06  ? 860  GLU A CD    1 
ATOM   6154  O  OE1   . GLU A 1  860  ? 134.256 154.203 144.337 1.00 69.18  ? 860  GLU A OE1   1 
ATOM   6155  O  OE2   . GLU A 1  860  ? 136.079 155.402 144.097 1.00 68.84  ? 860  GLU A OE2   1 
ATOM   6156  N  N     . VAL A 1  861  ? 131.412 155.693 145.227 1.00 69.28  ? 861  VAL A N     1 
ATOM   6157  C  CA    . VAL A 1  861  ? 130.879 155.925 143.888 1.00 68.59  ? 861  VAL A CA    1 
ATOM   6158  C  C     . VAL A 1  861  ? 130.015 157.179 143.814 1.00 68.60  ? 861  VAL A C     1 
ATOM   6159  O  O     . VAL A 1  861  ? 129.777 157.691 142.714 1.00 68.27  ? 861  VAL A O     1 
ATOM   6160  C  CB    . VAL A 1  861  ? 130.078 154.705 143.402 1.00 68.61  ? 861  VAL A CB    1 
ATOM   6161  C  CG1   . VAL A 1  861  ? 130.940 153.452 143.455 1.00 67.34  ? 861  VAL A CG1   1 
ATOM   6162  C  CG2   . VAL A 1  861  ? 128.817 154.528 144.231 1.00 66.54  ? 861  VAL A CG2   1 
ATOM   6163  N  N     . THR A 1  862  ? 129.538 157.689 144.947 1.00 66.97  ? 862  THR A N     1 
ATOM   6164  C  CA    . THR A 1  862  ? 128.722 158.896 144.971 1.00 67.79  ? 862  THR A CA    1 
ATOM   6165  C  C     . THR A 1  862  ? 129.551 160.170 145.069 1.00 67.32  ? 862  THR A C     1 
ATOM   6166  O  O     . THR A 1  862  ? 128.972 161.258 145.159 1.00 68.09  ? 862  THR A O     1 
ATOM   6167  C  CB    . THR A 1  862  ? 127.728 158.848 146.137 1.00 67.05  ? 862  THR A CB    1 
ATOM   6168  O  OG1   . THR A 1  862  ? 126.741 159.872 145.966 1.00 70.27  ? 862  THR A OG1   1 
ATOM   6169  C  CG2   . THR A 1  862  ? 128.444 159.074 147.457 1.00 70.89  ? 862  THR A CG2   1 
ATOM   6170  N  N     . ASN A 1  863  ? 130.881 160.057 145.060 1.00 72.45  ? 863  ASN A N     1 
ATOM   6171  C  CA    . ASN A 1  863  ? 131.811 161.177 145.177 1.00 74.26  ? 863  ASN A CA    1 
ATOM   6172  C  C     . ASN A 1  863  ? 131.724 161.878 146.529 1.00 75.19  ? 863  ASN A C     1 
ATOM   6173  O  O     . ASN A 1  863  ? 132.205 163.006 146.675 1.00 75.11  ? 863  ASN A O     1 
ATOM   6174  C  CB    . ASN A 1  863  ? 131.616 162.192 144.043 1.00 75.57  ? 863  ASN A CB    1 
ATOM   6175  C  CG    . ASN A 1  863  ? 131.845 161.584 142.673 1.00 74.42  ? 863  ASN A CG    1 
ATOM   6176  O  OD1   . ASN A 1  863  ? 130.943 161.558 141.835 1.00 74.70  ? 863  ASN A OD1   1 
ATOM   6177  N  ND2   . ASN A 1  863  ? 133.055 161.092 142.439 1.00 74.84  ? 863  ASN A ND2   1 
ATOM   6178  N  N     . LEU A 1  864  ? 131.118 161.234 147.523 1.00 75.16  ? 864  LEU A N     1 
ATOM   6179  C  CA    . LEU A 1  864  ? 131.088 161.714 148.905 1.00 75.54  ? 864  LEU A CA    1 
ATOM   6180  C  C     . LEU A 1  864  ? 131.677 160.599 149.764 1.00 73.60  ? 864  LEU A C     1 
ATOM   6181  O  O     . LEU A 1  864  ? 130.949 159.753 150.288 1.00 72.08  ? 864  LEU A O     1 
ATOM   6182  C  CB    . LEU A 1  864  ? 129.669 162.087 149.350 1.00 72.24  ? 864  LEU A CB    1 
ATOM   6183  C  CG    . LEU A 1  864  ? 129.124 163.461 148.946 1.00 71.16  ? 864  LEU A CG    1 
ATOM   6184  C  CD1   . LEU A 1  864  ? 130.114 164.561 149.300 1.00 78.11  ? 864  LEU A CD1   1 
ATOM   6185  C  CD2   . LEU A 1  864  ? 128.756 163.514 147.470 1.00 79.72  ? 864  LEU A CD2   1 
ATOM   6186  N  N     . ASP A 1  865  ? 133.004 160.607 149.907 1.00 79.14  ? 865  ASP A N     1 
ATOM   6187  C  CA    . ASP A 1  865  ? 133.698 159.489 150.539 1.00 78.99  ? 865  ASP A CA    1 
ATOM   6188  C  C     . ASP A 1  865  ? 133.362 159.387 152.023 1.00 80.93  ? 865  ASP A C     1 
ATOM   6189  O  O     . ASP A 1  865  ? 132.821 158.375 152.482 1.00 82.70  ? 865  ASP A O     1 
ATOM   6190  C  CB    . ASP A 1  865  ? 135.208 159.632 150.335 1.00 83.14  ? 865  ASP A CB    1 
ATOM   6191  C  CG    . ASP A 1  865  ? 135.597 159.663 148.870 1.00 84.02  ? 865  ASP A CG    1 
ATOM   6192  O  OD1   . ASP A 1  865  ? 134.891 159.036 148.052 1.00 76.62  ? 865  ASP A OD1   1 
ATOM   6193  O  OD2   . ASP A 1  865  ? 136.610 160.315 148.535 1.00 75.36  ? 865  ASP A OD2   1 
ATOM   6194  N  N     . LYS A 1  866  ? 133.699 160.370 152.839 1.00 75.67  ? 866  LYS A N     1 
ATOM   6195  C  CA    . LYS A 1  866  ? 133.454 160.130 154.259 1.00 75.88  ? 866  LYS A CA    1 
ATOM   6196  C  C     . LYS A 1  866  ? 132.682 161.095 155.143 1.00 75.90  ? 866  LYS A C     1 
ATOM   6197  O  O     . LYS A 1  866  ? 132.481 162.265 154.821 1.00 76.36  ? 866  LYS A O     1 
ATOM   6198  C  CB    . LYS A 1  866  ? 134.777 159.781 154.949 1.00 76.66  ? 866  LYS A CB    1 
ATOM   6199  C  CG    . LYS A 1  866  ? 135.748 160.944 155.044 1.00 76.69  ? 866  LYS A CG    1 
ATOM   6200  C  CD    . LYS A 1  866  ? 136.067 161.514 153.672 1.00 76.65  ? 866  LYS A CD    1 
ATOM   6201  C  CE    . LYS A 1  866  ? 137.079 162.644 153.770 1.00 76.96  ? 866  LYS A CE    1 
ATOM   6202  N  NZ    . LYS A 1  866  ? 137.441 163.194 152.435 1.00 77.57  ? 866  LYS A NZ    1 
ATOM   6203  N  N     . ASP A 1  867  ? 132.257 160.540 156.276 1.00 77.69  ? 867  ASP A N     1 
ATOM   6204  C  CA    . ASP A 1  867  ? 131.526 161.254 157.313 1.00 77.80  ? 867  ASP A CA    1 
ATOM   6205  C  C     . ASP A 1  867  ? 130.019 161.331 157.111 1.00 78.97  ? 867  ASP A C     1 
ATOM   6206  O  O     . ASP A 1  867  ? 129.327 161.994 157.881 1.00 80.12  ? 867  ASP A O     1 
ATOM   6207  C  CB    . ASP A 1  867  ? 132.117 162.654 157.497 1.00 80.68  ? 867  ASP A CB    1 
ATOM   6208  C  CG    . ASP A 1  867  ? 133.614 162.623 157.755 1.00 80.63  ? 867  ASP A CG    1 
ATOM   6209  O  OD1   . ASP A 1  867  ? 134.206 161.523 157.706 1.00 76.69  ? 867  ASP A OD1   1 
ATOM   6210  O  OD2   . ASP A 1  867  ? 134.202 163.695 158.007 1.00 76.92  ? 867  ASP A OD2   1 
ATOM   6211  N  N     . THR A 1  868  ? 129.504 160.658 156.088 1.00 74.77  ? 868  THR A N     1 
ATOM   6212  C  CA    . THR A 1  868  ? 128.066 160.693 155.844 1.00 73.14  ? 868  THR A CA    1 
ATOM   6213  C  C     . THR A 1  868  ? 127.359 159.341 155.856 1.00 72.26  ? 868  THR A C     1 
ATOM   6214  O  O     . THR A 1  868  ? 127.756 158.409 155.159 1.00 71.53  ? 868  THR A O     1 
ATOM   6215  C  CB    . THR A 1  868  ? 127.736 161.379 154.503 1.00 72.34  ? 868  THR A CB    1 
ATOM   6216  O  OG1   . THR A 1  868  ? 128.312 160.630 153.426 1.00 72.37  ? 868  THR A OG1   1 
ATOM   6217  C  CG2   . THR A 1  868  ? 128.279 162.794 154.476 1.00 72.40  ? 868  THR A CG2   1 
ATOM   6218  N  N     . PRO A 1  869  ? 126.295 159.262 156.647 1.00 71.56  ? 869  PRO A N     1 
ATOM   6219  C  CA    . PRO A 1  869  ? 125.440 158.070 156.728 1.00 71.06  ? 869  PRO A CA    1 
ATOM   6220  C  C     . PRO A 1  869  ? 124.240 158.167 155.798 1.00 71.48  ? 869  PRO A C     1 
ATOM   6221  O  O     . PRO A 1  869  ? 124.122 159.123 155.026 1.00 71.51  ? 869  PRO A O     1 
ATOM   6222  C  CB    . PRO A 1  869  ? 125.018 158.040 158.202 1.00 71.50  ? 869  PRO A CB    1 
ATOM   6223  C  CG    . PRO A 1  869  ? 125.078 159.466 158.632 1.00 70.14  ? 869  PRO A CG    1 
ATOM   6224  C  CD    . PRO A 1  869  ? 126.206 160.095 157.859 1.00 69.35  ? 869  PRO A CD    1 
ATOM   6225  N  N     . ALA A 1  870  ? 123.342 157.186 155.863 1.00 69.82  ? 870  ALA A N     1 
ATOM   6226  C  CA    . ALA A 1  870  ? 122.182 157.137 154.972 1.00 69.86  ? 870  ALA A CA    1 
ATOM   6227  C  C     . ALA A 1  870  ? 121.015 157.939 155.553 1.00 70.07  ? 870  ALA A C     1 
ATOM   6228  O  O     . ALA A 1  870  ? 119.907 157.440 155.748 1.00 69.91  ? 870  ALA A O     1 
ATOM   6229  C  CB    . ALA A 1  870  ? 121.784 155.691 154.705 1.00 69.27  ? 870  ALA A CB    1 
ATOM   6230  N  N     . ASP A 1  871  ? 121.287 159.214 155.832 1.00 71.04  ? 871  ASP A N     1 
ATOM   6231  C  CA    . ASP A 1  871  ? 120.264 160.114 156.348 1.00 72.17  ? 871  ASP A CA    1 
ATOM   6232  C  C     . ASP A 1  871  ? 120.230 161.414 155.554 1.00 73.22  ? 871  ASP A C     1 
ATOM   6233  O  O     . ASP A 1  871  ? 119.190 162.076 155.476 1.00 73.98  ? 871  ASP A O     1 
ATOM   6234  C  CB    . ASP A 1  871  ? 120.504 160.405 157.832 1.00 74.32  ? 871  ASP A CB    1 
ATOM   6235  C  CG    . ASP A 1  871  ? 121.792 161.169 158.076 1.00 74.38  ? 871  ASP A CG    1 
ATOM   6236  O  OD1   . ASP A 1  871  ? 122.710 161.076 157.235 1.00 71.98  ? 871  ASP A OD1   1 
ATOM   6237  O  OD2   . ASP A 1  871  ? 121.884 161.863 159.110 1.00 70.76  ? 871  ASP A OD2   1 
ATOM   6238  N  N     . ASP A 1  872  ? 121.362 161.785 154.968 1.00 72.47  ? 872  ASP A N     1 
ATOM   6239  C  CA    . ASP A 1  872  ? 121.456 163.057 154.260 1.00 72.54  ? 872  ASP A CA    1 
ATOM   6240  C  C     . ASP A 1  872  ? 120.662 162.999 152.960 1.00 73.69  ? 872  ASP A C     1 
ATOM   6241  O  O     . ASP A 1  872  ? 120.819 162.047 152.185 1.00 74.39  ? 872  ASP A O     1 
ATOM   6242  C  CB    . ASP A 1  872  ? 122.916 163.397 153.971 1.00 74.99  ? 872  ASP A CB    1 
ATOM   6243  C  CG    . ASP A 1  872  ? 123.727 163.604 155.234 1.00 74.18  ? 872  ASP A CG    1 
ATOM   6244  O  OD1   . ASP A 1  872  ? 123.141 164.021 156.256 1.00 71.39  ? 872  ASP A OD1   1 
ATOM   6245  O  OD2   . ASP A 1  872  ? 124.950 163.351 155.206 1.00 70.18  ? 872  ASP A OD2   1 
ATOM   6246  N  N     . PRO A 1  873  ? 119.798 163.980 152.689 1.00 72.11  ? 873  PRO A N     1 
ATOM   6247  C  CA    . PRO A 1  873  ? 119.079 163.985 151.404 1.00 72.77  ? 873  PRO A CA    1 
ATOM   6248  C  C     . PRO A 1  873  ? 119.999 164.108 150.204 1.00 73.28  ? 873  PRO A C     1 
ATOM   6249  O  O     . PRO A 1  873  ? 119.676 163.581 149.132 1.00 73.33  ? 873  PRO A O     1 
ATOM   6250  C  CB    . PRO A 1  873  ? 118.146 165.199 151.529 1.00 72.79  ? 873  PRO A CB    1 
ATOM   6251  C  CG    . PRO A 1  873  ? 118.018 165.435 153.002 1.00 72.88  ? 873  PRO A CG    1 
ATOM   6252  C  CD    . PRO A 1  873  ? 119.346 165.060 153.582 1.00 73.62  ? 873  PRO A CD    1 
ATOM   6253  N  N     . GLU A 1  874  ? 121.136 164.794 150.348 1.00 72.15  ? 874  GLU A N     1 
ATOM   6254  C  CA    . GLU A 1  874  ? 122.095 164.876 149.250 1.00 71.79  ? 874  GLU A CA    1 
ATOM   6255  C  C     . GLU A 1  874  ? 122.637 163.498 148.894 1.00 72.58  ? 874  GLU A C     1 
ATOM   6256  O  O     . GLU A 1  874  ? 122.789 163.167 147.712 1.00 73.27  ? 874  GLU A O     1 
ATOM   6257  C  CB    . GLU A 1  874  ? 123.235 165.826 149.619 1.00 73.15  ? 874  GLU A CB    1 
ATOM   6258  C  CG    . GLU A 1  874  ? 124.319 165.946 148.558 1.00 72.81  ? 874  GLU A CG    1 
ATOM   6259  C  CD    . GLU A 1  874  ? 123.823 166.595 147.279 1.00 73.26  ? 874  GLU A CD    1 
ATOM   6260  O  OE1   . GLU A 1  874  ? 122.844 167.368 147.341 1.00 70.45  ? 874  GLU A OE1   1 
ATOM   6261  O  OE2   . GLU A 1  874  ? 124.413 166.329 146.210 1.00 69.47  ? 874  GLU A OE2   1 
ATOM   6262  N  N     . LEU A 1  875  ? 122.936 162.680 149.906 1.00 69.80  ? 875  LEU A N     1 
ATOM   6263  C  CA    . LEU A 1  875  ? 123.346 161.304 149.650 1.00 69.89  ? 875  LEU A CA    1 
ATOM   6264  C  C     . LEU A 1  875  ? 122.200 160.483 149.075 1.00 70.76  ? 875  LEU A C     1 
ATOM   6265  O  O     . LEU A 1  875  ? 122.437 159.514 148.343 1.00 71.28  ? 875  LEU A O     1 
ATOM   6266  C  CB    . LEU A 1  875  ? 123.877 160.676 150.943 1.00 70.69  ? 875  LEU A CB    1 
ATOM   6267  C  CG    . LEU A 1  875  ? 124.606 159.328 150.907 1.00 71.75  ? 875  LEU A CG    1 
ATOM   6268  C  CD1   . LEU A 1  875  ? 123.640 158.158 151.055 1.00 69.14  ? 875  LEU A CD1   1 
ATOM   6269  C  CD2   . LEU A 1  875  ? 125.433 159.189 149.635 1.00 68.88  ? 875  LEU A CD2   1 
ATOM   6270  N  N     . LEU A 1  876  ? 120.956 160.856 149.385 1.00 68.61  ? 876  LEU A N     1 
ATOM   6271  C  CA    . LEU A 1  876  ? 119.801 160.137 148.861 1.00 68.19  ? 876  LEU A CA    1 
ATOM   6272  C  C     . LEU A 1  876  ? 119.524 160.482 147.402 1.00 69.38  ? 876  LEU A C     1 
ATOM   6273  O  O     . LEU A 1  876  ? 118.975 159.653 146.669 1.00 70.24  ? 876  LEU A O     1 
ATOM   6274  C  CB    . LEU A 1  876  ? 118.570 160.434 149.723 1.00 70.75  ? 876  LEU A CB    1 
ATOM   6275  C  CG    . LEU A 1  876  ? 117.278 159.653 149.465 1.00 70.15  ? 876  LEU A CG    1 
ATOM   6276  C  CD1   . LEU A 1  876  ? 116.575 159.355 150.779 1.00 66.30  ? 876  LEU A CD1   1 
ATOM   6277  C  CD2   . LEU A 1  876  ? 116.348 160.416 148.533 1.00 65.56  ? 876  LEU A CD2   1 
ATOM   6278  N  N     . LYS A 1  877  ? 119.899 161.684 146.965 1.00 65.24  ? 877  LYS A N     1 
ATOM   6279  C  CA    . LYS A 1  877  ? 119.636 162.137 145.603 1.00 64.86  ? 877  LYS A CA    1 
ATOM   6280  C  C     . LYS A 1  877  ? 120.604 161.557 144.579 1.00 65.04  ? 877  LYS A C     1 
ATOM   6281  O  O     . LYS A 1  877  ? 120.547 161.948 143.408 1.00 65.21  ? 877  LYS A O     1 
ATOM   6282  C  CB    . LYS A 1  877  ? 119.680 163.667 145.540 1.00 65.32  ? 877  LYS A CB    1 
ATOM   6283  C  CG    . LYS A 1  877  ? 118.521 164.357 146.241 1.00 65.70  ? 877  LYS A CG    1 
ATOM   6284  C  CD    . LYS A 1  877  ? 117.197 164.031 145.569 1.00 65.77  ? 877  LYS A CD    1 
ATOM   6285  C  CE    . LYS A 1  877  ? 116.041 164.736 146.258 1.00 65.24  ? 877  LYS A CE    1 
ATOM   6286  N  NZ    . LYS A 1  877  ? 114.738 164.434 145.605 1.00 65.52  ? 877  LYS A NZ    1 
ATOM   6287  N  N     . ARG A 1  878  ? 121.485 160.644 144.981 1.00 65.24  ? 878  ARG A N     1 
ATOM   6288  C  CA    . ARG A 1  878  ? 122.463 160.046 144.082 1.00 64.80  ? 878  ARG A CA    1 
ATOM   6289  C  C     . ARG A 1  878  ? 122.237 158.559 143.863 1.00 65.71  ? 878  ARG A C     1 
ATOM   6290  O  O     . ARG A 1  878  ? 122.215 158.100 142.717 1.00 66.04  ? 878  ARG A O     1 
ATOM   6291  C  CB    . ARG A 1  878  ? 123.882 160.280 144.618 1.00 65.93  ? 878  ARG A CB    1 
ATOM   6292  C  CG    . ARG A 1  878  ? 124.320 161.734 144.615 1.00 65.96  ? 878  ARG A CG    1 
ATOM   6293  C  CD    . ARG A 1  878  ? 124.392 162.285 143.199 1.00 66.18  ? 878  ARG A CD    1 
ATOM   6294  N  NE    . ARG A 1  878  ? 124.941 163.637 143.167 1.00 66.55  ? 878  ARG A NE    1 
ATOM   6295  C  CZ    . ARG A 1  878  ? 124.211 164.743 143.268 1.00 65.92  ? 878  ARG A CZ    1 
ATOM   6296  N  NH1   . ARG A 1  878  ? 124.796 165.932 143.228 1.00 63.02  ? 878  ARG A NH1   1 
ATOM   6297  N  NH2   . ARG A 1  878  ? 122.896 164.660 143.408 1.00 62.42  ? 878  ARG A NH2   1 
ATOM   6298  N  N     . LEU A 1  879  ? 122.068 157.788 144.941 1.00 61.70  ? 879  LEU A N     1 
ATOM   6299  C  CA    . LEU A 1  879  ? 121.904 156.345 144.793 1.00 61.26  ? 879  LEU A CA    1 
ATOM   6300  C  C     . LEU A 1  879  ? 120.599 156.003 144.085 1.00 61.21  ? 879  LEU A C     1 
ATOM   6301  O  O     . LEU A 1  879  ? 120.535 155.030 143.326 1.00 61.41  ? 879  LEU A O     1 
ATOM   6302  C  CB    . LEU A 1  879  ? 121.981 155.664 146.162 1.00 61.94  ? 879  LEU A CB    1 
ATOM   6303  C  CG    . LEU A 1  879  ? 121.162 156.244 147.318 1.00 61.12  ? 879  LEU A CG    1 
ATOM   6304  C  CD1   . LEU A 1  879  ? 119.772 155.635 147.376 1.00 61.60  ? 879  LEU A CD1   1 
ATOM   6305  C  CD2   . LEU A 1  879  ? 121.892 156.037 148.634 1.00 61.30  ? 879  LEU A CD2   1 
ATOM   6306  N  N     . GLN A 1  880  ? 119.547 156.792 144.317 1.00 62.84  ? 880  GLN A N     1 
ATOM   6307  C  CA    . GLN A 1  880  ? 118.283 156.553 143.631 1.00 63.94  ? 880  GLN A CA    1 
ATOM   6308  C  C     . GLN A 1  880  ? 118.381 156.837 142.139 1.00 64.75  ? 880  GLN A C     1 
ATOM   6309  O  O     . GLN A 1  880  ? 117.569 156.317 141.365 1.00 65.35  ? 880  GLN A O     1 
ATOM   6310  C  CB    . GLN A 1  880  ? 117.173 157.401 144.255 1.00 66.39  ? 880  GLN A CB    1 
ATOM   6311  C  CG    . GLN A 1  880  ? 117.317 158.896 144.018 1.00 66.61  ? 880  GLN A CG    1 
ATOM   6312  C  CD    . GLN A 1  880  ? 116.201 159.696 144.659 1.00 67.42  ? 880  GLN A CD    1 
ATOM   6313  O  OE1   . GLN A 1  880  ? 115.320 159.140 145.314 1.00 63.74  ? 880  GLN A OE1   1 
ATOM   6314  N  NE2   . GLN A 1  880  ? 116.233 161.010 144.472 1.00 63.98  ? 880  GLN A NE2   1 
ATOM   6315  N  N     . GLU A 1  881  ? 119.351 157.647 141.719 1.00 63.53  ? 881  GLU A N     1 
ATOM   6316  C  CA    . GLU A 1  881  ? 119.562 157.930 140.307 1.00 63.67  ? 881  GLU A CA    1 
ATOM   6317  C  C     . GLU A 1  881  ? 120.477 156.921 139.629 1.00 64.03  ? 881  GLU A C     1 
ATOM   6318  O  O     . GLU A 1  881  ? 120.431 156.792 138.400 1.00 64.13  ? 881  GLU A O     1 
ATOM   6319  C  CB    . GLU A 1  881  ? 120.140 159.338 140.128 1.00 63.67  ? 881  GLU A CB    1 
ATOM   6320  C  CG    . GLU A 1  881  ? 119.227 160.454 140.613 1.00 63.67  ? 881  GLU A CG    1 
ATOM   6321  C  CD    . GLU A 1  881  ? 117.962 160.579 139.784 1.00 62.87  ? 881  GLU A CD    1 
ATOM   6322  O  OE1   . GLU A 1  881  ? 117.981 160.182 138.601 1.00 63.02  ? 881  GLU A OE1   1 
ATOM   6323  O  OE2   . GLU A 1  881  ? 116.948 161.076 140.318 1.00 63.89  ? 881  GLU A OE2   1 
ATOM   6324  N  N     . ILE A 1  882  ? 121.307 156.203 140.395 1.00 61.47  ? 882  ILE A N     1 
ATOM   6325  C  CA    . ILE A 1  882  ? 122.216 155.219 139.810 1.00 60.50  ? 882  ILE A CA    1 
ATOM   6326  C  C     . ILE A 1  882  ? 121.634 153.813 139.798 1.00 61.50  ? 882  ILE A C     1 
ATOM   6327  O  O     . ILE A 1  882  ? 122.249 152.907 139.214 1.00 62.33  ? 882  ILE A O     1 
ATOM   6328  C  CB    . ILE A 1  882  ? 123.571 155.203 140.548 1.00 63.04  ? 882  ILE A CB    1 
ATOM   6329  C  CG1   . ILE A 1  882  ? 123.407 154.642 141.961 1.00 61.86  ? 882  ILE A CG1   1 
ATOM   6330  C  CG2   . ILE A 1  882  ? 124.176 156.599 140.583 1.00 59.41  ? 882  ILE A CG2   1 
ATOM   6331  C  CD1   . ILE A 1  882  ? 124.668 154.713 142.795 1.00 59.18  ? 882  ILE A CD1   1 
ATOM   6332  N  N     . LEU A 1  883  ? 120.476 153.596 140.421 1.00 58.93  ? 883  LEU A N     1 
ATOM   6333  C  CA    . LEU A 1  883  ? 119.791 152.313 140.364 1.00 59.16  ? 883  LEU A CA    1 
ATOM   6334  C  C     . LEU A 1  883  ? 118.724 152.269 139.275 1.00 59.90  ? 883  LEU A C     1 
ATOM   6335  O  O     . LEU A 1  883  ? 117.856 151.390 139.302 1.00 60.48  ? 883  LEU A O     1 
ATOM   6336  C  CB    . LEU A 1  883  ? 119.177 151.974 141.728 1.00 60.66  ? 883  LEU A CB    1 
ATOM   6337  C  CG    . LEU A 1  883  ? 118.252 152.971 142.438 1.00 60.92  ? 883  LEU A CG    1 
ATOM   6338  C  CD1   . LEU A 1  883  ? 116.812 152.888 141.943 1.00 58.22  ? 883  LEU A CD1   1 
ATOM   6339  C  CD2   . LEU A 1  883  ? 118.306 152.760 143.945 1.00 58.50  ? 883  LEU A CD2   1 
ATOM   6340  N  N     . ARG A 1  884  ? 118.777 153.193 138.314 1.00 58.40  ? 884  ARG A N     1 
ATOM   6341  C  CA    . ARG A 1  884  ? 117.759 153.302 137.279 1.00 58.58  ? 884  ARG A CA    1 
ATOM   6342  C  C     . ARG A 1  884  ? 118.147 152.624 135.972 1.00 57.54  ? 884  ARG A C     1 
ATOM   6343  O  O     . ARG A 1  884  ? 117.309 152.541 135.067 1.00 56.71  ? 884  ARG A O     1 
ATOM   6344  C  CB    . ARG A 1  884  ? 117.438 154.778 137.007 1.00 56.03  ? 884  ARG A CB    1 
ATOM   6345  C  CG    . ARG A 1  884  ? 116.836 155.532 138.188 1.00 54.94  ? 884  ARG A CG    1 
ATOM   6346  C  CD    . ARG A 1  884  ? 115.373 155.170 138.417 1.00 53.95  ? 884  ARG A CD    1 
ATOM   6347  N  NE    . ARG A 1  884  ? 115.213 153.892 139.104 1.00 53.72  ? 884  ARG A NE    1 
ATOM   6348  C  CZ    . ARG A 1  884  ? 114.040 153.325 139.367 1.00 53.81  ? 884  ARG A CZ    1 
ATOM   6349  N  NH1   . ARG A 1  884  ? 113.994 152.159 139.996 1.00 60.16  ? 884  ARG A NH1   1 
ATOM   6350  N  NH2   . ARG A 1  884  ? 112.914 153.923 139.001 1.00 59.75  ? 884  ARG A NH2   1 
ATOM   6351  N  N     . ASP A 1  885  ? 119.379 152.142 135.845 1.00 61.85  ? 885  ASP A N     1 
ATOM   6352  C  CA    . ASP A 1  885  ? 119.824 151.501 134.613 1.00 62.54  ? 885  ASP A CA    1 
ATOM   6353  C  C     . ASP A 1  885  ? 120.946 150.523 134.949 1.00 62.50  ? 885  ASP A C     1 
ATOM   6354  O  O     . ASP A 1  885  ? 121.230 150.254 136.119 1.00 62.31  ? 885  ASP A O     1 
ATOM   6355  C  CB    . ASP A 1  885  ? 120.243 152.555 133.580 1.00 62.62  ? 885  ASP A CB    1 
ATOM   6356  C  CG    . ASP A 1  885  ? 121.176 153.600 134.157 1.00 62.05  ? 885  ASP A CG    1 
ATOM   6357  O  OD1   . ASP A 1  885  ? 121.347 153.631 135.394 1.00 63.71  ? 885  ASP A OD1   1 
ATOM   6358  O  OD2   . ASP A 1  885  ? 121.724 154.401 133.372 1.00 63.25  ? 885  ASP A OD2   1 
ATOM   6359  N  N     . ASN A 1  886  ? 121.584 149.988 133.908 1.00 66.01  ? 886  ASN A N     1 
ATOM   6360  C  CA    . ASN A 1  886  ? 122.547 148.903 134.063 1.00 68.48  ? 886  ASN A CA    1 
ATOM   6361  C  C     . ASN A 1  886  ? 123.982 149.397 134.216 1.00 69.03  ? 886  ASN A C     1 
ATOM   6362  O  O     . ASN A 1  886  ? 124.763 148.794 134.960 1.00 69.06  ? 886  ASN A O     1 
ATOM   6363  C  CB    . ASN A 1  886  ? 122.453 147.954 132.865 1.00 68.41  ? 886  ASN A CB    1 
ATOM   6364  C  CG    . ASN A 1  886  ? 123.254 146.683 133.064 1.00 69.24  ? 886  ASN A CG    1 
ATOM   6365  O  OD1   . ASN A 1  886  ? 123.510 146.268 134.192 1.00 69.68  ? 886  ASN A OD1   1 
ATOM   6366  N  ND2   . ASN A 1  886  ? 123.656 146.058 131.962 1.00 70.19  ? 886  ASN A ND2   1 
ATOM   6367  N  N     . ASN A 1  887  ? 124.349 150.481 133.528 1.00 70.32  ? 887  ASN A N     1 
ATOM   6368  C  CA    . ASN A 1  887  ? 125.739 150.928 133.552 1.00 70.38  ? 887  ASN A CA    1 
ATOM   6369  C  C     . ASN A 1  887  ? 126.094 151.583 134.882 1.00 71.04  ? 887  ASN A C     1 
ATOM   6370  O  O     . ASN A 1  887  ? 127.186 151.357 135.417 1.00 70.68  ? 887  ASN A O     1 
ATOM   6371  C  CB    . ASN A 1  887  ? 126.006 151.884 132.389 1.00 70.00  ? 887  ASN A CB    1 
ATOM   6372  C  CG    . ASN A 1  887  ? 124.993 153.010 132.313 1.00 70.49  ? 887  ASN A CG    1 
ATOM   6373  O  OD1   . ASN A 1  887  ? 124.241 153.249 133.256 1.00 69.55  ? 887  ASN A OD1   1 
ATOM   6374  N  ND2   . ASN A 1  887  ? 124.974 153.711 131.186 1.00 69.04  ? 887  ASN A ND2   1 
ATOM   6375  N  N     . LYS A 1  888  ? 125.191 152.402 135.427 1.00 68.53  ? 888  LYS A N     1 
ATOM   6376  C  CA    . LYS A 1  888  ? 125.456 153.050 136.708 1.00 67.83  ? 888  LYS A CA    1 
ATOM   6377  C  C     . LYS A 1  888  ? 125.610 152.043 137.840 1.00 68.19  ? 888  LYS A C     1 
ATOM   6378  O  O     . LYS A 1  888  ? 126.255 152.353 138.848 1.00 69.20  ? 888  LYS A O     1 
ATOM   6379  C  CB    . LYS A 1  888  ? 124.346 154.047 137.038 1.00 70.07  ? 888  LYS A CB    1 
ATOM   6380  C  CG    . LYS A 1  888  ? 124.810 155.494 137.089 1.00 70.90  ? 888  LYS A CG    1 
ATOM   6381  C  CD    . LYS A 1  888  ? 125.244 155.990 135.720 1.00 71.53  ? 888  LYS A CD    1 
ATOM   6382  C  CE    . LYS A 1  888  ? 124.054 156.129 134.787 1.00 66.65  ? 888  LYS A CE    1 
ATOM   6383  N  NZ    . LYS A 1  888  ? 124.460 156.594 133.431 1.00 66.51  ? 888  LYS A NZ    1 
ATOM   6384  N  N     . SER A 1  889  ? 125.030 150.853 137.701 1.00 65.26  ? 889  SER A N     1 
ATOM   6385  C  CA    . SER A 1  889  ? 125.304 149.764 138.629 1.00 64.51  ? 889  SER A CA    1 
ATOM   6386  C  C     . SER A 1  889  ? 126.523 148.955 138.216 1.00 63.89  ? 889  SER A C     1 
ATOM   6387  O  O     . SER A 1  889  ? 127.181 148.354 139.073 1.00 63.00  ? 889  SER A O     1 
ATOM   6388  C  CB    . SER A 1  889  ? 124.086 148.841 138.741 1.00 65.19  ? 889  SER A CB    1 
ATOM   6389  O  OG    . SER A 1  889  ? 122.955 149.545 139.223 1.00 64.55  ? 889  SER A OG    1 
ATOM   6390  N  N     . GLY A 1  890  ? 126.839 148.929 136.921 1.00 66.45  ? 890  GLY A N     1 
ATOM   6391  C  CA    . GLY A 1  890  ? 128.018 148.248 136.425 1.00 67.52  ? 890  GLY A CA    1 
ATOM   6392  C  C     . GLY A 1  890  ? 129.326 148.958 136.691 1.00 68.39  ? 890  GLY A C     1 
ATOM   6393  O  O     . GLY A 1  890  ? 130.386 148.403 136.388 1.00 68.93  ? 890  GLY A O     1 
ATOM   6394  N  N     . ILE A 1  891  ? 129.282 150.170 137.245 1.00 68.20  ? 891  ILE A N     1 
ATOM   6395  C  CA    . ILE A 1  891  ? 130.496 150.869 137.647 1.00 67.80  ? 891  ILE A CA    1 
ATOM   6396  C  C     . ILE A 1  891  ? 130.761 150.744 139.143 1.00 68.25  ? 891  ILE A C     1 
ATOM   6397  O  O     . ILE A 1  891  ? 131.887 151.020 139.585 1.00 68.48  ? 891  ILE A O     1 
ATOM   6398  C  CB    . ILE A 1  891  ? 130.441 152.357 137.242 1.00 69.10  ? 891  ILE A CB    1 
ATOM   6399  C  CG1   . ILE A 1  891  ? 129.285 153.061 137.954 1.00 68.50  ? 891  ILE A CG1   1 
ATOM   6400  C  CG2   . ILE A 1  891  ? 130.309 152.493 135.733 1.00 67.04  ? 891  ILE A CG2   1 
ATOM   6401  C  CD1   . ILE A 1  891  ? 129.172 154.534 137.627 1.00 67.29  ? 891  ILE A CD1   1 
ATOM   6402  N  N     . LEU A 1  892  ? 129.766 150.338 139.933 1.00 65.88  ? 892  LEU A N     1 
ATOM   6403  C  CA    . LEU A 1  892  ? 129.950 150.129 141.362 1.00 65.17  ? 892  LEU A CA    1 
ATOM   6404  C  C     . LEU A 1  892  ? 130.084 148.662 141.739 1.00 64.60  ? 892  LEU A C     1 
ATOM   6405  O  O     . LEU A 1  892  ? 130.727 148.358 142.749 1.00 63.62  ? 892  LEU A O     1 
ATOM   6406  C  CB    . LEU A 1  892  ? 128.787 150.754 142.147 1.00 63.49  ? 892  LEU A CB    1 
ATOM   6407  C  CG    . LEU A 1  892  ? 127.346 150.418 141.745 1.00 63.09  ? 892  LEU A CG    1 
ATOM   6408  C  CD1   . LEU A 1  892  ? 126.848 149.136 142.406 1.00 64.89  ? 892  LEU A CD1   1 
ATOM   6409  C  CD2   . LEU A 1  892  ? 126.422 151.579 142.072 1.00 63.92  ? 892  LEU A CD2   1 
ATOM   6410  N  N     . ASP A 1  893  ? 129.499 147.750 140.958 1.00 65.92  ? 893  ASP A N     1 
ATOM   6411  C  CA    . ASP A 1  893  ? 129.625 146.330 141.266 1.00 67.86  ? 893  ASP A CA    1 
ATOM   6412  C  C     . ASP A 1  893  ? 131.059 145.849 141.097 1.00 69.45  ? 893  ASP A C     1 
ATOM   6413  O  O     . ASP A 1  893  ? 131.485 144.921 141.792 1.00 70.52  ? 893  ASP A O     1 
ATOM   6414  C  CB    . ASP A 1  893  ? 128.684 145.511 140.383 1.00 70.87  ? 893  ASP A CB    1 
ATOM   6415  C  CG    . ASP A 1  893  ? 129.063 145.563 138.915 1.00 71.39  ? 893  ASP A CG    1 
ATOM   6416  O  OD1   . ASP A 1  893  ? 129.747 146.527 138.508 1.00 68.44  ? 893  ASP A OD1   1 
ATOM   6417  O  OD2   . ASP A 1  893  ? 128.680 144.640 138.166 1.00 68.63  ? 893  ASP A OD2   1 
ATOM   6418  N  N     . ALA A 1  894  ? 131.814 146.463 140.184 1.00 68.81  ? 894  ALA A N     1 
ATOM   6419  C  CA    . ALA A 1  894  ? 133.203 146.064 139.983 1.00 68.77  ? 894  ALA A CA    1 
ATOM   6420  C  C     . ALA A 1  894  ? 134.055 146.412 141.195 1.00 69.31  ? 894  ALA A C     1 
ATOM   6421  O  O     . ALA A 1  894  ? 134.785 145.563 141.716 1.00 67.93  ? 894  ALA A O     1 
ATOM   6422  C  CB    . ALA A 1  894  ? 133.761 146.725 138.722 1.00 67.40  ? 894  ALA A CB    1 
ATOM   6423  N  N     . VAL A 1  895  ? 133.970 147.659 141.666 1.00 67.39  ? 895  VAL A N     1 
ATOM   6424  C  CA    . VAL A 1  895  ? 134.797 148.085 142.790 1.00 67.30  ? 895  VAL A CA    1 
ATOM   6425  C  C     . VAL A 1  895  ? 134.311 147.454 144.091 1.00 68.10  ? 895  VAL A C     1 
ATOM   6426  O  O     . VAL A 1  895  ? 135.118 147.051 144.938 1.00 67.91  ? 895  VAL A O     1 
ATOM   6427  C  CB    . VAL A 1  895  ? 134.831 149.624 142.876 1.00 68.73  ? 895  VAL A CB    1 
ATOM   6428  C  CG1   . VAL A 1  895  ? 133.422 150.200 142.826 1.00 66.43  ? 895  VAL A CG1   1 
ATOM   6429  C  CG2   . VAL A 1  895  ? 135.558 150.079 144.134 1.00 65.68  ? 895  VAL A CG2   1 
ATOM   6430  N  N     . THR A 1  896  ? 132.993 147.344 144.269 1.00 62.56  ? 896  THR A N     1 
ATOM   6431  C  CA    . THR A 1  896  ? 132.455 146.772 145.499 1.00 60.34  ? 896  THR A CA    1 
ATOM   6432  C  C     . THR A 1  896  ? 132.799 145.292 145.608 1.00 59.11  ? 896  THR A C     1 
ATOM   6433  O  O     . THR A 1  896  ? 133.348 144.840 146.619 1.00 58.35  ? 896  THR A O     1 
ATOM   6434  C  CB    . THR A 1  896  ? 130.940 146.978 145.562 1.00 58.91  ? 896  THR A CB    1 
ATOM   6435  O  OG1   . THR A 1  896  ? 130.638 148.373 145.435 1.00 60.33  ? 896  THR A OG1   1 
ATOM   6436  C  CG2   . THR A 1  896  ? 130.387 146.462 146.882 1.00 60.03  ? 896  THR A CG2   1 
ATOM   6437  N  N     . SER A 1  897  ? 132.492 144.520 144.564 1.00 60.34  ? 897  SER A N     1 
ATOM   6438  C  CA    . SER A 1  897  ? 132.772 143.090 144.600 1.00 60.29  ? 897  SER A CA    1 
ATOM   6439  C  C     . SER A 1  897  ? 134.263 142.789 144.534 1.00 60.25  ? 897  SER A C     1 
ATOM   6440  O  O     . SER A 1  897  ? 134.662 141.654 144.805 1.00 60.13  ? 897  SER A O     1 
ATOM   6441  C  CB    . SER A 1  897  ? 132.048 142.375 143.458 1.00 60.29  ? 897  SER A CB    1 
ATOM   6442  O  OG    . SER A 1  897  ? 132.310 140.983 143.479 1.00 60.11  ? 897  SER A OG    1 
ATOM   6443  N  N     . SER A 1  898  ? 135.094 143.770 144.175 1.00 60.30  ? 898  SER A N     1 
ATOM   6444  C  CA    . SER A 1  898  ? 136.537 143.547 144.167 1.00 60.31  ? 898  SER A CA    1 
ATOM   6445  C  C     . SER A 1  898  ? 137.119 143.643 145.572 1.00 60.24  ? 898  SER A C     1 
ATOM   6446  O  O     . SER A 1  898  ? 137.860 142.754 146.007 1.00 60.34  ? 898  SER A O     1 
ATOM   6447  C  CB    . SER A 1  898  ? 137.227 144.546 143.237 1.00 59.66  ? 898  SER A CB    1 
ATOM   6448  O  OG    . SER A 1  898  ? 137.159 145.861 143.760 1.00 60.40  ? 898  SER A OG    1 
ATOM   6449  N  N     . LYS A 1  899  ? 136.799 144.720 146.295 1.00 58.05  ? 899  LYS A N     1 
ATOM   6450  C  CA    . LYS A 1  899  ? 137.319 144.873 147.649 1.00 57.00  ? 899  LYS A CA    1 
ATOM   6451  C  C     . LYS A 1  899  ? 136.672 143.876 148.604 1.00 57.35  ? 899  LYS A C     1 
ATOM   6452  O  O     . LYS A 1  899  ? 137.301 143.443 149.576 1.00 57.69  ? 899  LYS A O     1 
ATOM   6453  C  CB    . LYS A 1  899  ? 137.110 146.306 148.138 1.00 57.71  ? 899  LYS A CB    1 
ATOM   6454  C  CG    . LYS A 1  899  ? 135.662 146.758 148.173 1.00 57.76  ? 899  LYS A CG    1 
ATOM   6455  C  CD    . LYS A 1  899  ? 135.544 148.161 148.740 1.00 57.79  ? 899  LYS A CD    1 
ATOM   6456  C  CE    . LYS A 1  899  ? 134.101 148.631 148.748 1.00 55.75  ? 899  LYS A CE    1 
ATOM   6457  N  NZ    . LYS A 1  899  ? 133.220 147.713 149.521 1.00 55.45  ? 899  LYS A NZ    1 
ATOM   6458  N  N     . VAL A 1  900  ? 135.418 143.498 148.344 1.00 54.82  ? 900  VAL A N     1 
ATOM   6459  C  CA    . VAL A 1  900  ? 134.783 142.458 149.147 1.00 54.62  ? 900  VAL A CA    1 
ATOM   6460  C  C     . VAL A 1  900  ? 135.415 141.104 148.850 1.00 54.26  ? 900  VAL A C     1 
ATOM   6461  O  O     . VAL A 1  900  ? 135.673 140.311 149.764 1.00 54.32  ? 900  VAL A O     1 
ATOM   6462  C  CB    . VAL A 1  900  ? 133.262 142.448 148.911 1.00 54.29  ? 900  VAL A CB    1 
ATOM   6463  C  CG1   . VAL A 1  900  ? 132.635 141.214 149.534 1.00 55.35  ? 900  VAL A CG1   1 
ATOM   6464  C  CG2   . VAL A 1  900  ? 132.632 143.705 149.491 1.00 55.18  ? 900  VAL A CG2   1 
ATOM   6465  N  N     . ASN A 1  901  ? 135.681 140.817 147.572 1.00 56.32  ? 901  ASN A N     1 
ATOM   6466  C  CA    . ASN A 1  901  ? 136.429 139.611 147.234 1.00 58.00  ? 901  ASN A CA    1 
ATOM   6467  C  C     . ASN A 1  901  ? 137.840 139.662 147.798 1.00 59.13  ? 901  ASN A C     1 
ATOM   6468  O  O     . ASN A 1  901  ? 138.431 138.616 148.092 1.00 60.11  ? 901  ASN A O     1 
ATOM   6469  C  CB    . ASN A 1  901  ? 136.470 139.416 145.718 1.00 60.87  ? 901  ASN A CB    1 
ATOM   6470  C  CG    . ASN A 1  901  ? 137.057 138.079 145.315 1.00 60.30  ? 901  ASN A CG    1 
ATOM   6471  O  OD1   . ASN A 1  901  ? 137.038 137.120 146.086 1.00 58.37  ? 901  ASN A OD1   1 
ATOM   6472  N  ND2   . ASN A 1  901  ? 137.581 138.007 144.097 1.00 58.74  ? 901  ASN A ND2   1 
ATOM   6473  N  N     . ALA A 1  902  ? 138.397 140.865 147.957 1.00 58.32  ? 902  ALA A N     1 
ATOM   6474  C  CA    . ALA A 1  902  ? 139.683 140.998 148.632 1.00 58.19  ? 902  ALA A CA    1 
ATOM   6475  C  C     . ALA A 1  902  ? 139.572 140.641 150.109 1.00 58.12  ? 902  ALA A C     1 
ATOM   6476  O  O     . ALA A 1  902  ? 140.515 140.085 150.682 1.00 57.64  ? 902  ALA A O     1 
ATOM   6477  C  CB    . ALA A 1  902  ? 140.224 142.418 148.464 1.00 57.92  ? 902  ALA A CB    1 
ATOM   6478  N  N     . ILE A 1  903  ? 138.435 140.952 150.736 1.00 56.74  ? 903  ILE A N     1 
ATOM   6479  C  CA    . ILE A 1  903  ? 138.212 140.538 152.118 1.00 56.03  ? 903  ILE A CA    1 
ATOM   6480  C  C     . ILE A 1  903  ? 138.065 139.024 152.199 1.00 56.51  ? 903  ILE A C     1 
ATOM   6481  O  O     . ILE A 1  903  ? 138.608 138.380 153.104 1.00 56.29  ? 903  ILE A O     1 
ATOM   6482  C  CB    . ILE A 1  903  ? 136.985 141.261 152.702 1.00 55.68  ? 903  ILE A CB    1 
ATOM   6483  C  CG1   . ILE A 1  903  ? 137.210 142.774 152.712 1.00 57.00  ? 903  ILE A CG1   1 
ATOM   6484  C  CG2   . ILE A 1  903  ? 136.684 140.759 154.108 1.00 55.25  ? 903  ILE A CG2   1 
ATOM   6485  C  CD1   . ILE A 1  903  ? 136.037 143.564 153.250 1.00 54.43  ? 903  ILE A CD1   1 
ATOM   6486  N  N     . THR A 1  904  ? 137.331 138.431 151.253 1.00 56.11  ? 904  THR A N     1 
ATOM   6487  C  CA    . THR A 1  904  ? 137.203 136.977 151.227 1.00 57.57  ? 904  THR A CA    1 
ATOM   6488  C  C     . THR A 1  904  ? 138.539 136.317 150.910 1.00 57.61  ? 904  THR A C     1 
ATOM   6489  O  O     . THR A 1  904  ? 138.837 135.229 151.416 1.00 57.73  ? 904  THR A O     1 
ATOM   6490  C  CB    . THR A 1  904  ? 136.144 136.552 150.210 1.00 57.34  ? 904  THR A CB    1 
ATOM   6491  O  OG1   . THR A 1  904  ? 136.581 136.895 148.889 1.00 59.01  ? 904  THR A OG1   1 
ATOM   6492  C  CG2   . THR A 1  904  ? 134.818 137.241 150.498 1.00 59.33  ? 904  THR A CG2   1 
ATOM   6493  N  N     . SER A 1  905  ? 139.354 136.957 150.068 1.00 60.59  ? 905  SER A N     1 
ATOM   6494  C  CA    . SER A 1  905  ? 140.697 136.446 149.826 1.00 62.02  ? 905  SER A CA    1 
ATOM   6495  C  C     . SER A 1  905  ? 141.575 136.589 151.061 1.00 62.04  ? 905  SER A C     1 
ATOM   6496  O  O     . SER A 1  905  ? 142.525 135.819 151.237 1.00 62.24  ? 905  SER A O     1 
ATOM   6497  C  CB    . SER A 1  905  ? 141.335 137.163 148.637 1.00 63.06  ? 905  SER A CB    1 
ATOM   6498  O  OG    . SER A 1  905  ? 141.656 138.503 148.962 1.00 62.95  ? 905  SER A OG    1 
ATOM   6499  N  N     . GLN A 1  906  ? 141.275 137.563 151.922 1.00 64.13  ? 906  GLN A N     1 
ATOM   6500  C  CA    . GLN A 1  906  ? 142.047 137.733 153.149 1.00 64.88  ? 906  GLN A CA    1 
ATOM   6501  C  C     . GLN A 1  906  ? 141.681 136.669 154.177 1.00 66.43  ? 906  GLN A C     1 
ATOM   6502  O  O     . GLN A 1  906  ? 142.560 136.095 154.829 1.00 67.68  ? 906  GLN A O     1 
ATOM   6503  C  CB    . GLN A 1  906  ? 141.825 139.137 153.716 1.00 68.44  ? 906  GLN A CB    1 
ATOM   6504  C  CG    . GLN A 1  906  ? 142.750 139.516 154.869 1.00 69.03  ? 906  GLN A CG    1 
ATOM   6505  C  CD    . GLN A 1  906  ? 142.247 139.028 156.217 1.00 68.69  ? 906  GLN A CD    1 
ATOM   6506  O  OE1   . GLN A 1  906  ? 141.064 138.733 156.383 1.00 63.25  ? 906  GLN A OE1   1 
ATOM   6507  N  NE2   . GLN A 1  906  ? 143.150 138.941 157.188 1.00 62.59  ? 906  GLN A NE2   1 
