data_5MJA
# 
_entry.id   5MJA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MJA         
WWPDB D_1200002553 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MJA 
_pdbx_database_status.recvd_initial_deposition_date   2016-11-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kung, A.'      1 
'Schimpl, M.'   2 
'Chen, Y.-C.'   3 
'Overman, R.C.' 4 
'Zhang, C.'     5 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'ACS Chem. Biol.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1554-8937 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            12 
_citation.language                  ? 
_citation.page_first                1499 
_citation.page_last                 1503 
_citation.title                     'A Chemical-Genetic Approach to Generate Selective Covalent Inhibitors of Protein Kinases.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acschembio.6b01083 
_citation.pdbx_database_id_PubMed   28459525 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kung, A.'      1 
primary 'Schimpl, M.'   2 
primary 'Ekanayake, A.' 3 
primary 'Chen, Y.C.'    4 
primary 'Overman, R.'   5 
primary 'Zhang, C.'     6 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MJA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     101.806 
_cell.length_a_esd                 ? 
_cell.length_b                     101.806 
_cell.length_b_esd                 ? 
_cell.length_c                     157.140 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MJA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Ephrin type-B receptor 1'                                                             34857.613 2   2.7.10.1 ? 
? 'phosphorylation on Tyr647 and Tyr778 as a result of autophosphorylation during recombinant expression in E.coli' 
2 non-polymer syn '2-chloranyl-~{N}-[4-[(2-chloranyl-5-oxidanyl-phenyl)amino]quinazolin-7-yl]ethanamide' 363.198   2   ?        ? 
? ?                                                                                                                 
3 non-polymer syn 'SULFATE ION'                                                                          96.063    2   ?        ? 
? ?                                                                                                                 
4 water       nat water                                                                                  18.015    340 ?        ? 
? ?                                                                                                                 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
;ELK,EPH tyrosine kinase 2,EPH-like kinase 6,hEK6,Neuronally-expressed EPH-related tyrosine kinase,NET,Tyrosine-protein kinase receptor EPH-2
;
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MGHHHHHHGSDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREI(PTR)VAIKTLKAGYSEKQRRDFLS
EASIMGQFDHRNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAA
RNILVNSNLVCKVSDFGLSRYLQDDTSDPT(PTR)TSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGER
PYWDMSNQDVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGHHHHHHGSDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASI
MGQFDHRNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLSEMNYVHRDLAARNIL
VNSNLVCKVSDFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQ
DVINAIEQDYRLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   GLY n 
1 10  SER n 
1 11  ASP n 
1 12  PRO n 
1 13  ASN n 
1 14  GLU n 
1 15  ALA n 
1 16  VAL n 
1 17  ARG n 
1 18  GLU n 
1 19  PHE n 
1 20  ALA n 
1 21  LYS n 
1 22  GLU n 
1 23  ILE n 
1 24  ASP n 
1 25  VAL n 
1 26  SER n 
1 27  PHE n 
1 28  VAL n 
1 29  LYS n 
1 30  ILE n 
1 31  GLU n 
1 32  GLU n 
1 33  VAL n 
1 34  ILE n 
1 35  GLY n 
1 36  ALA n 
1 37  GLY n 
1 38  GLU n 
1 39  PHE n 
1 40  GLY n 
1 41  GLU n 
1 42  VAL n 
