data_5M73
# 
_entry.id   5M73 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.315 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5M73         
WWPDB D_1200001291 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5M73 
_pdbx_database_status.recvd_initial_deposition_date   2016-10-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Becker, M.M.M.' 1 
'Wild, K.'       2 
'Sinning, I.'    3 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            45 
_citation.language                  ? 
_citation.page_first                470 
_citation.page_last                 481 
_citation.title                     
'Structures of human SRP72 complexes provide insights into SRP RNA remodeling and ribosome interaction.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkw1124 
_citation.pdbx_database_id_PubMed   27899666 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Becker, M.M.' 1 ? 
primary 'Lapouge, K.'  2 ? 
primary 'Segnitz, B.'  3 ? 
primary 'Wild, K.'     4 ? 
primary 'Sinning, I.'  5 ? 
# 
_cell.entry_id           5M73 
_cell.length_a           134.567 
_cell.length_b           139.306 
_cell.length_c           152.246 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
# 
_symmetry.entry_id                         5M73 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Human gene for small cytoplasmic 7SL RNA (7L30.1)' 47199.980 2  ? ? ? ? 
2 polymer     man 'Signal recognition particle 19 kDa protein'        14791.062 2  ? ? ? ? 
3 polymer     man 'Signal recognition particle subunit SRP68'         24280.811 2  ? ? ? ? 
4 polymer     man 'Signal recognition particle subunit SRP72'         17189.633 2  ? ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                                     24.305    45 ? ? ? ? 
6 non-polymer syn 'POTASSIUM ION'                                     39.098    10 ? ? ? ? 
7 non-polymer syn GLYCEROL                                            92.094    9  ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
2 SRP19                                              
3 'SRP68,Signal recognition particle 68 kDa protein' 
4 'SRP72,Signal recognition particle 72 kDa protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 polyribonucleotide no yes 
;(GTP)GGUGUCCGCACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGG
UGAACCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGGGAUCGCGCCUA
;
;GGGUGUCCGCACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAA
CCGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGGGAUCGCGCCUA
;
A,E ? 
2 'polypeptide(L)'   no no  
;MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRG
RVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQLEHHHHHH
;
;MACAAARSPADQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRG
RVRVQLKQEDGSLCLVQFPSRKSVMLYAAEMIPKLKTRTQLEHHHHHH
;
B,F ? 
3 'polypeptide(L)'   no no  
;MGHHHHHHLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEDLLTDNRYLLLVLMDA
ERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAF
NKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQ
;
;MGHHHHHHLEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEDLLTDNRYLLLVLMDA
ERAWSYAMQLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAF
NKCKTIYEKLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQ
;
C,G ? 
4 'polypeptide(L)'   no no  
;MGSLKVDVEALENSAGATYIRKKGGKVTGDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRK
KGKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQQKHHHHHH
;
;MGSLKVDVEALENSAGATYIRKKGGKVTGDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRK
KGKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQQKHHHHHH
;
D,H ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GTP n 
1 2   G   n 
1 3   G   n 
1 4   U   n 
1 5   G   n 
1 6   U   n 
1 7   C   n 
1 8   C   n 
1 9   G   n 
1 10  C   n 
1 11  A   n 
1 12  C   n 
1 13  U   n 
1 14  A   n 
1 15  A   n 
1 16  G   n 
1 17  U   n 
1 18  U   n 
1 19  C   n 
1 20  G   n 
1 21  G   n 
1 22  C   n 
1 23  A   n 
1 24  U   n 
1 25  C   n 
1 26  A   n 
1 27  A   n 
1 28  U   n 
1 29  A   n 
1 30  U   n 
1 31  G   n 
1 32  G   n 
1 33  U   n 
1 34  G   n 
1 35  A   n 
1 36  C   n 
1 37  C   n 
1 38  U   n 
1 39  C   n 
1 40  C   n 
1 41  C   n 
1 42  G   n 
1 43  G   n 
1 44  G   n 
1 45  A   n 
1 46  G   n 
1 47  C   n 
1 48  G   n 
1 49  G   n 
1 50  G   n 
1 51  G   n 
1 52  G   n 
1 53  A   n 
1 54  C   n 
1 55  C   n 
1 56  A   n 
1 57  C   n 
1 58  C   n 
1 59  A   n 
1 60  G   n 
1 61  G   n 
1 62  U   n 
1 63  U   n 
1 64  G   n 
1 65  C   n 
1 66  C   n 
1 67  U   n 
1 68  A   n 
1 69  A   n 
1 70  G   n 
1 71  G   n 
1 72  A   n 
1 73  G   n 
1 74  G   n 
1 75  G   n 
1 76  G   n 
1 77  U   n 
1 78  G   n 
1 79  A   n 
1 80  A   n 
1 81  C   n 
1 82  C   n 
1 83  G   n 
1 84  G   n 
1 85  C   n 
1 86  C   n 
1 87  C   n 
1 88  A   n 
1 89  G   n 
1 90  G   n 
1 91  U   n 
1 92  C   n 
1 93  G   n 
1 94  G   n 
1 95  A   n 
1 96  A   n 
1 97  A   n 
1 98  C   n 
1 99  G   n 
1 100 G   n 
1 101 A   n 
1 102 G   n 
1 103 C   n 
1 104 A   n 
1 105 G   n 
1 106 G   n 
1 107 U   n 
1 108 C   n 
1 109 A   n 
1 110 A   n 
1 111 A   n 
1 112 A   n 
1 113 C   n 
1 114 U   n 
1 115 C   n 
1 116 C   n 
1 117 C   n 
1 118 G   n 
1 119 U   n 
1 120 G   n 
1 121 C   n 
1 122 U   n 
1 123 G   n 
1 124 A   n 
1 125 U   n 
1 126 C   n 
1 127 A   n 
1 128 G   n 
1 129 U   n 
1 130 A   n 
1 131 G   n 
1 132 U   n 
1 133 G   n 
1 134 G   n 
1 135 G   n 
1 136 A   n 
1 137 U   n 
1 138 C   n 
1 139 G   n 
1 140 C   n 
1 141 G   n 
1 142 C   n 
1 143 C   n 
1 144 U   n 
1 145 A   n 
2 1   MET n 
2 2   ALA n 
2 3   CYS n 
2 4   ALA n 
2 5   ALA n 
2 6   ALA n 
2 7   ARG n 
2 8   SER n 
2 9   PRO n 
2 10  ALA n 
2 11  ASP n 
2 12  GLN n 
2 13  ASP n 
2 14  ARG n 
2 15  PHE n 
2 16  ILE n 
2 17  CYS n 
2 18  ILE n 
2 19  TYR n 
2 20  PRO n 
2 21  ALA n 
2 22  TYR n 
2 23  LEU n 
2 24  ASN n 
2 25  ASN n 
2 26  LYS n 
2 27  LYS n 
2 28  THR n 
2 29  ILE n 
2 30  ALA n 
2 31  GLU n 
2 32  GLY n 
2 33  ARG n 
2 34  ARG n 
2 35  ILE n 
2 36  PRO n 
2 37  ILE n 
2 38  SER n 
2 39  LYS n 
2 40  ALA n 
2 41  VAL n 
2 42  GLU n 
2 43  ASN n 
2 44  PRO n 
2 45  THR n 
2 46  ALA n 
2 47  THR n 
2 48  GLU n 
2 49  ILE n 
2 50  GLN n 
2 51  ASP n 
2 52  VAL n 
2 53  CYS n 
2 54  SER n 
2 55  ALA n 
2 56  VAL n 
2 57  GLY n 
2 58  LEU n 
2 59  ASN n 
2 60  VAL n 
2 61  PHE n 
2 62  LEU n 
2 63  GLU n 
2 64  LYS n 
2 65  ASN n 
2 66  LYS n 
2 67  MET n 
2 68  TYR n 
2 69  SER n 
2 70  ARG n 
2 71  GLU n 
2 72  TRP n 
2 73  ASN n 
2 74  ARG n 
2 75  ASP n 
2 76  VAL n 
2 77  GLN n 
2 78  TYR n 
2 79  ARG n 
2 80  GLY n 
2 81  ARG n 
2 82  VAL n 
2 83  ARG n 
2 84  VAL n 
2 85  GLN n 
2 86  LEU n 
2 87  LYS n 
2 88  GLN n 
2 89  GLU n 
2 90  ASP n 
2 91  GLY n 
2 92  SER n 
2 93  LEU n 
2 94  CYS n 
2 95  LEU n 
2 96  VAL n 
2 97  GLN n 
2 98  PHE n 
2 99  PRO n 
2 100 SER n 
2 101 ARG n 
2 102 LYS n 
2 103 SER n 
2 104 VAL n 
2 105 MET n 
2 106 LEU n 
2 107 TYR n 
2 108 ALA n 
2 109 ALA n 
2 110 GLU n 
2 111 MET n 
2 112 ILE n 
2 113 PRO n 
2 114 LYS n 
2 115 LEU n 
2 116 LYS n 
2 117 THR n 
2 118 ARG n 
2 119 THR n 
2 120 GLN n 
2 121 LEU n 
2 122 GLU n 
2 123 HIS n 
2 124 HIS n 
2 125 HIS n 
2 126 HIS n 
2 127 HIS n 
2 128 HIS n 
3 1   MET n 
3 2   GLY n 
3 3   HIS n 
3 4   HIS n 
3 5   HIS n 
3 6   HIS n 
3 7   HIS n 
3 8   HIS n 
3 9   LEU n 
3 10  GLU n 
3 11  ILE n 
3 12  LEU n 
3 13  GLN n 
3 14  ILE n 
3 15  ILE n 
3 16  LYS n 
3 17  GLU n 
3 18  SER n 
3 19  GLN n 
3 20  GLN n 
3 21  GLN n 
3 22  HIS n 
3 23  GLY n 
3 24  LEU n 
3 25  ARG n 
3 26  HIS n 
3 27  GLY n 
3 28  ASP n 
3 29  PHE n 
3 30  GLN n 
3 31  ARG n 
3 32  TYR n 
3 33  ARG n 
3 34  GLY n 
3 35  TYR n 
3 36  CYS n 
3 37  SER n 
3 38  ARG n 
3 39  ARG n 
3 40  GLN n 
3 41  ARG n 
3 42  ARG n 
3 43  LEU n 
3 44  ARG n 
3 45  LYS n 
3 46  THR n 
3 47  LEU n 
3 48  ASN n 
3 49  PHE n 
3 50  LYS n 
3 51  MET n 
3 52  GLY n 
3 53  ASN n 
3 54  ARG n 
3 55  HIS n 
3 56  LYS n 
3 57  PHE n 
3 58  THR n 
3 59  GLY n 
3 60  LYS n 
3 61  LYS n 
3 62  VAL n 
3 63  THR n 
3 64  GLU n 
3 65  ASP n 
3 66  LEU n 
3 67  LEU n 
3 68  THR n 
3 69  ASP n 
3 70  ASN n 
3 71  ARG n 
3 72  TYR n 
3 73  LEU n 
3 74  LEU n 
3 75  LEU n 
3 76  VAL n 
3 77  LEU n 
3 78  MET n 
3 79  ASP n 
3 80  ALA n 
3 81  GLU n 
3 82  ARG n 
3 83  ALA n 
3 84  TRP n 
3 85  SER n 
3 86  TYR n 
3 87  ALA n 
3 88  MET n 
3 89  GLN n 
3 90  LEU n 
3 91  LYS n 
3 92  GLN n 
3 93  GLU n 
3 94  ALA n 
3 95  ASN n 
3 96  THR n 
3 97  GLU n 
3 98  PRO n 
3 99  ARG n 
3 100 LYS n 
3 101 ARG n 
3 102 PHE n 
3 103 HIS n 
3 104 LEU n 
3 105 LEU n 
3 106 SER n 
3 107 ARG n 
3 108 LEU n 
3 109 ARG n 
3 110 LYS n 
3 111 ALA n 
3 112 VAL n 
3 113 LYS n 
3 114 HIS n 
3 115 ALA n 
3 116 GLU n 
3 117 GLU n 
3 118 LEU n 
3 119 GLU n 
3 120 ARG n 
3 121 LEU n 
3 122 CYS n 
3 123 GLU n 
3 124 SER n 
3 125 ASN n 
3 126 ARG n 
3 127 VAL n 
3 128 ASP n 
3 129 ALA n 
3 130 LYS n 
3 131 THR n 
3 132 LYS n 
3 133 LEU n 
3 134 GLU n 
3 135 ALA n 
3 136 GLN n 
3 137 ALA n 
3 138 TYR n 
3 139 THR n 
3 140 ALA n 
3 141 TYR n 
3 142 LEU n 
3 143 SER n 
3 144 GLY n 
3 145 MET n 
3 146 LEU n 
3 147 ARG n 
3 148 PHE n 
3 149 GLU n 
3 150 HIS n 
3 151 GLN n 
3 152 GLU n 
3 153 TRP n 
3 154 LYS n 
3 155 ALA n 
3 156 ALA n 
3 157 ILE n 
3 158 GLU n 
3 159 ALA n 
3 160 PHE n 
3 161 ASN n 
3 162 LYS n 
3 163 CYS n 
3 164 LYS n 
3 165 THR n 
3 166 ILE n 
3 167 TYR n 
3 168 GLU n 
3 169 LYS n 
3 170 LEU n 
3 171 ALA n 
3 172 SER n 
3 173 ALA n 
3 174 PHE n 
3 175 THR n 
3 176 GLU n 
3 177 GLU n 
3 178 GLN n 
3 179 ALA n 
3 180 VAL n 
3 181 LEU n 
3 182 TYR n 
3 183 ASN n 
3 184 GLN n 
3 185 ARG n 
3 186 VAL n 
3 187 GLU n 
3 188 GLU n 
3 189 ILE n 
3 190 SER n 
3 191 PRO n 
3 192 ASN n 
3 193 ILE n 
3 194 ARG n 
3 195 TYR n 
3 196 CYS n 
3 197 ALA n 
3 198 TYR n 
3 199 ASN n 
3 200 ILE n 
3 201 GLY n 
3 202 ASP n 
3 203 GLN n 
4 1   MET n 
4 2   GLY n 
4 3   SER n 
4 4   LEU n 
4 5   LYS n 
4 6   VAL n 
4 7   ASP n 
4 8   VAL n 
4 9   GLU n 
4 10  ALA n 
4 11  LEU n 
4 12  GLU n 
4 13  ASN n 
4 14  SER n 
4 15  ALA n 
4 16  GLY n 
4 17  ALA n 
4 18  THR n 
4 19  TYR n 
4 20  ILE n 
4 21  ARG n 
4 22  LYS n 
4 23  LYS n 
4 24  GLY n 
4 25  GLY n 
4 26  LYS n 
4 27  VAL n 
4 28  THR n 
4 29  GLY n 
4 30  ASP n 
4 31  SER n 
4 32  GLN n 
4 33  PRO n 
4 34  LYS n 
4 35  GLU n 
4 36  GLN n 
4 37  GLY n 
4 38  GLN n 
4 39  GLY n 
4 40  ASP n 
4 41  LEU n 
4 42  LYS n 
4 43  LYS n 
4 44  LYS n 
4 45  LYS n 
4 46  LYS n 
4 47  LYS n 
4 48  LYS n 
4 49  LYS n 
4 50  GLY n 
4 51  LYS n 
4 52  LEU n 
4 53  PRO n 
4 54  LYS n 
4 55  ASN n 
4 56  TYR n 
4 57  ASP n 
4 58  PRO n 
4 59  LYS n 
4 60  VAL n 
4 61  THR n 
4 62  PRO n 
4 63  ASP n 
4 64  PRO n 
4 65  GLU n 
4 66  ARG n 
4 67  TRP n 
4 68  LEU n 
4 69  PRO n 
4 70  MET n 
4 71  ARG n 
4 72  GLU n 
4 73  ARG n 
4 74  SER n 
4 75  TYR n 
4 76  TYR n 
4 77  ARG n 
4 78  GLY n 
4 79  ARG n 
4 80  LYS n 
4 81  LYS n 
4 82  GLY n 
4 83  LYS n 
4 84  LYS n 
4 85  LYS n 
4 86  ASP n 
4 87  GLN n 
4 88  ILE n 
4 89  GLY n 
4 90  LYS n 
4 91  GLY n 
4 92  THR n 
4 93  GLN n 
4 94  GLY n 
4 95  ALA n 
4 96  THR n 
4 97  ALA n 
4 98  GLY n 
4 99  ALA n 
4 100 SER n 
4 101 SER n 
4 102 GLU n 
4 103 LEU n 
4 104 ASP n 
4 105 ALA n 
4 106 SER n 
4 107 LYS n 
4 108 THR n 
4 109 VAL n 
4 110 SER n 
4 111 SER n 
4 112 PRO n 
4 113 PRO n 
4 114 THR n 
4 115 SER n 
4 116 PRO n 
4 117 ARG n 
4 118 PRO n 
4 119 GLY n 
4 120 SER n 
4 121 ALA n 
4 122 ALA n 
4 123 THR n 
4 124 VAL n 
4 125 SER n 
4 126 ALA n 
4 127 SER n 
4 128 THR n 
4 129 SER n 
4 130 ASN n 
4 131 ILE n 
4 132 ILE n 
4 133 PRO n 
4 134 PRO n 
4 135 ARG n 
4 136 HIS n 
4 137 GLN n 
4 138 LYS n 
4 139 PRO n 
4 140 ALA n 
4 141 GLY n 
4 142 ALA n 
4 143 PRO n 
4 144 ALA n 
4 145 THR n 
4 146 LYS n 
4 147 LYS n 
4 148 LYS n 
4 149 GLN n 
4 150 GLN n 
4 151 GLN n 
4 152 LYS n 
4 153 HIS n 
4 154 HIS n 
4 155 HIS n 
4 156 HIS n 
4 157 HIS n 
4 158 HIS n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 145 ?     ? ?     ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 128 Human ? SRP19 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 203 Human ? SRP68 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 158 Human ? SRP72 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 GB  X04249.1    23924  ? 1 
;GGUGUCCGCACUAAGUUCGGCAUCAAUAUGGUGACCUCCCGGGAGCGGGGGACCACCAGGUUGCCUAAGGAGGGGUGAAC
CGGCCCAGGUCGGAAACGGAGCAGGUCAAAACUCCCGUGCUGAUCAGUAGUGGGAUCGCGCCU
;
166 
2 UNP SRP19_HUMAN P09132 ? 2 
;DQDRFICIYPAYLNNKKTIAEGRRIPISKAVENPTATEIQDVCSAVGLNVFLEKNKMYSREWNRDVQYRGRVRVQLKQED
GSLCLVQFPSRKSVMLYAAEMIPKLKTR
;
11  
3 UNP SRP68_HUMAN Q9UHB9 ? 3 
;LEILQIIKESQQQHGLRHGDFQRYRGYCSRRQRRLRKTLNFKMGNRHKFTGKKVTEELLTDNRYLLLVLMDAERAWSYAM
QLKQEANTEPRKRFHLLSRLRKAVKHAEELERLCESNRVDAKTKLEAQAYTAYLSGMLRFEHQEWKAAIEAFNKCKTIYE
KLASAFTEEQAVLYNQRVEEISPNIRYCAYNIGDQ
;
60  
4 UNP SRP72_HUMAN O76094 ? 4 
;MSLKVDVEALENSAGATYIRKKGGKVTGDSQPKEQGQGDLKKKKKKKKGKLPKNYDPKVTPDPERWLPMRERSYYRGRKK
GKKKDQIGKGTQGATAGASSELDASKTVSSPPTSPRPGSAATVSASTSNIIPPRHQKPAGAPATKKKQQQKKKKGGK
;
512 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5M73 A 2  ? 144 ? 23924  166 ? 308 ? 106 248 
2 2 5M73 B 11 ? 118 ? P09132 11  ? 118 ? 11  118 
3 3 5M73 C 9  ? 203 ? Q9UHB9 60  ? 254 ? 60  254 
4 4 5M73 D 2  ? 158 ? O76094 512 ? 668 ? 512 668 
5 1 5M73 E 2  ? 144 ? 23924  166 ? 308 ? 106 248 
6 2 5M73 F 11 ? 118 ? P09132 11  ? 118 ? 11  118 
7 3 5M73 G 9  ? 203 ? Q9UHB9 60  ? 254 ? 60  254 
8 4 5M73 H 2  ? 158 ? O76094 512 ? 668 ? 512 668 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5M73 GTP A 1   ? GB  23924  ?   ?   insertion               105 1  
1 5M73 A   A 145 ? GB  23924  ?   ?   insertion               249 2  
2 5M73 MET B 1   ? UNP P09132 ?   ?   'initiating methionine' 1   3  
2 5M73 ALA B 2   ? UNP P09132 ?   ?   'expression tag'        2   4  
2 5M73 CYS B 3   ? UNP P09132 ?   ?   'expression tag'        3   5  
2 5M73 ALA B 4   ? UNP P09132 ?   ?   'expression tag'        4   6  
2 5M73 ALA B 5   ? UNP P09132 ?   ?   'expression tag'        5   7  
2 5M73 ALA B 6   ? UNP P09132 ?   ?   'expression tag'        6   8  
2 5M73 ARG B 7   ? UNP P09132 ?   ?   'expression tag'        7   9  
2 5M73 SER B 8   ? UNP P09132 ?   ?   'expression tag'        8   10 
2 5M73 PRO B 9   ? UNP P09132 ?   ?   'expression tag'        9   11 
2 5M73 ALA B 10  ? UNP P09132 ?   ?   'expression tag'        10  12 
2 5M73 THR B 119 ? UNP P09132 ?   ?   'expression tag'        119 13 
2 5M73 GLN B 120 ? UNP P09132 ?   ?   'expression tag'        120 14 
2 5M73 LEU B 121 ? UNP P09132 ?   ?   'expression tag'        121 15 
2 5M73 GLU B 122 ? UNP P09132 ?   ?   'expression tag'        122 16 
2 5M73 HIS B 123 ? UNP P09132 ?   ?   'expression tag'        123 17 
2 5M73 HIS B 124 ? UNP P09132 ?   ?   'expression tag'        124 18 
2 5M73 HIS B 125 ? UNP P09132 ?   ?   'expression tag'        125 19 
2 5M73 HIS B 126 ? UNP P09132 ?   ?   'expression tag'        126 20 
2 5M73 HIS B 127 ? UNP P09132 ?   ?   'expression tag'        127 21 
2 5M73 HIS B 128 ? UNP P09132 ?   ?   'expression tag'        128 22 
3 5M73 MET C 1   ? UNP Q9UHB9 ?   ?   'initiating methionine' 52  23 
3 5M73 GLY C 2   ? UNP Q9UHB9 ?   ?   'expression tag'        53  24 
3 5M73 HIS C 3   ? UNP Q9UHB9 ?   ?   'expression tag'        54  25 
3 5M73 HIS C 4   ? UNP Q9UHB9 ?   ?   'expression tag'        55  26 
3 5M73 HIS C 5   ? UNP Q9UHB9 ?   ?   'expression tag'        56  27 
3 5M73 HIS C 6   ? UNP Q9UHB9 ?   ?   'expression tag'        57  28 
3 5M73 HIS C 7   ? UNP Q9UHB9 ?   ?   'expression tag'        58  29 
3 5M73 HIS C 8   ? UNP Q9UHB9 ?   ?   'expression tag'        59  30 
3 5M73 ASP C 65  ? UNP Q9UHB9 GLU 116 conflict                116 31 
4 5M73 MET D 1   ? UNP O76094 ?   ?   'initiating methionine' 511 32 
4 5M73 GLY D 2   ? UNP O76094 MET 512 conflict                512 33 
4 5M73 HIS D 153 ? UNP O76094 LYS 663 conflict                663 34 
4 5M73 HIS D 154 ? UNP O76094 LYS 664 conflict                664 35 
4 5M73 HIS D 155 ? UNP O76094 LYS 665 conflict                665 36 
4 5M73 HIS D 156 ? UNP O76094 GLY 666 conflict                666 37 
4 5M73 HIS D 157 ? UNP O76094 GLY 667 conflict                667 38 
4 5M73 HIS D 158 ? UNP O76094 LYS 668 conflict                668 39 
5 5M73 GTP E 1   ? GB  23924  ?   ?   'expression tag'        105 40 
5 5M73 A   E 145 ? GB  23924  ?   ?   'expression tag'        249 41 
6 5M73 MET F 1   ? UNP P09132 ?   ?   'initiating methionine' 1   42 
6 5M73 ALA F 2   ? UNP P09132 ?   ?   'expression tag'        2   43 
6 5M73 CYS F 3   ? UNP P09132 ?   ?   'expression tag'        3   44 
6 5M73 ALA F 4   ? UNP P09132 ?   ?   'expression tag'        4   45 
6 5M73 ALA F 5   ? UNP P09132 ?   ?   'expression tag'        5   46 
6 5M73 ALA F 6   ? UNP P09132 ?   ?   'expression tag'        6   47 
6 5M73 ARG F 7   ? UNP P09132 ?   ?   'expression tag'        7   48 
6 5M73 SER F 8   ? UNP P09132 ?   ?   'expression tag'        8   49 
6 5M73 PRO F 9   ? UNP P09132 ?   ?   'expression tag'        9   50 
6 5M73 ALA F 10  ? UNP P09132 ?   ?   'expression tag'        10  51 
6 5M73 THR F 119 ? UNP P09132 ?   ?   'expression tag'        119 52 
6 5M73 GLN F 120 ? UNP P09132 ?   ?   'expression tag'        120 53 
6 5M73 LEU F 121 ? UNP P09132 ?   ?   'expression tag'        121 54 
6 5M73 GLU F 122 ? UNP P09132 ?   ?   'expression tag'        122 55 
6 5M73 HIS F 123 ? UNP P09132 ?   ?   'expression tag'        123 56 
6 5M73 HIS F 124 ? UNP P09132 ?   ?   'expression tag'        124 57 
6 5M73 HIS F 125 ? UNP P09132 ?   ?   'expression tag'        125 58 
6 5M73 HIS F 126 ? UNP P09132 ?   ?   'expression tag'        126 59 
6 5M73 HIS F 127 ? UNP P09132 ?   ?   'expression tag'        127 60 
6 5M73 HIS F 128 ? UNP P09132 ?   ?   'expression tag'        128 61 
7 5M73 MET G 1   ? UNP Q9UHB9 ?   ?   'initiating methionine' 52  62 
7 5M73 GLY G 2   ? UNP Q9UHB9 ?   ?   'expression tag'        53  63 
7 5M73 HIS G 3   ? UNP Q9UHB9 ?   ?   'expression tag'        54  64 
7 5M73 HIS G 4   ? UNP Q9UHB9 ?   ?   'expression tag'        55  65 
7 5M73 HIS G 5   ? UNP Q9UHB9 ?   ?   'expression tag'        56  66 
7 5M73 HIS G 6   ? UNP Q9UHB9 ?   ?   'expression tag'        57  67 
7 5M73 HIS G 7   ? UNP Q9UHB9 ?   ?   'expression tag'        58  68 
7 5M73 HIS G 8   ? UNP Q9UHB9 ?   ?   'expression tag'        59  69 
7 5M73 ASP G 65  ? UNP Q9UHB9 GLU 116 conflict                116 70 
8 5M73 MET H 1   ? UNP O76094 ?   ?   'initiating methionine' 511 71 
8 5M73 GLY H 2   ? UNP O76094 MET 512 conflict                512 72 
8 5M73 HIS H 153 ? UNP O76094 LYS 663 conflict                663 73 
8 5M73 HIS H 154 ? UNP O76094 LYS 664 conflict                664 74 
8 5M73 HIS H 155 ? UNP O76094 LYS 665 conflict                665 75 
8 5M73 HIS H 156 ? UNP O76094 GLY 666 conflict                666 76 
8 5M73 HIS H 157 ? UNP O76094 GLY 667 conflict                667 77 
8 5M73 HIS H 158 ? UNP O76094 LYS 668 conflict                668 78 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'   347.221 
ALA 'L-peptide linking' y ALANINE                      ?                               'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                     ?                               'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ?                               'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ?                               'C4 H7 N O4'        133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ?                               'C9 H14 N3 O8 P'    323.197 
CYS 'L-peptide linking' y CYSTEINE                     ?                               'C3 H7 N O2 S'      121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O8 P'   363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ?                               'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ?                               'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                      ?                               'C2 H5 N O2'        75.067  
GOL non-polymer         . GLYCEROL                     'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'          92.094  
GTP non-polymer         n "GUANOSINE-5'-TRIPHOSPHATE"  ?                               'C10 H16 N5 O14 P3' 523.180 
HIS 'L-peptide linking' y HISTIDINE                    ?                               'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ?                               'C6 H13 N O2'       131.173 
K   non-polymer         . 'POTASSIUM ION'              ?                               'K 1'               39.098  
LEU 'L-peptide linking' y LEUCINE                      ?                               'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                       ?                               'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                   ?                               'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ?                               'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ?                               'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                      ?                               'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                       ?                               'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                    ?                               'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ?                               'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                     ?                               'C9 H11 N O3'       181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ?                               'C9 H13 N2 O9 P'    324.181 
VAL 'L-peptide linking' y VALINE                       ?                               'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5M73 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.02 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         69.40 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            277.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;17 % (w/v) PEG3350
0.1 M KF
0.1 M Tris pH 8.5
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           80 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-02-06 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97779 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID29' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97779 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID29 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
_reflns.entry_id                     5M73 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             48.400 
_reflns.d_resolution_high            3.400 
_reflns.number_obs                   39893 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.253 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        8.7000 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              13.40 
_reflns.pdbx_CC_half                 ? 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 5M73 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.ls_number_reflns_obs                     39533 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             48.39 
_refine.ls_d_res_high                            3.40 
_refine.ls_percent_reflns_obs                    99.0 
_refine.ls_R_factor_obs                          0.239 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.237 
_refine.ls_R_factor_R_free                       0.280 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.840 
_refine.ls_number_reflns_R_free                  3638 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               137.4 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.details                                  ? 
_refine.pdbx_starting_model                      4p3e 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.500 
_refine.pdbx_overall_phase_error                 35.150 
_refine.overall_SU_B                             ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        5776 
_refine_hist.pdbx_number_atoms_nucleic_acid   6243 
_refine_hist.pdbx_number_atoms_ligand         109 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               12128 
_refine_hist.d_res_high                       3.40 
_refine_hist.d_res_low                        48.39 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.010  ? ? 12913 'X-RAY DIFFRACTION' ? 
f_angle_d          1.567  ? ? 18812 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.971 ? ? 7155  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.094  ? ? 2268  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.011  ? ? 1300  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.pdbx_type 
'X-RAY DIFFRACTION' 1 1 1 ? ? ? ? ? G 1754 POSITIONAL 
'X-RAY DIFFRACTION' 2 1 2 ? ? ? ? ? C 1754 POSITIONAL 
'X-RAY DIFFRACTION' 1 2 3 ? ? ? ? ? B 923  POSITIONAL 
'X-RAY DIFFRACTION' 2 2 4 ? ? ? ? ? F 923  POSITIONAL 
'X-RAY DIFFRACTION' 1 3 5 ? ? ? ? ? A 3324 POSITIONAL 
'X-RAY DIFFRACTION' 2 3 6 ? ? ? ? ? E 3324 POSITIONAL 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.number_reflns_obs 
'X-RAY DIFFRACTION' . 3.4000  3.4447  2775 0.3732 98.00  0.4019 . . 109 . . . . 
'X-RAY DIFFRACTION' . 3.4447  3.4919  2737 0.3662 99.00  0.4576 . . 111 . . . . 
'X-RAY DIFFRACTION' . 3.4919  3.5418  2718 0.3610 98.00  0.4072 . . 167 . . . . 
'X-RAY DIFFRACTION' . 3.5418  3.5946  2673 0.3518 98.00  0.3703 . . 147 . . . . 
'X-RAY DIFFRACTION' . 3.5946  3.6508  2756 0.3566 98.00  0.3981 . . 140 . . . . 
'X-RAY DIFFRACTION' . 3.6508  3.7106  2735 0.3575 99.00  0.3875 . . 122 . . . . 
'X-RAY DIFFRACTION' . 3.7106  3.7746  2771 0.3377 99.00  0.4099 . . 150 . . . . 
'X-RAY DIFFRACTION' . 3.7746  3.8432  2741 0.3375 98.00  0.3821 . . 121 . . . . 
'X-RAY DIFFRACTION' . 3.8432  3.9171  2754 0.3177 99.00  0.3603 . . 122 . . . . 
'X-RAY DIFFRACTION' . 3.9171  3.9970  2704 0.2985 98.00  0.3420 . . 142 . . . . 
'X-RAY DIFFRACTION' . 3.9970  4.0839  2758 0.2961 98.00  0.3732 . . 143 . . . . 
'X-RAY DIFFRACTION' . 4.0839  4.1788  2737 0.2859 99.00  0.3901 . . 137 . . . . 
'X-RAY DIFFRACTION' . 4.1788  4.2832  2755 0.2890 99.00  0.3156 . . 127 . . . . 
'X-RAY DIFFRACTION' . 4.2832  4.3990  2769 0.2715 99.00  0.3478 . . 156 . . . . 
'X-RAY DIFFRACTION' . 4.3990  4.5283  2734 0.2682 99.00  0.3177 . . 166 . . . . 
'X-RAY DIFFRACTION' . 4.5283  4.6744  2712 0.2480 99.00  0.2849 . . 178 . . . . 
'X-RAY DIFFRACTION' . 4.6744  4.8413  2749 0.2455 99.00  0.2836 . . 172 . . . . 
'X-RAY DIFFRACTION' . 4.8413  5.0349  2750 0.2263 99.00  0.3085 . . 138 . . . . 
'X-RAY DIFFRACTION' . 5.0349  5.2638  2800 0.2156 100.00 0.2933 . . 113 . . . . 
'X-RAY DIFFRACTION' . 5.2638  5.5410  2820 0.2321 100.00 0.2752 . . 126 . . . . 
'X-RAY DIFFRACTION' . 5.5410  5.8876  2759 0.2167 100.00 0.2804 . . 158 . . . . 
'X-RAY DIFFRACTION' . 5.8876  6.3413  2755 0.2133 100.00 0.2628 . . 178 . . . . 
'X-RAY DIFFRACTION' . 6.3413  6.9777  2774 0.2100 100.00 0.2400 . . 134 . . . . 
'X-RAY DIFFRACTION' . 6.9777  7.9835  2828 0.1744 100.00 0.2196 . . 103 . . . . 
'X-RAY DIFFRACTION' . 7.9835  10.0436 2786 0.1657 100.00 0.1937 . . 120 . . . . 
'X-RAY DIFFRACTION' . 10.0436 48.3975 2748 0.1442 99.00  0.1724 . . 158 . . . . 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 ? 1 
2 ? 1 
1 ? 2 
2 ? 2 
1 ? 3 
2 ? 3 
# 
loop_
_struct_ncs_dom_lim.dom_id 
_struct_ncs_dom_lim.beg_auth_asym_id 
_struct_ncs_dom_lim.beg_auth_seq_id 
_struct_ncs_dom_lim.end_auth_asym_id 
_struct_ncs_dom_lim.end_auth_seq_id 
_struct_ncs_dom_lim.pdbx_component_id 
_struct_ncs_dom_lim.pdbx_refine_code 
_struct_ncs_dom_lim.beg_label_asym_id 
_struct_ncs_dom_lim.beg_label_comp_id 
_struct_ncs_dom_lim.beg_label_seq_id 
_struct_ncs_dom_lim.beg_label_alt_id 
_struct_ncs_dom_lim.end_label_asym_id 
_struct_ncs_dom_lim.end_label_comp_id 
_struct_ncs_dom_lim.end_label_seq_id 
_struct_ncs_dom_lim.end_label_alt_id 
_struct_ncs_dom_lim.pdbx_ens_id 
_struct_ncs_dom_lim.selection_details 
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;(CHAIN G AND (RESSEQ 51:68 OR RESSEQ
70:92 OR RESSEQ 94:96 OR RESSEQ 98:151 OR
RESSEQ 153:219 OR RESSEQ 221:236 OR
RESSEQ 238:242 OR RESSEQ 244))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 1 
;(CHAIN C AND (RESSEQ 51:68 OR RESSEQ
70:92 OR RESSEQ 94:96 OR RESSEQ 98:151 OR
RESSEQ 153:219 OR RESSEQ 221:236 OR
RESSEQ 238:242 OR RESSEQ 244))
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;(CHAIN B AND (RESSEQ 14:57 OR RESSEQ
59:73 OR RESSEQ 75:78 OR RESSEQ 80:88 OR
RESSEQ 90:115))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 2 
;(CHAIN F AND (RESSEQ 14:57 OR RESSEQ
59:73 OR RESSEQ 75:78 OR RESSEQ 80:88 OR
RESSEQ 90:115))
;
1 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 
;(CHAIN A AND ((RESID 106 AND (NAME P OR
                         NAME OP1 OR NAME OP2 OR NAME O5 OR NAME
                         C5 OR NAME C4 OR NAME O4 OR NAME C3 OR
                         NAME O3 OR NAME C2 OR NAME O2 OR NAME C1
                         OR NAME N9 OR NAME C8 OR NAME N7 OR NAME
                         C5 OR NAME C6 OR NAME O6 OR NAME N2 )) OR
                         (RESID 107 AND (NAME P OR NAME OP1 OR
                         NAME OP2 OR NAME O5 OR NAME C5 OR NAME C4
                         OR NAME O4 OR NAME C3 OR NAME O3 OR NAME
                         C2 OR NAME O2 OR NAME C1 OR NAME N9 OR
                         NAME C8 OR NAME N7 OR NAME C5 OR NAME C6
                         OR NAME O6 OR NAME N2 )) OR (RESID 108
                         AND (NAME P OR NAME OP1 OR NAME OP2 OR
                         NAME O5 OR NAME C5 OR NAME C4 OR NAME O4
                         OR NAME C3 OR NAME O3 OR NAME C2 OR NAME
                         O2 OR NAME C1 OR NAME N1 OR NAME C2 OR
                         NAME N3 OR NAME C4 OR NAME C5 OR NAME C6 )
                         ) OR (RESID 109 AND (NAME P OR NAME OP1
                         OR NAME OP2 OR NAME O5 OR NAME C5 OR NAME
                         C4 OR NAME O4 OR NAME C3 OR NAME O3 OR
                         NAME C2 OR NAME O2 OR NAME C1 OR NAME N9
                         OR NAME C8 OR NAME N7 OR NAME C5 OR NAME
                         C6 OR NAME O6 OR NAME N2 )) OR (RESID 110
                         AND (NAME P OR NAME OP1 OR NAME OP2 OR
                         NAME O5 OR NAME C5 OR NAME C4 OR NAME O4
                         OR NAME C3 OR NAME O3 OR NAME C2 OR NAME
                         O2 OR NAME C1 OR NAME N1 OR NAME C2 OR
                         NAME N3 OR NAME C4 OR NAME C5 OR NAME C6 )
) OR RESSEQ 111:112 OR RESSEQ 114:117 OR
RESSEQ 119:168 OR RESSEQ 170:231 OR
RESSEQ 233:249))
;
2 ? ? ? ? 1 ? ? ? ? ? ? ? ? ? 3 
;(CHAIN E AND ((RESID 106 AND (NAME P OR
                         NAME OP1 OR NAME OP2 OR NAME O5 OR NAME
                         C5 OR NAME C4 OR NAME O4 OR NAME C3 OR
                         NAME O3 OR NAME C2 OR NAME O2 OR NAME C1
                         OR NAME N9 OR NAME C8 OR NAME N7 OR NAME
                         C5 OR NAME C6 OR NAME O6 OR NAME N2 )) OR
                         (RESID 107 AND (NAME P OR NAME OP1 OR
                         NAME OP2 OR NAME O5 OR NAME C5 OR NAME C4
                         OR NAME O4 OR NAME C3 OR NAME O3 OR NAME
                         C2 OR NAME O2 OR NAME C1 OR NAME N9 OR
                         NAME C8 OR NAME N7 OR NAME C5 OR NAME C6
                         OR NAME O6 OR NAME N2 )) OR (RESID 108
                         AND (NAME P OR NAME OP1 OR NAME OP2 OR
                         NAME O5 OR NAME C5 OR NAME C4 OR NAME O4
                         OR NAME C3 OR NAME O3 OR NAME C2 OR NAME
                         O2 OR NAME C1 OR NAME N1 OR NAME C2 OR
                         NAME N3 OR NAME C4 OR NAME C5 OR NAME C6 )
                         ) OR (RESID 109 AND (NAME P OR NAME OP1
                         OR NAME OP2 OR NAME O5 OR NAME C5 OR NAME
                         C4 OR NAME O4 OR NAME C3 OR NAME O3 OR
                         NAME C2 OR NAME O2 OR NAME C1 OR NAME N9
                         OR NAME C8 OR NAME N7 OR NAME C5 OR NAME
                         C6 OR NAME O6 OR NAME N2 )) OR (RESID 110
                         AND (NAME P OR NAME OP1 OR NAME OP2 OR
                         NAME O5 OR NAME C5 OR NAME C4 OR NAME O4
                         OR NAME C3 OR NAME O3 OR NAME C2 OR NAME
                         O2 OR NAME C1 OR NAME N1 OR NAME C2 OR
                         NAME N3 OR NAME C4 OR NAME C5 OR NAME C6 )
) OR RESSEQ 111:112 OR RESSEQ 114:117 OR
RESSEQ 119:168 OR RESSEQ 170:231 OR
RESSEQ 233:249))
;
# 
loop_
_struct_ncs_ens.id 
_struct_ncs_ens.details 
1 ? 
2 ? 
3 ? 
# 
_struct.entry_id                     5M73 
_struct.title                        'Structure of the human SRP S domain with SRP72 RNA-binding domain' 
_struct.pdbx_descriptor              
;Signal recognition particle 19 kDa protein, Signal recognition particle subunit SRP68, Signal recognition particle subunit SRP72/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5M73 
_struct_keywords.text            
'protein targeting, signal recognition particle, protein-RNA complex, RNA kink-turn, RNA BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'RNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 2 ? 
C  N N 3 ? 
D  N N 4 ? 
E  N N 1 ? 
F  N N 2 ? 
G  N N 3 ? 
H  N N 4 ? 
I  N N 5 ? 
J  N N 5 ? 
K  N N 5 ? 
L  N N 5 ? 
M  N N 5 ? 
N  N N 5 ? 
O  N N 5 ? 
P  N N 5 ? 
Q  N N 5 ? 
R  N N 5 ? 
S  N N 5 ? 
T  N N 5 ? 
U  N N 5 ? 
V  N N 5 ? 
W  N N 5 ? 
X  N N 5 ? 
Y  N N 5 ? 
Z  N N 5 ? 
AA N N 5 ? 
BA N N 5 ? 
CA N N 5 ? 
DA N N 5 ? 
EA N N 5 ? 
FA N N 5 ? 
GA N N 5 ? 
HA N N 5 ? 
IA N N 5 ? 
JA N N 6 ? 
KA N N 6 ? 
LA N N 6 ? 
MA N N 6 ? 
NA N N 6 ? 
OA N N 7 ? 
PA N N 7 ? 
QA N N 7 ? 
RA N N 7 ? 
SA N N 7 ? 
TA N N 7 ? 
UA N N 5 ? 
VA N N 5 ? 
WA N N 5 ? 
XA N N 5 ? 
YA N N 5 ? 
ZA N N 5 ? 
AB N N 5 ? 
BB N N 5 ? 
CB N N 5 ? 
DB N N 5 ? 
EB N N 5 ? 
FB N N 5 ? 
GB N N 5 ? 
HB N N 5 ? 
IB N N 5 ? 
JB N N 5 ? 
KB N N 5 ? 
LB N N 6 ? 
MB N N 6 ? 
NB N N 6 ? 
OB N N 6 ? 
PB N N 6 ? 
QB N N 7 ? 
RB N N 7 ? 
SB N N 7 ? 
TB N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP B 11  ? PHE B 15  ? ASP B 11  PHE B 15  5 ? 5  
HELX_P HELX_P2  AA2 TYR B 19  ? ASN B 24  ? TYR B 19  ASN B 24  5 ? 6  
HELX_P HELX_P3  AA3 THR B 28  ? GLY B 32  ? THR B 28  GLY B 32  5 ? 5  
HELX_P HELX_P4  AA4 THR B 45  ? VAL B 56  ? THR B 45  VAL B 56  1 ? 12 
HELX_P HELX_P5  AA5 SER B 100 ? ILE B 112 ? SER B 100 ILE B 112 1 ? 13 
HELX_P HELX_P6  AA6 PRO B 113 ? LEU B 115 ? PRO B 113 LEU B 115 5 ? 3  
HELX_P HELX_P7  AA7 GLU C 10  ? HIS C 22  ? GLU C 61  HIS C 73  1 ? 13 
HELX_P HELX_P8  AA8 ASP C 28  ? LEU C 47  ? ASP C 79  LEU C 98  1 ? 20 
HELX_P HELX_P9  AA9 GLU C 64  ? ASN C 70  ? GLU C 115 ASN C 121 5 ? 7  
HELX_P HELX_P10 AB1 TYR C 72  ? ASN C 95  ? TYR C 123 ASN C 146 1 ? 24 
HELX_P HELX_P11 AB2 THR C 96  ? PRO C 98  ? THR C 147 PRO C 149 5 ? 3  
HELX_P HELX_P12 AB3 ARG C 99  ? CYS C 122 ? ARG C 150 CYS C 173 1 ? 24 
HELX_P HELX_P13 AB4 ASP C 128 ? HIS C 150 ? ASP C 179 HIS C 201 1 ? 23 
HELX_P HELX_P14 AB5 GLU C 152 ? SER C 172 ? GLU C 203 SER C 223 1 ? 21 
HELX_P HELX_P15 AB6 THR C 175 ? GLY C 201 ? THR C 226 GLY C 252 1 ? 27 
HELX_P HELX_P16 AB7 LEU D 52  ? ASP D 57  ? LEU D 562 ASP D 567 1 ? 6  
HELX_P HELX_P17 AB8 ARG D 79  ? GLN D 93  ? ARG D 589 GLN D 603 1 ? 15 
HELX_P HELX_P18 AB9 TYR F 19  ? ASN F 24  ? TYR F 19  ASN F 24  5 ? 6  
HELX_P HELX_P19 AC1 THR F 45  ? ALA F 55  ? THR F 45  ALA F 55  1 ? 11 
HELX_P HELX_P20 AC2 ASP F 75  ? GLN F 77  ? ASP F 75  GLN F 77  5 ? 3  
HELX_P HELX_P21 AC3 SER F 100 ? THR F 117 ? SER F 100 THR F 117 1 ? 18 
HELX_P HELX_P22 AC4 GLU G 10  ? HIS G 22  ? GLU G 61  HIS G 73  1 ? 13 
HELX_P HELX_P23 AC5 GLY G 23  ? GLY G 27  ? GLY G 74  GLY G 78  5 ? 5  
HELX_P HELX_P24 AC6 ASP G 28  ? LEU G 47  ? ASP G 79  LEU G 98  1 ? 20 
HELX_P HELX_P25 AC7 GLU G 64  ? ASN G 70  ? GLU G 115 ASN G 121 5 ? 7  
HELX_P HELX_P26 AC8 ARG G 71  ? ASN G 95  ? ARG G 122 ASN G 146 1 ? 25 
HELX_P HELX_P27 AC9 THR G 96  ? PRO G 98  ? THR G 147 PRO G 149 5 ? 3  
HELX_P HELX_P28 AD1 ARG G 99  ? GLU G 123 ? ARG G 150 GLU G 174 1 ? 25 
HELX_P HELX_P29 AD2 ASP G 128 ? HIS G 150 ? ASP G 179 HIS G 201 1 ? 23 
HELX_P HELX_P30 AD3 GLU G 152 ? PHE G 174 ? GLU G 203 PHE G 225 1 ? 23 
HELX_P HELX_P31 AD4 THR G 175 ? ASN G 199 ? THR G 226 ASN G 250 1 ? 25 
HELX_P HELX_P32 AD5 ARG H 79  ? GLN H 93  ? ARG H 589 GLN H 603 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1   covale both ? A  GTP 1   "O3'" ? ? ? 1_555 A  G   2   P  ? ? A GTP 105 A G   106 1_555 ? ? ? ? ? ? ?               1.639 
? 
metalc1   metalc ?    ? A  G   5   O6    ? ? ? 1_555 KA K   .   K  ? ? A G   109 A K   329 1_555 ? ? ? ? ? ? ?               2.927 
? 
metalc2   metalc ?    ? A  U   6   O4    ? ? ? 1_555 KA K   .   K  ? ? A U   110 A K   329 1_555 ? ? ? ? ? ? ?               2.706 
? 
metalc3   metalc ?    ? A  U   28  O4    ? ? ? 1_555 J  MG  .   MG ? ? A U   132 A MG  302 1_555 ? ? ? ? ? ? ?               2.321 
? 
metalc4   metalc ?    ? A  G   74  OP2   ? ? ? 1_555 M  MG  .   MG ? ? A G   178 A MG  305 1_555 ? ? ? ? ? ? ?               1.737 
? 
metalc5   metalc ?    ? A  G   89  OP2   ? ? ? 1_555 JA K   .   K  ? ? A G   193 A K   328 1_555 ? ? ? ? ? ? ?               3.271 
? 
metalc6   metalc ?    ? A  G   90  O6    ? ? ? 1_555 JA K   .   K  ? ? A G   194 A K   328 1_555 ? ? ? ? ? ? ?               2.466 
? 
metalc7   metalc ?    ? A  U   91  O4    ? ? ? 1_555 JA K   .   K  ? ? A U   195 A K   328 1_555 ? ? ? ? ? ? ?               3.461 
? 
metalc8   metalc ?    ? A  G   105 O6    ? ? ? 1_555 Z  MG  .   MG ? ? A G   209 A MG  318 1_555 ? ? ? ? ? ? ?               2.915 
? 
metalc9   metalc ?    ? A  G   106 O6    ? ? ? 1_555 NA K   .   K  ? ? A G   210 A K   332 1_555 ? ? ? ? ? ? ?               2.893 
? 
metalc10  metalc ?    ? A  U   107 O4    ? ? ? 1_555 NA K   .   K  ? ? A U   211 A K   332 1_555 ? ? ? ? ? ? ?               3.465 
? 
metalc11  metalc ?    ? A  C   116 OP2   ? ? ? 1_555 AA MG  .   MG ? ? A C   220 A MG  319 1_555 ? ? ? ? ? ? ?               2.242 
? 
metalc12  metalc ?    ? A  G   133 O6    ? ? ? 1_555 Y  MG  .   MG ? ? A G   237 A MG  317 1_555 ? ? ? ? ? ? ?               2.827 
? 
metalc13  metalc ?    ? A  G   135 O6    ? ? ? 1_555 K  MG  .   MG ? ? A G   239 A MG  303 1_555 ? ? ? ? ? ? ?               2.950 
? 
metalc14  metalc ?    ? A  U   137 O2    ? ? ? 1_555 KA K   .   K  ? ? A U   241 A K   329 1_555 ? ? ? ? ? ? ?               2.671 
? 
metalc15  metalc ?    ? A  U   137 O4    ? ? ? 1_555 L  MG  .   MG ? ? A U   241 A MG  304 1_555 ? ? ? ? ? ? ?               2.511 
? 
metalc16  metalc ?    ? A  G   139 O6    ? ? ? 1_555 KA K   .   K  ? ? A G   243 A K   329 1_555 ? ? ? ? ? ? ?               3.254 
? 
metalc17  metalc ?    ? C  GLN 19  OE1   ? ? ? 1_555 VA MG  .   MG ? ? C GLN 70  C MG  302 1_555 ? ? ? ? ? ? ?               2.955 
? 
covale2   covale both ? E  GTP 1   "O3'" ? ? ? 1_555 E  G   2   P  ? ? E GTP 105 E G   106 1_555 ? ? ? ? ? ? ?               1.613 
? 
metalc18  metalc ?    ? E  G   5   O6    ? ? ? 1_555 PB K   .   K  ? ? E G   109 E K   319 1_555 ? ? ? ? ? ? ?               3.033 
? 
metalc19  metalc ?    ? E  U   6   O4    ? ? ? 1_555 PB K   .   K  ? ? E U   110 E K   319 1_555 ? ? ? ? ? ? ?               2.779 
? 
metalc20  metalc ?    ? E  U   28  O4    ? ? ? 1_555 XA MG  .   MG ? ? E U   132 E MG  301 1_555 ? ? ? ? ? ? ?               2.609 
? 
metalc21  metalc ?    ? E  G   90  O6    ? ? ? 1_555 LB K   .   K  ? ? E G   194 E K   315 1_555 ? ? ? ? ? ? ?               2.680 
? 
metalc22  metalc ?    ? E  U   91  O4    ? ? ? 1_555 LB K   .   K  ? ? E U   195 E K   315 1_555 ? ? ? ? ? ? ?               2.492 
? 
metalc23  metalc ?    ? E  G   94  O6    ? ? ? 1_555 IB MG  .   MG ? ? E G   198 E MG  312 1_555 ? ? ? ? ? ? ?               2.812 
? 
metalc24  metalc ?    ? E  G   100 O6    ? ? ? 1_555 LB K   .   K  ? ? E G   204 E K   315 1_555 ? ? ? ? ? ? ?               3.468 
? 
metalc25  metalc ?    ? E  U   114 O4    ? ? ? 1_555 OB K   .   K  ? ? E U   218 E K   318 1_555 ? ? ? ? ? ? ?               2.509 
? 
metalc26  metalc ?    ? E  U   119 O4    ? ? ? 1_555 NB K   .   K  ? ? E U   223 E K   317 1_555 ? ? ? ? ? ? ?               3.202 
? 
metalc27  metalc ?    ? E  G   133 O6    ? ? ? 1_555 GB MG  .   MG ? ? E G   237 E MG  310 1_555 ? ? ? ? ? ? ?               2.961 
? 
metalc28  metalc ?    ? E  G   135 O6    ? ? ? 1_555 FB MG  .   MG ? ? E G   239 E MG  309 1_555 ? ? ? ? ? ? ?               2.669 
? 
metalc29  metalc ?    ? E  U   137 O2    ? ? ? 1_555 PB K   .   K  ? ? E U   241 E K   319 1_555 ? ? ? ? ? ? ?               2.596 
? 
metalc30  metalc ?    ? E  G   139 O6    ? ? ? 1_555 PB K   .   K  ? ? E G   243 E K   319 1_555 ? ? ? ? ? ? ?               3.298 
? 
metalc31  metalc ?    ? LA K   .   K     ? ? ? 1_555 QA GOL .   O3 ? ? A K   330 A GOL 335 1_555 ? ? ? ? ? ? ?               3.224 
? 
metalc32  metalc ?    ? MA K   .   K     ? ? ? 1_555 RA GOL .   O1 ? ? A K   331 A GOL 336 1_555 ? ? ? ? ? ? ?               3.007 
? 
metalc33  metalc ?    ? LB K   .   K     ? ? ? 1_555 RB GOL .   O3 ? ? E K   315 E GOL 321 1_555 ? ? ? ? ? ? ?               3.119 
? 
metalc34  metalc ?    ? LB K   .   K     ? ? ? 1_555 RB GOL .   O1 ? ? E K   315 E GOL 321 1_555 ? ? ? ? ? ? ?               2.766 
? 
metalc35  metalc ?    ? MB K   .   K     ? ? ? 1_555 QB GOL .   O3 ? ? E K   316 E GOL 320 1_555 ? ? ? ? ? ? ?               2.910 
? 
metalc36  metalc ?    ? OB K   .   K     ? ? ? 1_555 SB GOL .   O3 ? ? E K   318 E GOL 322 1_555 ? ? ? ? ? ? ?               2.856 
? 
metalc37  metalc ?    ? OB K   .   K     ? ? ? 1_555 SB GOL .   O1 ? ? E K   318 E GOL 322 1_555 ? ? ? ? ? ? ?               2.910 
? 
hydrog1   hydrog ?    ? A  GTP 1   N1    ? ? ? 1_555 A  U   144 O2 ? ? A GTP 105 A U   248 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog2   hydrog ?    ? A  GTP 1   O6    ? ? ? 1_555 A  U   144 N3 ? ? A GTP 105 A U   248 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog3   hydrog ?    ? A  G   2   N1    ? ? ? 1_555 A  C   143 N3 ? ? A G   106 A C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog4   hydrog ?    ? A  G   2   N2    ? ? ? 1_555 A  C   143 O2 ? ? A G   106 A C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog5   hydrog ?    ? A  G   2   O6    ? ? ? 1_555 A  C   143 N4 ? ? A G   106 A C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog6   hydrog ?    ? A  G   3   N1    ? ? ? 1_555 A  C   142 N3 ? ? A G   107 A C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog7   hydrog ?    ? A  G   3   N2    ? ? ? 1_555 A  C   142 O2 ? ? A G   107 A C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog8   hydrog ?    ? A  G   3   O6    ? ? ? 1_555 A  C   142 N4 ? ? A G   107 A C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog9   hydrog ?    ? A  U   4   N3    ? ? ? 1_555 A  G   141 O6 ? ? A U   108 A G   245 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog10  hydrog ?    ? A  U   4   O2    ? ? ? 1_555 A  G   141 N1 ? ? A U   108 A G   245 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog11  hydrog ?    ? A  G   5   N1    ? ? ? 1_555 A  C   140 N3 ? ? A G   109 A C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog12  hydrog ?    ? A  G   5   N2    ? ? ? 1_555 A  C   140 O2 ? ? A G   109 A C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog13  hydrog ?    ? A  G   5   O6    ? ? ? 1_555 A  C   140 N4 ? ? A G   109 A C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog14  hydrog ?    ? A  U   6   N3    ? ? ? 1_555 A  G   139 O6 ? ? A U   110 A G   243 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog15  hydrog ?    ? A  U   6   O2    ? ? ? 1_555 A  G   139 N1 ? ? A U   110 A G   243 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog16  hydrog ?    ? A  C   7   N3    ? ? ? 1_555 A  G   135 N1 ? ? A C   111 A G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog17  hydrog ?    ? A  C   7   N4    ? ? ? 1_555 A  G   135 O6 ? ? A C   111 A G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog18  hydrog ?    ? A  C   7   O2    ? ? ? 1_555 A  G   135 N2 ? ? A C   111 A G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog19  hydrog ?    ? A  C   8   N3    ? ? ? 1_555 A  G   134 N1 ? ? A C   112 A G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog20  hydrog ?    ? A  C   8   N4    ? ? ? 1_555 A  G   134 O6 ? ? A C   112 A G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog21  hydrog ?    ? A  C   8   O2    ? ? ? 1_555 A  G   134 N2 ? ? A C   112 A G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog22  hydrog ?    ? A  C   10  N3    ? ? ? 1_555 A  G   133 N1 ? ? A C   114 A G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog23  hydrog ?    ? A  C   10  N4    ? ? ? 1_555 A  G   133 O6 ? ? A C   114 A G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog24  hydrog ?    ? A  C   10  O2    ? ? ? 1_555 A  G   133 N2 ? ? A C   114 A G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog25  hydrog ?    ? A  A   11  N1    ? ? ? 1_555 A  U   132 N3 ? ? A A   115 A U   236 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog26  hydrog ?    ? A  A   11  N6    ? ? ? 1_555 A  U   132 O4 ? ? A A   115 A U   236 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog27  hydrog ?    ? A  C   12  N3    ? ? ? 1_555 A  G   131 N1 ? ? A C   116 A G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog28  hydrog ?    ? A  C   12  N4    ? ? ? 1_555 A  G   131 O6 ? ? A C   116 A G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog29  hydrog ?    ? A  C   12  O2    ? ? ? 1_555 A  G   131 N2 ? ? A C   116 A G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog30  hydrog ?    ? A  U   13  N3    ? ? ? 1_555 A  A   130 N1 ? ? A U   117 A A   234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog31  hydrog ?    ? A  U   13  O4    ? ? ? 1_555 A  A   130 N6 ? ? A U   117 A A   234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog32  hydrog ?    ? A  A   14  N1    ? ? ? 1_555 A  U   129 N3 ? ? A A   118 A U   233 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog33  hydrog ?    ? A  A   14  N6    ? ? ? 1_555 A  U   129 O4 ? ? A A   118 A U   233 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog34  hydrog ?    ? A  A   15  N1    ? ? ? 1_555 A  G   128 N2 ? ? A A   119 A G   232 1_555 ? ? ? ? ? ? 'A-G MISPAIR'   ?     
? 
hydrog35  hydrog ?    ? A  G   16  N1    ? ? ? 1_555 A  C   126 N3 ? ? A G   120 A C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog36  hydrog ?    ? A  G   16  N2    ? ? ? 1_555 A  C   126 O2 ? ? A G   120 A C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog37  hydrog ?    ? A  G   16  O6    ? ? ? 1_555 A  C   126 N4 ? ? A G   120 A C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog38  hydrog ?    ? A  U   17  N3    ? ? ? 1_555 A  U   125 O2 ? ? A U   121 A U   229 1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     
? 
hydrog39  hydrog ?    ? A  U   17  O4    ? ? ? 1_555 A  U   125 N3 ? ? A U   121 A U   229 1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     
? 
hydrog40  hydrog ?    ? A  U   18  N3    ? ? ? 1_555 A  A   124 N1 ? ? A U   122 A A   228 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog41  hydrog ?    ? A  U   18  O4    ? ? ? 1_555 A  A   124 N6 ? ? A U   122 A A   228 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog42  hydrog ?    ? A  C   19  N3    ? ? ? 1_555 A  G   123 N1 ? ? A C   123 A G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog43  hydrog ?    ? A  C   19  N4    ? ? ? 1_555 A  G   123 O6 ? ? A C   123 A G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog44  hydrog ?    ? A  C   19  O2    ? ? ? 1_555 A  G   123 N2 ? ? A C   123 A G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog45  hydrog ?    ? A  G   20  N1    ? ? ? 1_555 A  U   122 O2 ? ? A G   124 A U   226 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog46  hydrog ?    ? A  G   20  O6    ? ? ? 1_555 A  U   122 N3 ? ? A G   124 A U   226 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog47  hydrog ?    ? A  G   21  N1    ? ? ? 1_555 A  C   121 N3 ? ? A G   125 A C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog48  hydrog ?    ? A  G   21  N2    ? ? ? 1_555 A  C   121 O2 ? ? A G   125 A C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog49  hydrog ?    ? A  G   21  O6    ? ? ? 1_555 A  C   121 N4 ? ? A G   125 A C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog50  hydrog ?    ? A  C   22  N3    ? ? ? 1_555 A  G   120 N1 ? ? A C   126 A G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog51  hydrog ?    ? A  C   22  N4    ? ? ? 1_555 A  G   120 O6 ? ? A C   126 A G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog52  hydrog ?    ? A  C   22  O2    ? ? ? 1_555 A  G   120 N2 ? ? A C   126 A G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog53  hydrog ?    ? A  A   23  N1    ? ? ? 1_555 A  U   119 N3 ? ? A A   127 A U   223 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog54  hydrog ?    ? A  A   23  N6    ? ? ? 1_555 A  U   119 O4 ? ? A A   127 A U   223 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog55  hydrog ?    ? A  U   24  N3    ? ? ? 1_555 A  G   118 O6 ? ? A U   128 A G   222 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog56  hydrog ?    ? A  U   24  O2    ? ? ? 1_555 A  G   118 N1 ? ? A U   128 A G   222 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog57  hydrog ?    ? A  C   25  N3    ? ? ? 1_555 A  G   64  N1 ? ? A C   129 A G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog58  hydrog ?    ? A  C   25  N4    ? ? ? 1_555 A  G   64  O6 ? ? A C   129 A G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog59  hydrog ?    ? A  C   25  O2    ? ? ? 1_555 A  G   64  N2 ? ? A C   129 A G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog60  hydrog ?    ? A  A   26  N1    ? ? ? 1_555 A  U   63  N3 ? ? A A   130 A U   167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog61  hydrog ?    ? A  A   26  N6    ? ? ? 1_555 A  U   63  O4 ? ? A A   130 A U   167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog62  hydrog ?    ? A  A   27  N1    ? ? ? 1_555 A  U   62  N3 ? ? A A   131 A U   166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog63  hydrog ?    ? A  A   27  N6    ? ? ? 1_555 A  U   62  O4 ? ? A A   131 A U   166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog64  hydrog ?    ? A  U   28  O4    ? ? ? 1_555 A  G   60  N2 ? ? A U   132 A G   164 1_555 ? ? ? ? ? ? 'U-G MISPAIR'   ?     
? 
hydrog65  hydrog ?    ? A  U   28  N3    ? ? ? 1_555 A  G   61  O6 ? ? A U   132 A G   165 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog66  hydrog ?    ? A  U   28  O2    ? ? ? 1_555 A  G   61  N1 ? ? A U   132 A G   165 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog67  hydrog ?    ? A  A   29  N6    ? ? ? 1_555 A  A   59  N1 ? ? A A   133 A A   163 1_555 ? ? ? ? ? ? 'A-A MISPAIR'   ?     
? 
hydrog68  hydrog ?    ? A  U   30  N3    ? ? ? 1_555 A  A   59  N1 ? ? A U   134 A A   163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog69  hydrog ?    ? A  U   30  O4    ? ? ? 1_555 A  A   59  N6 ? ? A U   134 A A   163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog70  hydrog ?    ? A  G   31  N1    ? ? ? 1_555 A  C   58  N3 ? ? A G   135 A C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog71  hydrog ?    ? A  G   31  N2    ? ? ? 1_555 A  C   58  O2 ? ? A G   135 A C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog72  hydrog ?    ? A  G   31  O6    ? ? ? 1_555 A  C   58  N4 ? ? A G   135 A C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog73  hydrog ?    ? A  G   32  N1    ? ? ? 1_555 A  C   57  N3 ? ? A G   136 A C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog74  hydrog ?    ? A  G   32  N2    ? ? ? 1_555 A  C   57  O2 ? ? A G   136 A C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog75  hydrog ?    ? A  G   32  O6    ? ? ? 1_555 A  C   57  N4 ? ? A G   136 A C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog76  hydrog ?    ? A  U   33  N3    ? ? ? 1_555 A  A   56  N1 ? ? A U   137 A A   160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog77  hydrog ?    ? A  U   33  O4    ? ? ? 1_555 A  A   56  N6 ? ? A U   137 A A   160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog78  hydrog ?    ? A  G   34  N1    ? ? ? 1_555 A  C   55  N3 ? ? A G   138 A C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog79  hydrog ?    ? A  G   34  N2    ? ? ? 1_555 A  C   55  O2 ? ? A G   138 A C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog80  hydrog ?    ? A  G   34  O6    ? ? ? 1_555 A  C   55  N4 ? ? A G   138 A C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog81  hydrog ?    ? A  C   37  N3    ? ? ? 1_555 A  G   52  N1 ? ? A C   141 A G   156 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog82  hydrog ?    ? A  C   37  N4    ? ? ? 1_555 A  G   52  O6 ? ? A C   141 A G   156 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog83  hydrog ?    ? A  C   37  O2    ? ? ? 1_555 A  G   52  N2 ? ? A C   141 A G   156 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog84  hydrog ?    ? A  U   38  N3    ? ? ? 1_555 A  G   51  O6 ? ? A U   142 A G   155 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog85  hydrog ?    ? A  U   38  O2    ? ? ? 1_555 A  G   51  N1 ? ? A U   142 A G   155 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog86  hydrog ?    ? A  C   39  N3    ? ? ? 1_555 A  G   50  N1 ? ? A C   143 A G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog87  hydrog ?    ? A  C   39  N4    ? ? ? 1_555 A  G   50  O6 ? ? A C   143 A G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog88  hydrog ?    ? A  C   39  O2    ? ? ? 1_555 A  G   50  N2 ? ? A C   143 A G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog89  hydrog ?    ? A  C   40  N3    ? ? ? 1_555 A  G   49  N1 ? ? A C   144 A G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog90  hydrog ?    ? A  C   40  N4    ? ? ? 1_555 A  G   49  O6 ? ? A C   144 A G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog91  hydrog ?    ? A  C   40  O2    ? ? ? 1_555 A  G   49  N2 ? ? A C   144 A G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog92  hydrog ?    ? A  C   41  N3    ? ? ? 1_555 A  G   48  N1 ? ? A C   145 A G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog93  hydrog ?    ? A  C   41  N4    ? ? ? 1_555 A  G   48  O6 ? ? A C   145 A G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog94  hydrog ?    ? A  C   41  O2    ? ? ? 1_555 A  G   48  N2 ? ? A C   145 A G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog95  hydrog ?    ? A  G   42  N1    ? ? ? 1_555 A  C   47  N3 ? ? A G   146 A C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog96  hydrog ?    ? A  G   42  N2    ? ? ? 1_555 A  C   47  O2 ? ? A G   146 A C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog97  hydrog ?    ? A  G   42  O6    ? ? ? 1_555 A  C   47  N4 ? ? A G   146 A C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog98  hydrog ?    ? A  G   44  O6    ? ? ? 1_555 A  A   96  N6 ? ? A G   148 A A   200 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog99  hydrog ?    ? A  A   45  N1    ? ? ? 1_555 A  A   97  N6 ? ? A A   149 A A   201 1_555 ? ? ? ? ? ? TYPE_1_PAIR     ?     
? 
hydrog100 hydrog ?    ? A  A   45  N6    ? ? ? 1_555 A  A   97  N1 ? ? A A   149 A A   201 1_555 ? ? ? ? ? ? TYPE_1_PAIR     ?     
? 
hydrog101 hydrog ?    ? A  G   46  N3    ? ? ? 1_555 A  G   93  N2 ? ? A G   150 A G   197 1_555 ? ? ? ? ? ? 'G-G MISPAIR'   ?     
? 
hydrog102 hydrog ?    ? A  G   46  N2    ? ? ? 1_555 A  A   97  N1 ? ? A G   150 A A   201 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog103 hydrog ?    ? A  G   46  N2    ? ? ? 1_555 A  C   98  O2 ? ? A G   150 A C   202 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog104 hydrog ?    ? A  G   61  O6    ? ? ? 1_555 A  A   72  N6 ? ? A G   165 A A   176 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog105 hydrog ?    ? A  G   71  N2    ? ? ? 1_555 A  C   117 O2 ? ? A G   175 A C   221 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog106 hydrog ?    ? A  G   73  N1    ? ? ? 1_555 A  C   116 N3 ? ? A G   177 A C   220 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog107 hydrog ?    ? A  G   73  N2    ? ? ? 1_555 A  C   116 O2 ? ? A G   177 A C   220 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog108 hydrog ?    ? A  G   73  O6    ? ? ? 1_555 A  C   116 N4 ? ? A G   177 A C   220 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog109 hydrog ?    ? A  G   74  N1    ? ? ? 1_555 A  C   115 N3 ? ? A G   178 A C   219 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog110 hydrog ?    ? A  G   74  N2    ? ? ? 1_555 A  C   115 O2 ? ? A G   178 A C   219 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog111 hydrog ?    ? A  G   74  O6    ? ? ? 1_555 A  C   115 N4 ? ? A G   178 A C   219 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog112 hydrog ?    ? A  G   75  N1    ? ? ? 1_555 A  U   114 O2 ? ? A G   179 A U   218 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog113 hydrog ?    ? A  G   75  O6    ? ? ? 1_555 A  U   114 N3 ? ? A G   179 A U   218 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog114 hydrog ?    ? A  G   76  N1    ? ? ? 1_555 A  C   113 N3 ? ? A G   180 A C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog115 hydrog ?    ? A  G   76  N2    ? ? ? 1_555 A  C   113 O2 ? ? A G   180 A C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog116 hydrog ?    ? A  G   76  O6    ? ? ? 1_555 A  C   113 N4 ? ? A G   180 A C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog117 hydrog ?    ? A  G   78  N2    ? ? ? 1_555 A  A   111 N7 ? ? A G   182 A A   215 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog118 hydrog ?    ? A  G   78  N3    ? ? ? 1_555 A  A   112 N6 ? ? A G   182 A A   216 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog119 hydrog ?    ? A  C   81  N4    ? ? ? 1_555 A  G   83  O6 ? ? A C   185 A G   187 1_555 ? ? ? ? ? ? 'C-G PAIR'      ?     
? 
hydrog120 hydrog ?    ? A  G   83  N1    ? ? ? 1_555 A  C   108 N3 ? ? A G   187 A C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog121 hydrog ?    ? A  G   83  N2    ? ? ? 1_555 A  C   108 O2 ? ? A G   187 A C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog122 hydrog ?    ? A  G   83  O6    ? ? ? 1_555 A  C   108 N4 ? ? A G   187 A C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog123 hydrog ?    ? A  G   84  N1    ? ? ? 1_555 A  U   107 O2 ? ? A G   188 A U   211 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog124 hydrog ?    ? A  G   84  O6    ? ? ? 1_555 A  U   107 N3 ? ? A G   188 A U   211 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog125 hydrog ?    ? A  C   85  N4    ? ? ? 1_555 A  G   106 O6 ? ? A C   189 A G   210 1_555 ? ? ? ? ? ? 'C-G PAIR'      ?     
? 
hydrog126 hydrog ?    ? A  C   86  N3    ? ? ? 1_555 A  G   105 N1 ? ? A C   190 A G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog127 hydrog ?    ? A  C   86  N4    ? ? ? 1_555 A  G   105 O6 ? ? A C   190 A G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog128 hydrog ?    ? A  C   86  O2    ? ? ? 1_555 A  G   105 N2 ? ? A C   190 A G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog129 hydrog ?    ? A  C   87  O2    ? ? ? 1_555 A  C   103 N4 ? ? A C   191 A C   207 1_555 ? ? ? ? ? ? 'C-C MISPAIR'   ?     
? 
hydrog130 hydrog ?    ? A  C   87  O2    ? ? ? 1_555 A  A   104 N6 ? ? A C   191 A A   208 1_555 ? ? ? ? ? ? 'C-A MISPAIR'   ?     
? 
hydrog131 hydrog ?    ? A  A   88  N6    ? ? ? 1_555 A  C   103 N3 ? ? A A   192 A C   207 1_555 ? ? ? ? ? ? TYPE_25_PAIR    ?     
? 
hydrog132 hydrog ?    ? A  A   88  N7    ? ? ? 1_555 A  C   103 N4 ? ? A A   192 A C   207 1_555 ? ? ? ? ? ? TYPE_25_PAIR    ?     
? 
hydrog133 hydrog ?    ? A  G   89  N7    ? ? ? 1_555 A  G   102 N2 ? ? A G   193 A G   206 1_555 ? ? ? ? ? ? 'G-G MISPAIR'   ?     
? 
hydrog134 hydrog ?    ? A  G   90  N2    ? ? ? 1_555 A  A   101 N1 ? ? A G   194 A A   205 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog135 hydrog ?    ? A  U   91  N3    ? ? ? 1_555 A  G   100 O6 ? ? A U   195 A G   204 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog136 hydrog ?    ? A  U   91  O2    ? ? ? 1_555 A  G   100 N1 ? ? A U   195 A G   204 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog137 hydrog ?    ? A  C   92  N3    ? ? ? 1_555 A  G   99  N1 ? ? A C   196 A G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog138 hydrog ?    ? A  C   92  N4    ? ? ? 1_555 A  G   99  O6 ? ? A C   196 A G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog139 hydrog ?    ? A  C   92  O2    ? ? ? 1_555 A  G   99  N2 ? ? A C   196 A G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog140 hydrog ?    ? A  G   93  N1    ? ? ? 1_555 A  C   98  N3 ? ? A G   197 A C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog141 hydrog ?    ? A  G   93  N2    ? ? ? 1_555 A  C   98  O2 ? ? A G   197 A C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog142 hydrog ?    ? A  G   93  O6    ? ? ? 1_555 A  C   98  N4 ? ? A G   197 A C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog143 hydrog ?    ? E  GTP 1   O6    ? ? ? 1_555 E  C   143 N4 ? ? E GTP 105 E C   247 1_555 ? ? ? ? ? ? 'GTP-C MISPAIR' ?     
? 
hydrog144 hydrog ?    ? E  GTP 1   N1    ? ? ? 1_555 E  U   144 O4 ? ? E GTP 105 E U   248 1_555 ? ? ? ? ? ? 'GTP-U MISPAIR' ?     
? 
hydrog145 hydrog ?    ? E  G   2   N1    ? ? ? 1_555 E  C   143 N3 ? ? E G   106 E C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog146 hydrog ?    ? E  G   2   N2    ? ? ? 1_555 E  C   143 O2 ? ? E G   106 E C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog147 hydrog ?    ? E  G   2   O6    ? ? ? 1_555 E  C   143 N4 ? ? E G   106 E C   247 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog148 hydrog ?    ? E  G   3   N1    ? ? ? 1_555 E  C   142 N3 ? ? E G   107 E C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog149 hydrog ?    ? E  G   3   N2    ? ? ? 1_555 E  C   142 O2 ? ? E G   107 E C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog150 hydrog ?    ? E  G   3   O6    ? ? ? 1_555 E  C   142 N4 ? ? E G   107 E C   246 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog151 hydrog ?    ? E  U   4   N3    ? ? ? 1_555 E  G   141 O6 ? ? E U   108 E G   245 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog152 hydrog ?    ? E  U   4   O2    ? ? ? 1_555 E  G   141 N1 ? ? E U   108 E G   245 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog153 hydrog ?    ? E  G   5   N1    ? ? ? 1_555 E  C   140 N3 ? ? E G   109 E C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog154 hydrog ?    ? E  G   5   N2    ? ? ? 1_555 E  C   140 O2 ? ? E G   109 E C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog155 hydrog ?    ? E  G   5   O6    ? ? ? 1_555 E  C   140 N4 ? ? E G   109 E C   244 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog156 hydrog ?    ? E  U   6   N3    ? ? ? 1_555 E  G   139 O6 ? ? E U   110 E G   243 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog157 hydrog ?    ? E  U   6   O2    ? ? ? 1_555 E  G   139 N1 ? ? E U   110 E G   243 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog158 hydrog ?    ? E  C   7   N3    ? ? ? 1_555 E  G   135 N1 ? ? E C   111 E G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog159 hydrog ?    ? E  C   7   N4    ? ? ? 1_555 E  G   135 O6 ? ? E C   111 E G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog160 hydrog ?    ? E  C   7   O2    ? ? ? 1_555 E  G   135 N2 ? ? E C   111 E G   239 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog161 hydrog ?    ? E  C   8   N3    ? ? ? 1_555 E  G   134 N1 ? ? E C   112 E G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog162 hydrog ?    ? E  C   8   N4    ? ? ? 1_555 E  G   134 O6 ? ? E C   112 E G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog163 hydrog ?    ? E  C   8   O2    ? ? ? 1_555 E  G   134 N2 ? ? E C   112 E G   238 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog164 hydrog ?    ? E  C   10  N3    ? ? ? 1_555 E  G   133 N1 ? ? E C   114 E G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog165 hydrog ?    ? E  C   10  N4    ? ? ? 1_555 E  G   133 O6 ? ? E C   114 E G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog166 hydrog ?    ? E  C   10  O2    ? ? ? 1_555 E  G   133 N2 ? ? E C   114 E G   237 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog167 hydrog ?    ? E  C   12  N3    ? ? ? 1_555 E  G   131 N1 ? ? E C   116 E G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog168 hydrog ?    ? E  C   12  N4    ? ? ? 1_555 E  G   131 O6 ? ? E C   116 E G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog169 hydrog ?    ? E  C   12  O2    ? ? ? 1_555 E  G   131 N2 ? ? E C   116 E G   235 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog170 hydrog ?    ? E  U   13  N3    ? ? ? 1_555 E  A   130 N1 ? ? E U   117 E A   234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog171 hydrog ?    ? E  U   13  O4    ? ? ? 1_555 E  A   130 N6 ? ? E U   117 E A   234 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog172 hydrog ?    ? E  A   14  N6    ? ? ? 1_555 E  U   129 O4 ? ? E A   118 E U   233 1_555 ? ? ? ? ? ? 'A-U PAIR'      ?     
? 
hydrog173 hydrog ?    ? E  A   15  N6    ? ? ? 1_555 E  G   128 O6 ? ? E A   119 E G   232 1_555 ? ? ? ? ? ? 'A-G MISPAIR'   ?     
? 
hydrog174 hydrog ?    ? E  G   16  N1    ? ? ? 1_555 E  C   126 N3 ? ? E G   120 E C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog175 hydrog ?    ? E  G   16  N2    ? ? ? 1_555 E  C   126 O2 ? ? E G   120 E C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog176 hydrog ?    ? E  G   16  O6    ? ? ? 1_555 E  C   126 N4 ? ? E G   120 E C   230 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog177 hydrog ?    ? E  U   17  N3    ? ? ? 1_555 E  U   125 O2 ? ? E U   121 E U   229 1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     
? 
hydrog178 hydrog ?    ? E  U   17  O4    ? ? ? 1_555 E  U   125 N3 ? ? E U   121 E U   229 1_555 ? ? ? ? ? ? TYPE_16_PAIR    ?     
? 
hydrog179 hydrog ?    ? E  U   18  N3    ? ? ? 1_555 E  A   124 N1 ? ? E U   122 E A   228 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog180 hydrog ?    ? E  U   18  O4    ? ? ? 1_555 E  A   124 N6 ? ? E U   122 E A   228 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog181 hydrog ?    ? E  C   19  N3    ? ? ? 1_555 E  G   123 N1 ? ? E C   123 E G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog182 hydrog ?    ? E  C   19  N4    ? ? ? 1_555 E  G   123 O6 ? ? E C   123 E G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog183 hydrog ?    ? E  C   19  O2    ? ? ? 1_555 E  G   123 N2 ? ? E C   123 E G   227 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog184 hydrog ?    ? E  G   20  N1    ? ? ? 1_555 E  U   122 O2 ? ? E G   124 E U   226 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog185 hydrog ?    ? E  G   20  O6    ? ? ? 1_555 E  U   122 N3 ? ? E G   124 E U   226 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog186 hydrog ?    ? E  G   21  N1    ? ? ? 1_555 E  C   121 N3 ? ? E G   125 E C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog187 hydrog ?    ? E  G   21  N2    ? ? ? 1_555 E  C   121 O2 ? ? E G   125 E C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog188 hydrog ?    ? E  G   21  O6    ? ? ? 1_555 E  C   121 N4 ? ? E G   125 E C   225 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog189 hydrog ?    ? E  C   22  N3    ? ? ? 1_555 E  G   120 N1 ? ? E C   126 E G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog190 hydrog ?    ? E  C   22  N4    ? ? ? 1_555 E  G   120 O6 ? ? E C   126 E G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog191 hydrog ?    ? E  C   22  O2    ? ? ? 1_555 E  G   120 N2 ? ? E C   126 E G   224 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog192 hydrog ?    ? E  A   23  N1    ? ? ? 1_555 E  U   119 N3 ? ? E A   127 E U   223 1_555 ? ? ? ? ? ? 'A-U PAIR'      ?     
? 
hydrog193 hydrog ?    ? E  U   24  N3    ? ? ? 1_555 E  G   118 O6 ? ? E U   128 E G   222 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog194 hydrog ?    ? E  U   24  O2    ? ? ? 1_555 E  G   118 N1 ? ? E U   128 E G   222 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog195 hydrog ?    ? E  C   25  N3    ? ? ? 1_555 E  G   64  N1 ? ? E C   129 E G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog196 hydrog ?    ? E  C   25  N4    ? ? ? 1_555 E  G   64  O6 ? ? E C   129 E G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog197 hydrog ?    ? E  C   25  O2    ? ? ? 1_555 E  G   64  N2 ? ? E C   129 E G   168 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog198 hydrog ?    ? E  A   26  N1    ? ? ? 1_555 E  U   63  N3 ? ? E A   130 E U   167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog199 hydrog ?    ? E  A   26  N6    ? ? ? 1_555 E  U   63  O4 ? ? E A   130 E U   167 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog200 hydrog ?    ? E  A   27  N1    ? ? ? 1_555 E  U   62  N3 ? ? E A   131 E U   166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog201 hydrog ?    ? E  A   27  N6    ? ? ? 1_555 E  U   62  O4 ? ? E A   131 E U   166 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog202 hydrog ?    ? E  U   28  O4    ? ? ? 1_555 E  G   60  N2 ? ? E U   132 E G   164 1_555 ? ? ? ? ? ? 'U-G MISPAIR'   ?     
? 
hydrog203 hydrog ?    ? E  U   28  N3    ? ? ? 1_555 E  G   61  O6 ? ? E U   132 E G   165 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog204 hydrog ?    ? E  U   28  O2    ? ? ? 1_555 E  G   61  N1 ? ? E U   132 E G   165 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog205 hydrog ?    ? E  A   29  N6    ? ? ? 1_555 E  A   59  N1 ? ? E A   133 E A   163 1_555 ? ? ? ? ? ? 'A-A MISPAIR'   ?     
? 
hydrog206 hydrog ?    ? E  U   30  N3    ? ? ? 1_555 E  A   59  N1 ? ? E U   134 E A   163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog207 hydrog ?    ? E  U   30  O4    ? ? ? 1_555 E  A   59  N6 ? ? E U   134 E A   163 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog208 hydrog ?    ? E  G   31  N1    ? ? ? 1_555 E  C   58  N3 ? ? E G   135 E C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog209 hydrog ?    ? E  G   31  N2    ? ? ? 1_555 E  C   58  O2 ? ? E G   135 E C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog210 hydrog ?    ? E  G   31  O6    ? ? ? 1_555 E  C   58  N4 ? ? E G   135 E C   162 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog211 hydrog ?    ? E  G   32  N1    ? ? ? 1_555 E  C   57  N3 ? ? E G   136 E C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog212 hydrog ?    ? E  G   32  N2    ? ? ? 1_555 E  C   57  O2 ? ? E G   136 E C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog213 hydrog ?    ? E  G   32  O6    ? ? ? 1_555 E  C   57  N4 ? ? E G   136 E C   161 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog214 hydrog ?    ? E  U   33  N3    ? ? ? 1_555 E  A   56  N1 ? ? E U   137 E A   160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog215 hydrog ?    ? E  U   33  O4    ? ? ? 1_555 E  A   56  N6 ? ? E U   137 E A   160 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog216 hydrog ?    ? E  G   34  N1    ? ? ? 1_555 E  C   55  N3 ? ? E G   138 E C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog217 hydrog ?    ? E  G   34  N2    ? ? ? 1_555 E  C   55  O2 ? ? E G   138 E C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog218 hydrog ?    ? E  G   34  O6    ? ? ? 1_555 E  C   55  N4 ? ? E G   138 E C   159 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog219 hydrog ?    ? E  A   35  N6    ? ? ? 1_555 E  C   54  N3 ? ? E A   139 E C   158 1_555 ? ? ? ? ? ? 'A-C MISPAIR'   ?     
? 
hydrog220 hydrog ?    ? E  C   37  N4    ? ? ? 1_555 E  G   52  O6 ? ? E C   141 E G   156 1_555 ? ? ? ? ? ? 'C-G PAIR'      ?     
? 
hydrog221 hydrog ?    ? E  U   38  N3    ? ? ? 1_555 E  G   51  O6 ? ? E U   142 E G   155 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog222 hydrog ?    ? E  U   38  O2    ? ? ? 1_555 E  G   51  N1 ? ? E U   142 E G   155 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog223 hydrog ?    ? E  C   39  N3    ? ? ? 1_555 E  G   50  N1 ? ? E C   143 E G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog224 hydrog ?    ? E  C   39  N4    ? ? ? 1_555 E  G   50  O6 ? ? E C   143 E G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog225 hydrog ?    ? E  C   39  O2    ? ? ? 1_555 E  G   50  N2 ? ? E C   143 E G   154 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog226 hydrog ?    ? E  C   40  N3    ? ? ? 1_555 E  G   49  N1 ? ? E C   144 E G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog227 hydrog ?    ? E  C   40  N4    ? ? ? 1_555 E  G   49  O6 ? ? E C   144 E G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog228 hydrog ?    ? E  C   40  O2    ? ? ? 1_555 E  G   49  N2 ? ? E C   144 E G   153 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog229 hydrog ?    ? E  C   41  N3    ? ? ? 1_555 E  G   48  N1 ? ? E C   145 E G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog230 hydrog ?    ? E  C   41  N4    ? ? ? 1_555 E  G   48  O6 ? ? E C   145 E G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog231 hydrog ?    ? E  C   41  O2    ? ? ? 1_555 E  G   48  N2 ? ? E C   145 E G   152 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog232 hydrog ?    ? E  G   42  N1    ? ? ? 1_555 E  C   47  N3 ? ? E G   146 E C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog233 hydrog ?    ? E  G   42  N2    ? ? ? 1_555 E  C   47  O2 ? ? E G   146 E C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog234 hydrog ?    ? E  G   42  O6    ? ? ? 1_555 E  C   47  N4 ? ? E G   146 E C   151 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog235 hydrog ?    ? E  A   45  N1    ? ? ? 1_555 E  G   93  N2 ? ? E A   149 E G   197 1_555 ? ? ? ? ? ? 'A-G MISPAIR'   ?     
? 
hydrog236 hydrog ?    ? E  A   45  N1    ? ? ? 1_555 E  A   97  N6 ? ? E A   149 E A   201 1_555 ? ? ? ? ? ? TYPE_1_PAIR     ?     
? 
hydrog237 hydrog ?    ? E  A   45  N6    ? ? ? 1_555 E  A   97  N1 ? ? E A   149 E A   201 1_555 ? ? ? ? ? ? TYPE_1_PAIR     ?     
? 
hydrog238 hydrog ?    ? E  G   46  N3    ? ? ? 1_555 E  G   93  N2 ? ? E G   150 E G   197 1_555 ? ? ? ? ? ? 'G-G MISPAIR'   ?     
? 
hydrog239 hydrog ?    ? E  G   46  N2    ? ? ? 1_555 E  A   97  N1 ? ? E G   150 E A   201 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog240 hydrog ?    ? E  G   46  N2    ? ? ? 1_555 E  C   98  O2 ? ? E G   150 E C   202 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog241 hydrog ?    ? E  G   61  O6    ? ? ? 1_555 E  A   72  N6 ? ? E G   165 E A   176 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog242 hydrog ?    ? E  G   71  N2    ? ? ? 1_555 E  C   117 O2 ? ? E G   175 E C   221 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog243 hydrog ?    ? E  G   73  O6    ? ? ? 1_555 E  C   116 N4 ? ? E G   177 E C   220 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog244 hydrog ?    ? E  G   74  N2    ? ? ? 1_555 E  C   115 O2 ? ? E G   178 E C   219 1_555 ? ? ? ? ? ? 'G-C PAIR'      ?     
? 
hydrog245 hydrog ?    ? E  G   75  N1    ? ? ? 1_555 E  U   114 O2 ? ? E G   179 E U   218 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog246 hydrog ?    ? E  G   75  O6    ? ? ? 1_555 E  U   114 N3 ? ? E G   179 E U   218 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog247 hydrog ?    ? E  G   76  N1    ? ? ? 1_555 E  C   113 N3 ? ? E G   180 E C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog248 hydrog ?    ? E  G   76  N2    ? ? ? 1_555 E  C   113 O2 ? ? E G   180 E C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog249 hydrog ?    ? E  G   76  O6    ? ? ? 1_555 E  C   113 N4 ? ? E G   180 E C   217 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog250 hydrog ?    ? E  U   77  O2    ? ? ? 1_555 E  A   112 N6 ? ? E U   181 E A   216 1_555 ? ? ? ? ? ? 'U-A PAIR'      ?     
? 
hydrog251 hydrog ?    ? E  G   78  N2    ? ? ? 1_555 E  A   111 N7 ? ? E G   182 E A   215 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog252 hydrog ?    ? E  G   78  N3    ? ? ? 1_555 E  A   112 N6 ? ? E G   182 E A   216 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog253 hydrog ?    ? E  G   83  N1    ? ? ? 1_555 E  C   108 N3 ? ? E G   187 E C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog254 hydrog ?    ? E  G   83  N2    ? ? ? 1_555 E  C   108 O2 ? ? E G   187 E C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog255 hydrog ?    ? E  G   83  O6    ? ? ? 1_555 E  C   108 N4 ? ? E G   187 E C   212 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog256 hydrog ?    ? E  G   84  N1    ? ? ? 1_555 E  U   107 O2 ? ? E G   188 E U   211 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog257 hydrog ?    ? E  G   84  O6    ? ? ? 1_555 E  U   107 N3 ? ? E G   188 E U   211 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog258 hydrog ?    ? E  C   85  N3    ? ? ? 1_555 E  G   106 N1 ? ? E C   189 E G   210 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog259 hydrog ?    ? E  C   85  N4    ? ? ? 1_555 E  G   106 O6 ? ? E C   189 E G   210 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog260 hydrog ?    ? E  C   85  O2    ? ? ? 1_555 E  G   106 N2 ? ? E C   189 E G   210 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog261 hydrog ?    ? E  C   86  N3    ? ? ? 1_555 E  G   105 N1 ? ? E C   190 E G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog262 hydrog ?    ? E  C   86  N4    ? ? ? 1_555 E  G   105 O6 ? ? E C   190 E G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog263 hydrog ?    ? E  C   86  O2    ? ? ? 1_555 E  G   105 N2 ? ? E C   190 E G   209 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog264 hydrog ?    ? E  C   87  O2    ? ? ? 1_555 E  A   104 N6 ? ? E C   191 E A   208 1_555 ? ? ? ? ? ? 'C-A MISPAIR'   ?     
? 
hydrog265 hydrog ?    ? E  C   87  O2    ? ? ? 1_555 E  G   105 N1 ? ? E C   191 E G   209 1_555 ? ? ? ? ? ? 'C-G PAIR'      ?     
? 
hydrog266 hydrog ?    ? E  A   88  N6    ? ? ? 1_555 E  C   103 N3 ? ? E A   192 E C   207 1_555 ? ? ? ? ? ? TYPE_25_PAIR    ?     
? 
hydrog267 hydrog ?    ? E  A   88  N7    ? ? ? 1_555 E  C   103 N4 ? ? E A   192 E C   207 1_555 ? ? ? ? ? ? TYPE_25_PAIR    ?     
? 
hydrog268 hydrog ?    ? E  G   90  N2    ? ? ? 1_555 E  A   101 N1 ? ? E G   194 E A   205 1_555 ? ? ? ? ? ? 'G-A MISPAIR'   ?     
? 
hydrog269 hydrog ?    ? E  U   91  N3    ? ? ? 1_555 E  G   100 O6 ? ? E U   195 E G   204 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog270 hydrog ?    ? E  U   91  O2    ? ? ? 1_555 E  G   100 N1 ? ? E U   195 E G   204 1_555 ? ? ? ? ? ? TYPE_28_PAIR    ?     
? 
hydrog271 hydrog ?    ? E  C   92  N3    ? ? ? 1_555 E  G   99  N1 ? ? E C   196 E G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog272 hydrog ?    ? E  C   92  N4    ? ? ? 1_555 E  G   99  O6 ? ? E C   196 E G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog273 hydrog ?    ? E  C   92  O2    ? ? ? 1_555 E  G   99  N2 ? ? E C   196 E G   203 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog274 hydrog ?    ? E  G   93  N1    ? ? ? 1_555 E  C   98  N3 ? ? E G   197 E C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog275 hydrog ?    ? E  G   93  N2    ? ? ? 1_555 E  C   98  O2 ? ? E G   197 E C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
hydrog276 hydrog ?    ? E  G   93  O6    ? ? ? 1_555 E  C   98  N4 ? ? E G   197 E C   202 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     
? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
covale ? ? 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE B 16 ? ILE B 18 ? ILE B 16  ILE B 18  
AA1 2 ARG B 81 ? VAL B 84 ? ARG B 81  VAL B 84  
AA1 3 VAL B 60 ? GLU B 63 ? VAL B 60  GLU B 63  
AA2 1 ILE F 16 ? ILE F 18 ? ILE F 16  ILE F 18  
AA2 2 ARG F 79 ? VAL F 84 ? ARG F 79  VAL F 84  
AA2 3 VAL F 60 ? MET F 67 ? VAL F 60  MET F 67  
AA3 1 GLY G 52 ? ASN G 53 ? GLY G 103 ASN G 104 
AA3 2 LYS G 56 ? PHE G 57 ? LYS G 107 PHE G 108 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE B 18 ? N ILE B 18  O VAL B 82 ? O VAL B 82  
AA1 2 3 O ARG B 81 ? O ARG B 81  N GLU B 63 ? N GLU B 63  
AA2 1 2 N ILE F 16 ? N ILE F 16  O VAL F 84 ? O VAL F 84  
AA2 2 3 O ARG F 81 ? O ARG F 81  N GLU F 63 ? N GLU F 63  
AA3 1 2 N ASN G 53 ? N ASN G 104 O LYS G 56 ? O LYS G 107 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG  301 ? 4 'binding site for residue MG A 301'  
AC2 Software A MG  302 ? 2 'binding site for residue MG A 302'  
AC3 Software A MG  303 ? 2 'binding site for residue MG A 303'  
AC4 Software A MG  304 ? 1 'binding site for residue MG A 304'  
AC5 Software A MG  305 ? 2 'binding site for residue MG A 305'  
AC6 Software A MG  309 ? 2 'binding site for residue MG A 309'  
AC7 Software A MG  310 ? 1 'binding site for residue MG A 310'  
AC8 Software A MG  311 ? 1 'binding site for residue MG A 311'  
AC9 Software A MG  312 ? 1 'binding site for residue MG A 312'  
AD1 Software A MG  314 ? 2 'binding site for residue MG A 314'  
AD2 Software A MG  315 ? 1 'binding site for residue MG A 315'  
AD3 Software A MG  316 ? 2 'binding site for residue MG A 316'  
AD4 Software A MG  317 ? 2 'binding site for residue MG A 317'  
AD5 Software A MG  318 ? 3 'binding site for residue MG A 318'  
AD6 Software A MG  319 ? 1 'binding site for residue MG A 319'  
AD7 Software A MG  320 ? 1 'binding site for residue MG A 320'  
AD8 Software A MG  321 ? 1 'binding site for residue MG A 321'  
AD9 Software A MG  322 ? 1 'binding site for residue MG A 322'  
AE1 Software A MG  324 ? 1 'binding site for residue MG A 324'  
AE2 Software A MG  325 ? 1 'binding site for residue MG A 325'  
AE3 Software A K   328 ? 4 'binding site for residue K A 328'   
AE4 Software A K   329 ? 5 'binding site for residue K A 329'   
AE5 Software A K   330 ? 1 'binding site for residue K A 330'   
AE6 Software A K   331 ? 1 'binding site for residue K A 331'   
AE7 Software A K   332 ? 4 'binding site for residue K A 332'   
AE8 Software A GOL 333 ? 4 'binding site for residue GOL A 333' 
AE9 Software A GOL 334 ? 5 'binding site for residue GOL A 334' 
AF1 Software A GOL 335 ? 4 'binding site for residue GOL A 335' 
AF2 Software A GOL 336 ? 3 'binding site for residue GOL A 336' 
AF3 Software A GOL 337 ? 6 'binding site for residue GOL A 337' 
AF4 Software B GOL 201 ? 2 'binding site for residue GOL B 201' 
AF5 Software C MG  302 ? 3 'binding site for residue MG C 302'  
AF6 Software C MG  303 ? 1 'binding site for residue MG C 303'  
AF7 Software E MG  301 ? 2 'binding site for residue MG E 301'  
AF8 Software E MG  302 ? 1 'binding site for residue MG E 302'  
AF9 Software E MG  303 ? 1 'binding site for residue MG E 303'  
AG1 Software E MG  304 ? 1 'binding site for residue MG E 304'  
AG2 Software E MG  305 ? 2 'binding site for residue MG E 305'  
AG3 Software E MG  307 ? 3 'binding site for residue MG E 307'  
AG4 Software E MG  308 ? 1 'binding site for residue MG E 308'  
AG5 Software E MG  309 ? 2 'binding site for residue MG E 309'  
AG6 Software E MG  310 ? 2 'binding site for residue MG E 310'  
AG7 Software E MG  311 ? 1 'binding site for residue MG E 311'  
AG8 Software E MG  312 ? 1 'binding site for residue MG E 312'  
AG9 Software E K   315 ? 4 'binding site for residue K E 315'   
AH1 Software E K   316 ? 2 'binding site for residue K E 316'   
AH2 Software E K   317 ? 1 'binding site for residue K E 317'   
AH3 Software E K   318 ? 3 'binding site for residue K E 318'   
AH4 Software E K   319 ? 4 'binding site for residue K E 319'   
AH5 Software E GOL 320 ? 5 'binding site for residue GOL E 320' 
AH6 Software E GOL 321 ? 5 'binding site for residue GOL E 321' 
AH7 Software E GOL 322 ? 4 'binding site for residue GOL E 322' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4 G   A  90  ? G   A 194 . ? 1_555 ? 
2   AC1 4 U   A  91  ? U   A 195 . ? 1_555 ? 
3   AC1 4 G   A  100 ? G   A 204 . ? 1_555 ? 
4   AC1 4 K   JA .   ? K   A 328 . ? 1_555 ? 
5   AC2 2 U   A  28  ? U   A 132 . ? 1_555 ? 
6   AC2 2 G   A  60  ? G   A 164 . ? 1_555 ? 
7   AC3 2 G   A  134 ? G   A 238 . ? 1_555 ? 
8   AC3 2 G   A  135 ? G   A 239 . ? 1_555 ? 
9   AC4 1 U   A  137 ? U   A 241 . ? 1_555 ? 
10  AC5 2 G   A  73  ? G   A 177 . ? 1_555 ? 
11  AC5 2 G   A  74  ? G   A 178 . ? 1_555 ? 
12  AC6 2 C   A  92  ? C   A 196 . ? 1_555 ? 
13  AC6 2 G   A  94  ? G   A 198 . ? 1_555 ? 
14  AC7 1 G   A  94  ? G   A 198 . ? 1_555 ? 
15  AC8 1 G   A  71  ? G   A 175 . ? 1_555 ? 
16  AC9 1 G   A  48  ? G   A 152 . ? 1_555 ? 
17  AD1 2 G   A  64  ? G   A 168 . ? 1_555 ? 
18  AD1 2 SER C  106 ? SER C 157 . ? 1_555 ? 
19  AD2 1 G   A  134 ? G   A 238 . ? 1_555 ? 
20  AD3 2 C   A  25  ? C   A 129 . ? 1_555 ? 
21  AD3 2 A   A  26  ? A   A 130 . ? 1_555 ? 
22  AD4 2 G   A  133 ? G   A 237 . ? 1_555 ? 
23  AD4 2 G   A  134 ? G   A 238 . ? 1_555 ? 
24  AD5 3 G   A  105 ? G   A 209 . ? 1_555 ? 
25  AD5 3 G   A  106 ? G   A 210 . ? 1_555 ? 
26  AD5 3 K   NA .   ? K   A 332 . ? 1_555 ? 
27  AD6 1 C   A  116 ? C   A 220 . ? 1_555 ? 
28  AD7 1 A   A  80  ? A   A 184 . ? 1_555 ? 
29  AD8 1 C   A  7   ? C   A 111 . ? 1_555 ? 
30  AD9 1 U   A  28  ? U   A 132 . ? 1_555 ? 
31  AE1 1 GOL OA .   ? GOL A 333 . ? 1_555 ? 
32  AE2 1 G   A  106 ? G   A 210 . ? 1_555 ? 
33  AE3 4 G   A  89  ? G   A 193 . ? 1_555 ? 
34  AE3 4 G   A  90  ? G   A 194 . ? 1_555 ? 
35  AE3 4 U   A  91  ? U   A 195 . ? 1_555 ? 
36  AE3 4 MG  I  .   ? MG  A 301 . ? 1_555 ? 
37  AE4 5 G   A  5   ? G   A 109 . ? 1_555 ? 
38  AE4 5 U   A  6   ? U   A 110 . ? 1_555 ? 
39  AE4 5 U   A  137 ? U   A 241 . ? 1_555 ? 
40  AE4 5 G   A  139 ? G   A 243 . ? 1_555 ? 
41  AE4 5 C   A  140 ? C   A 244 . ? 1_555 ? 
42  AE5 1 GOL QA .   ? GOL A 335 . ? 1_555 ? 
43  AE6 1 GOL RA .   ? GOL A 336 . ? 1_555 ? 
44  AE7 4 C   A  81  ? C   A 185 . ? 1_555 ? 
45  AE7 4 G   A  106 ? G   A 210 . ? 1_555 ? 
46  AE7 4 U   A  107 ? U   A 211 . ? 1_555 ? 
47  AE7 4 MG  Z  .   ? MG  A 318 . ? 1_555 ? 
48  AE8 4 C   A  87  ? C   A 191 . ? 1_555 ? 
49  AE8 4 A   A  101 ? A   A 205 . ? 1_555 ? 
50  AE8 4 G   A  102 ? G   A 206 . ? 1_555 ? 
51  AE8 4 MG  FA .   ? MG  A 324 . ? 1_555 ? 
52  AE9 5 A   A  23  ? A   A 127 . ? 1_555 ? 
53  AE9 5 U   A  24  ? U   A 128 . ? 1_555 ? 
54  AE9 5 C   A  117 ? C   A 221 . ? 1_555 ? 
55  AE9 5 G   A  118 ? G   A 222 . ? 1_555 ? 
56  AE9 5 U   A  119 ? U   A 223 . ? 1_555 ? 
57  AF1 4 G   A  75  ? G   A 179 . ? 1_555 ? 
58  AF1 4 U   A  77  ? U   A 181 . ? 1_555 ? 
59  AF1 4 K   LA .   ? K   A 330 . ? 1_555 ? 
60  AF1 4 GOL SA .   ? GOL A 337 . ? 1_555 ? 
61  AF2 3 C   A  85  ? C   A 189 . ? 1_555 ? 
62  AF2 3 A   A  101 ? A   A 205 . ? 1_555 ? 
63  AF2 3 K   MA .   ? K   A 331 . ? 1_555 ? 
64  AF3 6 G   A  75  ? G   A 179 . ? 1_555 ? 
65  AF3 6 G   A  76  ? G   A 180 . ? 1_555 ? 
66  AF3 6 A   A  112 ? A   A 216 . ? 1_555 ? 
67  AF3 6 C   A  113 ? C   A 217 . ? 1_555 ? 
68  AF3 6 U   A  114 ? U   A 218 . ? 1_555 ? 
69  AF3 6 GOL QA .   ? GOL A 335 . ? 1_555 ? 
70  AF4 2 ASN B  59  ? ASN B 59  . ? 1_555 ? 
71  AF4 2 GLN B  88  ? GLN B 88  . ? 1_555 ? 
72  AF5 3 GLN C  19  ? GLN C 70  . ? 1_555 ? 
73  AF5 3 ARG C  185 ? ARG C 236 . ? 1_555 ? 
74  AF5 3 GLU C  188 ? GLU C 239 . ? 1_555 ? 
75  AF6 1 U   A  63  ? U   A 167 . ? 1_555 ? 
76  AF7 2 U   E  28  ? U   E 132 . ? 1_555 ? 
77  AF7 2 G   E  60  ? G   E 164 . ? 1_555 ? 
78  AF8 1 G   E  131 ? G   E 235 . ? 1_555 ? 
79  AF9 1 U   E  107 ? U   E 211 . ? 1_555 ? 
80  AG1 1 G   E  42  ? G   E 146 . ? 1_555 ? 
81  AG2 2 G   E  31  ? G   E 135 . ? 1_555 ? 
82  AG2 2 G   E  32  ? G   E 136 . ? 1_555 ? 
83  AG3 3 C   E  81  ? C   E 185 . ? 1_555 ? 
84  AG3 3 A   E  104 ? A   E 208 . ? 1_555 ? 
85  AG3 3 G   E  105 ? G   E 209 . ? 1_555 ? 
86  AG4 1 G   E  102 ? G   E 206 . ? 1_555 ? 
87  AG5 2 G   E  134 ? G   E 238 . ? 1_555 ? 
88  AG5 2 G   E  135 ? G   E 239 . ? 1_555 ? 
89  AG6 2 U   E  132 ? U   E 236 . ? 1_555 ? 
90  AG6 2 G   E  133 ? G   E 237 . ? 1_555 ? 
91  AG7 1 G   E  94  ? G   E 198 . ? 1_555 ? 
92  AG8 1 G   E  94  ? G   E 198 . ? 1_555 ? 
93  AG9 4 G   E  90  ? G   E 194 . ? 1_555 ? 
94  AG9 4 U   E  91  ? U   E 195 . ? 1_555 ? 
95  AG9 4 G   E  100 ? G   E 204 . ? 1_555 ? 
96  AG9 4 GOL RB .   ? GOL E 321 . ? 1_555 ? 
97  AH1 2 U   E  77  ? U   E 181 . ? 1_555 ? 
98  AH1 2 GOL QB .   ? GOL E 320 . ? 1_555 ? 
99  AH2 1 U   E  119 ? U   E 223 . ? 1_555 ? 
100 AH3 3 C   E  113 ? C   E 217 . ? 1_555 ? 
101 AH3 3 U   E  114 ? U   E 218 . ? 1_555 ? 
102 AH3 3 GOL SB .   ? GOL E 322 . ? 1_555 ? 
103 AH4 4 G   E  5   ? G   E 109 . ? 1_555 ? 
104 AH4 4 U   E  6   ? U   E 110 . ? 1_555 ? 
105 AH4 4 U   E  137 ? U   E 241 . ? 1_555 ? 
106 AH4 4 G   E  139 ? G   E 243 . ? 1_555 ? 
107 AH5 5 G   E  75  ? G   E 179 . ? 1_555 ? 
108 AH5 5 G   E  76  ? G   E 180 . ? 1_555 ? 
109 AH5 5 U   E  77  ? U   E 181 . ? 1_555 ? 
110 AH5 5 K   MB .   ? K   E 316 . ? 1_555 ? 
111 AH5 5 GOL SB .   ? GOL E 322 . ? 1_555 ? 
112 AH6 5 A   E  88  ? A   E 192 . ? 1_555 ? 
113 AH6 5 G   E  89  ? G   E 193 . ? 1_555 ? 
114 AH6 5 G   E  99  ? G   E 203 . ? 1_555 ? 
115 AH6 5 G   E  100 ? G   E 204 . ? 1_555 ? 
116 AH6 5 K   LB .   ? K   E 315 . ? 1_555 ? 
117 AH7 4 G   E  74  ? G   E 178 . ? 1_555 ? 
118 AH7 4 G   E  75  ? G   E 179 . ? 1_555 ? 
119 AH7 4 K   OB .   ? K   E 318 . ? 1_555 ? 
120 AH7 4 GOL QB .   ? GOL E 320 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5M73 
_atom_sites.fract_transf_matrix[1][1]   0.007431 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007178 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006568 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
K  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
HETATM 1     P  PG    . GTP A  1 1   ? -22.921 87.262  -20.438 1.00 305.31 ? 105 GTP A PG    1 
HETATM 2     O  O1G   . GTP A  1 1   ? -22.470 86.426  -21.612 1.00 306.71 ? 105 GTP A O1G   1 
HETATM 3     O  O2G   . GTP A  1 1   ? -22.004 88.452  -20.293 1.00 306.45 ? 105 GTP A O2G   1 
HETATM 4     O  O3G   . GTP A  1 1   ? -22.867 86.440  -19.175 1.00 305.78 ? 105 GTP A O3G   1 
HETATM 5     O  O3B   . GTP A  1 1   ? -24.419 87.791  -20.708 1.00 303.61 ? 105 GTP A O3B   1 
HETATM 6     P  PB    . GTP A  1 1   ? -25.533 86.869  -21.417 1.00 289.19 ? 105 GTP A PB    1 
HETATM 7     O  O1B   . GTP A  1 1   ? -25.665 87.265  -22.867 1.00 290.34 ? 105 GTP A O1B   1 
HETATM 8     O  O2B   . GTP A  1 1   ? -25.181 85.408  -21.290 1.00 291.57 ? 105 GTP A O2B   1 
HETATM 9     O  O3A   . GTP A  1 1   ? -26.895 87.211  -20.637 1.00 271.02 ? 105 GTP A O3A   1 
HETATM 10    P  PA    . GTP A  1 1   ? -27.457 86.248  -19.481 1.00 254.31 ? 105 GTP A PA    1 
HETATM 11    O  O1A   . GTP A  1 1   ? -27.766 84.875  -20.022 1.00 255.05 ? 105 GTP A O1A   1 
HETATM 12    O  O2A   . GTP A  1 1   ? -28.695 86.881  -18.899 1.00 254.18 ? 105 GTP A O2A   1 
HETATM 13    O  "O5'" . GTP A  1 1   ? -26.277 86.178  -18.382 1.00 238.39 ? 105 GTP A "O5'" 1 
HETATM 14    C  "C5'" . GTP A  1 1   ? -25.478 85.014  -18.239 1.00 222.78 ? 105 GTP A "C5'" 1 
HETATM 15    C  "C4'" . GTP A  1 1   ? -25.863 84.241  -16.982 1.00 205.00 ? 105 GTP A "C4'" 1 
HETATM 16    O  "O4'" . GTP A  1 1   ? -27.265 84.303  -16.845 1.00 202.14 ? 105 GTP A "O4'" 1 
HETATM 17    C  "C3'" . GTP A  1 1   ? -25.561 82.744  -16.997 1.00 189.14 ? 105 GTP A "C3'" 1 
HETATM 18    O  "O3'" . GTP A  1 1   ? -24.270 82.390  -16.543 1.00 173.01 ? 105 GTP A "O3'" 1 
HETATM 19    C  "C2'" . GTP A  1 1   ? -26.583 82.223  -16.018 1.00 193.13 ? 105 GTP A "C2'" 1 
HETATM 20    O  "O2'" . GTP A  1 1   ? -26.030 82.319  -14.731 1.00 190.75 ? 105 GTP A "O2'" 1 
HETATM 21    C  "C1'" . GTP A  1 1   ? -27.741 83.188  -16.123 1.00 198.93 ? 105 GTP A "C1'" 1 
HETATM 22    N  N9    . GTP A  1 1   ? -28.838 82.544  -16.860 1.00 200.73 ? 105 GTP A N9    1 
HETATM 23    C  C8    . GTP A  1 1   ? -29.257 82.832  -18.131 1.00 200.00 ? 105 GTP A C8    1 
HETATM 24    N  N7    . GTP A  1 1   ? -30.301 82.026  -18.426 1.00 201.04 ? 105 GTP A N7    1 
HETATM 25    C  C5    . GTP A  1 1   ? -30.561 81.240  -17.360 1.00 202.55 ? 105 GTP A C5    1 
HETATM 26    C  C6    . GTP A  1 1   ? -31.510 80.254  -17.128 1.00 204.64 ? 105 GTP A C6    1 
HETATM 27    O  O6    . GTP A  1 1   ? -32.329 79.953  -17.995 1.00 204.14 ? 105 GTP A O6    1 
HETATM 28    N  N1    . GTP A  1 1   ? -31.528 79.609  -15.912 1.00 207.51 ? 105 GTP A N1    1 
HETATM 29    C  C2    . GTP A  1 1   ? -30.614 79.941  -14.934 1.00 207.32 ? 105 GTP A C2    1 
HETATM 30    N  N2    . GTP A  1 1   ? -30.641 79.313  -13.763 1.00 208.78 ? 105 GTP A N2    1 
HETATM 31    N  N3    . GTP A  1 1   ? -29.674 80.923  -15.173 1.00 205.06 ? 105 GTP A N3    1 
HETATM 32    C  C4    . GTP A  1 1   ? -29.649 81.560  -16.366 1.00 203.40 ? 105 GTP A C4    1 
ATOM   33    P  P     . G   A  1 2   ? -23.485 81.121  -17.222 1.00 308.28 ? 106 G   A P     1 
ATOM   34    O  OP1   . G   A  1 2   ? -22.075 80.955  -16.790 1.00 306.59 ? 106 G   A OP1   1 
ATOM   35    O  OP2   . G   A  1 2   ? -23.866 80.808  -18.620 1.00 308.26 ? 106 G   A OP2   1 
ATOM   36    O  "O5'" . G   A  1 2   ? -24.357 80.193  -16.273 1.00 268.53 ? 106 G   A "O5'" 1 
ATOM   37    C  "C5'" . G   A  1 2   ? -23.881 79.834  -14.989 1.00 233.21 ? 106 G   A "C5'" 1 
ATOM   38    C  "C4'" . G   A  1 2   ? -24.828 78.895  -14.287 1.00 206.45 ? 106 G   A "C4'" 1 
ATOM   39    O  "O4'" . G   A  1 2   ? -26.200 79.285  -14.523 1.00 196.67 ? 106 G   A "O4'" 1 
ATOM   40    C  "C3'" . G   A  1 2   ? -24.765 77.443  -14.722 1.00 196.85 ? 106 G   A "C3'" 1 
ATOM   41    O  "O3'" . G   A  1 2   ? -23.715 76.761  -14.069 1.00 196.03 ? 106 G   A "O3'" 1 
ATOM   42    C  "C2'" . G   A  1 2   ? -26.147 76.918  -14.349 1.00 185.26 ? 106 G   A "C2'" 1 
ATOM   43    O  "O2'" . G   A  1 2   ? -26.210 76.609  -12.967 1.00 174.10 ? 106 G   A "O2'" 1 
ATOM   44    C  "C1'" . G   A  1 2   ? -27.021 78.144  -14.596 1.00 187.29 ? 106 G   A "C1'" 1 
ATOM   45    N  N9    . G   A  1 2   ? -27.706 78.139  -15.900 1.00 178.48 ? 106 G   A N9    1 
ATOM   46    C  C8    . G   A  1 2   ? -27.429 78.954  -16.969 1.00 178.92 ? 106 G   A C8    1 
ATOM   47    N  N7    . G   A  1 2   ? -28.218 78.750  -17.986 1.00 180.55 ? 106 G   A N7    1 
ATOM   48    C  C5    . G   A  1 2   ? -29.074 77.752  -17.556 1.00 177.92 ? 106 G   A C5    1 
ATOM   49    C  C6    . G   A  1 2   ? -30.139 77.125  -18.237 1.00 178.68 ? 106 G   A C6    1 
ATOM   50    O  O6    . G   A  1 2   ? -30.543 77.346  -19.383 1.00 179.79 ? 106 G   A O6    1 
ATOM   51    N  N1    . G   A  1 2   ? -30.748 76.164  -17.442 1.00 168.40 ? 106 G   A N1    1 
ATOM   52    C  C2    . G   A  1 2   ? -30.380 75.843  -16.157 1.00 167.66 ? 106 G   A C2    1 
ATOM   53    N  N2    . G   A  1 2   ? -31.095 74.877  -15.556 1.00 177.00 ? 106 G   A N2    1 
ATOM   54    N  N3    . G   A  1 2   ? -29.382 76.430  -15.511 1.00 169.56 ? 106 G   A N3    1 
ATOM   55    C  C4    . G   A  1 2   ? -28.778 77.367  -16.268 1.00 173.72 ? 106 G   A C4    1 
ATOM   56    P  P     . G   A  1 3   ? -22.981 75.524  -14.759 1.00 162.49 ? 107 G   A P     1 
ATOM   57    O  OP1   . G   A  1 3   ? -21.980 75.104  -13.752 1.00 161.50 ? 107 G   A OP1   1 
ATOM   58    O  OP2   . G   A  1 3   ? -22.546 75.808  -16.150 1.00 162.52 ? 107 G   A OP2   1 
ATOM   59    O  "O5'" . G   A  1 3   ? -24.155 74.471  -14.884 1.00 160.87 ? 107 G   A "O5'" 1 
ATOM   60    C  "C5'" . G   A  1 3   ? -24.569 73.701  -13.775 1.00 159.81 ? 107 G   A "C5'" 1 
ATOM   61    C  "C4'" . G   A  1 3   ? -25.698 72.784  -14.160 1.00 164.64 ? 107 G   A "C4'" 1 
ATOM   62    O  "O4'" . G   A  1 3   ? -26.820 73.545  -14.675 1.00 160.55 ? 107 G   A "O4'" 1 
ATOM   63    C  "C3'" . G   A  1 3   ? -25.397 71.794  -15.273 1.00 158.68 ? 107 G   A "C3'" 1 
ATOM   64    O  "O3'" . G   A  1 3   ? -24.641 70.677  -14.850 1.00 153.72 ? 107 G   A "O3'" 1 
ATOM   65    C  "C2'" . G   A  1 3   ? -26.791 71.434  -15.769 1.00 156.13 ? 107 G   A "C2'" 1 
ATOM   66    O  "O2'" . G   A  1 3   ? -27.425 70.517  -14.889 1.00 154.92 ? 107 G   A "O2'" 1 
ATOM   67    C  "C1'" . G   A  1 3   ? -27.503 72.778  -15.649 1.00 166.30 ? 107 G   A "C1'" 1 
ATOM   68    N  N9    . G   A  1 3   ? -27.548 73.513  -16.924 1.00 168.48 ? 107 G   A N9    1 
ATOM   69    C  C8    . G   A  1 3   ? -26.803 74.596  -17.332 1.00 169.87 ? 107 G   A C8    1 
ATOM   70    N  N7    . G   A  1 3   ? -27.132 75.001  -18.534 1.00 162.92 ? 107 G   A N7    1 
ATOM   71    C  C5    . G   A  1 3   ? -28.152 74.137  -18.933 1.00 171.20 ? 107 G   A C5    1 
ATOM   72    C  C6    . G   A  1 3   ? -28.913 74.067  -20.133 1.00 169.73 ? 107 G   A C6    1 
ATOM   73    O  O6    . G   A  1 3   ? -28.843 74.783  -21.136 1.00 163.32 ? 107 G   A O6    1 
ATOM   74    N  N1    . G   A  1 3   ? -29.837 73.024  -20.101 1.00 160.72 ? 107 G   A N1    1 
ATOM   75    C  C2    . G   A  1 3   ? -30.014 72.163  -19.051 1.00 159.30 ? 107 G   A C2    1 
ATOM   76    N  N2    . G   A  1 3   ? -30.955 71.226  -19.186 1.00 158.23 ? 107 G   A N2    1 
ATOM   77    N  N3    . G   A  1 3   ? -29.320 72.212  -17.932 1.00 159.01 ? 107 G   A N3    1 
ATOM   78    C  C4    . G   A  1 3   ? -28.416 73.213  -17.945 1.00 169.55 ? 107 G   A C4    1 
ATOM   79    P  P     . U   A  1 4   ? -23.556 70.039  -15.845 1.00 166.21 ? 108 U   A P     1 
ATOM   80    O  OP1   . U   A  1 4   ? -22.811 68.993  -15.098 1.00 160.85 ? 108 U   A OP1   1 
ATOM   81    O  OP2   . U   A  1 4   ? -22.838 71.161  -16.498 1.00 153.53 ? 108 U   A OP2   1 
ATOM   82    O  "O5'" . U   A  1 4   ? -24.431 69.311  -16.959 1.00 167.18 ? 108 U   A "O5'" 1 
ATOM   83    C  "C5'" . U   A  1 4   ? -25.379 68.317  -16.603 1.00 149.45 ? 108 U   A "C5'" 1 
ATOM   84    C  "C4'" . U   A  1 4   ? -26.394 68.081  -17.695 1.00 149.42 ? 108 U   A "C4'" 1 
ATOM   85    O  "O4'" . U   A  1 4   ? -27.088 69.316  -18.008 1.00 171.18 ? 108 U   A "O4'" 1 
ATOM   86    C  "C3'" . U   A  1 4   ? -25.868 67.605  -19.038 1.00 148.18 ? 108 U   A "C3'" 1 
ATOM   87    O  "O3'" . U   A  1 4   ? -25.595 66.214  -19.050 1.00 145.68 ? 108 U   A "O3'" 1 
ATOM   88    C  "C2'" . U   A  1 4   ? -26.983 68.017  -19.991 1.00 149.43 ? 108 U   A "C2'" 1 
ATOM   89    O  "O2'" . U   A  1 4   ? -28.055 67.096  -19.909 1.00 148.48 ? 108 U   A "O2'" 1 
ATOM   90    C  "C1'" . U   A  1 4   ? -27.452 69.337  -19.373 1.00 169.66 ? 108 U   A "C1'" 1 
ATOM   91    N  N1    . U   A  1 4   ? -26.858 70.542  -20.025 1.00 169.98 ? 108 U   A N1    1 
ATOM   92    C  C2    . U   A  1 4   ? -27.385 71.035  -21.221 1.00 155.01 ? 108 U   A C2    1 
ATOM   93    O  O2    . U   A  1 4   ? -28.334 70.549  -21.802 1.00 154.71 ? 108 U   A O2    1 
ATOM   94    N  N3    . U   A  1 4   ? -26.760 72.140  -21.734 1.00 156.63 ? 108 U   A N3    1 
ATOM   95    C  C4    . U   A  1 4   ? -25.684 72.816  -21.202 1.00 166.34 ? 108 U   A C4    1 
ATOM   96    O  O4    . U   A  1 4   ? -25.234 73.810  -21.784 1.00 170.46 ? 108 U   A O4    1 
ATOM   97    C  C5    . U   A  1 4   ? -25.192 72.264  -19.979 1.00 162.63 ? 108 U   A C5    1 
ATOM   98    C  C6    . U   A  1 4   ? -25.780 71.186  -19.452 1.00 154.51 ? 108 U   A C6    1 
ATOM   99    P  P     . G   A  1 5   ? -24.327 65.615  -19.835 1.00 144.09 ? 109 G   A P     1 
ATOM   100   O  OP1   . G   A  1 5   ? -24.181 64.212  -19.413 1.00 141.81 ? 109 G   A OP1   1 
ATOM   101   O  OP2   . G   A  1 5   ? -23.171 66.530  -19.708 1.00 152.02 ? 109 G   A OP2   1 
ATOM   102   O  "O5'" . G   A  1 5   ? -24.762 65.668  -21.358 1.00 144.30 ? 109 G   A "O5'" 1 
ATOM   103   C  "C5'" . G   A  1 5   ? -24.939 64.471  -22.092 1.00 142.47 ? 109 G   A "C5'" 1 
ATOM   104   C  "C4'" . G   A  1 5   ? -26.029 64.637  -23.112 1.00 143.25 ? 109 G   A "C4'" 1 
ATOM   105   O  "O4'" . G   A  1 5   ? -26.811 65.807  -22.781 1.00 145.51 ? 109 G   A "O4'" 1 
ATOM   106   C  "C3'" . G   A  1 5   ? -25.555 64.891  -24.530 1.00 143.46 ? 109 G   A "C3'" 1 
ATOM   107   O  "O3'" . G   A  1 5   ? -25.219 63.700  -25.214 1.00 141.53 ? 109 G   A "O3'" 1 
ATOM   108   C  "C2'" . G   A  1 5   ? -26.726 65.644  -25.141 1.00 145.27 ? 109 G   A "C2'" 1 
ATOM   109   O  "O2'" . G   A  1 5   ? -27.783 64.761  -25.472 1.00 144.51 ? 109 G   A "O2'" 1 
ATOM   110   C  "C1'" . G   A  1 5   ? -27.186 66.486  -23.957 1.00 146.85 ? 109 G   A "C1'" 1 
ATOM   111   N  N9    . G   A  1 5   ? -26.579 67.839  -23.942 1.00 165.25 ? 109 G   A N9    1 
ATOM   112   C  C8    . G   A  1 5   ? -25.894 68.460  -22.921 1.00 167.84 ? 109 G   A C8    1 
ATOM   113   N  N7    . G   A  1 5   ? -25.492 69.678  -23.183 1.00 169.90 ? 109 G   A N7    1 
ATOM   114   C  C5    . G   A  1 5   ? -25.944 69.894  -24.471 1.00 169.28 ? 109 G   A C5    1 
ATOM   115   C  C6    . G   A  1 5   ? -25.813 71.024  -25.315 1.00 153.81 ? 109 G   A C6    1 
ATOM   116   O  O6    . G   A  1 5   ? -25.262 72.109  -25.108 1.00 155.46 ? 109 G   A O6    1 
ATOM   117   N  N1    . G   A  1 5   ? -26.427 70.794  -26.543 1.00 163.71 ? 109 G   A N1    1 
ATOM   118   C  C2    . G   A  1 5   ? -27.065 69.630  -26.908 1.00 163.19 ? 109 G   A C2    1 
ATOM   119   N  N2    . G   A  1 5   ? -27.599 69.557  -28.129 1.00 164.32 ? 109 G   A N2    1 
ATOM   120   N  N3    . G   A  1 5   ? -27.189 68.579  -26.138 1.00 161.39 ? 109 G   A N3    1 
ATOM   121   C  C4    . G   A  1 5   ? -26.614 68.776  -24.944 1.00 164.82 ? 109 G   A C4    1 
ATOM   122   P  P     . U   A  1 6   ? -23.761 63.513  -25.851 1.00 140.72 ? 110 U   A P     1 
ATOM   123   O  OP1   . U   A  1 6   ? -23.535 62.067  -25.969 1.00 138.59 ? 110 U   A OP1   1 
ATOM   124   O  OP2   . U   A  1 6   ? -22.801 64.254  -25.004 1.00 141.42 ? 110 U   A OP2   1 
ATOM   125   O  "O5'" . U   A  1 6   ? -23.889 64.108  -27.325 1.00 141.76 ? 110 U   A "O5'" 1 
ATOM   126   C  "C5'" . U   A  1 6   ? -25.004 63.778  -28.143 1.00 141.83 ? 110 U   A "C5'" 1 
ATOM   127   C  "C4'" . U   A  1 6   ? -25.294 64.849  -29.169 1.00 153.35 ? 110 U   A "C4'" 1 
ATOM   128   O  "O4'" . U   A  1 6   ? -25.750 66.060  -28.505 1.00 161.84 ? 110 U   A "O4'" 1 
ATOM   129   C  "C3'" . U   A  1 6   ? -24.120 65.309  -30.022 1.00 150.78 ? 110 U   A "C3'" 1 
ATOM   130   O  "O3'" . U   A  1 6   ? -23.865 64.442  -31.124 1.00 142.71 ? 110 U   A "O3'" 1 
ATOM   131   C  "C2'" . U   A  1 6   ? -24.556 66.713  -30.455 1.00 154.90 ? 110 U   A "C2'" 1 
ATOM   132   O  "O2'" . U   A  1 6   ? -25.467 66.650  -31.541 1.00 146.77 ? 110 U   A "O2'" 1 
ATOM   133   C  "C1'" . U   A  1 6   ? -25.338 67.197  -29.231 1.00 157.95 ? 110 U   A "C1'" 1 
ATOM   134   N  N1    . U   A  1 6   ? -24.564 68.090  -28.335 1.00 148.25 ? 110 U   A N1    1 
ATOM   135   C  C2    . U   A  1 6   ? -24.132 69.315  -28.801 1.00 150.06 ? 110 U   A C2    1 
ATOM   136   O  O2    . U   A  1 6   ? -24.321 69.708  -29.933 1.00 150.87 ? 110 U   A O2    1 
ATOM   137   N  N3    . U   A  1 6   ? -23.431 70.078  -27.900 1.00 155.62 ? 110 U   A N3    1 
ATOM   138   C  C4    . U   A  1 6   ? -23.141 69.748  -26.592 1.00 155.41 ? 110 U   A C4    1 
ATOM   139   O  O4    . U   A  1 6   ? -22.507 70.526  -25.881 1.00 158.47 ? 110 U   A O4    1 
ATOM   140   C  C5    . U   A  1 6   ? -23.639 68.481  -26.178 1.00 148.37 ? 110 U   A C5    1 
ATOM   141   C  C6    . U   A  1 6   ? -24.323 67.729  -27.037 1.00 147.48 ? 110 U   A C6    1 
ATOM   142   P  P     . C   A  1 7   ? -22.613 63.427  -31.142 1.00 140.84 ? 111 C   A P     1 
ATOM   143   O  OP1   . C   A  1 7   ? -22.540 62.840  -32.496 1.00 140.27 ? 111 C   A OP1   1 
ATOM   144   O  OP2   . C   A  1 7   ? -22.724 62.554  -29.967 1.00 139.50 ? 111 C   A OP2   1 
ATOM   145   O  "O5'" . C   A  1 7   ? -21.313 64.334  -30.957 1.00 158.31 ? 111 C   A "O5'" 1 
ATOM   146   C  "C5'" . C   A  1 7   ? -20.738 65.015  -32.064 1.00 157.04 ? 111 C   A "C5'" 1 
ATOM   147   C  "C4'" . C   A  1 7   ? -19.424 65.679  -31.724 1.00 143.24 ? 111 C   A "C4'" 1 
ATOM   148   O  "O4'" . C   A  1 7   ? -19.618 66.581  -30.613 1.00 144.43 ? 111 C   A "O4'" 1 
ATOM   149   C  "C3'" . C   A  1 7   ? -18.283 64.787  -31.269 1.00 149.44 ? 111 C   A "C3'" 1 
ATOM   150   O  "O3'" . C   A  1 7   ? -17.612 64.155  -32.351 1.00 145.92 ? 111 C   A "O3'" 1 
ATOM   151   C  "C2'" . C   A  1 7   ? -17.399 65.764  -30.490 1.00 142.95 ? 111 C   A "C2'" 1 
ATOM   152   O  "O2'" . C   A  1 7   ? -16.600 66.547  -31.361 1.00 144.10 ? 111 C   A "O2'" 1 
ATOM   153   C  "C1'" . C   A  1 7   ? -18.423 66.711  -29.890 1.00 144.35 ? 111 C   A "C1'" 1 
ATOM   154   N  N1    . C   A  1 7   ? -18.706 66.479  -28.473 1.00 143.95 ? 111 C   A N1    1 
ATOM   155   C  C2    . C   A  1 7   ? -17.707 66.615  -27.520 1.00 143.98 ? 111 C   A C2    1 
ATOM   156   O  O2    . C   A  1 7   ? -16.545 66.867  -27.844 1.00 144.29 ? 111 C   A O2    1 
ATOM   157   N  N3    . C   A  1 7   ? -18.040 66.430  -26.240 1.00 143.69 ? 111 C   A N3    1 
ATOM   158   C  C4    . C   A  1 7   ? -19.292 66.165  -25.915 1.00 143.45 ? 111 C   A C4    1 
ATOM   159   N  N4    . C   A  1 7   ? -19.576 65.993  -24.625 1.00 143.22 ? 111 C   A N4    1 
ATOM   160   C  C5    . C   A  1 7   ? -20.328 66.059  -26.877 1.00 143.53 ? 111 C   A C5    1 
ATOM   161   C  C6    . C   A  1 7   ? -19.994 66.234  -28.144 1.00 143.79 ? 111 C   A C6    1 
ATOM   162   P  P     . C   A  1 8   ? -17.083 62.640  -32.232 1.00 139.06 ? 112 C   A P     1 
ATOM   163   O  OP1   . C   A  1 8   ? -16.715 62.211  -33.606 1.00 138.79 ? 112 C   A OP1   1 
ATOM   164   O  OP2   . C   A  1 8   ? -18.087 61.899  -31.440 1.00 138.04 ? 112 C   A OP2   1 
ATOM   165   O  "O5'" . C   A  1 8   ? -15.740 62.735  -31.380 1.00 139.07 ? 112 C   A "O5'" 1 
ATOM   166   C  "C5'" . C   A  1 8   ? -14.583 63.298  -31.977 1.00 139.95 ? 112 C   A "C5'" 1 
ATOM   167   C  "C4'" . C   A  1 8   ? -13.405 63.344  -31.043 1.00 140.05 ? 112 C   A "C4'" 1 
ATOM   168   O  "O4'" . C   A  1 8   ? -13.838 63.898  -29.781 1.00 140.53 ? 112 C   A "O4'" 1 
ATOM   169   C  "C3'" . C   A  1 8   ? -12.730 62.034  -30.703 1.00 138.56 ? 112 C   A "C3'" 1 
ATOM   170   O  "O3'" . C   A  1 8   ? -11.373 62.327  -30.430 1.00 139.24 ? 112 C   A "O3'" 1 
ATOM   171   C  "C2'" . C   A  1 8   ? -13.372 61.661  -29.389 1.00 156.62 ? 112 C   A "C2'" 1 
ATOM   172   O  "O2'" . C   A  1 8   ? -12.566 60.820  -28.601 1.00 178.81 ? 112 C   A "O2'" 1 
ATOM   173   C  "C1'" . C   A  1 8   ? -13.514 63.020  -28.741 1.00 139.37 ? 112 C   A "C1'" 1 
ATOM   174   N  N1    . C   A  1 8   ? -14.612 63.090  -27.802 1.00 139.21 ? 112 C   A N1    1 
ATOM   175   C  C2    . C   A  1 8   ? -14.359 63.275  -26.459 1.00 139.39 ? 112 C   A C2    1 
ATOM   176   O  O2    . C   A  1 8   ? -13.203 63.346  -26.038 1.00 139.67 ? 112 C   A O2    1 
ATOM   177   N  N3    . C   A  1 8   ? -15.413 63.332  -25.636 1.00 139.30 ? 112 C   A N3    1 
ATOM   178   C  C4    . C   A  1 8   ? -16.632 63.241  -26.136 1.00 139.14 ? 112 C   A C4    1 
ATOM   179   N  N4    . C   A  1 8   ? -17.663 63.316  -25.303 1.00 141.19 ? 112 C   A N4    1 
ATOM   180   C  C5    . C   A  1 8   ? -16.897 63.070  -27.518 1.00 139.00 ? 112 C   A C5    1 
ATOM   181   C  C6    . C   A  1 8   ? -15.854 63.007  -28.321 1.00 139.03 ? 112 C   A C6    1 
ATOM   182   P  P     . G   A  1 9   ? -10.347 62.488  -31.638 1.00 139.92 ? 113 G   A P     1 
ATOM   183   O  OP1   . G   A  1 9   ? -9.425  63.595  -31.309 1.00 141.51 ? 113 G   A OP1   1 
ATOM   184   O  OP2   . G   A  1 9   ? -11.148 62.485  -32.886 1.00 139.84 ? 113 G   A OP2   1 
ATOM   185   O  "O5'" . G   A  1 9   ? -9.497  61.142  -31.601 1.00 154.73 ? 113 G   A "O5'" 1 
ATOM   186   C  "C5'" . G   A  1 9   ? -9.727  60.101  -32.546 1.00 155.67 ? 113 G   A "C5'" 1 
ATOM   187   C  "C4'" . G   A  1 9   ? -9.472  58.738  -31.951 1.00 136.30 ? 113 G   A "C4'" 1 
ATOM   188   O  "O4'" . G   A  1 9   ? -8.096  58.364  -32.181 1.00 136.65 ? 113 G   A "O4'" 1 
ATOM   189   C  "C3'" . G   A  1 9   ? -9.688  58.650  -30.452 1.00 135.85 ? 113 G   A "C3'" 1 
ATOM   190   O  "O3'" . G   A  1 9   ? -10.141 57.357  -30.121 1.00 134.31 ? 113 G   A "O3'" 1 
ATOM   191   C  "C2'" . G   A  1 9   ? -8.292  58.831  -29.879 1.00 141.06 ? 113 G   A "C2'" 1 
ATOM   192   O  "O2'" . G   A  1 9   ? -8.126  58.183  -28.635 1.00 135.89 ? 113 G   A "O2'" 1 
ATOM   193   C  "C1'" . G   A  1 9   ? -7.431  58.177  -30.948 1.00 142.06 ? 113 G   A "C1'" 1 
ATOM   194   N  N9    . G   A  1 9   ? -6.105  58.757  -31.114 1.00 138.86 ? 113 G   A N9    1 
ATOM   195   C  C8    . G   A  1 9   ? -5.745  59.463  -32.223 1.00 139.09 ? 113 G   A C8    1 
ATOM   196   N  N7    . G   A  1 9   ? -4.515  59.839  -32.167 1.00 140.27 ? 113 G   A N7    1 
ATOM   197   C  C5    . G   A  1 9   ? -4.025  59.326  -30.989 1.00 139.96 ? 113 G   A C5    1 
ATOM   198   C  C6    . G   A  1 9   ? -2.744  59.416  -30.416 1.00 157.97 ? 113 G   A C6    1 
ATOM   199   O  O6    . G   A  1 9   ? -1.748  59.981  -30.854 1.00 163.58 ? 113 G   A O6    1 
ATOM   200   N  N1    . G   A  1 9   ? -2.655  58.775  -29.200 1.00 140.29 ? 113 G   A N1    1 
ATOM   201   C  C2    . G   A  1 9   ? -3.675  58.121  -28.600 1.00 138.78 ? 113 G   A C2    1 
ATOM   202   N  N2    . G   A  1 9   ? -3.360  57.565  -27.421 1.00 138.40 ? 113 G   A N2    1 
ATOM   203   N  N3    . G   A  1 9   ? -4.886  58.025  -29.128 1.00 137.85 ? 113 G   A N3    1 
ATOM   204   C  C4    . G   A  1 9   ? -4.992  58.644  -30.320 1.00 138.52 ? 113 G   A C4    1 
ATOM   205   P  P     . C   A  1 10  ? -11.464 57.220  -29.250 1.00 133.48 ? 114 C   A P     1 
ATOM   206   O  OP1   . C   A  1 10  ? -11.492 55.823  -28.784 1.00 166.46 ? 114 C   A OP1   1 
ATOM   207   O  OP2   . C   A  1 10  ? -12.603 57.786  -30.011 1.00 133.80 ? 114 C   A OP2   1 
ATOM   208   O  "O5'" . C   A  1 10  ? -11.157 58.027  -27.920 1.00 134.22 ? 114 C   A "O5'" 1 
ATOM   209   C  "C5'" . C   A  1 10  ? -10.793 57.303  -26.763 1.00 133.47 ? 114 C   A "C5'" 1 
ATOM   210   C  "C4'" . C   A  1 10  ? -10.249 58.180  -25.680 1.00 134.51 ? 114 C   A "C4'" 1 
ATOM   211   O  "O4'" . C   A  1 10  ? -11.075 59.360  -25.572 1.00 135.45 ? 114 C   A "O4'" 1 
ATOM   212   C  "C3'" . C   A  1 10  ? -10.328 57.560  -24.301 1.00 156.13 ? 114 C   A "C3'" 1 
ATOM   213   O  "O3'" . C   A  1 10  ? -9.295  56.640  -24.017 1.00 154.77 ? 114 C   A "O3'" 1 
ATOM   214   C  "C2'" . C   A  1 10  ? -10.393 58.767  -23.379 1.00 134.93 ? 114 C   A "C2'" 1 
ATOM   215   O  "O2'" . C   A  1 10  ? -9.107  59.323  -23.199 1.00 136.14 ? 114 C   A "O2'" 1 
ATOM   216   C  "C1'" . C   A  1 10  ? -11.209 59.738  -24.219 1.00 135.74 ? 114 C   A "C1'" 1 
ATOM   217   N  N1    . C   A  1 10  ? -12.649 59.738  -23.905 1.00 135.24 ? 114 C   A N1    1 
ATOM   218   C  C2    . C   A  1 10  ? -13.194 59.925  -22.624 1.00 135.27 ? 114 C   A C2    1 
ATOM   219   O  O2    . C   A  1 10  ? -12.484 60.066  -21.618 1.00 135.63 ? 114 C   A O2    1 
ATOM   220   N  N3    . C   A  1 10  ? -14.543 59.940  -22.511 1.00 134.97 ? 114 C   A N3    1 
ATOM   221   C  C4    . C   A  1 10  ? -15.312 59.797  -23.588 1.00 134.70 ? 114 C   A C4    1 
ATOM   222   N  N4    . C   A  1 10  ? -16.638 59.813  -23.441 1.00 134.56 ? 114 C   A N4    1 
ATOM   223   C  C5    . C   A  1 10  ? -14.774 59.620  -24.888 1.00 134.66 ? 114 C   A C5    1 
ATOM   224   C  C6    . C   A  1 10  ? -13.455 59.604  -24.994 1.00 134.93 ? 114 C   A C6    1 
ATOM   225   P  P     . A   A  1 11  ? -9.667  55.097  -23.798 1.00 131.50 ? 115 A   A P     1 
ATOM   226   O  OP1   . A   A  1 11  ? -8.450  54.303  -24.076 1.00 131.47 ? 115 A   A OP1   1 
ATOM   227   O  OP2   . A   A  1 11  ? -10.957 54.777  -24.446 1.00 130.63 ? 115 A   A OP2   1 
ATOM   228   O  "O5'" . A   A  1 11  ? -9.935  55.041  -22.246 1.00 131.18 ? 115 A   A "O5'" 1 
ATOM   229   C  "C5'" . A   A  1 11  ? -8.935  55.503  -21.368 1.00 132.13 ? 115 A   A "C5'" 1 
ATOM   230   C  "C4'" . A   A  1 11  ? -9.492  55.766  -20.004 1.00 139.67 ? 115 A   A "C4'" 1 
ATOM   231   O  "O4'" . A   A  1 11  ? -10.498 56.801  -20.061 1.00 132.63 ? 115 A   A "O4'" 1 
ATOM   232   C  "C3'" . A   A  1 11  ? -10.207 54.607  -19.343 1.00 147.47 ? 115 A   A "C3'" 1 
ATOM   233   O  "O3'" . A   A  1 11  ? -9.329  53.661  -18.784 1.00 155.02 ? 115 A   A "O3'" 1 
ATOM   234   C  "C2'" . A   A  1 11  ? -11.091 55.304  -18.321 1.00 146.57 ? 115 A   A "C2'" 1 
ATOM   235   O  "O2'" . A   A  1 11  ? -10.319 55.694  -17.196 1.00 131.55 ? 115 A   A "O2'" 1 
ATOM   236   C  "C1'" . A   A  1 11  ? -11.477 56.570  -19.074 1.00 131.94 ? 115 A   A "C1'" 1 
ATOM   237   N  N9    . A   A  1 11  ? -12.801 56.508  -19.714 1.00 131.36 ? 115 A   A N9    1 
ATOM   238   C  C8    . A   A  1 11  ? -13.106 56.420  -21.048 1.00 131.20 ? 115 A   A C8    1 
ATOM   239   N  N7    . A   A  1 11  ? -14.396 56.439  -21.283 1.00 130.86 ? 115 A   A N7    1 
ATOM   240   C  C5    . A   A  1 11  ? -14.977 56.559  -20.028 1.00 132.26 ? 115 A   A C5    1 
ATOM   241   C  C6    . A   A  1 11  ? -16.318 56.633  -19.582 1.00 137.79 ? 115 A   A C6    1 
ATOM   242   N  N6    . A   A  1 11  ? -17.377 56.597  -20.400 1.00 140.78 ? 115 A   A N6    1 
ATOM   243   N  N1    . A   A  1 11  ? -16.557 56.743  -18.247 1.00 140.22 ? 115 A   A N1    1 
ATOM   244   C  C2    . A   A  1 11  ? -15.491 56.777  -17.437 1.00 140.84 ? 115 A   A C2    1 
ATOM   245   N  N3    . A   A  1 11  ? -14.193 56.721  -17.741 1.00 139.37 ? 115 A   A N3    1 
ATOM   246   C  C4    . A   A  1 11  ? -14.000 56.609  -19.061 1.00 131.09 ? 115 A   A C4    1 
ATOM   247   P  P     . C   A  1 12  ? -9.745  52.127  -18.799 1.00 128.34 ? 116 C   A P     1 
ATOM   248   O  OP1   . C   A  1 12  ? -8.474  51.415  -18.544 1.00 128.48 ? 116 C   A OP1   1 
ATOM   249   O  OP2   . C   A  1 12  ? -10.598 51.845  -19.975 1.00 127.68 ? 116 C   A OP2   1 
ATOM   250   O  "O5'" . C   A  1 12  ? -10.694 52.016  -17.539 1.00 127.66 ? 116 C   A "O5'" 1 
ATOM   251   C  "C5'" . C   A  1 12  ? -10.192 52.340  -16.259 1.00 128.22 ? 116 C   A "C5'" 1 
ATOM   252   C  "C4'" . C   A  1 12  ? -11.304 52.480  -15.265 1.00 135.85 ? 116 C   A "C4'" 1 
ATOM   253   O  "O4'" . C   A  1 12  ? -12.155 53.591  -15.648 1.00 131.67 ? 116 C   A "O4'" 1 
ATOM   254   C  "C3'" . C   A  1 12  ? -12.263 51.304  -15.159 1.00 149.16 ? 116 C   A "C3'" 1 
ATOM   255   O  "O3'" . C   A  1 12  ? -11.748 50.220  -14.375 1.00 157.18 ? 116 C   A "O3'" 1 
ATOM   256   C  "C2'" . C   A  1 12  ? -13.508 51.974  -14.581 1.00 153.14 ? 116 C   A "C2'" 1 
ATOM   257   O  "O2'" . C   A  1 12  ? -13.339 52.243  -13.199 1.00 155.26 ? 116 C   A "O2'" 1 
ATOM   258   C  "C1'" . C   A  1 12  ? -13.491 53.316  -15.303 1.00 127.66 ? 116 C   A "C1'" 1 
ATOM   259   N  N1    . C   A  1 12  ? -14.295 53.292  -16.536 1.00 127.35 ? 116 C   A N1    1 
ATOM   260   C  C2    . C   A  1 12  ? -15.678 53.433  -16.455 1.00 127.10 ? 116 C   A C2    1 
ATOM   261   O  O2    . C   A  1 12  ? -16.229 53.562  -15.361 1.00 127.11 ? 116 C   A O2    1 
ATOM   262   N  N3    . C   A  1 12  ? -16.403 53.411  -17.593 1.00 129.63 ? 116 C   A N3    1 
ATOM   263   C  C4    . C   A  1 12  ? -15.790 53.269  -18.767 1.00 134.35 ? 116 C   A C4    1 
ATOM   264   N  N4    . C   A  1 12  ? -16.542 53.258  -19.873 1.00 136.66 ? 116 C   A N4    1 
ATOM   265   C  C5    . C   A  1 12  ? -14.375 53.128  -18.874 1.00 133.92 ? 116 C   A C5    1 
ATOM   266   C  C6    . C   A  1 12  ? -13.677 53.145  -17.740 1.00 130.17 ? 116 C   A C6    1 
ATOM   267   P  P     . U   A  1 13  ? -12.213 48.681  -14.585 1.00 123.78 ? 117 U   A P     1 
ATOM   268   O  OP1   . U   A  1 13  ? -11.559 47.953  -13.472 1.00 130.88 ? 117 U   A OP1   1 
ATOM   269   O  OP2   . U   A  1 13  ? -12.029 48.181  -15.978 1.00 123.51 ? 117 U   A OP2   1 
ATOM   270   O  "O5'" . U   A  1 13  ? -13.757 48.713  -14.229 1.00 123.07 ? 117 U   A "O5'" 1 
ATOM   271   C  "C5'" . U   A  1 13  ? -14.162 49.051  -12.917 1.00 123.20 ? 117 U   A "C5'" 1 
ATOM   272   C  "C4'" . U   A  1 13  ? -15.654 49.014  -12.793 1.00 122.61 ? 117 U   A "C4'" 1 
ATOM   273   O  "O4'" . U   A  1 13  ? -16.226 50.044  -13.624 1.00 123.44 ? 117 U   A "O4'" 1 
ATOM   274   C  "C3'" . U   A  1 13  ? -16.340 47.758  -13.287 1.00 140.57 ? 117 U   A "C3'" 1 
ATOM   275   O  "O3'" . U   A  1 13  ? -16.243 46.666  -12.401 1.00 141.68 ? 117 U   A "O3'" 1 
ATOM   276   C  "C2'" . U   A  1 13  ? -17.756 48.248  -13.521 1.00 134.52 ? 117 U   A "C2'" 1 
ATOM   277   O  "O2'" . U   A  1 13  ? -18.435 48.433  -12.290 1.00 128.92 ? 117 U   A "O2'" 1 
ATOM   278   C  "C1'" . U   A  1 13  ? -17.478 49.619  -14.114 1.00 122.72 ? 117 U   A "C1'" 1 
ATOM   279   N  N1    . U   A  1 13  ? -17.432 49.579  -15.589 1.00 122.75 ? 117 U   A N1    1 
ATOM   280   C  C2    . U   A  1 13  ? -18.658 49.644  -16.207 1.00 122.63 ? 117 U   A C2    1 
ATOM   281   O  O2    . U   A  1 13  ? -19.694 49.721  -15.576 1.00 122.54 ? 117 U   A O2    1 
ATOM   282   N  N3    . U   A  1 13  ? -18.640 49.617  -17.575 1.00 122.71 ? 117 U   A N3    1 
ATOM   283   C  C4    . U   A  1 13  ? -17.534 49.531  -18.380 1.00 122.89 ? 117 U   A C4    1 
ATOM   284   O  O4    . U   A  1 13  ? -17.688 49.509  -19.603 1.00 122.98 ? 117 U   A O4    1 
ATOM   285   C  C5    . U   A  1 13  ? -16.293 49.465  -17.666 1.00 123.06 ? 117 U   A C5    1 
ATOM   286   C  C6    . U   A  1 13  ? -16.276 49.488  -16.326 1.00 122.98 ? 117 U   A C6    1 
ATOM   287   P  P     . A   A  1 14  ? -16.421 45.184  -12.955 1.00 118.99 ? 118 A   A P     1 
ATOM   288   O  OP1   . A   A  1 14  ? -16.179 44.373  -11.741 1.00 121.45 ? 118 A   A OP1   1 
ATOM   289   O  OP2   . A   A  1 14  ? -15.662 44.941  -14.210 1.00 119.16 ? 118 A   A OP2   1 
ATOM   290   O  "O5'" . A   A  1 14  ? -17.951 45.133  -13.358 1.00 118.52 ? 118 A   A "O5'" 1 
ATOM   291   C  "C5'" . A   A  1 14  ? -18.941 45.209  -12.354 1.00 118.29 ? 118 A   A "C5'" 1 
ATOM   292   C  "C4'" . A   A  1 14  ? -20.319 45.222  -12.945 1.00 129.80 ? 118 A   A "C4'" 1 
ATOM   293   O  "O4'" . A   A  1 14  ? -20.478 46.402  -13.761 1.00 119.19 ? 118 A   A "O4'" 1 
ATOM   294   C  "C3'" . A   A  1 14  ? -20.661 44.077  -13.885 1.00 129.14 ? 118 A   A "C3'" 1 
ATOM   295   O  "O3'" . A   A  1 14  ? -21.037 42.905  -13.196 1.00 126.56 ? 118 A   A "O3'" 1 
ATOM   296   C  "C2'" . A   A  1 14  ? -21.779 44.676  -14.719 1.00 126.25 ? 118 A   A "C2'" 1 
ATOM   297   O  "O2'" . A   A  1 14  ? -22.988 44.734  -13.975 1.00 123.32 ? 118 A   A "O2'" 1 
ATOM   298   C  "C1'" . A   A  1 14  ? -21.278 46.103  -14.880 1.00 123.79 ? 118 A   A "C1'" 1 
ATOM   299   N  N9    . A   A  1 14  ? -20.439 46.297  -16.066 1.00 119.32 ? 118 A   A N9    1 
ATOM   300   C  C8    . A   A  1 14  ? -19.069 46.263  -16.117 1.00 119.47 ? 118 A   A C8    1 
ATOM   301   N  N7    . A   A  1 14  ? -18.606 46.530  -17.310 1.00 119.92 ? 118 A   A N7    1 
ATOM   302   C  C5    . A   A  1 14  ? -19.749 46.765  -18.068 1.00 120.05 ? 118 A   A C5    1 
ATOM   303   C  C6    . A   A  1 14  ? -19.947 47.101  -19.410 1.00 120.51 ? 118 A   A C6    1 
ATOM   304   N  N6    . A   A  1 14  ? -18.945 47.272  -20.274 1.00 120.92 ? 118 A   A N6    1 
ATOM   305   N  N1    . A   A  1 14  ? -21.220 47.251  -19.843 1.00 120.63 ? 118 A   A N1    1 
ATOM   306   C  C2    . A   A  1 14  ? -22.234 47.081  -18.991 1.00 120.34 ? 118 A   A C2    1 
ATOM   307   N  N3    . A   A  1 14  ? -22.166 46.774  -17.704 1.00 119.87 ? 118 A   A N3    1 
ATOM   308   C  C4    . A   A  1 14  ? -20.888 46.630  -17.313 1.00 119.72 ? 118 A   A C4    1 
ATOM   309   P  P     . A   A  1 15  ? -20.880 41.472  -13.869 1.00 115.15 ? 119 A   A P     1 
ATOM   310   O  OP1   . A   A  1 15  ? -21.273 40.630  -12.733 1.00 114.34 ? 119 A   A OP1   1 
ATOM   311   O  OP2   . A   A  1 15  ? -19.589 41.280  -14.563 1.00 115.35 ? 119 A   A OP2   1 
ATOM   312   O  "O5'" . A   A  1 15  ? -22.033 41.405  -14.949 1.00 115.13 ? 119 A   A "O5'" 1 
ATOM   313   C  "C5'" . A   A  1 15  ? -23.342 41.041  -14.562 1.00 114.74 ? 119 A   A "C5'" 1 
ATOM   314   C  "C4'" . A   A  1 15  ? -24.342 41.422  -15.613 1.00 115.21 ? 119 A   A "C4'" 1 
ATOM   315   O  "O4'" . A   A  1 15  ? -24.051 42.757  -16.088 1.00 116.30 ? 119 A   A "O4'" 1 
ATOM   316   C  "C3'" . A   A  1 15  ? -24.348 40.574  -16.879 1.00 128.97 ? 119 A   A "C3'" 1 
ATOM   317   O  "O3'" . A   A  1 15  ? -25.040 39.340  -16.731 1.00 126.06 ? 119 A   A "O3'" 1 
ATOM   318   C  "C2'" . A   A  1 15  ? -24.973 41.524  -17.892 1.00 128.69 ? 119 A   A "C2'" 1 
ATOM   319   O  "O2'" . A   A  1 15  ? -26.376 41.607  -17.704 1.00 115.99 ? 119 A   A "O2'" 1 
ATOM   320   C  "C1'" . A   A  1 15  ? -24.362 42.856  -17.462 1.00 116.65 ? 119 A   A "C1'" 1 
ATOM   321   N  N9    . A   A  1 15  ? -23.106 43.126  -18.174 1.00 116.95 ? 119 A   A N9    1 
ATOM   322   C  C8    . A   A  1 15  ? -21.862 43.126  -17.606 1.00 116.87 ? 119 A   A C8    1 
ATOM   323   N  N7    . A   A  1 15  ? -20.898 43.401  -18.439 1.00 117.31 ? 119 A   A N7    1 
ATOM   324   C  C5    . A   A  1 15  ? -21.558 43.579  -19.622 1.00 117.62 ? 119 A   A C5    1 
ATOM   325   C  C6    . A   A  1 15  ? -21.043 43.885  -20.860 1.00 118.16 ? 119 A   A C6    1 
ATOM   326   N  N6    . A   A  1 15  ? -19.734 44.026  -21.029 1.00 118.44 ? 119 A   A N6    1 
ATOM   327   N  N1    . A   A  1 15  ? -21.920 44.009  -21.875 1.00 118.44 ? 119 A   A N1    1 
ATOM   328   C  C2    . A   A  1 15  ? -23.225 43.852  -21.613 1.00 118.27 ? 119 A   A C2    1 
ATOM   329   N  N3    . A   A  1 15  ? -23.829 43.540  -20.469 1.00 117.79 ? 119 A   A N3    1 
ATOM   330   C  C4    . A   A  1 15  ? -22.919 43.434  -19.493 1.00 117.45 ? 119 A   A C4    1 
ATOM   331   P  P     . G   A  1 16  ? -24.848 38.134  -17.781 1.00 121.41 ? 120 G   A P     1 
ATOM   332   O  OP1   . G   A  1 16  ? -26.155 37.665  -18.299 1.00 123.99 ? 120 G   A OP1   1 
ATOM   333   O  OP2   . G   A  1 16  ? -24.014 37.146  -17.079 1.00 112.75 ? 120 G   A OP2   1 
ATOM   334   O  "O5'" . G   A  1 16  ? -23.995 38.766  -18.969 1.00 125.35 ? 120 G   A "O5'" 1 
ATOM   335   C  "C5'" . G   A  1 16  ? -23.905 38.122  -20.235 1.00 124.15 ? 120 G   A "C5'" 1 
ATOM   336   C  "C4'" . G   A  1 16  ? -24.512 38.946  -21.345 1.00 120.73 ? 120 G   A "C4'" 1 
ATOM   337   O  "O4'" . G   A  1 16  ? -24.019 40.304  -21.255 1.00 121.80 ? 120 G   A "O4'" 1 
ATOM   338   C  "C3'" . G   A  1 16  ? -24.157 38.510  -22.765 1.00 120.62 ? 120 G   A "C3'" 1 
ATOM   339   O  "O3'" . G   A  1 16  ? -24.984 37.473  -23.251 1.00 126.19 ? 120 G   A "O3'" 1 
ATOM   340   C  "C2'" . G   A  1 16  ? -24.304 39.795  -23.553 1.00 122.46 ? 120 G   A "C2'" 1 
ATOM   341   O  "O2'" . G   A  1 16  ? -25.676 40.053  -23.801 1.00 126.66 ? 120 G   A "O2'" 1 
ATOM   342   C  "C1'" . G   A  1 16  ? -23.795 40.824  -22.546 1.00 122.85 ? 120 G   A "C1'" 1 
ATOM   343   N  N9    . G   A  1 16  ? -22.345 41.068  -22.663 1.00 122.58 ? 120 G   A N9    1 
ATOM   344   C  C8    . G   A  1 16  ? -21.457 40.946  -21.623 1.00 125.20 ? 120 G   A C8    1 
ATOM   345   N  N7    . G   A  1 16  ? -20.227 41.219  -21.942 1.00 123.49 ? 120 G   A N7    1 
ATOM   346   C  C5    . G   A  1 16  ? -20.307 41.539  -23.274 1.00 119.69 ? 120 G   A C5    1 
ATOM   347   C  C6    . G   A  1 16  ? -19.264 41.902  -24.128 1.00 119.96 ? 120 G   A C6    1 
ATOM   348   O  O6    . G   A  1 16  ? -18.066 42.002  -23.826 1.00 118.20 ? 120 G   A O6    1 
ATOM   349   N  N1    . G   A  1 16  ? -19.758 42.143  -25.408 1.00 120.06 ? 120 G   A N1    1 
ATOM   350   C  C2    . G   A  1 16  ? -21.079 42.049  -25.795 1.00 118.86 ? 120 G   A C2    1 
ATOM   351   N  N2    . G   A  1 16  ? -21.368 42.307  -27.079 1.00 122.76 ? 120 G   A N2    1 
ATOM   352   N  N3    . G   A  1 16  ? -22.055 41.697  -24.985 1.00 118.80 ? 120 G   A N3    1 
ATOM   353   C  C4    . G   A  1 16  ? -21.598 41.463  -23.745 1.00 119.95 ? 120 G   A C4    1 
ATOM   354   P  P     . U   A  1 17  ? -24.391 36.308  -24.180 1.00 114.65 ? 121 U   A P     1 
ATOM   355   O  OP1   . U   A  1 17  ? -25.570 35.489  -24.503 1.00 114.47 ? 121 U   A OP1   1 
ATOM   356   O  OP2   . U   A  1 17  ? -23.133 35.765  -23.618 1.00 114.24 ? 121 U   A OP2   1 
ATOM   357   O  "O5'" . U   A  1 17  ? -24.016 37.004  -25.544 1.00 115.51 ? 121 U   A "O5'" 1 
ATOM   358   C  "C5'" . U   A  1 17  ? -25.041 37.419  -26.422 1.00 128.34 ? 121 U   A "C5'" 1 
ATOM   359   C  "C4'" . U   A  1 17  ? -24.457 37.875  -27.725 1.00 126.89 ? 121 U   A "C4'" 1 
ATOM   360   O  "O4'" . U   A  1 17  ? -23.603 39.022  -27.485 1.00 122.05 ? 121 U   A "O4'" 1 
ATOM   361   C  "C3'" . U   A  1 17  ? -23.549 36.874  -28.415 1.00 128.72 ? 121 U   A "C3'" 1 
ATOM   362   O  "O3'" . U   A  1 17  ? -24.266 35.910  -29.171 1.00 136.71 ? 121 U   A "O3'" 1 
ATOM   363   C  "C2'" . U   A  1 17  ? -22.637 37.762  -29.250 1.00 124.79 ? 121 U   A "C2'" 1 
ATOM   364   O  "O2'" . U   A  1 17  ? -23.289 38.147  -30.445 1.00 126.08 ? 121 U   A "O2'" 1 
ATOM   365   C  "C1'" . U   A  1 17  ? -22.514 39.006  -28.373 1.00 122.65 ? 121 U   A "C1'" 1 
ATOM   366   N  N1    . U   A  1 17  ? -21.264 39.059  -27.582 1.00 119.62 ? 121 U   A N1    1 
ATOM   367   C  C2    . U   A  1 17  ? -20.080 39.228  -28.254 1.00 120.98 ? 121 U   A C2    1 
ATOM   368   O  O2    . U   A  1 17  ? -20.018 39.276  -29.461 1.00 121.36 ? 121 U   A O2    1 
ATOM   369   N  N3    . U   A  1 17  ? -18.958 39.291  -27.477 1.00 117.87 ? 121 U   A N3    1 
ATOM   370   C  C4    . U   A  1 17  ? -18.897 39.237  -26.107 1.00 117.33 ? 121 U   A C4    1 
ATOM   371   O  O4    . U   A  1 17  ? -17.803 39.322  -25.551 1.00 117.46 ? 121 U   A O4    1 
ATOM   372   C  C5    . U   A  1 17  ? -20.164 39.074  -25.474 1.00 116.76 ? 121 U   A C5    1 
ATOM   373   C  C6    . U   A  1 17  ? -21.276 39.000  -26.212 1.00 117.69 ? 121 U   A C6    1 
ATOM   374   P  P     . U   A  1 18  ? -23.625 34.466  -29.469 1.00 145.63 ? 122 U   A P     1 
ATOM   375   O  OP1   . U   A  1 18  ? -24.593 33.633  -30.237 1.00 147.17 ? 122 U   A OP1   1 
ATOM   376   O  OP2   . U   A  1 18  ? -23.022 33.956  -28.212 1.00 151.53 ? 122 U   A OP2   1 
ATOM   377   O  "O5'" . U   A  1 18  ? -22.420 34.796  -30.447 1.00 141.90 ? 122 U   A "O5'" 1 
ATOM   378   C  "C5'" . U   A  1 18  ? -22.666 35.328  -31.735 1.00 136.55 ? 122 U   A "C5'" 1 
ATOM   379   C  "C4'" . U   A  1 18  ? -21.377 35.680  -32.417 1.00 131.04 ? 122 U   A "C4'" 1 
ATOM   380   O  "O4'" . U   A  1 18  ? -20.724 36.786  -31.744 1.00 126.77 ? 122 U   A "O4'" 1 
ATOM   381   C  "C3'" . U   A  1 18  ? -20.338 34.588  -32.376 1.00 130.09 ? 122 U   A "C3'" 1 
ATOM   382   O  "O3'" . U   A  1 18  ? -20.558 33.548  -33.291 1.00 127.33 ? 122 U   A "O3'" 1 
ATOM   383   C  "C2'" . U   A  1 18  ? -19.041 35.353  -32.593 1.00 130.97 ? 122 U   A "C2'" 1 
ATOM   384   O  "O2'" . U   A  1 18  ? -18.864 35.696  -33.959 1.00 134.91 ? 122 U   A "O2'" 1 
ATOM   385   C  "C1'" . U   A  1 18  ? -19.319 36.622  -31.810 1.00 126.17 ? 122 U   A "C1'" 1 
ATOM   386   N  N1    . U   A  1 18  ? -18.775 36.511  -30.448 1.00 124.86 ? 122 U   A N1    1 
ATOM   387   C  C2    . U   A  1 18  ? -17.419 36.686  -30.302 1.00 123.65 ? 122 U   A C2    1 
ATOM   388   O  O2    . U   A  1 18  ? -16.683 36.933  -31.234 1.00 123.31 ? 122 U   A O2    1 
ATOM   389   N  N3    . U   A  1 18  ? -16.974 36.564  -29.017 1.00 122.87 ? 122 U   A N3    1 
ATOM   390   C  C4    . U   A  1 18  ? -17.729 36.281  -27.906 1.00 123.22 ? 122 U   A C4    1 
ATOM   391   O  O4    . U   A  1 18  ? -17.195 36.191  -26.807 1.00 124.52 ? 122 U   A O4    1 
ATOM   392   C  C5    . U   A  1 18  ? -19.122 36.097  -28.151 1.00 124.04 ? 122 U   A C5    1 
ATOM   393   C  C6    . U   A  1 18  ? -19.585 36.212  -29.392 1.00 125.18 ? 122 U   A C6    1 
ATOM   394   P  P     . C   A  1 19  ? -20.057 32.099  -32.865 1.00 126.76 ? 123 C   A P     1 
ATOM   395   O  OP1   . C   A  1 19  ? -20.465 31.143  -33.919 1.00 134.64 ? 123 C   A OP1   1 
ATOM   396   O  OP2   . C   A  1 19  ? -20.466 31.924  -31.452 1.00 123.25 ? 123 C   A OP2   1 
ATOM   397   O  "O5'" . C   A  1 19  ? -18.482 32.228  -32.903 1.00 127.33 ? 123 C   A "O5'" 1 
ATOM   398   C  "C5'" . C   A  1 19  ? -17.872 32.568  -34.124 1.00 131.68 ? 123 C   A "C5'" 1 
ATOM   399   C  "C4'" . C   A  1 19  ? -16.433 32.915  -33.934 1.00 139.06 ? 123 C   A "C4'" 1 
ATOM   400   O  "O4'" . C   A  1 19  ? -16.251 33.859  -32.858 1.00 137.50 ? 123 C   A "O4'" 1 
ATOM   401   C  "C3'" . C   A  1 19  ? -15.530 31.771  -33.549 1.00 145.96 ? 123 C   A "C3'" 1 
ATOM   402   O  "O3'" . C   A  1 19  ? -15.244 30.933  -34.643 1.00 121.14 ? 123 C   A "O3'" 1 
ATOM   403   C  "C2'" . C   A  1 19  ? -14.307 32.495  -32.995 1.00 152.81 ? 123 C   A "C2'" 1 
ATOM   404   O  "O2'" . C   A  1 19  ? -13.453 32.945  -34.037 1.00 169.36 ? 123 C   A "O2'" 1 
ATOM   405   C  "C1'" . C   A  1 19  ? -14.937 33.734  -32.364 1.00 138.14 ? 123 C   A "C1'" 1 
ATOM   406   N  N1    . C   A  1 19  ? -14.963 33.664  -30.904 1.00 128.29 ? 123 C   A N1    1 