ATOM   6508  N  N     . VAL A 1  907  ? 140.385 136.391 154.335 1.00 61.93  ? 907  VAL A N     1 
ATOM   6509  C  CA    . VAL A 1  907  ? 139.968 135.399 155.320 1.00 61.00  ? 907  VAL A CA    1 
ATOM   6510  C  C     . VAL A 1  907  ? 140.338 133.994 154.863 1.00 61.67  ? 907  VAL A C     1 
ATOM   6511  O  O     . VAL A 1  907  ? 140.554 133.104 155.693 1.00 62.06  ? 907  VAL A O     1 
ATOM   6512  C  CB    . VAL A 1  907  ? 138.461 135.522 155.615 1.00 61.99  ? 907  VAL A CB    1 
ATOM   6513  C  CG1   . VAL A 1  907  ? 138.126 136.926 156.091 1.00 60.38  ? 907  VAL A CG1   1 
ATOM   6514  C  CG2   . VAL A 1  907  ? 137.634 135.158 154.391 1.00 59.73  ? 907  VAL A CG2   1 
ATOM   6515  N  N     . VAL A 1  908  ? 140.427 133.766 153.551 1.00 61.43  ? 908  VAL A N     1 
ATOM   6516  C  CA    . VAL A 1  908  ? 140.830 132.452 153.060 1.00 63.26  ? 908  VAL A CA    1 
ATOM   6517  C  C     . VAL A 1  908  ? 142.346 132.304 153.025 1.00 64.00  ? 908  VAL A C     1 
ATOM   6518  O  O     . VAL A 1  908  ? 142.852 131.175 152.998 1.00 64.33  ? 908  VAL A O     1 
ATOM   6519  C  CB    . VAL A 1  908  ? 140.230 132.175 151.671 1.00 64.19  ? 908  VAL A CB    1 
ATOM   6520  C  CG1   . VAL A 1  908  ? 141.013 132.901 150.588 1.00 64.21  ? 908  VAL A CG1   1 
ATOM   6521  C  CG2   . VAL A 1  908  ? 140.182 130.678 151.397 1.00 64.00  ? 908  VAL A CG2   1 
ATOM   6522  N  N     . SER A 1  909  ? 143.090 133.410 153.032 1.00 64.08  ? 909  SER A N     1 
ATOM   6523  C  CA    . SER A 1  909  ? 144.544 133.345 153.092 1.00 64.32  ? 909  SER A CA    1 
ATOM   6524  C  C     . SER A 1  909  ? 145.071 133.277 154.517 1.00 64.03  ? 909  SER A C     1 
ATOM   6525  O  O     . SER A 1  909  ? 146.280 133.103 154.706 1.00 63.37  ? 909  SER A O     1 
ATOM   6526  C  CB    . SER A 1  909  ? 145.160 134.552 152.379 1.00 64.73  ? 909  SER A CB    1 
ATOM   6527  O  OG    . SER A 1  909  ? 144.823 135.760 153.038 1.00 64.80  ? 909  SER A OG    1 
ATOM   6528  N  N     . LYS A 1  910  ? 144.201 133.407 155.518 1.00 64.55  ? 910  LYS A N     1 
ATOM   6529  C  CA    . LYS A 1  910  ? 144.610 133.385 156.915 1.00 63.81  ? 910  LYS A CA    1 
ATOM   6530  C  C     . LYS A 1  910  ? 143.986 132.253 157.716 1.00 64.86  ? 910  LYS A C     1 
ATOM   6531  O  O     . LYS A 1  910  ? 144.645 131.713 158.607 1.00 65.84  ? 910  LYS A O     1 
ATOM   6532  C  CB    . LYS A 1  910  ? 144.266 134.723 157.587 1.00 66.10  ? 910  LYS A CB    1 
ATOM   6533  C  CG    . LYS A 1  910  ? 145.177 135.106 158.748 1.00 66.39  ? 910  LYS A CG    1 
ATOM   6534  C  CD    . LYS A 1  910  ? 144.672 134.564 160.075 1.00 66.77  ? 910  LYS A CD    1 
ATOM   6535  C  CE    . LYS A 1  910  ? 145.643 134.877 161.201 1.00 61.85  ? 910  LYS A CE    1 
ATOM   6536  N  NZ    . LYS A 1  910  ? 146.975 134.250 160.973 1.00 61.44  ? 910  LYS A NZ    1 
ATOM   6537  N  N     . CYS A 1  911  ? 142.740 131.875 157.420 1.00 59.72  ? 911  CYS A N     1 
ATOM   6538  C  CA    . CYS A 1  911  ? 142.081 130.824 158.190 1.00 57.97  ? 911  CYS A CA    1 
ATOM   6539  C  C     . CYS A 1  911  ? 142.681 129.458 157.881 1.00 57.70  ? 911  CYS A C     1 
ATOM   6540  O  O     . CYS A 1  911  ? 143.106 128.732 158.787 1.00 57.57  ? 911  CYS A O     1 
ATOM   6541  C  CB    . CYS A 1  911  ? 140.577 130.827 157.908 1.00 56.48  ? 911  CYS A CB    1 
ATOM   6542  S  SG    . CYS A 1  911  ? 140.113 130.056 156.341 1.00 56.02  ? 911  CYS A SG    1 
ATOM   6543  N  N     . VAL A 1  912  ? 142.718 129.086 156.611 1.00 54.66  ? 912  VAL A N     1 
ATOM   6544  C  CA    . VAL A 1  912  ? 143.242 127.793 156.175 1.00 53.29  ? 912  VAL A CA    1 
ATOM   6545  C  C     . VAL A 1  912  ? 144.683 127.988 155.717 1.00 52.95  ? 912  VAL A C     1 
ATOM   6546  O  O     . VAL A 1  912  ? 144.956 128.935 154.965 1.00 52.77  ? 912  VAL A O     1 
ATOM   6547  C  CB    . VAL A 1  912  ? 142.379 127.184 155.050 1.00 52.93  ? 912  VAL A CB    1 
ATOM   6548  C  CG1   . VAL A 1  912  ? 142.093 128.212 153.965 1.00 52.21  ? 912  VAL A CG1   1 
ATOM   6549  C  CG2   . VAL A 1  912  ? 143.048 125.951 154.456 1.00 52.78  ? 912  VAL A CG2   1 
ATOM   6550  N  N     . PRO A 1  913  ? 145.631 127.141 156.152 1.00 52.97  ? 913  PRO A N     1 
ATOM   6551  C  CA    . PRO A 1  913  ? 145.427 126.036 157.093 1.00 53.49  ? 913  PRO A CA    1 
ATOM   6552  C  C     . PRO A 1  913  ? 145.835 126.368 158.527 1.00 53.26  ? 913  PRO A C     1 
ATOM   6553  O  O     . PRO A 1  913  ? 146.520 125.566 159.162 1.00 52.98  ? 913  PRO A O     1 
ATOM   6554  C  CB    . PRO A 1  913  ? 146.331 124.948 156.523 1.00 52.92  ? 913  PRO A CB    1 
ATOM   6555  C  CG    . PRO A 1  913  ? 147.501 125.724 155.989 1.00 54.05  ? 913  PRO A CG    1 
ATOM   6556  C  CD    . PRO A 1  913  ? 146.960 127.066 155.519 1.00 55.08  ? 913  PRO A CD    1 
ATOM   6557  N  N     . ASP A 1  914  ? 145.421 127.529 159.030 1.00 53.44  ? 914  ASP A N     1 
ATOM   6558  C  CA    . ASP A 1  914  ? 145.792 127.976 160.369 1.00 53.18  ? 914  ASP A CA    1 
ATOM   6559  C  C     . ASP A 1  914  ? 144.656 127.895 161.375 1.00 52.97  ? 914  ASP A C     1 
ATOM   6560  O  O     . ASP A 1  914  ? 144.875 127.464 162.509 1.00 52.94  ? 914  ASP A O     1 
ATOM   6561  C  CB    . ASP A 1  914  ? 146.313 129.417 160.316 1.00 52.91  ? 914  ASP A CB    1 
ATOM   6562  C  CG    . ASP A 1  914  ? 147.528 129.565 159.422 1.00 53.22  ? 914  ASP A CG    1 
ATOM   6563  O  OD1   . ASP A 1  914  ? 148.297 128.588 159.293 1.00 53.39  ? 914  ASP A OD1   1 
ATOM   6564  O  OD2   . ASP A 1  914  ? 147.714 130.658 158.846 1.00 53.37  ? 914  ASP A OD2   1 
ATOM   6565  N  N     . GLY A 1  915  ? 143.441 128.298 160.991 1.00 54.47  ? 915  GLY A N     1 
ATOM   6566  C  CA    . GLY A 1  915  ? 142.330 128.312 161.925 1.00 55.90  ? 915  GLY A CA    1 
ATOM   6567  C  C     . GLY A 1  915  ? 141.622 126.986 162.095 1.00 56.56  ? 915  GLY A C     1 
ATOM   6568  O  O     . GLY A 1  915  ? 140.902 126.805 163.081 1.00 56.71  ? 915  GLY A O     1 
ATOM   6569  N  N     . THR A 1  916  ? 141.803 126.060 161.157 1.00 57.74  ? 916  THR A N     1 
ATOM   6570  C  CA    . THR A 1  916  ? 141.139 124.767 161.245 1.00 59.50  ? 916  THR A CA    1 
ATOM   6571  C  C     . THR A 1  916  ? 141.682 123.956 162.418 1.00 60.63  ? 916  THR A C     1 
ATOM   6572  O  O     . THR A 1  916  ? 142.844 124.089 162.812 1.00 61.20  ? 916  THR A O     1 
ATOM   6573  C  CB    . THR A 1  916  ? 141.313 123.984 159.943 1.00 61.13  ? 916  THR A CB    1 
ATOM   6574  O  OG1   . THR A 1  916  ? 140.727 122.682 160.082 1.00 60.56  ? 916  THR A OG1   1 
ATOM   6575  C  CG2   . THR A 1  916  ? 142.788 123.838 159.596 1.00 61.63  ? 916  THR A CG2   1 
ATOM   6576  N  N     . MET A 1  917  ? 140.817 123.113 162.984 1.00 60.94  ? 917  MET A N     1 
ATOM   6577  C  CA    . MET A 1  917  ? 141.223 122.275 164.107 1.00 61.49  ? 917  MET A CA    1 
ATOM   6578  C  C     . MET A 1  917  ? 142.183 121.181 163.652 1.00 62.52  ? 917  MET A C     1 
ATOM   6579  O  O     . MET A 1  917  ? 143.325 121.103 164.120 1.00 63.89  ? 917  MET A O     1 
ATOM   6580  C  CB    . MET A 1  917  ? 139.990 121.670 164.783 1.00 65.62  ? 917  MET A CB    1 
ATOM   6581  C  CG    . MET A 1  917  ? 140.309 120.787 165.979 1.00 65.43  ? 917  MET A CG    1 
ATOM   6582  S  SD    . MET A 1  917  ? 138.830 120.122 166.767 1.00 60.68  ? 917  MET A SD    1 
ATOM   6583  C  CE    . MET A 1  917  ? 138.001 121.631 167.258 1.00 60.74  ? 917  MET A CE    1 
ATOM   6584  N  N     . LYS A 1  918  ? 141.733 120.327 162.739 1.00 59.56  ? 918  LYS A N     1 
ATOM   6585  C  CA    . LYS A 1  918  ? 142.578 119.288 162.165 1.00 59.11  ? 918  LYS A CA    1 
ATOM   6586  C  C     . LYS A 1  918  ? 143.251 119.842 160.916 1.00 59.61  ? 918  LYS A C     1 
ATOM   6587  O  O     . LYS A 1  918  ? 142.575 120.168 159.933 1.00 60.33  ? 918  LYS A O     1 
ATOM   6588  C  CB    . LYS A 1  918  ? 141.755 118.042 161.841 1.00 61.09  ? 918  LYS A CB    1 
ATOM   6589  C  CG    . LYS A 1  918  ? 142.571 116.880 161.308 1.00 61.78  ? 918  LYS A CG    1 
ATOM   6590  C  CD    . LYS A 1  918  ? 141.739 115.609 161.238 1.00 62.20  ? 918  LYS A CD    1 
ATOM   6591  C  CE    . LYS A 1  918  ? 141.290 115.171 162.623 1.00 58.78  ? 918  LYS A CE    1 
ATOM   6592  N  NZ    . LYS A 1  918  ? 140.514 113.900 162.578 1.00 58.48  ? 918  LYS A NZ    1 
ATOM   6593  N  N     . LYS A 1  919  ? 144.576 119.950 160.953 1.00 59.31  ? 919  LYS A N     1 
ATOM   6594  C  CA    . LYS A 1  919  ? 145.336 120.592 159.896 1.00 60.33  ? 919  LYS A CA    1 
ATOM   6595  C  C     . LYS A 1  919  ? 145.983 119.548 158.987 1.00 61.12  ? 919  LYS A C     1 
ATOM   6596  O  O     . LYS A 1  919  ? 145.796 118.339 159.145 1.00 62.45  ? 919  LYS A O     1 
ATOM   6597  C  CB    . LYS A 1  919  ? 146.388 121.531 160.492 1.00 63.20  ? 919  LYS A CB    1 
ATOM   6598  C  CG    . LYS A 1  919  ? 147.363 120.852 161.440 1.00 63.32  ? 919  LYS A CG    1 
ATOM   6599  C  CD    . LYS A 1  919  ? 148.362 121.849 162.004 1.00 63.40  ? 919  LYS A CD    1 
ATOM   6600  C  CE    . LYS A 1  919  ? 147.661 122.967 162.757 1.00 60.75  ? 919  LYS A CE    1 
ATOM   6601  N  NZ    . LYS A 1  919  ? 148.627 123.961 163.302 1.00 61.02  ? 919  LYS A NZ    1 
ATOM   6602  N  N     . PHE A 1  920  ? 146.745 120.034 158.014 1.00 60.67  ? 920  PHE A N     1 
ATOM   6603  C  CA    . PHE A 1  920  ? 147.390 119.156 157.051 1.00 60.45  ? 920  PHE A CA    1 
ATOM   6604  C  C     . PHE A 1  920  ? 148.458 118.312 157.745 1.00 59.94  ? 920  PHE A C     1 
ATOM   6605  O  O     . PHE A 1  920  ? 149.160 118.806 158.633 1.00 59.24  ? 920  PHE A O     1 
ATOM   6606  C  CB    . PHE A 1  920  ? 148.014 119.985 155.927 1.00 58.85  ? 920  PHE A CB    1 
ATOM   6607  C  CG    . PHE A 1  920  ? 148.344 119.196 154.693 1.00 59.18  ? 920  PHE A CG    1 
ATOM   6608  C  CD1   . PHE A 1  920  ? 147.356 118.874 153.777 1.00 59.76  ? 920  PHE A CD1   1 
ATOM   6609  C  CD2   . PHE A 1  920  ? 149.642 118.782 154.445 1.00 60.08  ? 920  PHE A CD2   1 
ATOM   6610  C  CE1   . PHE A 1  920  ? 147.656 118.149 152.639 1.00 59.90  ? 920  PHE A CE1   1 
ATOM   6611  C  CE2   . PHE A 1  920  ? 149.947 118.058 153.309 1.00 61.72  ? 920  PHE A CE2   1 
ATOM   6612  C  CZ    . PHE A 1  920  ? 148.953 117.741 152.405 1.00 62.28  ? 920  PHE A CZ    1 
ATOM   6613  N  N     . PRO A 1  921  ? 148.608 117.031 157.367 1.00 62.46  ? 921  PRO A N     1 
ATOM   6614  C  CA    . PRO A 1  921  ? 147.817 116.326 156.355 1.00 61.81  ? 921  PRO A CA    1 
ATOM   6615  C  C     . PRO A 1  921  ? 146.732 115.419 156.929 1.00 62.62  ? 921  PRO A C     1 
ATOM   6616  O  O     . PRO A 1  921  ? 146.023 114.766 156.164 1.00 63.27  ? 921  PRO A O     1 
ATOM   6617  C  CB    . PRO A 1  921  ? 148.873 115.492 155.637 1.00 63.36  ? 921  PRO A CB    1 
ATOM   6618  C  CG    . PRO A 1  921  ? 149.809 115.106 156.746 1.00 61.49  ? 921  PRO A CG    1 
ATOM   6619  C  CD    . PRO A 1  921  ? 149.801 116.252 157.746 1.00 61.20  ? 921  PRO A CD    1 
ATOM   6620  N  N     . CYS A 1  922  ? 146.605 115.378 158.258 1.00 61.90  ? 922  CYS A N     1 
ATOM   6621  C  CA    . CYS A 1  922  ? 145.667 114.457 158.890 1.00 62.18  ? 922  CYS A CA    1 
ATOM   6622  C  C     . CYS A 1  922  ? 144.208 114.801 158.614 1.00 63.17  ? 922  CYS A C     1 
ATOM   6623  O  O     . CYS A 1  922  ? 143.334 113.981 158.916 1.00 64.28  ? 922  CYS A O     1 
ATOM   6624  C  CB    . CYS A 1  922  ? 145.916 114.407 160.400 1.00 60.74  ? 922  CYS A CB    1 
ATOM   6625  S  SG    . CYS A 1  922  ? 146.029 116.014 161.214 1.00 60.41  ? 922  CYS A SG    1 
ATOM   6626  N  N     . ASN A 1  923  ? 143.922 115.971 158.050 1.00 59.68  ? 923  ASN A N     1 
ATOM   6627  C  CA    . ASN A 1  923  ? 142.558 116.317 157.668 1.00 59.21  ? 923  ASN A CA    1 
ATOM   6628  C  C     . ASN A 1  923  ? 142.237 115.686 156.318 1.00 59.73  ? 923  ASN A C     1 
ATOM   6629  O  O     . ASN A 1  923  ? 142.869 116.009 155.308 1.00 59.89  ? 923  ASN A O     1 
ATOM   6630  C  CB    . ASN A 1  923  ? 142.379 117.833 157.623 1.00 59.46  ? 923  ASN A CB    1 
ATOM   6631  C  CG    . ASN A 1  923  ? 143.561 118.547 156.997 1.00 59.95  ? 923  ASN A CG    1 
ATOM   6632  O  OD1   . ASN A 1  923  ? 144.456 117.919 156.435 1.00 58.28  ? 923  ASN A OD1   1 
ATOM   6633  N  ND2   . ASN A 1  923  ? 143.567 119.871 157.094 1.00 59.54  ? 923  ASN A ND2   1 
ATOM   6634  N  N     . SER A 1  924  ? 141.252 114.787 156.304 1.00 56.82  ? 924  SER A N     1 
ATOM   6635  C  CA    . SER A 1  924  ? 140.973 114.005 155.104 1.00 56.40  ? 924  SER A CA    1 
ATOM   6636  C  C     . SER A 1  924  ? 140.411 114.875 153.985 1.00 56.34  ? 924  SER A C     1 
ATOM   6637  O  O     . SER A 1  924  ? 140.900 114.834 152.849 1.00 56.17  ? 924  SER A O     1 
ATOM   6638  C  CB    . SER A 1  924  ? 140.010 112.868 155.437 1.00 56.46  ? 924  SER A CB    1 
ATOM   6639  O  OG    . SER A 1  924  ? 138.782 113.370 155.935 1.00 56.71  ? 924  SER A OG    1 
ATOM   6640  N  N     . MET A 1  925  ? 139.377 115.664 154.285 1.00 56.01  ? 925  MET A N     1 
ATOM   6641  C  CA    . MET A 1  925  ? 138.730 116.458 153.244 1.00 55.56  ? 925  MET A CA    1 
ATOM   6642  C  C     . MET A 1  925  ? 139.659 117.542 152.712 1.00 55.25  ? 925  MET A C     1 
ATOM   6643  O  O     . MET A 1  925  ? 139.709 117.782 151.500 1.00 55.22  ? 925  MET A O     1 
ATOM   6644  C  CB    . MET A 1  925  ? 137.435 117.069 153.779 1.00 55.51  ? 925  MET A CB    1 
ATOM   6645  C  CG    . MET A 1  925  ? 136.591 117.793 152.736 1.00 55.69  ? 925  MET A CG    1 
ATOM   6646  S  SD    . MET A 1  925  ? 137.033 119.528 152.513 1.00 55.65  ? 925  MET A SD    1 
ATOM   6647  C  CE    . MET A 1  925  ? 135.883 120.010 151.228 1.00 55.32  ? 925  MET A CE    1 
ATOM   6648  N  N     . GLN A 1  926  ? 140.399 118.211 153.600 1.00 56.65  ? 926  GLN A N     1 
ATOM   6649  C  CA    . GLN A 1  926  ? 141.319 119.248 153.146 1.00 57.92  ? 926  GLN A CA    1 
ATOM   6650  C  C     . GLN A 1  926  ? 142.462 118.665 152.326 1.00 58.46  ? 926  GLN A C     1 
ATOM   6651  O  O     . GLN A 1  926  ? 142.857 119.258 151.318 1.00 59.26  ? 926  GLN A O     1 
ATOM   6652  C  CB    . GLN A 1  926  ? 141.870 120.033 154.336 1.00 59.82  ? 926  GLN A CB    1 
ATOM   6653  C  CG    . GLN A 1  926  ? 140.866 120.960 155.010 1.00 59.44  ? 926  GLN A CG    1 
ATOM   6654  C  CD    . GLN A 1  926  ? 139.914 120.231 155.938 1.00 60.40  ? 926  GLN A CD    1 
ATOM   6655  O  OE1   . GLN A 1  926  ? 139.882 119.002 155.976 1.00 58.77  ? 926  GLN A OE1   1 
ATOM   6656  N  NE2   . GLN A 1  926  ? 139.131 120.991 156.693 1.00 58.66  ? 926  GLN A NE2   1 
ATOM   6657  N  N     . ALA A 1  927  ? 142.998 117.511 152.729 1.00 61.10  ? 927  ALA A N     1 
ATOM   6658  C  CA    . ALA A 1  927  ? 144.090 116.905 151.974 1.00 62.80  ? 927  ALA A CA    1 
ATOM   6659  C  C     . ALA A 1  927  ? 143.627 116.455 150.594 1.00 63.48  ? 927  ALA A C     1 
ATOM   6660  O  O     . ALA A 1  927  ? 144.396 116.507 149.628 1.00 62.77  ? 927  ALA A O     1 
ATOM   6661  C  CB    . ALA A 1  927  ? 144.685 115.729 152.749 1.00 63.43  ? 927  ALA A CB    1 
ATOM   6662  N  N     . MET A 1  928  ? 142.375 116.010 150.483 1.00 62.16  ? 928  MET A N     1 
ATOM   6663  C  CA    . MET A 1  928  ? 141.848 115.595 149.187 1.00 62.07  ? 928  MET A CA    1 
ATOM   6664  C  C     . MET A 1  928  ? 141.639 116.794 148.271 1.00 62.66  ? 928  MET A C     1 
ATOM   6665  O  O     . MET A 1  928  ? 142.085 116.798 147.117 1.00 63.36  ? 928  MET A O     1 
ATOM   6666  C  CB    . MET A 1  928  ? 140.538 114.827 149.374 1.00 63.60  ? 928  MET A CB    1 
ATOM   6667  C  CG    . MET A 1  928  ? 139.793 114.578 148.076 1.00 63.63  ? 928  MET A CG    1 
ATOM   6668  S  SD    . MET A 1  928  ? 138.155 113.869 148.316 1.00 61.56  ? 928  MET A SD    1 
ATOM   6669  C  CE    . MET A 1  928  ? 137.525 113.948 146.644 1.00 61.81  ? 928  MET A CE    1 
ATOM   6670  N  N     . ALA A 1  929  ? 140.958 117.828 148.771 1.00 60.72  ? 929  ALA A N     1 
ATOM   6671  C  CA    . ALA A 1  929  ? 140.680 118.996 147.944 1.00 60.08  ? 929  ALA A CA    1 
ATOM   6672  C  C     . ALA A 1  929  ? 141.942 119.801 147.661 1.00 59.59  ? 929  ALA A C     1 
ATOM   6673  O  O     . ALA A 1  929  ? 142.053 120.425 146.599 1.00 59.70  ? 929  ALA A O     1 
ATOM   6674  C  CB    . ALA A 1  929  ? 139.624 119.874 148.615 1.00 58.82  ? 929  ALA A CB    1 
ATOM   6675  N  N     . LEU A 1  930  ? 142.899 119.805 148.591 1.00 59.93  ? 930  LEU A N     1 
ATOM   6676  C  CA    . LEU A 1  930  ? 144.165 120.486 148.336 1.00 60.11  ? 930  LEU A CA    1 
ATOM   6677  C  C     . LEU A 1  930  ? 144.995 119.737 147.302 1.00 62.12  ? 930  LEU A C     1 
ATOM   6678  O  O     . LEU A 1  930  ? 145.751 120.360 146.548 1.00 63.67  ? 930  LEU A O     1 
ATOM   6679  C  CB    . LEU A 1  930  ? 144.948 120.651 149.642 1.00 63.90  ? 930  LEU A CB    1 
ATOM   6680  C  CG    . LEU A 1  930  ? 146.163 121.584 149.701 1.00 64.15  ? 930  LEU A CG    1 
ATOM   6681  C  CD1   . LEU A 1  930  ? 147.448 120.868 149.303 1.00 57.96  ? 930  LEU A CD1   1 
ATOM   6682  C  CD2   . LEU A 1  930  ? 145.938 122.816 148.836 1.00 58.06  ? 930  LEU A CD2   1 
ATOM   6683  N  N     . SER A 1  931  ? 144.867 118.409 147.249 1.00 56.07  ? 931  SER A N     1 
ATOM   6684  C  CA    . SER A 1  931  ? 145.585 117.632 146.246 1.00 55.14  ? 931  SER A CA    1 
ATOM   6685  C  C     . SER A 1  931  ? 145.028 117.844 144.845 1.00 55.45  ? 931  SER A C     1 
ATOM   6686  O  O     . SER A 1  931  ? 145.727 117.569 143.866 1.00 55.50  ? 931  SER A O     1 
ATOM   6687  C  CB    . SER A 1  931  ? 145.544 116.145 146.604 1.00 54.06  ? 931  SER A CB    1 
ATOM   6688  O  OG    . SER A 1  931  ? 144.210 115.671 146.666 1.00 53.81  ? 931  SER A OG    1 
ATOM   6689  N  N     . GLY A 1  932  ? 143.798 118.334 144.726 1.00 53.78  ? 932  GLY A N     1 
ATOM   6690  C  CA    . GLY A 1  932  ? 143.192 118.563 143.433 1.00 53.75  ? 932  GLY A CA    1 
ATOM   6691  C  C     . GLY A 1  932  ? 142.455 117.386 142.839 1.00 53.32  ? 932  GLY A C     1 
ATOM   6692  O  O     . GLY A 1  932  ? 142.157 117.409 141.638 1.00 53.59  ? 932  GLY A O     1 
ATOM   6693  N  N     . ALA A 1  933  ? 142.157 116.354 143.631 1.00 52.55  ? 933  ALA A N     1 
ATOM   6694  C  CA    . ALA A 1  933  ? 141.370 115.232 143.129 1.00 52.01  ? 933  ALA A CA    1 
ATOM   6695  C  C     . ALA A 1  933  ? 139.973 115.690 142.726 1.00 51.81  ? 933  ALA A C     1 
ATOM   6696  O  O     . ALA A 1  933  ? 139.564 115.545 141.569 1.00 52.07  ? 933  ALA A O     1 
ATOM   6697  C  CB    . ALA A 1  933  ? 141.299 114.128 144.186 1.00 51.93  ? 933  ALA A CB    1 
ATOM   6698  N  N     . LYS A 1  934  ? 139.228 116.247 143.676 1.00 53.22  ? 934  LYS A N     1 
ATOM   6699  C  CA    . LYS A 1  934  ? 137.939 116.863 143.401 1.00 54.81  ? 934  LYS A CA    1 
ATOM   6700  C  C     . LYS A 1  934  ? 137.798 118.092 144.284 1.00 56.51  ? 934  LYS A C     1 
ATOM   6701  O  O     . LYS A 1  934  ? 138.114 118.047 145.476 1.00 58.13  ? 934  LYS A O     1 
ATOM   6702  C  CB    . LYS A 1  934  ? 136.777 115.892 143.650 1.00 59.75  ? 934  LYS A CB    1 
ATOM   6703  C  CG    . LYS A 1  934  ? 135.490 116.276 142.937 1.00 60.99  ? 934  LYS A CG    1 
ATOM   6704  C  CD    . LYS A 1  934  ? 134.321 115.426 143.401 1.00 62.08  ? 934  LYS A CD    1 
ATOM   6705  C  CE    . LYS A 1  934  ? 133.123 115.577 142.477 1.00 54.52  ? 934  LYS A CE    1 
ATOM   6706  N  NZ    . LYS A 1  934  ? 131.961 114.769 142.937 1.00 54.32  ? 934  LYS A NZ    1 
ATOM   6707  N  N     . GLY A 1  935  ? 137.326 119.185 143.696 1.00 54.51  ? 935  GLY A N     1 
ATOM   6708  C  CA    . GLY A 1  935  ? 137.270 120.455 144.386 1.00 54.82  ? 935  GLY A CA    1 
ATOM   6709  C  C     . GLY A 1  935  ? 138.626 121.137 144.429 1.00 55.46  ? 935  GLY A C     1 
ATOM   6710  O  O     . GLY A 1  935  ? 139.658 120.584 144.048 1.00 55.51  ? 935  GLY A O     1 
ATOM   6711  N  N     . SER A 1  936  ? 138.616 122.376 144.910 1.00 57.05  ? 936  SER A N     1 
ATOM   6712  C  CA    . SER A 1  936  ? 139.824 123.190 144.964 1.00 58.31  ? 936  SER A CA    1 
ATOM   6713  C  C     . SER A 1  936  ? 139.663 124.217 146.080 1.00 59.50  ? 936  SER A C     1 
ATOM   6714  O  O     . SER A 1  936  ? 138.744 124.127 146.901 1.00 59.80  ? 936  SER A O     1 
ATOM   6715  C  CB    . SER A 1  936  ? 140.100 123.852 143.609 1.00 58.17  ? 936  SER A CB    1 
ATOM   6716  O  OG    . SER A 1  936  ? 140.366 122.883 142.611 1.00 58.76  ? 936  SER A OG    1 
ATOM   6717  N  N     . ASN A 1  937  ? 140.568 125.198 146.110 1.00 57.53  ? 937  ASN A N     1 
ATOM   6718  C  CA    . ASN A 1  937  ? 140.516 126.230 147.140 1.00 56.80  ? 937  ASN A CA    1 
ATOM   6719  C  C     . ASN A 1  937  ? 139.240 127.057 147.048 1.00 57.67  ? 937  ASN A C     1 
ATOM   6720  O  O     . ASN A 1  937  ? 138.797 127.626 148.052 1.00 58.49  ? 937  ASN A O     1 
ATOM   6721  C  CB    . ASN A 1  937  ? 141.745 127.135 147.042 1.00 58.04  ? 937  ASN A CB    1 
ATOM   6722  C  CG    . ASN A 1  937  ? 143.039 126.388 147.299 1.00 59.23  ? 937  ASN A CG    1 
ATOM   6723  O  OD1   . ASN A 1  937  ? 143.076 125.441 148.085 1.00 55.30  ? 937  ASN A OD1   1 
ATOM   6724  N  ND2   . ASN A 1  937  ? 144.109 126.812 146.637 1.00 55.25  ? 937  ASN A ND2   1 
ATOM   6725  N  N     . VAL A 1  938  ? 138.637 127.139 145.859 1.00 54.18  ? 938  VAL A N     1 
ATOM   6726  C  CA    . VAL A 1  938  ? 137.373 127.848 145.715 1.00 53.78  ? 938  VAL A CA    1 
ATOM   6727  C  C     . VAL A 1  938  ? 136.250 127.136 146.460 1.00 54.85  ? 938  VAL A C     1 
ATOM   6728  O  O     . VAL A 1  938  ? 135.282 127.782 146.882 1.00 55.03  ? 938  VAL A O     1 
ATOM   6729  C  CB    . VAL A 1  938  ? 137.031 128.027 144.222 1.00 55.21  ? 938  VAL A CB    1 
ATOM   6730  C  CG1   . VAL A 1  938  ? 136.749 126.682 143.564 1.00 52.63  ? 938  VAL A CG1   1 
ATOM   6731  C  CG2   . VAL A 1  938  ? 135.856 128.982 144.044 1.00 52.34  ? 938  VAL A CG2   1 
ATOM   6732  N  N     . ASN A 1  939  ? 136.359 125.821 146.652 1.00 51.07  ? 939  ASN A N     1 
ATOM   6733  C  CA    . ASN A 1  939  ? 135.355 125.071 147.395 1.00 50.84  ? 939  ASN A CA    1 
ATOM   6734  C  C     . ASN A 1  939  ? 135.681 124.982 148.880 1.00 50.79  ? 939  ASN A C     1 
ATOM   6735  O  O     . ASN A 1  939  ? 134.768 125.001 149.713 1.00 50.86  ? 939  ASN A O     1 
ATOM   6736  C  CB    . ASN A 1  939  ? 135.203 123.666 146.808 1.00 51.38  ? 939  ASN A CB    1 
ATOM   6737  C  CG    . ASN A 1  939  ? 134.528 123.674 145.450 1.00 51.01  ? 939  ASN A CG    1 
ATOM   6738  O  OD1   . ASN A 1  939  ? 133.690 124.529 145.167 1.00 51.16  ? 939  ASN A OD1   1 
ATOM   6739  N  ND2   . ASN A 1  939  ? 134.891 122.719 144.603 1.00 50.64  ? 939  ASN A ND2   1 
ATOM   6740  N  N     . VAL A 1  940  ? 136.966 124.884 149.235 1.00 52.68  ? 940  VAL A N     1 
ATOM   6741  C  CA    . VAL A 1  940  ? 137.327 124.879 150.648 1.00 54.02  ? 940  VAL A CA    1 
ATOM   6742  C  C     . VAL A 1  940  ? 137.140 126.255 151.268 1.00 54.80  ? 940  VAL A C     1 
ATOM   6743  O  O     . VAL A 1  940  ? 137.042 126.368 152.493 1.00 55.20  ? 940  VAL A O     1 
ATOM   6744  C  CB    . VAL A 1  940  ? 138.771 124.384 150.855 1.00 55.28  ? 940  VAL A CB    1 
ATOM   6745  C  CG1   . VAL A 1  940  ? 139.044 123.158 150.001 1.00 55.78  ? 940  VAL A CG1   1 
ATOM   6746  C  CG2   . VAL A 1  940  ? 139.774 125.492 150.566 1.00 55.06  ? 940  VAL A CG2   1 
ATOM   6747  N  N     . SER A 1  941  ? 137.085 127.310 150.453 1.00 56.37  ? 941  SER A N     1 
ATOM   6748  C  CA    . SER A 1  941  ? 136.795 128.637 150.985 1.00 57.42  ? 941  SER A CA    1 
ATOM   6749  C  C     . SER A 1  941  ? 135.362 128.711 151.496 1.00 58.72  ? 941  SER A C     1 
ATOM   6750  O  O     . SER A 1  941  ? 135.099 129.263 152.571 1.00 59.14  ? 941  SER A O     1 
ATOM   6751  C  CB    . SER A 1  941  ? 137.040 129.697 149.911 1.00 56.52  ? 941  SER A CB    1 
ATOM   6752  O  OG    . SER A 1  941  ? 136.213 129.478 148.781 1.00 56.21  ? 941  SER A OG    1 
ATOM   6753  N  N     . GLN A 1  942  ? 134.421 128.147 150.738 1.00 55.73  ? 942  GLN A N     1 
ATOM   6754  C  CA    . GLN A 1  942  ? 133.020 128.189 151.139 1.00 55.41  ? 942  GLN A CA    1 
ATOM   6755  C  C     . GLN A 1  942  ? 132.743 127.223 152.284 1.00 55.09  ? 942  GLN A C     1 
ATOM   6756  O  O     . GLN A 1  942  ? 131.907 127.503 153.151 1.00 55.02  ? 942  GLN A O     1 
ATOM   6757  C  CB    . GLN A 1  942  ? 132.125 127.869 149.942 1.00 54.96  ? 942  GLN A CB    1 
ATOM   6758  C  CG    . GLN A 1  942  ? 132.488 128.624 148.674 1.00 54.75  ? 942  GLN A CG    1 
ATOM   6759  C  CD    . GLN A 1  942  ? 131.549 128.317 147.523 1.00 55.06  ? 942  GLN A CD    1 
ATOM   6760  O  OE1   . GLN A 1  942  ? 130.660 127.474 147.640 1.00 55.98  ? 942  GLN A OE1   1 
ATOM   6761  N  NE2   . GLN A 1  942  ? 131.742 129.004 146.403 1.00 56.35  ? 942  GLN A NE2   1 
ATOM   6762  N  N     . ILE A 1  943  ? 133.435 126.080 152.307 1.00 57.16  ? 943  ILE A N     1 
ATOM   6763  C  CA    . ILE A 1  943  ? 133.142 125.046 153.297 1.00 58.37  ? 943  ILE A CA    1 
ATOM   6764  C  C     . ILE A 1  943  ? 133.919 125.218 154.593 1.00 59.95  ? 943  ILE A C     1 
ATOM   6765  O  O     . ILE A 1  943  ? 133.570 124.584 155.596 1.00 60.08  ? 943  ILE A O     1 
ATOM   6766  C  CB    . ILE A 1  943  ? 133.413 123.648 152.705 1.00 60.03  ? 943  ILE A CB    1 
ATOM   6767  C  CG1   . ILE A 1  943  ? 132.555 122.594 153.407 1.00 60.67  ? 943  ILE A CG1   1 
ATOM   6768  C  CG2   . ILE A 1  943  ? 134.885 123.290 152.819 1.00 57.95  ? 943  ILE A CG2   1 
ATOM   6769  C  CD1   . ILE A 1  943  ? 131.078 122.914 153.403 1.00 57.63  ? 943  ILE A CD1   1 
ATOM   6770  N  N     . MET A 1  944  ? 134.958 126.054 154.613 1.00 58.11  ? 944  MET A N     1 
ATOM   6771  C  CA    . MET A 1  944  ? 135.735 126.272 155.830 1.00 58.34  ? 944  MET A CA    1 
ATOM   6772  C  C     . MET A 1  944  ? 135.372 127.579 156.526 1.00 59.56  ? 944  MET A C     1 
ATOM   6773  O  O     . MET A 1  944  ? 134.980 127.571 157.697 1.00 60.32  ? 944  MET A O     1 
ATOM   6774  C  CB    . MET A 1  944  ? 137.239 126.238 155.519 1.00 60.86  ? 944  MET A CB    1 
ATOM   6775  C  CG    . MET A 1  944  ? 137.813 124.844 155.300 1.00 61.13  ? 944  MET A CG    1 
ATOM   6776  S  SD    . MET A 1  944  ? 137.699 123.775 156.751 1.00 57.47  ? 944  MET A SD    1 
ATOM   6777  C  CE    . MET A 1  944  ? 136.268 122.776 156.344 1.00 56.69  ? 944  MET A CE    1 
ATOM   6778  N  N     . CYS A 1  945  ? 135.492 128.709 155.829 1.00 57.92  ? 945  CYS A N     1 
ATOM   6779  C  CA    . CYS A 1  945  ? 135.332 130.011 156.467 1.00 58.62  ? 945  CYS A CA    1 
ATOM   6780  C  C     . CYS A 1  945  ? 134.142 130.794 155.928 1.00 60.13  ? 945  CYS A C     1 
ATOM   6781  O  O     . CYS A 1  945  ? 133.260 131.167 156.708 1.00 61.90  ? 945  CYS A O     1 
ATOM   6782  C  CB    . CYS A 1  945  ? 136.622 130.826 156.306 1.00 57.47  ? 945  CYS A CB    1 
ATOM   6783  S  SG    . CYS A 1  945  ? 137.090 131.150 154.589 1.00 58.10  ? 945  CYS A SG    1 
ATOM   6784  N  N     . LEU A 1  946  ? 134.074 131.039 154.619 1.00 55.97  ? 946  LEU A N     1 
ATOM   6785  C  CA    . LEU A 1  946  ? 133.072 131.953 154.083 1.00 54.79  ? 946  LEU A CA    1 
ATOM   6786  C  C     . LEU A 1  946  ? 133.001 131.847 152.564 1.00 53.06  ? 946  LEU A C     1 
ATOM   6787  O  O     . LEU A 1  946  ? 134.034 131.812 151.888 1.00 52.09  ? 946  LEU A O     1 
ATOM   6788  C  CB    . LEU A 1  946  ? 133.393 133.386 154.530 1.00 51.92  ? 946  LEU A CB    1 
ATOM   6789  C  CG    . LEU A 1  946  ? 132.396 134.532 154.333 1.00 51.59  ? 946  LEU A CG    1 
ATOM   6790  C  CD1   . LEU A 1  946  ? 132.587 135.205 152.990 1.00 56.36  ? 946  LEU A CD1   1 
ATOM   6791  C  CD2   . LEU A 1  946  ? 130.966 134.034 154.486 1.00 56.67  ? 946  LEU A CD2   1 
ATOM   6792  N  N     . LEU A 1  947  ? 131.782 131.800 152.017 1.00 58.44  ? 947  LEU A N     1 
ATOM   6793  C  CA    . LEU A 1  947  ? 131.611 131.576 150.585 1.00 59.92  ? 947  LEU A CA    1 
ATOM   6794  C  C     . LEU A 1  947  ? 131.849 132.837 149.763 1.00 59.78  ? 947  LEU A C     1 
ATOM   6795  O  O     . LEU A 1  947  ? 132.434 132.759 148.677 1.00 59.84  ? 947  LEU A O     1 
ATOM   6796  C  CB    . LEU A 1  947  ? 130.216 131.012 150.295 1.00 59.95  ? 947  LEU A CB    1 
ATOM   6797  C  CG    . LEU A 1  947  ? 128.974 131.724 150.837 1.00 60.25  ? 947  LEU A CG    1 
ATOM   6798  C  CD1   . LEU A 1  947  ? 127.796 131.489 149.908 1.00 60.92  ? 947  LEU A CD1   1 
ATOM   6799  C  CD2   . LEU A 1  947  ? 128.638 131.240 152.239 1.00 62.15  ? 947  LEU A CD2   1 
ATOM   6800  N  N     . GLY A 1  948  ? 131.407 133.993 150.247 1.00 60.32  ? 948  GLY A N     1 
ATOM   6801  C  CA    . GLY A 1  948  ? 131.665 135.241 149.554 1.00 59.44  ? 948  GLY A CA    1 
ATOM   6802  C  C     . GLY A 1  948  ? 130.417 135.972 149.107 1.00 58.12  ? 948  GLY A C     1 
ATOM   6803  O  O     . GLY A 1  948  ? 129.337 135.782 149.673 1.00 57.56  ? 948  GLY A O     1 
ATOM   6804  N  N     . GLN A 1  949  ? 130.559 136.815 148.090 1.00 56.84  ? 949  GLN A N     1 
ATOM   6805  C  CA    . GLN A 1  949  ? 129.455 137.600 147.553 1.00 55.74  ? 949  GLN A CA    1 
ATOM   6806  C  C     . GLN A 1  949  ? 128.853 136.846 146.374 1.00 55.74  ? 949  GLN A C     1 
ATOM   6807  O  O     . GLN A 1  949  ? 129.546 136.566 145.390 1.00 55.34  ? 949  GLN A O     1 
ATOM   6808  C  CB    . GLN A 1  949  ? 129.934 138.990 147.130 1.00 54.67  ? 949  GLN A CB    1 
ATOM   6809  C  CG    . GLN A 1  949  ? 128.835 140.040 147.028 1.00 54.36  ? 949  GLN A CG    1 
ATOM   6810  C  CD    . GLN A 1  949  ? 128.038 139.936 145.744 1.00 54.77  ? 949  GLN A CD    1 
ATOM   6811  O  OE1   . GLN A 1  949  ? 128.523 139.419 144.740 1.00 55.23  ? 949  GLN A OE1   1 
ATOM   6812  N  NE2   . GLN A 1  949  ? 126.806 140.432 145.769 1.00 55.19  ? 949  GLN A NE2   1 
ATOM   6813  N  N     . GLN A 1  950  ? 127.566 136.521 146.476 1.00 55.48  ? 950  GLN A N     1 
ATOM   6814  C  CA    . GLN A 1  950  ? 126.872 135.731 145.459 1.00 56.02  ? 950  GLN A CA    1 
ATOM   6815  C  C     . GLN A 1  950  ? 126.555 136.633 144.273 1.00 56.27  ? 950  GLN A C     1 
ATOM   6816  O  O     . GLN A 1  950  ? 125.470 137.206 144.167 1.00 57.17  ? 950  GLN A O     1 
ATOM   6817  C  CB    . GLN A 1  950  ? 125.613 135.101 146.039 1.00 57.61  ? 950  GLN A CB    1 
ATOM   6818  C  CG    . GLN A 1  950  ? 125.882 134.136 147.181 1.00 56.70  ? 950  GLN A CG    1 
ATOM   6819  C  CD    . GLN A 1  950  ? 124.619 133.726 147.907 1.00 58.65  ? 950  GLN A CD    1 
ATOM   6820  O  OE1   . GLN A 1  950  ? 123.547 134.282 147.673 1.00 56.36  ? 950  GLN A OE1   1 
ATOM   6821  N  NE2   . GLN A 1  950  ? 124.739 132.749 148.797 1.00 55.79  ? 950  GLN A NE2   1 
ATOM   6822  N  N     . ALA A 1  951  ? 127.522 136.759 143.368 1.00 57.56  ? 951  ALA A N     1 
ATOM   6823  C  CA    . ALA A 1  951  ? 127.369 137.587 142.181 1.00 58.17  ? 951  ALA A CA    1 
ATOM   6824  C  C     . ALA A 1  951  ? 126.847 136.760 141.015 1.00 58.64  ? 951  ALA A C     1 
ATOM   6825  O  O     . ALA A 1  951  ? 127.225 135.598 140.842 1.00 58.15  ? 951  ALA A O     1 
ATOM   6826  C  CB    . ALA A 1  951  ? 128.699 138.238 141.800 1.00 57.76  ? 951  ALA A CB    1 
ATOM   6827  N  N     . LEU A 1  952  ? 125.976 137.369 140.217 1.00 59.31  ? 952  LEU A N     1 
ATOM   6828  C  CA    . LEU A 1  952  ? 125.494 136.753 138.988 1.00 60.52  ? 952  LEU A CA    1 
ATOM   6829  C  C     . LEU A 1  952  ? 126.526 136.987 137.886 1.00 60.74  ? 952  LEU A C     1 
ATOM   6830  O  O     . LEU A 1  952  ? 127.658 137.407 138.141 1.00 60.54  ? 952  LEU A O     1 
ATOM   6831  C  CB    . LEU A 1  952  ? 124.116 137.299 138.619 1.00 60.34  ? 952  LEU A CB    1 
ATOM   6832  C  CG    . LEU A 1  952  ? 122.937 136.966 139.540 1.00 60.14  ? 952  LEU A CG    1 
ATOM   6833  C  CD1   . LEU A 1  952  ? 123.011 135.521 140.010 1.00 61.76  ? 952  LEU A CD1   1 
ATOM   6834  C  CD2   . LEU A 1  952  ? 122.846 137.921 140.724 1.00 62.25  ? 952  LEU A CD2   1 
ATOM   6835  N  N     . GLU A 1  953  ? 126.148 136.714 136.640 1.00 63.10  ? 953  GLU A N     1 
ATOM   6836  C  CA    . GLU A 1  953  ? 127.057 136.916 135.514 1.00 64.58  ? 953  GLU A CA    1 
ATOM   6837  C  C     . GLU A 1  953  ? 127.262 138.412 135.308 1.00 66.43  ? 953  GLU A C     1 
ATOM   6838  O  O     . GLU A 1  953  ? 126.420 139.097 134.724 1.00 67.75  ? 953  GLU A O     1 
ATOM   6839  C  CB    . GLU A 1  953  ? 126.508 136.241 134.260 1.00 68.35  ? 953  GLU A CB    1 
ATOM   6840  C  CG    . GLU A 1  953  ? 125.000 136.365 134.076 1.00 68.49  ? 953  GLU A CG    1 
ATOM   6841  C  CD    . GLU A 1  953  ? 124.619 137.388 133.024 1.00 68.26  ? 953  GLU A CD    1 
ATOM   6842  O  OE1   . GLU A 1  953  ? 125.519 137.857 132.295 1.00 64.20  ? 953  GLU A OE1   1 
ATOM   6843  O  OE2   . GLU A 1  953  ? 123.420 137.724 132.925 1.00 64.26  ? 953  GLU A OE2   1 
ATOM   6844  N  N     . GLY A 1  954  ? 128.394 138.919 135.788 1.00 63.93  ? 954  GLY A N     1 
ATOM   6845  C  CA    . GLY A 1  954  ? 128.687 140.344 135.673 1.00 63.57  ? 954  GLY A CA    1 
ATOM   6846  C  C     . GLY A 1  954  ? 127.613 141.241 136.248 1.00 62.61  ? 954  GLY A C     1 
ATOM   6847  O  O     . GLY A 1  954  ? 127.358 142.326 135.711 1.00 63.23  ? 954  GLY A O     1 
ATOM   6848  N  N     . ARG A 1  955  ? 126.978 140.814 137.337 1.00 60.76  ? 955  ARG A N     1 
ATOM   6849  C  CA    . ARG A 1  955  ? 125.886 141.579 137.921 1.00 59.09  ? 955  ARG A CA    1 
ATOM   6850  C  C     . ARG A 1  955  ? 125.638 141.097 139.342 1.00 58.51  ? 955  ARG A C     1 
ATOM   6851  O  O     . ARG A 1  955  ? 125.837 139.920 139.656 1.00 58.19  ? 955  ARG A O     1 
ATOM   6852  C  CB    . ARG A 1  955  ? 124.608 141.453 137.080 1.00 57.46  ? 955  ARG A CB    1 
ATOM   6853  C  CG    . ARG A 1  955  ? 123.478 142.381 137.502 1.00 56.80  ? 955  ARG A CG    1 
ATOM   6854  C  CD    . ARG A 1  955  ? 123.975 143.808 137.644 1.00 56.41  ? 955  ARG A CD    1 
ATOM   6855  N  NE    . ARG A 1  955  ? 124.634 144.280 136.431 1.00 56.66  ? 955  ARG A NE    1 
ATOM   6856  C  CZ    . ARG A 1  955  ? 125.399 145.365 136.375 1.00 56.29  ? 955  ARG A CZ    1 
ATOM   6857  N  NH1   . ARG A 1  955  ? 125.603 146.089 137.466 1.00 58.60  ? 955  ARG A NH1   1 
ATOM   6858  N  NH2   . ARG A 1  955  ? 125.961 145.724 135.229 1.00 59.37  ? 955  ARG A NH2   1 
ATOM   6859  N  N     . ARG A 1  956  ? 125.207 142.022 140.196 1.00 57.59  ? 956  ARG A N     1 
ATOM   6860  C  CA    . ARG A 1  956  ? 124.824 141.702 141.562 1.00 57.31  ? 956  ARG A CA    1 
ATOM   6861  C  C     . ARG A 1  956  ? 123.333 141.372 141.602 1.00 57.49  ? 956  ARG A C     1 