1 43  TYR n 
1 44  LYS n 
1 45  GLY n 
1 46  ARG n 
1 47  LEU n 
1 48  LYS n 
1 49  LEU n 
1 50  PRO n 
1 51  GLY n 
1 52  LYS n 
1 53  ARG n 
1 54  GLU n 
1 55  ILE n 
1 56  PTR n 
1 57  VAL n 
1 58  ALA n 
1 59  ILE n 
1 60  LYS n 
1 61  THR n 
1 62  LEU n 
1 63  LYS n 
1 64  ALA n 
1 65  GLY n 
1 66  TYR n 
1 67  SER n 
1 68  GLU n 
1 69  LYS n 
1 70  GLN n 
1 71  ARG n 
1 72  ARG n 
1 73  ASP n 
1 74  PHE n 
1 75  LEU n 
1 76  SER n 
1 77  GLU n 
1 78  ALA n 
1 79  SER n 
1 80  ILE n 
1 81  MET n 
1 82  GLY n 
1 83  GLN n 
1 84  PHE n 
1 85  ASP n 
1 86  HIS n 
1 87  ARG n 
1 88  ASN n 
1 89  ILE n 
1 90  ILE n 
1 91  ARG n 
1 92  LEU n 
1 93  GLU n 
1 94  GLY n 
1 95  VAL n 
1 96  VAL n 
1 97  THR n 
1 98  LYS n 
1 99  SER n 
1 100 ARG n 
1 101 PRO n 
1 102 VAL n 
1 103 MET n 
1 104 ILE n 
1 105 ILE n 
1 106 THR n 
1 107 GLU n 
1 108 PHE n 
1 109 MET n 
1 110 GLU n 
1 111 ASN n 
1 112 GLY n 
1 113 ALA n 
1 114 LEU n 
1 115 ASP n 
1 116 SER n 
1 117 PHE n 
1 118 LEU n 
1 119 ARG n 
1 120 GLN n 
1 121 ASN n 
1 122 ASP n 
1 123 GLY n 
1 124 GLN n 
1 125 PHE n 
1 126 THR n 
1 127 VAL n 
1 128 ILE n 
1 129 GLN n 
1 130 LEU n 
1 131 VAL n 
1 132 GLY n 
1 133 MET n 
1 134 LEU n 
1 135 ARG n 
1 136 GLY n 
1 137 ILE n 
1 138 ALA n 
1 139 ALA n 
1 140 GLY n 
1 141 MET n 
1 142 LYS n 
1 143 TYR n 
1 144 LEU n 
1 145 SER n 
1 146 GLU n 
1 147 MET n 
1 148 ASN n 
1 149 TYR n 
1 150 VAL n 
1 151 HIS n 
1 152 ARG n 
1 153 ASP n 
1 154 LEU n 
1 155 ALA n 
1 156 ALA n 
1 157 ARG n 
1 158 ASN n 
1 159 ILE n 
1 160 LEU n 
1 161 VAL n 
1 162 ASN n 
1 163 SER n 
1 164 ASN n 
1 165 LEU n 
1 166 VAL n 
1 167 CYS n 
1 168 LYS n 
1 169 VAL n 
1 170 SER n 
1 171 ASP n 
1 172 PHE n 
1 173 GLY n 
1 174 LEU n 
1 175 SER n 
1 176 ARG n 
1 177 TYR n 
1 178 LEU n 
1 179 GLN n 
1 180 ASP n 
1 181 ASP n 
1 182 THR n 
1 183 SER n 
1 184 ASP n 
1 185 PRO n 
1 186 THR n 
1 187 PTR n 
1 188 THR n 
1 189 SER n 
1 190 SER n 
1 191 LEU n 
1 192 GLY n 
1 193 GLY n 
1 194 LYS n 
1 195 ILE n 
1 196 PRO n 
1 197 VAL n 
1 198 ARG n 
1 199 TRP n 
1 200 THR n 
1 201 ALA n 
1 202 PRO n 
1 203 GLU n 
1 204 ALA n 
1 205 ILE n 
1 206 ALA n 
1 207 TYR n 
1 208 ARG n 
1 209 LYS n 
1 210 PHE n 
1 211 THR n 
1 212 SER n 
1 213 ALA n 
1 214 SER n 
1 215 ASP n 
1 216 VAL n 
1 217 TRP n 
1 218 SER n 
1 219 TYR n 
1 220 GLY n 
1 221 ILE n 
1 222 VAL n 
1 223 MET n 
1 224 TRP n 
1 225 GLU n 
1 226 VAL n 
1 227 MET n 
1 228 SER n 
1 229 PHE n 
1 230 GLY n 
1 231 GLU n 
1 232 ARG n 
1 233 PRO n 
1 234 TYR n 
1 235 TRP n 
1 236 ASP n 
1 237 MET n 
1 238 SER n 
1 239 ASN n 
1 240 GLN n 
1 241 ASP n 
1 242 VAL n 
1 243 ILE n 
1 244 ASN n 
1 245 ALA n 
1 246 ILE n 
1 247 GLU n 
1 248 GLN n 
1 249 ASP n 
1 250 TYR n 
1 251 ARG n 
1 252 LEU n 
1 253 PRO n 
1 254 PRO n 
1 255 PRO n 
1 256 MET n 
1 257 ASP n 
1 258 CYS n 
1 259 PRO n 
1 260 ALA n 
1 261 ALA n 
1 262 LEU n 
1 263 HIS n 
1 264 GLN n 
1 265 LEU n 
1 266 MET n 
1 267 LEU n 
1 268 ASP n 
1 269 CYS n 
1 270 TRP n 
1 271 GLN n 
1 272 LYS n 
1 273 ASP n 
1 274 ARG n 
1 275 ASN n 
1 276 SER n 
1 277 ARG n 
1 278 PRO n 
1 279 ARG n 
1 280 PHE n 
1 281 ALA n 
1 282 GLU n 
1 283 ILE n 
1 284 VAL n 
1 285 ASN n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LYS n 
1 290 MET n 
1 291 ILE n 
1 292 ARG n 
1 293 ASN n 
1 294 PRO n 
1 295 ALA n 
1 296 SER n 
1 297 LEU n 
1 298 LYS n 
1 299 THR n 
1 300 VAL n 
1 301 ALA n 
1 302 THR n 
1 303 ILE n 
1 304 THR n 
1 305 ALA n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   305 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'EPHB1, ELK, EPHT2, HEK6, NET' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              GOLD 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    EPHB1_HUMAN 