ATOM   407   C  C2    . C   A  1 19  ? -13.749 33.909  -30.277 1.00 122.46 ? 123 C   A C2    1 
ATOM   408   O  O2    . C   A  1 19  ? -12.736 34.137  -30.950 1.00 120.67 ? 123 C   A O2    1 
ATOM   409   N  N3    . C   A  1 19  ? -13.719 33.874  -28.944 1.00 119.08 ? 123 C   A N3    1 
ATOM   410   C  C4    . C   A  1 19  ? -14.847 33.629  -28.291 1.00 118.11 ? 123 C   A C4    1 
ATOM   411   N  N4    . C   A  1 19  ? -14.783 33.602  -26.968 1.00 119.81 ? 123 C   A N4    1 
ATOM   412   C  C5    . C   A  1 19  ? -16.101 33.390  -28.920 1.00 117.75 ? 123 C   A C5    1 
ATOM   413   C  C6    . C   A  1 19  ? -16.122 33.415  -30.246 1.00 118.40 ? 123 C   A C6    1 
ATOM   414   P  P     . G   A  1 20  ? -14.578 29.527  -34.364 1.00 121.42 ? 124 G   A P     1 
ATOM   415   O  OP1   . G   A  1 20  ? -14.960 28.602  -35.455 1.00 152.44 ? 124 G   A OP1   1 
ATOM   416   O  OP2   . G   A  1 20  ? -14.843 29.284  -32.929 1.00 120.41 ? 124 G   A OP2   1 
ATOM   417   O  "O5'" . G   A  1 20  ? -13.021 29.782  -34.467 1.00 122.42 ? 124 G   A "O5'" 1 
ATOM   418   C  "C5'" . G   A  1 20  ? -12.128 28.820  -33.946 1.00 122.84 ? 124 G   A "C5'" 1 
ATOM   419   C  "C4'" . G   A  1 20  ? -10.765 29.407  -33.835 1.00 123.72 ? 124 G   A "C4'" 1 
ATOM   420   O  "O4'" . G   A  1 20  ? -10.904 30.728  -33.281 1.00 123.14 ? 124 G   A "O4'" 1 
ATOM   421   C  "C3'" . G   A  1 20  ? -9.820  28.714  -32.874 1.00 137.76 ? 124 G   A "C3'" 1 
ATOM   422   O  "O3'" . G   A  1 20  ? -9.173  27.586  -33.412 1.00 132.72 ? 124 G   A "O3'" 1 
ATOM   423   C  "C2'" . G   A  1 20  ? -8.888  29.836  -32.484 1.00 141.60 ? 124 G   A "C2'" 1 
ATOM   424   O  "O2'" . G   A  1 20  ? -8.032  30.166  -33.563 1.00 143.84 ? 124 G   A "O2'" 1 
ATOM   425   C  "C1'" . G   A  1 20  ? -9.887  30.960  -32.341 1.00 123.40 ? 124 G   A "C1'" 1 
ATOM   426   N  N9    . G   A  1 20  ? -10.528 30.882  -31.042 1.00 122.19 ? 124 G   A N9    1 
ATOM   427   C  C8    . G   A  1 20  ? -11.852 30.647  -30.814 1.00 121.08 ? 124 G   A C8    1 
ATOM   428   N  N7    . G   A  1 20  ? -12.122 30.628  -29.550 1.00 120.22 ? 124 G   A N7    1 
ATOM   429   C  C5    . G   A  1 20  ? -10.897 30.854  -28.957 1.00 120.84 ? 124 G   A C5    1 
ATOM   430   C  C6    . G   A  1 20  ? -10.578 30.935  -27.604 1.00 120.44 ? 124 G   A C6    1 
ATOM   431   O  O6    . G   A  1 20  ? -11.359 30.814  -26.656 1.00 123.37 ? 124 G   A O6    1 
ATOM   432   N  N1    . G   A  1 20  ? -9.218  31.173  -27.430 1.00 121.49 ? 124 G   A N1    1 
ATOM   433   C  C2    . G   A  1 20  ? -8.292  31.313  -28.431 1.00 122.78 ? 124 G   A C2    1 
ATOM   434   N  N2    . G   A  1 20  ? -7.033  31.535  -28.042 1.00 123.79 ? 124 G   A N2    1 
ATOM   435   N  N3    . G   A  1 20  ? -8.585  31.236  -29.706 1.00 123.13 ? 124 G   A N3    1 
ATOM   436   C  C4    . G   A  1 20  ? -9.893  30.996  -29.866 1.00 122.09 ? 124 G   A C4    1 
ATOM   437   P  P     . G   A  1 21  ? -8.725  26.421  -32.426 1.00 131.27 ? 125 G   A P     1 
ATOM   438   O  OP1   . G   A  1 21  ? -8.197  25.338  -33.275 1.00 138.42 ? 125 G   A OP1   1 
ATOM   439   O  OP2   . G   A  1 21  ? -9.865  26.221  -31.508 1.00 131.52 ? 125 G   A OP2   1 
ATOM   440   O  "O5'" . G   A  1 21  ? -7.503  27.003  -31.595 1.00 125.80 ? 125 G   A "O5'" 1 
ATOM   441   C  "C5'" . G   A  1 21  ? -6.223  27.128  -32.182 1.00 127.44 ? 125 G   A "C5'" 1 
ATOM   442   C  "C4'" . G   A  1 21  ? -5.150  27.136  -31.143 1.00 128.03 ? 125 G   A "C4'" 1 
ATOM   443   O  "O4'" . G   A  1 21  ? -5.411  28.237  -30.246 1.00 126.98 ? 125 G   A "O4'" 1 
ATOM   444   C  "C3'" . G   A  1 21  ? -5.090  25.919  -30.232 1.00 140.66 ? 125 G   A "C3'" 1 
ATOM   445   O  "O3'" . G   A  1 21  ? -4.344  24.831  -30.770 1.00 144.22 ? 125 G   A "O3'" 1 
ATOM   446   C  "C2'" . G   A  1 21  ? -4.492  26.500  -28.963 1.00 127.79 ? 125 G   A "C2'" 1 
ATOM   447   O  "O2'" . G   A  1 21  ? -3.104  26.722  -29.143 1.00 129.86 ? 125 G   A "O2'" 1 
ATOM   448   C  "C1'" . G   A  1 21  ? -5.174  27.855  -28.918 1.00 126.64 ? 125 G   A "C1'" 1 
ATOM   449   N  N9    . G   A  1 21  ? -6.483  27.788  -28.253 1.00 124.88 ? 125 G   A N9    1 
ATOM   450   C  C8    . G   A  1 21  ? -7.680  27.679  -28.903 1.00 124.00 ? 125 G   A C8    1 
ATOM   451   N  N7    . G   A  1 21  ? -8.704  27.626  -28.113 1.00 122.60 ? 125 G   A N7    1 
ATOM   452   C  C5    . G   A  1 21  ? -8.153  27.703  -26.856 1.00 122.49 ? 125 G   A C5    1 
ATOM   453   C  C6    . G   A  1 21  ? -8.796  27.687  -25.611 1.00 121.28 ? 125 G   A C6    1 
ATOM   454   O  O6    . G   A  1 21  ? -10.001 27.603  -25.385 1.00 120.07 ? 125 G   A O6    1 
ATOM   455   N  N1    . G   A  1 21  ? -7.887  27.775  -24.573 1.00 121.68 ? 125 G   A N1    1 
ATOM   456   C  C2    . G   A  1 21  ? -6.527  27.865  -24.718 1.00 123.14 ? 125 G   A C2    1 
ATOM   457   N  N2    . G   A  1 21  ? -5.805  27.937  -23.589 1.00 139.09 ? 125 G   A N2    1 
ATOM   458   N  N3    . G   A  1 21  ? -5.913  27.885  -25.892 1.00 124.34 ? 125 G   A N3    1 
ATOM   459   C  C4    . G   A  1 21  ? -6.783  27.790  -26.913 1.00 123.90 ? 125 G   A C4    1 
ATOM   460   P  P     . C   A  1 22  ? -4.739  23.294  -30.471 1.00 129.45 ? 126 C   A P     1 
ATOM   461   O  OP1   . C   A  1 22  ? -3.806  22.516  -31.315 1.00 131.46 ? 126 C   A OP1   1 
ATOM   462   O  OP2   . C   A  1 22  ? -6.203  23.044  -30.566 1.00 127.88 ? 126 C   A OP2   1 
ATOM   463   O  "O5'" . C   A  1 22  ? -4.341  23.090  -28.938 1.00 129.13 ? 126 C   A "O5'" 1 
ATOM   464   C  "C5'" . C   A  1 22  ? -3.033  23.397  -28.476 1.00 130.42 ? 126 C   A "C5'" 1 
ATOM   465   C  "C4'" . C   A  1 22  ? -2.956  23.501  -26.968 1.00 142.41 ? 126 C   A "C4'" 1 
ATOM   466   O  "O4'" . C   A  1 22  ? -3.756  24.598  -26.455 1.00 127.98 ? 126 C   A "O4'" 1 
ATOM   467   C  "C3'" . C   A  1 22  ? -3.455  22.306  -26.193 1.00 142.30 ? 126 C   A "C3'" 1 
ATOM   468   O  "O3'" . C   A  1 22  ? -2.519  21.268  -26.164 1.00 130.79 ? 126 C   A "O3'" 1 
ATOM   469   C  "C2'" . C   A  1 22  ? -3.714  22.892  -24.812 1.00 141.38 ? 126 C   A "C2'" 1 
ATOM   470   O  "O2'" . C   A  1 22  ? -2.498  23.046  -24.094 1.00 141.34 ? 126 C   A "O2'" 1 
ATOM   471   C  "C1'" . C   A  1 22  ? -4.248  24.267  -25.169 1.00 126.83 ? 126 C   A "C1'" 1 
ATOM   472   N  N1    . C   A  1 22  ? -5.718  24.279  -25.214 1.00 125.07 ? 126 C   A N1    1 
ATOM   473   C  C2    . C   A  1 22  ? -6.457  24.313  -24.035 1.00 123.64 ? 126 C   A C2    1 
ATOM   474   O  O2    . C   A  1 22  ? -5.883  24.318  -22.941 1.00 123.79 ? 126 C   A O2    1 
ATOM   475   N  N3    . C   A  1 22  ? -7.799  24.342  -24.127 1.00 122.21 ? 126 C   A N3    1 
ATOM   476   C  C4    . C   A  1 22  ? -8.387  24.343  -25.319 1.00 122.19 ? 126 C   A C4    1 
ATOM   477   N  N4    . C   A  1 22  ? -9.717  24.381  -25.386 1.00 133.78 ? 126 C   A N4    1 
ATOM   478   C  C5    . C   A  1 22  ? -7.649  24.305  -26.529 1.00 123.59 ? 126 C   A C5    1 
ATOM   479   C  C6    . C   A  1 22  ? -6.325  24.275  -26.428 1.00 124.99 ? 126 C   A C6    1 
ATOM   480   P  P     . A   A  1 23  ? -3.037  19.790  -25.923 1.00 130.68 ? 127 A   A P     1 
ATOM   481   O  OP1   . A   A  1 23  ? -1.749  19.055  -25.916 1.00 132.89 ? 127 A   A OP1   1 
ATOM   482   O  OP2   . A   A  1 23  ? -4.146  19.485  -26.873 1.00 129.89 ? 127 A   A OP2   1 
ATOM   483   O  "O5'" . A   A  1 23  ? -3.710  19.833  -24.477 1.00 129.51 ? 127 A   A "O5'" 1 
ATOM   484   C  "C5'" . A   A  1 23  ? -2.924  19.895  -23.296 1.00 133.29 ? 127 A   A "C5'" 1 
ATOM   485   C  "C4'" . A   A  1 23  ? -3.781  19.772  -22.060 1.00 134.76 ? 127 A   A "C4'" 1 
ATOM   486   O  "O4'" . A   A  1 23  ? -4.724  20.867  -21.993 1.00 132.21 ? 127 A   A "O4'" 1 
ATOM   487   C  "C3'" . A   A  1 23  ? -4.646  18.524  -21.987 1.00 141.52 ? 127 A   A "C3'" 1 
ATOM   488   O  "O3'" . A   A  1 23  ? -3.943  17.413  -21.479 1.00 148.06 ? 127 A   A "O3'" 1 
ATOM   489   C  "C2'" . A   A  1 23  ? -5.805  18.967  -21.103 1.00 138.54 ? 127 A   A "C2'" 1 
ATOM   490   O  "O2'" . A   A  1 23  ? -5.420  18.980  -19.733 1.00 145.94 ? 127 A   A "O2'" 1 
ATOM   491   C  "C1'" . A   A  1 23  ? -5.979  20.407  -21.548 1.00 127.03 ? 127 A   A "C1'" 1 
ATOM   492   N  N9    . A   A  1 23  ? -6.923  20.539  -22.673 1.00 123.70 ? 127 A   A N9    1 
ATOM   493   C  C8    . A   A  1 23  ? -6.621  20.568  -24.011 1.00 126.17 ? 127 A   A C8    1 
ATOM   494   N  N7    . A   A  1 23  ? -7.668  20.727  -24.785 1.00 124.90 ? 127 A   A N7    1 
ATOM   495   C  C5    . A   A  1 23  ? -8.735  20.816  -23.900 1.00 122.21 ? 127 A   A C5    1 
ATOM   496   C  C6    . A   A  1 23  ? -10.119 20.989  -24.085 1.00 120.87 ? 127 A   A C6    1 
ATOM   497   N  N6    . A   A  1 23  ? -10.726 21.112  -25.269 1.00 120.85 ? 127 A   A N6    1 
ATOM   498   N  N1    . A   A  1 23  ? -10.883 21.027  -22.981 1.00 119.51 ? 127 A   A N1    1 
ATOM   499   C  C2    . A   A  1 23  ? -10.301 20.903  -21.790 1.00 119.51 ? 127 A   A C2    1 
ATOM   500   N  N3    . A   A  1 23  ? -9.019  20.742  -21.493 1.00 120.72 ? 127 A   A N3    1 
ATOM   501   C  C4    . A   A  1 23  ? -8.281  20.702  -22.600 1.00 122.07 ? 127 A   A C4    1 
ATOM   502   P  P     . U   A  1 24  ? -4.456  15.927  -21.732 1.00 128.60 ? 128 U   A P     1 
ATOM   503   O  OP1   . U   A  1 24  ? -3.529  15.244  -20.828 1.00 129.83 ? 128 U   A OP1   1 
ATOM   504   O  OP2   . U   A  1 24  ? -4.566  15.547  -23.159 1.00 129.47 ? 128 U   A OP2   1 
ATOM   505   O  "O5'" . U   A  1 24  ? -5.907  15.916  -21.094 1.00 126.34 ? 128 U   A "O5'" 1 
ATOM   506   C  "C5'" . U   A  1 24  ? -6.039  15.617  -19.721 1.00 125.63 ? 128 U   A "C5'" 1 
ATOM   507   C  "C4'" . U   A  1 24  ? -7.462  15.684  -19.238 1.00 123.56 ? 128 U   A "C4'" 1 
ATOM   508   O  "O4'" . U   A  1 24  ? -8.188  16.675  -20.002 1.00 122.58 ? 128 U   A "O4'" 1 
ATOM   509   C  "C3'" . U   A  1 24  ? -8.266  14.385  -19.335 1.00 123.35 ? 128 U   A "C3'" 1 
ATOM   510   O  "O3'" . U   A  1 24  ? -8.834  14.034  -18.080 1.00 127.65 ? 128 U   A "O3'" 1 
ATOM   511   C  "C2'" . U   A  1 24  ? -9.363  14.693  -20.352 1.00 122.46 ? 128 U   A "C2'" 1 
ATOM   512   O  "O2'" . U   A  1 24  ? -10.601 14.080  -20.072 1.00 121.29 ? 128 U   A "O2'" 1 
ATOM   513   C  "C1'" . U   A  1 24  ? -9.482  16.200  -20.264 1.00 121.49 ? 128 U   A "C1'" 1 
ATOM   514   N  N1    . U   A  1 24  ? -9.927  16.769  -21.525 1.00 121.40 ? 128 U   A N1    1 
ATOM   515   C  C2    . U   A  1 24  ? -11.242 17.157  -21.649 1.00 127.19 ? 128 U   A C2    1 
ATOM   516   O  O2    . U   A  1 24  ? -12.043 17.068  -20.743 1.00 125.37 ? 128 U   A O2    1 
ATOM   517   N  N3    . U   A  1 24  ? -11.587 17.660  -22.875 1.00 120.07 ? 128 U   A N3    1 
ATOM   518   C  C4    . U   A  1 24  ? -10.738 17.789  -23.954 1.00 121.44 ? 128 U   A C4    1 
ATOM   519   O  O4    . U   A  1 24  ? -11.165 18.257  -25.007 1.00 127.17 ? 128 U   A O4    1 
ATOM   520   C  C5    . U   A  1 24  ? -9.392  17.353  -23.730 1.00 124.34 ? 128 U   A C5    1 
ATOM   521   C  C6    . U   A  1 24  ? -9.035  16.855  -22.548 1.00 122.89 ? 128 U   A C6    1 
ATOM   522   P  P     . C   A  1 25  ? -8.571  12.544  -17.542 1.00 125.09 ? 129 C   A P     1 
ATOM   523   O  OP1   . C   A  1 25  ? -7.571  12.003  -18.493 1.00 125.22 ? 129 C   A OP1   1 
ATOM   524   O  OP2   . C   A  1 25  ? -9.865  11.844  -17.349 1.00 121.94 ? 129 C   A OP2   1 
ATOM   525   O  "O5'" . C   A  1 25  ? -7.876  12.721  -16.116 1.00 128.02 ? 129 C   A "O5'" 1 
ATOM   526   C  "C5'" . C   A  1 25  ? -6.535  13.185  -16.010 1.00 129.75 ? 129 C   A "C5'" 1 
ATOM   527   C  "C4'" . C   A  1 25  ? -5.896  12.775  -14.704 1.00 129.00 ? 129 C   A "C4'" 1 
ATOM   528   O  "O4'" . C   A  1 25  ? -6.538  13.473  -13.612 1.00 123.29 ? 129 C   A "O4'" 1 
ATOM   529   C  "C3'" . C   A  1 25  ? -6.026  11.312  -14.316 1.00 132.11 ? 129 C   A "C3'" 1 
ATOM   530   O  "O3'" . C   A  1 25  ? -5.129  10.450  -14.992 1.00 132.85 ? 129 C   A "O3'" 1 
ATOM   531   C  "C2'" . C   A  1 25  ? -5.845  11.361  -12.805 1.00 136.12 ? 129 C   A "C2'" 1 
ATOM   532   O  "O2'" . C   A  1 25  ? -4.473  11.540  -12.469 1.00 126.83 ? 129 C   A "O2'" 1 
ATOM   533   C  "C1'" . C   A  1 25  ? -6.592  12.646  -12.470 1.00 123.19 ? 129 C   A "C1'" 1 
ATOM   534   N  N1    . C   A  1 25  ? -8.025  12.421  -12.157 1.00 121.33 ? 129 C   A N1    1 
ATOM   535   C  C2    . C   A  1 25  ? -8.439  12.264  -10.832 1.00 120.55 ? 129 C   A C2    1 
ATOM   536   O  O2    . C   A  1 25  ? -7.600  12.298  -9.920  1.00 121.03 ? 129 C   A O2    1 
ATOM   537   N  N3    . C   A  1 25  ? -9.755  12.095  -10.533 1.00 119.41 ? 129 C   A N3    1 
ATOM   538   C  C4    . C   A  1 25  ? -10.660 12.058  -11.515 1.00 118.45 ? 129 C   A C4    1 
ATOM   539   N  N4    . C   A  1 25  ? -11.951 11.881  -11.189 1.00 116.65 ? 129 C   A N4    1 
ATOM   540   C  C5    . C   A  1 25  ? -10.270 12.204  -12.878 1.00 119.07 ? 129 C   A C5    1 
ATOM   541   C  C6    . C   A  1 25  ? -8.970  12.384  -13.145 1.00 120.62 ? 129 C   A C6    1 
ATOM   542   P  P     . A   A  1 26  ? -5.469  8.894   -15.121 1.00 128.50 ? 130 A   A P     1 
ATOM   543   O  OP1   . A   A  1 26  ? -4.146  8.289   -15.337 1.00 131.03 ? 130 A   A OP1   1 
ATOM   544   O  OP2   . A   A  1 26  ? -6.556  8.632   -16.095 1.00 127.68 ? 130 A   A OP2   1 
ATOM   545   O  "O5'" . A   A  1 26  ? -6.080  8.532   -13.697 1.00 127.18 ? 130 A   A "O5'" 1 
ATOM   546   C  "C5'" . A   A  1 26  ? -5.724  7.341   -13.013 1.00 133.12 ? 130 A   A "C5'" 1 
ATOM   547   C  "C4'" . A   A  1 26  ? -5.605  7.568   -11.525 1.00 135.56 ? 130 A   A "C4'" 1 
ATOM   548   O  "O4'" . A   A  1 26  ? -6.433  8.692   -11.143 1.00 134.42 ? 130 A   A "O4'" 1 
ATOM   549   C  "C3'" . A   A  1 26  ? -6.098  6.432   -10.638 1.00 138.64 ? 130 A   A "C3'" 1 
ATOM   550   O  "O3'" . A   A  1 26  ? -5.160  5.376   -10.492 1.00 143.08 ? 130 A   A "O3'" 1 
ATOM   551   C  "C2'" . A   A  1 26  ? -6.468  7.159   -9.348  1.00 125.63 ? 130 A   A "C2'" 1 
ATOM   552   O  "O2'" . A   A  1 26  ? -5.313  7.525   -8.610  1.00 126.73 ? 130 A   A "O2'" 1 
ATOM   553   C  "C1'" . A   A  1 26  ? -7.062  8.438   -9.906  1.00 124.12 ? 130 A   A "C1'" 1 
ATOM   554   N  N9    . A   A  1 26  ? -8.493  8.282   -10.183 1.00 122.43 ? 130 A   A N9    1 
ATOM   555   C  C8    . A   A  1 26  ? -9.085  8.258   -11.418 1.00 122.26 ? 130 A   A C8    1 
ATOM   556   N  N7    . A   A  1 26  ? -10.380 8.118   -11.371 1.00 120.73 ? 130 A   A N7    1 
ATOM   557   C  C5    . A   A  1 26  ? -10.643 8.037   -10.017 1.00 119.85 ? 130 A   A C5    1 
ATOM   558   C  C6    . A   A  1 26  ? -11.837 7.872   -9.311  1.00 118.25 ? 130 A   A C6    1 
ATOM   559   N  N6    . A   A  1 26  ? -13.018 7.764   -9.915  1.00 117.30 ? 130 A   A N6    1 
ATOM   560   N  N1    . A   A  1 26  ? -11.771 7.816   -7.960  1.00 118.23 ? 130 A   A N1    1 
ATOM   561   C  C2    . A   A  1 26  ? -10.563 7.922   -7.378  1.00 119.07 ? 130 A   A C2    1 
ATOM   562   N  N3    . A   A  1 26  ? -9.367  8.102   -7.946  1.00 120.47 ? 130 A   A N3    1 
ATOM   563   C  C4    . A   A  1 26  ? -9.488  8.133   -9.275  1.00 120.86 ? 130 A   A C4    1 
ATOM   564   P  P     . A   A  1 27  ? -5.613  3.838   -10.635 1.00 130.22 ? 131 A   A P     1 
ATOM   565   O  OP1   . A   A  1 27  ? -4.445  3.160   -11.236 1.00 132.96 ? 131 A   A OP1   1 
ATOM   566   O  OP2   . A   A  1 27  ? -6.945  3.678   -11.273 1.00 128.72 ? 131 A   A OP2   1 
ATOM   567   O  "O5'" . A   A  1 27  ? -5.782  3.368   -9.132  1.00 129.65 ? 131 A   A "O5'" 1 
ATOM   568   C  "C5'" . A   A  1 27  ? -4.857  3.777   -8.140  1.00 130.25 ? 131 A   A "C5'" 1 
ATOM   569   C  "C4'" . A   A  1 27  ? -5.484  3.731   -6.773  1.00 138.91 ? 131 A   A "C4'" 1 
ATOM   570   O  "O4'" . A   A  1 27  ? -6.488  4.762   -6.696  1.00 126.31 ? 131 A   A "O4'" 1 
ATOM   571   C  "C3'" . A   A  1 27  ? -6.231  2.447   -6.411  1.00 145.84 ? 131 A   A "C3'" 1 
ATOM   572   O  "O3'" . A   A  1 27  ? -5.376  1.430   -5.897  1.00 151.08 ? 131 A   A "O3'" 1 
ATOM   573   C  "C2'" . A   A  1 27  ? -7.283  2.941   -5.419  1.00 145.40 ? 131 A   A "C2'" 1 
ATOM   574   O  "O2'" . A   A  1 27  ? -6.724  3.167   -4.137  1.00 148.30 ? 131 A   A "O2'" 1 
ATOM   575   C  "C1'" . A   A  1 27  ? -7.615  4.303   -5.993  1.00 124.75 ? 131 A   A "C1'" 1 
ATOM   576   N  N9    . A   A  1 27  ? -8.712  4.240   -6.952  1.00 123.69 ? 131 A   A N9    1 
ATOM   577   C  C8    . A   A  1 27  ? -8.611  4.361   -8.309  1.00 124.34 ? 131 A   A C8    1 
ATOM   578   N  N7    . A   A  1 27  ? -9.763  4.292   -8.917  1.00 133.37 ? 131 A   A N7    1 
ATOM   579   C  C5    . A   A  1 27  ? -10.665 4.122   -7.880  1.00 121.66 ? 131 A   A C5    1 
ATOM   580   C  C6    . A   A  1 27  ? -12.054 3.974   -7.871  1.00 120.08 ? 131 A   A C6    1 
ATOM   581   N  N6    . A   A  1 27  ? -12.794 3.981   -8.983  1.00 126.06 ? 131 A   A N6    1 
ATOM   582   N  N1    . A   A  1 27  ? -12.650 3.815   -6.670  1.00 118.95 ? 131 A   A N1    1 
ATOM   583   C  C2    . A   A  1 27  ? -11.889 3.797   -5.567  1.00 122.00 ? 131 A   A C2    1 
ATOM   584   N  N3    . A   A  1 27  ? -10.570 3.929   -5.451  1.00 120.84 ? 131 A   A N3    1 
ATOM   585   C  C4    . A   A  1 27  ? -10.025 4.081   -6.662  1.00 121.95 ? 131 A   A C4    1 
ATOM   586   P  P     . U   A  1 28  ? -5.545  -0.122  -6.278  1.00 131.96 ? 132 U   A P     1 
ATOM   587   O  OP1   . U   A  1 28  ? -5.329  -0.774  -4.979  1.00 132.36 ? 132 U   A OP1   1 
ATOM   588   O  OP2   . U   A  1 28  ? -4.791  -0.504  -7.498  1.00 134.16 ? 132 U   A OP2   1 
ATOM   589   O  "O5'" . U   A  1 28  ? -7.072  -0.338  -6.615  1.00 129.97 ? 132 U   A "O5'" 1 
ATOM   590   C  "C5'" . U   A  1 28  ? -7.728  -1.474  -6.102  1.00 129.86 ? 132 U   A "C5'" 1 
ATOM   591   C  "C4'" . U   A  1 28  ? -8.836  -1.069  -5.184  1.00 127.39 ? 132 U   A "C4'" 1 
ATOM   592   O  "O4'" . U   A  1 28  ? -9.365  0.180   -5.657  1.00 125.69 ? 132 U   A "O4'" 1 
ATOM   593   C  "C3'" . U   A  1 28  ? -10.029 -2.011  -5.148  1.00 136.50 ? 132 U   A "C3'" 1 
ATOM   594   O  "O3'" . U   A  1 28  ? -9.881  -3.020  -4.170  1.00 139.30 ? 132 U   A "O3'" 1 
ATOM   595   C  "C2'" . U   A  1 28  ? -11.197 -1.088  -4.856  1.00 124.02 ? 132 U   A "C2'" 1 
ATOM   596   O  "O2'" . U   A  1 28  ? -11.261 -0.812  -3.468  1.00 123.03 ? 132 U   A "O2'" 1 
ATOM   597   C  "C1'" . U   A  1 28  ? -10.761 0.195   -5.543  1.00 123.74 ? 132 U   A "C1'" 1 
ATOM   598   N  N1    . U   A  1 28  ? -11.298 0.393   -6.896  1.00 123.53 ? 132 U   A N1    1 
ATOM   599   C  C2    . U   A  1 28  ? -12.632 0.356   -7.202  1.00 122.06 ? 132 U   A C2    1 
ATOM   600   O  O2    . U   A  1 28  ? -13.495 0.063   -6.406  1.00 120.90 ? 132 U   A O2    1 
ATOM   601   N  N3    . U   A  1 28  ? -12.905 0.645   -8.517  1.00 122.17 ? 132 U   A N3    1 
ATOM   602   C  C4    . U   A  1 28  ? -12.008 0.999   -9.516  1.00 128.41 ? 132 U   A C4    1 
ATOM   603   O  O4    . U   A  1 28  ? -12.386 1.246   -10.668 1.00 123.42 ? 132 U   A O4    1 
ATOM   604   C  C5    . U   A  1 28  ? -10.654 1.046   -9.086  1.00 129.64 ? 132 U   A C5    1 
ATOM   605   C  C6    . U   A  1 28  ? -10.368 0.757   -7.823  1.00 124.87 ? 132 U   A C6    1 
ATOM   606   P  P     . A   A  1 29  ? -9.554  -4.536  -4.567  1.00 129.63 ? 133 A   A P     1 
ATOM   607   O  OP1   . A   A  1 29  ? -8.629  -5.005  -3.514  1.00 130.97 ? 133 A   A OP1   1 
ATOM   608   O  OP2   . A   A  1 29  ? -9.158  -4.702  -5.984  1.00 131.13 ? 133 A   A OP2   1 
ATOM   609   O  "O5'" . A   A  1 29  ? -10.965 -5.224  -4.384  1.00 128.29 ? 133 A   A "O5'" 1 
ATOM   610   C  "C5'" . A   A  1 29  ? -11.545 -5.276  -3.099  1.00 126.89 ? 133 A   A "C5'" 1 
ATOM   611   C  "C4'" . A   A  1 29  ? -13.027 -5.498  -3.168  1.00 125.21 ? 133 A   A "C4'" 1 
ATOM   612   O  "O4'" . A   A  1 29  ? -13.686 -4.267  -3.563  1.00 123.32 ? 133 A   A "O4'" 1 
ATOM   613   C  "C3'" . A   A  1 29  ? -13.523 -6.521  -4.182  1.00 129.45 ? 133 A   A "C3'" 1 
ATOM   614   O  "O3'" . A   A  1 29  ? -13.377 -7.873  -3.771  1.00 127.71 ? 133 A   A "O3'" 1 
ATOM   615   C  "C2'" . A   A  1 29  ? -14.969 -6.092  -4.367  1.00 128.97 ? 133 A   A "C2'" 1 
ATOM   616   O  "O2'" . A   A  1 29  ? -15.754 -6.504  -3.260  1.00 123.02 ? 133 A   A "O2'" 1 
ATOM   617   C  "C1'" . A   A  1 29  ? -14.827 -4.565  -4.334  1.00 127.88 ? 133 A   A "C1'" 1 
ATOM   618   N  N9    . A   A  1 29  ? -14.620 -4.040  -5.695  1.00 126.16 ? 133 A   A N9    1 
ATOM   619   C  C8    . A   A  1 29  ? -13.433 -3.820  -6.347  1.00 131.27 ? 133 A   A C8    1 
ATOM   620   N  N7    . A   A  1 29  ? -13.591 -3.395  -7.576  1.00 132.06 ? 133 A   A N7    1 
ATOM   621   C  C5    . A   A  1 29  ? -14.963 -3.345  -7.744  1.00 128.68 ? 133 A   A C5    1 
ATOM   622   C  C6    . A   A  1 29  ? -15.762 -2.972  -8.827  1.00 126.39 ? 133 A   A C6    1 
ATOM   623   N  N6    . A   A  1 29  ? -15.242 -2.562  -9.984  1.00 130.39 ? 133 A   A N6    1 
ATOM   624   N  N1    . A   A  1 29  ? -17.104 -3.033  -8.675  1.00 122.29 ? 133 A   A N1    1 
ATOM   625   C  C2    . A   A  1 29  ? -17.602 -3.442  -7.507  1.00 120.34 ? 133 A   A C2    1 
ATOM   626   N  N3    . A   A  1 29  ? -16.940 -3.812  -6.415  1.00 120.74 ? 133 A   A N3    1 
ATOM   627   C  C4    . A   A  1 29  ? -15.612 -3.745  -6.600  1.00 125.11 ? 133 A   A C4    1 
ATOM   628   P  P     . U   A  1 30  ? -13.086 -9.037  -4.849  1.00 133.30 ? 134 U   A P     1 
ATOM   629   O  OP1   . U   A  1 30  ? -13.184 -10.299 -4.099  1.00 131.07 ? 134 U   A OP1   1 
ATOM   630   O  OP2   . U   A  1 30  ? -11.866 -8.764  -5.638  1.00 131.87 ? 134 U   A OP2   1 
ATOM   631   O  "O5'" . U   A  1 30  ? -14.342 -9.020  -5.821  1.00 132.77 ? 134 U   A "O5'" 1 
ATOM   632   C  "C5'" . U   A  1 30  ? -15.626 -9.354  -5.326  1.00 127.58 ? 134 U   A "C5'" 1 
ATOM   633   C  "C4'" . U   A  1 30  ? -16.722 -8.981  -6.289  1.00 126.48 ? 134 U   A "C4'" 1 
ATOM   634   O  "O4'" . U   A  1 30  ? -16.641 -7.575  -6.654  1.00 125.17 ? 134 U   A "O4'" 1 
ATOM   635   C  "C3'" . U   A  1 30  ? -16.716 -9.677  -7.634  1.00 148.43 ? 134 U   A "C3'" 1 
ATOM   636   O  "O3'" . U   A  1 30  ? -17.119 -11.027 -7.619  1.00 129.41 ? 134 U   A "O3'" 1 
ATOM   637   C  "C2'" . U   A  1 30  ? -17.620 -8.771  -8.449  1.00 146.32 ? 134 U   A "C2'" 1 
ATOM   638   O  "O2'" . U   A  1 30  ? -18.973 -8.922  -8.044  1.00 125.19 ? 134 U   A "O2'" 1 
ATOM   639   C  "C1'" . U   A  1 30  ? -17.144 -7.404  -7.970  1.00 125.26 ? 134 U   A "C1'" 1 
ATOM   640   N  N1    . U   A  1 30  ? -16.083 -6.861  -8.862  1.00 126.37 ? 134 U   A N1    1 
ATOM   641   C  C2    . U   A  1 30  ? -16.505 -6.384  -10.087 1.00 126.17 ? 134 U   A C2    1 
ATOM   642   O  O2    . U   A  1 30  ? -17.674 -6.422  -10.416 1.00 125.21 ? 134 U   A O2    1 
ATOM   643   N  N3    . U   A  1 30  ? -15.544 -5.878  -10.935 1.00 127.21 ? 134 U   A N3    1 
ATOM   644   C  C4    . U   A  1 30  ? -14.187 -5.797  -10.668 1.00 128.50 ? 134 U   A C4    1 
ATOM   645   O  O4    . U   A  1 30  ? -13.415 -5.322  -11.496 1.00 129.43 ? 134 U   A O4    1 
ATOM   646   C  C5    . U   A  1 30  ? -13.818 -6.289  -9.382  1.00 128.69 ? 134 U   A C5    1 
ATOM   647   C  C6    . U   A  1 30  ? -14.747 -6.791  -8.548  1.00 127.62 ? 134 U   A C6    1 
ATOM   648   P  P     . G   A  1 31  ? -16.471 -12.041 -8.680  1.00 132.21 ? 135 G   A P     1 
ATOM   649   O  OP1   . G   A  1 31  ? -16.985 -13.353 -8.263  1.00 133.09 ? 135 G   A OP1   1 
ATOM   650   O  OP2   . G   A  1 31  ? -15.013 -11.809 -8.820  1.00 133.74 ? 135 G   A OP2   1 
ATOM   651   O  "O5'" . G   A  1 31  ? -17.179 -11.686 -10.058 1.00 131.92 ? 135 G   A "O5'" 1 
ATOM   652   C  "C5'" . G   A  1 31  ? -18.563 -11.947 -10.223 1.00 130.90 ? 135 G   A "C5'" 1 
ATOM   653   C  "C4'" . G   A  1 31  ? -19.118 -11.380 -11.506 1.00 130.55 ? 135 G   A "C4'" 1 
ATOM   654   O  "O4'" . G   A  1 31  ? -19.018 -9.928  -11.501 1.00 128.79 ? 135 G   A "O4'" 1 
ATOM   655   C  "C3'" . G   A  1 31  ? -18.405 -11.770 -12.789 1.00 138.19 ? 135 G   A "C3'" 1 
ATOM   656   O  "O3'" . G   A  1 31  ? -18.654 -13.090 -13.238 1.00 134.69 ? 135 G   A "O3'" 1 
ATOM   657   C  "C2'" . G   A  1 31  ? -18.880 -10.682 -13.739 1.00 136.16 ? 135 G   A "C2'" 1 
ATOM   658   O  "O2'" . G   A  1 31  ? -20.245 -10.874 -14.087 1.00 130.82 ? 135 G   A "O2'" 1 
ATOM   659   C  "C1'" . G   A  1 31  ? -18.798 -9.467  -12.822 1.00 129.42 ? 135 G   A "C1'" 1 
ATOM   660   N  N9    . G   A  1 31  ? -17.437 -8.899  -12.893 1.00 130.15 ? 135 G   A N9    1 
ATOM   661   C  C8    . G   A  1 31  ? -16.436 -8.921  -11.954 1.00 130.56 ? 135 G   A C8    1 
ATOM   662   N  N7    . G   A  1 31  ? -15.336 -8.334  -12.350 1.00 131.36 ? 135 G   A N7    1 
ATOM   663   C  C5    . G   A  1 31  ? -15.626 -7.915  -13.628 1.00 131.44 ? 135 G   A C5    1 
ATOM   664   C  C6    . G   A  1 31  ? -14.827 -7.227  -14.560 1.00 132.19 ? 135 G   A C6    1 
ATOM   665   O  O6    . G   A  1 31  ? -13.660 -6.843  -14.432 1.00 133.00 ? 135 G   A O6    1 
ATOM   666   N  N1    . G   A  1 31  ? -15.529 -6.988  -15.742 1.00 148.50 ? 135 G   A N1    1 
ATOM   667   C  C2    . G   A  1 31  ? -16.828 -7.369  -15.989 1.00 131.24 ? 135 G   A C2    1 
ATOM   668   N  N2    . G   A  1 31  ? -17.348 -7.053  -17.186 1.00 131.25 ? 135 G   A N2    1 
ATOM   669   N  N3    . G   A  1 31  ? -17.572 -8.013  -15.118 1.00 130.59 ? 135 G   A N3    1 
ATOM   670   C  C4    . G   A  1 31  ? -16.915 -8.238  -13.970 1.00 130.68 ? 135 G   A C4    1 
ATOM   671   P  P     . G   A  1 32  ? -17.520 -13.888 -14.054 1.00 130.78 ? 136 G   A P     1 
ATOM   672   O  OP1   . G   A  1 32  ? -17.948 -15.289 -14.041 1.00 155.20 ? 136 G   A OP1   1 
ATOM   673   O  OP2   . G   A  1 32  ? -16.160 -13.538 -13.579 1.00 130.78 ? 136 G   A OP2   1 
ATOM   674   O  "O5'" . G   A  1 32  ? -17.678 -13.393 -15.554 1.00 129.35 ? 136 G   A "O5'" 1 
ATOM   675   C  "C5'" . G   A  1 32  ? -18.954 -13.385 -16.181 1.00 129.24 ? 136 G   A "C5'" 1 
ATOM   676   C  "C4'" . G   A  1 32  ? -18.939 -12.569 -17.451 1.00 142.10 ? 136 G   A "C4'" 1 
ATOM   677   O  "O4'" . G   A  1 32  ? -18.665 -11.179 -17.131 1.00 136.12 ? 136 G   A "O4'" 1 
ATOM   678   C  "C3'" . G   A  1 32  ? -17.853 -12.938 -18.455 1.00 142.02 ? 136 G   A "C3'" 1 
ATOM   679   O  "O3'" . G   A  1 32  ? -18.195 -14.020 -19.294 1.00 125.78 ? 136 G   A "O3'" 1 
ATOM   680   C  "C2'" . G   A  1 32  ? -17.648 -11.637 -19.218 1.00 138.03 ? 136 G   A "C2'" 1 
ATOM   681   O  "O2'" . G   A  1 32  ? -18.694 -11.428 -20.156 1.00 141.41 ? 136 G   A "O2'" 1 
ATOM   682   C  "C1'" . G   A  1 32  ? -17.805 -10.618 -18.101 1.00 136.51 ? 136 G   A "C1'" 1 
ATOM   683   N  N9    . G   A  1 32  ? -16.515 -10.355 -17.443 1.00 141.03 ? 136 G   A N9    1 
ATOM   684   C  C8    . G   A  1 32  ? -16.220 -10.645 -16.136 1.00 149.01 ? 136 G   A C8    1 
ATOM   685   N  N7    . G   A  1 32  ? -15.012 -10.302 -15.792 1.00 148.93 ? 136 G   A N7    1 
ATOM   686   C  C5    . G   A  1 32  ? -14.470 -9.758  -16.936 1.00 143.75 ? 136 G   A C5    1 
ATOM   687   C  C6    . G   A  1 32  ? -13.180 -9.228  -17.139 1.00 142.07 ? 136 G   A C6    1 
ATOM   688   O  O6    . G   A  1 32  ? -12.238 -9.124  -16.349 1.00 139.54 ? 136 G   A O6    1 
ATOM   689   N  N1    . G   A  1 32  ? -13.048 -8.788  -18.434 1.00 136.17 ? 136 G   A N1    1 
ATOM   690   C  C2    . G   A  1 32  ? -14.016 -8.847  -19.395 1.00 132.95 ? 136 G   A C2    1 
ATOM   691   N  N2    . G   A  1 32  ? -13.653 -8.344  -20.579 1.00 134.60 ? 136 G   A N2    1 
ATOM   692   N  N3    . G   A  1 32  ? -15.226 -9.345  -19.223 1.00 130.11 ? 136 G   A N3    1 
ATOM   693   C  C4    . G   A  1 32  ? -15.386 -9.775  -17.965 1.00 139.41 ? 136 G   A C4    1 
ATOM   694   P  P     . U   A  1 33  ? -17.049 -15.001 -19.817 1.00 124.68 ? 137 U   A P     1 
ATOM   695   O  OP1   . U   A  1 33  ? -17.738 -15.959 -20.707 1.00 124.47 ? 137 U   A OP1   1 
ATOM   696   O  OP2   . U   A  1 33  ? -16.248 -15.441 -18.653 1.00 125.44 ? 137 U   A OP2   1 
ATOM   697   O  "O5'" . U   A  1 33  ? -16.120 -14.098 -20.746 1.00 123.53 ? 137 U   A "O5'" 1 
ATOM   698   C  "C5'" . U   A  1 33  ? -16.580 -13.614 -22.001 1.00 122.59 ? 137 U   A "C5'" 1 
ATOM   699   C  "C4'" . U   A  1 33  ? -15.539 -12.775 -22.702 1.00 121.63 ? 137 U   A "C4'" 1 
ATOM   700   O  "O4'" . U   A  1 33  ? -15.198 -11.638 -21.863 1.00 122.39 ? 137 U   A "O4'" 1 
ATOM   701   C  "C3'" . U   A  1 33  ? -14.187 -13.417 -22.978 1.00 144.58 ? 137 U   A "C3'" 1 
ATOM   702   O  "O3'" . U   A  1 33  ? -14.158 -14.318 -24.072 1.00 142.38 ? 137 U   A "O3'" 1 
ATOM   703   C  "C2'" . U   A  1 33  ? -13.304 -12.200 -23.160 1.00 120.43 ? 137 U   A "C2'" 1 
ATOM   704   O  "O2'" . U   A  1 33  ? -13.598 -11.584 -24.399 1.00 119.47 ? 137 U   A "O2'" 1 
ATOM   705   C  "C1'" . U   A  1 33  ? -13.841 -11.300 -22.051 1.00 121.74 ? 137 U   A "C1'" 1 
ATOM   706   N  N1    . U   A  1 33  ? -13.126 -11.557 -20.785 1.00 122.65 ? 137 U   A N1    1 
ATOM   707   C  C2    . U   A  1 33  ? -11.857 -11.050 -20.667 1.00 122.38 ? 137 U   A C2    1 
ATOM   708   O  O2    . U   A  1 33  ? -11.333 -10.408 -21.547 1.00 121.42 ? 137 U   A O2    1 
ATOM   709   N  N3    . U   A  1 33  ? -11.206 -11.331 -19.493 1.00 123.27 ? 137 U   A N3    1 
ATOM   710   C  C4    . U   A  1 33  ? -11.693 -12.057 -18.427 1.00 124.40 ? 137 U   A C4    1 
ATOM   711   O  O4    . U   A  1 33  ? -10.985 -12.234 -17.428 1.00 125.15 ? 137 U   A O4    1 
ATOM   712   C  C5    . U   A  1 33  ? -13.025 -12.548 -18.622 1.00 127.85 ? 137 U   A C5    1 
ATOM   713   C  C6    . U   A  1 33  ? -13.679 -12.288 -19.761 1.00 123.76 ? 137 U   A C6    1 
ATOM   714   P  P     . G   A  1 34  ? -13.243 -15.643 -24.006 1.00 119.17 ? 138 G   A P     1 
ATOM   715   O  OP1   . G   A  1 34  ? -13.641 -16.451 -25.172 1.00 118.12 ? 138 G   A OP1   1 
ATOM   716   O  OP2   . G   A  1 34  ? -13.238 -16.217 -22.643 1.00 120.34 ? 138 G   A OP2   1 
ATOM   717   O  "O5'" . G   A  1 34  ? -11.758 -15.147 -24.261 1.00 118.48 ? 138 G   A "O5'" 1 
ATOM   718   C  "C5'" . G   A  1 34  ? -11.360 -14.744 -25.556 1.00 117.23 ? 138 G   A "C5'" 1 
ATOM   719   C  "C4'" . G   A  1 34  ? -10.018 -14.076 -25.535 1.00 116.91 ? 138 G   A "C4'" 1 
ATOM   720   O  "O4'" . G   A  1 34  ? -10.035 -12.983 -24.595 1.00 117.91 ? 138 G   A "O4'" 1 
ATOM   721   C  "C3'" . G   A  1 34  ? -8.849  -14.921 -25.071 1.00 119.27 ? 138 G   A "C3'" 1 
ATOM   722   O  "O3'" . G   A  1 34  ? -8.372  -15.813 -26.062 1.00 118.04 ? 138 G   A "O3'" 1 
ATOM   723   C  "C2'" . G   A  1 34  ? -7.833  -13.860 -24.671 1.00 117.04 ? 138 G   A "C2'" 1 
ATOM   724   O  "O2'" . G   A  1 34  ? -7.219  -13.305 -25.822 1.00 115.90 ? 138 G   A "O2'" 1 
ATOM   725   C  "C1'" . G   A  1 34  ? -8.738  -12.785 -24.080 1.00 118.00 ? 138 G   A "C1'" 1 
ATOM   726   N  N9    . G   A  1 34  ? -8.811  -12.817 -22.613 1.00 119.38 ? 138 G   A N9    1 
ATOM   727   C  C8    . G   A  1 34  ? -9.916  -13.209 -21.913 1.00 120.33 ? 138 G   A C8    1 
ATOM   728   N  N7    . G   A  1 34  ? -9.755  -13.113 -20.625 1.00 121.52 ? 138 G   A N7    1 
ATOM   729   C  C5    . G   A  1 34  ? -8.479  -12.615 -20.462 1.00 121.35 ? 138 G   A C5    1 
ATOM   730   C  C6    . G   A  1 34  ? -7.787  -12.321 -19.269 1.00 122.35 ? 138 G   A C6    1 
ATOM   731   O  O6    . G   A  1 34  ? -8.182  -12.451 -18.106 1.00 123.60 ? 138 G   A O6    1 
ATOM   732   N  N1    . G   A  1 34  ? -6.513  -11.830 -19.536 1.00 121.79 ? 138 G   A N1    1 
ATOM   733   C  C2    . G   A  1 34  ? -5.977  -11.652 -20.787 1.00 120.46 ? 138 G   A C2    1 
ATOM   734   N  N2    . G   A  1 34  ? -4.725  -11.163 -20.848 1.00 120.13 ? 138 G   A N2    1 
ATOM   735   N  N3    . G   A  1 34  ? -6.631  -11.933 -21.909 1.00 119.53 ? 138 G   A N3    1 
ATOM   736   C  C4    . G   A  1 34  ? -7.874  -12.412 -21.680 1.00 120.04 ? 138 G   A C4    1 
ATOM   737   P  P     . A   A  1 35  ? -7.647  -17.181 -25.636 1.00 115.53 ? 139 A   A P     1 
ATOM   738   O  OP1   . A   A  1 35  ? -7.466  -17.969 -26.884 1.00 114.19 ? 139 A   A OP1   1 
ATOM   739   O  OP2   . A   A  1 35  ? -8.388  -17.742 -24.484 1.00 116.70 ? 139 A   A OP2   1 
ATOM   740   O  "O5'" . A   A  1 35  ? -6.213  -16.704 -25.138 1.00 119.26 ? 139 A   A "O5'" 1 
ATOM   741   C  "C5'" . A   A  1 35  ? -5.270  -16.217 -26.077 1.00 117.00 ? 139 A   A "C5'" 1 
ATOM   742   C  "C4'" . A   A  1 35  ? -4.134  -15.470 -25.423 1.00 115.08 ? 139 A   A "C4'" 1 
ATOM   743   O  "O4'" . A   A  1 35  ? -4.642  -14.472 -24.515 1.00 116.22 ? 139 A   A "O4'" 1 
ATOM   744   C  "C3'" . A   A  1 35  ? -3.200  -16.269 -24.544 1.00 143.82 ? 139 A   A "C3'" 1 
ATOM   745   O  "O3'" . A   A  1 35  ? -2.308  -17.094 -25.244 1.00 139.67 ? 139 A   A "O3'" 1 
ATOM   746   C  "C2'" . A   A  1 35  ? -2.527  -15.176 -23.726 1.00 116.32 ? 139 A   A "C2'" 1 
ATOM   747   O  "O2'" . A   A  1 35  ? -1.587  -14.464 -24.513 1.00 115.50 ? 139 A   A "O2'" 1 
ATOM   748   C  "C1'" . A   A  1 35  ? -3.696  -14.246 -23.488 1.00 116.97 ? 139 A   A "C1'" 1 
ATOM   749   N  N9    . A   A  1 35  ? -4.343  -14.516 -22.201 1.00 118.31 ? 139 A   A N9    1 
ATOM   750   C  C8    . A   A  1 35  ? -5.601  -15.021 -22.006 1.00 118.73 ? 139 A   A C8    1 
ATOM   751   N  N7    . A   A  1 35  ? -5.928  -15.118 -20.743 1.00 128.73 ? 139 A   A N7    1 
ATOM   752   C  C5    . A   A  1 35  ? -4.822  -14.630 -20.075 1.00 120.47 ? 139 A   A C5    1 
ATOM   753   C  C6    . A   A  1 35  ? -4.561  -14.479 -18.711 1.00 122.20 ? 139 A   A C6    1 
ATOM   754   N  N6    . A   A  1 35  ? -5.434  -14.824 -17.757 1.00 122.91 ? 139 A   A N6    1 
ATOM   755   N  N1    . A   A  1 35  ? -3.356  -13.960 -18.380 1.00 124.30 ? 139 A   A N1    1 
ATOM   756   C  C2    . A   A  1 35  ? -2.493  -13.618 -19.352 1.00 120.79 ? 139 A   A C2    1 
ATOM   757   N  N3    . A   A  1 35  ? -2.632  -13.729 -20.670 1.00 119.50 ? 139 A   A N3    1 
ATOM   758   C  C4    . A   A  1 35  ? -3.839  -14.239 -20.962 1.00 119.42 ? 139 A   A C4    1 
ATOM   759   P  P     . C   A  1 36  ? -2.080  -18.572 -24.715 1.00 114.61 ? 140 C   A P     1 
ATOM   760   O  OP1   . C   A  1 36  ? -1.370  -19.173 -25.860 1.00 113.24 ? 140 C   A OP1   1 
ATOM   761   O  OP2   . C   A  1 36  ? -3.360  -19.066 -24.155 1.00 115.33 ? 140 C   A OP2   1 
ATOM   762   O  "O5'" . C   A  1 36  ? -1.041  -18.446 -23.529 1.00 115.53 ? 140 C   A "O5'" 1 
ATOM   763   C  "C5'" . C   A  1 36  ? 0.291   -18.104 -23.821 1.00 115.05 ? 140 C   A "C5'" 1 
ATOM   764   C  "C4'" . C   A  1 36  ? 0.919   -17.402 -22.662 1.00 121.65 ? 140 C   A "C4'" 1 
ATOM   765   O  "O4'" . C   A  1 36  ? -0.032  -16.482 -22.082 1.00 125.79 ? 140 C   A "O4'" 1 
ATOM   766   C  "C3'" . C   A  1 36  ? 1.317   -18.262 -21.494 1.00 117.08 ? 140 C   A "C3'" 1 
ATOM   767   O  "O3'" . C   A  1 36  ? 2.523   -18.940 -21.710 1.00 116.50 ? 140 C   A "O3'" 1 
ATOM   768   C  "C2'" . C   A  1 36  ? 1.383   -17.252 -20.359 1.00 118.40 ? 140 C   A "C2'" 1 
ATOM   769   O  "O2'" . C   A  1 36  ? 2.535   -16.432 -20.464 1.00 118.27 ? 140 C   A "O2'" 1 
ATOM   770   C  "C1'" . C   A  1 36  ? 0.203   -16.370 -20.696 1.00 125.48 ? 140 C   A "C1'" 1 
ATOM   771   N  N1    . C   A  1 36  ? -1.013  -16.760 -19.980 1.00 123.74 ? 140 C   A N1    1 
ATOM   772   C  C2    . C   A  1 36  ? -1.061  -16.541 -18.606 1.00 120.76 ? 140 C   A C2    1 
ATOM   773   O  O2    . C   A  1 36  ? -0.081  -16.080 -17.994 1.00 121.28 ? 140 C   A O2    1 
ATOM   774   N  N3    . C   A  1 36  ? -2.196  -16.868 -17.978 1.00 121.58 ? 140 C   A N3    1 
ATOM   775   C  C4    . C   A  1 36  ? -3.222  -17.366 -18.675 1.00 121.01 ? 140 C   A C4    1 
ATOM   776   N  N4    . C   A  1 36  ? -4.330  -17.676 -18.005 1.00 128.28 ? 140 C   A N4    1 
ATOM   777   C  C5    . C   A  1 36  ? -3.194  -17.578 -20.081 1.00 119.55 ? 140 C   A C5    1 
ATOM   778   C  C6    . C   A  1 36  ? -2.065  -17.251 -20.696 1.00 121.90 ? 140 C   A C6    1 
ATOM   779   P  P     . C   A  1 37  ? 2.670   -20.431 -21.175 1.00 116.64 ? 141 C   A P     1 
ATOM   780   O  OP1   . C   A  1 37  ? 4.026   -20.877 -21.576 1.00 119.84 ? 141 C   A OP1   1 
ATOM   781   O  OP2   . C   A  1 37  ? 1.470   -21.199 -21.562 1.00 116.27 ? 141 C   A OP2   1 
ATOM   782   O  "O5'" . C   A  1 37  ? 2.598   -20.278 -19.600 1.00 118.28 ? 141 C   A "O5'" 1 
ATOM   783   C  "C5'" . C   A  1 37  ? 3.619   -19.588 -18.921 1.00 118.98 ? 141 C   A "C5'" 1 
ATOM   784   C  "C4'" . C   A  1 37  ? 3.278   -19.394 -17.477 1.00 120.57 ? 141 C   A "C4'" 1 
ATOM   785   O  "O4'" . C   A  1 37  ? 1.979   -18.780 -17.336 1.00 121.06 ? 141 C   A "O4'" 1 
ATOM   786   C  "C3'" . C   A  1 37  ? 3.151   -20.620 -16.610 1.00 139.08 ? 141 C   A "C3'" 1 
ATOM   787   O  "O3'" . C   A  1 37  ? 4.393   -21.219 -16.308 1.00 142.45 ? 141 C   A "O3'" 1 
ATOM   788   C  "C2'" . C   A  1 37  ? 2.441   -20.042 -15.397 1.00 122.76 ? 141 C   A "C2'" 1 
ATOM   789   O  "O2'" . C   A  1 37  ? 3.338   -19.217 -14.674 1.00 123.59 ? 141 C   A "O2'" 1 
ATOM   790   C  "C1'" . C   A  1 37  ? 1.462   -19.094 -16.061 1.00 122.42 ? 141 C   A "C1'" 1 
ATOM   791   N  N1    . C   A  1 37  ? 0.086   -19.615 -16.175 1.00 122.44 ? 141 C   A N1    1 
ATOM   792   C  C2    . C   A  1 37  ? -0.693  -19.805 -15.023 1.00 123.77 ? 141 C   A C2    1 
ATOM   793   O  O2    . C   A  1 37  ? -0.215  -19.584 -13.901 1.00 124.94 ? 141 C   A O2    1 
ATOM   794   N  N3    . C   A  1 37  ? -1.967  -20.236 -15.148 1.00 123.80 ? 141 C   A N3    1 
ATOM   795   C  C4    . C   A  1 37  ? -2.468  -20.461 -16.356 1.00 122.58 ? 141 C   A C4    1 
ATOM   796   N  N4    . C   A  1 37  ? -3.725  -20.891 -16.452 1.00 122.67 ? 141 C   A N4    1 
ATOM   797   C  C5    . C   A  1 37  ? -1.703  -20.258 -17.531 1.00 121.23 ? 141 C   A C5    1 
ATOM   798   C  C6    . C   A  1 37  ? -0.445  -19.832 -17.403 1.00 121.20 ? 141 C   A C6    1 
ATOM   799   P  P     . U   A  1 38  ? 4.512   -22.807 -16.213 1.00 120.87 ? 142 U   A P     1 
ATOM   800   O  OP1   . U   A  1 38  ? 5.935   -23.056 -15.871 1.00 120.98 ? 142 U   A OP1   1 
ATOM   801   O  OP2   . U   A  1 38  ? 3.918   -23.416 -17.422 1.00 119.49 ? 142 U   A OP2   1 
ATOM   802   O  "O5'" . U   A  1 38  ? 3.562   -23.159 -14.994 1.00 122.22 ? 142 U   A "O5'" 1 
ATOM   803   C  "C5'" . U   A  1 38  ? 3.902   -22.711 -13.700 1.00 123.72 ? 142 U   A "C5'" 1 
ATOM   804   C  "C4'" . U   A  1 38  ? 2.826   -23.018 -12.699 1.00 124.91 ? 142 U   A "C4'" 1 
ATOM   805   O  "O4'" . U   A  1 38  ? 1.617   -22.334 -13.067 1.00 124.88 ? 142 U   A "O4'" 1 
ATOM   806   C  "C3'" . U   A  1 38  ? 2.377   -24.455 -12.568 1.00 137.69 ? 142 U   A "C3'" 1 
ATOM   807   O  "O3'" . U   A  1 38  ? 3.282   -25.259 -11.841 1.00 138.39 ? 142 U   A "O3'" 1 
ATOM   808   C  "C2'" . U   A  1 38  ? 1.023   -24.300 -11.895 1.00 125.76 ? 142 U   A "C2'" 1 
ATOM   809   O  "O2'" . U   A  1 38  ? 1.167   -24.042 -10.509 1.00 127.39 ? 142 U   A "O2'" 1 
ATOM   810   C  "C1'" . U   A  1 38  ? 0.511   -23.027 -12.552 1.00 125.47 ? 142 U   A "C1'" 1 
ATOM   811   N  N1    . U   A  1 38  ? -0.415  -23.308 -13.650 1.00 124.35 ? 142 U   A N1    1 
ATOM   812   C  C2    . U   A  1 38  ? -1.679  -23.589 -13.226 1.00 125.00 ? 142 U   A C2    1 
ATOM   813   O  O2    . U   A  1 38  ? -1.968  -23.608 -12.043 1.00 126.38 ? 142 U   A O2    1 
ATOM   814   N  N3    . U   A  1 38  ? -2.569  -23.843 -14.228 1.00 124.03 ? 142 U   A N3    1 
ATOM   815   C  C4    . U   A  1 38  ? -2.302  -23.848 -15.575 1.00 122.51 ? 142 U   A C4    1 
ATOM   816   O  O4    . U   A  1 38  ? -3.222  -24.112 -16.351 1.00 121.82 ? 142 U   A O4    1 
ATOM   817   C  C5    . U   A  1 38  ? -0.947  -23.534 -15.923 1.00 121.93 ? 142 U   A C5    1 
ATOM   818   C  C6    . U   A  1 38  ? -0.052  -23.277 -14.966 1.00 122.85 ? 142 U   A C6    1 
ATOM   819   P  P     . C   A  1 39  ? 3.154   -26.852 -11.897 1.00 124.63 ? 143 C   A P     1 
ATOM   820   O  OP1   . C   A  1 39  ? 4.515   -27.388 -11.689 1.00 124.49 ? 143 C   A OP1   1 
ATOM   821   O  OP2   . C   A  1 39  ? 2.351   -27.291 -13.069 1.00 123.29 ? 143 C   A OP2   1 
ATOM   822   O  "O5'" . C   A  1 39  ? 2.253   -27.184 -10.643 1.00 126.11 ? 143 C   A "O5'" 1 
ATOM   823   C  "C5'" . C   A  1 39  ? 1.311   -28.230 -10.732 1.00 125.83 ? 143 C   A "C5'" 1 
ATOM   824   C  "C4'" . C   A  1 39  ? 0.130   -27.981 -9.849  1.00 127.16 ? 143 C   A "C4'" 1 
ATOM   825   O  "O4'" . C   A  1 39  ? -0.657  -26.905 -10.400 1.00 127.02 ? 143 C   A "O4'" 1 
ATOM   826   C  "C3'" . C   A  1 39  ? -0.848  -29.127 -9.739  1.00 148.12 ? 143 C   A "C3'" 1 
ATOM   827   O  "O3'" . C   A  1 39  ? -0.424  -30.109 -8.812  1.00 151.88 ? 143 C   A "O3'" 1 
ATOM   828   C  "C2'" . C   A  1 39  ? -2.151  -28.424 -9.371  1.00 128.05 ? 143 C   A "C2'" 1 
ATOM   829   O  "O2'" . C   A  1 39  ? -2.145  -28.059 -8.002  1.00 129.78 ? 143 C   A "O2'" 1 
ATOM   830   C  "C1'" . C   A  1 39  ? -2.030  -27.139 -10.176 1.00 127.50 ? 143 C   A "C1'" 1 
ATOM   831   N  N1    . C   A  1 39  ? -2.717  -27.140 -11.487 1.00 126.15 ? 143 C   A N1    1 
ATOM   832   C  C2    . C   A  1 39  ? -4.088  -27.348 -11.715 1.00 126.16 ? 143 C   A C2    1 
ATOM   833   O  O2    . C   A  1 39  ? -4.856  -27.593 -10.785 1.00 127.33 ? 143 C   A O2    1 
ATOM   834   N  N3    . C   A  1 39  ? -4.552  -27.253 -12.986 1.00 124.87 ? 143 C   A N3    1 
ATOM   835   C  C4    . C   A  1 39  ? -3.731  -26.975 -13.994 1.00 145.90 ? 143 C   A C4    1 
ATOM   836   N  N4    . C   A  1 39  ? -4.211  -26.894 -15.239 1.00 149.27 ? 143 C   A N4    1 
ATOM   837   C  C5    . C   A  1 39  ? -2.345  -26.761 -13.780 1.00 141.22 ? 143 C   A C5    1 
ATOM   838   C  C6    . C   A  1 39  ? -1.900  -26.841 -12.531 1.00 141.98 ? 143 C   A C6    1 
ATOM   839   P  P     . C   A  1 40  ? 0.078   -31.549 -9.314  1.00 126.54 ? 144 C   A P     1 
ATOM   840   O  OP1   . C   A  1 40  ? -0.117  -32.334 -8.088  1.00 127.74 ? 144 C   A OP1   1 
ATOM   841   O  OP2   . C   A  1 40  ? 1.361   -31.626 -10.063 1.00 125.37 ? 144 C   A OP2   1 
ATOM   842   O  "O5'" . C   A  1 40  ? -1.039  -31.957 -10.346 1.00 125.40 ? 144 C   A "O5'" 1 
ATOM   843   C  "C5'" . C   A  1 40  ? -1.858  -33.059 -10.071 1.00 125.47 ? 144 C   A "C5'" 1 
ATOM   844   C  "C4'" . C   A  1 40  ? -3.104  -32.658 -9.344  1.00 126.78 ? 144 C   A "C4'" 1 
ATOM   845   O  "O4'" . C   A  1 40  ? -3.547  -31.363 -9.814  1.00 126.83 ? 144 C   A "O4'" 1 
ATOM   846   C  "C3'" . C   A  1 40  ? -4.279  -33.587 -9.594  1.00 133.94 ? 144 C   A "C3'" 1 
ATOM   847   O  "O3'" . C   A  1 40  ? -4.269  -34.707 -8.725  1.00 135.86 ? 144 C   A "O3'" 1 
ATOM   848   C  "C2'" . C   A  1 40  ? -5.488  -32.672 -9.453  1.00 134.48 ? 144 C   A "C2'" 1 
ATOM   849   O  "O2'" . C   A  1 40  ? -5.785  -32.454 -8.084  1.00 136.98 ? 144 C   A "O2'" 1 
ATOM   850   C  "C1'" . C   A  1 40  ? -4.941  -31.367 -10.024 1.00 126.94 ? 144 C   A "C1'" 1 
ATOM   851   N  N1    . C   A  1 40  ? -5.172  -31.155 -11.472 1.00 125.41 ? 144 C   A N1    1 
ATOM   852   C  C2    . C   A  1 40  ? -6.360  -31.317 -12.199 1.00 124.86 ? 144 C   A C2    1 
ATOM   853   O  O2    . C   A  1 40  ? -7.375  -31.729 -11.647 1.00 125.63 ? 144 C   A O2    1 
ATOM   854   N  N3    . C   A  1 40  ? -6.362  -31.020 -13.525 1.00 130.62 ? 144 C   A N3    1 
ATOM   855   C  C4    . C   A  1 40  ? -5.274  -30.563 -14.134 1.00 137.88 ? 144 C   A C4    1 
ATOM   856   N  N4    . C   A  1 40  ? -5.300  -30.270 -15.440 1.00 141.66 ? 144 C   A N4    1 
ATOM   857   C  C5    . C   A  1 40  ? -4.072  -30.369 -13.413 1.00 140.92 ? 144 C   A C5    1 
ATOM   858   C  C6    . C   A  1 40  ? -4.081  -30.668 -12.116 1.00 142.94 ? 144 C   A C6    1 
ATOM   859   P  P     . C   A  1 41  ? -3.805  -36.152 -9.265  1.00 125.61 ? 145 C   A P     1 
ATOM   860   O  OP1   . C   A  1 41  ? -4.187  -37.079 -8.195  1.00 126.58 ? 145 C   A OP1   1 
ATOM   861   O  OP2   . C   A  1 41  ? -2.431  -36.256 -9.832  1.00 124.54 ? 145 C   A OP2   1 
ATOM   862   O  "O5'" . C   A  1 41  ? -4.819  -36.406 -10.442 1.00 124.38 ? 145 C   A "O5'" 1 
ATOM   863   C  "C5'" . C   A  1 41  ? -5.634  -37.544 -10.386 1.00 124.16 ? 145 C   A "C5'" 1 
ATOM   864   C  "C4'" . C   A  1 41  ? -7.040  -37.234 -10.791 1.00 124.24 ? 145 C   A "C4'" 1 
ATOM   865   O  "O4'" . C   A  1 41  ? -7.197  -35.833 -11.137 1.00 124.51 ? 145 C   A "O4'" 1 
ATOM   866   C  "C3'" . C   A  1 41  ? -7.484  -37.959 -12.036 1.00 145.27 ? 145 C   A "C3'" 1 
ATOM   867   O  "O3'" . C   A  1 41  ? -7.770  -39.313 -11.790 1.00 122.33 ? 145 C   A "O3'" 1 
ATOM   868   C  "C2'" . C   A  1 41  ? -8.656  -37.114 -12.494 1.00 143.49 ? 145 C   A "C2'" 1 
ATOM   869   O  "O2'" . C   A  1 41  ? -9.783  -37.324 -11.658 1.00 124.09 ? 145 C   A "O2'" 1 
ATOM   870   C  "C1'" . C   A  1 41  ? -8.111  -35.715 -12.213 1.00 123.61 ? 145 C   A "C1'" 1 
ATOM   871   N  N1    . C   A  1 41  ? -7.396  -35.133 -13.376 1.00 122.31 ? 145 C   A N1    1 
ATOM   872   C  C2    . C   A  1 41  ? -8.002  -34.982 -14.634 1.00 125.18 ? 145 C   A C2    1 
ATOM   873   O  O2    . C   A  1 41  ? -9.167  -35.367 -14.793 1.00 129.43 ? 145 C   A O2    1 
ATOM   874   N  N3    . C   A  1 41  ? -7.297  -34.431 -15.653 1.00 123.49 ? 145 C   A N3    1 
ATOM   875   C  C4    . C   A  1 41  ? -6.046  -34.010 -15.455 1.00 123.80 ? 145 C   A C4    1 
ATOM   876   N  N4    . C   A  1 41  ? -5.387  -33.462 -16.480 1.00 118.99 ? 145 C   A N4    1 
ATOM   877   C  C5    . C   A  1 41  ? -5.413  -34.132 -14.193 1.00 125.50 ? 145 C   A C5    1 
ATOM   878   C  C6    . C   A  1 41  ? -6.118  -34.689 -13.200 1.00 128.49 ? 145 C   A C6    1 
ATOM   879   P  P     . G   A  1 42  ? -6.745  -40.410 -12.320 1.00 120.86 ? 146 G   A P     1 
ATOM   880   O  OP1   . G   A  1 42  ? -6.896  -41.449 -11.290 1.00 121.57 ? 146 G   A OP1   1 
ATOM   881   O  OP2   . G   A  1 42  ? -5.390  -39.900 -12.629 1.00 120.35 ? 146 G   A OP2   1 
ATOM   882   O  "O5'" . G   A  1 42  ? -7.379  -40.804 -13.713 1.00 119.26 ? 146 G   A "O5'" 1 
ATOM   883   C  "C5'" . G   A  1 42  ? -8.770  -41.045 -13.792 1.00 119.51 ? 146 G   A "C5'" 1 
ATOM   884   C  "C4'" . G   A  1 42  ? -9.301  -40.872 -15.189 1.00 118.21 ? 146 G   A "C4'" 1 
ATOM   885   O  "O4'" . G   A  1 42  ? -9.344  -39.462 -15.536 1.00 118.55 ? 146 G   A "O4'" 1 
ATOM   886   C  "C3'" . G   A  1 42  ? -8.497  -41.487 -16.322 1.00 133.82 ? 146 G   A "C3'" 1 
ATOM   887   O  "O3'" . G   A  1 42  ? -8.609  -42.897 -16.434 1.00 115.51 ? 146 G   A "O3'" 1 
ATOM   888   C  "C2'" . G   A  1 42  ? -9.022  -40.709 -17.528 1.00 133.34 ? 146 G   A "C2'" 1 
ATOM   889   O  "O2'" . G   A  1 42  ? -10.324 -41.149 -17.892 1.00 115.47 ? 146 G   A "O2'" 1 
ATOM   890   C  "C1'" . G   A  1 42  ? -9.158  -39.308 -16.931 1.00 117.03 ? 146 G   A "C1'" 1 
ATOM   891   N  N9    . G   A  1 42  ? -7.954  -38.482 -17.210 1.00 116.72 ? 146 G   A N9    1 
ATOM   892   C  C8    . G   A  1 42  ? -6.881  -38.155 -16.409 1.00 117.41 ? 146 G   A C8    1 
ATOM   893   N  N7    . G   A  1 42  ? -5.987  -37.408 -17.012 1.00 116.83 ? 146 G   A N7    1 
ATOM   894   C  C5    . G   A  1 42  ? -6.481  -37.234 -18.290 1.00 115.69 ? 146 G   A C5    1 
ATOM   895   C  C6    . G   A  1 42  ? -5.972  -36.529 -19.408 1.00 133.53 ? 146 G   A C6    1 
ATOM   896   O  O6    . G   A  1 42  ? -4.934  -35.880 -19.543 1.00 137.55 ? 146 G   A O6    1 
ATOM   897   N  N1    . G   A  1 42  ? -6.815  -36.618 -20.506 1.00 127.80 ? 146 G   A N1    1 
ATOM   898   C  C2    . G   A  1 42  ? -7.992  -37.298 -20.526 1.00 127.07 ? 146 G   A C2    1 
ATOM   899   N  N2    . G   A  1 42  ? -8.683  -37.291 -21.669 1.00 129.54 ? 146 G   A N2    1 
ATOM   900   N  N3    . G   A  1 42  ? -8.478  -37.961 -19.499 1.00 127.40 ? 146 G   A N3    1 
ATOM   901   C  C4    . G   A  1 42  ? -7.683  -37.886 -18.421 1.00 127.58 ? 146 G   A C4    1 
ATOM   902   P  P     . G   A  1 43  ? -7.355  -43.803 -16.891 1.00 114.08 ? 147 G   A P     1 
ATOM   903   O  OP1   . G   A  1 43  ? -7.880  -45.142 -16.637 1.00 113.77 ? 147 G   A OP1   1 
ATOM   904   O  OP2   . G   A  1 43  ? -6.039  -43.450 -16.310 1.00 114.49 ? 147 G   A OP2   1 
ATOM   905   O  "O5'" . G   A  1 43  ? -7.275  -43.587 -18.465 1.00 112.45 ? 147 G   A "O5'" 1 
ATOM   906   C  "C5'" . G   A  1 43  ? -8.452  -43.692 -19.253 1.00 111.95 ? 147 G   A "C5'" 1 
ATOM   907   C  "C4'" . G   A  1 43  ? -8.234  -43.259 -20.683 1.00 110.60 ? 147 G   A "C4'" 1 
ATOM   908   O  "O4'" . G   A  1 43  ? -8.270  -41.807 -20.822 1.00 111.28 ? 147 G   A "O4'" 1 
ATOM   909   C  "C3'" . G   A  1 43  ? -6.904  -43.639 -21.293 1.00 135.54 ? 147 G   A "C3'" 1 
ATOM   910   O  "O3'" . G   A  1 43  ? -6.819  -45.018 -21.619 1.00 123.43 ? 147 G   A "O3'" 1 
ATOM   911   C  "C2'" . G   A  1 43  ? -6.833  -42.676 -22.479 1.00 108.59 ? 147 G   A "C2'" 1 
ATOM   912   O  "O2'" . G   A  1 43  ? -7.772  -43.029 -23.483 1.00 107.69 ? 147 G   A "O2'" 1 
ATOM   913   C  "C1'" . G   A  1 43  ? -7.358  -41.406 -21.831 1.00 110.14 ? 147 G   A "C1'" 1 
ATOM   914   N  N9    . G   A  1 43  ? -6.254  -40.638 -21.220 1.00 121.53 ? 147 G   A N9    1 
ATOM   915   C  C8    . G   A  1 43  ? -5.804  -40.781 -19.938 1.00 124.94 ? 147 G   A C8    1 
ATOM   916   N  N7    . G   A  1 43  ? -4.815  -39.990 -19.637 1.00 120.96 ? 147 G   A N7    1 
ATOM   917   C  C5    . G   A  1 43  ? -4.583  -39.272 -20.785 1.00 116.86 ? 147 G   A C5    1 
ATOM   918   C  C6    . G   A  1 43  ? -3.615  -38.273 -21.019 1.00 111.46 ? 147 G   A C6    1 
ATOM   919   O  O6    . G   A  1 43  ? -2.771  -37.827 -20.243 1.00 112.26 ? 147 G   A O6    1 
ATOM   920   N  N1    . G   A  1 43  ? -3.690  -37.782 -22.305 1.00 112.96 ? 147 G   A N1    1 
ATOM   921   C  C2    . G   A  1 43  ? -4.589  -38.194 -23.247 1.00 114.74 ? 147 G   A C2    1 
ATOM   922   N  N2    . G   A  1 43  ? -4.472  -37.575 -24.437 1.00 113.64 ? 147 G   A N2    1 
ATOM   923   N  N3    . G   A  1 43  ? -5.509  -39.138 -23.034 1.00 117.58 ? 147 G   A N3    1 
ATOM   924   C  C4    . G   A  1 43  ? -5.460  -39.644 -21.780 1.00 117.82 ? 147 G   A C4    1 
ATOM   925   P  P     . G   A  1 44  ? -5.437  -45.810 -21.417 1.00 107.39 ? 148 G   A P     1 
ATOM   926   O  OP1   . G   A  1 44  ? -5.770  -47.239 -21.501 1.00 106.53 ? 148 G   A OP1   1 
ATOM   927   O  OP2   . G   A  1 44  ? -4.725  -45.297 -20.220 1.00 108.75 ? 148 G   A OP2   1 
ATOM   928   O  "O5'" . G   A  1 44  ? -4.602  -45.461 -22.709 1.00 106.00 ? 148 G   A "O5'" 1 
ATOM   929   C  "C5'" . G   A  1 44  ? -3.213  -45.702 -22.780 1.00 105.36 ? 148 G   A "C5'" 1 
ATOM   930   C  "C4'" . G   A  1 44  ? -2.797  -45.635 -24.214 1.00 103.80 ? 148 G   A "C4'" 1 
ATOM   931   O  "O4'" . G   A  1 44  ? -3.769  -46.349 -24.995 1.00 102.86 ? 148 G   A "O4'" 1 
ATOM   932   C  "C3'" . G   A  1 44  ? -2.803  -44.252 -24.829 1.00 128.69 ? 148 G   A "C3'" 1 
ATOM   933   O  "O3'" . G   A  1 44  ? -1.647  -43.498 -24.516 1.00 141.30 ? 148 G   A "O3'" 1 
ATOM   934   C  "C2'" . G   A  1 44  ? -2.997  -44.541 -26.318 1.00 113.11 ? 148 G   A "C2'" 1 
ATOM   935   O  "O2'" . G   A  1 44  ? -1.776  -44.921 -26.925 1.00 101.25 ? 148 G   A "O2'" 1 
ATOM   936   C  "C1'" . G   A  1 44  ? -3.880  -45.777 -26.274 1.00 101.97 ? 148 G   A "C1'" 1 
ATOM   937   N  N9    . G   A  1 44  ? -5.299  -45.578 -26.595 1.00 102.23 ? 148 G   A N9    1 
ATOM   938   C  C8    . G   A  1 44  ? -6.370  -45.597 -25.739 1.00 103.42 ? 148 G   A C8    1 
ATOM   939   N  N7    . G   A  1 44  ? -7.509  -45.479 -26.360 1.00 103.28 ? 148 G   A N7    1 
ATOM   940   C  C5    . G   A  1 44  ? -7.161  -45.424 -27.692 1.00 101.90 ? 148 G   A C5    1 
ATOM   941   C  C6    . G   A  1 44  ? -7.967  -45.305 -28.830 1.00 101.17 ? 148 G   A C6    1 
ATOM   942   O  O6    . G   A  1 44  ? -9.192  -45.218 -28.900 1.00 101.62 ? 148 G   A O6    1 
ATOM   943   N  N1    . G   A  1 44  ? -7.191  -45.294 -29.973 1.00 99.83  ? 148 G   A N1    1 
ATOM   944   C  C2    . G   A  1 44  ? -5.829  -45.384 -30.027 1.00 99.25  ? 148 G   A C2    1 
ATOM   945   N  N2    . G   A  1 44  ? -5.303  -45.347 -31.257 1.00 97.96  ? 148 G   A N2    1 
ATOM   946   N  N3    . G   A  1 44  ? -5.061  -45.500 -28.966 1.00 99.92  ? 148 G   A N3    1 
ATOM   947   C  C4    . G   A  1 44  ? -5.803  -45.516 -27.852 1.00 101.22 ? 148 G   A C4    1 
ATOM   948   P  P     . A   A  1 45  ? -1.789  -42.006 -23.954 1.00 105.94 ? 149 A   A P     1 
ATOM   949   O  OP1   . A   A  1 45  ? -0.710  -41.766 -22.974 1.00 106.79 ? 149 A   A OP1   1 
ATOM   950   O  OP2   . A   A  1 45  ? -3.189  -41.741 -23.546 1.00 106.90 ? 149 A   A OP2   1 
ATOM   951   O  "O5'" . A   A  1 45  ? -1.543  -41.149 -25.253 1.00 105.06 ? 149 A   A "O5'" 1 
ATOM   952   C  "C5'" . A   A  1 45  ? -2.648  -40.700 -26.010 1.00 104.87 ? 149 A   A "C5'" 1 
ATOM   953   C  "C4'" . A   A  1 45  ? -2.280  -40.380 -27.433 1.00 103.56 ? 149 A   A "C4'" 1 
ATOM   954   O  "O4'" . A   A  1 45  ? -2.959  -41.322 -28.263 1.00 102.43 ? 149 A   A "O4'" 1 
ATOM   955   C  "C3'" . A   A  1 45  ? -2.724  -39.011 -27.953 1.00 129.35 ? 149 A   A "C3'" 1 
ATOM   956   O  "O3'" . A   A  1 45  ? -1.738  -38.014 -27.785 1.00 128.47 ? 149 A   A "O3'" 1 
ATOM   957   C  "C2'" . A   A  1 45  ? -3.036  -39.272 -29.416 1.00 125.47 ? 149 A   A "C2'" 1 
ATOM   958   O  "O2'" . A   A  1 45  ? -1.854  -39.249 -30.204 1.00 101.46 ? 149 A   A "O2'" 1 
ATOM   959   C  "C1'" . A   A  1 45  ? -3.541  -40.693 -29.365 1.00 101.92 ? 149 A   A "C1'" 1 
ATOM   960   N  N9    . A   A  1 45  ? -4.958  -40.774 -29.108 1.00 102.56 ? 149 A   A N9    1 
ATOM   961   C  C8    . A   A  1 45  ? -5.569  -40.967 -27.917 1.00 103.76 ? 149 A   A C8    1 
ATOM   962   N  N7    . A   A  1 45  ? -6.861  -41.034 -28.053 1.00 104.03 ? 149 A   A N7    1 
ATOM   963   C  C5    . A   A  1 45  ? -7.057  -40.871 -29.410 1.00 102.92 ? 149 A   A C5    1 
ATOM   964   C  C6    . A   A  1 45  ? -8.191  -40.836 -30.207 1.00 102.60 ? 149 A   A C6    1 
ATOM   965   N  N6    . A   A  1 45  ? -9.425  -40.979 -29.741 1.00 107.14 ? 149 A   A N6    1 
ATOM   966   N  N1    . A   A  1 45  ? -8.002  -40.652 -31.520 1.00 101.45 ? 149 A   A N1    1 
ATOM   967   C  C2    . A   A  1 45  ? -6.763  -40.506 -31.977 1.00 100.69 ? 149 A   A C2    1 
ATOM   968   N  N3    . A   A  1 45  ? -5.615  -40.533 -31.332 1.00 100.86 ? 149 A   A N3    1 
ATOM   969   C  C4    . A   A  1 45  ? -5.874  -40.689 -30.051 1.00 102.03 ? 149 A   A C4    1 
ATOM   970   P  P     . G   A  1 46  ? -2.105  -36.601 -27.164 1.00 105.76 ? 150 G   A P     1 
ATOM   971   O  OP1   . G   A  1 46  ? -0.798  -35.946 -27.294 1.00 105.62 ? 150 G   A OP1   1 
ATOM   972   O  OP2   . G   A  1 46  ? -2.669  -36.694 -25.796 1.00 107.18 ? 150 G   A OP2   1 
ATOM   973   O  "O5'" . G   A  1 46  ? -3.211  -36.051 -28.171 1.00 105.39 ? 150 G   A "O5'" 1 
ATOM   974   C  "C5'" . G   A  1 46  ? -2.836  -35.515 -29.428 1.00 104.38 ? 150 G   A "C5'" 1 
ATOM   975   C  "C4'" . G   A  1 46  ? -3.991  -35.351 -30.390 1.00 103.91 ? 150 G   A "C4'" 1 
ATOM   976   O  "O4'" . G   A  1 46  ? -4.655  -36.624 -30.538 1.00 103.35 ? 150 G   A "O4'" 1 
ATOM   977   C  "C3'" . G   A  1 46  ? -5.132  -34.406 -30.036 1.00 112.55 ? 150 G   A "C3'" 1 
ATOM   978   O  "O3'" . G   A  1 46  ? -4.853  -33.032 -30.253 1.00 116.83 ? 150 G   A "O3'" 1 
ATOM   979   C  "C2'" . G   A  1 46  ? -6.242  -34.928 -30.945 1.00 108.02 ? 150 G   A "C2'" 1 
ATOM   980   O  "O2'" . G   A  1 46  ? -5.988  -34.564 -32.293 1.00 103.22 ? 150 G   A "O2'" 1 
ATOM   981   C  "C1'" . G   A  1 46  ? -6.019  -36.431 -30.841 1.00 103.61 ? 150 G   A "C1'" 1 
ATOM   982   N  N9    . G   A  1 46  ? -6.829  -37.013 -29.759 1.00 104.56 ? 150 G   A N9    1 
ATOM   983   C  C8    . G   A  1 46  ? -6.432  -37.196 -28.471 1.00 105.52 ? 150 G   A C8    1 
ATOM   984   N  N7    . G   A  1 46  ? -7.374  -37.709 -27.736 1.00 106.27 ? 150 G   A N7    1 
ATOM   985   C  C5    . G   A  1 46  ? -8.465  -37.855 -28.568 1.00 105.80 ? 150 G   A C5    1 
ATOM   986   C  C6    . G   A  1 46  ? -9.769  -38.360 -28.315 1.00 106.25 ? 150 G   A C6    1 
ATOM   987   O  O6    . G   A  1 46  ? -10.284 -38.813 -27.278 1.00 107.18 ? 150 G   A O6    1 
ATOM   988   N  N1    . G   A  1 46  ? -10.520 -38.306 -29.468 1.00 105.50 ? 150 G   A N1    1 
ATOM   989   C  C2    . G   A  1 46  ? -10.074 -37.854 -30.671 1.00 104.48 ? 150 G   A C2    1 
ATOM   990   N  N2    . G   A  1 46  ? -10.967 -37.896 -31.652 1.00 103.93 ? 150 G   A N2    1 
ATOM   991   N  N3    . G   A  1 46  ? -8.873  -37.395 -30.916 1.00 104.04 ? 150 G   A N3    1 
ATOM   992   C  C4    . G   A  1 46  ? -8.132  -37.411 -29.819 1.00 104.76 ? 150 G   A C4    1 
ATOM   993   P  P     . C   A  1 47  ? -4.932  -31.966 -29.057 1.00 106.95 ? 151 C   A P     1 
ATOM   994   O  OP1   . C   A  1 47  ? -5.079  -30.659 -29.690 1.00 106.98 ? 151 C   A OP1   1 
ATOM   995   O  OP2   . C   A  1 47  ? -3.768  -32.120 -28.169 1.00 107.36 ? 151 C   A OP2   1 
ATOM   996   O  "O5'" . C   A  1 47  ? -6.151  -32.419 -28.153 1.00 107.96 ? 151 C   A "O5'" 1 
ATOM   997   C  "C5'" . C   A  1 47  ? -7.491  -32.294 -28.569 1.00 108.07 ? 151 C   A "C5'" 1 
ATOM   998   C  "C4'" . C   A  1 47  ? -8.363  -33.266 -27.815 1.00 108.63 ? 151 C   A "C4'" 1 
ATOM   999   O  "O4'" . C   A  1 47  ? -7.548  -34.368 -27.341 1.00 131.56 ? 151 C   A "O4'" 1 
ATOM   1000  C  "C3'" . C   A  1 47  ? -9.050  -32.765 -26.556 1.00 111.30 ? 151 C   A "C3'" 1 
ATOM   1001  O  "O3'" . C   A  1 47  ? -10.248 -32.064 -26.797 1.00 110.76 ? 151 C   A "O3'" 1 
ATOM   1002  C  "C2'" . C   A  1 47  ? -9.283  -34.044 -25.756 1.00 110.54 ? 151 C   A "C2'" 1 
ATOM   1003  O  "O2'" . C   A  1 47  ? -10.455 -34.718 -26.177 1.00 110.27 ? 151 C   A "O2'" 1 
ATOM   1004  C  "C1'" . C   A  1 47  ? -8.075  -34.884 -26.136 1.00 109.38 ? 151 C   A "C1'" 1 
ATOM   1005  N  N1    . C   A  1 47  ? -7.021  -34.869 -25.105 1.00 110.03 ? 151 C   A N1    1 
ATOM   1006  C  C2    . C   A  1 47  ? -7.282  -35.283 -23.806 1.00 111.19 ? 151 C   A C2    1 
ATOM   1007  O  O2    . C   A  1 47  ? -8.399  -35.641 -23.474 1.00 111.73 ? 151 C   A O2    1 
ATOM   1008  N  N3    . C   A  1 47  ? -6.308  -35.254 -22.899 1.00 111.79 ? 151 C   A N3    1 
ATOM   1009  C  C4    . C   A  1 47  ? -5.098  -34.869 -23.247 1.00 111.25 ? 151 C   A C4    1 
ATOM   1010  N  N4    . C   A  1 47  ? -4.158  -34.872 -22.309 1.00 111.92 ? 151 C   A N4    1 
ATOM   1011  C  C5    . C   A  1 47  ? -4.782  -34.472 -24.566 1.00 110.04 ? 151 C   A C5    1 
ATOM   1012  C  C6    . C   A  1 47  ? -5.765  -34.492 -25.458 1.00 109.46 ? 151 C   A C6    1 
ATOM   1013  P  P     . G   A  1 48  ? -10.935 -31.277 -25.584 1.00 112.47 ? 152 G   A P     1 
ATOM   1014  O  OP1   . G   A  1 48  ? -12.178 -30.646 -26.040 1.00 112.76 ? 152 G   A OP1   1 
ATOM   1015  O  OP2   . G   A  1 48  ? -9.858  -30.703 -24.757 1.00 113.09 ? 152 G   A OP2   1 
ATOM   1016  O  "O5'" . G   A  1 48  ? -11.505 -32.392 -24.637 1.00 113.13 ? 152 G   A "O5'" 1 
ATOM   1017  C  "C5'" . G   A  1 48  ? -12.770 -32.964 -24.889 1.00 122.23 ? 152 G   A "C5'" 1 
ATOM   1018  C  "C4'" . G   A  1 48  ? -13.127 -33.852 -23.744 1.00 122.55 ? 152 G   A "C4'" 1 
ATOM   1019  O  "O4'" . G   A  1 48  ? -11.993 -34.713 -23.479 1.00 113.45 ? 152 G   A "O4'" 1 
ATOM   1020  C  "C3'" . G   A  1 48  ? -13.330 -33.125 -22.433 1.00 122.51 ? 152 G   A "C3'" 1 
ATOM   1021  O  "O3'" . G   A  1 48  ? -14.616 -32.548 -22.307 1.00 118.91 ? 152 G   A "O3'" 1 
ATOM   1022  C  "C2'" . G   A  1 48  ? -13.011 -34.201 -21.410 1.00 116.13 ? 152 G   A "C2'" 1 
ATOM   1023  O  "O2'" . G   A  1 48  ? -14.073 -35.129 -21.321 1.00 116.25 ? 152 G   A "O2'" 1 
ATOM   1024  C  "C1'" . G   A  1 48  ? -11.852 -34.906 -22.091 1.00 114.69 ? 152 G   A "C1'" 1 
ATOM   1025  N  N9    . G   A  1 48  ? -10.568 -34.334 -21.679 1.00 120.28 ? 152 G   A N9    1 
ATOM   1026  C  C8    . G   A  1 48  ? -9.707  -33.567 -22.405 1.00 128.50 ? 152 G   A C8    1 
ATOM   1027  N  N7    . G   A  1 48  ? -8.641  -33.236 -21.732 1.00 130.43 ? 152 G   A N7    1 
ATOM   1028  C  C5    . G   A  1 48  ? -8.830  -33.790 -20.483 1.00 130.13 ? 152 G   A C5    1 
ATOM   1029  C  C6    . G   A  1 48  ? -8.023  -33.750 -19.323 1.00 127.94 ? 152 G   A C6    1 
ATOM   1030  O  O6    . G   A  1 48  ? -6.927  -33.197 -19.137 1.00 133.07 ? 152 G   A O6    1 
ATOM   1031  N  N1    . G   A  1 48  ? -8.620  -34.459 -18.288 1.00 124.81 ? 152 G   A N1    1 
ATOM   1032  C  C2    . G   A  1 48  ? -9.828  -35.108 -18.362 1.00 128.09 ? 152 G   A C2    1 
ATOM   1033  N  N2    . G   A  1 48  ? -10.253 -35.744 -17.260 1.00 134.08 ? 152 G   A N2    1 
ATOM   1034  N  N3    . G   A  1 48  ? -10.582 -35.134 -19.441 1.00 116.82 ? 152 G   A N3    1 
ATOM   1035  C  C4    . G   A  1 48  ? -10.022 -34.463 -20.446 1.00 115.87 ? 152 G   A C4    1 
ATOM   1036  P  P     . G   A  1 49  ? -14.788 -31.153 -21.551 1.00 117.93 ? 153 G   A P     1 
ATOM   1037  O  OP1   . G   A  1 49  ? -16.181 -30.718 -21.811 1.00 118.42 ? 153 G   A OP1   1 
ATOM   1038  O  OP2   . G   A  1 49  ? -13.588 -30.345 -21.886 1.00 117.42 ? 153 G   A OP2   1 
ATOM   1039  O  "O5'" . G   A  1 49  ? -14.649 -31.487 -20.001 1.00 119.30 ? 153 G   A "O5'" 1 
ATOM   1040  C  "C5'" . G   A  1 49  ? -15.687 -32.145 -19.294 1.00 120.20 ? 153 G   A "C5'" 1 
ATOM   1041  C  "C4'" . G   A  1 49  ? -15.268 -32.455 -17.880 1.00 121.37 ? 153 G   A "C4'" 1 
ATOM   1042  O  "O4'" . G   A  1 49  ? -14.019 -33.181 -17.903 1.00 120.55 ? 153 G   A "O4'" 1 
ATOM   1043  C  "C3'" . G   A  1 49  ? -14.954 -31.277 -16.983 1.00 164.34 ? 153 G   A "C3'" 1 
ATOM   1044  O  "O3'" . G   A  1 49  ? -16.098 -30.607 -16.492 1.00 160.35 ? 153 G   A "O3'" 1 
ATOM   1045  C  "C2'" . G   A  1 49  ? -14.094 -31.924 -15.907 1.00 123.18 ? 153 G   A "C2'" 1 
ATOM   1046  O  "O2'" . G   A  1 49  ? -14.892 -32.722 -15.051 1.00 124.12 ? 153 G   A "O2'" 1 
ATOM   1047  C  "C1'" . G   A  1 49  ? -13.269 -32.884 -16.746 1.00 121.60 ? 153 G   A "C1'" 1 
ATOM   1048  N  N9    . G   A  1 49  ? -11.964 -32.334 -17.144 1.00 123.67 ? 153 G   A N9    1 
ATOM   1049  C  C8    . G   A  1 49  ? -11.549 -31.915 -18.381 1.00 126.59 ? 153 G   A C8    1 
ATOM   1050  N  N7    . G   A  1 49  ? -10.311 -31.498 -18.386 1.00 129.35 ? 153 G   A N7    1 
ATOM   1051  C  C5    . G   A  1 49  ? -9.880  -31.653 -17.083 1.00 125.81 ? 153 G   A C5    1 
ATOM   1052  C  C6    . G   A  1 49  ? -8.630  -31.366 -16.485 1.00 126.36 ? 153 G   A C6    1 
ATOM   1053  O  O6    . G   A  1 49  ? -7.606  -30.900 -16.998 1.00 120.11 ? 153 G   A O6    1 
ATOM   1054  N  N1    . G   A  1 49  ? -8.650  -31.682 -15.132 1.00 127.73 ? 153 G   A N1    1 
ATOM   1055  C  C2    . G   A  1 49  ? -9.725  -32.205 -14.454 1.00 137.34 ? 153 G   A C2    1 
ATOM   1056  N  N2    . G   A  1 49  ? -9.570  -32.470 -13.146 1.00 152.67 ? 153 G   A N2    1 
ATOM   1057  N  N3    . G   A  1 49  ? -10.891 -32.470 -15.012 1.00 129.89 ? 153 G   A N3    1 
ATOM   1058  C  C4    . G   A  1 49  ? -10.896 -32.165 -16.314 1.00 125.16 ? 153 G   A C4    1 
ATOM   1059  P  P     . G   A  1 50  ? -16.056 -29.018 -16.275 1.00 156.88 ? 154 G   A P     1 
ATOM   1060  O  OP1   . G   A  1 50  ? -17.394 -28.715 -15.722 1.00 162.40 ? 154 G   A OP1   1 
ATOM   1061  O  OP2   . G   A  1 50  ? -15.534 -28.334 -17.487 1.00 159.00 ? 154 G   A OP2   1 
ATOM   1062  O  "O5'" . G   A  1 50  ? -14.981 -28.796 -15.126 1.00 157.67 ? 154 G   A "O5'" 1 
ATOM   1063  C  "C5'" . G   A  1 50  ? -15.364 -28.908 -13.771 1.00 156.02 ? 154 G   A "C5'" 1 
ATOM   1064  C  "C4'" . G   A  1 50  ? -14.167 -28.959 -12.865 1.00 148.46 ? 154 G   A "C4'" 1 
ATOM   1065  O  "O4'" . G   A  1 50  ? -13.105 -29.702 -13.507 1.00 145.07 ? 154 G   A "O4'" 1 
ATOM   1066  C  "C3'" . G   A  1 50  ? -13.484 -27.663 -12.467 1.00 148.65 ? 154 G   A "C3'" 1 
ATOM   1067  O  "O3'" . G   A  1 50  ? -14.193 -26.910 -11.499 1.00 161.09 ? 154 G   A "O3'" 1 
ATOM   1068  C  "C2'" . G   A  1 50  ? -12.140 -28.175 -11.975 1.00 149.86 ? 154 G   A "C2'" 1 
ATOM   1069  O  "O2'" . G   A  1 50  ? -12.268 -28.785 -10.704 1.00 156.37 ? 154 G   A "O2'" 1 
ATOM   1070  C  "C1'" . G   A  1 50  ? -11.863 -29.285 -12.985 1.00 144.42 ? 154 G   A "C1'" 1 
ATOM   1071  N  N9    . G   A  1 50  ? -10.979 -28.814 -14.055 1.00 125.13 ? 154 G   A N9    1 
ATOM   1072  C  C8    . G   A  1 50  ? -11.147 -28.475 -15.379 1.00 123.87 ? 154 G   A C8    1 
ATOM   1073  N  N7    . G   A  1 50  ? -10.032 -28.064 -15.936 1.00 123.02 ? 154 G   A N7    1 
ATOM   1074  C  C5    . G   A  1 50  ? -9.105  -28.123 -14.902 1.00 123.81 ? 154 G   A C5    1 
ATOM   1075  C  C6    . G   A  1 50  ? -7.732  -27.810 -14.837 1.00 123.55 ? 154 G   A C6    1 
ATOM   1076  O  O6    . G   A  1 50  ? -6.996  -27.393 -15.733 1.00 127.79 ? 154 G   A O6    1 
ATOM   1077  N  N1    . G   A  1 50  ? -7.219  -28.020 -13.555 1.00 124.74 ? 154 G   A N1    1 
ATOM   1078  C  C2    . G   A  1 50  ? -7.925  -28.479 -12.476 1.00 126.00 ? 154 G   A C2    1 
ATOM   1079  N  N2    . G   A  1 50  ? -7.287  -28.636 -11.309 1.00 145.85 ? 154 G   A N2    1 
ATOM   1080  N  N3    . G   A  1 50  ? -9.192  -28.776 -12.532 1.00 126.23 ? 154 G   A N3    1 
ATOM   1081  C  C4    . G   A  1 50  ? -9.696  -28.554 -13.749 1.00 125.12 ? 154 G   A C4    1 
ATOM   1082  P  P     . G   A  1 51  ? -13.913 -25.343 -11.313 1.00 130.25 ? 155 G   A P     1 
ATOM   1083  O  OP1   . G   A  1 51  ? -14.952 -24.953 -10.334 1.00 131.84 ? 155 G   A OP1   1 
ATOM   1084  O  OP2   . G   A  1 51  ? -13.789 -24.672 -12.630 1.00 128.92 ? 155 G   A OP2   1 
ATOM   1085  O  "O5'" . G   A  1 51  ? -12.493 -25.275 -10.594 1.00 130.56 ? 155 G   A "O5'" 1 
ATOM   1086  C  "C5'" . G   A  1 51  ? -12.360 -25.728 -9.262  1.00 131.91 ? 155 G   A "C5'" 1 
ATOM   1087  C  "C4'" . G   A  1 51  ? -10.940 -25.669 -8.760  1.00 132.02 ? 155 G   A "C4'" 1 
ATOM   1088  O  "O4'" . G   A  1 51  ? -10.061 -26.436 -9.617  1.00 130.53 ? 155 G   A "O4'" 1 
ATOM   1089  C  "C3'" . G   A  1 51  ? -10.251 -24.327 -8.692  1.00 152.01 ? 155 G   A "C3'" 1 
ATOM   1090  O  "O3'" . G   A  1 51  ? -10.695 -23.500 -7.640  1.00 160.46 ? 155 G   A "O3'" 1 
ATOM   1091  C  "C2'" . G   A  1 51  ? -8.793  -24.750 -8.567  1.00 140.96 ? 155 G   A "C2'" 1 
ATOM   1092  O  "O2'" . G   A  1 51  ? -8.535  -25.295 -7.284  1.00 133.59 ? 155 G   A "O2'" 1 
ATOM   1093  C  "C1'" . G   A  1 51  ? -8.753  -25.917 -9.535  1.00 130.36 ? 155 G   A "C1'" 1 
ATOM   1094  N  N9    . G   A  1 51  ? -8.316  -25.493 -10.870 1.00 138.23 ? 155 G   A N9    1 
ATOM   1095  C  C8    . G   A  1 51  ? -9.039  -25.464 -12.033 1.00 143.02 ? 155 G   A C8    1 
ATOM   1096  N  N7    . G   A  1 51  ? -8.334  -25.035 -13.045 1.00 148.23 ? 155 G   A N7    1 
ATOM   1097  C  C5    . G   A  1 51  ? -7.074  -24.771 -12.524 1.00 147.83 ? 155 G   A C5    1 
ATOM   1098  C  C6    . G   A  1 51  ? -5.885  -24.276 -13.136 1.00 151.80 ? 155 G   A C6    1 
ATOM   1099  O  O6    . G   A  1 51  ? -5.652  -23.953 -14.315 1.00 153.75 ? 155 G   A O6    1 
ATOM   1100  N  N1    . G   A  1 51  ? -4.864  -24.167 -12.201 1.00 151.20 ? 155 G   A N1    1 
ATOM   1101  C  C2    . G   A  1 51  ? -4.950  -24.480 -10.868 1.00 147.99 ? 155 G   A C2    1 
ATOM   1102  N  N2    . G   A  1 51  ? -3.825  -24.292 -10.159 1.00 151.98 ? 155 G   A N2    1 
ATOM   1103  N  N3    . G   A  1 51  ? -6.045  -24.946 -10.293 1.00 141.36 ? 155 G   A N3    1 
ATOM   1104  C  C4    . G   A  1 51  ? -7.055  -25.065 -11.177 1.00 140.39 ? 155 G   A C4    1 
ATOM   1105  P  P     . G   A  1 52  ? -10.826 -21.924 -7.876  1.00 133.91 ? 156 G   A P     1 
ATOM   1106  O  OP1   . G   A  1 52  ? -12.259 -21.608 -7.677  1.00 134.67 ? 156 G   A OP1   1 
ATOM   1107  O  OP2   . G   A  1 52  ? -10.200 -21.566 -9.171  1.00 132.30 ? 156 G   A OP2   1 
ATOM   1108  O  "O5'" . G   A  1 52  ? -9.903  -21.313 -6.733  1.00 135.08 ? 156 G   A "O5'" 1 
ATOM   1109  C  "C5'" . G   A  1 52  ? -8.963  -20.290 -7.030  1.00 141.20 ? 156 G   A "C5'" 1 
ATOM   1110  C  "C4'" . G   A  1 52  ? -7.541  -20.721 -6.797  1.00 134.44 ? 156 G   A "C4'" 1 
ATOM   1111  O  "O4'" . G   A  1 52  ? -7.236  -21.843 -7.663  1.00 133.11 ? 156 G   A "O4'" 1 
ATOM   1112  C  "C3'" . G   A  1 52  ? -6.485  -19.692 -7.173  1.00 144.02 ? 156 G   A "C3'" 1 
ATOM   1113  O  "O3'" . G   A  1 52  ? -6.303  -18.669 -6.219  1.00 135.17 ? 156 G   A "O3'" 1 
ATOM   1114  C  "C2'" . G   A  1 52  ? -5.266  -20.552 -7.433  1.00 144.41 ? 156 G   A "C2'" 1 
ATOM   1115  O  "O2'" . G   A  1 52  ? -4.731  -21.037 -6.211  1.00 146.77 ? 156 G   A "O2'" 1 
ATOM   1116  C  "C1'" . G   A  1 52  ? -5.912  -21.725 -8.156  1.00 132.21 ? 156 G   A "C1'" 1 
ATOM   1117  N  N9    . G   A  1 52  ? -5.986  -21.500 -9.611  1.00 130.60 ? 156 G   A N9    1 
ATOM   1118  C  C8    . G   A  1 52  ? -7.153  -21.630 -10.318 1.00 130.08 ? 156 G   A C8    1 
ATOM   1119  N  N7    . G   A  1 52  ? -7.014  -21.400 -11.588 1.00 128.67 ? 156 G   A N7    1 
ATOM   1120  C  C5    . G   A  1 52  ? -5.674  -21.097 -11.739 1.00 128.21 ? 156 G   A C5    1 
ATOM   1121  C  C6    . G   A  1 52  ? -4.973  -20.760 -12.921 1.00 132.08 ? 156 G   A C6    1 
ATOM   1122  O  O6    . G   A  1 52  ? -5.409  -20.666 -14.075 1.00 133.50 ? 156 G   A O6    1 
ATOM   1123  N  N1    . G   A  1 52  ? -3.631  -20.519 -12.665 1.00 129.32 ? 156 G   A N1    1 
ATOM   1124  C  C2    . G   A  1 52  ? -3.033  -20.595 -11.428 1.00 128.03 ? 156 G   A C2    1 
ATOM   1125  N  N2    . G   A  1 52  ? -1.717  -20.319 -11.408 1.00 127.83 ? 156 G   A N2    1 
ATOM   1126  N  N3    . G   A  1 52  ? -3.686  -20.909 -10.312 1.00 129.37 ? 156 G   A N3    1 
ATOM   1127  C  C4    . G   A  1 52  ? -5.004  -21.149 -10.532 1.00 129.38 ? 156 G   A C4    1 
ATOM   1128  P  P     . A   A  1 53  ? -6.544  -17.164 -6.694  1.00 134.91 ? 157 A   A P     1 
ATOM   1129  O  OP1   . A   A  1 53  ? -7.026  -16.445 -5.486  1.00 148.91 ? 157 A   A OP1   1 
ATOM   1130  O  OP2   . A   A  1 53  ? -7.384  -17.233 -7.919  1.00 133.70 ? 157 A   A OP2   1 
ATOM   1131  O  "O5'" . A   A  1 53  ? -5.102  -16.618 -7.104  1.00 134.16 ? 157 A   A "O5'" 1 
ATOM   1132  C  "C5'" . A   A  1 53  ? -3.984  -16.800 -6.249  1.00 134.88 ? 157 A   A "C5'" 1 
ATOM   1133  C  "C4'" . A   A  1 53  ? -2.692  -16.461 -6.944  1.00 133.84 ? 157 A   A "C4'" 1 
ATOM   1134  O  "O4'" . A   A  1 53  ? -2.418  -17.516 -7.882  1.00 138.16 ? 157 A   A "O4'" 1 
ATOM   1135  C  "C3'" . A   A  1 53  ? -2.650  -15.199 -7.802  1.00 146.32 ? 157 A   A "C3'" 1 
ATOM   1136  O  "O3'" . A   A  1 53  ? -2.368  -14.006 -7.106  1.00 142.58 ? 157 A   A "O3'" 1 
ATOM   1137  C  "C2'" . A   A  1 53  ? -1.590  -15.530 -8.831  1.00 131.58 ? 157 A   A "C2'" 1 
ATOM   1138  O  "O2'" . A   A  1 53  ? -0.294  -15.445 -8.257  1.00 132.01 ? 157 A   A "O2'" 1 
ATOM   1139  C  "C1'" . A   A  1 53  ? -1.892  -16.987 -9.077  1.00 133.79 ? 157 A   A "C1'" 1 
ATOM   1140  N  N9    . A   A  1 53  ? -2.919  -17.143 -10.110 1.00 130.61 ? 157 A   A N9    1 
ATOM   1141  C  C8    . A   A  1 53  ? -4.271  -17.331 -9.954  1.00 132.57 ? 157 A   A C8    1 
ATOM   1142  N  N7    . A   A  1 53  ? -4.903  -17.448 -11.093 1.00 133.46 ? 157 A   A N7    1 
ATOM   1143  C  C5    . A   A  1 53  ? -3.898  -17.314 -12.037 1.00 130.58 ? 157 A   A C5    1 
ATOM   1144  C  C6    . A   A  1 53  ? -3.918  -17.344 -13.430 1.00 133.01 ? 157 A   A C6    1 
ATOM   1145  N  N6    . A   A  1 53  ? -5.044  -17.528 -14.127 1.00 126.16 ? 157 A   A N6    1 
ATOM   1146  N  N1    . A   A  1 53  ? -2.731  -17.169 -14.064 1.00 131.60 ? 157 A   A N1    1 
ATOM   1147  C  C2    . A   A  1 53  ? -1.607  -16.980 -13.353 1.00 130.73 ? 157 A   A C2    1 
ATOM   1148  N  N3    . A   A  1 53  ? -1.471  -16.941 -12.034 1.00 130.58 ? 157 A   A N3    1 
ATOM   1149  C  C4    . A   A  1 53  ? -2.671  -17.100 -11.446 1.00 130.28 ? 157 A   A C4    1 
ATOM   1150  P  P     . C   A  1 54  ? -3.149  -12.665 -7.487  1.00 133.76 ? 158 C   A P     1 
ATOM   1151  O  OP1   . C   A  1 54  ? -2.788  -11.710 -6.413  1.00 140.39 ? 158 C   A OP1   1 
ATOM   1152  O  OP2   . C   A  1 54  ? -4.563  -12.972 -7.823  1.00 133.64 ? 158 C   A OP2   1 
ATOM   1153  O  "O5'" . C   A  1 54  ? -2.469  -12.189 -8.844  1.00 132.11 ? 158 C   A "O5'" 1 
ATOM   1154  C  "C5'" . C   A  1 54  ? -1.071  -11.988 -8.935  1.00 131.77 ? 158 C   A "C5'" 1 
ATOM   1155  C  "C4'" . C   A  1 54  ? -0.624  -11.982 -10.371 1.00 130.08 ? 158 C   A "C4'" 1 
ATOM   1156  O  "O4'" . C   A  1 54  ? -1.015  -13.237 -10.988 1.00 142.77 ? 158 C   A "O4'" 1 
ATOM   1157  C  "C3'" . C   A  1 54  ? -1.260  -10.946 -11.281 1.00 155.68 ? 158 C   A "C3'" 1 
ATOM   1158  O  "O3'" . C   A  1 54  ? -0.763  -9.624  -11.133 1.00 159.97 ? 158 C   A "O3'" 1 
ATOM   1159  C  "C2'" . C   A  1 54  ? -1.048  -11.576 -12.652 1.00 127.69 ? 158 C   A "C2'" 1 
ATOM   1160  O  "O2'" . C   A  1 54  ? 0.325   -11.573 -13.006 1.00 127.07 ? 158 C   A "O2'" 1 
ATOM   1161  C  "C1'" . C   A  1 54  ? -1.394  -13.013 -12.332 1.00 127.95 ? 158 C   A "C1'" 1 
ATOM   1162  N  N1    . C   A  1 54  ? -2.850  -13.251 -12.459 1.00 128.42 ? 158 C   A N1    1 
ATOM   1163  C  C2    . C   A  1 54  ? -3.359  -13.425 -13.744 1.00 128.59 ? 158 C   A C2    1 
ATOM   1164  O  O2    . C   A  1 54  ? -2.574  -13.365 -14.706 1.00 125.60 ? 158 C   A O2    1 
ATOM   1165  N  N3    . C   A  1 54  ? -4.688  -13.652 -13.891 1.00 128.50 ? 158 C   A N3    1 
ATOM   1166  C  C4    . C   A  1 54  ? -5.498  -13.704 -12.826 1.00 128.64 ? 158 C   A C4    1 
ATOM   1167  N  N4    . C   A  1 54  ? -6.802  -13.924 -13.030 1.00 128.31 ? 158 C   A N4    1 
ATOM   1168  C  C5    . C   A  1 54  ? -5.007  -13.526 -11.502 1.00 129.57 ? 158 C   A C5    1 
ATOM   1169  C  C6    . C   A  1 54  ? -3.692  -13.307 -11.374 1.00 129.43 ? 158 C   A C6    1 
ATOM   1170  P  P     . C   A  1 55  ? -1.730  -8.344  -11.311 1.00 129.49 ? 159 C   A P     1 
ATOM   1171  O  OP1   . C   A  1 55  ? -0.959  -7.323  -10.584 1.00 130.18 ? 159 C   A OP1   1 
ATOM   1172  O  OP2   . C   A  1 55  ? -3.162  -8.559  -10.970 1.00 130.12 ? 159 C   A OP2   1 
ATOM   1173  O  "O5'" . C   A  1 55  ? -1.657  -8.033  -12.870 1.00 127.80 ? 159 C   A "O5'" 1 
ATOM   1174  C  "C5'" . C   A  1 55  ? -0.396  -7.956  -13.511 1.00 126.90 ? 159 C   A "C5'" 1 
ATOM   1175  C  "C4'" . C   A  1 55  ? -0.472  -8.176  -15.003 1.00 125.34 ? 159 C   A "C4'" 1 
ATOM   1176  O  "O4'" . C   A  1 55  ? -0.908  -9.525  -15.331 1.00 138.26 ? 159 C   A "O4'" 1 
ATOM   1177  C  "C3'" . C   A  1 55  ? -1.418  -7.299  -15.792 1.00 131.76 ? 159 C   A "C3'" 1 
ATOM   1178  O  "O3'" . C   A  1 55  ? -0.938  -5.988  -15.975 1.00 132.20 ? 159 C   A "O3'" 1 
ATOM   1179  C  "C2'" . C   A  1 55  ? -1.561  -8.078  -17.095 1.00 129.97 ? 159 C   A "C2'" 1 
ATOM   1180  O  "O2'" . C   A  1 55  ? -0.406  -7.919  -17.903 1.00 122.38 ? 159 C   A "O2'" 1 
ATOM   1181  C  "C1'" . C   A  1 55  ? -1.581  -9.518  -16.579 1.00 133.49 ? 159 C   A "C1'" 1 
ATOM   1182  N  N1    . C   A  1 55  ? -2.966  -9.999  -16.398 1.00 133.67 ? 159 C   A N1    1 
ATOM   1183  C  C2    . C   A  1 55  ? -3.728  -10.417 -17.502 1.00 123.27 ? 159 C   A C2    1 
ATOM   1184  O  O2    . C   A  1 55  ? -3.230  -10.432 -18.634 1.00 122.03 ? 159 C   A O2    1 
ATOM   1185  N  N3    . C   A  1 55  ? -4.995  -10.830 -17.292 1.00 123.74 ? 159 C   A N3    1 
ATOM   1186  C  C4    . C   A  1 55  ? -5.503  -10.814 -16.062 1.00 129.89 ? 159 C   A C4    1 
ATOM   1187  N  N4    . C   A  1 55  ? -6.756  -11.222 -15.874 1.00 130.52 ? 159 C   A N4    1 
ATOM   1188  C  C5    . C   A  1 55  ? -4.758  -10.374 -14.937 1.00 126.13 ? 159 C   A C5    1 
ATOM   1189  C  C6    . C   A  1 55  ? -3.508  -9.972  -15.152 1.00 125.66 ? 159 C   A C6    1 
ATOM   1190  P  P     . A   A  1 56  ? -1.911  -4.764  -15.664 1.00 125.00 ? 160 A   A P     1 
ATOM   1191  O  OP1   . A   A  1 56  ? -0.983  -3.644  -15.444 1.00 125.05 ? 160 A   A OP1   1 
ATOM   1192  O  OP2   . A   A  1 56  ? -2.946  -5.041  -14.648 1.00 136.24 ? 160 A   A OP2   1 
ATOM   1193  O  "O5'" . A   A  1 56  ? -2.726  -4.620  -17.005 1.00 123.81 ? 160 A   A "O5'" 1 
ATOM   1194  C  "C5'" . A   A  1 56  ? -2.060  -4.266  -18.189 1.00 122.50 ? 160 A   A "C5'" 1 
ATOM   1195  C  "C4'" . A   A  1 56  ? -2.934  -4.508  -19.377 1.00 132.04 ? 160 A   A "C4'" 1 
ATOM   1196  O  "O4'" . A   A  1 56  ? -3.143  -5.925  -19.525 1.00 121.39 ? 160 A   A "O4'" 1 
ATOM   1197  C  "C3'" . A   A  1 56  ? -4.340  -3.919  -19.335 1.00 132.49 ? 160 A   A "C3'" 1 
ATOM   1198  O  "O3'" . A   A  1 56  ? -4.388  -2.568  -19.741 1.00 121.45 ? 160 A   A "O3'" 1 
ATOM   1199  C  "C2'" . A   A  1 56  ? -5.100  -4.812  -20.288 1.00 131.43 ? 160 A   A "C2'" 1 
ATOM   1200  O  "O2'" . A   A  1 56  ? -4.877  -4.390  -21.624 1.00 130.21 ? 160 A   A "O2'" 1 
ATOM   1201  C  "C1'" . A   A  1 56  ? -4.422  -6.162  -20.055 1.00 121.15 ? 160 A   A "C1'" 1 
ATOM   1202  N  N9    . A   A  1 56  ? -5.169  -6.985  -19.107 1.00 130.48 ? 160 A   A N9    1 
ATOM   1203  C  C8    . A   A  1 56  ? -4.854  -7.334  -17.828 1.00 130.58 ? 160 A   A C8    1 
ATOM   1204  N  N7    . A   A  1 56  ? -5.780  -8.089  -17.294 1.00 129.37 ? 160 A   A N7    1 
ATOM   1205  C  C5    . A   A  1 56  ? -6.743  -8.228  -18.285 1.00 129.03 ? 160 A   A C5    1 
ATOM   1206  C  C6    . A   A  1 56  ? -7.971  -8.905  -18.360 1.00 135.28 ? 160 A   A C6    1 
ATOM   1207  N  N6    . A   A  1 56  ? -8.496  -9.622  -17.370 1.00 136.66 ? 160 A   A N6    1 
ATOM   1208  N  N1    . A   A  1 56  ? -8.665  -8.812  -19.514 1.00 136.78 ? 160 A   A N1    1 
ATOM   1209  C  C2    . A   A  1 56  ? -8.165  -8.094  -20.528 1.00 143.39 ? 160 A   A C2    1 
ATOM   1210  N  N3    . A   A  1 56  ? -7.024  -7.425  -20.573 1.00 121.25 ? 160 A   A N3    1 
ATOM   1211  C  C4    . A   A  1 56  ? -6.370  -7.538  -19.409 1.00 127.79 ? 160 A   A C4    1 
ATOM   1212  P  P     . C   A  1 57  ? -5.693  -1.687  -19.461 1.00 121.99 ? 161 C   A P     1 
ATOM   1213  O  OP1   . C   A  1 57  ? -5.291  -0.441  -20.107 1.00 121.22 ? 161 C   A OP1   1 
ATOM   1214  O  OP2   . C   A  1 57  ? -6.143  -1.735  -18.053 1.00 123.45 ? 161 C   A OP2   1 
ATOM   1215  O  "O5'" . C   A  1 57  ? -6.831  -2.294  -20.390 1.00 121.41 ? 161 C   A "O5'" 1 
ATOM   1216  C  "C5'" . C   A  1 57  ? -7.009  -1.804  -21.710 1.00 120.21 ? 161 C   A "C5'" 1 
ATOM   1217  C  "C4'" . C   A  1 57  ? -8.264  -2.332  -22.357 1.00 119.96 ? 161 C   A "C4'" 1 
ATOM   1218  O  "O4'" . C   A  1 57  ? -8.230  -3.779  -22.343 1.00 119.99 ? 161 C   A "O4'" 1 
ATOM   1219  C  "C3'" . C   A  1 57  ? -9.595  -1.994  -21.692 1.00 120.94 ? 161 C   A "C3'" 1 
ATOM   1220  O  "O3'" . C   A  1 57  ? -10.106 -0.725  -22.017 1.00 120.73 ? 161 C   A "O3'" 1 
ATOM   1221  C  "C2'" . C   A  1 57  ? -10.492 -3.101  -22.191 1.00 120.78 ? 161 C   A "C2'" 1 
ATOM   1222  O  "O2'" . C   A  1 57  ? -10.879 -2.844  -23.534 1.00 119.68 ? 161 C   A "O2'" 1 
ATOM   1223  C  "C1'" . C   A  1 57  ? -9.533  -4.286  -22.156 1.00 130.78 ? 161 C   A "C1'" 1 
ATOM   1224  N  N1    . C   A  1 57  ? -9.573  -4.930  -20.827 1.00 121.78 ? 161 C   A N1    1 
ATOM   1225  C  C2    . C   A  1 57  ? -10.630 -5.771  -20.496 1.00 122.41 ? 161 C   A C2    1 
ATOM   1226  O  O2    . C   A  1 57  ? -11.530 -5.982  -21.321 1.00 121.91 ? 161 C   A O2    1 
ATOM   1227  N  N3    . C   A  1 57  ? -10.651 -6.321  -19.265 1.00 125.10 ? 161 C   A N3    1 
ATOM   1228  C  C4    . C   A  1 57  ? -9.682  -6.065  -18.394 1.00 124.13 ? 161 C   A C4    1 
ATOM   1229  N  N4    . C   A  1 57  ? -9.747  -6.640  -17.196 1.00 129.33 ? 161 C   A N4    1 
ATOM   1230  C  C5    . C   A  1 57  ? -8.591  -5.223  -18.706 1.00 123.52 ? 161 C   A C5    1 
ATOM   1231  C  C6    . C   A  1 57  ? -8.584  -4.683  -19.921 1.00 122.36 ? 161 C   A C6    1 
ATOM   1232  P  P     . C   A  1 58  ? -11.095 0.016   -20.999 1.00 121.91 ? 162 C   A P     1 
ATOM   1233  O  OP1   . C   A  1 58  ? -11.263 1.379   -21.547 1.00 127.16 ? 162 C   A OP1   1 
ATOM   1234  O  OP2   . C   A  1 58  ? -10.590 -0.182  -19.615 1.00 123.05 ? 162 C   A OP2   1 
ATOM   1235  O  "O5'" . C   A  1 58  ? -12.501 -0.730  -21.144 1.00 122.26 ? 162 C   A "O5'" 1 
ATOM   1236  C  "C5'" . C   A  1 58  ? -13.143 -0.893  -22.403 1.00 121.34 ? 162 C   A "C5'" 1 
ATOM   1237  C  "C4'" . C   A  1 58  ? -14.416 -1.693  -22.271 1.00 121.94 ? 162 C   A "C4'" 1 
ATOM   1238  O  "O4'" . C   A  1 58  ? -14.099 -3.063  -21.923 1.00 122.20 ? 162 C   A "O4'" 1 
ATOM   1239  C  "C3'" . C   A  1 58  ? -15.375 -1.242  -21.174 1.00 124.41 ? 162 C   A "C3'" 1 
ATOM   1240  O  "O3'" . C   A  1 58  ? -16.224 -0.179  -21.570 1.00 123.22 ? 162 C   A "O3'" 1 
ATOM   1241  C  "C2'" . C   A  1 58  ? -16.149 -2.509  -20.861 1.00 123.89 ? 162 C   A "C2'" 1 
ATOM   1242  O  "O2'" . C   A  1 58  ? -17.159 -2.726  -21.829 1.00 123.40 ? 162 C   A "O2'" 1 
ATOM   1243  C  "C1'" . C   A  1 58  ? -15.084 -3.579  -21.050 1.00 123.36 ? 162 C   A "C1'" 1 
ATOM   1244  N  N1    . C   A  1 58  ? -14.424 -3.981  -19.788 1.00 124.31 ? 162 C   A N1    1 
ATOM   1245  C  C2    . C   A  1 58  ? -15.064 -4.692  -18.755 1.00 125.54 ? 162 C   A C2    1 
ATOM   1246  O  O2    . C   A  1 58  ? -16.276 -4.950  -18.805 1.00 125.94 ? 162 C   A O2    1 
ATOM   1247  N  N3    . C   A  1 58  ? -14.343 -5.028  -17.655 1.00 126.35 ? 162 C   A N3    1 
ATOM   1248  C  C4    . C   A  1 58  ? -13.043 -4.749  -17.577 1.00 125.97 ? 162 C   A C4    1 
ATOM   1249  N  N4    . C   A  1 58  ? -12.345 -5.102  -16.497 1.00 126.81 ? 162 C   A N4    1 
ATOM   1250  C  C5    . C   A  1 58  ? -12.380 -4.066  -18.620 1.00 124.74 ? 162 C   A C5    1 
ATOM   1251  C  C6    . C   A  1 58  ? -13.090 -3.730  -19.695 1.00 123.94 ? 162 C   A C6    1 
ATOM   1252  P  P     . A   A  1 59  ? -16.750 0.894   -20.498 1.00 134.75 ? 163 A   A P     1 
ATOM   1253  O  OP1   . A   A  1 59  ? -17.482 1.950   -21.226 1.00 135.95 ? 163 A   A OP1   1 
ATOM   1254  O  OP2   . A   A  1 59  ? -15.605 1.279   -19.639 1.00 136.28 ? 163 A   A OP2   1 
ATOM   1255  O  "O5'" . A   A  1 59  ? -17.807 0.101   -19.605 1.00 141.26 ? 163 A   A "O5'" 1 
ATOM   1256  C  "C5'" . A   A  1 59  ? -19.012 -0.421  -20.150 1.00 143.56 ? 163 A   A "C5'" 1 
ATOM   1257  C  "C4'" . A   A  1 59  ? -19.559 -1.555  -19.305 1.00 145.82 ? 163 A   A "C4'" 1 
ATOM   1258  O  "O4'" . A   A  1 59  ? -18.488 -2.450  -18.911 1.00 146.39 ? 163 A   A "O4'" 1 
ATOM   1259  C  "C3'" . A   A  1 59  ? -20.210 -1.163  -17.987 1.00 147.81 ? 163 A   A "C3'" 1 
ATOM   1260  O  "O3'" . A   A  1 59  ? -21.556 -0.757  -18.136 1.00 147.37 ? 163 A   A "O3'" 1 
ATOM   1261  C  "C2'" . A   A  1 59  ? -20.080 -2.422  -17.135 1.00 154.02 ? 163 A   A "C2'" 1 
ATOM   1262  O  "O2'" . A   A  1 59  ? -21.149 -3.313  -17.409 1.00 159.57 ? 163 A   A "O2'" 1 
ATOM   1263  C  "C1'" . A   A  1 59  ? -18.793 -3.047  -17.667 1.00 151.19 ? 163 A   A "C1'" 1 
ATOM   1264  N  N9    . A   A  1 59  ? -17.633 -2.950  -16.759 1.00 149.87 ? 163 A   A N9    1 
ATOM   1265  C  C8    . A   A  1 59  ? -16.395 -2.478  -17.100 1.00 148.21 ? 163 A   A C8    1 
ATOM   1266  N  N7    . A   A  1 59  ? -15.513 -2.551  -16.140 1.00 148.81 ? 163 A   A N7    1 
ATOM   1267  C  C5    . A   A  1 59  ? -16.210 -3.124  -15.100 1.00 152.52 ? 163 A   A C5    1 
ATOM   1268  C  C6    . A   A  1 59  ? -15.804 -3.452  -13.805 1.00 157.24 ? 163 A   A C6    1 
ATOM   1269  N  N6    . A   A  1 59  ? -14.566 -3.231  -13.352 1.00 160.23 ? 163 A   A N6    1 
ATOM   1270  N  N1    . A   A  1 59  ? -16.721 -4.025  -12.993 1.00 157.10 ? 163 A   A N1    1 
ATOM   1271  C  C2    . A   A  1 59  ? -17.962 -4.244  -13.466 1.00 154.67 ? 163 A   A C2    1 
ATOM   1272  N  N3    . A   A  1 59  ? -18.452 -3.968  -14.677 1.00 151.99 ? 163 A   A N3    1 
ATOM   1273  C  C4    . A   A  1 59  ? -17.514 -3.403  -15.461 1.00 151.64 ? 163 A   A C4    1 
ATOM   1274  P  P     . G   A  1 60  ? -22.001 0.671   -17.588 1.00 129.06 ? 164 G   A P     1 
ATOM   1275  O  OP1   . G   A  1 60  ? -23.415 0.915   -17.953 1.00 129.32 ? 164 G   A OP1   1 
ATOM   1276  O  OP2   . G   A  1 60  ? -20.860 1.536   -17.937 1.00 128.14 ? 164 G   A OP2   1 
ATOM   1277  O  "O5'" . G   A  1 60  ? -21.984 0.540   -16.012 1.00 130.57 ? 164 G   A "O5'" 1 
ATOM   1278  C  "C5'" . G   A  1 60  ? -22.601 -0.561  -15.385 1.00 131.57 ? 164 G   A "C5'" 1 
ATOM   1279  C  "C4'" . G   A  1 60  ? -21.947 -0.838  -14.070 1.00 132.61 ? 164 G   A "C4'" 1 
ATOM   1280  O  "O4'" . G   A  1 60  ? -20.534 -1.069  -14.299 1.00 131.80 ? 164 G   A "O4'" 1 
ATOM   1281  C  "C3'" . G   A  1 60  ? -22.051 0.286   -13.062 1.00 133.54 ? 164 G   A "C3'" 1 
ATOM   1282  O  "O3'" . G   A  1 60  ? -22.357 -0.224  -11.779 1.00 135.03 ? 164 G   A "O3'" 1 
ATOM   1283  C  "C2'" . G   A  1 60  ? -20.668 0.932   -13.084 1.00 138.29 ? 164 G   A "C2'" 1 
ATOM   1284  O  "O2'" . G   A  1 60  ? -20.266 1.477   -11.849 1.00 140.09 ? 164 G   A "O2'" 1 
ATOM   1285  C  "C1'" . G   A  1 60  ? -19.754 -0.212  -13.506 1.00 132.19 ? 164 G   A "C1'" 1 
ATOM   1286  N  N9    . G   A  1 60  ? -18.649 0.248   -14.354 1.00 130.86 ? 164 G   A N9    1 
ATOM   1287  C  C8    . G   A  1 60  ? -18.809 0.579   -15.677 1.00 135.49 ? 164 G   A C8    1 
ATOM   1288  N  N7    . G   A  1 60  ? -17.727 0.985   -16.278 1.00 136.53 ? 164 G   A N7    1 
ATOM   1289  C  C5    . G   A  1 60  ? -16.760 0.925   -15.283 1.00 139.76 ? 164 G   A C5    1 
ATOM   1290  C  C6    . G   A  1 60  ? -15.376 1.253   -15.356 1.00 128.55 ? 164 G   A C6    1 
ATOM   1291  O  O6    . G   A  1 60  ? -14.722 1.659   -16.320 1.00 127.34 ? 164 G   A O6    1 
ATOM   1292  N  N1    . G   A  1 60  ? -14.738 1.068   -14.147 1.00 129.55 ? 164 G   A N1    1 
ATOM   1293  C  C2    . G   A  1 60  ? -15.352 0.626   -13.012 1.00 130.96 ? 164 G   A C2    1 
ATOM   1294  N  N2    . G   A  1 60  ? -14.521 0.537   -11.970 1.00 131.76 ? 164 G   A N2    1 
ATOM   1295  N  N3    . G   A  1 60  ? -16.643 0.306   -12.913 1.00 131.55 ? 164 G   A N3    1 
ATOM   1296  C  C4    . G   A  1 60  ? -17.300 0.467   -14.086 1.00 141.66 ? 164 G   A C4    1 
ATOM   1297  P  P     . G   A  1 61  ? -23.795 0.089   -11.140 1.00 136.28 ? 165 G   A P     1 
ATOM   1298  O  OP1   . G   A  1 61  ? -24.421 -1.203  -10.839 1.00 137.03 ? 165 G   A OP1   1 
ATOM   1299  O  OP2   . G   A  1 61  ? -24.563 1.057   -11.944 1.00 135.68 ? 165 G   A OP2   1 
ATOM   1300  O  "O5'" . G   A  1 61  ? -23.449 0.786   -9.764  1.00 137.47 ? 165 G   A "O5'" 1 
ATOM   1301  C  "C5'" . G   A  1 61  ? -24.065 0.339   -8.575  1.00 139.06 ? 165 G   A "C5'" 1 
ATOM   1302  C  "C4'" . G   A  1 61  ? -23.049 -0.152  -7.580  1.00 139.74 ? 165 G   A "C4'" 1 
ATOM   1303  O  "O4'" . G   A  1 61  ? -21.925 -0.747  -8.249  1.00 138.61 ? 165 G   A "O4'" 1 
ATOM   1304  C  "C3'" . G   A  1 61  ? -22.419 0.896   -6.697  1.00 140.28 ? 165 G   A "C3'" 1 
ATOM   1305  O  "O3'" . G   A  1 61  ? -23.256 1.226   -5.623  1.00 141.77 ? 165 G   A "O3'" 1 
ATOM   1306  C  "C2'" . G   A  1 61  ? -21.125 0.239   -6.242  1.00 140.34 ? 165 G   A "C2'" 1 
ATOM   1307  O  "O2'" . G   A  1 61  ? -21.357 -0.587  -5.122  1.00 141.78 ? 165 G   A "O2'" 1 
ATOM   1308  C  "C1'" . G   A  1 61  ? -20.786 -0.650  -7.428  1.00 139.02 ? 165 G   A "C1'" 1 
ATOM   1309  N  N9    . G   A  1 61  ? -19.658 -0.187  -8.225  1.00 137.65 ? 165 G   A N9    1 
ATOM   1310  C  C8    . G   A  1 61  ? -19.733 0.154   -9.535  1.00 136.24 ? 165 G   A C8    1 
ATOM   1311  N  N7    . G   A  1 61  ? -18.587 0.498   -10.041 1.00 143.72 ? 165 G   A N7    1 
ATOM   1312  C  C5    . G   A  1 61  ? -17.706 0.344   -8.982  1.00 136.03 ? 165 G   A C5    1 
ATOM   1313  C  C6    . G   A  1 61  ? -16.313 0.563   -8.932  1.00 135.56 ? 165 G   A C6    1 
ATOM   1314  O  O6    . G   A  1 61  ? -15.538 0.948   -9.817  1.00 150.53 ? 165 G   A O6    1 
ATOM   1315  N  N1    . G   A  1 61  ? -15.829 0.276   -7.674  1.00 136.79 ? 165 G   A N1    1 
ATOM   1316  C  C2    . G   A  1 61  ? -16.564 -0.153  -6.609  1.00 138.26 ? 165 G   A C2    1 
ATOM   1317  N  N2    . G   A  1 61  ? -15.841 -0.349  -5.506  1.00 140.63 ? 165 G   A N2    1 
ATOM   1318  N  N3    . G   A  1 61  ? -17.866 -0.359  -6.630  1.00 138.73 ? 165 G   A N3    1 
ATOM   1319  C  C4    . G   A  1 61  ? -18.356 -0.089  -7.849  1.00 137.55 ? 165 G   A C4    1 
ATOM   1320  P  P     . U   A  1 62  ? -23.380 2.744   -5.187  1.00 116.56 ? 166 U   A P     1 
ATOM   1321  O  OP1   . U   A  1 62  ? -24.519 2.796   -4.243  1.00 117.30 ? 166 U   A OP1   1 
ATOM   1322  O  OP2   . U   A  1 62  ? -23.310 3.578   -6.403  1.00 116.16 ? 166 U   A OP2   1 
ATOM   1323  O  "O5'" . U   A  1 62  ? -22.081 2.967   -4.325  1.00 115.83 ? 166 U   A "O5'" 1 
ATOM   1324  C  "C5'" . U   A  1 62  ? -22.081 2.467   -3.018  1.00 116.19 ? 166 U   A "C5'" 1 
ATOM   1325  C  "C4'" . U   A  1 62  ? -20.694 2.187   -2.564  1.00 115.65 ? 166 U   A "C4'" 1 
ATOM   1326  O  "O4'" . U   A  1 62  ? -19.904 1.668   -3.640  1.00 115.28 ? 166 U   A "O4'" 1 
ATOM   1327  C  "C3'" . U   A  1 62  ? -19.901 3.366   -2.083  1.00 114.90 ? 166 U   A "C3'" 1 
ATOM   1328  O  "O3'" . U   A  1 62  ? -20.268 3.682   -0.768  1.00 115.20 ? 166 U   A "O3'" 1 
ATOM   1329  C  "C2'" . U   A  1 62  ? -18.465 2.873   -2.193  1.00 114.42 ? 166 U   A "C2'" 1 
ATOM   1330  O  "O2'" . U   A  1 62  ? -18.049 2.202   -1.022  1.00 114.72 ? 166 U   A "O2'" 1 
ATOM   1331  C  "C1'" . U   A  1 62  ? -18.554 1.864   -3.333  1.00 114.62 ? 166 U   A "C1'" 1 
ATOM   1332  N  N1    . U   A  1 62  ? -17.816 2.256   -4.526  1.00 114.03 ? 166 U   A N1    1 
ATOM   1333  C  C2    . U   A  1 62  ? -16.459 2.254   -4.334  1.00 113.51 ? 166 U   A C2    1 
ATOM   1334  O  O2    . U   A  1 62  ? -15.930 1.981   -3.267  1.00 113.53 ? 166 U   A O2    1 
ATOM   1335  N  N3    . U   A  1 62  ? -15.743 2.597   -5.443  1.00 133.58 ? 166 U   A N3    1 
ATOM   1336  C  C4    . U   A  1 62  ? -16.258 2.928   -6.680  1.00 130.11 ? 166 U   A C4    1 
ATOM   1337  O  O4    . U   A  1 62  ? -15.481 3.211   -7.593  1.00 123.16 ? 166 U   A O4    1 
ATOM   1338  C  C5    . U   A  1 62  ? -17.688 2.873   -6.781  1.00 131.61 ? 166 U   A C5    1 
ATOM   1339  C  C6    . U   A  1 62  ? -18.422 2.536   -5.717  1.00 127.23 ? 166 U   A C6    1 
ATOM   1340  P  P     . U   A  1 63  ? -19.810 5.054   -0.113  1.00 114.60 ? 167 U   A P     1 
ATOM   1341  O  OP1   . U   A  1 63  ? -19.362 4.686   1.250   1.00 114.89 ? 167 U   A OP1   1 
ATOM   1342  O  OP2   . U   A  1 63  ? -20.940 5.989   -0.320  1.00 114.68 ? 167 U   A OP2   1 
ATOM   1343  O  "O5'" . U   A  1 63  ? -18.534 5.499   -0.971  1.00 117.52 ? 167 U   A "O5'" 1 
ATOM   1344  C  "C5'" . U   A  1 63  ? -17.772 6.668   -0.683  1.00 118.66 ? 167 U   A "C5'" 1 
ATOM   1345  C  "C4'" . U   A  1 63  ? -16.307 6.476   -1.014  1.00 112.66 ? 167 U   A "C4'" 1 
ATOM   1346  O  "O4'" . U   A  1 63  ? -16.151 5.806   -2.276  1.00 112.63 ? 167 U   A "O4'" 1 
ATOM   1347  C  "C3'" . U   A  1 63  ? -15.486 7.732   -1.176  1.00 112.05 ? 167 U   A "C3'" 1 
ATOM   1348  O  "O3'" . U   A  1 63  ? -15.093 8.268   0.055   1.00 111.99 ? 167 U   A "O3'" 1 
ATOM   1349  C  "C2'" . U   A  1 63  ? -14.305 7.284   -2.033  1.00 111.78 ? 167 U   A "C2'" 1 
ATOM   1350  O  "O2'" . U   A  1 63  ? -13.257 6.787   -1.227  1.00 111.78 ? 167 U   A "O2'" 1 
ATOM   1351  C  "C1'" . U   A  1 63  ? -14.901 6.128   -2.833  1.00 112.13 ? 167 U   A "C1'" 1 
ATOM   1352  N  N1    . U   A  1 63  ? -15.043 6.372   -4.281  1.00 112.00 ? 167 U   A N1    1 
ATOM   1353  C  C2    . U   A  1 63  ? -13.878 6.446   -5.001  1.00 111.68 ? 167 U   A C2    1 
ATOM   1354  O  O2    . U   A  1 63  ? -12.794 6.365   -4.464  1.00 111.48 ? 167 U   A O2    1 
ATOM   1355  N  N3    . U   A  1 63  ? -14.049 6.626   -6.349  1.00 111.69 ? 167 U   A N3    1 
ATOM   1356  C  C4    . U   A  1 63  ? -15.263 6.723   -7.003  1.00 112.00 ? 167 U   A C4    1 
ATOM   1357  O  O4    . U   A  1 63  ? -15.305 6.892   -8.217  1.00 112.08 ? 167 U   A O4    1 
ATOM   1358  C  C5    . U   A  1 63  ? -16.424 6.613   -6.187  1.00 112.32 ? 167 U   A C5    1 
ATOM   1359  C  C6    . U   A  1 63  ? -16.273 6.440   -4.882  1.00 112.31 ? 167 U   A C6    1 
ATOM   1360  P  P     . G   A  1 64  ? -15.130 9.848   0.217   1.00 119.81 ? 168 G   A P     1 
ATOM   1361  O  OP1   . G   A  1 64  ? -15.154 10.158  1.665   1.00 122.09 ? 168 G   A OP1   1 
ATOM   1362  O  OP2   . G   A  1 64  ? -16.243 10.267  -0.668  1.00 122.02 ? 168 G   A OP2   1 
ATOM   1363  O  "O5'" . G   A  1 64  ? -13.719 10.304  -0.369  1.00 117.47 ? 168 G   A "O5'" 1 
ATOM   1364  C  "C5'" . G   A  1 64  ? -12.554 9.687   0.157   1.00 117.03 ? 168 G   A "C5'" 1 
ATOM   1365  C  "C4'" . G   A  1 64  ? -11.273 10.115  -0.511  1.00 110.86 ? 168 G   A "C4'" 1 
ATOM   1366  O  "O4'" . G   A  1 64  ? -11.280 9.706   -1.902  1.00 110.80 ? 168 G   A "O4'" 1 
ATOM   1367  C  "C3'" . G   A  1 64  ? -10.941 11.599  -0.485  1.00 110.56 ? 168 G   A "C3'" 1 
ATOM   1368  O  "O3'" . G   A  1 64  ? -9.604  11.790  -0.038  1.00 113.63 ? 168 G   A "O3'" 1 
ATOM   1369  C  "C2'" . G   A  1 64  ? -11.073 12.030  -1.942  1.00 141.38 ? 168 G   A "C2'" 1 
ATOM   1370  O  "O2'" . G   A  1 64  ? -10.150 13.027  -2.317  1.00 148.16 ? 168 G   A "O2'" 1 
ATOM   1371  C  "C1'" . G   A  1 64  ? -10.805 10.744  -2.708  1.00 110.55 ? 168 G   A "C1'" 1 
ATOM   1372  N  N9    . G   A  1 64  ? -11.507 10.694  -3.992  1.00 110.59 ? 168 G   A N9    1 
ATOM   1373  C  C8    . G   A  1 64  ? -12.860 10.600  -4.170  1.00 110.75 ? 168 G   A C8    1 
ATOM   1374  N  N7    . G   A  1 64  ? -13.219 10.599  -5.421  1.00 112.33 ? 168 G   A N7    1 
ATOM   1375  C  C5    . G   A  1 64  ? -12.034 10.689  -6.114  1.00 116.74 ? 168 G   A C5    1 
ATOM   1376  C  C6    . G   A  1 64  ? -11.809 10.745  -7.506  1.00 120.36 ? 168 G   A C6    1 
ATOM   1377  O  O6    . G   A  1 64  ? -12.629 10.708  -8.429  1.00 120.58 ? 168 G   A O6    1 
ATOM   1378  N  N1    . G   A  1 64  ? -10.451 10.848  -7.802  1.00 126.77 ? 168 G   A N1    1 
ATOM   1379  C  C2    . G   A  1 64  ? -9.446  10.894  -6.864  1.00 131.06 ? 168 G   A C2    1 
ATOM   1380  N  N2    . G   A  1 64  ? -8.199  10.992  -7.363  1.00 141.36 ? 168 G   A N2    1 
ATOM   1381  N  N3    . G   A  1 64  ? -9.655  10.849  -5.554  1.00 123.62 ? 168 G   A N3    1 
ATOM   1382  C  C4    . G   A  1 64  ? -10.963 10.735  -5.252  1.00 121.30 ? 168 G   A C4    1 
ATOM   1383  P  P     . C   A  1 65  ? -9.339  11.960  1.539   1.00 121.58 ? 169 C   A P     1 
ATOM   1384  O  OP1   . C   A  1 65  ? -8.516  10.809  1.961   1.00 128.41 ? 169 C   A OP1   1 
ATOM   1385  O  OP2   . C   A  1 65  ? -10.622 12.271  2.219   1.00 122.91 ? 169 C   A OP2   1 
ATOM   1386  O  "O5'" . C   A  1 65  ? -8.380  13.213  1.695   1.00 125.52 ? 169 C   A "O5'" 1 
ATOM   1387  C  "C5'" . C   A  1 65  ? -8.413  14.268  0.754   1.00 129.71 ? 169 C   A "C5'" 1 
ATOM   1388  C  "C4'" . C   A  1 65  ? -7.084  14.428  0.083   1.00 133.92 ? 169 C   A "C4'" 1 
ATOM   1389  O  "O4'" . C   A  1 65  ? -6.127  15.016  1.006   1.00 138.75 ? 169 C   A "O4'" 1 
ATOM   1390  C  "C3'" . C   A  1 65  ? -6.461  13.132  -0.385  1.00 140.93 ? 169 C   A "C3'" 1 
ATOM   1391  O  "O3'" . C   A  1 65  ? -5.667  13.446  -1.511  1.00 148.97 ? 169 C   A "O3'" 1 
ATOM   1392  C  "C2'" . C   A  1 65  ? -5.546  12.769  0.773   1.00 141.93 ? 169 C   A "C2'" 1 
ATOM   1393  O  "O2'" . C   A  1 65  ? -4.497  11.892  0.427   1.00 145.36 ? 169 C   A "O2'" 1 
ATOM   1394  C  "C1'" . C   A  1 65  ? -5.027  14.144  1.160   1.00 141.98 ? 169 C   A "C1'" 1 
ATOM   1395  N  N1    . C   A  1 65  ? -4.521  14.283  2.533   1.00 145.67 ? 169 C   A N1    1 
ATOM   1396  C  C2    . C   A  1 65  ? -3.455  13.507  3.003   1.00 150.68 ? 169 C   A C2    1 
ATOM   1397  O  O2    . C   A  1 65  ? -2.941  12.628  2.285   1.00 155.98 ? 169 C   A O2    1 
ATOM   1398  N  N3    . C   A  1 65  ? -3.019  13.710  4.266   1.00 149.89 ? 169 C   A N3    1 
ATOM   1399  C  C4    . C   A  1 65  ? -3.568  14.642  5.042   1.00 146.77 ? 169 C   A C4    1 
ATOM   1400  N  N4    . C   A  1 65  ? -3.087  14.793  6.277   1.00 147.58 ? 169 C   A N4    1 
ATOM   1401  C  C5    . C   A  1 65  ? -4.635  15.458  4.578   1.00 144.72 ? 169 C   A C5    1 
ATOM   1402  C  C6    . C   A  1 65  ? -5.063  15.248  3.330   1.00 144.21 ? 169 C   A C6    1 
ATOM   1403  P  P     . C   A  1 66  ? -5.959  12.698  -2.885  1.00 154.14 ? 170 C   A P     1 
ATOM   1404  O  OP1   . C   A  1 66  ? -7.412  12.394  -2.980  1.00 155.45 ? 170 C   A OP1   1 
ATOM   1405  O  OP2   . C   A  1 66  ? -4.906  11.663  -3.028  1.00 152.89 ? 170 C   A OP2   1 
ATOM   1406  O  "O5'" . C   A  1 66  ? -5.614  13.756  -4.000  1.00 146.89 ? 170 C   A "O5'" 1 
ATOM   1407  C  "C5'" . C   A  1 66  ? -4.429  13.583  -4.745  1.00 138.99 ? 170 C   A "C5'" 1 
ATOM   1408  C  "C4'" . C   A  1 66  ? -4.587  14.210  -6.088  1.00 132.30 ? 170 C   A "C4'" 1 
ATOM   1409  O  "O4'" . C   A  1 66  ? -5.581  13.442  -6.803  1.00 128.09 ? 170 C   A "O4'" 1 
ATOM   1410  C  "C3'" . C   A  1 66  ? -5.138  15.626  -6.108  1.00 142.80 ? 170 C   A "C3'" 1 
ATOM   1411  O  "O3'" . C   A  1 66  ? -4.148  16.611  -5.861  1.00 111.12 ? 170 C   A "O3'" 1 
ATOM   1412  C  "C2'" . C   A  1 66  ? -5.783  15.692  -7.479  1.00 111.04 ? 170 C   A "C2'" 1 
ATOM   1413  O  "O2'" . C   A  1 66  ? -4.789  15.847  -8.482  1.00 111.49 ? 170 C   A "O2'" 1 
ATOM   1414  C  "C1'" . C   A  1 66  ? -6.366  14.288  -7.601  1.00 122.93 ? 170 C   A "C1'" 1 
ATOM   1415  N  N1    . C   A  1 66  ? -7.748  14.219  -7.083  1.00 110.66 ? 170 C   A N1    1 
ATOM   1416  C  C2    . C   A  1 66  ? -8.789  14.275  -7.990  1.00 114.19 ? 170 C   A C2    1 
ATOM   1417  O  O2    . C   A  1 66  ? -8.540  14.376  -9.177  1.00 115.61 ? 170 C   A O2    1 
ATOM   1418  N  N3    . C   A  1 66  ? -10.054 14.211  -7.586  1.00 115.81 ? 170 C   A N3    1 
ATOM   1419  C  C4    . C   A  1 66  ? -10.301 14.133  -6.297  1.00 114.93 ? 170 C   A C4    1 
ATOM   1420  N  N4    . C   A  1 66  ? -11.580 14.094  -5.940  1.00 116.27 ? 170 C   A N4    1 
ATOM   1421  C  C5    . C   A  1 66  ? -9.272  14.094  -5.320  1.00 112.19 ? 170 C   A C5    1 
ATOM   1422  C  C6    . C   A  1 66  ? -8.021  14.138  -5.755  1.00 110.43 ? 170 C   A C6    1 
ATOM   1423  P  P     . U   A  1 67  ? -4.485  17.991  -5.101  1.00 114.71 ? 171 U   A P     1 
ATOM   1424  O  OP1   . U   A  1 67  ? -3.428  18.931  -5.516  1.00 111.42 ? 171 U   A OP1   1 
ATOM   1425  O  OP2   . U   A  1 67  ? -4.865  17.848  -3.679  1.00 117.00 ? 171 U   A OP2   1 
ATOM   1426  O  "O5'" . U   A  1 67  ? -5.817  18.490  -5.768  1.00 113.67 ? 171 U   A "O5'" 1 
ATOM   1427  C  "C5'" . U   A  1 67  ? -5.803  19.729  -6.434  1.00 115.79 ? 171 U   A "C5'" 1 
ATOM   1428  C  "C4'" . U   A  1 67  ? -5.653  19.498  -7.904  1.00 119.94 ? 171 U   A "C4'" 1 
ATOM   1429  O  "O4'" . U   A  1 67  ? -6.430  18.330  -8.232  1.00 111.27 ? 171 U   A "O4'" 1 
ATOM   1430  C  "C3'" . U   A  1 67  ? -6.219  20.597  -8.785  1.00 124.91 ? 171 U   A "C3'" 1 
ATOM   1431  O  "O3'" . U   A  1 67  ? -5.298  21.659  -9.014  1.00 127.53 ? 171 U   A "O3'" 1 
ATOM   1432  C  "C2'" . U   A  1 67  ? -6.667  19.837  -10.024 1.00 123.48 ? 171 U   A "C2'" 1 
ATOM   1433  O  "O2'" . U   A  1 67  ? -5.552  19.518  -10.838 1.00 112.50 ? 171 U   A "O2'" 1 
ATOM   1434  C  "C1'" . U   A  1 67  ? -7.161  18.538  -9.401  1.00 111.51 ? 171 U   A "C1'" 1 
ATOM   1435  N  N1    . U   A  1 67  ? -8.588  18.498  -9.018  1.00 111.15 ? 171 U   A N1    1 
ATOM   1436  C  C2    . U   A  1 67  ? -9.505  18.356  -10.008 1.00 111.36 ? 171 U   A C2    1 
ATOM   1437  O  O2    . U   A  1 67  ? -9.146  18.337  -11.156 1.00 118.10 ? 171 U   A O2    1 
ATOM   1438  N  N3    . U   A  1 67  ? -10.813 18.262  -9.606  1.00 111.10 ? 171 U   A N3    1 
ATOM   1439  C  C4    . U   A  1 67  ? -11.286 18.273  -8.314  1.00 110.67 ? 171 U   A C4    1 
ATOM   1440  O  O4    . U   A  1 67  ? -12.494 18.177  -8.103  1.00 110.56 ? 171 U   A O4    1 
ATOM   1441  C  C5    . U   A  1 67  ? -10.268 18.398  -7.325  1.00 110.47 ? 171 U   A C5    1 
ATOM   1442  C  C6    . U   A  1 67  ? -8.990  18.488  -7.702  1.00 110.71 ? 171 U   A C6    1 
ATOM   1443  P  P     . A   A  1 68  ? -5.557  23.110  -8.378  1.00 112.01 ? 172 A   A P     1 
ATOM   1444  O  OP1   . A   A  1 68  ? -4.301  23.482  -7.672  1.00 112.23 ? 172 A   A OP1   1 
ATOM   1445  O  OP2   . A   A  1 68  ? -6.865  23.233  -7.678  1.00 111.39 ? 172 A   A OP2   1 
ATOM   1446  O  "O5'" . A   A  1 68  ? -5.778  23.970  -9.684  1.00 112.59 ? 172 A   A "O5'" 1 
ATOM   1447  C  "C5'" . A   A  1 68  ? -6.695  25.047  -9.687  1.00 115.97 ? 172 A   A "C5'" 1 
ATOM   1448  C  "C4'" . A   A  1 68  ? -7.440  25.092  -10.987 1.00 112.85 ? 172 A   A "C4'" 1 
ATOM   1449  O  "O4'" . A   A  1 68  ? -6.522  25.278  -12.071 1.00 113.73 ? 172 A   A "O4'" 1 
ATOM   1450  C  "C3'" . A   A  1 68  ? -8.202  23.846  -11.344 1.00 112.65 ? 172 A   A "C3'" 1 
ATOM   1451  O  "O3'" . A   A  1 68  ? -9.477  23.915  -10.775 1.00 112.10 ? 172 A   A "O3'" 1 
ATOM   1452  C  "C2'" . A   A  1 68  ? -8.262  23.885  -12.862 1.00 113.43 ? 172 A   A "C2'" 1 
ATOM   1453  O  "O2'" . A   A  1 68  ? -9.360  24.662  -13.293 1.00 113.53 ? 172 A   A "O2'" 1 
ATOM   1454  C  "C1'" . A   A  1 68  ? -6.996  24.639  -13.219 1.00 114.10 ? 172 A   A "C1'" 1 
ATOM   1455  N  N9    . A   A  1 68  ? -5.892  23.859  -13.768 1.00 121.35 ? 172 A   A N9    1 
ATOM   1456  C  C8    . A   A  1 68  ? -4.792  23.381  -13.108 1.00 129.46 ? 172 A   A C8    1 
ATOM   1457  N  N7    . A   A  1 68  ? -3.928  22.805  -13.900 1.00 134.96 ? 172 A   A N7    1 
ATOM   1458  C  C5    . A   A  1 68  ? -4.501  22.940  -15.156 1.00 131.59 ? 172 A   A C5    1 
ATOM   1459  C  C6    . A   A  1 68  ? -4.087  22.535  -16.430 1.00 132.30 ? 172 A   A C6    1 
ATOM   1460  N  N6    . A   A  1 68  ? -2.942  21.876  -16.657 1.00 134.34 ? 172 A   A N6    1 
ATOM   1461  N  N1    . A   A  1 68  ? -4.900  22.827  -17.472 1.00 131.41 ? 172 A   A N1    1 
ATOM   1462  C  C2    . A   A  1 68  ? -6.043  23.482  -17.245 1.00 116.69 ? 172 A   A C2    1 
ATOM   1463  N  N3    . A   A  1 68  ? -6.532  23.914  -16.087 1.00 115.86 ? 172 A   A N3    1 
ATOM   1464  C  C4    . A   A  1 68  ? -5.708  23.594  -15.084 1.00 123.89 ? 172 A   A C4    1 
ATOM   1465  P  P     . A   A  1 69  ? -10.063 22.683  -9.984  1.00 112.76 ? 173 A   A P     1 
ATOM   1466  O  OP1   . A   A  1 69  ? -10.016 23.062  -8.570  1.00 110.99 ? 173 A   A OP1   1 
ATOM   1467  O  OP2   . A   A  1 69  ? -9.333  21.501  -10.428 1.00 128.02 ? 173 A   A OP2   1 
ATOM   1468  O  "O5'" . A   A  1 69  ? -11.527 22.493  -10.566 1.00 111.55 ? 173 A   A "O5'" 1 
ATOM   1469  C  "C5'" . A   A  1 69  ? -11.925 21.215  -11.039 1.00 111.66 ? 173 A   A "C5'" 1 
ATOM   1470  C  "C4'" . A   A  1 69  ? -12.019 21.150  -12.541 1.00 112.35 ? 173 A   A "C4'" 1 
ATOM   1471  O  "O4'" . A   A  1 69  ? -10.766 21.556  -13.106 1.00 112.80 ? 173 A   A "O4'" 1 
ATOM   1472  C  "C3'" . A   A  1 69  ? -12.280 19.778  -13.153 1.00 112.55 ? 173 A   A "C3'" 1 
ATOM   1473  O  "O3'" . A   A  1 69  ? -13.661 19.449  -13.196 1.00 112.51 ? 173 A   A "O3'" 1 
ATOM   1474  C  "C2'" . A   A  1 69  ? -11.629 19.866  -14.541 1.00 113.31 ? 173 A   A "C2'" 1 
ATOM   1475  O  "O2'" . A   A  1 69  ? -12.544 20.350  -15.499 1.00 113.84 ? 173 A   A "O2'" 1 
ATOM   1476  C  "C1'" . A   A  1 69  ? -10.584 20.949  -14.355 1.00 113.43 ? 173 A   A "C1'" 1 
ATOM   1477  N  N9    . A   A  1 69  ? -9.173  20.600  -14.559 1.00 113.69 ? 173 A   A N9    1 
ATOM   1478  C  C8    . A   A  1 69  ? -8.144  20.656  -13.659 1.00 113.40 ? 173 A   A C8    1 
ATOM   1479  N  N7    . A   A  1 69  ? -6.972  20.410  -14.174 1.00 113.87 ? 173 A   A N7    1 
ATOM   1480  C  C5    . A   A  1 69  ? -7.251  20.217  -15.507 1.00 114.53 ? 173 A   A C5    1 
ATOM   1481  C  C6    . A   A  1 69  ? -6.426  19.908  -16.585 1.00 115.29 ? 173 A   A C6    1 
ATOM   1482  N  N6    . A   A  1 69  ? -5.110  19.730  -16.476 1.00 115.51 ? 173 A   A N6    1 
ATOM   1483  N  N1    . A   A  1 69  ? -7.015  19.782  -17.784 1.00 115.90 ? 173 A   A N1    1 
ATOM   1484  C  C2    . A   A  1 69  ? -8.338  19.947  -17.870 1.00 115.74 ? 173 A   A C2    1 
ATOM   1485  N  N3    . A   A  1 69  ? -9.219  20.230  -16.918 1.00 115.03 ? 173 A   A N3    1 
ATOM   1486  C  C4    . A   A  1 69  ? -8.594  20.355  -15.756 1.00 114.44 ? 173 A   A C4    1 
ATOM   1487  P  P     . G   A  1 70  ? -14.219 18.162  -12.436 1.00 112.14 ? 174 G   A P     1 
ATOM   1488  O  OP1   . G   A  1 70  ? -15.692 18.164  -12.469 1.00 112.24 ? 174 G   A OP1   1 
ATOM   1489  O  OP2   . G   A  1 70  ? -13.553 18.139  -11.122 1.00 111.58 ? 174 G   A OP2   1 
ATOM   1490  O  "O5'" . G   A  1 70  ? -13.779 16.997  -13.397 1.00 127.46 ? 174 G   A "O5'" 1 
ATOM   1491  C  "C5'" . G   A  1 70  ? -14.053 17.113  -14.778 1.00 127.21 ? 174 G   A "C5'" 1 
ATOM   1492  C  "C4'" . G   A  1 70  ? -13.121 16.264  -15.591 1.00 127.83 ? 174 G   A "C4'" 1 
ATOM   1493  O  "O4'" . G   A  1 70  ? -11.780 16.819  -15.551 1.00 113.58 ? 174 G   A "O4'" 1 
ATOM   1494  C  "C3'" . G   A  1 70  ? -12.914 14.847  -15.118 1.00 113.25 ? 174 G   A "C3'" 1 
ATOM   1495  O  "O3'" . G   A  1 70  ? -13.999 13.973  -15.375 1.00 113.43 ? 174 G   A "O3'" 1 
ATOM   1496  C  "C2'" . G   A  1 70  ? -11.614 14.506  -15.814 1.00 113.53 ? 174 G   A "C2'" 1 
ATOM   1497  O  "O2'" . G   A  1 70  ? -11.822 14.470  -17.215 1.00 114.27 ? 174 G   A "O2'" 1 
ATOM   1498  C  "C1'" . G   A  1 70  ? -10.839 15.780  -15.546 1.00 113.50 ? 174 G   A "C1'" 1 
ATOM   1499  N  N9    . G   A  1 70  ? -10.189 15.781  -14.232 1.00 112.88 ? 174 G   A N9    1 
ATOM   1500  C  C8    . G   A  1 70  ? -10.737 15.596  -12.999 1.00 112.30 ? 174 G   A C8    1 
ATOM   1501  N  N7    . G   A  1 70  ? -9.880  15.684  -12.035 1.00 111.95 ? 174 G   A N7    1 
ATOM   1502  C  C5    . G   A  1 70  ? -8.696  15.958  -12.675 1.00 118.87 ? 174 G   A C5    1 
ATOM   1503  C  C6    . G   A  1 70  ? -7.413  16.172  -12.143 1.00 128.33 ? 174 G   A C6    1 
ATOM   1504  O  O6    . G   A  1 70  ? -7.050  16.137  -10.972 1.00 135.61 ? 174 G   A O6    1 
ATOM   1505  N  N1    . G   A  1 70  ? -6.497  16.437  -13.138 1.00 130.74 ? 174 G   A N1    1 
ATOM   1506  C  C2    . G   A  1 70  ? -6.778  16.489  -14.475 1.00 133.82 ? 174 G   A C2    1 
ATOM   1507  N  N2    . G   A  1 70  ? -5.729  16.766  -15.267 1.00 145.18 ? 174 G   A N2    1 
ATOM   1508  N  N3    . G   A  1 70  ? -7.981  16.286  -14.985 1.00 122.02 ? 174 G   A N3    1 
ATOM   1509  C  C4    . G   A  1 70  ? -8.878  16.035  -14.025 1.00 114.10 ? 174 G   A C4    1 
ATOM   1510  P  P     . G   A  1 71  ? -14.235 12.736  -14.397 1.00 113.00 ? 175 G   A P     1 
ATOM   1511  O  OP1   . G   A  1 71  ? -14.597 13.127  -13.027 1.00 112.49 ? 175 G   A OP1   1 
ATOM   1512  O  OP2   . G   A  1 71  ? -13.089 11.835  -14.606 1.00 112.95 ? 175 G   A OP2   1 
ATOM   1513  O  "O5'" . G   A  1 71  ? -15.531 12.047  -14.946 1.00 113.45 ? 175 G   A "O5'" 1 
ATOM   1514  C  "C5'" . G   A  1 71  ? -16.650 11.947  -14.095 1.00 113.32 ? 175 G   A "C5'" 1 
ATOM   1515  C  "C4'" . G   A  1 71  ? -17.785 12.622  -14.740 1.00 113.80 ? 175 G   A "C4'" 1 
ATOM   1516  O  "O4'" . G   A  1 71  ? -17.202 13.449  -15.752 1.00 114.10 ? 175 G   A "O4'" 1 
ATOM   1517  C  "C3'" . G   A  1 71  ? -18.752 11.698  -15.451 1.00 114.43 ? 175 G   A "C3'" 1 
ATOM   1518  O  "O3'" . G   A  1 71  ? -20.069 12.172  -15.315 1.00 114.72 ? 175 G   A "O3'" 1 
ATOM   1519  C  "C2'" . G   A  1 71  ? -18.360 11.804  -16.910 1.00 115.01 ? 175 G   A "C2'" 1 
ATOM   1520  O  "O2'" . G   A  1 71  ? -19.462 11.669  -17.779 1.00 117.66 ? 175 G   A "O2'" 1 
ATOM   1521  C  "C1'" . G   A  1 71  ? -17.829 13.212  -16.977 1.00 114.86 ? 175 G   A "C1'" 1 
ATOM   1522  N  N9    . G   A  1 71  ? -16.857 13.461  -18.025 1.00 115.23 ? 175 G   A N9    1 
ATOM   1523  C  C8    . G   A  1 71  ? -15.499 13.429  -17.901 1.00 114.92 ? 175 G   A C8    1 
ATOM   1524  N  N7    . G   A  1 71  ? -14.913 13.756  -19.016 1.00 115.50 ? 175 G   A N7    1 
ATOM   1525  C  C5    . G   A  1 71  ? -15.945 14.025  -19.895 1.00 116.22 ? 175 G   A C5    1 
ATOM   1526  C  C6    . G   A  1 71  ? -15.906 14.410  -21.239 1.00 117.14 ? 175 G   A C6    1 
ATOM   1527  O  O6    . G   A  1 71  ? -14.912 14.598  -21.941 1.00 117.53 ? 175 G   A O6    1 
ATOM   1528  N  N1    . G   A  1 71  ? -17.187 14.570  -21.742 1.00 117.73 ? 175 G   A N1    1 
ATOM   1529  C  C2    . G   A  1 71  ? -18.354 14.390  -21.051 1.00 117.47 ? 175 G   A C2    1 
ATOM   1530  N  N2    . G   A  1 71  ? -19.480 14.608  -21.743 1.00 118.24 ? 175 G   A N2    1 
ATOM   1531  N  N3    . G   A  1 71  ? -18.398 14.027  -19.787 1.00 116.63 ? 175 G   A N3    1 
ATOM   1532  C  C4    . G   A  1 71  ? -17.159 13.868  -19.291 1.00 116.05 ? 175 G   A C4    1 
ATOM   1533  P  P     . A   A  1 72  ? -21.223 11.092  -15.427 1.00 115.29 ? 176 A   A P     1 
ATOM   1534  O  OP1   . A   A  1 72  ? -21.835 11.215  -16.765 1.00 116.12 ? 176 A   A OP1   1 
ATOM   1535  O  OP2   . A   A  1 72  ? -22.034 11.163  -14.202 1.00 115.08 ? 176 A   A OP2   1 
ATOM   1536  O  "O5'" . A   A  1 72  ? -20.399 9.737   -15.361 1.00 140.65 ? 176 A   A "O5'" 1 
ATOM   1537  C  "C5'" . A   A  1 72  ? -20.750 8.599   -16.153 1.00 141.35 ? 176 A   A "C5'" 1 
ATOM   1538  C  "C4'" . A   A  1 72  ? -19.593 8.051   -16.971 1.00 131.64 ? 176 A   A "C4'" 1 
ATOM   1539  O  "O4'" . A   A  1 72  ? -18.563 7.557   -16.080 1.00 125.79 ? 176 A   A "O4'" 1 
ATOM   1540  C  "C3'" . A   A  1 72  ? -19.964 6.905   -17.906 1.00 124.82 ? 176 A   A "C3'" 1 
ATOM   1541  O  "O3'" . A   A  1 72  ? -19.603 7.175   -19.255 1.00 123.65 ? 176 A   A "O3'" 1 
ATOM   1542  C  "C2'" . A   A  1 72  ? -19.218 5.691   -17.364 1.00 132.17 ? 176 A   A "C2'" 1 
ATOM   1543  O  "O2'" . A   A  1 72  ? -18.668 4.885   -18.379 1.00 148.07 ? 176 A   A "O2'" 1 
ATOM   1544  C  "C1'" . A   A  1 72  ? -18.128 6.283   -16.472 1.00 125.94 ? 176 A   A "C1'" 1 
ATOM   1545  N  N9    . A   A  1 72  ? -17.998 5.525   -15.227 1.00 125.01 ? 176 A   A N9    1 
ATOM   1546  C  C8    . A   A  1 72  ? -19.038 4.877   -14.613 1.00 122.10 ? 176 A   A C8    1 
ATOM   1547  N  N7    . A   A  1 72  ? -18.723 4.270   -13.506 1.00 119.66 ? 176 A   A N7    1 
ATOM   1548  C  C5    . A   A  1 72  ? -17.378 4.528   -13.386 1.00 121.47 ? 176 A   A C5    1 
ATOM   1549  C  C6    . A   A  1 72  ? -16.471 4.142   -12.411 1.00 124.39 ? 176 A   A C6    1 
ATOM   1550  N  N6    . A   A  1 72  ? -16.831 3.406   -11.368 1.00 113.58 ? 176 A   A N6    1 
ATOM   1551  N  N1    . A   A  1 72  ? -15.196 4.550   -12.546 1.00 124.69 ? 176 A   A N1    1 
ATOM   1552  C  C2    . A   A  1 72  ? -14.862 5.299   -13.610 1.00 127.23 ? 176 A   A C2    1 
ATOM   1553  N  N3    . A   A  1 72  ? -15.640 5.732   -14.608 1.00 128.10 ? 176 A   A N3    1 
ATOM   1554  C  C4    . A   A  1 72  ? -16.904 5.304   -14.427 1.00 125.70 ? 176 A   A C4    1 
ATOM   1555  P  P     . G   A  1 73  ? -18.095 7.396   -19.761 1.00 122.94 ? 177 G   A P     1 
ATOM   1556  O  OP1   . G   A  1 73  ? -17.570 6.101   -20.248 1.00 116.66 ? 177 G   A OP1   1 
ATOM   1557  O  OP2   . G   A  1 73  ? -17.221 8.054   -18.758 1.00 115.74 ? 177 G   A OP2   1 
ATOM   1558  O  "O5'" . G   A  1 73  ? -18.374 8.271   -21.072 1.00 125.96 ? 177 G   A "O5'" 1 
ATOM   1559  C  "C5'" . G   A  1 73  ? -19.547 8.011   -21.861 1.00 130.16 ? 177 G   A "C5'" 1 
ATOM   1560  C  "C4'" . G   A  1 73  ? -20.526 9.178   -21.926 1.00 137.52 ? 177 G   A "C4'" 1 
ATOM   1561  O  "O4'" . G   A  1 73  ? -19.847 10.418  -21.613 1.00 133.21 ? 177 G   A "O4'" 1 
ATOM   1562  C  "C3'" . G   A  1 73  ? -21.209 9.423   -23.282 1.00 147.45 ? 177 G   A "C3'" 1 
ATOM   1563  O  "O3'" . G   A  1 73  ? -22.449 8.730   -23.376 1.00 145.23 ? 177 G   A "O3'" 1 
ATOM   1564  C  "C2'" . G   A  1 73  ? -21.408 10.937  -23.334 1.00 119.93 ? 177 G   A "C2'" 1 
ATOM   1565  O  "O2'" . G   A  1 73  ? -22.620 11.304  -22.697 1.00 119.95 ? 177 G   A "O2'" 1 
ATOM   1566  C  "C1'" . G   A  1 73  ? -20.243 11.446  -22.493 1.00 118.92 ? 177 G   A "C1'" 1 
ATOM   1567  N  N9    . G   A  1 73  ? -19.057 11.900  -23.247 1.00 119.10 ? 177 G   A N9    1 
ATOM   1568  C  C8    . G   A  1 73  ? -17.795 11.594  -22.801 1.00 118.42 ? 177 G   A C8    1 
ATOM   1569  N  N7    . G   A  1 73  ? -16.844 12.076  -23.530 1.00 118.76 ? 177 G   A N7    1 
ATOM   1570  C  C5    . G   A  1 73  ? -17.516 12.749  -24.518 1.00 119.73 ? 177 G   A C5    1 
ATOM   1571  C  C6    . G   A  1 73  ? -16.950 13.457  -25.581 1.00 120.56 ? 177 G   A C6    1 
ATOM   1572  O  O6    . G   A  1 73  ? -15.747 13.593  -25.804 1.00 120.55 ? 177 G   A O6    1 
ATOM   1573  N  N1    . G   A  1 73  ? -17.922 14.022  -26.395 1.00 121.54 ? 177 G   A N1    1 
ATOM   1574  C  C2    . G   A  1 73  ? -19.281 13.918  -26.209 1.00 121.69 ? 177 G   A C2    1 
ATOM   1575  N  N2    . G   A  1 73  ? -20.062 14.545  -27.117 1.00 122.78 ? 177 G   A N2    1 
ATOM   1576  N  N3    . G   A  1 73  ? -19.815 13.237  -25.193 1.00 128.30 ? 177 G   A N3    1 
ATOM   1577  C  C4    . G   A  1 73  ? -18.884 12.668  -24.386 1.00 119.97 ? 177 G   A C4    1 
ATOM   1578  P  P     . G   A  1 74  ? -22.620 7.370   -24.216 1.00 138.63 ? 178 G   A P     1 
ATOM   1579  O  OP1   . G   A  1 74  ? -23.726 6.583   -23.627 1.00 138.51 ? 178 G   A OP1   1 
ATOM   1580  O  OP2   . G   A  1 74  ? -21.287 6.771   -24.384 1.00 146.93 ? 178 G   A OP2   1 
ATOM   1581  O  "O5'" . G   A  1 74  ? -23.112 7.843   -25.647 1.00 135.41 ? 178 G   A "O5'" 1 
ATOM   1582  C  "C5'" . G   A  1 74  ? -22.173 8.158   -26.651 1.00 136.91 ? 178 G   A "C5'" 1 
ATOM   1583  C  "C4'" . G   A  1 74  ? -22.599 9.354   -27.459 1.00 141.33 ? 178 G   A "C4'" 1 
ATOM   1584  O  "O4'" . G   A  1 74  ? -21.896 10.540  -27.006 1.00 122.98 ? 178 G   A "O4'" 1 
ATOM   1585  C  "C3'" . G   A  1 74  ? -22.254 9.248   -28.931 1.00 142.12 ? 178 G   A "C3'" 1 
ATOM   1586  O  "O3'" . G   A  1 74  ? -23.251 8.569   -29.656 1.00 140.03 ? 178 G   A "O3'" 1 
ATOM   1587  C  "C2'" . G   A  1 74  ? -22.125 10.691  -29.359 1.00 125.17 ? 178 G   A "C2'" 1 
ATOM   1588  O  "O2'" . G   A  1 74  ? -23.422 11.216  -29.561 1.00 125.95 ? 178 G   A "O2'" 1 
ATOM   1589  C  "C1'" . G   A  1 74  ? -21.511 11.320  -28.111 1.00 123.84 ? 178 G   A "C1'" 1 
ATOM   1590  N  N9    . G   A  1 74  ? -20.043 11.299  -28.142 1.00 123.35 ? 178 G   A N9    1 
ATOM   1591  C  C8    . G   A  1 74  ? -19.261 10.659  -27.232 1.00 122.24 ? 178 G   A C8    1 
ATOM   1592  N  N7    . G   A  1 74  ? -17.985 10.794  -27.451 1.00 122.06 ? 178 G   A N7    1 
ATOM   1593  C  C5    . G   A  1 74  ? -17.917 11.589  -28.571 1.00 123.15 ? 178 G   A C5    1 
ATOM   1594  C  C6    . G   A  1 74  ? -16.792 12.076  -29.279 1.00 139.02 ? 178 G   A C6    1 
ATOM   1595  O  O6    . G   A  1 74  ? -15.580 11.906  -29.073 1.00 139.91 ? 178 G   A O6    1 
ATOM   1596  N  N1    . G   A  1 74  ? -17.177 12.875  -30.355 1.00 139.91 ? 178 G   A N1    1 
ATOM   1597  C  C2    . G   A  1 74  ? -18.477 13.159  -30.692 1.00 141.44 ? 178 G   A C2    1 
ATOM   1598  N  N2    . G   A  1 74  ? -18.690 13.928  -31.774 1.00 145.49 ? 178 G   A N2    1 
ATOM   1599  N  N3    . G   A  1 74  ? -19.523 12.677  -30.039 1.00 139.80 ? 178 G   A N3    1 
ATOM   1600  C  C4    . G   A  1 74  ? -19.179 11.917  -28.998 1.00 123.95 ? 178 G   A C4    1 
ATOM   1601  P  P     . G   A  1 75  ? -22.860 7.867   -31.028 1.00 126.84 ? 179 G   A P     1 
ATOM   1602  O  OP1   . G   A  1 75  ? -24.110 7.258   -31.550 1.00 127.92 ? 179 G   A OP1   1 
ATOM   1603  O  OP2   . G   A  1 75  ? -21.630 7.083   -30.741 1.00 125.94 ? 179 G   A OP2   1 
ATOM   1604  O  "O5'" . G   A  1 75  ? -22.436 9.069   -31.986 1.00 127.69 ? 179 G   A "O5'" 1 
ATOM   1605  C  "C5'" . G   A  1 75  ? -23.385 9.769   -32.771 1.00 129.00 ? 179 G   A "C5'" 1 
ATOM   1606  C  "C4'" . G   A  1 75  ? -22.689 10.587  -33.825 1.00 129.92 ? 179 G   A "C4'" 1 
ATOM   1607  O  "O4'" . G   A  1 75  ? -21.723 11.437  -33.183 1.00 128.96 ? 179 G   A "O4'" 1 
ATOM   1608  C  "C3'" . G   A  1 75  ? -21.877 9.823   -34.861 1.00 130.61 ? 179 G   A "C3'" 1 
ATOM   1609  O  "O3'" . G   A  1 75  ? -22.664 9.347   -35.939 1.00 132.08 ? 179 G   A "O3'" 1 
ATOM   1610  C  "C2'" . G   A  1 75  ? -20.841 10.849  -35.303 1.00 130.90 ? 179 G   A "C2'" 1 
ATOM   1611  O  "O2'" . G   A  1 75  ? -21.396 11.745  -36.247 1.00 134.08 ? 179 G   A "O2'" 1 
ATOM   1612  C  "C1'" . G   A  1 75  ? -20.619 11.638  -34.024 1.00 129.53 ? 179 G   A "C1'" 1 
ATOM   1613  N  N9    . G   A  1 75  ? -19.420 11.255  -33.292 1.00 128.25 ? 179 G   A N9    1 
ATOM   1614  C  C8    . G   A  1 75  ? -19.357 10.671  -32.061 1.00 127.26 ? 179 G   A C8    1 
ATOM   1615  N  N7    . G   A  1 75  ? -18.126 10.514  -31.667 1.00 126.60 ? 179 G   A N7    1 
ATOM   1616  C  C5    . G   A  1 75  ? -17.356 11.018  -32.706 1.00 129.00 ? 179 G   A C5    1 
ATOM   1617  C  C6    . G   A  1 75  ? -15.952 11.110  -32.862 1.00 126.85 ? 179 G   A C6    1 
ATOM   1618  O  O6    . G   A  1 75  ? -15.030 10.761  -32.108 1.00 125.78 ? 179 G   A O6    1 
ATOM   1619  N  N1    . G   A  1 75  ? -15.654 11.702  -34.079 1.00 128.27 ? 179 G   A N1    1 
ATOM   1620  C  C2    . G   A  1 75  ? -16.545 12.155  -35.018 1.00 129.65 ? 179 G   A C2    1 
ATOM   1621  N  N2    . G   A  1 75  ? -15.997 12.701  -36.116 1.00 131.01 ? 179 G   A N2    1 
ATOM   1622  N  N3    . G   A  1 75  ? -17.853 12.068  -34.882 1.00 129.77 ? 179 G   A N3    1 
ATOM   1623  C  C4    . G   A  1 75  ? -18.161 11.494  -33.711 1.00 128.39 ? 179 G   A C4    1 
ATOM   1624  P  P     . G   A  1 76  ? -22.277 7.984   -36.688 1.00 132.54 ? 180 G   A P     1 
ATOM   1625  O  OP1   . G   A  1 76  ? -23.399 7.612   -37.584 1.00 134.05 ? 180 G   A OP1   1 
ATOM   1626  O  OP2   . G   A  1 76  ? -21.813 7.084   -35.614 1.00 130.96 ? 180 G   A OP2   1 
ATOM   1627  O  "O5'" . G   A  1 76  ? -21.056 8.366   -37.635 1.00 133.19 ? 180 G   A "O5'" 1 
ATOM   1628  C  "C5'" . G   A  1 76  ? -21.255 9.180   -38.775 1.00 134.86 ? 180 G   A "C5'" 1 
ATOM   1629  C  "C4'" . G   A  1 76  ? -19.966 9.811   -39.214 1.00 135.08 ? 180 G   A "C4'" 1 
ATOM   1630  O  "O4'" . G   A  1 76  ? -19.276 10.303  -38.056 1.00 133.52 ? 180 G   A "O4'" 1 
ATOM   1631  C  "C3'" . G   A  1 76  ? -18.949 8.922   -39.893 1.00 135.34 ? 180 G   A "C3'" 1 
ATOM   1632  O  "O3'" . G   A  1 76  ? -19.218 8.802   -41.268 1.00 142.13 ? 180 G   A "O3'" 1 
ATOM   1633  C  "C2'" . G   A  1 76  ? -17.627 9.626   -39.621 1.00 134.79 ? 180 G   A "C2'" 1 
ATOM   1634  O  "O2'" . G   A  1 76  ? -17.377 10.631  -40.585 1.00 136.33 ? 180 G   A "O2'" 1 
ATOM   1635  C  "C1'" . G   A  1 76  ? -17.893 10.286  -38.280 1.00 133.37 ? 180 G   A "C1'" 1 
ATOM   1636  N  N9    . G   A  1 76  ? -17.232 9.696   -37.121 1.00 137.14 ? 180 G   A N9    1 
ATOM   1637  C  C8    . G   A  1 76  ? -17.884 9.200   -36.029 1.00 137.04 ? 180 G   A C8    1 
ATOM   1638  N  N7    . G   A  1 76  ? -17.060 8.808   -35.106 1.00 137.22 ? 180 G   A N7    1 
ATOM   1639  C  C5    . G   A  1 76  ? -15.810 9.095   -35.622 1.00 137.14 ? 180 G   A C5    1 
ATOM   1640  C  C6    . G   A  1 76  ? -14.547 8.884   -35.045 1.00 139.17 ? 180 G   A C6    1 
ATOM   1641  O  O6    . G   A  1 76  ? -14.298 8.369   -33.951 1.00 146.39 ? 180 G   A O6    1 
ATOM   1642  N  N1    . G   A  1 76  ? -13.522 9.313   -35.888 1.00 137.28 ? 180 G   A N1    1 
ATOM   1643  C  C2    . G   A  1 76  ? -13.694 9.882   -37.128 1.00 142.01 ? 180 G   A C2    1 
ATOM   1644  N  N2    . G   A  1 76  ? -12.556 10.223  -37.774 1.00 149.68 ? 180 G   A N2    1 
ATOM   1645  N  N3    . G   A  1 76  ? -14.890 10.077  -37.675 1.00 139.40 ? 180 G   A N3    1 
ATOM   1646  C  C4    . G   A  1 76  ? -15.890 9.659   -36.867 1.00 136.81 ? 180 G   A C4    1 
ATOM   1647  P  P     . U   A  1 77  ? -19.361 7.355   -41.915 1.00 137.67 ? 181 U   A P     1 
ATOM   1648  O  OP1   . U   A  1 77  ? -19.673 7.598   -43.345 1.00 139.81 ? 181 U   A OP1   1 
ATOM   1649  O  OP2   . U   A  1 77  ? -20.298 6.589   -41.061 1.00 136.70 ? 181 U   A OP2   1 
ATOM   1650  O  "O5'" . U   A  1 77  ? -17.895 6.741   -41.786 1.00 136.77 ? 181 U   A "O5'" 1 
ATOM   1651  C  "C5'" . U   A  1 77  ? -16.784 7.436   -42.331 1.00 137.37 ? 181 U   A "C5'" 1 
ATOM   1652  C  "C4'" . U   A  1 77  ? -15.519 7.229   -41.536 1.00 135.88 ? 181 U   A "C4'" 1 
ATOM   1653  O  "O4'" . U   A  1 77  ? -15.747 7.525   -40.151 1.00 134.25 ? 181 U   A "O4'" 1 
ATOM   1654  C  "C3'" . U   A  1 77  ? -14.912 5.844   -41.526 1.00 135.19 ? 181 U   A "C3'" 1 
ATOM   1655  O  "O3'" . U   A  1 77  ? -14.125 5.651   -42.681 1.00 138.45 ? 181 U   A "O3'" 1 
ATOM   1656  C  "C2'" . U   A  1 77  ? -14.086 5.842   -40.241 1.00 133.34 ? 181 U   A "C2'" 1 
ATOM   1657  O  "O2'" . U   A  1 77  ? -12.806 6.408   -40.464 1.00 133.55 ? 181 U   A "O2'" 1 
ATOM   1658  C  "C1'" . U   A  1 77  ? -14.869 6.793   -39.341 1.00 132.76 ? 181 U   A "C1'" 1 
ATOM   1659  N  N1    . U   A  1 77  ? -15.662 6.159   -38.268 1.00 145.37 ? 181 U   A N1    1 
ATOM   1660  C  C2    . U   A  1 77  ? -15.094 6.074   -37.003 1.00 148.60 ? 181 U   A C2    1 
ATOM   1661  O  O2    . U   A  1 77  ? -13.970 6.481   -36.741 1.00 149.53 ? 181 U   A O2    1 
ATOM   1662  N  N3    . U   A  1 77  ? -15.909 5.526   -36.043 1.00 149.76 ? 181 U   A N3    1 
ATOM   1663  C  C4    . U   A  1 77  ? -17.193 5.049   -36.228 1.00 146.31 ? 181 U   A C4    1 
ATOM   1664  O  O4    . U   A  1 77  ? -17.802 4.565   -35.275 1.00 142.13 ? 181 U   A O4    1 
ATOM   1665  C  C5    . U   A  1 77  ? -17.702 5.174   -37.564 1.00 144.93 ? 181 U   A C5    1 
ATOM   1666  C  C6    . U   A  1 77  ? -16.940 5.718   -38.516 1.00 142.88 ? 181 U   A C6    1 
ATOM   1667  P  P     . G   A  1 78  ? -14.123 4.251   -43.434 1.00 136.87 ? 182 G   A P     1 
ATOM   1668  O  OP1   . G   A  1 78  ? -13.765 4.442   -44.854 1.00 138.79 ? 182 G   A OP1   1 
ATOM   1669  O  OP2   . G   A  1 78  ? -15.432 3.650   -43.128 1.00 136.63 ? 182 G   A OP2   1 
ATOM   1670  O  "O5'" . G   A  1 78  ? -12.932 3.501   -42.706 1.00 135.29 ? 182 G   A "O5'" 1 
ATOM   1671  C  "C5'" . G   A  1 78  ? -11.736 4.204   -42.400 1.00 134.91 ? 182 G   A "C5'" 1 
ATOM   1672  C  "C4'" . G   A  1 78  ? -11.032 3.659   -41.176 1.00 154.75 ? 182 G   A "C4'" 1 
ATOM   1673  O  "O4'" . G   A  1 78  ? -11.689 4.142   -39.977 1.00 154.00 ? 182 G   A "O4'" 1 
ATOM   1674  C  "C3'" . G   A  1 78  ? -11.011 2.149   -40.999 1.00 132.15 ? 182 G   A "C3'" 1 
ATOM   1675  O  "O3'" . G   A  1 78  ? -10.018 1.526   -41.786 1.00 132.64 ? 182 G   A "O3'" 1 
ATOM   1676  C  "C2'" . G   A  1 78  ? -10.821 1.995   -39.497 1.00 130.26 ? 182 G   A "C2'" 1 
ATOM   1677  O  "O2'" . G   A  1 78  ? -9.472  2.246   -39.134 1.00 129.68 ? 182 G   A "O2'" 1 
ATOM   1678  C  "C1'" . G   A  1 78  ? -11.686 3.143   -38.979 1.00 130.28 ? 182 G   A "C1'" 1 
ATOM   1679  N  N9    . G   A  1 78  ? -13.084 2.709   -38.793 1.00 130.26 ? 182 G   A N9    1 
ATOM   1680  C  C8    . G   A  1 78  ? -14.028 2.495   -39.770 1.00 131.59 ? 182 G   A C8    1 
ATOM   1681  N  N7    . G   A  1 78  ? -15.173 2.085   -39.306 1.00 131.30 ? 182 G   A N7    1 
ATOM   1682  C  C5    . G   A  1 78  ? -14.977 2.007   -37.945 1.00 129.67 ? 182 G   A C5    1 
ATOM   1683  C  C6    . G   A  1 78  ? -15.872 1.620   -36.930 1.00 128.79 ? 182 G   A C6    1 
ATOM   1684  O  O6    . G   A  1 78  ? -17.050 1.256   -37.028 1.00 129.27 ? 182 G   A O6    1 
ATOM   1685  N  N1    . G   A  1 78  ? -15.239 1.696   -35.702 1.00 127.30 ? 182 G   A N1    1 
ATOM   1686  C  C2    . G   A  1 78  ? -13.940 2.085   -35.483 1.00 129.06 ? 182 G   A C2    1 
ATOM   1687  N  N2    . G   A  1 78  ? -13.519 2.086   -34.216 1.00 131.84 ? 182 G   A N2    1 
ATOM   1688  N  N3    . G   A  1 78  ? -13.102 2.446   -36.424 1.00 127.58 ? 182 G   A N3    1 
ATOM   1689  C  C4    . G   A  1 78  ? -13.687 2.366   -37.620 1.00 129.01 ? 182 G   A C4    1 
ATOM   1690  P  P     . A   A  1 79  ? -10.457 0.489   -42.924 1.00 133.71 ? 183 A   A P     1 
ATOM   1691  O  OP1   . A   A  1 79  ? -9.789  0.801   -44.201 1.00 135.34 ? 183 A   A OP1   1 
ATOM   1692  O  OP2   . A   A  1 79  ? -11.921 0.261   -42.860 1.00 133.91 ? 183 A   A OP2   1 
ATOM   1693  O  "O5'" . A   A  1 79  ? -9.766  -0.836  -42.431 1.00 165.12 ? 183 A   A "O5'" 1 
ATOM   1694  C  "C5'" . A   A  1 79  ? -8.384  -0.806  -42.115 1.00 163.54 ? 183 A   A "C5'" 1 
ATOM   1695  C  "C4'" . A   A  1 79  ? -7.891  -2.172  -41.754 1.00 130.58 ? 183 A   A "C4'" 1 
ATOM   1696  O  "O4'" . A   A  1 79  ? -8.504  -2.617  -40.516 1.00 129.11 ? 183 A   A "O4'" 1 
ATOM   1697  C  "C3'" . A   A  1 79  ? -8.160  -3.248  -42.798 1.00 148.46 ? 183 A   A "C3'" 1 
ATOM   1698  O  "O3'" . A   A  1 79  ? -6.948  -3.953  -43.013 1.00 131.08 ? 183 A   A "O3'" 1 
ATOM   1699  C  "C2'" . A   A  1 79  ? -9.194  -4.148  -42.132 1.00 149.80 ? 183 A   A "C2'" 1 
ATOM   1700  O  "O2'" . A   A  1 79  ? -9.128  -5.502  -42.513 1.00 153.02 ? 183 A   A "O2'" 1 
ATOM   1701  C  "C1'" . A   A  1 79  ? -8.895  -3.957  -40.652 1.00 153.68 ? 183 A   A "C1'" 1 
ATOM   1702  N  N9    . A   A  1 79  ? -10.039 -4.251  -39.788 1.00 158.14 ? 183 A   A N9    1 
ATOM   1703  C  C8    . A   A  1 79  ? -11.363 -4.105  -40.109 1.00 158.86 ? 183 A   A C8    1 
ATOM   1704  N  N7    . A   A  1 79  ? -12.166 -4.555  -39.171 1.00 157.01 ? 183 A   A N7    1 
ATOM   1705  C  C5    . A   A  1 79  ? -11.327 -5.070  -38.189 1.00 151.67 ? 183 A   A C5    1 
ATOM   1706  C  C6    . A   A  1 79  ? -11.570 -5.670  -36.939 1.00 137.79 ? 183 A   A C6    1 
ATOM   1707  N  N6    . A   A  1 79  ? -12.781 -5.891  -36.438 1.00 127.38 ? 183 A   A N6    1 
ATOM   1708  N  N1    . A   A  1 79  ? -10.505 -6.062  -36.215 1.00 139.32 ? 183 A   A N1    1 
ATOM   1709  C  C2    . A   A  1 79  ? -9.281  -5.864  -36.716 1.00 148.08 ? 183 A   A C2    1 
ATOM   1710  N  N3    . A   A  1 79  ? -8.924  -5.304  -37.867 1.00 157.17 ? 183 A   A N3    1 
ATOM   1711  C  C4    . A   A  1 79  ? -10.007 -4.928  -38.578 1.00 158.25 ? 183 A   A C4    1 
ATOM   1712  P  P     . A   A  1 80  ? -6.744  -4.945  -44.251 1.00 132.06 ? 184 A   A P     1 
ATOM   1713  O  OP1   . A   A  1 80  ? -6.484  -4.258  -45.534 1.00 133.95 ? 184 A   A OP1   1 
ATOM   1714  O  OP2   . A   A  1 80  ? -7.840  -5.923  -44.190 1.00 131.80 ? 184 A   A OP2   1 
ATOM   1715  O  "O5'" . A   A  1 80  ? -5.326  -5.537  -43.887 1.00 131.06 ? 184 A   A "O5'" 1 
ATOM   1716  C  "C5'" . A   A  1 80  ? -4.255  -4.620  -43.916 1.00 131.38 ? 184 A   A "C5'" 1 
ATOM   1717  C  "C4'" . A   A  1 80  ? -3.093  -4.986  -43.039 1.00 130.01 ? 184 A   A "C4'" 1 
ATOM   1718  O  "O4'" . A   A  1 80  ? -3.432  -4.855  -41.638 1.00 128.50 ? 184 A   A "O4'" 1 
ATOM   1719  C  "C3'" . A   A  1 80  ? -2.492  -6.358  -43.197 1.00 129.41 ? 184 A   A "C3'" 1 
ATOM   1720  O  "O3'" . A   A  1 80  ? -1.116  -6.166  -42.945 1.00 129.10 ? 184 A   A "O3'" 1 
ATOM   1721  C  "C2'" . A   A  1 80  ? -3.124  -7.112  -42.034 1.00 127.80 ? 184 A   A "C2'" 1 
ATOM   1722  O  "O2'" . A   A  1 80  ? -2.412  -8.249  -41.621 1.00 143.10 ? 184 A   A "O2'" 1 
ATOM   1723  C  "C1'" . A   A  1 80  ? -3.108  -6.038  -40.962 1.00 127.15 ? 184 A   A "C1'" 1 
ATOM   1724  N  N9    . A   A  1 80  ? -4.091  -6.147  -39.883 1.00 126.09 ? 184 A   A N9    1 
ATOM   1725  C  C8    . A   A  1 80  ? -5.446  -6.266  -40.022 1.00 126.43 ? 184 A   A C8    1 
ATOM   1726  N  N7    . A   A  1 80  ? -6.097  -6.264  -38.884 1.00 125.40 ? 184 A   A N7    1 
ATOM   1727  C  C5    . A   A  1 80  ? -5.117  -6.081  -37.927 1.00 124.33 ? 184 A   A C5    1 
ATOM   1728  C  C6    . A   A  1 80  ? -5.191  -5.985  -36.532 1.00 123.06 ? 184 A   A C6    1 
ATOM   1729  N  N6    . A   A  1 80  ? -6.337  -6.065  -35.871 1.00 122.66 ? 184 A   A N6    1 
ATOM   1730  N  N1    . A   A  1 80  ? -4.053  -5.808  -35.839 1.00 122.31 ? 184 A   A N1    1 
ATOM   1731  C  C2    . A   A  1 80  ? -2.916  -5.738  -36.536 1.00 122.82 ? 184 A   A C2    1 
ATOM   1732  N  N3    . A   A  1 80  ? -2.722  -5.817  -37.857 1.00 124.02 ? 184 A   A N3    1 
ATOM   1733  C  C4    . A   A  1 80  ? -3.878  -5.985  -38.521 1.00 124.75 ? 184 A   A C4    1 
ATOM   1734  P  P     . C   A  1 81  ? -0.059  -6.775  -43.961 1.00 129.88 ? 185 C   A P     1 
ATOM   1735  O  OP1   . C   A  1 81  ? 1.226   -6.051  -43.931 1.00 130.25 ? 185 C   A OP1   1 
ATOM   1736  O  OP2   . C   A  1 81  ? -0.783  -6.992  -45.231 1.00 131.32 ? 185 C   A OP2   1 
ATOM   1737  O  "O5'" . C   A  1 81  ? 0.182   -8.196  -43.331 1.00 154.72 ? 185 C   A "O5'" 1 
ATOM   1738  C  "C5'" . C   A  1 81  ? 0.516   -8.298  -41.958 1.00 150.64 ? 185 C   A "C5'" 1 
ATOM   1739  C  "C4'" . C   A  1 81  ? 0.531   -9.731  -41.507 1.00 145.52 ? 185 C   A "C4'" 1 
ATOM   1740  O  "O4'" . C   A  1 81  ? -0.661  -10.070 -40.774 1.00 141.93 ? 185 C   A "O4'" 1 
ATOM   1741  C  "C3'" . C   A  1 81  ? 0.698   -10.801 -42.579 1.00 139.11 ? 185 C   A "C3'" 1 
ATOM   1742  O  "O3'" . C   A  1 81  ? 1.453   -11.854 -42.011 1.00 136.44 ? 185 C   A "O3'" 1 
ATOM   1743  C  "C2'" . C   A  1 81  ? -0.711  -11.333 -42.726 1.00 138.47 ? 185 C   A "C2'" 1 
ATOM   1744  O  "O2'" . C   A  1 81  ? -0.754  -12.652 -43.219 1.00 141.70 ? 185 C   A "O2'" 1 
ATOM   1745  C  "C1'" . C   A  1 81  ? -1.195  -11.259 -41.285 1.00 136.75 ? 185 C   A "C1'" 1 