ATOM   6862  O  O     . ARG A 1  956  ? 122.689 141.179 140.566 1.00 57.99  ? 956  ARG A O     1 
ATOM   6863  C  CB    . ARG A 1  956  ? 125.176 142.858 142.498 1.00 58.61  ? 956  ARG A CB    1 
ATOM   6864  C  CG    . ARG A 1  956  ? 124.442 144.153 142.187 1.00 58.90  ? 956  ARG A CG    1 
ATOM   6865  C  CD    . ARG A 1  956  ? 124.581 145.153 143.324 1.00 58.85  ? 956  ARG A CD    1 
ATOM   6866  N  NE    . ARG A 1  956  ? 125.975 145.487 143.596 1.00 59.10  ? 956  ARG A NE    1 
ATOM   6867  C  CZ    . ARG A 1  956  ? 126.369 146.310 144.562 1.00 58.45  ? 956  ARG A CZ    1 
ATOM   6868  N  NH1   . ARG A 1  956  ? 127.660 146.557 144.740 1.00 57.06  ? 956  ARG A NH1   1 
ATOM   6869  N  NH2   . ARG A 1  956  ? 125.474 146.885 145.353 1.00 57.48  ? 956  ARG A NH2   1 
ATOM   6870  N  N     . VAL A 1  957  ? 122.769 141.299 142.804 1.00 56.77  ? 957  VAL A N     1 
ATOM   6871  C  CA    . VAL A 1  957  ? 121.334 141.018 142.932 1.00 56.60  ? 957  VAL A CA    1 
ATOM   6872  C  C     . VAL A 1  957  ? 120.538 142.180 142.346 1.00 57.06  ? 957  VAL A C     1 
ATOM   6873  O  O     . VAL A 1  957  ? 120.850 143.354 142.629 1.00 57.48  ? 957  VAL A O     1 
ATOM   6874  C  CB    . VAL A 1  957  ? 120.962 140.769 144.407 1.00 56.83  ? 957  VAL A CB    1 
ATOM   6875  C  CG1   . VAL A 1  957  ? 121.429 141.921 145.290 1.00 55.85  ? 957  VAL A CG1   1 
ATOM   6876  C  CG2   . VAL A 1  957  ? 119.463 140.557 144.551 1.00 55.84  ? 957  VAL A CG2   1 
ATOM   6877  N  N     . PRO A 1  958  ? 119.532 141.927 141.510 1.00 54.79  ? 958  PRO A N     1 
ATOM   6878  C  CA    . PRO A 1  958  ? 118.769 143.033 140.927 1.00 53.80  ? 958  PRO A CA    1 
ATOM   6879  C  C     . PRO A 1  958  ? 117.856 143.690 141.949 1.00 54.47  ? 958  PRO A C     1 
ATOM   6880  O  O     . PRO A 1  958  ? 117.415 143.068 142.919 1.00 54.76  ? 958  PRO A O     1 
ATOM   6881  C  CB    . PRO A 1  958  ? 117.961 142.357 139.813 1.00 54.83  ? 958  PRO A CB    1 
ATOM   6882  C  CG    . PRO A 1  958  ? 117.822 140.943 140.267 1.00 52.23  ? 958  PRO A CG    1 
ATOM   6883  C  CD    . PRO A 1  958  ? 119.102 140.619 140.987 1.00 50.69  ? 958  PRO A CD    1 
ATOM   6884  N  N     . VAL A 1  959  ? 117.576 144.968 141.718 1.00 52.56  ? 959  VAL A N     1 
ATOM   6885  C  CA    . VAL A 1  959  ? 116.711 145.749 142.586 1.00 53.15  ? 959  VAL A CA    1 
ATOM   6886  C  C     . VAL A 1  959  ? 115.379 145.978 141.878 1.00 53.74  ? 959  VAL A C     1 
ATOM   6887  O  O     . VAL A 1  959  ? 115.223 145.706 140.688 1.00 54.14  ? 959  VAL A O     1 
ATOM   6888  C  CB    . VAL A 1  959  ? 117.358 147.085 142.999 1.00 53.88  ? 959  VAL A CB    1 
ATOM   6889  C  CG1   . VAL A 1  959  ? 118.684 146.837 143.702 1.00 53.20  ? 959  VAL A CG1   1 
ATOM   6890  C  CG2   . VAL A 1  959  ? 117.549 147.980 141.784 1.00 53.25  ? 959  VAL A CG2   1 
ATOM   6891  N  N     . MET A 1  960  ? 114.410 146.486 142.631 1.00 53.80  ? 960  MET A N     1 
ATOM   6892  C  CA    . MET A 1  960  ? 113.082 146.766 142.113 1.00 54.39  ? 960  MET A CA    1 
ATOM   6893  C  C     . MET A 1  960  ? 112.958 148.254 141.782 1.00 54.82  ? 960  MET A C     1 
ATOM   6894  O  O     . MET A 1  960  ? 113.939 149.005 141.807 1.00 55.36  ? 960  MET A O     1 
ATOM   6895  C  CB    . MET A 1  960  ? 112.023 146.291 143.110 1.00 55.42  ? 960  MET A CB    1 
ATOM   6896  C  CG    . MET A 1  960  ? 112.245 146.745 144.541 1.00 55.88  ? 960  MET A CG    1 
ATOM   6897  S  SD    . MET A 1  960  ? 111.566 148.379 144.859 1.00 54.48  ? 960  MET A SD    1 
ATOM   6898  C  CE    . MET A 1  960  ? 109.852 148.111 144.423 1.00 55.23  ? 960  MET A CE    1 
ATOM   6899  N  N     . VAL A 1  961  ? 111.738 148.689 141.464 1.00 53.77  ? 961  VAL A N     1 
ATOM   6900  C  CA    . VAL A 1  961  ? 111.536 150.042 140.949 1.00 53.30  ? 961  VAL A CA    1 
ATOM   6901  C  C     . VAL A 1  961  ? 111.771 151.081 142.040 1.00 53.26  ? 961  VAL A C     1 
ATOM   6902  O  O     . VAL A 1  961  ? 112.529 152.039 141.850 1.00 53.45  ? 961  VAL A O     1 
ATOM   6903  C  CB    . VAL A 1  961  ? 110.130 150.177 140.337 1.00 53.47  ? 961  VAL A CB    1 
ATOM   6904  C  CG1   . VAL A 1  961  ? 109.924 151.582 139.798 1.00 52.49  ? 961  VAL A CG1   1 
ATOM   6905  C  CG2   . VAL A 1  961  ? 109.927 149.142 139.242 1.00 52.88  ? 961  VAL A CG2   1 
ATOM   6906  N  N     . SER A 1  962  ? 111.124 150.911 143.195 1.00 52.84  ? 962  SER A N     1 
ATOM   6907  C  CA    . SER A 1  962  ? 111.216 151.916 144.251 1.00 53.36  ? 962  SER A CA    1 
ATOM   6908  C  C     . SER A 1  962  ? 112.611 152.009 144.856 1.00 52.93  ? 962  SER A C     1 
ATOM   6909  O  O     . SER A 1  962  ? 112.912 152.999 145.531 1.00 52.59  ? 962  SER A O     1 
ATOM   6910  C  CB    . SER A 1  962  ? 110.193 151.621 145.350 1.00 54.53  ? 962  SER A CB    1 
ATOM   6911  O  OG    . SER A 1  962  ? 110.259 152.590 146.382 1.00 54.76  ? 962  SER A OG    1 
ATOM   6912  N  N     . GLY A 1  963  ? 113.466 151.013 144.634 1.00 56.08  ? 963  GLY A N     1 
ATOM   6913  C  CA    . GLY A 1  963  ? 114.829 151.076 145.122 1.00 57.31  ? 963  GLY A CA    1 
ATOM   6914  C  C     . GLY A 1  963  ? 115.116 150.139 146.277 1.00 57.51  ? 963  GLY A C     1 
ATOM   6915  O  O     . GLY A 1  963  ? 115.954 150.439 147.132 1.00 57.96  ? 963  GLY A O     1 
ATOM   6916  N  N     . LYS A 1  964  ? 114.429 149.003 146.314 1.00 57.15  ? 964  LYS A N     1 
ATOM   6917  C  CA    . LYS A 1  964  ? 114.612 148.010 147.361 1.00 56.79  ? 964  LYS A CA    1 
ATOM   6918  C  C     . LYS A 1  964  ? 115.276 146.761 146.793 1.00 58.45  ? 964  LYS A C     1 
ATOM   6919  O  O     . LYS A 1  964  ? 115.245 146.504 145.587 1.00 59.81  ? 964  LYS A O     1 
ATOM   6920  C  CB    . LYS A 1  964  ? 113.275 147.636 148.015 1.00 60.82  ? 964  LYS A CB    1 
ATOM   6921  C  CG    . LYS A 1  964  ? 112.685 148.706 148.929 1.00 62.37  ? 964  LYS A CG    1 
ATOM   6922  C  CD    . LYS A 1  964  ? 111.930 149.770 148.147 1.00 63.47  ? 964  LYS A CD    1 
ATOM   6923  C  CE    . LYS A 1  964  ? 111.318 150.807 149.073 1.00 54.29  ? 964  LYS A CE    1 
ATOM   6924  N  NZ    . LYS A 1  964  ? 110.384 150.192 150.055 1.00 54.25  ? 964  LYS A NZ    1 
ATOM   6925  N  N     . THR A 1  965  ? 115.892 145.990 147.686 1.00 51.97  ? 965  THR A N     1 
ATOM   6926  C  CA    . THR A 1  965  ? 116.518 144.726 147.318 1.00 51.27  ? 965  THR A CA    1 
ATOM   6927  C  C     . THR A 1  965  ? 115.739 143.513 147.800 1.00 51.44  ? 965  THR A C     1 
ATOM   6928  O  O     . THR A 1  965  ? 115.785 142.463 147.149 1.00 51.50  ? 965  THR A O     1 
ATOM   6929  C  CB    . THR A 1  965  ? 117.945 144.654 147.873 1.00 51.86  ? 965  THR A CB    1 
ATOM   6930  O  OG1   . THR A 1  965  ? 117.913 144.800 149.298 1.00 50.91  ? 965  THR A OG1   1 
ATOM   6931  C  CG2   . THR A 1  965  ? 118.806 145.754 147.275 1.00 51.50  ? 965  THR A CG2   1 
ATOM   6932  N  N     . LEU A 1  966  ? 115.027 143.634 148.918 1.00 51.13  ? 966  LEU A N     1 
ATOM   6933  C  CA    . LEU A 1  966  ? 114.240 142.550 149.488 1.00 51.83  ? 966  LEU A CA    1 
ATOM   6934  C  C     . LEU A 1  966  ? 113.303 143.133 150.540 1.00 52.35  ? 966  LEU A C     1 
ATOM   6935  O  O     . LEU A 1  966  ? 113.692 144.055 151.269 1.00 52.56  ? 966  LEU A O     1 
ATOM   6936  C  CB    . LEU A 1  966  ? 115.153 141.478 150.091 1.00 52.58  ? 966  LEU A CB    1 
ATOM   6937  C  CG    . LEU A 1  966  ? 114.635 140.039 150.167 1.00 52.69  ? 966  LEU A CG    1 
ATOM   6938  C  CD1   . LEU A 1  966  ? 115.772 139.053 149.967 1.00 51.80  ? 966  LEU A CD1   1 
ATOM   6939  C  CD2   . LEU A 1  966  ? 113.940 139.778 151.492 1.00 52.26  ? 966  LEU A CD2   1 
ATOM   6940  N  N     . PRO A 1  967  ? 112.063 142.637 150.648 1.00 51.43  ? 967  PRO A N     1 
ATOM   6941  C  CA    . PRO A 1  967  ? 111.112 143.219 151.609 1.00 51.33  ? 967  PRO A CA    1 
ATOM   6942  C  C     . PRO A 1  967  ? 111.523 143.069 153.068 1.00 51.55  ? 967  PRO A C     1 
ATOM   6943  O  O     . PRO A 1  967  ? 110.805 143.529 153.961 1.00 51.57  ? 967  PRO A O     1 
ATOM   6944  C  CB    . PRO A 1  967  ? 109.812 142.454 151.320 1.00 51.52  ? 967  PRO A CB    1 
ATOM   6945  C  CG    . PRO A 1  967  ? 110.236 141.215 150.597 1.00 51.50  ? 967  PRO A CG    1 
ATOM   6946  C  CD    . PRO A 1  967  ? 111.426 141.623 149.792 1.00 51.74  ? 967  PRO A CD    1 
ATOM   6947  N  N     . SER A 1  968  ? 112.663 142.433 153.329 1.00 51.75  ? 968  SER A N     1 
ATOM   6948  C  CA    . SER A 1  968  ? 113.185 142.294 154.681 1.00 51.98  ? 968  SER A CA    1 
ATOM   6949  C  C     . SER A 1  968  ? 114.278 143.307 154.996 1.00 52.20  ? 968  SER A C     1 
ATOM   6950  O  O     . SER A 1  968  ? 114.941 143.186 156.031 1.00 52.14  ? 968  SER A O     1 
ATOM   6951  C  CB    . SER A 1  968  ? 113.710 140.874 154.903 1.00 51.68  ? 968  SER A CB    1 
ATOM   6952  O  OG    . SER A 1  968  ? 114.238 140.724 156.209 1.00 51.57  ? 968  SER A OG    1 
ATOM   6953  N  N     . PHE A 1  969  ? 114.479 144.301 154.134 1.00 51.22  ? 969  PHE A N     1 
ATOM   6954  C  CA    . PHE A 1  969  ? 115.519 145.303 154.317 1.00 50.94  ? 969  PHE A CA    1 
ATOM   6955  C  C     . PHE A 1  969  ? 114.907 146.697 154.261 1.00 50.58  ? 969  PHE A C     1 
ATOM   6956  O  O     . PHE A 1  969  ? 113.727 146.874 153.948 1.00 50.48  ? 969  PHE A O     1 
ATOM   6957  C  CB    . PHE A 1  969  ? 116.622 145.160 153.259 1.00 50.33  ? 969  PHE A CB    1 
ATOM   6958  C  CG    . PHE A 1  969  ? 117.485 143.945 153.445 1.00 50.42  ? 969  PHE A CG    1 
ATOM   6959  C  CD1   . PHE A 1  969  ? 117.818 143.503 154.713 1.00 50.43  ? 969  PHE A CD1   1 
ATOM   6960  C  CD2   . PHE A 1  969  ? 117.957 143.241 152.349 1.00 50.42  ? 969  PHE A CD2   1 
ATOM   6961  C  CE1   . PHE A 1  969  ? 118.611 142.385 154.888 1.00 50.72  ? 969  PHE A CE1   1 
ATOM   6962  C  CE2   . PHE A 1  969  ? 118.749 142.121 152.517 1.00 51.68  ? 969  PHE A CE2   1 
ATOM   6963  C  CZ    . PHE A 1  969  ? 119.077 141.693 153.788 1.00 51.17  ? 969  PHE A CZ    1 
ATOM   6964  N  N     . LYS A 1  970  ? 115.735 147.691 154.573 1.00 53.71  ? 970  LYS A N     1 
ATOM   6965  C  CA    . LYS A 1  970  ? 115.303 149.078 154.608 1.00 55.69  ? 970  LYS A CA    1 
ATOM   6966  C  C     . LYS A 1  970  ? 115.262 149.666 153.198 1.00 57.66  ? 970  LYS A C     1 
ATOM   6967  O  O     . LYS A 1  970  ? 115.995 149.220 152.311 1.00 59.30  ? 970  LYS A O     1 
ATOM   6968  C  CB    . LYS A 1  970  ? 116.240 149.910 155.482 1.00 60.93  ? 970  LYS A CB    1 
ATOM   6969  C  CG    . LYS A 1  970  ? 116.417 149.392 156.903 1.00 62.03  ? 970  LYS A CG    1 
ATOM   6970  C  CD    . LYS A 1  970  ? 117.614 148.457 157.015 1.00 62.52  ? 970  LYS A CD    1 
ATOM   6971  C  CE    . LYS A 1  970  ? 117.781 147.934 158.430 1.00 54.95  ? 970  LYS A CE    1 
ATOM   6972  N  NZ    . LYS A 1  970  ? 116.581 147.181 158.889 1.00 55.47  ? 970  LYS A NZ    1 
ATOM   6973  N  N     . PRO A 1  971  ? 114.405 150.659 152.965 1.00 53.96  ? 971  PRO A N     1 
ATOM   6974  C  CA    . PRO A 1  971  ? 114.388 151.324 151.656 1.00 53.29  ? 971  PRO A CA    1 
ATOM   6975  C  C     . PRO A 1  971  ? 115.709 152.030 151.384 1.00 53.63  ? 971  PRO A C     1 
ATOM   6976  O  O     . PRO A 1  971  ? 116.249 152.725 152.247 1.00 54.06  ? 971  PRO A O     1 
ATOM   6977  C  CB    . PRO A 1  971  ? 113.227 152.318 151.778 1.00 54.20  ? 971  PRO A CB    1 
ATOM   6978  C  CG    . PRO A 1  971  ? 112.367 151.770 152.870 1.00 53.06  ? 971  PRO A CG    1 
ATOM   6979  C  CD    . PRO A 1  971  ? 113.315 151.127 153.837 1.00 52.87  ? 971  PRO A CD    1 
ATOM   6980  N  N     . TYR A 1  972  ? 116.223 151.844 150.166 1.00 53.51  ? 972  TYR A N     1 
ATOM   6981  C  CA    . TYR A 1  972  ? 117.494 152.427 149.734 1.00 54.25  ? 972  TYR A CA    1 
ATOM   6982  C  C     . TYR A 1  972  ? 118.630 152.010 150.671 1.00 54.75  ? 972  TYR A C     1 
ATOM   6983  O  O     . TYR A 1  972  ? 119.258 152.830 151.344 1.00 55.54  ? 972  TYR A O     1 
ATOM   6984  C  CB    . TYR A 1  972  ? 117.390 153.954 149.629 1.00 55.51  ? 972  TYR A CB    1 
ATOM   6985  C  CG    . TYR A 1  972  ? 116.269 154.433 148.735 1.00 55.73  ? 972  TYR A CG    1 
ATOM   6986  C  CD1   . TYR A 1  972  ? 116.422 154.471 147.355 1.00 56.04  ? 972  TYR A CD1   1 
ATOM   6987  C  CD2   . TYR A 1  972  ? 115.058 154.851 149.272 1.00 55.91  ? 972  TYR A CD2   1 
ATOM   6988  C  CE1   . TYR A 1  972  ? 115.400 154.910 146.535 1.00 56.49  ? 972  TYR A CE1   1 
ATOM   6989  C  CE2   . TYR A 1  972  ? 114.030 155.293 148.459 1.00 56.46  ? 972  TYR A CE2   1 
ATOM   6990  C  CZ    . TYR A 1  972  ? 114.207 155.320 147.092 1.00 55.11  ? 972  TYR A CZ    1 
ATOM   6991  O  OH    . TYR A 1  972  ? 113.187 155.757 146.279 1.00 55.28  ? 972  TYR A OH    1 
ATOM   6992  N  N     . GLU A 1  973  ? 118.879 150.703 150.703 1.00 56.34  ? 973  GLU A N     1 
ATOM   6993  C  CA    . GLU A 1  973  ? 119.891 150.151 151.592 1.00 57.18  ? 973  GLU A CA    1 
ATOM   6994  C  C     . GLU A 1  973  ? 121.288 150.592 151.171 1.00 57.57  ? 973  GLU A C     1 
ATOM   6995  O  O     . GLU A 1  973  ? 121.579 150.748 149.982 1.00 57.63  ? 973  GLU A O     1 
ATOM   6996  C  CB    . GLU A 1  973  ? 119.802 148.622 151.610 1.00 57.51  ? 973  GLU A CB    1 
ATOM   6997  C  CG    . GLU A 1  973  ? 119.749 147.972 150.230 1.00 57.57  ? 973  GLU A CG    1 
ATOM   6998  C  CD    . GLU A 1  973  ? 121.122 147.779 149.611 1.00 56.97  ? 973  GLU A CD    1 
ATOM   6999  O  OE1   . GLU A 1  973  ? 122.117 147.740 150.365 1.00 57.28  ? 973  GLU A OE1   1 
ATOM   7000  O  OE2   . GLU A 1  973  ? 121.207 147.670 148.370 1.00 57.35  ? 973  GLU A OE2   1 
ATOM   7001  N  N     . THR A 1  974  ? 122.155 150.807 152.164 1.00 57.22  ? 974  THR A N     1 
ATOM   7002  C  CA    . THR A 1  974  ? 123.561 151.154 151.936 1.00 57.26  ? 974  THR A CA    1 
ATOM   7003  C  C     . THR A 1  974  ? 124.397 150.301 152.888 1.00 57.39  ? 974  THR A C     1 
ATOM   7004  O  O     . THR A 1  974  ? 124.700 150.722 154.009 1.00 57.45  ? 974  THR A O     1 
ATOM   7005  C  CB    . THR A 1  974  ? 123.817 152.642 152.146 1.00 57.26  ? 974  THR A CB    1 
ATOM   7006  O  OG1   . THR A 1  974  ? 123.347 153.032 153.443 1.00 56.81  ? 974  THR A OG1   1 
ATOM   7007  C  CG2   . THR A 1  974  ? 123.108 153.470 151.081 1.00 57.01  ? 974  THR A CG2   1 
ATOM   7008  N  N     . ASP A 1  975  ? 124.776 149.111 152.427 1.00 55.88  ? 975  ASP A N     1 
ATOM   7009  C  CA    . ASP A 1  975  ? 125.562 148.170 153.216 1.00 55.44  ? 975  ASP A CA    1 
ATOM   7010  C  C     . ASP A 1  975  ? 125.933 146.991 152.329 1.00 55.54  ? 975  ASP A C     1 
ATOM   7011  O  O     . ASP A 1  975  ? 125.325 146.770 151.276 1.00 55.69  ? 975  ASP A O     1 
ATOM   7012  C  CB    . ASP A 1  975  ? 124.801 147.685 154.456 1.00 55.62  ? 975  ASP A CB    1 
ATOM   7013  C  CG    . ASP A 1  975  ? 123.460 147.066 154.113 1.00 56.20  ? 975  ASP A CG    1 
ATOM   7014  O  OD1   . ASP A 1  975  ? 122.854 147.483 153.105 1.00 54.85  ? 975  ASP A OD1   1 
ATOM   7015  O  OD2   . ASP A 1  975  ? 123.013 146.164 154.852 1.00 54.51  ? 975  ASP A OD2   1 
ATOM   7016  N  N     . ALA A 1  976  ? 126.939 146.238 152.769 1.00 54.85  ? 976  ALA A N     1 
ATOM   7017  C  CA    . ALA A 1  976  ? 127.368 145.045 152.049 1.00 54.71  ? 976  ALA A CA    1 
ATOM   7018  C  C     . ALA A 1  976  ? 126.570 143.809 152.436 1.00 55.30  ? 976  ALA A C     1 
ATOM   7019  O  O     . ALA A 1  976  ? 126.450 142.882 151.627 1.00 54.25  ? 976  ALA A O     1 
ATOM   7020  C  CB    . ALA A 1  976  ? 128.857 144.784 152.291 1.00 53.75  ? 976  ALA A CB    1 
ATOM   7021  N  N     . MET A 1  977  ? 126.024 143.776 153.654 1.00 54.69  ? 977  MET A N     1 
ATOM   7022  C  CA    . MET A 1  977  ? 125.241 142.622 154.085 1.00 55.67  ? 977  MET A CA    1 
ATOM   7023  C  C     . MET A 1  977  ? 123.990 142.454 153.231 1.00 56.80  ? 977  MET A C     1 
ATOM   7024  O  O     . MET A 1  977  ? 123.594 141.327 152.910 1.00 57.40  ? 977  MET A O     1 
ATOM   7025  C  CB    . MET A 1  977  ? 124.873 142.764 155.563 1.00 57.94  ? 977  MET A CB    1 
ATOM   7026  C  CG    . MET A 1  977  ? 124.259 141.521 156.178 1.00 57.75  ? 977  MET A CG    1 
ATOM   7027  S  SD    . MET A 1  977  ? 123.986 141.697 157.952 1.00 54.84  ? 977  MET A SD    1 
ATOM   7028  C  CE    . MET A 1  977  ? 123.473 140.037 158.386 1.00 54.87  ? 977  MET A CE    1 
ATOM   7029  N  N     . ALA A 1  978  ? 123.356 143.562 152.854 1.00 53.72  ? 978  ALA A N     1 
ATOM   7030  C  CA    . ALA A 1  978  ? 122.185 143.531 151.989 1.00 52.94  ? 978  ALA A CA    1 
ATOM   7031  C  C     . ALA A 1  978  ? 122.534 143.572 150.509 1.00 53.45  ? 978  ALA A C     1 
ATOM   7032  O  O     . ALA A 1  978  ? 121.635 143.434 149.672 1.00 51.97  ? 978  ALA A O     1 
ATOM   7033  C  CB    . ALA A 1  978  ? 121.250 144.698 152.323 1.00 51.26  ? 978  ALA A CB    1 
ATOM   7034  N  N     . GLY A 1  979  ? 123.807 143.756 150.164 1.00 51.56  ? 979  GLY A N     1 
ATOM   7035  C  CA    . GLY A 1  979  ? 124.214 143.845 148.775 1.00 51.11  ? 979  GLY A CA    1 
ATOM   7036  C  C     . GLY A 1  979  ? 124.595 142.513 148.164 1.00 50.06  ? 979  GLY A C     1 
ATOM   7037  O  O     . GLY A 1  979  ? 125.437 142.455 147.262 1.00 49.77  ? 979  GLY A O     1 
ATOM   7038  N  N     . GLY A 1  980  ? 123.983 141.435 148.645 1.00 49.34  ? 980  GLY A N     1 
ATOM   7039  C  CA    . GLY A 1  980  ? 124.258 140.117 148.112 1.00 49.15  ? 980  GLY A CA    1 
ATOM   7040  C  C     . GLY A 1  980  ? 125.541 139.481 148.594 1.00 49.09  ? 980  GLY A C     1 
ATOM   7041  O  O     . GLY A 1  980  ? 126.041 138.557 147.945 1.00 49.35  ? 980  GLY A O     1 
ATOM   7042  N  N     . TYR A 1  981  ? 126.092 139.944 149.712 1.00 48.75  ? 981  TYR A N     1 
ATOM   7043  C  CA    . TYR A 1  981  ? 127.295 139.369 150.298 1.00 48.66  ? 981  TYR A CA    1 
ATOM   7044  C  C     . TYR A 1  981  ? 126.910 138.567 151.532 1.00 48.03  ? 981  TYR A C     1 
ATOM   7045  O  O     . TYR A 1  981  ? 126.214 139.076 152.417 1.00 47.18  ? 981  TYR A O     1 
ATOM   7046  C  CB    . TYR A 1  981  ? 128.306 140.458 150.659 1.00 46.94  ? 981  TYR A CB    1 
ATOM   7047  C  CG    . TYR A 1  981  ? 129.537 139.943 151.371 1.00 46.59  ? 981  TYR A CG    1 
ATOM   7048  C  CD1   . TYR A 1  981  ? 130.288 138.903 150.838 1.00 46.33  ? 981  TYR A CD1   1 
ATOM   7049  C  CD2   . TYR A 1  981  ? 129.955 140.504 152.572 1.00 46.41  ? 981  TYR A CD2   1 
ATOM   7050  C  CE1   . TYR A 1  981  ? 131.416 138.431 151.484 1.00 46.38  ? 981  TYR A CE1   1 
ATOM   7051  C  CE2   . TYR A 1  981  ? 131.082 140.040 153.224 1.00 46.76  ? 981  TYR A CE2   1 
ATOM   7052  C  CZ    . TYR A 1  981  ? 131.807 139.003 152.676 1.00 49.57  ? 981  TYR A CZ    1 
ATOM   7053  O  OH    . TYR A 1  981  ? 132.929 138.539 153.323 1.00 49.25  ? 981  TYR A OH    1 
ATOM   7054  N  N     . VAL A 1  982  ? 127.361 137.319 151.587 1.00 51.46  ? 982  VAL A N     1 
ATOM   7055  C  CA    . VAL A 1  982  ? 126.960 136.408 152.653 1.00 53.27  ? 982  VAL A CA    1 
ATOM   7056  C  C     . VAL A 1  982  ? 127.823 136.656 153.882 1.00 52.56  ? 982  VAL A C     1 
ATOM   7057  O  O     . VAL A 1  982  ? 129.054 136.733 153.790 1.00 52.80  ? 982  VAL A O     1 
ATOM   7058  C  CB    . VAL A 1  982  ? 127.064 134.948 152.188 1.00 52.11  ? 982  VAL A CB    1 
ATOM   7059  C  CG1   . VAL A 1  982  ? 126.473 134.016 153.235 1.00 55.80  ? 982  VAL A CG1   1 
ATOM   7060  C  CG2   . VAL A 1  982  ? 126.366 134.770 150.851 1.00 57.39  ? 982  VAL A CG2   1 
ATOM   7061  N  N     . LYS A 1  983  ? 127.174 136.781 155.039 1.00 57.18  ? 983  LYS A N     1 
ATOM   7062  C  CA    . LYS A 1  983  ? 127.866 136.918 156.313 1.00 57.96  ? 983  LYS A CA    1 
ATOM   7063  C  C     . LYS A 1  983  ? 127.863 135.634 157.128 1.00 58.76  ? 983  LYS A C     1 
ATOM   7064  O  O     . LYS A 1  983  ? 128.773 135.424 157.937 1.00 59.47  ? 983  LYS A O     1 
ATOM   7065  C  CB    . LYS A 1  983  ? 127.229 138.039 157.144 1.00 60.13  ? 983  LYS A CB    1 
ATOM   7066  C  CG    . LYS A 1  983  ? 127.197 139.396 156.457 1.00 60.28  ? 983  LYS A CG    1 
ATOM   7067  C  CD    . LYS A 1  983  ? 128.261 140.340 157.003 1.00 60.98  ? 983  LYS A CD    1 
ATOM   7068  C  CE    . LYS A 1  983  ? 129.642 140.015 156.459 1.00 58.30  ? 983  LYS A CE    1 
ATOM   7069  N  NZ    . LYS A 1  983  ? 130.672 140.972 156.950 1.00 58.69  ? 983  LYS A NZ    1 
ATOM   7070  N  N     . GLY A 1  984  ? 126.867 134.776 156.932 1.00 58.66  ? 984  GLY A N     1 
ATOM   7071  C  CA    . GLY A 1  984  ? 126.761 133.532 157.664 1.00 59.43  ? 984  GLY A CA    1 
ATOM   7072  C  C     . GLY A 1  984  ? 127.721 132.474 157.161 1.00 59.80  ? 984  GLY A C     1 
ATOM   7073  O  O     . GLY A 1  984  ? 128.708 132.754 156.477 1.00 58.87  ? 984  GLY A O     1 
ATOM   7074  N  N     . ARG A 1  985  ? 127.412 131.227 157.513 1.00 60.82  ? 985  ARG A N     1 
ATOM   7075  C  CA    . ARG A 1  985  ? 128.261 130.093 157.168 1.00 61.63  ? 985  ARG A CA    1 
ATOM   7076  C  C     . ARG A 1  985  ? 127.424 128.826 157.242 1.00 63.97  ? 985  ARG A C     1 
ATOM   7077  O  O     . ARG A 1  985  ? 126.715 128.611 158.230 1.00 65.75  ? 985  ARG A O     1 
ATOM   7078  C  CB    . ARG A 1  985  ? 129.466 130.011 158.115 1.00 66.32  ? 985  ARG A CB    1 
ATOM   7079  C  CG    . ARG A 1  985  ? 130.118 128.644 158.196 1.00 66.00  ? 985  ARG A CG    1 
ATOM   7080  C  CD    . ARG A 1  985  ? 131.023 128.360 157.011 1.00 65.52  ? 985  ARG A CD    1 
ATOM   7081  N  NE    . ARG A 1  985  ? 131.428 126.958 156.988 1.00 65.74  ? 985  ARG A NE    1 
ATOM   7082  C  CZ    . ARG A 1  985  ? 130.932 126.053 156.151 1.00 65.11  ? 985  ARG A CZ    1 
ATOM   7083  N  NH1   . ARG A 1  985  ? 131.348 124.796 156.207 1.00 60.21  ? 985  ARG A NH1   1 
ATOM   7084  N  NH2   . ARG A 1  985  ? 130.029 126.408 155.251 1.00 60.10  ? 985  ARG A NH2   1 
ATOM   7085  N  N     . PHE A 1  986  ? 127.512 127.988 156.206 1.00 58.73  ? 986  PHE A N     1 
ATOM   7086  C  CA    . PHE A 1  986  ? 126.725 126.758 156.161 1.00 58.31  ? 986  PHE A CA    1 
ATOM   7087  C  C     . PHE A 1  986  ? 127.087 125.781 157.273 1.00 58.56  ? 986  PHE A C     1 
ATOM   7088  O  O     . PHE A 1  986  ? 126.414 124.754 157.411 1.00 58.93  ? 986  PHE A O     1 
ATOM   7089  C  CB    . PHE A 1  986  ? 126.887 126.078 154.800 1.00 58.90  ? 986  PHE A CB    1 
ATOM   7090  C  CG    . PHE A 1  986  ? 126.366 126.890 153.649 1.00 58.30  ? 986  PHE A CG    1 
ATOM   7091  C  CD1   . PHE A 1  986  ? 125.242 127.684 153.796 1.00 58.08  ? 986  PHE A CD1   1 
ATOM   7092  C  CD2   . PHE A 1  986  ? 127.005 126.863 152.422 1.00 58.50  ? 986  PHE A CD2   1 
ATOM   7093  C  CE1   . PHE A 1  986  ? 124.763 128.433 152.737 1.00 58.67  ? 986  PHE A CE1   1 
ATOM   7094  C  CE2   . PHE A 1  986  ? 126.530 127.609 151.359 1.00 56.89  ? 986  PHE A CE2   1 
ATOM   7095  C  CZ    . PHE A 1  986  ? 125.408 128.395 151.517 1.00 57.57  ? 986  PHE A CZ    1 
ATOM   7096  N  N     . TYR A 1  987  ? 128.132 126.060 158.050 1.00 54.39  ? 987  TYR A N     1 
ATOM   7097  C  CA    . TYR A 1  987  ? 128.450 125.265 159.228 1.00 52.31  ? 987  TYR A CA    1 
ATOM   7098  C  C     . TYR A 1  987  ? 127.820 125.827 160.496 1.00 50.73  ? 987  TYR A C     1 
ATOM   7099  O  O     . TYR A 1  987  ? 127.555 125.069 161.436 1.00 49.57  ? 987  TYR A O     1 
ATOM   7100  C  CB    . TYR A 1  987  ? 129.970 125.169 159.403 1.00 48.95  ? 987  TYR A CB    1 
ATOM   7101  C  CG    . TYR A 1  987  ? 130.412 124.568 160.718 1.00 49.15  ? 987  TYR A CG    1 
ATOM   7102  C  CD1   . TYR A 1  987  ? 130.307 123.204 160.952 1.00 49.44  ? 987  TYR A CD1   1 
ATOM   7103  C  CD2   . TYR A 1  987  ? 130.942 125.367 161.725 1.00 49.18  ? 987  TYR A CD2   1 
ATOM   7104  C  CE1   . TYR A 1  987  ? 130.713 122.651 162.152 1.00 49.76  ? 987  TYR A CE1   1 
ATOM   7105  C  CE2   . TYR A 1  987  ? 131.350 124.823 162.928 1.00 49.63  ? 987  TYR A CE2   1 
ATOM   7106  C  CZ    . TYR A 1  987  ? 131.233 123.464 163.137 1.00 52.98  ? 987  TYR A CZ    1 
ATOM   7107  O  OH    . TYR A 1  987  ? 131.638 122.918 164.332 1.00 53.88  ? 987  TYR A OH    1 
ATOM   7108  N  N     . SER A 1  988  ? 127.563 127.136 160.537 1.00 53.38  ? 988  SER A N     1 
ATOM   7109  C  CA    . SER A 1  988  ? 126.995 127.788 161.711 1.00 53.40  ? 988  SER A CA    1 
ATOM   7110  C  C     . SER A 1  988  ? 125.735 128.571 161.358 1.00 53.48  ? 988  SER A C     1 
ATOM   7111  O  O     . SER A 1  988  ? 125.390 129.542 162.036 1.00 53.42  ? 988  SER A O     1 
ATOM   7112  C  CB    . SER A 1  988  ? 128.024 128.704 162.375 1.00 53.07  ? 988  SER A CB    1 
ATOM   7113  O  OG    . SER A 1  988  ? 128.461 129.713 161.483 1.00 53.20  ? 988  SER A OG    1 
ATOM   7114  N  N     . GLY A 1  989  ? 125.046 128.169 160.298 1.00 52.57  ? 989  GLY A N     1 
ATOM   7115  C  CA    . GLY A 1  989  ? 123.794 128.790 159.921 1.00 52.65  ? 989  GLY A CA    1 
ATOM   7116  C  C     . GLY A 1  989  ? 123.983 130.043 159.083 1.00 52.96  ? 989  GLY A C     1 
ATOM   7117  O  O     . GLY A 1  989  ? 125.049 130.656 159.043 1.00 53.63  ? 989  GLY A O     1 
ATOM   7118  N  N     . ILE A 1  990  ? 122.902 130.431 158.408 1.00 52.67  ? 990  ILE A N     1 
ATOM   7119  C  CA    . ILE A 1  990  ? 122.914 131.582 157.511 1.00 52.28  ? 990  ILE A CA    1 
ATOM   7120  C  C     . ILE A 1  990  ? 121.677 132.434 157.759 1.00 51.95  ? 990  ILE A C     1 
ATOM   7121  O  O     . ILE A 1  990  ? 120.901 132.170 158.684 1.00 51.76  ? 990  ILE A O     1 
ATOM   7122  C  CB    . ILE A 1  990  ? 122.989 131.145 156.035 1.00 51.90  ? 990  ILE A CB    1 
ATOM   7123  C  CG1   . ILE A 1  990  ? 121.866 130.155 155.716 1.00 52.11  ? 990  ILE A CG1   1 
ATOM   7124  C  CG2   . ILE A 1  990  ? 124.353 130.550 155.718 1.00 52.40  ? 990  ILE A CG2   1 
ATOM   7125  C  CD1   . ILE A 1  990  ? 121.815 129.738 154.264 1.00 52.12  ? 990  ILE A CD1   1 
ATOM   7126  N  N     . LYS A 1  991  ? 121.493 133.478 156.931 1.00 53.41  ? 991  LYS A N     1 
ATOM   7127  C  CA    . LYS A 1  991  ? 120.381 134.417 156.922 1.00 54.47  ? 991  LYS A CA    1 
ATOM   7128  C  C     . LYS A 1  991  ? 119.403 134.066 155.805 1.00 55.72  ? 991  LYS A C     1 
ATOM   7129  O  O     . LYS A 1  991  ? 119.828 133.671 154.714 1.00 55.73  ? 991  LYS A O     1 
ATOM   7130  C  CB    . LYS A 1  991  ? 120.889 135.847 156.726 1.00 55.65  ? 991  LYS A CB    1 
ATOM   7131  C  CG    . LYS A 1  991  ? 119.934 136.931 157.195 1.00 55.82  ? 991  LYS A CG    1 
ATOM   7132  C  CD    . LYS A 1  991  ? 120.537 138.316 157.032 1.00 55.76  ? 991  LYS A CD    1 
ATOM   7133  C  CE    . LYS A 1  991  ? 120.838 138.619 155.575 1.00 53.99  ? 991  LYS A CE    1 
ATOM   7134  N  NZ    . LYS A 1  991  ? 121.382 139.992 155.397 1.00 53.89  ? 991  LYS A NZ    1 
ATOM   7135  N  N     . PRO A 1  992  ? 118.093 134.184 156.046 1.00 53.48  ? 992  PRO A N     1 
ATOM   7136  C  CA    . PRO A 1  992  ? 117.124 133.847 154.988 1.00 53.51  ? 992  PRO A CA    1 
ATOM   7137  C  C     . PRO A 1  992  ? 117.284 134.672 153.724 1.00 53.20  ? 992  PRO A C     1 
ATOM   7138  O  O     . PRO A 1  992  ? 116.957 134.185 152.634 1.00 53.12  ? 992  PRO A O     1 
ATOM   7139  C  CB    . PRO A 1  992  ? 115.765 134.097 155.661 1.00 53.23  ? 992  PRO A CB    1 
ATOM   7140  C  CG    . PRO A 1  992  ? 116.066 134.952 156.856 1.00 53.42  ? 992  PRO A CG    1 
ATOM   7141  C  CD    . PRO A 1  992  ? 117.424 134.528 157.311 1.00 54.15  ? 992  PRO A CD    1 
ATOM   7142  N  N     . GLN A 1  993  ? 117.778 135.907 153.830 1.00 52.75  ? 993  GLN A N     1 
ATOM   7143  C  CA    . GLN A 1  993  ? 118.014 136.704 152.631 1.00 52.76  ? 993  GLN A CA    1 
ATOM   7144  C  C     . GLN A 1  993  ? 119.206 136.174 151.846 1.00 53.24  ? 993  GLN A C     1 
ATOM   7145  O  O     . GLN A 1  993  ? 119.207 136.206 150.610 1.00 53.48  ? 993  GLN A O     1 
ATOM   7146  C  CB    . GLN A 1  993  ? 118.222 138.173 153.003 1.00 53.57  ? 993  GLN A CB    1 
ATOM   7147  C  CG    . GLN A 1  993  ? 116.956 138.895 153.445 1.00 54.34  ? 993  GLN A CG    1 
ATOM   7148  C  CD    . GLN A 1  993  ? 116.467 138.449 154.808 1.00 53.51  ? 993  GLN A CD    1 
ATOM   7149  O  OE1   . GLN A 1  993  ? 115.311 138.059 154.969 1.00 52.12  ? 993  GLN A OE1   1 
ATOM   7150  N  NE2   . GLN A 1  993  ? 117.348 138.508 155.801 1.00 52.05  ? 993  GLN A NE2   1 
ATOM   7151  N  N     . GLU A 1  994  ? 120.230 135.679 152.545 1.00 51.47  ? 994  GLU A N     1 
ATOM   7152  C  CA    . GLU A 1  994  ? 121.372 135.085 151.857 1.00 51.31  ? 994  GLU A CA    1 
ATOM   7153  C  C     . GLU A 1  994  ? 120.996 133.749 151.228 1.00 52.78  ? 994  GLU A C     1 
ATOM   7154  O  O     . GLU A 1  994  ? 121.493 133.403 150.150 1.00 54.29  ? 994  GLU A O     1 
ATOM   7155  C  CB    . GLU A 1  994  ? 122.542 134.917 152.826 1.00 55.34  ? 994  GLU A CB    1 
ATOM   7156  C  CG    . GLU A 1  994  ? 122.933 136.192 153.559 1.00 56.47  ? 994  GLU A CG    1 
ATOM   7157  C  CD    . GLU A 1  994  ? 123.466 137.270 152.632 1.00 55.55  ? 994  GLU A CD    1 
ATOM   7158  O  OE1   . GLU A 1  994  ? 123.924 136.934 151.519 1.00 49.14  ? 994  GLU A OE1   1 
ATOM   7159  O  OE2   . GLU A 1  994  ? 123.425 138.456 153.018 1.00 49.39  ? 994  GLU A OE2   1 
ATOM   7160  N  N     . TYR A 1  995  ? 120.125 132.984 151.890 1.00 46.80  ? 995  TYR A N     1 
ATOM   7161  C  CA    . TYR A 1  995  ? 119.631 131.747 151.298 1.00 45.15  ? 995  TYR A CA    1 
ATOM   7162  C  C     . TYR A 1  995  ? 118.751 132.024 150.087 1.00 44.38  ? 995  TYR A C     1 
ATOM   7163  O  O     . TYR A 1  995  ? 118.759 131.245 149.126 1.00 43.26  ? 995  TYR A O     1 
ATOM   7164  C  CB    . TYR A 1  995  ? 118.864 130.933 152.340 1.00 42.99  ? 995  TYR A CB    1 
ATOM   7165  C  CG    . TYR A 1  995  ? 118.298 129.631 151.816 1.00 42.73  ? 995  TYR A CG    1 
ATOM   7166  C  CD1   . TYR A 1  995  ? 119.099 128.502 151.696 1.00 42.67  ? 995  TYR A CD1   1 
ATOM   7167  C  CD2   . TYR A 1  995  ? 116.963 129.530 151.446 1.00 43.00  ? 995  TYR A CD2   1 
ATOM   7168  C  CE1   . TYR A 1  995  ? 118.586 127.310 151.219 1.00 42.60  ? 995  TYR A CE1   1 
ATOM   7169  C  CE2   . TYR A 1  995  ? 116.442 128.342 150.968 1.00 42.71  ? 995  TYR A CE2   1 
ATOM   7170  C  CZ    . TYR A 1  995  ? 117.257 127.235 150.856 1.00 44.62  ? 995  TYR A CZ    1 
ATOM   7171  O  OH    . TYR A 1  995  ? 116.743 126.052 150.382 1.00 44.83  ? 995  TYR A OH    1 
ATOM   7172  N  N     . TYR A 1  996  ? 117.991 133.120 150.113 1.00 44.18  ? 996  TYR A N     1 
ATOM   7173  C  CA    . TYR A 1  996  ? 117.165 133.478 148.965 1.00 43.98  ? 996  TYR A CA    1 
ATOM   7174  C  C     . TYR A 1  996  ? 118.031 133.860 147.770 1.00 43.54  ? 996  TYR A C     1 
ATOM   7175  O  O     . TYR A 1  996  ? 117.802 133.392 146.650 1.00 43.19  ? 996  TYR A O     1 
ATOM   7176  C  CB    . TYR A 1  996  ? 116.219 134.620 149.336 1.00 42.75  ? 996  TYR A CB    1 
ATOM   7177  C  CG    . TYR A 1  996  ? 115.214 134.962 148.258 1.00 42.95  ? 996  TYR A CG    1 
ATOM   7178  C  CD1   . TYR A 1  996  ? 113.998 134.296 148.179 1.00 43.41  ? 996  TYR A CD1   1 
ATOM   7179  C  CD2   . TYR A 1  996  ? 115.480 135.953 147.320 1.00 43.56  ? 996  TYR A CD2   1 
ATOM   7180  C  CE1   . TYR A 1  996  ? 113.076 134.604 147.197 1.00 43.87  ? 996  TYR A CE1   1 
ATOM   7181  C  CE2   . TYR A 1  996  ? 114.564 136.268 146.334 1.00 43.69  ? 996  TYR A CE2   1 
ATOM   7182  C  CZ    . TYR A 1  996  ? 113.364 135.590 146.278 1.00 44.41  ? 996  TYR A CZ    1 
ATOM   7183  O  OH    . TYR A 1  996  ? 112.449 135.901 145.298 1.00 44.46  ? 996  TYR A OH    1 
ATOM   7184  N  N     . PHE A 1  997  ? 119.035 134.714 147.994 1.00 44.81  ? 997  PHE A N     1 
ATOM   7185  C  CA    . PHE A 1  997  ? 119.955 135.067 146.918 1.00 45.02  ? 997  PHE A CA    1 
ATOM   7186  C  C     . PHE A 1  997  ? 120.738 133.850 146.445 1.00 44.48  ? 997  PHE A C     1 
ATOM   7187  O  O     . PHE A 1  997  ? 121.067 133.735 145.258 1.00 43.63  ? 997  PHE A O     1 
ATOM   7188  C  CB    . PHE A 1  997  ? 120.907 136.172 147.377 1.00 43.28  ? 997  PHE A CB    1 
ATOM   7189  C  CG    . PHE A 1  997  ? 120.217 137.455 147.742 1.00 43.27  ? 997  PHE A CG    1 
ATOM   7190  C  CD1   . PHE A 1  997  ? 118.997 137.788 147.177 1.00 43.39  ? 997  PHE A CD1   1 
ATOM   7191  C  CD2   . PHE A 1  997  ? 120.792 138.330 148.649 1.00 43.53  ? 997  PHE A CD2   1 
ATOM   7192  C  CE1   . PHE A 1  997  ? 118.363 138.969 147.513 1.00 43.45  ? 997  PHE A CE1   1 
ATOM   7193  C  CE2   . PHE A 1  997  ? 120.162 139.512 148.988 1.00 45.57  ? 997  PHE A CE2   1 
ATOM   7194  C  CZ    . PHE A 1  997  ? 118.945 139.832 148.418 1.00 45.97  ? 997  PHE A CZ    1 
ATOM   7195  N  N     . HIS A 1  998  ? 121.051 132.931 147.362 1.00 45.93  ? 998  HIS A N     1 
ATOM   7196  C  CA    . HIS A 1  998  ? 121.683 131.678 146.963 1.00 46.40  ? 998  HIS A CA    1 
ATOM   7197  C  C     . HIS A 1  998  ? 120.767 130.864 146.062 1.00 46.31  ? 998  HIS A C     1 
ATOM   7198  O  O     . HIS A 1  998  ? 121.243 130.169 145.158 1.00 46.00  ? 998  HIS A O     1 
ATOM   7199  C  CB    . HIS A 1  998  ? 122.077 130.869 148.200 1.00 46.02  ? 998  HIS A CB    1 
ATOM   7200  C  CG    . HIS A 1  998  ? 123.051 129.768 147.916 1.00 45.89  ? 998  HIS A CG    1 
ATOM   7201  N  ND1   . HIS A 1  998  ? 122.658 128.511 147.510 1.00 45.78  ? 998  HIS A ND1   1 
ATOM   7202  C  CD2   . HIS A 1  998  ? 124.403 129.736 147.980 1.00 45.77  ? 998  HIS A CD2   1 
ATOM   7203  C  CE1   . HIS A 1  998  ? 123.726 127.754 147.336 1.00 47.53  ? 998  HIS A CE1   1 
ATOM   7204  N  NE2   . HIS A 1  998  ? 124.798 128.473 147.616 1.00 47.96  ? 998  HIS A NE2   1 
ATOM   7205  N  N     . CYS A 1  999  ? 119.453 130.939 146.290 1.00 49.16  ? 999  CYS A N     1 
ATOM   7206  C  CA    . CYS A 1  999  ? 118.508 130.278 145.397 1.00 50.71  ? 999  CYS A CA    1 
ATOM   7207  C  C     . CYS A 1  999  ? 118.446 130.966 144.040 1.00 51.73  ? 999  CYS A C     1 
ATOM   7208  O  O     . CYS A 1  999  ? 118.178 130.310 143.027 1.00 51.95  ? 999  CYS A O     1 
ATOM   7209  C  CB    . CYS A 1  999  ? 117.119 130.233 146.034 1.00 50.95  ? 999  CYS A CB    1 
ATOM   7210  S  SG    . CYS A 1  999  ? 116.992 129.149 147.477 1.00 51.88  ? 999  CYS A SG    1 
ATOM   7211  N  N     . MET A 1  1000 ? 118.687 132.277 143.999 1.00 50.06  ? 1000 MET A N     1 
ATOM   7212  C  CA    . MET A 1  1000 ? 118.713 132.989 142.726 1.00 49.55  ? 1000 MET A CA    1 
ATOM   7213  C  C     . MET A 1  1000 ? 119.890 132.530 141.875 1.00 49.63  ? 1000 MET A C     1 
ATOM   7214  O  O     . MET A 1  1000 ? 119.712 132.006 140.770 1.00 50.69  ? 1000 MET A O     1 
ATOM   7215  C  CB    . MET A 1  1000 ? 118.776 134.499 142.969 1.00 52.22  ? 1000 MET A CB    1 
ATOM   7216  C  CG    . MET A 1  1000 ? 117.713 135.041 143.916 1.00 52.68  ? 1000 MET A CG    1 
ATOM   7217  S  SD    . MET A 1  1000 ? 116.023 134.841 143.320 1.00 49.00  ? 1000 MET A SD    1 
ATOM   7218  C  CE    . MET A 1  1000 ? 115.483 133.409 144.253 1.00 49.21  ? 1000 MET A CE    1 
ATOM   7219  N  N     . ALA A 1  1001 ? 121.111 132.716 142.383 1.00 48.86  ? 1001 ALA A N     1 
ATOM   7220  C  CA    . ALA A 1  1001 ? 122.293 132.262 141.659 1.00 49.16  ? 1001 ALA A CA    1 
ATOM   7221  C  C     . ALA A 1  1001 ? 122.317 130.748 141.518 1.00 50.48  ? 1001 ALA A C     1 
ATOM   7222  O  O     . ALA A 1  1001 ? 122.864 130.224 140.540 1.00 48.15  ? 1001 ALA A O     1 
ATOM   7223  C  CB    . ALA A 1  1001 ? 123.561 132.749 142.362 1.00 47.28  ? 1001 ALA A CB    1 
ATOM   7224  N  N     . GLY A 1  1002 ? 121.740 130.029 142.484 1.00 48.42  ? 1002 GLY A N     1 
ATOM   7225  C  CA    . GLY A 1  1002 ? 121.692 128.580 142.388 1.00 49.16  ? 1002 GLY A CA    1 
ATOM   7226  C  C     . GLY A 1  1002 ? 120.916 128.101 141.177 1.00 49.86  ? 1002 GLY A C     1 
ATOM   7227  O  O     . GLY A 1  1002 ? 121.393 127.264 140.407 1.00 50.35  ? 1002 GLY A O     1 
ATOM   7228  N  N     . ARG A 1  1003 ? 119.703 128.629 140.990 1.00 50.32  ? 1003 ARG A N     1 
ATOM   7229  C  CA    . ARG A 1  1003 ? 118.898 128.215 139.846 1.00 50.50  ? 1003 ARG A CA    1 
ATOM   7230  C  C     . ARG A 1  1003 ? 119.479 128.744 138.541 1.00 49.64  ? 1003 ARG A C     1 
ATOM   7231  O  O     . ARG A 1  1003 ? 119.439 128.056 137.515 1.00 49.46  ? 1003 ARG A O     1 
ATOM   7232  C  CB    . ARG A 1  1003 ? 117.451 128.676 140.013 1.00 49.44  ? 1003 ARG A CB    1 
ATOM   7233  C  CG    . ARG A 1  1003 ? 116.520 128.129 138.940 1.00 48.94  ? 1003 ARG A CG    1 
ATOM   7234  C  CD    . ARG A 1  1003 ? 115.110 128.666 139.086 1.00 48.56  ? 1003 ARG A CD    1 
ATOM   7235  N  NE    . ARG A 1  1003 ? 114.535 128.350 140.389 1.00 48.55  ? 1003 ARG A NE    1 
ATOM   7236  C  CZ    . ARG A 1  1003 ? 113.297 128.664 140.752 1.00 48.47  ? 1003 ARG A CZ    1 
ATOM   7237  N  NH1   . ARG A 1  1003 ? 112.855 128.337 141.958 1.00 51.50  ? 1003 ARG A NH1   1 
ATOM   7238  N  NH2   . ARG A 1  1003 ? 112.497 129.301 139.908 1.00 51.87  ? 1003 ARG A NH2   1 
ATOM   7239  N  N     . GLU A 1  1004 ? 120.032 129.962 138.561 1.00 52.74  ? 1004 GLU A N     1 
ATOM   7240  C  CA    . GLU A 1  1004 ? 120.655 130.507 137.359 1.00 53.91  ? 1004 GLU A CA    1 
ATOM   7241  C  C     . GLU A 1  1004 ? 121.852 129.672 136.922 1.00 55.32  ? 1004 GLU A C     1 
ATOM   7242  O  O     . GLU A 1  1004 ? 122.251 129.727 135.753 1.00 55.94  ? 1004 GLU A O     1 
ATOM   7243  C  CB    . GLU A 1  1004 ? 121.077 131.959 137.589 1.00 56.84  ? 1004 GLU A CB    1 
ATOM   7244  C  CG    . GLU A 1  1004 ? 119.917 132.924 137.764 1.00 57.54  ? 1004 GLU A CG    1 
ATOM   7245  C  CD    . GLU A 1  1004 ? 120.373 134.365 137.874 1.00 57.64  ? 1004 GLU A CD    1 
ATOM   7246  O  OE1   . GLU A 1  1004 ? 121.423 134.703 137.288 1.00 53.54  ? 1004 GLU A OE1   1 
ATOM   7247  O  OE2   . GLU A 1  1004 ? 119.684 135.158 138.549 1.00 53.23  ? 1004 GLU A OE2   1 
ATOM   7248  N  N     . GLY A 1  1005 ? 122.439 128.905 137.842 1.00 53.67  ? 1005 GLY A N     1 
ATOM   7249  C  CA    . GLY A 1  1005 ? 123.506 127.994 137.461 1.00 54.08  ? 1005 GLY A CA    1 
ATOM   7250  C  C     . GLY A 1  1005 ? 123.052 126.966 136.444 1.00 54.25  ? 1005 GLY A C     1 
ATOM   7251  O  O     . GLY A 1  1005 ? 123.687 126.780 135.403 1.00 54.51  ? 1005 GLY A O     1 
ATOM   7252  N  N     . LEU A 1  1006 ? 121.941 126.287 136.728 1.00 54.46  ? 1006 LEU A N     1 
ATOM   7253  C  CA    . LEU A 1  1006 ? 121.373 125.340 135.777 1.00 54.87  ? 1006 LEU A CA    1 
ATOM   7254  C  C     . LEU A 1  1006 ? 120.484 126.008 134.736 1.00 55.07  ? 1006 LEU A C     1 
ATOM   7255  O  O     . LEU A 1  1006 ? 119.997 125.320 133.833 1.00 55.17  ? 1006 LEU A O     1 
ATOM   7256  C  CB    . LEU A 1  1006 ? 120.589 124.242 136.506 1.00 55.15  ? 1006 LEU A CB    1 
ATOM   7257  C  CG    . LEU A 1  1006 ? 119.391 124.602 137.385 1.00 55.42  ? 1006 LEU A CG    1 
ATOM   7258  C  CD1   . LEU A 1  1006 ? 118.398 123.454 137.400 1.00 55.28  ? 1006 LEU A CD1   1 
ATOM   7259  C  CD2   . LEU A 1  1006 ? 119.846 124.908 138.799 1.00 55.32  ? 1006 LEU A CD2   1 
ATOM   7260  N  N     . ILE A 1  1007 ? 120.258 127.319 134.837 1.00 55.77  ? 1007 ILE A N     1 
ATOM   7261  C  CA    . ILE A 1  1007 ? 119.614 128.047 133.746 1.00 55.98  ? 1007 ILE A CA    1 
ATOM   7262  C  C     . ILE A 1  1007 ? 120.587 128.214 132.587 1.00 55.21  ? 1007 ILE A C     1 
ATOM   7263  O  O     . ILE A 1  1007 ? 120.293 127.846 131.445 1.00 55.38  ? 1007 ILE A O     1 
ATOM   7264  C  CB    . ILE A 1  1007 ? 119.083 129.407 134.234 1.00 55.37  ? 1007 ILE A CB    1 
ATOM   7265  C  CG1   . ILE A 1  1007 ? 117.825 129.223 135.082 1.00 54.77  ? 1007 ILE A CG1   1 
ATOM   7266  C  CG2   . ILE A 1  1007 ? 118.797 130.324 133.052 1.00 57.76  ? 1007 ILE A CG2   1 
ATOM   7267  C  CD1   . ILE A 1  1007 ? 116.656 128.658 134.315 1.00 57.48  ? 1007 ILE A CD1   1 
ATOM   7268  N  N     . ASP A 1  1008 ? 121.767 128.771 132.871 1.00 61.16  ? 1008 ASP A N     1 
ATOM   7269  C  CA    . ASP A 1  1008 ? 122.807 128.861 131.852 1.00 63.95  ? 1008 ASP A CA    1 
ATOM   7270  C  C     . ASP A 1  1008 ? 123.251 127.474 131.404 1.00 65.69  ? 1008 ASP A C     1 
ATOM   7271  O  O     . ASP A 1  1008 ? 123.527 127.255 130.220 1.00 66.71  ? 1008 ASP A O     1 
ATOM   7272  C  CB    . ASP A 1  1008 ? 123.997 129.661 132.383 1.00 67.25  ? 1008 ASP A CB    1 
ATOM   7273  C  CG    . ASP A 1  1008 ? 123.632 131.095 132.715 1.00 67.31  ? 1008 ASP A CG    1 
ATOM   7274  O  OD1   . ASP A 1  1008 ? 122.727 131.648 132.057 1.00 64.24  ? 1008 ASP A OD1   1 
ATOM   7275  O  OD2   . ASP A 1  1008 ? 124.251 131.668 133.637 1.00 64.77  ? 1008 ASP A OD2   1 
ATOM   7276  N  N     . THR A 1  1009 ? 123.320 126.523 132.340 1.00 64.13  ? 1009 THR A N     1 
ATOM   7277  C  CA    . THR A 1  1009 ? 123.680 125.154 131.984 1.00 64.25  ? 1009 THR A CA    1 
ATOM   7278  C  C     . THR A 1  1009 ? 122.649 124.540 131.045 1.00 64.54  ? 1009 THR A C     1 
ATOM   7279  O  O     . THR A 1  1009 ? 122.995 123.752 130.158 1.00 64.71  ? 1009 THR A O     1 
ATOM   7280  C  CB    . THR A 1  1009 ? 123.834 124.305 133.247 1.00 64.67  ? 1009 THR A CB    1 
ATOM   7281  O  OG1   . THR A 1  1009 ? 124.752 124.943 134.145 1.00 64.74  ? 1009 THR A OG1   1 
ATOM   7282  C  CG2   . THR A 1  1009 ? 124.359 122.918 132.904 1.00 64.16  ? 1009 THR A CG2   1 
ATOM   7283  N  N     . ALA A 1  1010 ? 121.373 124.896 131.221 1.00 65.95  ? 1010 ALA A N     1 
ATOM   7284  C  CA    . ALA A 1  1010 ? 120.344 124.421 130.302 1.00 66.96  ? 1010 ALA A CA    1 
ATOM   7285  C  C     . ALA A 1  1010 ? 120.526 125.006 128.908 1.00 67.23  ? 1010 ALA A C     1 
ATOM   7286  O  O     . ALA A 1  1010 ? 120.109 124.390 127.920 1.00 66.61  ? 1010 ALA A O     1 
ATOM   7287  C  CB    . ALA A 1  1010 ? 118.955 124.760 130.842 1.00 66.48  ? 1010 ALA A CB    1 
ATOM   7288  N  N     . VAL A 1  1011 ? 121.142 126.185 128.807 1.00 66.14  ? 1011 VAL A N     1 
ATOM   7289  C  CA    . VAL A 1  1011 ? 121.418 126.776 127.503 1.00 65.95  ? 1011 VAL A CA    1 
ATOM   7290  C  C     . VAL A 1  1011 ? 122.699 126.221 126.891 1.00 66.43  ? 1011 VAL A C     1 
ATOM   7291  O  O     . VAL A 1  1011 ? 122.858 126.258 125.663 1.00 66.64  ? 1011 VAL A O     1 
ATOM   7292  C  CB    . VAL A 1  1011 ? 121.491 128.310 127.618 1.00 66.35  ? 1011 VAL A CB    1 
ATOM   7293  C  CG1   . VAL A 1  1011 ? 121.541 128.961 126.242 1.00 65.88  ? 1011 VAL A CG1   1 
ATOM   7294  C  CG2   . VAL A 1  1011 ? 120.306 128.838 128.409 1.00 66.01  ? 1011 VAL A CG2   1 
ATOM   7295  N  N     . LYS A 1  1012 ? 123.610 125.691 127.710 1.00 66.52  ? 1012 LYS A N     1 
ATOM   7296  C  CA    . LYS A 1  1012 ? 124.875 125.167 127.198 1.00 66.88  ? 1012 LYS A CA    1 
ATOM   7297  C  C     . LYS A 1  1012 ? 124.641 124.057 126.179 1.00 67.58  ? 1012 LYS A C     1 
ATOM   7298  O  O     . LYS A 1  1012 ? 125.090 124.144 125.030 1.00 67.98  ? 1012 LYS A O     1 
ATOM   7299  C  CB    . LYS A 1  1012 ? 125.739 124.660 128.355 1.00 68.62  ? 1012 LYS A CB    1 
ATOM   7300  C  CG    . LYS A 1  1012 ? 126.128 125.725 129.364 1.00 68.13  ? 1012 LYS A CG    1 
ATOM   7301  C  CD    . LYS A 1  1012 ? 127.030 125.155 130.447 1.00 67.90  ? 1012 LYS A CD    1 
ATOM   7302  C  CE    . LYS A 1  1012 ? 127.344 126.197 131.509 1.00 67.00  ? 1012 LYS A CE    1 
ATOM   7303  N  NZ    . LYS A 1  1012 ? 128.029 127.387 130.935 1.00 67.20  ? 1012 LYS A NZ    1 
ATOM   7304  N  N     . THR A 1  1013 ? 123.939 122.998 126.589 1.00 66.83  ? 1013 THR A N     1 
ATOM   7305  C  CA    . THR A 1  1013 ? 123.684 121.885 125.681 1.00 66.22  ? 1013 THR A CA    1 
ATOM   7306  C  C     . THR A 1  1013 ? 122.767 122.298 124.536 1.00 66.40  ? 1013 THR A C     1 
ATOM   7307  O  O     . THR A 1  1013 ? 122.895 121.779 123.421 1.00 66.35  ? 1013 THR A O     1 
ATOM   7308  C  CB    . THR A 1  1013 ? 123.082 120.709 126.451 1.00 66.34  ? 1013 THR A CB    1 
ATOM   7309  O  OG1   . THR A 1  1013 ? 123.875 120.445 127.616 1.00 64.96  ? 1013 THR A OG1   1 
ATOM   7310  C  CG2   . THR A 1  1013 ? 123.051 119.458 125.584 1.00 63.92  ? 1013 THR A CG2   1 
ATOM   7311  N  N     . SER A 1  1014 ? 121.851 123.236 124.785 1.00 63.28  ? 1014 SER A N     1 
ATOM   7312  C  CA    . SER A 1  1014 ? 120.922 123.681 123.753 1.00 63.27  ? 1014 SER A CA    1 
ATOM   7313  C  C     . SER A 1  1014 ? 121.568 124.603 122.726 1.00 62.87  ? 1014 SER A C     1 
ATOM   7314  O  O     . SER A 1  1014 ? 120.918 124.939 121.731 1.00 63.99  ? 1014 SER A O     1 
ATOM   7315  C  CB    . SER A 1  1014 ? 119.728 124.388 124.395 1.00 62.64  ? 1014 SER A CB    1 
ATOM   7316  O  OG    . SER A 1  1014 ? 119.068 123.540 125.319 1.00 62.52  ? 1014 SER A OG    1 
ATOM   7317  N  N     . ARG A 1  1015 ? 122.818 125.016 122.936 1.00 60.91  ? 1015 ARG A N     1 
ATOM   7318  C  CA    . ARG A 1  1015 ? 123.497 125.933 122.031 1.00 61.68  ? 1015 ARG A CA    1 
ATOM   7319  C  C     . ARG A 1  1015 ? 124.715 125.333 121.345 1.00 62.79  ? 1015 ARG A C     1 
ATOM   7320  O  O     . ARG A 1  1015 ? 125.000 125.690 120.201 1.00 61.64  ? 1015 ARG A O     1 
ATOM   7321  C  CB    . ARG A 1  1015 ? 123.927 127.199 122.785 1.00 64.37  ? 1015 ARG A CB    1 
ATOM   7322  C  CG    . ARG A 1  1015 ? 124.531 128.301 121.918 1.00 65.70  ? 1015 ARG A CG    1 
ATOM   7323  C  CD    . ARG A 1  1015 ? 123.491 128.974 121.030 1.00 67.49  ? 1015 ARG A CD    1 
ATOM   7324  N  NE    . ARG A 1  1015 ? 123.244 128.236 119.796 1.00 67.34  ? 1015 ARG A NE    1 
ATOM   7325  C  CZ    . ARG A 1  1015 ? 122.390 128.621 118.853 1.00 68.65  ? 1015 ARG A CZ    1 
ATOM   7326  N  NH1   . ARG A 1  1015 ? 122.228 127.887 117.760 1.00 59.68  ? 1015 ARG A NH1   1 
ATOM   7327  N  NH2   . ARG A 1  1015 ? 121.697 129.743 119.001 1.00 59.39  ? 1015 ARG A NH2   1 
ATOM   7328  N  N     . SER A 1  1016 ? 125.432 124.424 122.010 1.00 57.74  ? 1016 SER A N     1 
ATOM   7329  C  CA    . SER A 1  1016 ? 126.660 123.877 121.441 1.00 58.09  ? 1016 SER A CA    1 
ATOM   7330  C  C     . SER A 1  1016 ? 126.392 122.929 120.279 1.00 58.46  ? 1016 SER A C     1 
ATOM   7331  O  O     . SER A 1  1016 ? 127.275 122.726 119.439 1.00 58.60  ? 1016 SER A O     1 
ATOM   7332  C  CB    . SER A 1  1016 ? 127.464 123.157 122.524 1.00 56.19  ? 1016 SER A CB    1 
ATOM   7333  O  OG    . SER A 1  1016 ? 126.722 122.086 123.082 1.00 55.69  ? 1016 SER A OG    1 
ATOM   7334  N  N     . GLY A 1  1017 ? 125.195 122.341 120.217 1.00 54.89  ? 1017 GLY A N     1 
ATOM   7335  C  CA    . GLY A 1  1017 ? 124.897 121.390 119.159 1.00 54.35  ? 1017 GLY A CA    1 
ATOM   7336  C  C     . GLY A 1  1017 ? 124.953 121.986 117.766 1.00 55.00  ? 1017 GLY A C     1 
ATOM   7337  O  O     . GLY A 1  1017 ? 125.341 121.306 116.812 1.00 55.20  ? 1017 GLY A O     1 
ATOM   7338  N  N     . TYR A 1  1018 ? 124.570 123.258 117.627 1.00 52.90  ? 1018 TYR A N     1 
ATOM   7339  C  CA    . TYR A 1  1018 ? 124.519 123.873 116.304 1.00 53.11  ? 1018 TYR A CA    1 
ATOM   7340  C  C     . TYR A 1  1018 ? 125.908 124.048 115.704 1.00 53.38  ? 1018 TYR A C     1 
ATOM   7341  O  O     . TYR A 1  1018 ? 126.050 124.090 114.477 1.00 53.61  ? 1018 TYR A O     1 
ATOM   7342  C  CB    . TYR A 1  1018 ? 123.798 125.220 116.379 1.00 53.99  ? 1018 TYR A CB    1 
ATOM   7343  C  CG    . TYR A 1  1018 ? 123.604 125.886 115.035 1.00 54.28  ? 1018 TYR A CG    1 
ATOM   7344  C  CD1   . TYR A 1  1018 ? 122.611 125.459 114.164 1.00 54.14  ? 1018 TYR A CD1   1 
ATOM   7345  C  CD2   . TYR A 1  1018 ? 124.410 126.946 114.639 1.00 54.35  ? 1018 TYR A CD2   1 
ATOM   7346  C  CE1   . TYR A 1  1018 ? 122.428 126.064 112.934 1.00 53.71  ? 1018 TYR A CE1   1 
ATOM   7347  C  CE2   . TYR A 1  1018 ? 124.235 127.558 113.412 1.00 53.39  ? 1018 TYR A CE2   1 
ATOM   7348  C  CZ    . TYR A 1  1018 ? 123.243 127.113 112.564 1.00 51.81  ? 1018 TYR A CZ    1 
ATOM   7349  O  OH    . TYR A 1  1018 ? 123.064 127.719 111.342 1.00 51.90  ? 1018 TYR A OH    1 
ATOM   7350  N  N     . LEU A 1  1019 ? 126.940 124.155 116.543 1.00 49.90  ? 1019 LEU A N     1 
ATOM   7351  C  CA    . LEU A 1  1019 ? 128.296 124.321 116.028 1.00 50.43  ? 1019 LEU A CA    1 
ATOM   7352  C  C     . LEU A 1  1019 ? 128.753 123.071 115.284 1.00 50.88  ? 1019 LEU A C     1 
ATOM   7353  O  O     . LEU A 1  1019 ? 129.232 123.153 114.148 1.00 50.64  ? 1019 LEU A O     1 
ATOM   7354  C  CB    . LEU A 1  1019 ? 129.254 124.659 117.173 1.00 51.34  ? 1019 LEU A CB    1 
ATOM   7355  C  CG    . LEU A 1  1019 ? 130.581 125.355 116.846 1.00 50.90  ? 1019 LEU A CG    1 
ATOM   7356  C  CD1   . LEU A 1  1019 ? 131.630 124.385 116.312 1.00 49.14  ? 1019 LEU A CD1   1 
ATOM   7357  C  CD2   . LEU A 1  1019 ? 130.357 126.497 115.864 1.00 48.68  ? 1019 LEU A CD2   1 
ATOM   7358  N  N     . GLN A 1  1020 ? 128.614 121.902 115.913 1.00 50.47  ? 1020 GLN A N     1 
ATOM   7359  C  CA    . GLN A 1  1020 ? 129.011 120.658 115.262 1.00 50.24  ? 1020 GLN A CA    1 
ATOM   7360  C  C     . GLN A 1  1020 ? 128.095 120.335 114.088 1.00 49.73  ? 1020 GLN A C     1 
ATOM   7361  O  O     . GLN A 1  1020 ? 128.549 119.848 113.047 1.00 49.53  ? 1020 GLN A O     1 
ATOM   7362  C  CB    . GLN A 1  1020 ? 129.014 119.514 116.276 1.00 49.33  ? 1020 GLN A CB    1 
ATOM   7363  C  CG    . GLN A 1  1020 ? 130.071 119.649 117.359 1.00 48.97  ? 1020 GLN A CG    1 
ATOM   7364  C  CD    . GLN A 1  1020 ? 131.480 119.582 116.803 1.00 49.44  ? 1020 GLN A CD    1 
ATOM   7365  O  OE1   . GLN A 1  1020 ? 132.177 120.593 116.725 1.00 51.44  ? 1020 GLN A OE1   1 
ATOM   7366  N  NE2   . GLN A 1  1020 ? 131.907 118.387 116.415 1.00 51.52  ? 1020 GLN A NE2   1 
ATOM   7367  N  N     . ARG A 1  1021 ? 126.796 120.602 114.239 1.00 52.56  ? 1021 ARG A N     1 
ATOM   7368  C  CA    . ARG A 1  1021 ? 125.843 120.260 113.188 1.00 53.07  ? 1021 ARG A CA    1 
ATOM   7369  C  C     . ARG A 1  1021 ? 126.051 121.104 111.936 1.00 54.46  ? 1021 ARG A C     1 
ATOM   7370  O  O     . ARG A 1  1021 ? 125.858 120.612 110.818 1.00 55.14  ? 1021 ARG A O     1 
ATOM   7371  C  CB    . ARG A 1  1021 ? 124.413 120.415 113.712 1.00 55.73  ? 1021 ARG A CB    1 
ATOM   7372  C  CG    . ARG A 1  1021 ? 123.323 119.978 112.740 1.00 56.19  ? 1021 ARG A CG    1 
ATOM   7373  C  CD    . ARG A 1  1021 ? 122.705 121.167 112.019 1.00 56.56  ? 1021 ARG A CD    1 
ATOM   7374  N  NE    . ARG A 1  1021 ? 121.668 120.759 111.075 1.00 56.79  ? 1021 ARG A NE    1 
ATOM   7375  C  CZ    . ARG A 1  1021 ? 120.379 120.651 111.382 1.00 56.69  ? 1021 ARG A CZ    1 
ATOM   7376  N  NH1   . ARG A 1  1021 ? 119.964 120.917 112.612 1.00 52.07  ? 1021 ARG A NH1   1 
ATOM   7377  N  NH2   . ARG A 1  1021 ? 119.506 120.274 110.458 1.00 52.08  ? 1021 ARG A NH2   1 
ATOM   7378  N  N     . CYS A 1  1022 ? 126.448 122.366 112.096 1.00 51.35  ? 1022 CYS A N     1 
ATOM   7379  C  CA    . CYS A 1  1022 ? 126.619 123.259 110.958 1.00 51.15  ? 1022 CYS A CA    1 
ATOM   7380  C  C     . CYS A 1  1022 ? 128.024 123.225 110.374 1.00 51.87  ? 1022 CYS A C     1 
ATOM   7381  O  O     . CYS A 1  1022 ? 128.201 123.578 109.203 1.00 52.30  ? 1022 CYS A O     1 
ATOM   7382  C  CB    . CYS A 1  1022 ? 126.268 124.696 111.357 1.00 50.30  ? 1022 CYS A CB    1 
ATOM   7383  S  SG    . CYS A 1  1022 ? 126.186 125.868 109.981 1.00 49.88  ? 1022 CYS A SG    1 
ATOM   7384  N  N     . LEU A 1  1023 ? 129.024 122.813 111.153 1.00 50.48  ? 1023 LEU A N     1 
ATOM   7385  C  CA    . LEU A 1  1023 ? 130.391 122.724 110.658 1.00 51.31  ? 1023 LEU A CA    1 
ATOM   7386  C  C     . LEU A 1  1023 ? 130.735 121.360 110.080 1.00 51.81  ? 1023 LEU A C     1 
ATOM   7387  O  O     . LEU A 1  1023 ? 131.663 121.267 109.269 1.00 52.07  ? 1023 LEU A O     1 
ATOM   7388  C  CB    . LEU A 1  1023 ? 131.390 123.062 111.772 1.00 52.07  ? 1023 LEU A CB    1 
ATOM   7389  C  CG    . LEU A 1  1023 ? 131.837 124.521 111.898 1.00 52.23  ? 1023 LEU A CG    1 
ATOM   7390  C  CD1   . LEU A 1  1023 ? 132.528 124.980 110.621 1.00 51.65  ? 1023 LEU A CD1   1 
ATOM   7391  C  CD2   . LEU A 1  1023 ? 130.669 125.435 112.237 1.00 52.08  ? 1023 LEU A CD2   1 
ATOM   7392  N  N     . THR A 1  1024 ? 130.018 120.304 110.472 1.00 52.16  ? 1024 THR A N     1 
ATOM   7393  C  CA    . THR A 1  1024 ? 130.331 118.972 109.967 1.00 52.95  ? 1024 THR A CA    1 
ATOM   7394  C  C     . THR A 1  1024 ? 130.024 118.853 108.479 1.00 54.00  ? 1024 THR A C     1 
ATOM   7395  O  O     . THR A 1  1024 ? 130.756 118.185 107.744 1.00 54.12  ? 1024 THR A O     1 
ATOM   7396  C  CB    . THR A 1  1024 ? 129.560 117.913 110.759 1.00 54.39  ? 1024 THR A CB    1 
ATOM   7397  O  OG1   . THR A 1  1024 ? 129.927 117.990 112.143 1.00 52.69  ? 1024 THR A OG1   1 
ATOM   7398  C  CG2   . THR A 1  1024 ? 129.868 116.516 110.239 1.00 52.45  ? 1024 THR A CG2   1 
ATOM   7399  N  N     . LYS A 1  1025 ? 128.957 119.508 108.015 1.00 52.90  ? 1025 LYS A N     1 
ATOM   7400  C  CA    . LYS A 1  1025 ? 128.519 119.339 106.632 1.00 53.11  ? 1025 LYS A CA    1 
ATOM   7401  C  C     . LYS A 1  1025 ? 129.607 119.752 105.644 1.00 53.13  ? 1025 LYS A C     1 
ATOM   7402  O  O     . LYS A 1  1025 ? 129.848 119.063 104.646 1.00 53.00  ? 1025 LYS A O     1 
ATOM   7403  C  CB    . LYS A 1  1025 ? 127.241 120.142 106.387 1.00 52.78  ? 1025 LYS A CB    1 
ATOM   7404  C  CG    . LYS A 1  1025 ? 127.324 121.591 106.842 1.00 53.06  ? 1025 LYS A CG    1 
ATOM   7405  C  CD    . LYS A 1  1025 ? 126.215 122.430 106.239 1.00 53.42  ? 1025 LYS A CD    1 
ATOM   7406  C  CE    . LYS A 1  1025 ? 126.266 122.404 104.720 1.00 53.10  ? 1025 LYS A CE    1 
ATOM   7407  N  NZ    . LYS A 1  1025 ? 125.208 123.258 104.116 1.00 53.93  ? 1025 LYS A NZ    1 
ATOM   7408  N  N     . GLN A 1  1026 ? 130.280 120.870 105.909 1.00 52.68  ? 1026 GLN A N     1 
ATOM   7409  C  CA    . GLN A 1  1026 ? 131.256 121.414 104.972 1.00 52.58  ? 1026 GLN A CA    1 
ATOM   7410  C  C     . GLN A 1  1026 ? 132.684 121.004 105.309 1.00 53.37  ? 1026 GLN A C     1 
ATOM   7411  O  O     . GLN A 1  1026 ? 133.519 120.878 104.407 1.00 54.48  ? 1026 GLN A O     1 
ATOM   7412  C  CB    . GLN A 1  1026 ? 131.143 122.940 104.936 1.00 55.18  ? 1026 GLN A CB    1 
ATOM   7413  C  CG    . GLN A 1  1026 ? 129.756 123.441 104.569 1.00 54.98  ? 1026 GLN A CG    1 
ATOM   7414  C  CD    . GLN A 1  1026 ? 129.584 124.922 104.826 1.00 55.87  ? 1026 GLN A CD    1 
ATOM   7415  O  OE1   . GLN A 1  1026 ? 130.485 125.582 105.340 1.00 52.26  ? 1026 GLN A OE1   1 
ATOM   7416  N  NE2   . GLN A 1  1026 ? 128.420 125.454 104.470 1.00 51.94  ? 1026 GLN A NE2   1 
ATOM   7417  N  N     . LEU A 1  1027 ? 132.982 120.790 106.589 1.00 52.65  ? 1027 LEU A N     1 
ATOM   7418  C  CA    . LEU A 1  1027 ? 134.321 120.439 107.039 1.00 52.97  ? 1027 LEU A CA    1 
ATOM   7419  C  C     . LEU A 1  1027 ? 134.477 118.935 107.262 1.00 54.33  ? 1027 LEU A C     1 
ATOM   7420  O  O     . LEU A 1  1027 ? 135.227 118.518 108.152 1.00 55.13  ? 1027 LEU A O     1 
ATOM   7421  C  CB    . LEU A 1  1027 ? 134.657 121.229 108.309 1.00 55.77  ? 1027 LEU A CB    1 
ATOM   7422  C  CG    . LEU A 1  1027 ? 136.084 121.727 108.577 1.00 55.20  ? 1027 LEU A CG    1 
ATOM   7423  C  CD1   . LEU A 1  1027 ? 136.931 120.736 109.341 1.00 51.77  ? 1027 LEU A CD1   1 
ATOM   7424  C  CD2   . LEU A 1  1027 ? 136.759 122.085 107.269 1.00 51.82  ? 1027 LEU A CD2   1 
ATOM   7425  N  N     . GLU A 1  1028 ? 133.774 118.115 106.480 1.00 50.70  ? 1028 GLU A N     1 
ATOM   7426  C  CA    . GLU A 1  1028 ? 133.795 116.666 106.647 1.00 50.12  ? 1028 GLU A CA    1 
ATOM   7427  C  C     . GLU A 1  1028 ? 134.797 115.980 105.728 1.00 51.80  ? 1028 GLU A C     1 
ATOM   7428  O  O     . GLU A 1  1028 ? 135.500 115.059 106.158 1.00 53.60  ? 1028 GLU A O     1 
ATOM   7429  C  CB    . GLU A 1  1028 ? 132.399 116.091 106.394 1.00 55.27  ? 1028 GLU A CB    1 
ATOM   7430  C  CG    . GLU A 1  1028 ? 132.280 114.591 106.579 1.00 55.86  ? 1028 GLU A CG    1 
ATOM   7431  C  CD    . GLU A 1  1028 ? 130.886 114.084 106.262 1.00 56.37  ? 1028 GLU A CD    1 
ATOM   7432  O  OE1   . GLU A 1  1028 ? 130.054 114.887 105.789 1.00 48.57  ? 1028 GLU A OE1   1 
ATOM   7433  O  OE2   . GLU A 1  1028 ? 130.619 112.885 106.491 1.00 48.18  ? 1028 GLU A OE2   1 
ATOM   7434  N  N     . GLY A 1  1029 ? 134.881 116.410 104.472 1.00 48.21  ? 1029 GLY A N     1 
ATOM   7435  C  CA    . GLY A 1  1029 ? 135.663 115.725 103.470 1.00 48.42  ? 1029 GLY A CA    1 
ATOM   7436  C  C     . GLY A 1  1029 ? 137.115 116.125 103.355 1.00 48.13  ? 1029 GLY A C     1 
ATOM   7437  O  O     . GLY A 1  1029 ? 137.845 115.516 102.567 1.00 47.77  ? 1029 GLY A O     1 
ATOM   7438  N  N     . VAL A 1  1030 ? 137.563 117.123 104.108 1.00 47.82  ? 1030 VAL A N     1 
ATOM   7439  C  CA    . VAL A 1  1030 ? 138.964 117.525 104.072 1.00 47.69  ? 1030 VAL A CA    1 
ATOM   7440  C  C     . VAL A 1  1030 ? 139.795 116.524 104.862 1.00 48.46  ? 1030 VAL A C     1 
ATOM   7441  O  O     . VAL A 1  1030 ? 139.411 116.097 105.959 1.00 48.66  ? 1030 VAL A O     1 
ATOM   7442  C  CB    . VAL A 1  1030 ? 139.135 118.957 104.613 1.00 48.78  ? 1030 VAL A CB    1 
ATOM   7443  C  CG1   . VAL A 1  1030 ? 138.558 119.962 103.629 1.00 46.96  ? 1030 VAL A CG1   1 
ATOM   7444  C  CG2   . VAL A 1  1030 ? 138.467 119.099 105.969 1.00 46.80  ? 1030 VAL A CG2   1 
ATOM   7445  N  N     . HIS A 1  1031 ? 140.939 116.138 104.301 1.00 46.15  ? 1031 HIS A N     1 
ATOM   7446  C  CA    . HIS A 1  1031 ? 141.804 115.150 104.932 1.00 45.99  ? 1031 HIS A CA    1 
ATOM   7447  C  C     . HIS A 1  1031 ? 143.179 115.204 104.284 1.00 46.08  ? 1031 HIS A C     1 
ATOM   7448  O  O     . HIS A 1  1031 ? 143.318 115.609 103.127 1.00 45.93  ? 1031 HIS A O     1 
ATOM   7449  C  CB    . HIS A 1  1031 ? 141.222 113.737 104.818 1.00 45.78  ? 1031 HIS A CB    1 
ATOM   7450  C  CG    . HIS A 1  1031 ? 141.086 113.251 103.409 1.00 46.10  ? 1031 HIS A CG    1 
ATOM   7451  N  ND1   . HIS A 1  1031 ? 139.988 113.538 102.626 1.00 46.27  ? 1031 HIS A ND1   1 
ATOM   7452  C  CD2   . HIS A 1  1031 ? 141.908 112.497 102.642 1.00 46.08  ? 1031 HIS A CD2   1 
ATOM   7453  C  CE1   . HIS A 1  1031 ? 140.140 112.982 101.437 1.00 45.74  ? 1031 HIS A CE1   1 
ATOM   7454  N  NE2   . HIS A 1  1031 ? 141.297 112.344 101.421 1.00 45.90  ? 1031 HIS A NE2   1 
ATOM   7455  N  N     . VAL A 1  1032 ? 144.190 114.790 105.046 1.00 45.39  ? 1032 VAL A N     1 
ATOM   7456  C  CA    . VAL A 1  1032 ? 145.550 114.717 104.523 1.00 45.21  ? 1032 VAL A CA    1 
ATOM   7457  C  C     . VAL A 1  1032 ? 145.613 113.624 103.465 1.00 46.12  ? 1032 VAL A C     1 
ATOM   7458  O  O     . VAL A 1  1032 ? 145.397 112.441 103.759 1.00 46.52  ? 1032 VAL A O     1 
ATOM   7459  C  CB    . VAL A 1  1032 ? 146.560 114.456 105.648 1.00 46.79  ? 1032 VAL A CB    1 
ATOM   7460  C  CG1   . VAL A 1  1032 ? 147.931 114.148 105.068 1.00 43.77  ? 1032 VAL A CG1   1 
ATOM   7461  C  CG2   . VAL A 1  1032 ? 146.637 115.651 106.582 1.00 44.40  ? 1032 VAL A CG2   1 
ATOM   7462  N  N     . SER A 1  1033 ? 145.907 114.013 102.229 1.00 44.45  ? 1033 SER A N     1 
ATOM   7463  C  CA    . SER A 1  1033 ? 146.040 113.051 101.148 1.00 44.53  ? 1033 SER A CA    1 
ATOM   7464  C  C     . SER A 1  1033 ? 147.370 112.310 101.265 1.00 45.12  ? 1033 SER A C     1 
ATOM   7465  O  O     . SER A 1  1033 ? 148.187 112.573 102.150 1.00 45.60  ? 1033 SER A O     1 
ATOM   7466  C  CB    . SER A 1  1033 ? 145.913 113.747 99.796  1.00 43.93  ? 1033 SER A CB    1 
ATOM   7467  O  OG    . SER A 1  1033 ? 146.088 112.827 98.733  1.00 44.23  ? 1033 SER A OG    1 
ATOM   7468  N  N     . TYR A 1  1034 ? 147.591 111.372 100.347 1.00 43.68  ? 1034 TYR A N     1 
ATOM   7469  C  CA    . TYR A 1  1034 ? 148.790 110.544 100.366 1.00 43.92  ? 1034 TYR A CA    1 
ATOM   7470  C  C     . TYR A 1  1034 ? 150.020 111.255 99.820  1.00 45.15  ? 1034 TYR A C     1 
ATOM   7471  O  O     . TYR A 1  1034 ? 151.079 110.628 99.705  1.00 46.66  ? 1034 TYR A O     1 
ATOM   7472  C  CB    . TYR A 1  1034 ? 148.534 109.253 99.585  1.00 47.31  ? 1034 TYR A CB    1 
ATOM   7473  C  CG    . TYR A 1  1034 ? 147.475 108.382 100.221 1.00 47.93  ? 1034 TYR A CG    1 
ATOM   7474  C  CD1   . TYR A 1  1034 ? 147.515 108.092 101.579 1.00 48.13  ? 1034 TYR A CD1   1 
ATOM   7475  C  CD2   . TYR A 1  1034 ? 146.424 107.871 99.473  1.00 48.33  ? 1034 TYR A CD2   1 
ATOM   7476  C  CE1   . TYR A 1  1034 ? 146.549 107.302 102.169 1.00 47.83  ? 1034 TYR A CE1   1 
ATOM   7477  C  CE2   . TYR A 1  1034 ? 145.452 107.079 100.055 1.00 48.42  ? 1034 TYR A CE2   1 
ATOM   7478  C  CZ    . TYR A 1  1034 ? 145.519 106.799 101.404 1.00 43.27  ? 1034 TYR A CZ    1 
ATOM   7479  O  OH    . TYR A 1  1034 ? 144.554 106.014 101.991 1.00 42.65  ? 1034 TYR A OH    1 
ATOM   7480  N  N     . ASP A 1  1035 ? 149.912 112.542 99.484  1.00 43.18  ? 1035 ASP A N     1 
ATOM   7481  C  CA    . ASP A 1  1035 ? 151.058 113.353 99.096  1.00 43.14  ? 1035 ASP A CA    1 
ATOM   7482  C  C     . ASP A 1  1035 ? 151.373 114.426 100.133 1.00 42.97  ? 1035 ASP A C     1 
ATOM   7483  O  O     . ASP A 1  1035 ? 151.973 115.452 99.797  1.00 42.59  ? 1035 ASP A O     1 
ATOM   7484  C  CB    . ASP A 1  1035 ? 150.824 113.989 97.724  1.00 42.21  ? 1035 ASP A CB    1 
ATOM   7485  C  CG    . ASP A 1  1035 ? 149.633 114.926 97.711  1.00 42.87  ? 1035 ASP A CG    1 
ATOM   7486  O  OD1   . ASP A 1  1035 ? 148.716 114.735 98.535  1.00 43.14  ? 1035 ASP A OD1   1 
ATOM   7487  O  OD2   . ASP A 1  1035 ? 149.615 115.853 96.875  1.00 42.79  ? 1035 ASP A OD2   1 
ATOM   7488  N  N     . ASN A 1  1036 ? 150.974 114.202 101.388 1.00 43.59  ? 1036 ASN A N     1 
ATOM   7489  C  CA    . ASN A 1  1036 ? 151.214 115.137 102.489 1.00 43.55  ? 1036 ASN A CA    1 
ATOM   7490  C  C     . ASN A 1  1036 ? 150.610 116.510 102.196 1.00 43.98  ? 1036 ASN A C     1 
ATOM   7491  O  O     . ASN A 1  1036 ? 151.265 117.547 102.326 1.00 44.54  ? 1036 ASN A O     1 
ATOM   7492  C  CB    . ASN A 1  1036 ? 152.708 115.244 102.805 1.00 44.50  ? 1036 ASN A CB    1 
ATOM   7493  C  CG    . ASN A 1  1036 ? 153.280 113.949 103.351 1.00 44.90  ? 1036 ASN A CG    1 
ATOM   7494  O  OD1   . ASN A 1  1036 ? 152.619 113.236 104.106 1.00 43.16  ? 1036 ASN A OD1   1 
ATOM   7495  N  ND2   . ASN A 1  1036 ? 154.511 113.636 102.967 1.00 42.84  ? 1036 ASN A ND2   1 
ATOM   7496  N  N     . SER A 1  1037 ? 149.340 116.507 101.796 1.00 43.74  ? 1037 SER A N     1 
ATOM   7497  C  CA    . SER A 1  1037 ? 148.604 117.738 101.547 1.00 44.50  ? 1037 SER A CA    1 
ATOM   7498  C  C     . SER A 1  1037 ? 147.136 117.505 101.871 1.00 44.51  ? 1037 SER A C     1 
ATOM   7499  O  O     . SER A 1  1037 ? 146.569 116.473 101.500 1.00 44.40  ? 1037 SER A O     1 
ATOM   7500  C  CB    . SER A 1  1037 ? 148.760 118.205 100.095 1.00 45.32  ? 1037 SER A CB    1 
ATOM   7501  O  OG    . SER A 1  1037 ? 148.215 117.257 99.193  1.00 45.47  ? 1037 SER A OG    1 
ATOM   7502  N  N     . ILE A 1  1038 ? 146.529 118.464 102.564 1.00 46.34  ? 1038 ILE A N     1 
ATOM   7503  C  CA    . ILE A 1  1038 ? 145.121 118.369 102.941 1.00 47.25  ? 1038 ILE A CA    1 
ATOM   7504  C  C     . ILE A 1  1038 ? 144.275 118.646 101.702 1.00 46.61  ? 1038 ILE A C     1 
ATOM   7505  O  O     . ILE A 1  1038 ? 144.271 119.759 101.173 1.00 46.30  ? 1038 ILE A O     1 
ATOM   7506  C  CB    . ILE A 1  1038 ? 144.776 119.332 104.082 1.00 46.72  ? 1038 ILE A CB    1 
ATOM   7507  C  CG1   . ILE A 1  1038 ? 145.485 120.674 103.898 1.00 46.97  ? 1038 ILE A CG1   1 
ATOM   7508  C  CG2   . ILE A 1  1038 ? 145.140 118.721 105.425 1.00 49.42  ? 1038 ILE A CG2   1 
ATOM   7509  C  CD1   . ILE A 1  1038 ? 145.238 121.648 105.027 1.00 49.74  ? 1038 ILE A CD1   1 
ATOM   7510  N  N     . ARG A 1  1039 ? 143.558 117.629 101.236 1.00 51.91  ? 1039 ARG A N     1 
ATOM   7511  C  CA    . ARG A 1  1039 ? 142.723 117.719 100.046 1.00 53.49  ? 1039 ARG A CA    1 
ATOM   7512  C  C     . ARG A 1  1039 ? 141.255 117.545 100.416 1.00 53.91  ? 1039 ARG A C     1 
ATOM   7513  O  O     . ARG A 1  1039 ? 140.910 117.080 101.505 1.00 54.24  ? 1039 ARG A O     1 
ATOM   7514  C  CB    . ARG A 1  1039 ? 143.137 116.665 99.013  1.00 54.14  ? 1039 ARG A CB    1 
ATOM   7515  C  CG    . ARG A 1  1039 ? 144.565 116.800 98.517  1.00 53.78  ? 1039 ARG A CG    1 
ATOM   7516  C  CD    . ARG A 1  1039 ? 144.703 117.940 97.526  1.00 53.29  ? 1039 ARG A CD    1 
ATOM   7517  N  NE    . ARG A 1  1039 ? 146.076 118.089 97.055  1.00 53.41  ? 1039 ARG A NE    1 
ATOM   7518  C  CZ    . ARG A 1  1039 ? 146.448 118.930 96.096  1.00 53.12  ? 1039 ARG A CZ    1 
ATOM   7519  N  NH1   . ARG A 1  1039 ? 147.720 119.000 95.730  1.00 54.30  ? 1039 ARG A NH1   1 
ATOM   7520  N  NH2   . ARG A 1  1039 ? 145.546 119.696 95.499  1.00 54.39  ? 1039 ARG A NH2   1 
ATOM   7521  N  N     . ASP A 1  1040 ? 140.389 117.927 99.483  1.00 55.32  ? 1040 ASP A N     1 
ATOM   7522  C  CA    . ASP A 1  1040 ? 138.953 117.777 99.632  1.00 56.37  ? 1040 ASP A CA    1 
ATOM   7523  C  C     . ASP A 1  1040 ? 138.491 116.545 98.856  1.00 56.96  ? 1040 ASP A C     1 
ATOM   7524  O  O     . ASP A 1  1040 ? 139.299 115.771 98.333  1.00 57.45  ? 1040 ASP A O     1 
ATOM   7525  C  CB    . ASP A 1  1040 ? 138.246 119.055 99.172  1.00 58.28  ? 1040 ASP A CB    1 
ATOM   7526  C  CG    . ASP A 1  1040 ? 136.861 119.209 99.776  1.00 57.26  ? 1040 ASP A CG    1 
ATOM   7527  O  OD1   . ASP A 1  1040 ? 136.252 118.184 100.147 1.00 56.46  ? 1040 ASP A OD1   1 
ATOM   7528  O  OD2   . ASP A 1  1040 ? 136.382 120.358 99.879  1.00 56.57  ? 1040 ASP A OD2   1 
ATOM   7529  N  N     . ALA A 1  1041 ? 137.173 116.350 98.781  1.00 56.58  ? 1041 ALA A N     1 
ATOM   7530  C  CA    . ALA A 1  1041 ? 136.631 115.199 98.066  1.00 56.84  ? 1041 ALA A CA    1 
ATOM   7531  C  C     . ALA A 1  1041 ? 136.882 115.309 96.568  1.00 57.70  ? 1041 ALA A C     1 
ATOM   7532  O  O     . ALA A 1  1041 ? 137.315 114.344 95.927  1.00 56.63  ? 1041 ALA A O     1 
ATOM   7533  C  CB    . ALA A 1  1041 ? 135.137 115.060 98.355  1.00 56.35  ? 1041 ALA A CB    1 
ATOM   7534  N  N     . ASP A 1  1042 ? 136.613 116.482 95.989  1.00 56.63  ? 1042 ASP A N     1 
ATOM   7535  C  CA    . ASP A 1  1042 ? 136.813 116.661 94.554  1.00 56.74  ? 1042 ASP A CA    1 
ATOM   7536  C  C     . ASP A 1  1042 ? 138.292 116.618 94.189  1.00 56.87  ? 1042 ASP A C     1 
ATOM   7537  O  O     . ASP A 1  1042 ? 138.666 116.055 93.154  1.00 57.17  ? 1042 ASP A O     1 
ATOM   7538  C  CB    . ASP A 1  1042 ? 136.185 117.976 94.097  1.00 57.30  ? 1042 ASP A CB    1 
ATOM   7539  C  CG    . ASP A 1  1042 ? 136.681 119.167 94.892  1.00 57.83  ? 1042 ASP A CG    1 
ATOM   7540  O  OD1   . ASP A 1  1042 ? 136.996 118.993 96.088  1.00 56.78  ? 1042 ASP A OD1   1 
ATOM   7541  O  OD2   . ASP A 1  1042 ? 136.758 120.276 94.322  1.00 57.17  ? 1042 ASP A OD2   1 
ATOM   7542  N  N     . GLY A 1  1043 ? 139.148 117.203 95.024  1.00 56.33  ? 1043 GLY A N     1 
ATOM   7543  C  CA    . GLY A 1  1043 ? 140.573 117.191 94.764  1.00 55.73  ? 1043 GLY A CA    1 
ATOM   7544  C  C     . GLY A 1  1043 ? 141.272 118.486 95.121  1.00 55.00  ? 1043 GLY A C     1 
ATOM   7545  O  O     . GLY A 1  1043 ? 142.505 118.541 95.151  1.00 54.69  ? 1043 GLY A O     1 
ATOM   7546  N  N     . THR A 1  1044 ? 140.501 119.537 95.388  1.00 54.41  ? 1044 THR A N     1 
ATOM   7547  C  CA    . THR A 1  1044 ? 141.092 120.814 95.758  1.00 54.14  ? 1044 THR A CA    1 
ATOM   7548  C  C     . THR A 1  1044 ? 141.698 120.738 97.155  1.00 53.90  ? 1044 THR A C     1 
ATOM   7549  O  O     . THR A 1  1044 ? 141.236 119.989 98.020  1.00 53.77  ? 1044 THR A O     1 
ATOM   7550  C  CB    . THR A 1  1044 ? 140.048 121.932 95.696  1.00 53.70  ? 1044 THR A CB    1 
ATOM   7551  O  OG1   . THR A 1  1044 ? 140.648 123.171 96.096  1.00 53.97  ? 1044 THR A OG1   1 
ATOM   7552  C  CG2   . THR A 1  1044 ? 138.872 121.624 96.610  1.00 53.82  ? 1044 THR A CG2   1 
ATOM   7553  N  N     . LEU A 1  1045 ? 142.750 121.520 97.367  1.00 54.40  ? 1045 LEU A N     1 
ATOM   7554  C  CA    . LEU A 1  1045 ? 143.481 121.516 98.624  1.00 55.39  ? 1045 LEU A CA    1 
ATOM   7555  C  C     . LEU A 1  1045 ? 143.138 122.748 99.455  1.00 57.57  ? 1045 LEU A C     1 
ATOM   7556  O  O     . LEU A 1  1045 ? 142.527 123.708 98.981  1.00 59.73  ? 1045 LEU A O     1 
ATOM   7557  C  CB    . LEU A 1  1045 ? 144.992 121.447 98.376  1.00 60.68  ? 1045 LEU A CB    1 
ATOM   7558  C  CG    . LEU A 1  1045 ? 145.708 122.704 97.873  1.00 60.22  ? 1045 LEU A CG    1 
ATOM   7559  C  CD1   . LEU A 1  1045 ? 147.198 122.609 98.159  1.00 54.54  ? 1045 LEU A CD1   1 
ATOM   7560  C  CD2   . LEU A 1  1045 ? 145.472 122.922 96.386  1.00 54.19  ? 1045 LEU A CD2   1 
ATOM   7561  N  N     . VAL A 1  1046 ? 143.547 122.704 100.721 1.00 54.69  ? 1046 VAL A N     1 
ATOM   7562  C  CA    . VAL A 1  1046 ? 143.399 123.823 101.648 1.00 55.35  ? 1046 VAL A CA    1 
ATOM   7563  C  C     . VAL A 1  1046 ? 144.747 124.483 101.922 1.00 55.93  ? 1046 VAL A C     1 
ATOM   7564  O  O     . VAL A 1  1046 ? 144.906 125.690 101.740 1.00 56.36  ? 1046 VAL A O     1 
ATOM   7565  C  CB    . VAL A 1  1046 ? 142.717 123.371 102.959 1.00 55.72  ? 1046 VAL A CB    1 
ATOM   7566  C  CG1   . VAL A 1  1046 ? 142.366 124.572 103.819 1.00 55.94  ? 1046 VAL A CG1   1 
ATOM   7567  C  CG2   . VAL A 1  1046 ? 141.480 122.540 102.657 1.00 56.27  ? 1046 VAL A CG2   1 
ATOM   7568  N  N     . GLN A 1  1047 ? 145.730 123.701 102.361 1.00 56.46  ? 1047 GLN A N     1 
ATOM   7569  C  CA    . GLN A 1  1047 ? 147.100 124.154 102.543 1.00 57.34  ? 1047 GLN A CA    1 