ATOM   1746  N  N1    . C   A  1 81  ? -2.629  -11.124 -41.137 1.00 138.45 ? 185 C   A N1    1 
ATOM   1747  C  C2    . C   A  1 81  ? -3.029  -11.204 -39.829 1.00 141.93 ? 185 C   A C2    1 
ATOM   1748  O  O2    . C   A  1 81  ? -2.127  -11.393 -38.966 1.00 122.59 ? 185 C   A O2    1 
ATOM   1749  N  N3    . C   A  1 81  ? -4.361  -11.066 -39.624 1.00 140.56 ? 185 C   A N3    1 
ATOM   1750  C  C4    . C   A  1 81  ? -5.203  -10.870 -40.653 1.00 138.38 ? 185 C   A C4    1 
ATOM   1751  N  N4    . C   A  1 81  ? -6.508  -10.753 -40.417 1.00 134.03 ? 185 C   A N4    1 
ATOM   1752  C  C5    . C   A  1 81  ? -4.766  -10.781 -41.996 1.00 141.74 ? 185 C   A C5    1 
ATOM   1753  C  C6    . C   A  1 81  ? -3.459  -10.910 -42.188 1.00 142.42 ? 185 C   A C6    1 
ATOM   1754  P  P     . C   A  1 82  ? 2.788   -11.542 -41.199 1.00 148.23 ? 186 C   A P     1 
ATOM   1755  O  OP1   . C   A  1 82  ? 3.460   -10.365 -41.791 1.00 125.34 ? 186 C   A OP1   1 
ATOM   1756  O  OP2   . C   A  1 82  ? 3.557   -12.801 -41.106 1.00 158.38 ? 186 C   A OP2   1 
ATOM   1757  O  "O5'" . C   A  1 82  ? 2.262   -11.035 -39.776 1.00 122.99 ? 186 C   A "O5'" 1 
ATOM   1758  C  "C5'" . C   A  1 82  ? 1.291   -11.692 -38.970 1.00 121.98 ? 186 C   A "C5'" 1 
ATOM   1759  C  "C4'" . C   A  1 82  ? 1.924   -11.937 -37.650 1.00 120.64 ? 186 C   A "C4'" 1 
ATOM   1760  O  "O4'" . C   A  1 82  ? 3.351   -11.789 -37.821 1.00 120.78 ? 186 C   A "O4'" 1 
ATOM   1761  C  "C3'" . C   A  1 82  ? 1.494   -11.001 -36.542 1.00 120.15 ? 186 C   A "C3'" 1 
ATOM   1762  O  "O3'" . C   A  1 82  ? 1.058   -11.692 -35.401 1.00 118.96 ? 186 C   A "O3'" 1 
ATOM   1763  C  "C2'" . C   A  1 82  ? 2.743   -10.210 -36.163 1.00 138.99 ? 186 C   A "C2'" 1 
ATOM   1764  O  "O2'" . C   A  1 82  ? 2.969   -10.189 -34.773 1.00 137.56 ? 186 C   A "O2'" 1 
ATOM   1765  C  "C1'" . C   A  1 82  ? 3.894   -10.928 -36.854 1.00 120.36 ? 186 C   A "C1'" 1 
ATOM   1766  N  N1    . C   A  1 82  ? 4.912   -10.014 -37.457 1.00 140.06 ? 186 C   A N1    1 
ATOM   1767  C  C2    . C   A  1 82  ? 4.686   -8.992  -38.435 1.00 140.01 ? 186 C   A C2    1 
ATOM   1768  O  O2    . C   A  1 82  ? 3.580   -8.772  -38.947 1.00 123.38 ? 186 C   A O2    1 
ATOM   1769  N  N3    . C   A  1 82  ? 5.714   -8.225  -38.863 1.00 123.74 ? 186 C   A N3    1 
ATOM   1770  C  C4    . C   A  1 82  ? 6.943   -8.381  -38.373 1.00 138.45 ? 186 C   A C4    1 
ATOM   1771  N  N4    . C   A  1 82  ? 7.923   -7.592  -38.830 1.00 136.70 ? 186 C   A N4    1 
ATOM   1772  C  C5    . C   A  1 82  ? 7.211   -9.366  -37.382 1.00 138.14 ? 186 C   A C5    1 
ATOM   1773  C  C6    . C   A  1 82  ? 6.188   -10.124 -36.965 1.00 138.25 ? 186 C   A C6    1 
ATOM   1774  P  P     . G   A  1 83  ? 0.213   -10.884 -34.314 1.00 118.53 ? 187 G   A P     1 
ATOM   1775  O  OP1   . G   A  1 83  ? 1.044   -9.810  -33.774 1.00 118.48 ? 187 G   A OP1   1 
ATOM   1776  O  OP2   . G   A  1 83  ? -0.398  -11.789 -33.328 1.00 132.22 ? 187 G   A OP2   1 
ATOM   1777  O  "O5'" . G   A  1 83  ? -0.976  -10.258 -35.122 1.00 119.55 ? 187 G   A "O5'" 1 
ATOM   1778  C  "C5'" . G   A  1 83  ? -2.106  -11.041 -35.377 1.00 119.64 ? 187 G   A "C5'" 1 
ATOM   1779  C  "C4'" . G   A  1 83  ? -3.162  -10.699 -34.373 1.00 119.18 ? 187 G   A "C4'" 1 
ATOM   1780  O  "O4'" . G   A  1 83  ? -3.724  -9.419  -34.710 1.00 119.99 ? 187 G   A "O4'" 1 
ATOM   1781  C  "C3'" . G   A  1 83  ? -4.354  -11.629 -34.351 1.00 135.88 ? 187 G   A "C3'" 1 
ATOM   1782  O  "O3'" . G   A  1 83  ? -4.148  -12.795 -33.596 1.00 132.23 ? 187 G   A "O3'" 1 
ATOM   1783  C  "C2'" . G   A  1 83  ? -5.458  -10.740 -33.819 1.00 119.30 ? 187 G   A "C2'" 1 
ATOM   1784  O  "O2'" . G   A  1 83  ? -5.297  -10.557 -32.422 1.00 118.30 ? 187 G   A "O2'" 1 
ATOM   1785  C  "C1'" . G   A  1 83  ? -5.113  -9.428  -34.498 1.00 120.12 ? 187 G   A "C1'" 1 
ATOM   1786  N  N9    . G   A  1 83  ? -5.754  -9.289  -35.816 1.00 121.41 ? 187 G   A N9    1 
ATOM   1787  C  C8    . G   A  1 83  ? -5.067  -9.198  -36.993 1.00 122.28 ? 187 G   A C8    1 
ATOM   1788  N  N7    . G   A  1 83  ? -5.826  -9.066  -38.032 1.00 123.46 ? 187 G   A N7    1 
ATOM   1789  C  C5    . G   A  1 83  ? -7.094  -9.049  -37.514 1.00 123.34 ? 187 G   A C5    1 
ATOM   1790  C  C6    . G   A  1 83  ? -8.319  -8.925  -38.187 1.00 134.16 ? 187 G   A C6    1 
ATOM   1791  O  O6    . G   A  1 83  ? -8.526  -8.797  -39.392 1.00 141.03 ? 187 G   A O6    1 
ATOM   1792  N  N1    . G   A  1 83  ? -9.383  -8.965  -37.311 1.00 132.08 ? 187 G   A N1    1 
ATOM   1793  C  C2    . G   A  1 83  ? -9.277  -9.100  -35.954 1.00 134.91 ? 187 G   A C2    1 
ATOM   1794  N  N2    . G   A  1 83  ? -10.436 -9.119  -35.280 1.00 142.03 ? 187 G   A N2    1 
ATOM   1795  N  N3    . G   A  1 83  ? -8.124  -9.216  -35.310 1.00 132.13 ? 187 G   A N3    1 
ATOM   1796  C  C4    . G   A  1 83  ? -7.077  -9.180  -36.149 1.00 122.09 ? 187 G   A C4    1 
ATOM   1797  P  P     . G   A  1 84  ? -5.011  -14.081 -33.944 1.00 118.32 ? 188 G   A P     1 
ATOM   1798  O  OP1   . G   A  1 84  ? -4.454  -15.106 -33.041 1.00 119.26 ? 188 G   A OP1   1 
ATOM   1799  O  OP2   . G   A  1 84  ? -5.008  -14.250 -35.420 1.00 119.34 ? 188 G   A OP2   1 
ATOM   1800  O  "O5'" . G   A  1 84  ? -6.478  -13.718 -33.445 1.00 118.57 ? 188 G   A "O5'" 1 
ATOM   1801  C  "C5'" . G   A  1 84  ? -6.738  -13.563 -32.058 1.00 117.78 ? 188 G   A "C5'" 1 
ATOM   1802  C  "C4'" . G   A  1 84  ? -8.204  -13.424 -31.790 1.00 118.20 ? 188 G   A "C4'" 1 
ATOM   1803  O  "O4'" . G   A  1 84  ? -8.682  -12.220 -32.428 1.00 119.04 ? 188 G   A "O4'" 1 
ATOM   1804  C  "C3'" . G   A  1 84  ? -9.064  -14.519 -32.382 1.00 120.23 ? 188 G   A "C3'" 1 
ATOM   1805  O  "O3'" . G   A  1 84  ? -9.094  -15.679 -31.588 1.00 118.09 ? 188 G   A "O3'" 1 
ATOM   1806  C  "C2'" . G   A  1 84  ? -10.409 -13.831 -32.556 1.00 119.60 ? 188 G   A "C2'" 1 
ATOM   1807  O  "O2'" . G   A  1 84  ? -11.100 -13.733 -31.314 1.00 119.16 ? 188 G   A "O2'" 1 
ATOM   1808  C  "C1'" . G   A  1 84  ? -9.962  -12.433 -32.973 1.00 119.91 ? 188 G   A "C1'" 1 
ATOM   1809  N  N9    . G   A  1 84  ? -9.789  -12.307 -34.428 1.00 120.90 ? 188 G   A N9    1 
ATOM   1810  C  C8    . G   A  1 84  ? -8.568  -12.192 -35.026 1.00 120.87 ? 188 G   A C8    1 
ATOM   1811  N  N7    . G   A  1 84  ? -8.651  -12.067 -36.319 1.00 123.67 ? 188 G   A N7    1 
ATOM   1812  C  C5    . G   A  1 84  ? -10.001 -12.103 -36.602 1.00 122.74 ? 188 G   A C5    1 
ATOM   1813  C  C6    . G   A  1 84  ? -10.668 -12.014 -37.846 1.00 124.22 ? 188 G   A C6    1 
ATOM   1814  O  O6    . G   A  1 84  ? -10.199 -11.887 -38.989 1.00 124.96 ? 188 G   A O6    1 
ATOM   1815  N  N1    . G   A  1 84  ? -12.037 -12.097 -37.641 1.00 128.17 ? 188 G   A N1    1 
ATOM   1816  C  C2    . G   A  1 84  ? -12.674 -12.243 -36.431 1.00 132.10 ? 188 G   A C2    1 
ATOM   1817  N  N2    . G   A  1 84  ? -14.016 -12.308 -36.459 1.00 139.52 ? 188 G   A N2    1 
ATOM   1818  N  N3    . G   A  1 84  ? -12.049 -12.324 -35.272 1.00 127.88 ? 188 G   A N3    1 
ATOM   1819  C  C4    . G   A  1 84  ? -10.720 -12.248 -35.436 1.00 125.03 ? 188 G   A C4    1 
ATOM   1820  P  P     . C   A  1 85  ? -9.116  -17.101 -32.306 1.00 118.30 ? 189 C   A P     1 
ATOM   1821  O  OP1   . C   A  1 85  ? -8.920  -18.061 -31.209 1.00 119.24 ? 189 C   A OP1   1 
ATOM   1822  O  OP2   . C   A  1 85  ? -8.195  -17.100 -33.462 1.00 118.57 ? 189 C   A OP2   1 
ATOM   1823  O  "O5'" . C   A  1 85  ? -10.578 -17.192 -32.901 1.00 119.41 ? 189 C   A "O5'" 1 
ATOM   1824  C  "C5'" . C   A  1 85  ? -11.689 -17.133 -32.034 1.00 119.52 ? 189 C   A "C5'" 1 
ATOM   1825  C  "C4'" . C   A  1 85  ? -12.932 -16.782 -32.795 1.00 120.74 ? 189 C   A "C4'" 1 
ATOM   1826  O  "O4'" . C   A  1 85  ? -12.737 -15.550 -33.537 1.00 129.41 ? 189 C   A "O4'" 1 
ATOM   1827  C  "C3'" . C   A  1 85  ? -13.360 -17.761 -33.859 1.00 121.57 ? 189 C   A "C3'" 1 
ATOM   1828  O  "O3'" . C   A  1 85  ? -14.025 -18.885 -33.359 1.00 121.85 ? 189 C   A "O3'" 1 
ATOM   1829  C  "C2'" . C   A  1 85  ? -14.255 -16.907 -34.738 1.00 127.01 ? 189 C   A "C2'" 1 
ATOM   1830  O  "O2'" . C   A  1 85  ? -15.517 -16.706 -34.123 1.00 123.26 ? 189 C   A "O2'" 1 
ATOM   1831  C  "C1'" . C   A  1 85  ? -13.510 -15.583 -34.718 1.00 122.48 ? 189 C   A "C1'" 1 
ATOM   1832  N  N1    . C   A  1 85  ? -12.596 -15.486 -35.866 1.00 122.79 ? 189 C   A N1    1 
ATOM   1833  C  C2    . C   A  1 85  ? -13.124 -15.372 -37.154 1.00 124.11 ? 189 C   A C2    1 
ATOM   1834  O  O2    . C   A  1 85  ? -14.350 -15.367 -37.328 1.00 124.99 ? 189 C   A O2    1 
ATOM   1835  N  N3    . C   A  1 85  ? -12.275 -15.296 -38.195 1.00 124.48 ? 189 C   A N3    1 
ATOM   1836  C  C4    . C   A  1 85  ? -10.956 -15.314 -37.980 1.00 128.47 ? 189 C   A C4    1 
ATOM   1837  N  N4    . C   A  1 85  ? -10.137 -15.232 -39.032 1.00 133.07 ? 189 C   A N4    1 
ATOM   1838  C  C5    . C   A  1 85  ? -10.397 -15.418 -36.674 1.00 124.17 ? 189 C   A C5    1 
ATOM   1839  C  C6    . C   A  1 85  ? -11.248 -15.501 -35.650 1.00 121.88 ? 189 C   A C6    1 
ATOM   1840  P  P     . C   A  1 86  ? -13.957 -20.245 -34.187 1.00 124.33 ? 190 C   A P     1 
ATOM   1841  O  OP1   . C   A  1 86  ? -14.870 -21.159 -33.467 1.00 127.58 ? 190 C   A OP1   1 
ATOM   1842  O  OP2   . C   A  1 86  ? -12.528 -20.554 -34.419 1.00 124.35 ? 190 C   A OP2   1 
ATOM   1843  O  "O5'" . C   A  1 86  ? -14.599 -19.912 -35.608 1.00 123.34 ? 190 C   A "O5'" 1 
ATOM   1844  C  "C5'" . C   A  1 86  ? -16.001 -19.762 -35.752 1.00 124.47 ? 190 C   A "C5'" 1 
ATOM   1845  C  "C4'" . C   A  1 86  ? -16.435 -19.880 -37.190 1.00 125.80 ? 190 C   A "C4'" 1 
ATOM   1846  O  "O4'" . C   A  1 86  ? -15.945 -18.759 -37.956 1.00 126.11 ? 190 C   A "O4'" 1 
ATOM   1847  C  "C3'" . C   A  1 86  ? -15.916 -21.078 -37.952 1.00 134.92 ? 190 C   A "C3'" 1 
ATOM   1848  O  "O3'" . C   A  1 86  ? -16.629 -22.262 -37.676 1.00 136.84 ? 190 C   A "O3'" 1 
ATOM   1849  C  "C2'" . C   A  1 86  ? -16.038 -20.625 -39.397 1.00 133.68 ? 190 C   A "C2'" 1 
ATOM   1850  O  "O2'" . C   A  1 86  ? -17.390 -20.664 -39.811 1.00 133.78 ? 190 C   A "O2'" 1 
ATOM   1851  C  "C1'" . C   A  1 86  ? -15.665 -19.166 -39.276 1.00 126.90 ? 190 C   A "C1'" 1 
ATOM   1852  N  N1    . C   A  1 86  ? -14.248 -18.888 -39.535 1.00 126.15 ? 190 C   A N1    1 
ATOM   1853  C  C2    . C   A  1 86  ? -13.796 -18.656 -40.831 1.00 126.99 ? 190 C   A C2    1 
ATOM   1854  O  O2    . C   A  1 86  ? -14.572 -18.791 -41.782 1.00 128.33 ? 190 C   A O2    1 
ATOM   1855  N  N3    . C   A  1 86  ? -12.497 -18.336 -41.009 1.00 126.38 ? 190 C   A N3    1 
ATOM   1856  C  C4    . C   A  1 86  ? -11.697 -18.204 -39.956 1.00 125.01 ? 190 C   A C4    1 
ATOM   1857  N  N4    . C   A  1 86  ? -10.419 -17.872 -40.151 1.00 124.52 ? 190 C   A N4    1 
ATOM   1858  C  C5    . C   A  1 86  ? -12.153 -18.406 -38.625 1.00 124.14 ? 190 C   A C5    1 
ATOM   1859  C  C6    . C   A  1 86  ? -13.431 -18.731 -38.460 1.00 124.76 ? 190 C   A C6    1 
ATOM   1860  P  P     . C   A  1 87  ? -15.990 -23.663 -38.083 1.00 125.77 ? 191 C   A P     1 
ATOM   1861  O  OP1   . C   A  1 87  ? -16.789 -24.147 -39.233 1.00 128.08 ? 191 C   A OP1   1 
ATOM   1862  O  OP2   . C   A  1 87  ? -15.742 -24.451 -36.843 1.00 124.69 ? 191 C   A OP2   1 
ATOM   1863  O  "O5'" . C   A  1 87  ? -14.564 -23.293 -38.671 1.00 126.16 ? 191 C   A "O5'" 1 
ATOM   1864  C  "C5'" . C   A  1 87  ? -13.931 -24.158 -39.590 1.00 128.18 ? 191 C   A "C5'" 1 
ATOM   1865  C  "C4'" . C   A  1 87  ? -13.641 -23.474 -40.893 1.00 129.01 ? 191 C   A "C4'" 1 
ATOM   1866  O  "O4'" . C   A  1 87  ? -12.990 -22.210 -40.632 1.00 125.60 ? 191 C   A "O4'" 1 
ATOM   1867  C  "C3'" . C   A  1 87  ? -12.662 -24.219 -41.783 1.00 142.00 ? 191 C   A "C3'" 1 
ATOM   1868  O  "O3'" . C   A  1 87  ? -13.266 -25.239 -42.553 1.00 149.38 ? 191 C   A "O3'" 1 
ATOM   1869  C  "C2'" . C   A  1 87  ? -12.042 -23.111 -42.619 1.00 126.42 ? 191 C   A "C2'" 1 
ATOM   1870  O  "O2'" . C   A  1 87  ? -12.899 -22.789 -43.698 1.00 128.05 ? 191 C   A "O2'" 1 
ATOM   1871  C  "C1'" . C   A  1 87  ? -12.048 -21.938 -41.641 1.00 125.84 ? 191 C   A "C1'" 1 
ATOM   1872  N  N1    . C   A  1 87  ? -10.746 -21.628 -41.012 1.00 124.54 ? 191 C   A N1    1 
ATOM   1873  C  C2    . C   A  1 87  ? -9.693  -21.143 -41.778 1.00 124.67 ? 191 C   A C2    1 
ATOM   1874  O  O2    . C   A  1 87  ? -9.807  -21.089 -43.003 1.00 125.84 ? 191 C   A O2    1 
ATOM   1875  N  N3    . C   A  1 87  ? -8.539  -20.819 -41.183 1.00 123.60 ? 191 C   A N3    1 
ATOM   1876  C  C4    . C   A  1 87  ? -8.441  -20.916 -39.867 1.00 122.43 ? 191 C   A C4    1 
ATOM   1877  N  N4    . C   A  1 87  ? -7.284  -20.579 -39.314 1.00 121.48 ? 191 C   A N4    1 
ATOM   1878  C  C5    . C   A  1 87  ? -9.503  -21.358 -39.043 1.00 122.28 ? 191 C   A C5    1 
ATOM   1879  C  C6    . C   A  1 87  ? -10.637 -21.680 -39.655 1.00 123.37 ? 191 C   A C6    1 
ATOM   1880  P  P     . A   A  1 88  ? -12.426 -26.555 -42.915 1.00 126.23 ? 192 A   A P     1 
ATOM   1881  O  OP1   . A   A  1 88  ? -13.118 -27.617 -42.158 1.00 129.18 ? 192 A   A OP1   1 
ATOM   1882  O  OP2   . A   A  1 88  ? -10.985 -26.303 -42.657 1.00 125.01 ? 192 A   A OP2   1 
ATOM   1883  O  "O5'" . A   A  1 88  ? -12.716 -26.781 -44.468 1.00 127.72 ? 192 A   A "O5'" 1 
ATOM   1884  C  "C5'" . A   A  1 88  ? -14.057 -26.924 -44.915 1.00 129.15 ? 192 A   A "C5'" 1 
ATOM   1885  C  "C4'" . A   A  1 88  ? -14.201 -26.916 -46.420 1.00 130.65 ? 192 A   A "C4'" 1 
ATOM   1886  O  "O4'" . A   A  1 88  ? -13.948 -25.584 -46.941 1.00 131.25 ? 192 A   A "O4'" 1 
ATOM   1887  C  "C3'" . A   A  1 88  ? -13.265 -27.796 -47.232 1.00 147.21 ? 192 A   A "C3'" 1 
ATOM   1888  O  "O3'" . A   A  1 88  ? -13.597 -29.174 -47.237 1.00 152.50 ? 192 A   A "O3'" 1 
ATOM   1889  C  "C2'" . A   A  1 88  ? -13.334 -27.137 -48.604 1.00 137.31 ? 192 A   A "C2'" 1 
ATOM   1890  O  "O2'" . A   A  1 88  ? -14.583 -27.390 -49.227 1.00 134.81 ? 192 A   A "O2'" 1 
ATOM   1891  C  "C1'" . A   A  1 88  ? -13.327 -25.674 -48.207 1.00 134.81 ? 192 A   A "C1'" 1 
ATOM   1892  N  N9    . A   A  1 88  ? -11.947 -25.196 -48.076 1.00 139.37 ? 192 A   A N9    1 
ATOM   1893  C  C8    . A   A  1 88  ? -11.290 -24.858 -46.925 1.00 142.10 ? 192 A   A C8    1 
ATOM   1894  N  N7    . A   A  1 88  ? -10.054 -24.475 -47.122 1.00 143.98 ? 192 A   A N7    1 
ATOM   1895  C  C5    . A   A  1 88  ? -9.895  -24.582 -48.491 1.00 143.15 ? 192 A   A C5    1 
ATOM   1896  C  C6    . A   A  1 88  ? -8.796  -24.316 -49.312 1.00 141.65 ? 192 A   A C6    1 
ATOM   1897  N  N6    . A   A  1 88  ? -7.629  -23.880 -48.829 1.00 139.35 ? 192 A   A N6    1 
ATOM   1898  N  N1    . A   A  1 88  ? -8.949  -24.516 -50.639 1.00 143.77 ? 192 A   A N1    1 
ATOM   1899  C  C2    . A   A  1 88  ? -10.131 -24.955 -51.089 1.00 145.48 ? 192 A   A C2    1 
ATOM   1900  N  N3    . A   A  1 88  ? -11.238 -25.239 -50.404 1.00 145.35 ? 192 A   A N3    1 
ATOM   1901  C  C4    . A   A  1 88  ? -11.049 -25.027 -49.094 1.00 143.08 ? 192 A   A C4    1 
ATOM   1902  P  P     . G   A  1 89  ? -12.495 -30.252 -46.796 1.00 145.86 ? 193 G   A P     1 
ATOM   1903  O  OP1   . G   A  1 89  ? -13.022 -31.582 -47.156 1.00 157.66 ? 193 G   A OP1   1 
ATOM   1904  O  OP2   . G   A  1 89  ? -12.023 -29.969 -45.423 1.00 146.02 ? 193 G   A OP2   1 
ATOM   1905  O  "O5'" . G   A  1 89  ? -11.249 -29.931 -47.720 1.00 128.76 ? 193 G   A "O5'" 1 
ATOM   1906  C  "C5'" . G   A  1 89  ? -11.341 -30.090 -49.118 1.00 130.14 ? 193 G   A "C5'" 1 
ATOM   1907  C  "C4'" . G   A  1 89  ? -10.160 -29.477 -49.808 1.00 148.22 ? 193 G   A "C4'" 1 
ATOM   1908  O  "O4'" . G   A  1 89  ? -9.943  -28.123 -49.317 1.00 143.39 ? 193 G   A "O4'" 1 
ATOM   1909  C  "C3'" . G   A  1 89  ? -8.810  -30.136 -49.597 1.00 140.20 ? 193 G   A "C3'" 1 
ATOM   1910  O  "O3'" . G   A  1 89  ? -8.631  -31.356 -50.303 1.00 140.55 ? 193 G   A "O3'" 1 
ATOM   1911  C  "C2'" . G   A  1 89  ? -7.860  -29.022 -50.012 1.00 144.75 ? 193 G   A "C2'" 1 
ATOM   1912  O  "O2'" . G   A  1 89  ? -7.820  -28.883 -51.423 1.00 156.27 ? 193 G   A "O2'" 1 
ATOM   1913  C  "C1'" . G   A  1 89  ? -8.568  -27.799 -49.423 1.00 139.68 ? 193 G   A "C1'" 1 
ATOM   1914  N  N9    . G   A  1 89  ? -8.020  -27.456 -48.097 1.00 134.73 ? 193 G   A N9    1 
ATOM   1915  C  C8    . G   A  1 89  ? -8.619  -27.513 -46.861 1.00 131.26 ? 193 G   A C8    1 
ATOM   1916  N  N7    . G   A  1 89  ? -7.810  -27.148 -45.899 1.00 125.81 ? 193 G   A N7    1 
ATOM   1917  C  C5    . G   A  1 89  ? -6.616  -26.830 -46.531 1.00 125.42 ? 193 G   A C5    1 
ATOM   1918  C  C6    . G   A  1 89  ? -5.378  -26.375 -46.010 1.00 124.39 ? 193 G   A C6    1 
ATOM   1919  O  O6    . G   A  1 89  ? -5.059  -26.149 -44.842 1.00 123.23 ? 193 G   A O6    1 
ATOM   1920  N  N1    . G   A  1 89  ? -4.439  -26.184 -47.013 1.00 124.92 ? 193 G   A N1    1 
ATOM   1921  C  C2    . G   A  1 89  ? -4.645  -26.390 -48.351 1.00 126.28 ? 193 G   A C2    1 
ATOM   1922  N  N2    . G   A  1 89  ? -3.595  -26.140 -49.154 1.00 126.68 ? 193 G   A N2    1 
ATOM   1923  N  N3    . G   A  1 89  ? -5.797  -26.816 -48.846 1.00 127.24 ? 193 G   A N3    1 
ATOM   1924  C  C4    . G   A  1 89  ? -6.732  -27.016 -47.888 1.00 128.57 ? 193 G   A C4    1 
ATOM   1925  P  P     . G   A  1 90  ? -8.333  -32.722 -49.503 1.00 127.39 ? 194 G   A P     1 
ATOM   1926  O  OP1   . G   A  1 90  ? -8.317  -33.825 -50.487 1.00 127.97 ? 194 G   A OP1   1 
ATOM   1927  O  OP2   . G   A  1 90  ? -9.221  -32.799 -48.319 1.00 126.93 ? 194 G   A OP2   1 
ATOM   1928  O  "O5'" . G   A  1 90  ? -6.852  -32.526 -48.969 1.00 125.88 ? 194 G   A "O5'" 1 
ATOM   1929  C  "C5'" . G   A  1 90  ? -5.805  -32.179 -49.856 1.00 126.15 ? 194 G   A "C5'" 1 
ATOM   1930  C  "C4'" . G   A  1 90  ? -4.799  -31.291 -49.176 1.00 125.19 ? 194 G   A "C4'" 1 
ATOM   1931  O  "O4'" . G   A  1 90  ? -5.480  -30.139 -48.615 1.00 138.91 ? 194 G   A "O4'" 1 
ATOM   1932  C  "C3'" . G   A  1 90  ? -4.064  -31.883 -47.988 1.00 134.61 ? 194 G   A "C3'" 1 
ATOM   1933  O  "O3'" . G   A  1 90  ? -2.978  -32.708 -48.355 1.00 132.40 ? 194 G   A "O3'" 1 
ATOM   1934  C  "C2'" . G   A  1 90  ? -3.637  -30.637 -47.214 1.00 134.82 ? 194 G   A "C2'" 1 
ATOM   1935  O  "O2'" . G   A  1 90  ? -2.529  -30.013 -47.843 1.00 123.14 ? 194 G   A "O2'" 1 
ATOM   1936  C  "C1'" . G   A  1 90  ? -4.837  -29.727 -47.426 1.00 135.10 ? 194 G   A "C1'" 1 
ATOM   1937  N  N9    . G   A  1 90  ? -5.795  -29.741 -46.300 1.00 133.86 ? 194 G   A N9    1 
ATOM   1938  C  C8    . G   A  1 90  ? -7.120  -30.115 -46.330 1.00 139.15 ? 194 G   A C8    1 
ATOM   1939  N  N7    . G   A  1 90  ? -7.721  -29.990 -45.177 1.00 137.44 ? 194 G   A N7    1 
ATOM   1940  C  C5    . G   A  1 90  ? -6.742  -29.498 -44.341 1.00 128.73 ? 194 G   A C5    1 
ATOM   1941  C  C6    . G   A  1 90  ? -6.812  -29.182 -42.975 1.00 122.69 ? 194 G   A C6    1 
ATOM   1942  O  O6    . G   A  1 90  ? -7.755  -29.272 -42.195 1.00 121.72 ? 194 G   A O6    1 
ATOM   1943  N  N1    . G   A  1 90  ? -5.595  -28.730 -42.516 1.00 121.42 ? 194 G   A N1    1 
ATOM   1944  C  C2    . G   A  1 90  ? -4.464  -28.587 -43.262 1.00 120.73 ? 194 G   A C2    1 
ATOM   1945  N  N2    . G   A  1 90  ? -3.408  -28.110 -42.599 1.00 119.80 ? 194 G   A N2    1 
ATOM   1946  N  N3    . G   A  1 90  ? -4.376  -28.886 -44.539 1.00 121.63 ? 194 G   A N3    1 
ATOM   1947  C  C4    . G   A  1 90  ? -5.550  -29.334 -45.011 1.00 129.80 ? 194 G   A C4    1 
ATOM   1948  P  P     . U   A  1 91  ? -2.707  -34.072 -47.575 1.00 121.37 ? 195 U   A P     1 
ATOM   1949  O  OP1   . U   A  1 91  ? -1.519  -34.621 -48.252 1.00 121.04 ? 195 U   A OP1   1 
ATOM   1950  O  OP2   . U   A  1 91  ? -3.978  -34.768 -47.319 1.00 121.68 ? 195 U   A OP2   1 
ATOM   1951  O  "O5'" . U   A  1 91  ? -2.154  -33.651 -46.163 1.00 120.01 ? 195 U   A "O5'" 1 
ATOM   1952  C  "C5'" . U   A  1 91  ? -0.807  -33.282 -46.032 1.00 119.30 ? 195 U   A "C5'" 1 
ATOM   1953  C  "C4'" . U   A  1 91  ? -0.567  -32.698 -44.680 1.00 118.31 ? 195 U   A "C4'" 1 
ATOM   1954  O  "O4'" . U   A  1 91  ? -1.611  -31.736 -44.398 1.00 119.00 ? 195 U   A "O4'" 1 
ATOM   1955  C  "C3'" . U   A  1 91  ? -0.618  -33.633 -43.497 1.00 117.10 ? 195 U   A "C3'" 1 
ATOM   1956  O  "O3'" . U   A  1 91  ? 0.587   -34.366 -43.349 1.00 133.33 ? 195 U   A "O3'" 1 
ATOM   1957  C  "C2'" . U   A  1 91  ? -0.904  -32.674 -42.348 1.00 116.77 ? 195 U   A "C2'" 1 
ATOM   1958  O  "O2'" . U   A  1 91  ? 0.282   -31.982 -42.008 1.00 116.18 ? 195 U   A "O2'" 1 
ATOM   1959  C  "C1'" . U   A  1 91  ? -1.822  -31.650 -43.015 1.00 118.08 ? 195 U   A "C1'" 1 
ATOM   1960  N  N1    . U   A  1 91  ? -3.270  -31.796 -42.718 1.00 118.62 ? 195 U   A N1    1 
ATOM   1961  C  C2    . U   A  1 91  ? -3.739  -31.602 -41.431 1.00 131.01 ? 195 U   A C2    1 
ATOM   1962  O  O2    . U   A  1 91  ? -3.018  -31.354 -40.486 1.00 136.87 ? 195 U   A O2    1 
ATOM   1963  N  N3    . U   A  1 91  ? -5.095  -31.728 -41.246 1.00 125.35 ? 195 U   A N3    1 
ATOM   1964  C  C4    . U   A  1 91  ? -6.042  -32.010 -42.195 1.00 119.90 ? 195 U   A C4    1 
ATOM   1965  O  O4    . U   A  1 91  ? -7.233  -32.088 -41.882 1.00 120.47 ? 195 U   A O4    1 
ATOM   1966  C  C5    . U   A  1 91  ? -5.489  -32.178 -43.496 1.00 120.44 ? 195 U   A C5    1 
ATOM   1967  C  C6    . U   A  1 91  ? -4.174  -32.054 -43.712 1.00 119.81 ? 195 U   A C6    1 
ATOM   1968  P  P     . C   A  1 92  ? 0.567   -35.926 -42.952 1.00 115.27 ? 196 C   A P     1 
ATOM   1969  O  OP1   . C   A  1 92  ? 1.900   -36.476 -43.293 1.00 114.61 ? 196 C   A OP1   1 
ATOM   1970  O  OP2   . C   A  1 92  ? -0.651  -36.564 -43.500 1.00 116.10 ? 196 C   A OP2   1 
ATOM   1971  O  "O5'" . C   A  1 92  ? 0.420   -35.903 -41.374 1.00 114.35 ? 196 C   A "O5'" 1 
ATOM   1972  C  "C5'" . C   A  1 92  ? 1.321   -35.141 -40.597 1.00 113.66 ? 196 C   A "C5'" 1 
ATOM   1973  C  "C4'" . C   A  1 92  ? 0.780   -34.854 -39.226 1.00 113.24 ? 196 C   A "C4'" 1 
ATOM   1974  O  "O4'" . C   A  1 92  ? -0.287  -33.884 -39.319 1.00 114.13 ? 196 C   A "O4'" 1 
ATOM   1975  C  "C3'" . C   A  1 92  ? 0.124   -35.988 -38.474 1.00 118.14 ? 196 C   A "C3'" 1 
ATOM   1976  O  "O3'" . C   A  1 92  ? 1.004   -36.943 -37.928 1.00 115.67 ? 196 C   A "O3'" 1 
ATOM   1977  C  "C2'" . C   A  1 92  ? -0.671  -35.233 -37.425 1.00 119.69 ? 196 C   A "C2'" 1 
ATOM   1978  O  "O2'" . C   A  1 92  ? 0.214   -34.681 -36.461 1.00 112.19 ? 196 C   A "O2'" 1 
ATOM   1979  C  "C1'" . C   A  1 92  ? -1.188  -34.071 -38.249 1.00 113.98 ? 196 C   A "C1'" 1 
ATOM   1980  N  N1    . C   A  1 92  ? -2.545  -34.288 -38.792 1.00 115.00 ? 196 C   A N1    1 
ATOM   1981  C  C2    . C   A  1 92  ? -3.682  -34.238 -37.972 1.00 126.79 ? 196 C   A C2    1 
ATOM   1982  O  O2    . C   A  1 92  ? -3.568  -34.060 -36.757 1.00 128.67 ? 196 C   A O2    1 
ATOM   1983  N  N3    . C   A  1 92  ? -4.907  -34.406 -38.517 1.00 120.70 ? 196 C   A N3    1 
ATOM   1984  C  C4    . C   A  1 92  ? -5.019  -34.593 -39.823 1.00 124.43 ? 196 C   A C4    1 
ATOM   1985  N  N4    . C   A  1 92  ? -6.243  -34.754 -40.327 1.00 133.85 ? 196 C   A N4    1 
ATOM   1986  C  C5    . C   A  1 92  ? -3.881  -34.637 -40.674 1.00 116.83 ? 196 C   A C5    1 
ATOM   1987  C  C6    . C   A  1 92  ? -2.679  -34.473 -40.125 1.00 115.79 ? 196 C   A C6    1 
ATOM   1988  P  P     . G   A  1 93  ? 0.550   -38.476 -37.932 1.00 111.71 ? 197 G   A P     1 
ATOM   1989  O  OP1   . G   A  1 93  ? 1.780   -39.245 -37.619 1.00 110.68 ? 197 G   A OP1   1 
ATOM   1990  O  OP2   . G   A  1 93  ? -0.238  -38.763 -39.147 1.00 112.67 ? 197 G   A OP2   1 
ATOM   1991  O  "O5'" . G   A  1 93  ? -0.535  -38.562 -36.775 1.00 111.84 ? 197 G   A "O5'" 1 
ATOM   1992  C  "C5'" . G   A  1 93  ? -0.150  -38.360 -35.434 1.00 111.14 ? 197 G   A "C5'" 1 
ATOM   1993  C  "C4'" . G   A  1 93  ? -1.292  -38.557 -34.483 1.00 111.49 ? 197 G   A "C4'" 1 
ATOM   1994  O  "O4'" . G   A  1 93  ? -2.222  -37.471 -34.641 1.00 112.31 ? 197 G   A "O4'" 1 
ATOM   1995  C  "C3'" . G   A  1 93  ? -2.165  -39.777 -34.686 1.00 145.07 ? 197 G   A "C3'" 1 
ATOM   1996  O  "O3'" . G   A  1 93  ? -1.636  -40.994 -34.215 1.00 143.63 ? 197 G   A "O3'" 1 
ATOM   1997  C  "C2'" . G   A  1 93  ? -3.418  -39.362 -33.955 1.00 112.64 ? 197 G   A "C2'" 1 
ATOM   1998  O  "O2'" . G   A  1 93  ? -3.150  -39.344 -32.562 1.00 112.09 ? 197 G   A "O2'" 1 
ATOM   1999  C  "C1'" . G   A  1 93  ? -3.524  -37.922 -34.399 1.00 113.03 ? 197 G   A "C1'" 1 
ATOM   2000  N  N9    . G   A  1 93  ? -4.239  -37.812 -35.667 1.00 113.99 ? 197 G   A N9    1 
ATOM   2001  C  C8    . G   A  1 93  ? -3.719  -37.804 -36.923 1.00 114.13 ? 197 G   A C8    1 
ATOM   2002  N  N7    . G   A  1 93  ? -4.651  -37.674 -37.826 1.00 121.62 ? 197 G   A N7    1 
ATOM   2003  C  C5    . G   A  1 93  ? -5.843  -37.592 -37.124 1.00 115.78 ? 197 G   A C5    1 
ATOM   2004  C  C6    . G   A  1 93  ? -7.203  -37.442 -37.531 1.00 117.03 ? 197 G   A C6    1 
ATOM   2005  O  O6    . G   A  1 93  ? -7.694  -37.336 -38.666 1.00 125.57 ? 197 G   A O6    1 
ATOM   2006  N  N1    . G   A  1 93  ? -8.067  -37.417 -36.437 1.00 117.26 ? 197 G   A N1    1 
ATOM   2007  C  C2    . G   A  1 93  ? -7.665  -37.525 -35.129 1.00 116.42 ? 197 G   A C2    1 
ATOM   2008  N  N2    . G   A  1 93  ? -8.616  -37.491 -34.182 1.00 119.10 ? 197 G   A N2    1 
ATOM   2009  N  N3    . G   A  1 93  ? -6.410  -37.662 -34.757 1.00 115.29 ? 197 G   A N3    1 
ATOM   2010  C  C4    . G   A  1 93  ? -5.576  -37.690 -35.791 1.00 115.03 ? 197 G   A C4    1 
ATOM   2011  P  P     . G   A  1 94  ? -2.013  -42.357 -34.956 1.00 111.55 ? 198 G   A P     1 
ATOM   2012  O  OP1   . G   A  1 94  ? -1.487  -43.311 -33.964 1.00 110.81 ? 198 G   A OP1   1 
ATOM   2013  O  OP2   . G   A  1 94  ? -1.531  -42.415 -36.347 1.00 111.62 ? 198 G   A OP2   1 
ATOM   2014  O  "O5'" . G   A  1 94  ? -3.594  -42.403 -34.980 1.00 112.73 ? 198 G   A "O5'" 1 
ATOM   2015  C  "C5'" . G   A  1 94  ? -4.274  -42.798 -33.818 1.00 112.94 ? 198 G   A "C5'" 1 
ATOM   2016  C  "C4'" . G   A  1 94  ? -5.753  -42.857 -34.024 1.00 114.19 ? 198 G   A "C4'" 1 
ATOM   2017  O  "O4'" . G   A  1 94  ? -6.221  -41.612 -34.570 1.00 114.79 ? 198 G   A "O4'" 1 
ATOM   2018  C  "C3'" . G   A  1 94  ? -6.280  -43.885 -34.997 1.00 135.46 ? 198 G   A "C3'" 1 
ATOM   2019  O  "O3'" . G   A  1 94  ? -6.259  -45.218 -34.510 1.00 133.92 ? 198 G   A "O3'" 1 
ATOM   2020  C  "C2'" . G   A  1 94  ? -7.665  -43.332 -35.304 1.00 135.09 ? 198 G   A "C2'" 1 
ATOM   2021  O  "O2'" . G   A  1 94  ? -8.551  -43.564 -34.220 1.00 130.72 ? 198 G   A "O2'" 1 
ATOM   2022  C  "C1'" . G   A  1 94  ? -7.365  -41.834 -35.362 1.00 115.99 ? 198 G   A "C1'" 1 
ATOM   2023  N  N9    . G   A  1 94  ? -7.070  -41.384 -36.734 1.00 116.21 ? 198 G   A N9    1 
ATOM   2024  C  C8    . G   A  1 94  ? -5.837  -41.407 -37.332 1.00 115.39 ? 198 G   A C8    1 
ATOM   2025  N  N7    . G   A  1 94  ? -5.853  -40.961 -38.560 1.00 115.96 ? 198 G   A N7    1 
ATOM   2026  C  C5    . G   A  1 94  ? -7.171  -40.648 -38.787 1.00 117.19 ? 198 G   A C5    1 
ATOM   2027  C  C6    . G   A  1 94  ? -7.750  -40.146 -39.949 1.00 118.29 ? 198 G   A C6    1 
ATOM   2028  O  O6    . G   A  1 94  ? -7.182  -39.876 -41.008 1.00 118.39 ? 198 G   A O6    1 
ATOM   2029  N  N1    . G   A  1 94  ? -9.113  -39.979 -39.763 1.00 119.41 ? 198 G   A N1    1 
ATOM   2030  C  C2    . G   A  1 94  ? -9.815  -40.251 -38.617 1.00 119.49 ? 198 G   A C2    1 
ATOM   2031  N  N2    . G   A  1 94  ? -11.132 -40.018 -38.640 1.00 120.75 ? 198 G   A N2    1 
ATOM   2032  N  N3    . G   A  1 94  ? -9.266  -40.722 -37.525 1.00 118.50 ? 198 G   A N3    1 
ATOM   2033  C  C4    . G   A  1 94  ? -7.948  -40.913 -37.687 1.00 117.37 ? 198 G   A C4    1 
ATOM   2034  P  P     . A   A  1 95  ? -5.824  -46.385 -35.512 1.00 114.44 ? 199 A   A P     1 
ATOM   2035  O  OP1   . A   A  1 95  ? -6.570  -47.563 -35.084 1.00 115.01 ? 199 A   A OP1   1 
ATOM   2036  O  OP2   . A   A  1 95  ? -4.362  -46.446 -35.749 1.00 113.20 ? 199 A   A OP2   1 
ATOM   2037  O  "O5'" . A   A  1 95  ? -6.525  -45.963 -36.865 1.00 115.46 ? 199 A   A "O5'" 1 
ATOM   2038  C  "C5'" . A   A  1 95  ? -6.405  -46.762 -38.018 1.00 115.64 ? 199 A   A "C5'" 1 
ATOM   2039  C  "C4'" . A   A  1 95  ? -7.709  -47.440 -38.336 1.00 116.95 ? 199 A   A "C4'" 1 
ATOM   2040  O  "O4'" . A   A  1 95  ? -8.132  -48.238 -37.217 1.00 117.02 ? 199 A   A "O4'" 1 
ATOM   2041  C  "C3'" . A   A  1 95  ? -8.907  -46.555 -38.611 1.00 128.44 ? 199 A   A "C3'" 1 
ATOM   2042  O  "O3'" . A   A  1 95  ? -8.927  -46.061 -39.928 1.00 126.99 ? 199 A   A "O3'" 1 
ATOM   2043  C  "C2'" . A   A  1 95  ? -10.082 -47.483 -38.341 1.00 119.36 ? 199 A   A "C2'" 1 
ATOM   2044  O  "O2'" . A   A  1 95  ? -10.346 -48.281 -39.482 1.00 120.01 ? 199 A   A "O2'" 1 
ATOM   2045  C  "C1'" . A   A  1 95  ? -9.527  -48.389 -37.252 1.00 118.46 ? 199 A   A "C1'" 1 
ATOM   2046  N  N9    . A   A  1 95  ? -10.088 -48.172 -35.918 1.00 118.73 ? 199 A   A N9    1 
ATOM   2047  C  C8    . A   A  1 95  ? -9.420  -47.882 -34.763 1.00 117.78 ? 199 A   A C8    1 
ATOM   2048  N  N7    . A   A  1 95  ? -10.192 -47.829 -33.715 1.00 118.42 ? 199 A   A N7    1 
ATOM   2049  C  C5    . A   A  1 95  ? -11.434 -48.131 -34.228 1.00 119.87 ? 199 A   A C5    1 
ATOM   2050  C  C6    . A   A  1 95  ? -12.672 -48.234 -33.622 1.00 121.18 ? 199 A   A C6    1 
ATOM   2051  N  N6    . A   A  1 95  ? -12.840 -48.030 -32.321 1.00 121.20 ? 199 A   A N6    1 
ATOM   2052  N  N1    . A   A  1 95  ? -13.719 -48.559 -34.406 1.00 122.55 ? 199 A   A N1    1 
ATOM   2053  C  C2    . A   A  1 95  ? -13.536 -48.772 -35.715 1.00 122.60 ? 199 A   A C2    1 
ATOM   2054  N  N3    . A   A  1 95  ? -12.402 -48.696 -36.396 1.00 121.42 ? 199 A   A N3    1 
ATOM   2055  C  C4    . A   A  1 95  ? -11.387 -48.376 -35.576 1.00 120.08 ? 199 A   A C4    1 
ATOM   2056  P  P     . A   A  1 96  ? -9.370  -44.551 -40.182 1.00 122.86 ? 200 A   A P     1 
ATOM   2057  O  OP1   . A   A  1 96  ? -9.719  -44.368 -41.612 1.00 130.75 ? 200 A   A OP1   1 
ATOM   2058  O  OP2   . A   A  1 96  ? -8.288  -43.768 -39.555 1.00 122.76 ? 200 A   A OP2   1 
ATOM   2059  O  "O5'" . A   A  1 96  ? -10.740 -44.379 -39.388 1.00 120.49 ? 200 A   A "O5'" 1 
ATOM   2060  C  "C5'" . A   A  1 96  ? -11.969 -44.319 -40.096 1.00 122.07 ? 200 A   A "C5'" 1 
ATOM   2061  C  "C4'" . A   A  1 96  ? -13.108 -44.762 -39.230 1.00 122.93 ? 200 A   A "C4'" 1 
ATOM   2062  O  "O4'" . A   A  1 96  ? -12.562 -45.468 -38.106 1.00 121.93 ? 200 A   A "O4'" 1 
ATOM   2063  C  "C3'" . A   A  1 96  ? -13.955 -43.675 -38.596 1.00 123.59 ? 200 A   A "C3'" 1 
ATOM   2064  O  "O3'" . A   A  1 96  ? -14.939 -43.166 -39.473 1.00 140.41 ? 200 A   A "O3'" 1 
ATOM   2065  C  "C2'" . A   A  1 96  ? -14.522 -44.361 -37.355 1.00 123.81 ? 200 A   A "C2'" 1 
ATOM   2066  O  "O2'" . A   A  1 96  ? -15.653 -45.157 -37.671 1.00 125.28 ? 200 A   A "O2'" 1 
ATOM   2067  C  "C1'" . A   A  1 96  ? -13.389 -45.305 -36.983 1.00 122.48 ? 200 A   A "C1'" 1 
ATOM   2068  N  N9    . A   A  1 96  ? -12.572 -44.887 -35.839 1.00 121.23 ? 200 A   A N9    1 
ATOM   2069  C  C8    . A   A  1 96  ? -11.227 -44.608 -35.823 1.00 119.78 ? 200 A   A C8    1 
ATOM   2070  N  N7    . A   A  1 96  ? -10.775 -44.322 -34.627 1.00 119.01 ? 200 A   A N7    1 
ATOM   2071  C  C5    . A   A  1 96  ? -11.890 -44.437 -33.818 1.00 119.99 ? 200 A   A C5    1 
ATOM   2072  C  C6    . A   A  1 96  ? -12.053 -44.258 -32.447 1.00 119.90 ? 200 A   A C6    1 
ATOM   2073  N  N6    . A   A  1 96  ? -11.036 -43.921 -31.665 1.00 118.70 ? 200 A   A N6    1 
ATOM   2074  N  N1    . A   A  1 96  ? -13.286 -44.444 -31.926 1.00 121.17 ? 200 A   A N1    1 
ATOM   2075  C  C2    . A   A  1 96  ? -14.285 -44.799 -32.748 1.00 130.02 ? 200 A   A C2    1 
ATOM   2076  N  N3    . A   A  1 96  ? -14.247 -45.003 -34.067 1.00 128.32 ? 200 A   A N3    1 
ATOM   2077  C  C4    . A   A  1 96  ? -13.005 -44.794 -34.543 1.00 126.30 ? 200 A   A C4    1 
ATOM   2078  P  P     . A   A  1 97  ? -15.161 -41.584 -39.589 1.00 125.30 ? 201 A   A P     1 
ATOM   2079  O  OP1   . A   A  1 97  ? -16.049 -41.323 -40.752 1.00 126.85 ? 201 A   A OP1   1 
ATOM   2080  O  OP2   . A   A  1 97  ? -13.828 -40.944 -39.531 1.00 123.84 ? 201 A   A OP2   1 
ATOM   2081  O  "O5'" . A   A  1 97  ? -15.899 -41.210 -38.229 1.00 125.51 ? 201 A   A "O5'" 1 
ATOM   2082  C  "C5'" . A   A  1 97  ? -17.231 -41.636 -38.001 1.00 126.97 ? 201 A   A "C5'" 1 
ATOM   2083  C  "C4'" . A   A  1 97  ? -17.646 -41.506 -36.559 1.00 126.90 ? 201 A   A "C4'" 1 
ATOM   2084  O  "O4'" . A   A  1 97  ? -16.737 -42.256 -35.716 1.00 129.66 ? 201 A   A "O4'" 1 
ATOM   2085  C  "C3'" . A   A  1 97  ? -17.630 -40.107 -35.981 1.00 126.53 ? 201 A   A "C3'" 1 
ATOM   2086  O  "O3'" . A   A  1 97  ? -18.803 -39.384 -36.293 1.00 127.93 ? 201 A   A "O3'" 1 
ATOM   2087  C  "C2'" . A   A  1 97  ? -17.461 -40.371 -34.490 1.00 125.89 ? 201 A   A "C2'" 1 
ATOM   2088  O  "O2'" . A   A  1 97  ? -18.702 -40.776 -33.926 1.00 127.24 ? 201 A   A "O2'" 1 
ATOM   2089  C  "C1'" . A   A  1 97  ? -16.540 -41.588 -34.497 1.00 126.15 ? 201 A   A "C1'" 1 
ATOM   2090  N  N9    . A   A  1 97  ? -15.107 -41.246 -34.413 1.00 123.32 ? 201 A   A N9    1 
ATOM   2091  C  C8    . A   A  1 97  ? -14.249 -41.082 -35.468 1.00 122.69 ? 201 A   A C8    1 
ATOM   2092  N  N7    . A   A  1 97  ? -13.022 -40.804 -35.113 1.00 121.28 ? 201 A   A N7    1 
ATOM   2093  C  C5    . A   A  1 97  ? -13.068 -40.806 -33.729 1.00 120.94 ? 201 A   A C5    1 
ATOM   2094  C  C6    . A   A  1 97  ? -12.087 -40.582 -32.755 1.00 120.47 ? 201 A   A C6    1 
ATOM   2095  N  N6    . A   A  1 97  ? -10.811 -40.313 -33.037 1.00 118.51 ? 201 A   A N6    1 
ATOM   2096  N  N1    . A   A  1 97  ? -12.466 -40.645 -31.465 1.00 122.44 ? 201 A   A N1    1 
ATOM   2097  C  C2    . A   A  1 97  ? -13.741 -40.923 -31.176 1.00 125.12 ? 201 A   A C2    1 
ATOM   2098  N  N3    . A   A  1 97  ? -14.750 -41.159 -32.010 1.00 124.95 ? 201 A   A N3    1 
ATOM   2099  C  C4    . A   A  1 97  ? -14.343 -41.082 -33.284 1.00 122.19 ? 201 A   A C4    1 
ATOM   2100  P  P     . C   A  1 98  ? -18.718 -37.993 -37.096 1.00 128.01 ? 202 C   A P     1 
ATOM   2101  O  OP1   . C   A  1 98  ? -19.932 -37.257 -36.686 1.00 129.16 ? 202 C   A OP1   1 
ATOM   2102  O  OP2   . C   A  1 98  ? -18.455 -38.212 -38.533 1.00 128.37 ? 202 C   A OP2   1 
ATOM   2103  O  "O5'" . C   A  1 98  ? -17.455 -37.241 -36.496 1.00 126.27 ? 202 C   A "O5'" 1 
ATOM   2104  C  "C5'" . C   A  1 98  ? -17.577 -36.549 -35.269 1.00 125.86 ? 202 C   A "C5'" 1 
ATOM   2105  C  "C4'" . C   A  1 98  ? -16.298 -36.596 -34.486 1.00 124.21 ? 202 C   A "C4'" 1 
ATOM   2106  O  "O4'" . C   A  1 98  ? -15.373 -37.507 -35.113 1.00 123.53 ? 202 C   A "O4'" 1 
ATOM   2107  C  "C3'" . C   A  1 98  ? -15.502 -35.314 -34.399 1.00 134.57 ? 202 C   A "C3'" 1 
ATOM   2108  O  "O3'" . C   A  1 98  ? -16.042 -34.394 -33.480 1.00 136.89 ? 202 C   A "O3'" 1 
ATOM   2109  C  "C2'" . C   A  1 98  ? -14.122 -35.817 -34.012 1.00 127.98 ? 202 C   A "C2'" 1 
ATOM   2110  O  "O2'" . C   A  1 98  ? -14.075 -36.111 -32.628 1.00 130.59 ? 202 C   A "O2'" 1 
ATOM   2111  C  "C1'" . C   A  1 98  ? -14.055 -37.133 -34.785 1.00 124.40 ? 202 C   A "C1'" 1 
ATOM   2112  N  N1    . C   A  1 98  ? -13.250 -37.068 -36.012 1.00 121.73 ? 202 C   A N1    1 
ATOM   2113  C  C2    . C   A  1 98  ? -11.870 -37.132 -35.851 1.00 120.36 ? 202 C   A C2    1 
ATOM   2114  O  O2    . C   A  1 98  ? -11.425 -37.214 -34.706 1.00 124.42 ? 202 C   A O2    1 
ATOM   2115  N  N3    . C   A  1 98  ? -11.063 -37.108 -36.922 1.00 120.06 ? 202 C   A N3    1 
ATOM   2116  C  C4    . C   A  1 98  ? -11.628 -37.028 -38.120 1.00 121.13 ? 202 C   A C4    1 
ATOM   2117  N  N4    . C   A  1 98  ? -10.798 -37.003 -39.169 1.00 120.90 ? 202 C   A N4    1 
ATOM   2118  C  C5    . C   A  1 98  ? -13.043 -36.970 -38.313 1.00 122.55 ? 202 C   A C5    1 
ATOM   2119  C  C6    . C   A  1 98  ? -13.829 -36.998 -37.238 1.00 122.81 ? 202 C   A C6    1 
ATOM   2120  P  P     . G   A  1 99  ? -15.738 -32.848 -33.681 1.00 123.08 ? 203 G   A P     1 
ATOM   2121  O  OP1   . G   A  1 99  ? -16.604 -32.206 -32.663 1.00 126.33 ? 203 G   A OP1   1 
ATOM   2122  O  OP2   . G   A  1 99  ? -15.861 -32.542 -35.120 1.00 123.78 ? 203 G   A OP2   1 
ATOM   2123  O  "O5'" . G   A  1 99  ? -14.213 -32.704 -33.269 1.00 121.48 ? 203 G   A "O5'" 1 
ATOM   2124  C  "C5'" . G   A  1 99  ? -13.847 -32.912 -31.923 1.00 120.69 ? 203 G   A "C5'" 1 
ATOM   2125  C  "C4'" . G   A  1 99  ? -12.363 -33.018 -31.749 1.00 119.31 ? 203 G   A "C4'" 1 
ATOM   2126  O  "O4'" . G   A  1 99  ? -11.870 -34.125 -32.525 1.00 119.16 ? 203 G   A "O4'" 1 
ATOM   2127  C  "C3'" . G   A  1 99  ? -11.498 -31.866 -32.206 1.00 127.65 ? 203 G   A "C3'" 1 
ATOM   2128  O  "O3'" . G   A  1 99  ? -11.504 -30.769 -31.322 1.00 126.30 ? 203 G   A "O3'" 1 
ATOM   2129  C  "C2'" . G   A  1 99  ? -10.136 -32.534 -32.335 1.00 124.79 ? 203 G   A "C2'" 1 
ATOM   2130  O  "O2'" . G   A  1 99  ? -9.561  -32.758 -31.057 1.00 122.69 ? 203 G   A "O2'" 1 
ATOM   2131  C  "C1'" . G   A  1 99  ? -10.533 -33.888 -32.898 1.00 118.14 ? 203 G   A "C1'" 1 
ATOM   2132  N  N9    . G   A  1 99  ? -10.438 -33.908 -34.358 1.00 118.60 ? 203 G   A N9    1 
ATOM   2133  C  C8    . G   A  1 99  ? -11.435 -33.766 -35.283 1.00 119.82 ? 203 G   A C8    1 
ATOM   2134  N  N7    . G   A  1 99  ? -10.975 -33.819 -36.503 1.00 119.98 ? 203 G   A N7    1 
ATOM   2135  C  C5    . G   A  1 99  ? -9.612  -34.000 -36.351 1.00 118.77 ? 203 G   A C5    1 
ATOM   2136  C  C6    . G   A  1 99  ? -8.591  -34.125 -37.312 1.00 123.51 ? 203 G   A C6    1 
ATOM   2137  O  O6    . G   A  1 99  ? -8.681  -34.100 -38.539 1.00 130.56 ? 203 G   A O6    1 
ATOM   2138  N  N1    . G   A  1 99  ? -7.341  -34.293 -36.725 1.00 117.85 ? 203 G   A N1    1 
ATOM   2139  C  C2    . G   A  1 99  ? -7.114  -34.329 -35.376 1.00 117.37 ? 203 G   A C2    1 
ATOM   2140  N  N2    . G   A  1 99  ? -5.841  -34.496 -34.991 1.00 119.76 ? 203 G   A N2    1 
ATOM   2141  N  N3    . G   A  1 99  ? -8.062  -34.214 -34.468 1.00 116.73 ? 203 G   A N3    1 
ATOM   2142  C  C4    . G   A  1 99  ? -9.266  -34.043 -35.032 1.00 117.91 ? 203 G   A C4    1 
ATOM   2143  P  P     . G   A  1 100 ? -11.056 -29.341 -31.860 1.00 118.26 ? 204 G   A P     1 
ATOM   2144  O  OP1   . G   A  1 100 ? -11.240 -28.425 -30.714 1.00 151.17 ? 204 G   A OP1   1 
ATOM   2145  O  OP2   . G   A  1 100 ? -11.688 -29.107 -33.172 1.00 123.62 ? 204 G   A OP2   1 
ATOM   2146  O  "O5'" . G   A  1 100 ? -9.503  -29.491 -32.082 1.00 117.18 ? 204 G   A "O5'" 1 
ATOM   2147  C  "C5'" . G   A  1 100 ? -8.686  -29.587 -30.945 1.00 116.19 ? 204 G   A "C5'" 1 
ATOM   2148  C  "C4'" . G   A  1 100 ? -7.241  -29.682 -31.312 1.00 127.63 ? 204 G   A "C4'" 1 
ATOM   2149  O  "O4'" . G   A  1 100 ? -7.009  -30.829 -32.151 1.00 115.38 ? 204 G   A "O4'" 1 
ATOM   2150  C  "C3'" . G   A  1 100 ? -6.639  -28.543 -32.105 1.00 129.78 ? 204 G   A "C3'" 1 
ATOM   2151  O  "O3'" . G   A  1 100 ? -6.396  -27.383 -31.334 1.00 125.16 ? 204 G   A "O3'" 1 
ATOM   2152  C  "C2'" . G   A  1 100 ? -5.383  -29.197 -32.658 1.00 134.01 ? 204 G   A "C2'" 1 
ATOM   2153  O  "O2'" . G   A  1 100 ? -4.431  -29.390 -31.622 1.00 134.48 ? 204 G   A "O2'" 1 
ATOM   2154  C  "C1'" . G   A  1 100 ? -5.919  -30.574 -33.004 1.00 115.02 ? 204 G   A "C1'" 1 
ATOM   2155  N  N9    . G   A  1 100 ? -6.417  -30.634 -34.377 1.00 115.91 ? 204 G   A N9    1 
ATOM   2156  C  C8    . G   A  1 100 ? -7.722  -30.612 -34.781 1.00 116.97 ? 204 G   A C8    1 
ATOM   2157  N  N7    . G   A  1 100 ? -7.837  -30.711 -36.073 1.00 121.49 ? 204 G   A N7    1 
ATOM   2158  C  C5    . G   A  1 100 ? -6.541  -30.811 -36.530 1.00 117.00 ? 204 G   A C5    1 
ATOM   2159  C  C6    . G   A  1 100 ? -6.057  -30.934 -37.839 1.00 117.38 ? 204 G   A C6    1 
ATOM   2160  O  O6    . G   A  1 100 ? -6.704  -30.984 -38.892 1.00 118.41 ? 204 G   A O6    1 
ATOM   2161  N  N1    . G   A  1 100 ? -4.671  -30.996 -37.831 1.00 116.50 ? 204 G   A N1    1 
ATOM   2162  C  C2    . G   A  1 100 ? -3.870  -30.951 -36.716 1.00 115.42 ? 204 G   A C2    1 
ATOM   2163  N  N2    . G   A  1 100 ? -2.548  -31.028 -36.908 1.00 114.77 ? 204 G   A N2    1 
ATOM   2164  N  N3    . G   A  1 100 ? -4.324  -30.839 -35.492 1.00 115.10 ? 204 G   A N3    1 
ATOM   2165  C  C4    . G   A  1 100 ? -5.656  -30.773 -35.489 1.00 115.92 ? 204 G   A C4    1 
ATOM   2166  P  P     . A   A  1 101 ? -6.443  -25.939 -32.015 1.00 123.02 ? 205 A   A P     1 
ATOM   2167  O  OP1   . A   A  1 101 ? -6.504  -24.994 -30.881 1.00 128.47 ? 205 A   A OP1   1 
ATOM   2168  O  OP2   . A   A  1 101 ? -7.409  -25.921 -33.131 1.00 125.94 ? 205 A   A OP2   1 
ATOM   2169  O  "O5'" . A   A  1 101 ? -5.045  -25.770 -32.712 1.00 121.36 ? 205 A   A "O5'" 1 
ATOM   2170  C  "C5'" . A   A  1 101 ? -3.890  -25.599 -31.929 1.00 114.16 ? 205 A   A "C5'" 1 
ATOM   2171  C  "C4'" . A   A  1 101 ? -2.700  -25.772 -32.803 1.00 113.96 ? 205 A   A "C4'" 1 
ATOM   2172  O  "O4'" . A   A  1 101 ? -2.886  -27.021 -33.496 1.00 114.12 ? 205 A   A "O4'" 1 
ATOM   2173  C  "C3'" . A   A  1 101 ? -2.546  -24.783 -33.943 1.00 134.90 ? 205 A   A "C3'" 1 
ATOM   2174  O  "O3'" . A   A  1 101 ? -1.986  -23.538 -33.593 1.00 132.57 ? 205 A   A "O3'" 1 
ATOM   2175  C  "C2'" . A   A  1 101 ? -1.719  -25.577 -34.925 1.00 114.66 ? 205 A   A "C2'" 1 
ATOM   2176  O  "O2'" . A   A  1 101 ? -0.408  -25.745 -34.433 1.00 113.82 ? 205 A   A "O2'" 1 
ATOM   2177  C  "C1'" . A   A  1 101 ? -2.387  -26.917 -34.804 1.00 114.55 ? 205 A   A "C1'" 1 
ATOM   2178  N  N9    . A   A  1 101 ? -3.514  -27.012 -35.715 1.00 115.56 ? 205 A   A N9    1 
ATOM   2179  C  C8    . A   A  1 101 ? -4.862  -26.973 -35.496 1.00 116.15 ? 205 A   A C8    1 
ATOM   2180  N  N7    . A   A  1 101 ? -5.528  -27.133 -36.604 1.00 117.11 ? 205 A   A N7    1 
ATOM   2181  C  C5    . A   A  1 101 ? -4.535  -27.282 -37.552 1.00 117.10 ? 205 A   A C5    1 
ATOM   2182  C  C6    . A   A  1 101 ? -4.559  -27.479 -38.910 1.00 117.93 ? 205 A   A C6    1 
ATOM   2183  N  N6    . A   A  1 101 ? -5.697  -27.568 -39.566 1.00 121.77 ? 205 A   A N6    1 
ATOM   2184  N  N1    . A   A  1 101 ? -3.391  -27.577 -39.565 1.00 117.73 ? 205 A   A N1    1 
ATOM   2185  C  C2    . A   A  1 101 ? -2.250  -27.486 -38.885 1.00 116.74 ? 205 A   A C2    1 
ATOM   2186  N  N3    . A   A  1 101 ? -2.101  -27.293 -37.594 1.00 115.91 ? 205 A   A N3    1 
ATOM   2187  C  C4    . A   A  1 101 ? -3.296  -27.207 -37.015 1.00 116.15 ? 205 A   A C4    1 
ATOM   2188  P  P     . G   A  1 102 ? -2.526  -22.215 -34.293 1.00 115.50 ? 206 G   A P     1 
ATOM   2189  O  OP1   . G   A  1 102 ? -1.464  -21.293 -33.864 1.00 115.12 ? 206 G   A OP1   1 
ATOM   2190  O  OP2   . G   A  1 102 ? -3.963  -21.935 -34.058 1.00 116.02 ? 206 G   A OP2   1 
ATOM   2191  O  "O5'" . G   A  1 102 ? -2.396  -22.466 -35.853 1.00 116.32 ? 206 G   A "O5'" 1 
ATOM   2192  C  "C5'" . G   A  1 102 ? -3.213  -21.699 -36.720 1.00 117.43 ? 206 G   A "C5'" 1 
ATOM   2193  C  "C4'" . G   A  1 102 ? -3.347  -22.311 -38.082 1.00 118.25 ? 206 G   A "C4'" 1 
ATOM   2194  O  "O4'" . G   A  1 102 ? -3.994  -23.588 -37.970 1.00 118.07 ? 206 G   A "O4'" 1 
ATOM   2195  C  "C3'" . G   A  1 102 ? -4.212  -21.569 -39.090 1.00 145.18 ? 206 G   A "C3'" 1 
ATOM   2196  O  "O3'" . G   A  1 102 ? -3.560  -20.486 -39.720 1.00 146.62 ? 206 G   A "O3'" 1 
ATOM   2197  C  "C2'" . G   A  1 102 ? -4.563  -22.667 -40.070 1.00 120.15 ? 206 G   A "C2'" 1 
ATOM   2198  O  "O2'" . G   A  1 102 ? -3.416  -22.930 -40.851 1.00 120.18 ? 206 G   A "O2'" 1 
ATOM   2199  C  "C1'" . G   A  1 102 ? -4.739  -23.854 -39.140 1.00 119.18 ? 206 G   A "C1'" 1 
ATOM   2200  N  N9    . G   A  1 102 ? -6.150  -24.160 -38.800 1.00 119.56 ? 206 G   A N9    1 
ATOM   2201  C  C8    . G   A  1 102 ? -6.760  -24.071 -37.569 1.00 119.07 ? 206 G   A C8    1 
ATOM   2202  N  N7    . G   A  1 102 ? -8.011  -24.440 -37.564 1.00 119.70 ? 206 G   A N7    1 
ATOM   2203  C  C5    . G   A  1 102 ? -8.257  -24.801 -38.870 1.00 120.66 ? 206 G   A C5    1 
ATOM   2204  C  C6    . G   A  1 102 ? -9.447  -25.276 -39.461 1.00 121.73 ? 206 G   A C6    1 
ATOM   2205  O  O6    . G   A  1 102 ? -10.552 -25.483 -38.947 1.00 122.06 ? 206 G   A O6    1 
ATOM   2206  N  N1    . G   A  1 102 ? -9.254  -25.511 -40.808 1.00 122.54 ? 206 G   A N1    1 
ATOM   2207  C  C2    . G   A  1 102 ? -8.083  -25.312 -41.484 1.00 122.38 ? 206 G   A C2    1 
ATOM   2208  N  N2    . G   A  1 102 ? -8.124  -25.600 -42.787 1.00 123.39 ? 206 G   A N2    1 
ATOM   2209  N  N3    . G   A  1 102 ? -6.965  -24.873 -40.945 1.00 121.42 ? 206 G   A N3    1 
ATOM   2210  C  C4    . G   A  1 102 ? -7.126  -24.633 -39.640 1.00 120.59 ? 206 G   A C4    1 
ATOM   2211  P  P     . C   A  1 103 ? -4.371  -19.486 -40.669 1.00 121.62 ? 207 C   A P     1 
ATOM   2212  O  OP1   . C   A  1 103 ? -3.827  -18.201 -40.254 1.00 121.52 ? 207 C   A OP1   1 
ATOM   2213  O  OP2   . C   A  1 103 ? -5.835  -19.728 -40.631 1.00 122.12 ? 207 C   A OP2   1 
ATOM   2214  O  "O5'" . C   A  1 103 ? -3.865  -19.861 -42.130 1.00 122.57 ? 207 C   A "O5'" 1 
ATOM   2215  C  "C5'" . C   A  1 103 ? -2.480  -19.985 -42.414 1.00 122.26 ? 207 C   A "C5'" 1 
ATOM   2216  C  "C4'" . C   A  1 103 ? -2.237  -20.625 -43.765 1.00 123.16 ? 207 C   A "C4'" 1 
ATOM   2217  O  "O4'" . C   A  1 103 ? -2.879  -21.930 -43.797 1.00 122.88 ? 207 C   A "O4'" 1 
ATOM   2218  C  "C3'" . C   A  1 103 ? -2.812  -19.916 -44.984 1.00 157.55 ? 207 C   A "C3'" 1 
ATOM   2219  O  "O3'" . C   A  1 103 ? -2.034  -18.829 -45.471 1.00 147.03 ? 207 C   A "O3'" 1 
ATOM   2220  C  "C2'" . C   A  1 103 ? -2.941  -21.051 -45.994 1.00 125.42 ? 207 C   A "C2'" 1 
ATOM   2221  O  "O2'" . C   A  1 103 ? -1.689  -21.376 -46.565 1.00 125.40 ? 207 C   A "O2'" 1 
ATOM   2222  C  "C1'" . C   A  1 103 ? -3.358  -22.205 -45.097 1.00 124.20 ? 207 C   A "C1'" 1 
ATOM   2223  N  N1    . C   A  1 103 ? -4.827  -22.347 -45.042 1.00 124.73 ? 207 C   A N1    1 
ATOM   2224  C  C2    . C   A  1 103 ? -5.550  -22.694 -46.189 1.00 126.06 ? 207 C   A C2    1 
ATOM   2225  O  O2    . C   A  1 103 ? -4.976  -22.869 -47.271 1.00 126.81 ? 207 C   A O2    1 
ATOM   2226  N  N3    . C   A  1 103 ? -6.892  -22.806 -46.116 1.00 129.41 ? 207 C   A N3    1 
ATOM   2227  C  C4    . C   A  1 103 ? -7.518  -22.603 -44.960 1.00 134.65 ? 207 C   A C4    1 
ATOM   2228  N  N4    . C   A  1 103 ? -8.847  -22.721 -44.940 1.00 136.32 ? 207 C   A N4    1 
ATOM   2229  C  C5    . C   A  1 103 ? -6.811  -22.256 -43.776 1.00 138.98 ? 207 C   A C5    1 
ATOM   2230  C  C6    . C   A  1 103 ? -5.480  -22.147 -43.861 1.00 139.59 ? 207 C   A C6    1 
ATOM   2231  P  P     . A   A  1 104 ? -2.729  -17.428 -45.839 1.00 129.31 ? 208 A   A P     1 
ATOM   2232  O  OP1   . A   A  1 104 ? -1.645  -16.614 -46.418 1.00 127.59 ? 208 A   A OP1   1 
ATOM   2233  O  OP2   . A   A  1 104 ? -3.530  -16.932 -44.702 1.00 126.16 ? 208 A   A OP2   1 
ATOM   2234  O  "O5'" . A   A  1 104 ? -3.761  -17.770 -47.005 1.00 128.32 ? 208 A   A "O5'" 1 
ATOM   2235  C  "C5'" . A   A  1 104 ? -3.298  -18.088 -48.305 1.00 129.48 ? 208 A   A "C5'" 1 
ATOM   2236  C  "C4'" . A   A  1 104 ? -4.363  -18.695 -49.188 1.00 130.59 ? 208 A   A "C4'" 1 
ATOM   2237  O  "O4'" . A   A  1 104 ? -4.952  -19.854 -48.561 1.00 129.54 ? 208 A   A "O4'" 1 
ATOM   2238  C  "C3'" . A   A  1 104 ? -5.575  -17.853 -49.529 1.00 157.19 ? 208 A   A "C3'" 1 
ATOM   2239  O  "O3'" . A   A  1 104 ? -5.345  -16.846 -50.485 1.00 159.68 ? 208 A   A "O3'" 1 
ATOM   2240  C  "C2'" . A   A  1 104 ? -6.554  -18.907 -50.018 1.00 132.38 ? 208 A   A "C2'" 1 
ATOM   2241  O  "O2'" . A   A  1 104 ? -6.179  -19.367 -51.302 1.00 133.56 ? 208 A   A "O2'" 1 
ATOM   2242  C  "C1'" . A   A  1 104 ? -6.269  -20.032 -49.046 1.00 130.60 ? 208 A   A "C1'" 1 
ATOM   2243  N  N9    . A   A  1 104 ? -7.227  -20.043 -47.936 1.00 129.80 ? 208 A   A N9    1 
ATOM   2244  C  C8    . A   A  1 104 ? -7.111  -19.655 -46.626 1.00 134.80 ? 208 A   A C8    1 
ATOM   2245  N  N7    . A   A  1 104 ? -8.218  -19.838 -45.945 1.00 135.78 ? 208 A   A N7    1 
ATOM   2246  C  C5    . A   A  1 104 ? -9.105  -20.362 -46.874 1.00 137.31 ? 208 A   A C5    1 
ATOM   2247  C  C6    . A   A  1 104 ? -10.440 -20.773 -46.798 1.00 137.09 ? 208 A   A C6    1 
ATOM   2248  N  N6    . A   A  1 104 ? -11.157 -20.720 -45.677 1.00 135.67 ? 208 A   A N6    1 
ATOM   2249  N  N1    . A   A  1 104 ? -11.022 -21.247 -47.921 1.00 131.45 ? 208 A   A N1    1 
ATOM   2250  C  C2    . A   A  1 104 ? -10.311 -21.303 -49.049 1.00 132.24 ? 208 A   A C2    1 
ATOM   2251  N  N3    . A   A  1 104 ? -9.048  -20.939 -49.234 1.00 131.85 ? 208 A   A N3    1 
ATOM   2252  C  C4    . A   A  1 104 ? -8.508  -20.471 -48.102 1.00 130.47 ? 208 A   A C4    1 
ATOM   2253  P  P     . G   A  1 105 ? -5.938  -15.389 -50.229 1.00 134.11 ? 209 G   A P     1 
ATOM   2254  O  OP1   . G   A  1 105 ? -5.824  -14.811 -51.575 1.00 136.11 ? 209 G   A OP1   1 
ATOM   2255  O  OP2   . G   A  1 105 ? -5.331  -14.752 -49.035 1.00 132.72 ? 209 G   A OP2   1 
ATOM   2256  O  "O5'" . G   A  1 105 ? -7.484  -15.634 -49.975 1.00 134.29 ? 209 G   A "O5'" 1 
ATOM   2257  C  "C5'" . G   A  1 105 ? -8.357  -15.830 -51.065 1.00 135.96 ? 209 G   A "C5'" 1 
ATOM   2258  C  "C4'" . G   A  1 105 ? -9.731  -16.212 -50.608 1.00 135.86 ? 209 G   A "C4'" 1 
ATOM   2259  O  "O4'" . G   A  1 105 ? -9.628  -17.351 -49.724 1.00 134.32 ? 209 G   A "O4'" 1 
ATOM   2260  C  "C3'" . G   A  1 105 ? -10.509 -15.213 -49.783 1.00 167.72 ? 209 G   A "C3'" 1 
ATOM   2261  O  "O3'" . G   A  1 105 ? -11.076 -14.157 -50.540 1.00 160.32 ? 209 G   A "O3'" 1 
ATOM   2262  C  "C2'" . G   A  1 105 ? -11.531 -16.117 -49.109 1.00 134.99 ? 209 G   A "C2'" 1 
ATOM   2263  O  "O2'" . G   A  1 105 ? -12.478 -16.575 -50.059 1.00 136.52 ? 209 G   A "O2'" 1 
ATOM   2264  C  "C1'" . G   A  1 105 ? -10.666 -17.311 -48.767 1.00 133.64 ? 209 G   A "C1'" 1 
ATOM   2265  N  N9    . G   A  1 105 ? -10.092 -17.246 -47.402 1.00 131.77 ? 209 G   A N9    1 
ATOM   2266  C  C8    . G   A  1 105 ? -8.801  -16.922 -47.041 1.00 131.60 ? 209 G   A C8    1 
ATOM   2267  N  N7    . G   A  1 105 ? -8.581  -16.966 -45.754 1.00 129.29 ? 209 G   A N7    1 
ATOM   2268  C  C5    . G   A  1 105 ? -9.795  -17.343 -45.225 1.00 129.20 ? 209 G   A C5    1 
ATOM   2269  C  C6    . G   A  1 105 ? -10.148 -17.543 -43.880 1.00 127.94 ? 209 G   A C6    1 
ATOM   2270  O  O6    . G   A  1 105 ? -9.429  -17.413 -42.887 1.00 126.63 ? 209 G   A O6    1 
ATOM   2271  N  N1    . G   A  1 105 ? -11.479 -17.921 -43.756 1.00 128.45 ? 209 G   A N1    1 
ATOM   2272  C  C2    . G   A  1 105 ? -12.357 -18.082 -44.799 1.00 129.98 ? 209 G   A C2    1 
ATOM   2273  N  N2    . G   A  1 105 ? -13.612 -18.458 -44.490 1.00 130.35 ? 209 G   A N2    1 
ATOM   2274  N  N3    . G   A  1 105 ? -12.026 -17.893 -46.067 1.00 131.16 ? 209 G   A N3    1 
ATOM   2275  C  C4    . G   A  1 105 ? -10.738 -17.523 -46.212 1.00 130.70 ? 209 G   A C4    1 
ATOM   2276  P  P     . G   A  1 106 ? -11.102 -12.646 -49.972 1.00 137.28 ? 210 G   A P     1 
ATOM   2277  O  OP1   . G   A  1 106 ? -11.285 -11.810 -51.181 1.00 139.35 ? 210 G   A OP1   1 
ATOM   2278  O  OP2   . G   A  1 106 ? -9.947  -12.356 -49.094 1.00 135.74 ? 210 G   A OP2   1 
ATOM   2279  O  "O5'" . G   A  1 106 ? -12.408 -12.613 -49.064 1.00 136.78 ? 210 G   A "O5'" 1 
ATOM   2280  C  "C5'" . G   A  1 106 ? -13.654 -13.030 -49.594 1.00 137.97 ? 210 G   A "C5'" 1 
ATOM   2281  C  "C4'" . G   A  1 106 ? -14.544 -13.619 -48.535 1.00 136.94 ? 210 G   A "C4'" 1 
ATOM   2282  O  "O4'" . G   A  1 106 ? -13.832 -14.682 -47.866 1.00 135.34 ? 210 G   A "O4'" 1 
ATOM   2283  C  "C3'" . G   A  1 106 ? -14.956 -12.705 -47.402 1.00 136.11 ? 210 G   A "C3'" 1 
ATOM   2284  O  "O3'" . G   A  1 106 ? -16.040 -11.860 -47.708 1.00 137.41 ? 210 G   A "O3'" 1 
ATOM   2285  C  "C2'" . G   A  1 106 ? -15.266 -13.686 -46.283 1.00 134.67 ? 210 G   A "C2'" 1 
ATOM   2286  O  "O2'" . G   A  1 106 ? -16.521 -14.304 -46.502 1.00 135.56 ? 210 G   A "O2'" 1 
ATOM   2287  C  "C1'" . G   A  1 106 ? -14.204 -14.738 -46.508 1.00 133.96 ? 210 G   A "C1'" 1 
ATOM   2288  N  N9    . G   A  1 106 ? -13.011 -14.527 -45.674 1.00 132.38 ? 210 G   A N9    1 
ATOM   2289  C  C8    . G   A  1 106 ? -11.762 -14.121 -46.077 1.00 132.29 ? 210 G   A C8    1 
ATOM   2290  N  N7    . G   A  1 106 ? -10.904 -14.063 -45.096 1.00 130.77 ? 210 G   A N7    1 
ATOM   2291  C  C5    . G   A  1 106 ? -11.627 -14.458 -43.986 1.00 129.81 ? 210 G   A C5    1 
ATOM   2292  C  C6    . G   A  1 106 ? -11.214 -14.582 -42.643 1.00 128.58 ? 210 G   A C6    1 
ATOM   2293  O  O6    . G   A  1 106 ? -10.096 -14.363 -42.158 1.00 128.63 ? 210 G   A O6    1 
ATOM   2294  N  N1    . G   A  1 106 ? -12.275 -15.005 -41.852 1.00 127.84 ? 210 G   A N1    1 
ATOM   2295  C  C2    . G   A  1 106 ? -13.551 -15.278 -42.286 1.00 128.93 ? 210 G   A C2    1 
ATOM   2296  N  N2    . G   A  1 106 ? -14.425 -15.672 -41.348 1.00 128.48 ? 210 G   A N2    1 
ATOM   2297  N  N3    . G   A  1 106 ? -13.942 -15.165 -43.541 1.00 130.46 ? 210 G   A N3    1 
ATOM   2298  C  C4    . G   A  1 106 ? -12.929 -14.751 -44.325 1.00 130.80 ? 210 G   A C4    1 
ATOM   2299  P  P     . U   A  1 107 ? -16.065 -10.398 -47.065 1.00 137.10 ? 211 U   A P     1 
ATOM   2300  O  OP1   . U   A  1 107 ? -17.366 -9.799  -47.441 1.00 147.51 ? 211 U   A OP1   1 
ATOM   2301  O  OP2   . U   A  1 107 ? -14.774 -9.714  -47.341 1.00 136.94 ? 211 U   A OP2   1 
ATOM   2302  O  "O5'" . U   A  1 107 ? -16.071 -10.662 -45.497 1.00 135.14 ? 211 U   A "O5'" 1 
ATOM   2303  C  "C5'" . U   A  1 107 ? -17.159 -11.310 -44.861 1.00 134.90 ? 211 U   A "C5'" 1 
ATOM   2304  C  "C4'" . U   A  1 107 ? -16.823 -11.687 -43.439 1.00 133.01 ? 211 U   A "C4'" 1 
ATOM   2305  O  "O4'" . U   A  1 107 ? -15.564 -12.404 -43.402 1.00 132.01 ? 211 U   A "O4'" 1 
ATOM   2306  C  "C3'" . U   A  1 107 ? -16.610 -10.552 -42.451 1.00 148.68 ? 211 U   A "C3'" 1 
ATOM   2307  O  "O3'" . U   A  1 107 ? -17.831 -9.973  -41.998 1.00 150.68 ? 211 U   A "O3'" 1 
ATOM   2308  C  "C2'" . U   A  1 107 ? -15.788 -11.228 -41.354 1.00 137.49 ? 211 U   A "C2'" 1 
ATOM   2309  O  "O2'" . U   A  1 107 ? -16.629 -12.053 -40.566 1.00 129.86 ? 211 U   A "O2'" 1 
ATOM   2310  C  "C1'" . U   A  1 107 ? -14.916 -12.175 -42.167 1.00 133.00 ? 211 U   A "C1'" 1 
ATOM   2311  N  N1    . U   A  1 107 ? -13.503 -11.750 -42.387 1.00 135.76 ? 211 U   A N1    1 
ATOM   2312  C  C2    . U   A  1 107 ? -12.580 -11.909 -41.356 1.00 134.04 ? 211 U   A C2    1 
ATOM   2313  O  O2    . U   A  1 107 ? -12.874 -12.306 -40.246 1.00 133.59 ? 211 U   A O2    1 
ATOM   2314  N  N3    . U   A  1 107 ? -11.284 -11.559 -41.645 1.00 135.63 ? 211 U   A N3    1 
ATOM   2315  C  C4    . U   A  1 107 ? -10.802 -11.094 -42.851 1.00 142.88 ? 211 U   A C4    1 
ATOM   2316  O  O4    . U   A  1 107 ? -9.603  -10.821 -42.958 1.00 143.61 ? 211 U   A O4    1 
ATOM   2317  C  C5    . U   A  1 107 ? -11.796 -10.976 -43.879 1.00 145.96 ? 211 U   A C5    1 
ATOM   2318  C  C6    . U   A  1 107 ? -13.070 -11.314 -43.622 1.00 141.64 ? 211 U   A C6    1 
ATOM   2319  P  P     . C   A  1 108 ? -17.986 -8.376  -41.784 1.00 138.50 ? 212 C   A P     1 
ATOM   2320  O  OP1   . C   A  1 108 ? -19.395 -8.009  -42.035 1.00 133.94 ? 212 C   A OP1   1 
ATOM   2321  O  OP2   . C   A  1 108 ? -16.896 -7.653  -42.476 1.00 132.99 ? 212 C   A OP2   1 
ATOM   2322  O  "O5'" . C   A  1 108 ? -17.699 -8.188  -40.242 1.00 130.95 ? 212 C   A "O5'" 1 
ATOM   2323  C  "C5'" . C   A  1 108 ? -18.517 -8.828  -39.284 1.00 130.38 ? 212 C   A "C5'" 1 
ATOM   2324  C  "C4'" . C   A  1 108 ? -17.789 -8.847  -37.983 1.00 128.69 ? 212 C   A "C4'" 1 
ATOM   2325  O  "O4'" . C   A  1 108 ? -16.541 -9.541  -38.192 1.00 128.02 ? 212 C   A "O4'" 1 
ATOM   2326  C  "C3'" . C   A  1 108 ? -17.375 -7.487  -37.462 1.00 147.22 ? 212 C   A "C3'" 1 
ATOM   2327  O  "O3'" . C   A  1 108 ? -18.405 -6.859  -36.707 1.00 153.01 ? 212 C   A "O3'" 1 
ATOM   2328  C  "C2'" . C   A  1 108 ? -16.134 -7.809  -36.632 1.00 126.66 ? 212 C   A "C2'" 1 
ATOM   2329  O  "O2'" . C   A  1 108 ? -16.518 -8.305  -35.364 1.00 125.70 ? 212 C   A "O2'" 1 
ATOM   2330  C  "C1'" . C   A  1 108 ? -15.531 -8.979  -37.400 1.00 126.82 ? 212 C   A "C1'" 1 
ATOM   2331  N  N1    . C   A  1 108 ? -14.387 -8.633  -38.267 1.00 127.09 ? 212 C   A N1    1 
ATOM   2332  C  C2    . C   A  1 108 ? -13.103 -8.736  -37.730 1.00 129.26 ? 212 C   A C2    1 
ATOM   2333  O  O2    . C   A  1 108 ? -12.978 -9.072  -36.549 1.00 130.43 ? 212 C   A O2    1 
ATOM   2334  N  N3    . C   A  1 108 ? -12.032 -8.464  -38.497 1.00 130.00 ? 212 C   A N3    1 
ATOM   2335  C  C4    . C   A  1 108 ? -12.218 -8.109  -39.767 1.00 132.60 ? 212 C   A C4    1 
ATOM   2336  N  N4    . C   A  1 108 ? -11.127 -7.839  -40.489 1.00 129.82 ? 212 C   A N4    1 
ATOM   2337  C  C5    . C   A  1 108 ? -13.517 -8.011  -40.348 1.00 132.56 ? 212 C   A C5    1 
ATOM   2338  C  C6    . C   A  1 108 ? -14.568 -8.289  -39.572 1.00 128.52 ? 212 C   A C6    1 
ATOM   2339  P  P     . A   A  1 109 ? -18.939 -5.372  -37.025 1.00 128.99 ? 213 A   A P     1 
ATOM   2340  O  OP1   . A   A  1 109 ? -20.390 -5.327  -36.734 1.00 129.86 ? 213 A   A OP1   1 
ATOM   2341  O  OP2   . A   A  1 109 ? -18.445 -4.841  -38.314 1.00 130.06 ? 213 A   A OP2   1 
ATOM   2342  O  "O5'" . A   A  1 109 ? -18.157 -4.518  -35.960 1.00 127.67 ? 213 A   A "O5'" 1 
ATOM   2343  C  "C5'" . A   A  1 109 ? -16.924 -3.998  -36.387 1.00 127.51 ? 213 A   A "C5'" 1 
ATOM   2344  C  "C4'" . A   A  1 109 ? -15.920 -3.871  -35.292 1.00 126.03 ? 213 A   A "C4'" 1 
ATOM   2345  O  "O4'" . A   A  1 109 ? -14.632 -4.196  -35.836 1.00 125.88 ? 213 A   A "O4'" 1 
ATOM   2346  C  "C3'" . A   A  1 109 ? -15.783 -2.457  -34.753 1.00 143.37 ? 213 A   A "C3'" 1 
ATOM   2347  O  "O3'" . A   A  1 109 ? -16.681 -2.262  -33.663 1.00 140.75 ? 213 A   A "O3'" 1 
ATOM   2348  C  "C2'" . A   A  1 109 ? -14.310 -2.348  -34.362 1.00 141.40 ? 213 A   A "C2'" 1 
ATOM   2349  O  "O2'" . A   A  1 109 ? -14.131 -2.676  -32.996 1.00 139.28 ? 213 A   A "O2'" 1 
ATOM   2350  C  "C1'" . A   A  1 109 ? -13.634 -3.396  -35.251 1.00 144.25 ? 213 A   A "C1'" 1 
ATOM   2351  N  N9    . A   A  1 109 ? -12.792 -2.860  -36.337 1.00 146.54 ? 213 A   A N9    1 
ATOM   2352  C  C8    . A   A  1 109 ? -13.217 -2.425  -37.564 1.00 151.21 ? 213 A   A C8    1 
ATOM   2353  N  N7    . A   A  1 109 ? -12.235 -2.004  -38.326 1.00 150.21 ? 213 A   A N7    1 
ATOM   2354  C  C5    . A   A  1 109 ? -11.089 -2.171  -37.552 1.00 142.42 ? 213 A   A C5    1 
ATOM   2355  C  C6    . A   A  1 109 ? -9.727  -1.930  -37.792 1.00 133.64 ? 213 A   A C6    1 
ATOM   2356  N  N6    . A   A  1 109 ? -9.263  -1.438  -38.925 1.00 131.34 ? 213 A   A N6    1 
ATOM   2357  N  N1    . A   A  1 109 ? -8.839  -2.197  -36.823 1.00 125.44 ? 213 A   A N1    1 
ATOM   2358  C  C2    . A   A  1 109 ? -9.301  -2.698  -35.675 1.00 143.87 ? 213 A   A C2    1 
ATOM   2359  N  N3    . A   A  1 109 ? -10.556 -2.991  -35.331 1.00 142.86 ? 213 A   A N3    1 
ATOM   2360  C  C4    . A   A  1 109 ? -11.420 -2.681  -36.315 1.00 144.23 ? 213 A   A C4    1 
ATOM   2361  P  P     . A   A  1 110 ? -16.698 -0.892  -32.839 1.00 124.68 ? 214 A   A P     1 
ATOM   2362  O  OP1   . A   A  1 110 ? -17.566 -1.003  -31.639 1.00 125.83 ? 214 A   A OP1   1 
ATOM   2363  O  OP2   . A   A  1 110 ? -16.908 0.159   -33.861 1.00 148.63 ? 214 A   A OP2   1 
ATOM   2364  O  "O5'" . A   A  1 110 ? -15.220 -0.764  -32.293 1.00 123.61 ? 214 A   A "O5'" 1 
ATOM   2365  C  "C5'" . A   A  1 110 ? -14.909 -0.095  -31.092 1.00 125.19 ? 214 A   A "C5'" 1 
ATOM   2366  C  "C4'" . A   A  1 110 ? -14.690 -0.978  -29.899 1.00 121.44 ? 214 A   A "C4'" 1 
ATOM   2367  O  "O4'" . A   A  1 110 ? -14.168 -2.268  -30.306 1.00 121.37 ? 214 A   A "O4'" 1 
ATOM   2368  C  "C3'" . A   A  1 110 ? -13.595 -0.425  -29.015 1.00 130.00 ? 214 A   A "C3'" 1 
ATOM   2369  O  "O3'" . A   A  1 110 ? -13.967 0.679   -28.218 1.00 125.96 ? 214 A   A "O3'" 1 
ATOM   2370  C  "C2'" . A   A  1 110 ? -13.089 -1.658  -28.286 1.00 119.59 ? 214 A   A "C2'" 1 
ATOM   2371  O  "O2'" . A   A  1 110 ? -13.988 -2.049  -27.265 1.00 119.18 ? 214 A   A "O2'" 1 
ATOM   2372  C  "C1'" . A   A  1 110 ? -13.166 -2.690  -29.401 1.00 120.26 ? 214 A   A "C1'" 1 
ATOM   2373  N  N9    . A   A  1 110 ? -11.909 -2.733  -30.150 1.00 120.36 ? 214 A   A N9    1 
ATOM   2374  C  C8    . A   A  1 110 ? -11.776 -2.673  -31.506 1.00 121.37 ? 214 A   A C8    1 
ATOM   2375  N  N7    . A   A  1 110 ? -10.552 -2.740  -31.933 1.00 121.33 ? 214 A   A N7    1 
ATOM   2376  C  C5    . A   A  1 110 ? -9.826  -2.845  -30.773 1.00 124.18 ? 214 A   A C5    1 
ATOM   2377  C  C6    . A   A  1 110 ? -8.453  -2.946  -30.574 1.00 126.48 ? 214 A   A C6    1 
ATOM   2378  N  N6    . A   A  1 110 ? -7.578  -2.954  -31.585 1.00 124.45 ? 214 A   A N6    1 
ATOM   2379  N  N1    . A   A  1 110 ? -8.028  -3.037  -29.294 1.00 132.23 ? 214 A   A N1    1 
ATOM   2380  C  C2    . A   A  1 110 ? -8.930  -3.027  -28.297 1.00 134.14 ? 214 A   A C2    1 
ATOM   2381  N  N3    . A   A  1 110 ? -10.256 -2.934  -28.378 1.00 128.64 ? 214 A   A N3    1 
ATOM   2382  C  C4    . A   A  1 110 ? -10.642 -2.850  -29.660 1.00 123.63 ? 214 A   A C4    1 
ATOM   2383  P  P     . A   A  1 111 ? -13.135 2.030   -28.441 1.00 122.43 ? 215 A   A P     1 
ATOM   2384  O  OP1   . A   A  1 111 ? -13.718 3.102   -27.603 1.00 122.61 ? 215 A   A OP1   1 
ATOM   2385  O  OP2   . A   A  1 111 ? -12.883 2.214   -29.888 1.00 121.35 ? 215 A   A OP2   1 
ATOM   2386  O  "O5'" . A   A  1 111 ? -11.707 1.700   -27.873 1.00 119.40 ? 215 A   A "O5'" 1 
ATOM   2387  C  "C5'" . A   A  1 111 ? -10.755 2.725   -27.740 1.00 119.27 ? 215 A   A "C5'" 1 
ATOM   2388  C  "C4'" . A   A  1 111 ? -9.429  2.106   -27.986 1.00 119.08 ? 215 A   A "C4'" 1 
ATOM   2389  O  "O4'" . A   A  1 111 ? -9.619  1.006   -28.893 1.00 119.56 ? 215 A   A "O4'" 1 
ATOM   2390  C  "C3'" . A   A  1 111 ? -8.372  2.954   -28.648 1.00 126.46 ? 215 A   A "C3'" 1 
ATOM   2391  O  "O3'" . A   A  1 111 ? -7.688  3.749   -27.723 1.00 127.71 ? 215 A   A "O3'" 1 
ATOM   2392  C  "C2'" . A   A  1 111 ? -7.481  1.929   -29.322 1.00 126.59 ? 215 A   A "C2'" 1 
ATOM   2393  O  "O2'" . A   A  1 111 ? -6.559  1.398   -28.392 1.00 132.36 ? 215 A   A "O2'" 1 
ATOM   2394  C  "C1'" . A   A  1 111 ? -8.482  0.845   -29.700 1.00 122.30 ? 215 A   A "C1'" 1 
ATOM   2395  N  N9    . A   A  1 111 ? -8.891  0.912   -31.098 1.00 121.31 ? 215 A   A N9    1 
ATOM   2396  C  C8    . A   A  1 111 ? -10.179 0.884   -31.556 1.00 121.79 ? 215 A   A C8    1 
ATOM   2397  N  N7    . A   A  1 111 ? -10.251 0.946   -32.854 1.00 122.96 ? 215 A   A N7    1 
ATOM   2398  C  C5    . A   A  1 111 ? -8.929  1.019   -33.245 1.00 123.07 ? 215 A   A C5    1 
ATOM   2399  C  C6    . A   A  1 111 ? -8.361  1.112   -34.504 1.00 124.19 ? 215 A   A C6    1 
ATOM   2400  N  N6    . A   A  1 111 ? -9.122  1.139   -35.596 1.00 125.40 ? 215 A   A N6    1 
ATOM   2401  N  N1    . A   A  1 111 ? -7.011  1.180   -34.583 1.00 124.11 ? 215 A   A N1    1 
ATOM   2402  C  C2    . A   A  1 111 ? -6.286  1.158   -33.456 1.00 122.96 ? 215 A   A C2    1 
ATOM   2403  N  N3    . A   A  1 111 ? -6.721  1.068   -32.205 1.00 121.84 ? 215 A   A N3    1 
ATOM   2404  C  C4    . A   A  1 111 ? -8.066  1.022   -32.177 1.00 121.98 ? 215 A   A C4    1 
ATOM   2405  P  P     . A   A  1 112 ? -7.158  5.169   -28.193 1.00 134.99 ? 216 A   A P     1 
ATOM   2406  O  OP1   . A   A  1 112 ? -6.090  5.607   -27.257 1.00 140.92 ? 216 A   A OP1   1 
ATOM   2407  O  OP2   . A   A  1 112 ? -8.392  5.980   -28.366 1.00 129.95 ? 216 A   A OP2   1 
ATOM   2408  O  "O5'" . A   A  1 112 ? -6.535  4.884   -29.635 1.00 136.87 ? 216 A   A "O5'" 1 
ATOM   2409  C  "C5'" . A   A  1 112 ? -5.192  4.411   -29.783 1.00 138.03 ? 216 A   A "C5'" 1 
ATOM   2410  C  "C4'" . A   A  1 112 ? -4.563  4.934   -31.051 1.00 138.12 ? 216 A   A "C4'" 1 
ATOM   2411  O  "O4'" . A   A  1 112 ? -5.202  4.293   -32.195 1.00 122.88 ? 216 A   A "O4'" 1 
ATOM   2412  C  "C3'" . A   A  1 112 ? -4.776  6.431   -31.219 1.00 142.72 ? 216 A   A "C3'" 1 
ATOM   2413  O  "O3'" . A   A  1 112 ? -3.668  7.083   -31.826 1.00 139.92 ? 216 A   A "O3'" 1 
ATOM   2414  C  "C2'" . A   A  1 112 ? -5.996  6.499   -32.118 1.00 151.84 ? 216 A   A "C2'" 1 
ATOM   2415  O  "O2'" . A   A  1 112 ? -6.148  7.693   -32.846 1.00 153.10 ? 216 A   A "O2'" 1 
ATOM   2416  C  "C1'" . A   A  1 112 ? -5.840  5.258   -32.998 1.00 124.02 ? 216 A   A "C1'" 1 
ATOM   2417  N  N9    . A   A  1 112 ? -7.170  4.773   -33.320 1.00 124.19 ? 216 A   A N9    1 
ATOM   2418  C  C8    . A   A  1 112 ? -8.069  4.326   -32.400 1.00 123.22 ? 216 A   A C8    1 
ATOM   2419  N  N7    . A   A  1 112 ? -9.235  4.050   -32.914 1.00 123.75 ? 216 A   A N7    1 
ATOM   2420  C  C5    . A   A  1 112 ? -9.110  4.376   -34.249 1.00 125.15 ? 216 A   A C5    1 
ATOM   2421  C  C6    . A   A  1 112 ? -10.002 4.313   -35.327 1.00 126.36 ? 216 A   A C6    1 
ATOM   2422  N  N6    . A   A  1 112 ? -11.259 3.874   -35.271 1.00 126.37 ? 216 A   A N6    1 
ATOM   2423  N  N1    . A   A  1 112 ? -9.541  4.722   -36.517 1.00 146.14 ? 216 A   A N1    1 
ATOM   2424  C  C2    . A   A  1 112 ? -8.282  5.165   -36.609 1.00 139.89 ? 216 A   A C2    1 
ATOM   2425  N  N3    . A   A  1 112 ? -7.351  5.265   -35.669 1.00 138.39 ? 216 A   A N3    1 
ATOM   2426  C  C4    . A   A  1 112 ? -7.839  4.839   -34.505 1.00 125.45 ? 216 A   A C4    1 
ATOM   2427  P  P     . C   A  1 113 ? -3.668  8.688   -31.868 1.00 134.52 ? 217 C   A P     1 
ATOM   2428  O  OP1   . C   A  1 113 ? -2.308  9.165   -31.528 1.00 137.37 ? 217 C   A OP1   1 
ATOM   2429  O  OP2   . C   A  1 113 ? -4.822  9.164   -31.054 1.00 123.70 ? 217 C   A OP2   1 
ATOM   2430  O  "O5'" . C   A  1 113 ? -3.977  8.977   -33.406 1.00 134.00 ? 217 C   A "O5'" 1 
ATOM   2431  C  "C5'" . C   A  1 113 ? -4.914  9.965   -33.795 1.00 139.88 ? 217 C   A "C5'" 1 
ATOM   2432  C  "C4'" . C   A  1 113 ? -5.428  9.756   -35.198 1.00 128.24 ? 217 C   A "C4'" 1 
ATOM   2433  O  "O4'" . C   A  1 113 ? -6.221  8.543   -35.305 1.00 127.77 ? 217 C   A "O4'" 1 
ATOM   2434  C  "C3'" . C   A  1 113 ? -6.364  10.844  -35.665 1.00 143.58 ? 217 C   A "C3'" 1 
ATOM   2435  O  "O3'" . C   A  1 113 ? -5.640  11.989  -36.050 1.00 130.27 ? 217 C   A "O3'" 1 
ATOM   2436  C  "C2'" . C   A  1 113 ? -7.165  10.163  -36.778 1.00 143.88 ? 217 C   A "C2'" 1 
ATOM   2437  O  "O2'" . C   A  1 113 ? -6.423  10.135  -37.991 1.00 131.65 ? 217 C   A "O2'" 1 
ATOM   2438  C  "C1'" . C   A  1 113 ? -7.265  8.727   -36.248 1.00 128.89 ? 217 C   A "C1'" 1 
ATOM   2439  N  N1    . C   A  1 113 ? -8.563  8.357   -35.612 1.00 128.04 ? 217 C   A N1    1 
ATOM   2440  C  C2    . C   A  1 113 ? -9.842  8.307   -36.210 1.00 138.09 ? 217 C   A C2    1 
ATOM   2441  O  O2    . C   A  1 113 ? -10.068 8.683   -37.364 1.00 142.54 ? 217 C   A O2    1 
ATOM   2442  N  N3    . C   A  1 113 ? -10.921 7.901   -35.472 1.00 136.98 ? 217 C   A N3    1 
ATOM   2443  C  C4    . C   A  1 113 ? -10.794 7.505   -34.208 1.00 135.89 ? 217 C   A C4    1 
ATOM   2444  N  N4    . C   A  1 113 ? -11.862 7.101   -33.513 1.00 125.67 ? 217 C   A N4    1 
ATOM   2445  C  C5    . C   A  1 113 ? -9.522  7.513   -33.594 1.00 132.71 ? 217 C   A C5    1 
ATOM   2446  C  C6    . C   A  1 113 ? -8.484  7.927   -34.326 1.00 128.33 ? 217 C   A C6    1 
ATOM   2447  P  P     . U   A  1 114 ? -5.803  13.336  -35.206 1.00 138.28 ? 218 U   A P     1 
ATOM   2448  O  OP1   . U   A  1 114 ? -4.832  14.290  -35.787 1.00 141.21 ? 218 U   A OP1   1 
ATOM   2449  O  OP2   . U   A  1 114 ? -5.789  13.088  -33.748 1.00 128.10 ? 218 U   A OP2   1 
ATOM   2450  O  "O5'" . U   A  1 114 ? -7.277  13.782  -35.570 1.00 138.08 ? 218 U   A "O5'" 1 
ATOM   2451  C  "C5'" . U   A  1 114 ? -7.651  13.874  -36.928 1.00 139.79 ? 218 U   A "C5'" 1 
ATOM   2452  C  "C4'" . U   A  1 114 ? -9.137  13.783  -37.104 1.00 138.64 ? 218 U   A "C4'" 1 
ATOM   2453  O  "O4'" . U   A  1 114 ? -9.604  12.474  -36.688 1.00 131.03 ? 218 U   A "O4'" 1 
ATOM   2454  C  "C3'" . U   A  1 114 ? -9.992  14.735  -36.291 1.00 140.05 ? 218 U   A "C3'" 1 
ATOM   2455  O  "O3'" . U   A  1 114 ? -9.984  16.065  -36.788 1.00 146.58 ? 218 U   A "O3'" 1 
ATOM   2456  C  "C2'" . U   A  1 114 ? -11.349 14.041  -36.347 1.00 137.34 ? 218 U   A "C2'" 1 
ATOM   2457  O  "O2'" . U   A  1 114 ? -11.943 14.187  -37.629 1.00 132.99 ? 218 U   A "O2'" 1 
ATOM   2458  C  "C1'" . U   A  1 114 ? -10.929 12.577  -36.210 1.00 130.52 ? 218 U   A "C1'" 1 
ATOM   2459  N  N1    . U   A  1 114 ? -10.981 12.113  -34.807 1.00 128.68 ? 218 U   A N1    1 
ATOM   2460  C  C2    . U   A  1 114 ? -12.220 11.749  -34.321 1.00 128.08 ? 218 U   A C2    1 
ATOM   2461  O  O2    . U   A  1 114 ? -13.225 11.796  -34.995 1.00 128.97 ? 218 U   A O2    1 
ATOM   2462  N  N3    . U   A  1 114 ? -12.242 11.338  -33.015 1.00 126.51 ? 218 U   A N3    1 
ATOM   2463  C  C4    . U   A  1 114 ? -11.162 11.252  -32.161 1.00 125.71 ? 218 U   A C4    1 
ATOM   2464  O  O4    . U   A  1 114 ? -11.332 10.860  -31.007 1.00 124.20 ? 218 U   A O4    1 
ATOM   2465  C  C5    . U   A  1 114 ? -9.911  11.644  -32.737 1.00 126.18 ? 218 U   A C5    1 
ATOM   2466  C  C6    . U   A  1 114 ? -9.862  12.051  -34.011 1.00 127.72 ? 218 U   A C6    1 
ATOM   2467  P  P     . C   A  1 115 ? -10.006 17.329  -35.793 1.00 132.04 ? 219 C   A P     1 
ATOM   2468  O  OP1   . C   A  1 115 ? -9.306  18.380  -36.562 1.00 133.58 ? 219 C   A OP1   1 
ATOM   2469  O  OP2   . C   A  1 115 ? -9.550  16.973  -34.423 1.00 130.21 ? 219 C   A OP2   1 
ATOM   2470  O  "O5'" . C   A  1 115 ? -11.552 17.672  -35.662 1.00 131.93 ? 219 C   A "O5'" 1 
ATOM   2471  C  "C5'" . C   A  1 115 ? -12.366 17.765  -36.817 1.00 133.45 ? 219 C   A "C5'" 1 
ATOM   2472  C  "C4'" . C   A  1 115 ? -13.825 17.601  -36.482 1.00 132.96 ? 219 C   A "C4'" 1 
ATOM   2473  O  "O4'" . C   A  1 115 ? -14.104 16.222  -36.134 1.00 132.00 ? 219 C   A "O4'" 1 
ATOM   2474  C  "C3'" . C   A  1 115 ? -14.351 18.380  -35.289 1.00 139.85 ? 219 C   A "C3'" 1 
ATOM   2475  O  "O3'" . C   A  1 115 ? -14.581 19.749  -35.542 1.00 140.35 ? 219 C   A "O3'" 1 
ATOM   2476  C  "C2'" . C   A  1 115 ? -15.601 17.598  -34.914 1.00 131.07 ? 219 C   A "C2'" 1 
ATOM   2477  O  "O2'" . C   A  1 115 ? -16.673 17.879  -35.798 1.00 132.39 ? 219 C   A "O2'" 1 
ATOM   2478  C  "C1'" . C   A  1 115 ? -15.137 16.169  -35.167 1.00 132.97 ? 219 C   A "C1'" 1 
ATOM   2479  N  N1    . C   A  1 115 ? -14.626 15.551  -33.920 1.00 129.10 ? 219 C   A N1    1 
ATOM   2480  C  C2    . C   A  1 115 ? -15.552 15.001  -33.029 1.00 128.01 ? 219 C   A C2    1 
ATOM   2481  O  O2    . C   A  1 115 ? -16.751 15.047  -33.326 1.00 137.11 ? 219 C   A O2    1 
ATOM   2482  N  N3    . C   A  1 115 ? -15.123 14.444  -31.880 1.00 126.53 ? 219 C   A N3    1 
ATOM   2483  C  C4    . C   A  1 115 ? -13.819 14.431  -31.607 1.00 126.08 ? 219 C   A C4    1 
ATOM   2484  N  N4    . C   A  1 115 ? -13.450 13.880  -30.454 1.00 124.69 ? 219 C   A N4    1 
ATOM   2485  C  C5    . C   A  1 115 ? -12.850 14.986  -32.482 1.00 127.15 ? 219 C   A C5    1 
ATOM   2486  C  C6    . C   A  1 115 ? -13.294 15.533  -33.619 1.00 128.65 ? 219 C   A C6    1 
ATOM   2487  P  P     . C   A  1 116 ? -14.422 20.808  -34.352 1.00 131.45 ? 220 C   A P     1 
ATOM   2488  O  OP1   . C   A  1 116 ? -15.374 21.870  -34.716 1.00 132.32 ? 220 C   A OP1   1 
ATOM   2489  O  OP2   . C   A  1 116 ? -13.006 21.230  -34.182 1.00 131.44 ? 220 C   A OP2   1 
ATOM   2490  O  "O5'" . C   A  1 116 ? -14.939 20.004  -33.067 1.00 129.57 ? 220 C   A "O5'" 1 
ATOM   2491  C  "C5'" . C   A  1 116 ? -15.850 20.593  -32.153 1.00 128.69 ? 220 C   A "C5'" 1 
ATOM   2492  C  "C4'" . C   A  1 116 ? -17.200 19.913  -32.142 1.00 128.57 ? 220 C   A "C4'" 1 
ATOM   2493  O  "O4'" . C   A  1 116 ? -17.050 18.484  -32.351 1.00 128.40 ? 220 C   A "O4'" 1 
ATOM   2494  C  "C3'" . C   A  1 116 ? -17.961 20.010  -30.828 1.00 128.02 ? 220 C   A "C3'" 1 
ATOM   2495  O  "O3'" . C   A  1 116 ? -18.634 21.238  -30.661 1.00 130.77 ? 220 C   A "O3'" 1 
ATOM   2496  C  "C2'" . C   A  1 116 ? -18.887 18.807  -30.894 1.00 135.72 ? 220 C   A "C2'" 1 
ATOM   2497  O  "O2'" . C   A  1 116 ? -19.953 19.047  -31.795 1.00 141.81 ? 220 C   A "O2'" 1 
ATOM   2498  C  "C1'" . C   A  1 116 ? -17.970 17.777  -31.534 1.00 140.01 ? 220 C   A "C1'" 1 
ATOM   2499  N  N1    . C   A  1 116 ? -17.199 17.015  -30.526 1.00 139.29 ? 220 C   A N1    1 
ATOM   2500  C  C2    . C   A  1 116 ? -17.750 16.177  -29.524 1.00 134.62 ? 220 C   A C2    1 
ATOM   2501  O  O2    . C   A  1 116 ? -18.981 16.049  -29.388 1.00 132.49 ? 220 C   A O2    1 
ATOM   2502  N  N3    . C   A  1 116 ? -16.884 15.528  -28.688 1.00 132.44 ? 220 C   A N3    1 
ATOM   2503  C  C4    . C   A  1 116 ? -15.566 15.670  -28.824 1.00 131.78 ? 220 C   A C4    1 
ATOM   2504  N  N4    . C   A  1 116 ? -14.727 15.046  -28.004 1.00 122.68 ? 220 C   A N4    1 
ATOM   2505  C  C5    . C   A  1 116 ? -15.012 16.510  -29.814 1.00 136.54 ? 220 C   A C5    1 
ATOM   2506  C  C6    . C   A  1 116 ? -15.848 17.132  -30.639 1.00 139.20 ? 220 C   A C6    1 
ATOM   2507  P  P     . C   A  1 117 ? -18.472 22.045  -29.291 1.00 125.97 ? 221 C   A P     1 
ATOM   2508  O  OP1   . C   A  1 117 ? -19.005 23.397  -29.500 1.00 130.72 ? 221 C   A OP1   1 
ATOM   2509  O  OP2   . C   A  1 117 ? -17.082 21.855  -28.832 1.00 133.10 ? 221 C   A OP2   1 
ATOM   2510  O  "O5'" . C   A  1 117 ? -19.490 21.342  -28.301 1.00 128.12 ? 221 C   A "O5'" 1 
ATOM   2511  C  "C5'" . C   A  1 117 ? -20.833 21.139  -28.705 1.00 126.46 ? 221 C   A "C5'" 1 
ATOM   2512  C  "C4'" . C   A  1 117 ? -21.583 20.287  -27.717 1.00 129.09 ? 221 C   A "C4'" 1 
ATOM   2513  O  "O4'" . C   A  1 117 ? -21.161 18.904  -27.856 1.00 124.31 ? 221 C   A "O4'" 1 
ATOM   2514  C  "C3'" . C   A  1 117 ? -21.334 20.572  -26.247 1.00 129.96 ? 221 C   A "C3'" 1 
ATOM   2515  O  "O3'" . C   A  1 117 ? -21.989 21.704  -25.727 1.00 123.77 ? 221 C   A "O3'" 1 
ATOM   2516  C  "C2'" . C   A  1 117 ? -21.750 19.268  -25.599 1.00 132.11 ? 221 C   A "C2'" 1 
ATOM   2517  O  "O2'" . C   A  1 117 ? -23.161 19.128  -25.614 1.00 131.00 ? 221 C   A "O2'" 1 
ATOM   2518  C  "C1'" . C   A  1 117 ? -21.176 18.275  -26.593 1.00 122.99 ? 221 C   A "C1'" 1 
ATOM   2519  N  N1    . C   A  1 117 ? -19.795 17.921  -26.238 1.00 127.42 ? 221 C   A N1    1 
ATOM   2520  C  C2    . C   A  1 117 ? -19.623 17.175  -25.075 1.00 144.81 ? 221 C   A C2    1 
ATOM   2521  O  O2    . C   A  1 117 ? -20.616 16.854  -24.400 1.00 155.47 ? 221 C   A O2    1 
ATOM   2522  N  N3    . C   A  1 117 ? -18.379 16.805  -24.706 1.00 144.57 ? 221 C   A N3    1 
ATOM   2523  C  C4    . C   A  1 117 ? -17.338 17.148  -25.455 1.00 138.37 ? 221 C   A C4    1 
ATOM   2524  N  N4    . C   A  1 117 ? -16.133 16.772  -25.016 1.00 139.07 ? 221 C   A N4    1 
ATOM   2525  C  C5    . C   A  1 117 ? -17.489 17.927  -26.642 1.00 132.08 ? 221 C   A C5    1 
ATOM   2526  C  C6    . C   A  1 117 ? -18.728 18.284  -27.005 1.00 122.89 ? 221 C   A C6    1 
ATOM   2527  P  P     . G   A  1 118 ? -21.204 22.619  -24.679 1.00 121.65 ? 222 G   A P     1 
ATOM   2528  O  OP1   . G   A  1 118 ? -22.194 23.575  -24.187 1.00 121.45 ? 222 G   A OP1   1 
ATOM   2529  O  OP2   . G   A  1 118 ? -19.895 22.976  -25.262 1.00 122.07 ? 222 G   A OP2   1 
ATOM   2530  O  "O5'" . G   A  1 118 ? -20.889 21.704  -23.421 1.00 120.34 ? 222 G   A "O5'" 1 
ATOM   2531  C  "C5'" . G   A  1 118 ? -21.929 21.177  -22.609 1.00 119.79 ? 222 G   A "C5'" 1 
ATOM   2532  C  "C4'" . G   A  1 118 ? -21.382 20.298  -21.506 1.00 118.72 ? 222 G   A "C4'" 1 
ATOM   2533  O  "O4'" . G   A  1 118 ? -20.689 19.174  -22.102 1.00 119.00 ? 222 G   A "O4'" 1 
ATOM   2534  C  "C3'" . G   A  1 118 ? -20.341 20.919  -20.588 1.00 123.20 ? 222 G   A "C3'" 1 
ATOM   2535  O  "O3'" . G   A  1 118 ? -20.908 21.697  -19.550 1.00 120.96 ? 222 G   A "O3'" 1 
ATOM   2536  C  "C2'" . G   A  1 118 ? -19.579 19.704  -20.082 1.00 117.25 ? 222 G   A "C2'" 1 
ATOM   2537  O  "O2'" . G   A  1 118 ? -20.313 19.013  -19.083 1.00 116.65 ? 222 G   A "O2'" 1 
ATOM   2538  C  "C1'" . G   A  1 118 ? -19.574 18.828  -21.316 1.00 118.14 ? 222 G   A "C1'" 1 
ATOM   2539  N  N9    . G   A  1 118 ? -18.381 19.000  -22.137 1.00 118.60 ? 222 G   A N9    1 
ATOM   2540  C  C8    . G   A  1 118 ? -18.391 19.359  -23.443 1.00 119.73 ? 222 G   A C8    1 
ATOM   2541  N  N7    . G   A  1 118 ? -17.198 19.390  -23.948 1.00 120.02 ? 222 G   A N7    1 
ATOM   2542  C  C5    . G   A  1 118 ? -16.368 19.018  -22.926 1.00 119.02 ? 222 G   A C5    1 
ATOM   2543  C  C6    . G   A  1 118 ? -14.971 18.892  -22.926 1.00 118.91 ? 222 G   A C6    1 
ATOM   2544  O  O6    . G   A  1 118 ? -14.173 19.086  -23.847 1.00 119.70 ? 222 G   A O6    1 
ATOM   2545  N  N1    . G   A  1 118 ? -14.529 18.502  -21.680 1.00 117.82 ? 222 G   A N1    1 
ATOM   2546  C  C2    . G   A  1 118 ? -15.333 18.260  -20.597 1.00 122.73 ? 222 G   A C2    1 
ATOM   2547  N  N2    . G   A  1 118 ? -14.693 17.883  -19.484 1.00 123.80 ? 222 G   A N2    1 
ATOM   2548  N  N3    . G   A  1 118 ? -16.647 18.389  -20.592 1.00 117.13 ? 222 G   A N3    1 
ATOM   2549  C  C4    . G   A  1 118 ? -17.088 18.767  -21.794 1.00 118.14 ? 222 G   A C4    1 
ATOM   2550  P  P     . U   A  1 119 ? -20.337 23.155  -19.236 1.00 116.87 ? 223 U   A P     1 
ATOM   2551  O  OP1   . U   A  1 119 ? -21.234 23.688  -18.190 1.00 116.23 ? 223 U   A OP1   1 
ATOM   2552  O  OP2   . U   A  1 119 ? -20.095 23.818  -20.523 1.00 117.91 ? 223 U   A OP2   1 
ATOM   2553  O  "O5'" . U   A  1 119 ? -18.933 22.922  -18.546 1.00 116.18 ? 223 U   A "O5'" 1 
ATOM   2554  C  "C5'" . U   A  1 119 ? -18.895 22.263  -17.304 1.00 115.27 ? 223 U   A "C5'" 1 
ATOM   2555  C  "C4'" . U   A  1 119 ? -17.535 21.732  -16.990 1.00 114.92 ? 223 U   A "C4'" 1 
ATOM   2556  O  "O4'" . U   A  1 119 ? -17.119 20.808  -18.015 1.00 115.53 ? 223 U   A "O4'" 1 
ATOM   2557  C  "C3'" . U   A  1 119 ? -16.396 22.713  -16.946 1.00 114.89 ? 223 U   A "C3'" 1 
ATOM   2558  O  "O3'" . U   A  1 119 ? -16.378 23.504  -15.791 1.00 133.06 ? 223 U   A "O3'" 1 
ATOM   2559  C  "C2'" . U   A  1 119 ? -15.203 21.787  -17.050 1.00 114.88 ? 223 U   A "C2'" 1 
ATOM   2560  O  "O2'" . U   A  1 119 ? -15.015 21.105  -15.829 1.00 114.04 ? 223 U   A "O2'" 1 
ATOM   2561  C  "C1'" . U   A  1 119 ? -15.713 20.770  -18.059 1.00 115.48 ? 223 U   A "C1'" 1 
ATOM   2562  N  N1    . U   A  1 119 ? -15.233 21.103  -19.402 1.00 116.46 ? 223 U   A N1    1 
ATOM   2563  C  C2    . U   A  1 119 ? -13.905 20.814  -19.569 1.00 122.52 ? 223 U   A C2    1 
ATOM   2564  O  O2    . U   A  1 119 ? -13.232 20.275  -18.706 1.00 117.67 ? 223 U   A O2    1 
ATOM   2565  N  N3    . U   A  1 119 ? -13.395 21.123  -20.790 1.00 128.20 ? 223 U   A N3    1 
ATOM   2566  C  C4    . U   A  1 119 ? -14.064 21.717  -21.820 1.00 118.47 ? 223 U   A C4    1 
ATOM   2567  O  O4    . U   A  1 119 ? -13.454 21.943  -22.851 1.00 119.42 ? 223 U   A O4    1 
ATOM   2568  C  C5    . U   A  1 119 ? -15.438 22.005  -21.565 1.00 129.07 ? 223 U   A C5    1 
ATOM   2569  C  C6    . U   A  1 119 ? -15.975 21.702  -20.379 1.00 117.29 ? 223 U   A C6    1 
ATOM   2570  P  P     . G   A  1 120 ? -16.356 25.089  -15.950 1.00 114.39 ? 224 G   A P     1 
ATOM   2571  O  OP1   . G   A  1 120 ? -16.844 25.618  -14.666 1.00 113.56 ? 224 G   A OP1   1 
ATOM   2572  O  OP2   . G   A  1 120 ? -17.019 25.457  -17.210 1.00 115.29 ? 224 G   A OP2   1 
ATOM   2573  O  "O5'" . G   A  1 120 ? -14.821 25.441  -16.051 1.00 114.56 ? 224 G   A "O5'" 1 
ATOM   2574  C  "C5'" . G   A  1 120 ? -14.010 25.205  -14.930 1.00 113.86 ? 224 G   A "C5'" 1 
ATOM   2575  C  "C4'" . G   A  1 120 ? -12.584 24.967  -15.305 1.00 114.24 ? 224 G   A "C4'" 1 
ATOM   2576  O  "O4'" . G   A  1 120 ? -12.492 24.011  -16.374 1.00 114.83 ? 224 G   A "O4'" 1 
ATOM   2577  C  "C3'" . G   A  1 120 ? -11.804 26.140  -15.833 1.00 114.88 ? 224 G   A "C3'" 1 
ATOM   2578  O  "O3'" . G   A  1 120 ? -11.437 27.040  -14.814 1.00 114.40 ? 224 G   A "O3'" 1 
ATOM   2579  C  "C2'" . G   A  1 120 ? -10.616 25.451  -16.495 1.00 115.45 ? 224 G   A "C2'" 1 
ATOM   2580  O  "O2'" . G   A  1 120 ? -9.667  25.035  -15.529 1.00 114.91 ? 224 G   A "O2'" 1 
ATOM   2581  C  "C1'" . G   A  1 120 ? -11.270 24.193  -17.047 1.00 115.49 ? 224 G   A "C1'" 1 
ATOM   2582  N  N9    . G   A  1 120 ? -11.531 24.254  -18.473 1.00 116.51 ? 224 G   A N9    1 
ATOM   2583  C  C8    . G   A  1 120 ? -12.763 24.325  -19.035 1.00 116.79 ? 224 G   A C8    1 
ATOM   2584  N  N7    . G   A  1 120 ? -12.706 24.325  -20.327 1.00 117.83 ? 224 G   A N7    1 
ATOM   2585  C  C5    . G   A  1 120 ? -11.367 24.229  -20.592 1.00 118.21 ? 224 G   A C5    1 
ATOM   2586  C  C6    . G   A  1 120 ? -10.742 24.193  -21.828 1.00 119.36 ? 224 G   A C6    1 
ATOM   2587  O  O6    . G   A  1 120 ? -11.288 24.240  -22.929 1.00 135.08 ? 224 G   A O6    1 
ATOM   2588  N  N1    . G   A  1 120 ? -9.366  24.091  -21.686 1.00 119.48 ? 224 G   A N1    1 
ATOM   2589  C  C2    . G   A  1 120 ? -8.686  24.035  -20.499 1.00 118.61 ? 224 G   A C2    1 
ATOM   2590  N  N2    . G   A  1 120 ? -7.347  23.937  -20.570 1.00 118.97 ? 224 G   A N2    1 
ATOM   2591  N  N3    . G   A  1 120 ? -9.287  24.076  -19.325 1.00 117.54 ? 224 G   A N3    1 
ATOM   2592  C  C4    . G   A  1 120 ? -10.615 24.171  -19.463 1.00 117.41 ? 224 G   A C4    1 
ATOM   2593  P  P     . C   A  1 121 ? -11.563 28.600  -15.094 1.00 116.48 ? 225 C   A P     1 
ATOM   2594  O  OP1   . C   A  1 121 ? -11.385 29.282  -13.787 1.00 116.81 ? 225 C   A OP1   1 
ATOM   2595  O  OP2   . C   A  1 121 ? -12.779 28.808  -15.904 1.00 119.05 ? 225 C   A OP2   1 
ATOM   2596  O  "O5'" . C   A  1 121 ? -10.304 28.938  -15.994 1.00 115.84 ? 225 C   A "O5'" 1 
ATOM   2597  C  "C5'" . C   A  1 121 ? -9.034  29.013  -15.386 1.00 115.78 ? 225 C   A "C5'" 1 
ATOM   2598  C  "C4'" . C   A  1 121 ? -7.920  28.751  -16.352 1.00 116.79 ? 225 C   A "C4'" 1 
ATOM   2599  O  "O4'" . C   A  1 121 ? -8.321  27.732  -17.284 1.00 117.11 ? 225 C   A "O4'" 1 
ATOM   2600  C  "C3'" . C   A  1 121 ? -7.529  29.892  -17.251 1.00 126.50 ? 225 C   A "C3'" 1 
ATOM   2601  O  "O3'" . C   A  1 121 ? -6.750  30.878  -16.613 1.00 126.01 ? 225 C   A "O3'" 1 
ATOM   2602  C  "C2'" . C   A  1 121 ? -6.810  29.177  -18.385 1.00 118.92 ? 225 C   A "C2'" 1 
ATOM   2603  O  "O2'" . C   A  1 121 ? -5.498  28.843  -17.990 1.00 119.01 ? 225 C   A "O2'" 1 
ATOM   2604  C  "C1'" . C   A  1 121 ? -7.593  27.878  -18.476 1.00 118.33 ? 225 C   A "C1'" 1 
ATOM   2605  N  N1    . C   A  1 121 ? -8.538  27.852  -19.593 1.00 118.95 ? 225 C   A N1    1 
ATOM   2606  C  C2    . C   A  1 121 ? -8.051  27.674  -20.880 1.00 125.51 ? 225 C   A C2    1 
ATOM   2607  O  O2    . C   A  1 121 ? -6.837  27.580  -21.071 1.00 120.72 ? 225 C   A O2    1 
ATOM   2608  N  N3    . C   A  1 121 ? -8.934  27.626  -21.890 1.00 128.45 ? 225 C   A N3    1 
ATOM   2609  C  C4    . C   A  1 121 ? -10.235 27.729  -21.628 1.00 131.34 ? 225 C   A C4    1 
ATOM   2610  N  N4    . C   A  1 121 ? -11.086 27.672  -22.653 1.00 136.33 ? 225 C   A N4    1 
ATOM   2611  C  C5    . C   A  1 121 ? -10.747 27.894  -20.312 1.00 127.41 ? 225 C   A C5    1 
ATOM   2612  C  C6    . C   A  1 121 ? -9.865  27.944  -19.322 1.00 124.93 ? 225 C   A C6    1 
ATOM   2613  P  P     . U   A  1 122 ? -6.987  32.414  -16.998 1.00 118.69 ? 226 U   A P     1 
ATOM   2614  O  OP1   . U   A  1 122 ? -5.649  32.929  -17.334 1.00 132.53 ? 226 U   A OP1   1 
ATOM   2615  O  OP2   . U   A  1 122 ? -7.868  33.115  -16.052 1.00 117.74 ? 226 U   A OP2   1 
ATOM   2616  O  "O5'" . U   A  1 122 ? -7.797  32.369  -18.354 1.00 119.50 ? 226 U   A "O5'" 1 
ATOM   2617  C  "C5'" . U   A  1 122 ? -7.367  33.187  -19.418 1.00 120.92 ? 226 U   A "C5'" 1 
ATOM   2618  C  "C4'" . U   A  1 122 ? -6.366  32.488  -20.292 1.00 121.93 ? 226 U   A "C4'" 1 
ATOM   2619  O  "O4'" . U   A  1 122 ? -6.954  31.237  -20.718 1.00 121.63 ? 226 U   A "O4'" 1 
ATOM   2620  C  "C3'" . U   A  1 122 ? -6.053  33.228  -21.583 1.00 142.42 ? 226 U   A "C3'" 1 
ATOM   2621  O  "O3'" . U   A  1 122 ? -5.009  34.189  -21.443 1.00 137.27 ? 226 U   A "O3'" 1 
ATOM   2622  C  "C2'" . U   A  1 122 ? -5.779  32.102  -22.578 1.00 124.32 ? 226 U   A "C2'" 1 
ATOM   2623  O  "O2'" . U   A  1 122 ? -4.464  31.580  -22.436 1.00 124.58 ? 226 U   A "O2'" 1 
ATOM   2624  C  "C1'" . U   A  1 122 ? -6.757  31.040  -22.095 1.00 122.98 ? 226 U   A "C1'" 1 
ATOM   2625  N  N1    . U   A  1 122 ? -8.097  31.143  -22.712 1.00 123.11 ? 226 U   A N1    1 
ATOM   2626  C  C2    . U   A  1 122 ? -8.316  31.085  -24.073 1.00 135.55 ? 226 U   A C2    1 
ATOM   2627  O  O2    . U   A  1 122 ? -7.432  30.995  -24.911 1.00 125.64 ? 226 U   A O2    1 
ATOM   2628  N  N3    . U   A  1 122 ? -9.650  31.171  -24.415 1.00 137.18 ? 226 U   A N3    1 
ATOM   2629  C  C4    . U   A  1 122 ? -10.761 31.287  -23.587 1.00 134.67 ? 226 U   A C4    1 
ATOM   2630  O  O4    . U   A  1 122 ? -11.904 31.353  -24.059 1.00 135.45 ? 226 U   A O4    1 
ATOM   2631  C  C5    . U   A  1 122 ? -10.441 31.321  -22.201 1.00 132.18 ? 226 U   A C5    1 
ATOM   2632  C  C6    . U   A  1 122 ? -9.161  31.242  -21.841 1.00 121.89 ? 226 U   A C6    1 
ATOM   2633  P  P     . G   A  1 123 ? -5.324  35.769  -21.404 1.00 124.88 ? 227 G   A P     1 
ATOM   2634  O  OP1   . G   A  1 123 ? -4.143  36.339  -20.724 1.00 125.08 ? 227 G   A OP1   1 
ATOM   2635  O  OP2   . G   A  1 123 ? -6.689  36.150  -20.948 1.00 123.85 ? 227 G   A OP2   1 
ATOM   2636  O  "O5'" . G   A  1 123 ? -5.254  36.186  -22.927 1.00 126.74 ? 227 G   A "O5'" 1 
ATOM   2637  C  "C5'" . G   A  1 123 ? -4.140  35.829  -23.719 1.00 128.09 ? 227 G   A "C5'" 1 
ATOM   2638  C  "C4'" . G   A  1 123 ? -4.505  35.796  -25.176 1.00 129.55 ? 227 G   A "C4'" 1 
ATOM   2639  O  "O4'" . G   A  1 123 ? -5.394  34.687  -25.430 1.00 128.82 ? 227 G   A "O4'" 1 
ATOM   2640  C  "C3'" . G   A  1 123 ? -5.279  36.989  -25.697 1.00 149.41 ? 227 G   A "C3'" 1 
ATOM   2641  O  "O3'" . G   A  1 123 ? -4.484  38.126  -25.950 1.00 131.72 ? 227 G   A "O3'" 1 
ATOM   2642  C  "C2'" . G   A  1 123 ? -5.959  36.426  -26.931 1.00 148.20 ? 227 G   A "C2'" 1 
ATOM   2643  O  "O2'" . G   A  1 123 ? -5.032  36.321  -27.996 1.00 133.03 ? 227 G   A "O2'" 1 
ATOM   2644  C  "C1'" . G   A  1 123 ? -6.296  35.017  -26.464 1.00 129.76 ? 227 G   A "C1'" 1 
ATOM   2645  N  N9    . G   A  1 123 ? -7.673  34.876  -25.953 1.00 128.43 ? 227 G   A N9    1 
ATOM   2646  C  C8    . G   A  1 123 ? -8.081  34.928  -24.646 1.00 127.52 ? 227 G   A C8    1 
ATOM   2647  N  N7    . G   A  1 123 ? -9.367  34.745  -24.509 1.00 126.89 ? 227 G   A N7    1 
ATOM   2648  C  C5    . G   A  1 123 ? -9.838  34.547  -25.799 1.00 127.20 ? 227 G   A C5    1 
ATOM   2649  C  C6    . G   A  1 123 ? -11.146 34.302  -26.291 1.00 127.22 ? 227 G   A C6    1 
ATOM   2650  O  O6    . G   A  1 123 ? -12.206 34.197  -25.671 1.00 126.10 ? 227 G   A O6    1 
ATOM   2651  N  N1    . G   A  1 123 ? -11.169 34.173  -27.667 1.00 128.85 ? 227 G   A N1    1 
ATOM   2652  C  C2    . G   A  1 123 ? -10.076 34.268  -28.476 1.00 130.30 ? 227 G   A C2    1 
ATOM   2653  N  N2    . G   A  1 123 ? -10.285 34.126  -29.793 1.00 132.33 ? 227 G   A N2    1 
ATOM   2654  N  N3    . G   A  1 123 ? -8.852  34.495  -28.031 1.00 130.31 ? 227 G   A N3    1 
ATOM   2655  C  C4    . G   A  1 123 ? -8.801  34.625  -26.695 1.00 128.73 ? 227 G   A C4    1 
ATOM   2656  P  P     . A   A  1 124 ? -5.097  39.570  -25.660 1.00 131.76 ? 228 A   A P     1 
ATOM   2657  O  OP1   . A   A  1 124 ? -4.634  40.352  -26.799 1.00 133.94 ? 228 A   A OP1   1 
ATOM   2658  O  OP2   . A   A  1 124 ? -4.994  40.010  -24.255 1.00 130.31 ? 228 A   A OP2   1 
ATOM   2659  O  "O5'" . A   A  1 124 ? -6.645  39.404  -25.882 1.00 131.05 ? 228 A   A "O5'" 1 
ATOM   2660  C  "C5'" . A   A  1 124 ? -7.306  40.331  -26.696 1.00 132.20 ? 228 A   A "C5'" 1 
ATOM   2661  C  "C4'" . A   A  1 124 ? -7.626  39.702  -28.009 1.00 133.45 ? 228 A   A "C4'" 1 
ATOM   2662  O  "O4'" . A   A  1 124 ? -8.129  38.374  -27.777 1.00 132.19 ? 228 A   A "O4'" 1 
ATOM   2663  C  "C3'" . A   A  1 124 ? -8.725  40.387  -28.787 1.00 162.42 ? 228 A   A "C3'" 1 
ATOM   2664  O  "O3'" . A   A  1 124 ? -8.267  41.444  -29.573 1.00 136.22 ? 228 A   A "O3'" 1 
ATOM   2665  C  "C2'" . A   A  1 124 ? -9.316  39.265  -29.606 1.00 134.56 ? 228 A   A "C2'" 1 
ATOM   2666  O  "O2'" . A   A  1 124 ? -8.476  38.997  -30.713 1.00 136.40 ? 228 A   A "O2'" 1 
ATOM   2667  C  "C1'" . A   A  1 124 ? -9.206  38.109  -28.638 1.00 132.69 ? 228 A   A "C1'" 1 
ATOM   2668  N  N9    . A   A  1 124 ? -10.406 37.975  -27.806 1.00 130.99 ? 228 A   A N9    1 
ATOM   2669  C  C8    . A   A  1 124 ? -10.446 38.067  -26.443 1.00 129.25 ? 228 A   A C8    1 
ATOM   2670  N  N7    . A   A  1 124 ? -11.635 37.866  -25.945 1.00 128.06 ? 228 A   A N7    1 
ATOM   2671  C  C5    . A   A  1 124 ? -12.416 37.619  -27.055 1.00 129.08 ? 228 A   A C5    1 
ATOM   2672  C  C6    . A   A  1 124 ? -13.774 37.336  -27.190 1.00 128.68 ? 228 A   A C6    1 
ATOM   2673  N  N6    . A   A  1 124 ? -14.597 37.255  -26.151 1.00 132.12 ? 228 A   A N6    1 
ATOM   2674  N  N1    . A   A  1 124 ? -14.264 37.143  -28.428 1.00 130.08 ? 228 A   A N1    1 
ATOM   2675  C  C2    . A   A  1 124 ? -13.421 37.226  -29.457 1.00 131.75 ? 228 A   A C2    1 
ATOM   2676  N  N3    . A   A  1 124 ? -12.118 37.489  -29.453 1.00 132.31 ? 228 A   A N3    1 
ATOM   2677  C  C4    . A   A  1 124 ? -11.674 37.671  -28.208 1.00 130.88 ? 228 A   A C4    1 
ATOM   2678  P  P     . U   A  1 125 ? -9.298  42.581  -29.931 1.00 136.81 ? 229 U   A P     1 
ATOM   2679  O  OP1   . U   A  1 125 ? -8.709  43.237  -31.100 1.00 139.26 ? 229 U   A OP1   1 
ATOM   2680  O  OP2   . U   A  1 125 ? -9.664  43.200  -28.644 1.00 135.09 ? 229 U   A OP2   1 
ATOM   2681  O  "O5'" . U   A  1 125 ? -10.596 41.854  -30.463 1.00 136.54 ? 229 U   A "O5'" 1 
ATOM   2682  C  "C5'" . U   A  1 125 ? -10.943 41.975  -31.823 1.00 138.48 ? 229 U   A "C5'" 1 
ATOM   2683  C  "C4'" . U   A  1 125 ? -12.311 41.425  -32.077 1.00 137.96 ? 229 U   A "C4'" 1 
ATOM   2684  O  "O4'" . U   A  1 125 ? -12.574 40.376  -31.121 1.00 135.88 ? 229 U   A "O4'" 1 
ATOM   2685  C  "C3'" . U   A  1 125 ? -13.467 42.375  -31.872 1.00 146.75 ? 229 U   A "C3'" 1 
ATOM   2686  O  "O3'" . U   A  1 125 ? -13.695 43.252  -32.952 1.00 150.41 ? 229 U   A "O3'" 1 
ATOM   2687  C  "C2'" . U   A  1 125 ? -14.631 41.432  -31.600 1.00 136.33 ? 229 U   A "C2'" 1 
ATOM   2688  O  "O2'" . U   A  1 125 ? -15.078 40.818  -32.796 1.00 137.71 ? 229 U   A "O2'" 1 
ATOM   2689  C  "C1'" . U   A  1 125 ? -13.946 40.346  -30.808 1.00 134.89 ? 229 U   A "C1'" 1 
ATOM   2690  N  N1    . U   A  1 125 ? -14.106 40.472  -29.350 1.00 132.79 ? 229 U   A N1    1 
ATOM   2691  C  C2    . U   A  1 125 ? -15.315 40.090  -28.819 1.00 131.48 ? 229 U   A C2    1 
ATOM   2692  O  O2    . U   A  1 125 ? -16.264 39.782  -29.516 1.00 132.05 ? 229 U   A O2    1 
ATOM   2693  N  N3    . U   A  1 125 ? -15.395 40.169  -27.452 1.00 129.62 ? 229 U   A N3    1 
ATOM   2694  C  C4    . U   A  1 125 ? -14.382 40.525  -26.585 1.00 128.95 ? 229 U   A C4    1 
ATOM   2695  O  O4    . U   A  1 125 ? -14.596 40.542  -25.370 1.00 127.31 ? 229 U   A O4    1 
ATOM   2696  C  C5    . U   A  1 125 ? -13.142 40.853  -27.220 1.00 134.01 ? 229 U   A C5    1 
ATOM   2697  C  C6    . U   A  1 125 ? -13.040 40.801  -28.550 1.00 133.70 ? 229 U   A C6    1 
ATOM   2698  P  P     . C   A  1 126 ? -13.553 44.835  -32.741 1.00 140.27 ? 230 C   A P     1 
ATOM   2699  O  OP1   . C   A  1 126 ? -12.383 45.290  -33.523 1.00 142.34 ? 230 C   A OP1   1 
ATOM   2700  O  OP2   . C   A  1 126 ? -13.723 45.206  -31.324 1.00 138.14 ? 230 C   A OP2   1 
ATOM   2701  O  "O5'" . C   A  1 126 ? -14.851 45.348  -33.467 1.00 141.16 ? 230 C   A "O5'" 1 
ATOM   2702  C  "C5'" . C   A  1 126 ? -15.590 44.430  -34.247 1.00 141.67 ? 230 C   A "C5'" 1 
ATOM   2703  C  "C4'" . C   A  1 126 ? -17.019 44.351  -33.800 1.00 140.38 ? 230 C   A "C4'" 1 
ATOM   2704  O  "O4'" . C   A  1 126 ? -17.103 43.682  -32.517 1.00 137.97 ? 230 C   A "O4'" 1 
ATOM   2705  C  "C3'" . C   A  1 126 ? -17.742 45.680  -33.628 1.00 140.51 ? 230 C   A "C3'" 1 
ATOM   2706  O  "O3'" . C   A  1 126 ? -19.062 45.595  -34.121 1.00 140.87 ? 230 C   A "O3'" 1 
ATOM   2707  C  "C2'" . C   A  1 126 ? -17.802 45.868  -32.127 1.00 138.14 ? 230 C   A "C2'" 1 
ATOM   2708  O  "O2'" . C   A  1 126 ? -18.909 46.619  -31.692 1.00 147.01 ? 230 C   A "O2'" 1 
ATOM   2709  C  "C1'" . C   A  1 126 ? -17.907 44.440  -31.646 1.00 136.70 ? 230 C   A "C1'" 1 
ATOM   2710  N  N1    . C   A  1 126 ? -17.471 44.268  -30.267 1.00 134.64 ? 230 C   A N1    1 
ATOM   2711  C  C2    . C   A  1 126 ? -18.472 43.942  -29.362 1.00 132.86 ? 230 C   A C2    1 
ATOM   2712  O  O2    . C   A  1 126 ? -19.622 43.767  -29.792 1.00 133.12 ? 230 C   A O2    1 
ATOM   2713  N  N3    . C   A  1 126 ? -18.151 43.798  -28.064 1.00 131.02 ? 230 C   A N3    1 
ATOM   2714  C  C4    . C   A  1 126 ? -16.892 43.989  -27.680 1.00 130.95 ? 230 C   A C4    1 
ATOM   2715  N  N4    . C   A  1 126 ? -16.621 43.832  -26.391 1.00 129.19 ? 230 C   A N4    1 
ATOM   2716  C  C5    . C   A  1 126 ? -15.856 44.348  -28.590 1.00 132.75 ? 230 C   A C5    1 
ATOM   2717  C  C6    . C   A  1 126 ? -16.193 44.492  -29.874 1.00 134.59 ? 230 C   A C6    1 
ATOM   2718  P  P     . A   A  1 127 ? -19.725 46.949  -34.630 1.00 147.07 ? 231 A   A P     1 
ATOM   2719  O  OP1   . A   A  1 127 ? -20.831 47.279  -33.694 1.00 140.43 ? 231 A   A OP1   1 
ATOM   2720  O  OP2   . A   A  1 127 ? -19.977 46.757  -36.078 1.00 150.13 ? 231 A   A OP2   1 
ATOM   2721  O  "O5'" . A   A  1 127 ? -18.523 47.995  -34.483 1.00 150.87 ? 231 A   A "O5'" 1 
ATOM   2722  C  "C5'" . A   A  1 127 ? -18.148 48.847  -35.556 1.00 159.77 ? 231 A   A "C5'" 1 
ATOM   2723  C  "C4'" . A   A  1 127 ? -17.149 49.914  -35.155 1.00 164.98 ? 231 A   A "C4'" 1 
ATOM   2724  O  "O4'" . A   A  1 127 ? -16.828 50.686  -36.334 1.00 169.52 ? 231 A   A "O4'" 1 
ATOM   2725  C  "C3'" . A   A  1 127 ? -17.598 50.918  -34.089 1.00 163.00 ? 231 A   A "C3'" 1 
ATOM   2726  O  "O3'" . A   A  1 127 ? -17.055 50.600  -32.810 1.00 165.11 ? 231 A   A "O3'" 1 
ATOM   2727  C  "C2'" . A   A  1 127 ? -17.156 52.301  -34.596 1.00 159.33 ? 231 A   A "C2'" 1 
ATOM   2728  O  "O2'" . A   A  1 127 ? -16.027 52.761  -33.865 1.00 153.16 ? 231 A   A "O2'" 1 
ATOM   2729  C  "C1'" . A   A  1 127 ? -16.748 52.058  -36.055 1.00 165.20 ? 231 A   A "C1'" 1 
ATOM   2730  N  N9    . A   A  1 127 ? -17.606 52.750  -37.048 1.00 164.02 ? 231 A   A N9    1 
ATOM   2731  C  C8    . A   A  1 127 ? -17.202 53.019  -38.337 1.00 168.02 ? 231 A   A C8    1 
ATOM   2732  N  N7    . A   A  1 127 ? -18.100 53.595  -39.089 1.00 174.60 ? 231 A   A N7    1 
ATOM   2733  C  C5    . A   A  1 127 ? -19.191 53.698  -38.249 1.00 169.10 ? 231 A   A C5    1 
ATOM   2734  C  C6    . A   A  1 127 ? -20.466 54.228  -38.470 1.00 175.14 ? 231 A   A C6    1 
ATOM   2735  N  N6    . A   A  1 127 ? -20.837 54.759  -39.637 1.00 185.76 ? 231 A   A N6    1 
ATOM   2736  N  N1    . A   A  1 127 ? -21.345 54.196  -37.446 1.00 171.08 ? 231 A   A N1    1 
ATOM   2737  C  C2    . A   A  1 127 ? -20.966 53.661  -36.279 1.00 165.01 ? 231 A   A C2    1 
ATOM   2738  N  N3    . A   A  1 127 ? -19.789 53.129  -35.957 1.00 163.58 ? 231 A   A N3    1 
ATOM   2739  C  C4    . A   A  1 127 ? -18.926 53.171  -36.994 1.00 164.11 ? 231 A   A C4    1 
ATOM   2740  P  P     . G   A  1 128 ? -17.622 51.273  -31.462 1.00 164.26 ? 232 G   A P     1 
ATOM   2741  O  OP1   . G   A  1 128 ? -18.365 52.506  -31.811 1.00 171.37 ? 232 G   A OP1   1 
ATOM   2742  O  OP2   . G   A  1 128 ? -16.496 51.372  -30.504 1.00 169.39 ? 232 G   A OP2   1 
ATOM   2743  O  "O5'" . G   A  1 128 ? -18.669 50.205  -30.907 1.00 163.47 ? 232 G   A "O5'" 1 
ATOM   2744  C  "C5'" . G   A  1 128 ? -19.526 49.522  -31.814 1.00 159.55 ? 232 G   A "C5'" 1 
ATOM   2745  C  "C4'" . G   A  1 128 ? -20.801 49.030  -31.184 1.00 153.07 ? 232 G   A "C4'" 1 
ATOM   2746  O  "O4'" . G   A  1 128 ? -20.509 47.878  -30.352 1.00 151.43 ? 232 G   A "O4'" 1 
ATOM   2747  C  "C3'" . G   A  1 128 ? -21.540 50.034  -30.305 1.00 147.96 ? 232 G   A "C3'" 1 
ATOM   2748  O  "O3'" . G   A  1 128 ? -22.945 49.930  -30.510 1.00 152.63 ? 232 G   A "O3'" 1 
ATOM   2749  C  "C2'" . G   A  1 128 ? -21.200 49.577  -28.896 1.00 141.49 ? 232 G   A "C2'" 1 
ATOM   2750  O  "O2'" . G   A  1 128 ? -22.178 49.892  -27.931 1.00 138.22 ? 232 G   A "O2'" 1 
ATOM   2751  C  "C1'" . G   A  1 128 ? -21.063 48.070  -29.072 1.00 143.99 ? 232 G   A "C1'" 1 
ATOM   2752  N  N9    . G   A  1 128 ? -20.165 47.490  -28.082 1.00 140.49 ? 232 G   A N9    1 
ATOM   2753  C  C8    . G   A  1 128 ? -18.802 47.566  -28.106 1.00 142.84 ? 232 G   A C8    1 
ATOM   2754  N  N7    . G   A  1 128 ? -18.263 46.996  -27.074 1.00 140.11 ? 232 G   A N7    1 
ATOM   2755  C  C5    . G   A  1 128 ? -19.338 46.542  -26.343 1.00 135.11 ? 232 G   A C5    1 
ATOM   2756  C  C6    . G   A  1 128 ? -19.337 45.854  -25.135 1.00 132.66 ? 232 G   A C6    1 
ATOM   2757  O  O6    . G   A  1 128 ? -18.347 45.515  -24.492 1.00 136.63 ? 232 G   A O6    1 
ATOM   2758  N  N1    . G   A  1 128 ? -20.631 45.580  -24.722 1.00 130.13 ? 232 G   A N1    1 
ATOM   2759  C  C2    . G   A  1 128 ? -21.772 45.923  -25.398 1.00 130.55 ? 232 G   A C2    1 
ATOM   2760  N  N2    . G   A  1 128 ? -22.926 45.564  -24.831 1.00 131.02 ? 232 G   A N2    1 
ATOM   2761  N  N3    . G   A  1 128 ? -21.783 46.567  -26.541 1.00 131.23 ? 232 G   A N3    1 
ATOM   2762  C  C4    . G   A  1 128 ? -20.531 46.838  -26.940 1.00 134.29 ? 232 G   A C4    1 
ATOM   2763  P  P     . U   A  1 129 ? -23.904 51.101  -29.973 1.00 151.56 ? 233 U   A P     1 
ATOM   2764  O  OP1   . U   A  1 129 ? -24.667 51.666  -31.116 1.00 157.04 ? 233 U   A OP1   1 
ATOM   2765  O  OP2   . U   A  1 129 ? -23.112 52.007  -29.102 1.00 149.35 ? 233 U   A OP2   1 
ATOM   2766  O  "O5'" . U   A  1 129 ? -24.903 50.342  -29.005 1.00 146.35 ? 233 U   A "O5'" 1 
ATOM   2767  C  "C5'" . U   A  1 129 ? -25.127 50.833  -27.700 1.00 140.59 ? 233 U   A "C5'" 1 
ATOM   2768  C  "C4'" . U   A  1 129 ? -26.030 49.927  -26.913 1.00 139.25 ? 233 U   A "C4'" 1 
ATOM   2769  O  "O4'" . U   A  1 129 ? -25.337 48.672  -26.668 1.00 128.96 ? 233 U   A "O4'" 1 
ATOM   2770  C  "C3'" . U   A  1 129 ? -26.336 50.464  -25.530 1.00 138.93 ? 233 U   A "C3'" 1 
ATOM   2771  O  "O3'" . U   A  1 129 ? -27.465 51.290  -25.472 1.00 137.28 ? 233 U   A "O3'" 1 
ATOM   2772  C  "C2'" . U   A  1 129 ? -26.496 49.224  -24.681 1.00 126.10 ? 233 U   A "C2'" 1 
ATOM   2773  O  "O2'" . U   A  1 129 ? -27.802 48.704  -24.846 1.00 126.08 ? 233 U   A "O2'" 1 
ATOM   2774  C  "C1'" . U   A  1 129 ? -25.521 48.268  -25.333 1.00 126.93 ? 233 U   A "C1'" 1 
ATOM   2775  N  N1    . U   A  1 129 ? -24.211 48.370  -24.667 1.00 126.25 ? 233 U   A N1    1 
ATOM   2776  C  C2    . U   A  1 129 ? -24.084 47.883  -23.393 1.00 135.26 ? 233 U   A C2    1 
ATOM   2777  O  O2    . U   A  1 129 ? -25.013 47.413  -22.763 1.00 136.83 ? 233 U   A O2    1 
ATOM   2778  N  N3    . U   A  1 129 ? -22.831 48.024  -22.857 1.00 134.59 ? 233 U   A N3    1 
ATOM   2779  C  C4    . U   A  1 129 ? -21.712 48.551  -23.466 1.00 125.25 ? 233 U   A C4    1 
ATOM   2780  O  O4    . U   A  1 129 ? -20.646 48.607  -22.859 1.00 124.76 ? 233 U   A O4    1 
ATOM   2781  C  C5    . U   A  1 129 ? -21.927 49.014  -24.791 1.00 127.12 ? 233 U   A C5    1 
ATOM   2782  C  C6    . U   A  1 129 ? -23.140 48.898  -25.328 1.00 127.54 ? 233 U   A C6    1 
ATOM   2783  P  P     . A   A  1 130 ? -27.376 52.554  -24.505 1.00 133.38 ? 234 A   A P     1 
ATOM   2784  O  OP1   . A   A  1 130 ? -28.662 53.281  -24.510 1.00 136.78 ? 234 A   A OP1   1 
ATOM   2785  O  OP2   . A   A  1 130 ? -26.054 53.173  -24.787 1.00 127.26 ? 234 A   A OP2   1 
ATOM   2786  O  "O5'" . A   A  1 130 ? -27.258 51.938  -23.051 1.00 128.63 ? 234 A   A "O5'" 1 
ATOM   2787  C  "C5'" . A   A  1 130 ? -28.411 51.623  -22.296 1.00 125.63 ? 234 A   A "C5'" 1 
ATOM   2788  C  "C4'" . A   A  1 130 ? -27.999 51.207  -20.918 1.00 123.44 ? 234 A   A "C4'" 1 
ATOM   2789  O  "O4'" . A   A  1 130 ? -26.857 50.334  -21.043 1.00 121.60 ? 234 A   A "O4'" 1 
ATOM   2790  C  "C3'" . A   A  1 130 ? -27.509 52.350  -20.046 1.00 128.29 ? 234 A   A "C3'" 1 
ATOM   2791  O  "O3'" . A   A  1 130 ? -28.501 52.954  -19.259 1.00 133.62 ? 234 A   A "O3'" 1 
ATOM   2792  C  "C2'" . A   A  1 130 ? -26.375 51.764  -19.211 1.00 128.79 ? 234 A   A "C2'" 1 
ATOM   2793  O  "O2'" . A   A  1 130 ? -26.878 51.341  -17.956 1.00 130.87 ? 234 A   A "O2'" 1 
ATOM   2794  C  "C1'" . A   A  1 130 ? -25.989 50.505  -19.958 1.00 120.23 ? 234 A   A "C1'" 1 
ATOM   2795  N  N9    . A   A  1 130 ? -24.622 50.614  -20.481 1.00 121.16 ? 234 A   A N9    1 
ATOM   2796  C  C8    . A   A  1 130 ? -24.240 50.759  -21.783 1.00 122.95 ? 234 A   A C8    1 
ATOM   2797  N  N7    . A   A  1 130 ? -22.946 50.790  -21.941 1.00 123.48 ? 234 A   A N7    1 
ATOM   2798  C  C5    . A   A  1 130 ? -22.452 50.637  -20.666 1.00 121.94 ? 234 A   A C5    1 
ATOM   2799  C  C6    . A   A  1 130 ? -21.152 50.583  -20.170 1.00 121.70 ? 234 A   A C6    1 
ATOM   2800  N  N6    . A   A  1 130 ? -20.072 50.683  -20.943 1.00 123.06 ? 234 A   A N6    1 
ATOM   2801  N  N1    . A   A  1 130 ? -21.005 50.411  -18.841 1.00 120.66 ? 234 A   A N1    1 
ATOM   2802  C  C2    . A   A  1 130 ? -22.099 50.308  -18.080 1.00 118.83 ? 234 A   A C2    1 
ATOM   2803  N  N3    . A   A  1 130 ? -23.375 50.346  -18.438 1.00 118.92 ? 234 A   A N3    1 
ATOM   2804  C  C4    . A   A  1 130 ? -23.475 50.495  -19.761 1.00 120.51 ? 234 A   A C4    1 
ATOM   2805  P  P     . G   A  1 131 ? -28.295 54.491  -18.872 1.00 119.04 ? 235 G   A P     1 
ATOM   2806  O  OP1   . G   A  1 131 ? -29.574 54.971  -18.315 1.00 128.89 ? 235 G   A OP1   1 
ATOM   2807  O  OP2   . G   A  1 131 ? -27.616 55.142  -20.015 1.00 120.74 ? 235 G   A OP2   1 
ATOM   2808  O  "O5'" . G   A  1 131 ? -27.234 54.479  -17.694 1.00 117.78 ? 235 G   A "O5'" 1 
ATOM   2809  C  "C5'" . G   A  1 131 ? -27.586 53.974  -16.423 1.00 116.14 ? 235 G   A "C5'" 1 
ATOM   2810  C  "C4'" . G   A  1 131 ? -26.390 53.947  -15.523 1.00 119.13 ? 235 G   A "C4'" 1 
ATOM   2811  O  "O4'" . G   A  1 131 ? -25.408 53.011  -16.023 1.00 118.54 ? 235 G   A "O4'" 1 
ATOM   2812  C  "C3'" . G   A  1 131 ? -25.624 55.246  -15.445 1.00 129.11 ? 235 G   A "C3'" 1 
ATOM   2813  O  "O3'" . G   A  1 131 ? -26.246 56.205  -14.613 1.00 128.52 ? 235 G   A "O3'" 1 
ATOM   2814  C  "C2'" . G   A  1 131 ? -24.263 54.783  -14.945 1.00 134.39 ? 235 G   A "C2'" 1 
ATOM   2815  O  "O2'" . G   A  1 131 ? -24.313 54.512  -13.553 1.00 146.66 ? 235 G   A "O2'" 1 
ATOM   2816  C  "C1'" . G   A  1 131 ? -24.118 53.445  -15.662 1.00 121.76 ? 235 G   A "C1'" 1 
ATOM   2817  N  N9    . G   A  1 131 ? -23.287 53.531  -16.875 1.00 123.50 ? 235 G   A N9    1 
ATOM   2818  C  C8    . G   A  1 131 ? -23.684 53.681  -18.180 1.00 125.30 ? 235 G   A C8    1 
ATOM   2819  N  N7    . G   A  1 131 ? -22.677 53.676  -19.013 1.00 129.87 ? 235 G   A N7    1 
ATOM   2820  C  C5    . G   A  1 131 ? -21.554 53.500  -18.216 1.00 129.10 ? 235 G   A C5    1 
ATOM   2821  C  C6    . G   A  1 131 ? -20.172 53.413  -18.532 1.00 135.05 ? 235 G   A C6    1 
ATOM   2822  O  O6    . G   A  1 131 ? -19.608 53.475  -19.631 1.00 147.56 ? 235 G   A O6    1 
ATOM   2823  N  N1    . G   A  1 131 ? -19.383 53.234  -17.397 1.00 128.77 ? 235 G   A N1    1 
ATOM   2824  C  C2    . G   A  1 131 ? -19.866 53.143  -16.119 1.00 128.30 ? 235 G   A C2    1 
ATOM   2825  N  N2    . G   A  1 131 ? -18.960 52.963  -15.138 1.00 127.93 ? 235 G   A N2    1 
ATOM   2826  N  N3    . G   A  1 131 ? -21.151 53.219  -15.816 1.00 125.81 ? 235 G   A N3    1 
ATOM   2827  C  C4    . G   A  1 131 ? -21.926 53.389  -16.900 1.00 125.29 ? 235 G   A C4    1 
ATOM   2828  P  P     . U   A  1 132 ? -25.889 57.757  -14.762 1.00 161.40 ? 236 U   A P     1 
ATOM   2829  O  OP1   . U   A  1 132 ? -26.832 58.461  -13.865 1.00 164.38 ? 236 U   A OP1   1 
ATOM   2830  O  OP2   . U   A  1 132 ? -25.821 58.099  -16.204 1.00 156.73 ? 236 U   A OP2   1 
ATOM   2831  O  "O5'" . U   A  1 132 ? -24.427 57.887  -14.154 1.00 153.12 ? 236 U   A "O5'" 1 
ATOM   2832  C  "C5'" . U   A  1 132 ? -24.232 57.845  -12.753 1.00 153.62 ? 236 U   A "C5'" 1 
ATOM   2833  C  "C4'" . U   A  1 132 ? -22.786 57.621  -12.413 1.00 151.61 ? 236 U   A "C4'" 1 
ATOM   2834  O  "O4'" . U   A  1 132 ? -22.239 56.551  -13.225 1.00 150.07 ? 236 U   A "O4'" 1 
ATOM   2835  C  "C3'" . U   A  1 132 ? -21.870 58.789  -12.701 1.00 153.88 ? 236 U   A "C3'" 1 
ATOM   2836  O  "O3'" . U   A  1 132 ? -21.941 59.811  -11.729 1.00 151.53 ? 236 U   A "O3'" 1 
ATOM   2837  C  "C2'" . U   A  1 132 ? -20.508 58.115  -12.812 1.00 151.37 ? 236 U   A "C2'" 1 
ATOM   2838  O  "O2'" . U   A  1 132 ? -19.999 57.774  -11.533 1.00 148.35 ? 236 U   A "O2'" 1 
ATOM   2839  C  "C1'" . U   A  1 132 ? -20.885 56.823  -13.522 1.00 148.11 ? 236 U   A "C1'" 1 
ATOM   2840  N  N1    . U   A  1 132 ? -20.717 56.890  -14.988 1.00 147.20 ? 236 U   A N1    1 
ATOM   2841  C  C2    . U   A  1 132 ? -19.446 56.670  -15.490 1.00 145.32 ? 236 U   A C2    1 
ATOM   2842  O  O2    . U   A  1 132 ? -18.497 56.485  -14.751 1.00 144.42 ? 236 U   A O2    1 
ATOM   2843  N  N3    . U   A  1 132 ? -19.344 56.720  -16.869 1.00 144.74 ? 236 U   A N3    1 
ATOM   2844  C  C4    . U   A  1 132 ? -20.383 56.938  -17.759 1.00 145.84 ? 236 U   A C4    1 
ATOM   2845  O  O4    . U   A  1 132 ? -20.174 56.956  -18.980 1.00 145.33 ? 236 U   A O4    1 
ATOM   2846  C  C5    . U   A  1 132 ? -21.667 57.131  -17.148 1.00 147.73 ? 236 U   A C5    1 
ATOM   2847  C  C6    . U   A  1 132 ? -21.793 57.093  -15.819 1.00 148.35 ? 236 U   A C6    1 
ATOM   2848  P  P     . G   A  1 133 ? -21.681 61.325  -12.176 1.00 155.51 ? 237 G   A P     1 
ATOM   2849  O  OP1   . G   A  1 133 ? -21.202 62.095  -11.004 1.00 157.33 ? 237 G   A OP1   1 
ATOM   2850  O  OP2   . G   A  1 133 ? -22.875 61.781  -12.933 1.00 155.03 ? 237 G   A OP2   1 
ATOM   2851  O  "O5'" . G   A  1 133 ? -20.487 61.190  -13.213 1.00 149.08 ? 237 G   A "O5'" 1 
ATOM   2852  C  "C5'" . G   A  1 133 ? -19.437 62.133  -13.227 1.00 148.07 ? 237 G   A "C5'" 1 
ATOM   2853  C  "C4'" . G   A  1 133 ? -18.098 61.449  -13.288 1.00 146.11 ? 237 G   A "C4'" 1 
ATOM   2854  O  "O4'" . G   A  1 133 ? -18.218 60.208  -14.030 1.00 145.42 ? 237 G   A "O4'" 1 
ATOM   2855  C  "C3'" . G   A  1 133 ? -17.035 62.220  -14.039 1.00 151.64 ? 237 G   A "C3'" 1 
ATOM   2856  O  "O3'" . G   A  1 133 ? -16.443 63.251  -13.275 1.00 146.62 ? 237 G   A "O3'" 1 
ATOM   2857  C  "C2'" . G   A  1 133 ? -16.084 61.124  -14.504 1.00 143.07 ? 237 G   A "C2'" 1 
ATOM   2858  O  "O2'" . G   A  1 133 ? -15.246 60.688  -13.448 1.00 142.55 ? 237 G   A "O2'" 1 
ATOM   2859  C  "C1'" . G   A  1 133 ? -17.072 60.011  -14.835 1.00 143.64 ? 237 G   A "C1'" 1 
ATOM   2860  N  N9    . G   A  1 133 ? -17.513 60.075  -16.238 1.00 143.60 ? 237 G   A N9    1 
ATOM   2861  C  C8    . G   A  1 133 ? -18.817 60.197  -16.657 1.00 145.02 ? 237 G   A C8    1 
ATOM   2862  N  N7    . G   A  1 133 ? -18.946 60.229  -17.951 1.00 144.80 ? 237 G   A N7    1 
ATOM   2863  C  C5    . G   A  1 133 ? -17.647 60.121  -18.409 1.00 143.15 ? 237 G   A C5    1 
ATOM   2864  C  C6    . G   A  1 133 ? -17.171 60.108  -19.735 1.00 145.64 ? 237 G   A C6    1 
ATOM   2865  O  O6    . G   A  1 133 ? -17.825 60.189  -20.778 1.00 145.99 ? 237 G   A O6    1 
ATOM   2866  N  N1    . G   A  1 133 ? -15.788 59.988  -19.772 1.00 148.16 ? 237 G   A N1    1 
ATOM   2867  C  C2    . G   A  1 133 ? -14.973 59.893  -18.667 1.00 150.70 ? 237 G   A C2    1 
ATOM   2868  N  N2    . G   A  1 133 ? -13.657 59.785  -18.911 1.00 155.74 ? 237 G   A N2    1 
ATOM   2869  N  N3    . G   A  1 133 ? -15.412 59.904  -17.418 1.00 140.94 ? 237 G   A N3    1 
ATOM   2870  C  C4    . G   A  1 133 ? -16.749 60.017  -17.370 1.00 142.38 ? 237 G   A C4    1 
ATOM   2871  P  P     . G   A  1 134 ? -16.468 64.741  -13.855 1.00 146.18 ? 238 G   A P     1 
ATOM   2872  O  OP1   . G   A  1 134 ? -15.893 65.606  -12.810 1.00 153.25 ? 238 G   A OP1   1 
ATOM   2873  O  OP2   . G   A  1 134 ? -17.790 65.040  -14.446 1.00 148.88 ? 238 G   A OP2   1 
ATOM   2874  O  "O5'" . G   A  1 134 ? -15.431 64.701  -15.048 1.00 143.56 ? 238 G   A "O5'" 1 
ATOM   2875  C  "C5'" . G   A  1 134 ? -14.062 64.840  -14.752 1.00 142.39 ? 238 G   A "C5'" 1 
ATOM   2876  C  "C4'" . G   A  1 134 ? -13.188 64.368  -15.875 1.00 140.87 ? 238 G   A "C4'" 1 
ATOM   2877  O  "O4'" . G   A  1 134 ? -13.775 63.227  -16.546 1.00 140.70 ? 238 G   A "O4'" 1 
ATOM   2878  C  "C3'" . G   A  1 134 ? -12.955 65.330  -17.016 1.00 166.94 ? 238 G   A "C3'" 1 
ATOM   2879  O  "O3'" . G   A  1 134 ? -12.154 66.450  -16.693 1.00 168.33 ? 238 G   A "O3'" 1 
ATOM   2880  C  "C2'" . G   A  1 134 ? -12.411 64.392  -18.086 1.00 164.77 ? 238 G   A "C2'" 1 
ATOM   2881  O  "O2'" . G   A  1 134 ? -11.110 63.934  -17.753 1.00 138.34 ? 238 G   A "O2'" 1 
ATOM   2882  C  "C1'" . G   A  1 134 ? -13.351 63.211  -17.901 1.00 139.92 ? 238 G   A "C1'" 1 
ATOM   2883  N  N9    . G   A  1 134 ? -14.526 63.324  -18.784 1.00 140.86 ? 238 G   A N9    1 
ATOM   2884  C  C8    . G   A  1 134 ? -15.845 63.487  -18.425 1.00 142.30 ? 238 G   A C8    1 
ATOM   2885  N  N7    . G   A  1 134 ? -16.658 63.560  -19.444 1.00 142.97 ? 238 G   A N7    1 
ATOM   2886  C  C5    . G   A  1 134 ? -15.820 63.450  -20.540 1.00 141.91 ? 238 G   A C5    1 
ATOM   2887  C  C6    . G   A  1 134 ? -16.132 63.470  -21.918 1.00 147.55 ? 238 G   A C6    1 
ATOM   2888  O  O6    . G   A  1 134 ? -17.244 63.588  -22.436 1.00 151.34 ? 238 G   A O6    1 
ATOM   2889  N  N1    . G   A  1 134 ? -14.998 63.339  -22.717 1.00 141.03 ? 238 G   A N1    1 
ATOM   2890  C  C2    . G   A  1 134 ? -13.713 63.204  -22.248 1.00 139.79 ? 238 G   A C2    1 
ATOM   2891  N  N2    . G   A  1 134 ? -12.740 63.097  -23.176 1.00 139.01 ? 238 G   A N2    1 
ATOM   2892  N  N3    . G   A  1 134 ? -13.413 63.179  -20.952 1.00 139.53 ? 238 G   A N3    1 
ATOM   2893  C  C4    . G   A  1 134 ? -14.504 63.311  -20.160 1.00 140.62 ? 238 G   A C4    1 
ATOM   2894  P  P     . G   A  1 135 ? -12.718 67.923  -16.986 1.00 141.74 ? 239 G   A P     1 
ATOM   2895  O  OP1   . G   A  1 135 ? -12.089 68.812  -15.983 1.00 142.07 ? 239 G   A OP1   1 
ATOM   2896  O  OP2   . G   A  1 135 ? -14.195 67.926  -17.126 1.00 143.06 ? 239 G   A OP2   1 
ATOM   2897  O  "O5'" . G   A  1 135 ? -12.159 68.223  -18.435 1.00 140.98 ? 239 G   A "O5'" 1 
ATOM   2898  C  "C5'" . G   A  1 135 ? -10.762 68.211  -18.672 1.00 139.80 ? 239 G   A "C5'" 1 
ATOM   2899  C  "C4'" . G   A  1 135 ? -10.472 67.860  -20.099 1.00 139.15 ? 239 G   A "C4'" 1 
ATOM   2900  O  "O4'" . G   A  1 135 ? -11.157 66.629  -20.402 1.00 139.06 ? 239 G   A "O4'" 1 
ATOM   2901  C  "C3'" . G   A  1 135 ? -11.019 68.827  -21.135 1.00 157.14 ? 239 G   A "C3'" 1 
ATOM   2902  O  "O3'" . G   A  1 135 ? -10.244 69.981  -21.352 1.00 155.03 ? 239 G   A "O3'" 1 
ATOM   2903  C  "C2'" . G   A  1 135 ? -11.151 67.949  -22.353 1.00 139.57 ? 239 G   A "C2'" 1 
ATOM   2904  O  "O2'" . G   A  1 135 ? -9.871  67.676  -22.894 1.00 138.56 ? 239 G   A "O2'" 1 
ATOM   2905  C  "C1'" . G   A  1 135 ? -11.680 66.685  -21.706 1.00 139.41 ? 239 G   A "C1'" 1 
ATOM   2906  N  N9    . G   A  1 135 ? -13.138 66.723  -21.578 1.00 140.62 ? 239 G   A N9    1 
ATOM   2907  C  C8    . G   A  1 135 ? -13.877 66.774  -20.424 1.00 141.40 ? 239 G   A C8    1 
ATOM   2908  N  N7    . G   A  1 135 ? -15.159 66.770  -20.661 1.00 142.58 ? 239 G   A N7    1 
ATOM   2909  C  C5    . G   A  1 135 ? -15.260 66.706  -22.046 1.00 142.54 ? 239 G   A C5    1 
ATOM   2910  C  C6    . G   A  1 135 ? -16.383 66.676  -22.912 1.00 143.63 ? 239 G   A C6    1 
ATOM   2911  O  O6    . G   A  1 135 ? -17.586 66.695  -22.636 1.00 144.91 ? 239 G   A O6    1 
ATOM   2912  N  N1    . G   A  1 135 ? -16.000 66.622  -24.250 1.00 143.31 ? 239 G   A N1    1 
ATOM   2913  C  C2    . G   A  1 135 ? -14.709 66.595  -24.708 1.00 142.13 ? 239 G   A C2    1 
ATOM   2914  N  N2    . G   A  1 135 ? -14.524 66.550  -26.036 1.00 142.20 ? 239 G   A N2    1 
ATOM   2915  N  N3    . G   A  1 135 ? -13.660 66.621  -23.913 1.00 141.10 ? 239 G   A N3    1 
ATOM   2916  C  C4    . G   A  1 135 ? -14.012 66.674  -22.617 1.00 141.36 ? 239 G   A C4    1 
ATOM   2917  P  P     . A   A  1 136 ? -11.008 71.370  -21.528 1.00 141.28 ? 240 A   A P     1 
ATOM   2918  O  OP1   . A   A  1 136 ? -9.984  72.372  -21.893 1.00 141.11 ? 240 A   A OP1   1 
ATOM   2919  O  OP2   . A   A  1 136 ? -11.876 71.539  -20.331 1.00 142.21 ? 240 A   A OP2   1 
ATOM   2920  O  "O5'" . A   A  1 136 ? -11.981 71.145  -22.767 1.00 141.85 ? 240 A   A "O5'" 1 
ATOM   2921  C  "C5'" . A   A  1 136 ? -11.492 71.056  -24.093 1.00 141.47 ? 240 A   A "C5'" 1 
ATOM   2922  C  "C4'" . A   A  1 136 ? -12.638 70.864  -25.045 1.00 142.37 ? 240 A   A "C4'" 1 
ATOM   2923  O  "O4'" . A   A  1 136 ? -13.428 69.764  -24.558 1.00 142.40 ? 240 A   A "O4'" 1 
ATOM   2924  C  "C3'" . A   A  1 136 ? -13.649 71.989  -25.141 1.00 156.48 ? 240 A   A "C3'" 1 
ATOM   2925  O  "O3'" . A   A  1 136 ? -13.257 73.042  -25.983 1.00 159.19 ? 240 A   A "O3'" 1 
ATOM   2926  C  "C2'" . A   A  1 136 ? -14.888 71.267  -25.631 1.00 144.61 ? 240 A   A "C2'" 1 
ATOM   2927  O  "O2'" . A   A  1 136 ? -14.739 70.914  -26.996 1.00 144.55 ? 240 A   A "O2'" 1 
ATOM   2928  C  "C1'" . A   A  1 136 ? -14.794 69.986  -24.837 1.00 143.75 ? 240 A   A "C1'" 1 
ATOM   2929  N  N9    . A   A  1 136 ? -15.546 69.998  -23.570 1.00 144.38 ? 240 A   A N9    1 
ATOM   2930  C  C8    . A   A  1 136 ? -15.061 70.155  -22.297 1.00 144.02 ? 240 A   A C8    1 
ATOM   2931  N  N7    . A   A  1 136 ? -15.993 70.056  -21.380 1.00 144.97 ? 240 A   A N7    1 
ATOM   2932  C  C5    . A   A  1 136 ? -17.162 69.807  -22.092 1.00 145.99 ? 240 A   A C5    1 
ATOM   2933  C  C6    . A   A  1 136 ? -18.500 69.607  -21.702 1.00 147.42 ? 240 A   A C6    1 
ATOM   2934  N  N6    . A   A  1 136 ? -18.920 69.617  -20.435 1.00 153.51 ? 240 A   A N6    1 
ATOM   2935  N  N1    . A   A  1 136 ? -19.415 69.393  -22.671 1.00 148.28 ? 240 A   A N1    1 
ATOM   2936  C  C2    . A   A  1 136 ? -19.007 69.377  -23.944 1.00 147.76 ? 240 A   A C2    1 
ATOM   2937  N  N3    . A   A  1 136 ? -17.781 69.546  -24.432 1.00 146.49 ? 240 A   A N3    1 
ATOM   2938  C  C4    . A   A  1 136 ? -16.897 69.770  -23.445 1.00 145.63 ? 240 A   A C4    1 
ATOM   2939  P  P     . U   A  1 137 ? -13.603 74.542  -25.568 1.00 145.38 ? 241 U   A P     1 
ATOM   2940  O  OP1   . U   A  1 137 ? -12.832 75.256  -26.598 1.00 145.35 ? 241 U   A OP1   1 
ATOM   2941  O  OP2   . U   A  1 137 ? -13.408 74.795  -24.120 1.00 145.27 ? 241 U   A OP2   1 
ATOM   2942  O  "O5'" . U   A  1 137 ? -15.158 74.699  -25.871 1.00 146.91 ? 241 U   A "O5'" 1 
ATOM   2943  C  "C5'" . U   A  1 137 ? -15.644 74.463  -27.180 1.00 147.43 ? 241 U   A "C5'" 1 
ATOM   2944  C  "C4'" . U   A  1 137 ? -17.120 74.230  -27.176 1.00 148.75 ? 241 U   A "C4'" 1 
ATOM   2945  O  "O4'" . U   A  1 137 ? -17.467 73.456  -25.995 1.00 148.46 ? 241 U   A "O4'" 1 
ATOM   2946  C  "C3'" . U   A  1 137 ? -18.000 75.470  -27.138 1.00 150.47 ? 241 U   A "C3'" 1 
ATOM   2947  O  "O3'" . U   A  1 137 ? -19.155 75.232  -27.933 1.00 151.74 ? 241 U   A "O3'" 1 
ATOM   2948  C  "C2'" . U   A  1 137 ? -18.409 75.559  -25.670 1.00 165.01 ? 241 U   A "C2'" 1 
ATOM   2949  O  "O2'" . U   A  1 137 ? -19.622 76.259  -25.437 1.00 169.09 ? 241 U   A "O2'" 1 
ATOM   2950  C  "C1'" . U   A  1 137 ? -18.520 74.087  -25.305 1.00 149.95 ? 241 U   A "C1'" 1 
ATOM   2951  N  N1    . U   A  1 137 ? -18.387 73.798  -23.871 1.00 149.59 ? 241 U   A N1    1 
ATOM   2952  C  C2    . U   A  1 137 ? -19.514 73.317  -23.227 1.00 150.63 ? 241 U   A C2    1 
ATOM   2953  O  O2    . U   A  1 137 ? -20.573 73.124  -23.788 1.00 151.77 ? 241 U   A O2    1 
ATOM   2954  N  N3    . U   A  1 137 ? -19.368 73.058  -21.888 1.00 150.46 ? 241 U   A N3    1 
ATOM   2955  C  C4    . U   A  1 137 ? -18.227 73.230  -21.135 1.00 149.36 ? 241 U   A C4    1 
ATOM   2956  O  O4    . U   A  1 137 ? -18.257 72.947  -19.935 1.00 149.49 ? 241 U   A O4    1 
ATOM   2957  C  C5    . U   A  1 137 ? -17.102 73.739  -21.873 1.00 148.31 ? 241 U   A C5    1 
ATOM   2958  C  C6    . U   A  1 137 ? -17.217 73.996  -23.187 1.00 148.46 ? 241 U   A C6    1 
ATOM   2959  P  P     . C   A  1 138 ? -19.225 75.974  -29.336 1.00 152.65 ? 242 C   A P     1 
ATOM   2960  O  OP1   . C   A  1 138 ? -20.298 75.469  -30.203 1.00 153.83 ? 242 C   A OP1   1 
ATOM   2961  O  OP2   . C   A  1 138 ? -17.856 75.868  -29.834 1.00 151.24 ? 242 C   A OP2   1 
ATOM   2962  O  "O5'" . C   A  1 138 ? -19.546 77.491  -28.954 1.00 187.59 ? 242 C   A "O5'" 1 
ATOM   2963  C  "C5'" . C   A  1 138 ? -20.798 77.859  -28.353 1.00 191.00 ? 242 C   A "C5'" 1 
ATOM   2964  C  "C4'" . C   A  1 138 ? -21.210 79.286  -28.665 1.00 157.19 ? 242 C   A "C4'" 1 
ATOM   2965  O  "O4'" . C   A  1 138 ? -20.049 80.102  -28.936 1.00 156.46 ? 242 C   A "O4'" 1 
ATOM   2966  C  "C3'" . C   A  1 138 ? -22.137 79.431  -29.864 1.00 158.73 ? 242 C   A "C3'" 1 
ATOM   2967  O  "O3'" . C   A  1 138 ? -23.184 80.333  -29.565 1.00 160.74 ? 242 C   A "O3'" 1 
ATOM   2968  C  "C2'" . C   A  1 138 ? -21.247 80.008  -30.949 1.00 158.36 ? 242 C   A "C2'" 1 
ATOM   2969  O  "O2'" . C   A  1 138 ? -21.887 80.819  -31.897 1.00 160.11 ? 242 C   A "O2'" 1 
ATOM   2970  C  "C1'" . C   A  1 138 ? -20.200 80.776  -30.163 1.00 157.47 ? 242 C   A "C1'" 1 
ATOM   2971  N  N1    . C   A  1 138 ? -18.923 80.691  -30.849 1.00 156.15 ? 242 C   A N1    1 
ATOM   2972  C  C2    . C   A  1 138 ? -17.684 80.799  -30.236 1.00 154.71 ? 242 C   A C2    1 
ATOM   2973  O  O2    . C   A  1 138 ? -17.570 80.982  -29.015 1.00 154.41 ? 242 C   A O2    1 
ATOM   2974  N  N3    . C   A  1 138 ? -16.620 80.663  -31.043 1.00 153.80 ? 242 C   A N3    1 
ATOM   2975  C  C4    . C   A  1 138 ? -16.786 80.445  -32.353 1.00 154.33 ? 242 C   A C4    1 
ATOM   2976  N  N4    . C   A  1 138 ? -15.723 80.313  -33.137 1.00 153.62 ? 242 C   A N4    1 
ATOM   2977  C  C5    . C   A  1 138 ? -18.040 80.351  -32.977 1.00 155.81 ? 242 C   A C5    1 
ATOM   2978  C  C6    . C   A  1 138 ? -19.064 80.478  -32.173 1.00 156.64 ? 242 C   A C6    1 
ATOM   2979  P  P     . G   A  1 139 ? -24.706 79.917  -29.848 1.00 172.62 ? 243 G   A P     1 
ATOM   2980  O  OP1   . G   A  1 139 ? -25.400 81.171  -30.216 1.00 172.11 ? 243 G   A OP1   1 
ATOM   2981  O  OP2   . G   A  1 139 ? -25.220 79.090  -28.728 1.00 162.48 ? 243 G   A OP2   1 
ATOM   2982  O  "O5'" . G   A  1 139 ? -24.665 79.065  -31.191 1.00 162.24 ? 243 G   A "O5'" 1 
ATOM   2983  C  "C5'" . G   A  1 139 ? -24.488 79.697  -32.450 1.00 162.91 ? 243 G   A "C5'" 1 
ATOM   2984  C  "C4'" . G   A  1 139 ? -24.289 78.679  -33.531 1.00 162.37 ? 243 G   A "C4'" 1 
ATOM   2985  O  "O4'" . G   A  1 139 ? -23.128 77.847  -33.268 1.00 160.13 ? 243 G   A "O4'" 1 
ATOM   2986  C  "C3'" . G   A  1 139 ? -25.433 77.696  -33.606 1.00 163.34 ? 243 G   A "C3'" 1 
ATOM   2987  O  "O3'" . G   A  1 139 ? -26.571 78.210  -34.249 1.00 167.78 ? 243 G   A "O3'" 1 
ATOM   2988  C  "C2'" . G   A  1 139 ? -24.791 76.487  -34.254 1.00 166.24 ? 243 G   A "C2'" 1 
ATOM   2989  O  "O2'" . G   A  1 139 ? -24.572 76.731  -35.632 1.00 162.66 ? 243 G   A "O2'" 1 
ATOM   2990  C  "C1'" . G   A  1 139 ? -23.436 76.493  -33.556 1.00 170.33 ? 243 G   A "C1'" 1 
ATOM   2991  N  N9    . G   A  1 139 ? -23.463 75.762  -32.263 1.00 175.70 ? 243 G   A N9    1 
ATOM   2992  C  C8    . G   A  1 139 ? -22.867 76.272  -31.141 1.00 172.35 ? 243 G   A C8    1 
ATOM   2993  N  N7    . G   A  1 139 ? -22.963 75.529  -30.080 1.00 165.18 ? 243 G   A N7    1 
ATOM   2994  C  C5    . G   A  1 139 ? -23.664 74.436  -30.506 1.00 157.56 ? 243 G   A C5    1 
ATOM   2995  C  C6    . G   A  1 139 ? -24.055 73.325  -29.742 1.00 157.21 ? 243 G   A C6    1 
ATOM   2996  O  O6    . G   A  1 139 ? -23.836 73.090  -28.545 1.00 156.46 ? 243 G   A O6    1 
ATOM   2997  N  N1    . G   A  1 139 ? -24.743 72.421  -30.516 1.00 157.92 ? 243 G   A N1    1 
ATOM   2998  C  C2    . G   A  1 139 ? -25.029 72.587  -31.842 1.00 158.93 ? 243 G   A C2    1 
ATOM   2999  N  N2    . G   A  1 139 ? -25.716 71.580  -32.396 1.00 167.31 ? 243 G   A N2    1 
ATOM   3000  N  N3    . G   A  1 139 ? -24.681 73.638  -32.568 1.00 159.33 ? 243 G   A N3    1 
ATOM   3001  C  C4    . G   A  1 139 ? -23.987 74.537  -31.847 1.00 158.57 ? 243 G   A C4    1 
ATOM   3002  P  P     . C   A  1 140 ? -27.941 78.245  -33.420 1.00 171.45 ? 244 C   A P     1 
ATOM   3003  O  OP1   . C   A  1 140 ? -29.029 78.669  -34.322 1.00 179.41 ? 244 C   A OP1   1 
ATOM   3004  O  OP2   . C   A  1 140 ? -27.688 78.947  -32.138 1.00 168.30 ? 244 C   A OP2   1 
ATOM   3005  O  "O5'" . C   A  1 140 ? -28.187 76.728  -33.025 1.00 172.40 ? 244 C   A "O5'" 1 
ATOM   3006  C  "C5'" . C   A  1 140 ? -28.413 75.733  -34.010 1.00 166.76 ? 244 C   A "C5'" 1 
ATOM   3007  C  "C4'" . C   A  1 140 ? -28.992 74.508  -33.370 1.00 166.66 ? 244 C   A "C4'" 1 
ATOM   3008  O  "O4'" . C   A  1 140 ? -27.943 73.778  -32.692 1.00 164.27 ? 244 C   A "O4'" 1 
ATOM   3009  C  "C3'" . C   A  1 140 ? -30.004 74.788  -32.275 1.00 176.51 ? 244 C   A "C3'" 1 
ATOM   3010  O  "O3'" . C   A  1 140 ? -31.287 75.116  -32.779 1.00 182.30 ? 244 C   A "O3'" 1 
ATOM   3011  C  "C2'" . C   A  1 140 ? -29.948 73.515  -31.436 1.00 169.92 ? 244 C   A "C2'" 1 
ATOM   3012  O  "O2'" . C   A  1 140 ? -30.714 72.468  -32.014 1.00 167.82 ? 244 C   A "O2'" 1 
ATOM   3013  C  "C1'" . C   A  1 140 ? -28.465 73.155  -31.538 1.00 164.28 ? 244 C   A "C1'" 1 
ATOM   3014  N  N1    . C   A  1 140 ? -27.705 73.601  -30.356 1.00 164.22 ? 244 C   A N1    1 
ATOM   3015  C  C2    . C   A  1 140 ? -27.673 72.698  -29.312 1.00 164.62 ? 244 C   A C2    1 
ATOM   3016  O  O2    . C   A  1 140 ? -28.268 71.627  -29.467 1.00 166.20 ? 244 C   A O2    1 
ATOM   3017  N  N3    . C   A  1 140 ? -27.014 73.002  -28.182 1.00 165.27 ? 244 C   A N3    1 
ATOM   3018  C  C4    . C   A  1 140 ? -26.414 74.181  -28.067 1.00 167.93 ? 244 C   A C4    1 
ATOM   3019  N  N4    . C   A  1 140 ? -25.765 74.433  -26.927 1.00 169.80 ? 244 C   A N4    1 
ATOM   3020  C  C5    . C   A  1 140 ? -26.434 75.132  -29.127 1.00 167.02 ? 244 C   A C5    1 
ATOM   3021  C  C6    . C   A  1 140 ? -27.080 74.804  -30.254 1.00 165.16 ? 244 C   A C6    1 
ATOM   3022  P  P     . G   A  1 141 ? -32.488 75.472  -31.775 1.00 172.60 ? 245 G   A P     1 
ATOM   3023  O  OP1   . G   A  1 141 ? -33.559 76.106  -32.578 1.00 175.25 ? 245 G   A OP1   1 
ATOM   3024  O  OP2   . G   A  1 141 ? -31.939 76.212  -30.606 1.00 171.76 ? 245 G   A OP2   1 
ATOM   3025  O  "O5'" . G   A  1 141 ? -33.027 74.030  -31.372 1.00 178.39 ? 245 G   A "O5'" 1 
ATOM   3026  C  "C5'" . G   A  1 141 ? -33.903 73.824  -30.284 1.00 173.82 ? 245 G   A "C5'" 1 
ATOM   3027  C  "C4'" . G   A  1 141 ? -33.768 72.414  -29.790 1.00 172.64 ? 245 G   A "C4'" 1 
ATOM   3028  O  "O4'" . G   A  1 141 ? -32.366 72.070  -29.672 1.00 169.81 ? 245 G   A "O4'" 1 
ATOM   3029  C  "C3'" . G   A  1 141 ? -34.339 72.138  -28.417 1.00 173.35 ? 245 G   A "C3'" 1 
ATOM   3030  O  "O3'" . G   A  1 141 ? -35.726 71.900  -28.480 1.00 181.49 ? 245 G   A "O3'" 1 
ATOM   3031  C  "C2'" . G   A  1 141 ? -33.543 70.930  -27.950 1.00 177.33 ? 245 G   A "C2'" 1 
ATOM   3032  O  "O2'" . G   A  1 141 ? -34.064 69.734  -28.512 1.00 171.57 ? 245 G   A "O2'" 1 
ATOM   3033  C  "C1'" . G   A  1 141 ? -32.179 71.197  -28.582 1.00 174.21 ? 245 G   A "C1'" 1 
ATOM   3034  N  N9    . G   A  1 141 ? -31.182 71.757  -27.647 1.00 171.71 ? 245 G   A N9    1 
ATOM   3035  C  C8    . G   A  1 141 ? -30.398 72.863  -27.832 1.00 166.44 ? 245 G   A C8    1 
ATOM   3036  N  N7    . G   A  1 141 ? -29.574 73.070  -26.841 1.00 184.19 ? 245 G   A N7    1 
ATOM   3037  C  C5    . G   A  1 141 ? -29.800 72.034  -25.948 1.00 164.80 ? 245 G   A C5    1 
ATOM   3038  C  C6    . G   A  1 141 ? -29.211 71.727  -24.688 1.00 163.64 ? 245 G   A C6    1 
ATOM   3039  O  O6    . G   A  1 141 ? -28.335 72.290  -24.031 1.00 162.56 ? 245 G   A O6    1 
ATOM   3040  N  N1    . G   A  1 141 ? -29.766 70.598  -24.143 1.00 163.99 ? 245 G   A N1    1 
ATOM   3041  C  C2    . G   A  1 141 ? -30.740 69.837  -24.714 1.00 165.25 ? 245 G   A C2    1 
ATOM   3042  N  N2    . G   A  1 141 ? -31.113 68.766  -23.999 1.00 177.53 ? 245 G   A N2    1 
ATOM   3043  N  N3    . G   A  1 141 ? -31.298 70.104  -25.878 1.00 166.37 ? 245 G   A N3    1 
ATOM   3044  C  C4    . G   A  1 141 ? -30.781 71.208  -26.448 1.00 166.06 ? 245 G   A C4    1 
ATOM   3045  P  P     . C   A  1 142 ? -36.709 72.703  -27.510 1.00 187.12 ? 246 C   A P     1 
ATOM   3046  O  OP1   . C   A  1 142 ? -38.092 72.578  -28.042 1.00 193.76 ? 246 C   A OP1   1 
ATOM   3047  O  OP2   . C   A  1 142 ? -36.097 74.043  -27.320 1.00 186.00 ? 246 C   A OP2   1 
ATOM   3048  O  "O5'" . C   A  1 142 ? -36.583 71.941  -26.113 1.00 185.94 ? 246 C   A "O5'" 1 
ATOM   3049  C  "C5'" . C   A  1 142 ? -36.687 70.528  -26.029 1.00 183.48 ? 246 C   A "C5'" 1 
ATOM   3050  C  "C4'" . C   A  1 142 ? -36.092 70.003  -24.748 1.00 175.66 ? 246 C   A "C4'" 1 
ATOM   3051  O  "O4'" . C   A  1 142 ? -34.648 70.046  -24.796 1.00 172.74 ? 246 C   A "O4'" 1 
ATOM   3052  C  "C3'" . C   A  1 142 ? -36.442 70.767  -23.490 1.00 177.03 ? 246 C   A "C3'" 1 
ATOM   3053  O  "O3'" . C   A  1 142 ? -37.737 70.426  -23.032 1.00 179.70 ? 246 C   A "O3'" 1 
ATOM   3054  C  "C2'" . C   A  1 142 ? -35.317 70.373  -22.533 1.00 174.67 ? 246 C   A "C2'" 1 
ATOM   3055  O  "O2'" . C   A  1 142 ? -35.583 69.126  -21.912 1.00 174.67 ? 246 C   A "O2'" 1 
ATOM   3056  C  "C1'" . C   A  1 142 ? -34.132 70.200  -23.492 1.00 171.98 ? 246 C   A "C1'" 1 
ATOM   3057  N  N1    . C   A  1 142 ? -33.188 71.335  -23.483 1.00 171.94 ? 246 C   A N1    1 
ATOM   3058  C  C2    . C   A  1 142 ? -32.264 71.484  -22.440 1.00 169.33 ? 246 C   A C2    1 
ATOM   3059  O  O2    . C   A  1 142 ? -32.245 70.665  -21.519 1.00 169.04 ? 246 C   A O2    1 
ATOM   3060  N  N3    . C   A  1 142 ? -31.406 72.523  -22.468 1.00 168.37 ? 246 C   A N3    1 
ATOM   3061  C  C4    . C   A  1 142 ? -31.468 73.393  -23.472 1.00 174.92 ? 246 C   A C4    1 
ATOM   3062  N  N4    . C   A  1 142 ? -30.612 74.415  -23.469 1.00 175.45 ? 246 C   A N4    1 
ATOM   3063  C  C5    . C   A  1 142 ? -32.394 73.263  -24.547 1.00 174.58 ? 246 C   A C5    1 
ATOM   3064  C  C6    . C   A  1 142 ? -33.226 72.223  -24.514 1.00 173.70 ? 246 C   A C6    1 
ATOM   3065  P  P     . C   A  1 143 ? -38.548 71.424  -22.083 1.00 182.37 ? 247 C   A P     1 
ATOM   3066  O  OP1   . C   A  1 143 ? -39.891 70.869  -21.817 1.00 185.17 ? 247 C   A OP1   1 
ATOM   3067  O  OP2   . C   A  1 143 ? -38.427 72.745  -22.712 1.00 187.04 ? 247 C   A OP2   1 
ATOM   3068  O  "O5'" . C   A  1 143 ? -37.727 71.429  -20.723 1.00 181.04 ? 247 C   A "O5'" 1 
ATOM   3069  C  "C5'" . C   A  1 143 ? -37.650 70.250  -19.941 1.00 180.46 ? 247 C   A "C5'" 1 
ATOM   3070  C  "C4'" . C   A  1 143 ? -36.735 70.430  -18.762 1.00 183.04 ? 247 C   A "C4'" 1 
ATOM   3071  O  "O4'" . C   A  1 143 ? -35.367 70.634  -19.172 1.00 176.14 ? 247 C   A "O4'" 1 
ATOM   3072  C  "C3'" . C   A  1 143 ? -37.035 71.621  -17.882 1.00 183.76 ? 247 C   A "C3'" 1 
ATOM   3073  O  "O3'" . C   A  1 143 ? -38.126 71.353  -17.031 1.00 189.23 ? 247 C   A "O3'" 1 
ATOM   3074  C  "C2'" . C   A  1 143 ? -35.718 71.829  -17.142 1.00 182.55 ? 247 C   A "C2'" 1 
ATOM   3075  O  "O2'" . C   A  1 143 ? -35.597 70.940  -16.045 1.00 186.95 ? 247 C   A "O2'" 1 
ATOM   3076  C  "C1'" . C   A  1 143 ? -34.699 71.409  -18.201 1.00 175.75 ? 247 C   A "C1'" 1 
ATOM   3077  N  N1    . C   A  1 143 ? -34.054 72.540  -18.872 1.00 186.79 ? 247 C   A N1    1 
ATOM   3078  C  C2    . C   A  1 143 ? -33.068 73.279  -18.211 1.00 186.91 ? 247 C   A C2    1 
ATOM   3079  O  O2    . C   A  1 143 ? -32.760 73.012  -17.034 1.00 186.92 ? 247 C   A O2    1 
ATOM   3080  N  N3    . C   A  1 143 ? -32.486 74.304  -18.891 1.00 185.70 ? 247 C   A N3    1 
ATOM   3081  C  C4    . C   A  1 143 ? -32.849 74.562  -20.151 1.00 185.35 ? 247 C   A C4    1 
ATOM   3082  N  N4    . C   A  1 143 ? -32.270 75.569  -20.804 1.00 184.22 ? 247 C   A N4    1 
ATOM   3083  C  C5    . C   A  1 143 ? -33.839 73.797  -20.829 1.00 187.18 ? 247 C   A C5    1 
ATOM   3084  C  C6    . C   A  1 143 ? -34.407 72.794  -20.159 1.00 187.28 ? 247 C   A C6    1 
ATOM   3085  P  P     . U   A  1 144 ? -39.214 72.482  -16.731 1.00 196.10 ? 248 U   A P     1 