ATOM   7570  C  C     . GLN A 1  1047 ? 148.038 123.160 101.874 1.00 57.10  ? 1047 GLN A C     1 
ATOM   7571  O  O     . GLN A 1  1047 ? 147.634 122.069 101.462 1.00 57.11  ? 1047 GLN A O     1 
ATOM   7572  C  CB    . GLN A 1  1047 ? 147.455 124.304 104.030 1.00 57.14  ? 1047 GLN A CB    1 
ATOM   7573  C  CG    . GLN A 1  1047 ? 146.793 125.482 104.724 1.00 57.27  ? 1047 GLN A CG    1 
ATOM   7574  C  CD    . GLN A 1  1047 ? 147.456 126.803 104.390 1.00 57.33  ? 1047 GLN A CD    1 
ATOM   7575  O  OE1   . GLN A 1  1047 ? 148.531 126.838 103.792 1.00 59.35  ? 1047 GLN A OE1   1 
ATOM   7576  N  NE2   . GLN A 1  1047 ? 146.817 127.900 104.780 1.00 59.25  ? 1047 GLN A NE2   1 
ATOM   7577  N  N     . PHE A 1  1048 ? 149.310 123.547 101.765 1.00 62.45  ? 1048 PHE A N     1 
ATOM   7578  C  CA    . PHE A 1  1048 ? 150.303 122.637 101.204 1.00 65.72  ? 1048 PHE A CA    1 
ATOM   7579  C  C     . PHE A 1  1048 ? 150.575 121.472 102.147 1.00 70.17  ? 1048 PHE A C     1 
ATOM   7580  O  O     . PHE A 1  1048 ? 150.811 120.344 101.700 1.00 75.15  ? 1048 PHE A O     1 
ATOM   7581  C  CB    . PHE A 1  1048 ? 151.595 123.390 100.893 1.00 76.14  ? 1048 PHE A CB    1 
ATOM   7582  C  CG    . PHE A 1  1048 ? 152.769 122.492 100.625 1.00 77.04  ? 1048 PHE A CG    1 
ATOM   7583  C  CD1   . PHE A 1  1048 ? 152.780 121.658 99.520  1.00 78.98  ? 1048 PHE A CD1   1 
ATOM   7584  C  CD2   . PHE A 1  1048 ? 153.860 122.482 101.477 1.00 78.06  ? 1048 PHE A CD2   1 
ATOM   7585  C  CE1   . PHE A 1  1048 ? 153.858 120.829 99.269  1.00 64.03  ? 1048 PHE A CE1   1 
ATOM   7586  C  CE2   . PHE A 1  1048 ? 154.942 121.657 101.231 1.00 78.52  ? 1048 PHE A CE2   1 
ATOM   7587  C  CZ    . PHE A 1  1048 ? 154.940 120.829 100.126 1.00 64.06  ? 1048 PHE A CZ    1 
ATOM   7588  N  N     . MET A 1  1049 ? 150.542 121.725 103.452 1.00 62.86  ? 1049 MET A N     1 
ATOM   7589  C  CA    . MET A 1  1049 ? 150.761 120.683 104.443 1.00 63.04  ? 1049 MET A CA    1 
ATOM   7590  C  C     . MET A 1  1049 ? 150.077 121.106 105.735 1.00 64.16  ? 1049 MET A C     1 
ATOM   7591  O  O     . MET A 1  1049 ? 149.834 122.295 105.961 1.00 65.99  ? 1049 MET A O     1 
ATOM   7592  C  CB    . MET A 1  1049 ? 152.256 120.434 104.669 1.00 67.45  ? 1049 MET A CB    1 
ATOM   7593  C  CG    . MET A 1  1049 ? 152.575 119.097 105.314 1.00 67.30  ? 1049 MET A CG    1 
ATOM   7594  S  SD    . MET A 1  1049 ? 154.345 118.766 105.404 1.00 62.25  ? 1049 MET A SD    1 
ATOM   7595  C  CE    . MET A 1  1049 ? 154.776 118.767 103.665 1.00 62.36  ? 1049 MET A CE    1 
ATOM   7596  N  N     . TYR A 1  1050 ? 149.763 120.119 106.576 1.00 61.05  ? 1050 TYR A N     1 
ATOM   7597  C  CA    . TYR A 1  1050 ? 149.043 120.381 107.818 1.00 60.03  ? 1050 TYR A CA    1 
ATOM   7598  C  C     . TYR A 1  1050 ? 149.852 121.291 108.732 1.00 60.36  ? 1050 TYR A C     1 
ATOM   7599  O  O     . TYR A 1  1050 ? 150.861 120.870 109.307 1.00 61.32  ? 1050 TYR A O     1 
ATOM   7600  C  CB    . TYR A 1  1050 ? 148.715 119.065 108.528 1.00 61.39  ? 1050 TYR A CB    1 
ATOM   7601  C  CG    . TYR A 1  1050 ? 148.134 119.235 109.915 1.00 61.83  ? 1050 TYR A CG    1 
ATOM   7602  C  CD1   . TYR A 1  1050 ? 146.788 119.523 110.095 1.00 62.78  ? 1050 TYR A CD1   1 
ATOM   7603  C  CD2   . TYR A 1  1050 ? 148.930 119.097 111.045 1.00 63.45  ? 1050 TYR A CD2   1 
ATOM   7604  C  CE1   . TYR A 1  1050 ? 146.253 119.676 111.361 1.00 62.94  ? 1050 TYR A CE1   1 
ATOM   7605  C  CE2   . TYR A 1  1050 ? 148.404 119.245 112.314 1.00 62.43  ? 1050 TYR A CE2   1 
ATOM   7606  C  CZ    . TYR A 1  1050 ? 147.064 119.533 112.465 1.00 59.16  ? 1050 TYR A CZ    1 
ATOM   7607  O  OH    . TYR A 1  1050 ? 146.536 119.685 113.727 1.00 58.32  ? 1050 TYR A OH    1 
ATOM   7608  N  N     . GLY A 1  1051 ? 149.406 122.540 108.874 1.00 59.11  ? 1051 GLY A N     1 
ATOM   7609  C  CA    . GLY A 1  1051 ? 150.083 123.524 109.697 1.00 59.36  ? 1051 GLY A CA    1 
ATOM   7610  C  C     . GLY A 1  1051 ? 151.553 123.712 109.379 1.00 59.49  ? 1051 GLY A C     1 
ATOM   7611  O  O     . GLY A 1  1051 ? 152.310 124.220 110.211 1.00 59.85  ? 1051 GLY A O     1 
ATOM   7612  N  N     . GLY A 1  1052 ? 151.970 123.308 108.181 1.00 59.33  ? 1052 GLY A N     1 
ATOM   7613  C  CA    . GLY A 1  1052 ? 153.365 123.356 107.800 1.00 58.88  ? 1052 GLY A CA    1 
ATOM   7614  C  C     . GLY A 1  1052 ? 154.267 122.368 108.508 1.00 58.40  ? 1052 GLY A C     1 
ATOM   7615  O  O     . GLY A 1  1052 ? 155.459 122.307 108.186 1.00 58.46  ? 1052 GLY A O     1 
ATOM   7616  N  N     . ASP A 1  1053 ? 153.745 121.594 109.454 1.00 58.32  ? 1053 ASP A N     1 
ATOM   7617  C  CA    . ASP A 1  1053 ? 154.531 120.627 110.211 1.00 58.89  ? 1053 ASP A CA    1 
ATOM   7618  C  C     . ASP A 1  1053 ? 154.085 119.190 109.994 1.00 59.30  ? 1053 ASP A C     1 
ATOM   7619  O  O     . ASP A 1  1053 ? 154.933 118.300 109.886 1.00 59.63  ? 1053 ASP A O     1 
ATOM   7620  C  CB    . ASP A 1  1053 ? 154.468 120.956 111.710 1.00 59.16  ? 1053 ASP A CB    1 
ATOM   7621  C  CG    . ASP A 1  1053 ? 155.730 120.558 112.447 1.00 59.88  ? 1053 ASP A CG    1 
ATOM   7622  O  OD1   . ASP A 1  1053 ? 155.976 119.344 112.600 1.00 58.96  ? 1053 ASP A OD1   1 
ATOM   7623  O  OD2   . ASP A 1  1053 ? 156.485 121.462 112.864 1.00 59.07  ? 1053 ASP A OD2   1 
ATOM   7624  N  N     . ALA A 1  1054 ? 152.773 118.945 109.947 1.00 59.84  ? 1054 ALA A N     1 
ATOM   7625  C  CA    . ALA A 1  1054 ? 152.207 117.622 109.675 1.00 60.83  ? 1054 ALA A CA    1 
ATOM   7626  C  C     . ALA A 1  1054 ? 152.579 116.613 110.762 1.00 61.28  ? 1054 ALA A C     1 
ATOM   7627  O  O     . ALA A 1  1054 ? 152.978 115.482 110.483 1.00 60.78  ? 1054 ALA A O     1 
ATOM   7628  C  CB    . ALA A 1  1054 ? 152.620 117.113 108.291 1.00 60.05  ? 1054 ALA A CB    1 
ATOM   7629  N  N     . ILE A 1  1055 ? 152.439 117.033 112.016 1.00 61.20  ? 1055 ILE A N     1 
ATOM   7630  C  CA    . ILE A 1  1055 ? 152.615 116.153 113.165 1.00 61.63  ? 1055 ILE A CA    1 
ATOM   7631  C  C     . ILE A 1  1055 ? 151.307 116.113 113.942 1.00 62.23  ? 1055 ILE A C     1 
ATOM   7632  O  O     . ILE A 1  1055 ? 150.639 117.140 114.108 1.00 63.00  ? 1055 ILE A O     1 
ATOM   7633  C  CB    . ILE A 1  1055 ? 153.787 116.600 114.064 1.00 63.60  ? 1055 ILE A CB    1 
ATOM   7634  C  CG1   . ILE A 1  1055 ? 153.663 118.079 114.436 1.00 62.19  ? 1055 ILE A CG1   1 
ATOM   7635  C  CG2   . ILE A 1  1055 ? 155.118 116.319 113.382 1.00 61.79  ? 1055 ILE A CG2   1 
ATOM   7636  C  CD1   . ILE A 1  1055 ? 153.192 118.316 115.852 1.00 61.56  ? 1055 ILE A CD1   1 
ATOM   7637  N  N     . ASP A 1  1056 ? 150.941 114.923 114.409 1.00 61.68  ? 1056 ASP A N     1 
ATOM   7638  C  CA    . ASP A 1  1056 ? 149.658 114.728 115.063 1.00 61.29  ? 1056 ASP A CA    1 
ATOM   7639  C  C     . ASP A 1  1056 ? 149.712 115.208 116.511 1.00 61.29  ? 1056 ASP A C     1 
ATOM   7640  O  O     . ASP A 1  1056 ? 150.775 115.289 117.131 1.00 61.24  ? 1056 ASP A O     1 
ATOM   7641  C  CB    . ASP A 1  1056 ? 149.250 113.255 115.010 1.00 60.54  ? 1056 ASP A CB    1 
ATOM   7642  C  CG    . ASP A 1  1056 ? 147.761 113.050 115.233 1.00 62.18  ? 1056 ASP A CG    1 
ATOM   7643  O  OD1   . ASP A 1  1056 ? 147.102 113.962 115.776 1.00 60.34  ? 1056 ASP A OD1   1 
ATOM   7644  O  OD2   . ASP A 1  1056 ? 147.249 111.972 114.864 1.00 60.37  ? 1056 ASP A OD2   1 
ATOM   7645  N  N     . ILE A 1  1057 ? 148.532 115.533 117.045 1.00 59.15  ? 1057 ILE A N     1 
ATOM   7646  C  CA    . ILE A 1  1057 ? 148.440 115.946 118.441 1.00 58.46  ? 1057 ILE A CA    1 
ATOM   7647  C  C     . ILE A 1  1057 ? 148.748 114.777 119.367 1.00 58.43  ? 1057 ILE A C     1 
ATOM   7648  O  O     . ILE A 1  1057 ? 149.317 114.965 120.450 1.00 57.85  ? 1057 ILE A O     1 
ATOM   7649  C  CB    . ILE A 1  1057 ? 147.050 116.544 118.727 1.00 57.72  ? 1057 ILE A CB    1 
ATOM   7650  C  CG1   . ILE A 1  1057 ? 146.725 117.636 117.708 1.00 58.87  ? 1057 ILE A CG1   1 
ATOM   7651  C  CG2   . ILE A 1  1057 ? 146.985 117.107 120.138 1.00 58.60  ? 1057 ILE A CG2   1 
ATOM   7652  C  CD1   . ILE A 1  1057 ? 147.671 118.812 117.759 1.00 59.06  ? 1057 ILE A CD1   1 
ATOM   7653  N  N     . THR A 1  1058 ? 148.395 113.556 118.958 1.00 58.64  ? 1058 THR A N     1 
ATOM   7654  C  CA    . THR A 1  1058 ? 148.661 112.374 119.768 1.00 58.87  ? 1058 THR A CA    1 
ATOM   7655  C  C     . THR A 1  1058 ? 150.147 112.060 119.890 1.00 59.07  ? 1058 THR A C     1 
ATOM   7656  O  O     . THR A 1  1058 ? 150.516 111.217 120.715 1.00 59.31  ? 1058 THR A O     1 
ATOM   7657  C  CB    . THR A 1  1058 ? 147.929 111.162 119.187 1.00 58.88  ? 1058 THR A CB    1 
ATOM   7658  O  OG1   . THR A 1  1058 ? 148.389 110.920 117.851 1.00 58.31  ? 1058 THR A OG1   1 
ATOM   7659  C  CG2   . THR A 1  1058 ? 146.428 111.408 119.164 1.00 57.66  ? 1058 THR A CG2   1 
ATOM   7660  N  N     . LYS A 1  1059 ? 151.001 112.711 119.098 1.00 58.52  ? 1059 LYS A N     1 
ATOM   7661  C  CA    . LYS A 1  1059 ? 152.437 112.500 119.168 1.00 59.22  ? 1059 LYS A CA    1 
ATOM   7662  C  C     . LYS A 1  1059 ? 153.225 113.764 119.477 1.00 59.63  ? 1059 LYS A C     1 
ATOM   7663  O  O     . LYS A 1  1059 ? 154.437 113.674 119.703 1.00 59.93  ? 1059 LYS A O     1 
ATOM   7664  C  CB    . LYS A 1  1059 ? 152.955 111.895 117.854 1.00 60.47  ? 1059 LYS A CB    1 
ATOM   7665  C  CG    . LYS A 1  1059 ? 152.370 110.527 117.535 1.00 60.91  ? 1059 LYS A CG    1 
ATOM   7666  C  CD    . LYS A 1  1059 ? 152.946 109.960 116.250 1.00 61.31  ? 1059 LYS A CD    1 
ATOM   7667  C  CE    . LYS A 1  1059 ? 152.374 108.584 115.950 1.00 59.69  ? 1059 LYS A CE    1 
ATOM   7668  N  NZ    . LYS A 1  1059 ? 152.938 108.008 114.698 1.00 60.06  ? 1059 LYS A NZ    1 
ATOM   7669  N  N     . GLU A 1  1060 ? 152.583 114.933 119.495 1.00 59.63  ? 1060 GLU A N     1 
ATOM   7670  C  CA    . GLU A 1  1060 ? 153.239 116.180 119.887 1.00 59.55  ? 1060 GLU A CA    1 
ATOM   7671  C  C     . GLU A 1  1060 ? 153.318 116.205 121.411 1.00 59.64  ? 1060 GLU A C     1 
ATOM   7672  O  O     . GLU A 1  1060 ? 152.527 116.847 122.105 1.00 59.98  ? 1060 GLU A O     1 
ATOM   7673  C  CB    . GLU A 1  1060 ? 152.489 117.385 119.330 1.00 60.51  ? 1060 GLU A CB    1 
ATOM   7674  C  CG    . GLU A 1  1060 ? 153.186 118.721 119.551 1.00 61.08  ? 1060 GLU A CG    1 
ATOM   7675  C  CD    . GLU A 1  1060 ? 152.580 119.516 120.693 1.00 60.59  ? 1060 GLU A CD    1 
ATOM   7676  O  OE1   . GLU A 1  1060 ? 151.411 119.256 121.046 1.00 59.22  ? 1060 GLU A OE1   1 
ATOM   7677  O  OE2   . GLU A 1  1060 ? 153.274 120.401 121.237 1.00 59.36  ? 1060 GLU A OE2   1 
ATOM   7678  N  N     . SER A 1  1061 ? 154.293 115.467 121.937 1.00 58.58  ? 1061 SER A N     1 
ATOM   7679  C  CA    . SER A 1  1061 ? 154.430 115.275 123.375 1.00 58.05  ? 1061 SER A CA    1 
ATOM   7680  C  C     . SER A 1  1061 ? 155.713 115.867 123.933 1.00 58.13  ? 1061 SER A C     1 
ATOM   7681  O  O     . SER A 1  1061 ? 155.662 116.663 124.878 1.00 58.22  ? 1061 SER A O     1 
ATOM   7682  C  CB    . SER A 1  1061 ? 154.357 113.777 123.706 1.00 58.17  ? 1061 SER A CB    1 
ATOM   7683  O  OG    . SER A 1  1061 ? 155.394 113.061 123.057 1.00 57.89  ? 1061 SER A OG    1 
ATOM   7684  N  N     . HIS A 1  1062 ? 156.866 115.505 123.378 1.00 58.88  ? 1062 HIS A N     1 
ATOM   7685  C  CA    . HIS A 1  1062 ? 158.164 115.935 123.889 1.00 59.37  ? 1062 HIS A CA    1 
ATOM   7686  C  C     . HIS A 1  1062 ? 159.003 116.543 122.774 1.00 58.76  ? 1062 HIS A C     1 
ATOM   7687  O  O     . HIS A 1  1062 ? 160.181 116.225 122.598 1.00 58.04  ? 1062 HIS A O     1 
ATOM   7688  C  CB    . HIS A 1  1062 ? 158.901 114.772 124.548 1.00 57.23  ? 1062 HIS A CB    1 
ATOM   7689  C  CG    . HIS A 1  1062 ? 158.141 114.133 125.669 1.00 57.01  ? 1062 HIS A CG    1 
ATOM   7690  N  ND1   . HIS A 1  1062 ? 157.141 113.208 125.460 1.00 57.26  ? 1062 HIS A ND1   1 
ATOM   7691  C  CD2   . HIS A 1  1062 ? 158.233 114.290 127.011 1.00 57.79  ? 1062 HIS A CD2   1 
ATOM   7692  C  CE1   . HIS A 1  1062 ? 156.652 112.821 126.625 1.00 60.25  ? 1062 HIS A CE1   1 
ATOM   7693  N  NE2   . HIS A 1  1062 ? 157.297 113.462 127.581 1.00 60.24  ? 1062 HIS A NE2   1 
ATOM   7694  N  N     . MET A 1  1063 ? 158.395 117.439 121.997 1.00 60.94  ? 1063 MET A N     1 
ATOM   7695  C  CA    . MET A 1  1063 ? 159.091 118.124 120.916 1.00 61.25  ? 1063 MET A CA    1 
ATOM   7696  C  C     . MET A 1  1063 ? 159.666 119.468 121.348 1.00 62.82  ? 1063 MET A C     1 
ATOM   7697  O  O     . MET A 1  1063 ? 160.213 120.192 120.510 1.00 64.40  ? 1063 MET A O     1 
ATOM   7698  C  CB    . MET A 1  1063 ? 158.151 118.312 119.721 1.00 66.45  ? 1063 MET A CB    1 
ATOM   7699  C  CG    . MET A 1  1063 ? 157.008 119.285 119.958 1.00 66.55  ? 1063 MET A CG    1 
ATOM   7700  S  SD    . MET A 1  1063 ? 157.325 120.910 119.241 1.00 60.33  ? 1063 MET A SD    1 
ATOM   7701  C  CE    . MET A 1  1063 ? 155.823 121.779 119.684 1.00 60.35  ? 1063 MET A CE    1 
ATOM   7702  N  N     . THR A 1  1064 ? 159.560 119.813 122.633 1.00 59.90  ? 1064 THR A N     1 
ATOM   7703  C  CA    . THR A 1  1064 ? 160.127 121.046 123.157 1.00 60.10  ? 1064 THR A CA    1 
ATOM   7704  C  C     . THR A 1  1064 ? 160.969 120.837 124.408 1.00 60.21  ? 1064 THR A C     1 
ATOM   7705  O  O     . THR A 1  1064 ? 161.571 121.801 124.894 1.00 60.51  ? 1064 THR A O     1 
ATOM   7706  C  CB    . THR A 1  1064 ? 159.020 122.066 123.468 1.00 60.16  ? 1064 THR A CB    1 
ATOM   7707  O  OG1   . THR A 1  1064 ? 157.978 121.431 124.220 1.00 60.46  ? 1064 THR A OG1   1 
ATOM   7708  C  CG2   . THR A 1  1064 ? 158.442 122.639 122.185 1.00 60.91  ? 1064 THR A CG2   1 
ATOM   7709  N  N     . GLN A 1  1065 ? 161.030 119.620 124.940 1.00 60.04  ? 1065 GLN A N     1 
ATOM   7710  C  CA    . GLN A 1  1065 ? 161.824 119.300 126.125 1.00 59.32  ? 1065 GLN A CA    1 
ATOM   7711  C  C     . GLN A 1  1065 ? 162.801 118.196 125.736 1.00 59.23  ? 1065 GLN A C     1 
ATOM   7712  O  O     . GLN A 1  1065 ? 162.507 117.007 125.884 1.00 59.44  ? 1065 GLN A O     1 
ATOM   7713  C  CB    . GLN A 1  1065 ? 160.933 118.880 127.293 1.00 59.93  ? 1065 GLN A CB    1 
ATOM   7714  C  CG    . GLN A 1  1065 ? 160.023 119.983 127.810 1.00 60.25  ? 1065 GLN A CG    1 
ATOM   7715  C  CD    . GLN A 1  1065 ? 159.204 119.548 129.009 1.00 60.28  ? 1065 GLN A CD    1 
ATOM   7716  O  OE1   . GLN A 1  1065 ? 159.162 118.366 129.351 1.00 58.22  ? 1065 GLN A OE1   1 
ATOM   7717  N  NE2   . GLN A 1  1065 ? 158.548 120.504 129.656 1.00 57.36  ? 1065 GLN A NE2   1 
ATOM   7718  N  N     . PHE A 1  1066 ? 163.971 118.595 125.238 1.00 57.60  ? 1066 PHE A N     1 
ATOM   7719  C  CA    . PHE A 1  1066 ? 164.985 117.634 124.825 1.00 57.40  ? 1066 PHE A CA    1 
ATOM   7720  C  C     . PHE A 1  1066 ? 165.688 116.972 126.002 1.00 56.91  ? 1066 PHE A C     1 
ATOM   7721  O  O     . PHE A 1  1066 ? 166.411 115.993 125.795 1.00 56.62  ? 1066 PHE A O     1 
ATOM   7722  C  CB    . PHE A 1  1066 ? 166.014 118.311 123.919 1.00 56.53  ? 1066 PHE A CB    1 
ATOM   7723  C  CG    . PHE A 1  1066 ? 165.443 118.802 122.622 1.00 56.64  ? 1066 PHE A CG    1 
ATOM   7724  C  CD1   . PHE A 1  1066 ? 165.304 117.945 121.543 1.00 57.00  ? 1066 PHE A CD1   1 
ATOM   7725  C  CD2   . PHE A 1  1066 ? 165.038 120.119 122.482 1.00 56.90  ? 1066 PHE A CD2   1 
ATOM   7726  C  CE1   . PHE A 1  1066 ? 164.777 118.393 120.347 1.00 56.60  ? 1066 PHE A CE1   1 
ATOM   7727  C  CE2   . PHE A 1  1066 ? 164.510 120.573 121.288 1.00 58.41  ? 1066 PHE A CE2   1 
ATOM   7728  C  CZ    . PHE A 1  1066 ? 164.378 119.709 120.219 1.00 59.23  ? 1066 PHE A CZ    1 
ATOM   7729  N  N     . GLU A 1  1067 ? 165.499 117.479 127.222 1.00 59.12  ? 1067 GLU A N     1 
ATOM   7730  C  CA    . GLU A 1  1067 ? 166.026 116.794 128.395 1.00 59.80  ? 1067 GLU A CA    1 
ATOM   7731  C  C     . GLU A 1  1067 ? 165.334 115.461 128.635 1.00 60.58  ? 1067 GLU A C     1 
ATOM   7732  O  O     . GLU A 1  1067 ? 165.903 114.594 129.304 1.00 61.42  ? 1067 GLU A O     1 
ATOM   7733  C  CB    . GLU A 1  1067 ? 165.890 117.680 129.635 1.00 62.05  ? 1067 GLU A CB    1 
ATOM   7734  C  CG    . GLU A 1  1067 ? 166.636 119.000 129.543 1.00 62.66  ? 1067 GLU A CG    1 
ATOM   7735  C  CD    . GLU A 1  1067 ? 166.470 119.849 130.788 1.00 62.00  ? 1067 GLU A CD    1 
ATOM   7736  O  OE1   . GLU A 1  1067 ? 165.737 119.425 131.705 1.00 59.54  ? 1067 GLU A OE1   1 
ATOM   7737  O  OE2   . GLU A 1  1067 ? 167.073 120.941 130.849 1.00 59.16  ? 1067 GLU A OE2   1 
ATOM   7738  N  N     . PHE A 1  1068 ? 164.123 115.279 128.104 1.00 59.84  ? 1068 PHE A N     1 
ATOM   7739  C  CA    . PHE A 1  1068 ? 163.419 114.011 128.258 1.00 60.60  ? 1068 PHE A CA    1 
ATOM   7740  C  C     . PHE A 1  1068 ? 164.082 112.915 127.432 1.00 61.84  ? 1068 PHE A C     1 
ATOM   7741  O  O     . PHE A 1  1068 ? 164.442 111.854 127.957 1.00 63.52  ? 1068 PHE A O     1 
ATOM   7742  C  CB    . PHE A 1  1068 ? 161.952 114.182 127.856 1.00 63.42  ? 1068 PHE A CB    1 
ATOM   7743  C  CG    . PHE A 1  1068 ? 161.141 112.921 127.952 1.00 64.61  ? 1068 PHE A CG    1 
ATOM   7744  C  CD1   . PHE A 1  1068 ? 160.610 112.515 129.164 1.00 65.80  ? 1068 PHE A CD1   1 
ATOM   7745  C  CD2   . PHE A 1  1068 ? 160.901 112.149 126.827 1.00 66.51  ? 1068 PHE A CD2   1 
ATOM   7746  C  CE1   . PHE A 1  1068 ? 159.861 111.358 129.255 1.00 65.78  ? 1068 PHE A CE1   1 
ATOM   7747  C  CE2   . PHE A 1  1068 ? 160.152 110.990 126.913 1.00 60.37  ? 1068 PHE A CE2   1 
ATOM   7748  C  CZ    . PHE A 1  1068 ? 159.632 110.595 128.128 1.00 59.41  ? 1068 PHE A CZ    1 
ATOM   7749  N  N     . CYS A 1  1069 ? 164.250 113.154 126.129 1.00 61.08  ? 1069 CYS A N     1 
ATOM   7750  C  CA    . CYS A 1  1069 ? 164.883 112.158 125.271 1.00 61.39  ? 1069 CYS A CA    1 
ATOM   7751  C  C     . CYS A 1  1069 ? 166.358 111.992 125.613 1.00 62.25  ? 1069 CYS A C     1 
ATOM   7752  O  O     . CYS A 1  1069 ? 166.921 110.901 125.461 1.00 63.99  ? 1069 CYS A O     1 
ATOM   7753  C  CB    . CYS A 1  1069 ? 164.709 112.542 123.802 1.00 60.95  ? 1069 CYS A CB    1 
ATOM   7754  S  SG    . CYS A 1  1069 ? 165.452 114.126 123.347 1.00 61.20  ? 1069 CYS A SG    1 
ATOM   7755  N  N     . LEU A 1  1070 ? 167.005 113.066 126.076 1.00 60.85  ? 1070 LEU A N     1 
ATOM   7756  C  CA    . LEU A 1  1070 ? 168.407 112.967 126.468 1.00 60.90  ? 1070 LEU A CA    1 
ATOM   7757  C  C     . LEU A 1  1070 ? 168.568 112.181 127.763 1.00 60.25  ? 1070 LEU A C     1 
ATOM   7758  O  O     . LEU A 1  1070 ? 169.613 111.561 127.987 1.00 59.92  ? 1070 LEU A O     1 
ATOM   7759  C  CB    . LEU A 1  1070 ? 169.011 114.366 126.606 1.00 60.06  ? 1070 LEU A CB    1 
ATOM   7760  C  CG    . LEU A 1  1070 ? 170.515 114.498 126.861 1.00 59.65  ? 1070 LEU A CG    1 
ATOM   7761  C  CD1   . LEU A 1  1070 ? 171.073 115.692 126.103 1.00 61.94  ? 1070 LEU A CD1   1 
ATOM   7762  C  CD2   . LEU A 1  1070 ? 170.810 114.637 128.348 1.00 62.23  ? 1070 LEU A CD2   1 
ATOM   7763  N  N     . ASP A 1  1071 ? 167.550 112.194 128.625 1.00 63.25  ? 1071 ASP A N     1 
ATOM   7764  C  CA    . ASP A 1  1071 ? 167.591 111.438 129.869 1.00 64.72  ? 1071 ASP A CA    1 
ATOM   7765  C  C     . ASP A 1  1071 ? 167.166 109.988 129.693 1.00 65.98  ? 1071 ASP A C     1 
ATOM   7766  O  O     . ASP A 1  1071 ? 167.494 109.152 130.542 1.00 66.86  ? 1071 ASP A O     1 
ATOM   7767  C  CB    . ASP A 1  1071 ? 166.700 112.110 130.920 1.00 67.08  ? 1071 ASP A CB    1 
ATOM   7768  C  CG    . ASP A 1  1071 ? 167.138 111.812 132.336 1.00 67.18  ? 1071 ASP A CG    1 
ATOM   7769  O  OD1   . ASP A 1  1071 ? 168.204 111.185 132.513 1.00 64.82  ? 1071 ASP A OD1   1 
ATOM   7770  O  OD2   . ASP A 1  1071 ? 166.425 112.225 133.274 1.00 64.79  ? 1071 ASP A OD2   1 
ATOM   7771  N  N     . ASN A 1  1072 ? 166.446 109.676 128.620 1.00 65.12  ? 1072 ASN A N     1 
ATOM   7772  C  CA    . ASN A 1  1072 ? 166.043 108.318 128.276 1.00 65.45  ? 1072 ASN A CA    1 
ATOM   7773  C  C     . ASN A 1  1072 ? 166.616 107.927 126.925 1.00 66.29  ? 1072 ASN A C     1 
ATOM   7774  O  O     . ASN A 1  1072 ? 165.922 107.362 126.073 1.00 67.06  ? 1072 ASN A O     1 
ATOM   7775  C  CB    . ASN A 1  1072 ? 164.523 108.179 128.279 1.00 67.36  ? 1072 ASN A CB    1 
ATOM   7776  C  CG    . ASN A 1  1072 ? 163.923 108.352 129.660 1.00 67.31  ? 1072 ASN A CG    1 
ATOM   7777  O  OD1   . ASN A 1  1072 ? 164.550 108.022 130.666 1.00 65.28  ? 1072 ASN A OD1   1 
ATOM   7778  N  ND2   . ASN A 1  1072 ? 162.703 108.872 129.714 1.00 64.30  ? 1072 ASN A ND2   1 
ATOM   7779  N  N     . TYR A 1  1073 ? 167.897 108.239 126.706 1.00 66.50  ? 1073 TYR A N     1 
ATOM   7780  C  CA    . TYR A 1  1073 ? 168.509 108.011 125.401 1.00 67.67  ? 1073 TYR A CA    1 
ATOM   7781  C  C     . TYR A 1  1073 ? 168.459 106.537 125.013 1.00 70.30  ? 1073 TYR A C     1 
ATOM   7782  O  O     . TYR A 1  1073 ? 167.870 106.179 123.989 1.00 73.34  ? 1073 TYR A O     1 
ATOM   7783  C  CB    . TYR A 1  1073 ? 169.948 108.541 125.387 1.00 74.88  ? 1073 TYR A CB    1 
ATOM   7784  C  CG    . TYR A 1  1073 ? 170.828 108.083 126.533 1.00 75.93  ? 1073 TYR A CG    1 
ATOM   7785  C  CD1   . TYR A 1  1073 ? 170.745 108.681 127.785 1.00 75.95  ? 1073 TYR A CD1   1 
ATOM   7786  C  CD2   . TYR A 1  1073 ? 171.766 107.075 126.354 1.00 75.77  ? 1073 TYR A CD2   1 
ATOM   7787  C  CE1   . TYR A 1  1073 ? 171.550 108.272 128.830 1.00 75.39  ? 1073 TYR A CE1   1 
ATOM   7788  C  CE2   . TYR A 1  1073 ? 172.577 106.659 127.393 1.00 74.61  ? 1073 TYR A CE2   1 
ATOM   7789  C  CZ    . TYR A 1  1073 ? 172.465 107.261 128.628 1.00 65.99  ? 1073 TYR A CZ    1 
ATOM   7790  O  OH    . TYR A 1  1073 ? 173.272 106.851 129.665 1.00 66.24  ? 1073 TYR A OH    1 
ATOM   7791  N  N     . TYR A 1  1074 ? 169.047 105.663 125.835 1.00 64.90  ? 1074 TYR A N     1 
ATOM   7792  C  CA    . TYR A 1  1074 ? 169.033 104.237 125.517 1.00 64.63  ? 1074 TYR A CA    1 
ATOM   7793  C  C     . TYR A 1  1074 ? 167.629 103.649 125.594 1.00 66.47  ? 1074 TYR A C     1 
ATOM   7794  O  O     . TYR A 1  1074 ? 167.356 102.620 124.966 1.00 68.83  ? 1074 TYR A O     1 
ATOM   7795  C  CB    . TYR A 1  1074 ? 169.969 103.473 126.454 1.00 70.26  ? 1074 TYR A CB    1 
ATOM   7796  C  CG    . TYR A 1  1074 ? 171.434 103.583 126.097 1.00 71.67  ? 1074 TYR A CG    1 
ATOM   7797  C  CD1   . TYR A 1  1074 ? 171.832 103.988 124.830 1.00 72.20  ? 1074 TYR A CD1   1 
ATOM   7798  C  CD2   . TYR A 1  1074 ? 172.417 103.268 127.024 1.00 72.83  ? 1074 TYR A CD2   1 
ATOM   7799  C  CE1   . TYR A 1  1074 ? 173.171 104.087 124.500 1.00 71.51  ? 1074 TYR A CE1   1 
ATOM   7800  C  CE2   . TYR A 1  1074 ? 173.759 103.364 126.705 1.00 70.14  ? 1074 TYR A CE2   1 
ATOM   7801  C  CZ    . TYR A 1  1074 ? 174.129 103.772 125.441 1.00 62.28  ? 1074 TYR A CZ    1 
ATOM   7802  O  OH    . TYR A 1  1074 ? 175.463 103.868 125.119 1.00 61.60  ? 1074 TYR A OH    1 
ATOM   7803  N  N     . ALA A 1  1075 ? 166.732 104.280 126.355 1.00 60.05  ? 1075 ALA A N     1 
ATOM   7804  C  CA    . ALA A 1  1075 ? 165.375 103.764 126.494 1.00 58.66  ? 1075 ALA A CA    1 
ATOM   7805  C  C     . ALA A 1  1075 ? 164.633 103.803 125.163 1.00 58.61  ? 1075 ALA A C     1 
ATOM   7806  O  O     . ALA A 1  1075 ? 164.180 102.770 124.656 1.00 57.16  ? 1075 ALA A O     1 
ATOM   7807  C  CB    . ALA A 1  1075 ? 164.621 104.557 127.561 1.00 57.53  ? 1075 ALA A CB    1 
ATOM   7808  N  N     . LEU A 1  1076 ? 164.506 104.993 124.575 1.00 55.40  ? 1076 LEU A N     1 
ATOM   7809  C  CA    . LEU A 1  1076 ? 163.769 105.120 123.323 1.00 54.61  ? 1076 LEU A CA    1 
ATOM   7810  C  C     . LEU A 1  1076 ? 164.615 104.734 122.114 1.00 54.54  ? 1076 LEU A C     1 
ATOM   7811  O  O     . LEU A 1  1076 ? 164.061 104.395 121.063 1.00 54.31  ? 1076 LEU A O     1 
ATOM   7812  C  CB    . LEU A 1  1076 ? 163.230 106.545 123.173 1.00 54.29  ? 1076 LEU A CB    1 
ATOM   7813  C  CG    . LEU A 1  1076 ? 164.199 107.726 123.276 1.00 53.86  ? 1076 LEU A CG    1 
ATOM   7814  C  CD1   . LEU A 1  1076 ? 164.782 108.084 121.919 1.00 54.62  ? 1076 LEU A CD1   1 
ATOM   7815  C  CD2   . LEU A 1  1076 ? 163.510 108.931 123.901 1.00 54.05  ? 1076 LEU A CD2   1 
ATOM   7816  N  N     . LEU A 1  1077 ? 165.945 104.773 122.240 1.00 55.89  ? 1077 LEU A N     1 
ATOM   7817  C  CA    . LEU A 1  1077 ? 166.802 104.349 121.136 1.00 57.03  ? 1077 LEU A CA    1 
ATOM   7818  C  C     . LEU A 1  1077 ? 166.607 102.875 120.811 1.00 58.20  ? 1077 LEU A C     1 
ATOM   7819  O  O     . LEU A 1  1077 ? 166.703 102.478 119.645 1.00 58.69  ? 1077 LEU A O     1 
ATOM   7820  C  CB    . LEU A 1  1077 ? 168.269 104.624 121.469 1.00 58.81  ? 1077 LEU A CB    1 
ATOM   7821  C  CG    . LEU A 1  1077 ? 169.343 104.245 120.449 1.00 58.93  ? 1077 LEU A CG    1 
ATOM   7822  C  CD1   . LEU A 1  1077 ? 169.161 105.031 119.165 1.00 56.82  ? 1077 LEU A CD1   1 
ATOM   7823  C  CD2   . LEU A 1  1077 ? 170.730 104.473 121.030 1.00 56.69  ? 1077 LEU A CD2   1 
ATOM   7824  N  N     . LYS A 1  1078 ? 166.332 102.051 121.824 1.00 56.88  ? 1078 LYS A N     1 
ATOM   7825  C  CA    . LYS A 1  1078 ? 166.152 100.624 121.584 1.00 57.08  ? 1078 LYS A CA    1 
ATOM   7826  C  C     . LYS A 1  1078 ? 164.840 100.344 120.859 1.00 56.79  ? 1078 LYS A C     1 
ATOM   7827  O  O     . LYS A 1  1078 ? 164.769 99.435  120.026 1.00 56.91  ? 1078 LYS A O     1 
ATOM   7828  C  CB    . LYS A 1  1078 ? 166.208 99.855  122.903 1.00 57.08  ? 1078 LYS A CB    1 
ATOM   7829  C  CG    . LYS A 1  1078 ? 166.248 98.345  122.733 1.00 56.89  ? 1078 LYS A CG    1 
ATOM   7830  C  CD    . LYS A 1  1078 ? 166.020 97.628  124.052 1.00 56.96  ? 1078 LYS A CD    1 
ATOM   7831  C  CE    . LYS A 1  1078 ? 164.613 97.870  124.572 1.00 57.87  ? 1078 LYS A CE    1 
ATOM   7832  N  NZ    . LYS A 1  1078 ? 164.337 97.090  125.809 1.00 57.70  ? 1078 LYS A NZ    1 
ATOM   7833  N  N     . LYS A 1  1079 ? 163.794 101.114 121.160 1.00 59.32  ? 1079 LYS A N     1 
ATOM   7834  C  CA    . LYS A 1  1079 ? 162.490 100.881 120.552 1.00 60.16  ? 1079 LYS A CA    1 
ATOM   7835  C  C     . LYS A 1  1079 ? 162.322 101.579 119.209 1.00 60.57  ? 1079 LYS A C     1 
ATOM   7836  O  O     . LYS A 1  1079 ? 161.533 101.110 118.381 1.00 60.30  ? 1079 LYS A O     1 
ATOM   7837  C  CB    . LYS A 1  1079 ? 161.372 101.318 121.508 1.00 60.37  ? 1079 LYS A CB    1 
ATOM   7838  C  CG    . LYS A 1  1079 ? 161.300 102.812 121.781 1.00 60.75  ? 1079 LYS A CG    1 
ATOM   7839  C  CD    . LYS A 1  1079 ? 160.115 103.444 121.069 1.00 60.84  ? 1079 LYS A CD    1 
ATOM   7840  C  CE    . LYS A 1  1079 ? 159.937 104.898 121.473 1.00 59.46  ? 1079 LYS A CE    1 
ATOM   7841  N  NZ    . LYS A 1  1079 ? 158.780 105.529 120.779 1.00 59.34  ? 1079 LYS A NZ    1 
ATOM   7842  N  N     . TYR A 1  1080 ? 163.038 102.680 118.968 1.00 58.60  ? 1080 TYR A N     1 
ATOM   7843  C  CA    . TYR A 1  1080 ? 163.002 103.303 117.650 1.00 58.10  ? 1080 TYR A CA    1 
ATOM   7844  C  C     . TYR A 1  1080 ? 163.813 102.513 116.629 1.00 57.00  ? 1080 TYR A C     1 
ATOM   7845  O  O     . TYR A 1  1080 ? 163.425 102.449 115.457 1.00 55.48  ? 1080 TYR A O     1 
ATOM   7846  C  CB    . TYR A 1  1080 ? 163.514 104.744 117.722 1.00 54.13  ? 1080 TYR A CB    1 
ATOM   7847  C  CG    . TYR A 1  1080 ? 162.470 105.747 118.166 1.00 53.10  ? 1080 TYR A CG    1 
ATOM   7848  C  CD1   . TYR A 1  1080 ? 161.328 105.970 117.407 1.00 52.81  ? 1080 TYR A CD1   1 
ATOM   7849  C  CD2   . TYR A 1  1080 ? 162.635 106.483 119.332 1.00 51.85  ? 1080 TYR A CD2   1 
ATOM   7850  C  CE1   . TYR A 1  1080 ? 160.374 106.886 117.804 1.00 53.93  ? 1080 TYR A CE1   1 
ATOM   7851  C  CE2   . TYR A 1  1080 ? 161.686 107.404 119.736 1.00 55.02  ? 1080 TYR A CE2   1 
ATOM   7852  C  CZ    . TYR A 1  1080 ? 160.557 107.601 118.968 1.00 59.54  ? 1080 TYR A CZ    1 
ATOM   7853  O  OH    . TYR A 1  1080 ? 159.610 108.516 119.367 1.00 59.39  ? 1080 TYR A OH    1 
ATOM   7854  N  N     . ASN A 1  1081 ? 164.922 101.904 117.059 1.00 61.87  ? 1081 ASN A N     1 
ATOM   7855  C  CA    . ASN A 1  1081 ? 165.791 101.079 116.226 1.00 63.72  ? 1081 ASN A CA    1 
ATOM   7856  C  C     . ASN A 1  1081 ? 166.195 101.805 114.947 1.00 64.22  ? 1081 ASN A C     1 
ATOM   7857  O  O     . ASN A 1  1081 ? 165.720 101.455 113.860 1.00 64.62  ? 1081 ASN A O     1 
ATOM   7858  C  CB    . ASN A 1  1081 ? 165.103 99.753  115.891 1.00 64.27  ? 1081 ASN A CB    1 
ATOM   7859  C  CG    . ASN A 1  1081 ? 166.044 98.752  115.250 1.00 64.99  ? 1081 ASN A CG    1 
ATOM   7860  O  OD1   . ASN A 1  1081 ? 167.265 98.904  115.309 1.00 64.77  ? 1081 ASN A OD1   1 
ATOM   7861  N  ND2   . ASN A 1  1081 ? 165.480 97.719  114.637 1.00 64.72  ? 1081 ASN A ND2   1 
ATOM   7862  N  N     . PRO A 1  1082 ? 167.059 102.823 115.032 1.00 66.17  ? 1082 PRO A N     1 
ATOM   7863  C  CA    . PRO A 1  1082 ? 167.494 103.515 113.808 1.00 66.65  ? 1082 PRO A CA    1 
ATOM   7864  C  C     . PRO A 1  1082 ? 168.337 102.651 112.888 1.00 66.84  ? 1082 PRO A C     1 
ATOM   7865  O  O     . PRO A 1  1082 ? 168.443 102.971 111.697 1.00 66.88  ? 1082 PRO A O     1 
ATOM   7866  C  CB    . PRO A 1  1082 ? 168.302 104.708 114.342 1.00 66.75  ? 1082 PRO A CB    1 
ATOM   7867  C  CG    . PRO A 1  1082 ? 167.898 104.845 115.778 1.00 66.85  ? 1082 PRO A CG    1 
ATOM   7868  C  CD    . PRO A 1  1082 ? 167.608 103.454 116.242 1.00 66.51  ? 1082 PRO A CD    1 
ATOM   7869  N  N     . SER A 1  1083 ? 168.938 101.572 113.394 1.00 67.70  ? 1083 SER A N     1 
ATOM   7870  C  CA    . SER A 1  1083 ? 169.770 100.714 112.558 1.00 68.68  ? 1083 SER A CA    1 
ATOM   7871  C  C     . SER A 1  1083 ? 168.967 99.989  111.487 1.00 69.31  ? 1083 SER A C     1 
ATOM   7872  O  O     . SER A 1  1083 ? 169.545 99.558  110.483 1.00 69.46  ? 1083 SER A O     1 
ATOM   7873  C  CB    . SER A 1  1083 ? 170.515 99.698  113.425 1.00 68.77  ? 1083 SER A CB    1 
ATOM   7874  O  OG    . SER A 1  1083 ? 171.362 100.347 114.358 1.00 68.90  ? 1083 SER A OG    1 
ATOM   7875  N  N     . ALA A 1  1084 ? 167.657 99.836  111.677 1.00 68.69  ? 1084 ALA A N     1 
ATOM   7876  C  CA    . ALA A 1  1084 ? 166.813 99.189  110.682 1.00 68.79  ? 1084 ALA A CA    1 
ATOM   7877  C  C     . ALA A 1  1084 ? 166.351 100.137 109.584 1.00 68.50  ? 1084 ALA A C     1 
ATOM   7878  O  O     . ALA A 1  1084 ? 165.715 99.683  108.627 1.00 69.10  ? 1084 ALA A O     1 
ATOM   7879  C  CB    . ALA A 1  1084 ? 165.593 98.556  111.357 1.00 68.44  ? 1084 ALA A CB    1 
ATOM   7880  N  N     . LEU A 1  1085 ? 166.653 101.429 109.693 1.00 69.91  ? 1085 LEU A N     1 
ATOM   7881  C  CA    . LEU A 1  1085 ? 166.214 102.430 108.729 1.00 70.30  ? 1085 LEU A CA    1 
ATOM   7882  C  C     . LEU A 1  1085 ? 167.383 103.291 108.270 1.00 70.35  ? 1085 LEU A C     1 
ATOM   7883  O  O     . LEU A 1  1085 ? 167.244 104.500 108.063 1.00 69.87  ? 1085 LEU A O     1 
ATOM   7884  C  CB    . LEU A 1  1085 ? 165.102 103.300 109.312 1.00 69.18  ? 1085 LEU A CB    1 
ATOM   7885  C  CG    . LEU A 1  1085 ? 163.807 102.588 109.710 1.00 69.78  ? 1085 LEU A CG    1 
ATOM   7886  C  CD1   . LEU A 1  1085 ? 162.816 103.572 110.310 1.00 70.14  ? 1085 LEU A CD1   1 
ATOM   7887  C  CD2   . LEU A 1  1085 ? 163.199 101.871 108.514 1.00 69.51  ? 1085 LEU A CD2   1 
ATOM   7888  N  N     . ILE A 1  1086 ? 168.555 102.682 108.102 1.00 70.93  ? 1086 ILE A N     1 
ATOM   7889  C  CA    . ILE A 1  1086 ? 169.725 103.397 107.603 1.00 72.17  ? 1086 ILE A CA    1 
ATOM   7890  C  C     . ILE A 1  1086 ? 169.871 103.130 106.111 1.00 73.14  ? 1086 ILE A C     1 
ATOM   7891  O  O     . ILE A 1  1086 ? 170.374 103.975 105.362 1.00 73.75  ? 1086 ILE A O     1 
ATOM   7892  C  CB    . ILE A 1  1086 ? 171.001 103.004 108.374 1.00 74.14  ? 1086 ILE A CB    1 
ATOM   7893  C  CG1   . ILE A 1  1086 ? 171.142 101.481 108.459 1.00 73.15  ? 1086 ILE A CG1   1 
ATOM   7894  C  CG2   . ILE A 1  1086 ? 170.998 103.626 109.762 1.00 72.41  ? 1086 ILE A CG2   1 
ATOM   7895  C  CD1   . ILE A 1  1086 ? 172.066 100.882 107.417 1.00 72.55  ? 1086 ILE A CD1   1 
ATOM   7896  N  N     . GLU A 1  1087 ? 169.434 101.952 105.672 1.00 72.68  ? 1087 GLU A N     1 
ATOM   7897  C  CA    . GLU A 1  1087 ? 169.459 101.575 104.267 1.00 73.07  ? 1087 GLU A CA    1 
ATOM   7898  C  C     . GLU A 1  1087 ? 168.134 101.844 103.566 1.00 74.17  ? 1087 GLU A C     1 
ATOM   7899  O  O     . GLU A 1  1087 ? 167.929 101.363 102.446 1.00 75.11  ? 1087 GLU A O     1 
ATOM   7900  C  CB    . GLU A 1  1087 ? 169.826 100.096 104.124 1.00 76.36  ? 1087 GLU A CB    1 
ATOM   7901  C  CG    . GLU A 1  1087 ? 168.817 99.150  104.757 1.00 77.54  ? 1087 GLU A CG    1 
ATOM   7902  C  CD    . GLU A 1  1087 ? 169.149 97.691  104.513 1.00 76.52  ? 1087 GLU A CD    1 
ATOM   7903  O  OE1   . GLU A 1  1087 ? 170.176 97.414  103.858 1.00 71.89  ? 1087 GLU A OE1   1 
ATOM   7904  O  OE2   . GLU A 1  1087 ? 168.382 96.820  104.975 1.00 72.33  ? 1087 GLU A OE2   1 
ATOM   7905  N  N     . HIS A 1  1088 ? 167.236 102.598 104.194 1.00 69.26  ? 1088 HIS A N     1 
ATOM   7906  C  CA    . HIS A 1  1088 ? 165.895 102.830 103.672 1.00 67.07  ? 1088 HIS A CA    1 
ATOM   7907  C  C     . HIS A 1  1088 ? 165.691 104.232 103.123 1.00 67.38  ? 1088 HIS A C     1 
ATOM   7908  O  O     . HIS A 1  1088 ? 165.025 104.394 102.098 1.00 68.12  ? 1088 HIS A O     1 
ATOM   7909  C  CB    . HIS A 1  1088 ? 164.857 102.557 104.767 1.00 68.56  ? 1088 HIS A CB    1 
ATOM   7910  C  CG    . HIS A 1  1088 ? 163.455 102.435 104.255 1.00 68.78  ? 1088 HIS A CG    1 
ATOM   7911  N  ND1   . HIS A 1  1088 ? 163.101 101.549 103.260 1.00 68.75  ? 1088 HIS A ND1   1 
ATOM   7912  C  CD2   . HIS A 1  1088 ? 162.318 103.078 104.609 1.00 68.57  ? 1088 HIS A CD2   1 
ATOM   7913  C  CE1   . HIS A 1  1088 ? 161.806 101.658 103.019 1.00 65.55  ? 1088 HIS A CE1   1 
ATOM   7914  N  NE2   . HIS A 1  1088 ? 161.308 102.577 103.825 1.00 64.63  ? 1088 HIS A NE2   1 
ATOM   7915  N  N     . LEU A 1  1089 ? 166.248 105.252 103.772 1.00 65.74  ? 1089 LEU A N     1 
ATOM   7916  C  CA    . LEU A 1  1089 ? 166.073 106.639 103.365 1.00 66.62  ? 1089 LEU A CA    1 
ATOM   7917  C  C     . LEU A 1  1089 ? 167.441 107.283 103.163 1.00 67.22  ? 1089 LEU A C     1 
ATOM   7918  O  O     . LEU A 1  1089 ? 168.486 106.640 103.304 1.00 67.78  ? 1089 LEU A O     1 
ATOM   7919  C  CB    . LEU A 1  1089 ? 165.255 107.431 104.395 1.00 67.81  ? 1089 LEU A CB    1 
ATOM   7920  C  CG    . LEU A 1  1089 ? 163.864 106.949 104.828 1.00 68.00  ? 1089 LEU A CG    1 
ATOM   7921  C  CD1   . LEU A 1  1089 ? 163.054 106.428 103.649 1.00 67.10  ? 1089 LEU A CD1   1 
ATOM   7922  C  CD2   . LEU A 1  1089 ? 163.945 105.912 105.945 1.00 66.88  ? 1089 LEU A CD2   1 
ATOM   7923  N  N     . ASP A 1  1090 ? 167.426 108.570 102.829 1.00 68.13  ? 1090 ASP A N     1 
ATOM   7924  C  CA    . ASP A 1  1090 ? 168.634 109.360 102.638 1.00 69.15  ? 1090 ASP A CA    1 
ATOM   7925  C  C     . ASP A 1  1090 ? 168.811 110.315 103.813 1.00 69.77  ? 1090 ASP A C     1 
ATOM   7926  O  O     . ASP A 1  1090 ? 167.838 110.724 104.453 1.00 69.86  ? 1090 ASP A O     1 
ATOM   7927  C  CB    . ASP A 1  1090 ? 168.574 110.146 101.324 1.00 70.01  ? 1090 ASP A CB    1 
ATOM   7928  C  CG    . ASP A 1  1090 ? 169.933 110.656 100.881 1.00 69.50  ? 1090 ASP A CG    1 
ATOM   7929  O  OD1   . ASP A 1  1090 ? 170.855 110.711 101.721 1.00 68.92  ? 1090 ASP A OD1   1 
ATOM   7930  O  OD2   . ASP A 1  1090 ? 170.079 111.001 99.690  1.00 68.17  ? 1090 ASP A OD2   1 
ATOM   7931  N  N     . VAL A 1  1091 ? 170.067 110.668 104.092 1.00 69.49  ? 1091 VAL A N     1 
ATOM   7932  C  CA    . VAL A 1  1091 ? 170.420 111.493 105.241 1.00 69.92  ? 1091 VAL A CA    1 
ATOM   7933  C  C     . VAL A 1  1091 ? 171.149 112.765 104.822 1.00 71.08  ? 1091 VAL A C     1 
ATOM   7934  O  O     . VAL A 1  1091 ? 170.812 113.863 105.278 1.00 71.40  ? 1091 VAL A O     1 
ATOM   7935  C  CB    . VAL A 1  1091 ? 171.257 110.697 106.271 1.00 71.22  ? 1091 VAL A CB    1 
ATOM   7936  C  CG1   . VAL A 1  1091 ? 170.357 109.783 107.086 1.00 68.27  ? 1091 VAL A CG1   1 
ATOM   7937  C  CG2   . VAL A 1  1091 ? 172.338 109.885 105.572 1.00 68.95  ? 1091 VAL A CG2   1 
ATOM   7938  N  N     . GLU A 1  1092 ? 172.149 112.642 103.946 1.00 68.80  ? 1092 GLU A N     1 
ATOM   7939  C  CA    . GLU A 1  1092 ? 173.014 113.779 103.651 1.00 69.19  ? 1092 GLU A CA    1 
ATOM   7940  C  C     . GLU A 1  1092 ? 172.342 114.821 102.767 1.00 68.90  ? 1092 GLU A C     1 
ATOM   7941  O  O     . GLU A 1  1092 ? 172.816 115.960 102.708 1.00 68.80  ? 1092 GLU A O     1 
ATOM   7942  C  CB    . GLU A 1  1092 ? 174.313 113.309 102.991 1.00 68.83  ? 1092 GLU A CB    1 
ATOM   7943  C  CG    . GLU A 1  1092 ? 174.147 112.768 101.578 1.00 68.75  ? 1092 GLU A CG    1 
ATOM   7944  C  CD    . GLU A 1  1092 ? 173.788 111.297 101.552 1.00 69.07  ? 1092 GLU A CD    1 
ATOM   7945  O  OE1   . GLU A 1  1092 ? 173.699 110.685 102.637 1.00 69.38  ? 1092 GLU A OE1   1 
ATOM   7946  O  OE2   . GLU A 1  1092 ? 173.591 110.753 100.445 1.00 70.32  ? 1092 GLU A OE2   1 
ATOM   7947  N  N     . SER A 1  1093 ? 171.254 114.466 102.080 1.00 67.97  ? 1093 SER A N     1 
ATOM   7948  C  CA    . SER A 1  1093 ? 170.602 115.417 101.185 1.00 66.81  ? 1093 SER A CA    1 
ATOM   7949  C  C     . SER A 1  1093 ? 169.910 116.524 101.970 1.00 66.33  ? 1093 SER A C     1 
ATOM   7950  O  O     . SER A 1  1093 ? 170.221 117.710 101.806 1.00 65.90  ? 1093 SER A O     1 
ATOM   7951  C  CB    . SER A 1  1093 ? 169.604 114.688 100.283 1.00 66.08  ? 1093 SER A CB    1 
ATOM   7952  O  OG    . SER A 1  1093 ? 168.582 114.073 101.047 1.00 66.09  ? 1093 SER A OG    1 
ATOM   7953  N  N     . ALA A 1  1094 ? 168.963 116.154 102.835 1.00 64.87  ? 1094 ALA A N     1 
ATOM   7954  C  CA    . ALA A 1  1094 ? 168.221 117.150 103.596 1.00 63.55  ? 1094 ALA A CA    1 
ATOM   7955  C  C     . ALA A 1  1094 ? 169.069 117.814 104.672 1.00 64.23  ? 1094 ALA A C     1 
ATOM   7956  O  O     . ALA A 1  1094 ? 168.704 118.893 105.147 1.00 61.56  ? 1094 ALA A O     1 
ATOM   7957  C  CB    . ALA A 1  1094 ? 166.982 116.517 104.227 1.00 60.60  ? 1094 ALA A CB    1 
ATOM   7958  N  N     . LEU A 1  1095 ? 170.187 117.201 105.067 1.00 60.26  ? 1095 LEU A N     1 
ATOM   7959  C  CA    . LEU A 1  1095 ? 171.066 117.827 106.050 1.00 59.75  ? 1095 LEU A CA    1 
ATOM   7960  C  C     . LEU A 1  1095 ? 171.991 118.850 105.401 1.00 60.15  ? 1095 LEU A C     1 
ATOM   7961  O  O     . LEU A 1  1095 ? 172.323 119.868 106.018 1.00 60.46  ? 1095 LEU A O     1 
ATOM   7962  C  CB    . LEU A 1  1095 ? 171.881 116.764 106.787 1.00 60.48  ? 1095 LEU A CB    1 
ATOM   7963  C  CG    . LEU A 1  1095 ? 171.121 115.881 107.778 1.00 60.84  ? 1095 LEU A CG    1 
ATOM   7964  C  CD1   . LEU A 1  1095 ? 172.055 114.864 108.416 1.00 59.22  ? 1095 LEU A CD1   1 
ATOM   7965  C  CD2   . LEU A 1  1095 ? 170.442 116.730 108.843 1.00 59.30  ? 1095 LEU A CD2   1 
ATOM   7966  N  N     . LYS A 1  1096 ? 172.417 118.595 104.163 1.00 59.26  ? 1096 LYS A N     1 
ATOM   7967  C  CA    . LYS A 1  1096 ? 173.254 119.556 103.451 1.00 59.59  ? 1096 LYS A CA    1 
ATOM   7968  C  C     . LYS A 1  1096 ? 172.476 120.829 103.146 1.00 60.99  ? 1096 LYS A C     1 
ATOM   7969  O  O     . LYS A 1  1096 ? 172.952 121.942 103.397 1.00 62.49  ? 1096 LYS A O     1 
ATOM   7970  C  CB    . LYS A 1  1096 ? 173.797 118.925 102.167 1.00 63.17  ? 1096 LYS A CB    1 
ATOM   7971  C  CG    . LYS A 1  1096 ? 174.584 119.874 101.273 1.00 63.86  ? 1096 LYS A CG    1 
ATOM   7972  C  CD    . LYS A 1  1096 ? 173.754 120.338 100.083 1.00 64.40  ? 1096 LYS A CD    1 
ATOM   7973  C  CE    . LYS A 1  1096 ? 174.547 121.266 99.179  1.00 58.45  ? 1096 LYS A CE    1 
ATOM   7974  N  NZ    . LYS A 1  1096 ? 175.742 120.591 98.604  1.00 58.22  ? 1096 LYS A NZ    1 
ATOM   7975  N  N     . TYR A 1  1097 ? 171.264 120.683 102.605 1.00 57.46  ? 1097 TYR A N     1 
ATOM   7976  C  CA    . TYR A 1  1097 ? 170.451 121.854 102.296 1.00 56.73  ? 1097 TYR A CA    1 
ATOM   7977  C  C     . TYR A 1  1097 ? 169.934 122.524 103.562 1.00 56.68  ? 1097 TYR A C     1 
ATOM   7978  O  O     . TYR A 1  1097 ? 169.660 123.730 103.552 1.00 56.67  ? 1097 TYR A O     1 
ATOM   7979  C  CB    . TYR A 1  1097 ? 169.293 121.464 101.378 1.00 57.04  ? 1097 TYR A CB    1 
ATOM   7980  C  CG    . TYR A 1  1097 ? 168.485 122.641 100.880 1.00 56.89  ? 1097 TYR A CG    1 
ATOM   7981  C  CD1   . TYR A 1  1097 ? 168.998 123.504 99.921  1.00 56.75  ? 1097 TYR A CD1   1 
ATOM   7982  C  CD2   . TYR A 1  1097 ? 167.207 122.885 101.364 1.00 56.86  ? 1097 TYR A CD2   1 
ATOM   7983  C  CE1   . TYR A 1  1097 ? 168.262 124.582 99.462  1.00 56.70  ? 1097 TYR A CE1   1 
ATOM   7984  C  CE2   . TYR A 1  1097 ? 166.464 123.959 100.912 1.00 56.67  ? 1097 TYR A CE2   1 
ATOM   7985  C  CZ    . TYR A 1  1097 ? 166.996 124.804 99.962  1.00 56.36  ? 1097 TYR A CZ    1 
ATOM   7986  O  OH    . TYR A 1  1097 ? 166.259 125.873 99.508  1.00 55.87  ? 1097 TYR A OH    1 
ATOM   7987  N  N     . SER A 1  1098 ? 169.789 121.768 104.655 1.00 56.86  ? 1098 SER A N     1 
ATOM   7988  C  CA    . SER A 1  1098 ? 169.435 122.383 105.930 1.00 57.39  ? 1098 SER A CA    1 
ATOM   7989  C  C     . SER A 1  1098 ? 170.540 123.314 106.410 1.00 57.64  ? 1098 SER A C     1 
ATOM   7990  O  O     . SER A 1  1098 ? 170.265 124.422 106.884 1.00 57.83  ? 1098 SER A O     1 
ATOM   7991  C  CB    . SER A 1  1098 ? 169.148 121.309 106.978 1.00 57.74  ? 1098 SER A CB    1 
ATOM   7992  O  OG    . SER A 1  1098 ? 168.797 121.888 108.222 1.00 57.20  ? 1098 SER A OG    1 
ATOM   7993  N  N     . LYS A 1  1099 ? 171.797 122.878 106.298 1.00 58.93  ? 1099 LYS A N     1 
ATOM   7994  C  CA    . LYS A 1  1099 ? 172.914 123.754 106.635 1.00 59.75  ? 1099 LYS A CA    1 
ATOM   7995  C  C     . LYS A 1  1099 ? 172.976 124.957 105.704 1.00 60.15  ? 1099 LYS A C     1 
ATOM   7996  O  O     . LYS A 1  1099 ? 173.408 126.040 106.116 1.00 60.31  ? 1099 LYS A O     1 
ATOM   7997  C  CB    . LYS A 1  1099 ? 174.228 122.975 106.587 1.00 60.81  ? 1099 LYS A CB    1 
ATOM   7998  C  CG    . LYS A 1  1099 ? 174.363 121.893 107.652 1.00 61.39  ? 1099 LYS A CG    1 
ATOM   7999  C  CD    . LYS A 1  1099 ? 174.476 122.488 109.048 1.00 61.69  ? 1099 LYS A CD    1 
ATOM   8000  C  CE    . LYS A 1  1099 ? 173.229 122.214 109.877 1.00 60.18  ? 1099 LYS A CE    1 
ATOM   8001  N  NZ    . LYS A 1  1099 ? 173.344 122.775 111.252 1.00 59.60  ? 1099 LYS A NZ    1 
ATOM   8002  N  N     . LYS A 1  1100 ? 172.550 124.789 104.450 1.00 61.59  ? 1100 LYS A N     1 
ATOM   8003  C  CA    . LYS A 1  1100 ? 172.481 125.922 103.533 1.00 63.01  ? 1100 LYS A CA    1 
ATOM   8004  C  C     . LYS A 1  1100 ? 171.413 126.914 103.976 1.00 63.98  ? 1100 LYS A C     1 
ATOM   8005  O  O     . LYS A 1  1100 ? 171.643 128.129 103.989 1.00 64.77  ? 1100 LYS A O     1 
ATOM   8006  C  CB    . LYS A 1  1100 ? 172.206 125.431 102.111 1.00 65.45  ? 1100 LYS A CB    1 
ATOM   8007  C  CG    . LYS A 1  1100 ? 173.310 124.566 101.526 1.00 65.65  ? 1100 LYS A CG    1 
ATOM   8008  C  CD    . LYS A 1  1100 ? 174.619 125.331 101.427 1.00 65.76  ? 1100 LYS A CD    1 
ATOM   8009  C  CE    . LYS A 1  1100 ? 175.715 124.471 100.822 1.00 63.19  ? 1100 LYS A CE    1 
ATOM   8010  N  NZ    . LYS A 1  1100 ? 177.003 125.209 100.712 1.00 63.22  ? 1100 LYS A NZ    1 
ATOM   8011  N  N     . THR A 1  1101 ? 170.231 126.411 104.341 1.00 63.24  ? 1101 THR A N     1 
ATOM   8012  C  CA    . THR A 1  1101 ? 169.176 127.291 104.830 1.00 62.99  ? 1101 THR A CA    1 
ATOM   8013  C  C     . THR A 1  1101 ? 169.540 127.913 106.171 1.00 63.19  ? 1101 THR A C     1 
ATOM   8014  O  O     . THR A 1  1101 ? 169.249 129.089 106.403 1.00 63.35  ? 1101 THR A O     1 
ATOM   8015  C  CB    . THR A 1  1101 ? 167.856 126.528 104.946 1.00 63.07  ? 1101 THR A CB    1 
ATOM   8016  O  OG1   . THR A 1  1101 ? 168.041 125.368 105.766 1.00 62.44  ? 1101 THR A OG1   1 
ATOM   8017  C  CG2   . THR A 1  1101 ? 167.364 126.102 103.573 1.00 61.10  ? 1101 THR A CG2   1 
ATOM   8018  N  N     . LEU A 1  1102 ? 170.174 127.144 107.062 1.00 62.98  ? 1102 LEU A N     1 
ATOM   8019  C  CA    . LEU A 1  1102 ? 170.586 127.694 108.350 1.00 63.66  ? 1102 LEU A CA    1 
ATOM   8020  C  C     . LEU A 1  1102 ? 171.629 128.792 108.176 1.00 63.13  ? 1102 LEU A C     1 
ATOM   8021  O  O     . LEU A 1  1102 ? 171.603 129.798 108.894 1.00 62.34  ? 1102 LEU A O     1 
ATOM   8022  C  CB    . LEU A 1  1102 ? 171.122 126.581 109.251 1.00 62.10  ? 1102 LEU A CB    1 
ATOM   8023  C  CG    . LEU A 1  1102 ? 170.161 126.026 110.305 1.00 62.12  ? 1102 LEU A CG    1 
ATOM   8024  C  CD1   . LEU A 1  1102 ? 169.775 127.109 111.300 1.00 65.35  ? 1102 LEU A CD1   1 
ATOM   8025  C  CD2   . LEU A 1  1102 ? 168.923 125.430 109.654 1.00 65.44  ? 1102 LEU A CD2   1 
ATOM   8026  N  N     . LYS A 1  1103 ? 172.553 128.617 107.230 1.00 67.11  ? 1103 LYS A N     1 
ATOM   8027  C  CA    . LYS A 1  1103 ? 173.571 129.636 106.994 1.00 68.32  ? 1103 LYS A CA    1 
ATOM   8028  C  C     . LYS A 1  1103 ? 172.967 130.875 106.344 1.00 68.70  ? 1103 LYS A C     1 
ATOM   8029  O  O     . LYS A 1  1103 ? 173.202 132.001 106.794 1.00 69.58  ? 1103 LYS A O     1 
ATOM   8030  C  CB    . LYS A 1  1103 ? 174.696 129.066 106.130 1.00 70.54  ? 1103 LYS A CB    1 
ATOM   8031  C  CG    . LYS A 1  1103 ? 175.814 130.055 105.841 1.00 70.96  ? 1103 LYS A CG    1 
ATOM   8032  C  CD    . LYS A 1  1103 ? 176.906 129.426 104.991 1.00 71.03  ? 1103 LYS A CD    1 
ATOM   8033  C  CE    . LYS A 1  1103 ? 178.024 130.417 104.710 1.00 69.10  ? 1103 LYS A CE    1 
ATOM   8034  N  NZ    . LYS A 1  1103 ? 179.106 129.815 103.881 1.00 69.38  ? 1103 LYS A NZ    1 
ATOM   8035  N  N     . TYR A 1  1104 ? 172.184 130.683 105.278 1.00 69.49  ? 1104 TYR A N     1 
ATOM   8036  C  CA    . TYR A 1  1104 ? 171.572 131.819 104.594 1.00 69.69  ? 1104 TYR A CA    1 
ATOM   8037  C  C     . TYR A 1  1104 ? 170.594 132.562 105.497 1.00 70.41  ? 1104 TYR A C     1 
ATOM   8038  O  O     . TYR A 1  1104 ? 170.379 133.766 105.320 1.00 71.64  ? 1104 TYR A O     1 
ATOM   8039  C  CB    . TYR A 1  1104 ? 170.871 131.345 103.320 1.00 72.27  ? 1104 TYR A CB    1 
ATOM   8040  C  CG    . TYR A 1  1104 ? 170.181 132.446 102.545 1.00 72.46  ? 1104 TYR A CG    1 
ATOM   8041  C  CD1   . TYR A 1  1104 ? 170.900 133.291 101.710 1.00 72.23  ? 1104 TYR A CD1   1 
ATOM   8042  C  CD2   . TYR A 1  1104 ? 168.808 132.635 102.643 1.00 72.20  ? 1104 TYR A CD2   1 
ATOM   8043  C  CE1   . TYR A 1  1104 ? 170.273 134.298 101.000 1.00 72.25  ? 1104 TYR A CE1   1 
ATOM   8044  C  CE2   . TYR A 1  1104 ? 168.172 133.637 101.937 1.00 72.26  ? 1104 TYR A CE2   1 
ATOM   8045  C  CZ    . TYR A 1  1104 ? 168.909 134.465 101.117 1.00 69.04  ? 1104 TYR A CZ    1 
ATOM   8046  O  OH    . TYR A 1  1104 ? 168.280 135.465 100.411 1.00 68.51  ? 1104 TYR A OH    1 
ATOM   8047  N  N     . ARG A 1  1105 ? 169.996 131.867 106.466 1.00 68.38  ? 1105 ARG A N     1 
ATOM   8048  C  CA    . ARG A 1  1105 ? 169.067 132.518 107.382 1.00 68.29  ? 1105 ARG A CA    1 
ATOM   8049  C  C     . ARG A 1  1105 ? 169.802 133.271 108.484 1.00 68.52  ? 1105 ARG A C     1 
ATOM   8050  O  O     . ARG A 1  1105 ? 169.411 134.386 108.845 1.00 68.99  ? 1105 ARG A O     1 
ATOM   8051  C  CB    . ARG A 1  1105 ? 168.116 131.485 107.985 1.00 68.99  ? 1105 ARG A CB    1 
ATOM   8052  C  CG    . ARG A 1  1105 ? 166.958 132.070 108.774 1.00 69.33  ? 1105 ARG A CG    1 
ATOM   8053  C  CD    . ARG A 1  1105 ? 166.050 130.974 109.317 1.00 69.74  ? 1105 ARG A CD    1 
ATOM   8054  N  NE    . ARG A 1  1105 ? 165.500 130.127 108.260 1.00 70.01  ? 1105 ARG A NE    1 
ATOM   8055  C  CZ    . ARG A 1  1105 ? 165.956 128.913 107.958 1.00 69.77  ? 1105 ARG A CZ    1 
ATOM   8056  N  NH1   . ARG A 1  1105 ? 166.972 128.396 108.635 1.00 68.13  ? 1105 ARG A NH1   1 
ATOM   8057  N  NH2   . ARG A 1  1105 ? 165.393 128.216 106.980 1.00 67.38  ? 1105 ARG A NH2   1 
ATOM   8058  N  N     . LYS A 1  1106 ? 170.867 132.678 109.032 1.00 68.75  ? 1106 LYS A N     1 
ATOM   8059  C  CA    . LYS A 1  1106 ? 171.608 133.326 110.107 1.00 69.63  ? 1106 LYS A CA    1 
ATOM   8060  C  C     . LYS A 1  1106 ? 172.423 134.515 109.618 1.00 69.53  ? 1106 LYS A C     1 
ATOM   8061  O  O     . LYS A 1  1106 ? 172.818 135.355 110.435 1.00 69.27  ? 1106 LYS A O     1 
ATOM   8062  C  CB    . LYS A 1  1106 ? 172.527 132.318 110.802 1.00 69.39  ? 1106 LYS A CB    1 
ATOM   8063  C  CG    . LYS A 1  1106 ? 173.754 131.929 109.994 1.00 69.42  ? 1106 LYS A CG    1 
ATOM   8064  C  CD    . LYS A 1  1106 ? 174.644 130.971 110.768 1.00 69.18  ? 1106 LYS A CD    1 
ATOM   8065  C  CE    . LYS A 1  1106 ? 175.163 131.612 112.046 1.00 70.52  ? 1106 LYS A CE    1 
ATOM   8066  N  NZ    . LYS A 1  1106 ? 175.967 132.834 111.767 1.00 71.64  ? 1106 LYS A NZ    1 
ATOM   8067  N  N     . LYS A 1  1107 ? 172.688 134.609 108.313 1.00 70.30  ? 1107 LYS A N     1 
ATOM   8068  C  CA    . LYS A 1  1107 ? 173.467 135.731 107.800 1.00 69.78  ? 1107 LYS A CA    1 
ATOM   8069  C  C     . LYS A 1  1107 ? 172.663 137.026 107.831 1.00 69.92  ? 1107 LYS A C     1 
ATOM   8070  O  O     . LYS A 1  1107 ? 173.209 138.092 108.138 1.00 69.84  ? 1107 LYS A O     1 
ATOM   8071  C  CB    . LYS A 1  1107 ? 173.950 135.437 106.380 1.00 69.64  ? 1107 LYS A CB    1 
ATOM   8072  C  CG    . LYS A 1  1107 ? 175.127 134.478 106.306 1.00 69.13  ? 1107 LYS A CG    1 
ATOM   8073  C  CD    . LYS A 1  1107 ? 175.662 134.367 104.886 1.00 68.74  ? 1107 LYS A CD    1 
ATOM   8074  C  CE    . LYS A 1  1107 ? 174.590 133.876 103.926 1.00 68.84  ? 1107 LYS A CE    1 
ATOM   8075  N  NZ    . LYS A 1  1107 ? 175.102 133.764 102.532 1.00 68.43  ? 1107 LYS A NZ    1 
ATOM   8076  N  N     . HIS A 1  1108 ? 171.369 136.958 107.517 1.00 68.06  ? 1108 HIS A N     1 
ATOM   8077  C  CA    . HIS A 1  1108 ? 170.560 138.174 107.442 1.00 68.16  ? 1108 HIS A CA    1 
ATOM   8078  C  C     . HIS A 1  1108 ? 170.146 138.640 108.836 1.00 68.39  ? 1108 HIS A C     1 
ATOM   8079  O  O     . HIS A 1  1108 ? 170.612 139.676 109.321 1.00 68.40  ? 1108 HIS A O     1 
ATOM   8080  C  CB    . HIS A 1  1108 ? 169.340 137.909 106.552 1.00 67.87  ? 1108 HIS A CB    1 
ATOM   8081  C  CG    . HIS A 1  1108 ? 168.358 139.035 106.507 1.00 67.50  ? 1108 HIS A CG    1 
ATOM   8082  N  ND1   . HIS A 1  1108 ? 168.518 140.131 105.687 1.00 67.71  ? 1108 HIS A ND1   1 
ATOM   8083  C  CD2   . HIS A 1  1108 ? 167.192 139.225 107.167 1.00 68.12  ? 1108 HIS A CD2   1 
ATOM   8084  C  CE1   . HIS A 1  1108 ? 167.496 140.952 105.850 1.00 67.81  ? 1108 HIS A CE1   1 
ATOM   8085  N  NE2   . HIS A 1  1108 ? 166.676 140.425 106.743 1.00 68.17  ? 1108 HIS A NE2   1 
ATOM   8086  N  N     . SER A 1  1109 ? 169.279 137.871 109.498 1.00 67.14  ? 1109 SER A N     1 
ATOM   8087  C  CA    . SER A 1  1109 ? 169.030 137.954 110.936 1.00 66.96  ? 1109 SER A CA    1 
ATOM   8088  C  C     . SER A 1  1109 ? 168.731 139.352 111.477 1.00 66.69  ? 1109 SER A C     1 
ATOM   8089  O  O     . SER A 1  1109 ? 168.776 139.555 112.695 1.00 66.78  ? 1109 SER A O     1 
ATOM   8090  C  CB    . SER A 1  1109 ? 170.225 137.375 111.697 1.00 67.53  ? 1109 SER A CB    1 
ATOM   8091  O  OG    . SER A 1  1109 ? 170.367 135.989 111.443 1.00 67.45  ? 1109 SER A OG    1 
ATOM   8092  N  N     . LYS A 1  1110 ? 168.428 140.323 110.615 1.00 68.34  ? 1110 LYS A N     1 
ATOM   8093  C  CA    . LYS A 1  1110 ? 168.270 141.685 111.117 1.00 68.84  ? 1110 LYS A CA    1 
ATOM   8094  C  C     . LYS A 1  1110 ? 166.994 142.362 110.630 1.00 69.14  ? 1110 LYS A C     1 
ATOM   8095  O  O     . LYS A 1  1110 ? 166.477 143.265 111.296 1.00 68.97  ? 1110 LYS A O     1 
ATOM   8096  C  CB    . LYS A 1  1110 ? 169.492 142.536 110.746 1.00 69.35  ? 1110 LYS A CB    1 
ATOM   8097  C  CG    . LYS A 1  1110 ? 169.359 143.355 109.469 1.00 69.80  ? 1110 LYS A CG    1 
ATOM   8098  C  CD    . LYS A 1  1110 ? 169.636 142.527 108.228 1.00 70.12  ? 1110 LYS A CD    1 
ATOM   8099  C  CE    . LYS A 1  1110 ? 169.712 143.410 106.991 1.00 68.65  ? 1110 LYS A CE    1 
ATOM   8100  N  NZ    . LYS A 1  1110 ? 170.153 142.655 105.786 1.00 68.58  ? 1110 LYS A NZ    1 
ATOM   8101  N  N     . GLU A 1  1111 ? 166.472 141.942 109.479 1.00 68.90  ? 1111 GLU A N     1 
ATOM   8102  C  CA    . GLU A 1  1111 ? 165.349 142.637 108.873 1.00 70.03  ? 1111 GLU A CA    1 
ATOM   8103  C  C     . GLU A 1  1111 ? 164.254 141.644 108.507 1.00 70.20  ? 1111 GLU A C     1 
ATOM   8104  O  O     . GLU A 1  1111 ? 164.547 140.535 108.043 1.00 70.45  ? 1111 GLU A O     1 
ATOM   8105  C  CB    . GLU A 1  1111 ? 165.811 143.413 107.627 1.00 70.68  ? 1111 GLU A CB    1 
ATOM   8106  C  CG    . GLU A 1  1111 ? 164.764 144.312 106.993 1.00 71.46  ? 1111 GLU A CG    1 
ATOM   8107  C  CD    . GLU A 1  1111 ? 164.162 143.706 105.743 1.00 70.46  ? 1111 GLU A CD    1 
ATOM   8108  O  OE1   . GLU A 1  1111 ? 164.803 142.818 105.142 1.00 70.81  ? 1111 GLU A OE1   1 
ATOM   8109  O  OE2   . GLU A 1  1111 ? 163.047 144.115 105.361 1.00 71.01  ? 1111 GLU A OE2   1 
ATOM   8110  N  N     . PRO A 1  1112 ? 162.979 142.009 108.709 1.00 71.11  ? 1112 PRO A N     1 
ATOM   8111  C  CA    . PRO A 1  1112 ? 161.883 141.077 108.402 1.00 70.92  ? 1112 PRO A CA    1 
ATOM   8112  C  C     . PRO A 1  1112 ? 161.726 140.795 106.915 1.00 71.45  ? 1112 PRO A C     1 
ATOM   8113  O  O     . PRO A 1  1112 ? 162.533 141.243 106.095 1.00 71.28  ? 1112 PRO A O     1 
ATOM   8114  C  CB    . PRO A 1  1112 ? 160.645 141.783 108.975 1.00 71.26  ? 1112 PRO A CB    1 
ATOM   8115  C  CG    . PRO A 1  1112 ? 161.041 143.210 109.126 1.00 69.97  ? 1112 PRO A CG    1 
ATOM   8116  C  CD    . PRO A 1  1112 ? 162.504 143.205 109.424 1.00 68.96  ? 1112 PRO A CD    1 
ATOM   8117  N  N     . HIS A 1  1113 ? 160.683 140.047 106.560 1.00 70.07  ? 1113 HIS A N     1 
ATOM   8118  C  CA    . HIS A 1  1113 ? 160.556 139.445 105.240 1.00 70.57  ? 1113 HIS A CA    1 
ATOM   8119  C  C     . HIS A 1  1113 ? 159.892 140.360 104.214 1.00 71.76  ? 1113 HIS A C     1 
ATOM   8120  O  O     . HIS A 1  1113 ? 159.327 139.858 103.234 1.00 73.82  ? 1113 HIS A O     1 
ATOM   8121  C  CB    . HIS A 1  1113 ? 159.785 138.127 105.340 1.00 75.42  ? 1113 HIS A CB    1 
ATOM   8122  C  CG    . HIS A 1  1113 ? 160.478 137.082 106.156 1.00 76.19  ? 1113 HIS A CG    1 
ATOM   8123  N  ND1   . HIS A 1  1113 ? 161.147 136.019 105.590 1.00 75.66  ? 1113 HIS A ND1   1 
ATOM   8124  C  CD2   . HIS A 1  1113 ? 160.610 136.940 107.496 1.00 74.65  ? 1113 HIS A CD2   1 
ATOM   8125  C  CE1   . HIS A 1  1113 ? 161.659 135.264 106.547 1.00 70.14  ? 1113 HIS A CE1   1 
ATOM   8126  N  NE2   . HIS A 1  1113 ? 161.348 135.801 107.712 1.00 70.56  ? 1113 HIS A NE2   1 
ATOM   8127  N  N     . TYR A 1  1114 ? 159.940 141.677 104.404 1.00 69.11  ? 1114 TYR A N     1 
ATOM   8128  C  CA    . TYR A 1  1114 ? 159.453 142.580 103.370 1.00 67.95  ? 1114 TYR A CA    1 
ATOM   8129  C  C     . TYR A 1  1114 ? 160.556 143.045 102.427 1.00 67.17  ? 1114 TYR A C     1 
ATOM   8130  O  O     . TYR A 1  1114 ? 160.256 143.690 101.416 1.00 66.90  ? 1114 TYR A O     1 
ATOM   8131  C  CB    . TYR A 1  1114 ? 158.743 143.793 103.994 1.00 67.06  ? 1114 TYR A CB    1 
ATOM   8132  C  CG    . TYR A 1  1114 ? 159.637 144.796 104.692 1.00 67.77  ? 1114 TYR A CG    1 
ATOM   8133  C  CD1   . TYR A 1  1114 ? 160.192 145.864 103.998 1.00 68.83  ? 1114 TYR A CD1   1 
ATOM   8134  C  CD2   . TYR A 1  1114 ? 159.897 144.696 106.052 1.00 68.06  ? 1114 TYR A CD2   1 
ATOM   8135  C  CE1   . TYR A 1  1114 ? 160.999 146.788 104.632 1.00 66.83  ? 1114 TYR A CE1   1 
ATOM   8136  C  CE2   . TYR A 1  1114 ? 160.701 145.620 106.695 1.00 67.36  ? 1114 TYR A CE2   1 
ATOM   8137  C  CZ    . TYR A 1  1114 ? 161.251 146.661 105.981 1.00 67.44  ? 1114 TYR A CZ    1 
ATOM   8138  O  OH    . TYR A 1  1114 ? 162.052 147.580 106.618 1.00 67.53  ? 1114 TYR A OH    1 
ATOM   8139  N  N     . LYS A 1  1115 ? 161.818 142.734 102.732 1.00 66.90  ? 1115 LYS A N     1 
ATOM   8140  C  CA    . LYS A 1  1115 ? 162.923 142.953 101.808 1.00 66.99  ? 1115 LYS A CA    1 
ATOM   8141  C  C     . LYS A 1  1115 ? 163.857 141.758 101.685 1.00 66.86  ? 1115 LYS A C     1 
ATOM   8142  O  O     . LYS A 1  1115 ? 164.662 141.725 100.747 1.00 66.64  ? 1115 LYS A O     1 
ATOM   8143  C  CB    . LYS A 1  1115 ? 163.748 144.182 102.221 1.00 66.21  ? 1115 LYS A CB    1 
ATOM   8144  C  CG    . LYS A 1  1115 ? 163.051 145.512 101.993 1.00 65.84  ? 1115 LYS A CG    1 
ATOM   8145  C  CD    . LYS A 1  1115 ? 163.978 146.680 102.295 1.00 65.81  ? 1115 LYS A CD    1 
ATOM   8146  C  CE    . LYS A 1  1115 ? 164.479 146.633 103.729 1.00 67.58  ? 1115 LYS A CE    1 
ATOM   8147  N  NZ    . LYS A 1  1115 ? 165.397 147.765 104.034 1.00 67.72  ? 1115 LYS A NZ    1 
ATOM   8148  N  N     . GLN A 1  1116 ? 163.781 140.785 102.590 1.00 68.20  ? 1116 GLN A N     1 
ATOM   8149  C  CA    . GLN A 1  1116 ? 164.654 139.622 102.540 1.00 68.98  ? 1116 GLN A CA    1 
ATOM   8150  C  C     . GLN A 1  1116 ? 164.168 138.640 101.480 1.00 68.89  ? 1116 GLN A C     1 
ATOM   8151  O  O     . GLN A 1  1116 ? 162.972 138.362 101.371 1.00 68.99  ? 1116 GLN A O     1 
ATOM   8152  C  CB    . GLN A 1  1116 ? 164.710 138.947 103.912 1.00 69.05  ? 1116 GLN A CB    1 
ATOM   8153  C  CG    . GLN A 1  1116 ? 165.551 137.684 103.970 1.00 70.01  ? 1116 GLN A CG    1 
ATOM   8154  C  CD    . GLN A 1  1116 ? 164.709 136.423 103.950 1.00 68.61  ? 1116 GLN A CD    1 
ATOM   8155  O  OE1   . GLN A 1  1116 ? 163.484 136.480 104.052 1.00 70.04  ? 1116 GLN A OE1   1 
ATOM   8156  N  NE2   . GLN A 1  1116 ? 165.365 135.277 103.815 1.00 69.91  ? 1116 GLN A NE2   1 
ATOM   8157  N  N     . SER A 1  1117 ? 165.109 138.115 100.700 1.00 71.52  ? 1117 SER A N     1 
ATOM   8158  C  CA    . SER A 1  1117 ? 164.769 137.244 99.586  1.00 72.63  ? 1117 SER A CA    1 
ATOM   8159  C  C     . SER A 1  1117 ? 164.528 135.816 100.066 1.00 73.68  ? 1117 SER A C     1 
ATOM   8160  O  O     . SER A 1  1117 ? 164.961 135.409 101.148 1.00 73.94  ? 1117 SER A O     1 
ATOM   8161  C  CB    . SER A 1  1117 ? 165.877 137.264 98.533  1.00 72.57  ? 1117 SER A CB    1 
ATOM   8162  O  OG    . SER A 1  1117 ? 165.507 136.504 97.396  1.00 72.06  ? 1117 SER A OG    1 
ATOM   8163  N  N     . VAL A 1  1118 ? 163.831 135.046 99.230  1.00 72.99  ? 1118 VAL A N     1 
ATOM   8164  C  CA    . VAL A 1  1118 ? 163.431 133.687 99.573  1.00 73.58  ? 1118 VAL A CA    1 
ATOM   8165  C  C     . VAL A 1  1118 ? 164.084 132.727 98.583  1.00 75.54  ? 1118 VAL A C     1 
ATOM   8166  O  O     . VAL A 1  1118 ? 163.493 131.712 98.196  1.00 76.11  ? 1118 VAL A O     1 
ATOM   8167  C  CB    . VAL A 1  1118 ? 161.895 133.544 99.578  1.00 75.95  ? 1118 VAL A CB    1 
ATOM   8168  C  CG1   . VAL A 1  1118 ? 161.461 132.290 100.337 1.00 71.60  ? 1118 VAL A CG1   1 
ATOM   8169  C  CG2   . VAL A 1  1118 ? 161.246 134.784 100.177 1.00 71.85  ? 1118 VAL A CG2   1 
ATOM   8170  N  N     . LYS A 1  1119 ? 165.301 133.064 98.142  1.00 69.26  ? 1119 LYS A N     1 
ATOM   8171  C  CA    . LYS A 1  1119 ? 166.025 132.196 97.217  1.00 68.17  ? 1119 LYS A CA    1 
ATOM   8172  C  C     . LYS A 1  1119 ? 166.198 130.788 97.776  1.00 68.79  ? 1119 LYS A C     1 
ATOM   8173  O  O     . LYS A 1  1119 ? 166.154 129.812 97.019  1.00 69.61  ? 1119 LYS A O     1 
ATOM   8174  C  CB    . LYS A 1  1119 ? 167.390 132.800 96.884  1.00 70.08  ? 1119 LYS A CB    1 
ATOM   8175  C  CG    . LYS A 1  1119 ? 167.323 134.141 96.175  1.00 69.97  ? 1119 LYS A CG    1 
ATOM   8176  C  CD    . LYS A 1  1119 ? 168.715 134.665 95.860  1.00 69.89  ? 1119 LYS A CD    1 
ATOM   8177  C  CE    . LYS A 1  1119 ? 169.543 134.832 97.123  1.00 66.43  ? 1119 LYS A CE    1 
ATOM   8178  N  NZ    . LYS A 1  1119 ? 168.923 135.797 98.072  1.00 66.01  ? 1119 LYS A NZ    1 
ATOM   8179  N  N     . TYR A 1  1120 ? 166.393 130.663 99.086  1.00 65.10  ? 1120 TYR A N     1 
ATOM   8180  C  CA    . TYR A 1  1120 ? 166.519 129.364 99.745  1.00 64.92  ? 1120 TYR A CA    1 
ATOM   8181  C  C     . TYR A 1  1120 ? 165.194 129.060 100.436 1.00 65.37  ? 1120 TYR A C     1 
ATOM   8182  O  O     . TYR A 1  1120 ? 164.992 129.381 101.607 1.00 65.54  ? 1120 TYR A O     1 
ATOM   8183  C  CB    . TYR A 1  1120 ? 167.684 129.356 100.727 1.00 64.95  ? 1120 TYR A CB    1 
ATOM   8184  C  CG    . TYR A 1  1120 ? 169.042 129.258 100.070 1.00 64.60  ? 1120 TYR A CG    1 
ATOM   8185  C  CD1   . TYR A 1  1120 ? 169.593 128.023 99.754  1.00 65.83  ? 1120 TYR A CD1   1 
ATOM   8186  C  CD2   . TYR A 1  1120 ? 169.774 130.399 99.769  1.00 65.11  ? 1120 TYR A CD2   1 
ATOM   8187  C  CE1   . TYR A 1  1120 ? 170.834 127.927 99.155  1.00 65.75  ? 1120 TYR A CE1   1 
ATOM   8188  C  CE2   . TYR A 1  1120 ? 171.018 130.312 99.170  1.00 65.42  ? 1120 TYR A CE2   1 
ATOM   8189  C  CZ    . TYR A 1  1120 ? 171.542 129.073 98.866  1.00 64.24  ? 1120 TYR A CZ    1 
ATOM   8190  O  OH    . TYR A 1  1120 ? 172.778 128.982 98.269  1.00 64.56  ? 1120 TYR A OH    1 
ATOM   8191  N  N     . ASP A 1  1121 ? 164.282 128.436 99.694  1.00 63.74  ? 1121 ASP A N     1 
ATOM   8192  C  CA    . ASP A 1  1121 ? 163.012 128.027 100.267 1.00 63.36  ? 1121 ASP A CA    1 
ATOM   8193  C  C     . ASP A 1  1121 ? 163.237 126.930 101.308 1.00 64.15  ? 1121 ASP A C     1 
ATOM   8194  O  O     . ASP A 1  1121 ? 164.221 126.190 101.236 1.00 65.34  ? 1121 ASP A O     1 
ATOM   8195  C  CB    . ASP A 1  1121 ? 162.067 127.541 99.171  1.00 66.22  ? 1121 ASP A CB    1 
ATOM   8196  C  CG    . ASP A 1  1121 ? 162.740 126.603 98.192  1.00 65.71  ? 1121 ASP A CG    1 
ATOM   8197  O  OD1   . ASP A 1  1121 ? 163.985 126.505 98.220  1.00 62.24  ? 1121 ASP A OD1   1 
ATOM   8198  O  OD2   . ASP A 1  1121 ? 162.025 125.971 97.387  1.00 61.98  ? 1121 ASP A OD2   1 
ATOM   8199  N  N     . PRO A 1  1122 ? 162.346 126.816 102.296 1.00 60.50  ? 1122 PRO A N     1 
ATOM   8200  C  CA    . PRO A 1  1122 ? 162.585 125.879 103.401 1.00 59.59  ? 1122 PRO A CA    1 
ATOM   8201  C  C     . PRO A 1  1122 ? 162.703 124.439 102.924 1.00 59.41  ? 1122 PRO A C     1 
ATOM   8202  O  O     . PRO A 1  1122 ? 162.223 124.072 101.849 1.00 59.44  ? 1122 PRO A O     1 
ATOM   8203  C  CB    . PRO A 1  1122 ? 161.355 126.065 104.296 1.00 59.89  ? 1122 PRO A CB    1 
ATOM   8204  C  CG    . PRO A 1  1122 ? 160.847 127.425 103.968 1.00 58.80  ? 1122 PRO A CG    1 
ATOM   8205  C  CD    . PRO A 1  1122 ? 161.130 127.620 102.510 1.00 58.18  ? 1122 PRO A CD    1 
ATOM   8206  N  N     . VAL A 1  1123 ? 163.360 123.618 103.749 1.00 59.04  ? 1123 VAL A N     1 
ATOM   8207  C  CA    . VAL A 1  1123 ? 163.468 122.192 103.456 1.00 59.68  ? 1123 VAL A CA    1 
ATOM   8208  C  C     . VAL A 1  1123 ? 162.092 121.543 103.453 1.00 60.40  ? 1123 VAL A C     1 
ATOM   8209  O  O     . VAL A 1  1123 ? 161.893 120.490 102.834 1.00 60.99  ? 1123 VAL A O     1 
ATOM   8210  C  CB    . VAL A 1  1123 ? 164.415 121.507 104.462 1.00 60.32  ? 1123 VAL A CB    1 
ATOM   8211  C  CG1   . VAL A 1  1123 ? 165.768 122.198 104.475 1.00 59.39  ? 1123 VAL A CG1   1 
ATOM   8212  C  CG2   . VAL A 1  1123 ? 163.805 121.500 105.856 1.00 59.74  ? 1123 VAL A CG2   1 
ATOM   8213  N  N     . LEU A 1  1124 ? 161.124 122.155 104.138 1.00 60.99  ? 1124 LEU A N     1 
ATOM   8214  C  CA    . LEU A 1  1124 ? 159.757 121.652 104.117 1.00 62.74  ? 1124 LEU A CA    1 
ATOM   8215  C  C     . LEU A 1  1124 ? 159.072 121.964 102.792 1.00 63.94  ? 1124 LEU A C     1 
ATOM   8216  O  O     . LEU A 1  1124 ? 158.157 121.241 102.382 1.00 64.58  ? 1124 LEU A O     1 
ATOM   8217  C  CB    . LEU A 1  1124 ? 158.974 122.247 105.291 1.00 64.78  ? 1124 LEU A CB    1 
ATOM   8218  C  CG    . LEU A 1  1124 ? 157.629 121.651 105.720 1.00 64.41  ? 1124 LEU A CG    1 
ATOM   8219  C  CD1   . LEU A 1  1124 ? 156.463 122.191 104.897 1.00 63.54  ? 1124 LEU A CD1   1 
ATOM   8220  C  CD2   . LEU A 1  1124 ? 157.680 120.136 105.650 1.00 63.10  ? 1124 LEU A CD2   1 
ATOM   8221  N  N     . ALA A 1  1125 ? 159.512 123.019 102.103 1.00 63.12  ? 1125 ALA A N     1 
ATOM   8222  C  CA    . ALA A 1  1125 ? 158.842 123.436 100.875 1.00 63.05  ? 1125 ALA A CA    1 
ATOM   8223  C  C     . ALA A 1  1125 ? 159.140 122.485 99.721  1.00 62.91  ? 1125 ALA A C     1 
ATOM   8224  O  O     . ALA A 1  1125 ? 158.251 122.185 98.916  1.00 62.83  ? 1125 ALA A O     1 
ATOM   8225  C  CB    . ALA A 1  1125 ? 159.252 124.864 100.513 1.00 62.40  ? 1125 ALA A CB    1 
ATOM   8226  N  N     . LYS A 1  1126 ? 160.378 122.002 99.619  1.00 62.17  ? 1126 LYS A N     1 
ATOM   8227  C  CA    . LYS A 1  1126 ? 160.745 121.102 98.533  1.00 61.11  ? 1126 LYS A CA    1 
ATOM   8228  C  C     . LYS A 1  1126 ? 160.719 119.635 98.933  1.00 61.42  ? 1126 LYS A C     1 
ATOM   8229  O  O     . LYS A 1  1126 ? 160.558 118.773 98.060  1.00 61.60  ? 1126 LYS A O     1 
ATOM   8230  C  CB    . LYS A 1  1126 ? 162.141 121.439 98.001  1.00 61.34  ? 1126 LYS A CB    1 
ATOM   8231  C  CG    . LYS A 1  1126 ? 162.258 122.808 97.357  1.00 61.18  ? 1126 LYS A CG    1 
ATOM   8232  C  CD    . LYS A 1  1126 ? 163.593 122.982 96.641  1.00 61.01  ? 1126 LYS A CD    1 
ATOM   8233  C  CE    . LYS A 1  1126 ? 164.704 123.415 97.589  1.00 59.21  ? 1126 LYS A CE    1 
ATOM   8234  N  NZ    . LYS A 1  1126 ? 165.179 122.313 98.473  1.00 58.55  ? 1126 LYS A NZ    1 
ATOM   8235  N  N     . TYR A 1  1127 ? 160.872 119.326 100.219 1.00 58.34  ? 1127 TYR A N     1 
ATOM   8236  C  CA    . TYR A 1  1127 ? 160.931 117.940 100.661 1.00 58.72  ? 1127 TYR A CA    1 
ATOM   8237  C  C     . TYR A 1  1127 ? 159.963 117.733 101.813 1.00 59.76  ? 1127 TYR A C     1 
ATOM   8238  O  O     . TYR A 1  1127 ? 160.097 118.372 102.862 1.00 60.84  ? 1127 TYR A O     1 
ATOM   8239  C  CB    . TYR A 1  1127 ? 162.351 117.557 101.091 1.00 61.25  ? 1127 TYR A CB    1 
ATOM   8240  C  CG    . TYR A 1  1127 ? 163.386 117.699 99.999  1.00 61.78  ? 1127 TYR A CG    1 
ATOM   8241  C  CD1   . TYR A 1  1127 ? 163.574 116.694 99.058  1.00 62.14  ? 1127 TYR A CD1   1 
ATOM   8242  C  CD2   . TYR A 1  1127 ? 164.180 118.835 99.911  1.00 62.61  ? 1127 TYR A CD2   1 
ATOM   8243  C  CE1   . TYR A 1  1127 ? 164.520 116.820 98.059  1.00 62.03  ? 1127 TYR A CE1   1 
ATOM   8244  C  CE2   . TYR A 1  1127 ? 165.129 118.969 98.916  1.00 61.69  ? 1127 TYR A CE2   1 
ATOM   8245  C  CZ    . TYR A 1  1127 ? 165.295 117.958 97.993  1.00 58.66  ? 1127 TYR A CZ    1 
ATOM   8246  O  OH    . TYR A 1  1127 ? 166.239 118.087 97.000  1.00 59.00  ? 1127 TYR A OH    1 
ATOM   8247  N  N     . ASN A 1  1128 ? 158.997 116.845 101.617 1.00 58.71  ? 1128 ASN A N     1 
ATOM   8248  C  CA    . ASN A 1  1128 ? 158.126 116.469 102.715 1.00 58.66  ? 1128 ASN A CA    1 
ATOM   8249  C  C     . ASN A 1  1128 ? 158.869 115.547 103.680 1.00 58.71  ? 1128 ASN A C     1 
ATOM   8250  O  O     . ASN A 1  1128 ? 159.719 114.756 103.262 1.00 58.26  ? 1128 ASN A O     1 
ATOM   8251  C  CB    . ASN A 1  1128 ? 156.869 115.780 102.190 1.00 57.65  ? 1128 ASN A CB    1 
ATOM   8252  C  CG    . ASN A 1  1128 ? 157.166 114.780 101.090 1.00 58.16  ? 1128 ASN A CG    1 
ATOM   8253  O  OD1   . ASN A 1  1128 ? 158.321 114.442 100.836 1.00 58.35  ? 1128 ASN A OD1   1 
ATOM   8254  N  ND2   . ASN A 1  1128 ? 156.118 114.301 100.429 1.00 57.76  ? 1128 ASN A ND2   1 
ATOM   8255  N  N     . PRO A 1  1129 ? 158.575 115.634 104.981 1.00 58.94  ? 1129 PRO A N     1 
ATOM   8256  C  CA    . PRO A 1  1129 ? 159.320 114.835 105.966 1.00 59.67  ? 1129 PRO A CA    1 
ATOM   8257  C  C     . PRO A 1  1129 ? 159.089 113.336 105.861 1.00 60.32  ? 1129 PRO A C     1 
ATOM   8258  O  O     . PRO A 1  1129 ? 159.643 112.587 106.675 1.00 60.16  ? 1129 PRO A O     1 
ATOM   8259  C  CB    . PRO A 1  1129 ? 158.806 115.371 107.314 1.00 59.21  ? 1129 PRO A CB    1 
ATOM   8260  C  CG    . PRO A 1  1129 ? 158.164 116.688 106.998 1.00 59.88  ? 1129 PRO A CG    1 
ATOM   8261  C  CD    . PRO A 1  1129 ? 157.603 116.534 105.623 1.00 59.91  ? 1129 PRO A CD    1 
ATOM   8262  N  N     . ALA A 1  1130 ? 158.301 112.868 104.896 1.00 60.47  ? 1130 ALA A N     1 
ATOM   8263  C  CA    . ALA A 1  1130 ? 157.974 111.455 104.771 1.00 61.66  ? 1130 ALA A CA    1 
ATOM   8264  C  C     . ALA A 1  1130 ? 158.796 110.737 103.707 1.00 62.01  ? 1130 ALA A C     1 
ATOM   8265  O  O     . ALA A 1  1130 ? 158.545 109.555 103.451 1.00 62.62  ? 1130 ALA A O     1 
ATOM   8266  C  CB    . ALA A 1  1130 ? 156.482 111.287 104.467 1.00 63.06  ? 1130 ALA A CB    1 
ATOM   8267  N  N     . LYS A 1  1131 ? 159.764 111.408 103.083 1.00 63.90  ? 1131 LYS A N     1 
ATOM   8268  C  CA    . LYS A 1  1131 ? 160.581 110.776 102.054 1.00 65.47  ? 1131 LYS A CA    1 
ATOM   8269  C  C     . LYS A 1  1131 ? 161.979 110.414 102.546 1.00 65.87  ? 1131 LYS A C     1 
ATOM   8270  O  O     . LYS A 1  1131 ? 162.424 109.280 102.346 1.00 65.74  ? 1131 LYS A O     1 
ATOM   8271  C  CB    . LYS A 1  1131 ? 160.670 111.677 100.811 1.00 65.69  ? 1131 LYS A CB    1 
ATOM   8272  C  CG    . LYS A 1  1131 ? 161.251 113.065 101.046 1.00 65.33  ? 1131 LYS A CG    1 
ATOM   8273  C  CD    . LYS A 1  1131 ? 161.299 113.871 99.757  1.00 65.52  ? 1131 LYS A CD    1 
ATOM   8274  C  CE    . LYS A 1  1131 ? 162.107 113.159 98.686  1.00 65.87  ? 1131 LYS A CE    1 
ATOM   8275  N  NZ    . LYS A 1  1131 ? 162.166 113.943 97.421  1.00 65.76  ? 1131 LYS A NZ    1 
ATOM   8276  N  N     . TYR A 1  1132 ? 162.674 111.342 103.202 1.00 66.02  ? 1132 TYR A N     1 
ATOM   8277  C  CA    . TYR A 1  1132 ? 164.040 111.127 103.659 1.00 65.83  ? 1132 TYR A CA    1 
ATOM   8278  C  C     . TYR A 1  1132 ? 164.173 111.644 105.086 1.00 67.68  ? 1132 TYR A C     1 