ATOM   3086  O  OP1   . U   A  1 144 ? -40.482 71.833  -16.311 1.00 190.15 ? 248 U   A OP1   1 
ATOM   3087  O  OP2   . U   A  1 144 ? -39.192 73.416  -17.882 1.00 187.20 ? 248 U   A OP2   1 
ATOM   3088  O  "O5'" . U   A  1 144 ? -38.606 73.229  -15.471 1.00 187.40 ? 248 U   A "O5'" 1 
ATOM   3089  C  "C5'" . U   A  1 144 ? -38.061 74.516  -15.636 1.00 194.53 ? 248 U   A "C5'" 1 
ATOM   3090  C  "C4'" . U   A  1 144 ? -37.133 74.896  -14.521 1.00 196.99 ? 248 U   A "C4'" 1 
ATOM   3091  O  "O4'" . U   A  1 144 ? -35.776 74.639  -14.966 1.00 189.15 ? 248 U   A "O4'" 1 
ATOM   3092  C  "C3'" . U   A  1 144 ? -37.158 76.381  -14.198 1.00 207.77 ? 248 U   A "C3'" 1 
ATOM   3093  O  "O3'" . U   A  1 144 ? -38.167 76.721  -13.267 1.00 216.76 ? 248 U   A "O3'" 1 
ATOM   3094  C  "C2'" . U   A  1 144 ? -35.732 76.672  -13.765 1.00 202.91 ? 248 U   A "C2'" 1 
ATOM   3095  O  "O2'" . U   A  1 144 ? -35.514 76.241  -12.432 1.00 209.99 ? 248 U   A "O2'" 1 
ATOM   3096  C  "C1'" . U   A  1 144 ? -34.956 75.753  -14.702 1.00 196.63 ? 248 U   A "C1'" 1 
ATOM   3097  N  N1    . U   A  1 144 ? -34.670 76.390  -16.013 1.00 200.34 ? 248 U   A N1    1 
ATOM   3098  C  C2    . U   A  1 144 ? -33.664 77.322  -16.136 1.00 202.06 ? 248 U   A C2    1 
ATOM   3099  O  O2    . U   A  1 144 ? -32.980 77.686  -15.200 1.00 202.44 ? 248 U   A O2    1 
ATOM   3100  N  N3    . U   A  1 144 ? -33.491 77.824  -17.405 1.00 203.53 ? 248 U   A N3    1 
ATOM   3101  C  C4    . U   A  1 144 ? -34.195 77.499  -18.547 1.00 205.02 ? 248 U   A C4    1 
ATOM   3102  O  O4    . U   A  1 144 ? -33.929 78.033  -19.624 1.00 203.52 ? 248 U   A O4    1 
ATOM   3103  C  C5    . U   A  1 144 ? -35.211 76.525  -18.343 1.00 203.05 ? 248 U   A C5    1 
ATOM   3104  C  C6    . U   A  1 144 ? -35.392 76.022  -17.125 1.00 202.58 ? 248 U   A C6    1 
ATOM   3105  P  P     . A   A  1 145 ? -39.321 77.753  -13.697 1.00 214.33 ? 249 A   A P     1 
ATOM   3106  O  OP1   . A   A  1 145 ? -40.653 77.120  -13.524 1.00 219.83 ? 249 A   A OP1   1 
ATOM   3107  O  OP2   . A   A  1 145 ? -38.956 78.241  -15.049 1.00 215.94 ? 249 A   A OP2   1 
ATOM   3108  O  "O5'" . A   A  1 145 ? -39.147 78.956  -12.663 1.00 208.72 ? 249 A   A "O5'" 1 
ATOM   3109  C  "C5'" . A   A  1 145 ? -40.238 79.805  -12.321 1.00 207.18 ? 249 A   A "C5'" 1 
ATOM   3110  C  "C4'" . A   A  1 145 ? -39.791 80.978  -11.486 1.00 207.11 ? 249 A   A "C4'" 1 
ATOM   3111  O  "O4'" . A   A  1 145 ? -38.546 81.510  -12.019 1.00 202.85 ? 249 A   A "O4'" 1 
ATOM   3112  C  "C3'" . A   A  1 145 ? -40.771 82.148  -11.441 1.00 211.76 ? 249 A   A "C3'" 1 
ATOM   3113  O  "O3'" . A   A  1 145 ? -40.680 82.787  -10.168 1.00 213.51 ? 249 A   A "O3'" 1 
ATOM   3114  C  "C2'" . A   A  1 145 ? -40.215 83.081  -12.510 1.00 209.19 ? 249 A   A "C2'" 1 
ATOM   3115  O  "O2'" . A   A  1 145 ? -40.599 84.436  -12.393 1.00 209.35 ? 249 A   A "O2'" 1 
ATOM   3116  C  "C1'" . A   A  1 145 ? -38.713 82.877  -12.333 1.00 204.65 ? 249 A   A "C1'" 1 
ATOM   3117  N  N9    . A   A  1 145 ? -37.941 83.203  -13.525 1.00 202.26 ? 249 A   A N9    1 
ATOM   3118  C  C8    . A   A  1 145 ? -38.179 82.808  -14.811 1.00 201.79 ? 249 A   A C8    1 
ATOM   3119  N  N7    . A   A  1 145 ? -37.322 83.304  -15.668 1.00 199.51 ? 249 A   A N7    1 
ATOM   3120  C  C5    . A   A  1 145 ? -36.485 84.086  -14.885 1.00 198.10 ? 249 A   A C5    1 
ATOM   3121  C  C6    . A   A  1 145 ? -35.373 84.881  -15.187 1.00 195.10 ? 249 A   A C6    1 
ATOM   3122  N  N6    . A   A  1 145 ? -34.888 85.030  -16.418 1.00 191.54 ? 249 A   A N6    1 
ATOM   3123  N  N1    . A   A  1 145 ? -34.748 85.504  -14.167 1.00 197.76 ? 249 A   A N1    1 
ATOM   3124  C  C2    . A   A  1 145 ? -35.224 85.362  -12.926 1.00 200.81 ? 249 A   A C2    1 
ATOM   3125  N  N3    . A   A  1 145 ? -36.267 84.647  -12.519 1.00 202.50 ? 249 A   A N3    1 
ATOM   3126  C  C4    . A   A  1 145 ? -36.853 84.031  -13.560 1.00 200.38 ? 249 A   A C4    1 
ATOM   3127  N  N     . ASP B  2 11  ? 1.377   -56.464 -25.770 1.00 131.90 ? 11  ASP B N     1 
ATOM   3128  C  CA    . ASP B  2 11  ? 0.167   -55.647 -25.824 1.00 163.50 ? 11  ASP B CA    1 
ATOM   3129  C  C     . ASP B  2 11  ? 0.480   -54.277 -26.468 1.00 148.16 ? 11  ASP B C     1 
ATOM   3130  O  O     . ASP B  2 11  ? 0.534   -53.248 -25.787 1.00 140.35 ? 11  ASP B O     1 
ATOM   3131  C  CB    . ASP B  2 11  ? -0.424  -55.490 -24.404 1.00 158.12 ? 11  ASP B CB    1 
ATOM   3132  C  CG    . ASP B  2 11  ? -1.744  -54.686 -24.379 1.00 163.00 ? 11  ASP B CG    1 
ATOM   3133  O  OD1   . ASP B  2 11  ? -2.312  -54.480 -25.456 1.00 162.67 ? 11  ASP B OD1   1 
ATOM   3134  O  OD2   . ASP B  2 11  ? -2.182  -54.275 -23.301 1.00 167.35 ? 11  ASP B OD2   1 
ATOM   3135  N  N     . GLN B  2 12  ? 0.627   -54.276 -27.799 1.00 141.68 ? 12  GLN B N     1 
ATOM   3136  C  CA    . GLN B  2 12  ? 1.384   -53.220 -28.475 1.00 134.51 ? 12  GLN B CA    1 
ATOM   3137  C  C     . GLN B  2 12  ? 0.704   -51.851 -28.384 1.00 128.86 ? 12  GLN B C     1 
ATOM   3138  O  O     . GLN B  2 12  ? 1.347   -50.856 -28.033 1.00 111.24 ? 12  GLN B O     1 
ATOM   3139  C  CB    . GLN B  2 12  ? 1.633   -53.611 -29.937 1.00 132.65 ? 12  GLN B CB    1 
ATOM   3140  C  CG    . GLN B  2 12  ? 3.078   -54.049 -30.247 1.00 129.22 ? 12  GLN B CG    1 
ATOM   3141  C  CD    . GLN B  2 12  ? 4.109   -52.921 -30.127 1.00 124.14 ? 12  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B  2 12  ? 3.757   -51.759 -29.930 1.00 111.70 ? 12  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B  2 12  ? 5.390   -53.272 -30.243 1.00 115.18 ? 12  GLN B NE2   1 
ATOM   3144  N  N     . ASP B  2 13  ? -0.597  -51.790 -28.666 1.00 126.21 ? 13  ASP B N     1 
ATOM   3145  C  CA    . ASP B  2 13  ? -1.307  -50.542 -28.916 1.00 123.53 ? 13  ASP B CA    1 
ATOM   3146  C  C     . ASP B  2 13  ? -1.963  -49.934 -27.677 1.00 119.27 ? 13  ASP B C     1 
ATOM   3147  O  O     . ASP B  2 13  ? -2.803  -49.047 -27.812 1.00 114.14 ? 13  ASP B O     1 
ATOM   3148  C  CB    . ASP B  2 13  ? -2.376  -50.756 -29.998 1.00 133.27 ? 13  ASP B CB    1 
ATOM   3149  C  CG    . ASP B  2 13  ? -2.881  -49.435 -30.614 1.00 137.62 ? 13  ASP B CG    1 
ATOM   3150  O  OD1   . ASP B  2 13  ? -2.041  -48.578 -30.988 1.00 138.58 ? 13  ASP B OD1   1 
ATOM   3151  O  OD2   . ASP B  2 13  ? -4.119  -49.249 -30.718 1.00 138.48 ? 13  ASP B OD2   1 
ATOM   3152  N  N     . ARG B  2 14  ? -1.628  -50.366 -26.473 1.00 113.76 ? 14  ARG B N     1 
ATOM   3153  C  CA    . ARG B  2 14  ? -2.056  -49.593 -25.316 1.00 112.44 ? 14  ARG B CA    1 
ATOM   3154  C  C     . ARG B  2 14  ? -0.872  -49.028 -24.568 1.00 109.56 ? 14  ARG B C     1 
ATOM   3155  O  O     . ARG B  2 14  ? -0.882  -48.980 -23.335 1.00 110.31 ? 14  ARG B O     1 
ATOM   3156  C  CB    . ARG B  2 14  ? -2.918  -50.416 -24.368 1.00 116.94 ? 14  ARG B CB    1 
ATOM   3157  C  CG    . ARG B  2 14  ? -4.102  -51.008 -25.040 1.00 137.84 ? 14  ARG B CG    1 
ATOM   3158  C  CD    . ARG B  2 14  ? -4.938  -49.991 -25.727 1.00 117.85 ? 14  ARG B CD    1 
ATOM   3159  N  NE    . ARG B  2 14  ? -5.649  -49.219 -24.734 1.00 117.13 ? 14  ARG B NE    1 
ATOM   3160  C  CZ    . ARG B  2 14  ? -6.738  -49.640 -24.101 1.00 120.87 ? 14  ARG B CZ    1 
ATOM   3161  N  NH1   . ARG B  2 14  ? -7.244  -50.838 -24.360 1.00 131.92 ? 14  ARG B NH1   1 
ATOM   3162  N  NH2   . ARG B  2 14  ? -7.327  -48.863 -23.203 1.00 120.16 ? 14  ARG B NH2   1 
ATOM   3163  N  N     . PHE B  2 15  ? 0.183   -48.686 -25.288 1.00 106.83 ? 15  PHE B N     1 
ATOM   3164  C  CA    . PHE B  2 15  ? 1.285   -47.960 -24.685 1.00 103.83 ? 15  PHE B CA    1 
ATOM   3165  C  C     . PHE B  2 15  ? 0.924   -46.481 -24.598 1.00 112.91 ? 15  PHE B C     1 
ATOM   3166  O  O     . PHE B  2 15  ? 0.194   -45.960 -25.447 1.00 114.89 ? 15  PHE B O     1 
ATOM   3167  C  CB    . PHE B  2 15  ? 2.567   -48.143 -25.496 1.00 104.11 ? 15  PHE B CB    1 
ATOM   3168  C  CG    . PHE B  2 15  ? 3.151   -49.537 -25.435 1.00 107.56 ? 15  PHE B CG    1 
ATOM   3169  C  CD1   . PHE B  2 15  ? 2.430   -50.591 -24.920 1.00 110.46 ? 15  PHE B CD1   1 
ATOM   3170  C  CD2   . PHE B  2 15  ? 4.427   -49.779 -25.899 1.00 105.43 ? 15  PHE B CD2   1 
ATOM   3171  C  CE1   . PHE B  2 15  ? 2.978   -51.825 -24.868 1.00 113.65 ? 15  PHE B CE1   1 
ATOM   3172  C  CE2   . PHE B  2 15  ? 4.971   -51.012 -25.847 1.00 108.67 ? 15  PHE B CE2   1 
ATOM   3173  C  CZ    . PHE B  2 15  ? 4.247   -52.035 -25.331 1.00 112.79 ? 15  PHE B CZ    1 
ATOM   3174  N  N     . ILE B  2 16  ? 1.380   -45.813 -23.527 1.00 105.61 ? 16  ILE B N     1 
ATOM   3175  C  CA    . ILE B  2 16  ? 1.163   -44.368 -23.410 1.00 98.59  ? 16  ILE B CA    1 
ATOM   3176  C  C     . ILE B  2 16  ? 2.087   -43.629 -24.358 1.00 99.24  ? 16  ILE B C     1 
ATOM   3177  O  O     . ILE B  2 16  ? 3.152   -44.135 -24.771 1.00 101.73 ? 16  ILE B O     1 
ATOM   3178  C  CB    . ILE B  2 16  ? 1.342   -43.847 -21.976 1.00 95.30  ? 16  ILE B CB    1 
ATOM   3179  C  CG1   . ILE B  2 16  ? 2.742   -44.153 -21.450 1.00 95.18  ? 16  ILE B CG1   1 
ATOM   3180  C  CG2   . ILE B  2 16  ? 0.247   -44.353 -21.088 1.00 124.43 ? 16  ILE B CG2   1 
ATOM   3181  C  CD1   . ILE B  2 16  ? 3.664   -43.025 -21.485 1.00 91.95  ? 16  ILE B CD1   1 
ATOM   3182  N  N     . CYS B  2 17  ? 1.712   -42.378 -24.635 1.00 96.40  ? 17  CYS B N     1 
ATOM   3183  C  CA    . CYS B  2 17  ? 2.387   -41.565 -25.631 1.00 87.68  ? 17  CYS B CA    1 
ATOM   3184  C  C     . CYS B  2 17  ? 3.203   -40.457 -24.989 1.00 85.37  ? 17  CYS B C     1 
ATOM   3185  O  O     . CYS B  2 17  ? 2.824   -39.879 -23.983 1.00 85.06  ? 17  CYS B O     1 
ATOM   3186  C  CB    . CYS B  2 17  ? 1.367   -40.974 -26.589 1.00 156.63 ? 17  CYS B CB    1 
ATOM   3187  S  SG    . CYS B  2 17  ? 0.502   -42.217 -27.525 1.00 142.71 ? 17  CYS B SG    1 
ATOM   3188  N  N     . ILE B  2 18  ? 4.354   -40.216 -25.558 1.00 84.16  ? 18  ILE B N     1 
ATOM   3189  C  CA    . ILE B  2 18  ? 5.183   -39.087 -25.241 1.00 89.63  ? 18  ILE B CA    1 
ATOM   3190  C  C     . ILE B  2 18  ? 5.630   -38.560 -26.574 1.00 101.20 ? 18  ILE B C     1 
ATOM   3191  O  O     . ILE B  2 18  ? 6.255   -39.294 -27.333 1.00 110.89 ? 18  ILE B O     1 
ATOM   3192  C  CB    . ILE B  2 18  ? 6.381   -39.484 -24.384 1.00 82.49  ? 18  ILE B CB    1 
ATOM   3193  C  CG1   . ILE B  2 18  ? 5.923   -39.728 -22.981 1.00 83.65  ? 18  ILE B CG1   1 
ATOM   3194  C  CG2   . ILE B  2 18  ? 7.529   -38.522 -24.523 1.00 80.84  ? 18  ILE B CG2   1 
ATOM   3195  C  CD1   . ILE B  2 18  ? 7.020   -40.198 -22.126 1.00 84.45  ? 18  ILE B CD1   1 
ATOM   3196  N  N     . TYR B  2 19  ? 5.293   -37.318 -26.876 1.00 101.09 ? 19  TYR B N     1 
ATOM   3197  C  CA    . TYR B  2 19  ? 5.694   -36.543 -28.032 1.00 79.11  ? 19  TYR B CA    1 
ATOM   3198  C  C     . TYR B  2 19  ? 6.775   -35.583 -27.585 1.00 77.97  ? 19  TYR B C     1 
ATOM   3199  O  O     . TYR B  2 19  ? 6.813   -35.241 -26.412 1.00 77.52  ? 19  TYR B O     1 
ATOM   3200  C  CB    . TYR B  2 19  ? 4.540   -35.735 -28.578 1.00 78.87  ? 19  TYR B CB    1 
ATOM   3201  C  CG    . TYR B  2 19  ? 3.360   -36.434 -29.191 1.00 80.17  ? 19  TYR B CG    1 
ATOM   3202  C  CD1   . TYR B  2 19  ? 2.246   -36.732 -28.434 1.00 80.75  ? 19  TYR B CD1   1 
ATOM   3203  C  CD2   . TYR B  2 19  ? 3.300   -36.675 -30.544 1.00 81.12  ? 19  TYR B CD2   1 
ATOM   3204  C  CE1   . TYR B  2 19  ? 1.137   -37.301 -28.983 1.00 82.20  ? 19  TYR B CE1   1 
ATOM   3205  C  CE2   . TYR B  2 19  ? 2.178   -37.243 -31.105 1.00 82.59  ? 19  TYR B CE2   1 
ATOM   3206  C  CZ    . TYR B  2 19  ? 1.106   -37.562 -30.316 1.00 83.09  ? 19  TYR B CZ    1 
ATOM   3207  O  OH    . TYR B  2 19  ? -0.007  -38.145 -30.860 1.00 84.87  ? 19  TYR B OH    1 
ATOM   3208  N  N     . PRO B  2 20  ? 7.697   -35.119 -28.427 1.00 77.83  ? 20  PRO B N     1 
ATOM   3209  C  CA    . PRO B  2 20  ? 8.774   -34.271 -27.893 1.00 77.17  ? 20  PRO B CA    1 
ATOM   3210  C  C     . PRO B  2 20  ? 8.250   -33.038 -27.172 1.00 84.14  ? 20  PRO B C     1 
ATOM   3211  O  O     . PRO B  2 20  ? 8.753   -32.672 -26.100 1.00 86.60  ? 20  PRO B O     1 
ATOM   3212  C  CB    . PRO B  2 20  ? 9.555   -33.875 -29.140 1.00 77.66  ? 20  PRO B CB    1 
ATOM   3213  C  CG    . PRO B  2 20  ? 9.178   -34.819 -30.173 1.00 78.68  ? 20  PRO B CG    1 
ATOM   3214  C  CD    . PRO B  2 20  ? 7.777   -35.245 -29.885 1.00 78.65  ? 20  PRO B CD    1 
ATOM   3215  N  N     . ALA B  2 21  ? 7.199   -32.421 -27.727 1.00 81.04  ? 21  ALA B N     1 
ATOM   3216  C  CA    . ALA B  2 21  ? 6.681   -31.146 -27.233 1.00 77.92  ? 21  ALA B CA    1 
ATOM   3217  C  C     . ALA B  2 21  ? 6.310   -31.177 -25.761 1.00 75.57  ? 21  ALA B C     1 
ATOM   3218  O  O     . ALA B  2 21  ? 6.445   -30.172 -25.076 1.00 75.43  ? 21  ALA B O     1 
ATOM   3219  C  CB    . ALA B  2 21  ? 5.465   -30.726 -28.049 1.00 78.62  ? 21  ALA B CB    1 
ATOM   3220  N  N     . TYR B  2 22  ? 5.871   -32.302 -25.238 1.00 75.95  ? 22  TYR B N     1 
ATOM   3221  C  CA    . TYR B  2 22  ? 5.491   -32.306 -23.837 1.00 76.24  ? 22  TYR B CA    1 
ATOM   3222  C  C     . TYR B  2 22  ? 6.617   -31.805 -22.956 1.00 76.19  ? 22  TYR B C     1 
ATOM   3223  O  O     . TYR B  2 22  ? 6.367   -31.367 -21.831 1.00 76.59  ? 22  TYR B O     1 
ATOM   3224  C  CB    . TYR B  2 22  ? 5.068   -33.711 -23.384 1.00 113.53 ? 22  TYR B CB    1 
ATOM   3225  C  CG    . TYR B  2 22  ? 3.836   -34.302 -24.051 1.00 101.44 ? 22  TYR B CG    1 
ATOM   3226  C  CD1   . TYR B  2 22  ? 2.565   -33.905 -23.683 1.00 94.46  ? 22  TYR B CD1   1 
ATOM   3227  C  CD2   . TYR B  2 22  ? 3.946   -35.273 -25.015 1.00 94.56  ? 22  TYR B CD2   1 
ATOM   3228  C  CE1   . TYR B  2 22  ? 1.443   -34.443 -24.266 1.00 92.20  ? 22  TYR B CE1   1 
ATOM   3229  C  CE2   . TYR B  2 22  ? 2.838   -35.804 -25.599 1.00 95.30  ? 22  TYR B CE2   1 
ATOM   3230  C  CZ    . TYR B  2 22  ? 1.589   -35.392 -25.226 1.00 92.42  ? 22  TYR B CZ    1 
ATOM   3231  O  OH    . TYR B  2 22  ? 0.488   -35.943 -25.819 1.00 80.77  ? 22  TYR B OH    1 
ATOM   3232  N  N     . LEU B  2 23  ? 7.862   -31.910 -23.411 1.00 76.03  ? 23  LEU B N     1 
ATOM   3233  C  CA    . LEU B  2 23  ? 8.976   -31.501 -22.569 1.00 90.98  ? 23  LEU B CA    1 
ATOM   3234  C  C     . LEU B  2 23  ? 9.761   -30.308 -23.089 1.00 91.50  ? 23  LEU B C     1 
ATOM   3235  O  O     . LEU B  2 23  ? 10.707  -29.871 -22.425 1.00 76.57  ? 23  LEU B O     1 
ATOM   3236  C  CB    . LEU B  2 23  ? 9.952   -32.661 -22.375 1.00 88.09  ? 23  LEU B CB    1 
ATOM   3237  C  CG    . LEU B  2 23  ? 9.340   -34.027 -22.161 1.00 88.06  ? 23  LEU B CG    1 
ATOM   3238  C  CD1   . LEU B  2 23  ? 10.449  -35.008 -21.928 1.00 90.06  ? 23  LEU B CD1   1 
ATOM   3239  C  CD2   . LEU B  2 23  ? 8.403   -34.020 -21.004 1.00 84.79  ? 23  LEU B CD2   1 
ATOM   3240  N  N     . ASN B  2 24  ? 9.399   -29.740 -24.228 1.00 88.81  ? 24  ASN B N     1 
ATOM   3241  C  CA    . ASN B  2 24  ? 10.274  -28.741 -24.827 1.00 95.42  ? 24  ASN B CA    1 
ATOM   3242  C  C     . ASN B  2 24  ? 10.036  -27.413 -24.135 1.00 105.75 ? 24  ASN B C     1 
ATOM   3243  O  O     . ASN B  2 24  ? 8.993   -26.781 -24.339 1.00 110.51 ? 24  ASN B O     1 
ATOM   3244  C  CB    . ASN B  2 24  ? 10.017  -28.634 -26.322 1.00 94.42  ? 24  ASN B CB    1 
ATOM   3245  C  CG    . ASN B  2 24  ? 11.104  -27.908 -27.018 1.00 102.23 ? 24  ASN B CG    1 
ATOM   3246  O  OD1   . ASN B  2 24  ? 12.214  -27.816 -26.499 1.00 105.33 ? 24  ASN B OD1   1 
ATOM   3247  N  ND2   . ASN B  2 24  ? 10.811  -27.377 -28.188 1.00 105.71 ? 24  ASN B ND2   1 
ATOM   3248  N  N     . ASN B  2 25  ? 11.028  -26.937 -23.378 1.00 107.56 ? 25  ASN B N     1 
ATOM   3249  C  CA    . ASN B  2 25  ? 10.765  -25.750 -22.572 1.00 101.19 ? 25  ASN B CA    1 
ATOM   3250  C  C     . ASN B  2 25  ? 10.577  -24.503 -23.407 1.00 91.35  ? 25  ASN B C     1 
ATOM   3251  O  O     . ASN B  2 25  ? 10.033  -23.521 -22.917 1.00 84.23  ? 25  ASN B O     1 
ATOM   3252  C  CB    . ASN B  2 25  ? 11.904  -25.542 -21.579 1.00 98.34  ? 25  ASN B CB    1 
ATOM   3253  C  CG    . ASN B  2 25  ? 13.208  -25.185 -22.256 1.00 97.82  ? 25  ASN B CG    1 
ATOM   3254  O  OD1   . ASN B  2 25  ? 13.273  -25.016 -23.471 1.00 100.07 ? 25  ASN B OD1   1 
ATOM   3255  N  ND2   . ASN B  2 25  ? 14.270  -25.111 -21.468 1.00 100.25 ? 25  ASN B ND2   1 
ATOM   3256  N  N     . LYS B  2 26  ? 10.866  -24.559 -24.683 1.00 78.85  ? 26  LYS B N     1 
ATOM   3257  C  CA    . LYS B  2 26  ? 10.655  -23.406 -25.515 1.00 84.63  ? 26  LYS B CA    1 
ATOM   3258  C  C     . LYS B  2 26  ? 9.341   -23.526 -26.251 1.00 79.37  ? 26  LYS B C     1 
ATOM   3259  O  O     . LYS B  2 26  ? 9.194   -23.012 -27.360 1.00 86.81  ? 26  LYS B O     1 
ATOM   3260  C  CB    . LYS B  2 26  ? 11.871  -23.168 -26.418 1.00 91.97  ? 26  LYS B CB    1 
ATOM   3261  C  CG    . LYS B  2 26  ? 13.033  -22.720 -25.505 1.00 98.48  ? 26  LYS B CG    1 
ATOM   3262  C  CD    . LYS B  2 26  ? 14.299  -22.114 -26.123 1.00 101.77 ? 26  LYS B CD    1 
ATOM   3263  C  CE    . LYS B  2 26  ? 14.867  -22.825 -27.316 1.00 100.82 ? 26  LYS B CE    1 
ATOM   3264  N  NZ    . LYS B  2 26  ? 16.012  -22.032 -27.864 1.00 100.50 ? 26  LYS B NZ    1 
ATOM   3265  N  N     . LYS B  2 27  ? 8.439   -24.333 -25.724 1.00 78.09  ? 27  LYS B N     1 
ATOM   3266  C  CA    . LYS B  2 27  ? 7.068   -24.380 -26.194 1.00 87.02  ? 27  LYS B CA    1 
ATOM   3267  C  C     . LYS B  2 27  ? 6.128   -24.042 -25.045 1.00 88.22  ? 27  LYS B C     1 
ATOM   3268  O  O     . LYS B  2 27  ? 6.476   -24.205 -23.874 1.00 77.49  ? 27  LYS B O     1 
ATOM   3269  C  CB    . LYS B  2 27  ? 6.740   -25.736 -26.825 1.00 83.93  ? 27  LYS B CB    1 
ATOM   3270  C  CG    . LYS B  2 27  ? 7.199   -25.853 -28.292 1.00 80.55  ? 27  LYS B CG    1 
ATOM   3271  C  CD    . LYS B  2 27  ? 6.937   -27.225 -28.884 1.00 78.65  ? 27  LYS B CD    1 
ATOM   3272  C  CE    . LYS B  2 27  ? 6.260   -27.168 -30.235 1.00 78.00  ? 27  LYS B CE    1 
ATOM   3273  N  NZ    . LYS B  2 27  ? 4.866   -26.726 -30.147 1.00 77.96  ? 27  LYS B NZ    1 
ATOM   3274  N  N     . THR B  2 28  ? 4.964   -23.500 -25.393 1.00 88.44  ? 28  THR B N     1 
ATOM   3275  C  CA    . THR B  2 28  ? 3.929   -23.120 -24.445 1.00 93.87  ? 28  THR B CA    1 
ATOM   3276  C  C     . THR B  2 28  ? 2.905   -24.203 -24.220 1.00 97.77  ? 28  THR B C     1 
ATOM   3277  O  O     . THR B  2 28  ? 2.787   -25.150 -24.987 1.00 101.08 ? 28  THR B O     1 
ATOM   3278  C  CB    . THR B  2 28  ? 3.158   -21.940 -24.950 1.00 101.66 ? 28  THR B CB    1 
ATOM   3279  O  OG1   . THR B  2 28  ? 2.593   -22.308 -26.212 1.00 95.35  ? 28  THR B OG1   1 
ATOM   3280  C  CG2   . THR B  2 28  ? 4.081   -20.775 -25.110 1.00 114.54 ? 28  THR B CG2   1 
ATOM   3281  N  N     . ILE B  2 29  ? 2.027   -23.941 -23.259 1.00 73.40  ? 29  ILE B N     1 
ATOM   3282  C  CA    . ILE B  2 29  ? 0.955   -24.877 -22.949 1.00 73.03  ? 29  ILE B CA    1 
ATOM   3283  C  C     . ILE B  2 29  ? 0.000   -25.037 -24.124 1.00 73.53  ? 29  ILE B C     1 
ATOM   3284  O  O     . ILE B  2 29  ? -0.426  -26.146 -24.446 1.00 74.49  ? 29  ILE B O     1 
ATOM   3285  C  CB    . ILE B  2 29  ? 0.231   -24.445 -21.664 1.00 71.16  ? 29  ILE B CB    1 
ATOM   3286  C  CG1   . ILE B  2 29  ? 1.086   -24.809 -20.454 1.00 71.27  ? 29  ILE B CG1   1 
ATOM   3287  C  CG2   . ILE B  2 29  ? -1.147  -25.043 -21.591 1.00 70.60  ? 29  ILE B CG2   1 
ATOM   3288  C  CD1   . ILE B  2 29  ? 0.404   -24.573 -19.151 1.00 69.94  ? 29  ILE B CD1   1 
ATOM   3289  N  N     . ALA B  2 30  ? -0.365  -23.952 -24.779 1.00 73.02  ? 30  ALA B N     1 
ATOM   3290  C  CA    . ALA B  2 30  ? -1.189  -24.113 -25.970 1.00 95.45  ? 30  ALA B CA    1 
ATOM   3291  C  C     . ALA B  2 30  ? -0.447  -24.879 -27.051 1.00 99.34  ? 30  ALA B C     1 
ATOM   3292  O  O     . ALA B  2 30  ? -1.063  -25.381 -27.989 1.00 77.58  ? 30  ALA B O     1 
ATOM   3293  C  CB    . ALA B  2 30  ? -1.670  -22.762 -26.492 1.00 107.72 ? 30  ALA B CB    1 
ATOM   3294  N  N     . GLU B  2 31  ? 0.873   -24.863 -27.013 1.00 99.92  ? 31  GLU B N     1 
ATOM   3295  C  CA    . GLU B  2 31  ? 1.666   -25.618 -27.970 1.00 115.87 ? 31  GLU B CA    1 
ATOM   3296  C  C     . GLU B  2 31  ? 1.870   -27.094 -27.606 1.00 128.89 ? 31  GLU B C     1 
ATOM   3297  O  O     . GLU B  2 31  ? 2.460   -27.827 -28.410 1.00 137.04 ? 31  GLU B O     1 
ATOM   3298  C  CB    . GLU B  2 31  ? 3.009   -24.931 -28.130 1.00 119.22 ? 31  GLU B CB    1 
ATOM   3299  C  CG    . GLU B  2 31  ? 2.891   -23.629 -28.870 1.00 125.93 ? 31  GLU B CG    1 
ATOM   3300  C  CD    . GLU B  2 31  ? 4.114   -22.767 -28.686 1.00 126.93 ? 31  GLU B CD    1 
ATOM   3301  O  OE1   . GLU B  2 31  ? 4.679   -22.808 -27.569 1.00 128.27 ? 31  GLU B OE1   1 
ATOM   3302  O  OE2   . GLU B  2 31  ? 4.510   -22.069 -29.650 1.00 126.74 ? 31  GLU B OE2   1 
ATOM   3303  N  N     . GLY B  2 32  ? 1.419   -27.553 -26.436 1.00 125.16 ? 32  GLY B N     1 
ATOM   3304  C  CA    . GLY B  2 32  ? 1.504   -28.961 -26.064 1.00 119.85 ? 32  GLY B CA    1 
ATOM   3305  C  C     . GLY B  2 32  ? 2.299   -29.279 -24.808 1.00 122.28 ? 32  GLY B C     1 
ATOM   3306  O  O     . GLY B  2 32  ? 2.262   -30.425 -24.346 1.00 131.54 ? 32  GLY B O     1 
ATOM   3307  N  N     . ARG B  2 33  ? 3.011   -28.333 -24.226 1.00 79.01  ? 33  ARG B N     1 
ATOM   3308  C  CA    . ARG B  2 33  ? 3.811   -28.595 -23.040 1.00 78.70  ? 33  ARG B CA    1 
ATOM   3309  C  C     . ARG B  2 33  ? 2.931   -29.044 -21.874 1.00 77.29  ? 33  ARG B C     1 
ATOM   3310  O  O     . ARG B  2 33  ? 1.788   -28.609 -21.747 1.00 75.87  ? 33  ARG B O     1 
ATOM   3311  C  CB    . ARG B  2 33  ? 4.592   -27.330 -22.703 1.00 96.52  ? 33  ARG B CB    1 
ATOM   3312  C  CG    . ARG B  2 33  ? 5.445   -27.361 -21.469 1.00 109.65 ? 33  ARG B CG    1 
ATOM   3313  C  CD    . ARG B  2 33  ? 6.312   -26.110 -21.461 1.00 116.73 ? 33  ARG B CD    1 
ATOM   3314  N  NE    . ARG B  2 33  ? 5.486   -24.912 -21.561 1.00 116.09 ? 33  ARG B NE    1 
ATOM   3315  C  CZ    . ARG B  2 33  ? 4.773   -24.414 -20.559 1.00 115.33 ? 33  ARG B CZ    1 
ATOM   3316  N  NH1   . ARG B  2 33  ? 4.796   -24.986 -19.361 1.00 102.17 ? 33  ARG B NH1   1 
ATOM   3317  N  NH2   . ARG B  2 33  ? 4.047   -23.330 -20.759 1.00 125.96 ? 33  ARG B NH2   1 
ATOM   3318  N  N     . ARG B  2 34  ? 3.410   -30.038 -21.110 1.00 105.88 ? 34  ARG B N     1 
ATOM   3319  C  CA    . ARG B  2 34  ? 2.670   -30.578 -19.968 1.00 101.97 ? 34  ARG B CA    1 
ATOM   3320  C  C     . ARG B  2 34  ? 3.365   -30.419 -18.632 1.00 92.84  ? 34  ARG B C     1 
ATOM   3321  O  O     . ARG B  2 34  ? 2.754   -30.703 -17.601 1.00 94.71  ? 34  ARG B O     1 
ATOM   3322  C  CB    . ARG B  2 34  ? 2.379   -32.063 -20.166 1.00 102.19 ? 34  ARG B CB    1 
ATOM   3323  C  CG    . ARG B  2 34  ? 1.421   -32.351 -21.266 1.00 111.36 ? 34  ARG B CG    1 
ATOM   3324  C  CD    . ARG B  2 34  ? -0.008  -32.034 -20.941 1.00 124.71 ? 34  ARG B CD    1 
ATOM   3325  N  NE    . ARG B  2 34  ? -0.855  -32.914 -21.733 1.00 132.01 ? 34  ARG B NE    1 
ATOM   3326  C  CZ    . ARG B  2 34  ? -1.207  -32.668 -22.990 1.00 143.52 ? 34  ARG B CZ    1 
ATOM   3327  N  NH1   . ARG B  2 34  ? -0.798  -31.563 -23.603 1.00 144.47 ? 34  ARG B NH1   1 
ATOM   3328  N  NH2   . ARG B  2 34  ? -1.966  -33.531 -23.640 1.00 153.74 ? 34  ARG B NH2   1 
ATOM   3329  N  N     . ILE B  2 35  ? 4.609   -29.983 -18.618 1.00 91.77  ? 35  ILE B N     1 
ATOM   3330  C  CA    . ILE B  2 35  ? 5.392   -29.912 -17.391 1.00 92.45  ? 35  ILE B CA    1 
ATOM   3331  C  C     . ILE B  2 35  ? 5.823   -28.471 -17.165 1.00 112.22 ? 35  ILE B C     1 
ATOM   3332  O  O     . ILE B  2 35  ? 5.872   -27.656 -18.102 1.00 117.24 ? 35  ILE B O     1 
ATOM   3333  C  CB    . ILE B  2 35  ? 6.610   -30.853 -17.451 1.00 89.55  ? 35  ILE B CB    1 
ATOM   3334  C  CG1   . ILE B  2 35  ? 7.304   -30.659 -18.787 1.00 87.63  ? 35  ILE B CG1   1 
ATOM   3335  C  CG2   . ILE B  2 35  ? 6.183   -32.259 -17.226 1.00 88.20  ? 35  ILE B CG2   1 
ATOM   3336  C  CD1   . ILE B  2 35  ? 8.550   -31.424 -18.917 1.00 85.38  ? 35  ILE B CD1   1 
ATOM   3337  N  N     . PRO B  2 36  ? 6.138   -28.117 -15.924 1.00 97.35  ? 36  PRO B N     1 
ATOM   3338  C  CA    . PRO B  2 36  ? 6.629   -26.763 -15.648 1.00 116.13 ? 36  PRO B CA    1 
ATOM   3339  C  C     . PRO B  2 36  ? 7.886   -26.403 -16.426 1.00 108.78 ? 36  PRO B C     1 
ATOM   3340  O  O     . PRO B  2 36  ? 8.763   -27.237 -16.666 1.00 97.01  ? 36  PRO B O     1 
ATOM   3341  C  CB    . PRO B  2 36  ? 6.893   -26.794 -14.140 1.00 123.64 ? 36  PRO B CB    1 
ATOM   3342  C  CG    . PRO B  2 36  ? 6.847   -28.266 -13.758 1.00 100.49 ? 36  PRO B CG    1 
ATOM   3343  C  CD    . PRO B  2 36  ? 5.864   -28.856 -14.688 1.00 98.28  ? 36  PRO B CD    1 
ATOM   3344  N  N     . ILE B  2 37  ? 7.966   -25.121 -16.793 1.00 102.61 ? 37  ILE B N     1 
ATOM   3345  C  CA    . ILE B  2 37  ? 9.099   -24.622 -17.562 1.00 105.33 ? 37  ILE B CA    1 
ATOM   3346  C  C     . ILE B  2 37  ? 10.386  -24.808 -16.789 1.00 103.77 ? 37  ILE B C     1 
ATOM   3347  O  O     . ILE B  2 37  ? 11.454  -25.019 -17.371 1.00 102.99 ? 37  ILE B O     1 
ATOM   3348  C  CB    . ILE B  2 37  ? 8.873   -23.157 -17.962 1.00 107.51 ? 37  ILE B CB    1 
ATOM   3349  C  CG1   . ILE B  2 37  ? 7.786   -23.112 -19.018 1.00 110.32 ? 37  ILE B CG1   1 
ATOM   3350  C  CG2   . ILE B  2 37  ? 10.129  -22.562 -18.540 1.00 109.52 ? 37  ILE B CG2   1 
ATOM   3351  C  CD1   . ILE B  2 37  ? 7.183   -21.809 -19.186 1.00 115.30 ? 37  ILE B CD1   1 
ATOM   3352  N  N     . SER B  2 38  ? 10.312  -24.704 -15.472 1.00 105.85 ? 38  SER B N     1 
ATOM   3353  C  CA    . SER B  2 38  ? 11.512  -24.856 -14.665 1.00 107.32 ? 38  SER B CA    1 
ATOM   3354  C  C     . SER B  2 38  ? 12.186  -26.198 -14.898 1.00 103.54 ? 38  SER B C     1 
ATOM   3355  O  O     . SER B  2 38  ? 13.420  -26.281 -14.907 1.00 104.41 ? 38  SER B O     1 
ATOM   3356  C  CB    . SER B  2 38  ? 11.161  -24.680 -13.196 1.00 116.79 ? 38  SER B CB    1 
ATOM   3357  O  OG    . SER B  2 38  ? 10.085  -25.523 -12.871 1.00 112.85 ? 38  SER B OG    1 
ATOM   3358  N  N     . LYS B  2 39  ? 11.394  -27.259 -15.100 1.00 123.44 ? 39  LYS B N     1 
ATOM   3359  C  CA    . LYS B  2 39  ? 11.931  -28.614 -15.206 1.00 111.60 ? 39  LYS B CA    1 
ATOM   3360  C  C     . LYS B  2 39  ? 12.143  -29.125 -16.624 1.00 101.38 ? 39  LYS B C     1 
ATOM   3361  O  O     . LYS B  2 39  ? 13.068  -29.913 -16.841 1.00 91.77  ? 39  LYS B O     1 
ATOM   3362  C  CB    . LYS B  2 39  ? 11.003  -29.588 -14.476 1.00 107.94 ? 39  LYS B CB    1 
ATOM   3363  C  CG    . LYS B  2 39  ? 10.811  -29.248 -13.015 1.00 112.52 ? 39  LYS B CG    1 
ATOM   3364  C  CD    . LYS B  2 39  ? 9.861   -30.209 -12.324 1.00 112.52 ? 39  LYS B CD    1 
ATOM   3365  C  CE    . LYS B  2 39  ? 9.039   -29.504 -11.246 1.00 112.27 ? 39  LYS B CE    1 
ATOM   3366  N  NZ    . LYS B  2 39  ? 7.798   -30.230 -10.826 1.00 109.06 ? 39  LYS B NZ    1 
ATOM   3367  N  N     . ALA B  2 40  ? 11.416  -28.611 -17.603 1.00 92.75  ? 40  ALA B N     1 
ATOM   3368  C  CA    . ALA B  2 40  ? 11.567  -29.085 -18.965 1.00 90.09  ? 40  ALA B CA    1 
ATOM   3369  C  C     . ALA B  2 40  ? 12.951  -28.717 -19.476 1.00 91.31  ? 40  ALA B C     1 
ATOM   3370  O  O     . ALA B  2 40  ? 13.767  -28.134 -18.763 1.00 96.55  ? 40  ALA B O     1 
ATOM   3371  C  CB    . ALA B  2 40  ? 10.482  -28.498 -19.857 1.00 100.01 ? 40  ALA B CB    1 
ATOM   3372  N  N     . VAL B  2 41  ? 13.289  -29.212 -20.654 1.00 89.35  ? 41  VAL B N     1 
ATOM   3373  C  CA    . VAL B  2 41  ? 14.594  -28.934 -21.226 1.00 98.04  ? 41  VAL B CA    1 
ATOM   3374  C  C     . VAL B  2 41  ? 14.435  -28.402 -22.637 1.00 106.36 ? 41  VAL B C     1 
ATOM   3375  O  O     . VAL B  2 41  ? 13.352  -28.424 -23.226 1.00 90.65  ? 41  VAL B O     1 
ATOM   3376  C  CB    . VAL B  2 41  ? 15.501  -30.157 -21.217 1.00 102.27 ? 41  VAL B CB    1 
ATOM   3377  C  CG1   . VAL B  2 41  ? 15.643  -30.680 -19.801 1.00 98.98  ? 41  VAL B CG1   1 
ATOM   3378  C  CG2   . VAL B  2 41  ? 14.907  -31.196 -22.133 1.00 110.06 ? 41  VAL B CG2   1 
ATOM   3379  N  N     . GLU B  2 42  ? 15.560  -27.973 -23.194 1.00 116.50 ? 42  GLU B N     1 
ATOM   3380  C  CA    . GLU B  2 42  ? 15.565  -27.360 -24.509 1.00 119.88 ? 42  GLU B CA    1 
ATOM   3381  C  C     . GLU B  2 42  ? 15.559  -28.426 -25.594 1.00 112.36 ? 42  GLU B C     1 
ATOM   3382  O  O     . GLU B  2 42  ? 16.389  -29.340 -25.581 1.00 111.03 ? 42  GLU B O     1 
ATOM   3383  C  CB    . GLU B  2 42  ? 16.802  -26.478 -24.665 1.00 134.07 ? 42  GLU B CB    1 
ATOM   3384  C  CG    . GLU B  2 42  ? 16.953  -25.861 -26.050 1.00 145.45 ? 42  GLU B CG    1 
ATOM   3385  C  CD    . GLU B  2 42  ? 18.146  -24.922 -26.160 1.00 154.65 ? 42  GLU B CD    1 
ATOM   3386  O  OE1   . GLU B  2 42  ? 18.426  -24.188 -25.182 1.00 157.99 ? 42  GLU B OE1   1 
ATOM   3387  O  OE2   . GLU B  2 42  ? 18.787  -24.904 -27.239 1.00 156.83 ? 42  GLU B OE2   1 
ATOM   3388  N  N     . ASN B  2 43  ? 14.630  -28.288 -26.541 1.00 93.32  ? 43  ASN B N     1 
ATOM   3389  C  CA    . ASN B  2 43  ? 14.526  -29.122 -27.730 1.00 103.22 ? 43  ASN B CA    1 
ATOM   3390  C  C     . ASN B  2 43  ? 14.798  -30.606 -27.476 1.00 115.71 ? 43  ASN B C     1 
ATOM   3391  O  O     . ASN B  2 43  ? 15.594  -31.198 -28.212 1.00 116.62 ? 43  ASN B O     1 
ATOM   3392  C  CB    . ASN B  2 43  ? 15.508  -28.611 -28.792 1.00 107.02 ? 43  ASN B CB    1 
ATOM   3393  C  CG    . ASN B  2 43  ? 15.241  -27.158 -29.236 1.00 108.02 ? 43  ASN B CG    1 
ATOM   3394  O  OD1   . ASN B  2 43  ? 14.100  -26.757 -29.483 1.00 104.38 ? 43  ASN B OD1   1 
ATOM   3395  N  ND2   . ASN B  2 43  ? 16.314  -26.376 -29.361 1.00 112.44 ? 43  ASN B ND2   1 
ATOM   3396  N  N     . PRO B  2 44  ? 14.208  -31.253 -26.462 1.00 123.37 ? 44  PRO B N     1 
ATOM   3397  C  CA    . PRO B  2 44  ? 14.444  -32.686 -26.309 1.00 80.74  ? 44  PRO B CA    1 
ATOM   3398  C  C     . PRO B  2 44  ? 13.851  -33.412 -27.493 1.00 102.16 ? 44  PRO B C     1 
ATOM   3399  O  O     . PRO B  2 44  ? 12.760  -33.084 -27.958 1.00 85.18  ? 44  PRO B O     1 
ATOM   3400  C  CB    . PRO B  2 44  ? 13.706  -33.027 -25.018 1.00 79.21  ? 44  PRO B CB    1 
ATOM   3401  C  CG    . PRO B  2 44  ? 12.579  -32.127 -25.036 1.00 94.62  ? 44  PRO B CG    1 
ATOM   3402  C  CD    . PRO B  2 44  ? 13.163  -30.818 -25.521 1.00 118.51 ? 44  PRO B CD    1 
ATOM   3403  N  N     . THR B  2 45  ? 14.540  -34.454 -27.935 1.00 103.68 ? 45  THR B N     1 
ATOM   3404  C  CA    . THR B  2 45  ? 14.105  -35.192 -29.109 1.00 103.99 ? 45  THR B CA    1 
ATOM   3405  C  C     . THR B  2 45  ? 13.608  -36.581 -28.745 1.00 104.56 ? 45  THR B C     1 
ATOM   3406  O  O     . THR B  2 45  ? 13.914  -37.139 -27.679 1.00 98.09  ? 45  THR B O     1 
ATOM   3407  C  CB    . THR B  2 45  ? 15.246  -35.312 -30.124 1.00 106.79 ? 45  THR B CB    1 
ATOM   3408  O  OG1   . THR B  2 45  ? 16.221  -36.245 -29.646 1.00 104.30 ? 45  THR B OG1   1 
ATOM   3409  C  CG2   . THR B  2 45  ? 15.910  -33.973 -30.308 1.00 119.58 ? 45  THR B CG2   1 
ATOM   3410  N  N     . ALA B  2 46  ? 12.819  -37.133 -29.667 1.00 112.55 ? 46  ALA B N     1 
ATOM   3411  C  CA    . ALA B  2 46  ? 12.296  -38.467 -29.442 1.00 108.75 ? 46  ALA B CA    1 
ATOM   3412  C  C     . ALA B  2 46  ? 13.446  -39.440 -29.290 1.00 70.02  ? 46  ALA B C     1 
ATOM   3413  O  O     . ALA B  2 46  ? 13.444  -40.274 -28.386 1.00 68.80  ? 46  ALA B O     1 
ATOM   3414  C  CB    . ALA B  2 46  ? 11.379  -38.865 -30.591 1.00 93.22  ? 46  ALA B CB    1 
ATOM   3415  N  N     . THR B  2 47  ? 14.507  -39.232 -30.060 1.00 71.03  ? 47  THR B N     1 
ATOM   3416  C  CA    . THR B  2 47  ? 15.675  -40.081 -29.940 1.00 70.49  ? 47  THR B CA    1 
ATOM   3417  C  C     . THR B  2 47  ? 16.242  -40.003 -28.528 1.00 88.47  ? 47  THR B C     1 
ATOM   3418  O  O     . THR B  2 47  ? 16.533  -41.028 -27.904 1.00 87.48  ? 47  THR B O     1 
ATOM   3419  C  CB    . THR B  2 47  ? 16.724  -39.638 -30.953 1.00 77.77  ? 47  THR B CB    1 
ATOM   3420  O  OG1   . THR B  2 47  ? 16.202  -39.766 -32.284 1.00 77.12  ? 47  THR B OG1   1 
ATOM   3421  C  CG2   . THR B  2 47  ? 17.978  -40.484 -30.812 1.00 74.72  ? 47  THR B CG2   1 
ATOM   3422  N  N     . GLU B  2 48  ? 16.360  -38.796 -27.985 1.00 87.05  ? 48  GLU B N     1 
ATOM   3423  C  CA    . GLU B  2 48  ? 16.884  -38.647 -26.631 1.00 89.34  ? 48  GLU B CA    1 
ATOM   3424  C  C     . GLU B  2 48  ? 15.958  -39.267 -25.587 1.00 85.54  ? 48  GLU B C     1 
ATOM   3425  O  O     . GLU B  2 48  ? 16.425  -39.943 -24.655 1.00 85.98  ? 48  GLU B O     1 
ATOM   3426  C  CB    . GLU B  2 48  ? 17.125  -37.169 -26.339 1.00 96.98  ? 48  GLU B CB    1 
ATOM   3427  C  CG    . GLU B  2 48  ? 18.133  -36.514 -27.267 1.00 101.58 ? 48  GLU B CG    1 
ATOM   3428  C  CD    . GLU B  2 48  ? 18.170  -35.024 -27.089 1.00 109.90 ? 48  GLU B CD    1 
ATOM   3429  O  OE1   . GLU B  2 48  ? 17.124  -34.457 -26.705 1.00 112.85 ? 48  GLU B OE1   1 
ATOM   3430  O  OE2   . GLU B  2 48  ? 19.236  -34.415 -27.326 1.00 117.78 ? 48  GLU B OE2   1 
ATOM   3431  N  N     . ILE B  2 49  ? 14.648  -39.057 -25.720 1.00 87.06  ? 49  ILE B N     1 
ATOM   3432  C  CA    . ILE B  2 49  ? 13.715  -39.632 -24.750 1.00 92.15  ? 49  ILE B CA    1 
ATOM   3433  C  C     . ILE B  2 49  ? 13.792  -41.152 -24.743 1.00 99.06  ? 49  ILE B C     1 
ATOM   3434  O  O     . ILE B  2 49  ? 13.824  -41.784 -23.679 1.00 87.84  ? 49  ILE B O     1 
ATOM   3435  C  CB    . ILE B  2 49  ? 12.284  -39.167 -25.031 1.00 85.21  ? 49  ILE B CB    1 
ATOM   3436  C  CG1   . ILE B  2 49  ? 12.164  -37.696 -24.711 1.00 79.12  ? 49  ILE B CG1   1 
ATOM   3437  C  CG2   . ILE B  2 49  ? 11.298  -40.020 -24.248 1.00 83.58  ? 49  ILE B CG2   1 
ATOM   3438  C  CD1   . ILE B  2 49  ? 10.823  -37.188 -25.021 1.00 72.04  ? 49  ILE B CD1   1 
ATOM   3439  N  N     . GLN B  2 50  ? 13.755  -41.768 -25.927 1.00 106.77 ? 50  GLN B N     1 
ATOM   3440  C  CA    . GLN B  2 50  ? 13.870  -43.222 -25.970 1.00 102.78 ? 50  GLN B CA    1 
ATOM   3441  C  C     . GLN B  2 50  ? 15.152  -43.667 -25.297 1.00 98.41  ? 50  GLN B C     1 
ATOM   3442  O  O     . GLN B  2 50  ? 15.107  -44.490 -24.382 1.00 100.55 ? 50  GLN B O     1 
ATOM   3443  C  CB    . GLN B  2 50  ? 13.841  -43.752 -27.406 1.00 102.37 ? 50  GLN B CB    1 
ATOM   3444  C  CG    . GLN B  2 50  ? 14.357  -45.176 -27.541 1.00 106.06 ? 50  GLN B CG    1 
ATOM   3445  C  CD    . GLN B  2 50  ? 14.687  -45.546 -28.966 1.00 109.72 ? 50  GLN B CD    1 
ATOM   3446  O  OE1   . GLN B  2 50  ? 13.943  -46.282 -29.608 1.00 116.65 ? 50  GLN B OE1   1 
ATOM   3447  N  NE2   . GLN B  2 50  ? 15.838  -45.082 -29.453 1.00 106.90 ? 50  GLN B NE2   1 
ATOM   3448  N  N     . ASP B  2 51  ? 16.285  -43.036 -25.622 1.00 97.36  ? 51  ASP B N     1 
ATOM   3449  C  CA    . ASP B  2 51  ? 17.516  -43.521 -25.017 1.00 96.90  ? 51  ASP B CA    1 
ATOM   3450  C  C     . ASP B  2 51  ? 17.430  -43.470 -23.508 1.00 92.32  ? 51  ASP B C     1 
ATOM   3451  O  O     . ASP B  2 51  ? 17.831  -44.423 -22.828 1.00 97.92  ? 51  ASP B O     1 
ATOM   3452  C  CB    . ASP B  2 51  ? 18.745  -42.776 -25.523 1.00 103.75 ? 51  ASP B CB    1 
ATOM   3453  C  CG    . ASP B  2 51  ? 19.129  -43.198 -26.926 1.00 110.24 ? 51  ASP B CG    1 
ATOM   3454  O  OD1   . ASP B  2 51  ? 18.485  -44.138 -27.448 1.00 118.13 ? 51  ASP B OD1   1 
ATOM   3455  O  OD2   . ASP B  2 51  ? 20.113  -42.646 -27.480 1.00 109.84 ? 51  ASP B OD2   1 
ATOM   3456  N  N     . VAL B  2 52  ? 16.855  -42.414 -22.953 1.00 80.37  ? 52  VAL B N     1 
ATOM   3457  C  CA    . VAL B  2 52  ? 16.841  -42.451 -21.502 1.00 82.40  ? 52  VAL B CA    1 
ATOM   3458  C  C     . VAL B  2 52  ? 15.838  -43.460 -20.967 1.00 92.31  ? 52  VAL B C     1 
ATOM   3459  O  O     . VAL B  2 52  ? 16.125  -44.154 -19.982 1.00 104.88 ? 52  VAL B O     1 
ATOM   3460  C  CB    . VAL B  2 52  ? 16.578  -41.069 -20.928 1.00 82.35  ? 52  VAL B CB    1 
ATOM   3461  C  CG1   . VAL B  2 52  ? 17.684  -40.183 -21.355 1.00 88.37  ? 52  VAL B CG1   1 
ATOM   3462  C  CG2   . VAL B  2 52  ? 15.246  -40.558 -21.402 1.00 83.70  ? 52  VAL B CG2   1 
ATOM   3463  N  N     . CYS B  2 53  ? 14.688  -43.631 -21.605 1.00 89.41  ? 53  CYS B N     1 
ATOM   3464  C  CA    . CYS B  2 53  ? 13.773  -44.550 -20.942 1.00 99.80  ? 53  CYS B CA    1 
ATOM   3465  C  C     . CYS B  2 53  ? 14.209  -46.010 -21.102 1.00 106.85 ? 53  CYS B C     1 
ATOM   3466  O  O     . CYS B  2 53  ? 14.181  -46.763 -20.121 1.00 112.84 ? 53  CYS B O     1 
ATOM   3467  C  CB    . CYS B  2 53  ? 12.354  -44.303 -21.440 1.00 103.52 ? 53  CYS B CB    1 
ATOM   3468  S  SG    . CYS B  2 53  ? 11.884  -42.595 -21.159 1.00 105.30 ? 53  CYS B SG    1 
ATOM   3469  N  N     . SER B  2 54  ? 14.703  -46.420 -22.284 1.00 102.11 ? 54  SER B N     1 
ATOM   3470  C  CA    . SER B  2 54  ? 15.224  -47.782 -22.404 1.00 90.88  ? 54  SER B CA    1 
ATOM   3471  C  C     . SER B  2 54  ? 16.384  -47.961 -21.436 1.00 98.16  ? 54  SER B C     1 
ATOM   3472  O  O     . SER B  2 54  ? 16.546  -49.025 -20.836 1.00 109.24 ? 54  SER B O     1 
ATOM   3473  C  CB    . SER B  2 54  ? 15.661  -48.116 -23.843 1.00 84.59  ? 54  SER B CB    1 
ATOM   3474  O  OG    . SER B  2 54  ? 17.034  -47.832 -24.088 1.00 84.19  ? 54  SER B OG    1 
ATOM   3475  N  N     . ALA B  2 55  ? 17.183  -46.904 -21.245 1.00 93.47  ? 55  ALA B N     1 
ATOM   3476  C  CA    . ALA B  2 55  ? 18.303  -46.982 -20.310 1.00 92.98  ? 55  ALA B CA    1 
ATOM   3477  C  C     . ALA B  2 55  ? 17.832  -47.188 -18.872 1.00 86.82  ? 55  ALA B C     1 
ATOM   3478  O  O     . ALA B  2 55  ? 18.581  -47.725 -18.051 1.00 83.26  ? 55  ALA B O     1 
ATOM   3479  C  CB    . ALA B  2 55  ? 19.180  -45.735 -20.418 1.00 95.79  ? 55  ALA B CB    1 
ATOM   3480  N  N     . VAL B  2 56  ? 16.648  -46.689 -18.502 1.00 79.76  ? 56  VAL B N     1 
ATOM   3481  C  CA    . VAL B  2 56  ? 16.207  -46.908 -17.124 1.00 83.18  ? 56  VAL B CA    1 
ATOM   3482  C  C     . VAL B  2 56  ? 15.369  -48.172 -16.957 1.00 89.22  ? 56  VAL B C     1 
ATOM   3483  O  O     . VAL B  2 56  ? 14.969  -48.497 -15.829 1.00 88.58  ? 56  VAL B O     1 
ATOM   3484  C  CB    . VAL B  2 56  ? 15.438  -45.694 -16.560 1.00 93.94  ? 56  VAL B CB    1 
ATOM   3485  C  CG1   . VAL B  2 56  ? 13.982  -45.670 -17.037 1.00 93.55  ? 56  VAL B CG1   1 
ATOM   3486  C  CG2   . VAL B  2 56  ? 15.505  -45.697 -15.036 1.00 87.59  ? 56  VAL B CG2   1 
ATOM   3487  N  N     . GLY B  2 57  ? 15.130  -48.927 -18.023 1.00 114.32 ? 57  GLY B N     1 
ATOM   3488  C  CA    . GLY B  2 57  ? 14.409  -50.175 -17.856 1.00 117.55 ? 57  GLY B CA    1 
ATOM   3489  C  C     . GLY B  2 57  ? 12.930  -50.131 -18.143 1.00 110.44 ? 57  GLY B C     1 
ATOM   3490  O  O     . GLY B  2 57  ? 12.127  -50.595 -17.334 1.00 115.66 ? 57  GLY B O     1 
ATOM   3491  N  N     . LEU B  2 58  ? 12.551  -49.598 -19.289 1.00 109.33 ? 58  LEU B N     1 
ATOM   3492  C  CA    . LEU B  2 58  ? 11.153  -49.524 -19.670 1.00 108.25 ? 58  LEU B CA    1 
ATOM   3493  C  C     . LEU B  2 58  ? 10.986  -50.050 -21.080 1.00 109.55 ? 58  LEU B C     1 
ATOM   3494  O  O     . LEU B  2 58  ? 11.818  -49.788 -21.953 1.00 110.00 ? 58  LEU B O     1 
ATOM   3495  C  CB    . LEU B  2 58  ? 10.625  -48.092 -19.599 1.00 105.28 ? 58  LEU B CB    1 
ATOM   3496  C  CG    . LEU B  2 58  ? 10.277  -47.400 -18.287 1.00 103.45 ? 58  LEU B CG    1 
ATOM   3497  C  CD1   . LEU B  2 58  ? 10.243  -45.920 -18.564 1.00 100.95 ? 58  LEU B CD1   1 
ATOM   3498  C  CD2   . LEU B  2 58  ? 8.932   -47.853 -17.787 1.00 103.39 ? 58  LEU B CD2   1 
ATOM   3499  N  N     . ASN B  2 59  ? 9.912   -50.789 -21.301 1.00 121.84 ? 59  ASN B N     1 
ATOM   3500  C  CA    . ASN B  2 59  ? 9.596   -51.230 -22.653 1.00 126.77 ? 59  ASN B CA    1 
ATOM   3501  C  C     . ASN B  2 59  ? 9.193   -49.995 -23.421 1.00 124.65 ? 59  ASN B C     1 
ATOM   3502  O  O     . ASN B  2 59  ? 8.100   -49.469 -23.231 1.00 118.22 ? 59  ASN B O     1 
ATOM   3503  C  CB    . ASN B  2 59  ? 8.475   -52.261 -22.672 1.00 131.41 ? 59  ASN B CB    1 
ATOM   3504  C  CG    . ASN B  2 59  ? 8.922   -53.611 -22.182 1.00 138.16 ? 59  ASN B CG    1 
ATOM   3505  O  OD1   . ASN B  2 59  ? 8.194   -54.294 -21.462 1.00 141.48 ? 59  ASN B OD1   1 
ATOM   3506  N  ND2   . ASN B  2 59  ? 10.131  -54.004 -22.563 1.00 145.94 ? 59  ASN B ND2   1 
ATOM   3507  N  N     . VAL B  2 60  ? 10.076  -49.511 -24.274 1.00 109.55 ? 60  VAL B N     1 
ATOM   3508  C  CA    . VAL B  2 60  ? 9.816   -48.297 -25.022 1.00 107.89 ? 60  VAL B CA    1 
ATOM   3509  C  C     . VAL B  2 60  ? 10.194  -48.532 -26.462 1.00 109.54 ? 60  VAL B C     1 
ATOM   3510  O  O     . VAL B  2 60  ? 11.084  -49.328 -26.767 1.00 113.61 ? 60  VAL B O     1 
ATOM   3511  C  CB    . VAL B  2 60  ? 10.639  -47.111 -24.504 1.00 125.17 ? 60  VAL B CB    1 
ATOM   3512  C  CG1   . VAL B  2 60  ? 10.415  -46.926 -23.041 1.00 133.28 ? 60  VAL B CG1   1 
ATOM   3513  C  CG2   . VAL B  2 60  ? 12.123  -47.346 -24.787 1.00 116.93 ? 60  VAL B CG2   1 
ATOM   3514  N  N     . PHE B  2 61  ? 9.546   -47.817 -27.361 1.00 108.83 ? 61  PHE B N     1 
ATOM   3515  C  CA    . PHE B  2 61  ? 10.120  -47.869 -28.692 1.00 132.33 ? 61  PHE B CA    1 
ATOM   3516  C  C     . PHE B  2 61  ? 9.893   -46.527 -29.347 1.00 131.71 ? 61  PHE B C     1 
ATOM   3517  O  O     . PHE B  2 61  ? 8.930   -45.805 -29.033 1.00 136.91 ? 61  PHE B O     1 
ATOM   3518  C  CB    . PHE B  2 61  ? 9.613   -49.041 -29.535 1.00 134.12 ? 61  PHE B CB    1 
ATOM   3519  C  CG    . PHE B  2 61  ? 8.179   -48.972 -29.895 1.00 132.83 ? 61  PHE B CG    1 
ATOM   3520  C  CD1   . PHE B  2 61  ? 7.783   -48.430 -31.097 1.00 132.62 ? 61  PHE B CD1   1 
ATOM   3521  C  CD2   . PHE B  2 61  ? 7.224   -49.538 -29.073 1.00 133.39 ? 61  PHE B CD2   1 
ATOM   3522  C  CE1   . PHE B  2 61  ? 6.450   -48.392 -31.449 1.00 132.14 ? 61  PHE B CE1   1 
ATOM   3523  C  CE2   . PHE B  2 61  ? 5.890   -49.505 -29.416 1.00 132.95 ? 61  PHE B CE2   1 
ATOM   3524  C  CZ    . PHE B  2 61  ? 5.503   -48.927 -30.610 1.00 131.85 ? 61  PHE B CZ    1 
ATOM   3525  N  N     . LEU B  2 62  ? 10.796  -46.206 -30.260 1.00 126.03 ? 62  LEU B N     1 
ATOM   3526  C  CA    . LEU B  2 62  ? 10.822  -44.904 -30.884 1.00 109.45 ? 62  LEU B CA    1 
ATOM   3527  C  C     . LEU B  2 62  ? 10.079  -45.009 -32.190 1.00 110.83 ? 62  LEU B C     1 
ATOM   3528  O  O     . LEU B  2 62  ? 10.368  -45.888 -33.006 1.00 113.50 ? 62  LEU B O     1 
ATOM   3529  C  CB    . LEU B  2 62  ? 12.249  -44.449 -31.150 1.00 111.32 ? 62  LEU B CB    1 
ATOM   3530  C  CG    . LEU B  2 62  ? 12.331  -43.299 -32.141 1.00 120.77 ? 62  LEU B CG    1 
ATOM   3531  C  CD1   . LEU B  2 62  ? 11.709  -42.121 -31.505 1.00 114.22 ? 62  LEU B CD1   1 
ATOM   3532  C  CD2   . LEU B  2 62  ? 13.763  -42.997 -32.535 1.00 126.46 ? 62  LEU B CD2   1 
ATOM   3533  N  N     . GLU B  2 63  ? 9.121   -44.127 -32.367 1.00 109.38 ? 63  GLU B N     1 
ATOM   3534  C  CA    . GLU B  2 63  ? 8.433   -43.979 -33.626 1.00 110.64 ? 63  GLU B CA    1 
ATOM   3535  C  C     . GLU B  2 63  ? 9.022   -42.729 -34.257 1.00 111.44 ? 63  GLU B C     1 
ATOM   3536  O  O     . GLU B  2 63  ? 8.504   -41.630 -34.108 1.00 109.74 ? 63  GLU B O     1 
ATOM   3537  C  CB    . GLU B  2 63  ? 6.933   -43.889 -33.427 1.00 109.69 ? 63  GLU B CB    1 
ATOM   3538  C  CG    . GLU B  2 63  ? 6.373   -45.046 -32.633 1.00 109.69 ? 63  GLU B CG    1 
ATOM   3539  C  CD    . GLU B  2 63  ? 4.851   -45.080 -32.582 1.00 109.32 ? 63  GLU B CD    1 
ATOM   3540  O  OE1   . GLU B  2 63  ? 4.251   -44.322 -31.814 1.00 121.24 ? 63  GLU B OE1   1 
ATOM   3541  O  OE2   . GLU B  2 63  ? 4.240   -45.885 -33.303 1.00 112.23 ? 63  GLU B OE2   1 
ATOM   3542  N  N     . LYS B  2 64  ? 10.124  -42.914 -34.974 1.00 114.33 ? 64  LYS B N     1 
ATOM   3543  C  CA    . LYS B  2 64  ? 10.777  -41.829 -35.686 1.00 115.88 ? 64  LYS B CA    1 
ATOM   3544  C  C     . LYS B  2 64  ? 9.822   -41.151 -36.655 1.00 116.41 ? 64  LYS B C     1 
ATOM   3545  O  O     . LYS B  2 64  ? 10.100  -40.049 -37.126 1.00 117.22 ? 64  LYS B O     1 
ATOM   3546  C  CB    . LYS B  2 64  ? 12.005  -42.351 -36.455 1.00 119.55 ? 64  LYS B CB    1 
ATOM   3547  C  CG    . LYS B  2 64  ? 11.657  -43.382 -37.519 1.00 122.15 ? 64  LYS B CG    1 
ATOM   3548  C  CD    . LYS B  2 64  ? 12.783  -43.690 -38.518 1.00 126.23 ? 64  LYS B CD    1 
ATOM   3549  C  CE    . LYS B  2 64  ? 14.166  -43.262 -38.061 1.00 126.98 ? 64  LYS B CE    1 
ATOM   3550  N  NZ    . LYS B  2 64  ? 14.844  -44.229 -37.158 1.00 126.70 ? 64  LYS B NZ    1 
ATOM   3551  N  N     . ASN B  2 65  ? 8.730   -41.801 -37.006 1.00 116.34 ? 65  ASN B N     1 
ATOM   3552  C  CA    . ASN B  2 65  ? 7.884   -41.336 -38.087 1.00 117.68 ? 65  ASN B CA    1 
ATOM   3553  C  C     . ASN B  2 65  ? 6.577   -40.703 -37.627 1.00 114.96 ? 65  ASN B C     1 
ATOM   3554  O  O     . ASN B  2 65  ? 5.718   -40.403 -38.454 1.00 116.03 ? 65  ASN B O     1 
ATOM   3555  C  CB    . ASN B  2 65  ? 7.601   -42.506 -39.002 1.00 145.57 ? 65  ASN B CB    1 
ATOM   3556  C  CG    . ASN B  2 65  ? 7.170   -42.081 -40.343 1.00 144.66 ? 65  ASN B CG    1 
ATOM   3557  O  OD1   . ASN B  2 65  ? 7.238   -40.907 -40.689 1.00 137.91 ? 65  ASN B OD1   1 
ATOM   3558  N  ND2   . ASN B  2 65  ? 6.717   -43.037 -41.126 1.00 149.70 ? 65  ASN B ND2   1 
ATOM   3559  N  N     . LYS B  2 66  ? 6.380   -40.543 -36.334 1.00 111.69 ? 66  LYS B N     1 
ATOM   3560  C  CA    . LYS B  2 66  ? 5.204   -39.876 -35.781 1.00 121.22 ? 66  LYS B CA    1 
ATOM   3561  C  C     . LYS B  2 66  ? 5.496   -38.437 -35.326 1.00 119.78 ? 66  LYS B C     1 
ATOM   3562  O  O     . LYS B  2 66  ? 6.567   -38.149 -34.779 1.00 107.04 ? 66  LYS B O     1 
ATOM   3563  C  CB    . LYS B  2 66  ? 4.665   -40.691 -34.605 1.00 120.66 ? 66  LYS B CB    1 
ATOM   3564  C  CG    . LYS B  2 66  ? 4.062   -42.041 -34.968 1.00 123.45 ? 66  LYS B CG    1 
ATOM   3565  C  CD    . LYS B  2 66  ? 2.611   -41.861 -35.345 1.00 109.96 ? 66  LYS B CD    1 
ATOM   3566  C  CE    . LYS B  2 66  ? 1.982   -43.124 -35.849 1.00 111.91 ? 66  LYS B CE    1 
ATOM   3567  N  NZ    . LYS B  2 66  ? 0.563   -42.839 -36.029 1.00 112.08 ? 66  LYS B NZ    1 
ATOM   3568  N  N     . MET B  2 67  ? 4.543   -37.522 -35.575 1.00 121.29 ? 67  MET B N     1 
ATOM   3569  C  CA    . MET B  2 67  ? 4.682   -36.125 -35.156 1.00 123.48 ? 67  MET B CA    1 
ATOM   3570  C  C     . MET B  2 67  ? 3.450   -35.609 -34.416 1.00 119.00 ? 67  MET B C     1 
ATOM   3571  O  O     . MET B  2 67  ? 2.311   -35.966 -34.723 1.00 119.03 ? 67  MET B O     1 
ATOM   3572  C  CB    . MET B  2 67  ? 4.959   -35.222 -36.346 1.00 125.87 ? 67  MET B CB    1 
ATOM   3573  C  CG    . MET B  2 67  ? 5.967   -34.163 -36.085 1.00 108.07 ? 67  MET B CG    1 
ATOM   3574  S  SD    . MET B  2 67  ? 6.340   -33.627 -37.731 1.00 126.94 ? 67  MET B SD    1 
ATOM   3575  C  CE    . MET B  2 67  ? 7.370   -34.963 -38.330 1.00 131.55 ? 67  MET B CE    1 
ATOM   3576  N  N     . TYR B  2 68  ? 3.686   -34.617 -33.573 1.00 113.72 ? 68  TYR B N     1 
ATOM   3577  C  CA    . TYR B  2 68  ? 2.638   -34.055 -32.749 1.00 100.52 ? 68  TYR B CA    1 
ATOM   3578  C  C     . TYR B  2 68  ? 1.804   -33.138 -33.605 1.00 118.68 ? 68  TYR B C     1 
ATOM   3579  O  O     . TYR B  2 68  ? 2.345   -32.386 -34.408 1.00 128.48 ? 68  TYR B O     1 
ATOM   3580  C  CB    . TYR B  2 68  ? 3.264   -33.259 -31.618 1.00 100.24 ? 68  TYR B CB    1 
ATOM   3581  C  CG    . TYR B  2 68  ? 2.306   -32.866 -30.565 1.00 99.72  ? 68  TYR B CG    1 
ATOM   3582  C  CD1   . TYR B  2 68  ? 1.089   -33.472 -30.485 1.00 100.54 ? 68  TYR B CD1   1 
ATOM   3583  C  CD2   . TYR B  2 68  ? 2.665   -31.997 -29.562 1.00 94.41  ? 68  TYR B CD2   1 
ATOM   3584  C  CE1   . TYR B  2 68  ? 0.217   -33.167 -29.486 1.00 98.62  ? 68  TYR B CE1   1 
ATOM   3585  C  CE2   . TYR B  2 68  ? 1.799   -31.686 -28.549 1.00 92.70  ? 68  TYR B CE2   1 
ATOM   3586  C  CZ    . TYR B  2 68  ? 0.570   -32.283 -28.516 1.00 92.99  ? 68  TYR B CZ    1 
ATOM   3587  O  OH    . TYR B  2 68  ? -0.334  -32.012 -27.522 1.00 91.49  ? 68  TYR B OH    1 
ATOM   3588  N  N     . SER B  2 69  ? 0.486   -33.226 -33.487 1.00 101.53 ? 69  SER B N     1 
ATOM   3589  C  CA    . SER B  2 69  ? -0.327  -32.395 -34.362 1.00 106.80 ? 69  SER B CA    1 
ATOM   3590  C  C     . SER B  2 69  ? 0.037   -30.927 -34.185 1.00 110.15 ? 69  SER B C     1 
ATOM   3591  O  O     . SER B  2 69  ? 0.243   -30.204 -35.165 1.00 103.88 ? 69  SER B O     1 
ATOM   3592  C  CB    . SER B  2 69  ? -1.796  -32.626 -34.054 1.00 106.06 ? 69  SER B CB    1 
ATOM   3593  O  OG    . SER B  2 69  ? -2.093  -33.986 -34.218 1.00 110.69 ? 69  SER B OG    1 
ATOM   3594  N  N     . ARG B  2 70  ? 0.324   -30.539 -32.951 1.00 111.42 ? 70  ARG B N     1 
ATOM   3595  C  CA    . ARG B  2 70  ? 0.596   -29.174 -32.551 1.00 98.69  ? 70  ARG B CA    1 
ATOM   3596  C  C     . ARG B  2 70  ? 1.971   -28.691 -32.969 1.00 99.35  ? 70  ARG B C     1 
ATOM   3597  O  O     . ARG B  2 70  ? 2.348   -27.575 -32.615 1.00 114.16 ? 70  ARG B O     1 
ATOM   3598  C  CB    . ARG B  2 70  ? 0.442   -29.053 -31.035 1.00 95.94  ? 70  ARG B CB    1 
ATOM   3599  C  CG    . ARG B  2 70  ? -0.928  -29.405 -30.532 1.00 95.32  ? 70  ARG B CG    1 
ATOM   3600  C  CD    . ARG B  2 70  ? -1.010  -29.081 -29.076 1.00 92.80  ? 70  ARG B CD    1 
ATOM   3601  N  NE    . ARG B  2 70  ? -2.300  -29.414 -28.504 1.00 92.25  ? 70  ARG B NE    1 
ATOM   3602  C  CZ    . ARG B  2 70  ? -2.577  -29.278 -27.217 1.00 90.26  ? 70  ARG B CZ    1 
ATOM   3603  N  NH1   . ARG B  2 70  ? -1.651  -28.824 -26.396 1.00 88.63  ? 70  ARG B NH1   1 
ATOM   3604  N  NH2   . ARG B  2 70  ? -3.772  -29.591 -26.748 1.00 90.03  ? 70  ARG B NH2   1 
ATOM   3605  N  N     . GLU B  2 71  ? 2.760   -29.517 -33.616 1.00 100.70 ? 71  GLU B N     1 
ATOM   3606  C  CA    . GLU B  2 71  ? 4.079   -29.120 -34.056 1.00 101.62 ? 71  GLU B CA    1 
ATOM   3607  C  C     . GLU B  2 71  ? 3.934   -28.731 -35.513 1.00 104.47 ? 71  GLU B C     1 
ATOM   3608  O  O     . GLU B  2 71  ? 3.517   -29.539 -36.338 1.00 106.25 ? 71  GLU B O     1 
ATOM   3609  C  CB    . GLU B  2 71  ? 5.060   -30.258 -33.884 1.00 101.61 ? 71  GLU B CB    1 
ATOM   3610  C  CG    . GLU B  2 71  ? 6.445   -29.983 -34.302 1.00 103.42 ? 71  GLU B CG    1 
ATOM   3611  C  CD    . GLU B  2 71  ? 6.969   -28.763 -33.703 1.00 102.40 ? 71  GLU B CD    1 
ATOM   3612  O  OE1   . GLU B  2 71  ? 7.019   -27.745 -34.398 1.00 146.92 ? 71  GLU B OE1   1 
ATOM   3613  O  OE2   . GLU B  2 71  ? 7.338   -28.833 -32.519 1.00 103.59 ? 71  GLU B OE2   1 
ATOM   3614  N  N     . TRP B  2 72  ? 4.178   -27.469 -35.819 1.00 119.76 ? 72  TRP B N     1 
ATOM   3615  C  CA    . TRP B  2 72  ? 4.109   -26.993 -37.197 1.00 118.09 ? 72  TRP B CA    1 
ATOM   3616  C  C     . TRP B  2 72  ? 5.410   -27.238 -37.935 1.00 112.52 ? 72  TRP B C     1 
ATOM   3617  O  O     . TRP B  2 72  ? 5.393   -27.521 -39.132 1.00 115.99 ? 72  TRP B O     1 
ATOM   3618  C  CB    . TRP B  2 72  ? 3.779   -25.493 -37.212 1.00 115.07 ? 72  TRP B CB    1 
ATOM   3619  C  CG    . TRP B  2 72  ? 4.913   -24.661 -36.674 1.00 109.13 ? 72  TRP B CG    1 
ATOM   3620  C  CD1   . TRP B  2 72  ? 5.994   -24.197 -37.361 1.00 118.35 ? 72  TRP B CD1   1 
ATOM   3621  C  CD2   . TRP B  2 72  ? 5.099   -24.246 -35.319 1.00 105.54 ? 72  TRP B CD2   1 
ATOM   3622  N  NE1   . TRP B  2 72  ? 6.831   -23.508 -36.524 1.00 110.91 ? 72  TRP B NE1   1 
ATOM   3623  C  CE2   . TRP B  2 72  ? 6.304   -23.528 -35.263 1.00 108.36 ? 72  TRP B CE2   1 
ATOM   3624  C  CE3   . TRP B  2 72  ? 4.358   -24.404 -34.148 1.00 102.14 ? 72  TRP B CE3   1 
ATOM   3625  C  CZ2   . TRP B  2 72  ? 6.782   -22.972 -34.089 1.00 107.26 ? 72  TRP B CZ2   1 
ATOM   3626  C  CZ3   . TRP B  2 72  ? 4.835   -23.858 -32.988 1.00 106.51 ? 72  TRP B CZ3   1 
ATOM   3627  C  CH2   . TRP B  2 72  ? 6.030   -23.150 -32.962 1.00 105.82 ? 72  TRP B CH2   1 
ATOM   3628  N  N     . ASN B  2 73  ? 6.525   -27.193 -37.224 1.00 118.98 ? 73  ASN B N     1 
ATOM   3629  C  CA    . ASN B  2 73  ? 7.833   -27.303 -37.837 1.00 123.21 ? 73  ASN B CA    1 
ATOM   3630  C  C     . ASN B  2 73  ? 8.056   -28.749 -38.201 1.00 129.12 ? 73  ASN B C     1 
ATOM   3631  O  O     . ASN B  2 73  ? 7.923   -29.623 -37.348 1.00 130.20 ? 73  ASN B O     1 
ATOM   3632  C  CB    . ASN B  2 73  ? 8.915   -26.830 -36.873 1.00 124.05 ? 73  ASN B CB    1 
ATOM   3633  C  CG    . ASN B  2 73  ? 10.223  -26.543 -37.568 1.00 132.53 ? 73  ASN B CG    1 
ATOM   3634  O  OD1   . ASN B  2 73  ? 10.751  -27.390 -38.280 1.00 130.30 ? 73  ASN B OD1   1 
ATOM   3635  N  ND2   . ASN B  2 73  ? 10.743  -25.338 -37.384 1.00 142.24 ? 73  ASN B ND2   1 
ATOM   3636  N  N     . ARG B  2 74  ? 8.379   -29.006 -39.455 1.00 119.64 ? 74  ARG B N     1 
ATOM   3637  C  CA    . ARG B  2 74  ? 8.609   -30.362 -39.908 1.00 121.03 ? 74  ARG B CA    1 
ATOM   3638  C  C     . ARG B  2 74  ? 10.116  -30.618 -39.958 1.00 122.98 ? 74  ARG B C     1 
ATOM   3639  O  O     . ARG B  2 74  ? 10.760  -30.616 -40.998 1.00 126.96 ? 74  ARG B O     1 
ATOM   3640  C  CB    . ARG B  2 74  ? 7.916   -30.566 -41.243 1.00 124.25 ? 74  ARG B CB    1 
ATOM   3641  C  CG    . ARG B  2 74  ? 8.298   -31.811 -41.983 1.00 153.10 ? 74  ARG B CG    1 
ATOM   3642  C  CD    . ARG B  2 74  ? 8.345   -33.077 -41.122 1.00 145.49 ? 74  ARG B CD    1 
ATOM   3643  N  NE    . ARG B  2 74  ? 9.511   -33.863 -41.498 1.00 139.37 ? 74  ARG B NE    1 
ATOM   3644  C  CZ    . ARG B  2 74  ? 9.579   -34.599 -42.596 1.00 136.40 ? 74  ARG B CZ    1 
ATOM   3645  N  NH1   . ARG B  2 74  ? 8.535   -34.668 -43.416 1.00 131.23 ? 74  ARG B NH1   1 
ATOM   3646  N  NH2   . ARG B  2 74  ? 10.695  -35.253 -42.875 1.00 138.46 ? 74  ARG B NH2   1 
ATOM   3647  N  N     . ASP B  2 75  ? 10.687  -30.819 -38.777 1.00 120.27 ? 75  ASP B N     1 
ATOM   3648  C  CA    . ASP B  2 75  ? 12.131  -30.943 -38.645 1.00 121.90 ? 75  ASP B CA    1 
ATOM   3649  C  C     . ASP B  2 75  ? 12.465  -32.037 -37.645 1.00 119.59 ? 75  ASP B C     1 
ATOM   3650  O  O     . ASP B  2 75  ? 11.711  -32.304 -36.705 1.00 116.00 ? 75  ASP B O     1 
ATOM   3651  C  CB    . ASP B  2 75  ? 12.787  -29.615 -38.209 1.00 143.30 ? 75  ASP B CB    1 
ATOM   3652  C  CG    . ASP B  2 75  ? 14.306  -29.623 -38.357 1.00 143.14 ? 75  ASP B CG    1 
ATOM   3653  O  OD1   . ASP B  2 75  ? 14.827  -30.599 -38.946 1.00 141.77 ? 75  ASP B OD1   1 
ATOM   3654  O  OD2   . ASP B  2 75  ? 14.967  -28.652 -37.902 1.00 124.60 ? 75  ASP B OD2   1 
ATOM   3655  N  N     . VAL B  2 76  ? 13.639  -32.632 -37.847 1.00 121.96 ? 76  VAL B N     1 
ATOM   3656  C  CA    . VAL B  2 76  ? 14.064  -33.776 -37.048 1.00 122.30 ? 76  VAL B CA    1 
ATOM   3657  C  C     . VAL B  2 76  ? 13.998  -33.462 -35.561 1.00 117.07 ? 76  VAL B C     1 
ATOM   3658  O  O     . VAL B  2 76  ? 13.538  -34.279 -34.760 1.00 118.69 ? 76  VAL B O     1 
ATOM   3659  C  CB    . VAL B  2 76  ? 15.485  -34.184 -37.466 1.00 124.15 ? 76  VAL B CB    1 
ATOM   3660  C  CG1   . VAL B  2 76  ? 16.012  -35.266 -36.546 1.00 122.93 ? 76  VAL B CG1   1 
ATOM   3661  C  CG2   . VAL B  2 76  ? 15.495  -34.591 -38.931 1.00 128.14 ? 76  VAL B CG2   1 
ATOM   3662  N  N     . GLN B  2 77  ? 14.392  -32.258 -35.174 1.00 116.19 ? 77  GLN B N     1 
ATOM   3663  C  CA    . GLN B  2 77  ? 14.427  -31.959 -33.756 1.00 112.75 ? 77  GLN B CA    1 
ATOM   3664  C  C     . GLN B  2 77  ? 13.030  -31.955 -33.163 1.00 110.78 ? 77  GLN B C     1 
ATOM   3665  O  O     . GLN B  2 77  ? 12.864  -32.215 -31.972 1.00 113.24 ? 77  GLN B O     1 
ATOM   3666  C  CB    . GLN B  2 77  ? 15.138  -30.634 -33.534 1.00 123.97 ? 77  GLN B CB    1 
ATOM   3667  C  CG    . GLN B  2 77  ? 15.534  -30.380 -32.103 1.00 123.39 ? 77  GLN B CG    1 
ATOM   3668  C  CD    . GLN B  2 77  ? 16.301  -29.078 -31.935 1.00 132.31 ? 77  GLN B CD    1 
ATOM   3669  O  OE1   . GLN B  2 77  ? 15.788  -27.986 -32.216 1.00 128.93 ? 77  GLN B OE1   1 
ATOM   3670  N  NE2   . GLN B  2 77  ? 17.534  -29.186 -31.459 1.00 143.38 ? 77  GLN B NE2   1 
ATOM   3671  N  N     . TYR B  2 78  ? 12.021  -31.634 -33.955 1.00 112.41 ? 78  TYR B N     1 
ATOM   3672  C  CA    . TYR B  2 78  ? 10.648  -31.673 -33.476 1.00 115.06 ? 78  TYR B CA    1 
ATOM   3673  C  C     . TYR B  2 78  ? 9.944   -32.956 -33.889 1.00 106.75 ? 78  TYR B C     1 
ATOM   3674  O  O     . TYR B  2 78  ? 8.850   -33.240 -33.395 1.00 104.35 ? 78  TYR B O     1 
ATOM   3675  C  CB    . TYR B  2 78  ? 9.861   -30.449 -33.985 1.00 124.50 ? 78  TYR B CB    1 
ATOM   3676  C  CG    . TYR B  2 78  ? 10.442  -29.103 -33.563 1.00 127.46 ? 78  TYR B CG    1 
ATOM   3677  C  CD1   . TYR B  2 78  ? 10.395  -28.676 -32.246 1.00 125.64 ? 78  TYR B CD1   1 
ATOM   3678  C  CD2   . TYR B  2 78  ? 11.074  -28.275 -34.493 1.00 125.66 ? 78  TYR B CD2   1 
ATOM   3679  C  CE1   . TYR B  2 78  ? 10.943  -27.460 -31.872 1.00 119.83 ? 78  TYR B CE1   1 
ATOM   3680  C  CE2   . TYR B  2 78  ? 11.628  -27.080 -34.120 1.00 109.24 ? 78  TYR B CE2   1 
ATOM   3681  C  CZ    . TYR B  2 78  ? 11.560  -26.681 -32.812 1.00 123.31 ? 78  TYR B CZ    1 
ATOM   3682  O  OH    . TYR B  2 78  ? 12.103  -25.487 -32.433 1.00 121.29 ? 78  TYR B OH    1 
ATOM   3683  N  N     . ARG B  2 79  ? 10.538  -33.719 -34.792 1.00 109.84 ? 79  ARG B N     1 
ATOM   3684  C  CA    . ARG B  2 79  ? 9.961   -34.976 -35.229 1.00 114.16 ? 79  ARG B CA    1 
ATOM   3685  C  C     . ARG B  2 79  ? 9.962   -35.999 -34.090 1.00 112.12 ? 79  ARG B C     1 
ATOM   3686  O  O     . ARG B  2 79  ? 10.710  -35.888 -33.115 1.00 106.95 ? 79  ARG B O     1 
ATOM   3687  C  CB    . ARG B  2 79  ? 10.754  -35.512 -36.424 1.00 123.25 ? 79  ARG B CB    1 
ATOM   3688  C  CG    . ARG B  2 79  ? 10.119  -36.668 -37.163 1.00 132.60 ? 79  ARG B CG    1 
ATOM   3689  C  CD    . ARG B  2 79  ? 10.999  -37.161 -38.294 1.00 141.79 ? 79  ARG B CD    1 
ATOM   3690  N  NE    . ARG B  2 79  ? 12.191  -37.857 -37.801 1.00 140.62 ? 79  ARG B NE    1 
ATOM   3691  C  CZ    . ARG B  2 79  ? 12.954  -38.640 -38.556 1.00 136.12 ? 79  ARG B CZ    1 
ATOM   3692  N  NH1   . ARG B  2 79  ? 14.027  -39.227 -38.048 1.00 124.60 ? 79  ARG B NH1   1 
ATOM   3693  N  NH2   . ARG B  2 79  ? 12.634  -38.835 -39.823 1.00 126.86 ? 79  ARG B NH2   1 
ATOM   3694  N  N     . GLY B  2 80  ? 9.113   -37.013 -34.220 1.00 107.91 ? 80  GLY B N     1 
ATOM   3695  C  CA    . GLY B  2 80  ? 9.223   -38.101 -33.284 1.00 106.57 ? 80  GLY B CA    1 
ATOM   3696  C  C     . GLY B  2 80  ? 8.053   -38.340 -32.364 1.00 103.58 ? 80  GLY B C     1 
ATOM   3697  O  O     . GLY B  2 80  ? 7.247   -37.439 -32.140 1.00 102.30 ? 80  GLY B O     1 
ATOM   3698  N  N     . ARG B  2 81  ? 7.880   -39.595 -31.948 1.00 103.88 ? 81  ARG B N     1 
ATOM   3699  C  CA    . ARG B  2 81  ? 6.997   -39.978 -30.855 1.00 102.35 ? 81  ARG B CA    1 
ATOM   3700  C  C     . ARG B  2 81  ? 7.659   -41.133 -30.130 1.00 109.37 ? 81  ARG B C     1 
ATOM   3701  O  O     . ARG B  2 81  ? 8.238   -42.015 -30.756 1.00 130.61 ? 81  ARG B O     1 
ATOM   3702  C  CB    . ARG B  2 81  ? 5.597   -40.383 -31.317 1.00 102.97 ? 81  ARG B CB    1 
ATOM   3703  C  CG    . ARG B  2 81  ? 4.667   -40.772 -30.188 1.00 101.63 ? 81  ARG B CG    1 
ATOM   3704  C  CD    . ARG B  2 81  ? 3.217   -40.784 -30.622 1.00 102.05 ? 81  ARG B CD    1 
ATOM   3705  N  NE    . ARG B  2 81  ? 2.826   -41.896 -31.465 1.00 104.23 ? 81  ARG B NE    1 
ATOM   3706  C  CZ    . ARG B  2 81  ? 1.614   -42.026 -31.991 1.00 105.10 ? 81  ARG B CZ    1 
ATOM   3707  N  NH1   . ARG B  2 81  ? 0.717   -41.104 -31.755 1.00 111.47 ? 81  ARG B NH1   1 
ATOM   3708  N  NH2   . ARG B  2 81  ? 1.281   -43.060 -32.746 1.00 107.20 ? 81  ARG B NH2   1 
ATOM   3709  N  N     . VAL B  2 82  ? 7.589   -41.128 -28.815 1.00 101.04 ? 82  VAL B N     1 
ATOM   3710  C  CA    . VAL B  2 82  ? 8.132   -42.193 -27.990 1.00 101.45 ? 82  VAL B CA    1 
ATOM   3711  C  C     . VAL B  2 82  ? 6.951   -42.865 -27.314 1.00 101.07 ? 82  VAL B C     1 
ATOM   3712  O  O     . VAL B  2 82  ? 6.050   -42.181 -26.821 1.00 137.13 ? 82  VAL B O     1 
ATOM   3713  C  CB    . VAL B  2 82  ? 9.137   -41.642 -26.964 1.00 100.18 ? 82  VAL B CB    1 
ATOM   3714  C  CG1   . VAL B  2 82  ? 9.570   -42.704 -26.031 1.00 102.13 ? 82  VAL B CG1   1 
ATOM   3715  C  CG2   . VAL B  2 82  ? 10.345  -41.069 -27.662 1.00 100.94 ? 82  VAL B CG2   1 
ATOM   3716  N  N     . ARG B  2 83  ? 6.921   -44.194 -27.350 1.00 102.72 ? 83  ARG B N     1 
ATOM   3717  C  CA    . ARG B  2 83  ? 5.879   -44.984 -26.705 1.00 102.81 ? 83  ARG B CA    1 
ATOM   3718  C  C     . ARG B  2 83  ? 6.453   -45.695 -25.494 1.00 102.89 ? 83  ARG B C     1 
ATOM   3719  O  O     . ARG B  2 83  ? 7.584   -46.202 -25.545 1.00 115.06 ? 83  ARG B O     1 
ATOM   3720  C  CB    . ARG B  2 83  ? 5.316   -46.042 -27.652 1.00 104.99 ? 83  ARG B CB    1 
ATOM   3721  C  CG    . ARG B  2 83  ? 4.728   -45.513 -28.916 1.00 105.45 ? 83  ARG B CG    1 
ATOM   3722  C  CD    . ARG B  2 83  ? 3.517   -44.715 -28.605 1.00 103.95 ? 83  ARG B CD    1 
ATOM   3723  N  NE    . ARG B  2 83  ? 2.394   -45.548 -28.226 1.00 104.56 ? 83  ARG B NE    1 
ATOM   3724  C  CZ    . ARG B  2 83  ? 1.643   -46.206 -29.097 1.00 106.34 ? 83  ARG B CZ    1 
ATOM   3725  N  NH1   . ARG B  2 83  ? 1.884   -46.120 -30.402 1.00 107.66 ? 83  ARG B NH1   1 
ATOM   3726  N  NH2   . ARG B  2 83  ? 0.636   -46.940 -28.660 1.00 128.51 ? 83  ARG B NH2   1 
ATOM   3727  N  N     . VAL B  2 84  ? 5.689   -45.726 -24.405 1.00 101.87 ? 84  VAL B N     1 
ATOM   3728  C  CA    . VAL B  2 84  ? 6.134   -46.423 -23.205 1.00 102.19 ? 84  VAL B CA    1 
ATOM   3729  C  C     . VAL B  2 84  ? 5.030   -47.340 -22.691 1.00 127.18 ? 84  VAL B C     1 
ATOM   3730  O  O     . VAL B  2 84  ? 3.870   -46.931 -22.589 1.00 130.10 ? 84  VAL B O     1 
ATOM   3731  C  CB    . VAL B  2 84  ? 6.608   -45.456 -22.120 1.00 100.19 ? 84  VAL B CB    1 
ATOM   3732  C  CG1   . VAL B  2 84  ? 6.979   -46.214 -20.887 1.00 100.83 ? 84  VAL B CG1   1 
ATOM   3733  C  CG2   . VAL B  2 84  ? 7.824   -44.788 -22.620 1.00 99.96  ? 84  VAL B CG2   1 
ATOM   3734  N  N     . GLN B  2 85  ? 5.395   -48.594 -22.399 1.00 118.25 ? 85  GLN B N     1 
ATOM   3735  C  CA    . GLN B  2 85  ? 4.501   -49.551 -21.757 1.00 116.25 ? 85  GLN B CA    1 
ATOM   3736  C  C     . GLN B  2 85  ? 4.507   -49.295 -20.262 1.00 113.70 ? 85  GLN B C     1 
ATOM   3737  O  O     . GLN B  2 85  ? 5.561   -49.333 -19.618 1.00 112.09 ? 85  GLN B O     1 
ATOM   3738  C  CB    . GLN B  2 85  ? 4.927   -50.997 -22.028 1.00 129.27 ? 85  GLN B CB    1 
ATOM   3739  C  CG    . GLN B  2 85  ? 3.903   -52.057 -21.508 1.00 140.83 ? 85  GLN B CG    1 
ATOM   3740  C  CD    . GLN B  2 85  ? 4.398   -53.497 -21.564 1.00 138.45 ? 85  GLN B CD    1 
ATOM   3741  O  OE1   . GLN B  2 85  ? 5.374   -53.809 -22.241 1.00 121.52 ? 85  GLN B OE1   1 
ATOM   3742  N  NE2   . GLN B  2 85  ? 3.732   -54.375 -20.825 1.00 146.00 ? 85  GLN B NE2   1 
ATOM   3743  N  N     . LEU B  2 86  ? 3.343   -49.011 -19.710 1.00 104.25 ? 86  LEU B N     1 
ATOM   3744  C  CA    . LEU B  2 86  ? 3.283   -48.749 -18.288 1.00 103.36 ? 86  LEU B CA    1 
ATOM   3745  C  C     . LEU B  2 86  ? 2.695   -49.865 -17.473 1.00 105.24 ? 86  LEU B C     1 
ATOM   3746  O  O     . LEU B  2 86  ? 3.019   -49.981 -16.293 1.00 105.37 ? 86  LEU B O     1 
ATOM   3747  C  CB    . LEU B  2 86  ? 2.496   -47.489 -18.005 1.00 104.14 ? 86  LEU B CB    1 
ATOM   3748  C  CG    . LEU B  2 86  ? 3.396   -46.333 -18.336 1.00 99.11  ? 86  LEU B CG    1 
ATOM   3749  C  CD1   . LEU B  2 86  ? 2.695   -45.141 -17.790 1.00 96.86  ? 86  LEU B CD1   1 
ATOM   3750  C  CD2   . LEU B  2 86  ? 4.804   -46.548 -17.734 1.00 99.54  ? 86  LEU B CD2   1 
ATOM   3751  N  N     . LYS B  2 87  ? 1.762   -50.616 -18.023 1.00 106.74 ? 87  LYS B N     1 
ATOM   3752  C  CA    . LYS B  2 87  ? 1.123   -51.658 -17.239 1.00 126.90 ? 87  LYS B CA    1 
ATOM   3753  C  C     . LYS B  2 87  ? 1.019   -52.979 -18.010 1.00 135.20 ? 87  LYS B C     1 
ATOM   3754  O  O     . LYS B  2 87  ? 1.009   -53.004 -19.247 1.00 111.74 ? 87  LYS B O     1 
ATOM   3755  C  CB    . LYS B  2 87  ? -0.259  -51.150 -16.793 1.00 115.59 ? 87  LYS B CB    1 
ATOM   3756  C  CG    . LYS B  2 87  ? -0.192  -49.858 -15.992 1.00 110.57 ? 87  LYS B CG    1 
ATOM   3757  C  CD    . LYS B  2 87  ? -1.443  -49.006 -16.147 1.00 109.49 ? 87  LYS B CD    1 
ATOM   3758  C  CE    . LYS B  2 87  ? -2.722  -49.768 -15.860 1.00 112.24 ? 87  LYS B CE    1 
ATOM   3759  N  NZ    . LYS B  2 87  ? -3.936  -48.899 -15.802 1.00 111.81 ? 87  LYS B NZ    1 
ATOM   3760  N  N     . GLN B  2 88  ? 1.001   -54.085 -17.267 1.00 113.87 ? 88  GLN B N     1 
ATOM   3761  C  CA    . GLN B  2 88  ? 0.707   -55.389 -17.849 1.00 132.15 ? 88  GLN B CA    1 
ATOM   3762  C  C     . GLN B  2 88  ? -0.802  -55.606 -17.852 1.00 130.87 ? 88  GLN B C     1 
ATOM   3763  O  O     . GLN B  2 88  ? -1.547  -54.944 -17.129 1.00 116.08 ? 88  GLN B O     1 
ATOM   3764  C  CB    . GLN B  2 88  ? 1.432   -56.516 -17.103 1.00 119.36 ? 88  GLN B CB    1 
ATOM   3765  C  CG    . GLN B  2 88  ? 2.942   -56.453 -17.272 1.00 119.27 ? 88  GLN B CG    1 
ATOM   3766  C  CD    . GLN B  2 88  ? 3.681   -57.454 -16.431 1.00 121.87 ? 88  GLN B CD    1 
ATOM   3767  O  OE1   . GLN B  2 88  ? 3.165   -57.930 -15.426 1.00 123.20 ? 88  GLN B OE1   1 
ATOM   3768  N  NE2   . GLN B  2 88  ? 4.915   -57.747 -16.811 1.00 122.76 ? 88  GLN B NE2   1 
ATOM   3769  N  N     . GLU B  2 89  ? -1.246  -56.567 -18.665 1.00 133.22 ? 89  GLU B N     1 
ATOM   3770  C  CA    . GLU B  2 89  ? -2.675  -56.784 -18.872 1.00 141.39 ? 89  GLU B CA    1 
ATOM   3771  C  C     . GLU B  2 89  ? -3.438  -56.839 -17.562 1.00 143.82 ? 89  GLU B C     1 
ATOM   3772  O  O     . GLU B  2 89  ? -4.578  -56.377 -17.480 1.00 145.66 ? 89  GLU B O     1 
ATOM   3773  C  CB    . GLU B  2 89  ? -2.904  -58.075 -19.657 1.00 156.98 ? 89  GLU B CB    1 
ATOM   3774  C  CG    . GLU B  2 89  ? -3.257  -57.870 -21.119 1.00 168.83 ? 89  GLU B CG    1 
ATOM   3775  C  CD    . GLU B  2 89  ? -3.360  -59.188 -21.879 1.00 180.52 ? 89  GLU B CD    1 
ATOM   3776  O  OE1   . GLU B  2 89  ? -2.715  -60.179 -21.459 1.00 185.87 ? 89  GLU B OE1   1 
ATOM   3777  O  OE2   . GLU B  2 89  ? -4.087  -59.229 -22.896 1.00 182.14 ? 89  GLU B OE2   1 
ATOM   3778  N  N     . ASP B  2 90  ? -2.832  -57.387 -16.523 1.00 150.95 ? 90  ASP B N     1 
ATOM   3779  C  CA    . ASP B  2 90  ? -3.557  -57.479 -15.269 1.00 149.43 ? 90  ASP B CA    1 
ATOM   3780  C  C     . ASP B  2 90  ? -3.561  -56.174 -14.492 1.00 145.24 ? 90  ASP B C     1 
ATOM   3781  O  O     . ASP B  2 90  ? -3.993  -56.175 -13.338 1.00 135.62 ? 90  ASP B O     1 
ATOM   3782  C  CB    . ASP B  2 90  ? -3.006  -58.623 -14.405 1.00 149.73 ? 90  ASP B CB    1 
ATOM   3783  C  CG    . ASP B  2 90  ? -1.559  -58.416 -13.973 1.00 150.79 ? 90  ASP B CG    1 
ATOM   3784  O  OD1   . ASP B  2 90  ? -1.085  -57.262 -13.914 1.00 147.00 ? 90  ASP B OD1   1 
ATOM   3785  O  OD2   . ASP B  2 90  ? -0.889  -59.439 -13.690 1.00 155.84 ? 90  ASP B OD2   1 
ATOM   3786  N  N     . GLY B  2 91  ? -3.087  -55.070 -15.075 1.00 116.98 ? 91  GLY B N     1 
ATOM   3787  C  CA    . GLY B  2 91  ? -3.136  -53.795 -14.395 1.00 114.18 ? 91  GLY B CA    1 
ATOM   3788  C  C     . GLY B  2 91  ? -1.939  -53.463 -13.536 1.00 119.95 ? 91  GLY B C     1 
ATOM   3789  O  O     . GLY B  2 91  ? -1.824  -52.335 -13.064 1.00 110.80 ? 91  GLY B O     1 
ATOM   3790  N  N     . SER B  2 92  ? -1.051  -54.399 -13.299 1.00 124.81 ? 92  SER B N     1 
ATOM   3791  C  CA    . SER B  2 92  ? 0.079   -54.106 -12.440 1.00 127.91 ? 92  SER B CA    1 
ATOM   3792  C  C     . SER B  2 92  ? 1.134   -53.256 -13.151 1.00 112.56 ? 92  SER B C     1 
ATOM   3793  O  O     . SER B  2 92  ? 1.240   -53.231 -14.377 1.00 112.24 ? 92  SER B O     1 
ATOM   3794  C  CB    . SER B  2 92  ? 0.645   -55.425 -11.860 1.00 136.93 ? 92  SER B CB    1 
ATOM   3795  O  OG    . SER B  2 92  ? 1.039   -56.402 -12.827 1.00 142.66 ? 92  SER B OG    1 
ATOM   3796  N  N     . LEU B  2 93  ? 1.854   -52.489 -12.343 1.00 111.05 ? 93  LEU B N     1 
ATOM   3797  C  CA    . LEU B  2 93  ? 2.876   -51.567 -12.814 1.00 108.95 ? 93  LEU B CA    1 
ATOM   3798  C  C     . LEU B  2 93  ? 4.058   -52.301 -13.415 1.00 110.64 ? 93  LEU B C     1 
ATOM   3799  O  O     . LEU B  2 93  ? 4.477   -53.333 -12.912 1.00 113.20 ? 93  LEU B O     1 
ATOM   3800  C  CB    . LEU B  2 93  ? 3.405   -50.744 -11.651 1.00 107.51 ? 93  LEU B CB    1 
ATOM   3801  C  CG    . LEU B  2 93  ? 2.355   -49.977 -10.878 1.00 105.90 ? 93  LEU B CG    1 
ATOM   3802  C  CD1   . LEU B  2 93  ? 3.028   -49.205 -9.784  1.00 104.64 ? 93  LEU B CD1   1 
ATOM   3803  C  CD2   . LEU B  2 93  ? 1.602   -49.090 -11.817 1.00 103.73 ? 93  LEU B CD2   1 
ATOM   3804  N  N     . CYS B  2 94  ? 4.631   -51.752 -14.472 1.00 109.38 ? 94  CYS B N     1 
ATOM   3805  C  CA    . CYS B  2 94  ? 5.905   -52.282 -14.937 1.00 118.82 ? 94  CYS B CA    1 
ATOM   3806  C  C     . CYS B  2 94  ? 7.012   -51.955 -13.957 1.00 119.19 ? 94  CYS B C     1 
ATOM   3807  O  O     . CYS B  2 94  ? 7.917   -52.753 -13.748 1.00 124.94 ? 94  CYS B O     1 
ATOM   3808  C  CB    . CYS B  2 94  ? 6.248   -51.731 -16.312 1.00 118.28 ? 94  CYS B CB    1 
ATOM   3809  S  SG    . CYS B  2 94  ? 5.304   -52.509 -17.596 1.00 119.85 ? 94  CYS B SG    1 
ATOM   3810  N  N     . LEU B  2 95  ? 7.002   -50.756 -13.415 1.00 101.97 ? 95  LEU B N     1 
ATOM   3811  C  CA    . LEU B  2 95  ? 7.931   -50.348 -12.379 1.00 103.68 ? 95  LEU B CA    1 
ATOM   3812  C  C     . LEU B  2 95  ? 7.156   -49.489 -11.405 1.00 104.17 ? 95  LEU B C     1 
ATOM   3813  O  O     . LEU B  2 95  ? 6.355   -48.659 -11.831 1.00 102.78 ? 95  LEU B O     1 
ATOM   3814  C  CB    . LEU B  2 95  ? 9.124   -49.592 -12.948 1.00 103.16 ? 95  LEU B CB    1 
ATOM   3815  C  CG    . LEU B  2 95  ? 10.021  -50.473 -13.789 1.00 103.02 ? 95  LEU B CG    1 
ATOM   3816  C  CD1   . LEU B  2 95  ? 11.095  -49.711 -14.525 1.00 102.18 ? 95  LEU B CD1   1 
ATOM   3817  C  CD2   . LEU B  2 95  ? 10.654  -51.387 -12.821 1.00 123.89 ? 95  LEU B CD2   1 
ATOM   3818  N  N     . VAL B  2 96  ? 7.268   -49.771 -10.110 1.00 119.28 ? 96  VAL B N     1 
ATOM   3819  C  CA    . VAL B  2 96  ? 6.607   -48.893 -9.147  1.00 122.35 ? 96  VAL B CA    1 
ATOM   3820  C  C     . VAL B  2 96  ? 7.161   -47.487 -9.242  1.00 121.62 ? 96  VAL B C     1 
ATOM   3821  O  O     . VAL B  2 96  ? 6.518   -46.527 -8.810  1.00 122.77 ? 96  VAL B O     1 
ATOM   3822  C  CB    . VAL B  2 96  ? 6.738   -49.417 -7.710  1.00 131.72 ? 96  VAL B CB    1 
ATOM   3823  C  CG1   . VAL B  2 96  ? 6.132   -50.790 -7.597  1.00 139.48 ? 96  VAL B CG1   1 
ATOM   3824  C  CG2   . VAL B  2 96  ? 8.202   -49.400 -7.292  1.00 132.40 ? 96  VAL B CG2   1 
ATOM   3825  N  N     . GLN B  2 97  ? 8.379   -47.342 -9.745  1.00 121.39 ? 97  GLN B N     1 
ATOM   3826  C  CA    . GLN B  2 97  ? 8.997   -46.032 -9.771  1.00 122.43 ? 97  GLN B CA    1 
ATOM   3827  C  C     . GLN B  2 97  ? 8.284   -45.076 -10.717 1.00 104.86 ? 97  GLN B C     1 
ATOM   3828  O  O     . GLN B  2 97  ? 8.355   -43.869 -10.507 1.00 105.36 ? 97  GLN B O     1 
ATOM   3829  C  CB    . GLN B  2 97  ? 10.473  -46.209 -10.097 1.00 128.41 ? 97  GLN B CB    1 
ATOM   3830  C  CG    . GLN B  2 97  ? 11.030  -47.370 -9.269  1.00 143.13 ? 97  GLN B CG    1 
ATOM   3831  C  CD    . GLN B  2 97  ? 12.425  -47.819 -9.681  1.00 153.17 ? 97  GLN B CD    1 
ATOM   3832  O  OE1   . GLN B  2 97  ? 13.255  -46.993 -10.088 1.00 156.66 ? 97  GLN B OE1   1 
ATOM   3833  N  NE2   . GLN B  2 97  ? 12.697  -49.136 -9.564  1.00 153.00 ? 97  GLN B NE2   1 
ATOM   3834  N  N     . PHE B  2 98  ? 7.574   -45.557 -11.732 1.00 102.98 ? 98  PHE B N     1 
ATOM   3835  C  CA    . PHE B  2 98  ? 6.917   -44.673 -12.691 1.00 101.26 ? 98  PHE B CA    1 
ATOM   3836  C  C     . PHE B  2 98  ? 5.437   -45.016 -12.778 1.00 100.36 ? 98  PHE B C     1 
ATOM   3837  O  O     . PHE B  2 98  ? 4.982   -45.565 -13.786 1.00 98.68  ? 98  PHE B O     1 
ATOM   3838  C  CB    . PHE B  2 98  ? 7.510   -44.812 -14.087 1.00 99.54  ? 98  PHE B CB    1 
ATOM   3839  C  CG    . PHE B  2 98  ? 8.961   -44.553 -14.165 1.00 100.20 ? 98  PHE B CG    1 
ATOM   3840  C  CD1   . PHE B  2 98  ? 9.662   -44.070 -13.102 1.00 102.18 ? 98  PHE B CD1   1 
ATOM   3841  C  CD2   . PHE B  2 98  ? 9.627   -44.793 -15.326 1.00 98.87  ? 98  PHE B CD2   1 
ATOM   3842  C  CE1   . PHE B  2 98  ? 10.985  -43.866 -13.177 1.00 102.83 ? 98  PHE B CE1   1 
ATOM   3843  C  CE2   . PHE B  2 98  ? 10.965  -44.578 -15.415 1.00 99.47  ? 98  PHE B CE2   1 
ATOM   3844  C  CZ    . PHE B  2 98  ? 11.642  -44.110 -14.337 1.00 101.45 ? 98  PHE B CZ    1 
ATOM   3845  N  N     . PRO B  2 99  ? 4.637   -44.604 -11.794 1.00 101.42 ? 99  PRO B N     1 
ATOM   3846  C  CA    . PRO B  2 99  ? 3.211   -44.972 -11.785 1.00 100.69 ? 99  PRO B CA    1 
ATOM   3847  C  C     . PRO B  2 99  ? 2.298   -44.198 -12.716 1.00 98.98  ? 99  PRO B C     1 
ATOM   3848  O  O     . PRO B  2 99  ? 1.107   -44.521 -12.770 1.00 98.30  ? 99  PRO B O     1 
ATOM   3849  C  CB    . PRO B  2 99  ? 2.819   -44.739 -10.325 1.00 102.65 ? 99  PRO B CB    1 
ATOM   3850  C  CG    . PRO B  2 99  ? 3.721   -43.658 -9.897  1.00 103.92 ? 99  PRO B CG    1 
ATOM   3851  C  CD    . PRO B  2 99  ? 5.043   -43.986 -10.524 1.00 103.58 ? 99  PRO B CD    1 
ATOM   3852  N  N     . SER B  2 100 ? 2.770   -43.156 -13.388 1.00 113.93 ? 100 SER B N     1 
ATOM   3853  C  CA    . SER B  2 100 ? 1.886   -42.320 -14.185 1.00 101.23 ? 100 SER B CA    1 
ATOM   3854  C  C     . SER B  2 100 ? 2.643   -41.640 -15.315 1.00 103.80 ? 100 SER B C     1 
ATOM   3855  O  O     . SER B  2 100 ? 3.863   -41.473 -15.261 1.00 111.43 ? 100 SER B O     1 
ATOM   3856  C  CB    . SER B  2 100 ? 1.268   -41.251 -13.323 1.00 99.38  ? 100 SER B CB    1 
ATOM   3857  O  OG    . SER B  2 100 ? 2.330   -40.472 -12.807 1.00 102.41 ? 100 SER B OG    1 
ATOM   3858  N  N     . ARG B  2 101 ? 1.886   -41.133 -16.288 1.00 94.45  ? 101 ARG B N     1 
ATOM   3859  C  CA    . ARG B  2 101 ? 2.522   -40.483 -17.424 1.00 93.37  ? 101 ARG B CA    1 
ATOM   3860  C  C     . ARG B  2 101 ? 3.408   -39.335 -16.972 1.00 95.07  ? 101 ARG B C     1 
ATOM   3861  O  O     . ARG B  2 101 ? 4.541   -39.167 -17.452 1.00 95.01  ? 101 ARG B O     1 
ATOM   3862  C  CB    . ARG B  2 101 ? 1.457   -39.957 -18.353 1.00 91.78  ? 101 ARG B CB    1 
ATOM   3863  C  CG    . ARG B  2 101 ? 0.516   -40.971 -18.848 1.00 90.21  ? 101 ARG B CG    1 
ATOM   3864  C  CD    . ARG B  2 101 ? -0.647  -40.209 -19.341 1.00 89.31  ? 101 ARG B CD    1 
ATOM   3865  N  NE    . ARG B  2 101 ? -1.561  -40.998 -20.140 1.00 101.19 ? 101 ARG B NE    1 
ATOM   3866  C  CZ    . ARG B  2 101 ? -2.402  -41.891 -19.657 1.00 100.93 ? 101 ARG B CZ    1 
ATOM   3867  N  NH1   . ARG B  2 101 ? -2.455  -42.116 -18.350 1.00 89.28  ? 101 ARG B NH1   1 
ATOM   3868  N  NH2   . ARG B  2 101 ? -3.201  -42.536 -20.496 1.00 99.56  ? 101 ARG B NH2   1 
ATOM   3869  N  N     . LYS B  2 102 ? 2.919   -38.560 -16.012 1.00 124.99 ? 102 LYS B N     1 
ATOM   3870  C  CA    . LYS B  2 102 ? 3.627   -37.359 -15.596 1.00 127.37 ? 102 LYS B CA    1 
ATOM   3871  C  C     . LYS B  2 102 ? 5.036   -37.718 -15.154 1.00 126.95 ? 102 LYS B C     1 
ATOM   3872  O  O     . LYS B  2 102 ? 6.026   -37.193 -15.682 1.00 129.37 ? 102 LYS B O     1 
ATOM   3873  C  CB    . LYS B  2 102 ? 2.833   -36.685 -14.465 1.00 130.01 ? 102 LYS B CB    1 
ATOM   3874  C  CG    . LYS B  2 102 ? 3.377   -35.354 -13.942 1.00 136.52 ? 102 LYS B CG    1 
ATOM   3875  C  CD    . LYS B  2 102 ? 2.241   -34.448 -13.439 1.00 141.43 ? 102 LYS B CD    1 
ATOM   3876  C  CE    . LYS B  2 102 ? 1.351   -33.926 -14.561 1.00 141.76 ? 102 LYS B CE    1 
ATOM   3877  N  NZ    . LYS B  2 102 ? 2.168   -33.342 -15.647 1.00 143.38 ? 102 LYS B NZ    1 
ATOM   3878  N  N     . SER B  2 103 ? 5.130   -38.728 -14.292 1.00 121.17 ? 103 SER B N     1 
ATOM   3879  C  CA    . SER B  2 103 ? 6.399   -39.157 -13.729 1.00 118.13 ? 103 SER B CA    1 
ATOM   3880  C  C     . SER B  2 103 ? 7.383   -39.551 -14.810 1.00 118.27 ? 103 SER B C     1 
ATOM   3881  O  O     . SER B  2 103 ? 8.594   -39.314 -14.679 1.00 116.56 ? 103 SER B O     1 
ATOM   3882  C  CB    . SER B  2 103 ? 6.126   -40.313 -12.802 1.00 119.06 ? 103 SER B CB    1 
ATOM   3883  O  OG    . SER B  2 103 ? 5.670   -41.351 -13.628 1.00 120.76 ? 103 SER B OG    1 
ATOM   3884  N  N     . VAL B  2 104 ? 6.890   -40.162 -15.884 1.00 97.96  ? 104 VAL B N     1 
ATOM   3885  C  CA    . VAL B  2 104 ? 7.816   -40.513 -16.943 1.00 96.67  ? 104 VAL B CA    1 
ATOM   3886  C  C     . VAL B  2 104 ? 8.350   -39.253 -17.559 1.00 100.34 ? 104 VAL B C     1 
ATOM   3887  O  O     . VAL B  2 104 ? 9.568   -39.079 -17.703 1.00 101.28 ? 104 VAL B O     1 
ATOM   3888  C  CB    . VAL B  2 104 ? 7.150   -41.380 -18.016 1.00 98.17  ? 104 VAL B CB    1 
ATOM   3889  C  CG1   . VAL B  2 104 ? 8.154   -41.646 -19.143 1.00 93.15  ? 104 VAL B CG1   1 
ATOM   3890  C  CG2   . VAL B  2 104 ? 6.637   -42.649 -17.411 1.00 98.42  ? 104 VAL B CG2   1 
ATOM   3891  N  N     . MET B  2 105 ? 7.452   -38.315 -17.857 1.00 98.24  ? 105 MET B N     1 
ATOM   3892  C  CA    . MET B  2 105 ? 7.916   -37.101 -18.493 1.00 96.70  ? 105 MET B CA    1 
ATOM   3893  C  C     . MET B  2 105 ? 8.968   -36.434 -17.631 1.00 99.23  ? 105 MET B C     1 
ATOM   3894  O  O     . MET B  2 105 ? 10.089  -36.184 -18.098 1.00 99.39  ? 105 MET B O     1 
ATOM   3895  C  CB    . MET B  2 105 ? 6.715   -36.217 -18.774 1.00 96.42  ? 105 MET B CB    1 
ATOM   3896  C  CG    . MET B  2 105 ? 5.885   -36.874 -19.814 1.00 93.80  ? 105 MET B CG    1 
ATOM   3897  S  SD    . MET B  2 105 ? 4.398   -36.117 -20.436 1.00 92.75  ? 105 MET B SD    1 
ATOM   3898  C  CE    . MET B  2 105 ? 3.388   -36.150 -18.976 1.00 94.45  ? 105 MET B CE    1 
ATOM   3899  N  N     . LEU B  2 106 ? 8.695   -36.330 -16.328 1.00 101.23 ? 106 LEU B N     1 
ATOM   3900  C  CA    . LEU B  2 106 ? 9.633   -35.657 -15.447 1.00 103.89 ? 106 LEU B CA    1 
ATOM   3901  C  C     . LEU B  2 106 ? 10.973  -36.362 -15.473 1.00 103.88 ? 106 LEU B C     1 
ATOM   3902  O  O     . LEU B  2 106 ? 12.014  -35.715 -15.617 1.00 105.00 ? 106 LEU B O     1 
ATOM   3903  C  CB    . LEU B  2 106 ? 9.096   -35.600 -14.017 1.00 105.93 ? 106 LEU B CB    1 
ATOM   3904  C  CG    . LEU B  2 106 ? 7.866   -34.763 -13.691 1.00 106.72 ? 106 LEU B CG    1 
ATOM   3905  C  CD1   . LEU B  2 106 ? 7.372   -35.038 -12.274 1.00 108.39 ? 106 LEU B CD1   1 
ATOM   3906  C  CD2   . LEU B  2 106 ? 8.203   -33.321 -13.881 1.00 108.51 ? 106 LEU B CD2   1 
ATOM   3907  N  N     . TYR B  2 107 ? 10.972  -37.692 -15.410 1.00 102.68 ? 107 TYR B N     1 
ATOM   3908  C  CA    . TYR B  2 107 ? 12.253  -38.388 -15.432 1.00 117.56 ? 107 TYR B CA    1 
ATOM   3909  C  C     . TYR B  2 107 ? 13.007  -38.051 -16.710 1.00 114.07 ? 107 TYR B C     1 
ATOM   3910  O  O     . TYR B  2 107 ? 14.194  -37.697 -16.672 1.00 102.62 ? 107 TYR B O     1 
ATOM   3911  C  CB    . TYR B  2 107 ? 12.067  -39.901 -15.279 1.00 101.83 ? 107 TYR B CB    1 
ATOM   3912  C  CG    . TYR B  2 107 ? 13.385  -40.643 -15.147 1.00 102.35 ? 107 TYR B CG    1 
ATOM   3913  C  CD1   . TYR B  2 107 ? 13.988  -40.818 -13.918 1.00 104.48 ? 107 TYR B CD1   1 
ATOM   3914  C  CD2   . TYR B  2 107 ? 14.034  -41.138 -16.256 1.00 100.80 ? 107 TYR B CD2   1 
ATOM   3915  C  CE1   . TYR B  2 107 ? 15.190  -41.469 -13.803 1.00 105.73 ? 107 TYR B CE1   1 
ATOM   3916  C  CE2   . TYR B  2 107 ? 15.231  -41.792 -16.150 1.00 101.38 ? 107 TYR B CE2   1 
ATOM   3917  C  CZ    . TYR B  2 107 ? 15.807  -41.954 -14.924 1.00 104.67 ? 107 TYR B CZ    1 
ATOM   3918  O  OH    . TYR B  2 107 ? 17.006  -42.615 -14.840 1.00 107.81 ? 107 TYR B OH    1 
ATOM   3919  N  N     . ALA B  2 108 ? 12.313  -38.096 -17.847 1.00 99.33  ? 108 ALA B N     1 
ATOM   3920  C  CA    . ALA B  2 108 ? 12.981  -37.808 -19.101 1.00 98.01  ? 108 ALA B CA    1 
ATOM   3921  C  C     . ALA B  2 108 ? 13.677  -36.473 -19.015 1.00 111.27 ? 108 ALA B C     1 
ATOM   3922  O  O     . ALA B  2 108 ? 14.891  -36.374 -19.239 1.00 100.30 ? 108 ALA B O     1 
ATOM   3923  C  CB    . ALA B  2 108 ? 11.967  -37.799 -20.238 1.00 103.54 ? 108 ALA B CB    1 
ATOM   3924  N  N     . ALA B  2 109 ? 12.943  -35.460 -18.551 1.00 108.18 ? 109 ALA B N     1 
ATOM   3925  C  CA    . ALA B  2 109 ? 13.507  -34.120 -18.458 1.00 103.33 ? 109 ALA B CA    1 
ATOM   3926  C  C     . ALA B  2 109 ? 14.701  -34.088 -17.521 1.00 105.72 ? 109 ALA B C     1 
ATOM   3927  O  O     . ALA B  2 109 ? 15.681  -33.385 -17.777 1.00 111.82 ? 109 ALA B O     1 
ATOM   3928  C  CB    . ALA B  2 109 ? 12.443  -33.143 -17.983 1.00 116.94 ? 109 ALA B CB    1 
ATOM   3929  N  N     . GLU B  2 110 ? 14.648  -34.859 -16.441 1.00 121.18 ? 110 GLU B N     1 
ATOM   3930  C  CA    . GLU B  2 110 ? 15.763  -34.869 -15.506 1.00 128.19 ? 110 GLU B CA    1 
ATOM   3931  C  C     . GLU B  2 110 ? 17.016  -35.455 -16.130 1.00 134.83 ? 110 GLU B C     1 
ATOM   3932  O  O     . GLU B  2 110 ? 18.112  -34.913 -15.962 1.00 150.93 ? 110 GLU B O     1 
ATOM   3933  C  CB    . GLU B  2 110 ? 15.391  -35.659 -14.257 1.00 125.97 ? 110 GLU B CB    1 
ATOM   3934  C  CG    . GLU B  2 110 ? 16.473  -35.642 -13.201 1.00 130.74 ? 110 GLU B CG    1 
ATOM   3935  C  CD    . GLU B  2 110 ? 15.988  -36.162 -11.873 1.00 133.63 ? 110 GLU B CD    1 
ATOM   3936  O  OE1   . GLU B  2 110 ? 14.794  -36.503 -11.763 1.00 130.48 ? 110 GLU B OE1   1 
ATOM   3937  O  OE2   . GLU B  2 110 ? 16.804  -36.234 -10.939 1.00 138.84 ? 110 GLU B OE2   1 
ATOM   3938  N  N     . MET B  2 111 ? 16.893  -36.557 -16.845 1.00 118.26 ? 111 MET B N     1 
ATOM   3939  C  CA    . MET B  2 111 ? 18.127  -37.172 -17.300 1.00 122.86 ? 111 MET B CA    1 
ATOM   3940  C  C     . MET B  2 111 ? 18.649  -36.610 -18.609 1.00 119.65 ? 111 MET B C     1 
ATOM   3941  O  O     . MET B  2 111 ? 19.867  -36.534 -18.785 1.00 120.93 ? 111 MET B O     1 
ATOM   3942  C  CB    . MET B  2 111 ? 17.951  -38.689 -17.416 1.00 130.39 ? 111 MET B CB    1 
ATOM   3943  C  CG    . MET B  2 111 ? 17.623  -39.363 -16.100 1.00 139.63 ? 111 MET B CG    1 
ATOM   3944  S  SD    . MET B  2 111 ? 18.915  -39.097 -14.867 1.00 148.85 ? 111 MET B SD    1 
ATOM   3945  C  CE    . MET B  2 111 ? 18.290  -40.027 -13.462 1.00 145.11 ? 111 MET B CE    1 
ATOM   3946  N  N     . ILE B  2 112 ? 17.775  -36.146 -19.490 1.00 105.90 ? 112 ILE B N     1 
ATOM   3947  C  CA    . ILE B  2 112 ? 18.186  -35.824 -20.852 1.00 108.18 ? 112 ILE B CA    1 
ATOM   3948  C  C     . ILE B  2 112 ? 19.447  -34.975 -20.929 1.00 119.32 ? 112 ILE B C     1 
ATOM   3949  O  O     . ILE B  2 112 ? 20.340  -35.300 -21.720 1.00 129.98 ? 112 ILE B O     1 
ATOM   3950  C  CB    . ILE B  2 112 ? 17.053  -35.123 -21.602 1.00 101.52 ? 112 ILE B CB    1 
ATOM   3951  C  CG1   . ILE B  2 112 ? 16.028  -36.149 -22.011 1.00 111.08 ? 112 ILE B CG1   1 
ATOM   3952  C  CG2   . ILE B  2 112 ? 17.589  -34.424 -22.836 1.00 101.01 ? 112 ILE B CG2   1 
ATOM   3953  C  CD1   . ILE B  2 112 ? 14.862  -35.549 -22.674 1.00 121.53 ? 112 ILE B CD1   1 
ATOM   3954  N  N     . PRO B  2 113 ? 19.607  -33.940 -20.105 1.00 112.73 ? 113 PRO B N     1 
ATOM   3955  C  CA    . PRO B  2 113 ? 20.801  -33.095 -20.229 1.00 117.21 ? 113 PRO B CA    1 
ATOM   3956  C  C     . PRO B  2 113 ? 22.118  -33.789 -19.970 1.00 132.65 ? 113 PRO B C     1 
ATOM   3957  O  O     . PRO B  2 113 ? 23.157  -33.244 -20.352 1.00 135.27 ? 113 PRO B O     1 
ATOM   3958  C  CB    . PRO B  2 113 ? 20.548  -31.995 -19.192 1.00 128.63 ? 113 PRO B CB    1 
ATOM   3959  C  CG    . PRO B  2 113 ? 19.087  -31.950 -19.079 1.00 124.41 ? 113 PRO B CG    1 
ATOM   3960  C  CD    . PRO B  2 113 ? 18.691  -33.380 -19.102 1.00 126.46 ? 113 PRO B CD    1 
ATOM   3961  N  N     . LYS B  2 114 ? 22.137  -34.959 -19.352 1.00 127.99 ? 114 LYS B N     1 
ATOM   3962  C  CA    . LYS B  2 114 ? 23.422  -35.586 -19.056 1.00 126.90 ? 114 LYS B CA    1 
ATOM   3963  C  C     . LYS B  2 114 ? 24.020  -36.404 -20.189 1.00 124.78 ? 114 LYS B C     1 
ATOM   3964  O  O     . LYS B  2 114 ? 25.225  -36.674 -20.158 1.00 126.40 ? 114 LYS B O     1 
ATOM   3965  C  CB    . LYS B  2 114 ? 23.346  -36.469 -17.810 1.00 125.70 ? 114 LYS B CB    1 
ATOM   3966  C  CG    . LYS B  2 114 ? 23.045  -35.700 -16.555 1.00 128.46 ? 114 LYS B CG    1 
ATOM   3967  C  CD    . LYS B  2 114 ? 22.825  -36.626 -15.386 1.00 131.31 ? 114 LYS B CD    1 
ATOM   3968  C  CE    . LYS B  2 114 ? 22.857  -35.838 -14.092 1.00 138.48 ? 114 LYS B CE    1 
ATOM   3969  N  NZ    . LYS B  2 114 ? 22.598  -36.673 -12.895 1.00 142.97 ? 114 LYS B NZ    1 
ATOM   3970  N  N     . LEU B  2 115 ? 23.240  -36.788 -21.186 1.00 127.50 ? 115 LEU B N     1 
ATOM   3971  C  CA    . LEU B  2 115 ? 23.802  -37.620 -22.236 1.00 128.38 ? 115 LEU B CA    1 
ATOM   3972  C  C     . LEU B  2 115 ? 24.905  -36.935 -23.033 1.00 127.88 ? 115 LEU B C     1 
ATOM   3973  O  O     . LEU B  2 115 ? 26.099  -37.131 -22.773 1.00 129.78 ? 115 LEU B O     1 
ATOM   3974  C  CB    . LEU B  2 115 ? 22.683  -38.064 -23.158 1.00 132.62 ? 115 LEU B CB    1 
ATOM   3975  C  CG    . LEU B  2 115 ? 21.847  -39.033 -22.340 1.00 149.17 ? 115 LEU B CG    1 
ATOM   3976  C  CD1   . LEU B  2 115 ? 20.596  -39.347 -23.096 1.00 150.04 ? 115 LEU B CD1   1 
ATOM   3977  C  CD2   . LEU B  2 115 ? 22.645  -40.322 -21.984 1.00 163.13 ? 115 LEU B CD2   1 
ATOM   3978  N  N     . LYS B  2 116 ? 24.532  -36.140 -24.011 1.00 127.43 ? 116 LYS B N     1 
ATOM   3979  C  CA    . LYS B  2 116 ? 25.536  -35.612 -24.912 1.00 135.37 ? 116 LYS B CA    1 
ATOM   3980  C  C     . LYS B  2 116 ? 25.471  -34.101 -24.985 1.00 149.26 ? 116 LYS B C     1 
ATOM   3981  O  O     . LYS B  2 116 ? 25.881  -33.519 -25.986 1.00 151.56 ? 116 LYS B O     1 
ATOM   3982  C  CB    . LYS B  2 116 ? 25.375  -36.224 -26.296 1.00 130.31 ? 116 LYS B CB    1 
ATOM   3983  C  CG    . LYS B  2 116 ? 25.179  -37.727 -26.267 1.00 129.30 ? 116 LYS B CG    1 
ATOM   3984  C  CD    . LYS B  2 116 ? 24.572  -38.196 -27.571 1.00 125.58 ? 116 LYS B CD    1 
ATOM   3985  C  CE    . LYS B  2 116 ? 24.511  -39.701 -27.662 1.00 124.42 ? 116 LYS B CE    1 
ATOM   3986  N  NZ    . LYS B  2 116 ? 24.036  -40.121 -29.006 1.00 124.56 ? 116 LYS B NZ    1 
ATOM   3987  N  N     . THR B  2 117 ? 24.951  -33.452 -23.940 1.00 163.08 ? 117 THR B N     1 
ATOM   3988  C  CA    . THR B  2 117 ? 24.887  -31.992 -23.945 1.00 175.13 ? 117 THR B CA    1 
ATOM   3989  C  C     . THR B  2 117 ? 26.282  -31.375 -23.863 1.00 185.85 ? 117 THR B C     1 
ATOM   3990  O  O     . THR B  2 117 ? 26.523  -30.299 -24.430 1.00 188.82 ? 117 THR B O     1 
ATOM   3991  C  CB    . THR B  2 117 ? 23.989  -31.495 -22.798 1.00 182.80 ? 117 THR B CB    1 
ATOM   3992  O  OG1   . THR B  2 117 ? 22.625  -31.878 -23.048 1.00 181.13 ? 117 THR B OG1   1 
ATOM   3993  C  CG2   . THR B  2 117 ? 24.058  -29.964 -22.631 1.00 189.12 ? 117 THR B CG2   1 
ATOM   3994  N  N     . ARG B  2 118 ? 27.217  -32.060 -23.211 1.00 182.21 ? 118 ARG B N     1 
ATOM   3995  C  CA    . ARG B  2 118 ? 28.569  -31.549 -23.000 1.00 179.50 ? 118 ARG B CA    1 
ATOM   3996  C  C     . ARG B  2 118 ? 29.362  -31.336 -24.301 1.00 174.21 ? 118 ARG B C     1 
ATOM   3997  O  O     . ARG B  2 118 ? 29.428  -30.220 -24.842 1.00 169.37 ? 118 ARG B O     1 
ATOM   3998  C  CB    . ARG B  2 118 ? 29.312  -32.510 -22.066 1.00 178.86 ? 118 ARG B CB    1 
ATOM   3999  C  CG    . ARG B  2 118 ? 30.803  -32.636 -22.308 1.00 182.93 ? 118 ARG B CG    1 
ATOM   4000  C  CD    . ARG B  2 118 ? 31.160  -34.013 -22.862 1.00 182.19 ? 118 ARG B CD    1 
ATOM   4001  N  NE    . ARG B  2 118 ? 30.992  -34.077 -24.310 1.00 179.76 ? 118 ARG B NE    1 
ATOM   4002  C  CZ    . ARG B  2 118 ? 29.915  -34.555 -24.926 1.00 176.09 ? 118 ARG B CZ    1 
ATOM   4003  N  NH1   . ARG B  2 118 ? 28.889  -35.031 -24.226 1.00 176.58 ? 118 ARG B NH1   1 
ATOM   4004  N  NH2   . ARG B  2 118 ? 29.867  -34.558 -26.251 1.00 173.13 ? 118 ARG B NH2   1 
ATOM   4005  N  N     . HIS C  3 7   ? -11.098 47.263  2.741   1.00 148.15 ? 58  HIS C N     1 
ATOM   4006  C  CA    . HIS C  3 7   ? -11.555 46.880  4.078   1.00 147.95 ? 58  HIS C CA    1 
ATOM   4007  C  C     . HIS C  3 7   ? -12.635 45.769  4.066   1.00 143.78 ? 58  HIS C C     1 
ATOM   4008  O  O     . HIS C  3 7   ? -12.415 44.669  4.578   1.00 137.27 ? 58  HIS C O     1 
ATOM   4009  C  CB    . HIS C  3 7   ? -12.101 48.115  4.830   1.00 147.14 ? 58  HIS C CB    1 
ATOM   4010  C  CG    . HIS C  3 7   ? -11.060 49.133  5.181   1.00 150.11 ? 58  HIS C CG    1 
ATOM   4011  N  ND1   . HIS C  3 7   ? -10.659 50.123  4.307   1.00 152.30 ? 58  HIS C ND1   1 
ATOM   4012  C  CD2   . HIS C  3 7   ? -10.349 49.328  6.318   1.00 149.91 ? 58  HIS C CD2   1 
ATOM   4013  C  CE1   . HIS C  3 7   ? -9.744  50.880  4.887   1.00 150.98 ? 58  HIS C CE1   1 
ATOM   4014  N  NE2   . HIS C  3 7   ? -9.537  50.420  6.109   1.00 150.85 ? 58  HIS C NE2   1 
ATOM   4015  N  N     . HIS C  3 8   ? -13.767 46.069  3.428   1.00 145.24 ? 59  HIS C N     1 
ATOM   4016  C  CA    . HIS C  3 8   ? -15.086 45.544  3.752   1.00 139.68 ? 59  HIS C CA    1 
ATOM   4017  C  C     . HIS C  3 8   ? -15.559 44.540  2.707   1.00 135.33 ? 59  HIS C C     1 
ATOM   4018  O  O     . HIS C  3 8   ? -15.040 44.491  1.587   1.00 130.33 ? 59  HIS C O     1 
ATOM   4019  C  CB    . HIS C  3 8   ? -16.056 46.731  3.836   1.00 145.79 ? 59  HIS C CB    1 
ATOM   4020  C  CG    . HIS C  3 8   ? -17.386 46.424  4.444   1.00 146.36 ? 59  HIS C CG    1 
ATOM   4021  N  ND1   . HIS C  3 8   ? -17.531 45.895  5.708   1.00 146.64 ? 59  HIS C ND1   1 
ATOM   4022  C  CD2   . HIS C  3 8   ? -18.639 46.642  3.980   1.00 150.65 ? 59  HIS C CD2   1 
ATOM   4023  C  CE1   . HIS C  3 8   ? -18.816 45.772  5.983   1.00 150.02 ? 59  HIS C CE1   1 
ATOM   4024  N  NE2   . HIS C  3 8   ? -19.510 46.217  4.952   1.00 153.13 ? 59  HIS C NE2   1 
ATOM   4025  N  N     . LEU C  3 9   ? -16.553 43.722  3.090   1.00 140.26 ? 60  LEU C N     1 
ATOM   4026  C  CA    . LEU C  3 9   ? -17.155 42.755  2.169   1.00 135.85 ? 60  LEU C CA    1 
ATOM   4027  C  C     . LEU C  3 9   ? -18.411 42.056  2.687   1.00 126.15 ? 60  LEU C C     1 
ATOM   4028  O  O     . LEU C  3 9   ? -18.303 41.137  3.501   1.00 117.10 ? 60  LEU C O     1 
ATOM   4029  C  CB    . LEU C  3 9   ? -16.147 41.673  1.798   1.00 102.76 ? 60  LEU C CB    1 
ATOM   4030  C  CG    . LEU C  3 9   ? -16.846 40.925  0.685   1.00 100.74 ? 60  LEU C CG    1 
ATOM   4031  C  CD1   . LEU C  3 9   ? -17.105 41.920  -0.429  1.00 105.78 ? 60  LEU C CD1   1 
ATOM   4032  C  CD2   . LEU C  3 9   ? -15.992 39.765  0.198   1.00 99.85  ? 60  LEU C CD2   1 
ATOM   4033  N  N     . GLU C  3 10  ? -19.584 42.384  2.136   1.00 127.85 ? 61  GLU C N     1 
ATOM   4034  C  CA    . GLU C  3 10  ? -20.868 41.832  2.600   1.00 130.02 ? 61  GLU C CA    1 
ATOM   4035  C  C     . GLU C  3 10  ? -21.187 40.541  1.834   1.00 128.66 ? 61  GLU C C     1 
ATOM   4036  O  O     . GLU C  3 10  ? -21.987 40.519  0.894   1.00 122.33 ? 61  GLU C O     1 
ATOM   4037  C  CB    . GLU C  3 10  ? -21.993 42.863  2.457   1.00 136.83 ? 61  GLU C CB    1 
ATOM   4038  C  CG    . GLU C  3 10  ? -21.934 44.120  3.381   1.00 142.87 ? 61  GLU C CG    1 
ATOM   4039  C  CD    . GLU C  3 10  ? -23.231 44.968  3.365   1.00 142.65 ? 61  GLU C CD    1 
ATOM   4040  O  OE1   . GLU C  3 10  ? -23.935 44.981  2.335   1.00 142.11 ? 61  GLU C OE1   1 
ATOM   4041  O  OE2   . GLU C  3 10  ? -23.551 45.623  4.384   1.00 141.35 ? 61  GLU C OE2   1 
ATOM   4042  N  N     . ILE C  3 11  ? -20.551 39.436  2.256   1.00 138.68 ? 62  ILE C N     1 
ATOM   4043  C  CA    . ILE C  3 11  ? -20.562 38.199  1.461   1.00 140.71 ? 62  ILE C CA    1 
ATOM   4044  C  C     . ILE C  3 11  ? -21.976 37.676  1.262   1.00 94.11  ? 62  ILE C C     1 
ATOM   4045  O  O     . ILE C  3 11  ? -22.419 37.436  0.134   1.00 93.33  ? 62  ILE C O     1 
ATOM   4046  C  CB    . ILE C  3 11  ? -19.691 37.116  2.105   1.00 94.98  ? 62  ILE C CB    1 
ATOM   4047  C  CG1   . ILE C  3 11  ? -18.272 37.592  2.309   1.00 96.53  ? 62  ILE C CG1   1 
ATOM   4048  C  CG2   . ILE C  3 11  ? -19.596 35.977  1.155   1.00 93.51  ? 62  ILE C CG2   1 
ATOM   4049  C  CD1   . ILE C  3 11  ? -17.427 36.561  2.967   1.00 96.56  ? 62  ILE C CD1   1 
ATOM   4050  N  N     . LEU C  3 12  ? -22.703 37.484  2.358   1.00 94.12  ? 63  LEU C N     1 
ATOM   4051  C  CA    . LEU C  3 12  ? -24.007 36.860  2.239   1.00 93.01  ? 63  LEU C CA    1 
ATOM   4052  C  C     . LEU C  3 12  ? -24.888 37.659  1.308   1.00 93.43  ? 63  LEU C C     1 
ATOM   4053  O  O     . LEU C  3 12  ? -25.539 37.098  0.421   1.00 92.43  ? 63  LEU C O     1 
ATOM   4054  C  CB    . LEU C  3 12  ? -24.653 36.730  3.614   1.00 93.50  ? 63  LEU C CB    1 
ATOM   4055  C  CG    . LEU C  3 12  ? -26.062 36.135  3.682   1.00 92.71  ? 63  LEU C CG    1 
ATOM   4056  C  CD1   . LEU C  3 12  ? -26.008 34.759  3.171   1.00 120.62 ? 63  LEU C CD1   1 
ATOM   4057  C  CD2   . LEU C  3 12  ? -26.568 36.106  5.108   1.00 93.66  ? 63  LEU C CD2   1 
ATOM   4058  N  N     . GLN C  3 13  ? -24.827 38.984  1.421   1.00 104.10 ? 64  GLN C N     1 
ATOM   4059  C  CA    . GLN C  3 13  ? -25.621 39.830  0.543   1.00 105.84 ? 64  GLN C CA    1 
ATOM   4060  C  C     . GLN C  3 13  ? -25.205 39.619  -0.897  1.00 95.47  ? 64  GLN C C     1 
ATOM   4061  O  O     . GLN C  3 13  ? -26.059 39.436  -1.775  1.00 101.92 ? 64  GLN C O     1 
ATOM   4062  C  CB    . GLN C  3 13  ? -25.463 41.300  0.936   1.00 108.17 ? 64  GLN C CB    1 
ATOM   4063  C  CG    . GLN C  3 13  ? -26.127 42.312  -0.014  1.00 112.93 ? 64  GLN C CG    1 
ATOM   4064  C  CD    . GLN C  3 13  ? -27.648 42.338  0.082   1.00 118.36 ? 64  GLN C CD    1 
ATOM   4065  O  OE1   . GLN C  3 13  ? -28.208 42.254  1.174   1.00 125.09 ? 64  GLN C OE1   1 
ATOM   4066  N  NE2   . GLN C  3 13  ? -28.318 42.514  -1.053  1.00 115.10 ? 64  GLN C NE2   1 
ATOM   4067  N  N     . ILE C  3 14  ? -23.898 39.515  -1.142  1.00 95.37  ? 65  ILE C N     1 
ATOM   4068  C  CA    . ILE C  3 14  ? -23.448 39.352  -2.515  1.00 95.18  ? 65  ILE C CA    1 
ATOM   4069  C  C     . ILE C  3 14  ? -24.070 38.097  -3.092  1.00 119.28 ? 65  ILE C C     1 
ATOM   4070  O  O     . ILE C  3 14  ? -24.752 38.128  -4.126  1.00 93.74  ? 65  ILE C O     1 
ATOM   4071  C  CB    . ILE C  3 14  ? -21.910 39.303  -2.588  1.00 95.47  ? 65  ILE C CB    1 
ATOM   4072  C  CG1   . ILE C  3 14  ? -21.315 40.670  -2.303  1.00 97.46  ? 65  ILE C CG1   1 
ATOM   4073  C  CG2   . ILE C  3 14  ? -21.451 38.838  -3.956  1.00 95.23  ? 65  ILE C CG2   1 
ATOM   4074  C  CD1   . ILE C  3 14  ? -21.666 41.715  -3.371  1.00 115.57 ? 65  ILE C CD1   1 
ATOM   4075  N  N     . ILE C  3 15  ? -23.963 36.997  -2.354  1.00 119.28 ? 66  ILE C N     1 
ATOM   4076  C  CA    . ILE C  3 15  ? -24.426 35.752  -2.933  1.00 119.03 ? 66  ILE C CA    1 
ATOM   4077  C  C     . ILE C  3 15  ? -25.927 35.776  -3.103  1.00 118.96 ? 66  ILE C C     1 
ATOM   4078  O  O     . ILE C  3 15  ? -26.430 35.447  -4.174  1.00 116.29 ? 66  ILE C O     1 
ATOM   4079  C  CB    . ILE C  3 15  ? -23.962 34.550  -2.099  1.00 118.30 ? 66  ILE C CB    1 
ATOM   4080  C  CG1   . ILE C  3 15  ? -24.748 34.430  -0.806  1.00 122.80 ? 66  ILE C CG1   1 
ATOM   4081  C  CG2   . ILE C  3 15  ? -22.495 34.669  -1.766  1.00 118.51 ? 66  ILE C CG2   1 
ATOM   4082  C  CD1   . ILE C  3 15  ? -24.407 33.158  -0.063  1.00 130.23 ? 66  ILE C CD1   1 
ATOM   4083  N  N     . LYS C  3 16  ? -26.653 36.325  -2.145  1.00 91.28  ? 67  LYS C N     1 
ATOM   4084  C  CA    . LYS C  3 16  ? -28.097 36.255  -2.265  1.00 91.39  ? 67  LYS C CA    1 
ATOM   4085  C  C     . LYS C  3 16  ? -28.577 37.096  -3.436  1.00 92.70  ? 67  LYS C C     1 
ATOM   4086  O  O     . LYS C  3 16  ? -29.362 36.625  -4.264  1.00 92.57  ? 67  LYS C O     1 
ATOM   4087  C  CB    . LYS C  3 16  ? -28.742 36.689  -0.961  1.00 92.05  ? 67  LYS C CB    1 
ATOM   4088  C  CG    . LYS C  3 16  ? -28.536 35.714  0.168   1.00 90.98  ? 67  LYS C CG    1 
ATOM   4089  C  CD    . LYS C  3 16  ? -29.184 34.395  -0.127  1.00 96.08  ? 67  LYS C CD    1 
ATOM   4090  C  CE    . LYS C  3 16  ? -30.683 34.568  -0.297  1.00 96.84  ? 67  LYS C CE    1 
ATOM   4091  N  NZ    . LYS C  3 16  ? -31.466 33.325  0.003   1.00 93.26  ? 67  LYS C NZ    1 
ATOM   4092  N  N     . GLU C  3 17  ? -28.087 38.322  -3.570  1.00 102.74 ? 68  GLU C N     1 
ATOM   4093  C  CA    . GLU C  3 17  ? -28.619 39.075  -4.693  1.00 106.60 ? 68  GLU C CA    1 
ATOM   4094  C  C     . GLU C  3 17  ? -28.126 38.492  -6.007  1.00 95.58  ? 68  GLU C C     1 
ATOM   4095  O  O     . GLU C  3 17  ? -28.912 38.353  -6.949  1.00 95.92  ? 68  GLU C O     1 
ATOM   4096  C  CB    . GLU C  3 17  ? -28.293 40.582  -4.603  1.00 121.86 ? 68  GLU C CB    1 
ATOM   4097  C  CG    . GLU C  3 17  ? -26.833 41.017  -4.858  1.00 126.19 ? 68  GLU C CG    1 
ATOM   4098  C  CD    . GLU C  3 17  ? -26.554 42.484  -4.507  1.00 122.07 ? 68  GLU C CD    1 
ATOM   4099  O  OE1   . GLU C  3 17  ? -27.208 43.026  -3.588  1.00 121.54 ? 68  GLU C OE1   1 
ATOM   4100  O  OE2   . GLU C  3 17  ? -25.682 43.084  -5.178  1.00 118.18 ? 68  GLU C OE2   1 
ATOM   4101  N  N     . SER C  3 18  ? -26.885 38.022  -6.062  1.00 94.45  ? 69  SER C N     1 
ATOM   4102  C  CA    . SER C  3 18  ? -26.399 37.535  -7.340  1.00 94.52  ? 69  SER C CA    1 
ATOM   4103  C  C     . SER C  3 18  ? -27.225 36.345  -7.779  1.00 124.81 ? 69  SER C C     1 
ATOM   4104  O  O     . SER C  3 18  ? -27.770 36.324  -8.891  1.00 128.82 ? 69  SER C O     1 
ATOM   4105  C  CB    . SER C  3 18  ? -24.930 37.143  -7.240  1.00 93.95  ? 69  SER C CB    1 
ATOM   4106  O  OG    . SER C  3 18  ? -24.108 38.219  -6.877  1.00 95.05  ? 69  SER C OG    1 
ATOM   4107  N  N     . GLN C  3 19  ? -27.412 35.389  -6.865  1.00 114.35 ? 70  GLN C N     1 
ATOM   4108  C  CA    . GLN C  3 19  ? -28.188 34.197  -7.165  1.00 104.95 ? 70  GLN C CA    1 
ATOM   4109  C  C     . GLN C  3 19  ? -29.619 34.567  -7.529  1.00 106.67 ? 70  GLN C C     1 
ATOM   4110  O  O     . GLN C  3 19  ? -30.176 34.033  -8.492  1.00 120.17 ? 70  GLN C O     1 
ATOM   4111  C  CB    . GLN C  3 19  ? -28.158 33.245  -5.960  1.00 99.87  ? 70  GLN C CB    1 
ATOM   4112  C  CG    . GLN C  3 19  ? -26.782 32.631  -5.668  1.00 99.86  ? 70  GLN C CG    1 
ATOM   4113  C  CD    . GLN C  3 19  ? -26.684 31.798  -4.377  1.00 100.03 ? 70  GLN C CD    1 
ATOM   4114  O  OE1   . GLN C  3 19  ? -27.685 31.464  -3.730  1.00 97.10  ? 70  GLN C OE1   1 
ATOM   4115  N  NE2   . GLN C  3 19  ? -25.450 31.477  -3.999  1.00 103.69 ? 70  GLN C NE2   1 
ATOM   4116  N  N     . GLN C  3 20  ? -30.202 35.539  -6.834  1.00 98.39  ? 71  GLN C N     1 
ATOM   4117  C  CA    . GLN C  3 20  ? -31.591 35.870  -7.113  1.00 103.69 ? 71  GLN C CA    1 
ATOM   4118  C  C     . GLN C  3 20  ? -31.734 36.468  -8.500  1.00 114.63 ? 71  GLN C C     1 
ATOM   4119  O  O     . GLN C  3 20  ? -32.734 36.227  -9.182  1.00 114.56 ? 71  GLN C O     1 
ATOM   4120  C  CB    . GLN C  3 20  ? -32.144 36.798  -6.037  1.00 105.81 ? 71  GLN C CB    1 
ATOM   4121  C  CG    . GLN C  3 20  ? -32.244 36.110  -4.693  1.00 107.51 ? 71  GLN C CG    1 
ATOM   4122  C  CD    . GLN C  3 20  ? -33.398 35.135  -4.633  1.00 112.29 ? 71  GLN C CD    1 
ATOM   4123  O  OE1   . GLN C  3 20  ? -34.127 34.959  -5.607  1.00 117.13 ? 71  GLN C OE1   1 
ATOM   4124  N  NE2   . GLN C  3 20  ? -33.543 34.460  -3.499  1.00 110.12 ? 71  GLN C NE2   1 
ATOM   4125  N  N     . GLN C  3 21  ? -30.740 37.251  -8.926  1.00 127.17 ? 72  GLN C N     1 
ATOM   4126  C  CA    . GLN C  3 21  ? -30.786 37.921  -10.224 1.00 130.18 ? 72  GLN C CA    1 
ATOM   4127  C  C     . GLN C  3 21  ? -30.515 36.960  -11.383 1.00 122.98 ? 72  GLN C C     1 
ATOM   4128  O  O     . GLN C  3 21  ? -31.018 37.165  -12.492 1.00 131.48 ? 72  GLN C O     1 
ATOM   4129  C  CB    . GLN C  3 21  ? -29.773 39.073  -10.239 1.00 136.92 ? 72  GLN C CB    1 
ATOM   4130  C  CG    . GLN C  3 21  ? -29.737 39.930  -11.505 1.00 141.57 ? 72  GLN C CG    1 
ATOM   4131  C  CD    . GLN C  3 21  ? -29.663 41.413  -11.197 1.00 145.08 ? 72  GLN C CD    1 
ATOM   4132  O  OE1   . GLN C  3 21  ? -29.845 41.823  -10.054 1.00 147.24 ? 72  GLN C OE1   1 
ATOM   4133  N  NE2   . GLN C  3 21  ? -29.389 42.226  -12.217 1.00 147.67 ? 72  GLN C NE2   1 
ATOM   4134  N  N     . HIS C  3 22  ? -29.695 35.938  -11.174 1.00 119.71 ? 73  HIS C N     1 
ATOM   4135  C  CA    . HIS C  3 22  ? -29.179 35.150  -12.288 1.00 116.69 ? 73  HIS C CA    1 
ATOM   4136  C  C     . HIS C  3 22  ? -29.662 33.694  -12.267 1.00 111.09 ? 73  HIS C C     1 
ATOM   4137  O  O     . HIS C  3 22  ? -28.996 32.800  -12.790 1.00 100.89 ? 73  HIS C O     1 
ATOM   4138  C  CB    . HIS C  3 22  ? -27.662 35.232  -12.296 1.00 110.42 ? 73  HIS C CB    1 
ATOM   4139  C  CG    . HIS C  3 22  ? -27.161 36.628  -12.433 1.00 103.16 ? 73  HIS C CG    1 
ATOM   4140  N  ND1   . HIS C  3 22  ? -27.059 37.480  -11.356 1.00 103.98 ? 73  HIS C ND1   1 
ATOM   4141  C  CD2   . HIS C  3 22  ? -26.764 37.332  -13.515 1.00 104.74 ? 73  HIS C CD2   1 
ATOM   4142  C  CE1   . HIS C  3 22  ? -26.605 38.648  -11.766 1.00 110.52 ? 73  HIS C CE1   1 
ATOM   4143  N  NE2   . HIS C  3 22  ? -26.415 38.583  -13.072 1.00 110.35 ? 73  HIS C NE2   1 
ATOM   4144  N  N     . GLY C  3 23  ? -30.820 33.446  -11.665 1.00 109.75 ? 74  GLY C N     1 
ATOM   4145  C  CA    . GLY C  3 23  ? -31.555 32.224  -11.890 1.00 110.01 ? 74  GLY C CA    1 
ATOM   4146  C  C     . GLY C  3 23  ? -32.127 31.483  -10.699 1.00 104.33 ? 74  GLY C C     1 
ATOM   4147  O  O     . GLY C  3 23  ? -33.294 31.100  -10.764 1.00 110.52 ? 74  GLY C O     1 
ATOM   4148  N  N     . LEU C  3 24  ? -31.422 31.372  -9.572  1.00 91.50  ? 75  LEU C N     1 
ATOM   4149  C  CA    . LEU C  3 24  ? -31.882 30.435  -8.546  1.00 90.03  ? 75  LEU C CA    1 
ATOM   4150  C  C     . LEU C  3 24  ? -33.263 30.788  -8.034  1.00 90.55  ? 75  LEU C C     1 
ATOM   4151  O  O     . LEU C  3 24  ? -33.794 30.077  -7.185  1.00 89.64  ? 75  LEU C O     1 
ATOM   4152  C  CB    . LEU C  3 24  ? -30.914 30.336  -7.374  1.00 88.66  ? 75  LEU C CB    1 
ATOM   4153  C  CG    . LEU C  3 24  ? -29.490 29.975  -7.792  1.00 88.38  ? 75  LEU C CG    1 
ATOM   4154  C  CD1   . LEU C  3 24  ? -28.691 29.426  -6.636  1.00 87.14  ? 75  LEU C CD1   1 
ATOM   4155  C  CD2   . LEU C  3 24  ? -29.457 29.034  -8.969  1.00 88.83  ? 75  LEU C CD2   1 
ATOM   4156  N  N     . ARG C  3 25  ? -33.807 31.926  -8.453  1.00 109.39 ? 76  ARG C N     1 
ATOM   4157  C  CA    . ARG C  3 25  ? -35.186 32.253  -8.128  1.00 120.63 ? 76  ARG C CA    1 
ATOM   4158  C  C     . ARG C  3 25  ? -36.130 31.250  -8.776  1.00 120.88 ? 76  ARG C C     1 
ATOM   4159  O  O     . ARG C  3 25  ? -37.131 30.852  -8.178  1.00 120.68 ? 76  ARG C O     1 
ATOM   4160  C  CB    . ARG C  3 25  ? -35.487 33.693  -8.563  1.00 132.31 ? 76  ARG C CB    1 
ATOM   4161  C  CG    . ARG C  3 25  ? -36.901 34.211  -8.294  1.00 134.64 ? 76  ARG C CG    1 
ATOM   4162  C  CD    . ARG C  3 25  ? -36.949 35.741  -8.440  1.00 133.09 ? 76  ARG C CD    1 
ATOM   4163  N  NE    . ARG C  3 25  ? -36.710 36.196  -9.810  1.00 135.53 ? 76  ARG C NE    1 
ATOM   4164  C  CZ    . ARG C  3 25  ? -37.654 36.616  -10.649 1.00 134.92 ? 76  ARG C CZ    1 
ATOM   4165  N  NH1   . ARG C  3 25  ? -38.920 36.653  -10.262 1.00 137.82 ? 76  ARG C NH1   1 
ATOM   4166  N  NH2   . ARG C  3 25  ? -37.328 37.013  -11.874 1.00 134.17 ? 76  ARG C NH2   1 
ATOM   4167  N  N     . HIS C  3 26  ? -35.813 30.799  -9.986  1.00 123.25 ? 77  HIS C N     1 
ATOM   4168  C  CA    . HIS C  3 26  ? -36.541 29.691  -10.585 1.00 128.94 ? 77  HIS C CA    1 
ATOM   4169  C  C     . HIS C  3 26  ? -35.690 28.416  -10.627 1.00 123.92 ? 77  HIS C C     1 
ATOM   4170  O  O     . HIS C  3 26  ? -36.019 27.468  -11.349 1.00 128.09 ? 77  HIS C O     1 
ATOM   4171  C  CB    . HIS C  3 26  ? -37.053 30.081  -11.974 1.00 142.79 ? 77  HIS C CB    1 
ATOM   4172  C  CG    . HIS C  3 26  ? -35.967 30.413  -12.949 1.00 161.11 ? 77  HIS C CG    1 
ATOM   4173  N  ND1   . HIS C  3 26  ? -35.736 31.694  -13.402 1.00 170.54 ? 77  HIS C ND1   1 
ATOM   4174  C  CD2   . HIS C  3 26  ? -35.049 29.626  -13.562 1.00 167.25 ? 77  HIS C CD2   1 
ATOM   4175  C  CE1   . HIS C  3 26  ? -34.720 31.682  -14.248 1.00 174.11 ? 77  HIS C CE1   1 
ATOM   4176  N  NE2   . HIS C  3 26  ? -34.287 30.439  -14.365 1.00 171.81 ? 77  HIS C NE2   1 
ATOM   4177  N  N     . GLY C  3 27  ? -34.598 28.376  -9.856  1.00 111.24 ? 78  GLY C N     1 
ATOM   4178  C  CA    . GLY C  3 27  ? -33.902 27.133  -9.570  1.00 100.57 ? 78  GLY C CA    1 
ATOM   4179  C  C     . GLY C  3 27  ? -32.856 26.695  -10.567 1.00 98.79  ? 78  GLY C C     1 
ATOM   4180  O  O     . GLY C  3 27  ? -32.522 25.513  -10.602 1.00 100.91 ? 78  GLY C O     1 
ATOM   4181  N  N     . ASP C  3 28  ? -32.277 27.608  -11.340 1.00 91.45  ? 79  ASP C N     1 
ATOM   4182  C  CA    . ASP C  3 28  ? -31.387 27.229  -12.438 1.00 92.38  ? 79  ASP C CA    1 
ATOM   4183  C  C     . ASP C  3 28  ? -29.914 27.236  -12.046 1.00 91.51  ? 79  ASP C C     1 
ATOM   4184  O  O     . ASP C  3 28  ? -29.146 28.098  -12.432 1.00 92.22  ? 79  ASP C O     1 
ATOM   4185  C  CB    . ASP C  3 28  ? -31.636 28.129  -13.634 1.00 94.54  ? 79  ASP C CB    1 
ATOM   4186  C  CG    . ASP C  3 28  ? -30.865 27.692  -14.859 1.00 95.99  ? 79  ASP C CG    1 
ATOM   4187  O  OD1   . ASP C  3 28  ? -29.900 26.905  -14.731 1.00 102.57 ? 79  ASP C OD1   1 
ATOM   4188  O  OD2   . ASP C  3 28  ? -31.209 28.149  -15.967 1.00 111.94 ? 79  ASP C OD2   1 
ATOM   4189  N  N     . PHE C  3 29  ? -29.502 26.167  -11.384 1.00 90.31  ? 80  PHE C N     1 
ATOM   4190  C  CA    . PHE C  3 29  ? -28.140 26.078  -10.885 1.00 89.66  ? 80  PHE C CA    1 
ATOM   4191  C  C     . PHE C  3 29  ? -27.142 26.071  -12.025 1.00 91.12  ? 80  PHE C C     1 
ATOM   4192  O  O     . PHE C  3 29  ? -26.011 26.537  -11.864 1.00 91.19  ? 80  PHE C O     1 
ATOM   4193  C  CB    . PHE C  3 29  ? -28.021 24.833  -10.043 1.00 88.57  ? 80  PHE C CB    1 
ATOM   4194  C  CG    . PHE C  3 29  ? -28.947 24.834  -8.891  1.00 87.37  ? 80  PHE C CG    1 
ATOM   4195  C  CD1   . PHE C  3 29  ? -28.594 25.403  -7.697  1.00 86.45  ? 80  PHE C CD1   1 
ATOM   4196  C  CD2   . PHE C  3 29  ? -30.236 24.379  -9.045  1.00 87.52  ? 80  PHE C CD2   1 
ATOM   4197  C  CE1   . PHE C  3 29  ? -29.486 25.420  -6.644  1.00 85.68  ? 80  PHE C CE1   1 
ATOM   4198  C  CE2   . PHE C  3 29  ? -31.130 24.404  -8.006  1.00 86.73  ? 80  PHE C CE2   1 
ATOM   4199  C  CZ    . PHE C  3 29  ? -30.756 24.927  -6.809  1.00 85.81  ? 80  PHE C CZ    1 
ATOM   4200  N  N     . GLN C  3 30  ? -27.547 25.577  -13.189 1.00 92.57  ? 81  GLN C N     1 
ATOM   4201  C  CA    . GLN C  3 30  ? -26.632 25.539  -14.323 1.00 104.63 ? 81  GLN C CA    1 
ATOM   4202  C  C     . GLN C  3 30  ? -26.329 26.943  -14.828 1.00 111.52 ? 81  GLN C C     1 
ATOM   4203  O  O     . GLN C  3 30  ? -25.166 27.271  -15.124 1.00 119.80 ? 81  GLN C O     1 
ATOM   4204  C  CB    . GLN C  3 30  ? -27.230 24.665  -15.426 1.00 105.14 ? 81  GLN C CB    1 
ATOM   4205  C  CG    . GLN C  3 30  ? -26.277 24.265  -16.534 1.00 108.62 ? 81  GLN C CG    1 
ATOM   4206  C  CD    . GLN C  3 30  ? -26.894 23.280  -17.524 1.00 112.95 ? 81  GLN C CD    1 
ATOM   4207  O  OE1   . GLN C  3 30  ? -26.470 22.126  -17.606 1.00 110.78 ? 81  GLN C OE1   1 
ATOM   4208  N  NE2   . GLN C  3 30  ? -27.903 23.726  -18.265 1.00 116.39 ? 81  GLN C NE2   1 
ATOM   4209  N  N     . ARG C  3 31  ? -27.352 27.802  -14.890 1.00 106.26 ? 82  ARG C N     1 
ATOM   4210  C  CA    . ARG C  3 31  ? -27.115 29.181  -15.295 1.00 102.79 ? 82  ARG C CA    1 
ATOM   4211  C  C     . ARG C  3 31  ? -26.243 29.906  -14.280 1.00 98.12  ? 82  ARG C C     1 
ATOM   4212  O  O     . ARG C  3 31  ? -25.188 30.430  -14.641 1.00 96.48  ? 82  ARG C O     1 
ATOM   4213  C  CB    . ARG C  3 31  ? -28.464 29.885  -15.501 1.00 110.43 ? 82  ARG C CB    1 
ATOM   4214  C  CG    . ARG C  3 31  ? -28.440 31.390  -15.851 1.00 112.49 ? 82  ARG C CG    1 
ATOM   4215  C  CD    . ARG C  3 31  ? -29.856 31.950  -16.100 1.00 109.84 ? 82  ARG C CD    1 
ATOM   4216  N  NE    . ARG C  3 31  ? -29.935 33.350  -15.701 1.00 114.81 ? 82  ARG C NE    1 
ATOM   4217  C  CZ    . ARG C  3 31  ? -29.417 34.370  -16.380 1.00 125.44 ? 82  ARG C CZ    1 
ATOM   4218  N  NH1   . ARG C  3 31  ? -28.763 34.161  -17.515 1.00 128.91 ? 82  ARG C NH1   1 
ATOM   4219  N  NH2   . ARG C  3 31  ? -29.538 35.609  -15.908 1.00 128.49 ? 82  ARG C NH2   1 
ATOM   4220  N  N     . TYR C  3 32  ? -26.556 29.777  -12.990 1.00 93.63  ? 83  TYR C N     1 
ATOM   4221  C  CA    . TYR C  3 32  ? -25.801 30.522  -11.991 1.00 92.78  ? 83  TYR C CA    1 
ATOM   4222  C  C     . TYR C  3 32  ? -24.360 30.099  -12.009 1.00 92.88  ? 83  TYR C C     1 
ATOM   4223  O  O     . TYR C  3 32  ? -23.470 30.936  -11.911 1.00 93.42  ? 83  TYR C O     1 
ATOM   4224  C  CB    . TYR C  3 32  ? -26.379 30.320  -10.598 1.00 91.01  ? 83  TYR C CB    1 
ATOM   4225  C  CG    . TYR C  3 32  ? -25.605 30.981  -9.469  1.00 90.34  ? 83  TYR C CG    1 
ATOM   4226  C  CD1   . TYR C  3 32  ? -25.468 32.333  -9.351  1.00 91.11  ? 83  TYR C CD1   1 
ATOM   4227  C  CD2   . TYR C  3 32  ? -25.014 30.222  -8.520  1.00 89.21  ? 83  TYR C CD2   1 
ATOM   4228  C  CE1   . TYR C  3 32  ? -24.767 32.882  -8.282  1.00 90.71  ? 83  TYR C CE1   1 
ATOM   4229  C  CE2   . TYR C  3 32  ? -24.313 30.759  -7.493  1.00 88.89  ? 83  TYR C CE2   1 
ATOM   4230  C  CZ    . TYR C  3 32  ? -24.180 32.060  -7.371  1.00 89.61  ? 83  TYR C CZ    1 
ATOM   4231  O  OH    . TYR C  3 32  ? -23.471 32.489  -6.293  1.00 89.45  ? 83  TYR C OH    1 
ATOM   4232  N  N     . ARG C  3 33  ? -24.105 28.804  -12.147 1.00 99.76  ? 84  ARG C N     1 
ATOM   4233  C  CA    . ARG C  3 33  ? -22.728 28.404  -12.358 1.00 101.70 ? 84  ARG C CA    1 
ATOM   4234  C  C     . ARG C  3 33  ? -22.159 29.142  -13.559 1.00 110.76 ? 84  ARG C C     1 
ATOM   4235  O  O     . ARG C  3 33  ? -21.055 29.687  -13.485 1.00 120.24 ? 84  ARG C O     1 
ATOM   4236  C  CB    . ARG C  3 33  ? -22.637 26.886  -12.507 1.00 105.94 ? 84  ARG C CB    1 
ATOM   4237  C  CG    . ARG C  3 33  ? -21.285 26.351  -12.981 1.00 113.10 ? 84  ARG C CG    1 
ATOM   4238  C  CD    . ARG C  3 33  ? -21.264 24.800  -13.323 1.00 117.00 ? 84  ARG C CD    1 
ATOM   4239  N  NE    . ARG C  3 33  ? -22.480 24.184  -13.874 1.00 95.35  ? 84  ARG C NE    1 
ATOM   4240  C  CZ    . ARG C  3 33  ? -22.551 23.606  -15.071 1.00 97.25  ? 84  ARG C CZ    1 
ATOM   4241  N  NH1   . ARG C  3 33  ? -21.482 23.543  -15.849 1.00 99.25  ? 84  ARG C NH1   1 
ATOM   4242  N  NH2   . ARG C  3 33  ? -23.682 23.063  -15.479 1.00 97.40  ? 84  ARG C NH2   1 
ATOM   4243  N  N     . GLY C  3 34  ? -22.944 29.289  -14.629 1.00 113.24 ? 85  GLY C N     1 
ATOM   4244  C  CA    . GLY C  3 34  ? -22.403 29.963  -15.804 1.00 120.73 ? 85  GLY C CA    1 
ATOM   4245  C  C     . GLY C  3 34  ? -22.045 31.420  -15.563 1.00 119.52 ? 85  GLY C C     1 
ATOM   4246  O  O     . GLY C  3 34  ? -20.935 31.858  -15.870 1.00 100.55 ? 85  GLY C O     1 
ATOM   4247  N  N     . TYR C  3 35  ? -22.945 32.163  -14.937 1.00 119.24 ? 86  TYR C N     1 
ATOM   4248  C  CA    . TYR C  3 35  ? -22.653 33.552  -14.614 1.00 119.66 ? 86  TYR C CA    1 
ATOM   4249  C  C     . TYR C  3 35  ? -21.466 33.629  -13.675 1.00 111.10 ? 86  TYR C C     1 
ATOM   4250  O  O     . TYR C  3 35  ? -20.571 34.448  -13.868 1.00 112.08 ? 86  TYR C O     1 
ATOM   4251  C  CB    . TYR C  3 35  ? -23.907 34.197  -14.012 1.00 120.64 ? 86  TYR C CB    1 
ATOM   4252  C  CG    . TYR C  3 35  ? -23.737 35.433  -13.154 1.00 112.06 ? 86  TYR C CG    1 
ATOM   4253  C  CD1   . TYR C  3 35  ? -23.477 36.667  -13.700 1.00 111.16 ? 86  TYR C CD1   1 
ATOM   4254  C  CD2   . TYR C  3 35  ? -23.874 35.353  -11.786 1.00 111.28 ? 86  TYR C CD2   1 
ATOM   4255  C  CE1   . TYR C  3 35  ? -23.342 37.780  -12.890 1.00 108.31 ? 86  TYR C CE1   1 
ATOM   4256  C  CE2   . TYR C  3 35  ? -23.747 36.453  -10.982 1.00 108.51 ? 86  TYR C CE2   1 
ATOM   4257  C  CZ    . TYR C  3 35  ? -23.477 37.653  -11.524 1.00 106.68 ? 86  TYR C CZ    1 
ATOM   4258  O  OH    . TYR C  3 35  ? -23.348 38.708  -10.660 1.00 104.91 ? 86  TYR C OH    1 
ATOM   4259  N  N     . CYS C  3 36  ? -21.410 32.733  -12.696 1.00 101.07 ? 87  CYS C N     1 
ATOM   4260  C  CA    . CYS C  3 36  ? -20.312 32.739  -11.749 1.00 99.40  ? 87  CYS C CA    1 
ATOM   4261  C  C     . CYS C  3 36  ? -18.995 32.556  -12.486 1.00 97.24  ? 87  CYS C C     1 
ATOM   4262  O  O     . CYS C  3 36  ? -17.986 33.207  -12.176 1.00 97.95  ? 87  CYS C O     1 
ATOM   4263  C  CB    . CYS C  3 36  ? -20.557 31.647  -10.724 1.00 93.79  ? 87  CYS C CB    1 
ATOM   4264  S  SG    . CYS C  3 36  ? -22.048 31.976  -9.721  1.00 93.89  ? 87  CYS C SG    1 
ATOM   4265  N  N     . SER C  3 37  ? -18.998 31.699  -13.495 1.00 98.13  ? 88  SER C N     1 
ATOM   4266  C  CA    . SER C  3 37  ? -17.798 31.528  -14.297 1.00 112.78 ? 88  SER C CA    1 
ATOM   4267  C  C     . SER C  3 37  ? -17.499 32.768  -15.109 1.00 107.30 ? 88  SER C C     1 
ATOM   4268  O  O     . SER C  3 37  ? -16.369 33.260  -15.095 1.00 110.80 ? 88  SER C O     1 
ATOM   4269  C  CB    . SER C  3 37  ? -17.905 30.298  -15.201 1.00 132.57 ? 88  SER C CB    1 
ATOM   4270  O  OG    . SER C  3 37  ? -17.785 29.086  -14.445 1.00 144.60 ? 88  SER C OG    1 
ATOM   4271  N  N     . ARG C  3 38  ? -18.511 33.331  -15.766 1.00 111.42 ? 89  ARG C N     1 
ATOM   4272  C  CA    . ARG C  3 38  ? -18.263 34.491  -16.624 1.00 120.30 ? 89  ARG C CA    1 
ATOM   4273  C  C     . ARG C  3 38  ? -17.717 35.652  -15.813 1.00 104.72 ? 89  ARG C C     1 
ATOM   4274  O  O     . ARG C  3 38  ? -16.732 36.286  -16.199 1.00 106.54 ? 89  ARG C O     1 
ATOM   4275  C  CB    . ARG C  3 38  ? -19.552 34.887  -17.327 1.00 105.56 ? 89  ARG C CB    1 
ATOM   4276  C  CG    . ARG C  3 38  ? -20.012 33.819  -18.282 1.00 109.93 ? 89  ARG C CG    1 
ATOM   4277  C  CD    . ARG C  3 38  ? -21.227 34.256  -19.011 1.00 108.34 ? 89  ARG C CD    1 
ATOM   4278  N  NE    . ARG C  3 38  ? -22.383 34.052  -18.150 1.00 109.07 ? 89  ARG C NE    1 
ATOM   4279  C  CZ    . ARG C  3 38  ? -23.611 33.807  -18.585 1.00 112.65 ? 89  ARG C CZ    1 
ATOM   4280  N  NH1   . ARG C  3 38  ? -23.853 33.720  -19.885 1.00 114.80 ? 89  ARG C NH1   1 
ATOM   4281  N  NH2   . ARG C  3 38  ? -24.598 33.658  -17.715 1.00 114.13 ? 89  ARG C NH2   1 
ATOM   4282  N  N     . ARG C  3 39  ? -18.262 35.836  -14.616 1.00 102.68 ? 90  ARG C N     1 
ATOM   4283  C  CA    . ARG C  3 39  ? -17.803 36.873  -13.714 1.00 102.58 ? 90  ARG C CA    1 
ATOM   4284  C  C     . ARG C  3 39  ? -16.357 36.655  -13.343 1.00 103.00 ? 90  ARG C C     1 
ATOM   4285  O  O     . ARG C  3 39  ? -15.558 37.588  -13.384 1.00 104.50 ? 90  ARG C O     1 
ATOM   4286  C  CB    . ARG C  3 39  ? -18.659 36.887  -12.454 1.00 100.46 ? 90  ARG C CB    1 
ATOM   4287  C  CG    . ARG C  3 39  ? -18.362 38.039  -11.547 1.00 100.70 ? 90  ARG C CG    1 
ATOM   4288  C  CD    . ARG C  3 39  ? -19.387 38.192  -10.452 1.00 99.17  ? 90  ARG C CD    1 
ATOM   4289  N  NE    . ARG C  3 39  ? -19.235 39.486  -9.812  1.00 117.02 ? 90  ARG C NE    1 
ATOM   4290  C  CZ    . ARG C  3 39  ? -19.962 39.921  -8.793  1.00 116.07 ? 90  ARG C CZ    1 
ATOM   4291  N  NH1   . ARG C  3 39  ? -20.902 39.157  -8.253  1.00 97.77  ? 90  ARG C NH1   1 
ATOM   4292  N  NH2   . ARG C  3 39  ? -19.738 41.135  -8.314  1.00 115.08 ? 90  ARG C NH2   1 
ATOM   4293  N  N     . GLN C  3 40  ? -15.990 35.428  -12.963 1.00 122.56 ? 91  GLN C N     1 
ATOM   4294  C  CA    . GLN C  3 40  ? -14.567 35.209  -12.727 1.00 120.71 ? 91  GLN C CA    1 
ATOM   4295  C  C     . GLN C  3 40  ? -13.748 35.602  -13.951 1.00 118.06 ? 91  GLN C C     1 
ATOM   4296  O  O     . GLN C  3 40  ? -12.656 36.157  -13.817 1.00 121.30 ? 91  GLN C O     1 
ATOM   4297  C  CB    . GLN C  3 40  ? -14.267 33.781  -12.303 1.00 121.23 ? 91  GLN C CB    1 
ATOM   4298  C  CG    . GLN C  3 40  ? -13.015 33.716  -11.420 1.00 117.44 ? 91  GLN C CG    1 
ATOM   4299  C  CD    . GLN C  3 40  ? -12.550 32.294  -11.116 1.00 126.81 ? 91  GLN C CD    1 
ATOM   4300  O  OE1   . GLN C  3 40  ? -11.341 32.024  -11.007 1.00 131.97 ? 91  GLN C OE1   1 
ATOM   4301  N  NE2   . GLN C  3 40  ? -13.504 31.372  -11.000 1.00 126.76 ? 91  GLN C NE2   1 
ATOM   4302  N  N     . ARG C  3 41  ? -14.247 35.317  -15.155 1.00 110.82 ? 92  ARG C N     1 
ATOM   4303  C  CA    . ARG C  3 41  ? -13.475 35.679  -16.341 1.00 113.35 ? 92  ARG C CA    1 
ATOM   4304  C  C     . ARG C  3 41  ? -13.322 37.187  -16.435 1.00 120.51 ? 92  ARG C C     1 
ATOM   4305  O  O     . ARG C  3 41  ? -12.222 37.693  -16.686 1.00 116.97 ? 92  ARG C O     1 
ATOM   4306  C  CB    . ARG C  3 41  ? -14.143 35.121  -17.603 1.00 113.14 ? 92  ARG C CB    1 
ATOM   4307  C  CG    . ARG C  3 41  ? -13.374 35.238  -18.929 1.00 115.85 ? 92  ARG C CG    1 
ATOM   4308  C  CD    . ARG C  3 41  ? -11.960 34.705  -18.908 1.00 118.87 ? 92  ARG C CD    1 
ATOM   4309  N  NE    . ARG C  3 41  ? -11.436 34.675  -20.270 1.00 127.86 ? 92  ARG C NE    1 
ATOM   4310  C  CZ    . ARG C  3 41  ? -10.455 35.452  -20.729 1.00 139.67 ? 92  ARG C CZ    1 
ATOM   4311  N  NH1   . ARG C  3 41  ? -9.859  36.337  -19.943 1.00 144.20 ? 92  ARG C NH1   1 
ATOM   4312  N  NH2   . ARG C  3 41  ? -10.062 35.349  -21.990 1.00 145.66 ? 92  ARG C NH2   1 
ATOM   4313  N  N     . ARG C  3 42  ? -14.397 37.926  -16.158 1.00 130.55 ? 93  ARG C N     1 
ATOM   4314  C  CA    . ARG C  3 42  ? -14.316 39.380  -16.218 1.00 111.28 ? 93  ARG C CA    1 
ATOM   4315  C  C     . ARG C  3 42  ? -13.354 39.900  -15.164 1.00 111.12 ? 93  ARG C C     1 
ATOM   4316  O  O     . ARG C  3 42  ? -12.437 40.662  -15.477 1.00 113.29 ? 93  ARG C O     1 
ATOM   4317  C  CB    . ARG C  3 42  ? -15.718 39.977  -16.077 1.00 110.49 ? 93  ARG C CB    1 
ATOM   4318  C  CG    . ARG C  3 42  ? -16.619 39.582  -17.250 1.00 111.35 ? 93  ARG C CG    1 
ATOM   4319  C  CD    . ARG C  3 42  ? -17.925 40.287  -17.235 1.00 111.30 ? 93  ARG C CD    1 
ATOM   4320  N  NE    . ARG C  3 42  ? -18.903 39.648  -18.102 1.00 111.62 ? 93  ARG C NE    1 
ATOM   4321  C  CZ    . ARG C  3 42  ? -20.190 39.532  -17.798 1.00 110.42 ? 93  ARG C CZ    1 
ATOM   4322  N  NH1   . ARG C  3 42  ? -21.026 38.963  -18.648 1.00 111.10 ? 93  ARG C NH1   1 
ATOM   4323  N  NH2   . ARG C  3 42  ? -20.645 39.970  -16.634 1.00 108.77 ? 93  ARG C NH2   1 
ATOM   4324  N  N     . LEU C  3 43  ? -13.460 39.393  -13.938 1.00 108.83 ? 94  LEU C N     1 
ATOM   4325  C  CA    . LEU C  3 43  ? -12.559 39.854  -12.900 1.00 108.94 ? 94  LEU C CA    1 
ATOM   4326  C  C     . LEU C  3 43  ? -11.129 39.553  -13.267 1.00 110.75 ? 94  LEU C C     1 
ATOM   4327  O  O     . LEU C  3 43  ? -10.253 40.404  -13.124 1.00 132.07 ? 94  LEU C O     1 
ATOM   4328  C  CB    . LEU C  3 43  ? -12.886 39.207  -11.569 1.00 106.49 ? 94  LEU C CB    1 
ATOM   4329  C  CG    . LEU C  3 43  ? -14.164 39.748  -10.983 1.00 105.13 ? 94  LEU C CG    1 
ATOM   4330  C  CD1   . LEU C  3 43  ? -14.724 38.862  -9.923  1.00 102.75 ? 94  LEU C CD1   1 
ATOM   4331  C  CD2   . LEU C  3 43  ? -13.788 41.058  -10.393 1.00 126.52 ? 94  LEU C CD2   1 
ATOM   4332  N  N     . ARG C  3 44  ? -10.870 38.363  -13.774 1.00 110.70 ? 95  ARG C N     1 
ATOM   4333  C  CA    . ARG C  3 44  ? -9.497  38.036  -14.122 1.00 129.48 ? 95  ARG C CA    1 
ATOM   4334  C  C     . ARG C  3 44  ? -8.975  38.892  -15.273 1.00 115.72 ? 95  ARG C C     1 
ATOM   4335  O  O     . ARG C  3 44  ? -7.814  39.314  -15.251 1.00 117.75 ? 95  ARG C O     1 
ATOM   4336  C  CB    . ARG C  3 44  ? -9.349  36.546  -14.425 1.00 139.01 ? 95  ARG C CB    1 
ATOM   4337  C  CG    . ARG C  3 44  ? -8.497  35.848  -13.349 1.00 145.97 ? 95  ARG C CG    1 
ATOM   4338  C  CD    . ARG C  3 44  ? -8.456  34.334  -13.440 1.00 111.50 ? 95  ARG C CD    1 
ATOM   4339  N  NE    . ARG C  3 44  ? -9.736  33.677  -13.269 1.00 109.03 ? 95  ARG C NE    1 
ATOM   4340  C  CZ    . ARG C  3 44  ? -10.356 33.046  -14.255 1.00 127.21 ? 95  ARG C CZ    1 
ATOM   4341  N  NH1   . ARG C  3 44  ? -9.815  33.012  -15.467 1.00 111.72 ? 95  ARG C NH1   1 
ATOM   4342  N  NH2   . ARG C  3 44  ? -11.515 32.451  -14.032 1.00 125.99 ? 95  ARG C NH2   1 
ATOM   4343  N  N     . LYS C  3 45  ? -9.783  39.106  -16.309 1.00 131.29 ? 96  LYS C N     1 
ATOM   4344  C  CA    . LYS C  3 45  ? -9.315  39.883  -17.456 1.00 135.57 ? 96  LYS C CA    1 
ATOM   4345  C  C     . LYS C  3 45  ? -9.061  41.338  -17.076 1.00 135.45 ? 96  LYS C C     1 
ATOM   4346  O  O     . LYS C  3 45  ? -8.126  41.974  -17.586 1.00 142.05 ? 96  LYS C O     1 
ATOM   4347  C  CB    . LYS C  3 45  ? -10.318 39.790  -18.608 1.00 135.78 ? 96  LYS C CB    1 
ATOM   4348  C  CG    . LYS C  3 45  ? -9.666  39.611  -19.975 1.00 135.76 ? 96  LYS C CG    1 
ATOM   4349  C  CD    . LYS C  3 45  ? -10.683 39.381  -21.075 1.00 132.83 ? 96  LYS C CD    1 
ATOM   4350  C  CE    . LYS C  3 45  ? -9.981  39.160  -22.396 1.00 133.15 ? 96  LYS C CE    1 
ATOM   4351  N  NZ    . LYS C  3 45  ? -8.881  40.148  -22.619 1.00 137.59 ? 96  LYS C NZ    1 
ATOM   4352  N  N     . THR C  3 46  ? -9.902  41.889  -16.204 1.00 144.79 ? 97  THR C N     1 
ATOM   4353  C  CA    . THR C  3 46  ? -9.710  43.262  -15.766 1.00 119.74 ? 97  THR C CA    1 
ATOM   4354  C  C     . THR C  3 46  ? -8.443  43.407  -14.936 1.00 120.38 ? 97  THR C C     1 
ATOM   4355  O  O     . THR C  3 46  ? -7.548  44.178  -15.284 1.00 127.60 ? 97  THR C O     1 
ATOM   4356  C  CB    . THR C  3 46  ? -10.927 43.701  -14.951 1.00 117.69 ? 97  THR C CB    1 
ATOM   4357  O  OG1   . THR C  3 46  ? -12.086 43.765  -15.797 1.00 117.76 ? 97  THR C OG1   1 
ATOM   4358  C  CG2   . THR C  3 46  ? -10.686 45.041  -14.296 1.00 126.63 ? 97  THR C CG2   1 
ATOM   4359  N  N     . LEU C  3 47  ? -8.312  42.604  -13.893 1.00 118.30 ? 98  LEU C N     1 
ATOM   4360  C  CA    . LEU C  3 47  ? -7.244  42.712  -12.909 1.00 118.81 ? 98  LEU C CA    1 
ATOM   4361  C  C     . LEU C  3 47  ? -5.893  42.223  -13.386 1.00 120.98 ? 98  LEU C C     1 
ATOM   4362  O  O     . LEU C  3 47  ? -4.969  42.149  -12.569 1.00 121.56 ? 98  LEU C O     1 
ATOM   4363  C  CB    . LEU C  3 47  ? -7.650  41.984  -11.644 1.00 116.09 ? 98  LEU C CB    1 
ATOM   4364  C  CG    . LEU C  3 47  ? -8.682  42.830  -10.918 1.00 114.85 ? 98  LEU C CG    1 
ATOM   4365  C  CD1   . LEU C  3 47  ? -8.139  44.230  -10.839 1.00 151.81 ? 98  LEU C CD1   1 
ATOM   4366  C  CD2   . LEU C  3 47  ? -10.069 42.848  -11.500 1.00 113.59 ? 98  LEU C CD2   1 
ATOM   4367  N  N     . ASN C  3 48  ? -5.784  41.852  -14.651 1.00 136.09 ? 99  ASN C N     1 
ATOM   4368  C  CA    . ASN C  3 48  ? -4.593  41.258  -15.253 1.00 137.36 ? 99  ASN C CA    1 
ATOM   4369  C  C     . ASN C  3 48  ? -3.948  40.229  -14.321 1.00 136.44 ? 99  ASN C C     1 
ATOM   4370  O  O     . ASN C  3 48  ? -2.768  40.296  -13.977 1.00 141.60 ? 99  ASN C O     1 
ATOM   4371  C  CB    . ASN C  3 48  ? -3.601  42.349  -15.661 1.00 139.79 ? 99  ASN C CB    1 
ATOM   4372  C  CG    . ASN C  3 48  ? -3.702  42.714  -17.148 1.00 145.60 ? 99  ASN C CG    1 
ATOM   4373  O  OD1   . ASN C  3 48  ? -4.537  42.184  -17.883 1.00 145.97 ? 99  ASN C OD1   1 
ATOM   4374  N  ND2   . ASN C  3 48  ? -2.844  43.635  -17.588 1.00 150.89 ? 99  ASN C ND2   1 
ATOM   4375  N  N     . PHE C  3 49  ? -4.773  39.273  -13.906 1.00 131.24 ? 100 PHE C N     1 
ATOM   4376  C  CA    . PHE C  3 49  ? -4.399  38.234  -12.957 1.00 119.97 ? 100 PHE C CA    1 
ATOM   4377  C  C     . PHE C  3 49  ? -4.644  36.879  -13.600 1.00 139.63 ? 100 PHE C C     1 
ATOM   4378  O  O     . PHE C  3 49  ? -5.485  36.122  -13.123 1.00 117.03 ? 100 PHE C O     1 
ATOM   4379  C  CB    . PHE C  3 49  ? -5.183  38.366  -11.688 1.00 117.23 ? 100 PHE C CB    1 
ATOM   4380  C  CG    . PHE C  3 49  ? -4.649  37.552  -10.567 1.00 116.71 ? 100 PHE C CG    1 
ATOM   4381  C  CD1   . PHE C  3 49  ? -5.465  37.194  -9.520  1.00 114.13 ? 100 PHE C CD1   1 
ATOM   4382  C  CD2   . PHE C  3 49  ? -3.331  37.144  -10.558 1.00 119.12 ? 100 PHE C CD2   1 
ATOM   4383  C  CE1   . PHE C  3 49  ? -4.979  36.443  -8.484  1.00 113.95 ? 100 PHE C CE1   1 
ATOM   4384  C  CE2   . PHE C  3 49  ? -2.832  36.392  -9.519  1.00 119.01 ? 100 PHE C CE2   1 
ATOM   4385  C  CZ    . PHE C  3 49  ? -3.662  36.040  -8.477  1.00 116.41 ? 100 PHE C CZ    1 
ATOM   4386  N  N     . LYS C  3 50  ? -3.926  36.570  -14.670 1.00 135.18 ? 101 LYS C N     1 
ATOM   4387  C  CA    . LYS C  3 50  ? -4.243  35.386  -15.459 1.00 140.31 ? 101 LYS C CA    1 
ATOM   4388  C  C     . LYS C  3 50  ? -3.585  34.125  -14.899 1.00 149.36 ? 101 LYS C C     1 
ATOM   4389  O  O     . LYS C  3 50  ? -2.378  34.106  -14.628 1.00 124.66 ? 101 LYS C O     1 
ATOM   4390  C  CB    . LYS C  3 50  ? -3.836  35.597  -16.915 1.00 137.72 ? 101 LYS C CB    1 
ATOM   4391  C  CG    . LYS C  3 50  ? -4.849  36.385  -17.717 1.00 145.91 ? 101 LYS C CG    1 
ATOM   4392  C  CD    . LYS C  3 50  ? -4.501  37.829  -17.753 1.00 126.32 ? 101 LYS C CD    1 
ATOM   4393  C  CE    . LYS C  3 50  ? -5.325  38.516  -18.801 1.00 136.38 ? 101 LYS C CE    1 
ATOM   4394  N  NZ    . LYS C  3 50  ? -4.665  39.798  -19.222 1.00 144.56 ? 101 LYS C NZ    1 
ATOM   4395  N  N     . MET C  3 51  ? -4.395  33.068  -14.746 1.00 139.86 ? 102 MET C N     1 
ATOM   4396  C  CA    . MET C  3 51  ? -3.872  31.756  -14.363 1.00 139.34 ? 102 MET C CA    1 
ATOM   4397  C  C     . MET C  3 51  ? -2.989  31.184  -15.460 1.00 144.18 ? 102 MET C C     1 
ATOM   4398  O  O     . MET C  3 51  ? -1.868  30.733  -15.200 1.00 145.73 ? 102 MET C O     1 
ATOM   4399  C  CB    . MET C  3 51  ? -5.013  30.777  -14.057 1.00 136.28 ? 102 MET C CB    1 
ATOM   4400  C  CG    . MET C  3 51  ? -5.847  31.070  -12.818 1.00 133.60 ? 102 MET C CG    1 
ATOM   4401  S  SD    . MET C  3 51  ? -7.289  29.984  -12.714 1.00 115.93 ? 102 MET C SD    1 
ATOM   4402  C  CE    . MET C  3 51  ? -8.284  30.782  -11.452 1.00 112.70 ? 102 MET C CE    1 
ATOM   4403  N  N     . GLY C  3 52  ? -3.502  31.147  -16.686 1.00 136.90 ? 103 GLY C N     1 
ATOM   4404  C  CA    . GLY C  3 52  ? -2.795  30.487  -17.762 1.00 141.38 ? 103 GLY C CA    1 
ATOM   4405  C  C     . GLY C  3 52  ? -2.561  31.244  -19.054 1.00 149.81 ? 103 GLY C C     1 
ATOM   4406  O  O     . GLY C  3 52  ? -3.512  31.642  -19.729 1.00 130.51 ? 103 GLY C O     1 
ATOM   4407  N  N     . ASN C  3 53  ? -1.294  31.441  -19.408 1.00 134.89 ? 104 ASN C N     1 
ATOM   4408  C  CA    . ASN C  3 53  ? -0.919  31.966  -20.712 1.00 178.68 ? 104 ASN C CA    1 
ATOM   4409  C  C     . ASN C  3 53  ? -0.852  30.807  -21.688 1.00 140.70 ? 104 ASN C C     1 
ATOM   4410  O  O     . ASN C  3 53  ? -0.377  29.735  -21.326 1.00 141.40 ? 104 ASN C O     1 
ATOM   4411  C  CB    . ASN C  3 53  ? 0.439   32.665  -20.636 1.00 168.61 ? 104 ASN C CB    1 
ATOM   4412  C  CG    . ASN C  3 53  ? 0.730   33.529  -21.854 1.00 175.84 ? 104 ASN C CG    1 
ATOM   4413  O  OD1   . ASN C  3 53  ? -0.170  33.877  -22.617 1.00 184.60 ? 104 ASN C OD1   1 
ATOM   4414  N  ND2   . ASN C  3 53  ? 1.997   33.893  -22.032 1.00 172.74 ? 104 ASN C ND2   1 
ATOM   4415  N  N     . ARG C  3 54  ? -1.342  31.021  -22.914 1.00 148.99 ? 105 ARG C N     1 
ATOM   4416  C  CA    . ARG C  3 54  ? -1.337  29.991  -23.954 1.00 159.71 ? 105 ARG C CA    1 
ATOM   4417  C  C     . ARG C  3 54  ? -0.112  29.096  -23.853 1.00 169.73 ? 105 ARG C C     1 
ATOM   4418  O  O     . ARG C  3 54  ? 1.015   29.581  -23.734 1.00 175.10 ? 105 ARG C O     1 
ATOM   4419  C  CB    . ARG C  3 54  ? -1.340  30.617  -25.347 1.00 168.04 ? 105 ARG C CB    1 
ATOM   4420  C  CG    . ARG C  3 54  ? -2.636  31.172  -25.870 1.00 175.91 ? 105 ARG C CG    1 
ATOM   4421  C  CD    . ARG C  3 54  ? -2.354  31.583  -27.321 1.00 188.85 ? 105 ARG C CD    1 
ATOM   4422  N  NE    . ARG C  3 54  ? -3.206  32.641  -27.870 1.00 189.98 ? 105 ARG C NE    1 
ATOM   4423  C  CZ    . ARG C  3 54  ? -2.892  33.937  -27.908 1.00 185.65 ? 105 ARG C CZ    1 
ATOM   4424  N  NH1   . ARG C  3 54  ? -3.734  34.794  -28.456 1.00 185.88 ? 105 ARG C NH1   1 