ATOM   8279  O  O     . TYR A 1  1132 ? 163.211 112.136 105.685 1.00 69.91  ? 1132 TYR A O     1 
ATOM   8280  C  CB    . TYR A 1  1132 ? 165.054 111.818 102.737 1.00 70.81  ? 1132 TYR A CB    1 
ATOM   8281  C  CG    . TYR A 1  1132 ? 165.121 111.258 101.332 1.00 71.77  ? 1132 TYR A CG    1 
ATOM   8282  C  CD1   . TYR A 1  1132 ? 165.075 109.889 101.103 1.00 73.40  ? 1132 TYR A CD1   1 
ATOM   8283  C  CD2   . TYR A 1  1132 ? 165.236 112.100 100.233 1.00 72.60  ? 1132 TYR A CD2   1 
ATOM   8284  C  CE1   . TYR A 1  1132 ? 165.137 109.374 99.822  1.00 71.26  ? 1132 TYR A CE1   1 
ATOM   8285  C  CE2   . TYR A 1  1132 ? 165.301 111.595 98.948  1.00 72.41  ? 1132 TYR A CE2   1 
ATOM   8286  C  CZ    . TYR A 1  1132 ? 165.250 110.231 98.749  1.00 63.59  ? 1132 TYR A CZ    1 
ATOM   8287  O  OH    . TYR A 1  1132 ? 165.313 109.724 97.471  1.00 63.59  ? 1132 TYR A OH    1 
ATOM   8288  N  N     . LEU A 1  1133 ? 165.380 111.530 105.633 1.00 61.29  ? 1133 LEU A N     1 
ATOM   8289  C  CA    . LEU A 1  1133 ? 165.707 112.074 106.942 1.00 59.81  ? 1133 LEU A CA    1 
ATOM   8290  C  C     . LEU A 1  1133 ? 166.354 113.443 106.785 1.00 60.48  ? 1133 LEU A C     1 
ATOM   8291  O  O     . LEU A 1  1133 ? 167.103 113.682 105.833 1.00 60.91  ? 1133 LEU A O     1 
ATOM   8292  C  CB    . LEU A 1  1133 ? 166.649 111.143 107.713 1.00 61.54  ? 1133 LEU A CB    1 
ATOM   8293  C  CG    . LEU A 1  1133 ? 166.037 110.016 108.549 1.00 60.70  ? 1133 LEU A CG    1 
ATOM   8294  C  CD1   . LEU A 1  1133 ? 165.448 108.929 107.668 1.00 58.23  ? 1133 LEU A CD1   1 
ATOM   8295  C  CD2   . LEU A 1  1133 ? 167.073 109.435 109.499 1.00 58.32  ? 1133 LEU A CD2   1 
ATOM   8296  N  N     . GLY A 1  1134 ? 166.063 114.341 107.729 1.00 57.22  ? 1134 GLY A N     1 
ATOM   8297  C  CA    . GLY A 1  1134 ? 166.609 115.688 107.741 1.00 57.18  ? 1134 GLY A CA    1 
ATOM   8298  C  C     . GLY A 1  1134 ? 165.559 116.771 107.594 1.00 56.99  ? 1134 GLY A C     1 
ATOM   8299  O  O     . GLY A 1  1134 ? 165.713 117.859 108.160 1.00 56.96  ? 1134 GLY A O     1 
ATOM   8300  N  N     . SER A 1  1135 ? 164.495 116.497 106.841 1.00 56.78  ? 1135 SER A N     1 
ATOM   8301  C  CA    . SER A 1  1135 ? 163.432 117.472 106.627 1.00 56.54  ? 1135 SER A CA    1 
ATOM   8302  C  C     . SER A 1  1135 ? 162.706 117.730 107.942 1.00 56.61  ? 1135 SER A C     1 
ATOM   8303  O  O     . SER A 1  1135 ? 161.959 116.874 108.427 1.00 56.55  ? 1135 SER A O     1 
ATOM   8304  C  CB    . SER A 1  1135 ? 162.465 116.973 105.557 1.00 56.01  ? 1135 SER A CB    1 
ATOM   8305  O  OG    . SER A 1  1135 ? 161.422 117.906 105.338 1.00 55.85  ? 1135 SER A OG    1 
ATOM   8306  N  N     . VAL A 1  1136 ? 162.924 118.910 108.521 1.00 55.59  ? 1136 VAL A N     1 
ATOM   8307  C  CA    . VAL A 1  1136 ? 162.325 119.301 109.785 1.00 55.25  ? 1136 VAL A CA    1 
ATOM   8308  C  C     . VAL A 1  1136 ? 161.686 120.676 109.618 1.00 56.45  ? 1136 VAL A C     1 
ATOM   8309  O  O     . VAL A 1  1136 ? 161.684 121.257 108.533 1.00 56.94  ? 1136 VAL A O     1 
ATOM   8310  C  CB    . VAL A 1  1136 ? 163.347 119.306 110.940 1.00 56.88  ? 1136 VAL A CB    1 
ATOM   8311  C  CG1   . VAL A 1  1136 ? 163.857 117.899 111.208 1.00 52.87  ? 1136 VAL A CG1   1 
ATOM   8312  C  CG2   . VAL A 1  1136 ? 164.500 120.248 110.625 1.00 53.80  ? 1136 VAL A CG2   1 
ATOM   8313  N  N     . SER A 1  1137 ? 161.140 121.193 110.715 1.00 53.56  ? 1137 SER A N     1 
ATOM   8314  C  CA    . SER A 1  1137 ? 160.483 122.489 110.718 1.00 53.64  ? 1137 SER A CA    1 
ATOM   8315  C  C     . SER A 1  1137 ? 161.499 123.582 111.049 1.00 53.95  ? 1137 SER A C     1 
ATOM   8316  O  O     . SER A 1  1137 ? 162.710 123.350 111.079 1.00 53.78  ? 1137 SER A O     1 
ATOM   8317  C  CB    . SER A 1  1137 ? 159.314 122.483 111.700 1.00 53.94  ? 1137 SER A CB    1 
ATOM   8318  O  OG    . SER A 1  1137 ? 158.681 123.749 111.742 1.00 53.98  ? 1137 SER A OG    1 
ATOM   8319  N  N     . GLU A 1  1138 ? 161.008 124.794 111.303 1.00 54.66  ? 1138 GLU A N     1 
ATOM   8320  C  CA    . GLU A 1  1138 ? 161.875 125.921 111.623 1.00 55.92  ? 1138 GLU A CA    1 
ATOM   8321  C  C     . GLU A 1  1138 ? 162.039 126.106 113.128 1.00 57.19  ? 1138 GLU A C     1 
ATOM   8322  O  O     . GLU A 1  1138 ? 163.167 126.148 113.630 1.00 57.89  ? 1138 GLU A O     1 
ATOM   8323  C  CB    . GLU A 1  1138 ? 161.328 127.205 110.990 1.00 57.81  ? 1138 GLU A CB    1 
ATOM   8324  C  CG    . GLU A 1  1138 ? 162.184 128.434 111.251 1.00 57.74  ? 1138 GLU A CG    1 
ATOM   8325  C  CD    . GLU A 1  1138 ? 163.580 128.306 110.672 1.00 57.61  ? 1138 GLU A CD    1 
ATOM   8326  O  OE1   . GLU A 1  1138 ? 163.736 127.630 109.633 1.00 55.41  ? 1138 GLU A OE1   1 
ATOM   8327  O  OE2   . GLU A 1  1138 ? 164.522 128.878 111.259 1.00 55.11  ? 1138 GLU A OE2   1 
ATOM   8328  N  N     . ASN A 1  1139 ? 160.927 126.222 113.859 1.00 55.26  ? 1139 ASN A N     1 
ATOM   8329  C  CA    . ASN A 1  1139 ? 161.010 126.383 115.306 1.00 55.47  ? 1139 ASN A CA    1 
ATOM   8330  C  C     . ASN A 1  1139 ? 161.620 125.157 115.973 1.00 55.54  ? 1139 ASN A C     1 
ATOM   8331  O  O     . ASN A 1  1139 ? 162.231 125.273 117.042 1.00 55.36  ? 1139 ASN A O     1 
ATOM   8332  C  CB    . ASN A 1  1139 ? 159.626 126.668 115.888 1.00 55.21  ? 1139 ASN A CB    1 
ATOM   8333  C  CG    . ASN A 1  1139 ? 159.017 127.944 115.345 1.00 55.32  ? 1139 ASN A CG    1 
ATOM   8334  O  OD1   . ASN A 1  1139 ? 157.944 127.925 114.743 1.00 55.55  ? 1139 ASN A OD1   1 
ATOM   8335  N  ND2   . ASN A 1  1139 ? 159.701 129.062 115.555 1.00 55.53  ? 1139 ASN A ND2   1 
ATOM   8336  N  N     . PHE A 1  1140 ? 161.464 123.981 115.364 1.00 55.63  ? 1140 PHE A N     1 
ATOM   8337  C  CA    . PHE A 1  1140 ? 162.049 122.770 115.933 1.00 55.53  ? 1140 PHE A CA    1 
ATOM   8338  C  C     . PHE A 1  1140 ? 163.569 122.860 115.958 1.00 54.27  ? 1140 PHE A C     1 
ATOM   8339  O  O     . PHE A 1  1140 ? 164.197 122.640 116.999 1.00 52.90  ? 1140 PHE A O     1 
ATOM   8340  C  CB    . PHE A 1  1140 ? 161.590 121.543 115.144 1.00 53.04  ? 1140 PHE A CB    1 
ATOM   8341  C  CG    . PHE A 1  1140 ? 162.146 120.246 115.663 1.00 53.21  ? 1140 PHE A CG    1 
ATOM   8342  C  CD1   . PHE A 1  1140 ? 161.579 119.625 116.764 1.00 53.01  ? 1140 PHE A CD1   1 
ATOM   8343  C  CD2   . PHE A 1  1140 ? 163.233 119.645 115.047 1.00 52.62  ? 1140 PHE A CD2   1 
ATOM   8344  C  CE1   . PHE A 1  1140 ? 162.088 118.431 117.243 1.00 52.28  ? 1140 PHE A CE1   1 
ATOM   8345  C  CE2   . PHE A 1  1140 ? 163.745 118.451 115.522 1.00 56.77  ? 1140 PHE A CE2   1 
ATOM   8346  C  CZ    . PHE A 1  1140 ? 163.172 117.844 116.621 1.00 57.13  ? 1140 PHE A CZ    1 
ATOM   8347  N  N     . GLN A 1  1141 ? 164.180 123.195 114.819 1.00 58.13  ? 1141 GLN A N     1 
ATOM   8348  C  CA    . GLN A 1  1141 ? 165.635 123.272 114.748 1.00 59.23  ? 1141 GLN A CA    1 
ATOM   8349  C  C     . GLN A 1  1141 ? 166.182 124.518 115.433 1.00 59.94  ? 1141 GLN A C     1 
ATOM   8350  O  O     . GLN A 1  1141 ? 167.335 124.515 115.879 1.00 60.79  ? 1141 GLN A O     1 
ATOM   8351  C  CB    . GLN A 1  1141 ? 166.093 123.226 113.289 1.00 61.64  ? 1141 GLN A CB    1 
ATOM   8352  C  CG    . GLN A 1  1141 ? 165.544 124.347 112.424 1.00 62.26  ? 1141 GLN A CG    1 
ATOM   8353  C  CD    . GLN A 1  1141 ? 165.911 124.188 110.962 1.00 61.73  ? 1141 GLN A CD    1 
ATOM   8354  O  OE1   . GLN A 1  1141 ? 166.582 123.229 110.579 1.00 59.28  ? 1141 GLN A OE1   1 
ATOM   8355  N  NE2   . GLN A 1  1141 ? 165.471 125.130 110.134 1.00 59.43  ? 1141 GLN A NE2   1 
ATOM   8356  N  N     . ASP A 1  1142 ? 165.387 125.586 115.522 1.00 59.30  ? 1142 ASP A N     1 
ATOM   8357  C  CA    . ASP A 1  1142 ? 165.832 126.786 116.223 1.00 59.60  ? 1142 ASP A CA    1 
ATOM   8358  C  C     . ASP A 1  1142 ? 165.969 126.524 117.718 1.00 60.16  ? 1142 ASP A C     1 
ATOM   8359  O  O     . ASP A 1  1142 ? 167.024 126.773 118.313 1.00 60.57  ? 1142 ASP A O     1 
ATOM   8360  C  CB    . ASP A 1  1142 ? 164.863 127.941 115.964 1.00 60.89  ? 1142 ASP A CB    1 
ATOM   8361  C  CG    . ASP A 1  1142 ? 164.930 128.451 114.538 1.00 60.91  ? 1142 ASP A CG    1 
ATOM   8362  O  OD1   . ASP A 1  1142 ? 165.996 128.310 113.903 1.00 59.41  ? 1142 ASP A OD1   1 
ATOM   8363  O  OD2   . ASP A 1  1142 ? 163.916 128.995 114.053 1.00 59.43  ? 1142 ASP A OD2   1 
ATOM   8364  N  N     . LYS A 1  1143 ? 164.904 126.017 118.344 1.00 59.24  ? 1143 LYS A N     1 
ATOM   8365  C  CA    . LYS A 1  1143 ? 164.968 125.702 119.767 1.00 59.49  ? 1143 LYS A CA    1 
ATOM   8366  C  C     . LYS A 1  1143 ? 165.861 124.497 120.034 1.00 59.86  ? 1143 LYS A C     1 
ATOM   8367  O  O     . LYS A 1  1143 ? 166.366 124.334 121.151 1.00 60.44  ? 1143 LYS A O     1 
ATOM   8368  C  CB    . LYS A 1  1143 ? 163.561 125.464 120.315 1.00 60.72  ? 1143 LYS A CB    1 
ATOM   8369  C  CG    . LYS A 1  1143 ? 162.672 126.699 120.278 1.00 60.78  ? 1143 LYS A CG    1 
ATOM   8370  C  CD    . LYS A 1  1143 ? 161.257 126.391 120.739 1.00 60.96  ? 1143 LYS A CD    1 
ATOM   8371  C  CE    . LYS A 1  1143 ? 160.562 125.428 119.790 1.00 59.55  ? 1143 LYS A CE    1 
ATOM   8372  N  NZ    . LYS A 1  1143 ? 159.136 125.217 120.159 1.00 59.85  ? 1143 LYS A NZ    1 
ATOM   8373  N  N     . LEU A 1  1144 ? 166.067 123.645 119.028 1.00 59.77  ? 1144 LEU A N     1 
ATOM   8374  C  CA    . LEU A 1  1144 ? 167.006 122.536 119.172 1.00 60.37  ? 1144 LEU A CA    1 
ATOM   8375  C  C     . LEU A 1  1144 ? 168.434 123.053 119.283 1.00 59.75  ? 1144 LEU A C     1 
ATOM   8376  O  O     . LEU A 1  1144 ? 169.151 122.744 120.243 1.00 59.53  ? 1144 LEU A O     1 
ATOM   8377  C  CB    . LEU A 1  1144 ? 166.861 121.570 117.993 1.00 59.55  ? 1144 LEU A CB    1 
ATOM   8378  C  CG    . LEU A 1  1144 ? 167.724 120.305 117.916 1.00 59.78  ? 1144 LEU A CG    1 
ATOM   8379  C  CD1   . LEU A 1  1144 ? 169.044 120.573 117.198 1.00 62.08  ? 1144 LEU A CD1   1 
ATOM   8380  C  CD2   . LEU A 1  1144 ? 167.962 119.721 119.302 1.00 61.70  ? 1144 LEU A CD2   1 
ATOM   8381  N  N     . GLU A 1  1145 ? 168.870 123.840 118.297 1.00 65.00  ? 1145 GLU A N     1 
ATOM   8382  C  CA    . GLU A 1  1145 ? 170.204 124.425 118.350 1.00 67.48  ? 1145 GLU A CA    1 
ATOM   8383  C  C     . GLU A 1  1145 ? 170.366 125.378 119.525 1.00 69.82  ? 1145 GLU A C     1 
ATOM   8384  O  O     . GLU A 1  1145 ? 171.494 125.609 119.970 1.00 71.62  ? 1145 GLU A O     1 
ATOM   8385  C  CB    . GLU A 1  1145 ? 170.518 125.145 117.038 1.00 74.19  ? 1145 GLU A CB    1 
ATOM   8386  C  CG    . GLU A 1  1145 ? 170.642 124.214 115.841 1.00 75.92  ? 1145 GLU A CG    1 
ATOM   8387  C  CD    . GLU A 1  1145 ? 171.086 124.933 114.584 1.00 75.26  ? 1145 GLU A CD    1 
ATOM   8388  O  OE1   . GLU A 1  1145 ? 171.256 126.170 114.631 1.00 67.55  ? 1145 GLU A OE1   1 
ATOM   8389  O  OE2   . GLU A 1  1145 ? 171.268 124.261 113.546 1.00 67.90  ? 1145 GLU A OE2   1 
ATOM   8390  N  N     . SER A 1  1146 ? 169.265 125.936 120.036 1.00 66.74  ? 1146 SER A N     1 
ATOM   8391  C  CA    . SER A 1  1146 ? 169.336 126.701 121.275 1.00 65.48  ? 1146 SER A CA    1 
ATOM   8392  C  C     . SER A 1  1146 ? 169.579 125.785 122.467 1.00 65.02  ? 1146 SER A C     1 
ATOM   8393  O  O     . SER A 1  1146 ? 170.366 126.115 123.361 1.00 64.89  ? 1146 SER A O     1 
ATOM   8394  C  CB    . SER A 1  1146 ? 168.052 127.509 121.469 1.00 64.67  ? 1146 SER A CB    1 
ATOM   8395  O  OG    . SER A 1  1146 ? 167.857 128.420 120.401 1.00 64.72  ? 1146 SER A OG    1 
ATOM   8396  N  N     . PHE A 1  1147 ? 168.909 124.630 122.497 1.00 63.76  ? 1147 PHE A N     1 
ATOM   8397  C  CA    . PHE A 1  1147 ? 169.165 123.648 123.546 1.00 63.19  ? 1147 PHE A CA    1 
ATOM   8398  C  C     . PHE A 1  1147 ? 170.600 123.143 123.477 1.00 63.04  ? 1147 PHE A C     1 
ATOM   8399  O  O     . PHE A 1  1147 ? 171.297 123.081 124.496 1.00 62.87  ? 1147 PHE A O     1 
ATOM   8400  C  CB    . PHE A 1  1147 ? 168.174 122.487 123.432 1.00 62.88  ? 1147 PHE A CB    1 
ATOM   8401  C  CG    . PHE A 1  1147 ? 168.443 121.361 124.392 1.00 62.89  ? 1147 PHE A CG    1 
ATOM   8402  C  CD1   . PHE A 1  1147 ? 168.008 121.432 125.705 1.00 62.79  ? 1147 PHE A CD1   1 
ATOM   8403  C  CD2   . PHE A 1  1147 ? 169.121 120.224 123.977 1.00 63.10  ? 1147 PHE A CD2   1 
ATOM   8404  C  CE1   . PHE A 1  1147 ? 168.251 120.397 126.589 1.00 62.58  ? 1147 PHE A CE1   1 
ATOM   8405  C  CE2   . PHE A 1  1147 ? 169.368 119.187 124.857 1.00 62.59  ? 1147 PHE A CE2   1 
ATOM   8406  C  CZ    . PHE A 1  1147 ? 168.932 119.273 126.164 1.00 63.29  ? 1147 PHE A CZ    1 
ATOM   8407  N  N     . LEU A 1  1148 ? 171.060 122.783 122.276 1.00 61.54  ? 1148 LEU A N     1 
ATOM   8408  C  CA    . LEU A 1  1148 ? 172.441 122.340 122.110 1.00 61.47  ? 1148 LEU A CA    1 
ATOM   8409  C  C     . LEU A 1  1148 ? 173.428 123.449 122.449 1.00 61.80  ? 1148 LEU A C     1 
ATOM   8410  O  O     . LEU A 1  1148 ? 174.560 123.168 122.862 1.00 62.15  ? 1148 LEU A O     1 
ATOM   8411  C  CB    . LEU A 1  1148 ? 172.659 121.845 120.678 1.00 62.30  ? 1148 LEU A CB    1 
ATOM   8412  C  CG    . LEU A 1  1148 ? 174.053 121.330 120.307 1.00 62.13  ? 1148 LEU A CG    1 
ATOM   8413  C  CD1   . LEU A 1  1148 ? 174.469 120.193 121.226 1.00 61.49  ? 1148 LEU A CD1   1 
ATOM   8414  C  CD2   . LEU A 1  1148 ? 174.092 120.890 118.852 1.00 61.77  ? 1148 LEU A CD2   1 
ATOM   8415  N  N     . ASP A 1  1149 ? 173.021 124.710 122.291 1.00 62.76  ? 1149 ASP A N     1 
ATOM   8416  C  CA    . ASP A 1  1149 ? 173.902 125.820 122.639 1.00 63.95  ? 1149 ASP A CA    1 
ATOM   8417  C  C     . ASP A 1  1149 ? 174.092 125.921 124.149 1.00 66.01  ? 1149 ASP A C     1 
ATOM   8418  O  O     . ASP A 1  1149 ? 175.173 126.293 124.619 1.00 67.84  ? 1149 ASP A O     1 
ATOM   8419  C  CB    . ASP A 1  1149 ? 173.342 127.127 122.078 1.00 69.08  ? 1149 ASP A CB    1 
ATOM   8420  C  CG    . ASP A 1  1149 ? 174.259 128.309 122.326 1.00 68.41  ? 1149 ASP A CG    1 
ATOM   8421  O  OD1   . ASP A 1  1149 ? 175.491 128.110 122.365 1.00 62.75  ? 1149 ASP A OD1   1 
ATOM   8422  O  OD2   . ASP A 1  1149 ? 173.747 129.438 122.480 1.00 62.40  ? 1149 ASP A OD2   1 
ATOM   8423  N  N     . LYS A 1  1150 ? 173.056 125.593 124.922 1.00 61.98  ? 1150 LYS A N     1 
ATOM   8424  C  CA    . LYS A 1  1150 ? 173.113 125.640 126.377 1.00 61.64  ? 1150 LYS A CA    1 
ATOM   8425  C  C     . LYS A 1  1150 ? 173.139 124.244 126.996 1.00 61.68  ? 1150 LYS A C     1 
ATOM   8426  O  O     . LYS A 1  1150 ? 172.685 124.051 128.126 1.00 61.85  ? 1150 LYS A O     1 
ATOM   8427  C  CB    . LYS A 1  1150 ? 171.939 126.448 126.931 1.00 61.62  ? 1150 LYS A CB    1 
ATOM   8428  C  CG    . LYS A 1  1150 ? 170.569 125.899 126.569 1.00 61.27  ? 1150 LYS A CG    1 
ATOM   8429  C  CD    . LYS A 1  1150 ? 169.459 126.745 127.173 1.00 61.06  ? 1150 LYS A CD    1 
ATOM   8430  C  CE    . LYS A 1  1150 ? 168.085 126.206 126.807 1.00 61.73  ? 1150 LYS A CE    1 
ATOM   8431  N  NZ    . LYS A 1  1150 ? 167.854 126.221 125.337 1.00 61.29  ? 1150 LYS A NZ    1 
ATOM   8432  N  N     . ASN A 1  1151 ? 173.670 123.264 126.269 1.00 62.58  ? 1151 ASN A N     1 
ATOM   8433  C  CA    . ASN A 1  1151 ? 173.776 121.890 126.747 1.00 63.23  ? 1151 ASN A CA    1 
ATOM   8434  C  C     . ASN A 1  1151 ? 175.247 121.531 126.888 1.00 63.27  ? 1151 ASN A C     1 
ATOM   8435  O  O     . ASN A 1  1151 ? 176.010 121.642 125.922 1.00 62.80  ? 1151 ASN A O     1 
ATOM   8436  C  CB    . ASN A 1  1151 ? 173.074 120.917 125.796 1.00 62.26  ? 1151 ASN A CB    1 
ATOM   8437  C  CG    . ASN A 1  1151 ? 173.093 119.489 126.303 1.00 62.74  ? 1151 ASN A CG    1 
ATOM   8438  O  OD1   . ASN A 1  1151 ? 173.244 119.245 127.500 1.00 64.12  ? 1151 ASN A OD1   1 
ATOM   8439  N  ND2   . ASN A 1  1151 ? 172.937 118.536 125.392 1.00 63.98  ? 1151 ASN A ND2   1 
ATOM   8440  N  N     . SER A 1  1152 ? 175.641 121.102 128.088 1.00 65.65  ? 1152 SER A N     1 
ATOM   8441  C  CA    . SER A 1  1152 ? 177.016 120.676 128.363 1.00 67.22  ? 1152 SER A CA    1 
ATOM   8442  C  C     . SER A 1  1152 ? 176.941 119.392 129.187 1.00 68.23  ? 1152 SER A C     1 
ATOM   8443  O  O     . SER A 1  1152 ? 176.908 119.433 130.420 1.00 69.00  ? 1152 SER A O     1 
ATOM   8444  C  CB    . SER A 1  1152 ? 177.800 121.766 129.082 1.00 67.59  ? 1152 SER A CB    1 
ATOM   8445  O  OG    . SER A 1  1152 ? 179.125 121.345 129.354 1.00 67.50  ? 1152 SER A OG    1 
ATOM   8446  N  N     . LYS A 1  1153 ? 176.919 118.256 128.498 1.00 67.73  ? 1153 LYS A N     1 
ATOM   8447  C  CA    . LYS A 1  1153 ? 176.868 116.955 129.156 1.00 67.87  ? 1153 LYS A CA    1 
ATOM   8448  C  C     . LYS A 1  1153 ? 178.013 116.063 128.691 1.00 67.54  ? 1153 LYS A C     1 
ATOM   8449  O  O     . LYS A 1  1153 ? 177.854 115.263 127.769 1.00 67.67  ? 1153 LYS A O     1 
ATOM   8450  C  CB    . LYS A 1  1153 ? 175.525 116.267 128.892 1.00 67.62  ? 1153 LYS A CB    1 
ATOM   8451  C  CG    . LYS A 1  1153 ? 174.529 116.364 130.040 1.00 67.35  ? 1153 LYS A CG    1 
ATOM   8452  C  CD    . LYS A 1  1153 ? 174.086 117.797 130.285 1.00 66.93  ? 1153 LYS A CD    1 
ATOM   8453  C  CE    . LYS A 1  1153 ? 173.101 117.881 131.440 1.00 68.18  ? 1153 LYS A CE    1 
ATOM   8454  N  NZ    . LYS A 1  1153 ? 172.666 119.281 131.698 1.00 68.49  ? 1153 LYS A NZ    1 
ATOM   8455  N  N     . GLY A 1  1160 ? 177.566 108.699 129.072 1.00 69.39  ? 1160 GLY A N     1 
ATOM   8456  C  CA    . GLY A 1  1160 ? 178.508 109.230 128.104 1.00 69.47  ? 1160 GLY A CA    1 
ATOM   8457  C  C     . GLY A 1  1160 ? 178.071 109.027 126.667 1.00 69.50  ? 1160 GLY A C     1 
ATOM   8458  O  O     . GLY A 1  1160 ? 178.610 108.178 125.957 1.00 69.20  ? 1160 GLY A O     1 
ATOM   8459  N  N     . VAL A 1  1161 ? 177.086 109.811 126.238 1.00 69.58  ? 1161 VAL A N     1 
ATOM   8460  C  CA    . VAL A 1  1161 ? 176.546 109.743 124.885 1.00 69.41  ? 1161 VAL A CA    1 
ATOM   8461  C  C     . VAL A 1  1161 ? 177.015 110.968 124.113 1.00 68.75  ? 1161 VAL A C     1 
ATOM   8462  O  O     . VAL A 1  1161 ? 177.063 112.078 124.656 1.00 68.40  ? 1161 VAL A O     1 
ATOM   8463  C  CB    . VAL A 1  1161 ? 175.006 109.640 124.900 1.00 68.78  ? 1161 VAL A CB    1 
ATOM   8464  C  CG1   . VAL A 1  1161 ? 174.393 110.798 125.679 1.00 69.65  ? 1161 VAL A CG1   1 
ATOM   8465  C  CG2   . VAL A 1  1161 ? 174.450 109.583 123.483 1.00 69.92  ? 1161 VAL A CG2   1 
ATOM   8466  N  N     . ASN A 1  1162 ? 177.377 110.762 122.849 1.00 69.48  ? 1162 ASN A N     1 
ATOM   8467  C  CA    . ASN A 1  1162 ? 177.829 111.850 121.993 1.00 69.02  ? 1162 ASN A CA    1 
ATOM   8468  C  C     . ASN A 1  1162 ? 176.617 112.565 121.394 1.00 68.66  ? 1162 ASN A C     1 
ATOM   8469  O  O     . ASN A 1  1162 ? 175.472 112.348 121.797 1.00 68.27  ? 1162 ASN A O     1 
ATOM   8470  C  CB    . ASN A 1  1162 ? 178.780 111.320 120.921 1.00 67.59  ? 1162 ASN A CB    1 
ATOM   8471  C  CG    . ASN A 1  1162 ? 178.222 110.115 120.190 1.00 68.38  ? 1162 ASN A CG    1 
ATOM   8472  O  OD1   . ASN A 1  1162 ? 177.052 109.767 120.342 1.00 68.75  ? 1162 ASN A OD1   1 
ATOM   8473  N  ND2   . ASN A 1  1162 ? 179.063 109.470 119.389 1.00 68.23  ? 1162 ASN A ND2   1 
ATOM   8474  N  N     . GLU A 1  1163 ? 176.863 113.434 120.412 1.00 68.83  ? 1163 GLU A N     1 
ATOM   8475  C  CA    . GLU A 1  1163 ? 175.809 114.234 119.805 1.00 68.57  ? 1163 GLU A CA    1 
ATOM   8476  C  C     . GLU A 1  1163 ? 175.424 113.784 118.404 1.00 68.21  ? 1163 GLU A C     1 
ATOM   8477  O  O     . GLU A 1  1163 ? 174.336 114.138 117.939 1.00 67.72  ? 1163 GLU A O     1 
ATOM   8478  C  CB    . GLU A 1  1163 ? 176.229 115.712 119.759 1.00 67.45  ? 1163 GLU A CB    1 
ATOM   8479  C  CG    . GLU A 1  1163 ? 175.084 116.695 119.544 1.00 66.78  ? 1163 GLU A CG    1 
ATOM   8480  C  CD    . GLU A 1  1163 ? 174.107 116.721 120.704 1.00 67.64  ? 1163 GLU A CD    1 
ATOM   8481  O  OE1   . GLU A 1  1163 ? 174.510 116.377 121.836 1.00 68.28  ? 1163 GLU A OE1   1 
ATOM   8482  O  OE2   . GLU A 1  1163 ? 172.934 117.088 120.485 1.00 68.23  ? 1163 GLU A OE2   1 
ATOM   8483  N  N     . LYS A 1  1164 ? 176.272 113.008 117.725 1.00 67.97  ? 1164 LYS A N     1 
ATOM   8484  C  CA    . LYS A 1  1164 ? 175.976 112.611 116.352 1.00 68.30  ? 1164 LYS A CA    1 
ATOM   8485  C  C     . LYS A 1  1164 ? 174.811 111.630 116.301 1.00 68.92  ? 1164 LYS A C     1 
ATOM   8486  O  O     . LYS A 1  1164 ? 173.789 111.895 115.657 1.00 69.59  ? 1164 LYS A O     1 
ATOM   8487  C  CB    . LYS A 1  1164 ? 177.221 112.008 115.697 1.00 69.93  ? 1164 LYS A CB    1 
ATOM   8488  C  CG    . LYS A 1  1164 ? 177.059 111.753 114.206 1.00 70.09  ? 1164 LYS A CG    1 
ATOM   8489  C  CD    . LYS A 1  1164 ? 178.338 111.213 113.589 1.00 70.19  ? 1164 LYS A CD    1 
ATOM   8490  C  CE    . LYS A 1  1164 ? 178.195 111.056 112.084 1.00 68.34  ? 1164 LYS A CE    1 
ATOM   8491  N  NZ    . LYS A 1  1164 ? 177.077 110.142 111.723 1.00 68.57  ? 1164 LYS A NZ    1 
ATOM   8492  N  N     . LYS A 1  1165 ? 174.945 110.484 116.972 1.00 67.83  ? 1165 LYS A N     1 
ATOM   8493  C  CA    . LYS A 1  1165 ? 173.854 109.516 116.990 1.00 67.20  ? 1165 LYS A CA    1 
ATOM   8494  C  C     . LYS A 1  1165 ? 172.645 110.031 117.758 1.00 67.56  ? 1165 LYS A C     1 
ATOM   8495  O  O     . LYS A 1  1165 ? 171.539 109.517 117.562 1.00 67.77  ? 1165 LYS A O     1 
ATOM   8496  C  CB    . LYS A 1  1165 ? 174.325 108.186 117.583 1.00 67.67  ? 1165 LYS A CB    1 
ATOM   8497  C  CG    . LYS A 1  1165 ? 174.590 108.215 119.077 1.00 67.81  ? 1165 LYS A CG    1 
ATOM   8498  C  CD    . LYS A 1  1165 ? 174.978 106.836 119.587 1.00 67.79  ? 1165 LYS A CD    1 
ATOM   8499  C  CE    . LYS A 1  1165 ? 175.259 106.854 121.080 1.00 65.91  ? 1165 LYS A CE    1 
ATOM   8500  N  NZ    . LYS A 1  1165 ? 176.420 107.722 121.417 1.00 65.64  ? 1165 LYS A NZ    1 
ATOM   8501  N  N     . PHE A 1  1166 ? 172.829 111.031 118.622 1.00 64.88  ? 1166 PHE A N     1 
ATOM   8502  C  CA    . PHE A 1  1166 ? 171.685 111.691 119.240 1.00 64.52  ? 1166 PHE A CA    1 
ATOM   8503  C  C     . PHE A 1  1166 ? 170.969 112.594 118.244 1.00 64.70  ? 1166 PHE A C     1 
ATOM   8504  O  O     . PHE A 1  1166 ? 169.753 112.792 118.351 1.00 64.70  ? 1166 PHE A O     1 
ATOM   8505  C  CB    . PHE A 1  1166 ? 172.132 112.490 120.465 1.00 64.96  ? 1166 PHE A CB    1 
ATOM   8506  C  CG    . PHE A 1  1166 ? 171.016 113.224 121.154 1.00 64.81  ? 1166 PHE A CG    1 
ATOM   8507  C  CD1   . PHE A 1  1166 ? 170.173 112.562 122.032 1.00 64.43  ? 1166 PHE A CD1   1 
ATOM   8508  C  CD2   . PHE A 1  1166 ? 170.815 114.577 120.931 1.00 64.16  ? 1166 PHE A CD2   1 
ATOM   8509  C  CE1   . PHE A 1  1166 ? 169.146 113.235 122.670 1.00 64.17  ? 1166 PHE A CE1   1 
ATOM   8510  C  CE2   . PHE A 1  1166 ? 169.790 115.255 121.566 1.00 64.17  ? 1166 PHE A CE2   1 
ATOM   8511  C  CZ    . PHE A 1  1166 ? 168.955 114.583 122.436 1.00 64.11  ? 1166 PHE A CZ    1 
ATOM   8512  N  N     . ARG A 1  1167 ? 171.702 113.147 117.275 1.00 64.23  ? 1167 ARG A N     1 
ATOM   8513  C  CA    . ARG A 1  1167 ? 171.067 113.946 116.234 1.00 64.79  ? 1167 ARG A CA    1 
ATOM   8514  C  C     . ARG A 1  1167 ? 170.242 113.071 115.300 1.00 65.69  ? 1167 ARG A C     1 
ATOM   8515  O  O     . ARG A 1  1167 ? 169.120 113.436 114.930 1.00 66.27  ? 1167 ARG A O     1 
ATOM   8516  C  CB    . ARG A 1  1167 ? 172.124 114.727 115.452 1.00 66.40  ? 1167 ARG A CB    1 
ATOM   8517  C  CG    . ARG A 1  1167 ? 171.564 115.551 114.302 1.00 66.09  ? 1167 ARG A CG    1 
ATOM   8518  C  CD    . ARG A 1  1167 ? 172.650 116.359 113.603 1.00 66.24  ? 1167 ARG A CD    1 
ATOM   8519  N  NE    . ARG A 1  1167 ? 173.198 117.409 114.458 1.00 66.60  ? 1167 ARG A NE    1 
ATOM   8520  C  CZ    . ARG A 1  1167 ? 174.349 117.317 115.116 1.00 65.74  ? 1167 ARG A CZ    1 
ATOM   8521  N  NH1   . ARG A 1  1167 ? 175.086 116.219 115.018 1.00 64.67  ? 1167 ARG A NH1   1 
ATOM   8522  N  NH2   . ARG A 1  1167 ? 174.767 118.325 115.870 1.00 64.26  ? 1167 ARG A NH2   1 
ATOM   8523  N  N     . ALA A 1  1168 ? 170.779 111.913 114.908 1.00 65.31  ? 1168 ALA A N     1 
ATOM   8524  C  CA    . ALA A 1  1168 ? 169.994 110.966 114.126 1.00 66.22  ? 1168 ALA A CA    1 
ATOM   8525  C  C     . ALA A 1  1168 ? 168.864 110.368 114.953 1.00 66.91  ? 1168 ALA A C     1 
ATOM   8526  O  O     . ALA A 1  1168 ? 167.838 109.956 114.398 1.00 66.27  ? 1168 ALA A O     1 
ATOM   8527  C  CB    . ALA A 1  1168 ? 170.894 109.860 113.576 1.00 66.12  ? 1168 ALA A CB    1 
ATOM   8528  N  N     . LEU A 1  1169 ? 169.032 110.314 116.276 1.00 66.19  ? 1169 LEU A N     1 
ATOM   8529  C  CA    . LEU A 1  1169 ? 167.972 109.817 117.146 1.00 65.78  ? 1169 LEU A CA    1 
ATOM   8530  C  C     . LEU A 1  1169 ? 166.772 110.756 117.134 1.00 66.07  ? 1169 LEU A C     1 
ATOM   8531  O  O     . LEU A 1  1169 ? 165.639 110.335 116.872 1.00 65.88  ? 1169 LEU A O     1 
ATOM   8532  C  CB    . LEU A 1  1169 ? 168.512 109.636 118.566 1.00 65.97  ? 1169 LEU A CB    1 
ATOM   8533  C  CG    . LEU A 1  1169 ? 167.556 109.270 119.703 1.00 65.67  ? 1169 LEU A CG    1 
ATOM   8534  C  CD1   . LEU A 1  1169 ? 168.234 108.304 120.658 1.00 65.30  ? 1169 LEU A CD1   1 
ATOM   8535  C  CD2   . LEU A 1  1169 ? 167.102 110.515 120.454 1.00 65.00  ? 1169 LEU A CD2   1 
ATOM   8536  N  N     . MET A 1  1170 ? 167.003 112.040 117.419 1.00 64.27  ? 1170 MET A N     1 
ATOM   8537  C  CA    . MET A 1  1170 ? 165.912 113.007 117.415 1.00 64.12  ? 1170 MET A CA    1 
ATOM   8538  C  C     . MET A 1  1170 ? 165.376 113.246 116.009 1.00 66.06  ? 1170 MET A C     1 
ATOM   8539  O  O     . MET A 1  1170 ? 164.211 113.627 115.850 1.00 67.95  ? 1170 MET A O     1 
ATOM   8540  C  CB    . MET A 1  1170 ? 166.376 114.321 118.043 1.00 70.32  ? 1170 MET A CB    1 
ATOM   8541  C  CG    . MET A 1  1170 ? 167.515 114.994 117.299 1.00 70.03  ? 1170 MET A CG    1 
ATOM   8542  S  SD    . MET A 1  1170 ? 168.225 116.367 118.220 1.00 62.76  ? 1170 MET A SD    1 
ATOM   8543  C  CE    . MET A 1  1170 ? 169.384 117.014 117.020 1.00 62.21  ? 1170 MET A CE    1 
ATOM   8544  N  N     . GLN A 1  1171 ? 166.205 113.038 114.984 1.00 61.95  ? 1171 GLN A N     1 
ATOM   8545  C  CA    . GLN A 1  1171 ? 165.731 113.176 113.611 1.00 61.80  ? 1171 GLN A CA    1 
ATOM   8546  C  C     . GLN A 1  1171 ? 164.724 112.086 113.270 1.00 63.03  ? 1171 GLN A C     1 
ATOM   8547  O  O     . GLN A 1  1171 ? 163.640 112.368 112.746 1.00 63.71  ? 1171 GLN A O     1 
ATOM   8548  C  CB    . GLN A 1  1171 ? 166.911 113.143 112.640 1.00 63.59  ? 1171 GLN A CB    1 
ATOM   8549  C  CG    . GLN A 1  1171 ? 166.520 113.354 111.189 1.00 62.92  ? 1171 GLN A CG    1 
ATOM   8550  C  CD    . GLN A 1  1171 ? 165.835 114.687 110.963 1.00 63.57  ? 1171 GLN A CD    1 
ATOM   8551  O  OE1   . GLN A 1  1171 ? 164.773 114.756 110.345 1.00 60.35  ? 1171 GLN A OE1   1 
ATOM   8552  N  NE2   . GLN A 1  1171 ? 166.444 115.757 111.463 1.00 60.28  ? 1171 GLN A NE2   1 
ATOM   8553  N  N     . LEU A 1  1172 ? 165.070 110.828 113.556 1.00 58.76  ? 1172 LEU A N     1 
ATOM   8554  C  CA    . LEU A 1  1172 ? 164.126 109.734 113.346 1.00 57.59  ? 1172 LEU A CA    1 
ATOM   8555  C  C     . LEU A 1  1172 ? 162.914 109.867 114.258 1.00 56.93  ? 1172 LEU A C     1 
ATOM   8556  O  O     . LEU A 1  1172 ? 161.812 109.441 113.891 1.00 56.61  ? 1172 LEU A O     1 
ATOM   8557  C  CB    . LEU A 1  1172 ? 164.827 108.391 113.565 1.00 56.82  ? 1172 LEU A CB    1 
ATOM   8558  C  CG    . LEU A 1  1172 ? 164.076 107.111 113.187 1.00 55.98  ? 1172 LEU A CG    1 
ATOM   8559  C  CD1   . LEU A 1  1172 ? 165.042 106.089 112.609 1.00 57.32  ? 1172 LEU A CD1   1 
ATOM   8560  C  CD2   . LEU A 1  1172 ? 163.347 106.524 114.388 1.00 57.33  ? 1172 LEU A CD2   1 
ATOM   8561  N  N     . LYS A 1  1173 ? 163.094 110.451 115.445 1.00 57.23  ? 1173 LYS A N     1 
ATOM   8562  C  CA    . LYS A 1  1173 ? 161.964 110.675 116.340 1.00 56.84  ? 1173 LYS A CA    1 
ATOM   8563  C  C     . LYS A 1  1173 ? 161.003 111.705 115.761 1.00 57.77  ? 1173 LYS A C     1 
ATOM   8564  O  O     . LYS A 1  1173 ? 159.781 111.528 115.826 1.00 57.96  ? 1173 LYS A O     1 
ATOM   8565  C  CB    . LYS A 1  1173 ? 162.469 111.112 117.718 1.00 58.15  ? 1173 LYS A CB    1 
ATOM   8566  C  CG    . LYS A 1  1173 ? 161.397 111.175 118.800 1.00 57.94  ? 1173 LYS A CG    1 
ATOM   8567  C  CD    . LYS A 1  1173 ? 160.836 112.579 118.969 1.00 57.84  ? 1173 LYS A CD    1 
ATOM   8568  C  CE    . LYS A 1  1173 ? 159.756 112.618 120.037 1.00 55.14  ? 1173 LYS A CE    1 
ATOM   8569  N  NZ    . LYS A 1  1173 ? 159.186 113.984 120.203 1.00 55.39  ? 1173 LYS A NZ    1 
ATOM   8570  N  N     . TYR A 1  1174 ? 161.536 112.790 115.194 1.00 53.22  ? 1174 TYR A N     1 
ATOM   8571  C  CA    . TYR A 1  1174 ? 160.679 113.799 114.580 1.00 52.10  ? 1174 TYR A CA    1 
ATOM   8572  C  C     . TYR A 1  1174 ? 160.009 113.262 113.321 1.00 52.21  ? 1174 TYR A C     1 
ATOM   8573  O  O     . TYR A 1  1174 ? 158.857 113.604 113.029 1.00 52.19  ? 1174 TYR A O     1 
ATOM   8574  C  CB    . TYR A 1  1174 ? 161.492 115.056 114.265 1.00 52.27  ? 1174 TYR A CB    1 
ATOM   8575  C  CG    . TYR A 1  1174 ? 160.688 116.168 113.630 1.00 51.97  ? 1174 TYR A CG    1 
ATOM   8576  C  CD1   . TYR A 1  1174 ? 159.947 117.047 114.408 1.00 51.25  ? 1174 TYR A CD1   1 
ATOM   8577  C  CD2   . TYR A 1  1174 ? 160.674 116.343 112.252 1.00 51.60  ? 1174 TYR A CD2   1 
ATOM   8578  C  CE1   . TYR A 1  1174 ? 159.210 118.065 113.833 1.00 51.80  ? 1174 TYR A CE1   1 
ATOM   8579  C  CE2   . TYR A 1  1174 ? 159.942 117.359 111.668 1.00 51.61  ? 1174 TYR A CE2   1 
ATOM   8580  C  CZ    . TYR A 1  1174 ? 159.213 118.217 112.462 1.00 51.36  ? 1174 TYR A CZ    1 
ATOM   8581  O  OH    . TYR A 1  1174 ? 158.484 119.229 111.884 1.00 51.06  ? 1174 TYR A OH    1 
ATOM   8582  N  N     . MET A 1  1175 ? 160.716 112.421 112.561 1.00 51.14  ? 1175 MET A N     1 
ATOM   8583  C  CA    . MET A 1  1175 ? 160.129 111.848 111.355 1.00 51.15  ? 1175 MET A CA    1 
ATOM   8584  C  C     . MET A 1  1175 ? 159.066 110.808 111.686 1.00 52.13  ? 1175 MET A C     1 
ATOM   8585  O  O     . MET A 1  1175 ? 158.104 110.644 110.927 1.00 52.55  ? 1175 MET A O     1 
ATOM   8586  C  CB    . MET A 1  1175 ? 161.223 111.234 110.479 1.00 53.26  ? 1175 MET A CB    1 
ATOM   8587  C  CG    . MET A 1  1175 ? 160.729 110.714 109.139 1.00 53.03  ? 1175 MET A CG    1 
ATOM   8588  S  SD    . MET A 1  1175 ? 162.049 110.024 108.126 1.00 50.15  ? 1175 MET A SD    1 
ATOM   8589  C  CE    . MET A 1  1175 ? 161.132 109.522 106.671 1.00 49.66  ? 1175 MET A CE    1 
ATOM   8590  N  N     . ARG A 1  1176 ? 159.218 110.103 112.810 1.00 49.78  ? 1176 ARG A N     1 
ATOM   8591  C  CA    . ARG A 1  1176 ? 158.224 109.108 113.199 1.00 50.02  ? 1176 ARG A CA    1 
ATOM   8592  C  C     . ARG A 1  1176 ? 156.892 109.754 113.558 1.00 51.05  ? 1176 ARG A C     1 
ATOM   8593  O  O     . ARG A 1  1176 ? 155.834 109.150 113.349 1.00 51.86  ? 1176 ARG A O     1 
ATOM   8594  C  CB    . ARG A 1  1176 ? 158.748 108.276 114.369 1.00 52.33  ? 1176 ARG A CB    1 
ATOM   8595  C  CG    . ARG A 1  1176 ? 157.827 107.146 114.801 1.00 53.16  ? 1176 ARG A CG    1 
ATOM   8596  C  CD    . ARG A 1  1176 ? 157.582 106.168 113.663 1.00 53.95  ? 1176 ARG A CD    1 
ATOM   8597  N  NE    . ARG A 1  1176 ? 158.818 105.539 113.207 1.00 54.27  ? 1176 ARG A NE    1 
ATOM   8598  C  CZ    . ARG A 1  1176 ? 159.306 104.405 113.699 1.00 54.08  ? 1176 ARG A CZ    1 
ATOM   8599  N  NH1   . ARG A 1  1176 ? 160.438 103.905 113.223 1.00 49.85  ? 1176 ARG A NH1   1 
ATOM   8600  N  NH2   . ARG A 1  1176 ? 158.662 103.770 114.668 1.00 49.46  ? 1176 ARG A NH2   1 
ATOM   8601  N  N     . SER A 1  1177 ? 156.921 110.978 114.084 1.00 50.80  ? 1177 SER A N     1 
ATOM   8602  C  CA    . SER A 1  1177 ? 155.710 111.696 114.461 1.00 51.70  ? 1177 SER A CA    1 
ATOM   8603  C  C     . SER A 1  1177 ? 154.997 112.331 113.272 1.00 52.32  ? 1177 SER A C     1 
ATOM   8604  O  O     . SER A 1  1177 ? 154.073 113.125 113.476 1.00 52.73  ? 1177 SER A O     1 
ATOM   8605  C  CB    . SER A 1  1177 ? 156.040 112.771 115.500 1.00 52.19  ? 1177 SER A CB    1 
ATOM   8606  O  OG    . SER A 1  1177 ? 156.576 112.193 116.679 1.00 52.07  ? 1177 SER A OG    1 
ATOM   8607  N  N     . LEU A 1  1178 ? 155.405 112.008 112.047 1.00 53.11  ? 1178 LEU A N     1 
ATOM   8608  C  CA    . LEU A 1  1178 ? 154.747 112.551 110.867 1.00 53.91  ? 1178 LEU A CA    1 
ATOM   8609  C  C     . LEU A 1  1178 ? 153.321 112.019 110.772 1.00 55.23  ? 1178 LEU A C     1 
ATOM   8610  O  O     . LEU A 1  1178 ? 153.056 110.852 111.073 1.00 56.19  ? 1178 LEU A O     1 
ATOM   8611  C  CB    . LEU A 1  1178 ? 155.542 112.189 109.610 1.00 56.68  ? 1178 LEU A CB    1 
ATOM   8612  C  CG    . LEU A 1  1178 ? 155.430 113.059 108.352 1.00 56.14  ? 1178 LEU A CG    1 
ATOM   8613  C  CD1   . LEU A 1  1178 ? 154.161 112.770 107.563 1.00 53.03  ? 1178 LEU A CD1   1 
ATOM   8614  C  CD2   . LEU A 1  1178 ? 155.514 114.535 108.711 1.00 52.53  ? 1178 LEU A CD2   1 
ATOM   8615  N  N     . ILE A 1  1179 ? 152.399 112.890 110.360 1.00 52.43  ? 1179 ILE A N     1 
ATOM   8616  C  CA    . ILE A 1  1179 ? 150.990 112.517 110.294 1.00 51.88  ? 1179 ILE A CA    1 
ATOM   8617  C  C     . ILE A 1  1179 ? 150.792 111.438 109.240 1.00 51.27  ? 1179 ILE A C     1 
ATOM   8618  O  O     . ILE A 1  1179 ? 151.244 111.570 108.095 1.00 51.33  ? 1179 ILE A O     1 
ATOM   8619  C  CB    . ILE A 1  1179 ? 150.118 113.748 110.003 1.00 51.54  ? 1179 ILE A CB    1 
ATOM   8620  C  CG1   . ILE A 1  1179 ? 149.830 114.512 111.295 1.00 50.94  ? 1179 ILE A CG1   1 
ATOM   8621  C  CG2   . ILE A 1  1179 ? 148.815 113.342 109.324 1.00 52.06  ? 1179 ILE A CG2   1 
ATOM   8622  C  CD1   . ILE A 1  1179 ? 148.809 115.613 111.139 1.00 52.65  ? 1179 ILE A CD1   1 
ATOM   8623  N  N     . ASN A 1  1180 ? 150.119 110.362 109.626 1.00 51.76  ? 1180 ASN A N     1 
ATOM   8624  C  CA    . ASN A 1  1180 ? 149.788 109.293 108.699 1.00 51.77  ? 1180 ASN A CA    1 
ATOM   8625  C  C     . ASN A 1  1180 ? 148.870 109.826 107.603 1.00 52.76  ? 1180 ASN A C     1 
ATOM   8626  O  O     . ASN A 1  1180 ? 147.763 110.296 107.908 1.00 53.67  ? 1180 ASN A O     1 
ATOM   8627  C  CB    . ASN A 1  1180 ? 149.117 108.140 109.440 1.00 52.78  ? 1180 ASN A CB    1 
ATOM   8628  C  CG    . ASN A 1  1180 ? 148.756 106.989 108.525 1.00 54.93  ? 1180 ASN A CG    1 
ATOM   8629  O  OD1   . ASN A 1  1180 ? 149.283 106.872 107.420 1.00 50.79  ? 1180 ASN A OD1   1 
ATOM   8630  N  ND2   . ASN A 1  1180 ? 147.854 106.129 108.983 1.00 50.78  ? 1180 ASN A ND2   1 
ATOM   8631  N  N     . PRO A 1  1181 ? 149.281 109.786 106.336 1.00 50.47  ? 1181 PRO A N     1 
ATOM   8632  C  CA    . PRO A 1  1181 ? 148.411 110.288 105.266 1.00 50.22  ? 1181 PRO A CA    1 