ATOM   4425  N  NH2   . ARG C  3 54  ? -1.746  34.384  -27.407 1.00 186.76 ? 105 ARG C NH2   1 
ATOM   4426  N  N     . HIS C  3 55  ? -0.346  27.788  -23.898 1.00 172.49 ? 106 HIS C N     1 
ATOM   4427  C  CA    . HIS C  3 55  ? 0.637   26.718  -23.976 1.00 181.65 ? 106 HIS C CA    1 
ATOM   4428  C  C     . HIS C  3 55  ? 1.195   26.323  -22.608 1.00 178.06 ? 106 HIS C C     1 
ATOM   4429  O  O     . HIS C  3 55  ? 1.929   25.330  -22.529 1.00 185.29 ? 106 HIS C O     1 
ATOM   4430  C  CB    . HIS C  3 55  ? 1.822   27.052  -24.906 1.00 196.00 ? 106 HIS C CB    1 
ATOM   4431  C  CG    . HIS C  3 55  ? 1.430   27.391  -26.313 1.00 206.46 ? 106 HIS C CG    1 
ATOM   4432  N  ND1   . HIS C  3 55  ? 0.977   28.641  -26.685 1.00 208.64 ? 106 HIS C ND1   1 
ATOM   4433  C  CD2   . HIS C  3 55  ? 1.450   26.646  -27.446 1.00 213.97 ? 106 HIS C CD2   1 
ATOM   4434  C  CE1   . HIS C  3 55  ? 0.721   28.646  -27.981 1.00 213.44 ? 106 HIS C CE1   1 
ATOM   4435  N  NE2   . HIS C  3 55  ? 0.999   27.448  -28.467 1.00 217.00 ? 106 HIS C NE2   1 
ATOM   4436  N  N     . LYS C  3 56  ? 0.863   27.033  -21.529 1.00 169.02 ? 107 LYS C N     1 
ATOM   4437  C  CA    . LYS C  3 56  ? 1.345   26.694  -20.193 1.00 155.95 ? 107 LYS C CA    1 
ATOM   4438  C  C     . LYS C  3 56  ? 0.309   27.116  -19.163 1.00 148.95 ? 107 LYS C C     1 
ATOM   4439  O  O     . LYS C  3 56  ? -0.543  27.959  -19.434 1.00 153.67 ? 107 LYS C O     1 
ATOM   4440  C  CB    . LYS C  3 56  ? 2.709   27.339  -19.883 1.00 154.18 ? 107 LYS C CB    1 
ATOM   4441  C  CG    . LYS C  3 56  ? 3.868   26.818  -20.737 1.00 162.48 ? 107 LYS C CG    1 
ATOM   4442  C  CD    . LYS C  3 56  ? 5.205   27.473  -20.407 1.00 166.98 ? 107 LYS C CD    1 
ATOM   4443  C  CE    . LYS C  3 56  ? 6.325   26.903  -21.275 1.00 170.39 ? 107 LYS C CE    1 
ATOM   4444  N  NZ    . LYS C  3 56  ? 7.643   27.544  -21.005 1.00 165.15 ? 107 LYS C NZ    1 
ATOM   4445  N  N     . PHE C  3 57  ? 0.329   26.462  -18.014 1.00 126.88 ? 108 PHE C N     1 
ATOM   4446  C  CA    . PHE C  3 57  ? -0.571  26.787  -16.922 1.00 116.22 ? 108 PHE C CA    1 
ATOM   4447  C  C     . PHE C  3 57  ? 0.241   27.131  -15.682 1.00 123.56 ? 108 PHE C C     1 
ATOM   4448  O  O     . PHE C  3 57  ? 1.285   26.524  -15.426 1.00 122.92 ? 108 PHE C O     1 
ATOM   4449  C  CB    . PHE C  3 57  ? -1.519  25.639  -16.621 1.00 113.53 ? 108 PHE C CB    1 
ATOM   4450  C  CG    . PHE C  3 57  ? -2.411  25.895  -15.457 1.00 110.62 ? 108 PHE C CG    1 
ATOM   4451  C  CD1   . PHE C  3 57  ? -3.732  26.194  -15.634 1.00 108.35 ? 108 PHE C CD1   1 
ATOM   4452  C  CD2   . PHE C  3 57  ? -1.930  25.789  -14.165 1.00 110.84 ? 108 PHE C CD2   1 
ATOM   4453  C  CE1   . PHE C  3 57  ? -4.538  26.424  -14.543 1.00 108.28 ? 108 PHE C CE1   1 
ATOM   4454  C  CE2   . PHE C  3 57  ? -2.729  26.028  -13.084 1.00 108.64 ? 108 PHE C CE2   1 
ATOM   4455  C  CZ    . PHE C  3 57  ? -4.032  26.343  -13.269 1.00 106.05 ? 108 PHE C CZ    1 
ATOM   4456  N  N     . THR C  3 58  ? -0.239  28.107  -14.914 1.00 115.95 ? 109 THR C N     1 
ATOM   4457  C  CA    . THR C  3 58  ? 0.377   28.463  -13.645 1.00 117.25 ? 109 THR C CA    1 
ATOM   4458  C  C     . THR C  3 58  ? -0.683  28.568  -12.572 1.00 133.64 ? 109 THR C C     1 
ATOM   4459  O  O     . THR C  3 58  ? -1.767  29.108  -12.800 1.00 111.45 ? 109 THR C O     1 
ATOM   4460  C  CB    . THR C  3 58  ? 1.135   29.770  -13.699 1.00 120.72 ? 109 THR C CB    1 
ATOM   4461  O  OG1   . THR C  3 58  ? 2.340   29.569  -14.431 1.00 128.63 ? 109 THR C OG1   1 
ATOM   4462  C  CG2   . THR C  3 58  ? 1.485   30.248  -12.300 1.00 122.04 ? 109 THR C CG2   1 
ATOM   4463  N  N     . GLY C  3 59  ? -0.366  28.019  -11.413 1.00 130.09 ? 110 GLY C N     1 
ATOM   4464  C  CA    . GLY C  3 59  ? -1.231  28.134  -10.269 1.00 131.85 ? 110 GLY C CA    1 
ATOM   4465  C  C     . GLY C  3 59  ? -1.468  29.574  -9.880  1.00 135.20 ? 110 GLY C C     1 
ATOM   4466  O  O     . GLY C  3 59  ? -0.526  30.365  -9.741  1.00 135.38 ? 110 GLY C O     1 
ATOM   4467  N  N     . LYS C  3 60  ? -2.740  29.919  -9.720  1.00 132.44 ? 111 LYS C N     1 
ATOM   4468  C  CA    . LYS C  3 60  ? -3.116  31.194  -9.137  1.00 136.69 ? 111 LYS C CA    1 
ATOM   4469  C  C     . LYS C  3 60  ? -3.009  31.065  -7.628  1.00 137.85 ? 111 LYS C C     1 
ATOM   4470  O  O     . LYS C  3 60  ? -3.697  30.239  -7.017  1.00 141.84 ? 111 LYS C O     1 
ATOM   4471  C  CB    . LYS C  3 60  ? -4.541  31.545  -9.547  1.00 130.14 ? 111 LYS C CB    1 
ATOM   4472  C  CG    . LYS C  3 60  ? -5.412  32.126  -8.435  1.00 129.50 ? 111 LYS C CG    1 
ATOM   4473  C  CD    . LYS C  3 60  ? -6.706  31.329  -8.236  1.00 123.58 ? 111 LYS C CD    1 
ATOM   4474  C  CE    . LYS C  3 60  ? -7.796  32.212  -7.638  1.00 117.52 ? 111 LYS C CE    1 
ATOM   4475  N  NZ    . LYS C  3 60  ? -9.123  31.560  -7.529  1.00 112.83 ? 111 LYS C NZ    1 
ATOM   4476  N  N     . LYS C  3 61  ? -2.141  31.851  -7.024  1.00 145.15 ? 112 LYS C N     1 
ATOM   4477  C  CA    . LYS C  3 61  ? -2.077  31.924  -5.574  1.00 150.05 ? 112 LYS C CA    1 
ATOM   4478  C  C     . LYS C  3 61  ? -2.480  33.340  -5.197  1.00 151.84 ? 112 LYS C C     1 
ATOM   4479  O  O     . LYS C  3 61  ? -1.784  34.301  -5.532  1.00 157.40 ? 112 LYS C O     1 
ATOM   4480  C  CB    . LYS C  3 61  ? -0.686  31.546  -5.057  1.00 160.53 ? 112 LYS C CB    1 
ATOM   4481  C  CG    . LYS C  3 61  ? -0.679  30.690  -3.757  1.00 167.94 ? 112 LYS C CG    1 
ATOM   4482  C  CD    . LYS C  3 61  ? -1.293  29.282  -3.939  1.00 165.60 ? 112 LYS C CD    1 
ATOM   4483  C  CE    . LYS C  3 61  ? -1.282  28.461  -2.641  1.00 163.58 ? 112 LYS C CE    1 
ATOM   4484  N  NZ    . LYS C  3 61  ? -1.979  27.140  -2.779  1.00 159.01 ? 112 LYS C NZ    1 
ATOM   4485  N  N     . VAL C  3 62  ? -3.606  33.471  -4.511  1.00 136.20 ? 113 VAL C N     1 
ATOM   4486  C  CA    . VAL C  3 62  ? -4.039  34.774  -4.041  1.00 126.07 ? 113 VAL C CA    1 
ATOM   4487  C  C     . VAL C  3 62  ? -3.271  35.096  -2.773  1.00 138.34 ? 113 VAL C C     1 
ATOM   4488  O  O     . VAL C  3 62  ? -3.731  34.809  -1.663  1.00 137.39 ? 113 VAL C O     1 
ATOM   4489  C  CB    . VAL C  3 62  ? -5.546  34.797  -3.799  1.00 113.93 ? 113 VAL C CB    1 
ATOM   4490  C  CG1   . VAL C  3 62  ? -5.962  36.168  -3.293  1.00 111.58 ? 113 VAL C CG1   1 
ATOM   4491  C  CG2   . VAL C  3 62  ? -6.248  34.433  -5.077  1.00 111.20 ? 113 VAL C CG2   1 
ATOM   4492  N  N     . THR C  3 63  ? -2.092  35.686  -2.931  1.00 154.98 ? 114 THR C N     1 
ATOM   4493  C  CA    . THR C  3 63  ? -1.247  36.029  -1.797  1.00 162.84 ? 114 THR C CA    1 
ATOM   4494  C  C     . THR C  3 63  ? -1.849  37.183  -0.998  1.00 163.22 ? 114 THR C C     1 
ATOM   4495  O  O     . THR C  3 63  ? -2.945  37.671  -1.277  1.00 159.31 ? 114 THR C O     1 
ATOM   4496  C  CB    . THR C  3 63  ? 0.163   36.360  -2.281  1.00 173.33 ? 114 THR C CB    1 
ATOM   4497  O  OG1   . THR C  3 63  ? 0.090   37.364  -3.301  1.00 175.29 ? 114 THR C OG1   1 
ATOM   4498  C  CG2   . THR C  3 63  ? 0.835   35.100  -2.837  1.00 174.63 ? 114 THR C CG2   1 
ATOM   4499  N  N     . GLU C  3 64  ? -1.110  37.614  0.022   1.00 168.38 ? 115 GLU C N     1 
ATOM   4500  C  CA    . GLU C  3 64  ? -1.643  38.605  0.943   1.00 173.73 ? 115 GLU C CA    1 
ATOM   4501  C  C     . GLU C  3 64  ? -1.539  40.032  0.422   1.00 178.60 ? 115 GLU C C     1 
ATOM   4502  O  O     . GLU C  3 64  ? -2.355  40.876  0.805   1.00 179.57 ? 115 GLU C O     1 
ATOM   4503  C  CB    . GLU C  3 64  ? -0.930  38.501  2.293   1.00 181.77 ? 115 GLU C CB    1 
ATOM   4504  C  CG    . GLU C  3 64  ? -1.714  39.087  3.469   1.00 183.59 ? 115 GLU C CG    1 
ATOM   4505  C  CD    . GLU C  3 64  ? -1.554  40.594  3.620   1.00 188.32 ? 115 GLU C CD    1 
ATOM   4506  O  OE1   . GLU C  3 64  ? -0.538  41.142  3.141   1.00 193.02 ? 115 GLU C OE1   1 
ATOM   4507  O  OE2   . GLU C  3 64  ? -2.448  41.229  4.219   1.00 188.40 ? 115 GLU C OE2   1 
ATOM   4508  N  N     . ASP C  3 65  ? -0.567  40.338  -0.438  1.00 180.50 ? 116 ASP C N     1 
ATOM   4509  C  CA    . ASP C  3 65  ? -0.383  41.733  -0.830  1.00 182.92 ? 116 ASP C CA    1 
ATOM   4510  C  C     . ASP C  3 65  ? -1.631  42.278  -1.505  1.00 178.85 ? 116 ASP C C     1 
ATOM   4511  O  O     . ASP C  3 65  ? -2.363  43.095  -0.930  1.00 180.48 ? 116 ASP C O     1 
ATOM   4512  C  CB    . ASP C  3 65  ? 0.841   41.896  -1.740  1.00 187.59 ? 116 ASP C CB    1 
ATOM   4513  C  CG    . ASP C  3 65  ? 1.340   40.583  -2.302  1.00 187.28 ? 116 ASP C CG    1 
ATOM   4514  O  OD1   . ASP C  3 65  ? 0.586   39.583  -2.262  1.00 182.88 ? 116 ASP C OD1   1 
ATOM   4515  O  OD2   . ASP C  3 65  ? 2.494   40.555  -2.774  1.00 191.29 ? 116 ASP C OD2   1 
ATOM   4516  N  N     . LEU C  3 66  ? -1.973  41.722  -2.659  1.00 166.50 ? 117 LEU C N     1 
ATOM   4517  C  CA    . LEU C  3 66  ? -3.029  42.297  -3.471  1.00 160.53 ? 117 LEU C CA    1 
ATOM   4518  C  C     . LEU C  3 66  ? -4.345  42.365  -2.719  1.00 157.87 ? 117 LEU C C     1 
ATOM   4519  O  O     . LEU C  3 66  ? -5.278  43.036  -3.181  1.00 154.69 ? 117 LEU C O     1 
ATOM   4520  C  CB    . LEU C  3 66  ? -3.158  41.492  -4.764  1.00 157.65 ? 117 LEU C CB    1 
ATOM   4521  C  CG    . LEU C  3 66  ? -2.012  41.600  -5.795  1.00 169.09 ? 117 LEU C CG    1 
ATOM   4522  C  CD1   . LEU C  3 66  ? -0.602  41.333  -5.258  1.00 175.55 ? 117 LEU C CD1   1 
ATOM   4523  C  CD2   . LEU C  3 66  ? -2.265  40.684  -6.976  1.00 169.43 ? 117 LEU C CD2   1 
ATOM   4524  N  N     . LEU C  3 67  ? -4.401  41.756  -1.533  1.00 165.50 ? 118 LEU C N     1 
ATOM   4525  C  CA    . LEU C  3 67  ? -5.571  41.808  -0.671  1.00 167.87 ? 118 LEU C CA    1 
ATOM   4526  C  C     . LEU C  3 67  ? -5.931  43.224  -0.253  1.00 167.07 ? 118 LEU C C     1 
ATOM   4527  O  O     . LEU C  3 67  ? -6.995  43.430  0.344   1.00 164.41 ? 118 LEU C O     1 
ATOM   4528  C  CB    . LEU C  3 67  ? -5.345  40.992  0.594   1.00 180.89 ? 118 LEU C CB    1 
ATOM   4529  C  CG    . LEU C  3 67  ? -5.208  39.485  0.466   1.00 188.64 ? 118 LEU C CG    1 
ATOM   4530  C  CD1   . LEU C  3 67  ? -5.006  38.924  1.854   1.00 195.45 ? 118 LEU C CD1   1 
ATOM   4531  C  CD2   . LEU C  3 67  ? -6.433  38.872  -0.204  1.00 187.58 ? 118 LEU C CD2   1 
ATOM   4532  N  N     . THR C  3 68  ? -5.100  44.214  -0.554  1.00 168.34 ? 119 THR C N     1 
ATOM   4533  C  CA    . THR C  3 68  ? -5.549  45.552  -0.222  1.00 167.34 ? 119 THR C CA    1 
ATOM   4534  C  C     . THR C  3 68  ? -6.730  45.939  -1.095  1.00 156.24 ? 119 THR C C     1 
ATOM   4535  O  O     . THR C  3 68  ? -7.644  46.627  -0.629  1.00 155.05 ? 119 THR C O     1 
ATOM   4536  C  CB    . THR C  3 68  ? -4.405  46.554  -0.367  1.00 181.43 ? 119 THR C CB    1 
ATOM   4537  O  OG1   . THR C  3 68  ? -3.440  46.322  0.663   1.00 188.78 ? 119 THR C OG1   1 
ATOM   4538  C  CG2   . THR C  3 68  ? -4.917  47.990  -0.243  1.00 190.31 ? 119 THR C CG2   1 
ATOM   4539  N  N     . ASP C  3 69  ? -6.806  45.384  -2.302  1.00 146.66 ? 120 ASP C N     1 
ATOM   4540  C  CA    . ASP C  3 69  ? -7.813  45.839  -3.246  1.00 145.29 ? 120 ASP C CA    1 
ATOM   4541  C  C     . ASP C  3 69  ? -9.248  45.572  -2.811  1.00 143.40 ? 120 ASP C C     1 
ATOM   4542  O  O     . ASP C  3 69  ? -10.154 45.981  -3.542  1.00 149.56 ? 120 ASP C O     1 
ATOM   4543  C  CB    . ASP C  3 69  ? -7.564  45.185  -4.600  1.00 144.70 ? 120 ASP C CB    1 
ATOM   4544  C  CG    . ASP C  3 69  ? -6.263  45.642  -5.231  1.00 155.01 ? 120 ASP C CG    1 
ATOM   4545  O  OD1   . ASP C  3 69  ? -5.711  46.672  -4.798  1.00 164.89 ? 120 ASP C OD1   1 
ATOM   4546  O  OD2   . ASP C  3 69  ? -5.787  44.979  -6.162  1.00 157.21 ? 120 ASP C OD2   1 
ATOM   4547  N  N     . ASN C  3 70  ? -9.497  44.949  -1.655  1.00 142.45 ? 121 ASN C N     1 
ATOM   4548  C  CA    . ASN C  3 70  ? -10.853 44.633  -1.183  1.00 140.61 ? 121 ASN C CA    1 
ATOM   4549  C  C     . ASN C  3 70  ? -11.771 44.109  -2.302  1.00 138.29 ? 121 ASN C C     1 
ATOM   4550  O  O     . ASN C  3 70  ? -12.999 44.057  -2.164  1.00 134.63 ? 121 ASN C O     1 
ATOM   4551  C  CB    . ASN C  3 70  ? -11.448 45.872  -0.500  1.00 149.88 ? 121 ASN C CB    1 
ATOM   4552  C  CG    . ASN C  3 70  ? -12.693 45.561  0.320   1.00 153.96 ? 121 ASN C CG    1 
ATOM   4553  O  OD1   . ASN C  3 70  ? -13.537 46.427  0.534   1.00 165.52 ? 121 ASN C OD1   1 
ATOM   4554  N  ND2   . ASN C  3 70  ? -12.808 44.327  0.788   1.00 146.44 ? 121 ASN C ND2   1 
ATOM   4555  N  N     . ARG C  3 71  ? -11.161 43.762  -3.435  1.00 143.85 ? 122 ARG C N     1 
ATOM   4556  C  CA    . ARG C  3 71  ? -11.807 43.353  -4.669  1.00 120.56 ? 122 ARG C CA    1 
ATOM   4557  C  C     . ARG C  3 71  ? -11.416 41.945  -5.109  1.00 116.15 ? 122 ARG C C     1 
ATOM   4558  O  O     . ARG C  3 71  ? -12.192 41.301  -5.817  1.00 113.71 ? 122 ARG C O     1 
ATOM   4559  C  CB    . ARG C  3 71  ? -11.436 44.366  -5.769  1.00 128.46 ? 122 ARG C CB    1 
ATOM   4560  C  CG    . ARG C  3 71  ? -12.267 44.431  -7.017  1.00 127.05 ? 122 ARG C CG    1 
ATOM   4561  C  CD    . ARG C  3 71  ? -11.652 45.494  -7.952  1.00 134.02 ? 122 ARG C CD    1 
ATOM   4562  N  NE    . ARG C  3 71  ? -12.163 45.375  -9.312  1.00 135.60 ? 122 ARG C NE    1 
ATOM   4563  C  CZ    . ARG C  3 71  ? -13.323 45.876  -9.710  1.00 138.32 ? 122 ARG C CZ    1 
ATOM   4564  N  NH1   . ARG C  3 71  ? -14.073 46.535  -8.846  1.00 139.40 ? 122 ARG C NH1   1 
ATOM   4565  N  NH2   . ARG C  3 71  ? -13.735 45.717  -10.960 1.00 140.54 ? 122 ARG C NH2   1 
ATOM   4566  N  N     . TYR C  3 72  ? -10.215 41.478  -4.750  1.00 108.25 ? 123 TYR C N     1 
ATOM   4567  C  CA    . TYR C  3 72  ? -9.728  40.160  -5.155  1.00 106.44 ? 123 TYR C CA    1 
ATOM   4568  C  C     . TYR C  3 72  ? -10.405 39.020  -4.414  1.00 103.03 ? 123 TYR C C     1 
ATOM   4569  O  O     . TYR C  3 72  ? -10.560 37.935  -4.980  1.00 101.18 ? 123 TYR C O     1 
ATOM   4570  C  CB    . TYR C  3 72  ? -8.217  40.078  -4.990  1.00 115.26 ? 123 TYR C CB    1 
ATOM   4571  C  CG    . TYR C  3 72  ? -7.485  40.738  -6.118  1.00 118.55 ? 123 TYR C CG    1 
ATOM   4572  C  CD1   . TYR C  3 72  ? -8.175  41.345  -7.137  1.00 118.74 ? 123 TYR C CD1   1 
ATOM   4573  C  CD2   . TYR C  3 72  ? -6.103  40.714  -6.194  1.00 120.10 ? 123 TYR C CD2   1 
ATOM   4574  C  CE1   . TYR C  3 72  ? -7.514  41.930  -8.185  1.00 120.77 ? 123 TYR C CE1   1 
ATOM   4575  C  CE2   . TYR C  3 72  ? -5.435  41.303  -7.256  1.00 121.63 ? 123 TYR C CE2   1 
ATOM   4576  C  CZ    . TYR C  3 72  ? -6.142  41.910  -8.256  1.00 123.27 ? 123 TYR C CZ    1 
ATOM   4577  O  OH    . TYR C  3 72  ? -5.486  42.495  -9.327  1.00 121.54 ? 123 TYR C OH    1 
ATOM   4578  N  N     . LEU C  3 73  ? -10.733 39.204  -3.130  1.00 102.57 ? 124 LEU C N     1 
ATOM   4579  C  CA    . LEU C  3 73  ? -11.448 38.153  -2.416  1.00 99.65  ? 124 LEU C CA    1 
ATOM   4580  C  C     . LEU C  3 73  ? -12.652 37.683  -3.202  1.00 97.46  ? 124 LEU C C     1 
ATOM   4581  O  O     . LEU C  3 73  ? -12.949 36.487  -3.224  1.00 97.72  ? 124 LEU C O     1 
ATOM   4582  C  CB    . LEU C  3 73  ? -11.896 38.606  -1.037  1.00 99.85  ? 124 LEU C CB    1 
ATOM   4583  C  CG    . LEU C  3 73  ? -10.801 38.962  -0.065  1.00 102.13 ? 124 LEU C CG    1 
ATOM   4584  C  CD1   . LEU C  3 73  ? -11.494 39.423  1.191   1.00 118.27 ? 124 LEU C CD1   1 
ATOM   4585  C  CD2   . LEU C  3 73  ? -9.922  37.759  0.197   1.00 101.44 ? 124 LEU C CD2   1 
ATOM   4586  N  N     . LEU C  3 74  ? -13.336 38.598  -3.890  1.00 98.42  ? 125 LEU C N     1 
ATOM   4587  C  CA    . LEU C  3 74  ? -14.488 38.178  -4.676  1.00 121.62 ? 125 LEU C CA    1 
ATOM   4588  C  C     . LEU C  3 74  ? -14.098 37.074  -5.653  1.00 137.02 ? 125 LEU C C     1 
ATOM   4589  O  O     . LEU C  3 74  ? -14.888 36.153  -5.887  1.00 147.80 ? 125 LEU C O     1 
ATOM   4590  C  CB    . LEU C  3 74  ? -15.080 39.353  -5.463  1.00 102.03 ? 125 LEU C CB    1 
ATOM   4591  C  CG    . LEU C  3 74  ? -16.368 39.081  -6.269  1.00 97.81  ? 125 LEU C CG    1 
ATOM   4592  C  CD1   . LEU C  3 74  ? -17.542 38.741  -5.361  1.00 96.02  ? 125 LEU C CD1   1 
ATOM   4593  C  CD2   . LEU C  3 74  ? -16.751 40.148  -7.273  1.00 100.35 ? 125 LEU C CD2   1 
ATOM   4594  N  N     . LEU C  3 75  ? -12.866 37.107  -6.183  1.00 133.69 ? 126 LEU C N     1 
ATOM   4595  C  CA    . LEU C  3 75  ? -12.446 36.085  -7.142  1.00 135.30 ? 126 LEU C CA    1 
ATOM   4596  C  C     . LEU C  3 75  ? -12.534 34.692  -6.537  1.00 118.38 ? 126 LEU C C     1 
ATOM   4597  O  O     . LEU C  3 75  ? -13.239 33.817  -7.055  1.00 113.55 ? 126 LEU C O     1 
ATOM   4598  C  CB    . LEU C  3 75  ? -11.026 36.384  -7.621  1.00 141.32 ? 126 LEU C CB    1 
ATOM   4599  C  CG    . LEU C  3 75  ? -10.433 35.550  -8.750  1.00 148.80 ? 126 LEU C CG    1 
ATOM   4600  C  CD1   . LEU C  3 75  ? -10.805 36.168  -10.072 1.00 152.18 ? 126 LEU C CD1   1 
ATOM   4601  C  CD2   . LEU C  3 75  ? -8.929  35.517  -8.620  1.00 156.81 ? 126 LEU C CD2   1 
ATOM   4602  N  N     . VAL C  3 76  ? -11.903 34.500  -5.383  1.00 119.10 ? 127 VAL C N     1 
ATOM   4603  C  CA    . VAL C  3 76  ? -11.940 33.200  -4.728  1.00 111.24 ? 127 VAL C CA    1 
ATOM   4604  C  C     . VAL C  3 76  ? -13.353 32.858  -4.323  1.00 90.88  ? 127 VAL C C     1 
ATOM   4605  O  O     . VAL C  3 76  ? -13.835 31.753  -4.585  1.00 89.82  ? 127 VAL C O     1 
ATOM   4606  C  CB    . VAL C  3 76  ? -10.987 33.197  -3.526  1.00 112.04 ? 127 VAL C CB    1 
ATOM   4607  C  CG1   . VAL C  3 76  ? -11.204 31.995  -2.661  1.00 92.50  ? 127 VAL C CG1   1 
ATOM   4608  C  CG2   . VAL C  3 76  ? -9.568  33.177  -4.049  1.00 96.40  ? 127 VAL C CG2   1 
ATOM   4609  N  N     . LEU C  3 77  ? -14.080 33.839  -3.804  1.00 90.86  ? 128 LEU C N     1 
ATOM   4610  C  CA    . LEU C  3 77  ? -15.472 33.599  -3.488  1.00 89.18  ? 128 LEU C CA    1 
ATOM   4611  C  C     . LEU C  3 77  ? -16.196 33.060  -4.702  1.00 88.52  ? 128 LEU C C     1 
ATOM   4612  O  O     . LEU C  3 77  ? -17.099 32.241  -4.575  1.00 110.82 ? 128 LEU C O     1 
ATOM   4613  C  CB    . LEU C  3 77  ? -16.157 34.866  -3.022  1.00 89.97  ? 128 LEU C CB    1 
ATOM   4614  C  CG    . LEU C  3 77  ? -17.538 34.492  -2.516  1.00 88.48  ? 128 LEU C CG    1 
ATOM   4615  C  CD1   . LEU C  3 77  ? -17.241 33.632  -1.343  1.00 87.52  ? 128 LEU C CD1   1 
ATOM   4616  C  CD2   . LEU C  3 77  ? -18.352 35.653  -2.097  1.00 89.55  ? 128 LEU C CD2   1 
ATOM   4617  N  N     . MET C  3 78  ? -15.865 33.554  -5.884  1.00 89.92  ? 129 MET C N     1 
ATOM   4618  C  CA    . MET C  3 78  ? -16.492 32.998  -7.072  1.00 106.69 ? 129 MET C CA    1 
ATOM   4619  C  C     . MET C  3 78  ? -16.019 31.583  -7.385  1.00 117.50 ? 129 MET C C     1 
ATOM   4620  O  O     . MET C  3 78  ? -16.821 30.769  -7.854  1.00 125.30 ? 129 MET C O     1 
ATOM   4621  C  CB    . MET C  3 78  ? -16.317 33.921  -8.273  1.00 97.68  ? 129 MET C CB    1 
ATOM   4622  C  CG    . MET C  3 78  ? -17.200 35.115  -8.156  1.00 95.64  ? 129 MET C CG    1 
ATOM   4623  S  SD    . MET C  3 78  ? -18.946 34.642  -8.149  1.00 91.18  ? 129 MET C SD    1 
ATOM   4624  C  CE    . MET C  3 78  ? -19.329 34.762  -6.401  1.00 89.78  ? 129 MET C CE    1 
ATOM   4625  N  N     . ASP C  3 79  ? -14.776 31.227  -7.086  1.00 117.07 ? 130 ASP C N     1 
ATOM   4626  C  CA    . ASP C  3 79  ? -14.435 29.821  -7.263  1.00 123.73 ? 130 ASP C CA    1 
ATOM   4627  C  C     . ASP C  3 79  ? -15.325 28.960  -6.372  1.00 125.57 ? 130 ASP C C     1 
ATOM   4628  O  O     . ASP C  3 79  ? -16.007 28.036  -6.848  1.00 122.09 ? 130 ASP C O     1 
ATOM   4629  C  CB    . ASP C  3 79  ? -12.954 29.609  -6.966  1.00 133.78 ? 130 ASP C CB    1 
ATOM   4630  C  CG    . ASP C  3 79  ? -12.092 29.715  -8.208  1.00 142.50 ? 130 ASP C CG    1 
ATOM   4631  O  OD1   . ASP C  3 79  ? -12.655 29.737  -9.324  1.00 145.27 ? 130 ASP C OD1   1 
ATOM   4632  O  OD2   . ASP C  3 79  ? -10.856 29.816  -8.066  1.00 146.00 ? 130 ASP C OD2   1 
ATOM   4633  N  N     . ALA C  3 80  ? -15.463 29.368  -5.111  1.00 113.01 ? 131 ALA C N     1 
ATOM   4634  C  CA    . ALA C  3 80  ? -16.229 28.576  -4.164  1.00 110.94 ? 131 ALA C CA    1 
ATOM   4635  C  C     . ALA C  3 80  ? -17.691 28.516  -4.560  1.00 108.16 ? 131 ALA C C     1 
ATOM   4636  O  O     . ALA C  3 80  ? -18.292 27.437  -4.573  1.00 127.29 ? 131 ALA C O     1 
ATOM   4637  C  CB    . ALA C  3 80  ? -16.087 29.141  -2.756  1.00 122.97 ? 131 ALA C CB    1 
ATOM   4638  N  N     . GLU C  3 81  ? -18.268 29.628  -4.971  1.00 96.99  ? 132 GLU C N     1 
ATOM   4639  C  CA    . GLU C  3 81  ? -19.656 29.559  -5.386  1.00 84.43  ? 132 GLU C CA    1 
ATOM   4640  C  C     . GLU C  3 81  ? -19.804 28.671  -6.608  1.00 84.88  ? 132 GLU C C     1 
ATOM   4641  O  O     . GLU C  3 81  ? -20.747 27.880  -6.693  1.00 102.79 ? 132 GLU C O     1 
ATOM   4642  C  CB    . GLU C  3 81  ? -20.201 30.949  -5.662  1.00 94.30  ? 132 GLU C CB    1 
ATOM   4643  C  CG    . GLU C  3 81  ? -20.581 31.688  -4.417  1.00 95.64  ? 132 GLU C CG    1 
ATOM   4644  C  CD    . GLU C  3 81  ? -21.772 31.090  -3.764  1.00 84.15  ? 132 GLU C CD    1 
ATOM   4645  O  OE1   . GLU C  3 81  ? -22.856 31.206  -4.372  1.00 84.57  ? 132 GLU C OE1   1 
ATOM   4646  O  OE2   . GLU C  3 81  ? -21.618 30.525  -2.660  1.00 83.37  ? 132 GLU C OE2   1 
ATOM   4647  N  N     . ARG C  3 82  ? -18.831 28.704  -7.517  1.00 87.66  ? 133 ARG C N     1 
ATOM   4648  C  CA    . ARG C  3 82  ? -18.947 27.897  -8.733  1.00 94.18  ? 133 ARG C CA    1 
ATOM   4649  C  C     . ARG C  3 82  ? -19.044 26.427  -8.390  1.00 86.45  ? 133 ARG C C     1 
ATOM   4650  O  O     . ARG C  3 82  ? -20.034 25.764  -8.729  1.00 86.47  ? 133 ARG C O     1 
ATOM   4651  C  CB    . ARG C  3 82  ? -17.746 28.156  -9.628  1.00 97.93  ? 133 ARG C CB    1 
ATOM   4652  C  CG    . ARG C  3 82  ? -17.611 27.395  -10.899 1.00 90.25  ? 133 ARG C CG    1 
ATOM   4653  C  CD    . ARG C  3 82  ? -16.158 27.530  -11.192 1.00 91.70  ? 133 ARG C CD    1 
ATOM   4654  N  NE    . ARG C  3 82  ? -15.873 27.790  -12.589 1.00 105.72 ? 133 ARG C NE    1 
ATOM   4655  C  CZ    . ARG C  3 82  ? -14.648 28.008  -13.057 1.00 106.07 ? 133 ARG C CZ    1 
ATOM   4656  N  NH1   . ARG C  3 82  ? -13.607 27.988  -12.236 1.00 106.99 ? 133 ARG C NH1   1 
ATOM   4657  N  NH2   . ARG C  3 82  ? -14.462 28.253  -14.344 1.00 108.29 ? 133 ARG C NH2   1 
ATOM   4658  N  N     . ALA C  3 83  ? -18.124 25.947  -7.553  1.00 86.12  ? 134 ALA C N     1 
ATOM   4659  C  CA    . ALA C  3 83  ? -18.216 24.554  -7.157  1.00 85.99  ? 134 ALA C CA    1 
ATOM   4660  C  C     . ALA C  3 83  ? -19.561 24.281  -6.512  1.00 86.19  ? 134 ALA C C     1 
ATOM   4661  O  O     . ALA C  3 83  ? -20.389 23.565  -7.081  1.00 85.27  ? 134 ALA C O     1 
ATOM   4662  C  CB    . ALA C  3 83  ? -17.096 24.212  -6.178  1.00 86.05  ? 134 ALA C CB    1 
ATOM   4663  N  N     . TRP C  3 84  ? -19.893 25.047  -5.481  1.00 83.71  ? 135 TRP C N     1 
ATOM   4664  C  CA    . TRP C  3 84  ? -21.116 24.771  -4.744  1.00 82.92  ? 135 TRP C CA    1 
ATOM   4665  C  C     . TRP C  3 84  ? -22.319 24.693  -5.667  1.00 83.39  ? 135 TRP C C     1 
ATOM   4666  O  O     . TRP C  3 84  ? -23.158 23.786  -5.542  1.00 104.31 ? 135 TRP C O     1 
ATOM   4667  C  CB    . TRP C  3 84  ? -21.318 25.850  -3.701  1.00 82.21  ? 135 TRP C CB    1 
ATOM   4668  C  CG    . TRP C  3 84  ? -22.597 25.804  -2.991  1.00 81.78  ? 135 TRP C CG    1 
ATOM   4669  C  CD1   . TRP C  3 84  ? -22.806 25.282  -1.786  1.00 81.44  ? 135 TRP C CD1   1 
ATOM   4670  C  CD2   . TRP C  3 84  ? -23.861 26.310  -3.438  1.00 82.08  ? 135 TRP C CD2   1 
ATOM   4671  N  NE1   . TRP C  3 84  ? -24.119 25.412  -1.427  1.00 81.47  ? 135 TRP C NE1   1 
ATOM   4672  C  CE2   . TRP C  3 84  ? -24.792 26.041  -2.432  1.00 81.89  ? 135 TRP C CE2   1 
ATOM   4673  C  CE3   . TRP C  3 84  ? -24.290 26.963  -4.585  1.00 82.85  ? 135 TRP C CE3   1 
ATOM   4674  C  CZ2   . TRP C  3 84  ? -26.126 26.391  -2.534  1.00 82.46  ? 135 TRP C CZ2   1 
ATOM   4675  C  CZ3   . TRP C  3 84  ? -25.615 27.306  -4.689  1.00 84.58  ? 135 TRP C CZ3   1 
ATOM   4676  C  CH2   . TRP C  3 84  ? -26.519 27.021  -3.671  1.00 83.25  ? 135 TRP C CH2   1 
ATOM   4677  N  N     . SER C  3 85  ? -22.399 25.593  -6.638  1.00 84.03  ? 136 SER C N     1 
ATOM   4678  C  CA    . SER C  3 85  ? -23.525 25.539  -7.562  1.00 98.52  ? 136 SER C CA    1 
ATOM   4679  C  C     . SER C  3 85  ? -23.524 24.247  -8.356  1.00 112.19 ? 136 SER C C     1 
ATOM   4680  O  O     . SER C  3 85  ? -24.553 23.564  -8.453  1.00 121.89 ? 136 SER C O     1 
ATOM   4681  C  CB    . SER C  3 85  ? -23.520 26.710  -8.522  1.00 95.13  ? 136 SER C CB    1 
ATOM   4682  O  OG    . SER C  3 85  ? -24.429 26.434  -9.582  1.00 98.04  ? 136 SER C OG    1 
ATOM   4683  N  N     . TYR C  3 86  ? -22.382 23.905  -8.949  1.00 107.60 ? 137 TYR C N     1 
ATOM   4684  C  CA    . TYR C  3 86  ? -22.318 22.668  -9.706  1.00 94.48  ? 137 TYR C CA    1 
ATOM   4685  C  C     . TYR C  3 86  ? -22.806 21.497  -8.853  1.00 92.09  ? 137 TYR C C     1 
ATOM   4686  O  O     . TYR C  3 86  ? -23.631 20.691  -9.305  1.00 89.09  ? 137 TYR C O     1 
ATOM   4687  C  CB    . TYR C  3 86  ? -20.891 22.487  -10.216 1.00 90.51  ? 137 TYR C CB    1 
ATOM   4688  C  CG    . TYR C  3 86  ? -20.780 21.685  -11.467 1.00 92.58  ? 137 TYR C CG    1 
ATOM   4689  C  CD1   . TYR C  3 86  ? -21.862 21.506  -12.297 1.00 96.26  ? 137 TYR C CD1   1 
ATOM   4690  C  CD2   . TYR C  3 86  ? -19.569 21.160  -11.851 1.00 94.40  ? 137 TYR C CD2   1 
ATOM   4691  C  CE1   . TYR C  3 86  ? -21.749 20.760  -13.454 1.00 101.74 ? 137 TYR C CE1   1 
ATOM   4692  C  CE2   . TYR C  3 86  ? -19.439 20.431  -13.007 1.00 99.85  ? 137 TYR C CE2   1 
ATOM   4693  C  CZ    . TYR C  3 86  ? -20.524 20.223  -13.810 1.00 102.90 ? 137 TYR C CZ    1 
ATOM   4694  O  OH    . TYR C  3 86  ? -20.374 19.476  -14.967 1.00 106.85 ? 137 TYR C OH    1 
ATOM   4695  N  N     . ALA C  3 87  ? -22.407 21.458  -7.576  1.00 86.53  ? 138 ALA C N     1 
ATOM   4696  C  CA    . ALA C  3 87  ? -22.840 20.361  -6.719  1.00 86.53  ? 138 ALA C CA    1 
ATOM   4697  C  C     . ALA C  3 87  ? -24.355 20.297  -6.648  1.00 86.61  ? 138 ALA C C     1 
ATOM   4698  O  O     . ALA C  3 87  ? -24.958 19.271  -6.976  1.00 116.55 ? 138 ALA C O     1 
ATOM   4699  C  CB    . ALA C  3 87  ? -22.256 20.515  -5.316  1.00 85.29  ? 138 ALA C CB    1 
ATOM   4700  N  N     . MET C  3 88  ? -25.003 21.415  -6.366  1.00 85.65  ? 139 MET C N     1 
ATOM   4701  C  CA    . MET C  3 88  ? -26.452 21.333  -6.274  1.00 86.15  ? 139 MET C CA    1 
ATOM   4702  C  C     . MET C  3 88  ? -27.039 20.896  -7.614  1.00 88.05  ? 139 MET C C     1 
ATOM   4703  O  O     . MET C  3 88  ? -28.022 20.138  -7.658  1.00 108.03 ? 139 MET C O     1 
ATOM   4704  C  CB    . MET C  3 88  ? -27.019 22.679  -5.848  1.00 103.45 ? 139 MET C CB    1 
ATOM   4705  C  CG    . MET C  3 88  ? -26.606 23.155  -4.474  1.00 97.92  ? 139 MET C CG    1 
ATOM   4706  S  SD    . MET C  3 88  ? -27.023 22.070  -3.132  1.00 94.94  ? 139 MET C SD    1 
ATOM   4707  C  CE    . MET C  3 88  ? -28.768 22.440  -3.030  1.00 99.25  ? 139 MET C CE    1 
ATOM   4708  N  N     . GLN C  3 89  ? -26.393 21.282  -8.721  1.00 88.71  ? 140 GLN C N     1 
ATOM   4709  C  CA    . GLN C  3 89  ? -26.910 20.879  -10.025 1.00 95.65  ? 140 GLN C CA    1 
ATOM   4710  C  C     . GLN C  3 89  ? -26.914 19.387  -10.128 1.00 108.64 ? 140 GLN C C     1 
ATOM   4711  O  O     . GLN C  3 89  ? -27.883 18.788  -10.609 1.00 121.07 ? 140 GLN C O     1 
ATOM   4712  C  CB    . GLN C  3 89  ? -26.055 21.401  -11.174 1.00 91.80  ? 140 GLN C CB    1 
ATOM   4713  C  CG    . GLN C  3 89  ? -26.617 21.036  -12.560 1.00 94.57  ? 140 GLN C CG    1 
ATOM   4714  C  CD    . GLN C  3 89  ? -25.774 21.614  -13.691 1.00 103.52 ? 140 GLN C CD    1 
ATOM   4715  O  OE1   . GLN C  3 89  ? -24.771 22.303  -13.455 1.00 101.64 ? 140 GLN C OE1   1 
ATOM   4716  N  NE2   . GLN C  3 89  ? -26.220 21.402  -14.921 1.00 98.49  ? 140 GLN C NE2   1 
ATOM   4717  N  N     . LEU C  3 90  ? -25.828 18.767  -9.669  1.00 107.40 ? 141 LEU C N     1 
ATOM   4718  C  CA    . LEU C  3 90  ? -25.752 17.326  -9.751  1.00 93.70  ? 141 LEU C CA    1 
ATOM   4719  C  C     . LEU C  3 90  ? -26.816 16.697  -8.869  1.00 93.79  ? 141 LEU C C     1 
ATOM   4720  O  O     . LEU C  3 90  ? -27.630 15.921  -9.358  1.00 95.95  ? 141 LEU C O     1 
ATOM   4721  C  CB    . LEU C  3 90  ? -24.353 16.870  -9.382  1.00 93.50  ? 141 LEU C CB    1 
ATOM   4722  C  CG    . LEU C  3 90  ? -23.379 17.366  -10.453 1.00 94.23  ? 141 LEU C CG    1 
ATOM   4723  C  CD1   . LEU C  3 90  ? -21.939 17.062  -10.066 1.00 94.23  ? 141 LEU C CD1   1 
ATOM   4724  C  CD2   . LEU C  3 90  ? -23.721 16.889  -11.847 1.00 97.05  ? 141 LEU C CD2   1 
ATOM   4725  N  N     . LYS C  3 91  ? -26.944 17.163  -7.621  1.00 91.75  ? 142 LYS C N     1 
ATOM   4726  C  CA    . LYS C  3 91  ? -28.007 16.655  -6.759  1.00 92.08  ? 142 LYS C CA    1 
ATOM   4727  C  C     . LYS C  3 91  ? -29.339 16.613  -7.482  1.00 93.82  ? 142 LYS C C     1 
ATOM   4728  O  O     . LYS C  3 91  ? -30.155 15.730  -7.231  1.00 95.46  ? 142 LYS C O     1 
ATOM   4729  C  CB    . LYS C  3 91  ? -28.149 17.489  -5.500  1.00 89.96  ? 142 LYS C CB    1 
ATOM   4730  C  CG    . LYS C  3 91  ? -29.144 16.895  -4.530  1.00 110.20 ? 142 LYS C CG    1 
ATOM   4731  C  CD    . LYS C  3 91  ? -29.119 17.582  -3.179  1.00 114.89 ? 142 LYS C CD    1 
ATOM   4732  C  CE    . LYS C  3 91  ? -30.056 16.882  -2.184  1.00 124.69 ? 142 LYS C CE    1 
ATOM   4733  N  NZ    . LYS C  3 91  ? -31.506 17.267  -2.308  1.00 131.72 ? 142 LYS C NZ    1 
ATOM   4734  N  N     . GLN C  3 92  ? -29.608 17.578  -8.354  1.00 109.39 ? 143 GLN C N     1 
ATOM   4735  C  CA    . GLN C  3 92  ? -30.818 17.443  -9.165  1.00 111.77 ? 143 GLN C CA    1 
ATOM   4736  C  C     . GLN C  3 92  ? -30.651 16.359  -10.227 1.00 113.33 ? 143 GLN C C     1 
ATOM   4737  O  O     . GLN C  3 92  ? -31.574 15.583  -10.460 1.00 116.01 ? 143 GLN C O     1 
ATOM   4738  C  CB    . GLN C  3 92  ? -31.245 18.776  -9.802  1.00 118.58 ? 143 GLN C CB    1 
ATOM   4739  C  CG    . GLN C  3 92  ? -32.574 19.346  -9.241  1.00 125.65 ? 143 GLN C CG    1 
ATOM   4740  C  CD    . GLN C  3 92  ? -32.869 20.791  -9.688  1.00 128.95 ? 143 GLN C CD    1 
ATOM   4741  O  OE1   . GLN C  3 92  ? -31.990 21.654  -9.645  1.00 124.96 ? 143 GLN C OE1   1 
ATOM   4742  N  NE2   . GLN C  3 92  ? -34.118 21.061  -10.068 1.00 132.16 ? 143 GLN C NE2   1 
ATOM   4743  N  N     . GLU C  3 93  ? -29.510 16.305  -10.920 1.00 98.97  ? 144 GLU C N     1 
ATOM   4744  C  CA    . GLU C  3 93  ? -29.411 15.244  -11.927 1.00 102.12 ? 144 GLU C CA    1 
ATOM   4745  C  C     . GLU C  3 93  ? -29.258 13.833  -11.351 1.00 128.46 ? 144 GLU C C     1 
ATOM   4746  O  O     . GLU C  3 93  ? -29.399 12.863  -12.105 1.00 135.49 ? 144 GLU C O     1 
ATOM   4747  C  CB    . GLU C  3 93  ? -28.289 15.527  -12.931 1.00 106.28 ? 144 GLU C CB    1 
ATOM   4748  C  CG    . GLU C  3 93  ? -28.733 16.432  -14.097 1.00 110.12 ? 144 GLU C CG    1 
ATOM   4749  C  CD    . GLU C  3 93  ? -27.569 16.958  -14.933 1.00 110.95 ? 144 GLU C CD    1 
ATOM   4750  O  OE1   . GLU C  3 93  ? -26.451 16.423  -14.791 1.00 115.01 ? 144 GLU C OE1   1 
ATOM   4751  O  OE2   . GLU C  3 93  ? -27.772 17.882  -15.750 1.00 106.63 ? 144 GLU C OE2   1 
ATOM   4752  N  N     . ALA C  3 94  ? -29.011 13.680  -10.051 1.00 119.10 ? 145 ALA C N     1 
ATOM   4753  C  CA    . ALA C  3 94  ? -28.721 12.369  -9.488  1.00 117.89 ? 145 ALA C CA    1 
ATOM   4754  C  C     . ALA C  3 94  ? -29.990 11.597  -9.204  1.00 114.75 ? 145 ALA C C     1 
ATOM   4755  O  O     . ALA C  3 94  ? -29.972 10.366  -9.215  1.00 122.34 ? 145 ALA C O     1 
ATOM   4756  C  CB    . ALA C  3 94  ? -27.896 12.489  -8.209  1.00 115.95 ? 145 ALA C CB    1 
ATOM   4757  N  N     . ASN C  3 95  ? -31.098 12.288  -8.961  1.00 111.00 ? 146 ASN C N     1 
ATOM   4758  C  CA    . ASN C  3 95  ? -32.367 11.594  -8.813  1.00 118.40 ? 146 ASN C CA    1 
ATOM   4759  C  C     . ASN C  3 95  ? -32.643 10.667  -9.980  1.00 117.17 ? 146 ASN C C     1 
ATOM   4760  O  O     . ASN C  3 95  ? -33.531 9.818   -9.884  1.00 118.91 ? 146 ASN C O     1 
ATOM   4761  C  CB    . ASN C  3 95  ? -33.522 12.579  -8.677  1.00 124.87 ? 146 ASN C CB    1 
ATOM   4762  C  CG    . ASN C  3 95  ? -33.768 12.988  -7.244  1.00 131.03 ? 146 ASN C CG    1 
ATOM   4763  O  OD1   . ASN C  3 95  ? -33.413 12.266  -6.305  1.00 135.11 ? 146 ASN C OD1   1 
ATOM   4764  N  ND2   . ASN C  3 95  ? -34.381 14.150  -7.063  1.00 131.95 ? 146 ASN C ND2   1 
ATOM   4765  N  N     . THR C  3 96  ? -31.964 10.850  -11.109 1.00 111.45 ? 147 THR C N     1 
ATOM   4766  C  CA    . THR C  3 96  ? -32.116 9.906   -12.204 1.00 115.66 ? 147 THR C CA    1 
ATOM   4767  C  C     . THR C  3 96  ? -30.789 9.447   -12.794 1.00 116.52 ? 147 THR C C     1 
ATOM   4768  O  O     . THR C  3 96  ? -30.766 9.012   -13.942 1.00 119.83 ? 147 THR C O     1 
ATOM   4769  C  CB    . THR C  3 96  ? -32.981 10.481  -13.319 1.00 117.44 ? 147 THR C CB    1 
ATOM   4770  O  OG1   . THR C  3 96  ? -32.235 11.487  -14.013 1.00 115.74 ? 147 THR C OG1   1 
ATOM   4771  C  CG2   . THR C  3 96  ? -34.276 11.069  -12.769 1.00 116.80 ? 147 THR C CG2   1 
ATOM   4772  N  N     . GLU C  3 97  ? -29.676 9.579   -12.091 1.00 113.98 ? 148 GLU C N     1 
ATOM   4773  C  CA    . GLU C  3 97  ? -28.461 9.051   -12.708 1.00 115.60 ? 148 GLU C CA    1 
ATOM   4774  C  C     . GLU C  3 97  ? -27.466 8.550   -11.668 1.00 114.52 ? 148 GLU C C     1 
ATOM   4775  O  O     . GLU C  3 97  ? -26.261 8.537   -11.944 1.00 114.60 ? 148 GLU C O     1 
ATOM   4776  C  CB    . GLU C  3 97  ? -27.760 10.148  -13.509 1.00 131.49 ? 148 GLU C CB    1 
ATOM   4777  C  CG    . GLU C  3 97  ? -28.482 10.792  -14.690 1.00 130.10 ? 148 GLU C CG    1 
ATOM   4778  C  CD    . GLU C  3 97  ? -28.339 10.012  -15.966 1.00 129.60 ? 148 GLU C CD    1 
ATOM   4779  O  OE1   . GLU C  3 97  ? -27.608 8.999   -15.970 1.00 129.07 ? 148 GLU C OE1   1 
ATOM   4780  O  OE2   . GLU C  3 97  ? -28.934 10.435  -16.978 1.00 129.32 ? 148 GLU C OE2   1 
ATOM   4781  N  N     . PRO C  3 98  ? -27.929 7.997   -10.543 1.00 132.03 ? 149 PRO C N     1 
ATOM   4782  C  CA    . PRO C  3 98  ? -27.177 8.090   -9.278  1.00 130.01 ? 149 PRO C CA    1 
ATOM   4783  C  C     . PRO C  3 98  ? -25.664 8.187   -9.297  1.00 135.63 ? 149 PRO C C     1 
ATOM   4784  O  O     . PRO C  3 98  ? -25.102 8.663   -8.307  1.00 136.57 ? 149 PRO C O     1 
ATOM   4785  C  CB    . PRO C  3 98  ? -27.627 6.833   -8.530  1.00 128.78 ? 149 PRO C CB    1 
ATOM   4786  C  CG    . PRO C  3 98  ? -29.036 6.736   -8.907  1.00 131.96 ? 149 PRO C CG    1 
ATOM   4787  C  CD    . PRO C  3 98  ? -29.118 7.155   -10.371 1.00 133.72 ? 149 PRO C CD    1 
ATOM   4788  N  N     . ARG C  3 99  ? -24.975 7.793   -10.361 1.00 113.78 ? 150 ARG C N     1 
ATOM   4789  C  CA    . ARG C  3 99  ? -23.528 7.906   -10.283 1.00 113.38 ? 150 ARG C CA    1 
ATOM   4790  C  C     . ARG C  3 99  ? -23.096 9.365   -10.215 1.00 109.47 ? 150 ARG C C     1 
ATOM   4791  O  O     . ARG C  3 99  ? -22.052 9.676   -9.627  1.00 108.06 ? 150 ARG C O     1 
ATOM   4792  C  CB    . ARG C  3 99  ? -22.876 7.164   -11.449 1.00 117.46 ? 150 ARG C CB    1 
ATOM   4793  C  CG    . ARG C  3 99  ? -21.450 7.549   -11.639 1.00 117.10 ? 150 ARG C CG    1 
ATOM   4794  C  CD    . ARG C  3 99  ? -20.723 6.576   -12.486 1.00 121.78 ? 150 ARG C CD    1 
ATOM   4795  N  NE    . ARG C  3 99  ? -19.310 6.543   -12.126 1.00 122.10 ? 150 ARG C NE    1 
ATOM   4796  C  CZ    . ARG C  3 99  ? -18.819 6.275   -10.918 1.00 121.28 ? 150 ARG C CZ    1 
ATOM   4797  N  NH1   . ARG C  3 99  ? -19.602 6.008   -9.884  1.00 119.95 ? 150 ARG C NH1   1 
ATOM   4798  N  NH2   . ARG C  3 99  ? -17.513 6.299   -10.732 1.00 122.05 ? 150 ARG C NH2   1 
ATOM   4799  N  N     . LYS C  3 100 ? -23.932 10.274  -10.715 1.00 117.15 ? 151 LYS C N     1 
ATOM   4800  C  CA    . LYS C  3 100 ? -23.689 11.703  -10.528 1.00 104.34 ? 151 LYS C CA    1 
ATOM   4801  C  C     . LYS C  3 100 ? -23.393 12.073  -9.082  1.00 101.50 ? 151 LYS C C     1 
ATOM   4802  O  O     . LYS C  3 100 ? -22.571 12.953  -8.836  1.00 99.48  ? 151 LYS C O     1 
ATOM   4803  C  CB    . LYS C  3 100 ? -24.901 12.529  -10.988 1.00 103.36 ? 151 LYS C CB    1 
ATOM   4804  C  CG    . LYS C  3 100 ? -25.318 12.420  -12.457 1.00 106.12 ? 151 LYS C CG    1 
ATOM   4805  C  CD    . LYS C  3 100 ? -24.547 13.286  -13.451 1.00 106.06 ? 151 LYS C CD    1 
ATOM   4806  C  CE    . LYS C  3 100 ? -25.252 13.248  -14.813 1.00 108.95 ? 151 LYS C CE    1 
ATOM   4807  N  NZ    . LYS C  3 100 ? -24.489 13.887  -15.917 1.00 109.93 ? 151 LYS C NZ    1 
ATOM   4808  N  N     . ARG C  3 101 ? -23.966 11.362  -8.115  1.00 124.26 ? 152 ARG C N     1 
ATOM   4809  C  CA    . ARG C  3 101 ? -23.741 11.739  -6.728  1.00 117.49 ? 152 ARG C CA    1 
ATOM   4810  C  C     . ARG C  3 101 ? -22.261 11.841  -6.429  1.00 99.16  ? 152 ARG C C     1 
ATOM   4811  O  O     . ARG C  3 101 ? -21.828 12.719  -5.686  1.00 96.78  ? 152 ARG C O     1 
ATOM   4812  C  CB    . ARG C  3 101 ? -24.395 10.739  -5.777  1.00 125.91 ? 152 ARG C CB    1 
ATOM   4813  C  CG    . ARG C  3 101 ? -25.779 11.114  -5.291  1.00 126.11 ? 152 ARG C CG    1 
ATOM   4814  C  CD    . ARG C  3 101 ? -26.342 10.043  -4.369  1.00 127.65 ? 152 ARG C CD    1 
ATOM   4815  N  NE    . ARG C  3 101 ? -25.755 10.105  -3.037  1.00 128.03 ? 152 ARG C NE    1 
ATOM   4816  C  CZ    . ARG C  3 101 ? -26.202 10.896  -2.068  1.00 125.71 ? 152 ARG C CZ    1 
ATOM   4817  N  NH1   . ARG C  3 101 ? -27.246 11.692  -2.278  1.00 121.75 ? 152 ARG C NH1   1 
ATOM   4818  N  NH2   . ARG C  3 101 ? -25.613 10.885  -0.884  1.00 126.36 ? 152 ARG C NH2   1 
ATOM   4819  N  N     . PHE C  3 102 ? -21.455 11.000  -7.046  1.00 101.91 ? 153 PHE C N     1 
ATOM   4820  C  CA    . PHE C  3 102 ? -20.050 11.023  -6.680  1.00 117.69 ? 153 PHE C CA    1 
ATOM   4821  C  C     . PHE C  3 102 ? -19.396 12.310  -7.114  1.00 116.02 ? 153 PHE C C     1 
ATOM   4822  O  O     . PHE C  3 102 ? -18.726 12.968  -6.307  1.00 118.43 ? 153 PHE C O     1 
ATOM   4823  C  CB    . PHE C  3 102 ? -19.363 9.786   -7.238  1.00 120.06 ? 153 PHE C CB    1 
ATOM   4824  C  CG    . PHE C  3 102 ? -19.795 8.557   -6.520  1.00 123.21 ? 153 PHE C CG    1 
ATOM   4825  C  CD1   . PHE C  3 102 ? -19.203 8.204   -5.324  1.00 116.55 ? 153 PHE C CD1   1 
ATOM   4826  C  CD2   . PHE C  3 102 ? -20.908 7.858   -6.948  1.00 133.29 ? 153 PHE C CD2   1 
ATOM   4827  C  CE1   . PHE C  3 102 ? -19.662 7.142   -4.619  1.00 110.68 ? 153 PHE C CE1   1 
ATOM   4828  C  CE2   . PHE C  3 102 ? -21.369 6.797   -6.246  1.00 112.10 ? 153 PHE C CE2   1 
ATOM   4829  C  CZ    . PHE C  3 102 ? -20.749 6.436   -5.080  1.00 112.43 ? 153 PHE C CZ    1 
ATOM   4830  N  N     . HIS C  3 103 ? -19.714 12.767  -8.324  1.00 127.81 ? 154 HIS C N     1 
ATOM   4831  C  CA    . HIS C  3 103 ? -19.169 14.039  -8.782  1.00 123.44 ? 154 HIS C CA    1 
ATOM   4832  C  C     . HIS C  3 103 ? -19.596 15.136  -7.839  1.00 95.35  ? 154 HIS C C     1 
ATOM   4833  O  O     . HIS C  3 103 ? -18.769 15.925  -7.378  1.00 94.06  ? 154 HIS C O     1 
ATOM   4834  C  CB    . HIS C  3 103 ? -19.692 14.346  -10.180 1.00 114.94 ? 154 HIS C CB    1 
ATOM   4835  C  CG    . HIS C  3 103 ? -18.932 15.399  -10.902 1.00 99.26  ? 154 HIS C CG    1 
ATOM   4836  N  ND1   . HIS C  3 103 ? -19.374 15.945  -12.084 1.00 99.94  ? 154 HIS C ND1   1 
ATOM   4837  C  CD2   . HIS C  3 103 ? -17.724 15.951  -10.654 1.00 98.81  ? 154 HIS C CD2   1 
ATOM   4838  C  CE1   . HIS C  3 103 ? -18.474 16.803  -12.526 1.00 99.85  ? 154 HIS C CE1   1 
ATOM   4839  N  NE2   . HIS C  3 103 ? -17.464 16.828  -11.676 1.00 99.16  ? 154 HIS C NE2   1 
ATOM   4840  N  N     . LEU C  3 104 ? -20.854 15.075  -7.407  1.00 94.39  ? 155 LEU C N     1 
ATOM   4841  C  CA    . LEU C  3 104 ? -21.367 16.059  -6.483  1.00 91.71  ? 155 LEU C CA    1 
ATOM   4842  C  C     . LEU C  3 104 ? -20.459 16.180  -5.279  1.00 90.86  ? 155 LEU C C     1 
ATOM   4843  O  O     . LEU C  3 104 ? -19.929 17.250  -4.994  1.00 89.37  ? 155 LEU C O     1 
ATOM   4844  C  CB    . LEU C  3 104 ? -22.771 15.663  -6.077  1.00 91.64  ? 155 LEU C CB    1 
ATOM   4845  C  CG    . LEU C  3 104 ? -23.471 16.385  -4.951  1.00 89.59  ? 155 LEU C CG    1 
ATOM   4846  C  CD1   . LEU C  3 104 ? -24.936 16.244  -5.194  1.00 90.07  ? 155 LEU C CD1   1 
ATOM   4847  C  CD2   . LEU C  3 104 ? -23.125 15.804  -3.624  1.00 89.61  ? 155 LEU C CD2   1 
ATOM   4848  N  N     . LEU C  3 105 ? -20.154 15.072  -4.633  1.00 92.31  ? 156 LEU C N     1 
ATOM   4849  C  CA    . LEU C  3 105 ? -19.409 15.205  -3.395  1.00 91.76  ? 156 LEU C CA    1 
ATOM   4850  C  C     . LEU C  3 105 ? -18.056 15.829  -3.659  1.00 91.84  ? 156 LEU C C     1 
ATOM   4851  O  O     . LEU C  3 105 ? -17.660 16.772  -2.962  1.00 119.47 ? 156 LEU C O     1 
ATOM   4852  C  CB    . LEU C  3 105 ? -19.296 13.854  -2.722  1.00 93.89  ? 156 LEU C CB    1 
ATOM   4853  C  CG    . LEU C  3 105 ? -20.704 13.547  -2.211  1.00 93.45  ? 156 LEU C CG    1 
ATOM   4854  C  CD1   . LEU C  3 105 ? -20.850 12.103  -1.871  1.00 134.34 ? 156 LEU C CD1   1 
ATOM   4855  C  CD2   . LEU C  3 105 ? -20.971 14.358  -0.966  1.00 91.49  ? 156 LEU C CD2   1 
ATOM   4856  N  N     . SER C  3 106 ? -17.433 15.467  -4.780  1.00 93.63  ? 157 SER C N     1 
ATOM   4857  C  CA    . SER C  3 106 ? -16.108 16.008  -5.048  1.00 103.52 ? 157 SER C CA    1 
ATOM   4858  C  C     . SER C  3 106 ? -16.155 17.522  -5.030  1.00 91.87  ? 157 SER C C     1 
ATOM   4859  O  O     . SER C  3 106 ? -15.380 18.172  -4.312  1.00 91.38  ? 157 SER C O     1 
ATOM   4860  C  CB    . SER C  3 106 ? -15.592 15.520  -6.404  1.00 105.65 ? 157 SER C CB    1 
ATOM   4861  O  OG    . SER C  3 106 ? -15.324 14.130  -6.379  1.00 108.67 ? 157 SER C OG    1 
ATOM   4862  N  N     . ARG C  3 107 ? -17.184 18.086  -5.661  1.00 111.86 ? 158 ARG C N     1 
ATOM   4863  C  CA    . ARG C  3 107 ? -17.249 19.532  -5.778  1.00 88.96  ? 158 ARG C CA    1 
ATOM   4864  C  C     . ARG C  3 107 ? -17.423 20.182  -4.424  1.00 87.25  ? 158 ARG C C     1 
ATOM   4865  O  O     . ARG C  3 107 ? -16.675 21.105  -4.082  1.00 101.65 ? 158 ARG C O     1 
ATOM   4866  C  CB    . ARG C  3 107 ? -18.370 19.946  -6.719  1.00 88.48  ? 158 ARG C CB    1 
ATOM   4867  C  CG    . ARG C  3 107 ? -18.101 19.489  -8.092  1.00 100.46 ? 158 ARG C CG    1 
ATOM   4868  C  CD    . ARG C  3 107 ? -16.769 19.972  -8.440  1.00 96.04  ? 158 ARG C CD    1 
ATOM   4869  N  NE    . ARG C  3 107 ? -16.577 20.026  -9.858  1.00 115.54 ? 158 ARG C NE    1 
ATOM   4870  C  CZ    . ARG C  3 107 ? -15.428 20.389  -10.380 1.00 137.38 ? 158 ARG C CZ    1 
ATOM   4871  N  NH1   . ARG C  3 107 ? -14.436 20.689  -9.564  1.00 140.69 ? 158 ARG C NH1   1 
ATOM   4872  N  NH2   . ARG C  3 107 ? -15.287 20.495  -11.687 1.00 152.30 ? 158 ARG C NH2   1 
ATOM   4873  N  N     . LEU C  3 108 ? -18.335 19.665  -3.600  1.00 86.64  ? 159 LEU C N     1 
ATOM   4874  C  CA    . LEU C  3 108 ? -18.531 20.340  -2.334  1.00 85.36  ? 159 LEU C CA    1 
ATOM   4875  C  C     . LEU C  3 108 ? -17.235 20.382  -1.576  1.00 86.10  ? 159 LEU C C     1 
ATOM   4876  O  O     . LEU C  3 108 ? -16.935 21.372  -0.902  1.00 85.45  ? 159 LEU C O     1 
ATOM   4877  C  CB    . LEU C  3 108 ? -19.562 19.668  -1.461  1.00 85.13  ? 159 LEU C CB    1 
ATOM   4878  C  CG    . LEU C  3 108 ? -21.011 19.742  -1.830  1.00 84.51  ? 159 LEU C CG    1 
ATOM   4879  C  CD1   . LEU C  3 108 ? -21.731 19.023  -0.706  1.00 84.77  ? 159 LEU C CD1   1 
ATOM   4880  C  CD2   . LEU C  3 108 ? -21.414 21.120  -1.927  1.00 83.29  ? 159 LEU C CD2   1 
ATOM   4881  N  N     . ARG C  3 109 ? -16.416 19.342  -1.724  1.00 87.90  ? 160 ARG C N     1 
ATOM   4882  C  CA    . ARG C  3 109 ? -15.185 19.325  -0.956  1.00 102.11 ? 160 ARG C CA    1 
ATOM   4883  C  C     . ARG C  3 109 ? -14.290 20.459  -1.414  1.00 96.74  ? 160 ARG C C     1 
ATOM   4884  O  O     . ARG C  3 109 ? -13.841 21.275  -0.599  1.00 94.95  ? 160 ARG C O     1 
ATOM   4885  C  CB    . ARG C  3 109 ? -14.512 17.952  -1.048  1.00 107.18 ? 160 ARG C CB    1 
ATOM   4886  C  CG    . ARG C  3 109 ? -13.345 17.715  -2.013  1.00 107.62 ? 160 ARG C CG    1 
ATOM   4887  C  CD    . ARG C  3 109 ? -12.824 16.252  -1.885  1.00 105.78 ? 160 ARG C CD    1 
ATOM   4888  N  NE    . ARG C  3 109 ? -13.833 15.286  -2.316  1.00 104.46 ? 160 ARG C NE    1 
ATOM   4889  C  CZ    . ARG C  3 109 ? -14.768 14.768  -1.526  1.00 96.19  ? 160 ARG C CZ    1 
ATOM   4890  N  NH1   . ARG C  3 109 ? -14.826 15.100  -0.240  1.00 95.35  ? 160 ARG C NH1   1 
ATOM   4891  N  NH2   . ARG C  3 109 ? -15.655 13.927  -2.028  1.00 96.80  ? 160 ARG C NH2   1 
ATOM   4892  N  N     . LYS C  3 110 ? -14.145 20.616  -2.732  1.00 98.15  ? 161 LYS C N     1 
ATOM   4893  C  CA    . LYS C  3 110 ? -13.417 21.775  -3.219  1.00 104.80 ? 161 LYS C CA    1 
ATOM   4894  C  C     . LYS C  3 110 ? -14.114 23.059  -2.823  1.00 111.71 ? 161 LYS C C     1 
ATOM   4895  O  O     . LYS C  3 110 ? -13.440 24.027  -2.447  1.00 119.73 ? 161 LYS C O     1 
ATOM   4896  C  CB    . LYS C  3 110 ? -13.225 21.740  -4.727  1.00 90.58  ? 161 LYS C CB    1 
ATOM   4897  C  CG    . LYS C  3 110 ? -11.948 22.454  -5.100  1.00 92.09  ? 161 LYS C CG    1 
ATOM   4898  C  CD    . LYS C  3 110 ? -11.531 22.125  -6.461  1.00 93.92  ? 161 LYS C CD    1 
ATOM   4899  C  CE    . LYS C  3 110 ? -12.718 22.175  -7.359  1.00 92.90  ? 161 LYS C CE    1 
ATOM   4900  N  NZ    . LYS C  3 110 ? -12.516 22.985  -8.555  1.00 93.79  ? 161 LYS C NZ    1 
ATOM   4901  N  N     . ALA C  3 111 ? -15.446 23.092  -2.822  1.00 86.20  ? 162 ALA C N     1 
ATOM   4902  C  CA    . ALA C  3 111 ? -16.049 24.338  -2.397  1.00 84.95  ? 162 ALA C CA    1 
ATOM   4903  C  C     . ALA C  3 111 ? -15.586 24.644  -0.986  1.00 85.07  ? 162 ALA C C     1 
ATOM   4904  O  O     . ALA C  3 111 ? -14.987 25.695  -0.738  1.00 85.48  ? 162 ALA C O     1 
ATOM   4905  C  CB    . ALA C  3 111 ? -17.568 24.287  -2.501  1.00 83.73  ? 162 ALA C CB    1 
ATOM   4906  N  N     . VAL C  3 112 ? -15.642 23.657  -0.100  1.00 85.33  ? 163 VAL C N     1 
ATOM   4907  C  CA    . VAL C  3 112 ? -15.185 23.960  1.243   1.00 85.87  ? 163 VAL C CA    1 
ATOM   4908  C  C     . VAL C  3 112 ? -13.715 24.343  1.215   1.00 127.80 ? 163 VAL C C     1 
ATOM   4909  O  O     . VAL C  3 112 ? -13.315 25.334  1.831   1.00 127.54 ? 163 VAL C O     1 
ATOM   4910  C  CB    . VAL C  3 112 ? -15.465 22.803  2.207   1.00 86.33  ? 163 VAL C CB    1 
ATOM   4911  C  CG1   . VAL C  3 112 ? -14.728 23.030  3.514   1.00 87.60  ? 163 VAL C CG1   1 
ATOM   4912  C  CG2   . VAL C  3 112 ? -16.945 22.697  2.471   1.00 85.03  ? 163 VAL C CG2   1 
ATOM   4913  N  N     . LYS C  3 113 ? -12.912 23.659  0.401   1.00 124.04 ? 164 LYS C N     1 
ATOM   4914  C  CA    . LYS C  3 113 ? -11.486 23.966  0.410   1.00 120.55 ? 164 LYS C CA    1 
ATOM   4915  C  C     . LYS C  3 113 ? -11.253 25.426  0.051   1.00 113.84 ? 164 LYS C C     1 
ATOM   4916  O  O     . LYS C  3 113 ? -10.536 26.136  0.769   1.00 117.64 ? 164 LYS C O     1 
ATOM   4917  C  CB    . LYS C  3 113 ? -10.730 23.040  -0.549  1.00 127.17 ? 164 LYS C CB    1 
ATOM   4918  C  CG    . LYS C  3 113 ? -9.502  22.310  0.039   1.00 131.16 ? 164 LYS C CG    1 
ATOM   4919  C  CD    . LYS C  3 113 ? -8.935  21.296  -0.961  1.00 130.79 ? 164 LYS C CD    1 
ATOM   4920  C  CE    . LYS C  3 113 ? -7.596  20.717  -0.519  1.00 128.52 ? 164 LYS C CE    1 
ATOM   4921  N  NZ    . LYS C  3 113 ? -7.218  19.519  -1.334  1.00 125.35 ? 164 LYS C NZ    1 
ATOM   4922  N  N     . HIS C  3 114 ? -11.974 25.939  -0.949  1.00 107.75 ? 165 HIS C N     1 
ATOM   4923  C  CA    . HIS C  3 114 ? -11.784 27.341  -1.296  1.00 105.89 ? 165 HIS C CA    1 
ATOM   4924  C  C     . HIS C  3 114 ? -12.151 28.238  -0.135  1.00 89.18  ? 165 HIS C C     1 
ATOM   4925  O  O     . HIS C  3 114 ? -11.346 29.073  0.292   1.00 90.67  ? 165 HIS C O     1 
ATOM   4926  C  CB    . HIS C  3 114 ? -12.590 27.694  -2.532  1.00 88.62  ? 165 HIS C CB    1 
ATOM   4927  C  CG    . HIS C  3 114 ? -11.927 27.274  -3.795  1.00 89.89  ? 165 HIS C CG    1 
ATOM   4928  N  ND1   . HIS C  3 114 ? -12.609 27.096  -4.978  1.00 89.49  ? 165 HIS C ND1   1 
ATOM   4929  C  CD2   . HIS C  3 114 ? -10.622 27.044  -4.068  1.00 92.31  ? 165 HIS C CD2   1 
ATOM   4930  C  CE1   . HIS C  3 114 ? -11.753 26.748  -5.921  1.00 91.27  ? 165 HIS C CE1   1 
ATOM   4931  N  NE2   . HIS C  3 114 ? -10.541 26.717  -5.396  1.00 95.75  ? 165 HIS C NE2   1 
ATOM   4932  N  N     . ALA C  3 115 ? -13.302 27.984  0.476   1.00 87.66  ? 166 ALA C N     1 
ATOM   4933  C  CA    . ALA C  3 115 ? -13.696 28.812  1.596   1.00 87.68  ? 166 ALA C CA    1 
ATOM   4934  C  C     . ALA C  3 115 ? -12.653 28.755  2.693   1.00 89.45  ? 166 ALA C C     1 
ATOM   4935  O  O     . ALA C  3 115 ? -12.265 29.796  3.225   1.00 99.24  ? 166 ALA C O     1 
ATOM   4936  C  CB    . ALA C  3 115 ? -15.059 28.394  2.121   1.00 86.19  ? 166 ALA C CB    1 
ATOM   4937  N  N     . GLU C  3 116 ? -12.086 27.577  2.966   1.00 96.05  ? 167 GLU C N     1 
ATOM   4938  C  CA    . GLU C  3 116 ? -11.096 27.545  4.039   1.00 108.49 ? 167 GLU C CA    1 
ATOM   4939  C  C     . GLU C  3 116 ? -9.891  28.388  3.662   1.00 133.57 ? 167 GLU C C     1 
ATOM   4940  O  O     . GLU C  3 116 ? -9.467  29.247  4.445   1.00 144.01 ? 167 GLU C O     1 
ATOM   4941  C  CB    . GLU C  3 116 ? -10.724 26.105  4.405   1.00 104.21 ? 167 GLU C CB    1 
ATOM   4942  C  CG    . GLU C  3 116 ? -11.782 25.513  5.366   1.00 107.13 ? 167 GLU C CG    1 
ATOM   4943  C  CD    . GLU C  3 116 ? -11.651 24.022  5.707   1.00 105.75 ? 167 GLU C CD    1 
ATOM   4944  O  OE1   . GLU C  3 116 ? -12.358 23.583  6.648   1.00 92.82  ? 167 GLU C OE1   1 
ATOM   4945  O  OE2   . GLU C  3 116 ? -10.881 23.293  5.039   1.00 97.14  ? 167 GLU C OE2   1 
ATOM   4946  N  N     . GLU C  3 117 ? -9.428  28.275  2.413   1.00 142.74 ? 168 GLU C N     1 
ATOM   4947  C  CA    . GLU C  3 117 ? -8.351  29.153  1.965   1.00 150.20 ? 168 GLU C CA    1 
ATOM   4948  C  C     . GLU C  3 117 ? -8.814  30.598  1.982   1.00 146.51 ? 168 GLU C C     1 
ATOM   4949  O  O     . GLU C  3 117 ? -8.092  31.492  2.445   1.00 154.31 ? 168 GLU C O     1 
ATOM   4950  C  CB    . GLU C  3 117 ? -7.880  28.761  0.568   1.00 149.53 ? 168 GLU C CB    1 
ATOM   4951  C  CG    . GLU C  3 117 ? -6.667  29.542  0.104   1.00 152.70 ? 168 GLU C CG    1 
ATOM   4952  C  CD    . GLU C  3 117 ? -6.828  30.066  -1.295  1.00 152.56 ? 168 GLU C CD    1 
ATOM   4953  O  OE1   . GLU C  3 117 ? -7.887  29.794  -1.902  1.00 149.49 ? 168 GLU C OE1   1 
ATOM   4954  O  OE2   . GLU C  3 117 ? -5.900  30.749  -1.784  1.00 155.50 ? 168 GLU C OE2   1 
ATOM   4955  N  N     . LEU C  3 118 ? -10.048 30.836  1.537   1.00 141.98 ? 169 LEU C N     1 
ATOM   4956  C  CA    . LEU C  3 118 ? -10.583 32.185  1.606   1.00 125.29 ? 169 LEU C CA    1 
ATOM   4957  C  C     . LEU C  3 118 ? -10.617 32.667  3.049   1.00 111.83 ? 169 LEU C C     1 
ATOM   4958  O  O     . LEU C  3 118 ? -10.157 33.768  3.354   1.00 97.09  ? 169 LEU C O     1 
ATOM   4959  C  CB    . LEU C  3 118 ? -11.974 32.218  0.990   1.00 119.18 ? 169 LEU C CB    1 
ATOM   4960  C  CG    . LEU C  3 118 ? -12.831 33.460  1.135   1.00 91.85  ? 169 LEU C CG    1 
ATOM   4961  C  CD1   . LEU C  3 118 ? -13.635 33.655  -0.153  1.00 90.80  ? 169 LEU C CD1   1 
ATOM   4962  C  CD2   . LEU C  3 118 ? -13.740 33.340  2.342   1.00 91.11  ? 169 LEU C CD2   1 
ATOM   4963  N  N     . GLU C  3 119 ? -11.066 31.817  3.970   1.00 111.30 ? 170 GLU C N     1 
ATOM   4964  C  CA    . GLU C  3 119 ? -11.043 32.215  5.372   1.00 115.41 ? 170 GLU C CA    1 
ATOM   4965  C  C     . GLU C  3 119 ? -9.618  32.544  5.796   1.00 114.96 ? 170 GLU C C     1 
ATOM   4966  O  O     . GLU C  3 119 ? -9.380  33.556  6.464   1.00 112.68 ? 170 GLU C O     1 
ATOM   4967  C  CB    . GLU C  3 119 ? -11.645 31.105  6.240   1.00 119.86 ? 170 GLU C CB    1 
ATOM   4968  C  CG    . GLU C  3 119 ? -11.529 31.305  7.747   1.00 124.87 ? 170 GLU C CG    1 
ATOM   4969  C  CD    . GLU C  3 119 ? -12.132 30.164  8.539   1.00 129.21 ? 170 GLU C CD    1 
ATOM   4970  O  OE1   . GLU C  3 119 ? -12.902 29.385  7.958   1.00 129.05 ? 170 GLU C OE1   1 
ATOM   4971  O  OE2   . GLU C  3 119 ? -11.835 30.044  9.742   1.00 132.58 ? 170 GLU C OE2   1 
ATOM   4972  N  N     . ARG C  3 120 ? -8.648  31.739  5.340   1.00 118.46 ? 171 ARG C N     1 
ATOM   4973  C  CA    . ARG C  3 120 ? -7.243  32.001  5.641   1.00 123.63 ? 171 ARG C CA    1 
ATOM   4974  C  C     . ARG C  3 120 ? -6.846  33.386  5.147   1.00 123.51 ? 171 ARG C C     1 
ATOM   4975  O  O     . ARG C  3 120 ? -6.177  34.146  5.861   1.00 126.05 ? 171 ARG C O     1 
ATOM   4976  C  CB    . ARG C  3 120 ? -6.360  30.908  5.021   1.00 127.42 ? 171 ARG C CB    1 
ATOM   4977  C  CG    . ARG C  3 120 ? -4.886  31.260  4.850   1.00 133.27 ? 171 ARG C CG    1 
ATOM   4978  C  CD    . ARG C  3 120 ? -4.270  30.504  3.676   1.00 134.35 ? 171 ARG C CD    1 
ATOM   4979  N  NE    . ARG C  3 120 ? -3.079  31.182  3.169   1.00 138.55 ? 171 ARG C NE    1 
ATOM   4980  C  CZ    . ARG C  3 120 ? -2.589  31.037  1.940   1.00 139.16 ? 171 ARG C CZ    1 
ATOM   4981  N  NH1   . ARG C  3 120 ? -1.502  31.712  1.586   1.00 143.06 ? 171 ARG C NH1   1 
ATOM   4982  N  NH2   . ARG C  3 120 ? -3.183  30.230  1.062   1.00 136.83 ? 171 ARG C NH2   1 
ATOM   4983  N  N     . LEU C  3 121 ? -7.286  33.753  3.937   1.00 129.08 ? 172 LEU C N     1 
ATOM   4984  C  CA    . LEU C  3 121 ? -6.975  35.093  3.455   1.00 104.51 ? 172 LEU C CA    1 
ATOM   4985  C  C     . LEU C  3 121 ? -7.554  36.139  4.382   1.00 105.41 ? 172 LEU C C     1 
ATOM   4986  O  O     . LEU C  3 121 ? -6.891  37.121  4.702   1.00 108.44 ? 172 LEU C O     1 
ATOM   4987  C  CB    . LEU C  3 121 ? -7.477  35.312  2.034   1.00 102.94 ? 172 LEU C CB    1 
ATOM   4988  C  CG    . LEU C  3 121 ? -6.581  34.556  1.058   1.00 103.45 ? 172 LEU C CG    1 
ATOM   4989  C  CD1   . LEU C  3 121 ? -7.213  34.433  -0.315  1.00 101.65 ? 172 LEU C CD1   1 
ATOM   4990  C  CD2   . LEU C  3 121 ? -5.242  35.218  0.990   1.00 107.09 ? 172 LEU C CD2   1 
ATOM   4991  N  N     . CYS C  3 122 ? -8.766  35.934  4.861   1.00 103.25 ? 173 CYS C N     1 
ATOM   4992  C  CA    . CYS C  3 122 ? -9.319  36.975  5.709   1.00 117.94 ? 173 CYS C CA    1 
ATOM   4993  C  C     . CYS C  3 122 ? -8.725  36.976  7.107   1.00 123.66 ? 173 CYS C C     1 
ATOM   4994  O  O     . CYS C  3 122 ? -9.201  37.735  7.951   1.00 108.57 ? 173 CYS C O     1 
ATOM   4995  C  CB    . CYS C  3 122 ? -10.834 36.888  5.748   1.00 116.69 ? 173 CYS C CB    1 
ATOM   4996  S  SG    . CYS C  3 122 ? -11.496 37.314  4.139   1.00 121.48 ? 173 CYS C SG    1 
ATOM   4997  N  N     . GLU C  3 123 ? -7.769  36.098  7.411   1.00 128.27 ? 174 GLU C N     1 
ATOM   4998  C  CA    . GLU C  3 123 ? -7.050  36.233  8.675   1.00 140.44 ? 174 GLU C CA    1 
ATOM   4999  C  C     . GLU C  3 123 ? -6.062  37.402  8.662   1.00 146.02 ? 174 GLU C C     1 
ATOM   5000  O  O     . GLU C  3 123 ? -5.574  37.786  9.732   1.00 151.53 ? 174 GLU C O     1 
ATOM   5001  C  CB    . GLU C  3 123 ? -6.347  34.917  9.003   1.00 151.98 ? 174 GLU C CB    1 
ATOM   5002  C  CG    . GLU C  3 123 ? -7.322  33.886  9.568   1.00 160.40 ? 174 GLU C CG    1 
ATOM   5003  C  CD    . GLU C  3 123 ? -6.744  32.483  9.664   1.00 166.42 ? 174 GLU C CD    1 
ATOM   5004  O  OE1   . GLU C  3 123 ? -5.517  32.320  9.497   1.00 171.82 ? 174 GLU C OE1   1 
ATOM   5005  O  OE2   . GLU C  3 123 ? -7.533  31.538  9.890   1.00 167.40 ? 174 GLU C OE2   1 
ATOM   5006  N  N     . SER C  3 124 ? -5.755  37.957  7.479   1.00 148.49 ? 175 SER C N     1 
ATOM   5007  C  CA    . SER C  3 124 ? -4.850  39.101  7.328   1.00 150.84 ? 175 SER C CA    1 
ATOM   5008  C  C     . SER C  3 124 ? -5.263  40.310  8.156   1.00 148.81 ? 175 SER C C     1 
ATOM   5009  O  O     . SER C  3 124 ? -6.444  40.646  8.267   1.00 119.75 ? 175 SER C O     1 
ATOM   5010  C  CB    . SER C  3 124 ? -4.768  39.517  5.860   1.00 118.23 ? 175 SER C CB    1 
ATOM   5011  O  OG    . SER C  3 124 ? -4.063  40.737  5.732   1.00 122.12 ? 175 SER C OG    1 
ATOM   5012  N  N     . ASN C  3 125 ? -4.257  41.016  8.667   1.00 147.71 ? 176 ASN C N     1 
ATOM   5013  C  CA    . ASN C  3 125 ? -4.491  42.239  9.419   1.00 153.57 ? 176 ASN C CA    1 
ATOM   5014  C  C     . ASN C  3 125 ? -4.990  43.387  8.550   1.00 154.43 ? 176 ASN C C     1 
ATOM   5015  O  O     . ASN C  3 125 ? -5.297  44.457  9.088   1.00 158.78 ? 176 ASN C O     1 
ATOM   5016  C  CB    . ASN C  3 125 ? -3.205  42.644  10.139  1.00 162.13 ? 176 ASN C CB    1 
ATOM   5017  C  CG    . ASN C  3 125 ? -2.546  41.469  10.844  1.00 164.14 ? 176 ASN C CG    1 
ATOM   5018  O  OD1   . ASN C  3 125 ? -3.161  40.411  11.015  1.00 160.54 ? 176 ASN C OD1   1 
ATOM   5019  N  ND2   . ASN C  3 125 ? -1.290  41.644  11.249  1.00 167.25 ? 176 ASN C ND2   1 
ATOM   5020  N  N     . ARG C  3 126 ? -5.069  43.202  7.235   1.00 146.36 ? 177 ARG C N     1 
ATOM   5021  C  CA    . ARG C  3 126 ? -5.609  44.213  6.336   1.00 140.59 ? 177 ARG C CA    1 
ATOM   5022  C  C     . ARG C  3 126 ? -7.119  44.119  6.130   1.00 123.91 ? 177 ARG C C     1 
ATOM   5023  O  O     . ARG C  3 126 ? -7.659  44.870  5.316   1.00 124.04 ? 177 ARG C O     1 
ATOM   5024  C  CB    . ARG C  3 126 ? -4.872  44.203  4.988   1.00 135.46 ? 177 ARG C CB    1 
ATOM   5025  C  CG    . ARG C  3 126 ? -3.438  44.800  5.048   1.00 143.74 ? 177 ARG C CG    1 
ATOM   5026  C  CD    . ARG C  3 126 ? -3.470  46.361  4.863   1.00 152.65 ? 177 ARG C CD    1 
ATOM   5027  N  NE    . ARG C  3 126 ? -2.164  47.041  4.788   1.00 160.95 ? 177 ARG C NE    1 
ATOM   5028  C  CZ    . ARG C  3 126 ? -1.713  47.733  3.733   1.00 165.49 ? 177 ARG C CZ    1 
ATOM   5029  N  NH1   . ARG C  3 126 ? -2.457  47.858  2.643   1.00 161.76 ? 177 ARG C NH1   1 
ATOM   5030  N  NH2   . ARG C  3 126 ? -0.520  48.324  3.768   1.00 172.64 ? 177 ARG C NH2   1 
ATOM   5031  N  N     . VAL C  3 127 ? -7.809  43.168  6.742   1.00 120.91 ? 178 VAL C N     1 
ATOM   5032  C  CA    . VAL C  3 127 ? -9.238  43.024  6.502   1.00 117.80 ? 178 VAL C CA    1 
ATOM   5033  C  C     . VAL C  3 127 ? -10.011 43.242  7.801   1.00 118.72 ? 178 VAL C C     1 
ATOM   5034  O  O     . VAL C  3 127 ? -9.539  42.880  8.883   1.00 120.05 ? 178 VAL C O     1 
ATOM   5035  C  CB    . VAL C  3 127 ? -9.533  41.662  5.858   1.00 113.38 ? 178 VAL C CB    1 
ATOM   5036  C  CG1   . VAL C  3 127 ? -11.018 41.476  5.650   1.00 123.93 ? 178 VAL C CG1   1 
ATOM   5037  C  CG2   . VAL C  3 127 ? -8.768  41.551  4.552   1.00 113.14 ? 178 VAL C CG2   1 
ATOM   5038  N  N     . ASP C  3 128 ? -11.179 43.875  7.697   1.00 118.54 ? 179 ASP C N     1 
ATOM   5039  C  CA    . ASP C  3 128 ? -11.956 44.295  8.854   1.00 120.24 ? 179 ASP C CA    1 
ATOM   5040  C  C     . ASP C  3 128 ? -12.672 43.131  9.515   1.00 117.25 ? 179 ASP C C     1 
ATOM   5041  O  O     . ASP C  3 128 ? -12.901 42.086  8.913   1.00 126.16 ? 179 ASP C O     1 
ATOM   5042  C  CB    . ASP C  3 128 ? -13.013 45.314  8.459   1.00 132.10 ? 179 ASP C CB    1 
ATOM   5043  C  CG    . ASP C  3 128 ? -14.038 44.722  7.534   1.00 125.09 ? 179 ASP C CG    1 
ATOM   5044  O  OD1   . ASP C  3 128 ? -13.640 43.834  6.773   1.00 114.37 ? 179 ASP C OD1   1 
ATOM   5045  O  OD2   . ASP C  3 128 ? -15.226 45.113  7.574   1.00 120.96 ? 179 ASP C OD2   1 
ATOM   5046  N  N     . ALA C  3 129 ? -13.105 43.365  10.754  1.00 119.34 ? 180 ALA C N     1 
ATOM   5047  C  CA    . ALA C  3 129 ? -13.738 42.315  11.552  1.00 117.32 ? 180 ALA C CA    1 
ATOM   5048  C  C     . ALA C  3 129 ? -15.007 41.779  10.900  1.00 116.18 ? 180 ALA C C     1 
ATOM   5049  O  O     . ALA C  3 129 ? -15.248 40.565  10.901  1.00 114.68 ? 180 ALA C O     1 
ATOM   5050  C  CB    . ALA C  3 129 ? -14.055 42.834  12.954  1.00 120.92 ? 180 ALA C CB    1 
ATOM   5051  N  N     . LYS C  3 130 ? -15.825 42.657  10.323  1.00 118.02 ? 181 LYS C N     1 
ATOM   5052  C  CA    . LYS C  3 130 ? -17.088 42.182  9.778   1.00 115.11 ? 181 LYS C CA    1 
ATOM   5053  C  C     . LYS C  3 130 ? -16.851 41.177  8.661   1.00 111.62 ? 181 LYS C C     1 
ATOM   5054  O  O     . LYS C  3 130 ? -17.508 40.134  8.617   1.00 110.41 ? 181 LYS C O     1 
ATOM   5055  C  CB    . LYS C  3 130 ? -17.938 43.355  9.296   1.00 128.03 ? 181 LYS C CB    1 
ATOM   5056  C  CG    . LYS C  3 130 ? -19.315 42.966  8.748   1.00 125.80 ? 181 LYS C CG    1 
ATOM   5057  C  CD    . LYS C  3 130 ? -20.167 44.199  8.458   1.00 131.39 ? 181 LYS C CD    1 
ATOM   5058  C  CE    . LYS C  3 130 ? -21.467 43.844  7.756   1.00 129.95 ? 181 LYS C CE    1 
ATOM   5059  N  NZ    . LYS C  3 130 ? -21.173 43.263  6.418   1.00 127.11 ? 181 LYS C NZ    1 
ATOM   5060  N  N     . THR C  3 131 ? -15.870 41.424  7.792   1.00 113.80 ? 182 THR C N     1 
ATOM   5061  C  CA    . THR C  3 131 ? -15.618 40.457  6.726   1.00 114.28 ? 182 THR C CA    1 
ATOM   5062  C  C     . THR C  3 131 ? -15.041 39.170  7.287   1.00 114.03 ? 182 THR C C     1 
ATOM   5063  O  O     . THR C  3 131 ? -15.376 38.082  6.813   1.00 117.11 ? 182 THR C O     1 
ATOM   5064  C  CB    . THR C  3 131 ? -14.703 41.035  5.649   1.00 119.52 ? 182 THR C CB    1 
ATOM   5065  O  OG1   . THR C  3 131 ? -15.379 42.098  4.982   1.00 134.86 ? 182 THR C OG1   1 
ATOM   5066  C  CG2   . THR C  3 131 ? -14.362 39.996  4.613   1.00 102.36 ? 182 THR C CG2   1 
ATOM   5067  N  N     . LYS C  3 132 ? -14.206 39.255  8.318   1.00 112.87 ? 183 LYS C N     1 
ATOM   5068  C  CA    . LYS C  3 132 ? -13.752 38.019  8.937   1.00 106.52 ? 183 LYS C CA    1 
ATOM   5069  C  C     . LYS C  3 132 ? -14.931 37.190  9.434   1.00 104.49 ? 183 LYS C C     1 
ATOM   5070  O  O     . LYS C  3 132 ? -14.974 35.978  9.218   1.00 103.86 ? 183 LYS C O     1 
ATOM   5071  C  CB    . LYS C  3 132 ? -12.799 38.296  10.091  1.00 109.54 ? 183 LYS C CB    1 
ATOM   5072  C  CG    . LYS C  3 132 ? -11.455 38.879  9.727   1.00 114.00 ? 183 LYS C CG    1 
ATOM   5073  C  CD    . LYS C  3 132 ? -10.826 39.494  10.975  1.00 115.82 ? 183 LYS C CD    1 
ATOM   5074  C  CE    . LYS C  3 132 ? -9.486  40.146  10.701  1.00 116.71 ? 183 LYS C CE    1 
ATOM   5075  N  NZ    . LYS C  3 132 ? -8.418  39.157  10.401  1.00 116.10 ? 183 LYS C NZ    1 
ATOM   5076  N  N     . LEU C  3 133 ? -15.919 37.817  10.065  1.00 110.56 ? 184 LEU C N     1 
ATOM   5077  C  CA    . LEU C  3 133 ? -17.061 37.013  10.487  1.00 110.22 ? 184 LEU C CA    1 
ATOM   5078  C  C     . LEU C  3 133 ? -17.864 36.489  9.304   1.00 107.41 ? 184 LEU C C     1 
ATOM   5079  O  O     . LEU C  3 133 ? -18.278 35.333  9.315   1.00 108.82 ? 184 LEU C O     1 
ATOM   5080  C  CB    . LEU C  3 133 ? -17.956 37.770  11.456  1.00 113.59 ? 184 LEU C CB    1 
ATOM   5081  C  CG    . LEU C  3 133 ? -17.308 37.892  12.834  1.00 118.09 ? 184 LEU C CG    1 
ATOM   5082  C  CD1   . LEU C  3 133 ? -18.087 38.880  13.674  1.00 128.63 ? 184 LEU C CD1   1 
ATOM   5083  C  CD2   . LEU C  3 133 ? -17.182 36.547  13.541  1.00 113.29 ? 184 LEU C CD2   1 
ATOM   5084  N  N     . GLU C  3 134 ? -18.100 37.297  8.274   1.00 104.51 ? 185 GLU C N     1 
ATOM   5085  C  CA    . GLU C  3 134 ? -18.824 36.766  7.119   1.00 104.20 ? 185 GLU C CA    1 
ATOM   5086  C  C     . GLU C  3 134 ? -18.130 35.544  6.522   1.00 107.06 ? 185 GLU C C     1 
ATOM   5087  O  O     . GLU C  3 134 ? -18.790 34.545  6.218   1.00 104.46 ? 185 GLU C O     1 
ATOM   5088  C  CB    . GLU C  3 134 ? -19.030 37.858  6.060   1.00 105.49 ? 185 GLU C CB    1 
ATOM   5089  C  CG    . GLU C  3 134 ? -20.116 38.864  6.438   1.00 107.58 ? 185 GLU C CG    1 
ATOM   5090  C  CD    . GLU C  3 134 ? -21.285 38.888  5.462   1.00 107.43 ? 185 GLU C CD    1 
ATOM   5091  O  OE1   . GLU C  3 134 ? -21.405 37.972  4.617   1.00 109.59 ? 185 GLU C OE1   1 
ATOM   5092  O  OE2   . GLU C  3 134 ? -22.134 39.793  5.597   1.00 108.42 ? 185 GLU C OE2   1 
ATOM   5093  N  N     . ALA C  3 135 ? -16.800 35.578  6.384   1.00 119.20 ? 186 ALA C N     1 
ATOM   5094  C  CA    . ALA C  3 135 ? -16.098 34.421  5.823   1.00 117.24 ? 186 ALA C CA    1 
ATOM   5095  C  C     . ALA C  3 135 ? -16.116 33.235  6.773   1.00 119.21 ? 186 ALA C C     1 
ATOM   5096  O  O     . ALA C  3 135 ? -16.347 32.102  6.340   1.00 120.64 ? 186 ALA C O     1 
ATOM   5097  C  CB    . ALA C  3 135 ? -14.660 34.765  5.447   1.00 121.52 ? 186 ALA C CB    1 
ATOM   5098  N  N     . GLN C  3 136 ? -15.887 33.459  8.068   1.00 117.10 ? 187 GLN C N     1 
ATOM   5099  C  CA    . GLN C  3 136 ? -15.988 32.330  8.983   1.00 113.88 ? 187 GLN C CA    1 
ATOM   5100  C  C     . GLN C  3 136 ? -17.346 31.677  8.854   1.00 108.32 ? 187 GLN C C     1 
ATOM   5101  O  O     . GLN C  3 136 ? -17.428 30.461  8.692   1.00 107.82 ? 187 GLN C O     1 
ATOM   5102  C  CB    . GLN C  3 136 ? -15.752 32.752  10.431  1.00 121.46 ? 187 GLN C CB    1 
ATOM   5103  C  CG    . GLN C  3 136 ? -14.353 33.242  10.734  1.00 130.77 ? 187 GLN C CG    1 
ATOM   5104  C  CD    . GLN C  3 136 ? -13.862 32.771  12.095  1.00 138.91 ? 187 GLN C CD    1 
ATOM   5105  O  OE1   . GLN C  3 136 ? -14.526 31.972  12.768  1.00 143.67 ? 187 GLN C OE1   1 
ATOM   5106  N  NE2   . GLN C  3 136 ? -12.691 33.258  12.504  1.00 139.38 ? 187 GLN C NE2   1 
ATOM   5107  N  N     . ALA C  3 137 ? -18.408 32.475  8.778   1.00 93.25  ? 188 ALA C N     1 
ATOM   5108  C  CA    . ALA C  3 137 ? -19.736 31.894  8.642   1.00 90.38  ? 188 ALA C CA    1 
ATOM   5109  C  C     . ALA C  3 137 ? -19.914 31.185  7.308   1.00 88.13  ? 188 ALA C C     1 
ATOM   5110  O  O     . ALA C  3 137 ? -20.611 30.166  7.238   1.00 128.44 ? 188 ALA C O     1 
ATOM   5111  C  CB    . ALA C  3 137 ? -20.817 32.946  8.806   1.00 91.38  ? 188 ALA C CB    1 
ATOM   5112  N  N     . TYR C  3 138 ? -19.288 31.673  6.244   1.00 87.78  ? 189 TYR C N     1 
ATOM   5113  C  CA    . TYR C  3 138 ? -19.449 31.000  4.958   1.00 86.05  ? 189 TYR C CA    1 
ATOM   5114  C  C     . TYR C  3 138 ? -18.762 29.647  4.986   1.00 94.43  ? 189 TYR C C     1 
ATOM   5115  O  O     . TYR C  3 138 ? -19.369 28.621  4.661   1.00 101.43 ? 189 TYR C O     1 
ATOM   5116  C  CB    . TYR C  3 138 ? -18.865 31.858  3.842   1.00 86.30  ? 189 TYR C CB    1 
ATOM   5117  C  CG    . TYR C  3 138 ? -19.066 31.381  2.422   1.00 85.06  ? 189 TYR C CG    1 
ATOM   5118  C  CD1   . TYR C  3 138 ? -20.327 31.315  1.865   1.00 84.34  ? 189 TYR C CD1   1 
ATOM   5119  C  CD2   . TYR C  3 138 ? -17.997 31.034  1.630   1.00 85.05  ? 189 TYR C CD2   1 
ATOM   5120  C  CE1   . TYR C  3 138 ? -20.519 30.911  0.550   1.00 85.15  ? 189 TYR C CE1   1 
ATOM   5121  C  CE2   . TYR C  3 138 ? -18.182 30.615  0.319   1.00 86.87  ? 189 TYR C CE2   1 
ATOM   5122  C  CZ    . TYR C  3 138 ? -19.443 30.553  -0.224  1.00 86.49  ? 189 TYR C CZ    1 
ATOM   5123  O  OH    . TYR C  3 138 ? -19.626 30.142  -1.540  1.00 83.33  ? 189 TYR C OH    1 
ATOM   5124  N  N     . THR C  3 139 ? -17.514 29.614  5.450   1.00 92.70  ? 190 THR C N     1 
ATOM   5125  C  CA    . THR C  3 139 ? -16.811 28.343  5.565   1.00 92.95  ? 190 THR C CA    1 
ATOM   5126  C  C     . THR C  3 139 ? -17.561 27.376  6.468   1.00 97.96  ? 190 THR C C     1 
ATOM   5127  O  O     . THR C  3 139 ? -17.779 26.215  6.104   1.00 85.80  ? 190 THR C O     1 
ATOM   5128  C  CB    . THR C  3 139 ? -15.394 28.563  6.068   1.00 93.59  ? 190 THR C CB    1 
ATOM   5129  O  OG1   . THR C  3 139 ? -14.674 29.360  5.125   1.00 100.52 ? 190 THR C OG1   1 
ATOM   5130  C  CG2   . THR C  3 139 ? -14.700 27.237  6.257   1.00 91.49  ? 190 THR C CG2   1 
ATOM   5131  N  N     . ALA C  3 140 ? -18.000 27.840  7.635   1.00 101.99 ? 191 ALA C N     1 
ATOM   5132  C  CA    . ALA C  3 140 ? -18.770 26.952  8.489   1.00 105.10 ? 191 ALA C CA    1 
ATOM   5133  C  C     . ALA C  3 140 ? -19.968 26.399  7.730   1.00 107.12 ? 191 ALA C C     1 
ATOM   5134  O  O     . ALA C  3 140 ? -20.225 25.189  7.758   1.00 112.24 ? 191 ALA C O     1 
ATOM   5135  C  CB    . ALA C  3 140 ? -19.229 27.686  9.751   1.00 109.12 ? 191 ALA C CB    1 
ATOM   5136  N  N     . TYR C  3 141 ? -20.626 27.244  6.937   1.00 98.78  ? 192 TYR C N     1 
ATOM   5137  C  CA    . TYR C  3 141 ? -21.820 26.804  6.225   1.00 90.11  ? 192 TYR C CA    1 
ATOM   5138  C  C     . TYR C  3 141 ? -21.501 25.715  5.208   1.00 83.42  ? 192 TYR C C     1 
ATOM   5139  O  O     . TYR C  3 141 ? -22.225 24.722  5.104   1.00 89.09  ? 192 TYR C O     1 
ATOM   5140  C  CB    . TYR C  3 141 ? -22.486 27.996  5.564   1.00 91.41  ? 192 TYR C CB    1 
ATOM   5141  C  CG    . TYR C  3 141 ? -23.591 27.669  4.595   1.00 90.12  ? 192 TYR C CG    1 
ATOM   5142  C  CD1   . TYR C  3 141 ? -23.350 27.606  3.238   1.00 90.39  ? 192 TYR C CD1   1 
ATOM   5143  C  CD2   . TYR C  3 141 ? -24.878 27.457  5.033   1.00 90.09  ? 192 TYR C CD2   1 
ATOM   5144  C  CE1   . TYR C  3 141 ? -24.356 27.344  2.352   1.00 89.64  ? 192 TYR C CE1   1 
ATOM   5145  C  CE2   . TYR C  3 141 ? -25.887 27.192  4.147   1.00 89.26  ? 192 TYR C CE2   1 
ATOM   5146  C  CZ    . TYR C  3 141 ? -25.622 27.138  2.813   1.00 89.18  ? 192 TYR C CZ    1 
ATOM   5147  O  OH    . TYR C  3 141 ? -26.633 26.868  1.933   1.00 88.49  ? 192 TYR C OH    1 
ATOM   5148  N  N     . LEU C  3 142 ? -20.442 25.876  4.425   1.00 83.08  ? 193 LEU C N     1 
ATOM   5149  C  CA    . LEU C  3 142 ? -20.178 24.832  3.442   1.00 82.69  ? 193 LEU C CA    1 
ATOM   5150  C  C     . LEU C  3 142 ? -19.685 23.548  4.108   1.00 93.60  ? 193 LEU C C     1 
ATOM   5151  O  O     . LEU C  3 142 ? -20.113 22.447  3.738   1.00 83.57  ? 193 LEU C O     1 
ATOM   5152  C  CB    . LEU C  3 142 ? -19.205 25.299  2.375   1.00 82.65  ? 193 LEU C CB    1 
ATOM   5153  C  CG    . LEU C  3 142 ? -19.704 26.314  1.365   1.00 82.12  ? 193 LEU C CG    1 
ATOM   5154  C  CD1   . LEU C  3 142 ? -18.566 26.553  0.421   1.00 82.56  ? 193 LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C  3 142 ? -20.905 25.814  0.647   1.00 81.56  ? 193 LEU C CD2   1 
ATOM   5156  N  N     . SER C  3 143 ? -18.753 23.661  5.056   1.00 95.45  ? 194 SER C N     1 
ATOM   5157  C  CA    . SER C  3 143 ? -18.371 22.497  5.844   1.00 91.97  ? 194 SER C CA    1 
ATOM   5158  C  C     . SER C  3 143 ? -19.656 21.779  6.227   1.00 89.04  ? 194 SER C C     1 
ATOM   5159  O  O     . SER C  3 143 ? -19.778 20.562  6.073   1.00 94.32  ? 194 SER C O     1 
ATOM   5160  C  CB    . SER C  3 143 ? -17.553 22.895  7.084   1.00 91.11  ? 194 SER C CB    1 
ATOM   5161  O  OG    . SER C  3 143 ? -16.155 22.963  6.814   1.00 89.79  ? 194 SER C OG    1 
ATOM   5162  N  N     . GLY C  3 144 ? -20.671 22.549  6.596   1.00 85.22  ? 195 GLY C N     1 
ATOM   5163  C  CA    . GLY C  3 144 ? -21.936 21.949  6.976   1.00 85.42  ? 195 GLY C CA    1 
ATOM   5164  C  C     . GLY C  3 144 ? -22.658 21.230  5.851   1.00 84.75  ? 195 GLY C C     1 
ATOM   5165  O  O     . GLY C  3 144 ? -23.238 20.175  6.067   1.00 85.56  ? 195 GLY C O     1 
ATOM   5166  N  N     . MET C  3 145 ? -22.724 21.822  4.667   1.00 83.63  ? 196 MET C N     1 
ATOM   5167  C  CA    . MET C  3 145 ? -23.440 21.132  3.596   1.00 83.43  ? 196 MET C CA    1 
ATOM   5168  C  C     . MET C  3 145 ? -22.711 19.881  3.120   1.00 84.21  ? 196 MET C C     1 
ATOM   5169  O  O     . MET C  3 145 ? -23.354 18.875  2.790   1.00 84.94  ? 196 MET C O     1 
ATOM   5170  C  CB    . MET C  3 145 ? -23.747 22.070  2.441   1.00 93.06  ? 196 MET C CB    1 
ATOM   5171  C  CG    . MET C  3 145 ? -24.893 23.025  2.757   1.00 92.55  ? 196 MET C CG    1 
ATOM   5172  S  SD    . MET C  3 145 ? -26.467 22.183  3.043   1.00 90.32  ? 196 MET C SD    1 
ATOM   5173  C  CE    . MET C  3 145 ? -27.631 23.530  3.222   1.00 94.82  ? 196 MET C CE    1 
ATOM   5174  N  N     . LEU C  3 146 ? -21.385 19.930  3.026   1.00 92.97  ? 197 LEU C N     1 
ATOM   5175  C  CA    . LEU C  3 146 ? -20.621 18.734  2.686   1.00 88.70  ? 197 LEU C CA    1 
ATOM   5176  C  C     . LEU C  3 146 ? -20.917 17.667  3.719   1.00 92.76  ? 197 LEU C C     1 
ATOM   5177  O  O     . LEU C  3 146 ? -21.635 16.703  3.454   1.00 96.26  ? 197 LEU C O     1 
ATOM   5178  C  CB    . LEU C  3 146 ? -19.118 18.979  2.717   1.00 90.13  ? 197 LEU C CB    1 
ATOM   5179  C  CG    . LEU C  3 146 ? -18.303 17.704  2.574   1.00 91.56  ? 197 LEU C CG    1 
ATOM   5180  C  CD1   . LEU C  3 146 ? -18.517 17.241  1.159   1.00 93.00  ? 197 LEU C CD1   1 
ATOM   5181  C  CD2   . LEU C  3 146 ? -16.822 17.820  2.937   1.00 92.76  ? 197 LEU C CD2   1 
ATOM   5182  N  N     . ARG C  3 147 ? -20.423 17.881  4.931   1.00 103.82 ? 198 ARG C N     1 
ATOM   5183  C  CA    . ARG C  3 147 ? -20.604 16.933  6.017   1.00 111.27 ? 198 ARG C CA    1 
ATOM   5184  C  C     . ARG C  3 147 ? -22.073 16.622  6.295   1.00 111.25 ? 198 ARG C C     1 
ATOM   5185  O  O     . ARG C  3 147 ? -22.379 15.875  7.218   1.00 123.25 ? 198 ARG C O     1 
ATOM   5186  C  CB    . ARG C  3 147 ? -19.849 17.437  7.243   1.00 119.12 ? 198 ARG C CB    1 
ATOM   5187  C  CG    . ARG C  3 147 ? -18.352 17.193  7.029   1.00 126.99 ? 198 ARG C CG    1 
ATOM   5188  C  CD    . ARG C  3 147 ? -17.432 18.074  7.848   1.00 135.67 ? 198 ARG C CD    1 
ATOM   5189  N  NE    . ARG C  3 147 ? -16.186 18.322  7.115   1.00 139.85 ? 198 ARG C NE    1 
ATOM   5190  C  CZ    . ARG C  3 147 ? -15.191 19.103  7.536   1.00 141.12 ? 198 ARG C CZ    1 
ATOM   5191  N  NH1   . ARG C  3 147 ? -15.273 19.723  8.707   1.00 145.06 ? 198 ARG C NH1   1 
ATOM   5192  N  NH2   . ARG C  3 147 ? -14.107 19.262  6.781   1.00 139.28 ? 198 ARG C NH2   1 
ATOM   5193  N  N     . PHE C  3 148 ? -22.997 17.238  5.567   1.00 114.85 ? 199 PHE C N     1 
ATOM   5194  C  CA    . PHE C  3 148 ? -24.392 16.807  5.549   1.00 88.51  ? 199 PHE C CA    1 
ATOM   5195  C  C     . PHE C  3 148 ? -24.667 15.804  4.449   1.00 89.23  ? 199 PHE C C     1 
ATOM   5196  O  O     . PHE C  3 148 ? -25.490 14.912  4.620   1.00 90.70  ? 199 PHE C O     1 
ATOM   5197  C  CB    . PHE C  3 148 ? -25.321 17.980  5.333   1.00 92.34  ? 199 PHE C CB    1 
ATOM   5198  C  CG    . PHE C  3 148 ? -26.757 17.660  5.528   1.00 87.96  ? 199 PHE C CG    1 
ATOM   5199  C  CD1   . PHE C  3 148 ? -27.279 17.573  6.788   1.00 89.14  ? 199 PHE C CD1   1 
ATOM   5200  C  CD2   . PHE C  3 148 ? -27.585 17.469  4.457   1.00 87.92  ? 199 PHE C CD2   1 
ATOM   5201  C  CE1   . PHE C  3 148 ? -28.594 17.327  6.964   1.00 90.21  ? 199 PHE C CE1   1 
ATOM   5202  C  CE2   . PHE C  3 148 ? -28.907 17.212  4.643   1.00 89.03  ? 199 PHE C CE2   1 
ATOM   5203  C  CZ    . PHE C  3 148 ? -29.408 17.134  5.894   1.00 90.17  ? 199 PHE C CZ    1 
ATOM   5204  N  N     . GLU C  3 149 ? -24.106 16.002  3.261   1.00 88.46  ? 200 GLU C N     1 
ATOM   5205  C  CA    . GLU C  3 149 ? -24.345 15.010  2.222   1.00 98.90  ? 200 GLU C CA    1 
ATOM   5206  C  C     . GLU C  3 149 ? -23.657 13.687  2.520   1.00 99.89  ? 200 GLU C C     1 
ATOM   5207  O  O     . GLU C  3 149 ? -24.067 12.666  1.969   1.00 103.78 ? 200 GLU C O     1 
ATOM   5208  C  CB    . GLU C  3 149 ? -23.925 15.528  0.850   1.00 102.45 ? 200 GLU C CB    1 
ATOM   5209  C  CG    . GLU C  3 149 ? -24.949 16.436  0.184   1.00 98.68  ? 200 GLU C CG    1 
ATOM   5210  C  CD    . GLU C  3 149 ? -26.333 15.824  0.086   1.00 95.53  ? 200 GLU C CD    1 
ATOM   5211  O  OE1   . GLU C  3 149 ? -26.462 14.593  0.126   1.00 103.59 ? 200 GLU C OE1   1 
ATOM   5212  O  OE2   . GLU C  3 149 ? -27.307 16.572  -0.056  1.00 88.05  ? 200 GLU C OE2   1 
ATOM   5213  N  N     . HIS C  3 150 ? -22.616 13.674  3.357   1.00 98.65  ? 201 HIS C N     1 
ATOM   5214  C  CA    . HIS C  3 150 ? -22.046 12.420  3.847   1.00 95.06  ? 201 HIS C CA    1 
ATOM   5215  C  C     . HIS C  3 150 ? -22.852 11.833  5.003   1.00 96.51  ? 201 HIS C C     1 
ATOM   5216  O  O     . HIS C  3 150 ? -22.471 10.802  5.548   1.00 99.10  ? 201 HIS C O     1 
ATOM   5217  C  CB    . HIS C  3 150 ? -20.594 12.612  4.310   1.00 95.54  ? 201 HIS C CB    1 
ATOM   5218  C  CG    . HIS C  3 150 ? -19.600 12.790  3.203   1.00 118.40 ? 201 HIS C CG    1 
ATOM   5219  N  ND1   . HIS C  3 150 ? -18.241 12.821  3.434   1.00 117.69 ? 201 HIS C ND1   1 
ATOM   5220  C  CD2   . HIS C  3 150 ? -19.758 12.948  1.868   1.00 117.96 ? 201 HIS C CD2   1 
ATOM   5221  C  CE1   . HIS C  3 150 ? -17.606 12.984  2.290   1.00 118.80 ? 201 HIS C CE1   1 
ATOM   5222  N  NE2   . HIS C  3 150 ? -18.502 13.067  1.324   1.00 118.04 ? 201 HIS C NE2   1 
ATOM   5223  N  N     . GLN C  3 151 ? -23.949 12.472  5.382   1.00 111.68 ? 202 GLN C N     1 
ATOM   5224  C  CA    . GLN C  3 151 ? -24.841 12.073  6.465   1.00 96.67  ? 202 GLN C CA    1 
ATOM   5225  C  C     . GLN C  3 151 ? -24.142 12.022  7.811   1.00 97.88  ? 202 GLN C C     1 
ATOM   5226  O  O     . GLN C  3 151 ? -24.725 11.587  8.790   1.00 99.62  ? 202 GLN C O     1 
ATOM   5227  C  CB    . GLN C  3 151 ? -25.509 10.749  6.104   1.00 99.15  ? 202 GLN C CB    1 
ATOM   5228  C  CG    . GLN C  3 151 ? -26.192 10.895  4.745   1.00 98.18  ? 202 GLN C CG    1 
ATOM   5229  C  CD    . GLN C  3 151 ? -26.860 9.654   4.197   1.00 100.83 ? 202 GLN C CD    1 
ATOM   5230  O  OE1   . GLN C  3 151 ? -26.200 8.817   3.590   1.00 130.45 ? 202 GLN C OE1   1 
ATOM   5231  N  NE2   . GLN C  3 151 ? -28.173 9.541   4.378   1.00 101.61 ? 202 GLN C NE2   1 
ATOM   5232  N  N     . GLU C  3 152 ? -22.978 12.658  7.912   1.00 98.72  ? 203 GLU C N     1 
ATOM   5233  C  CA    . GLU C  3 152 ? -22.184 12.674  9.139   1.00 103.56 ? 203 GLU C CA    1 
ATOM   5234  C  C     . GLU C  3 152 ? -22.729 13.722  10.103  1.00 99.87  ? 203 GLU C C     1 
ATOM   5235  O  O     . GLU C  3 152 ? -22.135 14.773  10.341  1.00 101.33 ? 203 GLU C O     1 
ATOM   5236  C  CB    . GLU C  3 152 ? -20.733 12.962  8.808   1.00 109.83 ? 203 GLU C CB    1 
ATOM   5237  C  CG    . GLU C  3 152 ? -20.069 11.846  8.068   1.00 118.75 ? 203 GLU C CG    1 
ATOM   5238  C  CD    . GLU C  3 152 ? -18.645 12.178  7.706   1.00 129.18 ? 203 GLU C CD    1 
ATOM   5239  O  OE1   . GLU C  3 152 ? -17.765 12.064  8.590   1.00 133.89 ? 203 GLU C OE1   1 
ATOM   5240  O  OE2   . GLU C  3 152 ? -18.410 12.567  6.541   1.00 134.02 ? 203 GLU C OE2   1 
ATOM   5241  N  N     . TRP C  3 153 ? -23.802 13.346  10.789  1.00 98.74  ? 204 TRP C N     1 
ATOM   5242  C  CA    . TRP C  3 153 ? -24.670 14.326  11.427  1.00 97.91  ? 204 TRP C CA    1 
ATOM   5243  C  C     . TRP C  3 153 ? -23.938 15.148  12.476  1.00 98.27  ? 204 TRP C C     1 
ATOM   5244  O  O     . TRP C  3 153 ? -24.171 16.346  12.581  1.00 96.81  ? 204 TRP C O     1 
ATOM   5245  C  CB    . TRP C  3 153 ? -25.844 13.620  12.077  1.00 100.01 ? 204 TRP C CB    1 
ATOM   5246  C  CG    . TRP C  3 153 ? -26.412 12.579  11.203  1.00 107.26 ? 204 TRP C CG    1 
ATOM   5247  C  CD1   . TRP C  3 153 ? -26.414 11.251  11.445  1.00 115.19 ? 204 TRP C CD1   1 
ATOM   5248  C  CD2   . TRP C  3 153 ? -27.050 12.755  9.942   1.00 98.95  ? 204 TRP C CD2   1 
ATOM   5249  N  NE1   . TRP C  3 153 ? -27.011 10.585  10.417  1.00 113.96 ? 204 TRP C NE1   1 
ATOM   5250  C  CE2   . TRP C  3 153 ? -27.414 11.491  9.482   1.00 101.83 ? 204 TRP C CE2   1 
ATOM   5251  C  CE3   . TRP C  3 153 ? -27.359 13.852  9.168   1.00 96.34  ? 204 TRP C CE3   1 
ATOM   5252  C  CZ2   . TRP C  3 153 ? -28.046 11.294  8.278   1.00 100.32 ? 204 TRP C CZ2   1 
ATOM   5253  C  CZ3   . TRP C  3 153 ? -28.010 13.648  7.977   1.00 95.77  ? 204 TRP C CZ3   1 
ATOM   5254  C  CH2   . TRP C  3 153 ? -28.345 12.385  7.545   1.00 97.74  ? 204 TRP C CH2   1 
ATOM   5255  N  N     . LYS C  3 154 ? -23.050 14.543  13.264  1.00 100.58 ? 205 LYS C N     1 
ATOM   5256  C  CA    . LYS C  3 154 ? -22.441 15.310  14.351  1.00 101.49 ? 205 LYS C CA    1 
ATOM   5257  C  C     . LYS C  3 154 ? -21.556 16.424  13.811  1.00 121.72 ? 205 LYS C C     1 
ATOM   5258  O  O     . LYS C  3 154 ? -21.578 17.542  14.335  1.00 120.21 ? 205 LYS C O     1 
ATOM   5259  C  CB    . LYS C  3 154 ? -21.643 14.405  15.289  1.00 104.89 ? 205 LYS C CB    1 
ATOM   5260  C  CG    . LYS C  3 154 ? -21.065 15.099  16.543  1.00 106.64 ? 205 LYS C CG    1 
ATOM   5261  C  CD    . LYS C  3 154 ? -20.115 14.144  17.289  1.00 110.27 ? 205 LYS C CD    1 
ATOM   5262  C  CE    . LYS C  3 154 ? -19.628 14.641  18.653  1.00 112.95 ? 205 LYS C CE    1 
ATOM   5263  N  NZ    . LYS C  3 154 ? -20.613 14.443  19.754  1.00 115.25 ? 205 LYS C NZ    1 
ATOM   5264  N  N     . ALA C  3 155 ? -20.762 16.146  12.772  1.00 119.49 ? 206 ALA C N     1 
ATOM   5265  C  CA    . ALA C  3 155 ? -19.951 17.210  12.175  1.00 122.57 ? 206 ALA C CA    1 
ATOM   5266  C  C     . ALA C  3 155 ? -20.831 18.239  11.492  1.00 117.44 ? 206 ALA C C     1 
ATOM   5267  O  O     . ALA C  3 155 ? -20.531 19.436  11.515  1.00 114.09 ? 206 ALA C O     1 
ATOM   5268  C  CB    . ALA C  3 155 ? -18.946 16.647  11.172  1.00 129.91 ? 206 ALA C CB    1 
ATOM   5269  N  N     . ALA C  3 156 ? -21.929 17.786  10.890  1.00 103.55 ? 207 ALA C N     1 
ATOM   5270  C  CA    . ALA C  3 156 ? -22.857 18.708  10.256  1.00 98.34  ? 207 ALA C CA    1 
ATOM   5271  C  C     . ALA C  3 156 ? -23.462 19.655  11.279  1.00 100.47 ? 207 ALA C C     1 
ATOM   5272  O  O     . ALA C  3 156 ? -23.513 20.866  11.062  1.00 106.02 ? 207 ALA C O     1 
ATOM   5273  C  CB    . ALA C  3 156 ? -23.956 17.937  9.540   1.00 98.69  ? 207 ALA C CB    1 
ATOM   5274  N  N     . ILE C  3 157 ? -23.932 19.125  12.402  1.00 93.66  ? 208 ILE C N     1 
ATOM   5275  C  CA    . ILE C  3 157 ? -24.492 20.008  13.410  1.00 94.63  ? 208 ILE C CA    1 
ATOM   5276  C  C     . ILE C  3 157 ? -23.402 20.881  14.025  1.00 118.85 ? 208 ILE C C     1 
ATOM   5277  O  O     . ILE C  3 157 ? -23.675 22.011  14.432  1.00 122.21 ? 208 ILE C O     1 
ATOM   5278  C  CB    . ILE C  3 157 ? -25.270 19.213  14.469  1.00 97.13  ? 208 ILE C CB    1 
ATOM   5279  C  CG1   . ILE C  3 157 ? -26.465 20.014  14.959  1.00 97.71  ? 208 ILE C CG1   1 
ATOM   5280  C  CG2   . ILE C  3 157 ? -24.405 18.904  15.668  1.00 101.46 ? 208 ILE C CG2   1 
ATOM   5281  C  CD1   . ILE C  3 157 ? -27.283 19.284  15.977  1.00 100.46 ? 208 ILE C CD1   1 
ATOM   5282  N  N     . GLU C  3 158 ? -22.161 20.398  14.124  1.00 112.13 ? 209 GLU C N     1 
ATOM   5283  C  CA    . GLU C  3 158 ? -21.105 21.278  14.622  1.00 114.44 ? 209 GLU C CA    1 
ATOM   5284  C  C     . GLU C  3 158 ? -20.940 22.482  13.706  1.00 107.11 ? 209 GLU C C     1 
ATOM   5285  O  O     . GLU C  3 158 ? -20.970 23.631  14.159  1.00 112.22 ? 209 GLU C O     1 
ATOM   5286  C  CB    . GLU C  3 158 ? -19.780 20.525  14.763  1.00 123.60 ? 209 GLU C CB    1 
ATOM   5287  C  CG    . GLU C  3 158 ? -18.617 21.397  15.270  1.00 132.59 ? 209 GLU C CG    1 
ATOM   5288  C  CD    . GLU C  3 158 ? -17.248 20.873  14.849  1.00 137.44 ? 209 GLU C CD    1 
ATOM   5289  O  OE1   . GLU C  3 158 ? -16.600 21.496  13.977  1.00 138.74 ? 209 GLU C OE1   1 
ATOM   5290  O  OE2   . GLU C  3 158 ? -16.827 19.829  15.383  1.00 140.45 ? 209 GLU C OE2   1 
ATOM   5291  N  N     . ALA C  3 159 ? -20.839 22.244  12.399  1.00 99.98  ? 210 ALA C N     1 
ATOM   5292  C  CA    . ALA C  3 159 ? -20.653 23.367  11.487  1.00 97.66  ? 210 ALA C CA    1 
ATOM   5293  C  C     . ALA C  3 159 ? -21.891 24.248  11.436  1.00 93.57  ? 210 ALA C C     1 
ATOM   5294  O  O     . ALA C  3 159 ? -21.776 25.467  11.373  1.00 96.14  ? 210 ALA C O     1 
ATOM   5295  C  CB    . ALA C  3 159 ? -20.297 22.887  10.085  1.00 98.51  ? 210 ALA C CB    1 
ATOM   5296  N  N     . PHE C  3 160 ? -23.084 23.668  11.450  1.00 90.00  ? 211 PHE C N     1 
ATOM   5297  C  CA    . PHE C  3 160 ? -24.270 24.513  11.431  1.00 89.89  ? 211 PHE C CA    1 
ATOM   5298  C  C     . PHE C  3 160 ? -24.419 25.310  12.717  1.00 96.21  ? 211 PHE C C     1 
ATOM   5299  O  O     . PHE C  3 160 ? -24.910 26.432  12.681  1.00 97.32  ? 211 PHE C O     1 
ATOM   5300  C  CB    . PHE C  3 160 ? -25.536 23.714  11.179  1.00 90.42  ? 211 PHE C CB    1 
ATOM   5301  C  CG    . PHE C  3 160 ? -25.689 23.262  9.771   1.00 95.04  ? 211 PHE C CG    1 
ATOM   5302  C  CD1   . PHE C  3 160 ? -24.728 23.544  8.835   1.00 98.80  ? 211 PHE C CD1   1 
ATOM   5303  C  CD2   . PHE C  3 160 ? -26.820 22.588  9.363   1.00 98.11  ? 211 PHE C CD2   1 
ATOM   5304  C  CE1   . PHE C  3 160 ? -24.878 23.120  7.526   1.00 99.79  ? 211 PHE C CE1   1 
ATOM   5305  C  CE2   . PHE C  3 160 ? -26.961 22.172  8.047   1.00 99.26  ? 211 PHE C CE2   1 
ATOM   5306  C  CZ    . PHE C  3 160 ? -25.989 22.438  7.134   1.00 100.23 ? 211 PHE C CZ    1 
ATOM   5307  N  N     . ASN C  3 161 ? -24.092 24.745  13.873  1.00 93.91  ? 212 ASN C N     1 
ATOM   5308  C  CA    . ASN C  3 161 ? -24.171 25.564  15.082  1.00 96.29  ? 212 ASN C CA    1 
ATOM   5309  C  C     . ASN C  3 161 ? -23.111 26.665  15.089  1.00 99.62  ? 212 ASN C C     1 
ATOM   5310  O  O     . ASN C  3 161 ? -23.372 27.777  15.562  1.00 100.68 ? 212 ASN C O     1 
ATOM   5311  C  CB    . ASN C  3 161 ? -24.090 24.704  16.340  1.00 98.78  ? 212 ASN C CB    1 
ATOM   5312  C  CG    . ASN C  3 161 ? -25.443 24.151  16.749  1.00 99.80  ? 212 ASN C CG    1 
ATOM   5313  O  OD1   . ASN C  3 161 ? -26.486 24.635  16.312  1.00 99.16  ? 212 ASN C OD1   1 
ATOM   5314  N  ND2   . ASN C  3 161 ? -25.431 23.176  17.654  1.00 101.88 ? 212 ASN C ND2   1 
ATOM   5315  N  N     . LYS C  3 162 ? -21.911 26.382  14.577  1.00 99.85  ? 213 LYS C N     1 
ATOM   5316  C  CA    . LYS C  3 162 ? -20.917 27.437  14.404  1.00 99.94  ? 213 LYS C CA    1 
ATOM   5317  C  C     . LYS C  3 162 ? -21.456 28.520  13.484  1.00 102.43 ? 213 LYS C C     1 
ATOM   5318  O  O     . LYS C  3 162 ? -21.406 29.714  13.801  1.00 112.50 ? 213 LYS C O     1 
ATOM   5319  C  CB    . LYS C  3 162 ? -19.634 26.838  13.833  1.00 97.94  ? 213 LYS C CB    1 
ATOM   5320  C  CG    . LYS C  3 162 ? -18.581 27.802  13.333  1.00 97.33  ? 213 LYS C CG    1 
ATOM   5321  C  CD    . LYS C  3 162 ? -17.331 27.002  12.991  1.00 98.01  ? 213 LYS C CD    1 
ATOM   5322  C  CE    . LYS C  3 162 ? -16.116 27.860  12.708  1.00 100.14 ? 213 LYS C CE    1 
ATOM   5323  N  NZ    . LYS C  3 162 ? -14.941 27.025  12.332  1.00 102.07 ? 213 LYS C NZ    1 
ATOM   5324  N  N     . CYS C  3 163 ? -22.030 28.109  12.358  1.00 92.30  ? 214 CYS C N     1 
ATOM   5325  C  CA    . CYS C  3 163 ? -22.611 29.047  11.409  1.00 91.24  ? 214 CYS C CA    1 
ATOM   5326  C  C     . CYS C  3 163 ? -23.729 29.868  12.035  1.00 92.83  ? 214 CYS C C     1 
ATOM   5327  O  O     . CYS C  3 163 ? -23.696 31.099  11.996  1.00 124.08 ? 214 CYS C O     1 
ATOM   5328  C  CB    . CYS C  3 163 ? -23.122 28.286  10.205  1.00 89.60  ? 214 CYS C CB    1 
ATOM   5329  S  SG    . CYS C  3 163 ? -24.047 29.254  9.094   1.00 91.16  ? 214 CYS C SG    1 
ATOM   5330  N  N     . LYS C  3 164 ? -24.721 29.212  12.632  1.00 93.48  ? 215 LYS C N     1 
ATOM   5331  C  CA    . LYS C  3 164 ? -25.804 29.941  13.287  1.00 95.49  ? 215 LYS C CA    1 
ATOM   5332  C  C     . LYS C  3 164 ? -25.284 30.920  14.324  1.00 115.04 ? 215 LYS C C     1 
ATOM   5333  O  O     . LYS C  3 164 ? -25.736 32.065  14.390  1.00 120.52 ? 215 LYS C O     1 
ATOM   5334  C  CB    . LYS C  3 164 ? -26.760 28.981  13.963  1.00 96.37  ? 215 LYS C CB    1 
ATOM   5335  C  CG    . LYS C  3 164 ? -27.735 29.654  14.904  1.00 99.29  ? 215 LYS C CG    1 
ATOM   5336  C  CD    . LYS C  3 164 ? -28.579 28.595  15.560  1.00 103.90 ? 215 LYS C CD    1 
ATOM   5337  C  CE    . LYS C  3 164 ? -29.762 29.165  16.288  1.00 111.91 ? 215 LYS C CE    1 
ATOM   5338  N  NZ    . LYS C  3 164 ? -30.958 29.127  15.404  1.00 110.61 ? 215 LYS C NZ    1 
ATOM   5339  N  N     . THR C  3 165 ? -24.336 30.489  15.154  1.00 111.53 ? 216 THR C N     1 
ATOM   5340  C  CA    . THR C  3 165 ? -23.821 31.400  16.171  1.00 117.11 ? 216 THR C CA    1 
ATOM   5341  C  C     . THR C  3 165 ? -23.155 32.613  15.535  1.00 113.70 ? 216 THR C C     1 
ATOM   5342  O  O     . THR C  3 165 ? -23.367 33.748  15.978  1.00 117.67 ? 216 THR C O     1 
ATOM   5343  C  CB    . THR C  3 165 ? -22.846 30.685  17.099  1.00 124.88 ? 216 THR C CB    1 
ATOM   5344  O  OG1   . THR C  3 165 ? -23.553 29.711  17.871  1.00 131.42 ? 216 THR C OG1   1 
ATOM   5345  C  CG2   . THR C  3 165 ? -22.161 31.684  18.029  1.00 130.01 ? 216 THR C CG2   1 
ATOM   5346  N  N     . ILE C  3 166 ? -22.395 32.411  14.462  1.00 103.99 ? 217 ILE C N     1 
ATOM   5347  C  CA    . ILE C  3 166 ? -21.724 33.554  13.855  1.00 101.40 ? 217 ILE C CA    1 
ATOM   5348  C  C     . ILE C  3 166 ? -22.729 34.497  13.211  1.00 100.80 ? 217 ILE C C     1 
ATOM   5349  O  O     . ILE C  3 166 ? -22.772 35.691  13.530  1.00 102.52 ? 217 ILE C O     1 
ATOM   5350  C  CB    . ILE C  3 166 ? -20.667 33.097  12.844  1.00 99.74  ? 217 ILE C CB    1 
ATOM   5351  C  CG1   . ILE C  3 166 ? -19.471 32.525  13.591  1.00 98.90  ? 217 ILE C CG1   1 
ATOM   5352  C  CG2   . ILE C  3 166 ? -20.266 34.257  11.962  1.00 103.43 ? 217 ILE C CG2   1 
ATOM   5353  C  CD1   . ILE C  3 166 ? -18.382 32.047  12.696  1.00 97.32  ? 217 ILE C CD1   1 
ATOM   5354  N  N     . TYR C  3 167 ? -23.606 33.975  12.359  1.00 102.31 ? 218 TYR C N     1 
ATOM   5355  C  CA    . TYR C  3 167 ? -24.548 34.887  11.731  1.00 99.96  ? 218 TYR C CA    1 
ATOM   5356  C  C     . TYR C  3 167 ? -25.426 35.565  12.767  1.00 101.51 ? 218 TYR C C     1 
ATOM   5357  O  O     . TYR C  3 167 ? -25.803 36.722  12.587  1.00 104.91 ? 218 TYR C O     1 
ATOM   5358  C  CB    . TYR C  3 167 ? -25.414 34.179  10.689  1.00 101.67 ? 218 TYR C CB    1 
ATOM   5359  C  CG    . TYR C  3 167 ? -24.747 33.973  9.346   1.00 101.20 ? 218 TYR C CG    1 
ATOM   5360  C  CD1   . TYR C  3 167 ? -23.979 34.960  8.789   1.00 104.27 ? 218 TYR C CD1   1 
ATOM   5361  C  CD2   . TYR C  3 167 ? -24.936 32.818  8.612   1.00 101.58 ? 218 TYR C CD2   1 
ATOM   5362  C  CE1   . TYR C  3 167 ? -23.377 34.795  7.557   1.00 105.32 ? 218 TYR C CE1   1 
ATOM   5363  C  CE2   . TYR C  3 167 ? -24.332 32.645  7.381   1.00 102.27 ? 218 TYR C CE2   1 
ATOM   5364  C  CZ    . TYR C  3 167 ? -23.555 33.639  6.863   1.00 105.02 ? 218 TYR C CZ    1 
ATOM   5365  O  OH    . TYR C  3 167 ? -22.947 33.488  5.648   1.00 108.00 ? 218 TYR C OH    1 
ATOM   5366  N  N     . GLU C  3 168 ? -25.724 34.902  13.876  1.00 102.59 ? 219 GLU C N     1 
ATOM   5367  C  CA    . GLU C  3 168 ? -26.457 35.603  14.921  1.00 106.17 ? 219 GLU C CA    1 
ATOM   5368  C  C     . GLU C  3 168 ? -25.621 36.722  15.527  1.00 119.56 ? 219 GLU C C     1 
ATOM   5369  O  O     . GLU C  3 168 ? -26.146 37.812  15.793  1.00 128.30 ? 219 GLU C O     1 
ATOM   5370  C  CB    . GLU C  3 168 ? -26.974 34.625  15.972  1.00 112.85 ? 219 GLU C CB    1 
ATOM   5371  C  CG    . GLU C  3 168 ? -28.288 33.979  15.499  1.00 111.37 ? 219 GLU C CG    1 
ATOM   5372  C  CD    . GLU C  3 168 ? -28.929 33.051  16.505  1.00 113.48 ? 219 GLU C CD    1 
ATOM   5373  O  OE1   . GLU C  3 168 ? -28.244 32.653  17.464  1.00 115.42 ? 219 GLU C OE1   1 
ATOM   5374  O  OE2   . GLU C  3 168 ? -30.117 32.705  16.319  1.00 114.79 ? 219 GLU C OE2   1 
ATOM   5375  N  N     . LYS C  3 169 ? -24.320 36.492  15.729  1.00 113.80 ? 220 LYS C N     1 
ATOM   5376  C  CA    . LYS C  3 169 ? -23.464 37.585  16.193  1.00 116.77 ? 220 LYS C CA    1 
ATOM   5377  C  C     . LYS C  3 169 ? -23.526 38.776  15.245  1.00 117.19 ? 220 LYS C C     1 
ATOM   5378  O  O     . LYS C  3 169 ? -23.686 39.922  15.685  1.00 118.52 ? 220 LYS C O     1 
ATOM   5379  C  CB    . LYS C  3 169 ? -22.017 37.119  16.364  1.00 119.16 ? 220 LYS C CB    1 
ATOM   5380  C  CG    . LYS C  3 169 ? -21.641 36.801  17.800  1.00 124.89 ? 220 LYS C CG    1 
ATOM   5381  C  CD    . LYS C  3 169 ? -20.163 36.468  17.921  1.00 124.02 ? 220 LYS C CD    1 
ATOM   5382  C  CE    . LYS C  3 169 ? -19.862 35.827  19.266  1.00 127.90 ? 220 LYS C CE    1 
ATOM   5383  N  NZ    . LYS C  3 169 ? -18.414 35.547  19.431  1.00 129.90 ? 220 LYS C NZ    1 
ATOM   5384  N  N     . LEU C  3 170 ? -23.452 38.533  13.938  1.00 112.34 ? 221 LEU C N     1 
ATOM   5385  C  CA    . LEU C  3 170 ? -23.529 39.673  13.036  1.00 113.83 ? 221 LEU C CA    1 
ATOM   5386  C  C     . LEU C  3 170 ? -24.894 40.338  13.099  1.00 123.01 ? 221 LEU C C     1 
ATOM   5387  O  O     . LEU C  3 170 ? -24.979 41.557  13.233  1.00 128.07 ? 221 LEU C O     1 
ATOM   5388  C  CB    . LEU C  3 170 ? -23.232 39.269  11.605  1.00 110.69 ? 221 LEU C CB    1 
ATOM   5389  C  CG    . LEU C  3 170 ? -21.842 38.816  11.222  1.00 107.68 ? 221 LEU C CG    1 
ATOM   5390  C  CD1   . LEU C  3 170 ? -21.818 38.582  9.717   1.00 101.65 ? 221 LEU C CD1   1 
ATOM   5391  C  CD2   . LEU C  3 170 ? -20.874 39.854  11.649  1.00 111.92 ? 221 LEU C CD2   1 
ATOM   5392  N  N     . ALA C  3 171 ? -25.968 39.554  13.079  1.00 134.93 ? 222 ALA C N     1 
ATOM   5393  C  CA    . ALA C  3 171 ? -27.318 40.116  13.110  1.00 139.43 ? 222 ALA C CA    1 
ATOM   5394  C  C     . ALA C  3 171 ? -27.581 40.953  14.356  1.00 144.63 ? 222 ALA C C     1 
ATOM   5395  O  O     . ALA C  3 171 ? -28.371 41.899  14.300  1.00 148.89 ? 222 ALA C O     1 
ATOM   5396  C  CB    . ALA C  3 171 ? -28.366 39.006  12.995  1.00 144.07 ? 222 ALA C CB    1 
ATOM   5397  N  N     . SER C  3 172 ? -26.975 40.625  15.492  1.00 140.01 ? 223 SER C N     1 
ATOM   5398  C  CA    . SER C  3 172 ? -27.329 41.409  16.669  1.00 137.00 ? 223 SER C CA    1 
ATOM   5399  C  C     . SER C  3 172 ? -26.639 42.763  16.718  1.00 133.69 ? 223 SER C C     1 
ATOM   5400  O  O     . SER C  3 172 ? -26.943 43.563  17.610  1.00 134.26 ? 223 SER C O     1 
ATOM   5401  C  CB    . SER C  3 172 ? -27.019 40.631  17.947  1.00 134.88 ? 223 SER C CB    1 
ATOM   5402  O  OG    . SER C  3 172 ? -28.061 39.709  18.222  1.00 134.22 ? 223 SER C OG    1 
ATOM   5403  N  N     . ALA C  3 173 ? -25.752 43.052  15.773  1.00 129.49 ? 224 ALA C N     1 
ATOM   5404  C  CA    . ALA C  3 173 ? -24.951 44.266  15.842  1.00 131.17 ? 224 ALA C CA    1 
ATOM   5405  C  C     . ALA C  3 173 ? -25.489 45.421  15.005  1.00 134.18 ? 224 ALA C C     1 
ATOM   5406  O  O     . ALA C  3 173 ? -25.169 46.574  15.299  1.00 139.46 ? 224 ALA C O     1 
ATOM   5407  C  CB    . ALA C  3 173 ? -23.512 43.975  15.412  1.00 128.39 ? 224 ALA C CB    1 
ATOM   5408  N  N     . PHE C  3 174 ? -26.258 45.179  13.947  1.00 127.43 ? 225 PHE C N     1 
ATOM   5409  C  CA    . PHE C  3 174 ? -26.620 46.308  13.115  1.00 129.71 ? 225 PHE C CA    1 
ATOM   5410  C  C     . PHE C  3 174 ? -28.126 46.541  13.125  1.00 131.78 ? 225 PHE C C     1 
ATOM   5411  O  O     . PHE C  3 174 ? -28.820 46.134  14.073  1.00 132.96 ? 225 PHE C O     1 
ATOM   5412  C  CB    . PHE C  3 174 ? -26.071 46.086  11.716  1.00 126.03 ? 225 PHE C CB    1 
ATOM   5413  C  CG    . PHE C  3 174 ? -24.661 45.647  11.710  1.00 134.13 ? 225 PHE C CG    1 
ATOM   5414  C  CD1   . PHE C  3 174 ? -24.263 44.591  10.929  1.00 125.28 ? 225 PHE C CD1   1 
ATOM   5415  C  CD2   . PHE C  3 174 ? -23.707 46.361  12.415  1.00 136.74 ? 225 PHE C CD2   1 
ATOM   5416  C  CE1   . PHE C  3 174 ? -22.932 44.192  10.907  1.00 121.92 ? 225 PHE C CE1   1 
ATOM   5417  C  CE2   . PHE C  3 174 ? -22.387 45.967  12.417  1.00 133.77 ? 225 PHE C CE2   1 
ATOM   5418  C  CZ    . PHE C  3 174 ? -21.987 44.884  11.657  1.00 126.82 ? 225 PHE C CZ    1 
ATOM   5419  N  N     . THR C  3 175 ? -28.621 47.154  12.063  1.00 132.42 ? 226 THR C N     1 
ATOM   5420  C  CA    . THR C  3 175 ? -30.014 47.518  11.980  1.00 141.85 ? 226 THR C CA    1 
ATOM   5421  C  C     . THR C  3 175 ? -30.836 46.273  11.778  1.00 142.86 ? 226 THR C C     1 
ATOM   5422  O  O     . THR C  3 175 ? -30.399 45.328  11.126  1.00 126.76 ? 226 THR C O     1 
ATOM   5423  C  CB    . THR C  3 175 ? -30.228 48.471  10.809  1.00 145.07 ? 226 THR C CB    1 
ATOM   5424  O  OG1   . THR C  3 175 ? -29.599 47.928  9.642   1.00 132.33 ? 226 THR C OG1   1 
ATOM   5425  C  CG2   . THR C  3 175 ? -29.617 49.830  11.099  1.00 153.73 ? 226 THR C CG2   1 
ATOM   5426  N  N     . GLU C  3 176 ? -32.047 46.278  12.319  1.00 158.56 ? 227 GLU C N     1 
ATOM   5427  C  CA    . GLU C  3 176 ? -32.972 45.208  11.977  1.00 156.24 ? 227 GLU C CA    1 
ATOM   5428  C  C     . GLU C  3 176 ? -33.236 45.143  10.475  1.00 153.49 ? 227 GLU C C     1 
ATOM   5429  O  O     . GLU C  3 176 ? -33.405 44.049  9.925   1.00 150.66 ? 227 GLU C O     1 
ATOM   5430  C  CB    . GLU C  3 176 ? -34.251 45.358  12.793  1.00 161.84 ? 227 GLU C CB    1 
ATOM   5431  C  CG    . GLU C  3 176 ? -34.226 44.435  14.001  1.00 166.98 ? 227 GLU C CG    1 
ATOM   5432  C  CD    . GLU C  3 176 ? -35.499 44.487  14.814  1.00 177.42 ? 227 GLU C CD    1 
ATOM   5433  O  OE1   . GLU C  3 176 ? -35.943 45.606  15.165  1.00 178.28 ? 227 GLU C OE1   1 
ATOM   5434  O  OE2   . GLU C  3 176 ? -36.072 43.406  15.071  1.00 183.76 ? 227 GLU C OE2   1 
ATOM   5435  N  N     . GLU C  3 177 ? -33.202 46.285  9.786   1.00 158.69 ? 228 GLU C N     1 
ATOM   5436  C  CA    . GLU C  3 177 ? -33.375 46.290  8.334   1.00 160.78 ? 228 GLU C CA    1 
ATOM   5437  C  C     . GLU C  3 177 ? -32.299 45.458  7.634   1.00 151.14 ? 228 GLU C C     1 
ATOM   5438  O  O     . GLU C  3 177 ? -32.605 44.660  6.742   1.00 148.49 ? 228 GLU C O     1 
ATOM   5439  C  CB    . GLU C  3 177 ? -33.367 47.731  7.814   1.00 174.78 ? 228 GLU C CB    1 
ATOM   5440  C  CG    . GLU C  3 177 ? -33.571 47.866  6.309   1.00 174.81 ? 228 GLU C CG    1 
ATOM   5441  C  CD    . GLU C  3 177 ? -33.299 49.277  5.805   1.00 173.07 ? 228 GLU C CD    1 
ATOM   5442  O  OE1   . GLU C  3 177 ? -32.755 50.085  6.583   1.00 175.90 ? 228 GLU C OE1   1 
ATOM   5443  O  OE2   . GLU C  3 177 ? -33.626 49.576  4.636   1.00 171.47 ? 228 GLU C OE2   1 
ATOM   5444  N  N     . GLN C  3 178 ? -31.026 45.649  8.004   1.00 155.81 ? 229 GLN C N     1 
ATOM   5445  C  CA    . GLN C  3 178 ? -29.968 44.796  7.459   1.00 151.23 ? 229 GLN C CA    1 
ATOM   5446  C  C     . GLN C  3 178 ? -29.961 43.433  8.134   1.00 153.03 ? 229 GLN C C     1 
ATOM   5447  O  O     . GLN C  3 178 ? -29.508 42.450  7.538   1.00 155.04 ? 229 GLN C O     1 
ATOM   5448  C  CB    . GLN C  3 178 ? -28.589 45.457  7.601   1.00 150.10 ? 229 GLN C CB    1 
ATOM   5449  C  CG    . GLN C  3 178 ? -27.406 44.656  6.995   1.00 140.67 ? 229 GLN C CG    1 
ATOM   5450  C  CD    . GLN C  3 178 ? -27.032 45.067  5.562   1.00 136.16 ? 229 GLN C CD    1 
ATOM   5451  O  OE1   . GLN C  3 178 ? -27.338 44.356  4.603   1.00 128.84 ? 229 GLN C OE1   1 
ATOM   5452  N  NE2   . GLN C  3 178 ? -26.347 46.207  5.420   1.00 140.34 ? 229 GLN C NE2   1 
ATOM   5453  N  N     . ALA C  3 179 ? -30.456 43.353  9.374   1.00 155.65 ? 230 ALA C N     1 
ATOM   5454  C  CA    . ALA C  3 179 ? -30.505 42.073  10.079  1.00 147.30 ? 230 ALA C CA    1 
ATOM   5455  C  C     . ALA C  3 179 ? -31.406 41.085  9.368   1.00 130.94 ? 230 ALA C C     1 
ATOM   5456  O  O     . ALA C  3 179 ? -31.268 39.881  9.569   1.00 123.91 ? 230 ALA C O     1 
ATOM   5457  C  CB    . ALA C  3 179 ? -30.992 42.252  11.518  1.00 155.75 ? 230 ALA C CB    1 
ATOM   5458  N  N     . VAL C  3 180 ? -32.368 41.578  8.587   1.00 128.18 ? 231 VAL C N     1 
ATOM   5459  C  CA    . VAL C  3 180 ? -33.329 40.689  7.947   1.00 125.17 ? 231 VAL C CA    1 
ATOM   5460  C  C     . VAL C  3 180 ? -32.625 39.616  7.146   1.00 128.68 ? 231 VAL C C     1 
ATOM   5461  O  O     . VAL C  3 180 ? -32.978 38.433  7.222   1.00 136.33 ? 231 VAL C O     1 
ATOM   5462  C  CB    . VAL C  3 180 ? -34.282 41.486  7.049   1.00 126.70 ? 231 VAL C CB    1 
ATOM   5463  C  CG1   . VAL C  3 180 ? -35.171 40.540  6.265   1.00 120.27 ? 231 VAL C CG1   1 
ATOM   5464  C  CG2   . VAL C  3 180 ? -35.129 42.412  7.894   1.00 138.83 ? 231 VAL C CG2   1 
ATOM   5465  N  N     . LEU C  3 181 ? -31.603 39.993  6.385   1.00 126.79 ? 232 LEU C N     1 
ATOM   5466  C  CA    . LEU C  3 181 ? -30.924 38.985  5.581   1.00 123.52 ? 232 LEU C CA    1 
ATOM   5467  C  C     . LEU C  3 181 ? -30.297 37.905  6.449   1.00 106.41 ? 232 LEU C C     1 
ATOM   5468  O  O     . LEU C  3 181 ? -30.491 36.709  6.205   1.00 104.00 ? 232 LEU C O     1 
ATOM   5469  C  CB    . LEU C  3 181 ? -29.883 39.640  4.698   1.00 123.29 ? 232 LEU C CB    1 
ATOM   5470  C  CG    . LEU C  3 181 ? -29.246 38.573  3.844   1.00 123.80 ? 232 LEU C CG    1 
ATOM   5471  C  CD1   . LEU C  3 181 ? -30.238 38.181  2.771   1.00 123.74 ? 232 LEU C CD1   1 
ATOM   5472  C  CD2   . LEU C  3 181 ? -28.032 39.202  3.239   1.00 128.78 ? 232 LEU C CD2   1 
ATOM   5473  N  N     . TYR C  3 182 ? -29.608 38.305  7.510   1.00 107.09 ? 233 TYR C N     1 
ATOM   5474  C  CA    . TYR C  3 182 ? -28.951 37.326  8.362   1.00 104.64 ? 233 TYR C CA    1 
ATOM   5475  C  C     . TYR C  3 182 ? -29.966 36.429  9.074   1.00 104.42 ? 233 TYR C C     1 
ATOM   5476  O  O     . TYR C  3 182 ? -29.806 35.199  9.122   1.00 141.68 ? 233 TYR C O     1 
ATOM   5477  C  CB    . TYR C  3 182 ? -28.060 38.051  9.365   1.00 108.88 ? 233 TYR C CB    1 
ATOM   5478  C  CG    . TYR C  3 182 ? -26.879 38.771  8.733   1.00 107.86 ? 233 TYR C CG    1 
ATOM   5479  C  CD1   . TYR C  3 182 ? -26.720 38.819  7.358   1.00 109.58 ? 233 TYR C CD1   1 
ATOM   5480  C  CD2   . TYR C  3 182 ? -25.874 39.322  9.511   1.00 108.87 ? 233 TYR C CD2   1 
ATOM   5481  C  CE1   . TYR C  3 182 ? -25.621 39.446  6.780   1.00 107.73 ? 233 TYR C CE1   1 
ATOM   5482  C  CE2   . TYR C  3 182 ? -24.778 39.936  8.934   1.00 108.68 ? 233 TYR C CE2   1 
ATOM   5483  C  CZ    . TYR C  3 182 ? -24.650 39.986  7.578   1.00 107.90 ? 233 TYR C CZ    1 
ATOM   5484  O  OH    . TYR C  3 182 ? -23.552 40.588  7.019   1.00 109.08 ? 233 TYR C OH    1 
ATOM   5485  N  N     . ASN C  3 183 ? -31.048 37.008  9.587   1.00 107.46 ? 234 ASN C N     1 
ATOM   5486  C  CA    . ASN C  3 183 ? -32.090 36.179  10.177  1.00 108.81 ? 234 ASN C CA    1 
ATOM   5487  C  C     . ASN C  3 183 ? -32.644 35.220  9.138   1.00 107.06 ? 234 ASN C C     1 
ATOM   5488  O  O     . ASN C  3 183 ? -32.999 34.086  9.471   1.00 106.35 ? 234 ASN C O     1 
ATOM   5489  C  CB    . ASN C  3 183 ? -33.228 37.036  10.746  1.00 119.84 ? 234 ASN C CB    1 
ATOM   5490  C  CG    . ASN C  3 183 ? -32.873 37.726  12.069  1.00 124.47 ? 234 ASN C CG    1 
ATOM   5491  O  OD1   . ASN C  3 183 ? -31.971 37.302  12.790  1.00 121.37 ? 234 ASN C OD1   1 
ATOM   5492  N  ND2   . ASN C  3 183 ? -33.600 38.795  12.387  1.00 118.89 ? 234 ASN C ND2   1 
ATOM   5493  N  N     . GLN C  3 184 ? -32.704 35.650  7.870   1.00 108.35 ? 235 GLN C N     1 
ATOM   5494  C  CA    . GLN C  3 184 ? -33.158 34.756  6.810   1.00 109.69 ? 235 GLN C CA    1 
ATOM   5495  C  C     . GLN C  3 184 ? -32.194 33.611  6.566   1.00 107.05 ? 235 GLN C C     1 
ATOM   5496  O  O     . GLN C  3 184 ? -32.637 32.534  6.174   1.00 111.33 ? 235 GLN C O     1 
ATOM   5497  C  CB    . GLN C  3 184 ? -33.366 35.487  5.480   1.00 118.13 ? 235 GLN C CB    1 
ATOM   5498  C  CG    . GLN C  3 184 ? -34.650 36.272  5.333   1.00 127.06 ? 235 GLN C CG    1 
ATOM   5499  C  CD    . GLN C  3 184 ? -34.779 36.918  3.960   1.00 131.38 ? 235 GLN C CD    1 
ATOM   5500  O  OE1   . GLN C  3 184 ? -33.836 36.921  3.161   1.00 129.72 ? 235 GLN C OE1   1 
ATOM   5501  N  NE2   . GLN C  3 184 ? -35.965 37.440  3.670   1.00 138.18 ? 235 GLN C NE2   1 
ATOM   5502  N  N     . ARG C  3 185 ? -30.887 33.797  6.771   1.00 105.84 ? 236 ARG C N     1 
ATOM   5503  C  CA    . ARG C  3 185 ? -30.003 32.649  6.567   1.00 97.11  ? 236 ARG C CA    1 
ATOM   5504  C  C     . ARG C  3 185 ? -30.183 31.644  7.687   1.00 96.72  ? 236 ARG C C     1 
ATOM   5505  O  O     . ARG C  3 185 ? -30.344 30.442  7.430   1.00 113.33 ? 236 ARG C O     1 
ATOM   5506  C  CB    . ARG C  3 185 ? -28.539 33.072  6.504   1.00 95.82  ? 236 ARG C CB    1 
ATOM   5507  C  CG    . ARG C  3 185 ? -27.570 31.992  6.102   1.00 93.42  ? 236 ARG C CG    1 
ATOM   5508  C  CD    . ARG C  3 185 ? -27.920 31.541  4.710   1.00 93.34  ? 236 ARG C CD    1 
ATOM   5509  N  NE    . ARG C  3 185 ? -26.754 31.154  3.922   1.00 91.99  ? 236 ARG C NE    1 
ATOM   5510  C  CZ    . ARG C  3 185 ? -26.810 30.819  2.635   1.00 92.31  ? 236 ARG C CZ    1 
ATOM   5511  N  NH1   . ARG C  3 185 ? -27.969 30.810  1.997   1.00 93.82  ? 236 ARG C NH1   1 
ATOM   5512  N  NH2   . ARG C  3 185 ? -25.714 30.485  1.981   1.00 91.53  ? 236 ARG C NH2   1 
ATOM   5513  N  N     . VAL C  3 186 ? -30.306 32.118  8.927   1.00 98.08  ? 237 VAL C N     1 
ATOM   5514  C  CA    . VAL C  3 186 ? -30.458 31.132  9.990   1.00 101.33 ? 237 VAL C CA    1 
ATOM   5515  C  C     . VAL C  3 186 ? -31.781 30.400  9.853   1.00 99.60  ? 237 VAL C C     1 
ATOM   5516  O  O     . VAL C  3 186 ? -31.823 29.170  9.907   1.00 105.07 ? 237 VAL C O     1 
ATOM   5517  C  CB    . VAL C  3 186 ? -30.296 31.774  11.371  1.00 108.26 ? 237 VAL C CB    1 
ATOM   5518  C  CG1   . VAL C  3 186 ? -30.785 30.815  12.442  1.00 114.97 ? 237 VAL C CG1   1 
ATOM   5519  C  CG2   . VAL C  3 186 ? -28.826 32.093  11.608  1.00 106.21 ? 237 VAL C CG2   1 
ATOM   5520  N  N     . GLU C  3 187 ? -32.866 31.120  9.592   1.00 101.76 ? 238 GLU C N     1 
ATOM   5521  C  CA    . GLU C  3 187 ? -34.112 30.421  9.303   1.00 117.44 ? 238 GLU C CA    1 
ATOM   5522  C  C     . GLU C  3 187 ? -33.950 29.506  8.104   1.00 101.82 ? 238 GLU C C     1 
ATOM   5523  O  O     . GLU C  3 187 ? -34.641 28.488  7.994   1.00 102.92 ? 238 GLU C O     1 
ATOM   5524  C  CB    . GLU C  3 187 ? -35.250 31.405  9.053   1.00 125.40 ? 238 GLU C CB    1 
ATOM   5525  C  CG    . GLU C  3 187 ? -36.589 30.741  8.741   1.00 134.06 ? 238 GLU C CG    1 
ATOM   5526  C  CD    . GLU C  3 187 ? -37.315 30.266  9.985   1.00 147.74 ? 238 GLU C CD    1 
ATOM   5527  O  OE1   . GLU C  3 187 ? -36.660 30.054  11.025  1.00 154.71 ? 238 GLU C OE1   1 
ATOM   5528  O  OE2   . GLU C  3 187 ? -38.551 30.116  9.927   1.00 152.73 ? 238 GLU C OE2   1 
ATOM   5529  N  N     . GLU C  3 188 ? -33.094 29.890  7.164   1.00 103.63 ? 239 GLU C N     1 
ATOM   5530  C  CA    . GLU C  3 188 ? -32.966 29.135  5.928   1.00 105.87 ? 239 GLU C CA    1 
ATOM   5531  C  C     . GLU C  3 188 ? -32.349 27.758  6.182   1.00 101.21 ? 239 GLU C C     1 
ATOM   5532  O  O     . GLU C  3 188 ? -32.765 26.777  5.560   1.00 105.67 ? 239 GLU C O     1 
ATOM   5533  C  CB    . GLU C  3 188 ? -32.187 29.984  4.913   1.00 110.68 ? 239 GLU C CB    1 
ATOM   5534  C  CG    . GLU C  3 188 ? -32.036 29.476  3.476   1.00 114.36 ? 239 GLU C CG    1 
ATOM   5535  C  CD    . GLU C  3 188 ? -31.135 30.401  2.622   1.00 119.14 ? 239 GLU C CD    1 
ATOM   5536  O  OE1   . GLU C  3 188 ? -31.004 31.593  2.972   1.00 123.59 ? 239 GLU C OE1   1 
ATOM   5537  O  OE2   . GLU C  3 188 ? -30.572 29.956  1.595   1.00 119.34 ? 239 GLU C OE2   1 
ATOM   5538  N  N     . ILE C  3 189 ? -31.379 27.642  7.102   1.00 98.70  ? 240 ILE C N     1 
ATOM   5539  C  CA    . ILE C  3 189 ? -30.784 26.327  7.403   1.00 95.74  ? 240 ILE C CA    1 
ATOM   5540  C  C     . ILE C  3 189 ? -31.325 25.674  8.668   1.00 97.39  ? 240 ILE C C     1 
ATOM   5541  O  O     . ILE C  3 189 ? -30.814 24.626  9.061   1.00 97.22  ? 240 ILE C O     1 
ATOM   5542  C  CB    . ILE C  3 189 ? -29.254 26.346  7.521   1.00 93.37  ? 240 ILE C CB    1 
ATOM   5543  C  CG1   . ILE C  3 189 ? -28.828 27.121  8.746   1.00 93.17  ? 240 ILE C CG1   1 
ATOM   5544  C  CG2   . ILE C  3 189 ? -28.642 26.856  6.260   1.00 92.22  ? 240 ILE C CG2   1 
ATOM   5545  C  CD1   . ILE C  3 189 ? -27.366 27.060  8.967   1.00 91.33  ? 240 ILE C CD1   1 
ATOM   5546  N  N     . SER C  3 190 ? -32.273 26.276  9.364   1.00 111.60 ? 241 SER C N     1 
ATOM   5547  C  CA    . SER C  3 190 ? -32.774 25.610  10.564  1.00 112.93 ? 241 SER C CA    1 
ATOM   5548  C  C     . SER C  3 190 ? -33.297 24.195  10.321  1.00 112.24 ? 241 SER C C     1 
ATOM   5549  O  O     . SER C  3 190 ? -32.922 23.296  11.097  1.00 117.37 ? 241 SER C O     1 
ATOM   5550  C  CB    . SER C  3 190 ? -33.866 26.458  11.225  1.00 120.05 ? 241 SER C CB    1 
ATOM   5551  O  OG    . SER C  3 190 ? -34.311 25.843  12.427  1.00 127.28 ? 241 SER C OG    1 
ATOM   5552  N  N     . PRO C  3 191 ? -34.077 23.901  9.270   1.00 108.80 ? 242 PRO C N     1 
ATOM   5553  C  CA    . PRO C  3 191 ? -34.597 22.536  9.153   1.00 111.98 ? 242 PRO C CA    1 
ATOM   5554  C  C     . PRO C  3 191 ? -33.507 21.484  9.116   1.00 115.77 ? 242 PRO C C     1 
ATOM   5555  O  O     . PRO C  3 191 ? -33.659 20.426  9.740   1.00 119.15 ? 242 PRO C O     1 
ATOM   5556  C  CB    . PRO C  3 191 ? -35.403 22.586  7.849   1.00 111.82 ? 242 PRO C CB    1 
ATOM   5557  C  CG    . PRO C  3 191 ? -35.828 23.938  7.725   1.00 110.09 ? 242 PRO C CG    1 
ATOM   5558  C  CD    . PRO C  3 191 ? -34.663 24.757  8.229   1.00 107.46 ? 242 PRO C CD    1 
ATOM   5559  N  N     . ASN C  3 192 ? -32.387 21.754  8.449   1.00 118.03 ? 243 ASN C N     1 
ATOM   5560  C  CA    . ASN C  3 192 ? -31.280 20.810  8.526   1.00 123.31 ? 243 ASN C CA    1 
ATOM   5561  C  C     . ASN C  3 192 ? -30.816 20.631  9.955   1.00 124.01 ? 243 ASN C C     1 
ATOM   5562  O  O     . ASN C  3 192 ? -30.451 19.523  10.356  1.00 130.53 ? 243 ASN C O     1 
ATOM   5563  C  CB    . ASN C  3 192 ? -30.131 21.237  7.635   1.00 126.64 ? 243 ASN C CB    1 
ATOM   5564  C  CG    . ASN C  3 192 ? -30.517 21.233  6.206   1.00 133.79 ? 243 ASN C CG    1 
ATOM   5565  O  OD1   . ASN C  3 192 ? -31.648 20.885  5.875   1.00 141.56 ? 243 ASN C OD1   1 
ATOM   5566  N  ND2   . ASN C  3 192 ? -29.599 21.639  5.334   1.00 132.47 ? 243 ASN C ND2   1 
ATOM   5567  N  N     . ILE C  3 193 ? -30.816 21.699  10.745  1.00 123.03 ? 244 ILE C N     1 
ATOM   5568  C  CA    . ILE C  3 193 ? -30.407 21.537  12.134  1.00 119.83 ? 244 ILE C CA    1 
ATOM   5569  C  C     . ILE C  3 193 ? -31.339 20.566  12.848  1.00 121.18 ? 244 ILE C C     1 
ATOM   5570  O  O     . ILE C  3 193 ? -30.882 19.593  13.464  1.00 126.19 ? 244 ILE C O     1 
ATOM   5571  C  CB    . ILE C  3 193 ? -30.325 22.898  12.837  1.00 118.84 ? 244 ILE C CB    1 
ATOM   5572  C  CG1   . ILE C  3 193 ? -29.081 23.618  12.326  1.00 121.45 ? 244 ILE C CG1   1 
ATOM   5573  C  CG2   . ILE C  3 193 ? -30.261 22.719  14.341  1.00 121.85 ? 244 ILE C CG2   1 
ATOM   5574  C  CD1   . ILE C  3 193 ? -29.109 25.102  12.518  1.00 126.33 ? 244 ILE C CD1   1 
ATOM   5575  N  N     . ARG C  3 194 ? -32.659 20.765  12.722  1.00 119.13 ? 245 ARG C N     1 
ATOM   5576  C  CA    . ARG C  3 194 ? -33.566 19.840  13.404  1.00 119.94 ? 245 ARG C CA    1 
ATOM   5577  C  C     . ARG C  3 194 ? -33.395 18.410  12.900  1.00 122.44 ? 245 ARG C C     1 
ATOM   5578  O  O     . ARG C  3 194 ? -33.482 17.456  13.685  1.00 128.07 ? 245 ARG C O     1 
ATOM   5579  C  CB    . ARG C  3 194 ? -35.024 20.272  13.256  1.00 122.70 ? 245 ARG C CB    1 
ATOM   5580  C  CG    . ARG C  3 194 ? -35.912 19.625  14.317  1.00 133.17 ? 245 ARG C CG    1 
ATOM   5581  C  CD    . ARG C  3 194 ? -37.292 19.253  13.798  1.00 143.67 ? 245 ARG C CD    1 
ATOM   5582  N  NE    . ARG C  3 194 ? -38.203 20.396  13.705  1.00 147.68 ? 245 ARG C NE    1 
ATOM   5583  C  CZ    . ARG C  3 194 ? -39.043 20.771  14.669  1.00 146.16 ? 245 ARG C CZ    1 
ATOM   5584  N  NH1   . ARG C  3 194 ? -39.086 20.105  15.819  1.00 143.92 ? 245 ARG C NH1   1 
ATOM   5585  N  NH2   . ARG C  3 194 ? -39.838 21.819  14.484  1.00 146.32 ? 245 ARG C NH2   1 
ATOM   5586  N  N     . TYR C  3 195 ? -33.133 18.240  11.605  1.00 119.35 ? 246 TYR C N     1 
ATOM   5587  C  CA    . TYR C  3 195 ? -32.909 16.901  11.076  1.00 114.12 ? 246 TYR C CA    1 
ATOM   5588  C  C     . TYR C  3 195 ? -31.656 16.292  11.688  1.00 114.81 ? 246 TYR C C     1 
ATOM   5589  O  O     . TYR C  3 195 ? -31.685 15.146  12.153  1.00 120.21 ? 246 TYR C O     1 
ATOM   5590  C  CB    . TYR C  3 195 ? -32.807 16.972  9.555   1.00 112.76 ? 246 TYR C CB    1 
ATOM   5591  C  CG    . TYR C  3 195 ? -33.113 15.708  8.784   1.00 116.29 ? 246 TYR C CG    1 
ATOM   5592  C  CD1   . TYR C  3 195 ? -32.098 14.894  8.299   1.00 116.06 ? 246 TYR C CD1   1 
ATOM   5593  C  CD2   . TYR C  3 195 ? -34.426 15.373  8.478   1.00 120.29 ? 246 TYR C CD2   1 
ATOM   5594  C  CE1   . TYR C  3 195 ? -32.385 13.750  7.569   1.00 119.98 ? 246 TYR C CE1   1 
ATOM   5595  C  CE2   . TYR C  3 195 ? -34.728 14.236  7.757   1.00 128.41 ? 246 TYR C CE2   1 
ATOM   5596  C  CZ    . TYR C  3 195 ? -33.703 13.425  7.301   1.00 124.13 ? 246 TYR C CZ    1 
ATOM   5597  O  OH    . TYR C  3 195 ? -34.008 12.299  6.572   1.00 128.69 ? 246 TYR C OH    1 
ATOM   5598  N  N     . CYS C  3 196 ? -30.578 17.077  11.795  1.00 113.50 ? 247 CYS C N     1 
ATOM   5599  C  CA    . CYS C  3 196 ? -29.375 16.578  12.448  1.00 112.47 ? 247 CYS C CA    1 
ATOM   5600  C  C     . CYS C  3 196 ? -29.689 16.116  13.860  1.00 116.72 ? 247 CYS C C     1 
ATOM   5601  O  O     . CYS C  3 196 ? -29.296 15.015  14.270  1.00 123.34 ? 247 CYS C O     1 
ATOM   5602  C  CB    . CYS C  3 196 ? -28.285 17.648  12.469  1.00 108.13 ? 247 CYS C CB    1 
ATOM   5603  S  SG    . CYS C  3 196 ? -27.439 17.963  10.902  1.00 103.81 ? 247 CYS C SG    1 
ATOM   5604  N  N     . ALA C  3 197 ? -30.416 16.933  14.623  1.00 118.80 ? 248 ALA C N     1 
ATOM   5605  C  CA    . ALA C  3 197 ? -30.700 16.520  15.991  1.00 123.04 ? 248 ALA C CA    1 
ATOM   5606  C  C     . ALA C  3 197 ? -31.470 15.206  16.015  1.00 129.09 ? 248 ALA C C     1 
ATOM   5607  O  O     . ALA C  3 197 ? -31.069 14.265  16.711  1.00 127.58 ? 248 ALA C O     1 
ATOM   5608  C  CB    . ALA C  3 197 ? -31.470 17.609  16.731  1.00 125.11 ? 248 ALA C CB    1 
ATOM   5609  N  N     . TYR C  3 198 ? -32.489 15.067  15.159  1.00 138.17 ? 249 TYR C N     1 
ATOM   5610  C  CA    . TYR C  3 198 ? -33.241 13.821  15.188  1.00 127.58 ? 249 TYR C CA    1 
ATOM   5611  C  C     . TYR C  3 198 ? -32.404 12.640  14.762  1.00 128.46 ? 249 TYR C C     1 
ATOM   5612  O  O     . TYR C  3 198 ? -32.668 11.528  15.200  1.00 133.37 ? 249 TYR C O     1 
ATOM   5613  C  CB    . TYR C  3 198 ? -34.471 13.889  14.289  1.00 129.36 ? 249 TYR C CB    1 
ATOM   5614  C  CG    . TYR C  3 198 ? -34.940 12.524  13.826  1.00 134.34 ? 249 TYR C CG    1 
ATOM   5615  C  CD1   . TYR C  3 198 ? -35.772 11.733  14.606  1.00 151.05 ? 249 TYR C CD1   1 
ATOM   5616  C  CD2   . TYR C  3 198 ? -34.545 12.024  12.594  1.00 133.59 ? 249 TYR C CD2   1 
ATOM   5617  C  CE1   . TYR C  3 198 ? -36.195 10.459  14.168  1.00 153.70 ? 249 TYR C CE1   1 
ATOM   5618  C  CE2   . TYR C  3 198 ? -34.956 10.764  12.153  1.00 159.81 ? 249 TYR C CE2   1 
ATOM   5619  C  CZ    . TYR C  3 198 ? -35.783 9.991   12.941  1.00 144.90 ? 249 TYR C CZ    1 
ATOM   5620  O  OH    . TYR C  3 198 ? -36.183 8.760   12.490  1.00 150.66 ? 249 TYR C OH    1 
ATOM   5621  N  N     . ASN C  3 199 ? -31.361 12.844  13.984  1.00 124.33 ? 250 ASN C N     1 
ATOM   5622  C  CA    . ASN C  3 199 ? -30.510 11.698  13.713  1.00 125.95 ? 250 ASN C CA    1 
ATOM   5623  C  C     . ASN C  3 199 ? -29.511 11.432  14.828  1.00 128.88 ? 250 ASN C C     1 
ATOM   5624  O  O     . ASN C  3 199 ? -28.985 10.318  14.910  1.00 131.84 ? 250 ASN C O     1 
ATOM   5625  C  CB    . ASN C  3 199 ? -29.801 11.864  12.373  1.00 122.34 ? 250 ASN C CB    1 
ATOM   5626  C  CG    . ASN C  3 199 ? -30.745 11.663  11.223  1.00 124.29 ? 250 ASN C CG    1 
ATOM   5627  O  OD1   . ASN C  3 199 ? -31.923 11.395  11.435  1.00 128.08 ? 250 ASN C OD1   1 
ATOM   5628  N  ND2   . ASN C  3 199 ? -30.256 11.803  10.009  1.00 122.08 ? 250 ASN C ND2   1 
ATOM   5629  N  N     . ILE C  3 200 ? -29.243 12.400  15.701  1.00 127.30 ? 251 ILE C N     1 
ATOM   5630  C  CA    . ILE C  3 200 ? -28.334 12.097  16.801  1.00 127.77 ? 251 ILE C CA    1 
ATOM   5631  C  C     . ILE C  3 200 ? -29.075 11.437  17.948  1.00 134.20 ? 251 ILE C C     1 
ATOM   5632  O  O     . ILE C  3 200 ? -28.578 10.491  18.560  1.00 138.57 ? 251 ILE C O     1 
ATOM   5633  C  CB    . ILE C  3 200 ? -27.601 13.353  17.277  1.00 124.70 ? 251 ILE C CB    1 
ATOM   5634  C  CG1   . ILE C  3 200 ? -26.686 13.857  16.169  1.00 124.66 ? 251 ILE C CG1   1 
ATOM   5635  C  CG2   . ILE C  3 200 ? -26.786 13.018  18.505  1.00 121.04 ? 251 ILE C CG2   1 
ATOM   5636  C  CD1   . ILE C  3 200 ? -26.142 15.218  16.442  1.00 127.29 ? 251 ILE C CD1   1 
ATOM   5637  N  N     . GLY C  3 201 ? -30.263 11.922  18.267  1.00 136.21 ? 252 GLY C N     1 
ATOM   5638  C  CA    . GLY C  3 201 ? -30.970 11.414  19.427  1.00 136.85 ? 252 GLY C CA    1 
ATOM   5639  C  C     . GLY C  3 201 ? -31.766 10.154  19.161  1.00 169.50 ? 252 GLY C C     1 
ATOM   5640  O  O     . GLY C  3 201 ? -32.709 9.838   19.896  1.00 147.83 ? 252 GLY C O     1 
ATOM   5641  N  N     . ASP C  3 202 ? -31.390 9.424   18.105  1.00 159.46 ? 253 ASP C N     1 
ATOM   5642  C  CA    . ASP C  3 202 ? -32.094 8.199   17.734  1.00 166.67 ? 253 ASP C CA    1 
ATOM   5643  C  C     . ASP C  3 202 ? -31.651 7.008   18.577  1.00 178.51 ? 253 ASP C C     1 
ATOM   5644  O  O     . ASP C  3 202 ? -32.476 6.145   18.912  1.00 187.99 ? 253 ASP C O     1 
ATOM   5645  C  CB    . ASP C  3 202 ? -31.879 7.897   16.245  1.00 163.65 ? 253 ASP C CB    1 
ATOM   5646  C  CG    . ASP C  3 202 ? -33.177 7.536   15.522  1.00 163.51 ? 253 ASP C CG    1 
ATOM   5647  O  OD1   . ASP C  3 202 ? -33.102 7.107   14.347  1.00 162.33 ? 253 ASP C OD1   1 
ATOM   5648  O  OD2   . ASP C  3 202 ? -34.267 7.686   16.122  1.00 166.95 ? 253 ASP C OD2   1 
ATOM   5649  N  N     . GLN C  3 203 ? -30.369 6.943   18.924  1.00 171.15 ? 254 GLN C N     1 
ATOM   5650  C  CA    . GLN C  3 203 ? -29.819 5.821   19.670  1.00 168.82 ? 254 GLN C CA    1 
ATOM   5651  C  C     . GLN C  3 203 ? -30.394 5.764   21.074  1.00 166.53 ? 254 GLN C C     1 
ATOM   5652  O  O     . GLN C  3 203 ? -31.426 5.133   21.294  1.00 169.71 ? 254 GLN C O     1 
ATOM   5653  C  CB    . GLN C  3 203 ? -28.294 5.918   19.723  1.00 167.73 ? 254 GLN C CB    1 
ATOM   5654  C  CG    . GLN C  3 203 ? -27.732 7.239   19.213  1.00 165.75 ? 254 GLN C CG    1 
ATOM   5655  C  CD    . GLN C  3 203 ? -27.702 7.338   17.693  1.00 166.31 ? 254 GLN C CD    1 
ATOM   5656  O  OE1   . GLN C  3 203 ? -28.737 7.245   17.030  1.00 170.97 ? 254 GLN C OE1   1 
ATOM   5657  N  NE2   . GLN C  3 203 ? -26.513 7.540   17.137  1.00 161.23 ? 254 GLN C NE2   1 
ATOM   5658  N  N     . LYS D  4 47  ? -17.108 78.883  -23.450 1.00 110.55 ? 557 LYS D N     1 
ATOM   5659  C  CA    . LYS D  4 47  ? -16.626 80.095  -24.092 1.00 113.39 ? 557 LYS D CA    1 
ATOM   5660  C  C     . LYS D  4 47  ? -15.120 80.204  -23.982 1.00 118.41 ? 557 LYS D C     1 
ATOM   5661  O  O     . LYS D  4 47  ? -14.522 81.029  -24.654 1.00 113.98 ? 557 LYS D O     1 
ATOM   5662  C  CB    . LYS D  4 47  ? -17.291 81.330  -23.481 1.00 110.09 ? 557 LYS D CB    1 
ATOM   5663  C  CG    . LYS D  4 47  ? -18.753 81.483  -23.864 1.00 110.76 ? 557 LYS D CG    1 
ATOM   5664  C  CD    . LYS D  4 47  ? -18.944 81.090  -25.311 1.00 118.07 ? 557 LYS D CD    1 
ATOM   5665  C  CE    . LYS D  4 47  ? -20.242 81.616  -25.871 1.00 122.01 ? 557 LYS D CE    1 
ATOM   5666  N  NZ    . LYS D  4 47  ? -20.013 82.141  -27.244 1.00 126.45 ? 557 LYS D NZ    1 
ATOM   5667  N  N     . LYS D  4 48  ? -14.520 79.373  -23.125 1.00 120.74 ? 558 LYS D N     1 
ATOM   5668  C  CA    . LYS D  4 48  ? -13.069 79.369  -22.964 1.00 130.75 ? 558 LYS D CA    1 
ATOM   5669  C  C     . LYS D  4 48  ? -12.387 79.357  -24.320 1.00 143.25 ? 558 LYS D C     1 
ATOM   5670  O  O     . LYS D  4 48  ? -11.570 80.226  -24.629 1.00 149.77 ? 558 LYS D O     1 
ATOM   5671  C  CB    . LYS D  4 48  ? -12.614 78.157  -22.141 1.00 136.42 ? 558 LYS D CB    1 
ATOM   5672  C  CG    . LYS D  4 48  ? -13.575 77.668  -21.057 1.00 138.82 ? 558 LYS D CG    1 
ATOM   5673  C  CD    . LYS D  4 48  ? -13.114 76.317  -20.457 1.00 138.64 ? 558 LYS D CD    1 
ATOM   5674  C  CE    . LYS D  4 48  ? -14.287 75.517  -19.862 1.00 132.11 ? 558 LYS D CE    1 
ATOM   5675  N  NZ    . LYS D  4 48  ? -13.858 74.370  -19.001 1.00 106.84 ? 558 LYS D NZ    1 
ATOM   5676  N  N     . LYS D  4 49  ? -12.719 78.363  -25.135 1.00 142.62 ? 559 LYS D N     1 
ATOM   5677  C  CA    . LYS D  4 49  ? -12.365 78.295  -26.548 1.00 150.56 ? 559 LYS D CA    1 
ATOM   5678  C  C     . LYS D  4 49  ? -10.865 78.246  -26.780 1.00 166.12 ? 559 LYS D C     1 
ATOM   5679  O  O     . LYS D  4 49  ? -10.405 78.477  -27.901 1.00 168.61 ? 559 LYS D O     1 
ATOM   5680  C  CB    . LYS D  4 49  ? -12.986 79.456  -27.327 1.00 147.92 ? 559 LYS D CB    1 
ATOM   5681  C  CG    . LYS D  4 49  ? -14.472 79.395  -27.441 1.00 143.96 ? 559 LYS D CG    1 
ATOM   5682  C  CD    . LYS D  4 49  ? -14.839 78.068  -28.018 1.00 146.50 ? 559 LYS D CD    1 
ATOM   5683  C  CE    . LYS D  4 49  ? -16.156 78.124  -28.735 1.00 147.09 ? 559 LYS D CE    1 
ATOM   5684  N  NZ    . LYS D  4 49  ? -16.285 76.873  -29.510 1.00 146.00 ? 559 LYS D NZ    1 
ATOM   5685  N  N     . GLY D  4 50  ? -10.102 77.913  -25.745 1.00 182.14 ? 560 GLY D N     1 
ATOM   5686  C  CA    . GLY D  4 50  ? -8.664  78.081  -25.795 1.00 203.06 ? 560 GLY D CA    1 
ATOM   5687  C  C     . GLY D  4 50  ? -8.328  79.449  -26.346 1.00 224.84 ? 560 GLY D C     1 
ATOM   5688  O  O     . GLY D  4 50  ? -7.807  79.565  -27.459 1.00 229.19 ? 560 GLY D O     1 
ATOM   5689  N  N     . LYS D  4 51  ? -8.639  80.482  -25.556 1.00 231.34 ? 561 LYS D N     1 
ATOM   5690  C  CA    . LYS D  4 51  ? -8.703  81.889  -25.953 1.00 219.74 ? 561 LYS D CA    1 
ATOM   5691  C  C     . LYS D  4 51  ? -9.918  82.121  -26.852 1.00 208.77 ? 561 LYS D C     1 
ATOM   5692  O  O     . LYS D  4 51  ? -10.783 81.253  -26.966 1.00 223.56 ? 561 LYS D O     1 
ATOM   5693  C  CB    . LYS D  4 51  ? -7.410  82.356  -26.643 1.00 220.97 ? 561 LYS D CB    1 
ATOM   5694  C  CG    . LYS D  4 51  ? -6.118  81.892  -25.988 1.00 208.97 ? 561 LYS D CG    1 
ATOM   5695  C  CD    . LYS D  4 51  ? -5.929  82.524  -24.609 1.00 194.94 ? 561 LYS D CD    1 
ATOM   5696  C  CE    . LYS D  4 51  ? -4.895  83.662  -24.560 1.00 192.30 ? 561 LYS D CE    1 
ATOM   5697  N  NZ    . LYS D  4 51  ? -5.395  85.050  -24.741 1.00 188.75 ? 561 LYS D NZ    1 
ATOM   5698  N  N     . LEU D  4 52  ? -10.007 83.293  -27.482 1.00 248.38 ? 562 LEU D N     1 
ATOM   5699  C  CA    . LEU D  4 52  ? -11.194 83.693  -28.236 1.00 224.00 ? 562 LEU D CA    1 
ATOM   5700  C  C     . LEU D  4 52  ? -10.879 84.819  -29.213 1.00 225.56 ? 562 LEU D C     1 
ATOM   5701  O  O     . LEU D  4 52  ? -11.586 84.977  -30.206 1.00 219.39 ? 562 LEU D O     1 
ATOM   5702  C  CB    . LEU D  4 52  ? -12.298 84.132  -27.260 1.00 204.57 ? 562 LEU D CB    1 
ATOM   5703  C  CG    . LEU D  4 52  ? -13.534 84.905  -27.751 1.00 193.82 ? 562 LEU D CG    1 
ATOM   5704  C  CD1   . LEU D  4 52  ? -14.430 84.056  -28.603 1.00 182.75 ? 562 LEU D CD1   1 
ATOM   5705  C  CD2   . LEU D  4 52  ? -14.300 85.410  -26.554 1.00 183.32 ? 562 LEU D CD2   1 
ATOM   5706  N  N     . PRO D  4 53  ? -9.875  85.662  -28.946 1.00 232.91 ? 563 PRO D N     1 
ATOM   5707  C  CA    . PRO D  4 53  ? -9.401  86.572  -29.996 1.00 232.28 ? 563 PRO D CA    1 
ATOM   5708  C  C     . PRO D  4 53  ? -9.242  85.866  -31.337 1.00 223.74 ? 563 PRO D C     1 
ATOM   5709  O  O     . PRO D  4 53  ? -9.873  86.236  -32.337 1.00 226.67 ? 563 PRO D O     1 
ATOM   5710  C  CB    . PRO D  4 53  ? -8.057  87.058  -29.435 1.00 239.18 ? 563 PRO D CB    1 
ATOM   5711  C  CG    . PRO D  4 53  ? -8.186  86.897  -27.907 1.00 240.36 ? 563 PRO D CG    1 
ATOM   5712  C  CD    . PRO D  4 53  ? -9.452  86.146  -27.615 1.00 235.89 ? 563 PRO D CD    1 
ATOM   5713  N  N     . LYS D  4 54  ? -8.429  84.807  -31.346 1.00 229.03 ? 564 LYS D N     1 
ATOM   5714  C  CA    . LYS D  4 54  ? -8.260  84.020  -32.558 1.00 221.02 ? 564 LYS D CA    1 
ATOM   5715  C  C     . LYS D  4 54  ? -9.603  83.531  -33.079 1.00 214.48 ? 564 LYS D C     1 
ATOM   5716  O  O     . LYS D  4 54  ? -9.780  83.372  -34.290 1.00 208.52 ? 564 LYS D O     1 
ATOM   5717  C  CB    . LYS D  4 54  ? -7.326  82.848  -32.278 1.00 207.46 ? 564 LYS D CB    1 
ATOM   5718  C  CG    . LYS D  4 54  ? -6.216  83.164  -31.279 1.00 211.23 ? 564 LYS D CG    1 
ATOM   5719  C  CD    . LYS D  4 54  ? -5.028  83.856  -31.932 1.00 202.65 ? 564 LYS D CD    1 
ATOM   5720  C  CE    . LYS D  4 54  ? -3.840  83.929  -30.976 1.00 205.19 ? 564 LYS D CE    1 
ATOM   5721  N  NZ    . LYS D  4 54  ? -2.562  84.286  -31.656 1.00 208.39 ? 564 LYS D NZ    1 
ATOM   5722  N  N     . ASN D  4 55  ? -10.570 83.325  -32.182 1.00 208.53 ? 565 ASN D N     1 
ATOM   5723  C  CA    . ASN D  4 55  ? -11.888 82.864  -32.605 1.00 205.28 ? 565 ASN D CA    1 
ATOM   5724  C  C     . ASN D  4 55  ? -12.405 83.704  -33.766 1.00 202.89 ? 565 ASN D C     1 
ATOM   5725  O  O     . ASN D  4 55  ? -12.925 83.164  -34.748 1.00 197.78 ? 565 ASN D O     1 
ATOM   5726  C  CB    . ASN D  4 55  ? -12.851 82.891  -31.415 1.00 202.21 ? 565 ASN D CB    1 
ATOM   5727  C  CG    . ASN D  4 55  ? -14.130 82.150  -31.662 1.00 200.56 ? 565 ASN D CG    1 
ATOM   5728  O  OD1   . ASN D  4 55  ? -14.681 82.179  -32.759 1.00 202.87 ? 565 ASN D OD1   1 
ATOM   5729  N  ND2   . ASN D  4 55  ? -14.625 81.475  -30.628 1.00 197.42 ? 565 ASN D ND2   1 
ATOM   5730  N  N     . TYR D  4 56  ? -12.220 85.023  -33.705 1.00 203.67 ? 566 TYR D N     1 
ATOM   5731  C  CA    . TYR D  4 56  ? -12.590 85.860  -34.835 1.00 198.55 ? 566 TYR D CA    1 
ATOM   5732  C  C     . TYR D  4 56  ? -11.412 86.234  -35.713 1.00 202.45 ? 566 TYR D C     1 
ATOM   5733  O  O     . TYR D  4 56  ? -11.630 86.656  -36.852 1.00 200.65 ? 566 TYR D O     1 
ATOM   5734  C  CB    . TYR D  4 56  ? -13.288 87.158  -34.393 1.00 192.97 ? 566 TYR D CB    1 
ATOM   5735  C  CG    . TYR D  4 56  ? -13.568 87.317  -32.916 1.00 189.87 ? 566 TYR D CG    1 
ATOM   5736  C  CD1   . TYR D  4 56  ? -14.866 87.464  -32.446 1.00 187.97 ? 566 TYR D CD1   1 
ATOM   5737  C  CD2   . TYR D  4 56  ? -12.535 87.364  -31.995 1.00 191.80 ? 566 TYR D CD2   1 
ATOM   5738  C  CE1   . TYR D  4 56  ? -15.125 87.621  -31.090 1.00 189.27 ? 566 TYR D CE1   1 
ATOM   5739  C  CE2   . TYR D  4 56  ? -12.782 87.525  -30.645 1.00 193.54 ? 566 TYR D CE2   1 
ATOM   5740  C  CZ    . TYR D  4 56  ? -14.077 87.646  -30.191 1.00 193.61 ? 566 TYR D CZ    1 
ATOM   5741  O  OH    . TYR D  4 56  ? -14.315 87.805  -28.837 1.00 196.23 ? 566 TYR D OH    1 
ATOM   5742  N  N     . ASP D  4 57  ? -10.174 86.096  -35.221 1.00 203.17 ? 567 ASP D N     1 
ATOM   5743  C  CA    . ASP D  4 57  ? -9.026  86.537  -36.010 1.00 208.52 ? 567 ASP D CA    1 
ATOM   5744  C  C     . ASP D  4 57  ? -8.914  85.749  -37.311 1.00 214.41 ? 567 ASP D C     1 
ATOM   5745  O  O     . ASP D  4 57  ? -9.092  86.340  -38.390 1.00 217.09 ? 567 ASP D O     1 
ATOM   5746  C  CB    . ASP D  4 57  ? -7.752  86.469  -35.162 1.00 208.71 ? 567 ASP D CB    1 
ATOM   5747  C  CG    . ASP D  4 57  ? -6.601  87.265  -35.756 1.00 209.19 ? 567 ASP D CG    1 
ATOM   5748  O  OD1   . ASP D  4 57  ? -6.583  87.486  -36.984 1.00 208.29 ? 567 ASP D OD1   1 
ATOM   5749  O  OD2   . ASP D  4 57  ? -5.706  87.672  -34.989 1.00 205.62 ? 567 ASP D OD2   1 
ATOM   5750  N  N     . PRO D  4 58  ? -8.508  84.012  -37.294 1.00 199.43 ? 568 PRO D N     1 
ATOM   5751  C  CA    . PRO D  4 58  ? -8.589  83.215  -38.540 1.00 200.08 ? 568 PRO D CA    1 
ATOM   5752  C  C     . PRO D  4 58  ? -10.014 82.905  -38.984 1.00 198.74 ? 568 PRO D C     1 
ATOM   5753  O  O     . PRO D  4 58  ? -10.550 81.801  -38.790 1.00 193.70 ? 568 PRO D O     1 
ATOM   5754  C  CB    . PRO D  4 58  ? -7.798  81.952  -38.170 1.00 194.36 ? 568 PRO D CB    1 
ATOM   5755  C  CG    . PRO D  4 58  ? -7.823  81.903  -36.693 1.00 192.98 ? 568 PRO D CG    1 
ATOM   5756  C  CD    . PRO D  4 58  ? -7.697  83.315  -36.281 1.00 197.08 ? 568 PRO D CD    1 
ATOM   5757  N  N     . LYS D  4 59  ? -10.641 83.902  -39.599 1.00 203.30 ? 569 LYS D N     1 
ATOM   5758  C  CA    . LYS D  4 59  ? -11.824 83.732  -40.435 1.00 201.93 ? 569 LYS D CA    1 
ATOM   5759  C  C     . LYS D  4 59  ? -13.062 83.272  -39.665 1.00 202.25 ? 569 LYS D C     1 
ATOM   5760  O  O     . LYS D  4 59  ? -13.881 82.524  -40.207 1.00 198.40 ? 569 LYS D O     1 
ATOM   5761  C  CB    . LYS D  4 59  ? -11.532 82.794  -41.613 1.00 194.96 ? 569 LYS D CB    1 
ATOM   5762  C  CG    . LYS D  4 59  ? -10.742 83.434  -42.767 1.00 192.87 ? 569 LYS D CG    1 
ATOM   5763  C  CD    . LYS D  4 59  ? -9.346  83.919  -42.359 1.00 188.65 ? 569 LYS D CD    1 
ATOM   5764  C  CE    . LYS D  4 59  ? -8.724  84.774  -43.459 1.00 189.27 ? 569 LYS D CE    1 
ATOM   5765  N  NZ    . LYS D  4 59  ? -7.452  85.458  -43.065 1.00 190.67 ? 569 LYS D NZ    1 
ATOM   5766  N  N     . VAL D  4 60  ? -13.149 83.661  -38.389 1.00 204.41 ? 570 VAL D N     1 
ATOM   5767  C  CA    . VAL D  4 60  ? -14.382 83.929  -37.639 1.00 206.71 ? 570 VAL D CA    1 
ATOM   5768  C  C     . VAL D  4 60  ? -14.887 82.730  -36.843 1.00 200.40 ? 570 VAL D C     1 
ATOM   5769  O  O     . VAL D  4 60  ? -15.584 82.896  -35.838 1.00 202.03 ? 570 VAL D O     1 
ATOM   5770  C  CB    . VAL D  4 60  ? -15.517 84.447  -38.547 1.00 212.69 ? 570 VAL D CB    1 
ATOM   5771  C  CG1   . VAL D  4 60  ? -16.474 83.337  -38.956 1.00 210.62 ? 570 VAL D CG1   1 
ATOM   5772  C  CG2   . VAL D  4 60  ? -16.287 85.556  -37.834 1.00 217.31 ? 570 VAL D CG2   1 
ATOM   5773  N  N     . THR D  4 61  ? -14.544 81.522  -37.254 1.00 203.36 ? 571 THR D N     1 
ATOM   5774  C  CA    . THR D  4 61  ? -15.139 80.332  -36.667 1.00 207.58 ? 571 THR D CA    1 
ATOM   5775  C  C     . THR D  4 61  ? -14.352 79.130  -37.171 1.00 205.90 ? 571 THR D C     1 
ATOM   5776  O  O     . THR D  4 61  ? -13.668 79.233  -38.194 1.00 198.44 ? 571 THR D O     1 
ATOM   5777  C  CB    . THR D  4 61  ? -16.629 80.232  -37.040 1.00 175.13 ? 571 THR D CB    1 
ATOM   5778  O  OG1   . THR D  4 61  ? -17.346 79.559  -35.999 1.00 174.26 ? 571 THR D OG1   1 
ATOM   5779  C  CG2   . THR D  4 61  ? -16.810 79.495  -38.333 1.00 173.84 ? 571 THR D CG2   1 
ATOM   5780  N  N     . PRO D  4 62  ? -14.428 77.981  -36.487 1.00 212.73 ? 572 PRO D N     1 
ATOM   5781  C  CA    . PRO D  4 62  ? -13.735 76.801  -37.022 1.00 216.32 ? 572 PRO D CA    1 
ATOM   5782  C  C     . PRO D  4 62  ? -14.459 76.260  -38.240 1.00 216.04 ? 572 PRO D C     1 
ATOM   5783  O  O     . PRO D  4 62  ? -15.431 76.873  -38.692 1.00 229.02 ? 572 PRO D O     1 
ATOM   5784  C  CB    . PRO D  4 62  ? -13.764 75.801  -35.859 1.00 215.03 ? 572 PRO D CB    1 
ATOM   5785  C  CG    . PRO D  4 62  ? -14.997 76.148  -35.106 1.00 215.35 ? 572 PRO D CG    1 
ATOM   5786  C  CD    . PRO D  4 62  ? -15.172 77.648  -35.255 1.00 216.99 ? 572 PRO D CD    1 
ATOM   5787  N  N     . ASP D  4 63  ? -14.003 75.130  -38.789 1.00 206.09 ? 573 ASP D N     1 
ATOM   5788  C  CA    . ASP D  4 63  ? -14.646 74.582  -39.976 1.00 186.96 ? 573 ASP D CA    1 
ATOM   5789  C  C     . ASP D  4 63  ? -16.142 74.596  -39.711 1.00 181.31 ? 573 ASP D C     1 
ATOM   5790  O  O     . ASP D  4 63  ? -16.538 74.336  -38.585 1.00 160.99 ? 573 ASP D O     1 
ATOM   5791  C  CB    . ASP D  4 63  ? -14.124 73.175  -40.258 1.00 169.07 ? 573 ASP D CB    1 
ATOM   5792  C  CG    . ASP D  4 63  ? -12.600 73.123  -40.336 1.00 160.10 ? 573 ASP D CG    1 
ATOM   5793  O  OD1   . ASP D  4 63  ? -12.047 72.095  -40.770 1.00 155.75 ? 573 ASP D OD1   1 
ATOM   5794  O  OD2   . ASP D  4 63  ? -11.948 74.124  -39.973 1.00 162.00 ? 573 ASP D OD2   1 
ATOM   5795  N  N     . PRO D  4 64  ? -16.995 75.019  -40.645 1.00 178.90 ? 574 PRO D N     1 
ATOM   5796  C  CA    . PRO D  4 64  ? -18.433 75.039  -40.318 1.00 183.81 ? 574 PRO D CA    1 
ATOM   5797  C  C     . PRO D  4 64  ? -18.960 73.668  -39.941 1.00 189.18 ? 574 PRO D C     1 
ATOM   5798  O  O     . PRO D  4 64  ? -19.874 73.575  -39.114 1.00 193.27 ? 574 PRO D O     1 
ATOM   5799  C  CB    . PRO D  4 64  ? -19.082 75.570  -41.606 1.00 185.23 ? 574 PRO D CB    1 
ATOM   5800  C  CG    . PRO D  4 64  ? -18.059 75.359  -42.677 1.00 182.35 ? 574 PRO D CG    1 
ATOM   5801  C  CD    . PRO D  4 64  ? -16.733 75.544  -41.996 1.00 179.24 ? 574 PRO D CD    1 
ATOM   5802  N  N     . GLU D  4 65  ? -18.400 72.599  -40.532 1.00 190.21 ? 575 GLU D N     1 
ATOM   5803  C  CA    . GLU D  4 65  ? -18.733 71.233  -40.127 1.00 188.93 ? 575 GLU D CA    1 
ATOM   5804  C  C     . GLU D  4 65  ? -18.422 71.030  -38.657 1.00 184.20 ? 575 GLU D C     1 
ATOM   5805  O  O     . GLU D  4 65  ? -19.198 70.404  -37.921 1.00 185.84 ? 575 GLU D O     1 
ATOM   5806  C  CB    . GLU D  4 65  ? -17.973 70.221  -40.983 1.00 187.04 ? 575 GLU D CB    1 
ATOM   5807  C  CG    . GLU D  4 65  ? -18.084 70.440  -42.459 1.00 190.18 ? 575 GLU D CG    1 
ATOM   5808  C  CD    . GLU D  4 65  ? -17.439 69.321  -43.215 1.00 190.93 ? 575 GLU D CD    1 
ATOM   5809  O  OE1   . GLU D  4 65  ? -18.123 68.662  -44.029 1.00 193.66 ? 575 GLU D OE1   1 
ATOM   5810  O  OE2   . GLU D  4 65  ? -16.234 69.092  -42.980 1.00 188.72 ? 575 GLU D OE2   1 
ATOM   5811  N  N     . ARG D  4 66  ? -17.260 71.527  -38.230 1.00 185.56 ? 576 ARG D N     1 
ATOM   5812  C  CA    . ARG D  4 66  ? -17.063 71.998  -36.863 1.00 180.53 ? 576 ARG D CA    1 
ATOM   5813  C  C     . ARG D  4 66  ? -17.109 70.787  -35.952 1.00 154.69 ? 576 ARG D C     1 
ATOM   5814  O  O     . ARG D  4 66  ? -16.292 69.877  -36.097 1.00 151.51 ? 576 ARG D O     1 
ATOM   5815  C  CB    . ARG D  4 66  ? -18.133 73.045  -36.562 1.00 176.44 ? 576 ARG D CB    1 
ATOM   5816  C  CG    . ARG D  4 66  ? -17.628 74.361  -36.021 1.00 169.45 ? 576 ARG D CG    1 
ATOM   5817  C  CD    . ARG D  4 66  ? -18.590 74.962  -35.037 1.00 165.47 ? 576 ARG D CD    1 
ATOM   5818  N  NE    . ARG D  4 66  ? -17.868 75.289  -33.824 1.00 164.48 ? 576 ARG D NE    1 
ATOM   5819  C  CZ    . ARG D  4 66  ? -18.421 75.624  -32.673 1.00 166.53 ? 576 ARG D CZ    1 
ATOM   5820  N  NH1   . ARG D  4 66  ? -19.737 75.686  -32.530 1.00 169.70 ? 576 ARG D NH1   1 
ATOM   5821  N  NH2   . ARG D  4 66  ? -17.626 75.902  -31.670 1.00 165.73 ? 576 ARG D NH2   1 
ATOM   5822  N  N     . TRP D  4 67  ? -18.035 70.733  -35.049 1.00 129.13 ? 577 TRP D N     1 
ATOM   5823  C  CA    . TRP D  4 67  ? -18.296 69.518  -34.342 1.00 131.41 ? 577 TRP D CA    1 
ATOM   5824  C  C     . TRP D  4 67  ? -19.557 68.901  -34.938 1.00 137.36 ? 577 TRP D C     1 
ATOM   5825  O  O     . TRP D  4 67  ? -20.441 69.621  -35.426 1.00 126.06 ? 577 TRP D O     1 
ATOM   5826  C  CB    . TRP D  4 67  ? -18.367 69.823  -32.846 1.00 125.73 ? 577 TRP D CB    1 
ATOM   5827  C  CG    . TRP D  4 67  ? -19.566 70.482  -32.330 1.00 120.93 ? 577 TRP D CG    1 
ATOM   5828  C  CD1   . TRP D  4 67  ? -20.696 70.814  -33.006 1.00 122.80 ? 577 TRP D CD1   1 
ATOM   5829  C  CD2   . TRP D  4 67  ? -19.795 70.844  -30.973 1.00 120.07 ? 577 TRP D CD2   1 
ATOM   5830  N  NE1   . TRP D  4 67  ? -21.613 71.361  -32.158 1.00 123.01 ? 577 TRP D NE1   1 
ATOM   5831  C  CE2   . TRP D  4 67  ? -21.078 71.388  -30.902 1.00 121.41 ? 577 TRP D CE2   1 
ATOM   5832  C  CE3   . TRP D  4 67  ? -19.035 70.762  -29.803 1.00 118.59 ? 577 TRP D CE3   1 
ATOM   5833  C  CZ2   . TRP D  4 67  ? -21.613 71.841  -29.730 1.00 121.31 ? 577 TRP D CZ2   1 
ATOM   5834  C  CZ3   . TRP D  4 67  ? -19.588 71.213  -28.634 1.00 118.67 ? 577 TRP D CZ3   1 
ATOM   5835  C  CH2   . TRP D  4 67  ? -20.861 71.752  -28.607 1.00 120.01 ? 577 TRP D CH2   1 
ATOM   5836  N  N     . LEU D  4 68  ? -19.590 67.535  -34.937 1.00 141.44 ? 578 LEU D N     1 
ATOM   5837  C  CA    . LEU D  4 68  ? -20.445 66.590  -35.663 1.00 142.71 ? 578 LEU D CA    1 
ATOM   5838  C  C     . LEU D  4 68  ? -19.672 65.269  -35.739 1.00 150.38 ? 578 LEU D C     1 
ATOM   5839  O  O     . LEU D  4 68  ? -18.627 65.175  -35.088 1.00 153.15 ? 578 LEU D O     1 
ATOM   5840  C  CB    . LEU D  4 68  ? -20.803 67.141  -37.043 1.00 137.57 ? 578 LEU D CB    1 
ATOM   5841  C  CG    . LEU D  4 68  ? -22.293 67.311  -37.369 1.00 135.91 ? 578 LEU D CG    1 
ATOM   5842  C  CD1   . LEU D  4 68  ? -22.903 68.587  -36.782 1.00 133.06 ? 578 LEU D CD1   1 
ATOM   5843  C  CD2   . LEU D  4 68  ? -22.533 67.250  -38.868 1.00 138.79 ? 578 LEU D CD2   1 
ATOM   5844  N  N     . PRO D  4 69  ? -20.107 64.225  -36.468 1.00 153.87 ? 579 PRO D N     1 
ATOM   5845  C  CA    . PRO D  4 69  ? -19.292 62.985  -36.507 1.00 151.77 ? 579 PRO D CA    1 
ATOM   5846  C  C     . PRO D  4 69  ? -17.957 63.174  -37.223 1.00 150.55 ? 579 PRO D C     1 
ATOM   5847  O  O     . PRO D  4 69  ? -17.902 63.687  -38.341 1.00 146.93 ? 579 PRO D O     1 
ATOM   5848  C  CB    . PRO D  4 69  ? -20.182 61.990  -37.259 1.00 158.25 ? 579 PRO D CB    1 
ATOM   5849  C  CG    . PRO D  4 69  ? -21.547 62.459  -37.052 1.00 162.10 ? 579 PRO D CG    1 
ATOM   5850  C  CD    . PRO D  4 69  ? -21.475 63.961  -36.972 1.00 158.63 ? 579 PRO D CD    1 
ATOM   5851  N  N     . MET D  4 70  ? -16.875 62.718  -36.588 1.00 129.12 ? 580 MET D N     1 
ATOM   5852  C  CA    . MET D  4 70  ? -15.549 63.015  -37.124 1.00 127.64 ? 580 MET D CA    1 
ATOM   5853  C  C     . MET D  4 70  ? -15.334 62.362  -38.484 1.00 130.28 ? 580 MET D C     1 
ATOM   5854  O  O     . MET D  4 70  ? -14.642 62.917  -39.339 1.00 130.37 ? 580 MET D O     1 
ATOM   5855  C  CB    . MET D  4 70  ? -14.464 62.583  -36.138 1.00 125.08 ? 580 MET D CB    1 
ATOM   5856  C  CG    . MET D  4 70  ? -13.045 62.617  -36.713 1.00 137.17 ? 580 MET D CG    1 
ATOM   5857  S  SD    . MET D  4 70  ? -12.448 64.257  -37.170 1.00 122.90 ? 580 MET D SD    1 
ATOM   5858  C  CE    . MET D  4 70  ? -11.527 64.742  -35.713 1.00 119.55 ? 580 MET D CE    1 
ATOM   5859  N  N     . ARG D  4 71  ? -15.910 61.183  -38.705 1.00 132.80 ? 581 ARG D N     1 
ATOM   5860  C  CA    . ARG D  4 71  ? -15.860 60.558  -40.021 1.00 135.98 ? 581 ARG D CA    1 
ATOM   5861  C  C     . ARG D  4 71  ? -16.761 61.266  -41.013 1.00 138.72 ? 581 ARG D C     1 
ATOM   5862  O  O     . ARG D  4 71  ? -16.640 61.018  -42.218 1.00 141.58 ? 581 ARG D O     1 
ATOM   5863  C  CB    . ARG D  4 71  ? -16.293 59.093  -39.935 1.00 151.42 ? 581 ARG D CB    1 
ATOM   5864  C  CG    . ARG D  4 71  ? -17.812 58.947  -39.768 1.00 154.55 ? 581 ARG D CG    1 
ATOM   5865  C  CD    . ARG D  4 71  ? -18.318 57.507  -39.681 1.00 143.90 ? 581 ARG D CD    1 
ATOM   5866  N  NE    . ARG D  4 71  ? -19.681 57.492  -39.164 1.00 145.86 ? 581 ARG D NE    1 
ATOM   5867  C  CZ    . ARG D  4 71  ? -19.971 57.502  -37.872 1.00 144.18 ? 581 ARG D CZ    1 
ATOM   5868  N  NH1   . ARG D  4 71  ? -21.230 57.499  -37.472 1.00 146.47 ? 581 ARG D NH1   1 
ATOM   5869  N  NH2   . ARG D  4 71  ? -18.994 57.509  -36.979 1.00 140.57 ? 581 ARG D NH2   1 
ATOM   5870  N  N     . GLU D  4 72  ? -17.672 62.119  -40.523 1.00 143.57 ? 582 GLU D N     1 
ATOM   5871  C  CA    . GLU D  4 72  ? -18.647 62.813  -41.362 1.00 148.92 ? 582 GLU D CA    1 
ATOM   5872  C  C     . GLU D  4 72  ? -18.111 64.121  -41.938 1.00 146.98 ? 582 GLU D C     1 
ATOM   5873  O  O     . GLU D  4 72  ? -18.609 64.604  -42.962 1.00 142.45 ? 582 GLU D O     1 
ATOM   5874  C  CB    . GLU D  4 72  ? -19.907 63.109  -40.549 1.00 153.08 ? 582 GLU D CB    1 
ATOM   5875  C  CG    . GLU D  4 72  ? -21.018 62.084  -40.662 1.00 161.61 ? 582 GLU D CG    1 
ATOM   5876  C  CD    . GLU D  4 72  ? -21.919 62.350  -41.845 1.00 170.76 ? 582 GLU D CD    1 
ATOM   5877  O  OE1   . GLU D  4 72  ? -21.425 62.885  -42.859 1.00 177.84 ? 582 GLU D OE1   1 
ATOM   5878  O  OE2   . GLU D  4 72  ? -23.123 62.036  -41.762 1.00 176.74 ? 582 GLU D OE2   1 
ATOM   5879  N  N     . ARG D  4 73  ? -17.114 64.707  -41.295 1.00 140.16 ? 583 ARG D N     1 
ATOM   5880  C  CA    . ARG D  4 73  ? -16.616 66.009  -41.693 1.00 141.08 ? 583 ARG D CA    1 
ATOM   5881  C  C     . ARG D  4 73  ? -15.901 65.917  -43.044 1.00 144.10 ? 583 ARG D C     1 
ATOM   5882  O  O     . ARG D  4 73  ? -15.605 64.830  -43.543 1.00 145.47 ? 583 ARG D O     1 
ATOM   5883  C  CB    . ARG D  4 73  ? -15.707 66.554  -40.590 1.00 142.06 ? 583 ARG D CB    1 
ATOM   5884  C  CG    . ARG D  4 73  ? -16.344 66.532  -39.182 1.00 139.18 ? 583 ARG D CG    1 
ATOM   5885  C  CD    . ARG D  4 73  ? -15.330 66.804  -38.065 1.00 134.10 ? 583 ARG D CD    1 
ATOM   5886  N  NE    . ARG D  4 73  ? -15.971 66.871  -36.755 1.00 126.19 ? 583 ARG D NE    1 
ATOM   5887  C  CZ    . ARG D  4 73  ? -15.328 67.029  -35.601 1.00 127.47 ? 583 ARG D CZ    1 
ATOM   5888  N  NH1   . ARG D  4 73  ? -14.008 67.133  -35.562 1.00 125.91 ? 583 ARG D NH1   1 
ATOM   5889  N  NH2   . ARG D  4 73  ? -16.012 67.085  -34.472 1.00 132.59 ? 583 ARG D NH2   1 
ATOM   5890  N  N     . SER D  4 74  ? -15.640 67.072  -43.657 1.00 142.48 ? 584 SER D N     1 
ATOM   5891  C  CA    . SER D  4 74  ? -15.167 67.039  -45.035 1.00 151.64 ? 584 SER D CA    1 
ATOM   5892  C  C     . SER D  4 74  ? -13.661 66.898  -45.150 1.00 148.71 ? 584 SER D C     1 
ATOM   5893  O  O     . SER D  4 74  ? -13.169 66.615  -46.245 1.00 152.51 ? 584 SER D O     1 
ATOM   5894  C  CB    . SER D  4 74  ? -15.619 68.282  -45.799 1.00 157.15 ? 584 SER D CB    1 
ATOM   5895  O  OG    . SER D  4 74  ? -17.032 68.285  -45.918 1.00 162.38 ? 584 SER D OG    1 
ATOM   5896  N  N     . TYR D  4 75  ? -12.911 67.089  -44.069 1.00 147.60 ? 585 TYR D N     1 
ATOM   5897  C  CA    . TYR D  4 75  ? -11.553 66.568  -44.068 1.00 150.42 ? 585 TYR D CA    1 
ATOM   5898  C  C     . TYR D  4 75  ? -11.604 65.091  -44.449 1.00 163.21 ? 585 TYR D C     1 
ATOM   5899  O  O     . TYR D  4 75  ? -10.749 64.586  -45.184 1.00 171.62 ? 585 TYR D O     1 
ATOM   5900  C  CB    . TYR D  4 75  ? -10.858 66.713  -42.711 1.00 144.56 ? 585 TYR D CB    1 
ATOM   5901  C  CG    . TYR D  4 75  ? -11.401 67.671  -41.671 1.00 141.07 ? 585 TYR D CG    1 
ATOM   5902  C  CD1   . TYR D  4 75  ? -10.529 68.374  -40.871 1.00 137.14 ? 585 TYR D CD1   1 
ATOM   5903  C  CD2   . TYR D  4 75  ? -12.758 67.815  -41.428 1.00 139.43 ? 585 TYR D CD2   1 
ATOM   5904  C  CE1   . TYR D  4 75  ? -10.985 69.216  -39.899 1.00 133.76 ? 585 TYR D CE1   1 
ATOM   5905  C  CE2   . TYR D  4 75  ? -13.222 68.662  -40.461 1.00 132.38 ? 585 TYR D CE2   1 
ATOM   5906  C  CZ    . TYR D  4 75  ? -12.333 69.355  -39.690 1.00 133.21 ? 585 TYR D CZ    1 
ATOM   5907  O  OH    . TYR D  4 75  ? -12.778 70.212  -38.711 1.00 137.74 ? 585 TYR D OH    1 
ATOM   5908  N  N     . TYR D  4 76  ? -12.610 64.383  -43.931 1.00 164.63 ? 586 TYR D N     1 
ATOM   5909  C  CA    . TYR D  4 76  ? -13.007 63.064  -44.416 1.00 169.77 ? 586 TYR D CA    1 
ATOM   5910  C  C     . TYR D  4 76  ? -11.950 61.999  -44.149 1.00 165.31 ? 586 TYR D C     1 
ATOM   5911  O  O     . TYR D  4 76  ? -11.872 61.003  -44.868 1.00 169.21 ? 586 TYR D O     1 
ATOM   5912  C  CB    . TYR D  4 76  ? -13.353 63.102  -45.915 1.00 178.07 ? 586 TYR D CB    1 
ATOM   5913  C  CG    . TYR D  4 76  ? -14.491 62.169  -46.331 1.00 181.18 ? 586 TYR D CG    1 
ATOM   5914  C  CD1   . TYR D  4 76  ? -15.653 62.669  -46.912 1.00 181.58 ? 586 TYR D CD1   1 
ATOM   5915  C  CD2   . TYR D  4 76  ? -14.406 60.790  -46.137 1.00 181.30 ? 586 TYR D CD2   1 
ATOM   5916  C  CE1   . TYR D  4 76  ? -16.688 61.822  -47.285 1.00 184.32 ? 586 TYR D CE1   1 
ATOM   5917  C  CE2   . TYR D  4 76  ? -15.433 59.941  -46.504 1.00 184.43 ? 586 TYR D CE2   1 
ATOM   5918  C  CZ    . TYR D  4 76  ? -16.569 60.460  -47.076 1.00 185.49 ? 586 TYR D CZ    1 
ATOM   5919  O  OH    . TYR D  4 76  ? -17.581 59.600  -47.435 1.00 191.47 ? 586 TYR D OH    1 
ATOM   5920  N  N     . ARG D  4 77  ? -11.124 62.155  -43.125 1.00 158.91 ? 587 ARG D N     1 
ATOM   5921  C  CA    . ARG D  4 77  ? -10.158 61.104  -42.869 1.00 156.55 ? 587 ARG D CA    1 
ATOM   5922  C  C     . ARG D  4 77  ? -10.820 59.939  -42.147 1.00 151.15 ? 587 ARG D C     1 
ATOM   5923  O  O     . ARG D  4 77  ? -11.700 60.132  -41.299 1.00 148.27 ? 587 ARG D O     1 
ATOM   5924  C  CB    . ARG D  4 77  ? -8.952  61.618  -42.088 1.00 157.24 ? 587 ARG D CB    1 
ATOM   5925  C  CG    . ARG D  4 77  ? -7.628  61.366  -42.837 1.00 158.10 ? 587 ARG D CG    1 
ATOM   5926  C  CD    . ARG D  4 77  ? -7.444  59.888  -43.261 1.00 157.56 ? 587 ARG D CD    1 
ATOM   5927  N  NE    . ARG D  4 77  ? -8.244  59.500  -44.428 1.00 161.61 ? 587 ARG D NE    1 
ATOM   5928  C  CZ    . ARG D  4 77  ? -7.768  59.322  -45.656 1.00 166.80 ? 587 ARG D CZ    1 
ATOM   5929  N  NH1   . ARG D  4 77  ? -6.476  59.475  -45.906 1.00 170.80 ? 587 ARG D NH1   1 
ATOM   5930  N  NH2   . ARG D  4 77  ? -8.589  58.982  -46.638 1.00 168.53 ? 587 ARG D NH2   1 
ATOM   5931  N  N     . GLY D  4 78  ? -10.401 58.723  -42.527 1.00 149.66 ? 588 GLY D N     1 
ATOM   5932  C  CA    . GLY D  4 78  ? -10.952 57.464  -42.054 1.00 146.82 ? 588 GLY D CA    1 
ATOM   5933  C  C     . GLY D  4 78  ? -9.942  56.610  -41.321 1.00 140.70 ? 588 GLY D C     1 
ATOM   5934  O  O     . GLY D  4 78  ? -10.162 55.414  -41.119 1.00 135.69 ? 588 GLY D O     1 
ATOM   5935  N  N     . ARG D  4 79  ? -8.808  57.212  -40.962 1.00 135.62 ? 589 ARG D N     1 
ATOM   5936  C  CA    . ARG D  4 79  ? -7.972  56.724  -39.869 1.00 134.07 ? 589 ARG D CA    1 
ATOM   5937  C  C     . ARG D  4 79  ? -7.380  55.347  -40.147 1.00 130.27 ? 589 ARG D C     1 
ATOM   5938  O  O     . ARG D  4 79  ? -7.292  54.525  -39.247 1.00 129.07 ? 589 ARG D O     1 
ATOM   5939  C  CB    . ARG D  4 79  ? -8.772  56.706  -38.561 1.00 134.16 ? 589 ARG D CB    1 
ATOM   5940  C  CG    . ARG D  4 79  ? -7.956  56.795  -37.293 1.00 124.22 ? 589 ARG D CG    1 
ATOM   5941  C  CD    . ARG D  4 79  ? -8.806  56.467  -36.079 1.00 123.55 ? 589 ARG D CD    1 
ATOM   5942  N  NE    . ARG D  4 79  ? -8.084  56.796  -34.864 1.00 120.80 ? 589 ARG D NE    1 
ATOM   5943  C  CZ    . ARG D  4 79  ? -7.092  56.063  -34.375 1.00 119.76 ? 589 ARG D CZ    1 
ATOM   5944  N  NH1   . ARG D  4 79  ? -6.720  54.959  -34.989 1.00 121.07 ? 589 ARG D NH1   1 
ATOM   5945  N  NH2   . ARG D  4 79  ? -6.463  56.425  -33.273 1.00 117.64 ? 589 ARG D NH2   1 
ATOM   5946  N  N     . LYS D  4 80  ? -6.967  55.084  -41.382 1.00 132.82 ? 590 LYS D N     1 
ATOM   5947  C  CA    . LYS D  4 80  ? -6.471  53.747  -41.707 1.00 134.27 ? 590 LYS D CA    1 
ATOM   5948  C  C     . LYS D  4 80  ? -5.312  53.331  -40.798 1.00 131.35 ? 590 LYS D C     1 
ATOM   5949  O  O     . LYS D  4 80  ? -5.520  52.655  -39.786 1.00 129.98 ? 590 LYS D O     1 
ATOM   5950  C  CB    . LYS D  4 80  ? -6.073  53.666  -43.181 1.00 147.28 ? 590 LYS D CB    1 
ATOM   5951  C  CG    . LYS D  4 80  ? -5.825  52.245  -43.668 1.00 139.99 ? 590 LYS D CG    1 
ATOM   5952  C  CD    . LYS D  4 80  ? -5.482  52.210  -45.135 1.00 143.80 ? 590 LYS D CD    1 
ATOM   5953  C  CE    . LYS D  4 80  ? -4.328  51.273  -45.384 1.00 144.25 ? 590 LYS D CE    1 
ATOM   5954  N  NZ    . LYS D  4 80  ? -3.847  51.361  -46.783 1.00 148.06 ? 590 LYS D NZ    1 
ATOM   5955  N  N     . LYS D  4 81  ? -4.082  53.736  -41.128 1.00 130.67 ? 591 LYS D N     1 
ATOM   5956  C  CA    . LYS D  4 81  ? -2.898  53.179  -40.470 1.00 128.67 ? 591 LYS D CA    1 
ATOM   5957  C  C     . LYS D  4 81  ? -2.887  53.413  -38.974 1.00 125.38 ? 591 LYS D C     1 
ATOM   5958  O  O     . LYS D  4 81  ? -1.986  52.941  -38.276 1.00 123.73 ? 591 LYS D O     1 
ATOM   5959  C  CB    . LYS D  4 81  ? -1.623  53.755  -41.069 1.00 128.82 ? 591 LYS D CB    1 
ATOM   5960  C  CG    . LYS D  4 81  ? -0.361  52.998  -40.679 1.00 127.71 ? 591 LYS D CG    1 
ATOM   5961  C  CD    . LYS D  4 81  ? 0.897   53.819  -40.900 1.00 127.34 ? 591 LYS D CD    1 
ATOM   5962  C  CE    . LYS D  4 81  ? 1.093   54.227  -42.357 1.00 130.64 ? 591 LYS D CE    1 
ATOM   5963  N  NZ    . LYS D  4 81  ? 2.196   55.216  -42.546 1.00 130.66 ? 591 LYS D NZ    1 
ATOM   5964  N  N     . GLY D  4 82  ? -3.863  54.119  -38.464 1.00 124.63 ? 592 GLY D N     1 
ATOM   5965  C  CA    . GLY D  4 82  ? -3.864  54.407  -37.055 1.00 121.94 ? 592 GLY D CA    1 
ATOM   5966  C  C     . GLY D  4 82  ? -4.733  53.386  -36.396 1.00 124.70 ? 592 GLY D C     1 
ATOM   5967  O  O     . GLY D  4 82  ? -4.427  52.896  -35.308 1.00 124.94 ? 592 GLY D O     1 
ATOM   5968  N  N     . LYS D  4 83  ? -5.847  53.075  -37.055 1.00 129.96 ? 593 LYS D N     1 
ATOM   5969  C  CA    . LYS D  4 83  ? -6.578  51.883  -36.675 1.00 126.24 ? 593 LYS D CA    1 
ATOM   5970  C  C     . LYS D  4 83  ? -5.640  50.700  -36.743 1.00 126.42 ? 593 LYS D C     1 
ATOM   5971  O  O     . LYS D  4 83  ? -5.276  50.141  -35.709 1.00 138.61 ? 593 LYS D O     1 
ATOM   5972  C  CB    . LYS D  4 83  ? -7.810  51.681  -37.555 1.00 129.52 ? 593 LYS D CB    1 
ATOM   5973  C  CG    . LYS D  4 83  ? -9.056  51.339  -36.746 1.00 130.40 ? 593 LYS D CG    1 
ATOM   5974  C  CD    . LYS D  4 83  ? -10.285 51.136  -37.635 1.00 134.10 ? 593 LYS D CD    1 
ATOM   5975  C  CE    . LYS D  4 83  ? -11.486 50.566  -36.862 1.00 138.54 ? 593 LYS D CE    1 
ATOM   5976  N  NZ    . LYS D  4 83  ? -12.589 50.062  -37.757 1.00 142.06 ? 593 LYS D NZ    1 
ATOM   5977  N  N     . LYS D  4 84  ? -5.124  50.396  -37.940 1.00 128.15 ? 594 LYS D N     1 
ATOM   5978  C  CA    . LYS D  4 84  ? -4.234  49.247  -38.076 1.00 128.54 ? 594 LYS D CA    1 
ATOM   5979  C  C     . LYS D  4 84  ? -3.184  49.220  -36.972 1.00 125.48 ? 594 LYS D C     1 
ATOM   5980  O  O     . LYS D  4 84  ? -3.007  48.192  -36.312 1.00 155.28 ? 594 LYS D O     1 
ATOM   5981  C  CB    . LYS D  4 84  ? -3.573  49.229  -39.449 1.00 130.48 ? 594 LYS D CB    1 
ATOM   5982  C  CG    . LYS D  4 84  ? -2.633  48.049  -39.644 1.00 131.04 ? 594 LYS D CG    1 
ATOM   5983  C  CD    . LYS D  4 84  ? -2.148  47.972  -41.071 1.00 133.76 ? 594 LYS D CD    1 
ATOM   5984  C  CE    . LYS D  4 84  ? -0.931  47.110  -41.188 1.00 133.67 ? 594 LYS D CE    1 
ATOM   5985  N  NZ    . LYS D  4 84  ? -0.359  47.265  -42.549 1.00 136.37 ? 594 LYS D NZ    1 
ATOM   5986  N  N     . LYS D  4 85  ? -2.530  50.348  -36.693 1.00 123.36 ? 595 LYS D N     1 
ATOM   5987  C  CA    . LYS D  4 85  ? -1.598  50.326  -35.567 1.00 120.85 ? 595 LYS D CA    1 
ATOM   5988  C  C     . LYS D  4 85  ? -2.295  50.001  -34.246 1.00 119.97 ? 595 LYS D C     1 
ATOM   5989  O  O     . LYS D  4 85  ? -1.681  49.408  -33.352 1.00 118.87 ? 595 LYS D O     1 
ATOM   5990  C  CB    . LYS D  4 85  ? -0.850  51.650  -35.458 1.00 124.53 ? 595 LYS D CB    1 
ATOM   5991  C  CG    . LYS D  4 85  ? 0.395   51.765  -36.309 1.00 122.39 ? 595 LYS D CG    1 
ATOM   5992  C  CD    . LYS D  4 85  ? 1.082   53.046  -35.939 1.00 122.17 ? 595 LYS D CD    1 
ATOM   5993  C  CE    . LYS D  4 85  ? 2.085   53.492  -36.976 1.00 129.59 ? 595 LYS D CE    1 
ATOM   5994  N  NZ    . LYS D  4 85  ? 2.947   54.610  -36.430 1.00 131.92 ? 595 LYS D NZ    1 
ATOM   5995  N  N     . ASP D  4 86  ? -3.572  50.345  -34.093 1.00 129.16 ? 596 ASP D N     1 
ATOM   5996  C  CA    . ASP D  4 86  ? -4.176  50.056  -32.794 1.00 135.21 ? 596 ASP D CA    1 
ATOM   5997  C  C     . ASP D  4 86  ? -4.766  48.650  -32.706 1.00 131.28 ? 596 ASP D C     1 
ATOM   5998  O  O     . ASP D  4 86  ? -4.671  48.011  -31.656 1.00 128.67 ? 596 ASP D O     1 
ATOM   5999  C  CB    . ASP D  4 86  ? -5.241  51.099  -32.443 1.00 145.19 ? 596 ASP D CB    1 
ATOM   6000  C  CG    . ASP D  4 86  ? -5.400  51.287  -30.932 1.00 145.90 ? 596 ASP D CG    1 
ATOM   6001  O  OD1   . ASP D  4 86  ? -4.368  51.329  -30.222 1.00 146.50 ? 596 ASP D OD1   1 
ATOM   6002  O  OD2   . ASP D  4 86  ? -6.551  51.386  -30.455 1.00 150.06 ? 596 ASP D OD2   1 
ATOM   6003  N  N     . GLN D  4 87  ? -5.409  48.164  -33.763 1.00 124.84 ? 597 GLN D N     1 
ATOM   6004  C  CA    . GLN D  4 87  ? -5.680  46.742  -33.853 1.00 127.07 ? 597 GLN D CA    1 
ATOM   6005  C  C     . GLN D  4 87  ? -4.430  45.955  -33.463 1.00 125.77 ? 597 GLN D C     1 
ATOM   6006  O  O     . GLN D  4 87  ? -4.353  45.402  -32.360 1.00 125.24 ? 597 GLN D O     1 
ATOM   6007  C  CB    . GLN D  4 87  ? -6.139  46.388  -35.268 1.00 130.02 ? 597 GLN D CB    1 
ATOM   6008  C  CG    . GLN D  4 87  ? -7.142  47.351  -35.872 1.00 131.19 ? 597 GLN D CG    1 
ATOM   6009  C  CD    . GLN D  4 87  ? -8.563  47.155  -35.382 1.00 133.18 ? 597 GLN D CD    1 
ATOM   6010  O  OE1   . GLN D  4 87  ? -8.830  47.126  -34.178 1.00 132.16 ? 597 GLN D OE1   1 
ATOM   6011  N  NE2   . GLN D  4 87  ? -9.493  47.056  -36.324 1.00 136.39 ? 597 GLN D NE2   1 
ATOM   6012  N  N     . ILE D  4 88  ? -3.400  45.978  -34.320 1.00 125.33 ? 598 ILE D N     1 
ATOM   6013  C  CA    . ILE D  4 88  ? -2.199  45.187  -34.054 1.00 124.36 ? 598 ILE D CA    1 
ATOM   6014  C  C     . ILE D  4 88  ? -1.703  45.390  -32.640 1.00 121.99 ? 598 ILE D C     1 
ATOM   6015  O  O     . ILE D  4 88  ? -1.120  44.490  -32.037 1.00 121.71 ? 598 ILE D O     1 
ATOM   6016  C  CB    . ILE D  4 88  ? -1.099  45.534  -35.056 1.00 123.99 ? 598 ILE D CB    1 
ATOM   6017  C  CG1   . ILE D  4 88  ? -1.435  44.961  -36.408 1.00 126.98 ? 598 ILE D CG1   1 
ATOM   6018  C  CG2   . ILE D  4 88  ? 0.230   44.995  -34.590 1.00 122.51 ? 598 ILE D CG2   1 
ATOM   6019  C  CD1   . ILE D  4 88  ? -0.638  45.619  -37.483 1.00 140.21 ? 598 ILE D CD1   1 
ATOM   6020  N  N     . GLY D  4 89  ? -1.894  46.573  -32.094 1.00 120.47 ? 599 GLY D N     1 
ATOM   6021  C  CA    . GLY D  4 89  ? -1.481  46.733  -30.720 1.00 118.78 ? 599 GLY D CA    1 
ATOM   6022  C  C     . GLY D  4 89  ? -2.308  45.912  -29.760 1.00 120.02 ? 599 GLY D C     1 
ATOM   6023  O  O     . GLY D  4 89  ? -1.767  45.150  -28.960 1.00 119.81 ? 599 GLY D O     1 
ATOM   6024  N  N     . LYS D  4 90  ? -3.629  46.072  -29.820 1.00 121.58 ? 600 LYS D N     1 
ATOM   6025  C  CA    . LYS D  4 90  ? -4.491  45.368  -28.879 1.00 123.26 ? 600 LYS D CA    1 
ATOM   6026  C  C     . LYS D  4 90  ? -4.325  43.868  -29.037 1.00 142.07 ? 600 LYS D C     1 
ATOM   6027  O  O     . LYS D  4 90  ? -4.072  43.160  -28.059 1.00 138.26 ? 600 LYS D O     1 
ATOM   6028  C  CB    . LYS D  4 90  ? -5.961  45.758  -29.077 1.00 125.13 ? 600 LYS D CB    1 
ATOM   6029  C  CG    . LYS D  4 90  ? -6.268  47.230  -29.131 1.00 123.73 ? 600 LYS D CG    1 
ATOM   6030  C  CD    . LYS D  4 90  ? -7.412  47.483  -30.100 1.00 125.70 ? 600 LYS D CD    1 
ATOM   6031  C  CE    . LYS D  4 90  ? -8.723  46.944  -29.563 1.00 128.49 ? 600 LYS D CE    1 
ATOM   6032  N  NZ    . LYS D  4 90  ? -9.770  46.877  -30.622 1.00 131.13 ? 600 LYS D NZ    1 
ATOM   6033  N  N     . GLY D  4 91  ? -4.452  43.371  -30.269 1.00 145.07 ? 601 GLY D N     1 
ATOM   6034  C  CA    . GLY D  4 91  ? -4.276  41.969  -30.559 1.00 128.35 ? 601 GLY D CA    1 
ATOM   6035  C  C     . GLY D  4 91  ? -3.036  41.421  -29.901 1.00 126.67 ? 601 GLY D C     1 
ATOM   6036  O  O     . GLY D  4 91  ? -3.126  40.700  -28.918 1.00 127.39 ? 601 GLY D O     1 
ATOM   6037  N  N     . THR D  4 92  ? -1.868  41.816  -30.372 1.00 124.62 ? 602 THR D N     1 
ATOM   6038  C  CA    . THR D  4 92  ? -0.634  41.224  -29.882 1.00 123.33 ? 602 THR D CA    1 
ATOM   6039  C  C     . THR D  4 92  ? -0.440  41.350  -28.369 1.00 122.25 ? 602 THR D C     1 
ATOM   6040  O  O     . THR D  4 92  ? 0.531   40.785  -27.864 1.00 121.59 ? 602 THR D O     1 
ATOM   6041  C  CB    . THR D  4 92  ? 0.549   41.835  -30.635 1.00 121.54 ? 602 THR D CB    1 
ATOM   6042  O  OG1   . THR D  4 92  ? 1.660   40.931  -30.620 1.00 121.23 ? 602 THR D OG1   1 
ATOM   6043  C  CG2   . THR D  4 92  ? 0.968   43.160  -30.012 1.00 125.14 ? 602 THR D CG2   1 
ATOM   6044  N  N     . GLN D  4 93  ? -1.308  42.084  -27.662 1.00 135.26 ? 603 GLN D N     1 
ATOM   6045  C  CA    . GLN D  4 93  ? -1.401  42.222  -26.175 1.00 133.80 ? 603 GLN D CA    1 
ATOM   6046  C  C     . GLN D  4 93  ? -1.050  43.634  -25.690 1.00 130.45 ? 603 GLN D C     1 
ATOM   6047  O  O     . GLN D  4 93  ? -1.380  44.024  -24.562 1.00 130.25 ? 603 GLN D O     1 
ATOM   6048  C  CB    . GLN D  4 93  ? -0.541  41.212  -25.401 1.00 137.97 ? 603 GLN D CB    1 
ATOM   6049  C  CG    . GLN D  4 93  ? 0.803   41.756  -24.934 1.00 121.52 ? 603 GLN D CG    1 
ATOM   6050  C  CD    . GLN D  4 93  ? 1.361   41.007  -23.732 1.00 130.98 ? 603 GLN D CD    1 
ATOM   6051  O  OE1   . GLN D  4 93  ? 0.629   40.346  -22.983 1.00 124.55 ? 603 GLN D OE1   1 
ATOM   6052  N  NE2   . GLN D  4 93  ? 2.670   41.108  -23.542 1.00 129.14 ? 603 GLN D NE2   1 
HETATM 6053  O  O3A   . GTP E  1 1   ? -45.409 -58.383 -22.435 1.00 233.46 ? 105 GTP E O3A   1 
HETATM 6054  P  PA    . GTP E  1 1   ? -44.037 -58.832 -22.079 1.00 237.44 ? 105 GTP E PA    1 
HETATM 6055  O  O2A   . GTP E  1 1   ? -42.854 -58.113 -22.620 1.00 235.11 ? 105 GTP E O2A   1 
HETATM 6056  O  "O5'" . GTP E  1 1   ? -43.916 -58.863 -20.488 1.00 238.02 ? 105 GTP E "O5'" 1 
HETATM 6057  C  "C5'" . GTP E  1 1   ? -44.367 -57.775 -19.686 1.00 232.47 ? 105 GTP E "C5'" 1 
HETATM 6058  C  "C4'" . GTP E  1 1   ? -43.760 -57.833 -18.304 1.00 231.05 ? 105 GTP E "C4'" 1 
HETATM 6059  O  "O4'" . GTP E  1 1   ? -42.349 -58.155 -18.427 1.00 234.53 ? 105 GTP E "O4'" 1 
HETATM 6060  C  "C3'" . GTP E  1 1   ? -43.786 -56.542 -17.486 1.00 224.67 ? 105 GTP E "C3'" 1 
HETATM 6061  O  "O3'" . GTP E  1 1   ? -45.003 -56.336 -16.781 1.00 220.90 ? 105 GTP E "O3'" 1 
HETATM 6062  C  "C2'" . GTP E  1 1   ? -42.584 -56.702 -16.568 1.00 224.90 ? 105 GTP E "C2'" 1 
HETATM 6063  O  "O2'" . GTP E  1 1   ? -42.889 -57.557 -15.476 1.00 223.38 ? 105 GTP E "O2'" 1 
HETATM 6064  C  "C1'" . GTP E  1 1   ? -41.598 -57.422 -17.487 1.00 231.61 ? 105 GTP E "C1'" 1 
HETATM 6065  N  N9    . GTP E  1 1   ? -40.749 -56.478 -18.238 1.00 229.94 ? 105 GTP E N9    1 
HETATM 6066  C  C8    . GTP E  1 1   ? -40.493 -56.513 -19.590 1.00 230.37 ? 105 GTP E C8    1 
HETATM 6067  N  N7    . GTP E  1 1   ? -39.706 -55.554 -19.990 1.00 226.92 ? 105 GTP E N7    1 
HETATM 6068  C  C5    . GTP E  1 1   ? -39.422 -54.844 -18.829 1.00 221.95 ? 105 GTP E C5    1 
HETATM 6069  C  C6    . GTP E  1 1   ? -38.616 -53.696 -18.631 1.00 215.95 ? 105 GTP E C6    1 
HETATM 6070  O  O6    . GTP E  1 1   ? -37.972 -53.052 -19.466 1.00 213.19 ? 105 GTP E O6    1 
HETATM 6071  N  N1    . GTP E  1 1   ? -38.601 -53.311 -17.296 1.00 213.06 ? 105 GTP E N1    1 
HETATM 6072  C  C2    . GTP E  1 1   ? -39.278 -53.939 -16.279 1.00 216.05 ? 105 GTP E C2    1 
HETATM 6073  N  N2    . GTP E  1 1   ? -39.145 -53.423 -15.050 1.00 216.35 ? 105 GTP E N2    1 
HETATM 6074  N  N3    . GTP E  1 1   ? -40.031 -55.004 -16.451 1.00 220.51 ? 105 GTP E N3    1 
HETATM 6075  C  C4    . GTP E  1 1   ? -40.055 -55.403 -17.739 1.00 224.31 ? 105 GTP E C4    1 
ATOM   6076  P  P     . G   E  1 2   ? -45.764 -54.915 -16.850 1.00 216.94 ? 106 G   E P     1 
ATOM   6077  O  OP1   . G   E  1 2   ? -47.167 -55.076 -16.391 1.00 215.48 ? 106 G   E OP1   1 
ATOM   6078  O  OP2   . G   E  1 2   ? -45.518 -54.362 -18.200 1.00 218.59 ? 106 G   E OP2   1 
ATOM   6079  O  "O5'" . G   E  1 2   ? -45.013 -53.988 -15.790 1.00 208.15 ? 106 G   E "O5'" 1 
ATOM   6080  C  "C5'" . G   E  1 2   ? -45.621 -53.648 -14.549 1.00 208.45 ? 106 G   E "C5'" 1 
ATOM   6081  C  "C4'" . G   E  1 2   ? -44.770 -52.689 -13.745 1.00 198.47 ? 106 G   E "C4'" 1 
ATOM   6082  O  "O4'" . G   E  1 2   ? -43.372 -53.004 -13.951 1.00 209.21 ? 106 G   E "O4'" 1 
ATOM   6083  C  "C3'" . G   E  1 2   ? -44.873 -51.209 -14.106 1.00 205.30 ? 106 G   E "C3'" 1 
ATOM   6084  O  "O3'" . G   E  1 2   ? -45.980 -50.571 -13.493 1.00 199.67 ? 106 G   E "O3'" 1 
ATOM   6085  C  "C2'" . G   E  1 2   ? -43.533 -50.655 -13.648 1.00 194.68 ? 106 G   E "C2'" 1 
ATOM   6086  O  "O2'" . G   E  1 2   ? -43.530 -50.449 -12.243 1.00 194.37 ? 106 G   E "O2'" 1 
ATOM   6087  C  "C1'" . G   E  1 2   ? -42.601 -51.822 -13.951 1.00 203.83 ? 106 G   E "C1'" 1 
ATOM   6088  N  N9    . G   E  1 2   ? -41.955 -51.699 -15.270 1.00 205.37 ? 106 G   E N9    1 
ATOM   6089  C  C8    . G   E  1 2   ? -42.169 -52.501 -16.367 1.00 214.25 ? 106 G   E C8    1 
ATOM   6090  N  N7    . G   E  1 2   ? -41.442 -52.165 -17.399 1.00 213.60 ? 106 G   E N7    1 
ATOM   6091  C  C5    . G   E  1 2   ? -40.699 -51.085 -16.956 1.00 204.73 ? 106 G   E C5    1 
ATOM   6092  C  C6    . G   E  1 2   ? -39.739 -50.301 -17.637 1.00 203.73 ? 106 G   E C6    1 
ATOM   6093  O  O6    . G   E  1 2   ? -39.301 -50.400 -18.789 1.00 202.90 ? 106 G   E O6    1 
ATOM   6094  N  N1    . G   E  1 2   ? -39.230 -49.321 -16.796 1.00 201.51 ? 106 G   E N1    1 
ATOM   6095  C  C2    . G   E  1 2   ? -39.606 -49.102 -15.492 1.00 202.17 ? 106 G   E C2    1 
ATOM   6096  N  N2    . G   E  1 2   ? -38.998 -48.091 -14.854 1.00 208.42 ? 106 G   E N2    1 
ATOM   6097  N  N3    . G   E  1 2   ? -40.501 -49.828 -14.850 1.00 198.74 ? 106 G   E N3    1 
ATOM   6098  C  C4    . G   E  1 2   ? -41.002 -50.789 -15.642 1.00 201.10 ? 106 G   E C4    1 
ATOM   6099  P  P     . G   E  1 3   ? -46.694 -49.295 -14.168 1.00 188.52 ? 107 G   E P     1 
ATOM   6100  O  OP1   . G   E  1 3   ? -47.841 -48.971 -13.290 1.00 186.91 ? 107 G   E OP1   1 
ATOM   6101  O  OP2   . G   E  1 3   ? -46.934 -49.587 -15.601 1.00 189.08 ? 107 G   E OP2   1 
ATOM   6102  O  "O5'" . G   E  1 3   ? -45.612 -48.120 -14.108 1.00 186.68 ? 107 G   E "O5'" 1 
ATOM   6103  C  "C5'" . G   E  1 3   ? -45.395 -47.378 -12.913 1.00 185.31 ? 107 G   E "C5'" 1 
ATOM   6104  C  "C4'" . G   E  1 3   ? -44.307 -46.336 -13.066 1.00 187.59 ? 107 G   E "C4'" 1 
ATOM   6105  O  "O4'" . G   E  1 3   ? -43.096 -46.964 -13.556 1.00 187.04 ? 107 G   E "O4'" 1 
ATOM   6106  C  "C3'" . G   E  1 3   ? -44.542 -45.200 -14.054 1.00 186.70 ? 107 G   E "C3'" 1 
ATOM   6107  O  "O3'" . G   E  1 3   ? -45.364 -44.161 -13.550 1.00 178.16 ? 107 G   E "O3'" 1 
ATOM   6108  C  "C2'" . G   E  1 3   ? -43.127 -44.728 -14.348 1.00 184.18 ? 107 G   E "C2'" 1 
ATOM   6109  O  "O2'" . G   E  1 3   ? -42.632 -43.917 -13.288 1.00 179.84 ? 107 G   E "O2'" 1 
ATOM   6110  C  "C1'" . G   E  1 3   ? -42.364 -46.047 -14.346 1.00 184.67 ? 107 G   E "C1'" 1 
ATOM   6111  N  N9    . G   E  1 3   ? -42.208 -46.610 -15.701 1.00 185.98 ? 107 G   E N9    1 
ATOM   6112  C  C8    . G   E  1 3   ? -42.913 -47.664 -16.227 1.00 190.54 ? 107 G   E C8    1 
ATOM   6113  N  N7    . G   E  1 3   ? -42.549 -47.961 -17.443 1.00 193.72 ? 107 G   E N7    1 
ATOM   6114  C  C5    . G   E  1 3   ? -41.540 -47.051 -17.740 1.00 194.42 ? 107 G   E C5    1 
ATOM   6115  C  C6    . G   E  1 3   ? -40.763 -46.882 -18.918 1.00 198.86 ? 107 G   E C6    1 
ATOM   6116  O  O6    . G   E  1 3   ? -40.806 -47.528 -19.976 1.00 203.86 ? 107 G   E O6    1 
ATOM   6117  N  N1    . G   E  1 3   ? -39.852 -45.835 -18.789 1.00 186.26 ? 107 G   E N1    1 
ATOM   6118  C  C2    . G   E  1 3   ? -39.697 -45.049 -17.677 1.00 184.43 ? 107 G   E C2    1 
ATOM   6119  N  N2    . G   E  1 3   ? -38.763 -44.090 -17.742 1.00 182.96 ? 107 G   E N2    1 
ATOM   6120  N  N3    . G   E  1 3   ? -40.417 -45.200 -16.577 1.00 184.18 ? 107 G   E N3    1 
ATOM   6121  C  C4    . G   E  1 3   ? -41.314 -46.210 -16.673 1.00 185.78 ? 107 G   E C4    1 
ATOM   6122  P  P     . U   E  1 4   ? -46.329 -43.349 -14.541 1.00 175.63 ? 108 U   E P     1 
ATOM   6123  O  OP1   . U   E  1 4   ? -47.166 -42.458 -13.698 1.00 173.46 ? 108 U   E OP1   1 
ATOM   6124  O  OP2   . U   E  1 4   ? -46.980 -44.318 -15.457 1.00 177.21 ? 108 U   E OP2   1 
ATOM   6125  O  "O5'" . U   E  1 4   ? -45.329 -42.459 -15.408 1.00 174.26 ? 108 U   E "O5'" 1 
ATOM   6126  C  "C5'" . U   E  1 4   ? -44.419 -41.560 -14.788 1.00 176.36 ? 108 U   E "C5'" 1 
ATOM   6127  C  "C4'" . U   E  1 4   ? -43.312 -41.152 -15.729 1.00 175.82 ? 108 U   E "C4'" 1 
ATOM   6128  O  "O4'" . U   E  1 4   ? -42.591 -42.321 -16.187 1.00 175.71 ? 108 U   E "O4'" 1 
ATOM   6129  C  "C3'" . U   E  1 4   ? -43.751 -40.451 -17.006 1.00 174.42 ? 108 U   E "C3'" 1 
ATOM   6130  O  "O3'" . U   E  1 4   ? -43.982 -39.062 -16.810 1.00 167.76 ? 108 U   E "O3'" 1 
ATOM   6131  C  "C2'" . U   E  1 4   ? -42.590 -40.729 -17.954 1.00 172.02 ? 108 U   E "C2'" 1 
ATOM   6132  O  "O2'" . U   E  1 4   ? -41.521 -39.829 -17.714 1.00 170.77 ? 108 U   E "O2'" 1 
ATOM   6133  C  "C1'" . U   E  1 4   ? -42.148 -42.125 -17.509 1.00 175.46 ? 108 U   E "C1'" 1 
ATOM   6134  N  N1    . U   E  1 4   ? -42.656 -43.230 -18.356 1.00 184.44 ? 108 U   E N1    1 
ATOM   6135  C  C2    . U   E  1 4   ? -42.061 -43.444 -19.585 1.00 184.38 ? 108 U   E C2    1 
ATOM   6136  O  O2    . U   E  1 4   ? -41.187 -42.721 -20.031 1.00 184.17 ? 108 U   E O2    1 
ATOM   6137  N  N3    . U   E  1 4   ? -42.567 -44.508 -20.298 1.00 180.91 ? 108 U   E N3    1 
ATOM   6138  C  C4    . U   E  1 4   ? -43.559 -45.384 -19.897 1.00 182.23 ? 108 U   E C4    1 
ATOM   6139  O  O4    . U   E  1 4   ? -43.907 -46.300 -20.644 1.00 184.40 ? 108 U   E O4    1 
ATOM   6140  C  C5    . U   E  1 4   ? -44.098 -45.119 -18.599 1.00 189.78 ? 108 U   E C5    1 
ATOM   6141  C  C6    . U   E  1 4   ? -43.631 -44.082 -17.890 1.00 187.64 ? 108 U   E C6    1 
ATOM   6142  P  P     . G   E  1 5   ? -45.250 -38.334 -17.476 1.00 165.59 ? 109 G   E P     1 
ATOM   6143  O  OP1   . G   E  1 5   ? -45.256 -36.943 -16.971 1.00 162.92 ? 109 G   E OP1   1 
ATOM   6144  O  OP2   . G   E  1 5   ? -46.472 -39.149 -17.302 1.00 174.60 ? 109 G   E OP2   1 
ATOM   6145  O  "O5'" . G   E  1 5   ? -44.909 -38.324 -19.025 1.00 165.65 ? 109 G   E "O5'" 1 
ATOM   6146  C  "C5'" . G   E  1 5   ? -44.737 -37.109 -19.723 1.00 163.26 ? 109 G   E "C5'" 1 
ATOM   6147  C  "C4'" . G   E  1 5   ? -43.717 -37.260 -20.817 1.00 164.01 ? 109 G   E "C4'" 1 
ATOM   6148  O  "O4'" . G   E  1 5   ? -42.904 -38.435 -20.574 1.00 166.85 ? 109 G   E "O4'" 1 
ATOM   6149  C  "C3'" . G   E  1 5   ? -44.258 -37.466 -22.223 1.00 164.43 ? 109 G   E "C3'" 1 
ATOM   6150  O  "O3'" . G   E  1 5   ? -44.643 -36.261 -22.847 1.00 165.47 ? 109 G   E "O3'" 1 
ATOM   6151  C  "C2'" . G   E  1 5   ? -43.108 -38.165 -22.923 1.00 166.52 ? 109 G   E "C2'" 1 
ATOM   6152  O  "O2'" . G   E  1 5   ? -42.099 -37.238 -23.290 1.00 164.99 ? 109 G   E "O2'" 1 
ATOM   6153  C  "C1'" . G   E  1 5   ? -42.574 -39.053 -21.800 1.00 177.69 ? 109 G   E "C1'" 1 
ATOM   6154  N  N9    . G   E  1 5   ? -43.194 -40.395 -21.834 1.00 181.31 ? 109 G   E N9    1 
ATOM   6155  C  C8    . G   E  1 5   ? -43.903 -41.036 -20.844 1.00 182.05 ? 109 G   E C8    1 
ATOM   6156  N  N7    . G   E  1 5   ? -44.327 -42.220 -21.188 1.00 183.93 ? 109 G   E N7    1 
ATOM   6157  C  C5    . G   E  1 5   ? -43.884 -42.371 -22.489 1.00 175.58 ? 109 G   E C5    1 
ATOM   6158  C  C6    . G   E  1 5   ? -44.048 -43.440 -23.393 1.00 178.35 ? 109 G   E C6    1 
ATOM   6159  O  O6    . G   E  1 5   ? -44.620 -44.526 -23.231 1.00 192.53 ? 109 G   E O6    1 
ATOM   6160  N  N1    . G   E  1 5   ? -43.433 -43.164 -24.608 1.00 178.55 ? 109 G   E N1    1 
ATOM   6161  C  C2    . G   E  1 5   ? -42.763 -42.014 -24.917 1.00 176.25 ? 109 G   E C2    1 
ATOM   6162  N  N2    . G   E  1 5   ? -42.238 -41.916 -26.139 1.00 176.88 ? 109 G   E N2    1 
ATOM   6163  N  N3    . G   E  1 5   ? -42.603 -41.020 -24.088 1.00 173.62 ? 109 G   E N3    1 
ATOM   6164  C  C4    . G   E  1 5   ? -43.186 -41.261 -22.903 1.00 182.26 ? 109 G   E C4    1 
ATOM   6165  P  P     . U   E  1 6   ? -46.083 -36.120 -23.535 1.00 165.72 ? 110 U   E P     1 
ATOM   6166  O  OP1   . U   E  1 6   ? -46.397 -34.671 -23.578 1.00 158.54 ? 110 U   E OP1   1 
ATOM   6167  O  OP2   . U   E  1 6   ? -47.040 -37.074 -22.916 1.00 163.06 ? 110 U   E OP2   1 
ATOM   6168  O  "O5'" . U   E  1 6   ? -45.796 -36.595 -25.021 1.00 163.00 ? 110 U   E "O5'" 1 
ATOM   6169  C  "C5'" . U   E  1 6   ? -44.626 -36.146 -25.681 1.00 162.53 ? 110 U   E "C5'" 1 
ATOM   6170  C  "C4'" . U   E  1 6   ? -44.223 -37.103 -26.762 1.00 165.18 ? 110 U   E "C4'" 1 
ATOM   6171  O  "O4'" . U   E  1 6   ? -43.837 -38.372 -26.175 1.00 186.30 ? 110 U   E "O4'" 1 
ATOM   6172  C  "C3'" . U   E  1 6   ? -45.320 -37.470 -27.747 1.00 166.30 ? 110 U   E "C3'" 1 
ATOM   6173  O  "O3'" . U   E  1 6   ? -45.482 -36.501 -28.763 1.00 164.76 ? 110 U   E "O3'" 1 
ATOM   6174  C  "C2'" . U   E  1 6   ? -44.853 -38.817 -28.280 1.00 183.12 ? 110 U   E "C2'" 1 
ATOM   6175  O  "O2'" . U   E  1 6   ? -43.854 -38.636 -29.273 1.00 181.28 ? 110 U   E "O2'" 1 
ATOM   6176  C  "C1'" . U   E  1 6   ? -44.190 -39.432 -27.045 1.00 186.26 ? 110 U   E "C1'" 1 
ATOM   6177  N  N1    . U   E  1 6   ? -45.061 -40.405 -26.329 1.00 186.99 ? 110 U   E N1    1 
ATOM   6178  C  C2    . U   E  1 6   ? -45.457 -41.577 -26.955 1.00 175.19 ? 110 U   E C2    1 
ATOM   6179  O  O2    . U   E  1 6   ? -45.164 -41.873 -28.095 1.00 176.76 ? 110 U   E O2    1 
ATOM   6180  N  N3    . U   E  1 6   ? -46.256 -42.398 -26.206 1.00 176.39 ? 110 U   E N3    1 
ATOM   6181  C  C4    . U   E  1 6   ? -46.676 -42.201 -24.915 1.00 175.05 ? 110 U   E C4    1 
ATOM   6182  O  O4    . U   E  1 6   ? -47.389 -43.033 -24.368 1.00 176.43 ? 110 U   E O4    1 
ATOM   6183  C  C5    . U   E  1 6   ? -46.219 -40.993 -24.326 1.00 172.15 ? 110 U   E C5    1 
ATOM   6184  C  C6    . U   E  1 6   ? -45.451 -40.164 -25.035 1.00 186.29 ? 110 U   E C6    1 
ATOM   6185  P  P     . C   E  1 7   ? -46.749 -35.517 -28.758 1.00 162.58 ? 111 C   E P     1 
ATOM   6186  O  OP1   . C   E  1 7   ? -46.726 -34.822 -30.063 1.00 165.00 ? 111 C   E OP1   1 
ATOM   6187  O  OP2   . C   E  1 7   ? -46.797 -34.750 -27.485 1.00 160.23 ? 111 C   E OP2   1 
ATOM   6188  O  "O5'" . C   E  1 7   ? -48.011 -36.481 -28.794 1.00 164.66 ? 111 C   E "O5'" 1 
ATOM   6189  C  "C5'" . C   E  1 7   ? -48.452 -37.057 -30.011 1.00 166.82 ? 111 C   E "C5'" 1 
ATOM   6190  C  "C4'" . C   E  1 7   ? -49.772 -37.745 -29.816 1.00 168.26 ? 111 C   E "C4'" 1 
ATOM   6191  O  "O4'" . C   E  1 7   ? -49.648 -38.654 -28.701 1.00 169.29 ? 111 C   E "O4'" 1 
ATOM   6192  C  "C3'" . C   E  1 7   ? -50.952 -36.866 -29.435 1.00 166.29 ? 111 C   E "C3'" 1 
ATOM   6193  O  "O3'" . C   E  1 7   ? -51.562 -36.256 -30.558 1.00 166.15 ? 111 C   E "O3'" 1 
ATOM   6194  C  "C2'" . C   E  1 7   ? -51.879 -37.831 -28.716 1.00 167.86 ? 111 C   E "C2'" 1 
ATOM   6195  O  "O2'" . C   E  1 7   ? -52.621 -38.576 -29.665 1.00 170.36 ? 111 C   E "O2'" 1 
ATOM   6196  C  "C1'" . C   E  1 7   ? -50.889 -38.790 -28.058 1.00 169.17 ? 111 C   E "C1'" 1 
ATOM   6197  N  N1    . C   E  1 7   ? -50.717 -38.674 -26.592 1.00 167.87 ? 111 C   E N1    1 
ATOM   6198  C  C2    . C   E  1 7   ? -51.801 -38.825 -25.721 1.00 167.69 ? 111 C   E C2    1 
ATOM   6199  O  O2    . C   E  1 7   ? -52.946 -38.944 -26.180 1.00 168.38 ? 111 C   E O2    1 
ATOM   6200  N  N3    . C   E  1 7   ? -51.582 -38.776 -24.388 1.00 166.80 ? 111 C   E N3    1 
ATOM   6201  C  C4    . C   E  1 7   ? -50.347 -38.644 -23.908 1.00 166.28 ? 111 C   E C4    1 
ATOM   6202  N  N4    . C   E  1 7   ? -50.184 -38.606 -22.582 1.00 165.65 ? 111 C   E N4    1 
ATOM   6203  C  C5    . C   E  1 7   ? -49.221 -38.540 -24.771 1.00 166.53 ? 111 C   E C5    1 
ATOM   6204  C  C6    . C   E  1 7   ? -49.450 -38.580 -26.087 1.00 167.33 ? 111 C   E C6    1 
ATOM   6205  P  P     . C   E  1 8   ? -52.167 -34.768 -30.456 1.00 163.30 ? 112 C   E P     1 
ATOM   6206  O  OP1   . C   E  1 8   ? -52.463 -34.347 -31.843 1.00 163.85 ? 112 C   E OP1   1 
ATOM   6207  O  OP2   . C   E  1 8   ? -51.299 -33.949 -29.570 1.00 160.71 ? 112 C   E OP2   1 
ATOM   6208  O  "O5'" . C   E  1 8   ? -53.584 -34.913 -29.748 1.00 163.52 ? 112 C   E "O5'" 1 
ATOM   6209  C  "C5'" . C   E  1 8   ? -54.707 -35.432 -30.450 1.00 165.62 ? 112 C   E "C5'" 1 
ATOM   6210  C  "C4'" . C   E  1 8   ? -55.944 -35.397 -29.592 1.00 165.38 ? 112 C   E "C4'" 1 
ATOM   6211  O  "O4'" . C   E  1 8   ? -55.679 -36.062 -28.328 1.00 165.37 ? 112 C   E "O4'" 1 
ATOM   6212  C  "C3'" . C   E  1 8   ? -56.419 -34.002 -29.233 1.00 162.85 ? 112 C   E "C3'" 1 
ATOM   6213  O  "O3'" . C   E  1 8   ? -57.822 -34.033 -29.030 1.00 163.59 ? 112 C   E "O3'" 1 
ATOM   6214  C  "C2'" . C   E  1 8   ? -55.775 -33.788 -27.877 1.00 188.81 ? 112 C   E "C2'" 1 
ATOM   6215  O  "O2'" . C   E  1 8   ? -56.374 -32.793 -27.079 1.00 193.45 ? 112 C   E "O2'" 1 
ATOM   6216  C  "C1'" . C   E  1 8   ? -55.922 -35.170 -27.268 1.00 163.05 ? 112 C   E "C1'" 1 
ATOM   6217  N  N1    . C   E  1 8   ? -54.973 -35.433 -26.188 1.00 162.36 ? 112 C   E N1    1 
ATOM   6218  C  C2    . C   E  1 8   ? -55.441 -35.622 -24.887 1.00 162.07 ? 112 C   E C2    1 
ATOM   6219  O  O2    . C   E  1 8   ? -56.653 -35.609 -24.654 1.00 162.41 ? 112 C   E O2    1 
ATOM   6220  N  N3    . C   E  1 8   ? -54.545 -35.835 -23.904 1.00 161.61 ? 112 C   E N3    1 
ATOM   6221  C  C4    . C   E  1 8   ? -53.250 -35.848 -24.182 1.00 161.42 ? 112 C   E C4    1 
ATOM   6222  N  N4    . C   E  1 8   ? -52.385 -36.067 -23.196 1.00 161.20 ? 112 C   E N4    1 
ATOM   6223  C  C5    . C   E  1 8   ? -52.754 -35.647 -25.497 1.00 161.62 ? 112 C   E C5    1 
ATOM   6224  C  C6    . C   E  1 8   ? -53.644 -35.439 -26.465 1.00 162.08 ? 112 C   E C6    1 
ATOM   6225  P  P     . G   E  1 9   ? -58.827 -34.599 -30.134 1.00 166.26 ? 113 G   E P     1 
ATOM   6226  O  OP1   . G   E  1 9   ? -59.394 -35.821 -29.538 1.00 168.16 ? 113 G   E OP1   1 
ATOM   6227  O  OP2   . G   E  1 9   ? -58.215 -34.556 -31.481 1.00 167.13 ? 113 G   E OP2   1 
ATOM   6228  O  "O5'" . G   E  1 9   ? -60.016 -33.542 -30.145 1.00 181.53 ? 113 G   E "O5'" 1 
ATOM   6229  C  "C5'" . G   E  1 9   ? -60.161 -32.624 -31.225 1.00 180.02 ? 113 G   E "C5'" 1 
ATOM   6230  C  "C4'" . G   E  1 9   ? -60.213 -31.183 -30.761 1.00 171.16 ? 113 G   E "C4'" 1 
ATOM   6231  O  "O4'" . G   E  1 9   ? -61.576 -30.685 -30.863 1.00 163.16 ? 113 G   E "O4'" 1 
ATOM   6232  C  "C3'" . G   E  1 9   ? -59.766 -30.923 -29.317 1.00 163.40 ? 113 G   E "C3'" 1 
ATOM   6233  O  "O3'" . G   E  1 9   ? -59.018 -29.712 -29.258 1.00 162.76 ? 113 G   E "O3'" 1 
ATOM   6234  C  "C2'" . G   E  1 9   ? -61.088 -30.717 -28.584 1.00 163.03 ? 113 G   E "C2'" 1 
ATOM   6235  O  "O2'" . G   E  1 9   ? -61.012 -29.891 -27.445 1.00 160.49 ? 113 G   E "O2'" 1 
ATOM   6236  C  "C1'" . G   E  1 9   ? -61.929 -30.054 -29.655 1.00 161.46 ? 113 G   E "C1'" 1 
ATOM   6237  N  N9    . G   E  1 9   ? -63.364 -30.173 -29.415 1.00 162.93 ? 113 G   E N9    1 
ATOM   6238  C  C8    . G   E  1 9   ? -63.954 -29.766 -28.249 1.00 162.00 ? 113 G   E C8    1 
ATOM   6239  N  N7    . G   E  1 9   ? -65.239 -29.933 -28.226 1.00 163.66 ? 113 G   E N7    1 
ATOM   6240  C  C5    . G   E  1 9   ? -65.510 -30.474 -29.463 1.00 165.83 ? 113 G   E C5    1 
ATOM   6241  C  C6    . G   E  1 9   ? -66.757 -30.854 -29.984 1.00 170.76 ? 113 G   E C6    1 
ATOM   6242  O  O6    . G   E  1 9   ? -67.868 -30.785 -29.440 1.00 169.16 ? 113 G   E O6    1 
ATOM   6243  N  N1    . G   E  1 9   ? -66.600 -31.351 -31.265 1.00 175.22 ? 113 G   E N1    1 
ATOM   6244  C  C2    . G   E  1 9   ? -65.408 -31.480 -31.932 1.00 174.26 ? 113 G   E C2    1 
ATOM   6245  N  N2    . G   E  1 9   ? -65.550 -31.985 -33.164 1.00 172.14 ? 113 G   E N2    1 
ATOM   6246  N  N3    . G   E  1 9   ? -64.235 -31.107 -31.466 1.00 167.29 ? 113 G   E N3    1 
ATOM   6247  C  C4    . G   E  1 9   ? -64.368 -30.619 -30.224 1.00 165.44 ? 113 G   E C4    1 
ATOM   6248  P  P     . C   E  1 10  ? -57.882 -29.472 -28.138 1.00 157.52 ? 114 C   E P     1 
ATOM   6249  O  OP1   . C   E  1 10  ? -58.005 -28.054 -27.745 1.00 153.53 ? 114 C   E OP1   1 
ATOM   6250  O  OP2   . C   E  1 10  ? -56.599 -30.016 -28.647 1.00 157.16 ? 114 C   E OP2   1 
ATOM   6251  O  "O5'" . C   E  1 10  ? -58.343 -30.276 -26.842 1.00 159.71 ? 114 C   E "O5'" 1 
ATOM   6252  C  "C5'" . C   E  1 10  ? -58.732 -29.581 -25.665 1.00 155.00 ? 114 C   E "C5'" 1 
ATOM   6253  C  "C4'" . C   E  1 10  ? -59.461 -30.483 -24.702 1.00 156.29 ? 114 C   E "C4'" 1 
ATOM   6254  O  "O4'" . C   E  1 10  ? -58.743 -31.733 -24.547 1.00 157.46 ? 114 C   E "O4'" 1 
ATOM   6255  C  "C3'" . C   E  1 10  ? -59.573 -29.946 -23.293 1.00 154.99 ? 114 C   E "C3'" 1 
ATOM   6256  O  "O3'" . C   E  1 10  ? -60.638 -29.037 -23.171 1.00 154.63 ? 114 C   E "O3'" 1 
ATOM   6257  C  "C2'" . C   E  1 10  ? -59.726 -31.205 -22.451 1.00 161.06 ? 114 C   E "C2'" 1 
ATOM   6258  O  "O2'" . C   E  1 10  ? -61.064 -31.670 -22.488 1.00 163.70 ? 114 C   E "O2'" 1 
ATOM   6259  C  "C1'" . C   E  1 10  ? -58.851 -32.195 -23.218 1.00 157.53 ? 114 C   E "C1'" 1 
ATOM   6260  N  N1    . C   E  1 10  ? -57.476 -32.316 -22.689 1.00 156.67 ? 114 C   E N1    1 
ATOM   6261  C  C2    . C   E  1 10  ? -57.125 -32.594 -21.359 1.00 156.43 ? 114 C   E C2    1 
ATOM   6262  O  O2    . C   E  1 10  ? -57.975 -32.724 -20.471 1.00 156.79 ? 114 C   E O2    1 
ATOM   6263  N  N3    . C   E  1 10  ? -55.807 -32.698 -21.062 1.00 155.91 ? 114 C   E N3    1 
ATOM   6264  C  C4    . C   E  1 10  ? -54.878 -32.558 -22.001 1.00 155.58 ? 114 C   E C4    1 
ATOM   6265  N  N4    . C   E  1 10  ? -53.587 -32.667 -21.683 1.00 155.22 ? 114 C   E N4    1 
ATOM   6266  C  C5    . C   E  1 10  ? -55.216 -32.295 -23.351 1.00 155.77 ? 114 C   E C5    1 
ATOM   6267  C  C6    . C   E  1 10  ? -56.507 -32.191 -23.638 1.00 156.35 ? 114 C   E C6    1 
ATOM   6268  P  P     . A   E  1 11  ? -60.294 -27.515 -22.862 1.00 156.59 ? 115 A   E P     1 
ATOM   6269  O  OP1   . A   E  1 11  ? -61.357 -26.667 -23.454 1.00 164.26 ? 115 A   E OP1   1 
ATOM   6270  O  OP2   . A   E  1 11  ? -58.865 -27.340 -23.206 1.00 152.77 ? 115 A   E OP2   1 
ATOM   6271  O  "O5'" . A   E  1 11  ? -60.379 -27.410 -21.283 1.00 159.66 ? 115 A   E "O5'" 1 
ATOM   6272  C  "C5'" . A   E  1 11  ? -61.572 -27.762 -20.609 1.00 161.10 ? 115 A   E "C5'" 1 
ATOM   6273  C  "C4'" . A   E  1 11  ? -61.299 -28.050 -19.160 1.00 159.04 ? 115 A   E "C4'" 1 
ATOM   6274  O  "O4'" . A   E  1 11  ? -60.349 -29.133 -19.076 1.00 159.59 ? 115 A   E "O4'" 1 
ATOM   6275  C  "C3'" . A   E  1 11  ? -60.664 -26.933 -18.348 1.00 159.97 ? 115 A   E "C3'" 1 
ATOM   6276  O  "O3'" . A   E  1 11  ? -61.630 -26.016 -17.872 1.00 170.10 ? 115 A   E "O3'" 1 
ATOM   6277  C  "C2'" . A   E  1 11  ? -59.956 -27.694 -17.233 1.00 153.05 ? 115 A   E "C2'" 1 
ATOM   6278  O  "O2'" . A   E  1 11  ? -60.878 -28.070 -16.223 1.00 152.55 ? 115 A   E "O2'" 1 
ATOM   6279  C  "C1'" . A   E  1 11  ? -59.520 -28.966 -17.955 1.00 155.50 ? 115 A   E "C1'" 1 
ATOM   6280  N  N9    . A   E  1 11  ? -58.134 -28.943 -18.441 1.00 151.78 ? 115 A   E N9    1 
ATOM   6281  C  C8    . A   E  1 11  ? -57.734 -28.803 -19.748 1.00 151.32 ? 115 A   E C8    1 
ATOM   6282  N  N7    . A   E  1 11  ? -56.440 -28.862 -19.902 1.00 150.66 ? 115 A   E N7    1 
ATOM   6283  C  C5    . A   E  1 11  ? -55.969 -29.068 -18.617 1.00 150.62 ? 115 A   E C5    1 
ATOM   6284  C  C6    . A   E  1 11  ? -54.672 -29.215 -18.126 1.00 150.25 ? 115 A   E C6    1 
ATOM   6285  N  N6    . A   E  1 11  ? -53.592 -29.176 -18.915 1.00 149.75 ? 115 A   E N6    1 
ATOM   6286  N  N1    . A   E  1 11  ? -54.542 -29.405 -16.795 1.00 150.59 ? 115 A   E N1    1 
ATOM   6287  C  C2    . A   E  1 11  ? -55.637 -29.445 -16.020 1.00 151.18 ? 115 A   E C2    1 
ATOM   6288  N  N3    . A   E  1 11  ? -56.912 -29.318 -16.377 1.00 151.52 ? 115 A   E N3    1 
ATOM   6289  C  C4    . A   E  1 11  ? -57.000 -29.126 -17.702 1.00 151.23 ? 115 A   E C4    1 
ATOM   6290  P  P     . C   E  1 12  ? -61.315 -24.453 -17.744 1.00 149.35 ? 116 C   E P     1 
ATOM   6291  O  OP1   . C   E  1 12  ? -62.666 -23.856 -17.572 1.00 150.14 ? 116 C   E OP1   1 
ATOM   6292  O  OP2   . C   E  1 12  ? -60.434 -24.001 -18.846 1.00 148.11 ? 116 C   E OP2   1 
ATOM   6293  O  "O5'" . C   E  1 12  ? -60.504 -24.361 -16.383 1.00 148.71 ? 116 C   E "O5'" 1 
ATOM   6294  C  "C5'" . C   E  1 12  ? -61.107 -24.734 -15.159 1.00 149.78 ? 116 C   E "C5'" 1 
ATOM   6295  C  "C4'" . C   E  1 12  ? -60.082 -24.924 -14.074 1.00 149.43 ? 116 C   E "C4'" 1 
ATOM   6296  O  "O4'" . C   E  1 12  ? -59.273 -26.095 -14.351 1.00 149.83 ? 116 C   E "O4'" 1 
ATOM   6297  C  "C3'" . C   E  1 12  ? -59.061 -23.808 -13.883 1.00 174.47 ? 116 C   E "C3'" 1 
ATOM   6298  O  "O3'" . C   E  1 12  ? -59.574 -22.680 -13.173 1.00 178.38 ? 116 C   E "O3'" 1 
ATOM   6299  C  "C2'" . C   E  1 12  ? -57.925 -24.541 -13.174 1.00 170.65 ? 116 C   E "C2'" 1 
ATOM   6300  O  "O2'" . C   E  1 12  ? -58.233 -24.759 -11.805 1.00 168.96 ? 116 C   E "O2'" 1 
ATOM   6301  C  "C1'" . C   E  1 12  ? -57.959 -25.896 -13.876 1.00 148.96 ? 116 C   E "C1'" 1 
ATOM   6302  N  N1    . C   E  1 12  ? -57.040 -25.930 -15.032 1.00 150.39 ? 116 C   E N1    1 
ATOM   6303  C  C2    . C   E  1 12  ? -55.676 -26.161 -14.851 1.00 149.99 ? 116 C   E C2    1 
ATOM   6304  O  O2    . C   E  1 12  ? -55.226 -26.344 -13.718 1.00 148.09 ? 116 C   E O2    1 
ATOM   6305  N  N3    . C   E  1 12  ? -54.869 -26.177 -15.939 1.00 149.93 ? 116 C   E N3    1 
ATOM   6306  C  C4    . C   E  1 12  ? -55.364 -25.977 -17.158 1.00 150.06 ? 116 C   E C4    1 
ATOM   6307  N  N4    . C   E  1 12  ? -54.527 -26.002 -18.201 1.00 148.14 ? 116 C   E N4    1 
ATOM   6308  C  C5    . C   E  1 12  ? -56.752 -25.739 -17.367 1.00 152.55 ? 116 C   E C5    1 
ATOM   6309  C  C6    . C   E  1 12  ? -57.532 -25.719 -16.285 1.00 153.43 ? 116 C   E C6    1 
ATOM   6310  P  P     . U   E  1 13  ? -58.951 -21.196 -13.319 1.00 145.90 ? 117 U   E P     1 
ATOM   6311  O  OP1   . U   E  1 13  ? -59.817 -20.452 -12.383 1.00 146.58 ? 117 U   E OP1   1 
ATOM   6312  O  OP2   . U   E  1 13  ? -58.803 -20.719 -14.719 1.00 144.80 ? 117 U   E OP2   1 
ATOM   6313  O  "O5'" . U   E  1 13  ? -57.496 -21.312 -12.689 1.00 145.23 ? 117 U   E "O5'" 1 
ATOM   6314  C  "C5'" . U   E  1 13  ? -57.357 -21.612 -11.310 1.00 149.26 ? 117 U   E "C5'" 1 
ATOM   6315  C  "C4'" . U   E  1 13  ? -55.916 -21.676 -10.871 1.00 153.60 ? 117 U   E "C4'" 1 
ATOM   6316  O  "O4'" . U   E  1 13  ? -55.265 -22.824 -11.471 1.00 145.88 ? 117 U   E "O4'" 1 
ATOM   6317  C  "C3'" . U   E  1 13  ? -55.018 -20.519 -11.276 1.00 156.74 ? 117 U   E "C3'" 1 
ATOM   6318  O  "O3'" . U   E  1 13  ? -55.178 -19.334 -10.524 1.00 147.77 ? 117 U   E "O3'" 1 
ATOM   6319  C  "C2'" . U   E  1 13  ? -53.638 -21.140 -11.146 1.00 167.98 ? 117 U   E "C2'" 1 
ATOM   6320  O  "O2'" . U   E  1 13  ? -53.260 -21.259 -9.784  1.00 174.88 ? 117 U   E "O2'" 1 
ATOM   6321  C  "C1'" . U   E  1 13  ? -53.902 -22.530 -11.699 1.00 144.83 ? 117 U   E "C1'" 1 
ATOM   6322  N  N1    . U   E  1 13  ? -53.670 -22.539 -13.151 1.00 143.82 ? 117 U   E N1    1 
ATOM   6323  C  C2    . U   E  1 13  ? -52.369 -22.749 -13.522 1.00 143.25 ? 117 U   E C2    1 
ATOM   6324  O  O2    . U   E  1 13  ? -51.507 -22.933 -12.678 1.00 143.66 ? 117 U   E O2    1 
ATOM   6325  N  N3    . U   E  1 13  ? -52.170 -22.748 -14.887 1.00 142.43 ? 117 U   E N3    1 
ATOM   6326  C  C4    . U   E  1 13  ? -53.130 -22.545 -15.857 1.00 142.21 ? 117 U   E C4    1 
ATOM   6327  O  O4    . U   E  1 13  ? -52.828 -22.570 -17.049 1.00 141.64 ? 117 U   E O4    1 
ATOM   6328  C  C5    . U   E  1 13  ? -54.453 -22.316 -15.368 1.00 142.88 ? 117 U   E C5    1 
ATOM   6329  C  C6    . U   E  1 13  ? -54.675 -22.314 -14.060 1.00 143.61 ? 117 U   E C6    1 
ATOM   6330  P  P     . A   E  1 14  ? -54.701 -17.940 -11.159 1.00 142.37 ? 118 A   E P     1 
ATOM   6331  O  OP1   . A   E  1 14  ? -54.924 -16.959 -10.083 1.00 148.32 ? 118 A   E OP1   1 
ATOM   6332  O  OP2   . A   E  1 14  ? -55.282 -17.699 -12.503 1.00 144.50 ? 118 A   E OP2   1 
ATOM   6333  O  "O5'" . A   E  1 14  ? -53.136 -18.114 -11.367 1.00 144.41 ? 118 A   E "O5'" 1 
ATOM   6334  C  "C5'" . A   E  1 14  ? -52.275 -18.187 -10.248 1.00 147.18 ? 118 A   E "C5'" 1 
ATOM   6335  C  "C4'" . A   E  1 14  ? -50.835 -18.163 -10.669 1.00 147.95 ? 118 A   E "C4'" 1 
ATOM   6336  O  "O4'" . A   E  1 14  ? -50.562 -19.242 -11.590 1.00 151.49 ? 118 A   E "O4'" 1 
ATOM   6337  C  "C3'" . A   E  1 14  ? -50.377 -16.935 -11.428 1.00 152.07 ? 118 A   E "C3'" 1 
ATOM   6338  O  "O3'" . A   E  1 14  ? -50.174 -15.817 -10.587 1.00 155.76 ? 118 A   E "O3'" 1 
ATOM   6339  C  "C2'" . A   E  1 14  ? -49.102 -17.433 -12.101 1.00 151.66 ? 118 A   E "C2'" 1 
ATOM   6340  O  "O2'" . A   E  1 14  ? -48.009 -17.421 -11.193 1.00 154.07 ? 118 A   E "O2'" 1 
ATOM   6341  C  "C1'" . A   E  1 14  ? -49.459 -18.892 -12.400 1.00 150.11 ? 118 A   E "C1'" 1 
ATOM   6342  N  N9    . A   E  1 14  ? -49.755 -19.142 -13.826 1.00 146.72 ? 118 A   E N9    1 
ATOM   6343  C  C8    . A   E  1 14  ? -48.831 -19.527 -14.773 1.00 144.37 ? 118 A   E C8    1 
ATOM   6344  N  N7    . A   E  1 14  ? -49.314 -19.700 -15.971 1.00 143.16 ? 118 A   E N7    1 
ATOM   6345  C  C5    . A   E  1 14  ? -50.651 -19.402 -15.794 1.00 144.54 ? 118 A   E C5    1 
ATOM   6346  C  C6    . A   E  1 14  ? -51.700 -19.403 -16.706 1.00 148.78 ? 118 A   E C6    1 
ATOM   6347  N  N6    . A   E  1 14  ? -51.523 -19.726 -17.990 1.00 148.38 ? 118 A   E N6    1 
ATOM   6348  N  N1    . A   E  1 14  ? -52.923 -19.059 -16.234 1.00 153.42 ? 118 A   E N1    1 
ATOM   6349  C  C2    . A   E  1 14  ? -53.069 -18.739 -14.936 1.00 149.99 ? 118 A   E C2    1 
ATOM   6350  N  N3    . A   E  1 14  ? -52.150 -18.702 -13.977 1.00 146.72 ? 118 A   E N3    1 
ATOM   6351  C  C4    . A   E  1 14  ? -50.951 -19.047 -14.486 1.00 146.21 ? 118 A   E C4    1 
ATOM   6352  P  P     . A   E  1 15  ? -50.176 -14.332 -11.181 1.00 136.94 ? 119 A   E P     1 
ATOM   6353  O  OP1   . A   E  1 15  ? -49.709 -13.562 -10.015 1.00 137.43 ? 119 A   E OP1   1 
ATOM   6354  O  OP2   . A   E  1 15  ? -51.448 -14.004 -11.861 1.00 136.76 ? 119 A   E OP2   1 
ATOM   6355  O  "O5'" . A   E  1 15  ? -49.041 -14.323 -12.299 1.00 135.28 ? 119 A   E "O5'" 1 
ATOM   6356  C  "C5'" . A   E  1 15  ? -47.700 -14.077 -11.922 1.00 134.89 ? 119 A   E "C5'" 1 
ATOM   6357  C  "C4'" . A   E  1 15  ? -46.685 -14.501 -12.954 1.00 133.84 ? 119 A   E "C4'" 1 
ATOM   6358  O  "O4'" . A   E  1 15  ? -46.993 -15.811 -13.484 1.00 134.62 ? 119 A   E "O4'" 1 
ATOM   6359  C  "C3'" . A   E  1 15  ? -46.527 -13.643 -14.193 1.00 131.89 ? 119 A   E "C3'" 1 
ATOM   6360  O  "O3'" . A   E  1 15  ? -45.783 -12.470 -13.961 1.00 130.81 ? 119 A   E "O3'" 1 
ATOM   6361  C  "C2'" . A   E  1 15  ? -45.822 -14.600 -15.140 1.00 131.67 ? 119 A   E "C2'" 1 
ATOM   6362  O  "O2'" . A   E  1 15  ? -44.462 -14.743 -14.768 1.00 131.71 ? 119 A   E "O2'" 1 
ATOM   6363  C  "C1'" . A   E  1 15  ? -46.532 -15.905 -14.814 1.00 133.43 ? 119 A   E "C1'" 1 
ATOM   6364  N  N9    . A   E  1 15  ? -47.686 -16.087 -15.701 1.00 133.37 ? 119 A   E N9    1 
ATOM   6365  C  C8    . A   E  1 15  ? -49.018 -15.933 -15.413 1.00 134.02 ? 119 A   E C8    1 
ATOM   6366  N  N7    . A   E  1 15  ? -49.805 -16.145 -16.437 1.00 133.95 ? 119 A   E N7    1 
ATOM   6367  C  C5    . A   E  1 15  ? -48.924 -16.445 -17.456 1.00 133.17 ? 119 A   E C5    1 
ATOM   6368  C  C6    . A   E  1 15  ? -49.151 -16.771 -18.786 1.00 132.95 ? 119 A   E C6    1 
ATOM   6369  N  N6    . A   E  1 15  ? -50.386 -16.812 -19.286 1.00 133.49 ? 119 A   E N6    1 
ATOM   6370  N  N1    . A   E  1 15  ? -48.068 -17.005 -19.564 1.00 136.71 ? 119 A   E N1    1 
ATOM   6371  C  C2    . A   E  1 15  ? -46.844 -16.947 -19.015 1.00 131.93 ? 119 A   E C2    1 
ATOM   6372  N  N3    . A   E  1 15  ? -46.508 -16.644 -17.763 1.00 132.14 ? 119 A   E N3    1 
ATOM   6373  C  C4    . A   E  1 15  ? -47.612 -16.406 -17.031 1.00 132.77 ? 119 A   E C4    1 
ATOM   6374  P  P     . G   E  1 16  ? -45.828 -11.259 -15.013 1.00 128.85 ? 120 G   E P     1 
ATOM   6375  O  OP1   . G   E  1 16  ? -44.432 -11.065 -15.470 1.00 138.73 ? 120 G   E OP1   1 
ATOM   6376  O  OP2   . G   E  1 16  ? -46.536 -10.120 -14.391 1.00 128.92 ? 120 G   E OP2   1 
ATOM   6377  O  "O5'" . G   E  1 16  ? -46.664 -11.810 -16.254 1.00 128.64 ? 120 G   E "O5'" 1 
ATOM   6378  C  "C5'" . G   E  1 16  ? -46.610 -11.143 -17.509 1.00 127.76 ? 120 G   E "C5'" 1 
ATOM   6379  C  "C4'" . G   E  1 16  ? -45.973 -12.011 -18.564 1.00 129.37 ? 120 G   E "C4'" 1 
ATOM   6380  O  "O4'" . G   E  1 16  ? -46.617 -13.305 -18.548 1.00 130.67 ? 120 G   E "O4'" 1 
ATOM   6381  C  "C3'" . G   E  1 16  ? -46.107 -11.547 -20.013 1.00 130.22 ? 120 G   E "C3'" 1 
ATOM   6382  O  "O3'" . G   E  1 16  ? -45.134 -10.587 -20.394 1.00 133.46 ? 120 G   E "O3'" 1 
ATOM   6383  C  "C2'" . G   E  1 16  ? -45.995 -12.850 -20.790 1.00 131.19 ? 120 G   E "C2'" 1 
ATOM   6384  O  "O2'" . G   E  1 16  ? -44.642 -13.265 -20.872 1.00 131.98 ? 120 G   E "O2'" 1 
ATOM   6385  C  "C1'" . G   E  1 16  ? -46.718 -13.814 -19.859 1.00 131.40 ? 120 G   E "C1'" 1 
ATOM   6386  N  N9    . G   E  1 16  ? -48.144 -14.014 -20.186 1.00 134.26 ? 120 G   E N9    1 
ATOM   6387  C  C8    . G   E  1 16  ? -49.209 -13.894 -19.321 1.00 135.97 ? 120 G   E C8    1 
ATOM   6388  N  N7    . G   E  1 16  ? -50.362 -14.171 -19.861 1.00 137.00 ? 120 G   E N7    1 
ATOM   6389  C  C5    . G   E  1 16  ? -50.035 -14.471 -21.164 1.00 137.47 ? 120 G   E C5    1 
ATOM   6390  C  C6    . G   E  1 16  ? -50.879 -14.818 -22.231 1.00 139.82 ? 120 G   E C6    1 
ATOM   6391  O  O6    . G   E  1 16  ? -52.104 -14.945 -22.226 1.00 142.39 ? 120 G   E O6    1 
ATOM   6392  N  N1    . G   E  1 16  ? -50.156 -15.058 -23.399 1.00 139.29 ? 120 G   E N1    1 
ATOM   6393  C  C2    . G   E  1 16  ? -48.789 -14.964 -23.527 1.00 138.24 ? 120 G   E C2    1 
ATOM   6394  N  N2    . G   E  1 16  ? -48.265 -15.216 -24.742 1.00 139.12 ? 120 G   E N2    1 
ATOM   6395  N  N3    . G   E  1 16  ? -47.994 -14.625 -22.526 1.00 136.63 ? 120 G   E N3    1 
ATOM   6396  C  C4    . G   E  1 16  ? -48.679 -14.397 -21.386 1.00 135.89 ? 120 G   E C4    1 
ATOM   6397  P  P     . U   E  1 17  ? -45.485 -9.409  -21.432 1.00 122.40 ? 121 U   E P     1 
ATOM   6398  O  OP1   . U   E  1 17  ? -44.253 -8.615  -21.645 1.00 120.78 ? 121 U   E OP1   1 
ATOM   6399  O  OP2   . U   E  1 17  ? -46.769 -8.795  -21.039 1.00 122.97 ? 121 U   E OP2   1 
ATOM   6400  O  "O5'" . U   E  1 17  ? -45.763 -10.172 -22.799 1.00 138.15 ? 121 U   E "O5'" 1 
ATOM   6401  C  "C5'" . U   E  1 17  ? -44.711 -10.818 -23.504 1.00 135.98 ? 121 U   E "C5'" 1 
ATOM   6402  C  "C4'" . U   E  1 17  ? -45.170 -11.313 -24.850 1.00 131.09 ? 121 U   E "C4'" 1 
ATOM   6403  O  "O4'" . U   E  1 17  ? -46.206 -12.313 -24.687 1.00 130.21 ? 121 U   E "O4'" 1 
ATOM   6404  C  "C3'" . U   E  1 17  ? -45.804 -10.261 -25.740 1.00 128.46 ? 121 U   E "C3'" 1 
ATOM   6405  O  "O3'" . U   E  1 17  ? -44.844 -9.496  -26.443 1.00 126.43 ? 121 U   E "O3'" 1 
ATOM   6406  C  "C2'" . U   E  1 17  ? -46.683 -11.086 -26.664 1.00 130.38 ? 121 U   E "C2'" 1 
ATOM   6407  O  "O2'" . U   E  1 17  ? -45.904 -11.645 -27.707 1.00 134.88 ? 121 U   E "O2'" 1 
ATOM   6408  C  "C1'" . U   E  1 17  ? -47.122 -12.229 -25.753 1.00 130.41 ? 121 U   E "C1'" 1 
ATOM   6409  N  N1    . U   E  1 17  ? -48.493 -12.047 -25.221 1.00 132.28 ? 121 U   E N1    1 
ATOM   6410  C  C2    . U   E  1 17  ? -49.530 -12.124 -26.124 1.00 133.69 ? 121 U   E C2    1 
ATOM   6411  O  O2    . U   E  1 17  ? -49.366 -12.287 -27.312 1.00 133.75 ? 121 U   E O2    1 
ATOM   6412  N  N3    . U   E  1 17  ? -50.785 -11.961 -25.612 1.00 135.32 ? 121 U   E N3    1 
ATOM   6413  C  C4    . U   E  1 17  ? -51.123 -11.765 -24.300 1.00 136.87 ? 121 U   E C4    1 
ATOM   6414  O  O4    . U   E  1 17  ? -52.315 -11.645 -24.011 1.00 139.57 ? 121 U   E O4    1 
ATOM   6415  C  C5    . U   E  1 17  ? -50.000 -11.718 -23.413 1.00 135.25 ? 121 U   E C5    1 
ATOM   6416  C  C6    . U   E  1 17  ? -48.754 -11.855 -23.888 1.00 132.92 ? 121 U   E C6    1 
ATOM   6417  P  P     . U   E  1 18  ? -45.143 -7.966  -26.824 1.00 127.02 ? 122 U   E P     1 
ATOM   6418  O  OP1   . U   E  1 18  ? -43.926 -7.511  -27.538 1.00 122.61 ? 122 U   E OP1   1 
ATOM   6419  O  OP2   . U   E  1 18  ? -45.584 -7.261  -25.590 1.00 123.52 ? 122 U   E OP2   1 
ATOM   6420  O  "O5'" . U   E  1 18  ? -46.367 -8.037  -27.850 1.00 128.47 ? 122 U   E "O5'" 1 
ATOM   6421  C  "C5'" . U   E  1 18  ? -46.222 -8.635  -29.132 1.00 132.02 ? 122 U   E "C5'" 1 
ATOM   6422  C  "C4'" . U   E  1 18  ? -47.547 -8.763  -29.850 1.00 135.80 ? 122 U   E "C4'" 1 
ATOM   6423  O  "O4'" . U   E  1 18  ? -48.402 -9.692  -29.142 1.00 135.34 ? 122 U   E "O4'" 1 
ATOM   6424  C  "C3'" . U   E  1 18  ? -48.399 -7.508  -29.969 1.00 135.64 ? 122 U   E "C3'" 1 
ATOM   6425  O  "O3'" . U   E  1 18  ? -48.021 -6.675  -31.039 1.00 137.61 ? 122 U   E "O3'" 1 
ATOM   6426  C  "C2'" . U   E  1 18  ? -49.798 -8.058  -30.154 1.00 132.79 ? 122 U   E "C2'" 1 
ATOM   6427  O  "O2'" . U   E  1 18  ? -50.013 -8.447  -31.501 1.00 131.36 ? 122 U   E "O2'" 1 
ATOM   6428  C  "C1'" . U   E  1 18  ? -49.752 -9.300  -29.285 1.00 132.20 ? 122 U   E "C1'" 1 
ATOM   6429  N  N1    . U   E  1 18  ? -50.329 -9.092  -27.953 1.00 129.35 ? 122 U   E N1    1 
ATOM   6430  C  C2    . U   E  1 18  ? -51.695 -9.022  -27.876 1.00 128.35 ? 122 U   E C2    1 
ATOM   6431  O  O2    . U   E  1 18  ? -52.433 -9.058  -28.837 1.00 126.97 ? 122 U   E O2    1 
ATOM   6432  N  N3    . U   E  1 18  ? -52.168 -8.878  -26.615 1.00 130.88 ? 122 U   E N3    1 
ATOM   6433  C  C4    . U   E  1 18  ? -51.427 -8.812  -25.464 1.00 131.78 ? 122 U   E C4    1 
ATOM   6434  O  O4    . U   E  1 18  ? -52.018 -8.678  -24.399 1.00 133.46 ? 122 U   E O4    1 
ATOM   6435  C  C5    . U   E  1 18  ? -50.010 -8.905  -25.634 1.00 129.86 ? 122 U   E C5    1 
ATOM   6436  C  C6    . U   E  1 18  ? -49.516 -9.045  -26.859 1.00 128.32 ? 122 U   E C6    1 
ATOM   6437  P  P     . C   E  1 19  ? -48.353 -5.116  -30.948 1.00 143.46 ? 123 C   E P     1 
ATOM   6438  O  OP1   . C   E  1 19  ? -47.803 -4.561  -32.204 1.00 146.80 ? 123 C   E OP1   1 
ATOM   6439  O  OP2   . C   E  1 19  ? -47.912 -4.616  -29.622 1.00 139.96 ? 123 C   E OP2   1 
ATOM   6440  O  "O5'" . C   E  1 19  ? -49.942 -5.019  -31.044 1.00 143.73 ? 123 C   E "O5'" 1 
ATOM   6441  C  "C5'" . C   E  1 19  ? -50.600 -5.454  -32.214 1.00 146.41 ? 123 C   E "C5'" 1 
ATOM   6442  C  "C4'" . C   E  1 19  ? -52.084 -5.582  -32.020 1.00 151.31 ? 123 C   E "C4'" 1 
ATOM   6443  O  "O4'" . C   E  1 19  ? -52.400 -6.348  -30.837 1.00 156.99 ? 123 C   E "O4'" 1 
ATOM   6444  C  "C3'" . C   E  1 19  ? -52.904 -4.314  -31.857 1.00 150.26 ? 123 C   E "C3'" 1 
ATOM   6445  O  "O3'" . C   E  1 19  ? -53.109 -3.667  -33.102 1.00 146.19 ? 123 C   E "O3'" 1 
ATOM   6446  C  "C2'" . C   E  1 19  ? -54.205 -4.839  -31.255 1.00 159.42 ? 123 C   E "C2'" 1 
ATOM   6447  O  "O2'" . C   E  1 19  ? -55.093 -5.291  -32.265 1.00 166.75 ? 123 C   E "O2'" 1 
ATOM   6448  C  "C1'" . C   E  1 19  ? -53.725 -6.057  -30.451 1.00 162.13 ? 123 C   E "C1'" 1 
ATOM   6449  N  N1    . C   E  1 19  ? -53.855 -5.903  -28.991 1.00 165.28 ? 123 C   E N1    1 
ATOM   6450  C  C2    . C   E  1 19  ? -55.158 -6.042  -28.511 1.00 171.50 ? 123 C   E C2    1 
ATOM   6451  O  O2    . C   E  1 19  ? -56.062 -6.264  -29.322 1.00 174.37 ? 123 C   E O2    1 
ATOM   6452  N  N3    . C   E  1 19  ? -55.411 -5.928  -27.197 1.00 171.57 ? 123 C   E N3    1 
ATOM   6453  C  C4    . C   E  1 19  ? -54.402 -5.691  -26.371 1.00 169.32 ? 123 C   E C4    1 
ATOM   6454  N  N4    . C   E  1 19  ? -54.702 -5.586  -25.077 1.00 167.31 ? 123 C   E N4    1 
ATOM   6455  C  C5    . C   E  1 19  ? -53.057 -5.552  -26.835 1.00 171.04 ? 123 C   E C5    1 
ATOM   6456  C  C6    . C   E  1 19  ? -52.815 -5.667  -28.151 1.00 168.58 ? 123 C   E C6    1 
ATOM   6457  P  P     . G   E  1 20  ? -53.740 -2.195  -33.175 1.00 133.65 ? 124 G   E P     1 
ATOM   6458  O  OP1   . G   E  1 20  ? -53.310 -1.620  -34.472 1.00 125.56 ? 124 G   E OP1   1 
ATOM   6459  O  OP2   . G   E  1 20  ? -53.525 -1.489  -31.891 1.00 123.59 ? 124 G   E OP2   1 
ATOM   6460  O  "O5'" . G   E  1 20  ? -55.298 -2.445  -33.317 1.00 127.38 ? 124 G   E "O5'" 1 
ATOM   6461  C  "C5'" . G   E  1 20  ? -56.218 -1.431  -32.960 1.00 128.31 ? 124 G   E "C5'" 1 
ATOM   6462  C  "C4'" . G   E  1 20  ? -57.608 -1.988  -32.893 1.00 131.54 ? 124 G   E "C4'" 1 
ATOM   6463  O  "O4'" . G   E  1 20  ? -57.577 -3.315  -32.306 1.00 132.59 ? 124 G   E "O4'" 1 
ATOM   6464  C  "C3'" . G   E  1 20  ? -58.600 -1.225  -32.030 1.00 134.83 ? 124 G   E "C3'" 1 
ATOM   6465  O  "O3'" . G   E  1 20  ? -59.163 -0.104  -32.675 1.00 140.11 ? 124 G   E "O3'" 1 
ATOM   6466  C  "C2'" . G   E  1 20  ? -59.615 -2.300  -31.690 1.00 136.33 ? 124 G   E "C2'" 1 
ATOM   6467  O  "O2'" . G   E  1 20  ? -60.433 -2.597  -32.811 1.00 140.38 ? 124 G   E "O2'" 1 
ATOM   6468  C  "C1'" . G   E  1 20  ? -58.691 -3.483  -31.458 1.00 135.75 ? 124 G   E "C1'" 1 
ATOM   6469  N  N9    . G   E  1 20  ? -58.205 -3.518  -30.074 1.00 132.08 ? 124 G   E N9    1 
ATOM   6470  C  C8    . G   E  1 20  ? -56.903 -3.543  -29.647 1.00 129.82 ? 124 G   E C8    1 
ATOM   6471  N  N7    . G   E  1 20  ? -56.803 -3.594  -28.348 1.00 129.57 ? 124 G   E N7    1 
ATOM   6472  C  C5    . G   E  1 20  ? -58.114 -3.590  -27.895 1.00 131.70 ? 124 G   E C5    1 
ATOM   6473  C  C6    . G   E  1 20  ? -58.639 -3.623  -26.575 1.00 133.69 ? 124 G   E C6    1 
ATOM   6474  O  O6    . G   E  1 20  ? -58.032 -3.674  -25.494 1.00 131.69 ? 124 G   E O6    1 
ATOM   6475  N  N1    . G   E  1 20  ? -60.033 -3.621  -26.594 1.00 134.97 ? 124 G   E N1    1 
ATOM   6476  C  C2    . G   E  1 20  ? -60.814 -3.583  -27.724 1.00 136.40 ? 124 G   E C2    1 
ATOM   6477  N  N2    . G   E  1 20  ? -62.138 -3.578  -27.530 1.00 138.83 ? 124 G   E N2    1 
ATOM   6478  N  N3    . G   E  1 20  ? -60.339 -3.551  -28.951 1.00 135.69 ? 124 G   E N3    1 
ATOM   6479  C  C4    . G   E  1 20  ? -58.992 -3.553  -28.958 1.00 133.28 ? 124 G   E C4    1 
ATOM   6480  P  P     . G   E  1 21  ? -59.703 1.131   -31.817 1.00 144.80 ? 125 G   E P     1 
ATOM   6481  O  OP1   . G   E  1 21  ? -60.174 2.173   -32.751 1.00 152.67 ? 125 G   E OP1   1 
ATOM   6482  O  OP2   . G   E  1 21  ? -58.685 1.451   -30.796 1.00 153.76 ? 125 G   E OP2   1 
ATOM   6483  O  "O5'" . G   E  1 21  ? -60.984 0.535   -31.105 1.00 140.90 ? 125 G   E "O5'" 1 
ATOM   6484  C  "C5'" . G   E  1 21  ? -62.187 0.322   -31.816 1.00 138.94 ? 125 G   E "C5'" 1 
ATOM   6485  C  "C4'" . G   E  1 21  ? -63.320 0.256   -30.843 1.00 138.29 ? 125 G   E "C4'" 1 
ATOM   6486  O  "O4'" . G   E  1 21  ? -63.083 -0.839  -29.922 1.00 138.44 ? 125 G   E "O4'" 1 
ATOM   6487  C  "C3'" . G   E  1 21  ? -63.444 1.472   -29.949 1.00 138.52 ? 125 G   E "C3'" 1 
ATOM   6488  O  "O3'" . G   E  1 21  ? -64.174 2.516   -30.553 1.00 140.34 ? 125 G   E "O3'" 1 
ATOM   6489  C  "C2'" . G   E  1 21  ? -64.094 0.898   -28.706 1.00 136.40 ? 125 G   E "C2'" 1 
ATOM   6490  O  "O2'" . G   E  1 21  ? -65.463 0.641   -28.960 1.00 136.85 ? 125 G   E "O2'" 1 
ATOM   6491  C  "C1'" . G   E  1 21  ? -63.391 -0.442  -28.610 1.00 137.24 ? 125 G   E "C1'" 1 
ATOM   6492  N  N9    . G   E  1 21  ? -62.116 -0.350  -27.882 1.00 136.68 ? 125 G   E N9    1 
ATOM   6493  C  C8    . G   E  1 21  ? -60.893 -0.391  -28.486 1.00 137.15 ? 125 G   E C8    1 
ATOM   6494  N  N7    . G   E  1 21  ? -59.891 -0.314  -27.667 1.00 136.62 ? 125 G   E N7    1 
ATOM   6495  C  C5    . G   E  1 21  ? -60.478 -0.233  -26.426 1.00 135.74 ? 125 G   E C5    1 
ATOM   6496  C  C6    . G   E  1 21  ? -59.865 -0.125  -25.160 1.00 134.97 ? 125 G   E C6    1 
ATOM   6497  O  O6    . G   E  1 21  ? -58.665 -0.081  -24.867 1.00 134.90 ? 125 G   E O6    1 
ATOM   6498  N  N1    . G   E  1 21  ? -60.827 -0.063  -24.165 1.00 134.30 ? 125 G   E N1    1 
ATOM   6499  C  C2    . G   E  1 21  ? -62.186 -0.098  -24.371 1.00 134.38 ? 125 G   E C2    1 
ATOM   6500  N  N2    . G   E  1 21  ? -62.974 -0.019  -23.292 1.00 133.75 ? 125 G   E N2    1 
ATOM   6501  N  N3    . G   E  1 21  ? -62.764 -0.201  -25.557 1.00 135.13 ? 125 G   E N3    1 
ATOM   6502  C  C4    . G   E  1 21  ? -61.854 -0.267  -26.537 1.00 135.77 ? 125 G   E C4    1 
ATOM   6503  P  P     . C   E  1 22  ? -63.768 4.046   -30.311 1.00 135.41 ? 126 C   E P     1 
ATOM   6504  O  OP1   . C   E  1 22  ? -64.614 4.730   -31.303 1.00 136.89 ? 126 C   E OP1   1 
ATOM   6505  O  OP2   . C   E  1 22  ? -62.294 4.226   -30.365 1.00 135.30 ? 126 C   E OP2   1 
ATOM   6506  O  "O5'" . C   E  1 22  ? -64.260 4.376   -28.826 1.00 134.35 ? 126 C   E "O5'" 1 
ATOM   6507  C  "C5'" . C   E  1 22  ? -65.616 4.173   -28.446 1.00 134.36 ? 126 C   E "C5'" 1 
ATOM   6508  C  "C4'" . C   E  1 22  ? -65.813 4.211   -26.949 1.00 133.53 ? 126 C   E "C4'" 1 
ATOM   6509  O  "O4'" . C   E  1 22  ? -65.044 3.157   -26.324 1.00 133.68 ? 126 C   E "O4'" 1 
ATOM   6510  C  "C3'" . C   E  1 22  ? -65.347 5.462   -26.228 1.00 138.20 ? 126 C   E "C3'" 1 
ATOM   6511  O  "O3'" . C   E  1 22  ? -66.243 6.550   -26.319 1.00 132.16 ? 126 C   E "O3'" 1 
ATOM   6512  C  "C2'" . C   E  1 22  ? -65.154 4.968   -24.804 1.00 136.07 ? 126 C   E "C2'" 1 
ATOM   6513  O  "O2'" . C   E  1 22  ? -66.400 4.844   -24.139 1.00 134.75 ? 126 C   E "O2'" 1 
ATOM   6514  C  "C1'" . C   E  1 22  ? -64.606 3.572   -25.048 1.00 132.77 ? 126 C   E "C1'" 1 
ATOM   6515  N  N1    . C   E  1 22  ? -63.130 3.544   -25.025 1.00 132.71 ? 126 C   E N1    1 
ATOM   6516  C  C2    . C   E  1 22  ? -62.469 3.571   -23.796 1.00 132.10 ? 126 C   E C2    1 
ATOM   6517  O  O2    . C   E  1 22  ? -63.144 3.635   -22.762 1.00 131.62 ? 126 C   E O2    1 
ATOM   6518  N  N3    . C   E  1 22  ? -61.119 3.528   -23.769 1.00 132.14 ? 126 C   E N3    1 
ATOM   6519  C  C4    . C   E  1 22  ? -60.436 3.454   -24.907 1.00 132.76 ? 126 C   E C4    1 
ATOM   6520  N  N4    . C   E  1 22  ? -59.105 3.402   -24.847 1.00 132.88 ? 126 C   E N4    1 
ATOM   6521  C  C5    . C   E  1 22  ? -61.089 3.426   -26.172 1.00 136.99 ? 126 C   E C5    1 
ATOM   6522  C  C6    . C   E  1 22  ? -62.426 3.474   -26.189 1.00 133.33 ? 126 C   E C6    1 
ATOM   6523  P  P     . A   E  1 23  ? -65.670 8.029   -26.107 1.00 131.40 ? 127 A   E P     1 
ATOM   6524  O  OP1   . A   E  1 23  ? -66.832 8.938   -26.260 1.00 136.42 ? 127 A   E OP1   1 
ATOM   6525  O  OP2   . A   E  1 23  ? -64.475 8.166   -26.984 1.00 131.63 ? 127 A   E OP2   1 
ATOM   6526  O  "O5'" . A   E  1 23  ? -65.146 8.063   -24.594 1.00 130.72 ? 127 A   E "O5'" 1 
ATOM   6527  C  "C5'" . A   E  1 23  ? -66.052 8.160   -23.501 1.00 130.38 ? 127 A   E "C5'" 1 
ATOM   6528  C  "C4'" . A   E  1 23  ? -65.346 8.275   -22.168 1.00 129.83 ? 127 A   E "C4'" 1 
ATOM   6529  O  "O4'" . A   E  1 23  ? -64.523 7.100   -21.967 1.00 130.05 ? 127 A   E "O4'" 1 
ATOM   6530  C  "C3'" . A   E  1 23  ? -64.389 9.451   -21.969 1.00 139.47 ? 127 A   E "C3'" 1 
ATOM   6531  O  "O3'" . A   E  1 23  ? -65.047 10.629  -21.535 1.00 139.63 ? 127 A   E "O3'" 1 
ATOM   6532  C  "C2'" . A   E  1 23  ? -63.408 8.916   -20.939 1.00 138.16 ? 127 A   E "C2'" 1 
ATOM   6533  O  "O2'" . A   E  1 23  ? -63.992 8.965   -19.641 1.00 128.87 ? 127 A   E "O2'" 1 
ATOM   6534  C  "C1'" . A   E  1 23  ? -63.308 7.454   -21.352 1.00 129.69 ? 127 A   E "C1'" 1 
ATOM   6535  N  N9    . A   E  1 23  ? -62.243 7.169   -22.326 1.00 130.08 ? 127 A   E N9    1 
ATOM   6536  C  C8    . A   E  1 23  ? -62.421 7.055   -23.675 1.00 130.61 ? 127 A   E C8    1 
ATOM   6537  N  N7    . A   E  1 23  ? -61.333 6.734   -24.319 1.00 131.00 ? 127 A   E N7    1 
ATOM   6538  C  C5    . A   E  1 23  ? -60.382 6.605   -23.326 1.00 130.72 ? 127 A   E C5    1 
ATOM   6539  C  C6    . A   E  1 23  ? -59.024 6.271   -23.362 1.00 135.17 ? 127 A   E C6    1 
ATOM   6540  N  N6    . A   E  1 23  ? -58.354 6.011   -24.482 1.00 137.47 ? 127 A   E N6    1 
ATOM   6541  N  N1    . A   E  1 23  ? -58.354 6.231   -22.197 1.00 130.65 ? 127 A   E N1    1 
ATOM   6542  C  C2    . A   E  1 23  ? -59.014 6.506   -21.072 1.00 130.09 ? 127 A   E C2    1 
ATOM   6543  N  N3    . A   E  1 23  ? -60.296 6.823   -20.919 1.00 129.82 ? 127 A   E N3    1 
ATOM   6544  C  C4    . A   E  1 23  ? -60.930 6.861   -22.093 1.00 130.15 ? 127 A   E C4    1 
ATOM   6545  P  P     . U   E  1 24  ? -64.356 12.071  -21.690 1.00 128.82 ? 128 U   E P     1 
ATOM   6546  O  OP1   . U   E  1 24  ? -65.314 12.992  -21.051 1.00 128.65 ? 128 U   E OP1   1 
ATOM   6547  O  OP2   . U   E  1 24  ? -63.859 12.289  -23.062 1.00 129.08 ? 128 U   E OP2   1 
ATOM   6548  O  "O5'" . U   E  1 24  ? -63.043 12.026  -20.811 1.00 128.59 ? 128 U   E "O5'" 1 
ATOM   6549  C  "C5'" . U   E  1 24  ? -63.099 12.453  -19.467 1.00 128.32 ? 128 U   E "C5'" 1 
ATOM   6550  C  "C4'" . U   E  1 24  ? -61.757 12.350  -18.808 1.00 128.24 ? 128 U   E "C4'" 1 
ATOM   6551  O  "O4'" . U   E  1 24  ? -61.042 11.218  -19.365 1.00 128.46 ? 128 U   E "O4'" 1 
ATOM   6552  C  "C3'" . U   E  1 24  ? -60.849 13.576  -18.972 1.00 131.60 ? 128 U   E "C3'" 1 
ATOM   6553  O  "O3'" . U   E  1 24  ? -60.361 14.042  -17.712 1.00 128.14 ? 128 U   E "O3'" 1 
ATOM   6554  C  "C2'" . U   E  1 24  ? -59.691 13.063  -19.840 1.00 128.46 ? 128 U   E "C2'" 1 
ATOM   6555  O  "O2'" . U   E  1 24  ? -58.437 13.649  -19.553 1.00 128.53 ? 128 U   E "O2'" 1 
ATOM   6556  C  "C1'" . U   E  1 24  ? -59.693 11.564  -19.543 1.00 131.81 ? 128 U   E "C1'" 1 
ATOM   6557  N  N1    . U   E  1 24  ? -59.119 10.759  -20.631 1.00 130.05 ? 128 U   E N1    1 
ATOM   6558  C  C2    . U   E  1 24  ? -57.832 10.259  -20.481 1.00 129.16 ? 128 U   E C2    1 
ATOM   6559  O  O2    . U   E  1 24  ? -57.158 10.390  -19.478 1.00 132.33 ? 128 U   E O2    1 
ATOM   6560  N  N3    . U   E  1 24  ? -57.341 9.558   -21.547 1.00 129.65 ? 128 U   E N3    1 
ATOM   6561  C  C4    . U   E  1 24  ? -57.980 9.314   -22.738 1.00 129.94 ? 128 U   E C4    1 
ATOM   6562  O  O4    . U   E  1 24  ? -57.394 8.664   -23.601 1.00 130.50 ? 128 U   E O4    1 
ATOM   6563  C  C5    . U   E  1 24  ? -59.297 9.867   -22.830 1.00 132.49 ? 128 U   E C5    1 
ATOM   6564  C  C6    . U   E  1 24  ? -59.805 10.566  -21.804 1.00 130.82 ? 128 U   E C6    1 
ATOM   6565  P  P     . C   E  1 25  ? -60.626 15.570  -17.283 1.00 128.17 ? 129 C   E P     1 
ATOM   6566  O  OP1   . C   E  1 25  ? -61.682 16.129  -18.152 1.00 129.52 ? 129 C   E OP1   1 
ATOM   6567  O  OP2   . C   E  1 25  ? -59.328 16.278  -17.167 1.00 128.34 ? 129 C   E OP2   1 
ATOM   6568  O  "O5'" . C   E  1 25  ? -61.301 15.460  -15.848 1.00 128.11 ? 129 C   E "O5'" 1 
ATOM   6569  C  "C5'" . C   E  1 25  ? -62.612 14.933  -15.693 1.00 128.03 ? 129 C   E "C5'" 1 
ATOM   6570  C  "C4'" . C   E  1 25  ? -63.266 15.386  -14.405 1.00 134.21 ? 129 C   E "C4'" 1 
ATOM   6571  O  "O4'" . C   E  1 25  ? -62.584 14.825  -13.255 1.00 137.46 ? 129 C   E "O4'" 1 
ATOM   6572  C  "C3'" . C   E  1 25  ? -63.262 16.872  -14.123 1.00 133.92 ? 129 C   E "C3'" 1 
ATOM   6573  O  "O3'" . C   E  1 25  ? -64.256 17.562  -14.831 1.00 128.48 ? 129 C   E "O3'" 1 
ATOM   6574  C  "C2'" . C   E  1 25  ? -63.464 16.922  -12.617 1.00 128.55 ? 129 C   E "C2'" 1 
ATOM   6575  O  "O2'" . C   E  1 25  ? -64.816 16.638  -12.293 1.00 128.60 ? 129 C   E "O2'" 1 
ATOM   6576  C  "C1'" . C   E  1 25  ? -62.633 15.738  -12.174 1.00 128.35 ? 129 C   E "C1'" 1 
ATOM   6577  N  N1    . C   E  1 25  ? -61.250 16.089  -11.761 1.00 128.51 ? 129 C   E N1    1 
ATOM   6578  C  C2    . C   E  1 25  ? -61.034 16.366  -10.416 1.00 128.79 ? 129 C   E C2    1 
ATOM   6579  O  O2    . C   E  1 25  ? -62.002 16.358  -9.654  1.00 128.89 ? 129 C   E O2    1 
ATOM   6580  N  N3    . C   E  1 25  ? -59.786 16.639  -9.970  1.00 129.04 ? 129 C   E N3    1 
ATOM   6581  C  C4    . C   E  1 25  ? -58.750 16.639  -10.804 1.00 129.00 ? 129 C   E C4    1 
ATOM   6582  N  N4    . C   E  1 25  ? -57.540 16.917  -10.301 1.00 138.27 ? 129 C   E N4    1 
ATOM   6583  C  C5    . C   E  1 25  ? -58.926 16.356  -12.188 1.00 128.71 ? 129 C   E C5    1 
ATOM   6584  C  C6    . C   E  1 25  ? -60.173 16.088  -12.610 1.00 128.47 ? 129 C   E C6    1 
ATOM   6585  P  P     . A   E  1 26  ? -64.066 19.117  -15.064 1.00 128.78 ? 130 A   E P     1 
ATOM   6586  O  OP1   . A   E  1 26  ? -65.443 19.636  -15.212 1.00 128.99 ? 130 A   E OP1   1 
ATOM   6587  O  OP2   . A   E  1 26  ? -63.025 19.267  -16.103 1.00 128.68 ? 130 A   E OP2   1 
ATOM   6588  O  "O5'" . A   E  1 26  ? -63.432 19.644  -13.699 1.00 129.08 ? 130 A   E "O5'" 1 
ATOM   6589  C  "C5'" . A   E  1 26  ? -63.817 20.884  -13.124 1.00 131.45 ? 130 A   E "C5'" 1 
ATOM   6590  C  "C4'" . A   E  1 26  ? -63.955 20.771  -11.624 1.00 134.81 ? 130 A   E "C4'" 1 
ATOM   6591  O  "O4'" . A   E  1 26  ? -63.166 19.662  -11.137 1.00 129.57 ? 130 A   E "O4'" 1 
ATOM   6592  C  "C3'" . A   E  1 26  ? -63.482 21.951  -10.789 1.00 138.22 ? 130 A   E "C3'" 1 
ATOM   6593  O  "O3'" . A   E  1 26  ? -64.412 23.008  -10.741 1.00 133.92 ? 130 A   E "O3'" 1 
ATOM   6594  C  "C2'" . A   E  1 26  ? -63.193 21.310  -9.438  1.00 130.67 ? 130 A   E "C2'" 1 
ATOM   6595  O  "O2'" . A   E  1 26  ? -64.400 21.039  -8.743  1.00 130.81 ? 130 A   E "O2'" 1 
ATOM   6596  C  "C1'" . A   E  1 26  ? -62.609 19.976  -9.877  1.00 129.99 ? 130 A   E "C1'" 1 
ATOM   6597  N  N9    . A   E  1 26  ? -61.147 19.994  -10.033 1.00 130.00 ? 130 A   E N9    1 
ATOM   6598  C  C8    . A   E  1 26  ? -60.455 19.860  -11.207 1.00 129.70 ? 130 A   E C8    1 
ATOM   6599  N  N7    . A   E  1 26  ? -59.158 19.877  -11.065 1.00 129.87 ? 130 A   E N7    1 
ATOM   6600  C  C5    . A   E  1 26  ? -58.994 20.021  -9.711  1.00 130.28 ? 130 A   E C5    1 
ATOM   6601  C  C6    . A   E  1 26  ? -57.851 20.108  -8.936  1.00 130.70 ? 130 A   E C6    1 
ATOM   6602  N  N6    . A   E  1 26  ? -56.631 20.051  -9.455  1.00 130.75 ? 130 A   E N6    1 
ATOM   6603  N  N1    . A   E  1 26  ? -58.011 20.268  -7.611  1.00 131.17 ? 130 A   E N1    1 
ATOM   6604  C  C2    . A   E  1 26  ? -59.252 20.321  -7.125  1.00 131.19 ? 130 A   E C2    1 
ATOM   6605  N  N3    . A   E  1 26  ? -60.412 20.243  -7.763  1.00 130.82 ? 130 A   E N3    1 
ATOM   6606  C  C4    . A   E  1 26  ? -60.202 20.106  -9.066  1.00 130.38 ? 130 A   E C4    1 
ATOM   6607  P  P     . A   E  1 27  ? -63.907 24.513  -10.910 1.00 131.72 ? 131 A   E P     1 
ATOM   6608  O  OP1   . A   E  1 27  ? -65.033 25.176  -11.611 1.00 131.89 ? 131 A   E OP1   1 
ATOM   6609  O  OP2   . A   E  1 27  ? -62.513 24.586  -11.438 1.00 131.56 ? 131 A   E OP2   1 
ATOM   6610  O  "O5'" . A   E  1 27  ? -63.834 25.003  -9.405  1.00 132.53 ? 131 A   E "O5'" 1 
ATOM   6611  C  "C5'" . A   E  1 27  ? -64.841 24.615  -8.486  1.00 132.73 ? 131 A   E "C5'" 1 
ATOM   6612  C  "C4'" . A   E  1 27  ? -64.327 24.637  -7.071  1.00 137.11 ? 131 A   E "C4'" 1 
ATOM   6613  O  "O4'" . A   E  1 27  ? -63.358 23.582  -6.892  1.00 136.10 ? 131 A   E "O4'" 1 
ATOM   6614  C  "C3'" . A   E  1 27  ? -63.598 25.898  -6.635  1.00 136.41 ? 131 A   E "C3'" 1 
ATOM   6615  O  "O3'" . A   E  1 27  ? -64.488 26.886  -6.178  1.00 136.19 ? 131 A   E "O3'" 1 
ATOM   6616  C  "C2'" . A   E  1 27  ? -62.663 25.400  -5.544  1.00 136.33 ? 131 A   E "C2'" 1 
ATOM   6617  O  "O2'" . A   E  1 27  ? -63.358 25.253  -4.319  1.00 135.02 ? 131 A   E "O2'" 1 
ATOM   6618  C  "C1'" . A   E  1 27  ? -62.310 24.015  -6.060  1.00 137.09 ? 131 A   E "C1'" 1 
ATOM   6619  N  N9    . A   E  1 27  ? -61.075 23.991  -6.845  1.00 135.08 ? 131 A   E N9    1 
ATOM   6620  C  C8    . A   E  1 27  ? -60.934 23.829  -8.201  1.00 136.29 ? 131 A   E C8    1 
ATOM   6621  N  N7    . A   E  1 27  ? -59.689 23.831  -8.592  1.00 133.68 ? 131 A   E N7    1 
ATOM   6622  C  C5    . A   E  1 27  ? -58.986 23.987  -7.409  1.00 132.98 ? 131 A   E C5    1 
ATOM   6623  C  C6    . A   E  1 27  ? -57.625 24.072  -7.147  1.00 133.34 ? 131 A   E C6    1 
ATOM   6624  N  N6    . A   E  1 27  ? -56.710 23.995  -8.112  1.00 137.37 ? 131 A   E N6    1 
ATOM   6625  N  N1    . A   E  1 27  ? -57.253 24.241  -5.863  1.00 134.09 ? 131 A   E N1    1 
ATOM   6626  C  C2    . A   E  1 27  ? -58.197 24.336  -4.921  1.00 134.44 ? 131 A   E C2    1 
ATOM   6627  N  N3    . A   E  1 27  ? -59.512 24.254  -5.043  1.00 134.16 ? 131 A   E N3    1 
ATOM   6628  C  C4    . A   E  1 27  ? -59.827 24.096  -6.329  1.00 133.48 ? 131 A   E C4    1 
ATOM   6629  P  P     . U   E  1 28  ? -64.240 28.414  -6.539  1.00 136.09 ? 132 U   E P     1 
ATOM   6630  O  OP1   . U   E  1 28  ? -64.533 29.132  -5.280  1.00 137.37 ? 132 U   E OP1   1 
ATOM   6631  O  OP2   . U   E  1 28  ? -64.920 28.724  -7.824  1.00 135.68 ? 132 U   E OP2   1 
ATOM   6632  O  "O5'" . U   E  1 28  ? -62.677 28.513  -6.778  1.00 135.99 ? 132 U   E "O5'" 1 
ATOM   6633  C  "C5'" . U   E  1 28  ? -61.957 29.572  -6.190  1.00 137.13 ? 132 U   E "C5'" 1 
ATOM   6634  C  "C4'" . U   E  1 28  ? -60.907 29.056  -5.255  1.00 137.32 ? 132 U   E "C4'" 1 
ATOM   6635  O  "O4'" . U   E  1 28  ? -60.409 27.809  -5.772  1.00 136.12 ? 132 U   E "O4'" 1 
ATOM   6636  C  "C3'" . U   E  1 28  ? -59.683 29.945  -5.129  1.00 166.12 ? 132 U   E "C3'" 1 
ATOM   6637  O  "O3'" . U   E  1 28  ? -59.853 30.902  -4.101  1.00 169.26 ? 132 U   E "O3'" 1 
ATOM   6638  C  "C2'" . U   E  1 28  ? -58.544 28.970  -4.863  1.00 137.72 ? 132 U   E "C2'" 1 
ATOM   6639  O  "O2'" . U   E  1 28  ? -58.436 28.679  -3.484  1.00 138.36 ? 132 U   E "O2'" 1 
ATOM   6640  C  "C1'" . U   E  1 28  ? -59.019 27.720  -5.591  1.00 136.29 ? 132 U   E "C1'" 1 
ATOM   6641  N  N1    . U   E  1 28  ? -58.374 27.430  -6.886  1.00 135.48 ? 132 U   E N1    1 
ATOM   6642  C  C2    . U   E  1 28  ? -57.003 27.341  -6.995  1.00 135.59 ? 132 U   E C2    1 
ATOM   6643  O  O2    . U   E  1 28  ? -56.234 27.552  -6.075  1.00 136.38 ? 132 U   E O2    1 
ATOM   6644  N  N3    . U   E  1 28  ? -56.570 26.988  -8.253  1.00 147.96 ? 132 U   E N3    1 
ATOM   6645  C  C4    . U   E  1 28  ? -57.332 26.710  -9.378  1.00 148.03 ? 132 U   E C4    1 
ATOM   6646  O  O4    . U   E  1 28  ? -56.790 26.409  -10.446 1.00 145.71 ? 132 U   E O4    1 
ATOM   6647  C  C5    . U   E  1 28  ? -58.737 26.803  -9.166  1.00 150.55 ? 132 U   E C5    1 
ATOM   6648  C  C6    . U   E  1 28  ? -59.189 27.143  -7.956  1.00 151.90 ? 132 U   E C6    1 
ATOM   6649  P  P     . A   E  1 29  ? -60.124 32.439  -4.462  1.00 140.76 ? 133 A   E P     1 
ATOM   6650  O  OP1   . A   E  1 29  ? -61.111 32.902  -3.463  1.00 141.83 ? 133 A   E OP1   1 
ATOM   6651  O  OP2   . A   E  1 29  ? -60.355 32.626  -5.916  1.00 139.94 ? 133 A   E OP2   1 
ATOM   6652  O  "O5'" . A   E  1 29  ? -58.744 33.132  -4.133  1.00 141.79 ? 133 A   E "O5'" 1 
ATOM   6653  C  "C5'" . A   E  1 29  ? -58.298 33.195  -2.797  1.00 142.89 ? 133 A   E "C5'" 1 
ATOM   6654  C  "C4'" . A   E  1 29  ? -56.823 33.448  -2.733  1.00 143.44 ? 133 A   E "C4'" 1 
ATOM   6655  O  "O4'" . A   E  1 29  ? -56.113 32.228  -3.053  1.00 142.18 ? 133 A   E "O4'" 1 
ATOM   6656  C  "C3'" . A   E  1 29  ? -56.256 34.458  -3.720  1.00 154.29 ? 133 A   E "C3'" 1 
ATOM   6657  O  "O3'" . A   E  1 29  ? -56.469 35.822  -3.388  1.00 154.16 ? 133 A   E "O3'" 1 
ATOM   6658  C  "C2'" . A   E  1 29  ? -54.794 34.052  -3.764  1.00 152.94 ? 133 A   E "C2'" 1 
ATOM   6659  O  "O2'" . A   E  1 29  ? -54.128 34.453  -2.576  1.00 151.98 ? 133 A   E "O2'" 1 
ATOM   6660  C  "C1'" . A   E  1 29  ? -54.921 32.537  -3.735  1.00 142.27 ? 133 A   E "C1'" 1 
ATOM   6661  N  N9    . A   E  1 29  ? -55.039 32.019  -5.102  1.00 140.83 ? 133 A   E N9    1 
ATOM   6662  C  C8    . A   E  1 29  ? -56.193 31.738  -5.783  1.00 139.86 ? 133 A   E C8    1 
ATOM   6663  N  N7    . A   E  1 29  ? -55.973 31.303  -6.995  1.00 138.80 ? 133 A   E N7    1 
ATOM   6664  C  C5    . A   E  1 29  ? -54.597 31.305  -7.114  1.00 139.07 ? 133 A   E C5    1 
ATOM   6665  C  C6    . A   E  1 29  ? -53.763 30.950  -8.172  1.00 138.41 ? 133 A   E C6    1 
ATOM   6666  N  N6    . A   E  1 29  ? -54.243 30.508  -9.337  1.00 137.31 ? 133 A   E N6    1 
ATOM   6667  N  N1    . A   E  1 29  ? -52.431 31.072  -7.977  1.00 139.05 ? 133 A   E N1    1 
ATOM   6668  C  C2    . A   E  1 29  ? -51.984 31.522  -6.796  1.00 141.13 ? 133 A   E C2    1 
ATOM   6669  N  N3    . A   E  1 29  ? -52.687 31.887  -5.726  1.00 141.00 ? 133 A   E N3    1 
ATOM   6670  C  C4    . A   E  1 29  ? -54.002 31.749  -5.955  1.00 140.32 ? 133 A   E C4    1 
ATOM   6671  P  P     . U   E  1 30  ? -56.616 36.930  -4.545  1.00 145.65 ? 134 U   E P     1 
ATOM   6672  O  OP1   . U   E  1 30  ? -56.770 38.215  -3.842  1.00 147.59 ? 134 U   E OP1   1 
ATOM   6673  O  OP2   . U   E  1 30  ? -57.645 36.546  -5.537  1.00 144.30 ? 134 U   E OP2   1 
ATOM   6674  O  "O5'" . U   E  1 30  ? -55.223 36.898  -5.307  1.00 145.34 ? 134 U   E "O5'" 1 
ATOM   6675  C  "C5'" . U   E  1 30  ? -54.020 37.249  -4.647  1.00 146.55 ? 134 U   E "C5'" 1 
ATOM   6676  C  "C4'" . U   E  1 30  ? -52.816 36.840  -5.455  1.00 145.87 ? 134 U   E "C4'" 1 
ATOM   6677  O  "O4'" . U   E  1 30  ? -52.900 35.436  -5.811  1.00 144.47 ? 134 U   E "O4'" 1 
ATOM   6678  C  "C3'" . U   E  1 30  ? -52.632 37.518  -6.798  1.00 154.28 ? 134 U   E "C3'" 1 
ATOM   6679  O  "O3'" . U   E  1 30  ? -52.160 38.843  -6.706  1.00 152.39 ? 134 U   E "O3'" 1 
ATOM   6680  C  "C2'" . U   E  1 30  ? -51.676 36.564  -7.501  1.00 144.50 ? 134 U   E "C2'" 1 
ATOM   6681  O  "O2'" . U   E  1 30  ? -50.364 36.676  -6.976  1.00 145.49 ? 134 U   E "O2'" 1 
ATOM   6682  C  "C1'" . U   E  1 30  ? -52.238 35.220  -7.048  1.00 143.31 ? 134 U   E "C1'" 1 
ATOM   6683  N  N1    . U   E  1 30  ? -53.174 34.635  -8.042  1.00 145.68 ? 134 U   E N1    1 
ATOM   6684  C  C2    . U   E  1 30  ? -52.612 34.047  -9.171  1.00 147.16 ? 134 U   E C2    1 
ATOM   6685  O  O2    . U   E  1 30  ? -51.409 33.997  -9.368  1.00 149.18 ? 134 U   E O2    1 
ATOM   6686  N  N3    . U   E  1 30  ? -53.493 33.513  -10.083 1.00 139.49 ? 134 U   E N3    1 
ATOM   6687  C  C4    . U   E  1 30  ? -54.874 33.511  -9.967  1.00 139.16 ? 134 U   E C4    1 
ATOM   6688  O  O4    . U   E  1 30  ? -55.565 32.998  -10.847 1.00 138.09 ? 134 U   E O4    1 
ATOM   6689  C  C5    . U   E  1 30  ? -55.380 34.127  -8.779  1.00 145.15 ? 134 U   E C5    1 
ATOM   6690  C  C6    . U   E  1 30  ? -54.541 34.656  -7.877  1.00 144.70 ? 134 U   E C6    1 
ATOM   6691  P  P     . G   E  1 31  ? -52.640 39.932  -7.768  1.00 147.46 ? 135 G   E P     1 
ATOM   6692  O  OP1   . G   E  1 31  ? -52.017 41.158  -7.259  1.00 149.45 ? 135 G   E OP1   1 
ATOM   6693  O  OP2   . G   E  1 31  ? -54.084 39.878  -8.067  1.00 146.72 ? 135 G   E OP2   1 
ATOM   6694  O  "O5'" . G   E  1 31  ? -51.859 39.540  -9.079  1.00 146.33 ? 135 G   E "O5'" 1 
ATOM   6695  C  "C5'" . G   E  1 31  ? -50.460 39.690  -9.123  1.00 147.00 ? 135 G   E "C5'" 1 
ATOM   6696  C  "C4'" . G   E  1 31  ? -49.899 39.060  -10.360 1.00 145.71 ? 135 G   E "C4'" 1 
ATOM   6697  O  "O4'" . G   E  1 31  ? -50.144 37.634  -10.334 1.00 144.23 ? 135 G   E "O4'" 1 
ATOM   6698  C  "C3'" . G   E  1 31  ? -50.495 39.493  -11.686 1.00 157.14 ? 135 G   E "C3'" 1 
ATOM   6699  O  "O3'" . G   E  1 31  ? -50.045 40.759  -12.135 1.00 158.79 ? 135 G   E "O3'" 1 
ATOM   6700  C  "C2'" . G   E  1 31  ? -50.088 38.343  -12.593 1.00 155.76 ? 135 G   E "C2'" 1 
ATOM   6701  O  "O2'" . G   E  1 31  ? -48.705 38.419  -12.913 1.00 156.51 ? 135 G   E "O2'" 1 
ATOM   6702  C  "C1'" . G   E  1 31  ? -50.296 37.158  -11.656 1.00 142.89 ? 135 G   E "C1'" 1 
ATOM   6703  N  N9    . G   E  1 31  ? -51.627 36.549  -11.819 1.00 141.72 ? 135 G   E N9    1 
ATOM   6704  C  C8    . G   E  1 31  ? -52.736 36.651  -11.023 1.00 141.90 ? 135 G   E C8    1 
ATOM   6705  N  N7    . G   E  1 31  ? -53.754 35.970  -11.484 1.00 140.70 ? 135 G   E N7    1 
ATOM   6706  C  C5    . G   E  1 31  ? -53.286 35.400  -12.656 1.00 139.70 ? 135 G   E C5    1 
ATOM   6707  C  C6    . G   E  1 31  ? -53.921 34.552  -13.597 1.00 138.33 ? 135 G   E C6    1 
ATOM   6708  O  O6    . G   E  1 31  ? -55.077 34.114  -13.588 1.00 142.24 ? 135 G   E O6    1 
ATOM   6709  N  N1    . G   E  1 31  ? -53.065 34.208  -14.641 1.00 137.83 ? 135 G   E N1    1 
ATOM   6710  C  C2    . G   E  1 31  ? -51.764 34.625  -14.759 1.00 138.54 ? 135 G   E C2    1 
ATOM   6711  N  N2    . G   E  1 31  ? -51.069 34.204  -15.828 1.00 138.01 ? 135 G   E N2    1 
ATOM   6712  N  N3    . G   E  1 31  ? -51.167 35.411  -13.884 1.00 139.80 ? 135 G   E N3    1 
ATOM   6713  C  C4    . G   E  1 31  ? -51.983 35.763  -12.877 1.00 140.32 ? 135 G   E C4    1 
ATOM   6714  P  P     . G   E  1 32  ? -51.006 41.689  -13.027 1.00 158.14 ? 136 G   E P     1 
ATOM   6715  O  OP1   . G   E  1 32  ? -50.384 43.036  -12.969 1.00 147.85 ? 136 G   E OP1   1 
ATOM   6716  O  OP2   . G   E  1 32  ? -52.426 41.513  -12.625 1.00 145.71 ? 136 G   E OP2   1 
ATOM   6717  O  "O5'" . G   E  1 32  ? -50.863 41.084  -14.496 1.00 144.65 ? 136 G   E "O5'" 1 
ATOM   6718  C  "C5'" . G   E  1 32  ? -49.583 40.868  -15.067 1.00 144.62 ? 136 G   E "C5'" 1 
ATOM   6719  C  "C4'" . G   E  1 32  ? -49.649 39.952  -16.260 1.00 143.06 ? 136 G   E "C4'" 1 
ATOM   6720  O  "O4'" . G   E  1 32  ? -50.022 38.616  -15.834 1.00 141.94 ? 136 G   E "O4'" 1 
ATOM   6721  C  "C3'" . G   E  1 32  ? -50.678 40.299  -17.325 1.00 148.83 ? 136 G   E "C3'" 1 
ATOM   6722  O  "O3'" . G   E  1 32  ? -50.254 41.320  -18.210 1.00 143.00 ? 136 G   E "O3'" 1 
ATOM   6723  C  "C2'" . G   E  1 32  ? -50.918 38.953  -18.000 1.00 140.78 ? 136 G   E "C2'" 1 
ATOM   6724  O  "O2'" . G   E  1 32  ? -49.850 38.613  -18.868 1.00 140.53 ? 136 G   E "O2'" 1 
ATOM   6725  C  "C1'" . G   E  1 32  ? -50.852 38.012  -16.805 1.00 140.60 ? 136 G   E "C1'" 1 
ATOM   6726  N  N9    . G   E  1 32  ? -52.192 37.750  -16.237 1.00 146.91 ? 136 G   E N9    1 
ATOM   6727  C  C8    . G   E  1 32  ? -52.715 38.080  -15.008 1.00 148.52 ? 136 G   E C8    1 
ATOM   6728  N  N7    . G   E  1 32  ? -53.951 37.679  -14.845 1.00 140.26 ? 136 G   E N7    1 
ATOM   6729  C  C5    . G   E  1 32  ? -54.265 37.055  -16.034 1.00 139.04 ? 136 G   E C5    1 
ATOM   6730  C  C6    . G   E  1 32  ? -55.458 36.429  -16.455 1.00 138.03 ? 136 G   E C6    1 
ATOM   6731  O  O6    . G   E  1 32  ? -56.524 36.304  -15.841 1.00 138.42 ? 136 G   E O6    1 
ATOM   6732  N  N1    . G   E  1 32  ? -55.344 35.911  -17.749 1.00 137.10 ? 136 G   E N1    1 
ATOM   6733  C  C2    . G   E  1 32  ? -54.220 35.988  -18.536 1.00 137.13 ? 136 G   E C2    1 
ATOM   6734  N  N2    . G   E  1 32  ? -54.276 35.431  -19.762 1.00 136.27 ? 136 G   E N2    1 
ATOM   6735  N  N3    . G   E  1 32  ? -53.108 36.582  -18.144 1.00 138.48 ? 136 G   E N3    1 
ATOM   6736  C  C4    . G   E  1 32  ? -53.197 37.089  -16.898 1.00 138.98 ? 136 G   E C4    1 
ATOM   6737  P  P     . U   E  1 33  ? -51.334 42.306  -18.872 1.00 143.13 ? 137 U   E P     1 
ATOM   6738  O  OP1   . U   E  1 33  ? -50.607 43.276  -19.697 1.00 143.88 ? 137 U   E OP1   1 
ATOM   6739  O  OP2   . U   E  1 33  ? -52.258 42.775  -17.820 1.00 143.82 ? 137 U   E OP2   1 
ATOM   6740  O  "O5'" . U   E  1 33  ? -52.158 41.383  -19.872 1.00 149.39 ? 137 U   E "O5'" 1 
ATOM   6741  C  "C5'" . U   E  1 33  ? -51.543 40.855  -21.039 1.00 146.77 ? 137 U   E "C5'" 1 
ATOM   6742  C  "C4'" . U   E  1 33  ? -52.497 40.013  -21.848 1.00 139.38 ? 137 U   E "C4'" 1 
ATOM   6743  O  "O4'" . U   E  1 33  ? -52.954 38.875  -21.070 1.00 138.66 ? 137 U   E "O4'" 1 
ATOM   6744  C  "C3'" . U   E  1 33  ? -53.786 40.691  -22.272 1.00 153.61 ? 137 U   E "C3'" 1 
ATOM   6745  O  "O3'" . U   E  1 33  ? -53.639 41.566  -23.372 1.00 154.35 ? 137 U   E "O3'" 1 
ATOM   6746  C  "C2'" . U   E  1 33  ? -54.690 39.503  -22.557 1.00 138.07 ? 137 U   E "C2'" 1 
ATOM   6747  O  "O2'" . U   E  1 33  ? -54.336 38.883  -23.780 1.00 137.29 ? 137 U   E "O2'" 1 
ATOM   6748  C  "C1'" . U   E  1 33  ? -54.286 38.560  -21.433 1.00 137.89 ? 137 U   E "C1'" 1 
ATOM   6749  N  N1    . U   E  1 33  ? -55.172 38.642  -20.249 1.00 138.18 ? 137 U   E N1    1 
ATOM   6750  C  C2    . U   E  1 33  ? -56.451 38.120  -20.365 1.00 137.45 ? 137 U   E C2    1 
ATOM   6751  O  O2    . U   E  1 33  ? -56.895 37.659  -21.402 1.00 136.63 ? 137 U   E O2    1 
ATOM   6752  N  N3    . U   E  1 33  ? -57.220 38.205  -19.229 1.00 139.43 ? 137 U   E N3    1 
ATOM   6753  C  C4    . U   E  1 33  ? -56.832 38.720  -18.014 1.00 138.86 ? 137 U   E C4    1 
ATOM   6754  O  O4    . U   E  1 33  ? -57.625 38.726  -17.075 1.00 153.29 ? 137 U   E O4    1 
ATOM   6755  C  C5    . U   E  1 33  ? -55.495 39.223  -17.973 1.00 139.58 ? 137 U   E C5    1 
ATOM   6756  C  C6    . U   E  1 33  ? -54.723 39.157  -19.059 1.00 139.21 ? 137 U   E C6    1 
ATOM   6757  P  P     . G   E  1 34  ? -54.464 42.935  -23.388 1.00 140.54 ? 138 G   E P     1 
ATOM   6758  O  OP1   . G   E  1 34  ? -53.956 43.692  -24.550 1.00 140.85 ? 138 G   E OP1   1 
ATOM   6759  O  OP2   . G   E  1 34  ? -54.395 43.500  -22.020 1.00 141.66 ? 138 G   E OP2   1 
ATOM   6760  O  "O5'" . G   E  1 34  ? -55.965 42.463  -23.646 1.00 139.68 ? 138 G   E "O5'" 1 
ATOM   6761  C  "C5'" . G   E  1 34  ? -56.349 41.935  -24.903 1.00 138.69 ? 138 G   E "C5'" 1 
ATOM   6762  C  "C4'" . G   E  1 34  ? -57.680 41.231  -24.841 1.00 142.79 ? 138 G   E "C4'" 1 
ATOM   6763  O  "O4'" . G   E  1 34  ? -57.667 40.207  -23.814 1.00 150.42 ? 138 G   E "O4'" 1 
ATOM   6764  C  "C3'" . G   E  1 34  ? -58.888 42.069  -24.485 1.00 140.40 ? 138 G   E "C3'" 1 
ATOM   6765  O  "O3'" . G   E  1 34  ? -59.363 42.831  -25.566 1.00 138.70 ? 138 G   E "O3'" 1 
ATOM   6766  C  "C2'" . G   E  1 34  ? -59.891 41.017  -24.038 1.00 148.48 ? 138 G   E "C2'" 1 
ATOM   6767  O  "O2'" . G   E  1 34  ? -60.466 40.374  -25.167 1.00 154.09 ? 138 G   E "O2'" 1 
ATOM   6768  C  "C1'" . G   E  1 34  ? -58.983 40.010  -23.332 1.00 149.23 ? 138 G   E "C1'" 1 
ATOM   6769  N  N9    . G   E  1 34  ? -59.019 40.150  -21.863 1.00 144.47 ? 138 G   E N9    1 
ATOM   6770  C  C8    . G   E  1 34  ? -58.039 40.634  -21.038 1.00 144.81 ? 138 G   E C8    1 
ATOM   6771  N  N7    . G   E  1 34  ? -58.381 40.613  -19.777 1.00 144.88 ? 138 G   E N7    1 
ATOM   6772  C  C5    . G   E  1 34  ? -59.662 40.090  -19.763 1.00 143.49 ? 138 G   E C5    1 
ATOM   6773  C  C6    . G   E  1 34  ? -60.543 39.844  -18.681 1.00 139.00 ? 138 G   E C6    1 
ATOM   6774  O  O6    . G   E  1 34  ? -60.362 40.048  -17.477 1.00 139.79 ? 138 G   E O6    1 
ATOM   6775  N  N1    . G   E  1 34  ? -61.752 39.304  -19.112 1.00 138.30 ? 138 G   E N1    1 
ATOM   6776  C  C2    . G   E  1 34  ? -62.062 39.044  -20.425 1.00 137.52 ? 138 G   E C2    1 
ATOM   6777  N  N2    . G   E  1 34  ? -63.274 38.527  -20.675 1.00 137.02 ? 138 G   E N2    1 
ATOM   6778  N  N3    . G   E  1 34  ? -61.244 39.271  -21.439 1.00 137.31 ? 138 G   E N3    1 
ATOM   6779  C  C4    . G   E  1 34  ? -60.066 39.787  -21.041 1.00 140.43 ? 138 G   E C4    1 
ATOM   6780  P  P     . A   E  1 35  ? -60.143 44.184  -25.250 1.00 145.31 ? 139 A   E P     1 
ATOM   6781  O  OP1   . A   E  1 35  ? -60.317 44.924  -26.519 1.00 147.09 ? 139 A   E OP1   1 
ATOM   6782  O  OP2   . A   E  1 35  ? -59.439 44.771  -24.087 1.00 146.17 ? 139 A   E OP2   1 
ATOM   6783  O  "O5'" . A   E  1 35  ? -61.593 43.738  -24.778 1.00 142.95 ? 139 A   E "O5'" 1 
ATOM   6784  C  "C5'" . A   E  1 35  ? -62.502 43.204  -25.717 1.00 140.19 ? 139 A   E "C5'" 1 
ATOM   6785  C  "C4'" . A   E  1 35  ? -63.707 42.596  -25.053 1.00 138.56 ? 139 A   E "C4'" 1 
ATOM   6786  O  "O4'" . A   E  1 35  ? -63.298 41.707  -23.991 1.00 138.23 ? 139 A   E "O4'" 1 
ATOM   6787  C  "C3'" . A   E  1 35  ? -64.682 43.525  -24.356 1.00 156.06 ? 139 A   E "C3'" 1 
ATOM   6788  O  "O3'" . A   E  1 35  ? -65.509 44.259  -25.235 1.00 156.56 ? 139 A   E "O3'" 1 
ATOM   6789  C  "C2'" . A   E  1 35  ? -65.445 42.565  -23.453 1.00 139.27 ? 139 A   E "C2'" 1 
ATOM   6790  O  "O2'" . A   E  1 35  ? -66.391 41.811  -24.194 1.00 138.48 ? 139 A   E "O2'" 1 
ATOM   6791  C  "C1'" . A   E  1 35  ? -64.334 41.613  -23.034 1.00 138.57 ? 139 A   E "C1'" 1 
ATOM   6792  N  N9    . A   E  1 35  ? -63.817 41.880  -21.685 1.00 139.33 ? 139 A   E N9    1 
ATOM   6793  C  C8    . A   E  1 35  ? -62.612 42.389  -21.279 1.00 139.92 ? 139 A   E C8    1 
ATOM   6794  N  N7    . A   E  1 35  ? -62.501 42.453  -19.974 1.00 140.60 ? 139 A   E N7    1 
ATOM   6795  C  C5    . A   E  1 35  ? -63.703 41.948  -19.510 1.00 141.11 ? 139 A   E C5    1 
ATOM   6796  C  C6    . A   E  1 35  ? -64.204 41.752  -18.220 1.00 146.52 ? 139 A   E C6    1 
ATOM   6797  N  N6    . A   E  1 35  ? -63.504 42.063  -17.127 1.00 148.01 ? 139 A   E N6    1 
ATOM   6798  N  N1    . A   E  1 35  ? -65.446 41.228  -18.099 1.00 150.89 ? 139 A   E N1    1 
ATOM   6799  C  C2    . A   E  1 35  ? -66.128 40.923  -19.211 1.00 152.39 ? 139 A   E C2    1 
ATOM   6800  N  N3    . A   E  1 35  ? -65.755 41.069  -20.479 1.00 139.32 ? 139 A   E N3    1 
ATOM   6801  C  C4    . A   E  1 35  ? -64.522 41.593  -20.553 1.00 139.63 ? 139 A   E C4    1 
ATOM   6802  P  P     . C   E  1 36  ? -65.843 45.785  -24.906 1.00 141.51 ? 140 C   E P     1 
ATOM   6803  O  OP1   . C   E  1 36  ? -66.351 46.334  -26.179 1.00 141.53 ? 140 C   E OP1   1 
ATOM   6804  O  OP2   . C   E  1 36  ? -64.683 46.363  -24.202 1.00 142.26 ? 140 C   E OP2   1 
ATOM   6805  O  "O5'" . C   E  1 36  ? -67.047 45.723  -23.869 1.00 142.08 ? 140 C   E "O5'" 1 
ATOM   6806  C  "C5'" . C   E  1 36  ? -68.330 45.314  -24.305 1.00 141.73 ? 140 C   E "C5'" 1 
ATOM   6807  C  "C4'" . C   E  1 36  ? -69.102 44.658  -23.197 1.00 141.80 ? 140 C   E "C4'" 1 
ATOM   6808  O  "O4'" . C   E  1 36  ? -68.212 43.794  -22.459 1.00 145.18 ? 140 C   E "O4'" 1 
ATOM   6809  C  "C3'" . C   E  1 36  ? -69.679 45.563  -22.128 1.00 143.29 ? 140 C   E "C3'" 1 
ATOM   6810  O  "O3'" . C   E  1 36  ? -70.882 46.186  -22.522 1.00 155.36 ? 140 C   E "O3'" 1 
ATOM   6811  C  "C2'" . C   E  1 36  ? -69.846 44.610  -20.957 1.00 143.01 ? 140 C   E "C2'" 1 
ATOM   6812  O  "O2'" . C   E  1 36  ? -70.973 43.768  -21.158 1.00 142.42 ? 140 C   E "O2'" 1 
ATOM   6813  C  "C1'" . C   E  1 36  ? -68.598 43.748  -21.106 1.00 144.01 ? 140 C   E "C1'" 1 
ATOM   6814  N  N1    . C   E  1 36  ? -67.459 44.231  -20.296 1.00 145.92 ? 140 C   E N1    1 
ATOM   6815  C  C2    . C   E  1 36  ? -67.508 44.064  -18.919 1.00 151.85 ? 140 C   E C2    1 
ATOM   6816  O  O2    . C   E  1 36  ? -68.518 43.549  -18.412 1.00 158.64 ? 140 C   E O2    1 
ATOM   6817  N  N3    . C   E  1 36  ? -66.458 44.471  -18.174 1.00 151.13 ? 140 C   E N3    1 
ATOM   6818  C  C4    . C   E  1 36  ? -65.392 45.020  -18.756 1.00 143.87 ? 140 C   E C4    1 
ATOM   6819  N  N4    . C   E  1 36  ? -64.385 45.412  -17.972 1.00 144.67 ? 140 C   E N4    1 
ATOM   6820  C  C5    . C   E  1 36  ? -65.309 45.189  -20.164 1.00 143.23 ? 140 C   E C5    1 
ATOM   6821  C  C6    . C   E  1 36  ? -66.356 44.783  -20.889 1.00 142.56 ? 140 C   E C6    1 
ATOM   6822  P  P     . C   E  1 37  ? -71.199 47.679  -22.044 1.00 145.86 ? 141 C   E P     1 
ATOM   6823  O  OP1   . C   E  1 37  ? -72.527 47.959  -22.638 1.00 146.24 ? 141 C   E OP1   1 
ATOM   6824  O  OP2   . C   E  1 37  ? -70.032 48.559  -22.284 1.00 146.33 ? 141 C   E OP2   1 
ATOM   6825  O  "O5'" . C   E  1 37  ? -71.402 47.554  -20.473 1.00 146.69 ? 141 C   E "O5'" 1 
ATOM   6826  C  "C5'" . C   E  1 37  ? -72.544 46.891  -19.962 1.00 146.65 ? 141 C   E "C5'" 1 
ATOM   6827  C  "C4'" . C   E  1 37  ? -72.473 46.678  -18.473 1.00 147.30 ? 141 C   E "C4'" 1 
ATOM   6828  O  "O4'" . C   E  1 37  ? -71.296 45.933  -18.111 1.00 146.36 ? 141 C   E "O4'" 1 
ATOM   6829  C  "C3'" . C   E  1 37  ? -72.384 47.896  -17.588 1.00 162.87 ? 141 C   E "C3'" 1 
ATOM   6830  O  "O3'" . C   E  1 37  ? -73.599 48.596  -17.484 1.00 165.39 ? 141 C   E "O3'" 1 
ATOM   6831  C  "C2'" . C   E  1 37  ? -71.927 47.287  -16.275 1.00 149.25 ? 141 C   E "C2'" 1 
ATOM   6832  O  "O2'" . C   E  1 37  ? -73.009 46.627  -15.640 1.00 149.30 ? 141 C   E "O2'" 1 
ATOM   6833  C  "C1'" . C   E  1 37  ? -70.965 46.217  -16.772 1.00 147.43 ? 141 C   E "C1'" 1 
ATOM   6834  N  N1    . C   E  1 37  ? -69.552 46.603  -16.706 1.00 147.53 ? 141 C   E N1    1 
ATOM   6835  C  C2    . C   E  1 37  ? -68.944 46.744  -15.468 1.00 148.41 ? 141 C   E C2    1 
ATOM   6836  O  O2    . C   E  1 37  ? -69.614 46.586  -14.439 1.00 154.95 ? 141 C   E O2    1 
ATOM   6837  N  N3    . C   E  1 37  ? -67.638 47.058  -15.418 1.00 148.56 ? 141 C   E N3    1 
ATOM   6838  C  C4    . C   E  1 37  ? -66.958 47.211  -16.543 1.00 147.84 ? 141 C   E C4    1 
ATOM   6839  N  N4    . C   E  1 37  ? -65.669 47.532  -16.456 1.00 148.10 ? 141 C   E N4    1 
ATOM   6840  C  C5    . C   E  1 37  ? -67.573 47.072  -17.811 1.00 146.93 ? 141 C   E C5    1 
ATOM   6841  C  C6    . C   E  1 37  ? -68.857 46.745  -17.854 1.00 146.78 ? 141 C   E C6    1 
ATOM   6842  P  P     . U   E  1 38  ? -73.564 50.185  -17.384 1.00 152.46 ? 142 U   E P     1 
ATOM   6843  O  OP1   . U   E  1 38  ? -74.987 50.605  -17.330 1.00 153.58 ? 142 U   E OP1   1 
ATOM   6844  O  OP2   . U   E  1 38  ? -72.657 50.687  -18.444 1.00 151.99 ? 142 U   E OP2   1 
ATOM   6845  O  "O5'" . U   E  1 38  ? -72.807 50.448  -16.011 1.00 153.55 ? 142 U   E "O5'" 1 
ATOM   6846  C  "C5'" . U   E  1 38  ? -73.389 50.017  -14.799 1.00 154.16 ? 142 U   E "C5'" 1 
ATOM   6847  C  "C4'" . U   E  1 38  ? -72.489 50.250  -13.617 1.00 155.11 ? 142 U   E "C4'" 1 
ATOM   6848  O  "O4'" . U   E  1 38  ? -71.279 49.463  -13.718 1.00 153.63 ? 142 U   E "O4'" 1 
ATOM   6849  C  "C3'" . U   E  1 38  ? -71.979 51.657  -13.403 1.00 168.99 ? 142 U   E "C3'" 1 
ATOM   6850  O  "O3'" . U   E  1 38  ? -72.979 52.505  -12.868 1.00 173.49 ? 142 U   E "O3'" 1 
ATOM   6851  C  "C2'" . U   E  1 38  ? -70.802 51.425  -12.462 1.00 165.57 ? 142 U   E "C2'" 1 
ATOM   6852  O  "O2'" . U   E  1 38  ? -71.266 51.224  -11.138 1.00 170.09 ? 142 U   E "O2'" 1 
ATOM   6853  C  "C1'" . U   E  1 38  ? -70.256 50.088  -12.974 1.00 158.66 ? 142 U   E "C1'" 1 
ATOM   6854  N  N1    . U   E  1 38  ? -69.048 50.225  -13.807 1.00 153.98 ? 142 U   E N1    1 
ATOM   6855  C  C2    . U   E  1 38  ? -67.857 50.407  -13.134 1.00 154.55 ? 142 U   E C2    1 
ATOM   6856  O  O2    . U   E  1 38  ? -67.774 50.467  -11.921 1.00 155.66 ? 142 U   E O2    1 
ATOM   6857  N  N3    . U   E  1 38  ? -66.757 50.510  -13.933 1.00 154.49 ? 142 U   E N3    1 
ATOM   6858  C  C4    . U   E  1 38  ? -66.744 50.450  -15.306 1.00 154.62 ? 142 U   E C4    1 
ATOM   6859  O  O4    . U   E  1 38  ? -65.667 50.563  -15.886 1.00 155.03 ? 142 U   E O4    1 
ATOM   6860  C  C5    . U   E  1 38  ? -68.021 50.257  -15.926 1.00 154.69 ? 142 U   E C5    1 
ATOM   6861  C  C6    . U   E  1 38  ? -69.113 50.149  -15.172 1.00 152.79 ? 142 U   E C6    1 
ATOM   6862  P  P     . C   E  1 39  ? -72.766 54.087  -12.836 1.00 161.19 ? 143 C   E P     1 
ATOM   6863  O  OP1   . C   E  1 39  ? -74.085 54.744  -12.865 1.00 162.60 ? 143 C   E OP1   1 
ATOM   6864  O  OP2   . C   E  1 39  ? -71.734 54.463  -13.825 1.00 160.48 ? 143 C   E OP2   1 
ATOM   6865  O  "O5'" . C   E  1 39  ? -72.147 54.324  -11.404 1.00 162.71 ? 143 C   E "O5'" 1 
ATOM   6866  C  "C5'" . C   E  1 39  ? -71.142 55.292  -11.261 1.00 164.01 ? 143 C   E "C5'" 1 
ATOM   6867  C  "C4'" . C   E  1 39  ? -70.189 54.930  -10.171 1.00 164.31 ? 143 C   E "C4'" 1 
ATOM   6868  O  "O4'" . C   E  1 39  ? -69.400 53.789  -10.577 1.00 161.97 ? 143 C   E "O4'" 1 
ATOM   6869  C  "C3'" . C   E  1 39  ? -69.168 56.005  -9.872  1.00 174.97 ? 143 C   E "C3'" 1 
ATOM   6870  O  "O3'" . C   E  1 39  ? -69.695 57.019  -9.032  1.00 182.00 ? 143 C   E "O3'" 1 
ATOM   6871  C  "C2'" . C   E  1 39  ? -68.014 55.206  -9.280  1.00 170.50 ? 143 C   E "C2'" 1 
ATOM   6872  O  "O2'" . C   E  1 39  ? -68.297 54.849  -7.936  1.00 166.12 ? 143 C   E "O2'" 1 
ATOM   6873  C  "C1'" . C   E  1 39  ? -68.072 53.931  -10.124 1.00 162.37 ? 143 C   E "C1'" 1 
ATOM   6874  N  N1    . C   E  1 39  ? -67.207 53.988  -11.327 1.00 161.12 ? 143 C   E N1    1 
ATOM   6875  C  C2    . C   E  1 39  ? -65.820 54.215  -11.300 1.00 161.30 ? 143 C   E C2    1 
ATOM   6876  O  O2    . C   E  1 39  ? -65.247 54.406  -10.223 1.00 162.98 ? 143 C   E O2    1 
ATOM   6877  N  N3    . C   E  1 39  ? -65.135 54.241  -12.469 1.00 160.14 ? 143 C   E N3    1 
ATOM   6878  C  C4    . C   E  1 39  ? -65.759 54.033  -13.622 1.00 158.82 ? 143 C   E C4    1 
ATOM   6879  N  N4    . C   E  1 39  ? -65.055 54.061  -14.753 1.00 160.10 ? 143 C   E N4    1 
ATOM   6880  C  C5    . C   E  1 39  ? -67.154 53.778  -13.679 1.00 158.58 ? 143 C   E C5    1 
ATOM   6881  C  C6    . C   E  1 39  ? -67.821 53.761  -12.524 1.00 159.74 ? 143 C   E C6    1 
ATOM   6882  P  P     . C   E  1 40  ? -70.041 58.483  -9.605  1.00 170.58 ? 144 C   E P     1 
ATOM   6883  O  OP1   . C   E  1 40  ? -70.112 59.312  -8.394  1.00 173.39 ? 144 C   E OP1   1 
ATOM   6884  O  OP2   . C   E  1 40  ? -71.169 58.541  -10.568 1.00 169.91 ? 144 C   E OP2   1 
ATOM   6885  O  "O5'" . C   E  1 40  ? -68.735 58.895  -10.389 1.00 170.10 ? 144 C   E "O5'" 1 
ATOM   6886  C  "C5'" . C   E  1 40  ? -67.979 60.004  -9.946  1.00 172.33 ? 144 C   E "C5'" 1 
ATOM   6887  C  "C4'" . C   E  1 40  ? -66.872 59.609  -9.009  1.00 172.55 ? 144 C   E "C4'" 1 
ATOM   6888  O  "O4'" . C   E  1 40  ? -66.344 58.322  -9.410  1.00 169.84 ? 144 C   E "O4'" 1 
ATOM   6889  C  "C3'" . C   E  1 40  ? -65.675 60.551  -9.042  1.00 176.65 ? 144 C   E "C3'" 1 
ATOM   6890  O  "O3'" . C   E  1 40  ? -65.819 61.643  -8.152  1.00 181.96 ? 144 C   E "O3'" 1 
ATOM   6891  C  "C2'" . C   E  1 40  ? -64.501 59.639  -8.724  1.00 172.69 ? 144 C   E "C2'" 1 
ATOM   6892  O  "O2'" . C   E  1 40  ? -64.422 59.395  -7.328  1.00 173.92 ? 144 C   E "O2'" 1 
ATOM   6893  C  "C1'" . C   E  1 40  ? -64.936 58.348  -9.407  1.00 169.75 ? 144 C   E "C1'" 1 
ATOM   6894  N  N1    . C   E  1 40  ? -64.530 58.267  -10.827 1.00 168.01 ? 144 C   E N1    1 
ATOM   6895  C  C2    . C   E  1 40  ? -63.248 58.505  -11.357 1.00 167.77 ? 144 C   E C2    1 
ATOM   6896  O  O2    . C   E  1 40  ? -62.302 58.854  -10.635 1.00 169.13 ? 144 C   E O2    1 
ATOM   6897  N  N3    . C   E  1 40  ? -63.091 58.353  -12.702 1.00 167.80 ? 144 C   E N3    1 
ATOM   6898  C  C4    . C   E  1 40  ? -64.102 57.978  -13.492 1.00 168.19 ? 144 C   E C4    1 
ATOM   6899  N  N4    . C   E  1 40  ? -63.916 57.836  -14.808 1.00 167.33 ? 144 C   E N4    1 
ATOM   6900  C  C5    . C   E  1 40  ? -65.394 57.727  -12.970 1.00 169.08 ? 144 C   E C5    1 
ATOM   6901  C  C6    . C   E  1 40  ? -65.545 57.879  -11.658 1.00 166.58 ? 144 C   E C6    1 
ATOM   6902  P  P     . C   E  1 41  ? -66.215 63.106  -8.685  1.00 179.09 ? 145 C   E P     1 
ATOM   6903  O  OP1   . C   E  1 41  ? -66.072 63.973  -7.494  1.00 182.21 ? 145 C   E OP1   1 
ATOM   6904  O  OP2   . C   E  1 41  ? -67.493 63.066  -9.448  1.00 178.25 ? 145 C   E OP2   1 
ATOM   6905  O  "O5'" . C   E  1 41  ? -65.047 63.487  -9.697  1.00 178.42 ? 145 C   E "O5'" 1 
ATOM   6906  C  "C5'" . C   E  1 41  ? -64.321 64.692  -9.530  1.00 180.82 ? 145 C   E "C5'" 1 
ATOM   6907  C  "C4'" . C   E  1 41  ? -62.838 64.496  -9.715  1.00 180.17 ? 145 C   E "C4'" 1 
ATOM   6908  O  "O4'" . C   E  1 41  ? -62.530 63.101  -9.988  1.00 186.53 ? 145 C   E "O4'" 1 
ATOM   6909  C  "C3'" . C   E  1 41  ? -62.213 65.228  -10.884 1.00 180.08 ? 145 C   E "C3'" 1 
ATOM   6910  O  "O3'" . C   E  1 41  ? -62.040 66.611  -10.664 1.00 182.98 ? 145 C   E "O3'" 1 
ATOM   6911  C  "C2'" . C   E  1 41  ? -60.925 64.449  -11.090 1.00 178.43 ? 145 C   E "C2'" 1 
ATOM   6912  O  "O2'" . C   E  1 41  ? -59.995 64.741  -10.056 1.00 180.31 ? 145 C   E "O2'" 1 
ATOM   6913  C  "C1'" . C   E  1 41  ? -61.431 63.020  -10.883 1.00 186.31 ? 145 C   E "C1'" 1 
ATOM   6914  N  N1    . C   E  1 41  ? -61.912 62.412  -12.156 1.00 184.63 ? 145 C   E N1    1 
ATOM   6915  C  C2    . C   E  1 41  ? -61.081 62.231  -13.285 1.00 171.93 ? 145 C   E C2    1 
ATOM   6916  O  O2    . C   E  1 41  ? -59.886 62.557  -13.229 1.00 172.64 ? 145 C   E O2    1 
ATOM   6917  N  N3    . C   E  1 41  ? -61.609 61.683  -14.408 1.00 169.76 ? 145 C   E N3    1 
ATOM   6918  C  C4    . C   E  1 41  ? -62.893 61.326  -14.448 1.00 169.11 ? 145 C   E C4    1 
ATOM   6919  N  N4    . C   E  1 41  ? -63.381 60.793  -15.564 1.00 167.09 ? 145 C   E N4    1 
ATOM   6920  C  C5    . C   E  1 41  ? -63.757 61.495  -13.336 1.00 170.61 ? 145 C   E C5    1 
ATOM   6921  C  C6    . C   E  1 41  ? -63.228 62.035  -12.234 1.00 183.29 ? 145 C   E C6    1 
ATOM   6922  P  P     . G   E  1 42  ? -62.959 67.655  -11.459 1.00 183.97 ? 146 G   E P     1 
ATOM   6923  O  OP1   . G   E  1 42  ? -63.090 68.846  -10.590 1.00 187.44 ? 146 G   E OP1   1 
ATOM   6924  O  OP2   . G   E  1 42  ? -64.196 66.980  -11.920 1.00 182.14 ? 146 G   E OP2   1 
ATOM   6925  O  "O5'" . G   E  1 42  ? -62.075 68.020  -12.734 1.00 183.07 ? 146 G   E "O5'" 1 
ATOM   6926  C  "C5'" . G   E  1 42  ? -60.687 68.287  -12.588 1.00 183.82 ? 146 G   E "C5'" 1 
ATOM   6927  C  "C4'" . G   E  1 42  ? -59.918 68.150  -13.883 1.00 182.01 ? 146 G   E "C4'" 1 
ATOM   6928  O  "O4'" . G   E  1 42  ? -59.792 66.753  -14.262 1.00 185.18 ? 146 G   E "O4'" 1 
ATOM   6929  C  "C3'" . G   E  1 42  ? -60.516 68.809  -15.118 1.00 181.71 ? 146 G   E "C3'" 1 
ATOM   6930  O  "O3'" . G   E  1 42  ? -60.328 70.217  -15.137 1.00 184.40 ? 146 G   E "O3'" 1 
ATOM   6931  C  "C2'" . G   E  1 42  ? -59.808 68.066  -16.248 1.00 179.04 ? 146 G   E "C2'" 1 
ATOM   6932  O  "O2'" . G   E  1 42  ? -58.484 68.545  -16.426 1.00 179.87 ? 146 G   E "O2'" 1 
ATOM   6933  C  "C1'" . G   E  1 42  ? -59.736 66.645  -15.673 1.00 185.45 ? 146 G   E "C1'" 1 
ATOM   6934  N  N9    . G   E  1 42  ? -60.848 65.793  -16.159 1.00 184.68 ? 146 G   E N9    1 
ATOM   6935  C  C8    . G   E  1 42  ? -62.027 65.442  -15.534 1.00 183.90 ? 146 G   E C8    1 
ATOM   6936  N  N7    . G   E  1 42  ? -62.803 64.681  -16.268 1.00 172.85 ? 146 G   E N7    1 
ATOM   6937  C  C5    . G   E  1 42  ? -62.103 64.525  -17.449 1.00 171.32 ? 146 G   E C5    1 
ATOM   6938  C  C6    . G   E  1 42  ? -62.426 63.814  -18.623 1.00 168.92 ? 146 G   E C6    1 
ATOM   6939  O  O6    . G   E  1 42  ? -63.432 63.157  -18.886 1.00 167.60 ? 146 G   E O6    1 
ATOM   6940  N  N1    . G   E  1 42  ? -61.425 63.923  -19.579 1.00 168.17 ? 146 G   E N1    1 
ATOM   6941  C  C2    . G   E  1 42  ? -60.262 64.626  -19.418 1.00 169.55 ? 146 G   E C2    1 
ATOM   6942  N  N2    . G   E  1 42  ? -59.399 64.632  -20.435 1.00 168.64 ? 146 G   E N2    1 
ATOM   6943  N  N3    . G   E  1 42  ? -59.947 65.295  -18.332 1.00 171.82 ? 146 G   E N3    1 
ATOM   6944  C  C4    . G   E  1 42  ? -60.906 65.202  -17.398 1.00 172.57 ? 146 G   E C4    1 
ATOM   6945  P  P     . G   E  1 43  ? -61.463 71.198  -15.718 1.00 185.53 ? 147 G   E P     1 
ATOM   6946  O  OP1   . G   E  1 43  ? -61.093 72.552  -15.269 1.00 188.80 ? 147 G   E OP1   1 
ATOM   6947  O  OP2   . G   E  1 43  ? -62.812 70.661  -15.423 1.00 184.83 ? 147 G   E OP2   1 
ATOM   6948  O  "O5'" . G   E  1 43  ? -61.285 71.119  -17.293 1.00 183.46 ? 147 G   E "O5'" 1 
ATOM   6949  C  "C5'" . G   E  1 43  ? -60.018 71.329  -17.892 1.00 183.23 ? 147 G   E "C5'" 1 
ATOM   6950  C  "C4'" . G   E  1 43  ? -60.041 70.975  -19.358 1.00 189.06 ? 147 G   E "C4'" 1 
ATOM   6951  O  "O4'" . G   E  1 43  ? -59.958 69.529  -19.527 1.00 186.58 ? 147 G   E "O4'" 1 
ATOM   6952  C  "C3'" . G   E  1 43  ? -61.301 71.340  -20.120 1.00 189.61 ? 147 G   E "C3'" 1 
ATOM   6953  O  "O3'" . G   E  1 43  ? -61.432 72.705  -20.447 1.00 182.78 ? 147 G   E "O3'" 1 
ATOM   6954  C  "C2'" . G   E  1 43  ? -61.231 70.408  -21.315 1.00 189.49 ? 147 G   E "C2'" 1 
ATOM   6955  O  "O2'" . G   E  1 43  ? -60.221 70.845  -22.215 1.00 191.94 ? 147 G   E "O2'" 1 
ATOM   6956  C  "C1'" . G   E  1 43  ? -60.749 69.130  -20.633 1.00 176.02 ? 147 G   E "C1'" 1 
ATOM   6957  N  N9    . G   E  1 43  ? -61.883 68.341  -20.105 1.00 175.13 ? 147 G   E N9    1 
ATOM   6958  C  C8    . G   E  1 43  ? -62.506 68.514  -18.891 1.00 176.75 ? 147 G   E C8    1 
ATOM   6959  N  N7    . G   E  1 43  ? -63.488 67.681  -18.678 1.00 186.93 ? 147 G   E N7    1 
ATOM   6960  C  C5    . G   E  1 43  ? -63.532 66.891  -19.819 1.00 184.36 ? 147 G   E C5    1 
ATOM   6961  C  C6    . G   E  1 43  ? -64.393 65.802  -20.168 1.00 170.74 ? 147 G   E C6    1 
ATOM   6962  O  O6    . G   E  1 43  ? -65.322 65.274  -19.539 1.00 170.56 ? 147 G   E O6    1 
ATOM   6963  N  N1    . G   E  1 43  ? -64.080 65.300  -21.419 1.00 168.66 ? 147 G   E N1    1 
ATOM   6964  C  C2    . G   E  1 43  ? -63.081 65.771  -22.232 1.00 176.44 ? 147 G   E C2    1 
ATOM   6965  N  N2    . G   E  1 43  ? -62.954 65.138  -23.409 1.00 172.54 ? 147 G   E N2    1 
ATOM   6966  N  N3    . G   E  1 43  ? -62.276 66.782  -21.925 1.00 181.30 ? 147 G   E N3    1 
ATOM   6967  C  C4    . G   E  1 43  ? -62.553 67.299  -20.711 1.00 184.47 ? 147 G   E C4    1 
ATOM   6968  P  P     . G   E  1 44  ? -62.909 73.316  -20.523 1.00 183.85 ? 148 G   E P     1 
ATOM   6969  O  OP1   . G   E  1 44  ? -62.827 74.792  -20.462 1.00 197.18 ? 148 G   E OP1   1 
ATOM   6970  O  OP2   . G   E  1 44  ? -63.765 72.572  -19.567 1.00 183.56 ? 148 G   E OP2   1 
ATOM   6971  O  "O5'" . G   E  1 44  ? -63.405 72.887  -21.965 1.00 181.41 ? 148 G   E "O5'" 1 
ATOM   6972  C  "C5'" . G   E  1 44  ? -64.770 72.994  -22.317 1.00 181.29 ? 148 G   E "C5'" 1 
ATOM   6973  C  "C4'" . G   E  1 44  ? -64.931 72.951  -23.809 1.00 179.61 ? 148 G   E "C4'" 1 
ATOM   6974  O  "O4'" . G   E  1 44  ? -63.880 73.739  -24.404 1.00 180.36 ? 148 G   E "O4'" 1 
ATOM   6975  C  "C3'" . G   E  1 44  ? -64.775 71.592  -24.460 1.00 187.94 ? 148 G   E "C3'" 1 
ATOM   6976  O  "O3'" . G   E  1 44  ? -65.965 70.827  -24.380 1.00 186.87 ? 148 G   E "O3'" 1 
ATOM   6977  C  "C2'" . G   E  1 44  ? -64.366 71.952  -25.885 1.00 175.63 ? 148 G   E "C2'" 1 
ATOM   6978  O  "O2'" . G   E  1 44  ? -65.505 72.318  -26.645 1.00 175.63 ? 148 G   E "O2'" 1 
ATOM   6979  C  "C1'" . G   E  1 44  ? -63.527 73.210  -25.658 1.00 178.06 ? 148 G   E "C1'" 1 
ATOM   6980  N  N9    . G   E  1 44  ? -62.080 72.939  -25.635 1.00 177.58 ? 148 G   E N9    1 
ATOM   6981  C  C8    . G   E  1 44  ? -61.319 72.605  -24.541 1.00 178.12 ? 148 G   E C8    1 
ATOM   6982  N  N7    . G   E  1 44  ? -60.061 72.425  -24.825 1.00 177.57 ? 148 G   E N7    1 
ATOM   6983  C  C5    . G   E  1 44  ? -59.990 72.659  -26.189 1.00 176.61 ? 148 G   E C5    1 
ATOM   6984  C  C6    . G   E  1 44  ? -58.884 72.618  -27.069 1.00 178.28 ? 148 G   E C6    1 
ATOM   6985  O  O6    . G   E  1 44  ? -57.705 72.352  -26.811 1.00 181.81 ? 148 G   E O6    1 
ATOM   6986  N  N1    . G   E  1 44  ? -59.253 72.922  -28.373 1.00 175.02 ? 148 G   E N1    1 
ATOM   6987  C  C2    . G   E  1 44  ? -60.521 73.220  -28.788 1.00 175.04 ? 148 G   E C2    1 
ATOM   6988  N  N2    . G   E  1 44  ? -60.654 73.475  -30.098 1.00 174.26 ? 148 G   E N2    1 
ATOM   6989  N  N3    . G   E  1 44  ? -61.564 73.258  -27.977 1.00 175.84 ? 148 G   E N3    1 
ATOM   6990  C  C4    . G   E  1 44  ? -61.228 72.963  -26.705 1.00 176.57 ? 148 G   E C4    1 
ATOM   6991  P  P     . A   E  1 45  ? -65.959 69.322  -23.824 1.00 173.23 ? 149 A   E P     1 
ATOM   6992  O  OP1   . A   E  1 45  ? -67.259 69.097  -23.152 1.00 173.69 ? 149 A   E OP1   1 
ATOM   6993  O  OP2   . A   E  1 45  ? -64.698 69.044  -23.092 1.00 173.36 ? 149 A   E OP2   1 
ATOM   6994  O  "O5'" . A   E  1 45  ? -65.962 68.466  -25.156 1.00 170.51 ? 149 A   E "O5'" 1 
ATOM   6995  C  "C5'" . A   E  1 45  ? -64.753 68.009  -25.730 1.00 169.11 ? 149 A   E "C5'" 1 
ATOM   6996  C  "C4'" . A   E  1 45  ? -64.905 67.795  -27.211 1.00 167.47 ? 149 A   E "C4'" 1 
ATOM   6997  O  "O4'" . A   E  1 45  ? -64.084 68.763  -27.901 1.00 168.37 ? 149 A   E "O4'" 1 
ATOM   6998  C  "C3'" . A   E  1 45  ? -64.437 66.443  -27.734 1.00 173.40 ? 149 A   E "C3'" 1 
ATOM   6999  O  "O3'" . A   E  1 45  ? -65.480 65.489  -27.727 1.00 172.03 ? 149 A   E "O3'" 1 
ATOM   7000  C  "C2'" . A   E  1 45  ? -63.932 66.758  -29.136 1.00 164.21 ? 149 A   E "C2'" 1 
ATOM   7001  O  "O2'" . A   E  1 45  ? -65.008 66.843  -30.053 1.00 163.69 ? 149 A   E "O2'" 1 
ATOM   7002  C  "C1'" . A   E  1 45  ? -63.392 68.159  -28.960 1.00 166.48 ? 149 A   E "C1'" 1 
ATOM   7003  N  N9    . A   E  1 45  ? -61.964 68.208  -28.647 1.00 166.81 ? 149 A   E N9    1 
ATOM   7004  C  C8    . A   E  1 45  ? -61.394 68.637  -27.484 1.00 168.50 ? 149 A   E C8    1 
ATOM   7005  N  N7    . A   E  1 45  ? -60.089 68.634  -27.516 1.00 168.54 ? 149 A   E N7    1 
ATOM   7006  C  C5    . A   E  1 45  ? -59.798 68.200  -28.795 1.00 166.78 ? 149 A   E C5    1 
ATOM   7007  C  C6    . A   E  1 45  ? -58.588 67.976  -29.455 1.00 166.02 ? 149 A   E C6    1 
ATOM   7008  N  N6    . A   E  1 45  ? -57.394 68.170  -28.898 1.00 170.06 ? 149 A   E N6    1 
ATOM   7009  N  N1    . A   E  1 45  ? -58.653 67.542  -30.726 1.00 170.94 ? 149 A   E N1    1 
ATOM   7010  C  C2    . A   E  1 45  ? -59.855 67.348  -31.280 1.00 170.29 ? 149 A   E C2    1 
ATOM   7011  N  N3    . A   E  1 45  ? -61.064 67.528  -30.763 1.00 164.09 ? 149 A   E N3    1 
ATOM   7012  C  C4    . A   E  1 45  ? -60.950 67.959  -29.507 1.00 165.74 ? 149 A   E C4    1 
ATOM   7013  P  P     . G   E  1 46  ? -65.241 64.031  -27.123 1.00 161.81 ? 150 G   E P     1 
ATOM   7014  O  OP1   . G   E  1 46  ? -66.517 63.318  -27.349 1.00 160.74 ? 150 G   E OP1   1 
ATOM   7015  O  OP2   . G   E  1 46  ? -64.689 64.095  -25.752 1.00 162.95 ? 150 G   E OP2   1 
ATOM   7016  O  "O5'" . G   E  1 46  ? -64.080 63.454  -28.033 1.00 160.19 ? 150 G   E "O5'" 1 
ATOM   7017  C  "C5'" . G   E  1 46  ? -64.358 62.932  -29.316 1.00 158.55 ? 150 G   E "C5'" 1 
ATOM   7018  C  "C4'" . G   E  1 46  ? -63.088 62.723  -30.089 1.00 157.67 ? 150 G   E "C4'" 1 
ATOM   7019  O  "O4'" . G   E  1 46  ? -62.388 63.988  -30.191 1.00 159.34 ? 150 G   E "O4'" 1 
ATOM   7020  C  "C3'" . G   E  1 46  ? -62.056 61.787  -29.461 1.00 183.73 ? 150 G   E "C3'" 1 
ATOM   7021  O  "O3'" . G   E  1 46  ? -62.324 60.384  -29.634 1.00 182.53 ? 150 G   E "O3'" 1 
ATOM   7022  C  "C2'" . G   E  1 46  ? -60.770 62.260  -30.137 1.00 181.96 ? 150 G   E "C2'" 1 
ATOM   7023  O  "O2'" . G   E  1 46  ? -60.707 61.803  -31.481 1.00 178.92 ? 150 G   E "O2'" 1 
ATOM   7024  C  "C1'" . G   E  1 46  ? -60.997 63.769  -30.180 1.00 159.07 ? 150 G   E "C1'" 1 
ATOM   7025  N  N9    . G   E  1 46  ? -60.435 64.441  -28.996 1.00 160.91 ? 150 G   E N9    1 
ATOM   7026  C  C8    . G   E  1 46  ? -61.152 64.905  -27.927 1.00 162.36 ? 150 G   E C8    1 
ATOM   7027  N  N7    . G   E  1 46  ? -60.401 65.475  -27.028 1.00 163.98 ? 150 G   E N7    1 
ATOM   7028  C  C5    . G   E  1 46  ? -59.113 65.385  -27.532 1.00 163.55 ? 150 G   E C5    1 
ATOM   7029  C  C6    . G   E  1 46  ? -57.884 65.833  -26.988 1.00 164.83 ? 150 G   E C6    1 
ATOM   7030  O  O6    . G   E  1 46  ? -57.673 66.411  -25.920 1.00 166.67 ? 150 G   E O6    1 
ATOM   7031  N  N1    . G   E  1 46  ? -56.820 65.542  -27.826 1.00 163.89 ? 150 G   E N1    1 
ATOM   7032  C  C2    . G   E  1 46  ? -56.917 64.904  -29.032 1.00 161.99 ? 150 G   E C2    1 
ATOM   7033  N  N2    . G   E  1 46  ? -55.754 64.719  -29.676 1.00 168.75 ? 150 G   E N2    1 
ATOM   7034  N  N3    . G   E  1 46  ? -58.060 64.481  -29.553 1.00 160.81 ? 150 G   E N3    1 
ATOM   7035  C  C4    . G   E  1 46  ? -59.116 64.762  -28.759 1.00 161.67 ? 150 G   E C4    1 
ATOM   7036  P  P     . C   E  1 47  ? -62.423 59.306  -28.414 1.00 154.25 ? 151 C   E P     1 
ATOM   7037  O  OP1   . C   E  1 47  ? -62.037 58.451  -29.544 1.00 152.48 ? 151 C   E OP1   1 
ATOM   7038  O  OP2   . C   E  1 47  ? -63.779 59.768  -28.053 1.00 155.12 ? 151 C   E OP2   1 
ATOM   7039  O  "O5'" . C   E  1 47  ? -61.285 59.845  -27.439 1.00 155.62 ? 151 C   E "O5'" 1 
ATOM   7040  C  "C5'" . C   E  1 47  ? -59.900 59.735  -27.731 1.00 155.36 ? 151 C   E "C5'" 1 
ATOM   7041  C  "C4'" . C   E  1 47  ? -59.157 60.753  -26.915 1.00 157.36 ? 151 C   E "C4'" 1 
ATOM   7042  O  "O4'" . C   E  1 47  ? -60.094 61.776  -26.513 1.00 161.65 ? 151 C   E "O4'" 1 
ATOM   7043  C  "C3'" . C   E  1 47  ? -58.557 60.270  -25.609 1.00 157.73 ? 151 C   E "C3'" 1 
ATOM   7044  O  "O3'" . C   E  1 47  ? -57.263 59.753  -25.779 1.00 157.09 ? 151 C   E "O3'" 1 
ATOM   7045  C  "C2'" . C   E  1 47  ? -58.520 61.520  -24.754 1.00 160.15 ? 151 C   E "C2'" 1 
ATOM   7046  O  "O2'" . C   E  1 47  ? -57.350 62.270  -25.022 1.00 161.19 ? 151 C   E "O2'" 1 
ATOM   7047  C  "C1'" . C   E  1 47  ? -59.734 62.295  -25.256 1.00 160.73 ? 151 C   E "C1'" 1 
ATOM   7048  N  N1    . C   E  1 47  ? -60.893 62.255  -24.341 1.00 161.33 ? 151 C   E N1    1 
ATOM   7049  C  C2    . C   E  1 47  ? -60.747 62.731  -23.032 1.00 163.15 ? 151 C   E C2    1 
ATOM   7050  O  O2    . C   E  1 47  ? -59.648 63.144  -22.642 1.00 164.20 ? 151 C   E O2    1 
ATOM   7051  N  N3    . C   E  1 47  ? -61.808 62.717  -22.207 1.00 163.80 ? 151 C   E N3    1 
ATOM   7052  C  C4    . C   E  1 47  ? -62.979 62.265  -22.644 1.00 162.73 ? 151 C   E C4    1 
ATOM   7053  N  N4    . C   E  1 47  ? -63.998 62.274  -21.784 1.00 163.53 ? 151 C   E N4    1 
ATOM   7054  C  C5    . C   E  1 47  ? -63.164 61.796  -23.975 1.00 160.92 ? 151 C   E C5    1 
ATOM   7055  C  C6    . C   E  1 47  ? -62.103 61.812  -24.787 1.00 160.28 ? 151 C   E C6    1 
ATOM   7056  P  P     . G   E  1 48  ? -56.623 58.883  -24.604 1.00 156.89 ? 152 G   E P     1 
ATOM   7057  O  OP1   . G   E  1 48  ? -55.300 58.425  -25.085 1.00 161.11 ? 152 G   E OP1   1 
ATOM   7058  O  OP2   . G   E  1 48  ? -57.705 57.976  -24.174 1.00 155.80 ? 152 G   E OP2   1 
ATOM   7059  O  "O5'" . G   E  1 48  ? -56.336 59.857  -23.378 1.00 159.23 ? 152 G   E "O5'" 1 
ATOM   7060  C  "C5'" . G   E  1 48  ? -55.102 60.545  -23.270 1.00 160.58 ? 152 G   E "C5'" 1 
ATOM   7061  C  "C4'" . G   E  1 48  ? -54.955 61.193  -21.918 1.00 162.69 ? 152 G   E "C4'" 1 
ATOM   7062  O  "O4'" . G   E  1 48  ? -56.105 62.024  -21.648 1.00 163.91 ? 152 G   E "O4'" 1 
ATOM   7063  C  "C3'" . G   E  1 48  ? -54.884 60.284  -20.702 1.00 162.41 ? 152 G   E "C3'" 1 
ATOM   7064  O  "O3'" . G   E  1 48  ? -53.610 59.731  -20.475 1.00 162.14 ? 152 G   E "O3'" 1 
ATOM   7065  C  "C2'" . G   E  1 48  ? -55.296 61.208  -19.577 1.00 164.72 ? 152 G   E "C2'" 1 
ATOM   7066  O  "O2'" . G   E  1 48  ? -54.215 62.048  -19.221 1.00 166.64 ? 152 G   E "O2'" 1 
ATOM   7067  C  "C1'" . G   E  1 48  ? -56.358 62.052  -20.260 1.00 165.16 ? 152 G   E "C1'" 1 
ATOM   7068  N  N9    . G   E  1 48  ? -57.716 61.574  -19.995 1.00 166.69 ? 152 G   E N9    1 
ATOM   7069  C  C8    . G   E  1 48  ? -58.608 61.026  -20.874 1.00 166.06 ? 152 G   E C8    1 
ATOM   7070  N  N7    . G   E  1 48  ? -59.742 60.732  -20.305 1.00 167.07 ? 152 G   E N7    1 
ATOM   7071  C  C5    . G   E  1 48  ? -59.582 61.106  -18.979 1.00 170.94 ? 152 G   E C5    1 
ATOM   7072  C  C6    . G   E  1 48  ? -60.472 61.023  -17.877 1.00 179.28 ? 152 G   E C6    1 
ATOM   7073  O  O6    . G   E  1 48  ? -61.623 60.578  -17.862 1.00 185.23 ? 152 G   E O6    1 
ATOM   7074  N  N1    . G   E  1 48  ? -59.906 61.518  -16.705 1.00 179.27 ? 152 G   E N1    1 
ATOM   7075  C  C2    . G   E  1 48  ? -58.640 62.028  -16.601 1.00 177.91 ? 152 G   E C2    1 
ATOM   7076  N  N2    . G   E  1 48  ? -58.257 62.456  -15.389 1.00 181.10 ? 152 G   E N2    1 
ATOM   7077  N  N3    . G   E  1 48  ? -57.802 62.108  -17.627 1.00 173.85 ? 152 G   E N3    1 
ATOM   7078  C  C4    . G   E  1 48  ? -58.333 61.630  -18.773 1.00 170.63 ? 152 G   E C4    1 
ATOM   7079  P  P     . G   E  1 49  ? -53.505 58.276  -19.821 1.00 161.27 ? 153 G   E P     1 
ATOM   7080  O  OP1   . G   E  1 49  ? -52.062 57.940  -19.882 1.00 162.99 ? 153 G   E OP1   1 
ATOM   7081  O  OP2   . G   E  1 49  ? -54.545 57.424  -20.443 1.00 158.60 ? 153 G   E OP2   1 
ATOM   7082  O  "O5'" . G   E  1 49  ? -53.920 58.468  -18.287 1.00 164.72 ? 153 G   E "O5'" 1 
ATOM   7083  C  "C5'" . G   E  1 49  ? -53.033 59.082  -17.363 1.00 168.60 ? 153 G   E "C5'" 1 
ATOM   7084  C  "C4'" . G   E  1 49  ? -53.649 59.300  -15.996 1.00 172.67 ? 153 G   E "C4'" 1 
ATOM   7085  O  "O4'" . G   E  1 49  ? -54.846 60.119  -16.078 1.00 177.60 ? 153 G   E "O4'" 1 
ATOM   7086  C  "C3'" . G   E  1 49  ? -54.116 58.083  -15.223 1.00 174.01 ? 153 G   E "C3'" 1 
ATOM   7087  O  "O3'" . G   E  1 49  ? -53.082 57.337  -14.641 1.00 164.08 ? 153 G   E "O3'" 1 
ATOM   7088  C  "C2'" . G   E  1 49  ? -55.041 58.694  -14.189 1.00 180.28 ? 153 G   E "C2'" 1 
ATOM   7089  O  "O2'" . G   E  1 49  ? -54.287 59.304  -13.155 1.00 185.35 ? 153 G   E "O2'" 1 
ATOM   7090  C  "C1'" . G   E  1 49  ? -55.723 59.779  -15.017 1.00 182.15 ? 153 G   E "C1'" 1 
ATOM   7091  N  N9    . G   E  1 49  ? -56.992 59.278  -15.565 1.00 188.37 ? 153 G   E N9    1 
ATOM   7092  C  C8    . G   E  1 49  ? -57.287 58.890  -16.850 1.00 188.31 ? 153 G   E C8    1 
ATOM   7093  N  N7    . G   E  1 49  ? -58.518 58.474  -16.979 1.00 188.17 ? 153 G   E N7    1 
ATOM   7094  C  C5    . G   E  1 49  ? -59.051 58.585  -15.702 1.00 190.49 ? 153 G   E C5    1 
ATOM   7095  C  C6    . G   E  1 49  ? -60.344 58.286  -15.218 1.00 190.31 ? 153 G   E C6    1 
ATOM   7096  O  O6    . G   E  1 49  ? -61.302 57.841  -15.855 1.00 185.36 ? 153 G   E O6    1 
ATOM   7097  N  N1    . G   E  1 49  ? -60.456 58.541  -13.848 1.00 197.14 ? 153 G   E N1    1 
ATOM   7098  C  C2    . G   E  1 49  ? -59.460 59.036  -13.040 1.00 203.26 ? 153 G   E C2    1 
ATOM   7099  N  N2    . G   E  1 49  ? -59.749 59.228  -11.737 1.00 209.24 ? 153 G   E N2    1 
ATOM   7100  N  N3    . G   E  1 49  ? -58.249 59.322  -13.493 1.00 200.52 ? 153 G   E N3    1 
ATOM   7101  C  C4    . G   E  1 49  ? -58.121 59.073  -14.817 1.00 193.43 ? 153 G   E C4    1 
ATOM   7102  P  P     . G   E  1 50  ? -53.327 55.776  -14.425 1.00 161.87 ? 154 G   E P     1 