ATOM   8633  C  C     . PRO A 1  1181 ? 147.146 109.452 105.144 1.00 51.34  ? 1181 PRO A C     1 
ATOM   8634  O  O     . PRO A 1  1181 ? 147.187 108.220 105.153 1.00 51.72  ? 1181 PRO A O     1 
ATOM   8635  C  CB    . PRO A 1  1181 ? 149.289 110.174 104.013 1.00 51.25  ? 1181 PRO A CB    1 
ATOM   8636  C  CG    . PRO A 1  1181 ? 150.302 109.131 104.354 1.00 49.32  ? 1181 PRO A CG    1 
ATOM   8637  C  CD    . PRO A 1  1181 ? 150.570 109.298 105.819 1.00 48.68  ? 1181 PRO A CD    1 
ATOM   8638  N  N     . GLY A 1  1182 ? 146.014 110.140 105.032 1.00 48.89  ? 1182 GLY A N     1 
ATOM   8639  C  CA    . GLY A 1  1182 ? 144.721 109.497 104.959 1.00 48.56  ? 1182 GLY A CA    1 
ATOM   8640  C  C     . GLY A 1  1182 ? 143.857 109.638 106.194 1.00 48.21  ? 1182 GLY A C     1 
ATOM   8641  O  O     . GLY A 1  1182 ? 142.771 109.047 106.236 1.00 48.02  ? 1182 GLY A O     1 
ATOM   8642  N  N     . GLU A 1  1183 ? 144.295 110.397 107.194 1.00 48.37  ? 1183 GLU A N     1 
ATOM   8643  C  CA    . GLU A 1  1183 ? 143.544 110.561 108.430 1.00 48.49  ? 1183 GLU A CA    1 
ATOM   8644  C  C     . GLU A 1  1183 ? 142.537 111.693 108.282 1.00 49.08  ? 1183 GLU A C     1 
ATOM   8645  O  O     . GLU A 1  1183 ? 142.805 112.697 107.615 1.00 49.48  ? 1183 GLU A O     1 
ATOM   8646  C  CB    . GLU A 1  1183 ? 144.494 110.842 109.598 1.00 50.05  ? 1183 GLU A CB    1 
ATOM   8647  C  CG    . GLU A 1  1183 ? 143.929 110.513 110.974 1.00 50.16  ? 1183 GLU A CG    1 
ATOM   8648  C  CD    . GLU A 1  1183 ? 143.010 111.592 111.511 1.00 50.80  ? 1183 GLU A CD    1 
ATOM   8649  O  OE1   . GLU A 1  1183 ? 143.258 112.782 111.224 1.00 48.02  ? 1183 GLU A OE1   1 
ATOM   8650  O  OE2   . GLU A 1  1183 ? 142.038 111.249 112.216 1.00 48.27  ? 1183 GLU A OE2   1 
ATOM   8651  N  N     . ALA A 1  1184 ? 141.373 111.524 108.910 1.00 47.41  ? 1184 ALA A N     1 
ATOM   8652  C  CA    . ALA A 1  1184 ? 140.309 112.527 108.861 1.00 47.08  ? 1184 ALA A CA    1 
ATOM   8653  C  C     . ALA A 1  1184 ? 140.682 113.674 109.795 1.00 47.35  ? 1184 ALA A C     1 
ATOM   8654  O  O     . ALA A 1  1184 ? 140.212 113.785 110.930 1.00 46.75  ? 1184 ALA A O     1 
ATOM   8655  C  CB    . ALA A 1  1184 ? 138.967 111.909 109.231 1.00 46.94  ? 1184 ALA A CB    1 
ATOM   8656  N  N     . VAL A 1  1185 ? 141.558 114.548 109.293 1.00 47.08  ? 1185 VAL A N     1 
ATOM   8657  C  CA    . VAL A 1  1185 ? 142.011 115.688 110.082 1.00 48.03  ? 1185 VAL A CA    1 
ATOM   8658  C  C     . VAL A 1  1185 ? 140.896 116.714 110.237 1.00 49.11  ? 1185 VAL A C     1 
ATOM   8659  O  O     . VAL A 1  1185 ? 140.851 117.450 111.232 1.00 49.69  ? 1185 VAL A O     1 
ATOM   8660  C  CB    . VAL A 1  1185 ? 143.271 116.299 109.440 1.00 49.39  ? 1185 VAL A CB    1 
ATOM   8661  C  CG1   . VAL A 1  1185 ? 143.737 117.524 110.209 1.00 47.46  ? 1185 VAL A CG1   1 
ATOM   8662  C  CG2   . VAL A 1  1185 ? 144.379 115.261 109.372 1.00 47.83  ? 1185 VAL A CG2   1 
ATOM   8663  N  N     . GLY A 1  1186 ? 139.974 116.771 109.278 1.00 46.77  ? 1186 GLY A N     1 
ATOM   8664  C  CA    . GLY A 1  1186 ? 138.875 117.713 109.328 1.00 46.55  ? 1186 GLY A CA    1 
ATOM   8665  C  C     . GLY A 1  1186 ? 138.017 117.581 110.569 1.00 46.37  ? 1186 GLY A C     1 
ATOM   8666  O  O     . GLY A 1  1186 ? 137.873 118.538 111.335 1.00 45.79  ? 1186 GLY A O     1 
ATOM   8667  N  N     . ILE A 1  1187 ? 137.447 116.391 110.783 1.00 47.28  ? 1187 ILE A N     1 
ATOM   8668  C  CA    . ILE A 1  1187 ? 136.612 116.171 111.960 1.00 48.59  ? 1187 ILE A CA    1 
ATOM   8669  C  C     . ILE A 1  1187 ? 137.410 116.392 113.238 1.00 49.87  ? 1187 ILE A C     1 
ATOM   8670  O  O     . ILE A 1  1187 ? 136.851 116.779 114.271 1.00 50.02  ? 1187 ILE A O     1 
ATOM   8671  C  CB    . ILE A 1  1187 ? 135.990 114.762 111.917 1.00 49.79  ? 1187 ILE A CB    1 
ATOM   8672  C  CG1   . ILE A 1  1187 ? 135.380 114.496 110.539 1.00 50.85  ? 1187 ILE A CG1   1 
ATOM   8673  C  CG2   . ILE A 1  1187 ? 134.929 114.616 112.993 1.00 48.71  ? 1187 ILE A CG2   1 
ATOM   8674  C  CD1   . ILE A 1  1187 ? 134.252 115.440 110.179 1.00 48.63  ? 1187 ILE A CD1   1 
ATOM   8675  N  N     . ILE A 1  1188 ? 138.724 116.164 113.192 1.00 49.43  ? 1188 ILE A N     1 
ATOM   8676  C  CA    . ILE A 1  1188 ? 139.573 116.473 114.337 1.00 50.31  ? 1188 ILE A CA    1 
ATOM   8677  C  C     . ILE A 1  1188 ? 139.620 117.979 114.573 1.00 50.23  ? 1188 ILE A C     1 
ATOM   8678  O  O     . ILE A 1  1188 ? 139.574 118.444 115.718 1.00 50.11  ? 1188 ILE A O     1 
ATOM   8679  C  CB    . ILE A 1  1188 ? 140.980 115.882 114.129 1.00 50.34  ? 1188 ILE A CB    1 
ATOM   8680  C  CG1   . ILE A 1  1188 ? 140.965 114.370 114.365 1.00 50.23  ? 1188 ILE A CG1   1 
ATOM   8681  C  CG2   . ILE A 1  1188 ? 141.996 116.566 115.033 1.00 51.13  ? 1188 ILE A CG2   1 
ATOM   8682  C  CD1   . ILE A 1  1188 ? 142.337 113.733 114.311 1.00 52.03  ? 1188 ILE A CD1   1 
ATOM   8683  N  N     . ALA A 1  1189 ? 139.698 118.763 113.496 1.00 51.47  ? 1189 ALA A N     1 
ATOM   8684  C  CA    . ALA A 1  1189 ? 139.732 120.215 113.634 1.00 51.96  ? 1189 ALA A CA    1 
ATOM   8685  C  C     . ALA A 1  1189 ? 138.406 120.748 114.164 1.00 52.64  ? 1189 ALA A C     1 
ATOM   8686  O  O     . ALA A 1  1189 ? 138.381 121.588 115.071 1.00 52.25  ? 1189 ALA A O     1 
ATOM   8687  C  CB    . ALA A 1  1189 ? 140.078 120.861 112.293 1.00 52.47  ? 1189 ALA A CB    1 
ATOM   8688  N  N     . SER A 1  1190 ? 137.289 120.272 113.605 1.00 52.38  ? 1190 SER A N     1 
ATOM   8689  C  CA    . SER A 1  1190 ? 135.982 120.677 114.111 1.00 52.57  ? 1190 SER A CA    1 
ATOM   8690  C  C     . SER A 1  1190 ? 135.770 120.206 115.544 1.00 52.26  ? 1190 SER A C     1 
ATOM   8691  O  O     . SER A 1  1190 ? 135.063 120.864 116.316 1.00 52.44  ? 1190 SER A O     1 
ATOM   8692  C  CB    . SER A 1  1190 ? 134.875 120.138 113.204 1.00 53.34  ? 1190 SER A CB    1 
ATOM   8693  O  OG    . SER A 1  1190 ? 134.883 118.722 113.173 1.00 53.44  ? 1190 SER A OG    1 
ATOM   8694  N  N     . GLN A 1  1191 ? 136.368 119.071 115.915 1.00 54.53  ? 1191 GLN A N     1 
ATOM   8695  C  CA    . GLN A 1  1191 ? 136.308 118.624 117.302 1.00 56.34  ? 1191 GLN A CA    1 
ATOM   8696  C  C     . GLN A 1  1191 ? 137.116 119.545 118.209 1.00 60.51  ? 1191 GLN A C     1 
ATOM   8697  O  O     . GLN A 1  1191 ? 136.733 119.785 119.360 1.00 65.03  ? 1191 GLN A O     1 
ATOM   8698  C  CB    . GLN A 1  1191 ? 136.805 117.181 117.405 1.00 69.16  ? 1191 GLN A CB    1 
ATOM   8699  C  CG    . GLN A 1  1191 ? 136.775 116.589 118.806 1.00 70.86  ? 1191 GLN A CG    1 
ATOM   8700  C  CD    . GLN A 1  1191 ? 138.062 116.820 119.570 1.00 71.23  ? 1191 GLN A CD    1 
ATOM   8701  O  OE1   . GLN A 1  1191 ? 139.079 117.206 118.995 1.00 54.88  ? 1191 GLN A OE1   1 
ATOM   8702  N  NE2   . GLN A 1  1191 ? 138.025 116.584 120.877 1.00 54.14  ? 1191 GLN A NE2   1 
ATOM   8703  N  N     . SER A 1  1192 ? 138.237 120.070 117.706 1.00 54.91  ? 1192 SER A N     1 
ATOM   8704  C  CA    . SER A 1  1192 ? 139.045 120.990 118.498 1.00 55.24  ? 1192 SER A CA    1 
ATOM   8705  C  C     . SER A 1  1192 ? 138.330 122.315 118.726 1.00 56.29  ? 1192 SER A C     1 
ATOM   8706  O  O     . SER A 1  1192 ? 138.601 123.002 119.718 1.00 56.95  ? 1192 SER A O     1 
ATOM   8707  C  CB    . SER A 1  1192 ? 140.393 121.225 117.818 1.00 54.29  ? 1192 SER A CB    1 
ATOM   8708  O  OG    . SER A 1  1192 ? 141.106 120.009 117.666 1.00 54.98  ? 1192 SER A OG    1 
ATOM   8709  N  N     . VAL A 1  1193 ? 137.419 122.694 117.823 1.00 52.75  ? 1193 VAL A N     1 
ATOM   8710  C  CA    . VAL A 1  1193 ? 136.645 123.919 117.984 1.00 51.63  ? 1193 VAL A CA    1 
ATOM   8711  C  C     . VAL A 1  1193 ? 135.257 123.652 118.556 1.00 51.65  ? 1193 VAL A C     1 
ATOM   8712  O  O     . VAL A 1  1193 ? 134.518 124.602 118.843 1.00 51.67  ? 1193 VAL A O     1 
ATOM   8713  C  CB    . VAL A 1  1193 ? 136.539 124.668 116.637 1.00 51.86  ? 1193 VAL A CB    1 
ATOM   8714  C  CG1   . VAL A 1  1193 ? 135.431 124.074 115.775 1.00 50.93  ? 1193 VAL A CG1   1 
ATOM   8715  C  CG2   . VAL A 1  1193 ? 136.334 126.164 116.856 1.00 51.24  ? 1193 VAL A CG2   1 
ATOM   8716  N  N     . GLY A 1  1194 ? 134.889 122.387 118.747 1.00 51.39  ? 1194 GLY A N     1 
ATOM   8717  C  CA    . GLY A 1  1194 ? 133.577 122.044 119.258 1.00 51.56  ? 1194 GLY A CA    1 
ATOM   8718  C  C     . GLY A 1  1194 ? 133.589 121.568 120.695 1.00 52.10  ? 1194 GLY A C     1 
ATOM   8719  O  O     . GLY A 1  1194 ? 132.627 121.793 121.436 1.00 51.69  ? 1194 GLY A O     1 
ATOM   8720  N  N     . GLU A 1  1195 ? 134.672 120.896 121.101 1.00 52.94  ? 1195 GLU A N     1 
ATOM   8721  C  CA    . GLU A 1  1195 ? 134.754 120.414 122.480 1.00 53.20  ? 1195 GLU A CA    1 
ATOM   8722  C  C     . GLU A 1  1195 ? 134.823 121.554 123.490 1.00 53.40  ? 1195 GLU A C     1 
ATOM   8723  O  O     . GLU A 1  1195 ? 134.093 121.499 124.496 1.00 53.77  ? 1195 GLU A O     1 
ATOM   8724  C  CB    . GLU A 1  1195 ? 135.934 119.446 122.625 1.00 54.03  ? 1195 GLU A CB    1 
ATOM   8725  C  CG    . GLU A 1  1195 ? 136.281 119.093 124.066 1.00 54.21  ? 1195 GLU A CG    1 
ATOM   8726  C  CD    . GLU A 1  1195 ? 135.163 118.360 124.786 1.00 54.29  ? 1195 GLU A CD    1 
ATOM   8727  O  OE1   . GLU A 1  1195 ? 134.324 117.729 124.109 1.00 53.27  ? 1195 GLU A OE1   1 
ATOM   8728  O  OE2   . GLU A 1  1195 ? 135.124 118.417 126.033 1.00 53.27  ? 1195 GLU A OE2   1 
ATOM   8729  N  N     . PRO A 1  1196 ? 135.650 122.591 123.313 1.00 54.28  ? 1196 PRO A N     1 
ATOM   8730  C  CA    . PRO A 1  1196 ? 135.608 123.714 124.267 1.00 54.83  ? 1196 PRO A CA    1 
ATOM   8731  C  C     . PRO A 1  1196 ? 134.293 124.471 124.254 1.00 55.45  ? 1196 PRO A C     1 
ATOM   8732  O  O     . PRO A 1  1196 ? 134.005 125.192 125.218 1.00 55.90  ? 1196 PRO A O     1 
ATOM   8733  C  CB    . PRO A 1  1196 ? 136.771 124.608 123.814 1.00 55.31  ? 1196 PRO A CB    1 
ATOM   8734  C  CG    . PRO A 1  1196 ? 137.674 123.703 123.060 1.00 55.46  ? 1196 PRO A CG    1 
ATOM   8735  C  CD    . PRO A 1  1196 ? 136.764 122.747 122.359 1.00 56.08  ? 1196 PRO A CD    1 
ATOM   8736  N  N     . SER A 1  1197 ? 133.485 124.335 123.198 1.00 55.89  ? 1197 SER A N     1 
ATOM   8737  C  CA    . SER A 1  1197 ? 132.203 125.026 123.142 1.00 56.21  ? 1197 SER A CA    1 
ATOM   8738  C  C     . SER A 1  1197 ? 131.248 124.563 124.235 1.00 55.74  ? 1197 SER A C     1 
ATOM   8739  O  O     . SER A 1  1197 ? 130.337 125.313 124.605 1.00 55.17  ? 1197 SER A O     1 
ATOM   8740  C  CB    . SER A 1  1197 ? 131.557 124.831 121.769 1.00 56.74  ? 1197 SER A CB    1 
ATOM   8741  O  OG    . SER A 1  1197 ? 130.306 125.491 121.694 1.00 56.67  ? 1197 SER A OG    1 
ATOM   8742  N  N     . THR A 1  1198 ? 131.432 123.349 124.757 1.00 56.88  ? 1198 THR A N     1 
ATOM   8743  C  CA    . THR A 1  1198 ? 130.607 122.882 125.864 1.00 56.81  ? 1198 THR A CA    1 
ATOM   8744  C  C     . THR A 1  1198 ? 130.996 123.540 127.182 1.00 57.27  ? 1198 THR A C     1 
ATOM   8745  O  O     . THR A 1  1198 ? 130.169 123.611 128.097 1.00 57.32  ? 1198 THR A O     1 
ATOM   8746  C  CB    . THR A 1  1198 ? 130.707 121.359 125.986 1.00 57.57  ? 1198 THR A CB    1 
ATOM   8747  O  OG1   . THR A 1  1198 ? 130.634 120.770 124.683 1.00 56.31  ? 1198 THR A OG1   1 
ATOM   8748  C  CG2   . THR A 1  1198 ? 129.572 120.809 126.840 1.00 56.35  ? 1198 THR A CG2   1 
ATOM   8749  N  N     . GLN A 1  1199 ? 132.228 124.039 127.291 1.00 56.46  ? 1199 GLN A N     1 
ATOM   8750  C  CA    . GLN A 1  1199 ? 132.717 124.664 128.512 1.00 57.19  ? 1199 GLN A CA    1 
ATOM   8751  C  C     . GLN A 1  1199 ? 132.802 126.180 128.431 1.00 57.37  ? 1199 GLN A C     1 
ATOM   8752  O  O     . GLN A 1  1199 ? 132.561 126.851 129.438 1.00 57.72  ? 1199 GLN A O     1 
ATOM   8753  C  CB    . GLN A 1  1199 ? 134.101 124.107 128.874 1.00 57.85  ? 1199 GLN A CB    1 
ATOM   8754  C  CG    . GLN A 1  1199 ? 134.647 124.592 130.207 1.00 57.93  ? 1199 GLN A CG    1 
ATOM   8755  C  CD    . GLN A 1  1199 ? 136.012 124.012 130.523 1.00 57.82  ? 1199 GLN A CD    1 
ATOM   8756  O  OE1   . GLN A 1  1199 ? 136.565 123.235 129.745 1.00 58.20  ? 1199 GLN A OE1   1 
ATOM   8757  N  NE2   . GLN A 1  1199 ? 136.564 124.388 131.671 1.00 57.98  ? 1199 GLN A NE2   1 
ATOM   8758  N  N     . MET A 1  1200 ? 133.124 126.737 127.263 1.00 59.52  ? 1200 MET A N     1 
ATOM   8759  C  CA    . MET A 1  1200 ? 133.257 128.186 127.106 1.00 60.42  ? 1200 MET A CA    1 
ATOM   8760  C  C     . MET A 1  1200 ? 131.915 128.914 127.086 1.00 61.24  ? 1200 MET A C     1 
ATOM   8761  O  O     . MET A 1  1200 ? 131.899 130.131 126.854 1.00 61.90  ? 1200 MET A O     1 
ATOM   8762  C  CB    . MET A 1  1200 ? 134.038 128.507 125.831 1.00 63.82  ? 1200 MET A CB    1 
ATOM   8763  C  CG    . MET A 1  1200 ? 133.267 128.261 124.543 1.00 64.25  ? 1200 MET A CG    1 
ATOM   8764  S  SD    . MET A 1  1200 ? 134.221 128.703 123.078 1.00 60.89  ? 1200 MET A SD    1 
ATOM   8765  C  CE    . MET A 1  1200 ? 133.031 128.370 121.783 1.00 61.16  ? 1200 MET A CE    1 
ATOM   8766  N  N     . THR A 1  1201 ? 130.804 128.222 127.319 1.00 62.07  ? 1201 THR A N     1 
ATOM   8767  C  CA    . THR A 1  1201 ? 129.482 128.846 127.326 1.00 63.80  ? 1201 THR A CA    1 
ATOM   8768  C  C     . THR A 1  1201 ? 129.332 129.681 128.591 1.00 63.52  ? 1201 THR A C     1 
ATOM   8769  O  O     . THR A 1  1201 ? 128.997 129.162 129.658 1.00 62.82  ? 1201 THR A O     1 
ATOM   8770  C  CB    . THR A 1  1201 ? 128.396 127.781 127.240 1.00 63.74  ? 1201 THR A CB    1 
ATOM   8771  O  OG1   . THR A 1  1201 ? 128.795 126.633 127.999 1.00 65.45  ? 1201 THR A OG1   1 
ATOM   8772  C  CG2   . THR A 1  1201 ? 128.158 127.372 125.795 1.00 65.34  ? 1201 THR A CG2   1 
ATOM   8773  N  N     . LEU A 1  1202 ? 129.576 130.984 128.473 1.00 67.57  ? 1202 LEU A N     1 
ATOM   8774  C  CA    . LEU A 1  1202 ? 129.448 131.894 129.601 1.00 69.08  ? 1202 LEU A CA    1 
ATOM   8775  C  C     . LEU A 1  1202 ? 129.262 133.300 129.049 1.00 69.92  ? 1202 LEU A C     1 
ATOM   8776  O  O     . LEU A 1  1202 ? 129.916 133.680 128.076 1.00 70.00  ? 1202 LEU A O     1 
ATOM   8777  C  CB    . LEU A 1  1202 ? 130.678 131.817 130.518 1.00 69.97  ? 1202 LEU A CB    1 
ATOM   8778  C  CG    . LEU A 1  1202 ? 130.550 132.245 131.984 1.00 69.68  ? 1202 LEU A CG    1 
ATOM   8779  C  CD1   . LEU A 1  1202 ? 130.501 133.755 132.148 1.00 69.80  ? 1202 LEU A CD1   1 
ATOM   8780  C  CD2   . LEU A 1  1202 ? 129.328 131.596 132.621 1.00 69.61  ? 1202 LEU A CD2   1 
ATOM   8781  N  N     . ASN A 1  1203 ? 128.366 134.065 129.676 1.00 70.62  ? 1203 ASN A N     1 
ATOM   8782  C  CA    . ASN A 1  1203 ? 128.011 135.379 129.145 1.00 70.80  ? 1203 ASN A CA    1 
ATOM   8783  C  C     . ASN A 1  1203 ? 129.115 136.398 129.400 1.00 69.95  ? 1203 ASN A C     1 
ATOM   8784  O  O     . ASN A 1  1203 ? 129.707 136.940 128.458 1.00 68.46  ? 1203 ASN A O     1 
ATOM   8785  C  CB    . ASN A 1  1203 ? 126.689 135.848 129.756 1.00 67.68  ? 1203 ASN A CB    1 
ATOM   8786  C  CG    . ASN A 1  1203 ? 126.189 137.142 129.144 1.00 67.74  ? 1203 ASN A CG    1 
ATOM   8787  O  OD1   . ASN A 1  1203 ? 126.586 137.514 128.038 1.00 71.27  ? 1203 ASN A OD1   1 
ATOM   8788  N  ND2   . ASN A 1  1203 ? 125.314 137.837 129.861 1.00 71.31  ? 1203 ASN A ND2   1 
ATOM   8789  N  N     . THR A 1  1204 ? 129.410 136.673 130.670 1.00 71.76  ? 1204 THR A N     1 
ATOM   8790  C  CA    . THR A 1  1204 ? 130.408 137.670 131.051 1.00 72.47  ? 1204 THR A CA    1 
ATOM   8791  C  C     . THR A 1  1204 ? 131.335 137.057 132.092 1.00 72.81  ? 1204 THR A C     1 
ATOM   8792  O  O     . THR A 1  1204 ? 130.950 136.901 133.256 1.00 72.66  ? 1204 THR A O     1 
ATOM   8793  C  CB    . THR A 1  1204 ? 129.747 138.938 131.595 1.00 73.00  ? 1204 THR A CB    1 
ATOM   8794  O  OG1   . THR A 1  1204 ? 128.870 138.598 132.677 1.00 73.14  ? 1204 THR A OG1   1 
ATOM   8795  C  CG2   . THR A 1  1204 ? 128.954 139.644 130.504 1.00 73.02  ? 1204 THR A CG2   1 
ATOM   8796  N  N     . PHE A 1  1205 ? 132.549 136.713 131.676 1.00 74.06  ? 1205 PHE A N     1 
ATOM   8797  C  CA    . PHE A 1  1205 ? 133.531 136.125 132.579 1.00 75.10  ? 1205 PHE A CA    1 
ATOM   8798  C  C     . PHE A 1  1205 ? 134.656 137.111 132.876 1.00 76.24  ? 1205 PHE A C     1 
ATOM   8799  O  O     . PHE A 1  1205 ? 135.056 137.890 132.010 1.00 78.00  ? 1205 PHE A O     1 
ATOM   8800  C  CB    . PHE A 1  1205 ? 134.100 134.834 131.986 1.00 78.54  ? 1205 PHE A CB    1 
ATOM   8801  C  CG    . PHE A 1  1205 ? 135.160 134.191 132.834 1.00 78.58  ? 1205 PHE A CG    1 
ATOM   8802  C  CD1   . PHE A 1  1205 ? 134.816 133.426 133.937 1.00 78.48  ? 1205 PHE A CD1   1 
ATOM   8803  C  CD2   . PHE A 1  1205 ? 136.502 134.343 132.525 1.00 78.68  ? 1205 PHE A CD2   1 
ATOM   8804  C  CE1   . PHE A 1  1205 ? 135.789 132.832 134.718 1.00 78.91  ? 1205 PHE A CE1   1 
ATOM   8805  C  CE2   . PHE A 1  1205 ? 137.480 133.752 133.302 1.00 74.59  ? 1205 PHE A CE2   1 
ATOM   8806  C  CZ    . PHE A 1  1205 ? 137.123 132.995 134.400 1.00 74.29  ? 1205 PHE A CZ    1 
ATOM   8807  N  N     . ASN A 1  1214 ? 133.419 145.827 127.297 1.00 65.24  ? 1214 ASN A N     1 
ATOM   8808  C  CA    . ASN A 1  1214 ? 133.332 146.770 126.187 1.00 65.01  ? 1214 ASN A CA    1 
ATOM   8809  C  C     . ASN A 1  1214 ? 133.122 146.046 124.860 1.00 65.96  ? 1214 ASN A C     1 
ATOM   8810  O  O     . ASN A 1  1214 ? 132.428 146.545 123.973 1.00 66.71  ? 1214 ASN A O     1 
ATOM   8811  C  CB    . ASN A 1  1214 ? 134.590 147.640 126.124 1.00 67.02  ? 1214 ASN A CB    1 
ATOM   8812  C  CG    . ASN A 1  1214 ? 135.869 146.826 126.200 1.00 66.81  ? 1214 ASN A CG    1 
ATOM   8813  O  OD1   . ASN A 1  1214 ? 135.854 145.604 126.055 1.00 63.69  ? 1214 ASN A OD1   1 
ATOM   8814  N  ND2   . ASN A 1  1214 ? 136.987 147.505 126.431 1.00 63.78  ? 1214 ASN A ND2   1 
ATOM   8815  N  N     . VAL A 1  1215 ? 133.726 144.871 124.731 1.00 61.33  ? 1215 VAL A N     1 
ATOM   8816  C  CA    . VAL A 1  1215 ? 133.616 144.064 123.526 1.00 59.41  ? 1215 VAL A CA    1 
ATOM   8817  C  C     . VAL A 1  1215 ? 132.807 142.808 123.844 1.00 59.41  ? 1215 VAL A C     1 
ATOM   8818  O  O     . VAL A 1  1215 ? 132.507 142.506 124.998 1.00 59.68  ? 1215 VAL A O     1 
ATOM   8819  C  CB    . VAL A 1  1215 ? 134.996 143.704 122.941 1.00 59.32  ? 1215 VAL A CB    1 
ATOM   8820  C  CG1   . VAL A 1  1215 ? 135.746 144.964 122.539 1.00 57.87  ? 1215 VAL A CG1   1 
ATOM   8821  C  CG2   . VAL A 1  1215 ? 135.802 142.894 123.945 1.00 57.71  ? 1215 VAL A CG2   1 
ATOM   8822  N  N     . THR A 1  1216 ? 132.450 142.075 122.793 1.00 56.37  ? 1216 THR A N     1 
ATOM   8823  C  CA    . THR A 1  1216 ? 131.688 140.843 122.933 1.00 55.67  ? 1216 THR A CA    1 
ATOM   8824  C  C     . THR A 1  1216 ? 132.631 139.653 123.054 1.00 55.51  ? 1216 THR A C     1 
ATOM   8825  O  O     . THR A 1  1216 ? 133.668 139.596 122.388 1.00 55.28  ? 1216 THR A O     1 
ATOM   8826  C  CB    . THR A 1  1216 ? 130.751 140.645 121.739 1.00 55.64  ? 1216 THR A CB    1 
ATOM   8827  O  OG1   . THR A 1  1216 ? 131.520 140.576 120.531 1.00 55.09  ? 1216 THR A OG1   1 
ATOM   8828  C  CG2   . THR A 1  1216 ? 129.765 141.799 121.641 1.00 55.06  ? 1216 THR A CG2   1 
ATOM   8829  N  N     . LEU A 1  1217 ? 132.264 138.704 123.914 1.00 54.50  ? 1217 LEU A N     1 
ATOM   8830  C  CA    . LEU A 1  1217 ? 133.071 137.514 124.144 1.00 54.34  ? 1217 LEU A CA    1 
ATOM   8831  C  C     . LEU A 1  1217 ? 132.161 136.298 124.245 1.00 55.27  ? 1217 LEU A C     1 
ATOM   8832  O  O     . LEU A 1  1217 ? 130.956 136.415 124.480 1.00 56.17  ? 1217 LEU A O     1 
ATOM   8833  C  CB    . LEU A 1  1217 ? 133.921 137.630 125.420 1.00 57.12  ? 1217 LEU A CB    1 
ATOM   8834  C  CG    . LEU A 1  1217 ? 135.013 138.700 125.509 1.00 56.15  ? 1217 LEU A CG    1 
ATOM   8835  C  CD1   . LEU A 1  1217 ? 134.444 140.044 125.940 1.00 53.46  ? 1217 LEU A CD1   1 
ATOM   8836  C  CD2   . LEU A 1  1217 ? 136.111 138.255 126.460 1.00 53.68  ? 1217 LEU A CD2   1 
ATOM   8837  N  N     . GLY A 1  1218 ? 132.758 135.124 124.061 1.00 53.15  ? 1218 GLY A N     1 
ATOM   8838  C  CA    . GLY A 1  1218 ? 132.049 133.874 124.250 1.00 52.48  ? 1218 GLY A CA    1 
ATOM   8839  C  C     . GLY A 1  1218 ? 131.255 133.406 123.048 1.00 51.64  ? 1218 GLY A C     1 
ATOM   8840  O  O     . GLY A 1  1218 ? 131.667 133.602 121.901 1.00 51.69  ? 1218 GLY A O     1 
ATOM   8841  N  N     . ILE A 1  1219 ? 130.110 132.769 123.313 1.00 50.91  ? 1219 ILE A N     1 
ATOM   8842  C  CA    . ILE A 1  1219 ? 129.279 132.253 122.221 1.00 50.65  ? 1219 ILE A CA    1 
ATOM   8843  C  C     . ILE A 1  1219 ? 128.801 133.356 121.288 1.00 51.24  ? 1219 ILE A C     1 
ATOM   8844  O  O     . ILE A 1  1219 ? 128.848 133.161 120.065 1.00 51.88  ? 1219 ILE A O     1 
ATOM   8845  C  CB    . ILE A 1  1219 ? 128.131 131.405 122.787 1.00 51.91  ? 1219 ILE A CB    1 
ATOM   8846  C  CG1   . ILE A 1  1219 ? 128.685 130.276 123.657 1.00 51.46  ? 1219 ILE A CG1   1 
ATOM   8847  C  CG2   . ILE A 1  1219 ? 127.276 130.840 121.661 1.00 50.51  ? 1219 ILE A CG2   1 
ATOM   8848  C  CD1   . ILE A 1  1219 ? 129.599 129.327 122.916 1.00 50.27  ? 1219 ILE A CD1   1 
ATOM   8849  N  N     . PRO A 1  1220 ? 128.325 134.519 121.764 1.00 51.79  ? 1220 PRO A N     1 
ATOM   8850  C  CA    . PRO A 1  1220 ? 127.894 135.554 120.808 1.00 52.56  ? 1220 PRO A CA    1 
ATOM   8851  C  C     . PRO A 1  1220 ? 128.998 136.039 119.883 1.00 53.11  ? 1220 PRO A C     1 
ATOM   8852  O  O     . PRO A 1  1220 ? 128.700 136.605 118.827 1.00 53.36  ? 1220 PRO A O     1 
ATOM   8853  C  CB    . PRO A 1  1220 ? 127.386 136.678 121.721 1.00 52.94  ? 1220 PRO A CB    1 
ATOM   8854  C  CG    . PRO A 1  1220 ? 126.960 135.987 122.955 1.00 53.23  ? 1220 PRO A CG    1 
ATOM   8855  C  CD    . PRO A 1  1220 ? 127.953 134.879 123.145 1.00 54.11  ? 1220 PRO A CD    1 
ATOM   8856  N  N     . ARG A 1  1221 ? 130.267 135.845 120.250 1.00 53.43  ? 1221 ARG A N     1 
ATOM   8857  C  CA    . ARG A 1  1221 ? 131.354 136.242 119.360 1.00 53.60  ? 1221 ARG A CA    1 
ATOM   8858  C  C     . ARG A 1  1221 ? 131.796 135.093 118.462 1.00 54.22  ? 1221 ARG A C     1 
ATOM   8859  O  O     . ARG A 1  1221 ? 131.985 135.283 117.256 1.00 54.47  ? 1221 ARG A O     1 
ATOM   8860  C  CB    . ARG A 1  1221 ? 132.541 136.766 120.170 1.00 54.81  ? 1221 ARG A CB    1 
ATOM   8861  C  CG    . ARG A 1  1221 ? 133.763 137.080 119.320 1.00 54.74  ? 1221 ARG A CG    1 
ATOM   8862  C  CD    . ARG A 1  1221 ? 134.123 138.556 119.373 1.00 54.60  ? 1221 ARG A CD    1 
ATOM   8863  N  NE    . ARG A 1  1221 ? 135.015 138.935 118.282 1.00 55.01  ? 1221 ARG A NE    1 
ATOM   8864  C  CZ    . ARG A 1  1221 ? 134.600 139.373 117.098 1.00 54.39  ? 1221 ARG A CZ    1 
ATOM   8865  N  NH1   . ARG A 1  1221 ? 133.302 139.491 116.852 1.00 52.62  ? 1221 ARG A NH1   1 
ATOM   8866  N  NH2   . ARG A 1  1221 ? 135.480 139.694 116.161 1.00 52.13  ? 1221 ARG A NH2   1 
ATOM   8867  N  N     . LEU A 1  1222 ? 131.971 133.898 119.033 1.00 51.54  ? 1222 LEU A N     1 
ATOM   8868  C  CA    . LEU A 1  1222 ? 132.399 132.747 118.245 1.00 50.23  ? 1222 LEU A CA    1 
ATOM   8869  C  C     . LEU A 1  1222 ? 131.355 132.391 117.193 1.00 48.85  ? 1222 LEU A C     1 
ATOM   8870  O  O     . LEU A 1  1222 ? 131.673 132.231 116.009 1.00 47.95  ? 1222 LEU A O     1 
ATOM   8871  C  CB    . LEU A 1  1222 ? 132.676 131.558 119.171 1.00 47.69  ? 1222 LEU A CB    1 
ATOM   8872  C  CG    . LEU A 1  1222 ? 133.430 130.342 118.622 1.00 47.96  ? 1222 LEU A CG    1 
ATOM   8873  C  CD1   . LEU A 1  1222 ? 132.498 129.352 117.931 1.00 51.02  ? 1222 LEU A CD1   1 
ATOM   8874  C  CD2   . LEU A 1  1222 ? 134.542 130.780 117.680 1.00 51.03  ? 1222 LEU A CD2   1 
ATOM   8875  N  N     . ARG A 1  1223 ? 130.094 132.262 117.611 1.00 52.80  ? 1223 ARG A N     1 
ATOM   8876  C  CA    . ARG A 1  1223 ? 129.027 131.945 116.667 1.00 54.51  ? 1223 ARG A CA    1 
ATOM   8877  C  C     . ARG A 1  1223 ? 128.844 133.052 115.637 1.00 55.95  ? 1223 ARG A C     1 
ATOM   8878  O  O     . ARG A 1  1223 ? 128.420 132.785 114.506 1.00 56.89  ? 1223 ARG A O     1 
ATOM   8879  C  CB    . ARG A 1  1223 ? 127.724 131.687 117.429 1.00 57.59  ? 1223 ARG A CB    1 
ATOM   8880  C  CG    . ARG A 1  1223 ? 126.551 131.219 116.578 1.00 58.36  ? 1223 ARG A CG    1 
ATOM   8881  C  CD    . ARG A 1  1223 ? 125.621 132.369 116.223 1.00 59.17  ? 1223 ARG A CD    1 
ATOM   8882  N  NE    . ARG A 1  1223 ? 125.149 133.077 117.411 1.00 59.34  ? 1223 ARG A NE    1 
ATOM   8883  C  CZ    . ARG A 1  1223 ? 124.382 134.161 117.377 1.00 59.80  ? 1223 ARG A CZ    1 
ATOM   8884  N  NH1   . ARG A 1  1223 ? 123.999 134.669 116.215 1.00 54.90  ? 1223 ARG A NH1   1 
ATOM   8885  N  NH2   . ARG A 1  1223 ? 124.000 134.740 118.508 1.00 55.29  ? 1223 ARG A NH2   1 
ATOM   8886  N  N     . GLU A 1  1224 ? 129.174 134.295 115.998 1.00 55.38  ? 1224 GLU A N     1 
ATOM   8887  C  CA    . GLU A 1  1224 ? 129.004 135.410 115.072 1.00 55.95  ? 1224 GLU A CA    1 
ATOM   8888  C  C     . GLU A 1  1224 ? 130.025 135.352 113.941 1.00 56.97  ? 1224 GLU A C     1 
ATOM   8889  O  O     . GLU A 1  1224 ? 129.676 135.516 112.766 1.00 58.30  ? 1224 GLU A O     1 
ATOM   8890  C  CB    . GLU A 1  1224 ? 129.117 136.736 115.823 1.00 59.89  ? 1224 GLU A CB    1 
ATOM   8891  C  CG    . GLU A 1  1224 ? 128.969 137.972 114.953 1.00 60.78  ? 1224 GLU A CG    1 
ATOM   8892  C  CD    . GLU A 1  1224 ? 127.544 138.194 114.486 1.00 61.07  ? 1224 GLU A CD    1 
ATOM   8893  O  OE1   . GLU A 1  1224 ? 126.615 137.651 115.121 1.00 55.59  ? 1224 GLU A OE1   1 
ATOM   8894  O  OE2   . GLU A 1  1224 ? 127.352 138.913 113.484 1.00 55.53  ? 1224 GLU A OE2   1 
ATOM   8895  N  N     . ILE A 1  1225 ? 131.293 135.123 114.279 1.00 55.59  ? 1225 ILE A N     1 
ATOM   8896  C  CA    . ILE A 1  1225 ? 132.352 135.177 113.278 1.00 55.73  ? 1225 ILE A CA    1 
ATOM   8897  C  C     . ILE A 1  1225 ? 132.331 133.939 112.388 1.00 55.61  ? 1225 ILE A C     1 
ATOM   8898  O  O     . ILE A 1  1225 ? 132.626 134.017 111.191 1.00 56.06  ? 1225 ILE A O     1 
ATOM   8899  C  CB    . ILE A 1  1225 ? 133.716 135.361 113.969 1.00 56.17  ? 1225 ILE A CB    1 
ATOM   8900  C  CG1   . ILE A 1  1225 ? 133.738 136.672 114.757 1.00 54.92  ? 1225 ILE A CG1   1 
ATOM   8901  C  CG2   . ILE A 1  1225 ? 134.848 135.340 112.952 1.00 55.63  ? 1225 ILE A CG2   1 
ATOM   8902  C  CD1   . ILE A 1  1225 ? 133.527 137.900 113.898 1.00 56.01  ? 1225 ILE A CD1   1 
ATOM   8903  N  N     . VAL A 1  1226 ? 131.962 132.787 112.946 1.00 55.23  ? 1226 VAL A N     1 
ATOM   8904  C  CA    . VAL A 1  1226 ? 132.119 131.531 112.219 1.00 54.74  ? 1226 VAL A CA    1 
ATOM   8905  C  C     . VAL A 1  1226 ? 131.007 131.337 111.192 1.00 55.16  ? 1226 VAL A C     1 
ATOM   8906  O  O     . VAL A 1  1226 ? 131.269 130.932 110.053 1.00 54.96  ? 1226 VAL A O     1 
ATOM   8907  C  CB    . VAL A 1  1226 ? 132.190 130.356 113.211 1.00 55.52  ? 1226 VAL A CB    1 
ATOM   8908  C  CG1   . VAL A 1  1226 ? 132.150 129.028 112.473 1.00 54.40  ? 1226 VAL A CG1   1 
ATOM   8909  C  CG2   . VAL A 1  1226 ? 133.454 130.452 114.053 1.00 54.62  ? 1226 VAL A CG2   1 
ATOM   8910  N  N     . MET A 1  1227 ? 129.757 131.626 111.557 1.00 55.49  ? 1227 MET A N     1 
ATOM   8911  C  CA    . MET A 1  1227 ? 128.621 131.205 110.741 1.00 56.87  ? 1227 MET A CA    1 
ATOM   8912  C  C     . MET A 1  1227 ? 127.658 132.311 110.329 1.00 56.76  ? 1227 MET A C     1 
ATOM   8913  O  O     . MET A 1  1227 ? 126.947 132.129 109.333 1.00 56.90  ? 1227 MET A O     1 
ATOM   8914  C  CB    . MET A 1  1227 ? 127.819 130.116 111.473 1.00 57.04  ? 1227 MET A CB    1 
ATOM   8915  C  CG    . MET A 1  1227 ? 128.592 128.827 111.697 1.00 56.32  ? 1227 MET A CG    1 
ATOM   8916  S  SD    . MET A 1  1227 ? 127.719 127.660 112.756 1.00 58.33  ? 1227 MET A SD    1 
ATOM   8917  C  CE    . MET A 1  1227 ? 127.650 128.581 114.289 1.00 59.13  ? 1227 MET A CE    1 
ATOM   8918  N  N     . THR A 1  1228 ? 127.600 133.438 111.037 1.00 58.71  ? 1228 THR A N     1 
ATOM   8919  C  CA    . THR A 1  1228 ? 126.567 134.438 110.785 1.00 58.34  ? 1228 THR A CA    1 
ATOM   8920  C  C     . THR A 1  1228 ? 126.892 135.377 109.626 1.00 58.26  ? 1228 THR A C     1 
ATOM   8921  O  O     . THR A 1  1228 ? 126.249 136.430 109.525 1.00 58.35  ? 1228 THR A O     1 
ATOM   8922  C  CB    . THR A 1  1228 ? 126.305 135.266 112.044 1.00 58.25  ? 1228 THR A CB    1 
ATOM   8923  O  OG1   . THR A 1  1228 ? 127.474 136.024 112.369 1.00 58.08  ? 1228 THR A OG1   1 
ATOM   8924  C  CG2   . THR A 1  1228 ? 125.941 134.365 113.211 1.00 58.48  ? 1228 THR A CG2   1 
ATOM   8925  N  N     . ALA A 1  1229 ? 127.857 135.039 108.767 1.00 57.56  ? 1229 ALA A N     1 
ATOM   8926  C  CA    . ALA A 1  1229 ? 128.241 135.880 107.631 1.00 57.25  ? 1229 ALA A CA    1 
ATOM   8927  C  C     . ALA A 1  1229 ? 128.660 137.273 108.114 1.00 57.88  ? 1229 ALA A C     1 
ATOM   8928  O  O     . ALA A 1  1229 ? 127.997 138.282 107.867 1.00 56.42  ? 1229 ALA A O     1 
ATOM   8929  C  CB    . ALA A 1  1229 ? 127.110 135.965 106.598 1.00 56.59  ? 1229 ALA A CB    1 
ATOM   8930  N  N     . SER A 1  1230 ? 129.780 137.276 108.841 1.00 55.52  ? 1230 SER A N     1 
ATOM   8931  C  CA    . SER A 1  1230 ? 130.290 138.454 109.533 1.00 55.59  ? 1230 SER A CA    1 
ATOM   8932  C  C     . SER A 1  1230 ? 130.215 139.709 108.672 1.00 55.43  ? 1230 SER A C     1 
ATOM   8933  O  O     . SER A 1  1230 ? 130.709 139.739 107.542 1.00 55.05  ? 1230 SER A O     1 
ATOM   8934  C  CB    . SER A 1  1230 ? 131.736 138.209 109.968 1.00 55.80  ? 1230 SER A CB    1 
ATOM   8935  O  OG    . SER A 1  1230 ? 131.836 137.045 110.765 1.00 56.03  ? 1230 SER A OG    1 
ATOM   8936  N  N     . ALA A 1  1231 ? 129.590 140.741 109.225 1.00 55.78  ? 1231 ALA A N     1 
ATOM   8937  C  CA    . ALA A 1  1231 ? 129.406 142.022 108.554 1.00 55.80  ? 1231 ALA A CA    1 
ATOM   8938  C  C     . ALA A 1  1231 ? 129.669 143.109 109.590 1.00 55.65  ? 1231 ALA A C     1 
ATOM   8939  O  O     . ALA A 1  1231 ? 130.274 142.855 110.637 1.00 56.82  ? 1231 ALA A O     1 
ATOM   8940  C  CB    . ALA A 1  1231 ? 128.011 142.110 107.918 1.00 56.45  ? 1231 ALA A CB    1 
ATOM   8941  N  N     . ALA A 1  1232 ? 129.254 144.338 109.282 1.00 58.94  ? 1232 ALA A N     1 
ATOM   8942  C  CA    . ALA A 1  1232 ? 129.332 145.434 110.241 1.00 60.77  ? 1232 ALA A CA    1 
ATOM   8943  C  C     . ALA A 1  1232 ? 128.783 145.000 111.594 1.00 61.49  ? 1232 ALA A C     1 
ATOM   8944  O  O     . ALA A 1  1232 ? 127.610 144.637 111.713 1.00 61.27  ? 1232 ALA A O     1 
ATOM   8945  C  CB    . ALA A 1  1232 ? 128.560 146.646 109.715 1.00 61.04  ? 1232 ALA A CB    1 
ATOM   8946  N  N     . ILE A 1  1233 ? 129.638 145.040 112.607 1.00 61.93  ? 1233 ILE A N     1 
ATOM   8947  C  CA    . ILE A 1  1233 ? 129.347 144.433 113.889 1.00 62.00  ? 1233 ILE A CA    1 
ATOM   8948  C  C     . ILE A 1  1233 ? 128.895 145.511 114.867 1.00 61.35  ? 1233 ILE A C     1 
ATOM   8949  O  O     . ILE A 1  1233 ? 129.028 146.707 114.617 1.00 60.42  ? 1233 ILE A O     1 
ATOM   8950  C  CB    . ILE A 1  1233 ? 130.566 143.645 114.434 1.00 59.95  ? 1233 ILE A CB    1 
ATOM   8951  C  CG1   . ILE A 1  1233 ? 130.119 142.556 115.413 1.00 61.72  ? 1233 ILE A CG1   1 
ATOM   8952  C  CG2   . ILE A 1  1233 ? 131.562 144.586 115.091 1.00 62.08  ? 1233 ILE A CG2   1 
ATOM   8953  C  CD1   . ILE A 1  1233 ? 129.106 141.597 114.833 1.00 61.73  ? 1233 ILE A CD1   1 
ATOM   8954  N  N     . LYS A 1  1234 ? 128.330 145.079 115.999 1.00 61.67  ? 1234 LYS A N     1 
ATOM   8955  C  CA    . LYS A 1  1234 ? 127.838 146.015 117.004 1.00 60.88  ? 1234 LYS A CA    1 
ATOM   8956  C  C     . LYS A 1  1234 ? 128.959 146.905 117.526 1.00 61.74  ? 1234 LYS A C     1 
ATOM   8957  O  O     . LYS A 1  1234 ? 128.852 148.137 117.506 1.00 62.93  ? 1234 LYS A O     1 
ATOM   8958  C  CB    . LYS A 1  1234 ? 127.185 145.244 118.153 1.00 64.00  ? 1234 LYS A CB    1 
ATOM   8959  C  CG    . LYS A 1  1234 ? 126.139 144.233 117.711 1.00 65.13  ? 1234 LYS A CG    1 
ATOM   8960  C  CD    . LYS A 1  1234 ? 124.901 144.916 117.157 1.00 65.66  ? 1234 LYS A CD    1 
ATOM   8961  C  CE    . LYS A 1  1234 ? 124.202 145.737 118.228 1.00 59.82  ? 1234 LYS A CE    1 
ATOM   8962  N  NZ    . LYS A 1  1234 ? 122.957 146.374 117.715 1.00 59.22  ? 1234 LYS A NZ    1 
ATOM   8963  N  N     . THR A 1  1235 ? 130.048 146.298 118.002 1.00 60.43  ? 1235 THR A N     1 
ATOM   8964  C  CA    . THR A 1  1235 ? 131.178 147.022 118.582 1.00 61.62  ? 1235 THR A CA    1 
ATOM   8965  C  C     . THR A 1  1235 ? 132.444 146.680 117.807 1.00 62.02  ? 1235 THR A C     1 
ATOM   8966  O  O     . THR A 1  1235 ? 133.176 145.747 118.174 1.00 62.41  ? 1235 THR A O     1 
ATOM   8967  C  CB    . THR A 1  1235 ? 131.343 146.689 120.064 1.00 62.00  ? 1235 THR A CB    1 
ATOM   8968  O  OG1   . THR A 1  1235 ? 131.564 145.281 120.218 1.00 62.68  ? 1235 THR A OG1   1 
ATOM   8969  C  CG2   . THR A 1  1235 ? 130.098 147.090 120.844 1.00 63.03  ? 1235 THR A CG2   1 
ATOM   8970  N  N     . PRO A 1  1236 ? 132.742 147.405 116.730 1.00 63.06  ? 1236 PRO A N     1 
ATOM   8971  C  CA    . PRO A 1  1236 ? 134.009 147.185 116.026 1.00 62.56  ? 1236 PRO A CA    1 
ATOM   8972  C  C     . PRO A 1  1236 ? 135.190 147.649 116.863 1.00 63.05  ? 1236 PRO A C     1 
ATOM   8973  O  O     . PRO A 1  1236 ? 135.081 148.561 117.685 1.00 63.30  ? 1236 PRO A O     1 
ATOM   8974  C  CB    . PRO A 1  1236 ? 133.859 148.025 114.752 1.00 63.37  ? 1236 PRO A CB    1 
ATOM   8975  C  CG    . PRO A 1  1236 ? 132.844 149.064 115.101 1.00 61.95  ? 1236 PRO A CG    1 
ATOM   8976  C  CD    . PRO A 1  1236 ? 131.900 148.415 116.068 1.00 62.23  ? 1236 PRO A CD    1 
ATOM   8977  N  N     . GLN A 1  1237 ? 136.334 147.002 116.646 1.00 61.09  ? 1237 GLN A N     1 
ATOM   8978  C  CA    . GLN A 1  1237 ? 137.517 147.233 117.460 1.00 60.94  ? 1237 GLN A CA    1 
ATOM   8979  C  C     . GLN A 1  1237 ? 138.764 147.234 116.587 1.00 62.48  ? 1237 GLN A C     1 
ATOM   8980  O  O     . GLN A 1  1237 ? 138.880 146.431 115.657 1.00 64.20  ? 1237 GLN A O     1 
ATOM   8981  C  CB    . GLN A 1  1237 ? 137.640 146.166 118.559 1.00 65.96  ? 1237 GLN A CB    1 
ATOM   8982  C  CG    . GLN A 1  1237 ? 138.938 146.210 119.349 1.00 66.95  ? 1237 GLN A CG    1 
ATOM   8983  C  CD    . GLN A 1  1237 ? 139.091 147.480 120.159 1.00 66.86  ? 1237 GLN A CD    1 
ATOM   8984  O  OE1   . GLN A 1  1237 ? 138.104 148.119 120.530 1.00 58.85  ? 1237 GLN A OE1   1 
ATOM   8985  N  NE2   . GLN A 1  1237 ? 140.332 147.858 120.435 1.00 58.60  ? 1237 GLN A NE2   1 
ATOM   8986  N  N     . MET A 1  1238 ? 139.688 148.143 116.889 1.00 56.71  ? 1238 MET A N