ATOM   7103  O  OP1   . G   E  1 50  ? -52.087 55.246  -13.805 1.00 163.71 ? 154 G   E OP1   1 
ATOM   7104  O  OP2   . G   E  1 50  ? -53.849 55.189  -15.685 1.00 159.71 ? 154 G   E OP2   1 
ATOM   7105  O  "O5'" . G   E  1 50  ? -54.507 55.722  -13.351 1.00 162.47 ? 154 G   E "O5'" 1 
ATOM   7106  C  "C5'" . G   E  1 50  ? -54.210 55.830  -11.967 1.00 169.49 ? 154 G   E "C5'" 1 
ATOM   7107  C  "C4'" . G   E  1 50  ? -55.434 55.931  -11.083 1.00 169.64 ? 154 G   E "C4'" 1 
ATOM   7108  O  "O4'" . G   E  1 50  ? -56.458 56.797  -11.645 1.00 168.17 ? 154 G   E "O4'" 1 
ATOM   7109  C  "C3'" . G   E  1 50  ? -56.188 54.643  -10.807 1.00 169.64 ? 154 G   E "C3'" 1 
ATOM   7110  O  "O3'" . G   E  1 50  ? -55.544 53.757  -9.919  1.00 174.50 ? 154 G   E "O3'" 1 
ATOM   7111  C  "C2'" . G   E  1 50  ? -57.506 55.166  -10.267 1.00 170.05 ? 154 G   E "C2'" 1 
ATOM   7112  O  "O2'" . G   E  1 50  ? -57.361 55.610  -8.928  1.00 174.16 ? 154 G   E "O2'" 1 
ATOM   7113  C  "C1'" . G   E  1 50  ? -57.726 56.382  -11.165 1.00 168.93 ? 154 G   E "C1'" 1 
ATOM   7114  N  N9    . G   E  1 50  ? -58.593 56.028  -12.295 1.00 164.48 ? 154 G   E N9    1 
ATOM   7115  C  C8    . G   E  1 50  ? -58.320 56.042  -13.637 1.00 163.03 ? 154 G   E C8    1 
ATOM   7116  N  N7    . G   E  1 50  ? -59.339 55.652  -14.354 1.00 163.97 ? 154 G   E N7    1 
ATOM   7117  C  C5    . G   E  1 50  ? -60.338 55.375  -13.433 1.00 163.24 ? 154 G   E C5    1 
ATOM   7118  C  C6    . G   E  1 50  ? -61.667 54.914  -13.608 1.00 159.95 ? 154 G   E C6    1 
ATOM   7119  O  O6    . G   E  1 50  ? -62.252 54.655  -14.661 1.00 158.60 ? 154 G   E O6    1 
ATOM   7120  N  N1    . G   E  1 50  ? -62.335 54.755  -12.399 1.00 160.86 ? 154 G   E N1    1 
ATOM   7121  C  C2    . G   E  1 50  ? -61.794 55.013  -11.170 1.00 173.83 ? 154 G   E C2    1 
ATOM   7122  N  N2    . G   E  1 50  ? -62.578 54.803  -10.100 1.00 177.65 ? 154 G   E N2    1 
ATOM   7123  N  N3    . G   E  1 50  ? -60.555 55.447  -10.998 1.00 169.45 ? 154 G   E N3    1 
ATOM   7124  C  C4    . G   E  1 50  ? -59.892 55.615  -12.160 1.00 164.13 ? 154 G   E C4    1 
ATOM   7125  P  P     . G   E  1 51  ? -55.924 52.200  -9.987  1.00 170.37 ? 155 G   E P     1 
ATOM   7126  O  OP1   . G   E  1 51  ? -54.994 51.452  -9.104  1.00 174.17 ? 155 G   E OP1   1 
ATOM   7127  O  OP2   . G   E  1 51  ? -56.059 51.838  -11.418 1.00 171.61 ? 155 G   E OP2   1 
ATOM   7128  O  "O5'" . G   E  1 51  ? -57.386 52.110  -9.365  1.00 166.08 ? 155 G   E "O5'" 1 
ATOM   7129  C  "C5'" . G   E  1 51  ? -57.599 52.414  -7.999  1.00 168.27 ? 155 G   E "C5'" 1 
ATOM   7130  C  "C4'" . G   E  1 51  ? -59.038 52.238  -7.591  1.00 170.33 ? 155 G   E "C4'" 1 
ATOM   7131  O  "O4'" . G   E  1 51  ? -59.928 53.054  -8.392  1.00 156.38 ? 155 G   E "O4'" 1 
ATOM   7132  C  "C3'" . G   E  1 51  ? -59.614 50.844  -7.728  1.00 170.86 ? 155 G   E "C3'" 1 
ATOM   7133  O  "O3'" . G   E  1 51  ? -59.174 49.971  -6.708  1.00 152.68 ? 155 G   E "O3'" 1 
ATOM   7134  C  "C2'" . G   E  1 51  ? -61.107 51.115  -7.691  1.00 174.63 ? 155 G   E "C2'" 1 
ATOM   7135  O  "O2'" . G   E  1 51  ? -61.542 51.327  -6.360  1.00 178.33 ? 155 G   E "O2'" 1 
ATOM   7136  C  "C1'" . G   E  1 51  ? -61.192 52.430  -8.477  1.00 155.20 ? 155 G   E "C1'" 1 
ATOM   7137  N  N9    . G   E  1 51  ? -61.481 52.161  -9.887  1.00 154.15 ? 155 G   E N9    1 
ATOM   7138  C  C8    . G   E  1 51  ? -60.592 52.138  -10.926 1.00 153.87 ? 155 G   E C8    1 
ATOM   7139  N  N7    . G   E  1 51  ? -61.163 51.813  -12.051 1.00 156.26 ? 155 G   E N7    1 
ATOM   7140  C  C5    . G   E  1 51  ? -62.494 51.582  -11.727 1.00 159.99 ? 155 G   E C5    1 
ATOM   7141  C  C6    . G   E  1 51  ? -63.598 51.189  -12.534 1.00 164.35 ? 155 G   E C6    1 
ATOM   7142  O  O6    . G   E  1 51  ? -63.649 50.952  -13.750 1.00 166.96 ? 155 G   E O6    1 
ATOM   7143  N  N1    . G   E  1 51  ? -64.757 51.074  -11.778 1.00 163.87 ? 155 G   E N1    1 
ATOM   7144  C  C2    . G   E  1 51  ? -64.851 51.297  -10.431 1.00 161.25 ? 155 G   E C2    1 
ATOM   7145  N  N2    . G   E  1 51  ? -66.073 51.116  -9.916  1.00 159.89 ? 155 G   E N2    1 
ATOM   7146  N  N3    . G   E  1 51  ? -63.835 51.665  -9.668  1.00 153.88 ? 155 G   E N3    1 
ATOM   7147  C  C4    . G   E  1 51  ? -62.696 51.774  -10.381 1.00 153.53 ? 155 G   E C4    1 
ATOM   7148  P  P     . G   E  1 52  ? -58.920 48.431  -7.045  1.00 150.03 ? 156 G   E P     1 
ATOM   7149  O  OP1   . G   E  1 52  ? -57.497 48.130  -6.752  1.00 154.51 ? 156 G   E OP1   1 
ATOM   7150  O  OP2   . G   E  1 52  ? -59.498 48.153  -8.383  1.00 148.75 ? 156 G   E OP2   1 
ATOM   7151  O  "O5'" . G   E  1 52  ? -59.833 47.668  -5.997  1.00 149.56 ? 156 G   E "O5'" 1 
ATOM   7152  C  "C5'" . G   E  1 52  ? -60.730 46.670  -6.440  1.00 156.37 ? 156 G   E "C5'" 1 
ATOM   7153  C  "C4'" . G   E  1 52  ? -62.155 47.046  -6.143  1.00 158.87 ? 156 G   E "C4'" 1 
ATOM   7154  O  "O4'" . G   E  1 52  ? -62.485 48.321  -6.761  1.00 150.33 ? 156 G   E "O4'" 1 
ATOM   7155  C  "C3'" . G   E  1 52  ? -63.199 46.096  -6.696  1.00 159.49 ? 156 G   E "C3'" 1 
ATOM   7156  O  "O3'" . G   E  1 52  ? -63.371 44.930  -5.930  1.00 165.83 ? 156 G   E "O3'" 1 
ATOM   7157  C  "C2'" . G   E  1 52  ? -64.430 46.972  -6.760  1.00 155.70 ? 156 G   E "C2'" 1 
ATOM   7158  O  "O2'" . G   E  1 52  ? -64.956 47.165  -5.456  1.00 157.26 ? 156 G   E "O2'" 1 
ATOM   7159  C  "C1'" . G   E  1 52  ? -63.812 48.282  -7.248  1.00 153.12 ? 156 G   E "C1'" 1 
ATOM   7160  N  N9    . G   E  1 52  ? -63.744 48.303  -8.722  1.00 152.13 ? 156 G   E N9    1 
ATOM   7161  C  C8    . G   E  1 52  ? -62.621 48.491  -9.497  1.00 151.98 ? 156 G   E C8    1 
ATOM   7162  N  N7    . G   E  1 52  ? -62.858 48.438  -10.781 1.00 148.74 ? 156 G   E N7    1 
ATOM   7163  C  C5    . G   E  1 52  ? -64.218 48.189  -10.859 1.00 149.62 ? 156 G   E C5    1 
ATOM   7164  C  C6    . G   E  1 52  ? -65.045 48.034  -11.994 1.00 149.70 ? 156 G   E C6    1 
ATOM   7165  O  O6    . G   E  1 52  ? -64.714 48.095  -13.185 1.00 148.99 ? 156 G   E O6    1 
ATOM   7166  N  N1    . G   E  1 52  ? -66.371 47.794  -11.623 1.00 153.94 ? 156 G   E N1    1 
ATOM   7167  C  C2    . G   E  1 52  ? -66.846 47.713  -10.333 1.00 156.34 ? 156 G   E C2    1 
ATOM   7168  N  N2    . G   E  1 52  ? -68.159 47.473  -10.172 1.00 151.17 ? 156 G   E N2    1 
ATOM   7169  N  N3    . G   E  1 52  ? -66.075 47.865  -9.272  1.00 155.75 ? 156 G   E N3    1 
ATOM   7170  C  C4    . G   E  1 52  ? -64.784 48.097  -9.603  1.00 152.35 ? 156 G   E C4    1 
ATOM   7171  P  P     . A   E  1 53  ? -63.137 43.513  -6.630  1.00 168.02 ? 157 A   E P     1 
ATOM   7172  O  OP1   . A   E  1 53  ? -62.789 42.524  -5.582  1.00 171.15 ? 157 A   E OP1   1 
ATOM   7173  O  OP2   . A   E  1 53  ? -62.216 43.681  -7.782  1.00 167.05 ? 157 A   E OP2   1 
ATOM   7174  O  "O5'" . A   E  1 53  ? -64.577 43.182  -7.214  1.00 168.86 ? 157 A   E "O5'" 1 
ATOM   7175  C  "C5'" . A   E  1 53  ? -65.752 43.444  -6.459  1.00 167.20 ? 157 A   E "C5'" 1 
ATOM   7176  C  "C4'" . A   E  1 53  ? -66.982 43.274  -7.312  1.00 162.69 ? 157 A   E "C4'" 1 
ATOM   7177  O  "O4'" . A   E  1 53  ? -67.156 44.428  -8.177  1.00 157.20 ? 157 A   E "O4'" 1 
ATOM   7178  C  "C3'" . A   E  1 53  ? -66.936 42.085  -8.268  1.00 162.11 ? 157 A   E "C3'" 1 
ATOM   7179  O  "O3'" . A   E  1 53  ? -67.294 40.860  -7.648  1.00 161.33 ? 157 A   E "O3'" 1 
ATOM   7180  C  "C2'" . A   E  1 53  ? -67.871 42.519  -9.385  1.00 163.17 ? 157 A   E "C2'" 1 
ATOM   7181  O  "O2'" . A   E  1 53  ? -69.228 42.371  -9.000  1.00 173.43 ? 157 A   E "O2'" 1 
ATOM   7182  C  "C1'" . A   E  1 53  ? -67.553 44.008  -9.465  1.00 154.57 ? 157 A   E "C1'" 1 
ATOM   7183  N  N9    . A   E  1 53  ? -66.428 44.256  -10.378 1.00 147.64 ? 157 A   E N9    1 
ATOM   7184  C  C8    . A   E  1 53  ? -65.138 44.559  -10.035 1.00 147.79 ? 157 A   E C8    1 
ATOM   7185  N  N7    . A   E  1 53  ? -64.347 44.727  -11.065 1.00 144.51 ? 157 A   E N7    1 
ATOM   7186  C  C5    . A   E  1 53  ? -65.173 44.523  -12.156 1.00 144.77 ? 157 A   E C5    1 
ATOM   7187  C  C6    . A   E  1 53  ? -64.933 44.562  -13.535 1.00 144.78 ? 157 A   E C6    1 
ATOM   7188  N  N6    . A   E  1 53  ? -63.744 44.832  -14.075 1.00 144.46 ? 157 A   E N6    1 
ATOM   7189  N  N1    . A   E  1 53  ? -65.978 44.307  -14.350 1.00 145.50 ? 157 A   E N1    1 
ATOM   7190  C  C2    . A   E  1 53  ? -67.175 44.034  -13.812 1.00 146.88 ? 157 A   E C2    1 
ATOM   7191  N  N3    . A   E  1 53  ? -67.520 43.973  -12.529 1.00 146.61 ? 157 A   E N3    1 
ATOM   7192  C  C4    . A   E  1 53  ? -66.461 44.236  -11.747 1.00 145.52 ? 157 A   E C4    1 
ATOM   7193  P  P     . C   E  1 54  ? -66.450 39.528  -7.943  1.00 161.53 ? 158 C   E P     1 
ATOM   7194  O  OP1   . C   E  1 54  ? -66.749 38.569  -6.845  1.00 158.29 ? 158 C   E OP1   1 
ATOM   7195  O  OP2   . C   E  1 54  ? -65.054 39.958  -8.223  1.00 162.44 ? 158 C   E OP2   1 
ATOM   7196  O  "O5'" . C   E  1 54  ? -67.026 38.969  -9.318  1.00 155.40 ? 158 C   E "O5'" 1 
ATOM   7197  C  "C5'" . C   E  1 54  ? -68.399 38.642  -9.455  1.00 150.92 ? 158 C   E "C5'" 1 
ATOM   7198  C  "C4'" . C   E  1 54  ? -68.799 38.604  -10.905 1.00 148.91 ? 158 C   E "C4'" 1 
ATOM   7199  O  "O4'" . C   E  1 54  ? -68.593 39.917  -11.493 1.00 143.29 ? 158 C   E "O4'" 1 
ATOM   7200  C  "C3'" . C   E  1 54  ? -67.979 37.686  -11.798 1.00 149.00 ? 158 C   E "C3'" 1 
ATOM   7201  O  "O3'" . C   E  1 54  ? -68.288 36.308  -11.692 1.00 152.39 ? 158 C   E "O3'" 1 
ATOM   7202  C  "C2'" . C   E  1 54  ? -68.211 38.298  -13.169 1.00 141.28 ? 158 C   E "C2'" 1 
ATOM   7203  O  "O2'" . C   E  1 54  ? -69.529 38.044  -13.626 1.00 143.07 ? 158 C   E "O2'" 1 
ATOM   7204  C  "C1'" . C   E  1 54  ? -68.124 39.777  -12.818 1.00 142.58 ? 158 C   E "C1'" 1 
ATOM   7205  N  N1    . C   E  1 54  ? -66.721 40.239  -12.857 1.00 141.37 ? 158 C   E N1    1 
ATOM   7206  C  C2    . C   E  1 54  ? -66.154 40.513  -14.099 1.00 141.33 ? 158 C   E C2    1 
ATOM   7207  O  O2    . C   E  1 54  ? -66.843 40.376  -15.121 1.00 142.30 ? 158 C   E O2    1 
ATOM   7208  N  N3    . C   E  1 54  ? -64.867 40.923  -14.146 1.00 141.98 ? 158 C   E N3    1 
ATOM   7209  C  C4    . C   E  1 54  ? -64.151 41.064  -13.026 1.00 143.49 ? 158 C   E C4    1 
ATOM   7210  N  N4    . C   E  1 54  ? -62.885 41.481  -13.133 1.00 145.70 ? 158 C   E N4    1 
ATOM   7211  C  C5    . C   E  1 54  ? -64.704 40.788  -11.745 1.00 142.34 ? 158 C   E C5    1 
ATOM   7212  C  C6    . C   E  1 54  ? -65.977 40.384  -11.715 1.00 141.56 ? 158 C   E C6    1 
ATOM   7213  P  P     . C   E  1 55  ? -67.108 35.219  -11.838 1.00 151.81 ? 159 C   E P     1 
ATOM   7214  O  OP1   . C   E  1 55  ? -67.477 33.963  -11.121 1.00 151.07 ? 159 C   E OP1   1 
ATOM   7215  O  OP2   . C   E  1 55  ? -65.858 35.941  -11.477 1.00 152.74 ? 159 C   E OP2   1 
ATOM   7216  O  "O5'" . C   E  1 55  ? -67.050 34.904  -13.404 1.00 149.29 ? 159 C   E "O5'" 1 
ATOM   7217  C  "C5'" . C   E  1 55  ? -68.237 34.606  -14.127 1.00 147.97 ? 159 C   E "C5'" 1 
ATOM   7218  C  "C4'" . C   E  1 55  ? -68.095 34.908  -15.601 1.00 150.05 ? 159 C   E "C4'" 1 
ATOM   7219  O  "O4'" . C   E  1 55  ? -67.809 36.324  -15.798 1.00 155.90 ? 159 C   E "O4'" 1 
ATOM   7220  C  "C3'" . C   E  1 55  ? -66.972 34.213  -16.346 1.00 146.86 ? 159 C   E "C3'" 1 
ATOM   7221  O  "O3'" . C   E  1 55  ? -67.266 32.867  -16.655 1.00 144.86 ? 159 C   E "O3'" 1 
ATOM   7222  C  "C2'" . C   E  1 55  ? -66.791 35.110  -17.565 1.00 151.08 ? 159 C   E "C2'" 1 
ATOM   7223  O  "O2'" . C   E  1 55  ? -67.843 34.894  -18.494 1.00 140.54 ? 159 C   E "O2'" 1 
ATOM   7224  C  "C1'" . C   E  1 55  ? -66.996 36.495  -16.945 1.00 154.43 ? 159 C   E "C1'" 1 
ATOM   7225  N  N1    . C   E  1 55  ? -65.717 37.140  -16.530 1.00 152.95 ? 159 C   E N1    1 
ATOM   7226  C  C2    . C   E  1 55  ? -64.820 37.693  -17.468 1.00 155.76 ? 159 C   E C2    1 
ATOM   7227  O  O2    . C   E  1 55  ? -65.094 37.626  -18.672 1.00 158.70 ? 159 C   E O2    1 
ATOM   7228  N  N3    . C   E  1 55  ? -63.664 38.270  -17.045 1.00 155.49 ? 159 C   E N3    1 
ATOM   7229  C  C4    . C   E  1 55  ? -63.388 38.330  -15.744 1.00 155.68 ? 159 C   E C4    1 
ATOM   7230  N  N4    . C   E  1 55  ? -62.250 38.907  -15.355 1.00 157.53 ? 159 C   E N4    1 
ATOM   7231  C  C5    . C   E  1 55  ? -64.275 37.799  -14.767 1.00 154.04 ? 159 C   E C5    1 
ATOM   7232  C  C6    . C   E  1 55  ? -65.407 37.228  -15.199 1.00 154.09 ? 159 C   E C6    1 
ATOM   7233  P  P     . A   E  1 56  ? -66.165 31.737  -16.385 1.00 133.59 ? 160 A   E P     1 
ATOM   7234  O  OP1   . A   E  1 56  ? -66.872 30.447  -16.262 1.00 138.35 ? 160 A   E OP1   1 
ATOM   7235  O  OP2   . A   E  1 56  ? -65.269 32.239  -15.317 1.00 132.23 ? 160 A   E OP2   1 
ATOM   7236  O  "O5'" . A   E  1 56  ? -65.293 31.684  -17.705 1.00 133.38 ? 160 A   E "O5'" 1 
ATOM   7237  C  "C5'" . A   E  1 56  ? -65.865 31.293  -18.938 1.00 134.93 ? 160 A   E "C5'" 1 
ATOM   7238  C  "C4'" . A   E  1 56  ? -64.945 31.668  -20.061 1.00 142.32 ? 160 A   E "C4'" 1 
ATOM   7239  O  "O4'" . A   E  1 56  ? -64.826 33.116  -20.114 1.00 145.01 ? 160 A   E "O4'" 1 
ATOM   7240  C  "C3'" . A   E  1 56  ? -63.516 31.176  -19.910 1.00 132.97 ? 160 A   E "C3'" 1 
ATOM   7241  O  "O3'" . A   E  1 56  ? -63.360 29.856  -20.386 1.00 132.06 ? 160 A   E "O3'" 1 
ATOM   7242  C  "C2'" . A   E  1 56  ? -62.719 32.192  -20.715 1.00 141.30 ? 160 A   E "C2'" 1 
ATOM   7243  O  "O2'" . A   E  1 56  ? -62.754 31.869  -22.097 1.00 140.26 ? 160 A   E "O2'" 1 
ATOM   7244  C  "C1'" . A   E  1 56  ? -63.514 33.482  -20.471 1.00 145.18 ? 160 A   E "C1'" 1 
ATOM   7245  N  N9    . A   E  1 56  ? -62.944 34.270  -19.365 1.00 135.01 ? 160 A   E N9    1 
ATOM   7246  C  C8    . A   E  1 56  ? -63.461 34.483  -18.121 1.00 134.51 ? 160 A   E C8    1 
ATOM   7247  N  N7    . A   E  1 56  ? -62.693 35.220  -17.358 1.00 134.00 ? 160 A   E N7    1 
ATOM   7248  C  C5    . A   E  1 56  ? -61.597 35.502  -18.149 1.00 134.14 ? 160 A   E C5    1 
ATOM   7249  C  C6    . A   E  1 56  ? -60.426 36.250  -17.933 1.00 134.14 ? 160 A   E C6    1 
ATOM   7250  N  N6    . A   E  1 56  ? -60.150 36.878  -16.788 1.00 133.90 ? 160 A   E N6    1 
ATOM   7251  N  N1    . A   E  1 56  ? -59.531 36.339  -18.947 1.00 134.77 ? 160 A   E N1    1 
ATOM   7252  C  C2    . A   E  1 56  ? -59.829 35.707  -20.083 1.00 135.32 ? 160 A   E C2    1 
ATOM   7253  N  N3    . A   E  1 56  ? -60.894 34.982  -20.400 1.00 135.40 ? 160 A   E N3    1 
ATOM   7254  C  C4    . A   E  1 56  ? -61.751 34.926  -19.384 1.00 134.78 ? 160 A   E C4    1 
ATOM   7255  P  P     . C   E  1 57  ? -62.069 28.986  -19.996 1.00 129.35 ? 161 C   E P     1 
ATOM   7256  O  OP1   . C   E  1 57  ? -62.204 27.713  -20.726 1.00 129.12 ? 161 C   E OP1   1 
ATOM   7257  O  OP2   . C   E  1 57  ? -61.778 29.059  -18.550 1.00 127.57 ? 161 C   E OP2   1 
ATOM   7258  O  "O5'" . C   E  1 57  ? -60.859 29.714  -20.693 1.00 129.85 ? 161 C   E "O5'" 1 
ATOM   7259  C  "C5'" . C   E  1 57  ? -60.490 29.373  -22.007 1.00 130.97 ? 161 C   E "C5'" 1 
ATOM   7260  C  "C4'" . C   E  1 57  ? -59.161 29.976  -22.331 1.00 131.17 ? 161 C   E "C4'" 1 
ATOM   7261  O  "O4'" . C   E  1 57  ? -59.203 31.421  -22.172 1.00 138.06 ? 161 C   E "O4'" 1 
ATOM   7262  C  "C3'" . C   E  1 57  ? -58.029 29.547  -21.425 1.00 128.75 ? 161 C   E "C3'" 1 
ATOM   7263  O  "O3'" . C   E  1 57  ? -57.505 28.288  -21.754 1.00 127.47 ? 161 C   E "O3'" 1 
ATOM   7264  C  "C2'" . C   E  1 57  ? -57.030 30.676  -21.588 1.00 135.30 ? 161 C   E "C2'" 1 
ATOM   7265  O  "O2'" . C   E  1 57  ? -56.327 30.550  -22.814 1.00 131.36 ? 161 C   E "O2'" 1 
ATOM   7266  C  "C1'" . C   E  1 57  ? -57.963 31.881  -21.667 1.00 136.76 ? 161 C   E "C1'" 1 
ATOM   7267  N  N1    . C   E  1 57  ? -58.166 32.492  -20.337 1.00 130.97 ? 161 C   E N1    1 
ATOM   7268  C  C2    . C   E  1 57  ? -57.142 33.273  -19.801 1.00 131.00 ? 161 C   E C2    1 
ATOM   7269  O  O2    . C   E  1 57  ? -56.094 33.434  -20.450 1.00 131.79 ? 161 C   E O2    1 
ATOM   7270  N  N3    . C   E  1 57  ? -57.314 33.819  -18.572 1.00 130.47 ? 161 C   E N3    1 
ATOM   7271  C  C4    . C   E  1 57  ? -58.444 33.618  -17.895 1.00 129.95 ? 161 C   E C4    1 
ATOM   7272  N  N4    . C   E  1 57  ? -58.586 34.174  -16.692 1.00 129.76 ? 161 C   E N4    1 
ATOM   7273  C  C5    . C   E  1 57  ? -59.499 32.839  -18.429 1.00 129.96 ? 161 C   E C5    1 
ATOM   7274  C  C6    . C   E  1 57  ? -59.318 32.299  -19.638 1.00 130.47 ? 161 C   E C6    1 
ATOM   7275  P  P     . C   E  1 58  ? -56.773 27.458  -20.607 1.00 131.71 ? 162 C   E P     1 
ATOM   7276  O  OP1   . C   E  1 58  ? -56.530 26.055  -21.061 1.00 129.09 ? 162 C   E OP1   1 
ATOM   7277  O  OP2   . C   E  1 58  ? -57.560 27.809  -19.393 1.00 131.03 ? 162 C   E OP2   1 
ATOM   7278  O  "O5'" . C   E  1 58  ? -55.359 28.172  -20.484 1.00 132.48 ? 162 C   E "O5'" 1 
ATOM   7279  C  "C5'" . C   E  1 58  ? -54.550 28.342  -21.635 1.00 135.51 ? 162 C   E "C5'" 1 
ATOM   7280  C  "C4'" . C   E  1 58  ? -53.344 29.168  -21.315 1.00 137.03 ? 162 C   E "C4'" 1 
ATOM   7281  O  "O4'" . C   E  1 58  ? -53.739 30.527  -21.024 1.00 141.16 ? 162 C   E "O4'" 1 
ATOM   7282  C  "C3'" . C   E  1 58  ? -52.588 28.727  -20.084 1.00 134.06 ? 162 C   E "C3'" 1 
ATOM   7283  O  "O3'" . C   E  1 58  ? -51.716 27.663  -20.394 1.00 125.03 ? 162 C   E "O3'" 1 
ATOM   7284  C  "C2'" . C   E  1 58  ? -51.885 30.005  -19.644 1.00 140.74 ? 162 C   E "C2'" 1 
ATOM   7285  O  "O2'" . C   E  1 58  ? -50.717 30.234  -20.415 1.00 146.47 ? 162 C   E "O2'" 1 
ATOM   7286  C  "C1'" . C   E  1 58  ? -52.917 31.067  -20.015 1.00 143.79 ? 162 C   E "C1'" 1 
ATOM   7287  N  N1    . C   E  1 58  ? -53.778 31.471  -18.883 1.00 143.59 ? 162 C   E N1    1 
ATOM   7288  C  C2    . C   E  1 58  ? -53.311 32.346  -17.894 1.00 145.83 ? 162 C   E C2    1 
ATOM   7289  O  O2    . C   E  1 58  ? -52.166 32.810  -17.979 1.00 152.53 ? 162 C   E O2    1 
ATOM   7290  N  N3    . C   E  1 58  ? -54.145 32.703  -16.879 1.00 141.38 ? 162 C   E N3    1 
ATOM   7291  C  C4    . C   E  1 58  ? -55.378 32.211  -16.806 1.00 135.88 ? 162 C   E C4    1 
ATOM   7292  N  N4    . C   E  1 58  ? -56.175 32.567  -15.795 1.00 129.72 ? 162 C   E N4    1 
ATOM   7293  C  C5    . C   E  1 58  ? -55.859 31.303  -17.787 1.00 140.79 ? 162 C   E C5    1 
ATOM   7294  C  C6    . C   E  1 58  ? -55.042 30.969  -18.793 1.00 142.89 ? 162 C   E C6    1 
ATOM   7295  P  P     . A   E  1 59  ? -51.389 26.546  -19.309 1.00 123.93 ? 163 A   E P     1 
ATOM   7296  O  OP1   . A   E  1 59  ? -50.627 25.498  -20.028 1.00 129.62 ? 163 A   E OP1   1 
ATOM   7297  O  OP2   . A   E  1 59  ? -52.652 26.251  -18.584 1.00 122.73 ? 163 A   E OP2   1 
ATOM   7298  O  "O5'" . A   E  1 59  ? -50.400 27.262  -18.292 1.00 121.43 ? 163 A   E "O5'" 1 
ATOM   7299  C  "C5'" . A   E  1 59  ? -49.108 27.672  -18.705 1.00 122.89 ? 163 A   E "C5'" 1 
ATOM   7300  C  "C4'" . A   E  1 59  ? -48.603 28.793  -17.836 1.00 124.06 ? 163 A   E "C4'" 1 
ATOM   7301  O  "O4'" . A   E  1 59  ? -49.654 29.761  -17.629 1.00 125.75 ? 163 A   E "O4'" 1 
ATOM   7302  C  "C3'" . A   E  1 59  ? -48.163 28.422  -16.434 1.00 122.56 ? 163 A   E "C3'" 1 
ATOM   7303  O  "O3'" . A   E  1 59  ? -46.835 27.950  -16.404 1.00 122.70 ? 163 A   E "O3'" 1 
ATOM   7304  C  "C2'" . A   E  1 59  ? -48.329 29.724  -15.654 1.00 124.03 ? 163 A   E "C2'" 1 
ATOM   7305  O  "O2'" . A   E  1 59  ? -47.177 30.537  -15.801 1.00 126.34 ? 163 A   E "O2'" 1 
ATOM   7306  C  "C1'" . A   E  1 59  ? -49.485 30.400  -16.386 1.00 125.83 ? 163 A   E "C1'" 1 
ATOM   7307  N  N9    . A   E  1 59  ? -50.765 30.401  -15.657 1.00 126.67 ? 163 A   E N9    1 
ATOM   7308  C  C8    . A   E  1 59  ? -51.937 29.872  -16.122 1.00 125.49 ? 163 A   E C8    1 
ATOM   7309  N  N7    . A   E  1 59  ? -52.947 30.028  -15.312 1.00 126.36 ? 163 A   E N7    1 
ATOM   7310  C  C5    . A   E  1 59  ? -52.408 30.720  -14.247 1.00 128.87 ? 163 A   E C5    1 
ATOM   7311  C  C6    . A   E  1 59  ? -52.995 31.183  -13.062 1.00 132.53 ? 163 A   E C6    1 
ATOM   7312  N  N6    . A   E  1 59  ? -54.287 30.990  -12.767 1.00 136.22 ? 163 A   E N6    1 
ATOM   7313  N  N1    . A   E  1 59  ? -52.210 31.860  -12.187 1.00 131.84 ? 163 A   E N1    1 
ATOM   7314  C  C2    . A   E  1 59  ? -50.912 32.046  -12.492 1.00 130.60 ? 163 A   E C2    1 
ATOM   7315  N  N3    . A   E  1 59  ? -50.254 31.643  -13.586 1.00 129.68 ? 163 A   E N3    1 
ATOM   7316  C  C4    . A   E  1 59  ? -51.061 30.970  -14.435 1.00 128.42 ? 163 A   E C4    1 
ATOM   7317  P  P     . G   E  1 60  ? -46.517 26.524  -15.774 1.00 120.13 ? 164 G   E P     1 
ATOM   7318  O  OP1   . G   E  1 60  ? -45.069 26.280  -15.975 1.00 121.94 ? 164 G   E OP1   1 
ATOM   7319  O  OP2   . G   E  1 60  ? -47.598 25.622  -16.232 1.00 118.27 ? 164 G   E OP2   1 
ATOM   7320  O  "O5'" . G   E  1 60  ? -46.734 26.711  -14.221 1.00 119.38 ? 164 G   E "O5'" 1 
ATOM   7321  C  "C5'" . G   E  1 60  ? -46.177 27.823  -13.563 1.00 121.41 ? 164 G   E "C5'" 1 
ATOM   7322  C  "C4'" . G   E  1 60  ? -46.994 28.162  -12.358 1.00 120.97 ? 164 G   E "C4'" 1 
ATOM   7323  O  "O4'" . G   E  1 60  ? -48.357 28.450  -12.776 1.00 120.62 ? 164 G   E "O4'" 1 
ATOM   7324  C  "C3'" . G   E  1 60  ? -47.077 27.047  -11.339 1.00 132.09 ? 164 G   E "C3'" 1 
ATOM   7325  O  "O3'" . G   E  1 60  ? -46.871 27.550  -10.034 1.00 135.54 ? 164 G   E "O3'" 1 
ATOM   7326  C  "C2'" . G   E  1 60  ? -48.476 26.461  -11.539 1.00 135.14 ? 164 G   E "C2'" 1 
ATOM   7327  O  "O2'" . G   E  1 60  ? -49.071 25.925  -10.381 1.00 140.67 ? 164 G   E "O2'" 1 
ATOM   7328  C  "C1'" . G   E  1 60  ? -49.278 27.634  -12.090 1.00 118.66 ? 164 G   E "C1'" 1 
ATOM   7329  N  N9    . G   E  1 60  ? -50.245 27.166  -13.086 1.00 118.01 ? 164 G   E N9    1 
ATOM   7330  C  C8    . G   E  1 60  ? -49.815 26.687  -14.295 1.00 117.70 ? 164 G   E C8    1 
ATOM   7331  N  N7    . G   E  1 60  ? -50.757 26.266  -15.084 1.00 118.32 ? 164 G   E N7    1 
ATOM   7332  C  C5    . G   E  1 60  ? -51.916 26.444  -14.341 1.00 117.57 ? 164 G   E C5    1 
ATOM   7333  C  C6    . G   E  1 60  ? -53.260 26.148  -14.718 1.00 117.50 ? 164 G   E C6    1 
ATOM   7334  O  O6    . G   E  1 60  ? -53.687 25.669  -15.782 1.00 116.68 ? 164 G   E O6    1 
ATOM   7335  N  N1    . G   E  1 60  ? -54.144 26.470  -13.704 1.00 118.91 ? 164 G   E N1    1 
ATOM   7336  C  C2    . G   E  1 60  ? -53.781 27.011  -12.502 1.00 120.55 ? 164 G   E C2    1 
ATOM   7337  N  N2    . G   E  1 60  ? -54.828 27.225  -11.698 1.00 125.63 ? 164 G   E N2    1 
ATOM   7338  N  N3    . G   E  1 60  ? -52.529 27.300  -12.126 1.00 119.60 ? 164 G   E N3    1 
ATOM   7339  C  C4    . G   E  1 60  ? -51.629 26.994  -13.091 1.00 117.51 ? 164 G   E C4    1 
ATOM   7340  P  P     . G   E  1 61  ? -45.530 27.089  -9.288  1.00 129.65 ? 165 G   E P     1 
ATOM   7341  O  OP1   . G   E  1 61  ? -44.676 28.269  -9.021  1.00 123.20 ? 165 G   E OP1   1 
ATOM   7342  O  OP2   . G   E  1 61  ? -44.964 25.959  -10.069 1.00 127.34 ? 165 G   E OP2   1 
ATOM   7343  O  "O5'" . G   E  1 61  ? -46.063 26.495  -7.923  1.00 121.59 ? 165 G   E "O5'" 1 
ATOM   7344  C  "C5'" . G   E  1 61  ? -45.492 26.924  -6.708  1.00 120.81 ? 165 G   E "C5'" 1 
ATOM   7345  C  "C4'" . G   E  1 61  ? -46.520 27.610  -5.855  1.00 121.66 ? 165 G   E "C4'" 1 
ATOM   7346  O  "O4'" . G   E  1 61  ? -47.477 28.292  -6.689  1.00 121.68 ? 165 G   E "O4'" 1 
ATOM   7347  C  "C3'" . G   E  1 61  ? -47.383 26.713  -5.003  1.00 135.49 ? 165 G   E "C3'" 1 
ATOM   7348  O  "O3'" . G   E  1 61  ? -46.714 26.279  -3.844  1.00 135.24 ? 165 G   E "O3'" 1 
ATOM   7349  C  "C2'" . G   E  1 61  ? -48.606 27.584  -4.728  1.00 121.04 ? 165 G   E "C2'" 1 
ATOM   7350  O  "O2'" . G   E  1 61  ? -48.359 28.512  -3.687  1.00 123.64 ? 165 G   E "O2'" 1 
ATOM   7351  C  "C1'" . G   E  1 61  ? -48.708 28.387  -6.013  1.00 121.46 ? 165 G   E "C1'" 1 
ATOM   7352  N  N9    . G   E  1 61  ? -49.756 27.882  -6.888  1.00 124.03 ? 165 G   E N9    1 
ATOM   7353  C  C8    . G   E  1 61  ? -49.581 27.382  -8.139  1.00 131.37 ? 165 G   E C8    1 
ATOM   7354  N  N7    . G   E  1 61  ? -50.700 27.022  -8.702  1.00 135.69 ? 165 G   E N7    1 
ATOM   7355  C  C5    . G   E  1 61  ? -51.666 27.328  -7.749  1.00 129.32 ? 165 G   E C5    1 
ATOM   7356  C  C6    . G   E  1 61  ? -53.074 27.163  -7.785  1.00 126.50 ? 165 G   E C6    1 
ATOM   7357  O  O6    . G   E  1 61  ? -53.799 26.695  -8.680  1.00 127.29 ? 165 G   E O6    1 
ATOM   7358  N  N1    . G   E  1 61  ? -53.631 27.613  -6.599  1.00 124.32 ? 165 G   E N1    1 
ATOM   7359  C  C2    . G   E  1 61  ? -52.959 28.146  -5.533  1.00 120.16 ? 165 G   E C2    1 
ATOM   7360  N  N2    . G   E  1 61  ? -53.738 28.511  -4.506  1.00 121.49 ? 165 G   E N2    1 
ATOM   7361  N  N3    . G   E  1 61  ? -51.651 28.302  -5.485  1.00 120.58 ? 165 G   E N3    1 
ATOM   7362  C  C4    . G   E  1 61  ? -51.087 27.880  -6.626  1.00 122.74 ? 165 G   E C4    1 
ATOM   7363  P  P     . U   E  1 62  ? -46.835 24.753  -3.400  1.00 118.32 ? 166 U   E P     1 
ATOM   7364  O  OP1   . U   E  1 62  ? -45.774 24.531  -2.387  1.00 120.27 ? 166 U   E OP1   1 
ATOM   7365  O  OP2   . U   E  1 62  ? -46.961 23.893  -4.603  1.00 115.78 ? 166 U   E OP2   1 
ATOM   7366  O  "O5'" . U   E  1 62  ? -48.215 24.697  -2.646  1.00 118.22 ? 166 U   E "O5'" 1 
ATOM   7367  C  "C5'" . U   E  1 62  ? -48.284 25.154  -1.322  1.00 120.42 ? 166 U   E "C5'" 1 
ATOM   7368  C  "C4'" . U   E  1 62  ? -49.685 25.530  -1.018  1.00 120.88 ? 166 U   E "C4'" 1 
ATOM   7369  O  "O4'" . U   E  1 62  ? -50.262 26.080  -2.203  1.00 120.24 ? 166 U   E "O4'" 1 
ATOM   7370  C  "C3'" . U   E  1 62  ? -50.626 24.396  -0.679  1.00 119.25 ? 166 U   E "C3'" 1 
ATOM   7371  O  "O3'" . U   E  1 62  ? -50.509 23.950  0.655   1.00 120.36 ? 166 U   E "O3'" 1 
ATOM   7372  C  "C2'" . U   E  1 62  ? -51.984 24.991  -1.000  1.00 119.69 ? 166 U   E "C2'" 1 
ATOM   7373  O  "O2'" . U   E  1 62  ? -52.469 25.746  0.089   1.00 127.04 ? 166 U   E "O2'" 1 
ATOM   7374  C  "C1'" . U   E  1 62  ? -51.650 25.952  -2.130  1.00 119.88 ? 166 U   E "C1'" 1 
ATOM   7375  N  N1    . U   E  1 62  ? -52.131 25.482  -3.417  1.00 117.83 ? 166 U   E N1    1 
ATOM   7376  C  C2    . U   E  1 62  ? -53.490 25.540  -3.541  1.00 117.89 ? 166 U   E C2    1 
ATOM   7377  O  O2    . U   E  1 62  ? -54.235 25.924  -2.661  1.00 119.45 ? 166 U   E O2    1 
ATOM   7378  N  N3    . U   E  1 62  ? -53.943 25.129  -4.740  1.00 119.13 ? 166 U   E N3    1 
ATOM   7379  C  C4    . U   E  1 62  ? -53.156 24.679  -5.767  1.00 132.75 ? 166 U   E C4    1 
ATOM   7380  O  O4    . U   E  1 62  ? -53.738 24.339  -6.790  1.00 142.13 ? 166 U   E O4    1 
ATOM   7381  C  C5    . U   E  1 62  ? -51.736 24.655  -5.548  1.00 135.43 ? 166 U   E C5    1 
ATOM   7382  C  C6    . U   E  1 62  ? -51.260 25.065  -4.381  1.00 116.41 ? 166 U   E C6    1 
ATOM   7383  P  P     . U   E  1 63  ? -51.191 22.583  1.135   1.00 118.86 ? 167 U   E P     1 
ATOM   7384  O  OP1   . U   E  1 63  ? -51.831 22.887  2.436   1.00 121.40 ? 167 U   E OP1   1 
ATOM   7385  O  OP2   . U   E  1 63  ? -50.179 21.520  0.955   1.00 117.12 ? 167 U   E OP2   1 
ATOM   7386  O  "O5'" . U   E  1 63  ? -52.363 22.290  0.098   1.00 117.03 ? 167 U   E "O5'" 1 
ATOM   7387  C  "C5'" . U   E  1 63  ? -53.264 21.210  0.278   1.00 115.89 ? 167 U   E "C5'" 1 
ATOM   7388  C  "C4'" . U   E  1 63  ? -54.630 21.568  -0.244  1.00 116.21 ? 167 U   E "C4'" 1 
ATOM   7389  O  "O4'" . U   E  1 63  ? -54.503 22.117  -1.557  1.00 115.31 ? 167 U   E "O4'" 1 
ATOM   7390  C  "C3'" . U   E  1 63  ? -55.595 20.431  -0.442  1.00 128.81 ? 167 U   E "C3'" 1 
ATOM   7391  O  "O3'" . U   E  1 63  ? -56.174 20.006  0.770   1.00 126.56 ? 167 U   E "O3'" 1 
ATOM   7392  C  "C2'" . U   E  1 63  ? -56.581 20.987  -1.473  1.00 115.06 ? 167 U   E "C2'" 1 
ATOM   7393  O  "O2'" . U   E  1 63  ? -57.568 21.792  -0.857  1.00 117.57 ? 167 U   E "O2'" 1 
ATOM   7394  C  "C1'" . U   E  1 63  ? -55.694 21.924  -2.271  1.00 114.85 ? 167 U   E "C1'" 1 
ATOM   7395  N  N1    . U   E  1 63  ? -55.366 21.502  -3.648  1.00 112.79 ? 167 U   E N1    1 
ATOM   7396  C  C2    . U   E  1 63  ? -56.381 21.525  -4.571  1.00 112.69 ? 167 U   E C2    1 
ATOM   7397  O  O2    . U   E  1 63  ? -57.520 21.789  -4.253  1.00 114.08 ? 167 U   E O2    1 
ATOM   7398  N  N3    . U   E  1 63  ? -56.008 21.204  -5.852  1.00 111.19 ? 167 U   E N3    1 
ATOM   7399  C  C4    . U   E  1 63  ? -54.739 20.889  -6.277  1.00 109.85 ? 167 U   E C4    1 
ATOM   7400  O  O4    . U   E  1 63  ? -54.534 20.624  -7.456  1.00 108.89 ? 167 U   E O4    1 
ATOM   7401  C  C5    . U   E  1 63  ? -53.731 20.909  -5.270  1.00 110.03 ? 167 U   E C5    1 
ATOM   7402  C  C6    . U   E  1 63  ? -54.070 21.222  -4.020  1.00 111.50 ? 167 U   E C6    1 
ATOM   7403  P  P     . G   E  1 64  ? -56.301 18.436  1.046   1.00 119.46 ? 168 G   E P     1 
ATOM   7404  O  OP1   . G   E  1 64  ? -56.423 18.227  2.503   1.00 122.50 ? 168 G   E OP1   1 
ATOM   7405  O  OP2   . G   E  1 64  ? -55.211 17.814  0.266   1.00 112.14 ? 168 G   E OP2   1 
ATOM   7406  O  "O5'" . G   E  1 64  ? -57.694 18.030  0.405   1.00 117.94 ? 168 G   E "O5'" 1 
ATOM   7407  C  "C5'" . G   E  1 64  ? -58.864 18.717  0.815   1.00 117.24 ? 168 G   E "C5'" 1 
ATOM   7408  C  "C4'" . G   E  1 64  ? -60.080 18.260  0.063   1.00 117.09 ? 168 G   E "C4'" 1 
ATOM   7409  O  "O4'" . G   E  1 64  ? -59.881 18.514  -1.346  1.00 115.39 ? 168 G   E "O4'" 1 
ATOM   7410  C  "C3'" . G   E  1 64  ? -60.438 16.786  0.198   1.00 117.40 ? 168 G   E "C3'" 1 
ATOM   7411  O  "O3'" . G   E  1 64  ? -61.817 16.657  0.455   1.00 126.13 ? 168 G   E "O3'" 1 
ATOM   7412  C  "C2'" . G   E  1 64  ? -60.117 16.192  -1.164  1.00 116.42 ? 168 G   E "C2'" 1 
ATOM   7413  O  "O2'" . G   E  1 64  ? -60.995 15.154  -1.543  1.00 118.15 ? 168 G   E "O2'" 1 
ATOM   7414  C  "C1'" . G   E  1 64  ? -60.250 17.390  -2.099  1.00 113.80 ? 168 G   E "C1'" 1 
ATOM   7415  N  N9    . G   E  1 64  ? -59.312 17.295  -3.212  1.00 111.46 ? 168 G   E N9    1 
ATOM   7416  C  C8    . G   E  1 64  ? -57.967 17.128  -3.062  1.00 109.92 ? 168 G   E C8    1 
ATOM   7417  N  N7    . G   E  1 64  ? -57.344 17.006  -4.197  1.00 108.22 ? 168 G   E N7    1 
ATOM   7418  C  C5    . G   E  1 64  ? -58.330 17.086  -5.150  1.00 108.65 ? 168 G   E C5    1 
ATOM   7419  C  C6    . G   E  1 64  ? -58.227 17.026  -6.554  1.00 107.71 ? 168 G   E C6    1 
ATOM   7420  O  O6    . G   E  1 64  ? -57.230 16.874  -7.275  1.00 106.25 ? 168 G   E O6    1 
ATOM   7421  N  N1    . G   E  1 64  ? -59.480 17.156  -7.132  1.00 109.03 ? 168 G   E N1    1 
ATOM   7422  C  C2    . G   E  1 64  ? -60.656 17.313  -6.450  1.00 110.98 ? 168 G   E C2    1 
ATOM   7423  N  N2    . G   E  1 64  ? -61.761 17.419  -7.200  1.00 112.32 ? 168 G   E N2    1 
ATOM   7424  N  N3    . G   E  1 64  ? -60.755 17.367  -5.137  1.00 111.90 ? 168 G   E N3    1 
ATOM   7425  C  C4    . G   E  1 64  ? -59.558 17.243  -4.556  1.00 110.62 ? 168 G   E C4    1 
ATOM   7426  P  P     . C   E  1 65  ? -62.266 16.252  1.927   1.00 147.85 ? 169 C   E P     1 
ATOM   7427  O  OP1   . C   E  1 65  ? -62.943 17.442  2.510   1.00 154.33 ? 169 C   E OP1   1 
ATOM   7428  O  OP2   . C   E  1 65  ? -61.051 15.707  2.580   1.00 144.93 ? 169 C   E OP2   1 
ATOM   7429  O  "O5'" . C   E  1 65  ? -63.336 15.090  1.699   1.00 155.69 ? 169 C   E "O5'" 1 
ATOM   7430  C  "C5'" . C   E  1 65  ? -64.647 15.180  2.256   1.00 163.20 ? 169 C   E "C5'" 1 
ATOM   7431  C  "C4'" . C   E  1 65  ? -65.695 14.623  1.323   1.00 167.11 ? 169 C   E "C4'" 1 
ATOM   7432  O  "O4'" . C   E  1 65  ? -66.978 14.683  1.991   1.00 169.85 ? 169 C   E "O4'" 1 
ATOM   7433  C  "C3'" . C   E  1 65  ? -65.837 15.371  0.003   1.00 165.32 ? 169 C   E "C3'" 1 
ATOM   7434  O  "O3'" . C   E  1 65  ? -65.851 14.480  -1.101  1.00 158.83 ? 169 C   E "O3'" 1 
ATOM   7435  C  "C2'" . C   E  1 65  ? -67.151 16.145  0.117   1.00 167.14 ? 169 C   E "C2'" 1 
ATOM   7436  O  "O2'" . C   E  1 65  ? -67.908 16.174  -1.077  1.00 170.74 ? 169 C   E "O2'" 1 
ATOM   7437  C  "C1'" . C   E  1 65  ? -67.912 15.445  1.249   1.00 166.89 ? 169 C   E "C1'" 1 
ATOM   7438  N  N1    . C   E  1 65  ? -68.491 16.436  2.174   1.00 163.39 ? 169 C   E N1    1 
ATOM   7439  C  C2    . C   E  1 65  ? -68.950 16.105  3.454   1.00 160.54 ? 169 C   E C2    1 
ATOM   7440  O  O2    . C   E  1 65  ? -68.881 14.930  3.852   1.00 159.91 ? 169 C   E O2    1 
ATOM   7441  N  N3    . C   E  1 65  ? -69.452 17.095  4.235   1.00 164.95 ? 169 C   E N3    1 
ATOM   7442  C  C4    . C   E  1 65  ? -69.515 18.362  3.795   1.00 173.46 ? 169 C   E C4    1 
ATOM   7443  N  N4    . C   E  1 65  ? -70.024 19.311  4.595   1.00 178.15 ? 169 C   E N4    1 
ATOM   7444  C  C5    . C   E  1 65  ? -69.055 18.727  2.497   1.00 173.99 ? 169 C   E C5    1 
ATOM   7445  C  C6    . C   E  1 65  ? -68.561 17.737  1.745   1.00 168.37 ? 169 C   E C6    1 
ATOM   7446  P  P     . C   E  1 66  ? -64.483 14.323  -1.917  1.00 141.66 ? 170 C   E P     1 
ATOM   7447  O  OP1   . C   E  1 66  ? -63.768 13.243  -1.195  1.00 136.26 ? 170 C   E OP1   1 
ATOM   7448  O  OP2   . C   E  1 66  ? -63.850 15.654  -2.080  1.00 137.49 ? 170 C   E OP2   1 
ATOM   7449  O  "O5'" . C   E  1 66  ? -64.914 13.784  -3.347  1.00 134.20 ? 170 C   E "O5'" 1 
ATOM   7450  C  "C5'" . C   E  1 66  ? -66.034 14.315  -4.033  1.00 132.54 ? 170 C   E "C5'" 1 
ATOM   7451  C  "C4'" . C   E  1 66  ? -65.939 13.995  -5.496  1.00 126.23 ? 170 C   E "C4'" 1 
ATOM   7452  O  "O4'" . C   E  1 66  ? -64.907 14.808  -6.099  1.00 118.68 ? 170 C   E "O4'" 1 
ATOM   7453  C  "C3'" . C   E  1 66  ? -65.515 12.567  -5.810  1.00 127.16 ? 170 C   E "C3'" 1 
ATOM   7454  O  "O3'" . C   E  1 66  ? -66.568 11.614  -5.715  1.00 139.58 ? 170 C   E "O3'" 1 
ATOM   7455  C  "C2'" . C   E  1 66  ? -64.918 12.716  -7.204  1.00 118.45 ? 170 C   E "C2'" 1 
ATOM   7456  O  "O2'" . C   E  1 66  ? -65.928 12.834  -8.193  1.00 117.18 ? 170 C   E "O2'" 1 
ATOM   7457  C  "C1'" . C   E  1 66  ? -64.237 14.073  -7.087  1.00 114.68 ? 170 C   E "C1'" 1 
ATOM   7458  N  N1    . C   E  1 66  ? -62.830 13.963  -6.697  1.00 111.05 ? 170 C   E N1    1 
ATOM   7459  C  C2    . C   E  1 66  ? -61.981 13.897  -7.764  1.00 109.20 ? 170 C   E C2    1 
ATOM   7460  O  O2    . C   E  1 66  ? -62.508 13.914  -8.870  1.00 109.87 ? 170 C   E O2    1 
ATOM   7461  N  N3    . C   E  1 66  ? -60.663 13.800  -7.566  1.00 107.11 ? 170 C   E N3    1 
ATOM   7462  C  C4    . C   E  1 66  ? -60.209 13.791  -6.317  1.00 106.90 ? 170 C   E C4    1 
ATOM   7463  N  N4    . C   E  1 66  ? -58.887 13.695  -6.153  1.00 107.17 ? 170 C   E N4    1 
ATOM   7464  C  C5    . C   E  1 66  ? -61.073 13.873  -5.184  1.00 108.86 ? 170 C   E C5    1 
ATOM   7465  C  C6    . C   E  1 66  ? -62.383 13.965  -5.414  1.00 110.92 ? 170 C   E C6    1 
ATOM   7466  P  P     . U   E  1 67  ? -66.325 10.136  -5.117  1.00 115.94 ? 171 U   E P     1 
ATOM   7467  O  OP1   . U   E  1 67  ? -67.419 9.373   -5.730  1.00 117.73 ? 171 U   E OP1   1 
ATOM   7468  O  OP2   . U   E  1 67  ? -66.188 10.053  -3.648  1.00 116.56 ? 171 U   E OP2   1 
ATOM   7469  O  "O5'" . U   E  1 67  ? -64.933 9.691   -5.724  1.00 112.17 ? 171 U   E "O5'" 1 
ATOM   7470  C  "C5'" . U   E  1 67  ? -64.841 8.495   -6.470  1.00 124.86 ? 171 U   E "C5'" 1 
ATOM   7471  C  "C4'" . U   E  1 67  ? -64.867 8.735   -7.954  1.00 123.31 ? 171 U   E "C4'" 1 
ATOM   7472  O  "O4'" . U   E  1 67  ? -64.069 9.906   -8.255  1.00 109.67 ? 171 U   E "O4'" 1 
ATOM   7473  C  "C3'" . U   E  1 67  ? -64.236 7.627   -8.792  1.00 118.05 ? 171 U   E "C3'" 1 
ATOM   7474  O  "O3'" . U   E  1 67  ? -65.110 6.553   -9.064  1.00 117.08 ? 171 U   E "O3'" 1 
ATOM   7475  C  "C2'" . U   E  1 67  ? -63.746 8.364   -10.020 1.00 112.81 ? 171 U   E "C2'" 1 
ATOM   7476  O  "O2'" . U   E  1 67  ? -64.816 8.635   -10.913 1.00 110.37 ? 171 U   E "O2'" 1 
ATOM   7477  C  "C1'" . U   E  1 67  ? -63.283 9.671   -9.397  1.00 107.80 ? 171 U   E "C1'" 1 
ATOM   7478  N  N1    . U   E  1 67  ? -61.883 9.625   -8.955  1.00 105.16 ? 171 U   E N1    1 
ATOM   7479  C  C2    . U   E  1 67  ? -60.935 9.664   -9.931  1.00 106.14 ? 171 U   E C2    1 
ATOM   7480  O  O2    . U   E  1 67  ? -61.222 9.677   -11.106 1.00 113.23 ? 171 U   E O2    1 
ATOM   7481  N  N3    . U   E  1 67  ? -59.650 9.657   -9.484  1.00 101.99 ? 171 U   E N3    1 
ATOM   7482  C  C4    . U   E  1 67  ? -59.235 9.636   -8.178  1.00 100.92 ? 171 U   E C4    1 
ATOM   7483  O  O4    . U   E  1 67  ? -58.027 9.637   -7.943  1.00 99.27  ? 171 U   E O4    1 
ATOM   7484  C  C5    . U   E  1 67  ? -60.290 9.615   -7.214  1.00 102.76 ? 171 U   E C5    1 
ATOM   7485  C  C6    . U   E  1 67  ? -61.555 9.619   -7.626  1.00 104.78 ? 171 U   E C6    1 
ATOM   7486  P  P     . A   E  1 68  ? -64.812 5.127   -8.413  1.00 107.98 ? 172 A   E P     1 
ATOM   7487  O  OP1   . A   E  1 68  ? -66.041 4.732   -7.677  1.00 110.82 ? 172 A   E OP1   1 
ATOM   7488  O  OP2   . A   E  1 68  ? -63.470 5.161   -7.749  1.00 105.08 ? 172 A   E OP2   1 
ATOM   7489  O  "O5'" . A   E  1 68  ? -64.575 4.198   -9.677  1.00 106.82 ? 172 A   E "O5'" 1 
ATOM   7490  C  "C5'" . A   E  1 68  ? -63.733 3.068   -9.565  1.00 104.16 ? 172 A   E "C5'" 1 
ATOM   7491  C  "C4'" . A   E  1 68  ? -62.879 2.875   -10.779 1.00 102.30 ? 172 A   E "C4'" 1 
ATOM   7492  O  "O4'" . A   E  1 68  ? -63.705 2.728   -11.945 1.00 104.41 ? 172 A   E "O4'" 1 
ATOM   7493  C  "C3'" . A   E  1 68  ? -61.982 4.024   -11.105 1.00 101.27 ? 172 A   E "C3'" 1 
ATOM   7494  O  "O3'" . A   E  1 68  ? -60.802 3.936   -10.376 1.00 98.73  ? 172 A   E "O3'" 1 
ATOM   7495  C  "C2'" . A   E  1 68  ? -61.753 3.881   -12.596 1.00 101.24 ? 172 A   E "C2'" 1 
ATOM   7496  O  "O2'" . A   E  1 68  ? -60.742 2.914   -12.835 1.00 98.67  ? 172 A   E "O2'" 1 
ATOM   7497  C  "C1'" . A   E  1 68  ? -63.065 3.277   -13.058 1.00 103.82 ? 172 A   E "C1'" 1 
ATOM   7498  N  N9    . A   E  1 68  ? -64.029 4.212   -13.641 1.00 123.65 ? 172 A   E N9    1 
ATOM   7499  C  C8    . A   E  1 68  ? -65.147 4.661   -12.985 1.00 128.20 ? 172 A   E C8    1 
ATOM   7500  N  N7    . A   E  1 68  ? -65.938 5.400   -13.710 1.00 130.09 ? 172 A   E N7    1 
ATOM   7501  C  C5    . A   E  1 68  ? -65.316 5.391   -14.936 1.00 130.75 ? 172 A   E C5    1 
ATOM   7502  C  C6    . A   E  1 68  ? -65.677 5.995   -16.127 1.00 136.09 ? 172 A   E C6    1 
ATOM   7503  N  N6    . A   E  1 68  ? -66.782 6.739   -16.243 1.00 138.21 ? 172 A   E N6    1 
ATOM   7504  N  N1    . A   E  1 68  ? -64.847 5.800   -17.173 1.00 138.42 ? 172 A   E N1    1 
ATOM   7505  C  C2    . A   E  1 68  ? -63.745 5.048   -17.016 1.00 132.84 ? 172 A   E C2    1 
ATOM   7506  N  N3    . A   E  1 68  ? -63.304 4.425   -15.930 1.00 126.32 ? 172 A   E N3    1 
ATOM   7507  C  C4    . A   E  1 68  ? -64.157 4.641   -14.926 1.00 123.59 ? 172 A   E C4    1 
ATOM   7508  P  P     . A   E  1 69  ? -60.310 5.237   -9.624  1.00 98.76  ? 173 A   E P     1 
ATOM   7509  O  OP1   . A   E  1 69  ? -60.504 5.021   -8.180  1.00 98.98  ? 173 A   E OP1   1 
ATOM   7510  O  OP2   . A   E  1 69  ? -61.107 6.315   -10.223 1.00 145.00 ? 173 A   E OP2   1 
ATOM   7511  O  "O5'" . A   E  1 69  ? -58.775 5.381   -10.067 1.00 97.70  ? 173 A   E "O5'" 1 
ATOM   7512  C  "C5'" . A   E  1 69  ? -58.243 6.610   -10.577 1.00 98.70  ? 173 A   E "C5'" 1 
ATOM   7513  C  "C4'" . A   E  1 69  ? -57.959 6.599   -12.067 1.00 96.65  ? 173 A   E "C4'" 1 
ATOM   7514  O  "O4'" . A   E  1 69  ? -59.180 6.307   -12.770 1.00 98.55  ? 173 A   E "O4'" 1 
ATOM   7515  C  "C3'" . A   E  1 69  ? -57.502 7.931   -12.652 1.00 97.48  ? 173 A   E "C3'" 1 
ATOM   7516  O  "O3'" . A   E  1 69  ? -56.097 8.137   -12.541 1.00 95.88  ? 173 A   E "O3'" 1 
ATOM   7517  C  "C2'" . A   E  1 69  ? -58.011 7.902   -14.102 1.00 98.91  ? 173 A   E "C2'" 1 
ATOM   7518  O  "O2'" . A   E  1 69  ? -57.041 7.336   -14.961 1.00 97.67  ? 173 A   E "O2'" 1 
ATOM   7519  C  "C1'" . A   E  1 69  ? -59.178 6.926   -14.033 1.00 99.74  ? 173 A   E "C1'" 1 
ATOM   7520  N  N9    . A   E  1 69  ? -60.535 7.426   -14.341 1.00 102.58 ? 173 A   E N9    1 
ATOM   7521  C  C8    . A   E  1 69  ? -61.592 7.467   -13.471 1.00 103.97 ? 173 A   E C8    1 
ATOM   7522  N  N7    . A   E  1 69  ? -62.733 7.847   -13.988 1.00 106.72 ? 173 A   E N7    1 
ATOM   7523  C  C5    . A   E  1 69  ? -62.435 8.036   -15.317 1.00 107.18 ? 173 A   E C5    1 
ATOM   7524  C  C6    . A   E  1 69  ? -63.236 8.448   -16.394 1.00 109.94 ? 173 A   E C6    1 
ATOM   7525  N  N6    . A   E  1 69  ? -64.536 8.756   -16.313 1.00 112.75 ? 173 A   E N6    1 
ATOM   7526  N  N1    . A   E  1 69  ? -62.627 8.535   -17.586 1.00 109.98 ? 173 A   E N1    1 
ATOM   7527  C  C2    . A   E  1 69  ? -61.320 8.238   -17.663 1.00 117.20 ? 173 A   E C2    1 
ATOM   7528  N  N3    . A   E  1 69  ? -60.462 7.848   -16.715 1.00 104.70 ? 173 A   E N3    1 
ATOM   7529  C  C4    . A   E  1 69  ? -61.092 7.759   -15.547 1.00 104.69 ? 173 A   E C4    1 
ATOM   7530  P  P     . G   E  1 70  ? -55.514 9.381   -11.697 1.00 96.21  ? 174 G   E P     1 
ATOM   7531  O  OP1   . G   E  1 70  ? -54.035 9.303   -11.590 1.00 94.69  ? 174 G   E OP1   1 
ATOM   7532  O  OP2   . G   E  1 70  ? -56.309 9.560   -10.460 1.00 96.99  ? 174 G   E OP2   1 
ATOM   7533  O  "O5'" . G   E  1 70  ? -55.834 10.592  -12.655 1.00 108.41 ? 174 G   E "O5'" 1 
ATOM   7534  C  "C5'" . G   E  1 70  ? -55.520 10.513  -14.035 1.00 107.60 ? 174 G   E "C5'" 1 
ATOM   7535  C  "C4'" . G   E  1 70  ? -56.327 11.480  -14.864 1.00 108.98 ? 174 G   E "C4'" 1 
ATOM   7536  O  "O4'" . G   E  1 70  ? -57.718 11.056  -14.965 1.00 102.03 ? 174 G   E "O4'" 1 
ATOM   7537  C  "C3'" . G   E  1 70  ? -56.450 12.893  -14.330 1.00 109.61 ? 174 G   E "C3'" 1 
ATOM   7538  O  "O3'" . G   E  1 70  ? -55.315 13.709  -14.407 1.00 101.92 ? 174 G   E "O3'" 1 
ATOM   7539  C  "C2'" . G   E  1 70  ? -57.639 13.401  -15.110 1.00 111.85 ? 174 G   E "C2'" 1 
ATOM   7540  O  "O2'" . G   E  1 70  ? -57.305 13.567  -16.483 1.00 112.17 ? 174 G   E "O2'" 1 
ATOM   7541  C  "C1'" . G   E  1 70  ? -58.549 12.199  -14.974 1.00 104.16 ? 174 G   E "C1'" 1 
ATOM   7542  N  N9    . G   E  1 70  ? -59.244 12.285  -13.691 1.00 104.38 ? 174 G   E N9    1 
ATOM   7543  C  C8    . G   E  1 70  ? -58.797 12.504  -12.414 1.00 103.43 ? 174 G   E C8    1 
ATOM   7544  N  N7    . G   E  1 70  ? -59.746 12.547  -11.535 1.00 104.50 ? 174 G   E N7    1 
ATOM   7545  C  C5    . G   E  1 70  ? -60.875 12.360  -12.297 1.00 106.23 ? 174 G   E C5    1 
ATOM   7546  C  C6    . G   E  1 70  ? -62.225 12.297  -11.930 1.00 109.77 ? 174 G   E C6    1 
ATOM   7547  O  O6    . G   E  1 70  ? -62.746 12.404  -10.825 1.00 109.04 ? 174 G   E O6    1 
ATOM   7548  N  N1    . G   E  1 70  ? -63.016 12.085  -13.041 1.00 117.74 ? 174 G   E N1    1 
ATOM   7549  C  C2    . G   E  1 70  ? -62.586 11.943  -14.335 1.00 128.56 ? 174 G   E C2    1 
ATOM   7550  N  N2    . G   E  1 70  ? -63.543 11.750  -15.258 1.00 141.37 ? 174 G   E N2    1 
ATOM   7551  N  N3    . G   E  1 70  ? -61.323 12.003  -14.690 1.00 107.82 ? 174 G   E N3    1 
ATOM   7552  C  C4    . G   E  1 70  ? -60.565 12.201  -13.616 1.00 106.17 ? 174 G   E C4    1 
ATOM   7553  P  P     . G   E  1 71  ? -55.214 14.862  -13.325 1.00 154.13 ? 175 G   E P     1 
ATOM   7554  O  OP1   . G   E  1 71  ? -55.078 14.277  -11.982 1.00 157.12 ? 175 G   E OP1   1 
ATOM   7555  O  OP2   . G   E  1 71  ? -56.272 15.857  -13.603 1.00 162.42 ? 175 G   E OP2   1 
ATOM   7556  O  "O5'" . G   E  1 71  ? -53.845 15.540  -13.652 1.00 151.59 ? 175 G   E "O5'" 1 
ATOM   7557  C  "C5'" . G   E  1 71  ? -52.837 15.544  -12.674 1.00 152.65 ? 175 G   E "C5'" 1 
ATOM   7558  C  "C4'" . G   E  1 71  ? -51.677 14.822  -13.225 1.00 150.98 ? 175 G   E "C4'" 1 
ATOM   7559  O  "O4'" . G   E  1 71  ? -52.190 13.977  -14.270 1.00 149.76 ? 175 G   E "O4'" 1 
ATOM   7560  C  "C3'" . G   E  1 71  ? -50.658 15.739  -13.867 1.00 148.81 ? 175 G   E "C3'" 1 
ATOM   7561  O  "O3'" . G   E  1 71  ? -49.350 15.285  -13.625 1.00 148.97 ? 175 G   E "O3'" 1 
ATOM   7562  C  "C2'" . G   E  1 71  ? -50.948 15.622  -15.348 1.00 146.33 ? 175 G   E "C2'" 1 
ATOM   7563  O  "O2'" . G   E  1 71  ? -49.793 15.760  -16.138 1.00 144.55 ? 175 G   E "O2'" 1 
ATOM   7564  C  "C1'" . G   E  1 71  ? -51.483 14.210  -15.452 1.00 147.09 ? 175 G   E "C1'" 1 
ATOM   7565  N  N9    . G   E  1 71  ? -52.389 14.001  -16.574 1.00 146.09 ? 175 G   E N9    1 
ATOM   7566  C  C8    . G   E  1 71  ? -53.750 14.127  -16.644 1.00 147.12 ? 175 G   E C8    1 
ATOM   7567  N  N7    . G   E  1 71  ? -54.228 13.839  -17.822 1.00 146.15 ? 175 G   E N7    1 
ATOM   7568  C  C5    . G   E  1 71  ? -53.104 13.509  -18.563 1.00 144.31 ? 175 G   E C5    1 
ATOM   7569  C  C6    . G   E  1 71  ? -52.967 13.118  -19.910 1.00 142.97 ? 175 G   E C6    1 
ATOM   7570  O  O6    . G   E  1 71  ? -53.849 12.982  -20.761 1.00 143.12 ? 175 G   E O6    1 
ATOM   7571  N  N1    . G   E  1 71  ? -51.636 12.882  -20.228 1.00 141.78 ? 175 G   E N1    1 
ATOM   7572  C  C2    . G   E  1 71  ? -50.572 13.005  -19.374 1.00 141.92 ? 175 G   E C2    1 
ATOM   7573  N  N2    . G   E  1 71  ? -49.367 12.733  -19.881 1.00 141.08 ? 175 G   E N2    1 
ATOM   7574  N  N3    . G   E  1 71  ? -50.683 13.367  -18.118 1.00 143.22 ? 175 G   E N3    1 
ATOM   7575  C  C4    . G   E  1 71  ? -51.968 13.595  -17.799 1.00 144.29 ? 175 G   E C4    1 
ATOM   7576  P  P     . A   E  1 72  ? -48.207 16.389  -13.616 1.00 148.55 ? 176 A   E P     1 
ATOM   7577  O  OP1   . A   E  1 72  ? -47.503 16.301  -14.910 1.00 146.24 ? 176 A   E OP1   1 
ATOM   7578  O  OP2   . A   E  1 72  ? -47.483 16.332  -12.339 1.00 151.91 ? 176 A   E OP2   1 
ATOM   7579  O  "O5'" . A   E  1 72  ? -49.029 17.750  -13.577 1.00 160.36 ? 176 A   E "O5'" 1 
ATOM   7580  C  "C5'" . A   E  1 72  ? -48.596 18.885  -14.323 1.00 159.91 ? 176 A   E "C5'" 1 
ATOM   7581  C  "C4'" . A   E  1 72  ? -49.673 19.397  -15.246 1.00 150.80 ? 176 A   E "C4'" 1 
ATOM   7582  O  "O4'" . A   E  1 72  ? -50.759 19.952  -14.459 1.00 146.57 ? 176 A   E "O4'" 1 
ATOM   7583  C  "C3'" . A   E  1 72  ? -49.229 20.479  -16.223 1.00 143.19 ? 176 A   E "C3'" 1 
ATOM   7584  O  "O3'" . A   E  1 72  ? -49.487 20.127  -17.581 1.00 141.15 ? 176 A   E "O3'" 1 
ATOM   7585  C  "C2'" . A   E  1 72  ? -50.020 21.719  -15.826 1.00 166.63 ? 176 A   E "C2'" 1 
ATOM   7586  O  "O2'" . A   E  1 72  ? -50.506 22.452  -16.925 1.00 171.99 ? 176 A   E "O2'" 1 
ATOM   7587  C  "C1'" . A   E  1 72  ? -51.175 21.177  -14.997 1.00 145.46 ? 176 A   E "C1'" 1 
ATOM   7588  N  N9    . A   E  1 72  ? -51.508 22.083  -13.902 1.00 147.56 ? 176 A   E N9    1 
ATOM   7589  C  C8    . A   E  1 72  ? -50.606 22.891  -13.267 1.00 148.63 ? 176 A   E C8    1 
ATOM   7590  N  N7    . A   E  1 72  ? -51.112 23.654  -12.337 1.00 150.74 ? 176 A   E N7    1 
ATOM   7591  C  C5    . A   E  1 72  ? -52.449 23.327  -12.379 1.00 151.05 ? 176 A   E C5    1 
ATOM   7592  C  C6    . A   E  1 72  ? -53.516 23.798  -11.623 1.00 153.32 ? 176 A   E C6    1 
ATOM   7593  N  N6    . A   E  1 72  ? -53.368 24.720  -10.673 1.00 155.55 ? 176 A   E N6    1 
ATOM   7594  N  N1    . A   E  1 72  ? -54.734 23.283  -11.887 1.00 156.84 ? 176 A   E N1    1 
ATOM   7595  C  C2    . A   E  1 72  ? -54.863 22.357  -12.850 1.00 151.67 ? 176 A   E C2    1 
ATOM   7596  N  N3    . A   E  1 72  ? -53.919 21.833  -13.634 1.00 149.37 ? 176 A   E N3    1 
ATOM   7597  C  C4    . A   E  1 72  ? -52.721 22.363  -13.334 1.00 149.18 ? 176 A   E C4    1 
ATOM   7598  P  P     . G   E  1 73  ? -50.956 19.868  -18.176 1.00 140.59 ? 177 G   E P     1 
ATOM   7599  O  OP1   . G   E  1 73  ? -51.421 21.104  -18.813 1.00 139.55 ? 177 G   E OP1   1 
ATOM   7600  O  OP2   . G   E  1 73  ? -51.911 19.237  -17.244 1.00 142.45 ? 177 G   E OP2   1 
ATOM   7601  O  "O5'" . G   E  1 73  ? -50.596 18.967  -19.423 1.00 139.19 ? 177 G   E "O5'" 1 
ATOM   7602  C  "C5'" . G   E  1 73  ? -49.419 19.270  -20.166 1.00 138.12 ? 177 G   E "C5'" 1 
ATOM   7603  C  "C4'" . G   E  1 73  ? -48.361 18.189  -20.072 1.00 155.32 ? 177 G   E "C4'" 1 
ATOM   7604  O  "O4'" . G   E  1 73  ? -48.967 16.948  -19.617 1.00 160.46 ? 177 G   E "O4'" 1 
ATOM   7605  C  "C3'" . G   E  1 73  ? -47.692 17.828  -21.397 1.00 149.66 ? 177 G   E "C3'" 1 
ATOM   7606  O  "O3'" . G   E  1 73  ? -46.582 18.629  -21.724 1.00 137.43 ? 177 G   E "O3'" 1 
ATOM   7607  C  "C2'" . G   E  1 73  ? -47.378 16.348  -21.266 1.00 138.14 ? 177 G   E "C2'" 1 
ATOM   7608  O  "O2'" . G   E  1 73  ? -46.179 16.146  -20.541 1.00 139.17 ? 177 G   E "O2'" 1 
ATOM   7609  C  "C1'" . G   E  1 73  ? -48.540 15.868  -20.414 1.00 138.96 ? 177 G   E "C1'" 1 
ATOM   7610  N  N9    . G   E  1 73  ? -49.695 15.510  -21.252 1.00 138.52 ? 177 G   E N9    1 
ATOM   7611  C  C8    . G   E  1 73  ? -50.996 15.845  -20.961 1.00 139.03 ? 177 G   E C8    1 
ATOM   7612  N  N7    . G   E  1 73  ? -51.855 15.425  -21.840 1.00 138.98 ? 177 G   E N7    1 
ATOM   7613  C  C5    . G   E  1 73  ? -51.070 14.776  -22.767 1.00 138.31 ? 177 G   E C5    1 
ATOM   7614  C  C6    . G   E  1 73  ? -51.473 14.128  -23.944 1.00 138.32 ? 177 G   E C6    1 
ATOM   7615  O  O6    . G   E  1 73  ? -52.627 14.013  -24.371 1.00 138.99 ? 177 G   E O6    1 
ATOM   7616  N  N1    . G   E  1 73  ? -50.375 13.599  -24.619 1.00 137.90 ? 177 G   E N1    1 
ATOM   7617  C  C2    . G   E  1 73  ? -49.064 13.680  -24.204 1.00 137.61 ? 177 G   E C2    1 
ATOM   7618  N  N2    . G   E  1 73  ? -48.131 13.105  -24.979 1.00 137.61 ? 177 G   E N2    1 
ATOM   7619  N  N3    . G   E  1 73  ? -48.689 14.286  -23.098 1.00 137.71 ? 177 G   E N3    1 
ATOM   7620  C  C4    . G   E  1 73  ? -49.736 14.804  -22.426 1.00 138.02 ? 177 G   E C4    1 
ATOM   7621  P  P     . G   E  1 74  ? -46.782 19.726  -22.867 1.00 136.31 ? 178 G   E P     1 
ATOM   7622  O  OP1   . G   E  1 74  ? -45.888 20.883  -22.590 1.00 136.85 ? 178 G   E OP1   1 
ATOM   7623  O  OP2   . G   E  1 74  ? -48.243 19.961  -22.988 1.00 135.68 ? 178 G   E OP2   1 
ATOM   7624  O  "O5'" . G   E  1 74  ? -46.334 18.943  -24.181 1.00 135.98 ? 178 G   E "O5'" 1 
ATOM   7625  C  "C5'" . G   E  1 74  ? -44.987 18.530  -24.348 1.00 136.82 ? 178 G   E "C5'" 1 
ATOM   7626  C  "C4'" . G   E  1 74  ? -44.861 17.419  -25.356 1.00 136.83 ? 178 G   E "C4'" 1 
ATOM   7627  O  "O4'" . G   E  1 74  ? -45.739 16.327  -24.992 1.00 158.31 ? 178 G   E "O4'" 1 
ATOM   7628  C  "C3'" . G   E  1 74  ? -45.243 17.734  -26.791 1.00 139.35 ? 178 G   E "C3'" 1 
ATOM   7629  O  "O3'" . G   E  1 74  ? -44.201 18.372  -27.492 1.00 140.76 ? 178 G   E "O3'" 1 
ATOM   7630  C  "C2'" . G   E  1 74  ? -45.588 16.361  -27.350 1.00 136.55 ? 178 G   E "C2'" 1 
ATOM   7631  O  "O2'" . G   E  1 74  ? -44.405 15.629  -27.625 1.00 137.59 ? 178 G   E "O2'" 1 
ATOM   7632  C  "C1'" . G   E  1 74  ? -46.260 15.716  -26.151 1.00 136.49 ? 178 G   E "C1'" 1 
ATOM   7633  N  N9    . G   E  1 74  ? -47.713 15.925  -26.163 1.00 145.08 ? 178 G   E N9    1 
ATOM   7634  C  C8    . G   E  1 74  ? -48.444 16.674  -25.274 1.00 144.00 ? 178 G   E C8    1 
ATOM   7635  N  N7    . G   E  1 74  ? -49.718 16.664  -25.546 1.00 144.49 ? 178 G   E N7    1 
ATOM   7636  C  C5    . G   E  1 74  ? -49.825 15.868  -26.677 1.00 144.43 ? 178 G   E C5    1 
ATOM   7637  C  C6    . G   E  1 74  ? -50.964 15.499  -27.426 1.00 143.19 ? 178 G   E C6    1 
ATOM   7638  O  O6    . G   E  1 74  ? -52.145 15.812  -27.242 1.00 143.53 ? 178 G   E O6    1 
ATOM   7639  N  N1    . G   E  1 74  ? -50.618 14.686  -28.493 1.00 137.11 ? 178 G   E N1    1 
ATOM   7640  C  C2    . G   E  1 74  ? -49.354 14.270  -28.804 1.00 137.14 ? 178 G   E C2    1 
ATOM   7641  N  N2    . G   E  1 74  ? -49.258 13.489  -29.895 1.00 138.07 ? 178 G   E N2    1 
ATOM   7642  N  N3    . G   E  1 74  ? -48.279 14.622  -28.115 1.00 136.69 ? 178 G   E N3    1 
ATOM   7643  C  C4    . G   E  1 74  ? -48.592 15.413  -27.075 1.00 136.13 ? 178 G   E C4    1 
ATOM   7644  P  P     . G   E  1 75  ? -44.514 19.205  -28.822 1.00 136.73 ? 179 G   E P     1 
ATOM   7645  O  OP1   . G   E  1 75  ? -43.211 19.752  -29.255 1.00 140.67 ? 179 G   E OP1   1 
ATOM   7646  O  OP2   . G   E  1 75  ? -45.683 20.088  -28.587 1.00 135.80 ? 179 G   E OP2   1 
ATOM   7647  O  "O5'" . G   E  1 75  ? -44.969 18.097  -29.873 1.00 143.16 ? 179 G   E "O5'" 1 
ATOM   7648  C  "C5'" . G   E  1 75  ? -44.004 17.386  -30.638 1.00 144.44 ? 179 G   E "C5'" 1 
ATOM   7649  C  "C4'" . G   E  1 75  ? -44.631 16.619  -31.775 1.00 138.84 ? 179 G   E "C4'" 1 
ATOM   7650  O  "O4'" . G   E  1 75  ? -45.676 15.770  -31.254 1.00 138.17 ? 179 G   E "O4'" 1 
ATOM   7651  C  "C3'" . G   E  1 75  ? -45.321 17.436  -32.856 1.00 145.97 ? 179 G   E "C3'" 1 
ATOM   7652  O  "O3'" . G   E  1 75  ? -44.421 17.914  -33.838 1.00 148.74 ? 179 G   E "O3'" 1 
ATOM   7653  C  "C2'" . G   E  1 75  ? -46.339 16.463  -33.427 1.00 139.22 ? 179 G   E "C2'" 1 
ATOM   7654  O  "O2'" . G   E  1 75  ? -45.721 15.601  -34.365 1.00 140.95 ? 179 G   E "O2'" 1 
ATOM   7655  C  "C1'" . G   E  1 75  ? -46.711 15.641  -32.199 1.00 138.43 ? 179 G   E "C1'" 1 
ATOM   7656  N  N9    . G   E  1 75  ? -47.965 16.073  -31.574 1.00 137.39 ? 179 G   E N9    1 
ATOM   7657  C  C8    . G   E  1 75  ? -48.107 16.658  -30.345 1.00 137.84 ? 179 G   E C8    1 
ATOM   7658  N  N7    . G   E  1 75  ? -49.356 16.894  -30.054 1.00 139.43 ? 179 G   E N7    1 
ATOM   7659  C  C5    . G   E  1 75  ? -50.073 16.430  -31.147 1.00 140.40 ? 179 G   E C5    1 
ATOM   7660  C  C6    . G   E  1 75  ? -51.468 16.420  -31.408 1.00 142.76 ? 179 G   E C6    1 
ATOM   7661  O  O6    . G   E  1 75  ? -52.419 16.828  -30.723 1.00 148.05 ? 179 G   E O6    1 
ATOM   7662  N  N1    . G   E  1 75  ? -51.724 15.854  -32.640 1.00 142.07 ? 179 G   E N1    1 
ATOM   7663  C  C2    . G   E  1 75  ? -50.796 15.358  -33.508 1.00 141.85 ? 179 G   E C2    1 
ATOM   7664  N  N2    . G   E  1 75  ? -51.305 14.852  -34.637 1.00 150.22 ? 179 G   E N2    1 
ATOM   7665  N  N3    . G   E  1 75  ? -49.497 15.368  -33.287 1.00 139.15 ? 179 G   E N3    1 
ATOM   7666  C  C4    . G   E  1 75  ? -49.218 15.915  -32.093 1.00 138.22 ? 179 G   E C4    1 
ATOM   7667  P  P     . G   E  1 76  ? -44.741 19.270  -34.628 1.00 140.35 ? 180 G   E P     1 
ATOM   7668  O  OP1   . G   E  1 76  ? -43.476 19.654  -35.301 1.00 142.26 ? 180 G   E OP1   1 
ATOM   7669  O  OP2   . G   E  1 76  ? -45.426 20.192  -33.681 1.00 138.53 ? 180 G   E OP2   1 
ATOM   7670  O  "O5'" . G   E  1 76  ? -45.793 18.855  -35.754 1.00 140.97 ? 180 G   E "O5'" 1 
ATOM   7671  C  "C5'" . G   E  1 76  ? -45.390 18.067  -36.863 1.00 143.09 ? 180 G   E "C5'" 1 
ATOM   7672  C  "C4'" . G   E  1 76  ? -46.562 17.447  -37.581 1.00 143.71 ? 180 G   E "C4'" 1 
ATOM   7673  O  "O4'" . G   E  1 76  ? -47.440 16.801  -36.635 1.00 142.32 ? 180 G   E "O4'" 1 
ATOM   7674  C  "C3'" . G   E  1 76  ? -47.471 18.408  -38.323 1.00 157.18 ? 180 G   E "C3'" 1 
ATOM   7675  O  "O3'" . G   E  1 76  ? -46.973 18.780  -39.593 1.00 159.39 ? 180 G   E "O3'" 1 
ATOM   7676  C  "C2'" . G   E  1 76  ? -48.794 17.652  -38.389 1.00 144.07 ? 180 G   E "C2'" 1 
ATOM   7677  O  "O2'" . G   E  1 76  ? -48.809 16.738  -39.472 1.00 146.54 ? 180 G   E "O2'" 1 
ATOM   7678  C  "C1'" . G   E  1 76  ? -48.773 16.865  -37.089 1.00 142.61 ? 180 G   E "C1'" 1 
ATOM   7679  N  N9    . G   E  1 76  ? -49.563 17.482  -36.019 1.00 144.45 ? 180 G   E N9    1 
ATOM   7680  C  C8    . G   E  1 76  ? -48.984 17.972  -34.883 1.00 143.30 ? 180 G   E C8    1 
ATOM   7681  N  N7    . G   E  1 76  ? -49.850 18.440  -34.040 1.00 145.62 ? 180 G   E N7    1 
ATOM   7682  C  C5    . G   E  1 76  ? -51.076 18.244  -34.653 1.00 145.26 ? 180 G   E C5    1 
ATOM   7683  C  C6    . G   E  1 76  ? -52.370 18.566  -34.185 1.00 145.19 ? 180 G   E C6    1 
ATOM   7684  O  O6    . G   E  1 76  ? -52.674 19.104  -33.118 1.00 137.31 ? 180 G   E O6    1 
ATOM   7685  N  N1    . G   E  1 76  ? -53.351 18.201  -35.097 1.00 140.18 ? 180 G   E N1    1 
ATOM   7686  C  C2    . G   E  1 76  ? -53.125 17.603  -36.310 1.00 145.88 ? 180 G   E C2    1 
ATOM   7687  N  N2    . G   E  1 76  ? -54.222 17.333  -37.049 1.00 148.95 ? 180 G   E N2    1 
ATOM   7688  N  N3    . G   E  1 76  ? -51.906 17.297  -36.754 1.00 144.54 ? 180 G   E N3    1 
ATOM   7689  C  C4    . G   E  1 76  ? -50.928 17.642  -35.882 1.00 143.46 ? 180 G   E C4    1 
ATOM   7690  P  P     . U   E  1 77  ? -46.845 20.331  -39.963 1.00 146.02 ? 181 U   E P     1 
ATOM   7691  O  OP1   . U   E  1 77  ? -46.242 20.463  -41.307 1.00 148.93 ? 181 U   E OP1   1 
ATOM   7692  O  OP2   . U   E  1 77  ? -46.200 20.970  -38.801 1.00 144.19 ? 181 U   E OP2   1 
ATOM   7693  O  "O5'" . U   E  1 77  ? -48.355 20.812  -40.045 1.00 145.14 ? 181 U   E "O5'" 1 
ATOM   7694  C  "C5'" . U   E  1 77  ? -49.271 20.111  -40.862 1.00 146.77 ? 181 U   E "C5'" 1 
ATOM   7695  C  "C4'" . U   E  1 77  ? -50.658 20.174  -40.293 1.00 145.52 ? 181 U   E "C4'" 1 
ATOM   7696  O  "O4'" . U   E  1 77  ? -50.621 19.848  -38.890 1.00 144.65 ? 181 U   E "O4'" 1 
ATOM   7697  C  "C3'" . U   E  1 77  ? -51.319 21.530  -40.343 1.00 144.75 ? 181 U   E "C3'" 1 
ATOM   7698  O  "O3'" . U   E  1 77  ? -51.925 21.756  -41.596 1.00 147.02 ? 181 U   E "O3'" 1 
ATOM   7699  C  "C2'" . U   E  1 77  ? -52.329 21.460  -39.205 1.00 146.00 ? 181 U   E "C2'" 1 
ATOM   7700  O  "O2'" . U   E  1 77  ? -53.510 20.807  -39.639 1.00 144.58 ? 181 U   E "O2'" 1 
ATOM   7701  C  "C1'" . U   E  1 77  ? -51.631 20.540  -38.210 1.00 148.02 ? 181 U   E "C1'" 1 
ATOM   7702  N  N1    . U   E  1 77  ? -51.029 21.226  -37.045 1.00 156.03 ? 181 U   E N1    1 
ATOM   7703  C  C2    . U   E  1 77  ? -51.823 21.455  -35.931 1.00 161.29 ? 181 U   E C2    1 
ATOM   7704  O  O2    . U   E  1 77  ? -53.016 21.193  -35.898 1.00 162.66 ? 181 U   E O2    1 
ATOM   7705  N  N3    . U   E  1 77  ? -51.185 22.058  -34.873 1.00 160.98 ? 181 U   E N3    1 
ATOM   7706  C  C4    . U   E  1 77  ? -49.853 22.407  -34.797 1.00 157.94 ? 181 U   E C4    1 
ATOM   7707  O  O4    . U   E  1 77  ? -49.426 22.938  -33.772 1.00 157.85 ? 181 U   E O4    1 
ATOM   7708  C  C5    . U   E  1 77  ? -49.090 22.100  -35.970 1.00 155.80 ? 181 U   E C5    1 
ATOM   7709  C  C6    . U   E  1 77  ? -49.684 21.519  -37.021 1.00 155.89 ? 181 U   E C6    1 
ATOM   7710  P  P     . G   E  1 78  ? -51.827 23.185  -42.296 1.00 147.49 ? 182 G   E P     1 
ATOM   7711  O  OP1   . G   E  1 78  ? -52.074 23.010  -43.744 1.00 150.73 ? 182 G   E OP1   1 
ATOM   7712  O  OP2   . G   E  1 78  ? -50.603 23.846  -41.790 1.00 146.18 ? 182 G   E OP2   1 
ATOM   7713  O  "O5'" . G   E  1 78  ? -53.064 23.975  -41.706 1.00 145.99 ? 182 G   E "O5'" 1 
ATOM   7714  C  "C5'" . G   E  1 78  ? -54.334 23.372  -41.529 1.00 146.49 ? 182 G   E "C5'" 1 
ATOM   7715  C  "C4'" . G   E  1 78  ? -55.051 24.053  -40.393 1.00 144.32 ? 182 G   E "C4'" 1 
ATOM   7716  O  "O4'" . G   E  1 78  ? -54.568 23.543  -39.124 1.00 149.65 ? 182 G   E "O4'" 1 
ATOM   7717  C  "C3'" . G   E  1 78  ? -54.818 25.554  -40.291 1.00 156.85 ? 182 G   E "C3'" 1 
ATOM   7718  O  "O3'" . G   E  1 78  ? -55.613 26.338  -41.153 1.00 158.12 ? 182 G   E "O3'" 1 
ATOM   7719  C  "C2'" . G   E  1 78  ? -55.089 25.832  -38.827 1.00 140.71 ? 182 G   E "C2'" 1 
ATOM   7720  O  "O2'" . G   E  1 78  ? -56.484 25.845  -38.586 1.00 141.22 ? 182 G   E "O2'" 1 
ATOM   7721  C  "C1'" . G   E  1 78  ? -54.490 24.592  -38.181 1.00 140.23 ? 182 G   E "C1'" 1 
ATOM   7722  N  N9    . G   E  1 78  ? -53.080 24.818  -37.818 1.00 139.12 ? 182 G   E N9    1 
ATOM   7723  C  C8    . G   E  1 78  ? -51.947 24.694  -38.585 1.00 140.12 ? 182 G   E C8    1 
ATOM   7724  N  N7    . G   E  1 78  ? -50.858 24.987  -37.927 1.00 139.11 ? 182 G   E N7    1 
ATOM   7725  C  C5    . G   E  1 78  ? -51.295 25.335  -36.657 1.00 137.28 ? 182 G   E C5    1 
ATOM   7726  C  C6    . G   E  1 78  ? -50.581 25.750  -35.502 1.00 135.95 ? 182 G   E C6    1 
ATOM   7727  O  O6    . G   E  1 78  ? -49.370 25.912  -35.320 1.00 136.10 ? 182 G   E O6    1 
ATOM   7728  N  N1    . G   E  1 78  ? -51.442 25.993  -34.453 1.00 134.76 ? 182 G   E N1    1 
ATOM   7729  C  C2    . G   E  1 78  ? -52.800 25.858  -34.495 1.00 134.90 ? 182 G   E C2    1 
ATOM   7730  N  N2    . G   E  1 78  ? -53.431 26.151  -33.355 1.00 140.62 ? 182 G   E N2    1 
ATOM   7731  N  N3    . G   E  1 78  ? -53.483 25.474  -35.554 1.00 136.21 ? 182 G   E N3    1 
ATOM   7732  C  C4    . G   E  1 78  ? -52.665 25.233  -36.587 1.00 137.28 ? 182 G   E C4    1 
ATOM   7733  P  P     . A   E  1 79  ? -54.911 27.135  -42.351 1.00 165.09 ? 183 A   E P     1 
ATOM   7734  O  OP1   . A   E  1 79  ? -55.799 26.936  -43.522 1.00 169.45 ? 183 A   E OP1   1 
ATOM   7735  O  OP2   . A   E  1 79  ? -53.459 26.861  -42.423 1.00 171.26 ? 183 A   E OP2   1 
ATOM   7736  O  "O5'" . A   E  1 79  ? -55.001 28.650  -41.918 1.00 158.42 ? 183 A   E "O5'" 1 
ATOM   7737  C  "C5'" . A   E  1 79  ? -55.623 29.578  -42.768 1.00 155.92 ? 183 A   E "C5'" 1 
ATOM   7738  C  "C4'" . A   E  1 79  ? -57.063 29.690  -42.400 1.00 152.89 ? 183 A   E "C4'" 1 
ATOM   7739  O  "O4'" . A   E  1 79  ? -57.208 29.278  -41.014 1.00 151.73 ? 183 A   E "O4'" 1 
ATOM   7740  C  "C3'" . A   E  1 79  ? -57.583 31.110  -42.470 1.00 148.72 ? 183 A   E "C3'" 1 
ATOM   7741  O  "O3'" . A   E  1 79  ? -58.231 31.331  -43.699 1.00 149.15 ? 183 A   E "O3'" 1 
ATOM   7742  C  "C2'" . A   E  1 79  ? -58.545 31.208  -41.301 1.00 151.40 ? 183 A   E "C2'" 1 
ATOM   7743  O  "O2'" . A   E  1 79  ? -59.819 30.731  -41.704 1.00 155.61 ? 183 A   E "O2'" 1 
ATOM   7744  C  "C1'" . A   E  1 79  ? -57.964 30.212  -40.303 1.00 151.84 ? 183 A   E "C1'" 1 
ATOM   7745  N  N9    . A   E  1 79  ? -57.063 30.844  -39.312 1.00 151.15 ? 183 A   E N9    1 
ATOM   7746  C  C8    . A   E  1 79  ? -55.887 31.494  -39.603 1.00 151.75 ? 183 A   E C8    1 
ATOM   7747  N  N7    . A   E  1 79  ? -55.236 31.923  -38.549 1.00 149.74 ? 183 A   E N7    1 
ATOM   7748  C  C5    . A   E  1 79  ? -56.012 31.507  -37.477 1.00 145.39 ? 183 A   E C5    1 
ATOM   7749  C  C6    . A   E  1 79  ? -55.849 31.667  -36.094 1.00 139.39 ? 183 A   E C6    1 
ATOM   7750  N  N6    . A   E  1 79  ? -54.826 32.309  -35.522 1.00 134.53 ? 183 A   E N6    1 
ATOM   7751  N  N1    . A   E  1 79  ? -56.797 31.112  -35.315 1.00 141.47 ? 183 A   E N1    1 
ATOM   7752  C  C2    . A   E  1 79  ? -57.826 30.466  -35.887 1.00 143.78 ? 183 A   E C2    1 
ATOM   7753  N  N3    . A   E  1 79  ? -58.088 30.257  -37.174 1.00 145.80 ? 183 A   E N3    1 
ATOM   7754  C  C4    . A   E  1 79  ? -57.114 30.790  -37.931 1.00 146.99 ? 183 A   E C4    1 
ATOM   7755  P  P     . A   E  1 80  ? -58.486 32.814  -44.224 1.00 148.49 ? 184 A   E P     1 
ATOM   7756  O  OP1   . A   E  1 80  ? -58.504 32.803  -45.700 1.00 151.73 ? 184 A   E OP1   1 
ATOM   7757  O  OP2   . A   E  1 80  ? -57.577 33.675  -43.438 1.00 145.93 ? 184 A   E OP2   1 
ATOM   7758  O  "O5'" . A   E  1 80  ? -59.950 33.170  -43.759 1.00 148.55 ? 184 A   E "O5'" 1 
ATOM   7759  C  "C5'" . A   E  1 80  ? -61.054 32.366  -44.128 1.00 150.94 ? 184 A   E "C5'" 1 
ATOM   7760  C  "C4'" . A   E  1 80  ? -62.219 32.710  -43.251 1.00 150.44 ? 184 A   E "C4'" 1 
ATOM   7761  O  "O4'" . A   E  1 80  ? -61.890 32.483  -41.848 1.00 156.33 ? 184 A   E "O4'" 1 
ATOM   7762  C  "C3'" . A   E  1 80  ? -62.614 34.169  -43.330 1.00 150.16 ? 184 A   E "C3'" 1 
ATOM   7763  O  "O3'" . A   E  1 80  ? -63.984 34.222  -43.000 1.00 151.51 ? 184 A   E "O3'" 1 
ATOM   7764  C  "C2'" . A   E  1 80  ? -61.830 34.772  -42.178 1.00 146.74 ? 184 A   E "C2'" 1 
ATOM   7765  O  "O2'" . A   E  1 80  ? -62.218 36.044  -41.733 1.00 145.80 ? 184 A   E "O2'" 1 
ATOM   7766  C  "C1'" . A   E  1 80  ? -62.038 33.705  -41.137 1.00 145.88 ? 184 A   E "C1'" 1 
ATOM   7767  N  N9    . A   E  1 80  ? -61.115 33.773  -40.008 1.00 147.48 ? 184 A   E N9    1 
ATOM   7768  C  C8    . A   E  1 80  ? -59.770 34.001  -40.066 1.00 145.36 ? 184 A   E C8    1 
ATOM   7769  N  N7    . A   E  1 80  ? -59.205 34.009  -38.888 1.00 142.26 ? 184 A   E N7    1 
ATOM   7770  C  C5    . A   E  1 80  ? -60.245 33.784  -38.001 1.00 143.21 ? 184 A   E C5    1 
ATOM   7771  C  C6    . A   E  1 80  ? -60.273 33.699  -36.605 1.00 138.10 ? 184 A   E C6    1 
ATOM   7772  N  N6    . A   E  1 80  ? -59.168 33.821  -35.866 1.00 136.35 ? 184 A   E N6    1 
ATOM   7773  N  N1    . A   E  1 80  ? -61.465 33.483  -36.008 1.00 139.02 ? 184 A   E N1    1 
ATOM   7774  C  C2    . A   E  1 80  ? -62.553 33.367  -36.775 1.00 141.22 ? 184 A   E C2    1 
ATOM   7775  N  N3    . A   E  1 80  ? -62.644 33.441  -38.102 1.00 142.71 ? 184 A   E N3    1 
ATOM   7776  C  C4    . A   E  1 80  ? -61.442 33.659  -38.668 1.00 146.25 ? 184 A   E C4    1 
ATOM   7777  P  P     . C   E  1 81  ? -64.971 35.112  -43.860 1.00 154.12 ? 185 C   E P     1 
ATOM   7778  O  OP1   . C   E  1 81  ? -66.325 34.560  -43.617 1.00 156.52 ? 185 C   E OP1   1 
ATOM   7779  O  OP2   . C   E  1 81  ? -64.425 35.113  -45.243 1.00 157.62 ? 185 C   E OP2   1 
ATOM   7780  O  "O5'" . C   E  1 81  ? -64.796 36.562  -43.189 1.00 166.88 ? 185 C   E "O5'" 1 
ATOM   7781  C  "C5'" . C   E  1 81  ? -64.885 36.734  -41.769 1.00 160.83 ? 185 C   E "C5'" 1 
ATOM   7782  C  "C4'" . C   E  1 81  ? -64.590 38.148  -41.291 1.00 152.52 ? 185 C   E "C4'" 1 
ATOM   7783  O  "O4'" . C   E  1 81  ? -63.336 38.315  -40.549 1.00 149.39 ? 185 C   E "O4'" 1 
ATOM   7784  C  "C3'" . C   E  1 81  ? -64.628 39.263  -42.317 1.00 158.16 ? 185 C   E "C3'" 1 
ATOM   7785  O  "O3'" . C   E  1 81  ? -65.381 40.310  -41.761 1.00 157.99 ? 185 C   E "O3'" 1 
ATOM   7786  C  "C2'" . C   E  1 81  ? -63.177 39.688  -42.431 1.00 160.94 ? 185 C   E "C2'" 1 
ATOM   7787  O  "O2'" . C   E  1 81  ? -63.012 41.021  -42.864 1.00 168.04 ? 185 C   E "O2'" 1 
ATOM   7788  C  "C1'" . C   E  1 81  ? -62.688 39.495  -41.003 1.00 154.54 ? 185 C   E "C1'" 1 
ATOM   7789  N  N1    . C   E  1 81  ? -61.214 39.385  -40.896 1.00 155.08 ? 185 C   E N1    1 
ATOM   7790  C  C2    . C   E  1 81  ? -60.449 40.516  -41.244 1.00 162.08 ? 185 C   E C2    1 
ATOM   7791  O  O2    . C   E  1 81  ? -61.018 41.557  -41.610 1.00 173.94 ? 185 C   E O2    1 
ATOM   7792  N  N3    . C   E  1 81  ? -59.094 40.492  -41.196 1.00 155.38 ? 185 C   E N3    1 
ATOM   7793  C  C4    . C   E  1 81  ? -58.456 39.401  -40.810 1.00 148.76 ? 185 C   E C4    1 
ATOM   7794  N  N4    . C   E  1 81  ? -57.123 39.435  -40.774 1.00 143.06 ? 185 C   E N4    1 
ATOM   7795  C  C5    . C   E  1 81  ? -59.194 38.238  -40.449 1.00 149.18 ? 185 C   E C5    1 
ATOM   7796  C  C6    . C   E  1 81  ? -60.541 38.267  -40.504 1.00 152.07 ? 185 C   E C6    1 
ATOM   7797  P  P     . C   E  1 82  ? -66.940 40.026  -41.650 1.00 161.37 ? 186 C   E P     1 
ATOM   7798  O  OP1   . C   E  1 82  ? -67.247 39.297  -42.882 1.00 163.99 ? 186 C   E OP1   1 
ATOM   7799  O  OP2   . C   E  1 82  ? -67.585 41.332  -41.378 1.00 167.30 ? 186 C   E OP2   1 
ATOM   7800  O  "O5'" . C   E  1 82  ? -67.144 39.073  -40.387 1.00 153.74 ? 186 C   E "O5'" 1 
ATOM   7801  C  "C5'" . C   E  1 82  ? -66.646 39.457  -39.125 1.00 149.02 ? 186 C   E "C5'" 1 
ATOM   7802  C  "C4'" . C   E  1 82  ? -67.806 39.607  -38.193 1.00 154.00 ? 186 C   E "C4'" 1 
ATOM   7803  O  "O4'" . C   E  1 82  ? -69.015 39.397  -38.956 1.00 159.31 ? 186 C   E "O4'" 1 
ATOM   7804  C  "C3'" . C   E  1 82  ? -67.859 38.658  -37.009 1.00 157.40 ? 186 C   E "C3'" 1 
ATOM   7805  O  "O3'" . C   E  1 82  ? -67.703 39.366  -35.795 1.00 153.37 ? 186 C   E "O3'" 1 
ATOM   7806  C  "C2'" . C   E  1 82  ? -69.193 37.902  -37.115 1.00 163.41 ? 186 C   E "C2'" 1 
ATOM   7807  O  "O2'" . C   E  1 82  ? -69.985 38.124  -35.958 1.00 168.11 ? 186 C   E "O2'" 1 
ATOM   7808  C  "C1'" . C   E  1 82  ? -69.903 38.539  -38.304 1.00 161.87 ? 186 C   E "C1'" 1 
ATOM   7809  N  N1    . C   E  1 82  ? -70.441 37.531  -39.265 1.00 161.09 ? 186 C   E N1    1 
ATOM   7810  C  C2    . C   E  1 82  ? -70.677 37.839  -40.619 1.00 163.43 ? 186 C   E C2    1 
ATOM   7811  O  O2    . C   E  1 82  ? -70.392 38.934  -41.103 1.00 162.42 ? 186 C   E O2    1 
ATOM   7812  N  N3    . C   E  1 82  ? -71.178 36.903  -41.444 1.00 166.93 ? 186 C   E N3    1 
ATOM   7813  C  C4    . C   E  1 82  ? -71.489 35.699  -40.979 1.00 165.64 ? 186 C   E C4    1 
ATOM   7814  N  N4    . C   E  1 82  ? -71.992 34.819  -41.843 1.00 169.56 ? 186 C   E N4    1 
ATOM   7815  C  C5    . C   E  1 82  ? -71.298 35.351  -39.615 1.00 161.28 ? 186 C   E C5    1 
ATOM   7816  C  C6    . C   E  1 82  ? -70.789 36.286  -38.808 1.00 158.45 ? 186 C   E C6    1 
ATOM   7817  P  P     . G   E  1 83  ? -67.107 38.617  -34.516 1.00 144.70 ? 187 G   E P     1 
ATOM   7818  O  OP1   . G   E  1 83  ? -68.066 37.562  -34.146 1.00 147.05 ? 187 G   E OP1   1 
ATOM   7819  O  OP2   . G   E  1 83  ? -66.683 39.620  -33.508 1.00 143.05 ? 187 G   E OP2   1 
ATOM   7820  O  "O5'" . G   E  1 83  ? -65.779 37.970  -35.094 1.00 142.82 ? 187 G   E "O5'" 1 
ATOM   7821  C  "C5'" . G   E  1 83  ? -64.613 38.752  -35.253 1.00 140.68 ? 187 G   E "C5'" 1 
ATOM   7822  C  "C4'" . G   E  1 83  ? -63.570 38.419  -34.228 1.00 138.69 ? 187 G   E "C4'" 1 
ATOM   7823  O  "O4'" . G   E  1 83  ? -62.974 37.151  -34.590 1.00 138.48 ? 187 G   E "O4'" 1 
ATOM   7824  C  "C3'" . G   E  1 83  ? -62.391 39.383  -34.162 1.00 151.74 ? 187 G   E "C3'" 1 
ATOM   7825  O  "O3'" . G   E  1 83  ? -62.628 40.521  -33.347 1.00 145.99 ? 187 G   E "O3'" 1 
ATOM   7826  C  "C2'" . G   E  1 83  ? -61.256 38.499  -33.667 1.00 135.64 ? 187 G   E "C2'" 1 
ATOM   7827  O  "O2'" . G   E  1 83  ? -61.344 38.313  -32.264 1.00 135.31 ? 187 G   E "O2'" 1 
ATOM   7828  C  "C1'" . G   E  1 83  ? -61.586 37.176  -34.353 1.00 136.63 ? 187 G   E "C1'" 1 
ATOM   7829  N  N9    . G   E  1 83  ? -60.869 36.959  -35.626 1.00 136.75 ? 187 G   E N9    1 
ATOM   7830  C  C8    . G   E  1 83  ? -61.418 36.816  -36.876 1.00 138.40 ? 187 G   E C8    1 
ATOM   7831  N  N7    . G   E  1 83  ? -60.528 36.613  -37.808 1.00 138.49 ? 187 G   E N7    1 
ATOM   7832  C  C5    . G   E  1 83  ? -59.311 36.604  -37.145 1.00 136.80 ? 187 G   E C5    1 
ATOM   7833  C  C6    . G   E  1 83  ? -57.983 36.415  -37.625 1.00 137.82 ? 187 G   E C6    1 
ATOM   7834  O  O6    . G   E  1 83  ? -57.594 36.217  -38.776 1.00 137.67 ? 187 G   E O6    1 
ATOM   7835  N  N1    . G   E  1 83  ? -57.035 36.478  -36.619 1.00 142.35 ? 187 G   E N1    1 
ATOM   7836  C  C2    . G   E  1 83  ? -57.340 36.681  -35.299 1.00 151.07 ? 187 G   E C2    1 
ATOM   7837  N  N2    . G   E  1 83  ? -56.301 36.726  -34.450 1.00 157.87 ? 187 G   E N2    1 
ATOM   7838  N  N3    . G   E  1 83  ? -58.576 36.854  -34.839 1.00 151.78 ? 187 G   E N3    1 
ATOM   7839  C  C4    . G   E  1 83  ? -59.511 36.812  -35.802 1.00 135.72 ? 187 G   E C4    1 
ATOM   7840  P  P     . G   E  1 84  ? -61.784 41.866  -33.585 1.00 135.71 ? 188 G   E P     1 
ATOM   7841  O  OP1   . G   E  1 84  ? -62.311 42.870  -32.635 1.00 140.08 ? 188 G   E OP1   1 
ATOM   7842  O  OP2   . G   E  1 84  ? -61.764 42.157  -35.039 1.00 136.32 ? 188 G   E OP2   1 
ATOM   7843  O  "O5'" . G   E  1 84  ? -60.316 41.476  -33.100 1.00 134.34 ? 188 G   E "O5'" 1 
ATOM   7844  C  "C5'" . G   E  1 84  ? -60.055 41.203  -31.733 1.00 133.88 ? 188 G   E "C5'" 1 
ATOM   7845  C  "C4'" . G   E  1 84  ? -58.598 40.924  -31.484 1.00 132.98 ? 188 G   E "C4'" 1 
ATOM   7846  O  "O4'" . G   E  1 84  ? -58.212 39.713  -32.169 1.00 132.84 ? 188 G   E "O4'" 1 
ATOM   7847  C  "C3'" . G   E  1 84  ? -57.623 41.967  -31.987 1.00 132.81 ? 188 G   E "C3'" 1 
ATOM   7848  O  "O3'" . G   E  1 84  ? -57.451 43.019  -31.069 1.00 132.92 ? 188 G   E "O3'" 1 
ATOM   7849  C  "C2'" . G   E  1 84  ? -56.348 41.175  -32.190 1.00 132.49 ? 188 G   E "C2'" 1 
ATOM   7850  O  "O2'" . G   E  1 84  ? -55.662 41.001  -30.960 1.00 132.28 ? 188 G   E "O2'" 1 
ATOM   7851  C  "C1'" . G   E  1 84  ? -56.898 39.834  -32.652 1.00 132.51 ? 188 G   E "C1'" 1 
ATOM   7852  N  N9    . G   E  1 84  ? -56.947 39.711  -34.107 1.00 133.09 ? 188 G   E N9    1 
ATOM   7853  C  C8    . G   E  1 84  ? -58.071 39.609  -34.866 1.00 136.08 ? 188 G   E C8    1 
ATOM   7854  N  N7    . G   E  1 84  ? -57.799 39.466  -36.134 1.00 137.86 ? 188 G   E N7    1 
ATOM   7855  C  C5    . G   E  1 84  ? -56.419 39.492  -36.200 1.00 138.65 ? 188 G   E C5    1 
ATOM   7856  C  C6    . G   E  1 84  ? -55.561 39.390  -37.316 1.00 145.16 ? 188 G   E C6    1 
ATOM   7857  O  O6    . G   E  1 84  ? -55.852 39.261  -38.517 1.00 136.59 ? 188 G   E O6    1 
ATOM   7858  N  N1    . G   E  1 84  ? -54.237 39.464  -36.898 1.00 150.08 ? 188 G   E N1    1 
ATOM   7859  C  C2    . G   E  1 84  ? -53.796 39.615  -35.600 1.00 150.10 ? 188 G   E C2    1 
ATOM   7860  N  N2    . G   E  1 84  ? -52.467 39.669  -35.401 1.00 156.93 ? 188 G   E N2    1 
ATOM   7861  N  N3    . G   E  1 84  ? -54.599 39.702  -34.560 1.00 141.05 ? 188 G   E N3    1 
ATOM   7862  C  C4    . G   E  1 84  ? -55.881 39.632  -34.944 1.00 137.12 ? 188 G   E C4    1 
ATOM   7863  P  P     . C   E  1 85  ? -57.253 44.498  -31.622 1.00 133.30 ? 189 C   E P     1 
ATOM   7864  O  OP1   . C   E  1 85  ? -57.167 45.393  -30.448 1.00 135.39 ? 189 C   E OP1   1 
ATOM   7865  O  OP2   . C   E  1 85  ? -58.296 44.690  -32.660 1.00 133.65 ? 189 C   E OP2   1 
ATOM   7866  O  "O5'" . C   E  1 85  ? -55.816 44.471  -32.307 1.00 133.41 ? 189 C   E "O5'" 1 
ATOM   7867  C  "C5'" . C   E  1 85  ? -54.656 44.175  -31.546 1.00 133.49 ? 189 C   E "C5'" 1 
ATOM   7868  C  "C4'" . C   E  1 85  ? -53.489 43.829  -32.435 1.00 133.96 ? 189 C   E "C4'" 1 
ATOM   7869  O  "O4'" . C   E  1 85  ? -53.859 42.753  -33.335 1.00 133.63 ? 189 C   E "O4'" 1 
ATOM   7870  C  "C3'" . C   E  1 85  ? -52.999 44.927  -33.364 1.00 143.85 ? 189 C   E "C3'" 1 
ATOM   7871  O  "O3'" . C   E  1 85  ? -52.186 45.883  -32.691 1.00 141.59 ? 189 C   E "O3'" 1 
ATOM   7872  C  "C2'" . C   E  1 85  ? -52.270 44.129  -34.450 1.00 144.55 ? 189 C   E "C2'" 1 
ATOM   7873  O  "O2'" . C   E  1 85  ? -50.986 43.716  -34.004 1.00 136.26 ? 189 C   E "O2'" 1 
ATOM   7874  C  "C1'" . C   E  1 85  ? -53.149 42.878  -34.553 1.00 134.57 ? 189 C   E "C1'" 1 
ATOM   7875  N  N1    . C   E  1 85  ? -54.120 42.876  -35.682 1.00 134.81 ? 189 C   E N1    1 
ATOM   7876  C  C2    . C   E  1 85  ? -53.721 42.765  -37.030 1.00 136.02 ? 189 C   E C2    1 
ATOM   7877  O  O2    . C   E  1 85  ? -52.524 42.695  -37.339 1.00 136.96 ? 189 C   E O2    1 
ATOM   7878  N  N3    . C   E  1 85  ? -54.673 42.741  -38.003 1.00 136.57 ? 189 C   E N3    1 
ATOM   7879  C  C4    . C   E  1 85  ? -55.969 42.820  -37.698 1.00 136.01 ? 189 C   E C4    1 
ATOM   7880  N  N4    . C   E  1 85  ? -56.876 42.800  -38.685 1.00 137.00 ? 189 C   E N4    1 
ATOM   7881  C  C5    . C   E  1 85  ? -56.399 42.922  -36.345 1.00 134.83 ? 189 C   E C5    1 
ATOM   7882  C  C6    . C   E  1 85  ? -55.458 42.939  -35.392 1.00 134.25 ? 189 C   E C6    1 
ATOM   7883  P  P     . C   E  1 86  ? -52.086 47.410  -33.200 1.00 142.84 ? 190 C   E P     1 
ATOM   7884  O  OP1   . C   E  1 86  ? -51.136 48.091  -32.284 1.00 146.56 ? 190 C   E OP1   1 
ATOM   7885  O  OP2   . C   E  1 86  ? -53.453 47.953  -33.361 1.00 146.62 ? 190 C   E OP2   1 
ATOM   7886  O  "O5'" . C   E  1 86  ? -51.429 47.313  -34.652 1.00 144.37 ? 190 C   E "O5'" 1 
ATOM   7887  C  "C5'" . C   E  1 86  ? -50.031 47.112  -34.800 1.00 142.47 ? 190 C   E "C5'" 1 
ATOM   7888  C  "C4'" . C   E  1 86  ? -49.559 47.375  -36.208 1.00 141.39 ? 190 C   E "C4'" 1 
ATOM   7889  O  "O4'" . C   E  1 86  ? -49.975 46.306  -37.092 1.00 140.86 ? 190 C   E "O4'" 1 
ATOM   7890  C  "C3'" . C   E  1 86  ? -50.087 48.622  -36.885 1.00 150.12 ? 190 C   E "C3'" 1 
ATOM   7891  O  "O3'" . C   E  1 86  ? -49.455 49.807  -36.463 1.00 156.70 ? 190 C   E "O3'" 1 
ATOM   7892  C  "C2'" . C   E  1 86  ? -49.871 48.302  -38.357 1.00 146.05 ? 190 C   E "C2'" 1 
ATOM   7893  O  "O2'" . C   E  1 86  ? -48.504 48.461  -38.702 1.00 145.97 ? 190 C   E "O2'" 1 
ATOM   7894  C  "C1'" . C   E  1 86  ? -50.208 46.814  -38.387 1.00 142.11 ? 190 C   E "C1'" 1 
ATOM   7895  N  N1    . C   E  1 86  ? -51.633 46.607  -38.713 1.00 140.74 ? 190 C   E N1    1 
ATOM   7896  C  C2    . C   E  1 86  ? -51.998 46.387  -40.043 1.00 141.85 ? 190 C   E C2    1 
ATOM   7897  O  O2    . C   E  1 86  ? -51.125 46.311  -40.919 1.00 145.67 ? 190 C   E O2    1 
ATOM   7898  N  N3    . C   E  1 86  ? -53.305 46.214  -40.322 1.00 141.04 ? 190 C   E N3    1 
ATOM   7899  C  C4    . C   E  1 86  ? -54.210 46.287  -39.348 1.00 139.29 ? 190 C   E C4    1 
ATOM   7900  N  N4    . C   E  1 86  ? -55.489 46.111  -39.664 1.00 151.63 ? 190 C   E N4    1 
ATOM   7901  C  C5    . C   E  1 86  ? -53.871 46.533  -37.994 1.00 138.15 ? 190 C   E C5    1 
ATOM   7902  C  C6    . C   E  1 86  ? -52.581 46.691  -37.731 1.00 138.92 ? 190 C   E C6    1 
ATOM   7903  P  P     . C   E  1 87  ? -50.144 51.222  -36.756 1.00 143.89 ? 191 C   E P     1 
ATOM   7904  O  OP1   . C   E  1 87  ? -49.263 51.872  -37.756 1.00 146.59 ? 191 C   E OP1   1 
ATOM   7905  O  OP2   . C   E  1 87  ? -50.510 51.850  -35.462 1.00 143.09 ? 191 C   E OP2   1 
ATOM   7906  O  "O5'" . C   E  1 87  ? -51.529 50.872  -37.454 1.00 142.32 ? 191 C   E "O5'" 1 
ATOM   7907  C  "C5'" . C   E  1 87  ? -52.143 51.802  -38.327 1.00 148.90 ? 191 C   E "C5'" 1 
ATOM   7908  C  "C4'" . C   E  1 87  ? -52.283 51.217  -39.703 1.00 150.53 ? 191 C   E "C4'" 1 
ATOM   7909  O  "O4'" . C   E  1 87  ? -52.871 49.900  -39.618 1.00 148.10 ? 191 C   E "O4'" 1 
ATOM   7910  C  "C3'" . C   E  1 87  ? -53.175 51.975  -40.666 1.00 155.34 ? 191 C   E "C3'" 1 
ATOM   7911  O  "O3'" . C   E  1 87  ? -52.453 53.030  -41.271 1.00 158.15 ? 191 C   E "O3'" 1 
ATOM   7912  C  "C2'" . C   E  1 87  ? -53.621 50.893  -41.652 1.00 153.69 ? 191 C   E "C2'" 1 
ATOM   7913  O  "O2'" . C   E  1 87  ? -52.650 50.710  -42.676 1.00 152.01 ? 191 C   E "O2'" 1 
ATOM   7914  C  "C1'" . C   E  1 87  ? -53.648 49.638  -40.764 1.00 150.82 ? 191 C   E "C1'" 1 
ATOM   7915  N  N1    . C   E  1 87  ? -55.002 49.227  -40.323 1.00 141.21 ? 191 C   E N1    1 
ATOM   7916  C  C2    . C   E  1 87  ? -55.869 48.567  -41.200 1.00 141.66 ? 191 C   E C2    1 
ATOM   7917  O  O2    . C   E  1 87  ? -55.497 48.312  -42.350 1.00 151.19 ? 191 C   E O2    1 
ATOM   7918  N  N3    . C   E  1 87  ? -57.082 48.186  -40.756 1.00 140.58 ? 191 C   E N3    1 
ATOM   7919  C  C4    . C   E  1 87  ? -57.428 48.473  -39.504 1.00 139.11 ? 191 C   E C4    1 
ATOM   7920  N  N4    . C   E  1 87  ? -58.631 48.107  -39.086 1.00 138.53 ? 191 C   E N4    1 
ATOM   7921  C  C5    . C   E  1 87  ? -56.581 49.145  -38.594 1.00 138.59 ? 191 C   E C5    1 
ATOM   7922  C  C6    . C   E  1 87  ? -55.383 49.502  -39.043 1.00 139.68 ? 191 C   E C6    1 
ATOM   7923  P  P     . A   E  1 88  ? -53.192 54.359  -41.746 1.00 154.20 ? 192 A   E P     1 
ATOM   7924  O  OP1   . A   E  1 88  ? -52.795 55.426  -40.799 1.00 157.21 ? 192 A   E OP1   1 
ATOM   7925  O  OP2   . A   E  1 88  ? -54.629 54.015  -41.894 1.00 153.74 ? 192 A   E OP2   1 
ATOM   7926  O  "O5'" . A   E  1 88  ? -52.555 54.630  -43.184 1.00 159.64 ? 192 A   E "O5'" 1 
ATOM   7927  C  "C5'" . A   E  1 88  ? -51.148 54.782  -43.337 1.00 161.62 ? 192 A   E "C5'" 1 
ATOM   7928  C  "C4'" . A   E  1 88  ? -50.728 54.796  -44.788 1.00 163.10 ? 192 A   E "C4'" 1 
ATOM   7929  O  "O4'" . A   E  1 88  ? -50.845 53.458  -45.349 1.00 155.94 ? 192 A   E "O4'" 1 
ATOM   7930  C  "C3'" . A   E  1 88  ? -51.560 55.668  -45.723 1.00 167.45 ? 192 A   E "C3'" 1 
ATOM   7931  O  "O3'" . A   E  1 88  ? -51.248 57.062  -45.645 1.00 175.36 ? 192 A   E "O3'" 1 
ATOM   7932  C  "C2'" . A   E  1 88  ? -51.294 55.013  -47.078 1.00 168.11 ? 192 A   E "C2'" 1 
ATOM   7933  O  "O2'" . A   E  1 88  ? -50.001 55.338  -47.565 1.00 170.67 ? 192 A   E "O2'" 1 
ATOM   7934  C  "C1'" . A   E  1 88  ? -51.294 53.534  -46.685 1.00 158.02 ? 192 A   E "C1'" 1 
ATOM   7935  N  N9    . A   E  1 88  ? -52.661 52.993  -46.717 1.00 155.94 ? 192 A   E N9    1 
ATOM   7936  C  C8    . A   E  1 88  ? -53.436 52.634  -45.645 1.00 152.69 ? 192 A   E C8    1 
ATOM   7937  N  N7    . A   E  1 88  ? -54.629 52.210  -45.975 1.00 152.32 ? 192 A   E N7    1 
ATOM   7938  C  C5    . A   E  1 88  ? -54.636 52.309  -47.353 1.00 155.96 ? 192 A   E C5    1 
ATOM   7939  C  C6    . A   E  1 88  ? -55.619 52.013  -48.298 1.00 158.32 ? 192 A   E C6    1 
ATOM   7940  N  N6    . A   E  1 88  ? -56.821 51.547  -47.976 1.00 154.62 ? 192 A   E N6    1 
ATOM   7941  N  N1    . A   E  1 88  ? -55.317 52.214  -49.593 1.00 163.90 ? 192 A   E N1    1 
ATOM   7942  C  C2    . A   E  1 88  ? -54.103 52.691  -49.906 1.00 167.32 ? 192 A   E C2    1 
ATOM   7943  N  N3    . A   E  1 88  ? -53.090 53.011  -49.105 1.00 165.48 ? 192 A   E N3    1 
ATOM   7944  C  C4    . A   E  1 88  ? -53.432 52.790  -47.827 1.00 159.03 ? 192 A   E C4    1 
ATOM   7945  P  P     . G   E  1 89  ? -52.394 58.164  -45.332 1.00 157.40 ? 193 G   E P     1 
ATOM   7946  O  OP1   . G   E  1 89  ? -51.814 59.501  -45.573 1.00 159.96 ? 193 G   E OP1   1 
ATOM   7947  O  OP2   . G   E  1 89  ? -53.039 57.932  -44.018 1.00 154.06 ? 193 G   E OP2   1 
ATOM   7948  O  "O5'" . G   E  1 89  ? -53.486 57.923  -46.467 1.00 163.99 ? 193 G   E "O5'" 1 
ATOM   7949  C  "C5'" . G   E  1 89  ? -53.167 58.200  -47.821 1.00 165.27 ? 193 G   E "C5'" 1 
ATOM   7950  C  "C4'" . G   E  1 89  ? -54.191 57.681  -48.805 1.00 164.37 ? 193 G   E "C4'" 1 
ATOM   7951  O  "O4'" . G   E  1 89  ? -54.442 56.264  -48.616 1.00 162.51 ? 193 G   E "O4'" 1 
ATOM   7952  C  "C3'" . G   E  1 89  ? -55.582 58.283  -48.763 1.00 164.31 ? 193 G   E "C3'" 1 
ATOM   7953  O  "O3'" . G   E  1 89  ? -55.654 59.596  -49.275 1.00 162.67 ? 193 G   E "O3'" 1 
ATOM   7954  C  "C2'" . G   E  1 89  ? -56.371 57.262  -49.569 1.00 164.42 ? 193 G   E "C2'" 1 
ATOM   7955  O  "O2'" . G   E  1 89  ? -56.079 57.383  -50.955 1.00 164.98 ? 193 G   E "O2'" 1 
ATOM   7956  C  "C1'" . G   E  1 89  ? -55.752 55.960  -49.058 1.00 164.40 ? 193 G   E "C1'" 1 
ATOM   7957  N  N9    . G   E  1 89  ? -56.530 55.455  -47.918 1.00 161.77 ? 193 G   E N9    1 
ATOM   7958  C  C8    . G   E  1 89  ? -56.166 55.398  -46.596 1.00 157.34 ? 193 G   E C8    1 
ATOM   7959  N  N7    . G   E  1 89  ? -57.123 54.925  -45.847 1.00 155.84 ? 193 G   E N7    1 
ATOM   7960  C  C5    . G   E  1 89  ? -58.166 54.657  -46.720 1.00 159.47 ? 193 G   E C5    1 
ATOM   7961  C  C6    . G   E  1 89  ? -59.457 54.126  -46.486 1.00 156.72 ? 193 G   E C6    1 
ATOM   7962  O  O6    . G   E  1 89  ? -59.968 53.780  -45.419 1.00 157.38 ? 193 G   E O6    1 
ATOM   7963  N  N1    . G   E  1 89  ? -60.189 54.011  -47.659 1.00 160.37 ? 193 G   E N1    1 
ATOM   7964  C  C2    . G   E  1 89  ? -59.761 54.361  -48.912 1.00 167.13 ? 193 G   E C2    1 
ATOM   7965  N  N2    . G   E  1 89  ? -60.650 54.165  -49.908 1.00 173.38 ? 193 G   E N2    1 
ATOM   7966  N  N3    . G   E  1 89  ? -58.553 54.865  -49.140 1.00 168.66 ? 193 G   E N3    1 
ATOM   7967  C  C4    . G   E  1 89  ? -57.817 54.982  -48.006 1.00 164.35 ? 193 G   E C4    1 
ATOM   7968  P  P     . G   E  1 90  ? -56.084 60.793  -48.300 1.00 160.95 ? 194 G   E P     1 
ATOM   7969  O  OP1   . G   E  1 90  ? -55.914 62.024  -49.090 1.00 163.84 ? 194 G   E OP1   1 
ATOM   7970  O  OP2   . G   E  1 90  ? -55.357 60.643  -47.017 1.00 158.93 ? 194 G   E OP2   1 
ATOM   7971  O  "O5'" . G   E  1 90  ? -57.636 60.571  -48.034 1.00 158.90 ? 194 G   E "O5'" 1 
ATOM   7972  C  "C5'" . G   E  1 90  ? -58.550 60.449  -49.110 1.00 160.58 ? 194 G   E "C5'" 1 
ATOM   7973  C  "C4'" . G   E  1 90  ? -59.700 59.547  -48.750 1.00 158.73 ? 194 G   E "C4'" 1 
ATOM   7974  O  "O4'" . G   E  1 90  ? -59.196 58.252  -48.333 1.00 175.48 ? 194 G   E "O4'" 1 
ATOM   7975  C  "C3'" . G   E  1 90  ? -60.557 60.004  -47.582 1.00 156.28 ? 194 G   E "C3'" 1 
ATOM   7976  O  "O3'" . G   E  1 90  ? -61.519 60.970  -47.961 1.00 157.44 ? 194 G   E "O3'" 1 
ATOM   7977  C  "C2'" . G   E  1 90  ? -61.170 58.698  -47.085 1.00 164.89 ? 194 G   E "C2'" 1 
ATOM   7978  O  "O2'" . G   E  1 90  ? -62.254 58.301  -47.912 1.00 156.12 ? 194 G   E "O2'" 1 
ATOM   7979  C  "C1'" . G   E  1 90  ? -60.021 57.716  -47.312 1.00 171.45 ? 194 G   E "C1'" 1 
ATOM   7980  N  N9    . G   E  1 90  ? -59.204 57.486  -46.097 1.00 175.12 ? 194 G   E N9    1 
ATOM   7981  C  C8    . G   E  1 90  ? -57.860 57.764  -46.012 1.00 178.46 ? 194 G   E C8    1 
ATOM   7982  N  N7    . G   E  1 90  ? -57.332 57.465  -44.857 1.00 175.55 ? 194 G   E N7    1 
ATOM   7983  C  C5    . G   E  1 90  ? -58.385 56.958  -44.134 1.00 148.95 ? 194 G   E C5    1 
ATOM   7984  C  C6    . G   E  1 90  ? -58.357 56.500  -42.815 1.00 146.70 ? 194 G   E C6    1 
ATOM   7985  O  O6    . G   E  1 90  ? -57.378 56.466  -42.070 1.00 146.09 ? 194 G   E O6    1 
ATOM   7986  N  N1    . G   E  1 90  ? -59.609 56.068  -42.419 1.00 145.60 ? 194 G   E N1    1 
ATOM   7987  C  C2    . G   E  1 90  ? -60.729 56.078  -43.205 1.00 146.67 ? 194 G   E C2    1 
ATOM   7988  N  N2    . G   E  1 90  ? -61.835 55.608  -42.620 1.00 145.80 ? 194 G   E N2    1 
ATOM   7989  N  N3    . G   E  1 90  ? -60.767 56.516  -44.454 1.00 148.80 ? 194 G   E N3    1 
ATOM   7990  C  C4    . G   E  1 90  ? -59.552 56.935  -44.869 1.00 149.80 ? 194 G   E C4    1 
ATOM   7991  P  P     . U   E  1 91  ? -61.856 62.215  -47.006 1.00 156.24 ? 195 U   E P     1 
ATOM   7992  O  OP1   . U   E  1 91  ? -62.755 63.093  -47.769 1.00 158.22 ? 195 U   E OP1   1 
ATOM   7993  O  OP2   . U   E  1 91  ? -60.590 62.694  -46.409 1.00 155.69 ? 195 U   E OP2   1 
ATOM   7994  O  "O5'" . U   E  1 91  ? -62.755 61.639  -45.834 1.00 153.81 ? 195 U   E "O5'" 1 
ATOM   7995  C  "C5'" . U   E  1 91  ? -64.135 61.378  -46.040 1.00 154.35 ? 195 U   E "C5'" 1 
ATOM   7996  C  "C4'" . U   E  1 91  ? -64.746 60.682  -44.845 1.00 163.64 ? 195 U   E "C4'" 1 
ATOM   7997  O  "O4'" . U   E  1 91  ? -63.925 59.549  -44.453 1.00 150.81 ? 195 U   E "O4'" 1 
ATOM   7998  C  "C3'" . U   E  1 91  ? -64.857 61.520  -43.583 1.00 161.66 ? 195 U   E "C3'" 1 
ATOM   7999  O  "O3'" . U   E  1 91  ? -66.012 62.349  -43.597 1.00 161.45 ? 195 U   E "O3'" 1 
ATOM   8000  C  "C2'" . U   E  1 91  ? -64.885 60.465  -42.477 1.00 148.93 ? 195 U   E "C2'" 1 
ATOM   8001  O  "O2'" . U   E  1 91  ? -66.192 59.941  -42.294 1.00 149.35 ? 195 U   E "O2'" 1 
ATOM   8002  C  "C1'" . U   E  1 91  ? -63.994 59.364  -43.060 1.00 148.74 ? 195 U   E "C1'" 1 
ATOM   8003  N  N1    . U   E  1 91  ? -62.612 59.344  -42.531 1.00 147.57 ? 195 U   E N1    1 
ATOM   8004  C  C2    . U   E  1 91  ? -62.395 59.131  -41.187 1.00 145.80 ? 195 U   E C2    1 
ATOM   8005  O  O2    . U   E  1 91  ? -63.278 59.057  -40.352 1.00 145.14 ? 195 U   E O2    1 
ATOM   8006  N  N3    . U   E  1 91  ? -61.078 59.105  -40.811 1.00 145.25 ? 195 U   E N3    1 
ATOM   8007  C  C4    . U   E  1 91  ? -59.979 59.197  -41.623 1.00 146.34 ? 195 U   E C4    1 
ATOM   8008  O  O4    . U   E  1 91  ? -58.871 59.131  -41.109 1.00 146.03 ? 195 U   E O4    1 
ATOM   8009  C  C5    . U   E  1 91  ? -60.275 59.366  -43.006 1.00 148.17 ? 195 U   E C5    1 
ATOM   8010  C  C6    . U   E  1 91  ? -61.549 59.408  -43.401 1.00 148.65 ? 195 U   E C6    1 
ATOM   8011  P  P     . C   E  1 92  ? -65.972 63.865  -43.062 1.00 152.03 ? 196 C   E P     1 
ATOM   8012  O  OP1   . C   E  1 92  ? -67.251 64.524  -43.430 1.00 153.70 ? 196 C   E OP1   1 
ATOM   8013  O  OP2   . C   E  1 92  ? -64.668 64.473  -43.422 1.00 152.28 ? 196 C   E OP2   1 
ATOM   8014  O  "O5'" . C   E  1 92  ? -66.018 63.686  -41.489 1.00 150.16 ? 196 C   E "O5'" 1 
ATOM   8015  C  "C5'" . C   E  1 92  ? -66.996 62.857  -40.884 1.00 149.80 ? 196 C   E "C5'" 1 
ATOM   8016  C  "C4'" . C   E  1 92  ? -66.579 62.479  -39.492 1.00 148.08 ? 196 C   E "C4'" 1 
ATOM   8017  O  "O4'" . C   E  1 92  ? -65.510 61.496  -39.524 1.00 146.82 ? 196 C   E "O4'" 1 
ATOM   8018  C  "C3'" . C   E  1 92  ? -65.998 63.610  -38.670 1.00 159.49 ? 196 C   E "C3'" 1 
ATOM   8019  O  "O3'" . C   E  1 92  ? -66.983 64.496  -38.163 1.00 158.01 ? 196 C   E "O3'" 1 
ATOM   8020  C  "C2'" . C   E  1 92  ? -65.219 62.864  -37.600 1.00 146.25 ? 196 C   E "C2'" 1 
ATOM   8021  O  "O2'" . C   E  1 92  ? -66.099 62.361  -36.611 1.00 147.28 ? 196 C   E "O2'" 1 
ATOM   8022  C  "C1'" . C   E  1 92  ? -64.670 61.681  -38.401 1.00 145.66 ? 196 C   E "C1'" 1 
ATOM   8023  N  N1    . C   E  1 92  ? -63.266 61.848  -38.841 1.00 145.54 ? 196 C   E N1    1 
ATOM   8024  C  C2    . C   E  1 92  ? -62.250 61.799  -37.886 1.00 144.72 ? 196 C   E C2    1 
ATOM   8025  O  O2    . C   E  1 92  ? -62.559 61.670  -36.699 1.00 154.59 ? 196 C   E O2    1 
ATOM   8026  N  N3    . C   E  1 92  ? -60.961 61.923  -38.274 1.00 148.32 ? 196 C   E N3    1 
ATOM   8027  C  C4    . C   E  1 92  ? -60.657 62.061  -39.562 1.00 152.81 ? 196 C   E C4    1 
ATOM   8028  N  N4    . C   E  1 92  ? -59.369 62.175  -39.902 1.00 157.47 ? 196 C   E N4    1 
ATOM   8029  C  C5    . C   E  1 92  ? -61.671 62.099  -40.560 1.00 153.38 ? 196 C   E C5    1 
ATOM   8030  C  C6    . C   E  1 92  ? -62.944 61.985  -40.157 1.00 146.62 ? 196 C   E C6    1 
ATOM   8031  P  P     . G   E  1 93  ? -66.653 66.066  -38.042 1.00 149.53 ? 197 G   E P     1 
ATOM   8032  O  OP1   . G   E  1 93  ? -67.929 66.761  -37.760 1.00 150.82 ? 197 G   E OP1   1 
ATOM   8033  O  OP2   . G   E  1 93  ? -65.808 66.476  -39.198 1.00 150.02 ? 197 G   E OP2   1 
ATOM   8034  O  "O5'" . G   E  1 93  ? -65.743 66.164  -36.741 1.00 148.59 ? 197 G   E "O5'" 1 
ATOM   8035  C  "C5'" . G   E  1 93  ? -66.287 65.878  -35.466 1.00 148.39 ? 197 G   E "C5'" 1 
ATOM   8036  C  "C4'" . G   E  1 93  ? -65.260 66.032  -34.382 1.00 147.95 ? 197 G   E "C4'" 1 
ATOM   8037  O  "O4'" . G   E  1 93  ? -64.329 64.921  -34.409 1.00 146.64 ? 197 G   E "O4'" 1 
ATOM   8038  C  "C3'" . G   E  1 93  ? -64.374 67.257  -34.474 1.00 148.76 ? 197 G   E "C3'" 1 
ATOM   8039  O  "O3'" . G   E  1 93  ? -65.024 68.419  -33.994 1.00 155.28 ? 197 G   E "O3'" 1 
ATOM   8040  C  "C2'" . G   E  1 93  ? -63.170 66.841  -33.642 1.00 148.26 ? 197 G   E "C2'" 1 
ATOM   8041  O  "O2'" . G   E  1 93  ? -63.470 66.943  -32.258 1.00 148.72 ? 197 G   E "O2'" 1 
ATOM   8042  C  "C1'" . G   E  1 93  ? -63.052 65.360  -34.010 1.00 146.77 ? 197 G   E "C1'" 1 
ATOM   8043  N  N9    . G   E  1 93  ? -62.110 65.094  -35.108 1.00 146.54 ? 197 G   E N9    1 
ATOM   8044  C  C8    . G   E  1 93  ? -62.418 64.873  -36.419 1.00 146.60 ? 197 G   E C8    1 
ATOM   8045  N  N7    . G   E  1 93  ? -61.368 64.641  -37.156 1.00 148.67 ? 197 G   E N7    1 
ATOM   8046  C  C5    . G   E  1 93  ? -60.302 64.694  -36.280 1.00 146.77 ? 197 G   E C5    1 
ATOM   8047  C  C6    . G   E  1 93  ? -58.910 64.522  -36.497 1.00 150.55 ? 197 G   E C6    1 
ATOM   8048  O  O6    . G   E  1 93  ? -58.287 64.278  -37.539 1.00 153.55 ? 197 G   E O6    1 
ATOM   8049  N  N1    . G   E  1 93  ? -58.200 64.666  -35.317 1.00 147.59 ? 197 G   E N1    1 
ATOM   8050  C  C2    . G   E  1 93  ? -58.761 64.938  -34.101 1.00 147.41 ? 197 G   E C2    1 
ATOM   8051  N  N2    . G   E  1 93  ? -57.926 65.043  -33.062 1.00 165.95 ? 197 G   E N2    1 
ATOM   8052  N  N3    . G   E  1 93  ? -60.052 65.097  -33.891 1.00 146.95 ? 197 G   E N3    1 
ATOM   8053  C  C4    . G   E  1 93  ? -60.756 64.963  -35.015 1.00 146.62 ? 197 G   E C4    1 
ATOM   8054  P  P     . G   E  1 94  ? -64.658 69.863  -34.589 1.00 151.43 ? 198 G   E P     1 
ATOM   8055  O  OP1   . G   E  1 94  ? -65.354 70.939  -33.821 1.00 152.83 ? 198 G   E OP1   1 
ATOM   8056  O  OP2   . G   E  1 94  ? -64.838 69.757  -36.052 1.00 151.40 ? 198 G   E OP2   1 
ATOM   8057  O  "O5'" . G   E  1 94  ? -63.097 69.977  -34.326 1.00 154.10 ? 198 G   E "O5'" 1 
ATOM   8058  C  "C5'" . G   E  1 94  ? -62.614 70.321  -33.041 1.00 159.04 ? 198 G   E "C5'" 1 
ATOM   8059  C  "C4'" . G   E  1 94  ? -61.115 70.338  -33.019 1.00 161.01 ? 198 G   E "C4'" 1 
ATOM   8060  O  "O4'" . G   E  1 94  ? -60.615 69.092  -33.572 1.00 161.10 ? 198 G   E "O4'" 1 
ATOM   8061  C  "C3'" . G   E  1 94  ? -60.460 71.392  -33.884 1.00 170.68 ? 198 G   E "C3'" 1 
ATOM   8062  O  "O3'" . G   E  1 94  ? -60.518 72.711  -33.339 1.00 182.95 ? 198 G   E "O3'" 1 
ATOM   8063  C  "C2'" . G   E  1 94  ? -59.062 70.801  -34.076 1.00 166.92 ? 198 G   E "C2'" 1 
ATOM   8064  O  "O2'" . G   E  1 94  ? -58.302 70.903  -32.877 1.00 167.60 ? 198 G   E "O2'" 1 
ATOM   8065  C  "C1'" . G   E  1 94  ? -59.399 69.320  -34.250 1.00 162.01 ? 198 G   E "C1'" 1 
ATOM   8066  N  N9    . G   E  1 94  ? -59.591 68.911  -35.659 1.00 159.59 ? 198 G   E N9    1 
ATOM   8067  C  C8    . G   E  1 94  ? -60.813 68.803  -36.282 1.00 158.20 ? 198 G   E C8    1 
ATOM   8068  N  N7    . G   E  1 94  ? -60.742 68.390  -37.514 1.00 157.77 ? 198 G   E N7    1 
ATOM   8069  C  C5    . G   E  1 94  ? -59.390 68.196  -37.724 1.00 158.40 ? 198 G   E C5    1 
ATOM   8070  C  C6    . G   E  1 94  ? -58.727 67.750  -38.888 1.00 159.11 ? 198 G   E C6    1 
ATOM   8071  O  O6    . G   E  1 94  ? -59.213 67.432  -39.980 1.00 158.95 ? 198 G   E O6    1 
ATOM   8072  N  N1    . G   E  1 94  ? -57.358 67.690  -38.684 1.00 160.17 ? 198 G   E N1    1 
ATOM   8073  C  C2    . G   E  1 94  ? -56.704 68.010  -37.523 1.00 159.98 ? 198 G   E C2    1 
ATOM   8074  N  N2    . G   E  1 94  ? -55.369 67.872  -37.572 1.00 160.40 ? 198 G   E N2    1 
ATOM   8075  N  N3    . G   E  1 94  ? -57.316 68.426  -36.422 1.00 159.55 ? 198 G   E N3    1 
ATOM   8076  C  C4    . G   E  1 94  ? -58.656 68.498  -36.592 1.00 159.06 ? 198 G   E C4    1 
ATOM   8077  P  P     . A   E  1 95  ? -60.882 73.965  -34.290 1.00 157.48 ? 199 A   E P     1 
ATOM   8078  O  OP1   . A   E  1 95  ? -60.226 75.161  -33.730 1.00 159.83 ? 199 A   E OP1   1 
ATOM   8079  O  OP2   . A   E  1 95  ? -62.325 74.009  -34.626 1.00 156.72 ? 199 A   E OP2   1 
ATOM   8080  O  "O5'" . A   E  1 95  ? -60.117 73.621  -35.634 1.00 157.46 ? 199 A   E "O5'" 1 
ATOM   8081  C  "C5'" . A   E  1 95  ? -60.167 74.486  -36.746 1.00 158.78 ? 199 A   E "C5'" 1 
ATOM   8082  C  "C4'" . A   E  1 95  ? -58.837 75.150  -36.952 1.00 161.05 ? 199 A   E "C4'" 1 
ATOM   8083  O  "O4'" . A   E  1 95  ? -58.479 75.925  -35.792 1.00 162.50 ? 199 A   E "O4'" 1 
ATOM   8084  C  "C3'" . A   E  1 95  ? -57.638 74.244  -37.163 1.00 161.85 ? 199 A   E "C3'" 1 
ATOM   8085  O  "O3'" . A   E  1 95  ? -57.552 73.767  -38.488 1.00 161.24 ? 199 A   E "O3'" 1 
ATOM   8086  C  "C2'" . A   E  1 95  ? -56.465 75.148  -36.799 1.00 164.65 ? 199 A   E "C2'" 1 
ATOM   8087  O  "O2'" . A   E  1 95  ? -56.105 75.958  -37.907 1.00 166.22 ? 199 A   E "O2'" 1 
ATOM   8088  C  "C1'" . A   E  1 95  ? -57.077 76.051  -35.724 1.00 164.49 ? 199 A   E "C1'" 1 
ATOM   8089  N  N9    . A   E  1 95  ? -56.607 75.755  -34.358 1.00 164.73 ? 199 A   E N9    1 
ATOM   8090  C  C8    . A   E  1 95  ? -57.300 75.208  -33.309 1.00 163.10 ? 199 A   E C8    1 
ATOM   8091  N  N7    . A   E  1 95  ? -56.595 75.093  -32.209 1.00 164.26 ? 199 A   E N7    1 
ATOM   8092  C  C5    . A   E  1 95  ? -55.355 75.604  -32.564 1.00 166.88 ? 199 A   E C5    1 
ATOM   8093  C  C6    . A   E  1 95  ? -54.163 75.767  -31.843 1.00 169.56 ? 199 A   E C6    1 
ATOM   8094  N  N6    . A   E  1 95  ? -54.040 75.409  -30.569 1.00 169.85 ? 199 A   E N6    1 
ATOM   8095  N  N1    . A   E  1 95  ? -53.094 76.312  -32.469 1.00 172.37 ? 199 A   E N1    1 
ATOM   8096  C  C2    . A   E  1 95  ? -53.224 76.668  -33.752 1.00 173.52 ? 199 A   E C2    1 
ATOM   8097  N  N3    . A   E  1 95  ? -54.298 76.563  -34.537 1.00 172.00 ? 199 A   E N3    1 
ATOM   8098  C  C4    . A   E  1 95  ? -55.341 76.010  -33.882 1.00 170.49 ? 199 A   E C4    1 
ATOM   8099  P  P     . A   E  1 96  ? -57.100 72.261  -38.770 1.00 159.52 ? 200 A   E P     1 
ATOM   8100  O  OP1   . A   E  1 96  ? -56.713 72.196  -40.198 1.00 160.86 ? 200 A   E OP1   1 
ATOM   8101  O  OP2   . A   E  1 96  ? -58.180 71.398  -38.255 1.00 156.83 ? 200 A   E OP2   1 
ATOM   8102  O  "O5'" . A   E  1 96  ? -55.776 72.079  -37.897 1.00 160.61 ? 200 A   E "O5'" 1 
ATOM   8103  C  "C5'" . A   E  1 96  ? -54.491 72.097  -38.507 1.00 162.94 ? 200 A   E "C5'" 1 
ATOM   8104  C  "C4'" . A   E  1 96  ? -53.424 72.571  -37.549 1.00 165.12 ? 200 A   E "C4'" 1 
ATOM   8105  O  "O4'" . A   E  1 96  ? -54.033 73.287  -36.453 1.00 164.84 ? 200 A   E "O4'" 1 
ATOM   8106  C  "C3'" . A   E  1 96  ? -52.581 71.497  -36.877 1.00 164.73 ? 200 A   E "C3'" 1 
ATOM   8107  O  "O3'" . A   E  1 96  ? -51.499 71.095  -37.695 1.00 166.60 ? 200 A   E "O3'" 1 
ATOM   8108  C  "C2'" . A   E  1 96  ? -52.111 72.178  -35.594 1.00 166.50 ? 200 A   E "C2'" 1 
ATOM   8109  O  "O2'" . A   E  1 96  ? -50.957 72.969  -35.821 1.00 170.41 ? 200 A   E "O2'" 1 
ATOM   8110  C  "C1'" . A   E  1 96  ? -53.277 73.111  -35.279 1.00 165.76 ? 200 A   E "C1'" 1 
ATOM   8111  N  N9    . A   E  1 96  ? -54.161 72.564  -34.249 1.00 176.27 ? 200 A   E N9    1 
ATOM   8112  C  C8    . A   E  1 96  ? -55.466 72.188  -34.429 1.00 181.09 ? 200 A   E C8    1 
ATOM   8113  N  N7    . A   E  1 96  ? -56.037 71.729  -33.341 1.00 180.55 ? 200 A   E N7    1 
ATOM   8114  C  C5    . A   E  1 96  ? -55.044 71.826  -32.390 1.00 172.74 ? 200 A   E C5    1 
ATOM   8115  C  C6    . A   E  1 96  ? -55.061 71.493  -31.039 1.00 165.02 ? 200 A   E C6    1 
ATOM   8116  N  N6    . A   E  1 96  ? -56.151 70.998  -30.454 1.00 159.09 ? 200 A   E N6    1 
ATOM   8117  N  N1    . A   E  1 96  ? -53.922 71.698  -30.344 1.00 167.28 ? 200 A   E N1    1 
ATOM   8118  C  C2    . A   E  1 96  ? -52.856 72.209  -30.990 1.00 170.51 ? 200 A   E C2    1 
ATOM   8119  N  N3    . A   E  1 96  ? -52.721 72.566  -32.270 1.00 171.30 ? 200 A   E N3    1 
ATOM   8120  C  C4    . A   E  1 96  ? -53.877 72.348  -32.923 1.00 173.12 ? 200 A   E C4    1 
ATOM   8121  P  P     . A   E  1 97  ? -51.118 69.554  -37.879 1.00 165.00 ? 201 A   E P     1 
ATOM   8122  O  OP1   . A   E  1 97  ? -50.058 69.540  -38.914 1.00 167.94 ? 201 A   E OP1   1 
ATOM   8123  O  OP2   . A   E  1 97  ? -52.357 68.760  -38.086 1.00 161.42 ? 201 A   E OP2   1 
ATOM   8124  O  "O5'" . A   E  1 97  ? -50.467 69.141  -36.479 1.00 168.15 ? 201 A   E "O5'" 1 
ATOM   8125  C  "C5'" . A   E  1 97  ? -49.193 69.628  -36.070 1.00 168.75 ? 201 A   E "C5'" 1 
ATOM   8126  C  "C4'" . A   E  1 97  ? -48.972 69.434  -34.585 1.00 177.47 ? 201 A   E "C4'" 1 
ATOM   8127  O  "O4'" . A   E  1 97  ? -50.039 70.092  -33.854 1.00 174.24 ? 201 A   E "O4'" 1 
ATOM   8128  C  "C3'" . A   E  1 97  ? -48.996 67.994  -34.086 1.00 172.00 ? 201 A   E "C3'" 1 
ATOM   8129  O  "O3'" . A   E  1 97  ? -47.738 67.352  -34.205 1.00 171.79 ? 201 A   E "O3'" 1 
ATOM   8130  C  "C2'" . A   E  1 97  ? -49.468 68.130  -32.640 1.00 168.15 ? 201 A   E "C2'" 1 
ATOM   8131  O  "O2'" . A   E  1 97  ? -48.399 68.465  -31.768 1.00 170.23 ? 201 A   E "O2'" 1 
ATOM   8132  C  "C1'" . A   E  1 97  ? -50.413 69.324  -32.731 1.00 169.37 ? 201 A   E "C1'" 1 
ATOM   8133  N  N9    . A   E  1 97  ? -51.820 68.925  -32.900 1.00 167.42 ? 201 A   E N9    1 
ATOM   8134  C  C8    . A   E  1 97  ? -52.511 68.843  -34.081 1.00 170.52 ? 201 A   E C8    1 
ATOM   8135  N  N7    . A   E  1 97  ? -53.763 68.488  -33.939 1.00 167.01 ? 201 A   E N7    1 
ATOM   8136  C  C5    . A   E  1 97  ? -53.904 68.344  -32.572 1.00 162.48 ? 201 A   E C5    1 
ATOM   8137  C  C6    . A   E  1 97  ? -55.000 67.979  -31.792 1.00 159.92 ? 201 A   E C6    1 
ATOM   8138  N  N6    . A   E  1 97  ? -56.194 67.692  -32.310 1.00 162.20 ? 201 A   E N6    1 
ATOM   8139  N  N1    . A   E  1 97  ? -54.818 67.919  -30.458 1.00 156.86 ? 201 A   E N1    1 
ATOM   8140  C  C2    . A   E  1 97  ? -53.611 68.215  -29.961 1.00 159.59 ? 201 A   E C2    1 
ATOM   8141  N  N3    . A   E  1 97  ? -52.500 68.575  -30.597 1.00 161.77 ? 201 A   E N3    1 
ATOM   8142  C  C4    . A   E  1 97  ? -52.721 68.620  -31.917 1.00 162.57 ? 201 A   E C4    1 
ATOM   8143  P  P     . C   E  1 98  ? -47.615 65.966  -35.001 1.00 166.25 ? 202 C   E P     1 
ATOM   8144  O  OP1   . C   E  1 98  ? -46.440 65.237  -34.462 1.00 167.97 ? 202 C   E OP1   1 
ATOM   8145  O  OP2   . C   E  1 98  ? -47.675 66.263  -36.455 1.00 167.96 ? 202 C   E OP2   1 
ATOM   8146  O  "O5'" . C   E  1 98  ? -48.931 65.186  -34.558 1.00 162.41 ? 202 C   E "O5'" 1 
ATOM   8147  C  "C5'" . C   E  1 98  ? -48.976 64.517  -33.311 1.00 165.27 ? 202 C   E "C5'" 1 
ATOM   8148  C  "C4'" . C   E  1 98  ? -50.336 64.587  -32.654 1.00 169.49 ? 202 C   E "C4'" 1 
ATOM   8149  O  "O4'" . C   E  1 98  ? -51.194 65.583  -33.270 1.00 173.07 ? 202 C   E "O4'" 1 
ATOM   8150  C  "C3'" . C   E  1 98  ? -51.176 63.325  -32.701 1.00 166.76 ? 202 C   E "C3'" 1 
ATOM   8151  O  "O3'" . C   E  1 98  ? -50.754 62.341  -31.786 1.00 162.17 ? 202 C   E "O3'" 1 
ATOM   8152  C  "C2'" . C   E  1 98  ? -52.567 63.847  -32.381 1.00 171.46 ? 202 C   E "C2'" 1 
ATOM   8153  O  "O2'" . C   E  1 98  ? -52.733 64.025  -30.981 1.00 176.22 ? 202 C   E "O2'" 1 
ATOM   8154  C  "C1'" . C   E  1 98  ? -52.550 65.213  -33.073 1.00 172.08 ? 202 C   E "C1'" 1 
ATOM   8155  N  N1    . C   E  1 98  ? -53.252 65.136  -34.371 1.00 169.47 ? 202 C   E N1    1 
ATOM   8156  C  C2    . C   E  1 98  ? -54.651 65.162  -34.357 1.00 167.97 ? 202 C   E C2    1 
ATOM   8157  O  O2    . C   E  1 98  ? -55.227 65.280  -33.271 1.00 169.08 ? 202 C   E O2    1 
ATOM   8158  N  N3    . C   E  1 98  ? -55.333 65.064  -35.516 1.00 167.62 ? 202 C   E N3    1 
ATOM   8159  C  C4    . C   E  1 98  ? -54.659 64.942  -36.656 1.00 168.53 ? 202 C   E C4    1 
ATOM   8160  N  N4    . C   E  1 98  ? -55.365 64.854  -37.784 1.00 170.99 ? 202 C   E N4    1 
ATOM   8161  C  C5    . C   E  1 98  ? -53.234 64.906  -36.697 1.00 173.11 ? 202 C   E C5    1 
ATOM   8162  C  C6    . C   E  1 98  ? -52.570 64.999  -35.539 1.00 173.41 ? 202 C   E C6    1 
ATOM   8163  P  P     . G   E  1 99  ? -51.139 60.813  -32.058 1.00 156.22 ? 203 G   E P     1 
ATOM   8164  O  OP1   . G   E  1 99  ? -50.464 60.021  -31.004 1.00 160.07 ? 203 G   E OP1   1 
ATOM   8165  O  OP2   . G   E  1 99  ? -50.937 60.508  -33.497 1.00 160.60 ? 203 G   E OP2   1 
ATOM   8166  O  "O5'" . G   E  1 99  ? -52.703 60.762  -31.783 1.00 152.66 ? 203 G   E "O5'" 1 
ATOM   8167  C  "C5'" . G   E  1 99  ? -53.220 61.014  -30.490 1.00 148.78 ? 203 G   E "C5'" 1 
ATOM   8168  C  "C4'" . G   E  1 99  ? -54.720 61.086  -30.517 1.00 148.20 ? 203 G   E "C4'" 1 
ATOM   8169  O  "O4'" . G   E  1 99  ? -55.163 62.146  -31.397 1.00 147.56 ? 203 G   E "O4'" 1 
ATOM   8170  C  "C3'" . G   E  1 99  ? -55.429 59.852  -31.050 1.00 145.31 ? 203 G   E "C3'" 1 
ATOM   8171  O  "O3'" . G   E  1 99  ? -55.530 58.815  -30.094 1.00 143.94 ? 203 G   E "O3'" 1 
ATOM   8172  C  "C2'" . G   E  1 99  ? -56.780 60.404  -31.461 1.00 144.17 ? 203 G   E "C2'" 1 
ATOM   8173  O  "O2'" . G   E  1 99  ? -57.644 60.536  -30.343 1.00 150.47 ? 203 G   E "O2'" 1 
ATOM   8174  C  "C1'" . G   E  1 99  ? -56.392 61.784  -31.988 1.00 145.83 ? 203 G   E "C1'" 1 
ATOM   8175  N  N9    . G   E  1 99  ? -56.218 61.725  -33.438 1.00 145.75 ? 203 G   E N9    1 
ATOM   8176  C  C8    . G   E  1 99  ? -55.067 61.704  -34.175 1.00 152.72 ? 203 G   E C8    1 
ATOM   8177  N  N7    . G   E  1 99  ? -55.315 61.620  -35.455 1.00 151.90 ? 203 G   E N7    1 
ATOM   8178  C  C5    . G   E  1 99  ? -56.702 61.578  -35.548 1.00 148.54 ? 203 G   E C5    1 
ATOM   8179  C  C6    . G   E  1 99  ? -57.578 61.483  -36.658 1.00 149.20 ? 203 G   E C6    1 
ATOM   8180  O  O6    . G   E  1 99  ? -57.317 61.422  -37.861 1.00 153.84 ? 203 G   E O6    1 
ATOM   8181  N  N1    . G   E  1 99  ? -58.914 61.472  -36.269 1.00 144.26 ? 203 G   E N1    1 
ATOM   8182  C  C2    . G   E  1 99  ? -59.352 61.538  -34.976 1.00 143.78 ? 203 G   E C2    1 
ATOM   8183  N  N2    . G   E  1 99  ? -60.671 61.507  -34.762 1.00 151.29 ? 203 G   E N2    1 
ATOM   8184  N  N3    . G   E  1 99  ? -58.551 61.625  -33.939 1.00 144.07 ? 203 G   E N3    1 
ATOM   8185  C  C4    . G   E  1 99  ? -57.262 61.645  -34.303 1.00 144.88 ? 203 G   E C4    1 
ATOM   8186  P  P     . G   E  1 100 ? -55.821 57.316  -30.573 1.00 142.02 ? 204 G   E P     1 
ATOM   8187  O  OP1   . G   E  1 100 ? -55.777 56.475  -29.355 1.00 141.74 ? 204 G   E OP1   1 
ATOM   8188  O  OP2   . G   E  1 100 ? -54.975 57.009  -31.748 1.00 152.70 ? 204 G   E OP2   1 
ATOM   8189  O  "O5'" . G   E  1 100 ? -57.320 57.352  -31.093 1.00 141.01 ? 204 G   E "O5'" 1 
ATOM   8190  C  "C5'" . G   E  1 100 ? -58.382 57.502  -30.180 1.00 141.05 ? 204 G   E "C5'" 1 
ATOM   8191  C  "C4'" . G   E  1 100 ? -59.706 57.482  -30.883 1.00 140.52 ? 204 G   E "C4'" 1 
ATOM   8192  O  "O4'" . G   E  1 100 ? -59.768 58.525  -31.881 1.00 141.09 ? 204 G   E "O4'" 1 
ATOM   8193  C  "C3'" . G   E  1 100 ? -60.100 56.237  -31.652 1.00 139.39 ? 204 G   E "C3'" 1 
ATOM   8194  O  "O3'" . G   E  1 100 ? -60.538 55.190  -30.818 1.00 138.93 ? 204 G   E "O3'" 1 
ATOM   8195  C  "C2'" . G   E  1 100 ? -61.204 56.762  -32.554 1.00 141.68 ? 204 G   E "C2'" 1 
ATOM   8196  O  "O2'" . G   E  1 100 ? -62.398 56.946  -31.810 1.00 142.42 ? 204 G   E "O2'" 1 
ATOM   8197  C  "C1'" . G   E  1 100 ? -60.659 58.139  -32.912 1.00 140.62 ? 204 G   E "C1'" 1 
ATOM   8198  N  N9    . G   E  1 100 ? -59.971 58.170  -34.218 1.00 140.72 ? 204 G   E N9    1 
ATOM   8199  C  C8    . G   E  1 100 ? -58.624 58.115  -34.475 1.00 141.00 ? 204 G   E C8    1 
ATOM   8200  N  N7    . G   E  1 100 ? -58.338 58.177  -35.750 1.00 141.50 ? 204 G   E N7    1 
ATOM   8201  C  C5    . G   E  1 100 ? -59.565 58.276  -36.377 1.00 141.49 ? 204 G   E C5    1 
ATOM   8202  C  C6    . G   E  1 100 ? -59.873 58.374  -37.755 1.00 142.26 ? 204 G   E C6    1 
ATOM   8203  O  O6    . G   E  1 100 ? -59.085 58.392  -38.715 1.00 143.14 ? 204 G   E O6    1 
ATOM   8204  N  N1    . G   E  1 100 ? -61.252 58.453  -37.949 1.00 142.39 ? 204 G   E N1    1 
ATOM   8205  C  C2    . G   E  1 100 ? -62.199 58.438  -36.949 1.00 141.94 ? 204 G   E C2    1 
ATOM   8206  N  N2    . G   E  1 100 ? -63.483 58.523  -37.329 1.00 142.64 ? 204 G   E N2    1 
ATOM   8207  N  N3    . G   E  1 100 ? -61.911 58.350  -35.664 1.00 141.29 ? 204 G   E N3    1 
ATOM   8208  C  C4    . G   E  1 100 ? -60.583 58.262  -35.449 1.00 141.03 ? 204 G   E C4    1 
ATOM   8209  P  P     . A   E  1 101 ? -60.411 53.672  -31.307 1.00 159.72 ? 205 A   E P     1 
ATOM   8210  O  OP1   . A   E  1 101 ? -60.690 52.896  -30.076 1.00 158.30 ? 205 A   E OP1   1 
ATOM   8211  O  OP2   . A   E  1 101 ? -59.168 53.465  -32.085 1.00 160.57 ? 205 A   E OP2   1 
ATOM   8212  O  "O5'" . A   E  1 101 ? -61.624 53.483  -32.322 1.00 157.96 ? 205 A   E "O5'" 1 
ATOM   8213  C  "C5'" . A   E  1 101 ? -62.958 53.439  -31.849 1.00 156.83 ? 205 A   E "C5'" 1 
ATOM   8214  C  "C4'" . A   E  1 101 ? -63.965 53.604  -32.958 1.00 156.44 ? 205 A   E "C4'" 1 
ATOM   8215  O  "O4'" . A   E  1 101 ? -63.731 54.862  -33.641 1.00 159.10 ? 205 A   E "O4'" 1 
ATOM   8216  C  "C3'" . A   E  1 101 ? -63.943 52.582  -34.083 1.00 154.89 ? 205 A   E "C3'" 1 
ATOM   8217  O  "O3'" . A   E  1 101 ? -64.575 51.359  -33.767 1.00 152.75 ? 205 A   E "O3'" 1 
ATOM   8218  C  "C2'" . A   E  1 101 ? -64.642 53.335  -35.198 1.00 156.20 ? 205 A   E "C2'" 1 
ATOM   8219  O  "O2'" . A   E  1 101 ? -66.037 53.404  -34.955 1.00 155.73 ? 205 A   E "O2'" 1 
ATOM   8220  C  "C1'" . A   E  1 101 ? -64.049 54.725  -35.010 1.00 165.99 ? 205 A   E "C1'" 1 
ATOM   8221  N  N9    . A   E  1 101 ? -62.813 54.831  -35.787 1.00 166.11 ? 205 A   E N9    1 
ATOM   8222  C  C8    . A   E  1 101 ? -61.517 54.711  -35.364 1.00 171.10 ? 205 A   E C8    1 
ATOM   8223  N  N7    . A   E  1 101 ? -60.657 54.825  -36.344 1.00 174.12 ? 205 A   E N7    1 
ATOM   8224  C  C5    . A   E  1 101 ? -61.446 55.013  -37.466 1.00 173.43 ? 205 A   E C5    1 
ATOM   8225  C  C6    . A   E  1 101 ? -61.123 55.193  -38.810 1.00 176.25 ? 205 A   E C6    1 
ATOM   8226  N  N6    . A   E  1 101 ? -59.866 55.212  -39.248 1.00 181.63 ? 205 A   E N6    1 
ATOM   8227  N  N1    . A   E  1 101 ? -62.143 55.349  -39.679 1.00 175.84 ? 205 A   E N1    1 
ATOM   8228  C  C2    . A   E  1 101 ? -63.401 55.324  -39.212 1.00 171.71 ? 205 A   E C2    1 
ATOM   8229  N  N3    . A   E  1 101 ? -63.828 55.162  -37.965 1.00 167.98 ? 205 A   E N3    1 
ATOM   8230  C  C4    . A   E  1 101 ? -62.781 55.012  -37.140 1.00 168.38 ? 205 A   E C4    1 
ATOM   8231  P  P     . G   E  1 102 ? -63.927 49.997  -34.299 1.00 151.40 ? 206 G   E P     1 
ATOM   8232  O  OP1   . G   E  1 102 ? -64.935 48.933  -34.067 1.00 150.06 ? 206 G   E OP1   1 
ATOM   8233  O  OP2   . G   E  1 102 ? -62.536 49.902  -33.792 1.00 151.75 ? 206 G   E OP2   1 
ATOM   8234  O  "O5'" . G   E  1 102 ? -63.800 50.219  -35.870 1.00 152.32 ? 206 G   E "O5'" 1 
ATOM   8235  C  "C5'" . G   E  1 102 ? -62.908 49.446  -36.662 1.00 152.16 ? 206 G   E "C5'" 1 
ATOM   8236  C  "C4'" . G   E  1 102 ? -62.619 50.142  -37.964 1.00 154.00 ? 206 G   E "C4'" 1 
ATOM   8237  O  "O4'" . G   E  1 102 ? -61.995 51.415  -37.682 1.00 155.87 ? 206 G   E "O4'" 1 
ATOM   8238  C  "C3'" . G   E  1 102 ? -61.655 49.467  -38.929 1.00 154.41 ? 206 G   E "C3'" 1 
ATOM   8239  O  "O3'" . G   E  1 102 ? -62.271 48.459  -39.715 1.00 153.84 ? 206 G   E "O3'" 1 
ATOM   8240  C  "C2'" . G   E  1 102 ? -61.155 50.638  -39.756 1.00 157.02 ? 206 G   E "C2'" 1 
ATOM   8241  O  "O2'" . G   E  1 102 ? -62.142 50.987  -40.710 1.00 158.07 ? 206 G   E "O2'" 1 
ATOM   8242  C  "C1'" . G   E  1 102 ? -61.098 51.753  -38.713 1.00 157.81 ? 206 G   E "C1'" 1 
ATOM   8243  N  N9    . G   E  1 102 ? -59.753 51.925  -38.124 1.00 158.70 ? 206 G   E N9    1 
ATOM   8244  C  C8    . G   E  1 102 ? -59.393 51.682  -36.818 1.00 159.66 ? 206 G   E C8    1 
ATOM   8245  N  N7    . G   E  1 102 ? -58.139 51.928  -36.562 1.00 159.40 ? 206 G   E N7    1 
ATOM   8246  C  C5    . G   E  1 102 ? -57.630 52.365  -37.771 1.00 161.53 ? 206 G   E C5    1 
ATOM   8247  C  C6    . G   E  1 102 ? -56.318 52.769  -38.110 1.00 164.32 ? 206 G   E C6    1 
ATOM   8248  O  O6    . G   E  1 102 ? -55.307 52.828  -37.396 1.00 165.52 ? 206 G   E O6    1 
ATOM   8249  N  N1    . G   E  1 102 ? -56.251 53.131  -39.448 1.00 166.24 ? 206 G   E N1    1 
ATOM   8250  C  C2    . G   E  1 102 ? -57.292 53.108  -40.339 1.00 165.64 ? 206 G   E C2    1 
ATOM   8251  N  N2    . G   E  1 102 ? -56.998 53.498  -41.584 1.00 168.26 ? 206 G   E N2    1 
ATOM   8252  N  N3    . G   E  1 102 ? -58.520 52.735  -40.035 1.00 163.13 ? 206 G   E N3    1 
ATOM   8253  C  C4    . G   E  1 102 ? -58.614 52.379  -38.741 1.00 161.15 ? 206 G   E C4    1 
ATOM   8254  P  P     . C   E  1 103 ? -61.402 47.513  -40.685 1.00 154.31 ? 207 C   E P     1 
ATOM   8255  O  OP1   . C   E  1 103 ? -61.825 46.130  -40.408 1.00 159.02 ? 207 C   E OP1   1 
ATOM   8256  O  OP2   . C   E  1 103 ? -59.974 47.845  -40.554 1.00 155.07 ? 207 C   E OP2   1 
ATOM   8257  O  "O5'" . C   E  1 103 ? -61.819 47.896  -42.180 1.00 156.44 ? 207 C   E "O5'" 1 
ATOM   8258  C  "C5'" . C   E  1 103 ? -63.180 47.959  -42.605 1.00 156.89 ? 207 C   E "C5'" 1 
ATOM   8259  C  "C4'" . C   E  1 103 ? -63.308 48.505  -44.015 1.00 167.01 ? 207 C   E "C4'" 1 
ATOM   8260  O  "O4'" . C   E  1 103 ? -62.760 49.850  -44.085 1.00 161.23 ? 207 C   E "O4'" 1 
ATOM   8261  C  "C3'" . C   E  1 103 ? -62.549 47.731  -45.086 1.00 167.89 ? 207 C   E "C3'" 1 
ATOM   8262  O  "O3'" . C   E  1 103 ? -63.279 46.600  -45.549 1.00 166.25 ? 207 C   E "O3'" 1 
ATOM   8263  C  "C2'" . C   E  1 103 ? -62.309 48.785  -46.166 1.00 163.98 ? 207 C   E "C2'" 1 
ATOM   8264  O  "O2'" . C   E  1 103 ? -63.444 48.945  -47.004 1.00 165.81 ? 207 C   E "O2'" 1 
ATOM   8265  C  "C1'" . C   E  1 103 ? -62.117 50.053  -45.325 1.00 163.87 ? 207 C   E "C1'" 1 
ATOM   8266  N  N1    . C   E  1 103 ? -60.695 50.358  -45.046 1.00 167.33 ? 207 C   E N1    1 
ATOM   8267  C  C2    . C   E  1 103 ? -59.814 50.728  -46.064 1.00 175.29 ? 207 C   E C2    1 
ATOM   8268  O  O2    . C   E  1 103 ? -60.214 50.799  -47.234 1.00 182.81 ? 207 C   E O2    1 
ATOM   8269  N  N3    . C   E  1 103 ? -58.525 50.994  -45.749 1.00 173.47 ? 207 C   E N3    1 
ATOM   8270  C  C4    . C   E  1 103 ? -58.104 50.919  -44.488 1.00 166.81 ? 207 C   E C4    1 
ATOM   8271  N  N4    . C   E  1 103 ? -56.825 51.191  -44.234 1.00 167.38 ? 207 C   E N4    1 
ATOM   8272  C  C5    . C   E  1 103 ? -58.981 50.554  -43.435 1.00 163.04 ? 207 C   E C5    1 
ATOM   8273  C  C6    . C   E  1 103 ? -60.251 50.290  -43.760 1.00 162.28 ? 207 C   E C6    1 
ATOM   8274  P  P     . A   E  1 104 ? -62.578 45.163  -45.695 1.00 160.53 ? 208 A   E P     1 
ATOM   8275  O  OP1   . A   E  1 104 ? -63.600 44.259  -46.278 1.00 161.72 ? 208 A   E OP1   1 
ATOM   8276  O  OP2   . A   E  1 104 ? -61.913 44.822  -44.413 1.00 158.02 ? 208 A   E OP2   1 
ATOM   8277  O  "O5'" . A   E  1 104 ? -61.472 45.385  -46.817 1.00 162.81 ? 208 A   E "O5'" 1 
ATOM   8278  C  "C5'" . A   E  1 104 ? -61.851 45.508  -48.176 1.00 165.84 ? 208 A   E "C5'" 1 
ATOM   8279  C  "C4'" . A   E  1 104 ? -60.761 46.116  -49.022 1.00 168.18 ? 208 A   E "C4'" 1 
ATOM   8280  O  "O4'" . A   E  1 104 ? -60.367 47.403  -48.480 1.00 167.99 ? 208 A   E "O4'" 1 
ATOM   8281  C  "C3'" . A   E  1 104 ? -59.447 45.359  -49.119 1.00 174.11 ? 208 A   E "C3'" 1 
ATOM   8282  O  "O3'" . A   E  1 104 ? -59.488 44.247  -49.987 1.00 173.69 ? 208 A   E "O3'" 1 
ATOM   8283  C  "C2'" . A   E  1 104 ? -58.488 46.444  -49.572 1.00 179.79 ? 208 A   E "C2'" 1 
ATOM   8284  O  "O2'" . A   E  1 104 ? -58.661 46.715  -50.956 1.00 185.39 ? 208 A   E "O2'" 1 
ATOM   8285  C  "C1'" . A   E  1 104 ? -59.009 47.644  -48.785 1.00 169.40 ? 208 A   E "C1'" 1 
ATOM   8286  N  N9    . A   E  1 104 ? -58.271 47.851  -47.528 1.00 167.23 ? 208 A   E N9    1 
ATOM   8287  C  C8    . A   E  1 104 ? -58.743 47.786  -46.242 1.00 164.30 ? 208 A   E C8    1 
ATOM   8288  N  N7    . A   E  1 104 ? -57.831 48.057  -45.342 1.00 163.52 ? 208 A   E N7    1 
ATOM   8289  C  C5    . A   E  1 104 ? -56.697 48.338  -46.087 1.00 166.11 ? 208 A   E C5    1 
ATOM   8290  C  C6    . A   E  1 104 ? -55.391 48.696  -45.733 1.00 167.23 ? 208 A   E C6    1 
ATOM   8291  N  N6    . A   E  1 104 ? -54.982 48.847  -44.476 1.00 167.75 ? 208 A   E N6    1 
ATOM   8292  N  N1    . A   E  1 104 ? -54.499 48.900  -46.719 1.00 170.34 ? 208 A   E N1    1 
ATOM   8293  C  C2    . A   E  1 104 ? -54.899 48.756  -47.982 1.00 172.19 ? 208 A   E C2    1 
ATOM   8294  N  N3    . A   E  1 104 ? -56.100 48.423  -48.437 1.00 171.50 ? 208 A   E N3    1 
ATOM   8295  C  C4    . A   E  1 104 ? -56.964 48.238  -47.430 1.00 168.39 ? 208 A   E C4    1 
ATOM   8296  P  P     . G   E  1 105 ? -58.784 42.884  -49.531 1.00 177.35 ? 209 G   E P     1 
ATOM   8297  O  OP1   . G   E  1 105 ? -58.870 41.913  -50.647 1.00 184.66 ? 209 G   E OP1   1 
ATOM   8298  O  OP2   . G   E  1 105 ? -59.307 42.535  -48.190 1.00 173.65 ? 209 G   E OP2   1 
ATOM   8299  O  "O5'" . G   E  1 105 ? -57.258 43.265  -49.323 1.00 168.21 ? 209 G   E "O5'" 1 
ATOM   8300  C  "C5'" . G   E  1 105 ? -56.376 43.351  -50.426 1.00 171.26 ? 209 G   E "C5'" 1 
ATOM   8301  C  "C4'" . G   E  1 105 ? -55.023 43.786  -49.958 1.00 171.10 ? 209 G   E "C4'" 1 
ATOM   8302  O  "O4'" . G   E  1 105 ? -55.184 44.990  -49.184 1.00 170.06 ? 209 G   E "O4'" 1 
ATOM   8303  C  "C3'" . G   E  1 105 ? -54.324 42.843  -48.994 1.00 178.49 ? 209 G   E "C3'" 1 
ATOM   8304  O  "O3'" . G   E  1 105 ? -53.685 41.737  -49.611 1.00 177.16 ? 209 G   E "O3'" 1 
ATOM   8305  C  "C2'" . G   E  1 105 ? -53.380 43.779  -48.263 1.00 168.60 ? 209 G   E "C2'" 1 
ATOM   8306  O  "O2'" . G   E  1 105 ? -52.286 44.141  -49.088 1.00 171.74 ? 209 G   E "O2'" 1 
ATOM   8307  C  "C1'" . G   E  1 105 ? -54.262 45.003  -48.119 1.00 168.50 ? 209 G   E "C1'" 1 
ATOM   8308  N  N9    . G   E  1 105 ? -55.019 45.005  -46.858 1.00 165.32 ? 209 G   E N9    1 
ATOM   8309  C  C8    . G   E  1 105 ? -56.362 44.756  -46.690 1.00 173.20 ? 209 G   E C8    1 
ATOM   8310  N  N7    . G   E  1 105 ? -56.753 44.870  -45.445 1.00 172.27 ? 209 G   E N7    1 
ATOM   8311  C  C5    . G   E  1 105 ? -55.599 45.226  -44.753 1.00 171.19 ? 209 G   E C5    1 
ATOM   8312  C  C6    . G   E  1 105 ? -55.387 45.487  -43.371 1.00 159.62 ? 209 G   E C6    1 
ATOM   8313  O  O6    . G   E  1 105 ? -56.209 45.465  -42.445 1.00 157.64 ? 209 G   E O6    1 
ATOM   8314  N  N1    . G   E  1 105 ? -54.052 45.810  -43.109 1.00 160.90 ? 209 G   E N1    1 
ATOM   8315  C  C2    . G   E  1 105 ? -53.047 45.876  -44.051 1.00 163.45 ? 209 G   E C2    1 
ATOM   8316  N  N2    . G   E  1 105 ? -51.818 46.202  -43.618 1.00 164.83 ? 209 G   E N2    1 
ATOM   8317  N  N3    . G   E  1 105 ? -53.237 45.635  -45.340 1.00 164.96 ? 209 G   E N3    1 
ATOM   8318  C  C4    . G   E  1 105 ? -54.523 45.321  -45.616 1.00 171.37 ? 209 G   E C4    1 
ATOM   8319  P  P     . G   E  1 106 ? -53.734 40.287  -48.912 1.00 171.73 ? 210 G   E P     1 
ATOM   8320  O  OP1   . G   E  1 106 ? -53.396 39.266  -49.932 1.00 178.73 ? 210 G   E OP1   1 
ATOM   8321  O  OP2   . G   E  1 106 ? -54.996 40.190  -48.141 1.00 166.00 ? 210 G   E OP2   1 
ATOM   8322  O  "O5'" . G   E  1 106 ? -52.548 40.296  -47.854 1.00 171.01 ? 210 G   E "O5'" 1 
ATOM   8323  C  "C5'" . G   E  1 106 ? -51.233 40.663  -48.232 1.00 173.26 ? 210 G   E "C5'" 1 
ATOM   8324  C  "C4'" . G   E  1 106 ? -50.505 41.262  -47.062 1.00 172.98 ? 210 G   E "C4'" 1 
ATOM   8325  O  "O4'" . G   E  1 106 ? -51.305 42.340  -46.523 1.00 174.90 ? 210 G   E "O4'" 1 
ATOM   8326  C  "C3'" . G   E  1 106 ? -50.276 40.341  -45.874 1.00 169.56 ? 210 G   E "C3'" 1 
ATOM   8327  O  "O3'" . G   E  1 106 ? -49.121 39.543  -46.039 1.00 172.37 ? 210 G   E "O3'" 1 
ATOM   8328  C  "C2'" . G   E  1 106 ? -50.175 41.308  -44.706 1.00 170.17 ? 210 G   E "C2'" 1 
ATOM   8329  O  "O2'" . G   E  1 106 ? -48.874 41.874  -44.650 1.00 168.61 ? 210 G   E "O2'" 1 
ATOM   8330  C  "C1'" . G   E  1 106 ? -51.166 42.396  -45.121 1.00 172.72 ? 210 G   E "C1'" 1 
ATOM   8331  N  N9    . G   E  1 106 ? -52.503 42.292  -44.486 1.00 170.13 ? 210 G   E N9    1 
ATOM   8332  C  C8    . G   E  1 106 ? -53.710 42.005  -45.091 1.00 170.23 ? 210 G   E C8    1 
ATOM   8333  N  N7    . G   E  1 106 ? -54.727 42.028  -44.266 1.00 167.78 ? 210 G   E N7    1 
ATOM   8334  C  C5    . G   E  1 106 ? -54.171 42.371  -43.043 1.00 163.22 ? 210 G   E C5    1 
ATOM   8335  C  C6    . G   E  1 106 ? -54.781 42.547  -41.772 1.00 158.12 ? 210 G   E C6    1 
ATOM   8336  O  O6    . G   E  1 106 ? -55.973 42.432  -41.457 1.00 154.90 ? 210 G   E O6    1 
ATOM   8337  N  N1    . G   E  1 106 ? -53.837 42.889  -40.804 1.00 156.13 ? 210 G   E N1    1 
ATOM   8338  C  C2    . G   E  1 106 ? -52.489 43.048  -41.027 1.00 158.41 ? 210 G   E C2    1 
ATOM   8339  N  N2    . G   E  1 106 ? -51.742 43.377  -39.962 1.00 158.08 ? 210 G   E N2    1 
ATOM   8340  N  N3    . G   E  1 106 ? -51.914 42.887  -42.206 1.00 162.61 ? 210 G   E N3    1 
ATOM   8341  C  C4    . G   E  1 106 ? -52.805 42.549  -43.164 1.00 164.81 ? 210 G   E C4    1 
ATOM   8342  P  P     . U   E  1 107 ? -49.055 38.074  -45.411 1.00 165.89 ? 211 U   E P     1 
ATOM   8343  O  OP1   . U   E  1 107 ? -47.703 37.543  -45.675 1.00 167.97 ? 211 U   E OP1   1 
ATOM   8344  O  OP2   . U   E  1 107 ? -50.287 37.352  -45.803 1.00 165.33 ? 211 U   E OP2   1 
ATOM   8345  O  "O5'" . U   E  1 107 ? -49.139 38.307  -43.846 1.00 163.54 ? 211 U   E "O5'" 1 
ATOM   8346  C  "C5'" . U   E  1 107 ? -48.091 38.946  -43.138 1.00 164.08 ? 211 U   E "C5'" 1 
ATOM   8347  C  "C4'" . U   E  1 107 ? -48.557 39.308  -41.756 1.00 162.00 ? 211 U   E "C4'" 1 
ATOM   8348  O  "O4'" . U   E  1 107 ? -49.787 40.060  -41.852 1.00 161.13 ? 211 U   E "O4'" 1 
ATOM   8349  C  "C3'" . U   E  1 107 ? -48.918 38.140  -40.857 1.00 172.82 ? 211 U   E "C3'" 1 
ATOM   8350  O  "O3'" . U   E  1 107 ? -47.784 37.538  -40.262 1.00 175.63 ? 211 U   E "O3'" 1 
ATOM   8351  C  "C2'" . U   E  1 107 ? -49.887 38.769  -39.861 1.00 158.53 ? 211 U   E "C2'" 1 
ATOM   8352  O  "O2'" . U   E  1 107 ? -49.169 39.510  -38.889 1.00 158.92 ? 211 U   E "O2'" 1 
ATOM   8353  C  "C1'" . U   E  1 107 ? -50.614 39.777  -40.745 1.00 158.48 ? 211 U   E "C1'" 1 
ATOM   8354  N  N1    . U   E  1 107 ? -51.950 39.363  -41.244 1.00 157.48 ? 211 U   E N1    1 
ATOM   8355  C  C2    . U   E  1 107 ? -53.020 39.472  -40.385 1.00 155.68 ? 211 U   E C2    1 
ATOM   8356  O  O2    . U   E  1 107 ? -52.888 39.809  -39.230 1.00 154.85 ? 211 U   E O2    1 
ATOM   8357  N  N3    . U   E  1 107 ? -54.242 39.147  -40.909 1.00 155.29 ? 211 U   E N3    1 
ATOM   8358  C  C4    . U   E  1 107 ? -54.514 38.752  -42.197 1.00 156.64 ? 211 U   E C4    1 
ATOM   8359  O  O4    . U   E  1 107 ? -55.679 38.499  -42.504 1.00 156.55 ? 211 U   E O4    1 
ATOM   8360  C  C5    . U   E  1 107 ? -53.366 38.683  -43.050 1.00 162.58 ? 211 U   E C5    1 
ATOM   8361  C  C6    . U   E  1 107 ? -52.158 39.000  -42.558 1.00 162.28 ? 211 U   E C6    1 
ATOM   8362  P  P     . C   E  1 108 ? -47.682 35.941  -40.098 1.00 161.95 ? 212 C   E P     1 
ATOM   8363  O  OP1   . C   E  1 108 ? -46.233 35.627  -40.088 1.00 164.07 ? 212 C   E OP1   1 
ATOM   8364  O  OP2   . C   E  1 108 ? -48.581 35.233  -41.044 1.00 161.92 ? 212 C   E OP2   1 
ATOM   8365  O  "O5'" . C   E  1 108 ? -48.252 35.702  -38.637 1.00 160.40 ? 212 C   E "O5'" 1 
ATOM   8366  C  "C5'" . C   E  1 108 ? -47.611 36.296  -37.523 1.00 160.58 ? 212 C   E "C5'" 1 
ATOM   8367  C  "C4'" . C   E  1 108 ? -48.485 36.267  -36.300 1.00 159.07 ? 212 C   E "C4'" 1 
ATOM   8368  O  "O4'" . C   E  1 108 ? -49.676 37.056  -36.520 1.00 157.36 ? 212 C   E "O4'" 1 
ATOM   8369  C  "C3'" . C   E  1 108 ? -49.011 34.906  -35.893 1.00 164.44 ? 212 C   E "C3'" 1 
ATOM   8370  O  "O3'" . C   E  1 108 ? -48.047 34.167  -35.164 1.00 167.85 ? 212 C   E "O3'" 1 
ATOM   8371  C  "C2'" . C   E  1 108 ? -50.261 35.255  -35.091 1.00 157.33 ? 212 C   E "C2'" 1 
ATOM   8372  O  "O2'" . C   E  1 108 ? -49.892 35.638  -33.778 1.00 157.59 ? 212 C   E "O2'" 1 
ATOM   8373  C  "C1'" . C   E  1 108 ? -50.763 36.505  -35.815 1.00 156.18 ? 212 C   E "C1'" 1 
ATOM   8374  N  N1    . C   E  1 108 ? -51.855 36.243  -36.784 1.00 155.49 ? 212 C   E N1    1 
ATOM   8375  C  C2    . C   E  1 108 ? -53.209 36.362  -36.424 1.00 154.23 ? 212 C   E C2    1 
ATOM   8376  O  O2    . C   E  1 108 ? -53.511 36.671  -35.271 1.00 153.55 ? 212 C   E O2    1 
ATOM   8377  N  N3    . C   E  1 108 ? -54.172 36.135  -37.351 1.00 154.14 ? 212 C   E N3    1 
ATOM   8378  C  C4    . C   E  1 108 ? -53.829 35.809  -38.592 1.00 155.27 ? 212 C   E C4    1 
ATOM   8379  N  N4    . C   E  1 108 ? -54.795 35.584  -39.481 1.00 155.66 ? 212 C   E N4    1 
ATOM   8380  C  C5    . C   E  1 108 ? -52.468 35.689  -38.989 1.00 156.47 ? 212 C   E C5    1 
ATOM   8381  C  C6    . C   E  1 108 ? -51.529 35.920  -38.068 1.00 156.51 ? 212 C   E C6    1 
ATOM   8382  P  P     . A   E  1 109 ? -47.696 32.647  -35.559 1.00 162.34 ? 213 A   E P     1 
ATOM   8383  O  OP1   . A   E  1 109 ? -46.227 32.472  -35.518 1.00 164.40 ? 213 A   E OP1   1 
ATOM   8384  O  OP2   . A   E  1 109 ? -48.503 32.205  -36.721 1.00 162.05 ? 213 A   E OP2   1 
ATOM   8385  O  "O5'" . A   E  1 109 ? -48.311 31.845  -34.355 1.00 162.54 ? 213 A   E "O5'" 1 
ATOM   8386  C  "C5'" . A   E  1 109 ? -48.888 32.557  -33.285 1.00 161.33 ? 213 A   E "C5'" 1 
ATOM   8387  C  "C4'" . A   E  1 109 ? -50.175 31.923  -32.885 1.00 160.90 ? 213 A   E "C4'" 1 
ATOM   8388  O  "O4'" . A   E  1 109 ? -51.217 32.303  -33.817 1.00 159.36 ? 213 A   E "O4'" 1 
ATOM   8389  C  "C3'" . A   E  1 109 ? -50.162 30.405  -32.917 1.00 173.99 ? 213 A   E "C3'" 1 
ATOM   8390  O  "O3'" . A   E  1 109 ? -49.618 29.876  -31.720 1.00 173.22 ? 213 A   E "O3'" 1 
ATOM   8391  C  "C2'" . A   E  1 109 ? -51.619 30.044  -33.167 1.00 173.19 ? 213 A   E "C2'" 1 
ATOM   8392  O  "O2'" . A   E  1 109 ? -52.324 29.958  -31.938 1.00 176.37 ? 213 A   E "O2'" 1 
ATOM   8393  C  "C1'" . A   E  1 109 ? -52.133 31.251  -33.955 1.00 165.06 ? 213 A   E "C1'" 1 
ATOM   8394  N  N9    . A   E  1 109 ? -52.302 30.964  -35.382 1.00 164.67 ? 213 A   E N9    1 
ATOM   8395  C  C8    . A   E  1 109 ? -51.655 31.519  -36.451 1.00 164.46 ? 213 A   E C8    1 
ATOM   8396  N  N7    . A   E  1 109 ? -52.098 31.057  -37.597 1.00 168.09 ? 213 A   E N7    1 
ATOM   8397  C  C5    . A   E  1 109 ? -53.115 30.170  -37.244 1.00 175.20 ? 213 A   E C5    1 
ATOM   8398  C  C6    . A   E  1 109 ? -53.983 29.337  -37.979 1.00 181.49 ? 213 A   E C6    1 
ATOM   8399  N  N6    . A   E  1 109 ? -53.985 29.268  -39.316 1.00 184.36 ? 213 A   E N6    1 
ATOM   8400  N  N1    . A   E  1 109 ? -54.886 28.593  -37.289 1.00 180.68 ? 213 A   E N1    1 
ATOM   8401  C  C2    . A   E  1 109 ? -54.904 28.642  -35.956 1.00 177.49 ? 213 A   E C2    1 
ATOM   8402  N  N3    . A   E  1 109 ? -54.135 29.380  -35.165 1.00 175.37 ? 213 A   E N3    1 
ATOM   8403  C  C4    . A   E  1 109 ? -53.259 30.121  -35.878 1.00 172.59 ? 213 A   E C4    1 
ATOM   8404  P  P     . A   E  1 110 ? -49.670 28.318  -31.344 1.00 167.69 ? 214 A   E P     1 
ATOM   8405  O  OP1   . A   E  1 110 ? -49.052 28.255  -30.000 1.00 169.18 ? 214 A   E OP1   1 
ATOM   8406  O  OP2   . A   E  1 110 ? -49.196 27.462  -32.462 1.00 169.19 ? 214 A   E OP2   1 
ATOM   8407  O  "O5'" . A   E  1 110 ? -51.223 28.028  -31.229 1.00 167.34 ? 214 A   E "O5'" 1 
ATOM   8408  C  "C5'" . A   E  1 110 ? -51.726 27.278  -30.155 1.00 173.52 ? 214 A   E "C5'" 1 
ATOM   8409  C  "C4'" . A   E  1 110 ? -52.103 28.226  -29.060 1.00 167.96 ? 214 A   E "C4'" 1 
ATOM   8410  O  "O4'" . A   E  1 110 ? -52.556 29.484  -29.617 1.00 164.80 ? 214 A   E "O4'" 1 
ATOM   8411  C  "C3'" . A   E  1 110 ? -53.226 27.805  -28.147 1.00 193.95 ? 214 A   E "C3'" 1 
ATOM   8412  O  "O3'" . A   E  1 110 ? -52.784 26.892  -27.177 1.00 190.36 ? 214 A   E "O3'" 1 
ATOM   8413  C  "C2'" . A   E  1 110 ? -53.712 29.127  -27.577 1.00 166.78 ? 214 A   E "C2'" 1 
ATOM   8414  O  "O2'" . A   E  1 110 ? -52.846 29.569  -26.548 1.00 182.77 ? 214 A   E "O2'" 1 
ATOM   8415  C  "C1'" . A   E  1 110 ? -53.543 30.053  -28.780 1.00 163.93 ? 214 A   E "C1'" 1 
ATOM   8416  N  N9    . A   E  1 110 ? -54.794 30.218  -29.542 1.00 162.62 ? 214 A   E N9    1 
ATOM   8417  C  C8    . A   E  1 110 ? -54.981 30.035  -30.885 1.00 162.15 ? 214 A   E C8    1 
ATOM   8418  N  N7    . A   E  1 110 ? -56.201 30.255  -31.301 1.00 161.40 ? 214 A   E N7    1 
ATOM   8419  C  C5    . A   E  1 110 ? -56.868 30.598  -30.145 1.00 161.25 ? 214 A   E C5    1 
ATOM   8420  C  C6    . A   E  1 110 ? -58.199 30.944  -29.927 1.00 160.79 ? 214 A   E C6    1 
ATOM   8421  N  N6    . A   E  1 110 ? -59.105 30.992  -30.907 1.00 160.44 ? 214 A   E N6    1 
ATOM   8422  N  N1    . A   E  1 110 ? -58.553 31.239  -28.659 1.00 161.06 ? 214 A   E N1    1 
ATOM   8423  C  C2    . A   E  1 110 ? -57.635 31.189  -27.687 1.00 161.88 ? 214 A   E C2    1 
ATOM   8424  N  N3    . A   E  1 110 ? -56.349 30.875  -27.785 1.00 162.47 ? 214 A   E N3    1 
ATOM   8425  C  C4    . A   E  1 110 ? -56.025 30.578  -29.052 1.00 162.04 ? 214 A   E C4    1 
ATOM   8426  P  P     . A   E  1 111 ? -53.669 25.608  -26.877 1.00 153.23 ? 215 A   E P     1 
ATOM   8427  O  OP1   . A   E  1 111 ? -54.615 26.063  -25.838 1.00 156.70 ? 215 A   E OP1   1 
ATOM   8428  O  OP2   . A   E  1 111 ? -52.824 24.395  -26.709 1.00 157.67 ? 215 A   E OP2   1 
ATOM   8429  O  "O5'" . A   E  1 111 ? -54.546 25.396  -28.172 1.00 142.59 ? 215 A   E "O5'" 1 
ATOM   8430  C  "C5'" . A   E  1 111 ? -55.746 24.676  -28.032 1.00 139.95 ? 215 A   E "C5'" 1 
ATOM   8431  C  "C4'" . A   E  1 111 ? -56.869 25.656  -27.868 1.00 144.06 ? 215 A   E "C4'" 1 
ATOM   8432  O  "O4'" . A   E  1 111 ? -56.599 26.816  -28.693 1.00 149.09 ? 215 A   E "O4'" 1 
ATOM   8433  C  "C3'" . A   E  1 111 ? -58.203 25.145  -28.348 1.00 145.97 ? 215 A   E "C3'" 1 
ATOM   8434  O  "O3'" . A   E  1 111 ? -58.891 24.470  -27.325 1.00 145.23 ? 215 A   E "O3'" 1 
ATOM   8435  C  "C2'" . A   E  1 111 ? -58.934 26.404  -28.781 1.00 148.76 ? 215 A   E "C2'" 1 
ATOM   8436  O  "O2'" . A   E  1 111 ? -59.538 27.032  -27.666 1.00 149.45 ? 215 A   E "O2'" 1 
ATOM   8437  C  "C1'" . A   E  1 111 ? -57.792 27.281  -29.281 1.00 152.45 ? 215 A   E "C1'" 1 
ATOM   8438  N  N9    . A   E  1 111 ? -57.621 27.210  -30.743 1.00 160.14 ? 215 A   E N9    1 
ATOM   8439  C  C8    . A   E  1 111 ? -56.405 27.240  -31.374 1.00 165.60 ? 215 A   E C8    1 
ATOM   8440  N  N7    . A   E  1 111 ? -56.470 27.194  -32.679 1.00 166.76 ? 215 A   E N7    1 
ATOM   8441  C  C5    . A   E  1 111 ? -57.829 27.146  -32.929 1.00 164.03 ? 215 A   E C5    1 
ATOM   8442  C  C6    . A   E  1 111 ? -58.535 27.084  -34.134 1.00 165.53 ? 215 A   E C6    1 
ATOM   8443  N  N6    . A   E  1 111 ? -57.937 27.062  -35.325 1.00 171.53 ? 215 A   E N6    1 
ATOM   8444  N  N1    . A   E  1 111 ? -59.878 27.049  -34.068 1.00 162.07 ? 215 A   E N1    1 
ATOM   8445  C  C2    . A   E  1 111 ? -60.455 27.075  -32.863 1.00 161.26 ? 215 A   E C2    1 
ATOM   8446  N  N3    . A   E  1 111 ? -59.899 27.134  -31.656 1.00 160.44 ? 215 A   E N3    1 
ATOM   8447  C  C4    . A   E  1 111 ? -58.561 27.183  -31.754 1.00 161.18 ? 215 A   E C4    1 
ATOM   8448  P  P     . A   E  1 112 ? -59.698 23.154  -27.691 1.00 144.29 ? 216 A   E P     1 
ATOM   8449  O  OP1   . A   E  1 112 ? -60.868 23.082  -26.783 1.00 146.68 ? 216 A   E OP1   1 
ATOM   8450  O  OP2   . A   E  1 112 ? -58.678 22.075  -27.725 1.00 138.27 ? 216 A   E OP2   1 
ATOM   8451  O  "O5'" . A   E  1 112 ? -60.219 23.448  -29.171 1.00 150.86 ? 216 A   E "O5'" 1 
ATOM   8452  C  "C5'" . A   E  1 112 ? -61.445 24.119  -29.465 1.00 154.90 ? 216 A   E "C5'" 1 
ATOM   8453  C  "C4'" . A   E  1 112 ? -61.979 23.652  -30.800 1.00 156.34 ? 216 A   E "C4'" 1 
ATOM   8454  O  "O4'" . A   E  1 112 ? -61.121 24.182  -31.858 1.00 156.86 ? 216 A   E "O4'" 1 
ATOM   8455  C  "C3'" . A   E  1 112 ? -61.972 22.129  -30.956 1.00 157.65 ? 216 A   E "C3'" 1 
ATOM   8456  O  "O3'" . A   E  1 112 ? -63.090 21.629  -31.698 1.00 157.59 ? 216 A   E "O3'" 1 
ATOM   8457  C  "C2'" . A   E  1 112 ? -60.682 21.873  -31.723 1.00 162.67 ? 216 A   E "C2'" 1 
ATOM   8458  O  "O2'" . A   E  1 112 ? -60.667 20.685  -32.474 1.00 170.56 ? 216 A   E "O2'" 1 
ATOM   8459  C  "C1'" . A   E  1 112 ? -60.557 23.119  -32.604 1.00 157.72 ? 216 A   E "C1'" 1 
ATOM   8460  N  N9    . A   E  1 112 ? -59.145 23.395  -32.888 1.00 155.39 ? 216 A   E N9    1 
ATOM   8461  C  C8    . A   E  1 112 ? -58.190 23.788  -31.985 1.00 155.37 ? 216 A   E C8    1 
ATOM   8462  N  N7    . A   E  1 112 ? -56.982 23.881  -32.482 1.00 154.02 ? 216 A   E N7    1 
ATOM   8463  C  C5    . A   E  1 112 ? -57.142 23.493  -33.794 1.00 152.41 ? 216 A   E C5    1 
ATOM   8464  C  C6    . A   E  1 112 ? -56.225 23.382  -34.839 1.00 151.07 ? 216 A   E C6    1 
ATOM   8465  N  N6    . A   E  1 112 ? -54.927 23.664  -34.721 1.00 150.67 ? 216 A   E N6    1 
ATOM   8466  N  N1    . A   E  1 112 ? -56.704 22.966  -36.024 1.00 150.74 ? 216 A   E N1    1 
ATOM   8467  C  C2    . A   E  1 112 ? -58.007 22.686  -36.134 1.00 150.90 ? 216 A   E C2    1 
ATOM   8468  N  N3    . A   E  1 112 ? -58.967 22.757  -35.222 1.00 151.32 ? 216 A   E N3    1 
ATOM   8469  C  C4    . A   E  1 112 ? -58.460 23.175  -34.059 1.00 152.84 ? 216 A   E C4    1 
ATOM   8470  P  P     . C   E  1 113 ? -63.388 20.038  -31.697 1.00 147.35 ? 217 C   E P     1 
ATOM   8471  O  OP1   . C   E  1 113 ? -64.854 19.879  -31.515 1.00 146.95 ? 217 C   E OP1   1 
ATOM   8472  O  OP2   . C   E  1 113 ? -62.459 19.391  -30.735 1.00 142.20 ? 217 C   E OP2   1 
ATOM   8473  O  "O5'" . C   E  1 113 ? -62.957 19.547  -33.160 1.00 149.88 ? 217 C   E "O5'" 1 
ATOM   8474  C  "C5'" . C   E  1 113 ? -62.179 18.366  -33.374 1.00 146.69 ? 217 C   E "C5'" 1 
ATOM   8475  C  "C4'" . C   E  1 113 ? -61.534 18.362  -34.748 1.00 145.74 ? 217 C   E "C4'" 1 
ATOM   8476  O  "O4'" . C   E  1 113 ? -60.587 19.455  -34.878 1.00 144.71 ? 217 C   E "O4'" 1 
ATOM   8477  C  "C3'" . C   E  1 113 ? -60.719 17.134  -35.120 1.00 143.28 ? 217 C   E "C3'" 1 
ATOM   8478  O  "O3'" . C   E  1 113 ? -61.512 16.037  -35.533 1.00 143.49 ? 217 C   E "O3'" 1 
ATOM   8479  C  "C2'" . C   E  1 113 ? -59.779 17.653  -36.205 1.00 142.36 ? 217 C   E "C2'" 1 
ATOM   8480  O  "O2'" . C   E  1 113 ? -60.441 17.712  -37.457 1.00 146.49 ? 217 C   E "O2'" 1 
ATOM   8481  C  "C1'" . C   E  1 113 ? -59.527 19.081  -35.740 1.00 141.62 ? 217 C   E "C1'" 1 
ATOM   8482  N  N1    . C   E  1 113 ? -58.260 19.260  -35.007 1.00 134.99 ? 217 C   E N1    1 
ATOM   8483  C  C2    . C   E  1 113 ? -56.967 19.068  -35.507 1.00 132.75 ? 217 C   E C2    1 
ATOM   8484  O  O2    . C   E  1 113 ? -56.727 18.639  -36.642 1.00 135.38 ? 217 C   E O2    1 
ATOM   8485  N  N3    . C   E  1 113 ? -55.943 19.332  -34.659 1.00 131.13 ? 217 C   E N3    1 
ATOM   8486  C  C4    . C   E  1 113 ? -56.154 19.776  -33.424 1.00 130.58 ? 217 C   E C4    1 
ATOM   8487  N  N4    . C   E  1 113 ? -55.142 20.040  -32.604 1.00 133.40 ? 217 C   E N4    1 
ATOM   8488  C  C5    . C   E  1 113 ? -57.447 20.001  -32.920 1.00 130.91 ? 217 C   E C5    1 
ATOM   8489  C  C6    . C   E  1 113 ? -58.432 19.733  -33.754 1.00 132.30 ? 217 C   E C6    1 
ATOM   8490  P  P     . U   E  1 114 ? -61.450 14.669  -34.705 1.00 131.83 ? 218 U   E P     1 
ATOM   8491  O  OP1   . U   E  1 114 ? -62.466 13.759  -35.287 1.00 136.41 ? 218 U   E OP1   1 
ATOM   8492  O  OP2   . U   E  1 114 ? -61.450 14.989  -33.261 1.00 126.49 ? 218 U   E OP2   1 
ATOM   8493  O  "O5'" . U   E  1 114 ? -59.998 14.116  -35.023 1.00 129.68 ? 218 U   E "O5'" 1 
ATOM   8494  C  "C5'" . U   E  1 114 ? -59.571 13.979  -36.364 1.00 133.48 ? 218 U   E "C5'" 1 
ATOM   8495  C  "C4'" . U   E  1 114 ? -58.074 13.944  -36.459 1.00 130.77 ? 218 U   E "C4'" 1 
ATOM   8496  O  "O4'" . U   E  1 114 ? -57.516 15.216  -36.067 1.00 129.95 ? 218 U   E "O4'" 1 
ATOM   8497  C  "C3'" . U   E  1 114 ? -57.365 12.959  -35.555 1.00 133.64 ? 218 U   E "C3'" 1 
ATOM   8498  O  "O3'" . U   E  1 114 ? -57.449 11.625  -36.018 1.00 137.28 ? 218 U   E "O3'" 1 
ATOM   8499  C  "C2'" . U   E  1 114 ? -55.953 13.522  -35.521 1.00 133.53 ? 218 U   E "C2'" 1 
ATOM   8500  O  "O2'" . U   E  1 114 ? -55.274 13.251  -36.735 1.00 136.16 ? 218 U   E "O2'" 1 
ATOM   8501  C  "C1'" . U   E  1 114 ? -56.241 15.017  -35.492 1.00 131.20 ? 218 U   E "C1'" 1 
ATOM   8502  N  N1    . U   E  1 114 ? -56.223 15.597  -34.137 1.00 131.78 ? 218 U   E N1    1 
ATOM   8503  C  C2    . U   E  1 114 ? -54.988 15.897  -33.600 1.00 133.15 ? 218 U   E C2    1 
ATOM   8504  O  O2    . U   E  1 114 ? -53.949 15.669  -34.184 1.00 132.75 ? 218 U   E O2    1 
ATOM   8505  N  N3    . U   E  1 114 ? -55.015 16.466  -32.355 1.00 134.09 ? 218 U   E N3    1 
ATOM   8506  C  C4    . U   E  1 114 ? -56.149 16.759  -31.625 1.00 139.03 ? 218 U   E C4    1 
ATOM   8507  O  O4    . U   E  1 114 ? -56.036 17.263  -30.514 1.00 140.12 ? 218 U   E O4    1 
ATOM   8508  C  C5    . U   E  1 114 ? -57.390 16.425  -32.256 1.00 140.17 ? 218 U   E C5    1 
ATOM   8509  C  C6    . U   E  1 114 ? -57.388 15.868  -33.469 1.00 135.69 ? 218 U   E C6    1 
ATOM   8510  P  P     . C   E  1 115 ? -57.569 10.419  -34.969 1.00 135.17 ? 219 C   E P     1 
ATOM   8511  O  OP1   . C   E  1 115 ? -58.299 9.343   -35.680 1.00 137.84 ? 219 C   E OP1   1 
ATOM   8512  O  OP2   . C   E  1 115 ? -58.046 10.910  -33.656 1.00 132.05 ? 219 C   E OP2   1 
ATOM   8513  O  "O5'" . C   E  1 115 ? -56.059 9.980   -34.745 1.00 134.09 ? 219 C   E "O5'" 1 
ATOM   8514  C  "C5'" . C   E  1 115 ? -55.209 9.745   -35.853 1.00 136.66 ? 219 C   E "C5'" 1 
ATOM   8515  C  "C4'" . C   E  1 115 ? -53.761 9.791   -35.451 1.00 135.51 ? 219 C   E "C4'" 1 
ATOM   8516  O  "O4'" . C   E  1 115 ? -53.348 11.157  -35.192 1.00 133.56 ? 219 C   E "O4'" 1 
ATOM   8517  C  "C3'" . C   E  1 115 ? -53.393 9.046   -34.177 1.00 137.02 ? 219 C   E "C3'" 1 
ATOM   8518  O  "O3'" . C   E  1 115 ? -53.290 7.638   -34.351 1.00 137.79 ? 219 C   E "O3'" 1 
ATOM   8519  C  "C2'" . C   E  1 115 ? -52.089 9.726   -33.773 1.00 137.32 ? 219 C   E "C2'" 1 
ATOM   8520  O  "O2'" . C   E  1 115 ? -50.999 9.241   -34.547 1.00 143.67 ? 219 C   E "O2'" 1 
ATOM   8521  C  "C1'" . C   E  1 115 ? -52.373 11.178  -34.172 1.00 130.27 ? 219 C   E "C1'" 1 
ATOM   8522  N  N1    . C   E  1 115 ? -52.903 11.963  -33.041 1.00 124.15 ? 219 C   E N1    1 
ATOM   8523  C  C2    . C   E  1 115 ? -52.016 12.547  -32.129 1.00 120.93 ? 219 C   E C2    1 
ATOM   8524  O  O2    . C   E  1 115 ? -50.789 12.426  -32.281 1.00 119.52 ? 219 C   E O2    1 
ATOM   8525  N  N3    . C   E  1 115 ? -52.526 13.246  -31.094 1.00 121.52 ? 219 C   E N3    1 
ATOM   8526  C  C4    . C   E  1 115 ? -53.847 13.362  -30.959 1.00 121.90 ? 219 C   E C4    1 
ATOM   8527  N  N4    . C   E  1 115 ? -54.298 14.062  -29.923 1.00 121.15 ? 219 C   E N4    1 
ATOM   8528  C  C5    . C   E  1 115 ? -54.769 12.773  -31.867 1.00 122.91 ? 219 C   E C5    1 
ATOM   8529  C  C6    . C   E  1 115 ? -54.253 12.083  -32.884 1.00 123.51 ? 219 C   E C6    1 
ATOM   8530  P  P     . C   E  1 116 ? -53.681 6.621   -33.164 1.00 131.93 ? 220 C   E P     1 
ATOM   8531  O  OP1   . C   E  1 116 ? -52.826 5.427   -33.342 1.00 134.89 ? 220 C   E OP1   1 
ATOM   8532  O  OP2   . C   E  1 116 ? -55.161 6.478   -33.127 1.00 127.80 ? 220 C   E OP2   1 
ATOM   8533  O  "O5'" . C   E  1 116 ? -53.231 7.363   -31.828 1.00 126.48 ? 220 C   E "O5'" 1 
ATOM   8534  C  "C5'" . C   E  1 116 ? -52.486 6.697   -30.821 1.00 122.80 ? 220 C   E "C5'" 1 
ATOM   8535  C  "C4'" . C   E  1 116 ? -51.108 7.288   -30.673 1.00 122.66 ? 220 C   E "C4'" 1 
ATOM   8536  O  "O4'" . C   E  1 116 ? -51.165 8.712   -30.954 1.00 127.58 ? 220 C   E "O4'" 1 
ATOM   8537  C  "C3'" . C   E  1 116 ? -50.527 7.219   -29.270 1.00 122.02 ? 220 C   E "C3'" 1 
ATOM   8538  O  "O3'" . C   E  1 116 ? -49.978 5.967   -28.923 1.00 123.97 ? 220 C   E "O3'" 1 
ATOM   8539  C  "C2'" . C   E  1 116 ? -49.547 8.383   -29.257 1.00 122.03 ? 220 C   E "C2'" 1 
ATOM   8540  O  "O2'" . C   E  1 116 ? -48.374 8.075   -30.001 1.00 116.69 ? 220 C   E "O2'" 1 
ATOM   8541  C  "C1'" . C   E  1 116 ? -50.344 9.421   -30.041 1.00 128.43 ? 220 C   E "C1'" 1 
ATOM   8542  N  N1    . C   E  1 116 ? -51.242 10.240  -29.172 1.00 130.28 ? 220 C   E N1    1 
ATOM   8543  C  C2    . C   E  1 116 ? -50.763 11.085  -28.156 1.00 131.02 ? 220 C   E C2    1 
ATOM   8544  O  O2    . C   E  1 116 ? -49.547 11.139  -27.929 1.00 130.77 ? 220 C   E O2    1 
ATOM   8545  N  N3    . C   E  1 116 ? -51.645 11.810  -27.413 1.00 130.44 ? 220 C   E N3    1 
ATOM   8546  C  C4    . C   E  1 116 ? -52.958 11.749  -27.642 1.00 126.78 ? 220 C   E C4    1 
ATOM   8547  N  N4    . C   E  1 116 ? -53.781 12.479  -26.887 1.00 122.95 ? 220 C   E N4    1 
ATOM   8548  C  C5    . C   E  1 116 ? -53.479 10.924  -28.671 1.00 128.70 ? 220 C   E C5    1 
ATOM   8549  C  C6    . C   E  1 116 ? -52.599 10.212  -29.392 1.00 130.87 ? 220 C   E C6    1 
ATOM   8550  P  P     . C   E  1 117 ? -50.345 5.325   -27.502 1.00 122.21 ? 221 C   E P     1 
ATOM   8551  O  OP1   . C   E  1 117 ? -49.983 3.911   -27.560 1.00 125.05 ? 221 C   E OP1   1 
ATOM   8552  O  OP2   . C   E  1 117 ? -51.736 5.664   -27.127 1.00 124.43 ? 221 C   E OP2   1 
ATOM   8553  O  "O5'" . C   E  1 117 ? -49.342 6.038   -26.499 1.00 123.83 ? 221 C   E "O5'" 1 
ATOM   8554  C  "C5'" . C   E  1 117 ? -47.960 6.133   -26.809 1.00 126.53 ? 221 C   E "C5'" 1 
ATOM   8555  C  "C4'" . C   E  1 117 ? -47.218 6.951   -25.783 1.00 125.72 ? 221 C   E "C4'" 1 
ATOM   8556  O  "O4'" . C   E  1 117 ? -47.464 8.374   -25.974 1.00 124.89 ? 221 C   E "O4'" 1 
ATOM   8557  C  "C3'" . C   E  1 117 ? -47.614 6.716   -24.335 1.00 121.70 ? 221 C   E "C3'" 1 
ATOM   8558  O  "O3'" . C   E  1 117 ? -47.086 5.542   -23.755 1.00 118.85 ? 221 C   E "O3'" 1 
ATOM   8559  C  "C2'" . C   E  1 117 ? -47.112 7.976   -23.669 1.00 121.94 ? 221 C   E "C2'" 1 
ATOM   8560  O  "O2'" . C   E  1 117 ? -45.697 7.936   -23.563 1.00 121.80 ? 221 C   E "O2'" 1 
ATOM   8561  C  "C1'" . C   E  1 117 ? -47.490 9.021   -24.714 1.00 122.32 ? 221 C   E "C1'" 1 
ATOM   8562  N  N1    . C   E  1 117 ? -48.867 9.522   -24.480 1.00 119.69 ? 221 C   E N1    1 
ATOM   8563  C  C2    . C   E  1 117 ? -49.177 10.208  -23.304 1.00 121.64 ? 221 C   E C2    1 
ATOM   8564  O  O2    . C   E  1 117 ? -48.315 10.374  -22.437 1.00 123.24 ? 221 C   E O2    1 
ATOM   8565  N  N3    . C   E  1 117 ? -50.439 10.643  -23.098 1.00 120.98 ? 221 C   E N3    1 
ATOM   8566  C  C4    . C   E  1 117 ? -51.372 10.463  -24.024 1.00 117.88 ? 221 C   E C4    1 
ATOM   8567  N  N4    . C   E  1 117 ? -52.598 10.915  -23.774 1.00 123.17 ? 221 C   E N4    1 
ATOM   8568  C  C5    . C   E  1 117 ? -51.092 9.793   -25.238 1.00 116.80 ? 221 C   E C5    1 
ATOM   8569  C  C6    . C   E  1 117 ? -49.842 9.360   -25.425 1.00 117.27 ? 221 C   E C6    1 
ATOM   8570  P  P     . G   E  1 118 ? -48.005 4.661   -22.777 1.00 117.61 ? 222 G   E P     1 
ATOM   8571  O  OP1   . G   E  1 118 ? -47.120 3.619   -22.216 1.00 117.43 ? 222 G   E OP1   1 
ATOM   8572  O  OP2   . G   E  1 118 ? -49.254 4.305   -23.499 1.00 112.51 ? 222 G   E OP2   1 
ATOM   8573  O  "O5'" . G   E  1 118 ? -48.415 5.642   -21.590 1.00 115.67 ? 222 G   E "O5'" 1 
ATOM   8574  C  "C5'" . G   E  1 118 ? -47.457 6.186   -20.698 1.00 118.67 ? 222 G   E "C5'" 1 
ATOM   8575  C  "C4'" . G   E  1 118 ? -48.129 7.065   -19.675 1.00 117.35 ? 222 G   E "C4'" 1 
ATOM   8576  O  "O4'" . G   E  1 118 ? -48.745 8.198   -20.330 1.00 116.59 ? 222 G   E "O4'" 1 
ATOM   8577  C  "C3'" . G   E  1 118 ? -49.275 6.432   -18.913 1.00 114.36 ? 222 G   E "C3'" 1 
ATOM   8578  O  "O3'" . G   E  1 118 ? -48.842 5.627   -17.844 1.00 115.38 ? 222 G   E "O3'" 1 
ATOM   8579  C  "C2'" . G   E  1 118 ? -50.086 7.633   -18.466 1.00 115.19 ? 222 G   E "C2'" 1 
ATOM   8580  O  "O2'" . G   E  1 118 ? -49.434 8.268   -17.384 1.00 116.24 ? 222 G   E "O2'" 1 
ATOM   8581  C  "C1'" . G   E  1 118 ? -49.947 8.544   -19.671 1.00 117.47 ? 222 G   E "C1'" 1 
ATOM   8582  N  N9    . G   E  1 118 ? -51.062 8.434   -20.628 1.00 121.87 ? 222 G   E N9    1 
ATOM   8583  C  C8    . G   E  1 118 ? -50.931 8.064   -21.939 1.00 125.87 ? 222 G   E C8    1 
ATOM   8584  N  N7    . G   E  1 118 ? -52.050 8.078   -22.605 1.00 128.20 ? 222 G   E N7    1 
ATOM   8585  C  C5    . G   E  1 118 ? -52.988 8.476   -21.677 1.00 126.56 ? 222 G   E C5    1 
ATOM   8586  C  C6    . G   E  1 118 ? -54.383 8.649   -21.836 1.00 126.34 ? 222 G   E C6    1 
ATOM   8587  O  O6    . G   E  1 118 ? -55.088 8.486   -22.842 1.00 126.31 ? 222 G   E O6    1 
ATOM   8588  N  N1    . G   E  1 118 ? -54.953 9.054   -20.646 1.00 124.68 ? 222 G   E N1    1 
ATOM   8589  C  C2    . G   E  1 118 ? -54.284 9.258   -19.473 1.00 122.62 ? 222 G   E C2    1 
ATOM   8590  N  N2    . G   E  1 118 ? -55.068 9.647   -18.463 1.00 122.33 ? 222 G   E N2    1 
ATOM   8591  N  N3    . G   E  1 118 ? -52.981 9.094   -19.307 1.00 121.36 ? 222 G   E N3    1 
ATOM   8592  C  C4    . G   E  1 118 ? -52.396 8.706   -20.449 1.00 122.94 ? 222 G   E C4    1 
ATOM   8593  P  P     . U   E  1 119 ? -49.489 4.181   -17.664 1.00 117.28 ? 223 U   E P     1 
ATOM   8594  O  OP1   . U   E  1 119 ? -48.745 3.479   -16.596 1.00 120.16 ? 223 U   E OP1   1 
ATOM   8595  O  OP2   . U   E  1 119 ? -49.655 3.625   -19.029 1.00 116.69 ? 223 U   E OP2   1 
ATOM   8596  O  "O5'" . U   E  1 119 ? -50.949 4.487   -17.147 1.00 113.17 ? 223 U   E "O5'" 1 
ATOM   8597  C  "C5'" . U   E  1 119 ? -51.123 5.206   -15.953 1.00 110.27 ? 223 U   E "C5'" 1 
ATOM   8598  C  "C4'" . U   E  1 119 ? -52.519 5.718   -15.887 1.00 106.85 ? 223 U   E "C4'" 1 
ATOM   8599  O  "O4'" . U   E  1 119 ? -52.789 6.521   -17.057 1.00 108.34 ? 223 U   E "O4'" 1 
ATOM   8600  C  "C3'" . U   E  1 119 ? -53.602 4.671   -15.937 1.00 113.35 ? 223 U   E "C3'" 1 
ATOM   8601  O  "O3'" . U   E  1 119 ? -53.760 3.991   -14.710 1.00 122.77 ? 223 U   E "O3'" 1 
ATOM   8602  C  "C2'" . U   E  1 119 ? -54.804 5.492   -16.370 1.00 109.50 ? 223 U   E "C2'" 1 
ATOM   8603  O  "O2'" . U   E  1 119 ? -55.258 6.293   -15.293 1.00 105.80 ? 223 U   E "O2'" 1 
ATOM   8604  C  "C1'" . U   E  1 119 ? -54.159 6.438   -17.374 1.00 112.49 ? 223 U   E "C1'" 1 
ATOM   8605  N  N1    . U   E  1 119 ? -54.296 5.990   -18.769 1.00 125.30 ? 223 U   E N1    1 
ATOM   8606  C  C2    . U   E  1 119 ? -55.547 6.042   -19.349 1.00 133.97 ? 223 U   E C2    1 
ATOM   8607  O  O2    . U   E  1 119 ? -56.543 6.391   -18.746 1.00 134.54 ? 223 U   E O2    1 
ATOM   8608  N  N3    . U   E  1 119 ? -55.600 5.639   -20.659 1.00 138.34 ? 223 U   E N3    1 
ATOM   8609  C  C4    . U   E  1 119 ? -54.534 5.220   -21.435 1.00 145.39 ? 223 U   E C4    1 
ATOM   8610  O  O4    . U   E  1 119 ? -54.730 4.887   -22.608 1.00 149.06 ? 223 U   E O4    1 
ATOM   8611  C  C5    . U   E  1 119 ? -53.264 5.213   -20.763 1.00 145.25 ? 223 U   E C5    1 
ATOM   8612  C  C6    . U   E  1 119 ? -53.188 5.601   -19.483 1.00 135.42 ? 223 U   E C6    1 
ATOM   8613  P  P     . G   E  1 120 ? -53.747 2.390   -14.662 1.00 107.39 ? 224 G   E P     1 
ATOM   8614  O  OP1   . G   E  1 120 ? -53.361 2.019   -13.284 1.00 107.77 ? 224 G   E OP1   1 
ATOM   8615  O  OP2   . G   E  1 120 ? -53.015 1.825   -15.808 1.00 108.15 ? 224 G   E OP2   1 
ATOM   8616  O  "O5'" . G   E  1 120 ? -55.270 2.040   -14.855 1.00 107.02 ? 224 G   E "O5'" 1 
ATOM   8617  C  "C5'" . G   E  1 120 ? -56.150 2.394   -13.823 1.00 106.46 ? 224 G   E "C5'" 1 
ATOM   8618  C  "C4'" . G   E  1 120 ? -57.501 2.705   -14.355 1.00 105.99 ? 224 G   E "C4'" 1 
ATOM   8619  O  "O4'" . G   E  1 120 ? -57.404 3.634   -15.444 1.00 105.85 ? 224 G   E "O4'" 1 
ATOM   8620  C  "C3'" . G   E  1 120 ? -58.252 1.558   -14.959 1.00 120.65 ? 224 G   E "C3'" 1 
ATOM   8621  O  "O3'" . G   E  1 120 ? -58.761 0.699   -13.980 1.00 118.57 ? 224 G   E "O3'" 1 
ATOM   8622  C  "C2'" . G   E  1 120 ? -59.314 2.276   -15.784 1.00 106.17 ? 224 G   E "C2'" 1 
ATOM   8623  O  "O2'" . G   E  1 120 ? -60.361 2.753   -14.956 1.00 105.65 ? 224 G   E "O2'" 1 
ATOM   8624  C  "C1'" . G   E  1 120 ? -58.530 3.487   -16.278 1.00 105.94 ? 224 G   E "C1'" 1 
ATOM   8625  N  N9    . G   E  1 120 ? -58.076 3.357   -17.665 1.00 106.52 ? 224 G   E N9    1 
ATOM   8626  C  C8    . G   E  1 120 ? -56.790 3.166   -18.082 1.00 113.27 ? 224 G   E C8    1 
ATOM   8627  N  N7    . G   E  1 120 ? -56.681 3.112   -19.382 1.00 115.70 ? 224 G   E N7    1 
ATOM   8628  C  C5    . G   E  1 120 ? -57.970 3.298   -19.837 1.00 107.63 ? 224 G   E C5    1 
ATOM   8629  C  C6    . G   E  1 120 ? -58.454 3.330   -21.157 1.00 112.38 ? 224 G   E C6    1 
ATOM   8630  O  O6    . G   E  1 120 ? -57.818 3.203   -22.212 1.00 117.50 ? 224 G   E O6    1 
ATOM   8631  N  N1    . G   E  1 120 ? -59.830 3.543   -21.166 1.00 110.35 ? 224 G   E N1    1 
ATOM   8632  C  C2    . G   E  1 120 ? -60.629 3.695   -20.054 1.00 107.66 ? 224 G   E C2    1 
ATOM   8633  N  N2    . G   E  1 120 ? -61.942 3.893   -20.263 1.00 107.91 ? 224 G   E N2    1 
ATOM   8634  N  N3    . G   E  1 120 ? -60.171 3.656   -18.816 1.00 106.89 ? 224 G   E N3    1 
ATOM   8635  C  C4    . G   E  1 120 ? -58.844 3.457   -18.790 1.00 106.95 ? 224 G   E C4    1 
ATOM   8636  P  P     . C   E  1 121 ? -58.663 -0.871  -14.191 1.00 107.89 ? 225 C   E P     1 
ATOM   8637  O  OP1   . C   E  1 121 ? -58.964 -1.409  -12.846 1.00 108.05 ? 225 C   E OP1   1 
ATOM   8638  O  OP2   . C   E  1 121 ? -57.396 -1.225  -14.867 1.00 108.68 ? 225 C   E OP2   1 
ATOM   8639  O  "O5'" . C   E  1 121 ? -59.824 -1.152  -15.222 1.00 108.14 ? 225 C   E "O5'" 1 
ATOM   8640  C  "C5'" . C   E  1 121 ? -61.167 -1.040  -14.812 1.00 107.72 ? 225 C   E "C5'" 1 
ATOM   8641  C  "C4'" . C   E  1 121 ? -62.017 -0.734  -15.995 1.00 107.86 ? 225 C   E "C4'" 1 
ATOM   8642  O  "O4'" . C   E  1 121 ? -61.256 0.093   -16.888 1.00 107.69 ? 225 C   E "O4'" 1 
ATOM   8643  C  "C3'" . C   E  1 121 ? -62.401 -1.915  -16.855 1.00 121.31 ? 225 C   E "C3'" 1 
ATOM   8644  O  "O3'" . C   E  1 121 ? -63.495 -2.632  -16.308 1.00 118.26 ? 225 C   E "O3'" 1 
ATOM   8645  C  "C2'" . C   E  1 121 ? -62.689 -1.264  -18.206 1.00 118.27 ? 225 C   E "C2'" 1 
ATOM   8646  O  "O2'" . C   E  1 121 ? -63.996 -0.730  -18.262 1.00 119.80 ? 225 C   E "O2'" 1 
ATOM   8647  C  "C1'" . C   E  1 121 ? -61.721 -0.086  -18.198 1.00 115.35 ? 225 C   E "C1'" 1 
ATOM   8648  N  N1    . C   E  1 121 ? -60.603 -0.140  -19.161 1.00 118.32 ? 225 C   E N1    1 
ATOM   8649  C  C2    . C   E  1 121 ? -60.950 0.034   -20.502 1.00 122.52 ? 225 C   E C2    1 
ATOM   8650  O  O2    . C   E  1 121 ? -62.149 0.145   -20.794 1.00 119.77 ? 225 C   E O2    1 
ATOM   8651  N  N3    . C   E  1 121 ? -59.981 0.061   -21.438 1.00 127.27 ? 225 C   E N3    1 
ATOM   8652  C  C4    . C   E  1 121 ? -58.708 -0.050  -21.069 1.00 132.26 ? 225 C   E C4    1 
ATOM   8653  N  N4    . C   E  1 121 ? -57.784 -0.021  -22.036 1.00 141.49 ? 225 C   E N4    1 
ATOM   8654  C  C5    . C   E  1 121 ? -58.323 -0.209  -19.701 1.00 126.31 ? 225 C   E C5    1 
ATOM   8655  C  C6    . C   E  1 121 ? -59.295 -0.234  -18.777 1.00 121.08 ? 225 C   E C6    1 
ATOM   8656  P  P     . U   E  1 122 ? -63.550 -4.227  -16.396 1.00 115.92 ? 226 U   E P     1 
ATOM   8657  O  OP1   . U   E  1 122 ? -64.909 -4.572  -16.873 1.00 117.50 ? 226 U   E OP1   1 
ATOM   8658  O  OP2   . U   E  1 122 ? -62.997 -4.758  -15.136 1.00 116.10 ? 226 U   E OP2   1 
ATOM   8659  O  "O5'" . U   E  1 122 ? -62.508 -4.601  -17.528 1.00 115.35 ? 226 U   E "O5'" 1 
ATOM   8660  C  "C5'" . U   E  1 122 ? -62.856 -5.522  -18.539 1.00 116.65 ? 226 U   E "C5'" 1 
ATOM   8661  C  "C4'" . U   E  1 122 ? -63.585 -4.821  -19.653 1.00 116.41 ? 226 U   E "C4'" 1 
ATOM   8662  O  "O4'" . U   E  1 122 ? -62.935 -3.565  -19.962 1.00 114.71 ? 226 U   E "O4'" 1 
ATOM   8663  C  "C3'" . U   E  1 122 ? -63.668 -5.562  -20.975 1.00 120.09 ? 226 U   E "C3'" 1 
ATOM   8664  O  "O3'" . U   E  1 122 ? -64.774 -6.444  -20.993 1.00 125.08 ? 226 U   E "O3'" 1 
ATOM   8665  C  "C2'" . U   E  1 122 ? -63.765 -4.437  -22.003 1.00 119.37 ? 226 U   E "C2'" 1 
ATOM   8666  O  "O2'" . U   E  1 122 ? -65.097 -3.960  -22.099 1.00 120.87 ? 226 U   E "O2'" 1 
ATOM   8667  C  "C1'" . U   E  1 122 ? -62.926 -3.342  -21.349 1.00 116.42 ? 226 U   E "C1'" 1 
ATOM   8668  N  N1    . U   E  1 122 ? -61.516 -3.262  -21.791 1.00 120.52 ? 226 U   E N1    1 
ATOM   8669  C  C2    . U   E  1 122 ? -61.143 -3.104  -23.114 1.00 127.79 ? 226 U   E C2    1 
ATOM   8670  O  O2    . U   E  1 122 ? -61.918 -3.070  -24.056 1.00 131.17 ? 226 U   E O2    1 
ATOM   8671  N  N3    . U   E  1 122 ? -59.781 -3.010  -23.301 1.00 128.40 ? 226 U   E N3    1 
ATOM   8672  C  C4    . U   E  1 122 ? -58.786 -3.039  -22.342 1.00 124.19 ? 226 U   E C4    1 
ATOM   8673  O  O4    . U   E  1 122 ? -57.602 -2.948  -22.672 1.00 124.88 ? 226 U   E O4    1 
ATOM   8674  C  C5    . U   E  1 122 ? -59.261 -3.183  -21.007 1.00 121.13 ? 226 U   E C5    1 
ATOM   8675  C  C6    . U   E  1 122 ? -60.572 -3.272  -20.795 1.00 119.94 ? 226 U   E C6    1 
ATOM   8676  P  P     . G   E  1 123 ? -64.564 -8.031  -20.895 1.00 120.14 ? 227 G   E P     1 
ATOM   8677  O  OP1   . G   E  1 123 ? -65.769 -8.611  -20.237 1.00 120.54 ? 227 G   E OP1   1 
ATOM   8678  O  OP2   . G   E  1 123 ? -63.231 -8.304  -20.308 1.00 121.54 ? 227 G   E OP2   1 
ATOM   8679  O  "O5'" . G   E  1 123 ? -64.489 -8.456  -22.430 1.00 124.35 ? 227 G   E "O5'" 1 
ATOM   8680  C  "C5'" . G   E  1 123 ? -65.496 -8.029  -23.337 1.00 124.95 ? 227 G   E "C5'" 1 
ATOM   8681  C  "C4'" . G   E  1 123 ? -64.995 -7.949  -24.757 1.00 127.06 ? 227 G   E "C4'" 1 
ATOM   8682  O  "O4'" . G   E  1 123 ? -64.065 -6.856  -24.895 1.00 125.20 ? 227 G   E "O4'" 1 
ATOM   8683  C  "C3'" . G   E  1 123 ? -64.216 -9.140  -25.254 1.00 131.86 ? 227 G   E "C3'" 1 
ATOM   8684  O  "O3'" . G   E  1 123 ? -65.043 -10.208 -25.631 1.00 137.22 ? 227 G   E "O3'" 1 
ATOM   8685  C  "C2'" . G   E  1 123 ? -63.414 -8.556  -26.403 1.00 127.62 ? 227 G   E "C2'" 1 
ATOM   8686  O  "O2'" . G   E  1 123 ? -64.241 -8.381  -27.542 1.00 129.15 ? 227 G   E "O2'" 1 
ATOM   8687  C  "C1'" . G   E  1 123 ? -63.083 -7.179  -25.851 1.00 125.07 ? 227 G   E "C1'" 1 
ATOM   8688  N  N9    . G   E  1 123 ? -61.785 -7.124  -25.168 1.00 123.31 ? 227 G   E N9    1 
ATOM   8689  C  C8    . G   E  1 123 ? -61.577 -7.230  -23.821 1.00 121.85 ? 227 G   E C8    1 
ATOM   8690  N  N7    . G   E  1 123 ? -60.322 -7.102  -23.499 1.00 121.30 ? 227 G   E N7    1 
ATOM   8691  C  C5    . G   E  1 123 ? -59.674 -6.878  -24.701 1.00 122.32 ? 227 G   E C5    1 
ATOM   8692  C  C6    . G   E  1 123 ? -58.306 -6.663  -24.989 1.00 122.41 ? 227 G   E C6    1 
ATOM   8693  O  O6    . G   E  1 123 ? -57.338 -6.617  -24.227 1.00 121.62 ? 227 G   E O6    1 
ATOM   8694  N  N1    . G   E  1 123 ? -58.097 -6.485  -26.344 1.00 123.76 ? 227 G   E N1    1 
ATOM   8695  C  C2    . G   E  1 123 ? -59.073 -6.514  -27.303 1.00 125.03 ? 227 G   E C2    1 
ATOM   8696  N  N2    . G   E  1 123 ? -58.678 -6.322  -28.566 1.00 131.73 ? 227 G   E N2    1 
ATOM   8697  N  N3    . G   E  1 123 ? -60.352 -6.706  -27.048 1.00 125.03 ? 227 G   E N3    1 
ATOM   8698  C  C4    . G   E  1 123 ? -60.571 -6.886  -25.738 1.00 123.60 ? 227 G   E C4    1 
ATOM   8699  P  P     . A   E  1 124 ? -64.544 -11.681 -25.302 1.00 141.59 ? 228 A   E P     1 
ATOM   8700  O  OP1   . A   E  1 124 ? -64.977 -12.552 -26.419 1.00 149.79 ? 228 A   E OP1   1 
ATOM   8701  O  OP2   . A   E  1 124 ? -64.946 -11.970 -23.901 1.00 131.08 ? 228 A   E OP2   1 
ATOM   8702  O  "O5'" . A   E  1 124 ? -62.953 -11.569 -25.330 1.00 139.54 ? 228 A   E "O5'" 1 
ATOM   8703  C  "C5'" . A   E  1 124 ? -62.170 -12.473 -26.100 1.00 147.34 ? 228 A   E "C5'" 1 
ATOM   8704  C  "C4'" . A   E  1 124 ? -61.490 -11.812 -27.274 1.00 168.61 ? 228 A   E "C4'" 1 
ATOM   8705  O  "O4'" . A   E  1 124 ? -60.920 -10.558 -26.846 1.00 131.97 ? 228 A   E "O4'" 1 
ATOM   8706  C  "C3'" . A   E  1 124 ? -60.314 -12.589 -27.849 1.00 191.61 ? 228 A   E "C3'" 1 
ATOM   8707  O  "O3'" . A   E  1 124 ? -60.733 -13.524 -28.821 1.00 141.77 ? 228 A   E "O3'" 1 
ATOM   8708  C  "C2'" . A   E  1 124 ? -59.402 -11.501 -28.402 1.00 188.30 ? 228 A   E "C2'" 1 
ATOM   8709  O  "O2'" . A   E  1 124 ? -59.809 -11.078 -29.688 1.00 192.79 ? 228 A   E "O2'" 1 
ATOM   8710  C  "C1'" . A   E  1 124 ? -59.652 -10.368 -27.425 1.00 208.22 ? 228 A   E "C1'" 1 
ATOM   8711  N  N9    . A   E  1 124 ? -58.662 -10.314 -26.353 1.00 130.92 ? 228 A   E N9    1 
ATOM   8712  C  C8    . A   E  1 124 ? -58.845 -10.560 -25.020 1.00 129.71 ? 228 A   E C8    1 
ATOM   8713  N  N7    . A   E  1 124 ? -57.749 -10.400 -24.320 1.00 130.72 ? 228 A   E N7    1 
ATOM   8714  C  C5    . A   E  1 124 ? -56.801 -10.035 -25.266 1.00 129.31 ? 228 A   E C5    1 
ATOM   8715  C  C6    . A   E  1 124 ? -55.439 -9.725  -25.172 1.00 128.92 ? 228 A   E C6    1 
ATOM   8716  N  N6    . A   E  1 124 ? -54.761 -9.741  -24.028 1.00 127.94 ? 228 A   E N6    1 
ATOM   8717  N  N1    . A   E  1 124 ? -54.790 -9.398  -26.307 1.00 129.76 ? 228 A   E N1    1 
ATOM   8718  C  C2    . A   E  1 124 ? -55.476 -9.390  -27.455 1.00 141.26 ? 228 A   E C2    1 
ATOM   8719  N  N3    . A   E  1 124 ? -56.756 -9.668  -27.677 1.00 131.64 ? 228 A   E N3    1 
ATOM   8720  C  C4    . A   E  1 124 ? -57.355 -9.995  -26.526 1.00 130.68 ? 228 A   E C4    1 
ATOM   8721  P  P     . U   E  1 125 ? -59.849 -14.815 -29.138 1.00 145.64 ? 229 U   E P     1 
ATOM   8722  O  OP1   . U   E  1 125 ? -60.329 -15.296 -30.450 1.00 149.15 ? 229 U   E OP1   1 
ATOM   8723  O  OP2   . U   E  1 125 ? -59.892 -15.677 -27.933 1.00 146.02 ? 229 U   E OP2   1 
ATOM   8724  O  "O5'" . U   E  1 125 ? -58.378 -14.241 -29.340 1.00 144.62 ? 229 U   E "O5'" 1 
ATOM   8725  C  "C5'" . U   E  1 125 ? -57.767 -14.248 -30.619 1.00 146.85 ? 229 U   E "C5'" 1 
ATOM   8726  C  "C4'" . U   E  1 125 ? -56.329 -13.818 -30.530 1.00 145.80 ? 229 U   E "C4'" 1 
ATOM   8727  O  "O4'" . U   E  1 125 ? -56.184 -12.872 -29.458 1.00 141.69 ? 229 U   E "O4'" 1 
ATOM   8728  C  "C3'" . U   E  1 125 ? -55.314 -14.896 -30.223 1.00 148.44 ? 229 U   E "C3'" 1 
ATOM   8729  O  "O3'" . U   E  1 125 ? -54.939 -15.548 -31.424 1.00 163.18 ? 229 U   E "O3'" 1 
ATOM   8730  C  "C2'" . U   E  1 125 ? -54.165 -14.106 -29.595 1.00 145.65 ? 229 U   E "C2'" 1 
ATOM   8731  O  "O2'" . U   E  1 125 ? -53.363 -13.516 -30.602 1.00 145.91 ? 229 U   E "O2'" 1 
ATOM   8732  C  "C1'" . U   E  1 125 ? -54.906 -12.974 -28.886 1.00 141.41 ? 229 U   E "C1'" 1 
ATOM   8733  N  N1    . U   E  1 125 ? -55.075 -13.100 -27.423 1.00 144.89 ? 229 U   E N1    1 
ATOM   8734  C  C2    . U   E  1 125 ? -54.096 -12.574 -26.588 1.00 147.34 ? 229 U   E C2    1 
ATOM   8735  O  O2    . U   E  1 125 ? -53.081 -12.031 -26.992 1.00 137.13 ? 229 U   E O2    1 
ATOM   8736  N  N3    . U   E  1 125 ? -54.363 -12.677 -25.241 1.00 148.80 ? 229 U   E N3    1 
ATOM   8737  C  C4    . U   E  1 125 ? -55.477 -13.259 -24.657 1.00 147.85 ? 229 U   E C4    1 
ATOM   8738  O  O4    . U   E  1 125 ? -55.574 -13.297 -23.425 1.00 135.09 ? 229 U   E O4    1 
ATOM   8739  C  C5    . U   E  1 125 ? -56.436 -13.774 -25.592 1.00 145.45 ? 229 U   E C5    1 
ATOM   8740  C  C6    . U   E  1 125 ? -56.215 -13.672 -26.909 1.00 143.33 ? 229 U   E C6    1 
ATOM   8741  P  P     . C   E  1 126 ? -55.327 -17.074 -31.732 1.00 157.33 ? 230 C   E P     1 
ATOM   8742  O  OP1   . C   E  1 126 ? -56.335 -17.113 -32.818 1.00 159.19 ? 230 C   E OP1   1 
ATOM   8743  O  OP2   . C   E  1 126 ? -55.523 -17.823 -30.468 1.00 160.84 ? 230 C   E OP2   1 
ATOM   8744  O  "O5'" . C   E  1 126 ? -54.000 -17.657 -32.351 1.00 162.57 ? 230 C   E "O5'" 1 
ATOM   8745  C  "C5'" . C   E  1 126 ? -53.146 -18.435 -31.538 1.00 164.24 ? 230 C   E "C5'" 1 
ATOM   8746  C  "C4'" . C   E  1 126 ? -51.829 -17.755 -31.314 1.00 161.51 ? 230 C   E "C4'" 1 
ATOM   8747  O  "O4'" . C   E  1 126 ? -51.936 -16.876 -30.169 1.00 155.41 ? 230 C   E "O4'" 1 
ATOM   8748  C  "C3'" . C   E  1 126 ? -50.708 -18.731 -31.014 1.00 163.31 ? 230 C   E "C3'" 1 
ATOM   8749  O  "O3'" . C   E  1 126 ? -49.510 -18.321 -31.651 1.00 163.68 ? 230 C   E "O3'" 1 
ATOM   8750  C  "C2'" . C   E  1 126 ? -50.563 -18.648 -29.498 1.00 163.16 ? 230 C   E "C2'" 1 
ATOM   8751  O  "O2'" . C   E  1 126 ? -49.264 -18.928 -29.031 1.00 167.01 ? 230 C   E "O2'" 1 
ATOM   8752  C  "C1'" . C   E  1 126 ? -50.949 -17.203 -29.217 1.00 159.23 ? 230 C   E "C1'" 1 
ATOM   8753  N  N1    . C   E  1 126 ? -51.587 -17.037 -27.907 1.00 162.57 ? 230 C   E N1    1 
ATOM   8754  C  C2    . C   E  1 126 ? -50.994 -16.303 -26.875 1.00 165.94 ? 230 C   E C2    1 
ATOM   8755  O  O2    . C   E  1 126 ? -49.878 -15.788 -27.043 1.00 168.14 ? 230 C   E O2    1 
ATOM   8756  N  N3    . C   E  1 126 ? -51.655 -16.179 -25.689 1.00 164.42 ? 230 C   E N3    1 
ATOM   8757  C  C4    . C   E  1 126 ? -52.856 -16.742 -25.514 1.00 162.08 ? 230 C   E C4    1 
ATOM   8758  N  N4    . C   E  1 126 ? -53.472 -16.589 -24.333 1.00 156.17 ? 230 C   E N4    1 
ATOM   8759  C  C5    . C   E  1 126 ? -53.478 -17.492 -26.556 1.00 164.60 ? 230 C   E C5    1 
ATOM   8760  C  C6    . C   E  1 126 ? -52.816 -17.607 -27.716 1.00 164.85 ? 230 C   E C6    1 
ATOM   8761  P  P     . A   E  1 127 ? -48.626 -19.464 -32.330 1.00 169.22 ? 231 A   E P     1 
ATOM   8762  O  OP1   . A   E  1 127 ? -47.455 -19.696 -31.452 1.00 176.96 ? 231 A   E OP1   1 
ATOM   8763  O  OP2   . A   E  1 127 ? -48.408 -19.058 -33.743 1.00 170.40 ? 231 A   E OP2   1 
ATOM   8764  O  "O5'" . A   E  1 127 ? -49.612 -20.727 -32.263 1.00 187.53 ? 231 A   E "O5'" 1 
ATOM   8765  C  "C5'" . A   E  1 127 ? -49.215 -22.027 -31.807 1.00 190.33 ? 231 A   E "C5'" 1 
ATOM   8766  C  "C4'" . A   E  1 127 ? -50.432 -22.876 -31.481 1.00 189.85 ? 231 A   E "C4'" 1 
ATOM   8767  O  "O4'" . A   E  1 127 ? -51.323 -22.862 -32.620 1.00 188.88 ? 231 A   E "O4'" 1 
ATOM   8768  C  "C3'" . A   E  1 127 ? -50.177 -24.341 -31.117 1.00 184.33 ? 231 A   E "C3'" 1 
ATOM   8769  O  "O3'" . A   E  1 127 ? -50.341 -24.613 -29.712 1.00 206.27 ? 231 A   E "O3'" 1 
ATOM   8770  C  "C2'" . A   E  1 127 ? -51.195 -25.152 -31.936 1.00 188.36 ? 231 A   E "C2'" 1 
ATOM   8771  O  "O2'" . A   E  1 127 ? -52.155 -25.835 -31.160 1.00 189.18 ? 231 A   E "O2'" 1 
ATOM   8772  C  "C1'" . A   E  1 127 ? -51.871 -24.136 -32.866 1.00 185.58 ? 231 A   E "C1'" 1 
ATOM   8773  N  N9    . A   E  1 127 ? -51.674 -24.426 -34.294 1.00 189.61 ? 231 A   E N9    1 
ATOM   8774  C  C8    . A   E  1 127 ? -52.542 -24.136 -35.319 1.00 190.12 ? 231 A   E C8    1 
ATOM   8775  N  N7    . A   E  1 127 ? -52.113 -24.521 -36.497 1.00 201.70 ? 231 A   E N7    1 
ATOM   8776  C  C5    . A   E  1 127 ? -50.877 -25.112 -36.246 1.00 203.15 ? 231 A   E C5    1 
ATOM   8777  C  C6    . A   E  1 127 ? -49.912 -25.721 -37.089 1.00 206.66 ? 231 A   E C6    1 
ATOM   8778  N  N6    . A   E  1 127 ? -50.040 -25.847 -38.416 1.00 205.26 ? 231 A   E N6    1 
ATOM   8779  N  N1    . A   E  1 127 ? -48.784 -26.211 -36.523 1.00 206.32 ? 231 A   E N1    1 
ATOM   8780  C  C2    . A   E  1 127 ? -48.637 -26.096 -35.200 1.00 202.49 ? 231 A   E C2    1 
ATOM   8781  N  N3    . A   E  1 127 ? -49.466 -25.544 -34.318 1.00 199.00 ? 231 A   E N3    1 
ATOM   8782  C  C4    . A   E  1 127 ? -50.594 -25.068 -34.891 1.00 199.05 ? 231 A   E C4    1 
ATOM   8783  P  P     . G   E  1 128 ? -51.583 -24.103 -28.816 1.00 199.02 ? 232 G   E P     1 
ATOM   8784  O  OP1   . G   E  1 128 ? -52.014 -25.273 -28.007 1.00 202.64 ? 232 G   E OP1   1 
ATOM   8785  O  OP2   . G   E  1 128 ? -52.618 -23.383 -29.603 1.00 198.10 ? 232 G   E OP2   1 
ATOM   8786  O  "O5'" . G   E  1 128 ? -50.909 -23.088 -27.790 1.00 194.33 ? 232 G   E "O5'" 1 
ATOM   8787  C  "C5'" . G   E  1 128 ? -50.269 -21.900 -28.247 1.00 191.06 ? 232 G   E "C5'" 1 
ATOM   8788  C  "C4'" . G   E  1 128 ? -48.776 -21.931 -28.030 1.00 182.35 ? 232 G   E "C4'" 1 
ATOM   8789  O  "O4'" . G   E  1 128 ? -48.389 -20.688 -27.376 1.00 173.54 ? 232 G   E "O4'" 1 
ATOM   8790  C  "C3'" . G   E  1 128 ? -48.295 -23.059 -27.120 1.00 183.54 ? 232 G   E "C3'" 1 
ATOM   8791  O  "O3'" . G   E  1 128 ? -46.985 -23.502 -27.474 1.00 186.86 ? 232 G   E "O3'" 1 
ATOM   8792  C  "C2'" . G   E  1 128 ? -48.230 -22.381 -25.766 1.00 183.02 ? 232 G   E "C2'" 1 
ATOM   8793  O  "O2'" . G   E  1 128 ? -47.358 -22.985 -24.842 1.00 193.53 ? 232 G   E "O2'" 1 
ATOM   8794  C  "C1'" . G   E  1 128 ? -47.772 -20.977 -26.141 1.00 175.37 ? 232 G   E "C1'" 1 
ATOM   8795  N  N9    . G   E  1 128 ? -48.179 -20.006 -25.128 1.00 161.43 ? 232 G   E N9    1 
ATOM   8796  C  C8    . G   E  1 128 ? -47.332 -19.221 -24.394 1.00 158.75 ? 232 G   E C8    1 
ATOM   8797  N  N7    . G   E  1 128 ? -47.970 -18.517 -23.510 1.00 155.01 ? 232 G   E N7    1 
ATOM   8798  C  C5    . G   E  1 128 ? -49.301 -18.863 -23.672 1.00 155.15 ? 232 G   E C5    1 
ATOM   8799  C  C6    . G   E  1 128 ? -50.443 -18.418 -22.983 1.00 152.14 ? 232 G   E C6    1 
ATOM   8800  O  O6    . G   E  1 128 ? -50.504 -17.592 -22.076 1.00 179.29 ? 232 G   E O6    1 
ATOM   8801  N  N1    . G   E  1 128 ? -51.601 -19.018 -23.436 1.00 153.65 ? 232 G   E N1    1 
ATOM   8802  C  C2    . G   E  1 128 ? -51.666 -19.940 -24.430 1.00 157.70 ? 232 G   E C2    1 
ATOM   8803  N  N2    . G   E  1 128 ? -52.897 -20.392 -24.712 1.00 158.72 ? 232 G   E N2    1 
ATOM   8804  N  N3    . G   E  1 128 ? -50.602 -20.373 -25.082 1.00 160.69 ? 232 G   E N3    1 
ATOM   8805  C  C4    . G   E  1 128 ? -49.455 -19.801 -24.650 1.00 159.15 ? 232 G   E C4    1 
ATOM   8806  P  P     . U   E  1 129 ? -46.394 -24.832 -26.779 1.00 183.13 ? 233 U   E P     1 
ATOM   8807  O  OP1   . U   E  1 129 ? -45.385 -25.424 -27.690 1.00 187.76 ? 233 U   E OP1   1 
ATOM   8808  O  OP2   . U   E  1 129 ? -47.567 -25.618 -26.319 1.00 184.62 ? 233 U   E OP2   1 
ATOM   8809  O  "O5'" . U   E  1 129 ? -45.657 -24.313 -25.457 1.00 180.23 ? 233 U   E "O5'" 1 
ATOM   8810  C  "C5'" . U   E  1 129 ? -44.461 -23.533 -25.522 1.00 178.50 ? 233 U   E "C5'" 1 
ATOM   8811  C  "C4'" . U   E  1 129 ? -43.894 -23.247 -24.147 1.00 176.63 ? 233 U   E "C4'" 1 
ATOM   8812  O  "O4'" . U   E  1 129 ? -44.487 -22.039 -23.580 1.00 175.29 ? 233 U   E "O4'" 1 
ATOM   8813  C  "C3'" . U   E  1 129 ? -44.071 -24.368 -23.126 1.00 179.92 ? 233 U   E "C3'" 1 
ATOM   8814  O  "O3'" . U   E  1 129 ? -42.829 -25.039 -22.839 1.00 183.93 ? 233 U   E "O3'" 1 
ATOM   8815  C  "C2'" . U   E  1 129 ? -44.676 -23.690 -21.887 1.00 179.24 ? 233 U   E "C2'" 1 
ATOM   8816  O  "O2'" . U   E  1 129 ? -44.130 -24.016 -20.633 1.00 176.51 ? 233 U   E "O2'" 1 
ATOM   8817  C  "C1'" . U   E  1 129 ? -44.649 -22.182 -22.183 1.00 174.70 ? 233 U   E "C1'" 1 
ATOM   8818  N  N1    . U   E  1 129 ? -45.895 -21.571 -21.698 1.00 165.98 ? 233 U   E N1    1 
ATOM   8819  C  C2    . U   E  1 129 ? -45.932 -21.282 -20.352 1.00 163.94 ? 233 U   E C2    1 
ATOM   8820  O  O2    . U   E  1 129 ? -44.961 -21.396 -19.621 1.00 175.61 ? 233 U   E O2    1 
ATOM   8821  N  N3    . U   E  1 129 ? -47.139 -20.850 -19.869 1.00 160.78 ? 233 U   E N3    1 
ATOM   8822  C  C4    . U   E  1 129 ? -48.303 -20.693 -20.574 1.00 159.53 ? 233 U   E C4    1 
ATOM   8823  O  O4    . U   E  1 129 ? -49.314 -20.280 -20.021 1.00 156.75 ? 233 U   E O4    1 
ATOM   8824  C  C5    . U   E  1 129 ? -48.194 -21.062 -21.932 1.00 161.99 ? 233 U   E C5    1 
ATOM   8825  C  C6    . U   E  1 129 ? -47.038 -21.491 -22.424 1.00 165.08 ? 233 U   E C6    1 
ATOM   8826  P  P     . A   E  1 130 ? -41.699 -24.449 -21.848 1.00 186.67 ? 234 A   E P     1 
ATOM   8827  O  OP1   . A   E  1 130 ? -41.531 -23.016 -22.173 1.00 177.02 ? 234 A   E OP1   1 
ATOM   8828  O  OP2   . A   E  1 130 ? -40.524 -25.358 -21.870 1.00 187.63 ? 234 A   E OP2   1 
ATOM   8829  O  "O5'" . A   E  1 130 ? -42.344 -24.562 -20.391 1.00 185.29 ? 234 A   E "O5'" 1 
ATOM   8830  C  "C5'" . A   E  1 130 ? -41.551 -24.660 -19.214 1.00 188.51 ? 234 A   E "C5'" 1 
ATOM   8831  C  "C4'" . A   E  1 130 ? -42.391 -24.839 -17.960 1.00 191.94 ? 234 A   E "C4'" 1 
ATOM   8832  O  "O4'" . A   E  1 130 ? -43.448 -23.842 -17.900 1.00 175.20 ? 234 A   E "O4'" 1 
ATOM   8833  C  "C3'" . A   E  1 130 ? -43.060 -26.205 -17.761 1.00 197.75 ? 234 A   E "C3'" 1 
ATOM   8834  O  "O3'" . A   E  1 130 ? -42.348 -27.027 -16.813 1.00 200.48 ? 234 A   E "O3'" 1 
ATOM   8835  C  "C2'" . A   E  1 130 ? -44.475 -25.885 -17.239 1.00 199.20 ? 234 A   E "C2'" 1 
ATOM   8836  O  "O2'" . A   E  1 130 ? -44.867 -26.518 -16.043 1.00 204.01 ? 234 A   E "O2'" 1 
ATOM   8837  C  "C1'" . A   E  1 130 ? -44.544 -24.349 -17.159 1.00 190.97 ? 234 A   E "C1'" 1 
ATOM   8838  N  N9    . A   E  1 130 ? -45.826 -23.845 -17.659 1.00 172.01 ? 234 A   E N9    1 
ATOM   8839  C  C8    . A   E  1 130 ? -46.241 -23.765 -18.945 1.00 171.88 ? 234 A   E C8    1 
ATOM   8840  N  N7    . A   E  1 130 ? -47.470 -23.362 -19.126 1.00 169.04 ? 234 A   E N7    1 
ATOM   8841  C  C5    . A   E  1 130 ? -47.950 -23.262 -17.847 1.00 167.38 ? 234 A   E C5    1 
ATOM   8842  C  C6    . A   E  1 130 ? -49.215 -22.899 -17.378 1.00 164.40 ? 234 A   E C6    1 
ATOM   8843  N  N6    . A   E  1 130 ? -50.217 -22.561 -18.187 1.00 162.61 ? 234 A   E N6    1 
ATOM   8844  N  N1    . A   E  1 130 ? -49.396 -22.897 -16.043 1.00 173.59 ? 234 A   E N1    1 
ATOM   8845  C  C2    . A   E  1 130 ? -48.354 -23.243 -15.264 1.00 175.15 ? 234 A   E C2    1 
ATOM   8846  N  N3    . A   E  1 130 ? -47.111 -23.605 -15.601 1.00 168.67 ? 234 A   E N3    1 
ATOM   8847  C  C4    . A   E  1 130 ? -46.972 -23.609 -16.933 1.00 169.37 ? 234 A   E C4    1 
ATOM   8848  P  P     . G   E  1 131 ? -42.161 -26.651 -15.249 1.00 193.49 ? 235 G   E P     1 
ATOM   8849  O  OP1   . G   E  1 131 ? -41.968 -25.188 -15.056 1.00 194.05 ? 235 G   E OP1   1 
ATOM   8850  O  OP2   . G   E  1 131 ? -41.153 -27.596 -14.711 1.00 193.23 ? 235 G   E OP2   1 
ATOM   8851  O  "O5'" . G   E  1 131 ? -43.556 -26.991 -14.545 1.00 190.42 ? 235 G   E "O5'" 1 
ATOM   8852  C  "C5'" . G   E  1 131 ? -43.841 -26.430 -13.267 1.00 189.67 ? 235 G   E "C5'" 1 
ATOM   8853  C  "C4'" . G   E  1 131 ? -45.259 -26.654 -12.781 1.00 184.28 ? 235 G   E "C4'" 1 
ATOM   8854  O  "O4'" . G   E  1 131 ? -46.222 -25.889 -13.551 1.00 180.99 ? 235 G   E "O4'" 1 
ATOM   8855  C  "C3'" . G   E  1 131 ? -45.830 -28.063 -12.785 1.00 182.67 ? 235 G   E "C3'" 1 
ATOM   8856  O  "O3'" . G   E  1 131 ? -45.329 -28.850 -11.717 1.00 183.48 ? 235 G   E "O3'" 1 
ATOM   8857  C  "C2'" . G   E  1 131 ? -47.328 -27.801 -12.653 1.00 182.91 ? 235 G   E "C2'" 1 
ATOM   8858  O  "O2'" . G   E  1 131 ? -47.674 -27.570 -11.295 1.00 186.22 ? 235 G   E "O2'" 1 
ATOM   8859  C  "C1'" . G   E  1 131 ? -47.497 -26.492 -13.430 1.00 181.76 ? 235 G   E "C1'" 1 
ATOM   8860  N  N9    . G   E  1 131 ? -48.177 -26.621 -14.742 1.00 184.07 ? 235 G   E N9    1 
ATOM   8861  C  C8    . G   E  1 131 ? -47.708 -26.821 -16.018 1.00 186.04 ? 235 G   E C8    1 
ATOM   8862  N  N7    . G   E  1 131 ? -48.654 -26.867 -16.928 1.00 184.87 ? 235 G   E N7    1 
ATOM   8863  C  C5    . G   E  1 131 ? -49.828 -26.683 -16.215 1.00 183.18 ? 235 G   E C5    1 
ATOM   8864  C  C6    . G   E  1 131 ? -51.188 -26.632 -16.621 1.00 180.86 ? 235 G   E C6    1 
ATOM   8865  O  O6    . G   E  1 131 ? -51.688 -26.735 -17.744 1.00 182.43 ? 235 G   E O6    1 
ATOM   8866  N  N1    . G   E  1 131 ? -52.035 -26.429 -15.537 1.00 176.56 ? 235 G   E N1    1 
ATOM   8867  C  C2    . G   E  1 131 ? -51.629 -26.294 -14.237 1.00 176.57 ? 235 G   E C2    1 
ATOM   8868  N  N2    . G   E  1 131 ? -52.569 -26.103 -13.300 1.00 181.05 ? 235 G   E N2    1 
ATOM   8869  N  N3    . G   E  1 131 ? -50.373 -26.340 -13.854 1.00 178.84 ? 235 G   E N3    1 
ATOM   8870  C  C4    . G   E  1 131 ? -49.537 -26.540 -14.879 1.00 182.24 ? 235 G   E C4    1 
ATOM   8871  P  P     . U   E  1 132 ? -45.502 -30.451 -11.699 1.00 180.26 ? 236 U   E P     1 
ATOM   8872  O  OP1   . U   E  1 132 ? -44.711 -30.904 -10.533 1.00 182.29 ? 236 U   E OP1   1 
ATOM   8873  O  OP2   . U   E  1 132 ? -45.314 -31.036 -13.054 1.00 178.74 ? 236 U   E OP2   1 
ATOM   8874  O  "O5'" . U   E  1 132 ? -47.027 -30.672 -11.330 1.00 179.26 ? 236 U   E "O5'" 1 
ATOM   8875  C  "C5'" . U   E  1 132 ? -47.478 -30.547 -9.995  1.00 180.64 ? 236 U   E "C5'" 1 
ATOM   8876  C  "C4'" . U   E  1 132 ? -48.959 -30.316 -9.980  1.00 179.63 ? 236 U   E "C4'" 1 
ATOM   8877  O  "O4'" . U   E  1 132 ? -49.263 -29.319 -10.982 1.00 178.42 ? 236 U   E "O4'" 1 
ATOM   8878  C  "C3'" . U   E  1 132 ? -49.829 -31.493 -10.377 1.00 179.36 ? 236 U   E "C3'" 1 
ATOM   8879  O  "O3'" . U   E  1 132 ? -50.026 -32.451 -9.350  1.00 181.54 ? 236 U   E "O3'" 1 
ATOM   8880  C  "C2'" . U   E  1 132 ? -51.096 -30.801 -10.859 1.00 177.24 ? 236 U   E "C2'" 1 
ATOM   8881  O  "O2'" . U   E  1 132 ? -51.851 -30.324 -9.760  1.00 178.37 ? 236 U   E "O2'" 1 
ATOM   8882  C  "C1'" . U   E  1 132 ? -50.505 -29.597 -11.582 1.00 176.88 ? 236 U   E "C1'" 1 
ATOM   8883  N  N1    . U   E  1 132 ? -50.269 -29.906 -13.008 1.00 175.47 ? 236 U   E N1    1 
ATOM   8884  C  C2    . U   E  1 132 ? -51.311 -29.628 -13.857 1.00 183.75 ? 236 U   E C2    1 
ATOM   8885  O  O2    . U   E  1 132 ? -52.339 -29.112 -13.450 1.00 174.28 ? 236 U   E O2    1 
ATOM   8886  N  N3    . U   E  1 132 ? -51.083 -29.948 -15.180 1.00 184.74 ? 236 U   E N3    1 
ATOM   8887  C  C4    . U   E  1 132 ? -49.946 -30.530 -15.727 1.00 183.35 ? 236 U   E C4    1 
ATOM   8888  O  O4    . U   E  1 132 ? -49.882 -30.765 -16.941 1.00 172.71 ? 236 U   E O4    1 
ATOM   8889  C  C5    . U   E  1 132 ? -48.916 -30.807 -14.771 1.00 181.68 ? 236 U   E C5    1 
ATOM   8890  C  C6    . U   E  1 132 ? -49.117 -30.502 -13.484 1.00 175.55 ? 236 U   E C6    1 
ATOM   8891  P  P     . G   E  1 133 ? -50.260 -34.003 -9.716  1.00 179.29 ? 237 G   E P     1 
ATOM   8892  O  OP1   . G   E  1 133 ? -51.079 -34.587 -8.627  1.00 180.85 ? 237 G   E OP1   1 
ATOM   8893  O  OP2   . G   E  1 133 ? -48.988 -34.629 -10.153 1.00 179.29 ? 237 G   E OP2   1 
ATOM   8894  O  "O5'" . G   E  1 133 ? -51.207 -33.972 -10.985 1.00 177.26 ? 237 G   E "O5'" 1 
ATOM   8895  C  "C5'" . G   E  1 133 ? -52.203 -34.958 -11.141 1.00 177.15 ? 237 G   E "C5'" 1 
ATOM   8896  C  "C4'" . G   E  1 133 ? -53.524 -34.339 -11.476 1.00 176.40 ? 237 G   E "C4'" 1 
ATOM   8897  O  "O4'" . G   E  1 133 ? -53.320 -33.118 -12.213 1.00 175.21 ? 237 G   E "O4'" 1 
ATOM   8898  C  "C3'" . G   E  1 133 ? -54.407 -35.161 -12.382 1.00 187.72 ? 237 G   E "C3'" 1 
ATOM   8899  O  "O3'" . G   E  1 133 ? -55.079 -36.186 -11.703 1.00 191.29 ? 237 G   E "O3'" 1 
ATOM   8900  C  "C2'" . G   E  1 133 ? -55.308 -34.121 -13.009 1.00 174.71 ? 237 G   E "C2'" 1 
ATOM   8901  O  "O2'" . G   E  1 133 ? -56.295 -33.714 -12.078 1.00 175.67 ? 237 G   E "O2'" 1 
ATOM   8902  C  "C1'" . G   E  1 133 ? -54.326 -32.973 -13.191 1.00 174.11 ? 237 G   E "C1'" 1 
ATOM   8903  N  N9    . G   E  1 133 ? -53.683 -32.962 -14.520 1.00 172.99 ? 237 G   E N9    1 
ATOM   8904  C  C8    . G   E  1 133 ? -52.329 -32.979 -14.762 1.00 172.98 ? 237 G   E C8    1 
ATOM   8905  N  N7    . G   E  1 133 ? -52.022 -32.930 -16.025 1.00 172.17 ? 237 G   E N7    1 
ATOM   8906  C  C5    . G   E  1 133 ? -53.248 -32.873 -16.662 1.00 171.62 ? 237 G   E C5    1 
ATOM   8907  C  C6    . G   E  1 133 ? -53.549 -32.814 -18.041 1.00 171.01 ? 237 G   E C6    1 
ATOM   8908  O  O6    . G   E  1 133 ? -52.757 -32.797 -18.982 1.00 170.84 ? 237 G   E O6    1 
ATOM   8909  N  N1    . G   E  1 133 ? -54.921 -32.772 -18.280 1.00 170.93 ? 237 G   E N1    1 
ATOM   8910  C  C2    . G   E  1 133 ? -55.889 -32.785 -17.303 1.00 171.36 ? 237 G   E C2    1 
ATOM   8911  N  N2    . G   E  1 133 ? -57.172 -32.739 -17.713 1.00 171.45 ? 237 G   E N2    1 
ATOM   8912  N  N3    . G   E  1 133 ? -55.610 -32.840 -16.006 1.00 171.98 ? 237 G   E N3    1 
ATOM   8913  C  C4    . G   E  1 133 ? -54.284 -32.887 -15.756 1.00 172.08 ? 237 G   E C4    1 
ATOM   8914  P  P     . G   E  1 134 ? -54.940 -37.667 -12.261 1.00 177.46 ? 238 G   E P     1 
ATOM   8915  O  OP1   . G   E  1 134 ? -55.591 -38.509 -11.236 1.00 179.61 ? 238 G   E OP1   1 
ATOM   8916  O  OP2   . G   E  1 134 ? -53.523 -37.886 -12.664 1.00 176.83 ? 238 G   E OP2   1 
ATOM   8917  O  "O5'" . G   E  1 134 ? -55.848 -37.629 -13.567 1.00 176.30 ? 238 G   E "O5'" 1 
ATOM   8918  C  "C5'" . G   E  1 134 ? -57.250 -37.782 -13.433 1.00 177.16 ? 238 G   E "C5'" 1 
ATOM   8919  C  "C4'" . G   E  1 134 ? -58.027 -37.284 -14.628 1.00 176.06 ? 238 G   E "C4'" 1 
ATOM   8920  O  "O4'" . G   E  1 134 ? -57.457 -36.069 -15.188 1.00 174.45 ? 238 G   E "O4'" 1 
ATOM   8921  C  "C3'" . G   E  1 134 ? -58.106 -38.204 -15.824 1.00 191.64 ? 238 G   E "C3'" 1 
ATOM   8922  O  "O3'" . G   E  1 134 ? -58.917 -39.346 -15.618 1.00 189.44 ? 238 G   E "O3'" 1 
ATOM   8923  C  "C2'" . G   E  1 134 ? -58.594 -37.243 -16.904 1.00 174.80 ? 238 G   E "C2'" 1 
ATOM   8924  O  "O2'" . G   E  1 134 ? -59.954 -36.895 -16.692 1.00 175.54 ? 238 G   E "O2'" 1 
ATOM   8925  C  "C1'" . G   E  1 134 ? -57.757 -36.009 -16.573 1.00 173.65 ? 238 G   E "C1'" 1 
ATOM   8926  N  N9    . G   E  1 134 ? -56.494 -35.970 -17.333 1.00 172.71 ? 238 G   E N9    1 
ATOM   8927  C  C8    . G   E  1 134 ? -55.233 -36.013 -16.791 1.00 172.63 ? 238 G   E C8    1 
ATOM   8928  N  N7    . G   E  1 134 ? -54.278 -35.958 -17.677 1.00 171.97 ? 238 G   E N7    1 
ATOM   8929  C  C5    . G   E  1 134 ? -54.944 -35.878 -18.885 1.00 171.63 ? 238 G   E C5    1 
ATOM   8930  C  C6    . G   E  1 134 ? -54.414 -35.799 -20.194 1.00 171.24 ? 238 G   E C6    1 
ATOM   8931  O  O6    . G   E  1 134 ? -53.228 -35.782 -20.532 1.00 171.04 ? 238 G   E O6    1 
ATOM   8932  N  N1    . G   E  1 134 ? -55.423 -35.735 -21.149 1.00 171.40 ? 238 G   E N1    1 
ATOM   8933  C  C2    . G   E  1 134 ? -56.773 -35.749 -20.881 1.00 171.87 ? 238 G   E C2    1 
ATOM   8934  N  N2    . G   E  1 134 ? -57.597 -35.681 -21.944 1.00 173.08 ? 238 G   E N2    1 
ATOM   8935  N  N3    . G   E  1 134 ? -57.276 -35.818 -19.651 1.00 172.21 ? 238 G   E N3    1 
ATOM   8936  C  C4    . G   E  1 134 ? -56.313 -35.885 -18.701 1.00 172.08 ? 238 G   E C4    1 
ATOM   8937  P  P     . G   E  1 135 ? -58.306 -40.819 -15.829 1.00 178.70 ? 239 G   E P     1 
ATOM   8938  O  OP1   . G   E  1 135 ? -59.186 -41.699 -15.031 1.00 181.13 ? 239 G   E OP1   1 
ATOM   8939  O  OP2   . G   E  1 135 ? -56.839 -40.864 -15.586 1.00 177.90 ? 239 G   E OP2   1 
ATOM   8940  O  "O5'" . G   E  1 135 ? -58.565 -41.083 -17.375 1.00 178.18 ? 239 G   E "O5'" 1 
ATOM   8941  C  "C5'" . G   E  1 135 ? -59.887 -41.016 -17.884 1.00 179.00 ? 239 G   E "C5'" 1 
ATOM   8942  C  "C4'" . G   E  1 135 ? -59.911 -40.549 -19.315 1.00 177.93 ? 239 G   E "C4'" 1 
ATOM   8943  O  "O4'" . G   E  1 135 ? -59.168 -39.310 -19.421 1.00 175.99 ? 239 G   E "O4'" 1 
ATOM   8944  C  "C3'" . G   E  1 135 ? -59.239 -41.440 -20.338 1.00 180.02 ? 239 G   E "C3'" 1 
ATOM   8945  O  "O3'" . G   E  1 135 ? -60.023 -42.524 -20.754 1.00 181.23 ? 239 G   E "O3'" 1 
ATOM   8946  C  "C2'" . G   E  1 135 ? -58.933 -40.468 -21.458 1.00 176.65 ? 239 G   E "C2'" 1 
ATOM   8947  O  "O2'" . G   E  1 135 ? -60.129 -40.101 -22.126 1.00 177.37 ? 239 G   E "O2'" 1 
ATOM   8948  C  "C1'" . G   E  1 135 ? -58.477 -39.270 -20.655 1.00 175.21 ? 239 G   E "C1'" 1 
ATOM   8949  N  N9    . G   E  1 135 ? -57.027 -39.298 -20.394 1.00 174.29 ? 239 G   E N9    1 
ATOM   8950  C  C8    . G   E  1 135 ? -56.387 -39.456 -19.192 1.00 175.64 ? 239 G   E C8    1 
ATOM   8951  N  N7    . G   E  1 135 ? -55.086 -39.407 -19.293 1.00 173.67 ? 239 G   E N7    1 
ATOM   8952  C  C5    . G   E  1 135 ? -54.855 -39.203 -20.639 1.00 173.08 ? 239 G   E C5    1 
ATOM   8953  C  C6    . G   E  1 135 ? -53.641 -39.069 -21.344 1.00 172.51 ? 239 G   E C6    1 
ATOM   8954  O  O6    . G   E  1 135 ? -52.484 -39.100 -20.916 1.00 172.28 ? 239 G   E O6    1 
ATOM   8955  N  N1    . G   E  1 135 ? -53.883 -38.881 -22.694 1.00 172.54 ? 239 G   E N1    1 
ATOM   8956  C  C2    . G   E  1 135 ? -55.121 -38.828 -23.284 1.00 173.09 ? 239 G   E C2    1 
ATOM   8957  N  N2    . G   E  1 135 ? -55.157 -38.644 -24.605 1.00 173.41 ? 239 G   E N2    1 
ATOM   8958  N  N3    . G   E  1 135 ? -56.256 -38.949 -22.636 1.00 173.59 ? 239 G   E N3    1 
ATOM   8959  C  C4    . G   E  1 135 ? -56.043 -39.138 -21.328 1.00 173.53 ? 239 G   E C4    1 
ATOM   8960  P  P     . A   E  1 136 ? -59.296 -43.918 -20.971 1.00 181.09 ? 240 A   E P     1 
ATOM   8961  O  OP1   . A   E  1 136 ? -60.300 -44.783 -21.625 1.00 183.37 ? 240 A   E OP1   1 
ATOM   8962  O  OP2   . A   E  1 136 ? -58.632 -44.276 -19.693 1.00 181.20 ? 240 A   E OP2   1 
ATOM   8963  O  "O5'" . A   E  1 136 ? -58.155 -43.606 -22.037 1.00 179.45 ? 240 A   E "O5'" 1 
ATOM   8964  C  "C5'" . A   E  1 136 ? -58.477 -43.351 -23.391 1.00 179.55 ? 240 A   E "C5'" 1 
ATOM   8965  C  "C4'" . A   E  1 136 ? -57.244 -43.109 -24.220 1.00 178.32 ? 240 A   E "C4'" 1 
ATOM   8966  O  "O4'" . A   E  1 136 ? -56.467 -42.024 -23.652 1.00 176.45 ? 240 A   E "O4'" 1 
ATOM   8967  C  "C3'" . A   E  1 136 ? -56.239 -44.241 -24.282 1.00 188.56 ? 240 A   E "C3'" 1 
ATOM   8968  O  "O3'" . A   E  1 136 ? -56.590 -45.312 -25.123 1.00 190.51 ? 240 A   E "O3'" 1 
ATOM   8969  C  "C2'" . A   E  1 136 ? -54.971 -43.515 -24.700 1.00 186.46 ? 240 A   E "C2'" 1 
ATOM   8970  O  "O2'" . A   E  1 136 ? -55.062 -43.087 -26.054 1.00 177.32 ? 240 A   E "O2'" 1 
ATOM   8971  C  "C1'" . A   E  1 136 ? -55.083 -42.268 -23.855 1.00 175.80 ? 240 A   E "C1'" 1 
ATOM   8972  N  N9    . A   E  1 136 ? -54.419 -42.425 -22.541 1.00 175.38 ? 240 A   E N9    1 
ATOM   8973  C  C8    . A   E  1 136 ? -55.003 -42.675 -21.321 1.00 176.00 ? 240 A   E C8    1 
ATOM   8974  N  N7    . A   E  1 136 ? -54.152 -42.726 -20.322 1.00 175.74 ? 240 A   E N7    1 
ATOM   8975  C  C5    . A   E  1 136 ? -52.921 -42.493 -20.919 1.00 174.82 ? 240 A   E C5    1 
ATOM   8976  C  C6    . A   E  1 136 ? -51.619 -42.421 -20.393 1.00 174.41 ? 240 A   E C6    1 
ATOM   8977  N  N6    . A   E  1 136 ? -51.335 -42.586 -19.099 1.00 174.91 ? 240 A   E N6    1 
ATOM   8978  N  N1    . A   E  1 136 ? -50.609 -42.170 -21.255 1.00 173.81 ? 240 A   E N1    1 
ATOM   8979  C  C2    . A   E  1 136 ? -50.894 -42.005 -22.553 1.00 173.68 ? 240 A   E C2    1 
ATOM   8980  N  N3    . A   E  1 136 ? -52.078 -42.051 -23.164 1.00 174.08 ? 240 A   E N3    1 
ATOM   8981  C  C4    . A   E  1 136 ? -53.067 -42.300 -22.283 1.00 174.60 ? 240 A   E C4    1 
ATOM   8982  P  P     . U   E  1 137 ? -56.185 -46.791 -24.667 1.00 182.00 ? 241 U   E P     1 
ATOM   8983  O  OP1   . U   E  1 137 ? -56.977 -47.716 -25.506 1.00 184.37 ? 241 U   E OP1   1 
ATOM   8984  O  OP2   . U   E  1 137 ? -56.259 -46.880 -23.190 1.00 181.99 ? 241 U   E OP2   1 
ATOM   8985  O  "O5'" . U   E  1 137 ? -54.636 -46.882 -25.023 1.00 180.83 ? 241 U   E "O5'" 1 
ATOM   8986  C  "C5'" . U   E  1 137 ? -54.189 -46.598 -26.342 1.00 180.59 ? 241 U   E "C5'" 1 
ATOM   8987  C  "C4'" . U   E  1 137 ? -52.707 -46.376 -26.385 1.00 179.30 ? 241 U   E "C4'" 1 
ATOM   8988  O  "O4'" . U   E  1 137 ? -52.322 -45.666 -25.182 1.00 177.86 ? 241 U   E "O4'" 1 
ATOM   8989  C  "C3'" . U   E  1 137 ? -51.886 -47.656 -26.404 1.00 180.25 ? 241 U   E "C3'" 1 
ATOM   8990  O  "O3'" . U   E  1 137 ? -50.732 -47.500 -27.228 1.00 179.79 ? 241 U   E "O3'" 1 
ATOM   8991  C  "C2'" . U   E  1 137 ? -51.477 -47.822 -24.944 1.00 186.04 ? 241 U   E "C2'" 1 
ATOM   8992  O  "O2'" . U   E  1 137 ? -50.291 -48.568 -24.752 1.00 186.95 ? 241 U   E "O2'" 1 
ATOM   8993  C  "C1'" . U   E  1 137 ? -51.320 -46.377 -24.497 1.00 177.91 ? 241 U   E "C1'" 1 
ATOM   8994  N  N1    . U   E  1 137 ? -51.596 -46.210 -23.064 1.00 177.73 ? 241 U   E N1    1 
ATOM   8995  C  C2    . U   E  1 137 ? -50.590 -45.770 -22.233 1.00 176.84 ? 241 U   E C2    1 
ATOM   8996  O  O2    . U   E  1 137 ? -49.484 -45.469 -22.631 1.00 176.16 ? 241 U   E O2    1 
ATOM   8997  N  N3    . U   E  1 137 ? -50.946 -45.661 -20.909 1.00 177.10 ? 241 U   E N3    1 
ATOM   8998  C  C4    . U   E  1 137 ? -52.167 -45.965 -20.340 1.00 178.17 ? 241 U   E C4    1 
ATOM   8999  O  O4    . U   E  1 137 ? -52.315 -45.813 -19.125 1.00 178.57 ? 241 U   E O4    1 
ATOM   9000  C  C5    . U   E  1 137 ? -53.154 -46.436 -21.262 1.00 179.07 ? 241 U   E C5    1 
ATOM   9001  C  C6    . U   E  1 137 ? -52.833 -46.543 -22.558 1.00 178.82 ? 241 U   E C6    1 
ATOM   9002  P  P     . C   E  1 138 ? -50.707 -48.192 -28.680 1.00 181.41 ? 242 C   E P     1 
ATOM   9003  O  OP1   . C   E  1 138 ? -49.479 -47.769 -29.363 1.00 180.84 ? 242 C   E OP1   1 
ATOM   9004  O  OP2   . C   E  1 138 ? -51.996 -47.923 -29.366 1.00 182.41 ? 242 C   E OP2   1 
ATOM   9005  O  "O5'" . C   E  1 138 ? -50.685 -49.762 -28.335 1.00 199.67 ? 242 C   E "O5'" 1 
ATOM   9006  C  "C5'" . C   E  1 138 ? -49.642 -50.361 -27.546 1.00 199.13 ? 242 C   E "C5'" 1 
ATOM   9007  C  "C4'" . C   E  1 138 ? -49.391 -51.834 -27.842 1.00 184.72 ? 242 C   E "C4'" 1 
ATOM   9008  O  "O4'" . C   E  1 138 ? -50.532 -52.429 -28.515 1.00 186.75 ? 242 C   E "O4'" 1 
ATOM   9009  C  "C3'" . C   E  1 138 ? -48.181 -52.114 -28.715 1.00 184.85 ? 242 C   E "C3'" 1 
ATOM   9010  O  "O3'" . C   E  1 138 ? -47.371 -53.142 -28.169 1.00 185.54 ? 242 C   E "O3'" 1 
ATOM   9011  C  "C2'" . C   E  1 138 ? -48.763 -52.566 -30.050 1.00 186.71 ? 242 C   E "C2'" 1 
ATOM   9012  O  "O2'" . C   E  1 138 ? -48.008 -53.551 -30.716 1.00 188.15 ? 242 C   E "O2'" 1 
ATOM   9013  C  "C1'" . C   E  1 138 ? -50.123 -53.118 -29.678 1.00 188.21 ? 242 C   E "C1'" 1 
ATOM   9014  N  N1    . C   E  1 138 ? -51.069 -52.768 -30.735 1.00 189.28 ? 242 C   E N1    1 
ATOM   9015  C  C2    . C   E  1 138 ? -52.431 -52.635 -30.504 1.00 190.13 ? 242 C   E C2    1 
ATOM   9016  O  O2    . C   E  1 138 ? -52.908 -52.833 -29.381 1.00 190.07 ? 242 C   E O2    1 
ATOM   9017  N  N3    . C   E  1 138 ? -53.213 -52.265 -31.534 1.00 191.27 ? 242 C   E N3    1 
ATOM   9018  C  C4    . C   E  1 138 ? -52.708 -52.056 -32.745 1.00 191.72 ? 242 C   E C4    1 
ATOM   9019  N  N4    . C   E  1 138 ? -53.561 -51.704 -33.699 1.00 193.22 ? 242 C   E N4    1 
ATOM   9020  C  C5    . C   E  1 138 ? -51.319 -52.179 -33.011 1.00 190.92 ? 242 C   E C5    1 
ATOM   9021  C  C6    . C   E  1 138 ? -50.555 -52.530 -31.978 1.00 189.66 ? 242 C   E C6    1 
ATOM   9022  P  P     . G   E  1 139 ? -45.816 -52.814 -27.932 1.00 186.38 ? 243 G   E P     1 
ATOM   9023  O  OP1   . G   E  1 139 ? -45.070 -54.066 -28.218 1.00 189.02 ? 243 G   E OP1   1 
ATOM   9024  O  OP2   . G   E  1 139 ? -45.703 -52.129 -26.619 1.00 183.21 ? 243 G   E OP2   1 
ATOM   9025  O  "O5'" . G   E  1 139 ? -45.466 -51.795 -29.117 1.00 187.49 ? 243 G   E "O5'" 1 
ATOM   9026  C  "C5'" . G   E  1 139 ? -45.347 -52.263 -30.457 1.00 188.54 ? 243 G   E "C5'" 1 
ATOM   9027  C  "C4'" . G   E  1 139 ? -45.447 -51.155 -31.479 1.00 189.76 ? 243 G   E "C4'" 1 
ATOM   9028  O  "O4'" . G   E  1 139 ? -46.621 -50.340 -31.206 1.00 183.94 ? 243 G   E "O4'" 1 
ATOM   9029  C  "C3'" . G   E  1 139 ? -44.318 -50.143 -31.548 1.00 183.55 ? 243 G   E "C3'" 1 
ATOM   9030  O  "O3'" . G   E  1 139 ? -43.193 -50.600 -32.268 1.00 187.50 ? 243 G   E "O3'" 1 
ATOM   9031  C  "C2'" . G   E  1 139 ? -44.991 -48.953 -32.196 1.00 183.28 ? 243 G   E "C2'" 1 
ATOM   9032  O  "O2'" . G   E  1 139 ? -45.202 -49.204 -33.578 1.00 185.12 ? 243 G   E "O2'" 1 
ATOM   9033  C  "C1'" . G   E  1 139 ? -46.342 -48.986 -31.501 1.00 190.62 ? 243 G   E "C1'" 1 
ATOM   9034  N  N9    . G   E  1 139 ? -46.340 -48.207 -30.236 1.00 193.33 ? 243 G   E N9    1 
ATOM   9035  C  C8    . G   E  1 139 ? -46.892 -48.625 -29.046 1.00 194.76 ? 243 G   E C8    1 
ATOM   9036  N  N7    . G   E  1 139 ? -46.783 -47.756 -28.080 1.00 194.27 ? 243 G   E N7    1 
ATOM   9037  C  C5    . G   E  1 139 ? -46.104 -46.697 -28.648 1.00 178.51 ? 243 G   E C5    1 
ATOM   9038  C  C6    . G   E  1 139 ? -45.701 -45.492 -28.053 1.00 177.30 ? 243 G   E C6    1 
ATOM   9039  O  O6    . G   E  1 139 ? -45.884 -45.145 -26.888 1.00 183.80 ? 243 G   E O6    1 
ATOM   9040  N  N1    . G   E  1 139 ? -45.033 -44.675 -28.950 1.00 177.52 ? 243 G   E N1    1 
ATOM   9041  C  C2    . G   E  1 139 ? -44.797 -44.987 -30.257 1.00 178.79 ? 243 G   E C2    1 
ATOM   9042  N  N2    . G   E  1 139 ? -44.144 -44.066 -30.969 1.00 179.22 ? 243 G   E N2    1 
ATOM   9043  N  N3    . G   E  1 139 ? -45.170 -46.113 -30.827 1.00 179.90 ? 243 G   E N3    1 
ATOM   9044  C  C4    . G   E  1 139 ? -45.821 -46.936 -29.974 1.00 192.77 ? 243 G   E C4    1 
ATOM   9045  P  P     . C   E  1 140 ? -41.749 -50.587 -31.576 1.00 188.67 ? 244 C   E P     1 
ATOM   9046  O  OP1   . C   E  1 140 ? -40.749 -50.865 -32.630 1.00 189.55 ? 244 C   E OP1   1 
ATOM   9047  O  OP2   . C   E  1 140 ? -41.800 -51.425 -30.353 1.00 189.08 ? 244 C   E OP2   1 
ATOM   9048  O  "O5'" . C   E  1 140 ? -41.559 -49.065 -31.150 1.00 187.01 ? 244 C   E "O5'" 1 
ATOM   9049  C  "C5'" . C   E  1 140 ? -41.483 -48.030 -32.122 1.00 186.93 ? 244 C   E "C5'" 1 
ATOM   9050  C  "C4'" . C   E  1 140 ? -40.941 -46.766 -31.513 1.00 187.43 ? 244 C   E "C4'" 1 
ATOM   9051  O  "O4'" . C   E  1 140 ? -41.980 -46.102 -30.749 1.00 186.41 ? 244 C   E "O4'" 1 
ATOM   9052  C  "C3'" . C   E  1 140 ? -39.820 -46.967 -30.509 1.00 187.04 ? 244 C   E "C3'" 1 
ATOM   9053  O  "O3'" . C   E  1 140 ? -38.560 -47.186 -31.118 1.00 189.67 ? 244 C   E "O3'" 1 
ATOM   9054  C  "C2'" . C   E  1 140 ? -39.896 -45.702 -29.666 1.00 187.79 ? 244 C   E "C2'" 1 
ATOM   9055  O  "O2'" . C   E  1 140 ? -39.264 -44.610 -30.318 1.00 192.67 ? 244 C   E "O2'" 1 
ATOM   9056  C  "C1'" . C   E  1 140 ? -41.406 -45.449 -29.637 1.00 185.46 ? 244 C   E "C1'" 1 
ATOM   9057  N  N1    . C   E  1 140 ? -42.045 -45.938 -28.394 1.00 181.77 ? 244 C   E N1    1 
ATOM   9058  C  C2    . C   E  1 140 ? -41.985 -45.084 -27.306 1.00 184.61 ? 244 C   E C2    1 
ATOM   9059  O  O2    . C   E  1 140 ? -41.388 -44.008 -27.429 1.00 182.84 ? 244 C   E O2    1 
ATOM   9060  N  N3    . C   E  1 140 ? -42.549 -45.443 -26.134 1.00 190.99 ? 244 C   E N3    1 
ATOM   9061  C  C4    . C   E  1 140 ? -43.175 -46.616 -26.020 1.00 177.33 ? 244 C   E C4    1 
ATOM   9062  N  N4    . C   E  1 140 ? -43.721 -46.914 -24.834 1.00 177.14 ? 244 C   E N4    1 
ATOM   9063  C  C5    . C   E  1 140 ? -43.270 -47.505 -27.127 1.00 179.81 ? 244 C   E C5    1 
ATOM   9064  C  C6    . C   E  1 140 ? -42.703 -47.129 -28.287 1.00 180.65 ? 244 C   E C6    1 
ATOM   9065  P  P     . G   E  1 141 ? -37.250 -47.433 -30.215 1.00 188.07 ? 245 G   E P     1 
ATOM   9066  O  OP1   . G   E  1 141 ? -36.231 -48.097 -31.060 1.00 190.15 ? 245 G   E OP1   1 
ATOM   9067  O  OP2   . G   E  1 141 ? -37.676 -48.083 -28.949 1.00 189.85 ? 245 G   E OP2   1 
ATOM   9068  O  "O5'" . G   E  1 141 ? -36.714 -45.968 -29.883 1.00 189.08 ? 245 G   E "O5'" 1 
ATOM   9069  C  "C5'" . G   E  1 141 ? -35.735 -45.767 -28.876 1.00 188.55 ? 245 G   E "C5'" 1 
ATOM   9070  C  "C4'" . G   E  1 141 ? -35.773 -44.367 -28.314 1.00 186.50 ? 245 G   E "C4'" 1 
ATOM   9071  O  "O4'" . G   E  1 141 ? -37.143 -43.953 -28.106 1.00 181.75 ? 245 G   E "O4'" 1 
ATOM   9072  C  "C3'" . G   E  1 141 ? -35.123 -44.226 -26.951 1.00 187.50 ? 245 G   E "C3'" 1 
ATOM   9073  O  "O3'" . G   E  1 141 ? -33.723 -44.043 -27.034 1.00 193.39 ? 245 G   E "O3'" 1 
ATOM   9074  C  "C2'" . G   E  1 141 ? -35.845 -43.035 -26.344 1.00 182.43 ? 245 G   E "C2'" 1 
ATOM   9075  O  "O2'" . G   E  1 141 ? -35.283 -41.828 -26.825 1.00 183.33 ? 245 G   E "O2'" 1 
ATOM   9076  C  "C1'" . G   E  1 141 ? -37.245 -43.187 -26.930 1.00 181.70 ? 245 G   E "C1'" 1 
ATOM   9077  N  N9    . G   E  1 141 ? -38.166 -43.893 -26.028 1.00 182.84 ? 245 G   E N9    1 
ATOM   9078  C  C8    . G   E  1 141 ? -38.809 -45.056 -26.347 1.00 183.47 ? 245 G   E C8    1 
ATOM   9079  N  N7    . G   E  1 141 ? -39.586 -45.494 -25.402 1.00 184.01 ? 245 G   E N7    1 
ATOM   9080  C  C5    . G   E  1 141 ? -39.455 -44.559 -24.395 1.00 185.77 ? 245 G   E C5    1 
ATOM   9081  C  C6    . G   E  1 141 ? -40.069 -44.515 -23.122 1.00 186.78 ? 245 G   E C6    1 
ATOM   9082  O  O6    . G   E  1 141 ? -40.867 -45.313 -22.616 1.00 188.87 ? 245 G   E O6    1 
ATOM   9083  N  N1    . G   E  1 141 ? -39.661 -43.401 -22.408 1.00 187.91 ? 245 G   E N1    1 
ATOM   9084  C  C2    . G   E  1 141 ? -38.782 -42.451 -22.858 1.00 187.92 ? 245 G   E C2    1 
ATOM   9085  N  N2    . G   E  1 141 ? -38.524 -41.448 -22.005 1.00 187.43 ? 245 G   E N2    1 
ATOM   9086  N  N3    . G   E  1 141 ? -38.199 -42.484 -24.046 1.00 187.84 ? 245 G   E N3    1 
ATOM   9087  C  C4    . G   E  1 141 ? -38.579 -43.560 -24.761 1.00 185.79 ? 245 G   E C4    1 
ATOM   9088  P  P     . C   E  1 142 ? -32.741 -44.980 -26.180 1.00 197.13 ? 246 C   E P     1 
ATOM   9089  O  OP1   . C   E  1 142 ? -31.347 -44.696 -26.612 1.00 203.74 ? 246 C   E OP1   1 
ATOM   9090  O  OP2   . C   E  1 142 ? -33.272 -46.368 -26.236 1.00 194.36 ? 246 C   E OP2   1 
ATOM   9091  O  "O5'" . C   E  1 142 ? -32.897 -44.396 -24.709 1.00 194.56 ? 246 C   E "O5'" 1 
ATOM   9092  C  "C5'" . C   E  1 142 ? -32.839 -42.997 -24.494 1.00 191.70 ? 246 C   E "C5'" 1 
ATOM   9093  C  "C4'" . C   E  1 142 ? -33.469 -42.614 -23.185 1.00 189.08 ? 246 C   E "C4'" 1 
ATOM   9094  O  "O4'" . C   E  1 142 ? -34.909 -42.750 -23.250 1.00 186.66 ? 246 C   E "O4'" 1 
ATOM   9095  C  "C3'" . C   E  1 142 ? -33.080 -43.449 -21.985 1.00 190.82 ? 246 C   E "C3'" 1 
ATOM   9096  O  "O3'" . C   E  1 142 ? -31.816 -43.070 -21.473 1.00 193.50 ? 246 C   E "O3'" 1 
ATOM   9097  C  "C2'" . C   E  1 142 ? -34.225 -43.178 -21.016 1.00 189.82 ? 246 C   E "C2'" 1 
ATOM   9098  O  "O2'" . C   E  1 142 ? -34.036 -41.940 -20.355 1.00 193.19 ? 246 C   E "O2'" 1 
ATOM   9099  C  "C1'" . C   E  1 142 ? -35.413 -43.024 -21.962 1.00 187.47 ? 246 C   E "C1'" 1 
ATOM   9100  N  N1    . C   E  1 142 ? -36.254 -44.230 -21.996 1.00 187.19 ? 246 C   E N1    1 
ATOM   9101  C  C2    . C   E  1 142 ? -37.117 -44.464 -20.916 1.00 188.20 ? 246 C   E C2    1 
ATOM   9102  O  O2    . C   E  1 142 ? -37.152 -43.662 -19.977 1.00 186.00 ? 246 C   E O2    1 
ATOM   9103  N  N3    . C   E  1 142 ? -37.895 -45.560 -20.929 1.00 190.03 ? 246 C   E N3    1 
ATOM   9104  C  C4    . C   E  1 142 ? -37.817 -46.395 -21.963 1.00 192.65 ? 246 C   E C4    1 
ATOM   9105  N  N4    . C   E  1 142 ? -38.601 -47.474 -21.939 1.00 195.24 ? 246 C   E N4    1 
ATOM   9106  C  C5    . C   E  1 142 ? -36.944 -46.174 -23.071 1.00 193.24 ? 246 C   E C5    1 
ATOM   9107  C  C6    . C   E  1 142 ? -36.179 -45.082 -23.053 1.00 189.83 ? 246 C   E C6    1 
ATOM   9108  P  P     . C   E  1 143 ? -30.948 -44.095 -20.601 1.00 197.59 ? 247 C   E P     1 
ATOM   9109  O  OP1   . C   E  1 143 ? -29.704 -43.420 -20.158 1.00 201.88 ? 247 C   E OP1   1 
ATOM   9110  O  OP2   . C   E  1 143 ? -30.873 -45.337 -21.396 1.00 198.01 ? 247 C   E OP2   1 
ATOM   9111  O  "O5'" . C   E  1 143 ? -31.840 -44.335 -19.306 1.00 197.48 ? 247 C   E "O5'" 1 
ATOM   9112  C  "C5'" . C   E  1 143 ? -32.103 -43.252 -18.435 1.00 200.52 ? 247 C   E "C5'" 1 
ATOM   9113  C  "C4'" . C   E  1 143 ? -33.084 -43.603 -17.350 1.00 203.13 ? 247 C   E "C4'" 1 
ATOM   9114  O  "O4'" . C   E  1 143 ? -34.377 -43.973 -17.897 1.00 202.62 ? 247 C   E "O4'" 1 
ATOM   9115  C  "C3'" . C   E  1 143 ? -32.729 -44.776 -16.475 1.00 209.95 ? 247 C   E "C3'" 1 
ATOM   9116  O  "O3'" . C   E  1 143 ? -31.702 -44.468 -15.559 1.00 217.75 ? 247 C   E "O3'" 1 
ATOM   9117  C  "C2'" . C   E  1 143 ? -34.071 -45.122 -15.838 1.00 209.70 ? 247 C   E "C2'" 1 
ATOM   9118  O  "O2'" . C   E  1 143 ? -34.374 -44.228 -14.779 1.00 214.21 ? 247 C   E "O2'" 1 
ATOM   9119  C  "C1'" . C   E  1 143 ? -35.037 -44.840 -16.994 1.00 204.41 ? 247 C   E "C1'" 1 
ATOM   9120  N  N1    . C   E  1 143 ? -35.417 -46.093 -17.680 1.00 208.59 ? 247 C   E N1    1 
ATOM   9121  C  C2    . C   E  1 143 ? -36.393 -46.906 -17.083 1.00 212.08 ? 247 C   E C2    1 
ATOM   9122  O  O2    . C   E  1 143 ? -36.937 -46.532 -16.032 1.00 212.61 ? 247 C   E O2    1 
ATOM   9123  N  N3    . C   E  1 143 ? -36.742 -48.079 -17.673 1.00 213.78 ? 247 C   E N3    1 
ATOM   9124  C  C4    . C   E  1 143 ? -36.148 -48.465 -18.804 1.00 211.88 ? 247 C   E C4    1 
ATOM   9125  N  N4    . C   E  1 143 ? -36.539 -49.627 -19.341 1.00 205.78 ? 247 C   E N4    1 
ATOM   9126  C  C5    . C   E  1 143 ? -35.142 -47.659 -19.421 1.00 214.59 ? 247 C   E C5    1 
ATOM   9127  C  C6    . C   E  1 143 ? -34.804 -46.498 -18.830 1.00 212.38 ? 247 C   E C6    1 
ATOM   9128  P  P     . U   E  1 144 ? -30.595 -45.582 -15.248 1.00 223.30 ? 248 U   E P     1 
ATOM   9129  O  OP1   . U   E  1 144 ? -29.325 -44.927 -14.852 1.00 230.21 ? 248 U   E OP1   1 
ATOM   9130  O  OP2   . U   E  1 144 ? -30.613 -46.554 -16.369 1.00 224.76 ? 248 U   E OP2   1 
ATOM   9131  O  "O5'" . U   E  1 144 ? -31.184 -46.331 -13.982 1.00 223.11 ? 248 U   E "O5'" 1 
ATOM   9132  C  "C5'" . U   E  1 144 ? -31.763 -47.611 -14.108 1.00 221.09 ? 248 U   E "C5'" 1 
ATOM   9133  C  "C4'" . U   E  1 144 ? -32.561 -47.967 -12.882 1.00 221.49 ? 248 U   E "C4'" 1 
ATOM   9134  O  "O4'" . U   E  1 144 ? -33.977 -47.690 -13.091 1.00 219.16 ? 248 U   E "O4'" 1 
ATOM   9135  C  "C3'" . U   E  1 144 ? -32.510 -49.437 -12.505 1.00 220.97 ? 248 U   E "C3'" 1 
ATOM   9136  O  "O3'" . U   E  1 144 ? -31.376 -49.748 -11.723 1.00 220.14 ? 248 U   E "O3'" 1 
ATOM   9137  C  "C2'" . U   E  1 144 ? -33.828 -49.655 -11.773 1.00 220.14 ? 248 U   E "C2'" 1 
ATOM   9138  O  "O2'" . U   E  1 144 ? -33.752 -49.184 -10.435 1.00 221.55 ? 248 U   E "O2'" 1 
ATOM   9139  C  "C1'" . U   E  1 144 ? -34.759 -48.743 -12.564 1.00 216.32 ? 248 U   E "C1'" 1 
ATOM   9140  N  N1    . U   E  1 144 ? -35.491 -49.465 -13.638 1.00 208.44 ? 248 U   E N1    1 
ATOM   9141  C  C2    . U   E  1 144 ? -35.100 -49.461 -14.973 1.00 203.20 ? 248 U   E C2    1 
ATOM   9142  O  O2    . U   E  1 144 ? -34.140 -48.881 -15.432 1.00 203.00 ? 248 U   E O2    1 
ATOM   9143  N  N3    . U   E  1 144 ? -35.900 -50.183 -15.812 1.00 202.76 ? 248 U   E N3    1 
ATOM   9144  C  C4    . U   E  1 144 ? -37.017 -50.902 -15.483 1.00 204.94 ? 248 U   E C4    1 
ATOM   9145  O  O4    . U   E  1 144 ? -37.608 -51.496 -16.377 1.00 207.84 ? 248 U   E O4    1 
ATOM   9146  C  C5    . U   E  1 144 ? -37.367 -50.868 -14.099 1.00 206.94 ? 248 U   E C5    1 
ATOM   9147  C  C6    . U   E  1 144 ? -36.609 -50.168 -13.254 1.00 208.49 ? 248 U   E C6    1 
ATOM   9148  P  P     . A   E  1 145 ? -30.260 -50.730 -12.319 1.00 215.70 ? 249 A   E P     1 
ATOM   9149  O  OP1   . A   E  1 145 ? -28.911 -50.144 -12.104 1.00 217.66 ? 249 A   E OP1   1 
ATOM   9150  O  OP2   . A   E  1 145 ? -30.663 -51.087 -13.702 1.00 215.70 ? 249 A   E OP2   1 
ATOM   9151  O  "O5'" . A   E  1 145 ? -30.450 -52.016 -11.409 1.00 218.23 ? 249 A   E "O5'" 1 
ATOM   9152  C  "C5'" . A   E  1 145 ? -29.405 -52.939 -11.157 1.00 217.12 ? 249 A   E "C5'" 1 
ATOM   9153  C  "C4'" . A   E  1 145 ? -29.982 -54.187 -10.550 1.00 210.04 ? 249 A   E "C4'" 1 
ATOM   9154  O  "O4'" . A   E  1 145 ? -31.178 -54.531 -11.305 1.00 203.77 ? 249 A   E "O4'" 1 
ATOM   9155  C  "C3'" . A   E  1 145 ? -29.075 -55.410 -10.601 1.00 209.83 ? 249 A   E "C3'" 1 
ATOM   9156  O  "O3'" . A   E  1 145 ? -29.321 -56.235 -9.465  1.00 213.46 ? 249 A   E "O3'" 1 
ATOM   9157  C  "C2'" . A   E  1 145 ? -29.546 -56.120 -11.860 1.00 206.22 ? 249 A   E "C2'" 1 
ATOM   9158  O  "O2'" . A   E  1 145 ? -29.285 -57.505 -11.880 1.00 210.58 ? 249 A   E "O2'" 1 
ATOM   9159  C  "C1'" . A   E  1 145 ? -31.044 -55.826 -11.843 1.00 202.78 ? 249 A   E "C1'" 1 
ATOM   9160  N  N9    . A   E  1 145 ? -31.629 -55.860 -13.182 1.00 199.99 ? 249 A   E N9    1 
ATOM   9161  C  C8    . A   E  1 145 ? -31.127 -55.329 -14.341 1.00 198.06 ? 249 A   E C8    1 
ATOM   9162  N  N7    . A   E  1 145 ? -31.860 -55.592 -15.396 1.00 196.24 ? 249 A   E N7    1 
ATOM   9163  C  C5    . A   E  1 145 ? -32.897 -56.367 -14.904 1.00 197.03 ? 249 A   E C5    1 
ATOM   9164  C  C6    . A   E  1 145 ? -34.002 -56.986 -15.512 1.00 197.78 ? 249 A   E C6    1 
ATOM   9165  N  N6    . A   E  1 145 ? -34.297 -56.905 -16.809 1.00 195.05 ? 249 A   E N6    1 
ATOM   9166  N  N1    . A   E  1 145 ? -34.843 -57.673 -14.716 1.00 203.03 ? 249 A   E N1    1 
ATOM   9167  C  C2    . A   E  1 145 ? -34.572 -57.762 -13.409 1.00 207.77 ? 249 A   E C2    1 
ATOM   9168  N  N3    . A   E  1 145 ? -33.560 -57.240 -12.726 1.00 206.90 ? 249 A   E N3    1 
ATOM   9169  C  C4    . A   E  1 145 ? -32.753 -56.549 -13.543 1.00 201.25 ? 249 A   E C4    1 
ATOM   9170  N  N     . ARG F  2 14  ? -65.102 78.188  -26.318 1.00 188.96 ? 14  ARG F N     1 
ATOM   9171  C  CA    . ARG F  2 14  ? -64.756 77.139  -25.363 1.00 187.23 ? 14  ARG F CA    1 
ATOM   9172  C  C     . ARG F  2 14  ? -65.998 76.666  -24.598 1.00 193.50 ? 14  ARG F C     1 
ATOM   9173  O  O     . ARG F  2 14  ? -65.985 76.545  -23.369 1.00 195.79 ? 14  ARG F O     1 
ATOM   9174  C  CB    . ARG F  2 14  ? -63.646 77.598  -24.405 1.00 182.92 ? 14  ARG F CB    1 
ATOM   9175  C  CG    . ARG F  2 14  ? -62.355 78.019  -25.124 1.00 183.18 ? 14  ARG F CG    1 
ATOM   9176  C  CD    . ARG F  2 14  ? -61.092 77.947  -24.240 1.00 180.85 ? 14  ARG F CD    1 
ATOM   9177  N  NE    . ARG F  2 14  ? -61.125 78.853  -23.089 1.00 196.14 ? 14  ARG F NE    1 
ATOM   9178  C  CZ    . ARG F  2 14  ? -60.055 79.227  -22.384 1.00 195.93 ? 14  ARG F CZ    1 
ATOM   9179  N  NH1   . ARG F  2 14  ? -58.848 78.782  -22.710 1.00 183.02 ? 14  ARG F NH1   1 
ATOM   9180  N  NH2   . ARG F  2 14  ? -60.194 80.053  -21.352 1.00 193.19 ? 14  ARG F NH2   1 
ATOM   9181  N  N     . PHE F  2 15  ? -67.097 76.521  -25.336 1.00 199.74 ? 15  PHE F N     1 
ATOM   9182  C  CA    . PHE F  2 15  ? -68.327 75.916  -24.830 1.00 204.02 ? 15  PHE F CA    1 
ATOM   9183  C  C     . PHE F  2 15  ? -68.161 74.386  -24.796 1.00 198.61 ? 15  PHE F C     1 
ATOM   9184  O  O     . PHE F  2 15  ? -67.513 73.794  -25.665 1.00 194.22 ? 15  PHE F O     1 
ATOM   9185  C  CB    . PHE F  2 15  ? -69.507 76.300  -25.726 1.00 207.77 ? 15  PHE F CB    1 
ATOM   9186  C  CG    . PHE F  2 15  ? -69.817 77.786  -25.760 1.00 214.61 ? 15  PHE F CG    1 
ATOM   9187  C  CD1   . PHE F  2 15  ? -68.938 78.726  -25.235 1.00 218.21 ? 15  PHE F CD1   1 
ATOM   9188  C  CD2   . PHE F  2 15  ? -70.957 78.242  -26.399 1.00 216.91 ? 15  PHE F CD2   1 
ATOM   9189  C  CE1   . PHE F  2 15  ? -69.210 80.075  -25.303 1.00 222.80 ? 15  PHE F CE1   1 
ATOM   9190  C  CE2   . PHE F  2 15  ? -71.232 79.594  -26.473 1.00 219.61 ? 15  PHE F CE2   1 
ATOM   9191  C  CZ    . PHE F  2 15  ? -70.356 80.512  -25.924 1.00 222.82 ? 15  PHE F CZ    1 
ATOM   9192  N  N     . ILE F  2 16  ? -68.762 73.738  -23.788 1.00 196.95 ? 16  ILE F N     1 
ATOM   9193  C  CA    . ILE F  2 16  ? -68.605 72.272  -23.622 1.00 190.52 ? 16  ILE F CA    1 
ATOM   9194  C  C     . ILE F  2 16  ? -69.433 71.485  -24.647 1.00 191.00 ? 16  ILE F C     1 
ATOM   9195  O  O     . ILE F  2 16  ? -70.340 72.013  -25.305 1.00 204.23 ? 16  ILE F O     1 
ATOM   9196  C  CB    . ILE F  2 16  ? -68.933 71.842  -22.181 1.00 188.17 ? 16  ILE F CB    1 
ATOM   9197  C  CG1   . ILE F  2 16  ? -70.391 72.122  -21.811 1.00 191.48 ? 16  ILE F CG1   1 
ATOM   9198  C  CG2   . ILE F  2 16  ? -68.014 72.551  -21.207 1.00 190.90 ? 16  ILE F CG2   1 
ATOM   9199  C  CD1   . ILE F  2 16  ? -71.255 70.887  -21.850 1.00 187.10 ? 16  ILE F CD1   1 
ATOM   9200  N  N     . CYS F  2 17  ? -69.079 70.196  -24.803 1.00 182.65 ? 17  CYS F N     1 
ATOM   9201  C  CA    . CYS F  2 17  ? -69.668 69.297  -25.796 1.00 169.53 ? 17  CYS F CA    1 
ATOM   9202  C  C     . CYS F  2 17  ? -70.498 68.174  -25.182 1.00 149.25 ? 17  CYS F C     1 
ATOM   9203  O  O     . CYS F  2 17  ? -70.201 67.697  -24.088 1.00 146.33 ? 17  CYS F O     1 
ATOM   9204  C  CB    . CYS F  2 17  ? -68.584 68.680  -26.676 1.00 154.37 ? 17  CYS F CB    1 
ATOM   9205  S  SG    . CYS F  2 17  ? -67.719 69.847  -27.718 1.00 161.11 ? 17  CYS F SG    1 
ATOM   9206  N  N     . ILE F  2 18  ? -71.559 67.787  -25.895 1.00 150.34 ? 18  ILE F N     1 
ATOM   9207  C  CA    . ILE F  2 18  ? -72.394 66.618  -25.618 1.00 147.49 ? 18  ILE F CA    1 
ATOM   9208  C  C     . ILE F  2 18  ? -72.717 65.920  -26.930 1.00 145.99 ? 18  ILE F C     1 
ATOM   9209  O  O     . ILE F  2 18  ? -73.294 66.539  -27.828 1.00 150.40 ? 18  ILE F O     1 
ATOM   9210  C  CB    . ILE F  2 18  ? -73.704 67.000  -24.927 1.00 152.25 ? 18  ILE F CB    1 
ATOM   9211  C  CG1   . ILE F  2 18  ? -73.438 67.432  -23.502 1.00 153.09 ? 18  ILE F CG1   1 
ATOM   9212  C  CG2   . ILE F  2 18  ? -74.711 65.894  -25.042 1.00 150.52 ? 18  ILE F CG2   1 
ATOM   9213  C  CD1   . ILE F  2 18  ? -74.662 67.961  -22.836 1.00 172.09 ? 18  ILE F CD1   1 
ATOM   9214  N  N     . TYR F  2 19  ? -72.374 64.569  -27.041 1.00 147.34 ? 19  TYR F N     1 
ATOM   9215  C  CA    . TYR F  2 19  ? -72.754 63.805  -28.231 1.00 138.66 ? 19  TYR F CA    1 
ATOM   9216  C  C     . TYR F  2 19  ? -73.929 62.871  -27.968 1.00 143.42 ? 19  TYR F C     1 
ATOM   9217  O  O     . TYR F  2 19  ? -74.033 62.284  -26.888 1.00 136.07 ? 19  TYR F O     1 
ATOM   9218  C  CB    . TYR F  2 19  ? -71.597 62.948  -28.742 1.00 132.77 ? 19  TYR F CB    1 
ATOM   9219  C  CG    . TYR F  2 19  ? -70.460 63.711  -29.336 1.00 132.92 ? 19  TYR F CG    1 
ATOM   9220  C  CD1   . TYR F  2 19  ? -69.380 64.103  -28.564 1.00 131.24 ? 19  TYR F CD1   1 
ATOM   9221  C  CD2   . TYR F  2 19  ? -70.441 63.990  -30.693 1.00 134.82 ? 19  TYR F CD2   1 
ATOM   9222  C  CE1   . TYR F  2 19  ? -68.333 64.787  -29.125 1.00 131.60 ? 19  TYR F CE1   1 
ATOM   9223  C  CE2   . TYR F  2 19  ? -69.400 64.668  -31.262 1.00 135.15 ? 19  TYR F CE2   1 
ATOM   9224  C  CZ    . TYR F  2 19  ? -68.347 65.066  -30.473 1.00 133.53 ? 19  TYR F CZ    1 
ATOM   9225  O  OH    . TYR F  2 19  ? -67.299 65.750  -31.034 1.00 146.62 ? 19  TYR F OH    1 
ATOM   9226  N  N     . PRO F  2 20  ? -74.752 62.620  -28.998 1.00 145.44 ? 20  PRO F N     1 
ATOM   9227  C  CA    . PRO F  2 20  ? -75.914 61.734  -28.819 1.00 145.75 ? 20  PRO F CA    1 
ATOM   9228  C  C     . PRO F  2 20  ? -75.529 60.397  -28.250 1.00 142.64 ? 20  PRO F C     1 
ATOM   9229  O  O     . PRO F  2 20  ? -76.270 59.846  -27.431 1.00 146.32 ? 20  PRO F O     1 
ATOM   9230  C  CB    . PRO F  2 20  ? -76.462 61.562  -30.237 1.00 147.25 ? 20  PRO F CB    1 
ATOM   9231  C  CG    . PRO F  2 20  ? -75.994 62.740  -30.973 1.00 155.23 ? 20  PRO F CG    1 
ATOM   9232  C  CD    . PRO F  2 20  ? -74.682 63.162  -30.362 1.00 143.16 ? 20  PRO F CD    1 
ATOM   9233  N  N     . ALA F  2 21  ? -74.386 59.853  -28.686 1.00 137.84 ? 21  ALA F N     1 
ATOM   9234  C  CA    . ALA F  2 21  ? -73.951 58.531  -28.243 1.00 131.31 ? 21  ALA F CA    1 
ATOM   9235  C  C     . ALA F  2 21  ? -73.847 58.447  -26.727 1.00 129.69 ? 21  ALA F C     1 
ATOM   9236  O  O     . ALA F  2 21  ? -74.054 57.375  -26.153 1.00 125.56 ? 21  ALA F O     1 
ATOM   9237  C  CB    . ALA F  2 21  ? -72.610 58.179  -28.887 1.00 125.07 ? 21  ALA F CB    1 
ATOM   9238  N  N     . TYR F  2 22  ? -73.528 59.559  -26.062 1.00 125.44 ? 22  TYR F N     1 
ATOM   9239  C  CA    . TYR F  2 22  ? -73.417 59.529  -24.612 1.00 124.55 ? 22  TYR F CA    1 
ATOM   9240  C  C     . TYR F  2 22  ? -74.708 59.036  -23.984 1.00 126.50 ? 22  TYR F C     1 
ATOM   9241  O  O     . TYR F  2 22  ? -74.700 58.583  -22.842 1.00 126.00 ? 22  TYR F O     1 
ATOM   9242  C  CB    . TYR F  2 22  ? -73.052 60.904  -24.064 1.00 127.80 ? 22  TYR F CB    1 
ATOM   9243  C  CG    . TYR F  2 22  ? -71.732 61.480  -24.546 1.00 131.40 ? 22  TYR F CG    1 
ATOM   9244  C  CD1   . TYR F  2 22  ? -70.788 60.707  -25.186 1.00 133.27 ? 22  TYR F CD1   1 
ATOM   9245  C  CD2   . TYR F  2 22  ? -71.440 62.819  -24.365 1.00 134.19 ? 22  TYR F CD2   1 
ATOM   9246  C  CE1   . TYR F  2 22  ? -69.583 61.267  -25.635 1.00 139.62 ? 22  TYR F CE1   1 
ATOM   9247  C  CE2   . TYR F  2 22  ? -70.248 63.376  -24.806 1.00 132.79 ? 22  TYR F CE2   1 
ATOM   9248  C  CZ    . TYR F  2 22  ? -69.325 62.604  -25.441 1.00 124.40 ? 22  TYR F CZ    1 
ATOM   9249  O  OH    . TYR F  2 22  ? -68.144 63.169  -25.870 1.00 123.73 ? 22  TYR F OH    1 
ATOM   9250  N  N     . LEU F  2 23  ? -75.834 59.164  -24.683 1.00 133.93 ? 23  LEU F N     1 
ATOM   9251  C  CA    . LEU F  2 23  ? -77.119 58.727  -24.156 1.00 143.07 ? 23  LEU F CA    1 
ATOM   9252  C  C     . LEU F  2 23  ? -77.730 57.534  -24.879 1.00 149.57 ? 23  LEU F C     1 
ATOM   9253  O  O     . LEU F  2 23  ? -78.856 57.149  -24.541 1.00 157.26 ? 23  LEU F O     1 
ATOM   9254  C  CB    . LEU F  2 23  ? -78.137 59.861  -24.166 1.00 147.26 ? 23  LEU F CB    1 
ATOM   9255  C  CG    . LEU F  2 23  ? -77.626 61.201  -23.711 1.00 141.64 ? 23  LEU F CG    1 
ATOM   9256  C  CD1   . LEU F  2 23  ? -78.801 62.146  -23.718 1.00 154.95 ? 23  LEU F CD1   1 
ATOM   9257  C  CD2   . LEU F  2 23  ? -77.049 61.047  -22.336 1.00 139.18 ? 23  LEU F CD2   1 
ATOM   9258  N  N     . ASN F  2 24  ? -77.051 56.935  -25.859 1.00 156.60 ? 24  ASN F N     1 
ATOM   9259  C  CA    . ASN F  2 24  ? -77.674 55.865  -26.641 1.00 153.58 ? 24  ASN F CA    1 
ATOM   9260  C  C     . ASN F  2 24  ? -77.586 54.546  -25.879 1.00 144.46 ? 24  ASN F C     1 
ATOM   9261  O  O     . ASN F  2 24  ? -76.503 53.965  -25.731 1.00 139.21 ? 24  ASN F O     1 
ATOM   9262  C  CB    . ASN F  2 24  ? -77.023 55.751  -28.014 1.00 155.17 ? 24  ASN F CB    1 
ATOM   9263  C  CG    . ASN F  2 24  ? -77.817 54.877  -28.960 1.00 156.70 ? 24  ASN F CG    1 
ATOM   9264  O  OD1   . ASN F  2 24  ? -79.007 54.636  -28.752 1.00 157.11 ? 24  ASN F OD1   1 
ATOM   9265  N  ND2   . ASN F  2 24  ? -77.171 54.418  -30.019 1.00 155.39 ? 24  ASN F ND2   1 
ATOM   9266  N  N     . ASN F  2 25  ? -78.738 54.046  -25.435 1.00 141.78 ? 25  ASN F N     1 
ATOM   9267  C  CA    . ASN F  2 25  ? -78.769 52.850  -24.607 1.00 134.23 ? 25  ASN F CA    1 
ATOM   9268  C  C     . ASN F  2 25  ? -78.427 51.590  -25.374 1.00 128.71 ? 25  ASN F C     1 
ATOM   9269  O  O     . ASN F  2 25  ? -78.276 50.538  -24.753 1.00 131.24 ? 25  ASN F O     1 
ATOM   9270  C  CB    . ASN F  2 25  ? -80.145 52.711  -23.961 1.00 138.80 ? 25  ASN F CB    1 
ATOM   9271  C  CG    . ASN F  2 25  ? -81.236 52.401  -24.969 1.00 139.84 ? 25  ASN F CG    1 
ATOM   9272  O  OD1   . ASN F  2 25  ? -80.982 52.211  -26.162 1.00 138.89 ? 25  ASN F OD1   1 
ATOM   9273  N  ND2   . ASN F  2 25  ? -82.471 52.383  -24.496 1.00 145.46 ? 25  ASN F ND2   1 
ATOM   9274  N  N     . LYS F  2 26  ? -78.279 51.671  -26.691 1.00 125.91 ? 26  LYS F N     1 
ATOM   9275  C  CA    . LYS F  2 26  ? -77.885 50.527  -27.493 1.00 122.68 ? 26  LYS F CA    1 
ATOM   9276  C  C     . LYS F  2 26  ? -76.412 50.575  -27.835 1.00 119.26 ? 26  LYS F C     1 
ATOM   9277  O  O     . LYS F  2 26  ? -75.948 49.798  -28.677 1.00 117.09 ? 26  LYS F O     1 
ATOM   9278  C  CB    . LYS F  2 26  ? -78.682 50.488  -28.790 1.00 127.82 ? 26  LYS F CB    1 
ATOM   9279  C  CG    . LYS F  2 26  ? -80.159 50.208  -28.665 1.00 138.97 ? 26  LYS F CG    1 
ATOM   9280  C  CD    . LYS F  2 26  ? -80.734 49.989  -30.064 1.00 144.58 ? 26  LYS F CD    1 
ATOM   9281  C  CE    . LYS F  2 26  ? -80.210 51.040  -31.050 1.00 148.86 ? 26  LYS F CE    1 
ATOM   9282  N  NZ    . LYS F  2 26  ? -80.600 50.799  -32.470 1.00 151.13 ? 26  LYS F NZ    1 
ATOM   9283  N  N     . LYS F  2 27  ? -75.670 51.483  -27.214 1.00 122.28 ? 27  LYS F N     1 
ATOM   9284  C  CA    . LYS F  2 27  ? -74.238 51.580  -27.416 1.00 115.96 ? 27  LYS F CA    1 
ATOM   9285  C  C     . LYS F  2 27  ? -73.490 51.203  -26.153 1.00 112.43 ? 27  LYS F C     1 
ATOM   9286  O  O     . LYS F  2 27  ? -73.987 51.353  -25.033 1.00 113.28 ? 27  LYS F O     1 
ATOM   9287  C  CB    . LYS F  2 27  ? -73.820 52.977  -27.866 1.00 118.68 ? 27  LYS F CB    1 
ATOM   9288  C  CG    . LYS F  2 27  ? -74.086 53.197  -29.327 1.00 122.74 ? 27  LYS F CG    1 
ATOM   9289  C  CD    . LYS F  2 27  ? -73.627 54.541  -29.825 1.00 123.67 ? 27  LYS F CD    1 
ATOM   9290  C  CE    . LYS F  2 27  ? -74.091 54.702  -31.259 1.00 126.43 ? 27  LYS F CE    1 
ATOM   9291  N  NZ    . LYS F  2 27  ? -73.399 53.727  -32.160 1.00 123.52 ? 27  LYS F NZ    1 
ATOM   9292  N  N     . THR F  2 28  ? -72.286 50.701  -26.367 1.00 112.38 ? 28  THR F N     1 
ATOM   9293  C  CA    . THR F  2 28  ? -71.405 50.265  -25.307 1.00 111.71 ? 28  THR F CA    1 
ATOM   9294  C  C     . THR F  2 28  ? -70.570 51.420  -24.816 1.00 113.56 ? 28  THR F C     1 
ATOM   9295  O  O     . THR F  2 28  ? -70.527 52.484  -25.425 1.00 123.88 ? 28  THR F O     1 
ATOM   9296  C  CB    . THR F  2 28  ? -70.454 49.216  -25.830 1.00 118.18 ? 28  THR F CB    1 
ATOM   9297  O  OG1   . THR F  2 28  ? -69.716 49.808  -26.906 1.00 117.77 ? 28  THR F OG1   1 
ATOM   9298  C  CG2   . THR F  2 28  ? -71.235 48.039  -26.357 1.00 129.32 ? 28  THR F CG2   1 
ATOM   9299  N  N     . ILE F  2 29  ? -69.801 51.164  -23.764 1.00 102.87 ? 29  ILE F N     1 
ATOM   9300  C  CA    . ILE F  2 29  ? -68.893 52.183  -23.258 1.00 116.85 ? 29  ILE F CA    1 
ATOM   9301  C  C     . ILE F  2 29  ? -67.852 52.525  -24.315 1.00 102.79 ? 29  ILE F C     1 
ATOM   9302  O  O     . ILE F  2 29  ? -67.505 53.693  -24.511 1.00 106.18 ? 29  ILE F O     1 
ATOM   9303  C  CB    . ILE F  2 29  ? -68.239 51.714  -21.950 1.00 115.57 ? 29  ILE F CB    1 
ATOM   9304  C  CG1   . ILE F  2 29  ? -69.269 51.719  -20.824 1.00 117.19 ? 29  ILE F CG1   1 
ATOM   9305  C  CG2   . ILE F  2 29  ? -67.097 52.648  -21.580 1.00 100.59 ? 29  ILE F CG2   1 
ATOM   9306  C  CD1   . ILE F  2 29  ? -68.701 51.339  -19.479 1.00 113.12 ? 29  ILE F CD1   1 
ATOM   9307  N  N     . ALA F  2 30  ? -67.327 51.520  -25.010 1.00 99.60  ? 30  ALA F N     1 
ATOM   9308  C  CA    . ALA F  2 30  ? -66.393 51.830  -26.087 1.00 116.37 ? 30  ALA F CA    1 
ATOM   9309  C  C     . ALA F  2 30  ? -67.062 52.618  -27.197 1.00 103.46 ? 30  ALA F C     1 
ATOM   9310  O  O     . ALA F  2 30  ? -66.408 53.426  -27.855 1.00 104.92 ? 30  ALA F O     1 
ATOM   9311  C  CB    . ALA F  2 30  ? -65.769 50.556  -26.655 1.00 115.52 ? 30  ALA F CB    1 
ATOM   9312  N  N     . GLU F  2 31  ? -68.356 52.416  -27.407 1.00 129.75 ? 31  GLU F N     1 
ATOM   9313  C  CA    . GLU F  2 31  ? -69.066 53.142  -28.451 1.00 134.77 ? 31  GLU F CA    1 
ATOM   9314  C  C     . GLU F  2 31  ? -69.485 54.557  -28.048 1.00 141.15 ? 31  GLU F C     1 
ATOM   9315  O  O     . GLU F  2 31  ? -70.014 55.287  -28.894 1.00 146.42 ? 31  GLU F O     1 
ATOM   9316  C  CB    . GLU F  2 31  ? -70.279 52.328  -28.905 1.00 139.72 ? 31  GLU F CB    1 
ATOM   9317  C  CG    . GLU F  2 31  ? -69.883 51.103  -29.721 1.00 140.23 ? 31  GLU F CG    1 
ATOM   9318  C  CD    . GLU F  2 31  ? -71.013 50.108  -29.875 1.00 140.88 ? 31  GLU F CD    1 
ATOM   9319  O  OE1   . GLU F  2 31  ? -71.806 49.975  -28.916 1.00 143.02 ? 31  GLU F OE1   1 
ATOM   9320  O  OE2   . GLU F  2 31  ? -71.104 49.463  -30.949 1.00 136.96 ? 31  GLU F OE2   1 
ATOM   9321  N  N     . GLY F  2 32  ? -69.269 54.962  -26.796 1.00 140.44 ? 32  GLY F N     1 
ATOM   9322  C  CA    . GLY F  2 32  ? -69.491 56.335  -26.356 1.00 143.50 ? 32  GLY F CA    1 
ATOM   9323  C  C     . GLY F  2 32  ? -70.494 56.551  -25.235 1.00 146.56 ? 32  GLY F C     1 
ATOM   9324  O  O     . GLY F  2 32  ? -70.556 57.667  -24.702 1.00 141.47 ? 32  GLY F O     1 
ATOM   9325  N  N     . ARG F  2 33  ? -71.289 55.566  -24.842 1.00 118.05 ? 33  ARG F N     1 
ATOM   9326  C  CA    . ARG F  2 33  ? -72.263 55.778  -23.780 1.00 120.30 ? 33  ARG F CA    1 
ATOM   9327  C  C     . ARG F  2 33  ? -71.547 56.116  -22.474 1.00 129.09 ? 33  ARG F C     1 
ATOM   9328  O  O     . ARG F  2 33  ? -70.501 55.549  -22.162 1.00 115.51 ? 33  ARG F O     1 
ATOM   9329  C  CB    . ARG F  2 33  ? -73.138 54.537  -23.630 1.00 118.81 ? 33  ARG F CB    1 
ATOM   9330  C  CG    . ARG F  2 33  ? -74.183 54.604  -22.537 1.00 121.09 ? 33  ARG F CG    1 
ATOM   9331  C  CD    . ARG F  2 33  ? -75.084 53.396  -22.674 1.00 127.84 ? 33  ARG F CD    1 
ATOM   9332  N  NE    . ARG F  2 33  ? -74.270 52.188  -22.622 1.00 124.83 ? 33  ARG F NE    1 
ATOM   9333  C  CZ    . ARG F  2 33  ? -73.749 51.685  -21.506 1.00 127.30 ? 33  ARG F CZ    1 
ATOM   9334  N  NH1   . ARG F  2 33  ? -73.975 52.260  -20.335 1.00 125.65 ? 33  ARG F NH1   1 
ATOM   9335  N  NH2   . ARG F  2 33  ? -73.003 50.596  -21.559 1.00 130.92 ? 33  ARG F NH2   1 
ATOM   9336  N  N     . ARG F  2 34  ? -72.077 57.104  -21.747 1.00 132.37 ? 34  ARG F N     1 
ATOM   9337  C  CA    . ARG F  2 34  ? -71.466 57.618  -20.522 1.00 136.47 ? 34  ARG F CA    1 
ATOM   9338  C  C     . ARG F  2 34  ? -72.286 57.409  -19.256 1.00 138.95 ? 34  ARG F C     1 
ATOM   9339  O  O     . ARG F  2 34  ? -71.784 57.696  -18.162 1.00 136.29 ? 34  ARG F O     1 
ATOM   9340  C  CB    . ARG F  2 34  ? -71.203 59.126  -20.662 1.00 147.80 ? 34  ARG F CB    1 
ATOM   9341  C  CG    . ARG F  2 34  ? -70.163 59.504  -21.684 1.00 152.85 ? 34  ARG F CG    1 
ATOM   9342  C  CD    . ARG F  2 34  ? -68.787 59.168  -21.164 1.00 149.82 ? 34  ARG F CD    1 
ATOM   9343  N  NE    . ARG F  2 34  ? -67.783 60.062  -21.726 1.00 151.01 ? 34  ARG F NE    1 
ATOM   9344  C  CZ    . ARG F  2 34  ? -67.206 59.882  -22.909 1.00 152.87 ? 34  ARG F CZ    1 
ATOM   9345  N  NH1   . ARG F  2 34  ? -67.529 58.832  -23.655 1.00 151.43 ? 34  ARG F NH1   1 
ATOM   9346  N  NH2   . ARG F  2 34  ? -66.303 60.749  -23.345 1.00 156.36 ? 34  ARG F NH2   1 
ATOM   9347  N  N     . ILE F  2 35  ? -73.531 56.967  -19.369 1.00 149.41 ? 35  ILE F N     1 
ATOM   9348  C  CA    . ILE F  2 35  ? -74.417 56.848  -18.214 1.00 150.10 ? 35  ILE F CA    1 
ATOM   9349  C  C     . ILE F  2 35  ? -74.879 55.402  -18.115 1.00 145.27 ? 35  ILE F C     1 
ATOM   9350  O  O     . ILE F  2 35  ? -74.828 54.646  -19.100 1.00 142.26 ? 35  ILE F O     1 
ATOM   9351  C  CB    . ILE F  2 35  ? -75.631 57.798  -18.319 1.00 158.67 ? 35  ILE F CB    1 
ATOM   9352  C  CG1   . ILE F  2 35  ? -76.345 57.584  -19.649 1.00 163.19 ? 35  ILE F CG1   1 
ATOM   9353  C  CG2   . ILE F  2 35  ? -75.195 59.229  -18.140 1.00 162.67 ? 35  ILE F CG2   1 
ATOM   9354  C  CD1   . ILE F  2 35  ? -77.616 58.366  -19.792 1.00 172.38 ? 35  ILE F CD1   1 
ATOM   9355  N  N     . PRO F  2 36  ? -75.342 54.987  -16.939 1.00 145.90 ? 36  PRO F N     1 
ATOM   9356  C  CA    . PRO F  2 36  ? -75.882 53.632  -16.785 1.00 140.28 ? 36  PRO F CA    1 
ATOM   9357  C  C     . PRO F  2 36  ? -77.026 53.355  -17.748 1.00 140.81 ? 36  PRO F C     1 
ATOM   9358  O  O     . PRO F  2 36  ? -77.816 54.243  -18.079 1.00 139.06 ? 36  PRO F O     1 
ATOM   9359  C  CB    . PRO F  2 36  ? -76.373 53.615  -15.336 1.00 138.55 ? 36  PRO F CB    1 
ATOM   9360  C  CG    . PRO F  2 36  ? -76.431 55.077  -14.932 1.00 138.78 ? 36  PRO F CG    1 
ATOM   9361  C  CD    . PRO F  2 36  ? -75.324 55.717  -15.668 1.00 127.68 ? 36  PRO F CD    1 
ATOM   9362  N  N     . ILE F  2 37  ? -77.116 52.087  -18.178 1.00 140.82 ? 37  ILE F N     1 
ATOM   9363  C  CA    . ILE F  2 37  ? -78.136 51.678  -19.147 1.00 144.33 ? 37  ILE F CA    1 
ATOM   9364  C  C     . ILE F  2 37  ? -79.536 51.918  -18.599 1.00 153.18 ? 37  ILE F C     1 
ATOM   9365  O  O     . ILE F  2 37  ? -80.468 52.226  -19.353 1.00 160.54 ? 37  ILE F O     1 
ATOM   9366  C  CB    . ILE F  2 37  ? -77.925 50.216  -19.577 1.00 135.35 ? 37  ILE F CB    1 
ATOM   9367  C  CG1   . ILE F  2 37  ? -76.683 50.136  -20.442 1.00 132.64 ? 37  ILE F CG1   1 
ATOM   9368  C  CG2   . ILE F  2 37  ? -79.104 49.708  -20.391 1.00 133.64 ? 37  ILE F CG2   1 
ATOM   9369  C  CD1   . ILE F  2 37  ? -76.144 48.770  -20.563 1.00 129.57 ? 37  ILE F CD1   1 
ATOM   9370  N  N     . SER F  2 38  ? -79.712 51.767  -17.289 1.00 147.65 ? 38  SER F N     1 
ATOM   9371  C  CA    . SER F  2 38  ? -81.029 51.977  -16.701 1.00 152.12 ? 38  SER F CA    1 
ATOM   9372  C  C     . SER F  2 38  ? -81.574 53.368  -17.032 1.00 160.04 ? 38  SER F C     1 
ATOM   9373  O  O     . SER F  2 38  ? -82.778 53.534  -17.272 1.00 162.99 ? 38  SER F O     1 
ATOM   9374  C  CB    . SER F  2 38  ? -80.953 51.740  -15.193 1.00 149.17 ? 38  SER F CB    1 
ATOM   9375  O  OG    . SER F  2 38  ? -79.904 52.495  -14.613 1.00 146.66 ? 38  SER F OG    1 
ATOM   9376  N  N     . LYS F  2 39  ? -80.701 54.377  -17.079 1.00 159.52 ? 39  LYS F N     1 
ATOM   9377  C  CA    . LYS F  2 39  ? -81.124 55.745  -17.354 1.00 157.83 ? 39  LYS F CA    1 
ATOM   9378  C  C     . LYS F  2 39  ? -80.974 56.160  -18.810 1.00 152.40 ? 39  LYS F C     1 
ATOM   9379  O  O     . LYS F  2 39  ? -81.597 57.146  -19.218 1.00 155.99 ? 39  LYS F O     1 
ATOM   9380  C  CB    . LYS F  2 39  ? -80.349 56.720  -16.468 1.00 156.21 ? 39  LYS F CB    1 
ATOM   9381  C  CG    . LYS F  2 39  ? -80.540 56.410  -15.002 1.00 153.61 ? 39  LYS F CG    1 
ATOM   9382  C  CD    . LYS F  2 39  ? -79.751 57.334  -14.128 1.00 151.66 ? 39  LYS F CD    1 
ATOM   9383  C  CE    . LYS F  2 39  ? -79.265 56.584  -12.914 1.00 146.31 ? 39  LYS F CE    1 
ATOM   9384  N  NZ    . LYS F  2 39  ? -78.126 57.283  -12.269 1.00 145.30 ? 39  LYS F NZ    1 
ATOM   9385  N  N     . ALA F  2 40  ? -80.180 55.440  -19.601 1.00 146.60 ? 40  ALA F N     1 
ATOM   9386  C  CA    . ALA F  2 40  ? -80.003 55.806  -20.997 1.00 146.59 ? 40  ALA F CA    1 
ATOM   9387  C  C     . ALA F  2 40  ? -81.295 55.558  -21.772 1.00 152.36 ? 40  ALA F C     1 
ATOM   9388  O  O     . ALA F  2 40  ? -82.210 54.876  -21.305 1.00 155.75 ? 40  ALA F O     1 
ATOM   9389  C  CB    . ALA F  2 40  ? -78.849 55.019  -21.615 1.00 137.78 ? 40  ALA F CB    1 
ATOM   9390  N  N     . VAL F  2 41  ? -81.372 56.142  -22.963 1.00 155.61 ? 41  VAL F N     1 
ATOM   9391  C  CA    . VAL F  2 41  ? -82.558 56.050  -23.797 1.00 147.19 ? 41  VAL F CA    1 
ATOM   9392  C  C     . VAL F  2 41  ? -82.170 55.501  -25.155 1.00 160.22 ? 41  VAL F C     1 
ATOM   9393  O  O     . VAL F  2 41  ? -80.994 55.389  -25.498 1.00 157.85 ? 41  VAL F O     1 
ATOM   9394  C  CB    . VAL F  2 41  ? -83.261 57.400  -23.947 1.00 152.81 ? 41  VAL F CB    1 
ATOM   9395  C  CG1   . VAL F  2 41  ? -83.615 57.923  -22.598 1.00 155.15 ? 41  VAL F CG1   1 
ATOM   9396  C  CG2   . VAL F  2 41  ? -82.339 58.366  -24.656 1.00 152.86 ? 41  VAL F CG2   1 
ATOM   9397  N  N     . GLU F  2 42  ? -83.185 55.169  -25.938 1.00 159.84 ? 42  GLU F N     1 
ATOM   9398  C  CA    . GLU F  2 42  ? -82.974 54.559  -27.240 1.00 163.43 ? 42  GLU F CA    1 
ATOM   9399  C  C     . GLU F  2 42  ? -82.772 55.625  -28.312 1.00 167.83 ? 42  GLU F C     1 
ATOM   9400  O  O     . GLU F  2 42  ? -83.590 56.542  -28.446 1.00 174.17 ? 42  GLU F O     1 
ATOM   9401  C  CB    . GLU F  2 42  ? -84.163 53.664  -27.583 1.00 172.39 ? 42  GLU F CB    1 
ATOM   9402  C  CG    . GLU F  2 42  ? -84.100 53.023  -28.952 1.00 181.10 ? 42  GLU F CG    1 
ATOM   9403  C  CD    . GLU F  2 42  ? -85.249 52.058  -29.196 1.00 185.81 ? 42  GLU F CD    1 
ATOM   9404  O  OE1   . GLU F  2 42  ? -85.626 51.327  -28.257 1.00 185.43 ? 42  GLU F OE1   1 
ATOM   9405  O  OE2   . GLU F  2 42  ? -85.776 52.027  -30.326 1.00 189.77 ? 42  GLU F OE2   1 
ATOM   9406  N  N     . ASN F  2 43  ? -81.689 55.483  -29.092 1.00 166.81 ? 43  ASN F N     1 
ATOM   9407  C  CA    . ASN F  2 43  ? -81.363 56.336  -30.238 1.00 162.86 ? 43  ASN F CA    1 
ATOM   9408  C  C     . ASN F  2 43  ? -81.644 57.825  -30.041 1.00 166.98 ? 43  ASN F C     1 
ATOM   9409  O  O     . ASN F  2 43  ? -82.338 58.422  -30.872 1.00 162.67 ? 43  ASN F O     1 
ATOM   9410  C  CB    . ASN F  2 43  ? -82.113 55.838  -31.473 1.00 155.93 ? 43  ASN F CB    1 
ATOM   9411  C  CG    . ASN F  2 43  ? -81.721 54.434  -31.854 1.00 147.38 ? 43  ASN F CG    1 
ATOM   9412  O  OD1   . ASN F  2 43  ? -80.543 54.095  -31.862 1.00 143.27 ? 43  ASN F OD1   1 
ATOM   9413  N  ND2   . ASN F  2 43  ? -82.705 53.606  -32.160 1.00 146.78 ? 43  ASN F ND2   1 
ATOM   9414  N  N     . PRO F  2 44  ? -81.169 58.454  -28.960 1.00 170.72 ? 44  PRO F N     1 
ATOM   9415  C  CA    . PRO F  2 44  ? -81.375 59.898  -28.814 1.00 178.30 ? 44  PRO F CA    1 
ATOM   9416  C  C     . PRO F  2 44  ? -80.636 60.671  -29.893 1.00 186.18 ? 44  PRO F C     1 
ATOM   9417  O  O     . PRO F  2 44  ? -79.527 60.313  -30.298 1.00 184.19 ? 44  PRO F O     1 
ATOM   9418  C  CB    . PRO F  2 44  ? -80.799 60.197  -27.427 1.00 173.76 ? 44  PRO F CB    1 
ATOM   9419  C  CG    . PRO F  2 44  ? -79.698 59.225  -27.316 1.00 168.16 ? 44  PRO F CG    1 
ATOM   9420  C  CD    . PRO F  2 44  ? -80.277 57.952  -27.899 1.00 167.02 ? 44  PRO F CD    1 
ATOM   9421  N  N     . THR F  2 45  ? -81.256 61.758  -30.342 1.00 197.19 ? 45  THR F N     1 
ATOM   9422  C  CA    . THR F  2 45  ? -80.684 62.620  -31.364 1.00 202.09 ? 45  THR F CA    1 
ATOM   9423  C  C     . THR F  2 45  ? -80.370 63.991  -30.777 1.00 214.18 ? 45  THR F C     1 
ATOM   9424  O  O     . THR F  2 45  ? -80.869 64.372  -29.712 1.00 213.53 ? 45  THR F O     1 
ATOM   9425  C  CB    . THR F  2 45  ? -81.621 62.781  -32.570 1.00 206.00 ? 45  THR F CB    1 
ATOM   9426  O  OG1   . THR F  2 45  ? -82.713 63.651  -32.231 1.00 212.63 ? 45  THR F OG1   1 
ATOM   9427  C  CG2   . THR F  2 45  ? -82.167 61.427  -32.992 1.00 205.84 ? 45  THR F CG2   1 
ATOM   9428  N  N     . ALA F  2 46  ? -79.511 64.725  -31.492 1.00 219.70 ? 46  ALA F N     1 
ATOM   9429  C  CA    . ALA F  2 46  ? -79.130 66.059  -31.050 1.00 202.04 ? 46  ALA F CA    1 
ATOM   9430  C  C     . ALA F  2 46  ? -80.341 66.963  -30.960 1.00 223.90 ? 46  ALA F C     1 
ATOM   9431  O  O     . ALA F  2 46  ? -80.401 67.844  -30.091 1.00 177.03 ? 46  ALA F O     1 
ATOM   9432  C  CB    . ALA F  2 46  ? -78.094 66.650  -32.001 1.00 212.46 ? 46  ALA F CB    1 
ATOM   9433  N  N     . THR F  2 47  ? -81.317 66.749  -31.846 1.00 176.79 ? 47  THR F N     1 
ATOM   9434  C  CA    . THR F  2 47  ? -82.531 67.554  -31.838 1.00 182.33 ? 47  THR F CA    1 
ATOM   9435  C  C     . THR F  2 47  ? -83.298 67.382  -30.529 1.00 198.77 ? 47  THR F C     1 
ATOM   9436  O  O     . THR F  2 47  ? -83.703 68.368  -29.894 1.00 203.58 ? 47  THR F O     1 
ATOM   9437  C  CB    . THR F  2 47  ? -83.404 67.157  -33.026 1.00 184.14 ? 47  THR F CB    1 
ATOM   9438  O  OG1   . THR F  2 47  ? -82.697 67.424  -34.242 1.00 183.90 ? 47  THR F OG1   1 
ATOM   9439  C  CG2   . THR F  2 47  ? -84.690 67.953  -33.025 1.00 189.97 ? 47  THR F CG2   1 
ATOM   9440  N  N     . GLU F  2 48  ? -83.483 66.131  -30.095 1.00 191.33 ? 48  GLU F N     1 
ATOM   9441  C  CA    . GLU F  2 48  ? -84.186 65.873  -28.839 1.00 194.33 ? 48  GLU F CA    1 
ATOM   9442  C  C     . GLU F  2 48  ? -83.425 66.439  -27.646 1.00 196.43 ? 48  GLU F C     1 
ATOM   9443  O  O     . GLU F  2 48  ? -84.028 67.040  -26.742 1.00 201.83 ? 48  GLU F O     1 
ATOM   9444  C  CB    . GLU F  2 48  ? -84.424 64.371  -28.674 1.00 193.85 ? 48  GLU F CB    1 
ATOM   9445  C  CG    . GLU F  2 48  ? -85.393 63.800  -29.697 1.00 198.19 ? 48  GLU F CG    1 
ATOM   9446  C  CD    . GLU F  2 48  ? -84.898 62.522  -30.352 1.00 192.87 ? 48  GLU F CD    1 
ATOM   9447  O  OE1   . GLU F  2 48  ? -84.592 61.543  -29.630 1.00 187.14 ? 48  GLU F OE1   1 
ATOM   9448  O  OE2   . GLU F  2 48  ? -84.816 62.508  -31.600 1.00 194.69 ? 48  GLU F OE2   1 
ATOM   9449  N  N     . ILE F  2 49  ? -82.097 66.281  -27.642 1.00 194.26 ? 49  ILE F N     1 
ATOM   9450  C  CA    . ILE F  2 49  ? -81.295 66.833  -26.556 1.00 187.63 ? 49  ILE F CA    1 
ATOM   9451  C  C     . ILE F  2 49  ? -81.531 68.327  -26.459 1.00 189.98 ? 49  ILE F C     1 
ATOM   9452  O  O     . ILE F  2 49  ? -81.832 68.850  -25.382 1.00 183.16 ? 49  ILE F O     1 
ATOM   9453  C  CB    . ILE F  2 49  ? -79.804 66.534  -26.777 1.00 181.81 ? 49  ILE F CB    1 
ATOM   9454  C  CG1   . ILE F  2 49  ? -79.525 65.038  -26.649 1.00 182.45 ? 49  ILE F CG1   1 
ATOM   9455  C  CG2   . ILE F  2 49  ? -78.950 67.378  -25.824 1.00 183.01 ? 49  ILE F CG2   1 
ATOM   9456  C  CD1   . ILE F  2 49  ? -78.092 64.679  -26.976 1.00 160.56 ? 49  ILE F CD1   1 
ATOM   9457  N  N     . GLN F  2 50  ? -81.447 69.029  -27.599 1.00 189.63 ? 50  GLN F N     1 
ATOM   9458  C  CA    . GLN F  2 50  ? -81.685 70.471  -27.602 1.00 192.71 ? 50  GLN F CA    1 
ATOM   9459  C  C     . GLN F  2 50  ? -83.071 70.808  -27.072 1.00 196.93 ? 50  GLN F C     1 
ATOM   9460  O  O     . GLN F  2 50  ? -83.221 71.729  -26.262 1.00 202.48 ? 50  GLN F O     1 
ATOM   9461  C  CB    . GLN F  2 50  ? -81.521 71.058  -29.006 1.00 193.21 ? 50  GLN F CB    1 
ATOM   9462  C  CG    . GLN F  2 50  ? -82.136 72.460  -29.145 1.00 196.25 ? 50  GLN F CG    1 
ATOM   9463  C  CD    . GLN F  2 50  ? -82.292 72.912  -30.580 1.00 198.46 ? 50  GLN F CD    1 
ATOM   9464  O  OE1   . GLN F  2 50  ? -81.539 73.759  -31.054 1.00 199.63 ? 50  GLN F OE1   1 
ATOM   9465  N  NE2   . GLN F  2 50  ? -83.283 72.361  -31.277 1.00 199.33 ? 50  GLN F NE2   1 
ATOM   9466  N  N     . ASP F  2 51  ? -84.097 70.072  -27.507 1.00 196.80 ? 51  ASP F N     1 
ATOM   9467  C  CA    . ASP F  2 51  ? -85.449 70.405  -27.068 1.00 205.17 ? 51  ASP F CA    1 
ATOM   9468  C  C     . ASP F  2 51  ? -85.592 70.279  -25.558 1.00 212.85 ? 51  ASP F C     1 
ATOM   9469  O  O     . ASP F  2 51  ? -86.150 71.167  -24.905 1.00 220.30 ? 51  ASP F O     1 
ATOM   9470  C  CB    . ASP F  2 51  ? -86.482 69.528  -27.771 1.00 202.89 ? 51  ASP F CB    1 
ATOM   9471  C  CG    . ASP F  2 51  ? -86.677 69.907  -29.213 1.00 204.49 ? 51  ASP F CG    1 
ATOM   9472  O  OD1   . ASP F  2 51  ? -86.104 70.930  -29.637 1.00 210.41 ? 51  ASP F OD1   1 
ATOM   9473  O  OD2   . ASP F  2 51  ? -87.430 69.195  -29.912 1.00 201.01 ? 51  ASP F OD2   1 
ATOM   9474  N  N     . VAL F  2 52  ? -85.072 69.194  -24.980 1.00 212.34 ? 52  VAL F N     1 
ATOM   9475  C  CA    . VAL F  2 52  ? -85.247 68.989  -23.542 1.00 213.60 ? 52  VAL F CA    1 
ATOM   9476  C  C     . VAL F  2 52  ? -84.359 69.907  -22.705 1.00 211.03 ? 52  VAL F C     1 
ATOM   9477  O  O     . VAL F  2 52  ? -84.755 70.328  -21.611 1.00 211.29 ? 52  VAL F O     1 
ATOM   9478  C  CB    . VAL F  2 52  ? -85.022 67.512  -23.198 1.00 216.08 ? 52  VAL F CB    1 
ATOM   9479  C  CG1   . VAL F  2 52  ? -86.077 66.674  -23.875 1.00 218.73 ? 52  VAL F CG1   1 
ATOM   9480  C  CG2   . VAL F  2 52  ? -83.641 67.074  -23.654 1.00 215.45 ? 52  VAL F CG2   1 
ATOM   9481  N  N     . CYS F  2 53  ? -83.143 70.200  -23.161 1.00 208.58 ? 53  CYS F N     1 
ATOM   9482  C  CA    . CYS F  2 53  ? -82.292 71.088  -22.376 1.00 211.56 ? 53  CYS F CA    1 
ATOM   9483  C  C     . CYS F  2 53  ? -82.718 72.546  -22.528 1.00 215.95 ? 53  CYS F C     1 
ATOM   9484  O  O     . CYS F  2 53  ? -82.367 73.380  -21.687 1.00 220.63 ? 53  CYS F O     1 
ATOM   9485  C  CB    . CYS F  2 53  ? -80.811 70.882  -22.723 1.00 210.48 ? 53  CYS F CB    1 
ATOM   9486  S  SG    . CYS F  2 53  ? -80.359 71.040  -24.436 1.00 217.40 ? 53  CYS F SG    1 
ATOM   9487  N  N     . SER F  2 54  ? -83.431 72.883  -23.610 1.00 214.22 ? 54  SER F N     1 
ATOM   9488  C  CA    . SER F  2 54  ? -83.886 74.259  -23.808 1.00 212.94 ? 54  SER F CA    1 
ATOM   9489  C  C     . SER F  2 54  ? -84.730 74.750  -22.641 1.00 214.13 ? 54  SER F C     1 
ATOM   9490  O  O     . SER F  2 54  ? -84.643 75.919  -22.251 1.00 216.92 ? 54  SER F O     1 
ATOM   9491  C  CB    . SER F  2 54  ? -84.683 74.373  -25.109 1.00 212.60 ? 54  SER F CB    1 
ATOM   9492  O  OG    . SER F  2 54  ? -86.057 74.095  -24.892 1.00 212.86 ? 54  SER F OG    1 
ATOM   9493  N  N     . ALA F  2 55  ? -85.539 73.865  -22.060 1.00 212.85 ? 55  ALA F N     1 
ATOM   9494  C  CA    . ALA F  2 55  ? -86.415 74.254  -20.959 1.00 218.16 ? 55  ALA F CA    1 
ATOM   9495  C  C     . ALA F  2 55  ? -85.632 74.707  -19.732 1.00 220.46 ? 55  ALA F C     1 
ATOM   9496  O  O     . ALA F  2 55  ? -86.100 75.564  -18.977 1.00 224.17 ? 55  ALA F O     1 
ATOM   9497  C  CB    . ALA F  2 55  ? -87.339 73.091  -20.593 1.00 215.17 ? 55  ALA F CB    1 
ATOM   9498  N  N     . VAL F  2 56  ? -84.440 74.157  -19.520 1.00 221.71 ? 56  VAL F N     1 
ATOM   9499  C  CA    . VAL F  2 56  ? -83.666 74.400  -18.305 1.00 224.37 ? 56  VAL F CA    1 
ATOM   9500  C  C     . VAL F  2 56  ? -82.794 75.644  -18.428 1.00 223.85 ? 56  VAL F C     1 
ATOM   9501  O  O     . VAL F  2 56  ? -82.029 75.984  -17.517 1.00 214.54 ? 56  VAL F O     1 
ATOM   9502  C  CB    . VAL F  2 56  ? -82.818 73.154  -17.969 1.00 225.79 ? 56  VAL F CB    1 
ATOM   9503  C  CG1   . VAL F  2 56  ? -81.519 73.110  -18.790 1.00 221.62 ? 56  VAL F CG1   1 
ATOM   9504  C  CG2   . VAL F  2 56  ? -82.545 73.064  -16.473 1.00 231.71 ? 56  VAL F CG2   1 
ATOM   9505  N  N     . GLY F  2 57  ? -82.960 76.377  -19.513 1.00 221.33 ? 57  GLY F N     1 
ATOM   9506  C  CA    . GLY F  2 57  ? -82.131 77.540  -19.716 1.00 229.13 ? 57  GLY F CA    1 
ATOM   9507  C  C     . GLY F  2 57  ? -81.071 77.152  -20.714 1.00 229.59 ? 57  GLY F C     1 
ATOM   9508  O  O     . GLY F  2 57  ? -80.039 76.568  -20.368 1.00 208.95 ? 57  GLY F O     1 
ATOM   9509  N  N     . LEU F  2 58  ? -81.357 77.459  -21.977 1.00 230.21 ? 58  LEU F N     1 
ATOM   9510  C  CA    . LEU F  2 58  ? -80.544 77.012  -23.102 1.00 227.51 ? 58  LEU F CA    1 
ATOM   9511  C  C     . LEU F  2 58  ? -79.537 78.085  -23.511 1.00 232.60 ? 58  LEU F C     1 
ATOM   9512  O  O     . LEU F  2 58  ? -79.671 78.756  -24.535 1.00 235.85 ? 58  LEU F O     1 
ATOM   9513  C  CB    . LEU F  2 58  ? -81.429 76.638  -24.282 1.00 226.66 ? 58  LEU F CB    1 
ATOM   9514  C  CG    . LEU F  2 58  ? -80.669 75.584  -25.069 1.00 223.83 ? 58  LEU F CG    1 
ATOM   9515  C  CD1   . LEU F  2 58  ? -80.485 74.434  -24.114 1.00 222.55 ? 58  LEU F CD1   1 
ATOM   9516  C  CD2   . LEU F  2 58  ? -81.365 75.142  -26.347 1.00 223.57 ? 58  LEU F CD2   1 
ATOM   9517  N  N     . ASN F  2 59  ? -78.498 78.229  -22.696 1.00 234.38 ? 59  ASN F N     1 
ATOM   9518  C  CA    . ASN F  2 59  ? -77.300 78.906  -23.180 1.00 227.82 ? 59  ASN F CA    1 
ATOM   9519  C  C     . ASN F  2 59  ? -76.444 77.960  -24.006 1.00 218.91 ? 59  ASN F C     1 
ATOM   9520  O  O     . ASN F  2 59  ? -75.219 77.940  -23.887 1.00 215.07 ? 59  ASN F O     1 
ATOM   9521  C  CB    . ASN F  2 59  ? -76.515 79.496  -22.009 1.00 224.02 ? 59  ASN F CB    1 
ATOM   9522  C  CG    . ASN F  2 59  ? -76.264 78.492  -20.894 1.00 218.40 ? 59  ASN F CG    1 
ATOM   9523  O  OD1   . ASN F  2 59  ? -76.779 78.633  -19.784 1.00 222.29 ? 59  ASN F OD1   1 
ATOM   9524  N  ND2   . ASN F  2 59  ? -75.456 77.483  -21.181 1.00 218.34 ? 59  ASN F ND2   1 
ATOM   9525  N  N     . VAL F  2 60  ? -77.093 77.154  -24.848 1.00 214.75 ? 60  VAL F N     1 
ATOM   9526  C  CA    . VAL F  2 60  ? -76.442 76.110  -25.623 1.00 206.71 ? 60  VAL F CA    1 
ATOM   9527  C  C     . VAL F  2 60  ? -76.975 76.184  -27.044 1.00 201.78 ? 60  VAL F C     1 
ATOM   9528  O  O     . VAL F  2 60  ? -78.073 76.685  -27.296 1.00 203.77 ? 60  VAL F O     1 
ATOM   9529  C  CB    . VAL F  2 60  ? -76.688 74.699  -25.036 1.00 211.40 ? 60  VAL F CB    1 
ATOM   9530  C  CG1   . VAL F  2 60  ? -77.102 74.769  -23.564 1.00 218.17 ? 60  VAL F CG1   1 
ATOM   9531  C  CG2   . VAL F  2 60  ? -77.658 73.898  -25.897 1.00 213.08 ? 60  VAL F CG2   1 
ATOM   9532  N  N     . PHE F  2 61  ? -76.197 75.650  -27.982 1.00 194.10 ? 61  PHE F N     1 
ATOM   9533  C  CA    . PHE F  2 61  ? -76.652 75.581  -29.361 1.00 205.60 ? 61  PHE F CA    1 
ATOM   9534  C  C     . PHE F  2 61  ? -76.201 74.281  -30.002 1.00 197.19 ? 61  PHE F C     1 
ATOM   9535  O  O     . PHE F  2 61  ? -75.181 73.698  -29.618 1.00 191.80 ? 61  PHE F O     1 
ATOM   9536  C  CB    . PHE F  2 61  ? -76.157 76.797  -30.158 1.00 208.84 ? 61  PHE F CB    1 
ATOM   9537  C  CG    . PHE F  2 61  ? -74.664 76.891  -30.265 1.00 204.88 ? 61  PHE F CG    1 
ATOM   9538  C  CD1   . PHE F  2 61  ? -73.972 76.332  -31.327 1.00 208.68 ? 61  PHE F CD1   1 
ATOM   9539  C  CD2   . PHE F  2 61  ? -73.954 77.590  -29.304 1.00 203.95 ? 61  PHE F CD2   1 
ATOM   9540  C  CE1   . PHE F  2 61  ? -72.594 76.444  -31.406 1.00 190.89 ? 61  PHE F CE1   1 
ATOM   9541  C  CE2   . PHE F  2 61  ? -72.587 77.700  -29.374 1.00 203.45 ? 61  PHE F CE2   1 
ATOM   9542  C  CZ    . PHE F  2 61  ? -71.903 77.128  -30.427 1.00 203.79 ? 61  PHE F CZ    1 
ATOM   9543  N  N     . LEU F  2 62  ? -76.985 73.839  -30.983 1.00 197.21 ? 62  LEU F N     1 
ATOM   9544  C  CA    . LEU F  2 62  ? -76.791 72.549  -31.628 1.00 192.87 ? 62  LEU F CA    1 
ATOM   9545  C  C     . LEU F  2 62  ? -76.080 72.702  -32.968 1.00 191.42 ? 62  LEU F C     1 
ATOM   9546  O  O     . LEU F  2 62  ? -76.439 73.559  -33.784 1.00 194.74 ? 62  LEU F O     1 
ATOM   9547  C  CB    . LEU F  2 62  ? -78.122 71.808  -31.804 1.00 195.00 ? 62  LEU F CB    1 
ATOM   9548  C  CG    . LEU F  2 62  ? -79.208 72.015  -32.867 1.00 197.66 ? 62  LEU F CG    1 
ATOM   9549  C  CD1   . LEU F  2 62  ? -78.773 71.604  -34.244 1.00 195.13 ? 62  LEU F CD1   1 
ATOM   9550  C  CD2   . LEU F  2 62  ? -80.379 71.148  -32.492 1.00 199.10 ? 62  LEU F CD2   1 
ATOM   9551  N  N     . GLU F  2 63  ? -75.064 71.870  -33.169 1.00 183.97 ? 63  GLU F N     1 
ATOM   9552  C  CA    . GLU F  2 63  ? -74.352 71.726  -34.432 1.00 178.85 ? 63  GLU F CA    1 
ATOM   9553  C  C     . GLU F  2 63  ? -74.904 70.452  -35.070 1.00 176.20 ? 63  GLU F C     1 
ATOM   9554  O  O     . GLU F  2 63  ? -74.385 69.349  -34.866 1.00 171.48 ? 63  GLU F O     1 
ATOM   9555  C  CB    . GLU F  2 63  ? -72.853 71.642  -34.190 1.00 175.63 ? 63  GLU F CB    1 
ATOM   9556  C  CG    . GLU F  2 63  ? -72.267 72.777  -33.361 1.00 177.94 ? 63  GLU F CG    1 
ATOM   9557  C  CD    . GLU F  2 63  ? -70.753 72.691  -33.243 1.00 179.85 ? 63  GLU F CD    1 
ATOM   9558  O  OE1   . GLU F  2 63  ? -70.203 73.227  -32.262 1.00 176.76 ? 63  GLU F OE1   1 
ATOM   9559  O  OE2   . GLU F  2 63  ? -70.108 72.072  -34.115 1.00 180.51 ? 63  GLU F OE2   1 
ATOM   9560  N  N     . LYS F  2 64  ? -76.002 70.613  -35.813 1.00 149.50 ? 64  LYS F N     1 
ATOM   9561  C  CA    . LYS F  2 64  ? -76.678 69.514  -36.495 1.00 146.95 ? 64  LYS F CA    1 
ATOM   9562  C  C     . LYS F  2 64  ? -75.784 68.797  -37.492 1.00 143.55 ? 64  LYS F C     1 
ATOM   9563  O  O     . LYS F  2 64  ? -76.115 67.691  -37.917 1.00 141.26 ? 64  LYS F O     1 
ATOM   9564  C  CB    . LYS F  2 64  ? -77.925 70.034  -37.220 1.00 148.65 ? 64  LYS F CB    1 
ATOM   9565  C  CG    . LYS F  2 64  ? -77.833 71.509  -37.622 1.00 167.77 ? 64  LYS F CG    1 
ATOM   9566  C  CD    . LYS F  2 64  ? -79.004 71.960  -38.499 1.00 167.21 ? 64  LYS F CD    1 
ATOM   9567  C  CE    . LYS F  2 64  ? -79.244 73.458  -38.416 1.00 157.67 ? 64  LYS F CE    1 
ATOM   9568  N  NZ    . LYS F  2 64  ? -80.397 73.848  -39.263 1.00 159.58 ? 64  LYS F NZ    1 
ATOM   9569  N  N     . ASN F  2 65  ? -74.720 69.432  -37.957 1.00 147.37 ? 65  ASN F N     1 
ATOM   9570  C  CA    . ASN F  2 65  ? -73.942 68.888  -39.058 1.00 148.85 ? 65  ASN F CA    1 
ATOM   9571  C  C     . ASN F  2 65  ? -72.590 68.343  -38.658 1.00 145.18 ? 65  ASN F C     1 
ATOM   9572  O  O     . ASN F  2 65  ? -71.772 68.074  -39.534 1.00 140.36 ? 65  ASN F O     1 
ATOM   9573  C  CB    . ASN F  2 65  ? -73.806 69.924  -40.156 1.00 161.37 ? 65  ASN F CB    1 
ATOM   9574  C  CG    . ASN F  2 65  ? -75.130 70.210  -40.791 1.00 179.19 ? 65  ASN F CG    1 
ATOM   9575  O  OD1   . ASN F  2 65  ? -76.034 69.365  -40.745 1.00 187.32 ? 65  ASN F OD1   1 
ATOM   9576  N  ND2   . ASN F  2 65  ? -75.277 71.393  -41.373 1.00 184.93 ? 65  ASN F ND2   1 
ATOM   9577  N  N     . LYS F  2 66  ? -72.298 68.249  -37.376 1.00 150.70 ? 66  LYS F N     1 
ATOM   9578  C  CA    . LYS F  2 66  ? -71.079 67.588  -36.941 1.00 154.03 ? 66  LYS F CA    1 
ATOM   9579  C  C     . LYS F  2 66  ? -71.412 66.169  -36.475 1.00 164.49 ? 66  LYS F C     1 
ATOM   9580  O  O     . LYS F  2 66  ? -72.473 65.936  -35.887 1.00 174.98 ? 66  LYS F O     1 
ATOM   9581  C  CB    . LYS F  2 66  ? -70.383 68.414  -35.856 1.00 155.73 ? 66  LYS F CB    1 
ATOM   9582  C  CG    . LYS F  2 66  ? -69.985 69.750  -36.451 1.00 157.34 ? 66  LYS F CG    1 
ATOM   9583  C  CD    . LYS F  2 66  ? -68.720 69.660  -37.277 1.00 155.48 ? 66  LYS F CD    1 
ATOM   9584  C  CE    . LYS F  2 66  ? -68.511 70.916  -38.117 1.00 152.85 ? 66  LYS F CE    1 
ATOM   9585  N  NZ    . LYS F  2 66  ? -67.212 70.857  -38.847 1.00 147.98 ? 66  LYS F NZ    1 
ATOM   9586  N  N     . MET F  2 67  ? -70.522 65.211  -36.768 1.00 157.62 ? 67  MET F N     1 
ATOM   9587  C  CA    . MET F  2 67  ? -70.743 63.825  -36.384 1.00 148.26 ? 67  MET F CA    1 
ATOM   9588  C  C     . MET F  2 67  ? -69.633 63.293  -35.490 1.00 140.28 ? 67  MET F C     1 
ATOM   9589  O  O     . MET F  2 67  ? -68.476 63.709  -35.579 1.00 140.77 ? 67  MET F O     1 
ATOM   9590  C  CB    . MET F  2 67  ? -70.848 62.908  -37.588 1.00 152.62 ? 67  MET F CB    1 
ATOM   9591  C  CG    . MET F  2 67  ? -71.837 61.784  -37.362 1.00 162.54 ? 67  MET F CG    1 
ATOM   9592  S  SD    . MET F  2 67  ? -72.212 60.803  -38.825 1.00 169.60 ? 67  MET F SD    1 
ATOM   9593  C  CE    . MET F  2 67  ? -73.312 61.897  -39.717 1.00 174.08 ? 67  MET F CE    1 
ATOM   9594  N  N     . TYR F  2 68  ? -70.003 62.293  -34.690 1.00 141.77 ? 68  TYR F N     1 
ATOM   9595  C  CA    . TYR F  2 68  ? -69.134 61.653  -33.706 1.00 145.91 ? 68  TYR F CA    1 
ATOM   9596  C  C     . TYR F  2 68  ? -68.266 60.572  -34.336 1.00 144.59 ? 68  TYR F C     1 
ATOM   9597  O  O     . TYR F  2 68  ? -68.772 59.720  -35.067 1.00 144.97 ? 68  TYR F O     1 
ATOM   9598  C  CB    . TYR F  2 68  ? -69.999 61.024  -32.622 1.00 149.22 ? 68  TYR F CB    1 
ATOM   9599  C  CG    . TYR F  2 68  ? -69.236 60.535  -31.443 1.00 150.19 ? 68  TYR F CG    1 
ATOM   9600  C  CD1   . TYR F  2 68  ? -68.103 61.196  -31.021 1.00 154.83 ? 68  TYR F CD1   1 
ATOM   9601  C  CD2   . TYR F  2 68  ? -69.661 59.428  -30.731 1.00 152.32 ? 68  TYR F CD2   1 
ATOM   9602  C  CE1   . TYR F  2 68  ? -67.396 60.761  -29.924 1.00 158.94 ? 68  TYR F CE1   1 
ATOM   9603  C  CE2   . TYR F  2 68  ? -68.959 58.979  -29.627 1.00 157.09 ? 68  TYR F CE2   1 
ATOM   9604  C  CZ    . TYR F  2 68  ? -67.821 59.652  -29.226 1.00 158.94 ? 68  TYR F CZ    1 
ATOM   9605  O  OH    . TYR F  2 68  ? -67.108 59.220  -28.124 1.00 160.39 ? 68  TYR F OH    1 
ATOM   9606  N  N     . SER F  2 69  ? -66.968 60.585  -34.022 1.00 142.82 ? 69  SER F N     1 
ATOM   9607  C  CA    . SER F  2 69  ? -66.042 59.663  -34.678 1.00 137.20 ? 69  SER F CA    1 
ATOM   9608  C  C     . SER F  2 69  ? -66.432 58.206  -34.466 1.00 130.96 ? 69  SER F C     1 
ATOM   9609  O  O     . SER F  2 69  ? -66.321 57.391  -35.388 1.00 127.65 ? 69  SER F O     1 
ATOM   9610  C  CB    . SER F  2 69  ? -64.625 59.903  -34.164 1.00 141.88 ? 69  SER F CB    1 
ATOM   9611  O  OG    . SER F  2 69  ? -64.222 61.223  -34.432 1.00 148.76 ? 69  SER F OG    1 
ATOM   9612  N  N     . ARG F  2 70  ? -66.954 57.876  -33.294 1.00 133.10 ? 70  ARG F N     1 
ATOM   9613  C  CA    . ARG F  2 70  ? -67.258 56.496  -32.961 1.00 131.18 ? 70  ARG F CA    1 
ATOM   9614  C  C     . ARG F  2 70  ? -68.537 56.012  -33.606 1.00 130.48 ? 70  ARG F C     1 
ATOM   9615  O  O     . ARG F  2 70  ? -68.925 54.864  -33.383 1.00 149.86 ? 70  ARG F O     1 
ATOM   9616  C  CB    . ARG F  2 70  ? -67.380 56.334  -31.455 1.00 134.02 ? 70  ARG F CB    1 
ATOM   9617  C  CG    . ARG F  2 70  ? -66.187 56.820  -30.698 1.00 135.28 ? 70  ARG F CG    1 
ATOM   9618  C  CD    . ARG F  2 70  ? -66.333 56.446  -29.250 1.00 138.29 ? 70  ARG F CD    1 
ATOM   9619  N  NE    . ARG F  2 70  ? -65.297 57.049  -28.423 1.00 140.03 ? 70  ARG F NE    1 
ATOM   9620  C  CZ    . ARG F  2 70  ? -65.233 56.921  -27.103 1.00 146.28 ? 70  ARG F CZ    1 
ATOM   9621  N  NH1   . ARG F  2 70  ? -66.138 56.199  -26.456 1.00 144.68 ? 70  ARG F NH1   1 
ATOM   9622  N  NH2   . ARG F  2 70  ? -64.264 57.517  -26.428 1.00 150.38 ? 70  ARG F NH2   1 
ATOM   9623  N  N     . GLU F  2 71  ? -69.214 56.858  -34.361 1.00 129.61 ? 71  GLU F N     1 
ATOM   9624  C  CA    . GLU F  2 71  ? -70.475 56.499  -34.982 1.00 129.27 ? 71  GLU F CA    1 
ATOM   9625  C  C     . GLU F  2 71  ? -70.183 55.965  -36.378 1.00 126.91 ? 71  GLU F C     1 
ATOM   9626  O  O     . GLU F  2 71  ? -69.649 56.676  -37.231 1.00 125.48 ? 71  GLU F O     1 
ATOM   9627  C  CB    . GLU F  2 71  ? -71.400 57.705  -35.036 1.00 145.44 ? 71  GLU F CB    1 
ATOM   9628  C  CG    . GLU F  2 71  ? -72.719 57.432  -35.690 1.00 143.52 ? 71  GLU F CG    1 
ATOM   9629  C  CD    . GLU F  2 71  ? -73.364 56.188  -35.163 1.00 143.22 ? 71  GLU F CD    1 
ATOM   9630  O  OE1   . GLU F  2 71  ? -73.910 56.254  -34.043 1.00 144.31 ? 71  GLU F OE1   1 
ATOM   9631  O  OE2   . GLU F  2 71  ? -73.329 55.153  -35.857 1.00 143.18 ? 71  GLU F OE2   1 
ATOM   9632  N  N     . TRP F  2 72  ? -70.469 54.697  -36.594 1.00 143.19 ? 72  TRP F N     1 
ATOM   9633  C  CA    . TRP F  2 72  ? -70.280 54.110  -37.910 1.00 146.72 ? 72  TRP F CA    1 
ATOM   9634  C  C     . TRP F  2 72  ? -71.471 54.329  -38.822 1.00 148.80 ? 72  TRP F C     1 
ATOM   9635  O  O     . TRP F  2 72  ? -71.294 54.491  -40.033 1.00 144.77 ? 72  TRP F O     1 
ATOM   9636  C  CB    . TRP F  2 72  ? -70.010 52.607  -37.769 1.00 154.40 ? 72  TRP F CB    1 
ATOM   9637  C  CG    . TRP F  2 72  ? -71.199 51.800  -37.281 1.00 158.99 ? 72  TRP F CG    1 
ATOM   9638  C  CD1   . TRP F  2 72  ? -72.213 51.283  -38.031 1.00 159.04 ? 72  TRP F CD1   1 
ATOM   9639  C  CD2   . TRP F  2 72  ? -71.478 51.423  -35.926 1.00 162.14 ? 72  TRP F CD2   1 
ATOM   9640  N  NE1   . TRP F  2 72  ? -73.103 50.610  -37.232 1.00 161.02 ? 72  TRP F NE1   1 
ATOM   9641  C  CE2   . TRP F  2 72  ? -72.675 50.683  -35.934 1.00 163.74 ? 72  TRP F CE2   1 
ATOM   9642  C  CE3   . TRP F  2 72  ? -70.832 51.643  -34.705 1.00 165.11 ? 72  TRP F CE3   1 
ATOM   9643  C  CZ2   . TRP F  2 72  ? -73.240 50.159  -34.771 1.00 168.79 ? 72  TRP F CZ2   1 
ATOM   9644  C  CZ3   . TRP F  2 72  ? -71.392 51.124  -33.553 1.00 171.09 ? 72  TRP F CZ3   1 
ATOM   9645  C  CH2   . TRP F  2 72  ? -72.582 50.390  -33.593 1.00 172.76 ? 72  TRP F CH2   1 
ATOM   9646  N  N     . ASN F  2 73  ? -72.672 54.367  -38.258 1.00 158.48 ? 73  ASN F N     1 
ATOM   9647  C  CA    . ASN F  2 73  ? -73.889 54.468  -39.046 1.00 163.86 ? 73  ASN F CA    1 
ATOM   9648  C  C     . ASN F  2 73  ? -74.077 55.909  -39.493 1.00 165.98 ? 73  ASN F C     1 
ATOM   9649  O  O     . ASN F  2 73  ? -74.090 56.820  -38.663 1.00 173.06 ? 73  ASN F O     1 
ATOM   9650  C  CB    . ASN F  2 73  ? -75.079 53.975  -38.225 1.00 166.48 ? 73  ASN F CB    1 
ATOM   9651  C  CG    . ASN F  2 73  ? -76.272 53.635  -39.082 1.00 166.37 ? 73  ASN F CG    1 
ATOM   9652  O  OD1   . ASN F  2 73  ? -76.149 53.464  -40.293 1.00 164.66 ? 73  ASN F OD1   1 
ATOM   9653  N  ND2   . ASN F  2 73  ? -77.439 53.535  -38.459 1.00 169.72 ? 73  ASN F ND2   1 
ATOM   9654  N  N     . ARG F  2 74  ? -74.209 56.117  -40.803 1.00 158.28 ? 74  ARG F N     1 
ATOM   9655  C  CA    . ARG F  2 74  ? -74.347 57.461  -41.367 1.00 149.53 ? 74  ARG F CA    1 
ATOM   9656  C  C     . ARG F  2 74  ? -75.831 57.790  -41.539 1.00 144.44 ? 74  ARG F C     1 
ATOM   9657  O  O     . ARG F  2 74  ? -76.391 57.788  -42.634 1.00 140.58 ? 74  ARG F O     1 
ATOM   9658  C  CB    . ARG F  2 74  ? -73.595 57.563  -42.686 1.00 147.89 ? 74  ARG F CB    1 
ATOM   9659  C  CG    . ARG F  2 74  ? -72.210 56.932  -42.678 1.00 149.14 ? 74  ARG F CG    1 
ATOM   9660  C  CD    . ARG F  2 74  ? -71.603 56.920  -44.081 1.00 155.41 ? 74  ARG F CD    1 
ATOM   9661  N  NE    . ARG F  2 74  ? -71.004 58.207  -44.461 1.00 163.16 ? 74  ARG F NE    1 
ATOM   9662  C  CZ    . ARG F  2 74  ? -71.619 59.168  -45.155 1.00 163.55 ? 74  ARG F CZ    1 
ATOM   9663  N  NH1   . ARG F  2 74  ? -72.870 59.011  -45.555 1.00 171.93 ? 74  ARG F NH1   1 
ATOM   9664  N  NH2   . ARG F  2 74  ? -70.981 60.295  -45.451 1.00 152.40 ? 74  ARG F NH2   1 
ATOM   9665  N  N     . ASP F  2 75  ? -76.472 58.070  -40.414 1.00 153.26 ? 75  ASP F N     1 
ATOM   9666  C  CA    . ASP F  2 75  ? -77.892 58.373  -40.395 1.00 157.02 ? 75  ASP F CA    1 
ATOM   9667  C  C     . ASP F  2 75  ? -78.147 59.632  -39.593 1.00 155.63 ? 75  ASP F C     1 
ATOM   9668  O  O     . ASP F  2 75  ? -77.389 59.986  -38.687 1.00 154.47 ? 75  ASP F O     1 
ATOM   9669  C  CB    . ASP F  2 75  ? -78.714 57.230  -39.818 1.00 166.50 ? 75  ASP F CB    1 
ATOM   9670  C  CG    . ASP F  2 75  ? -79.152 56.255  -40.878 1.00 173.16 ? 75  ASP F CG    1 
ATOM   9671  O  OD1   . ASP F  2 75  ? -78.763 56.459  -42.052 1.00 174.47 ? 75  ASP F OD1   1 
ATOM   9672  O  OD2   . ASP F  2 75  ? -79.872 55.290  -40.540 1.00 175.73 ? 75  ASP F OD2   1 
ATOM   9673  N  N     . VAL F  2 76  ? -79.237 60.303  -39.960 1.00 164.99 ? 76  VAL F N     1 
ATOM   9674  C  CA    . VAL F  2 76  ? -79.600 61.583  -39.361 1.00 172.00 ? 76  VAL F CA    1 
ATOM   9675  C  C     . VAL F  2 76  ? -79.725 61.473  -37.846 1.00 174.35 ? 76  VAL F C     1 
ATOM   9676  O  O     . VAL F  2 76  ? -79.376 62.403  -37.108 1.00 175.21 ? 76  VAL F O     1 
ATOM   9677  C  CB    . VAL F  2 76  ? -80.898 62.104  -40.003 1.00 177.12 ? 76  VAL F CB    1 
ATOM   9678  C  CG1   . VAL F  2 76  ? -81.395 63.350  -39.287 1.00 182.21 ? 76  VAL F CG1   1 
ATOM   9679  C  CG2   . VAL F  2 76  ? -80.673 62.367  -41.490 1.00 175.65 ? 76  VAL F CG2   1 
ATOM   9680  N  N     . GLN F  2 77  ? -80.223 60.338  -37.354 1.00 177.39 ? 77  GLN F N     1 
ATOM   9681  C  CA    . GLN F  2 77  ? -80.458 60.229  -35.919 1.00 181.06 ? 77  GLN F CA    1 
ATOM   9682  C  C     . GLN F  2 77  ? -79.160 60.271  -35.121 1.00 178.42 ? 77  GLN F C     1 
ATOM   9683  O  O     . GLN F  2 77  ? -79.160 60.737  -33.977 1.00 176.72 ? 77  GLN F O     1 
ATOM   9684  C  CB    . GLN F  2 77  ? -81.257 58.962  -35.604 1.00 187.52 ? 77  GLN F CB    1 
ATOM   9685  C  CG    . GLN F  2 77  ? -80.593 57.652  -36.017 1.00 190.48 ? 77  GLN F CG    1 
ATOM   9686  C  CD    . GLN F  2 77  ? -81.365 56.418  -35.544 1.00 195.62 ? 77  GLN F CD    1 
ATOM   9687  O  OE1   . GLN F  2 77  ? -80.955 55.732  -34.600 1.00 196.26 ? 77  GLN F OE1   1 
ATOM   9688  N  NE2   . GLN F  2 77  ? -82.480 56.126  -36.212 1.00 198.27 ? 77  GLN F NE2   1 
ATOM   9689  N  N     . TYR F  2 78  ? -78.049 59.823  -35.699 1.00 182.14 ? 78  TYR F N     1 
ATOM   9690  C  CA    . TYR F  2 78  ? -76.776 59.824  -34.988 1.00 182.71 ? 78  TYR F CA    1 
ATOM   9691  C  C     . TYR F  2 78  ? -75.898 61.039  -35.282 1.00 177.79 ? 78  TYR F C     1 
ATOM   9692  O  O     . TYR F  2 78  ? -74.853 61.188  -34.643 1.00 181.69 ? 78  TYR F O     1 
ATOM   9693  C  CB    . TYR F  2 78  ? -75.973 58.546  -35.290 1.00 187.76 ? 78  TYR F CB    1 
ATOM   9694  C  CG    . TYR F  2 78  ? -76.617 57.231  -34.886 1.00 193.17 ? 78  TYR F CG    1 
ATOM   9695  C  CD1   . TYR F  2 78  ? -76.808 56.904  -33.551 1.00 196.93 ? 78  TYR F CD1   1 
ATOM   9696  C  CD2   . TYR F  2 78  ? -76.965 56.284  -35.847 1.00 196.07 ? 78  TYR F CD2   1 
ATOM   9697  C  CE1   . TYR F  2 78  ? -77.376 55.689  -33.179 1.00 202.01 ? 78  TYR F CE1   1 
ATOM   9698  C  CE2   . TYR F  2 78  ? -77.530 55.063  -35.486 1.00 199.09 ? 78  TYR F CE2   1 
ATOM   9699  C  CZ    . TYR F  2 78  ? -77.734 54.770  -34.150 1.00 200.69 ? 78  TYR F CZ    1 
ATOM   9700  O  OH    . TYR F  2 78  ? -78.297 53.563  -33.785 1.00 203.42 ? 78  TYR F OH    1 
ATOM   9701  N  N     . ARG F  2 79  ? -76.260 61.902  -36.223 1.00 171.79 ? 79  ARG F N     1 
ATOM   9702  C  CA    . ARG F  2 79  ? -75.448 63.102  -36.333 1.00 154.88 ? 79  ARG F CA    1 
ATOM   9703  C  C     . ARG F  2 79  ? -75.864 64.101  -35.264 1.00 147.70 ? 79  ARG F C     1 
ATOM   9704  O  O     . ARG F  2 79  ? -76.951 64.019  -34.693 1.00 148.65 ? 79  ARG F O     1 
ATOM   9705  C  CB    . ARG F  2 79  ? -75.565 63.722  -37.721 1.00 147.11 ? 79  ARG F CB    1 
ATOM   9706  C  CG    . ARG F  2 79  ? -76.983 63.826  -38.201 1.00 149.63 ? 79  ARG F CG    1 
ATOM   9707  C  CD    . ARG F  2 79  ? -77.080 64.362  -39.615 1.00 147.66 ? 79  ARG F CD    1 
ATOM   9708  N  NE    . ARG F  2 79  ? -76.834 63.345  -40.633 1.00 145.26 ? 79  ARG F NE    1 
ATOM   9709  C  CZ    . ARG F  2 79  ? -75.758 63.318  -41.412 1.00 141.67 ? 79  ARG F CZ    1 
ATOM   9710  N  NH1   . ARG F  2 79  ? -74.824 64.249  -41.282 1.00 143.91 ? 79  ARG F NH1   1 
ATOM   9711  N  NH2   . ARG F  2 79  ? -75.608 62.362  -42.316 1.00 135.13 ? 79  ARG F NH2   1 
ATOM   9712  N  N     . GLY F  2 80  ? -74.978 65.047  -34.986 1.00 145.49 ? 80  GLY F N     1 
ATOM   9713  C  CA    . GLY F  2 80  ? -75.316 66.102  -34.055 1.00 144.72 ? 80  GLY F CA    1 
ATOM   9714  C  C     . GLY F  2 80  ? -74.322 66.287  -32.934 1.00 146.03 ? 80  GLY F C     1 
ATOM   9715  O  O     . GLY F  2 80  ? -73.665 65.330  -32.523 1.00 145.56 ? 80  GLY F O     1 
ATOM   9716  N  N     . ARG F  2 81  ? -74.164 67.523  -32.468 1.00 168.88 ? 81  ARG F N     1 
ATOM   9717  C  CA    . ARG F  2 81  ? -73.350 67.832  -31.298 1.00 170.42 ? 81  ARG F CA    1 
ATOM   9718  C  C     . ARG F  2 81  ? -73.996 69.004  -30.575 1.00 173.59 ? 81  ARG F C     1 
ATOM   9719  O  O     . ARG F  2 81  ? -74.585 69.866  -31.223 1.00 198.59 ? 81  ARG F O     1 
ATOM   9720  C  CB    . ARG F  2 81  ? -71.920 68.181  -31.696 1.00 172.25 ? 81  ARG F CB    1 
ATOM   9721  C  CG    . ARG F  2 81  ? -70.962 68.451  -30.561 1.00 174.03 ? 81  ARG F CG    1 
ATOM   9722  C  CD    . ARG F  2 81  ? -69.568 68.485  -31.141 1.00 174.98 ? 81  ARG F CD    1 
ATOM   9723  N  NE    . ARG F  2 81  ? -69.345 69.720  -31.885 1.00 178.67 ? 81  ARG F NE    1 
ATOM   9724  C  CZ    . ARG F  2 81  ? -68.258 69.977  -32.606 1.00 180.11 ? 81  ARG F CZ    1 
ATOM   9725  N  NH1   . ARG F  2 81  ? -67.302 69.070  -32.702 1.00 196.47 ? 81  ARG F NH1   1 
ATOM   9726  N  NH2   . ARG F  2 81  ? -68.132 71.131  -33.250 1.00 183.74 ? 81  ARG F NH2   1 
ATOM   9727  N  N     . VAL F  2 82  ? -73.955 69.028  -29.248 1.00 174.05 ? 82  VAL F N     1 
ATOM   9728  C  CA    . VAL F  2 82  ? -74.516 70.156  -28.511 1.00 177.27 ? 82  VAL F CA    1 
ATOM   9729  C  C     . VAL F  2 82  ? -73.407 70.862  -27.732 1.00 187.58 ? 82  VAL F C     1 
ATOM   9730  O  O     . VAL F  2 82  ? -72.592 70.209  -27.073 1.00 179.50 ? 82  VAL F O     1 
ATOM   9731  C  CB    . VAL F  2 82  ? -75.667 69.710  -27.597 1.00 175.47 ? 82  VAL F CB    1 
ATOM   9732  C  CG1   . VAL F  2 82  ? -76.132 70.857  -26.754 1.00 178.91 ? 82  VAL F CG1   1 
ATOM   9733  C  CG2   . VAL F  2 82  ? -76.818 69.172  -28.439 1.00 172.88 ? 82  VAL F CG2   1 
ATOM   9734  N  N     . ARG F  2 83  ? -73.376 72.195  -27.822 1.00 190.52 ? 83  ARG F N     1 
ATOM   9735  C  CA    . ARG F  2 83  ? -72.409 73.040  -27.122 1.00 195.72 ? 83  ARG F CA    1 
ATOM   9736  C  C     . ARG F  2 83  ? -73.123 73.792  -26.008 1.00 198.09 ? 83  ARG F C     1 
ATOM   9737  O  O     . ARG F  2 83  ? -74.167 74.393  -26.259 1.00 200.98 ? 83  ARG F O     1 
ATOM   9738  C  CB    . ARG F  2 83  ? -71.792 74.052  -28.088 1.00 199.73 ? 83  ARG F CB    1 
ATOM   9739  C  CG    . ARG F  2 83  ? -71.104 73.455  -29.298 1.00 196.46 ? 83  ARG F CG    1 
ATOM   9740  C  CD    . ARG F  2 83  ? -69.874 72.651  -28.926 1.00 196.58 ? 83  ARG F CD    1 
ATOM   9741  N  NE    . ARG F  2 83  ? -68.780 73.510  -28.481 1.00 202.56 ? 83  ARG F NE    1 
ATOM   9742  C  CZ    . ARG F  2 83  ? -68.012 74.226  -29.298 1.00 206.37 ? 83  ARG F CZ    1 
ATOM   9743  N  NH1   . ARG F  2 83  ? -68.209 74.184  -30.609 1.00 206.34 ? 83  ARG F NH1   1 
ATOM   9744  N  NH2   . ARG F  2 83  ? -67.042 74.987  -28.806 1.00 212.00 ? 83  ARG F NH2   1 
ATOM   9745  N  N     . VAL F  2 84  ? -72.529 73.834  -24.810 1.00 200.12 ? 84  VAL F N     1 
ATOM   9746  C  CA    . VAL F  2 84  ? -73.170 74.431  -23.638 1.00 194.46 ? 84  VAL F CA    1 
ATOM   9747  C  C     . VAL F  2 84  ? -72.226 75.411  -22.947 1.00 217.81 ? 84  VAL F C     1 
ATOM   9748  O  O     . VAL F  2 84  ? -71.062 75.087  -22.688 1.00 199.55 ? 84  VAL F O     1 
ATOM   9749  C  CB    . VAL F  2 84  ? -73.632 73.356  -22.636 1.00 191.23 ? 84  VAL F CB    1 
ATOM   9750  C  CG1   . VAL F  2 84  ? -74.278 73.995  -21.413 1.00 193.62 ? 84  VAL F CG1   1 
ATOM   9751  C  CG2   . VAL F  2 84  ? -74.575 72.391  -23.299 1.00 186.80 ? 84  VAL F CG2   1 
ATOM   9752  N  N     . GLN F  2 85  ? -72.731 76.615  -22.664 1.00 216.34 ? 85  GLN F N     1 
ATOM   9753  C  CA    . GLN F  2 85  ? -72.037 77.568  -21.803 1.00 219.21 ? 85  GLN F CA    1 
ATOM   9754  C  C     . GLN F  2 85  ? -72.377 77.235  -20.354 1.00 218.13 ? 85  GLN F C     1 
ATOM   9755  O  O     . GLN F  2 85  ? -73.551 77.228  -19.968 1.00 215.88 ? 85  GLN F O     1 
ATOM   9756  C  CB    . GLN F  2 85  ? -72.421 79.013  -22.151 1.00 223.31 ? 85  GLN F CB    1 
ATOM   9757  C  CG    . GLN F  2 85  ? -71.598 80.105  -21.414 1.00 228.39 ? 85  GLN F CG    1 
ATOM   9758  C  CD    . GLN F  2 85  ? -72.069 81.543  -21.681 1.00 229.87 ? 85  GLN F CD    1 
ATOM   9759  O  OE1   . GLN F  2 85  ? -72.969 82.058  -21.016 1.00 231.35 ? 85  GLN F OE1   1 
ATOM   9760  N  NE2   . GLN F  2 85  ? -71.434 82.197  -22.648 1.00 229.16 ? 85  GLN F NE2   1 
ATOM   9761  N  N     . LEU F  2 86  ? -71.356 76.936  -19.557 1.00 221.43 ? 86  LEU F N     1 
ATOM   9762  C  CA    . LEU F  2 86  ? -71.550 76.594  -18.155 1.00 222.16 ? 86  LEU F CA    1 
ATOM   9763  C  C     . LEU F  2 86  ? -71.232 77.735  -17.208 1.00 235.95 ? 86  LEU F C     1 
ATOM   9764  O  O     . LEU F  2 86  ? -71.780 77.777  -16.103 1.00 239.21 ? 86  LEU F O     1 
ATOM   9765  C  CB    . LEU F  2 86  ? -70.701 75.384  -17.783 1.00 216.19 ? 86  LEU F CB    1 
ATOM   9766  C  CG    . LEU F  2 86  ? -71.311 74.118  -18.369 1.00 211.90 ? 86  LEU F CG    1 
ATOM   9767  C  CD1   . LEU F  2 86  ? -70.610 72.875  -17.829 1.00 210.79 ? 86  LEU F CD1   1 
ATOM   9768  C  CD2   . LEU F  2 86  ? -72.813 74.086  -18.101 1.00 209.48 ? 86  LEU F CD2   1 
ATOM   9769  N  N     . LYS F  2 87  ? -70.298 78.600  -17.586 1.00 242.93 ? 87  LYS F N     1 
ATOM   9770  C  CA    . LYS F  2 87  ? -69.882 79.744  -16.791 1.00 254.89 ? 87  LYS F CA    1 
ATOM   9771  C  C     . LYS F  2 87  ? -69.802 80.969  -17.697 1.00 259.11 ? 87  LYS F C     1 
ATOM   9772  O  O     . LYS F  2 87  ? -69.670 80.854  -18.917 1.00 258.61 ? 87  LYS F O     1 
ATOM   9773  C  CB    . LYS F  2 87  ? -68.548 79.492  -16.071 1.00 264.01 ? 87  LYS F CB    1 
ATOM   9774  C  CG    . LYS F  2 87  ? -67.588 78.544  -16.758 1.00 265.61 ? 87  LYS F CG    1 
ATOM   9775  C  CD    . LYS F  2 87  ? -66.350 78.378  -15.894 1.00 267.50 ? 87  LYS F CD    1 
ATOM   9776  C  CE    . LYS F  2 87  ? -65.259 77.603  -16.596 1.00 263.27 ? 87  LYS F CE    1 
ATOM   9777  N  NZ    . LYS F  2 87  ? -64.055 77.506  -15.728 1.00 264.70 ? 87  LYS F NZ    1 
ATOM   9778  N  N     . GLN F  2 88  ? -69.882 82.153  -17.090 1.00 266.27 ? 88  GLN F N     1 
ATOM   9779  C  CA    . GLN F  2 88  ? -69.780 83.393  -17.850 1.00 260.28 ? 88  GLN F CA    1 
ATOM   9780  C  C     . GLN F  2 88  ? -68.317 83.720  -18.112 1.00 266.36 ? 88  GLN F C     1 
ATOM   9781  O  O     . GLN F  2 88  ? -67.930 84.891  -18.167 1.00 268.35 ? 88