_struct_ref.pdbx_db_accession          P54762 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;DPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLPGKREIYVAIKTLKAGYSEKQRRDFLSEASIMGQFDHPNII
RLEGVVTKSRPVMIITEFMENGALDSFLRQNDGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVS
DFGLSRYLQDDTSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDY
RLPPPMDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNPASLKTVATITA
;
_struct_ref.pdbx_align_begin           602 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MJA A 11 ? 305 ? P54762 602 ? 896 ? 602 896 
2 1 5MJA B 11 ? 305 ? P54762 602 ? 896 ? 602 896 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5MJA MET A 1   ? UNP P54762 ?   ?   'initiating methionine' 592 1  
1 5MJA GLY A 2   ? UNP P54762 ?   ?   'expression tag'        593 2  
1 5MJA HIS A 3   ? UNP P54762 ?   ?   'expression tag'        594 3  
1 5MJA HIS A 4   ? UNP P54762 ?   ?   'expression tag'        595 4  
1 5MJA HIS A 5   ? UNP P54762 ?   ?   'expression tag'        596 5  
1 5MJA HIS A 6   ? UNP P54762 ?   ?   'expression tag'        597 6  
1 5MJA HIS A 7   ? UNP P54762 ?   ?   'expression tag'        598 7  
1 5MJA HIS A 8   ? UNP P54762 ?   ?   'expression tag'        599 8  
1 5MJA GLY A 9   ? UNP P54762 ?   ?   'expression tag'        600 9  
1 5MJA SER A 10  ? UNP P54762 ?   ?   'expression tag'        601 10 
1 5MJA ARG A 87  ? UNP P54762 PRO 678 conflict                678 11 
1 5MJA SER A 145 ? UNP P54762 ALA 736 conflict                736 12 
2 5MJA MET B 1   ? UNP P54762 ?   ?   'initiating methionine' 592 13 
2 5MJA GLY B 2   ? UNP P54762 ?   ?   'expression tag'        593 14 
2 5MJA HIS B 3   ? UNP P54762 ?   ?   'expression tag'        594 15 
2 5MJA HIS B 4   ? UNP P54762 ?   ?   'expression tag'        595 16 
2 5MJA HIS B 5   ? UNP P54762 ?   ?   'expression tag'        596 17 
2 5MJA HIS B 6   ? UNP P54762 ?   ?   'expression tag'        597 18 
2 5MJA HIS B 7   ? UNP P54762 ?   ?   'expression tag'        598 19 
2 5MJA HIS B 8   ? UNP P54762 ?   ?   'expression tag'        599 20 
2 5MJA GLY B 9   ? UNP P54762 ?   ?   'expression tag'        600 21 
2 5MJA SER B 10  ? UNP P54762 ?   ?   'expression tag'        601 22 
2 5MJA ARG B 87  ? UNP P54762 PRO 678 conflict                678 23 
2 5MJA SER B 145 ? UNP P54762 ALA 736 conflict                736 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
7O3 non-polymer         . '2-chloranyl-~{N}-[4-[(2-chloranyl-5-oxidanyl-phenyl)amino]quinazolin-7-yl]ethanamide' ?                 
'C16 H12 Cl2 N4 O2' 363.198 
ALA 'L-peptide linking' y ALANINE                                                                                ?                 
'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ?                 
'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ?                 
'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ?                 
'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                               ?                 
'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ?                 
'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ?                 
'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ?                 
'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                              ?                 
'C6 H10 N3 O2 1'    156.162 
HOH non-polymer         . WATER                                                                                  ?                 
'H2 O'              18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ?                 
'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                ?                 
'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                                                                 ?                 
'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ?                 
'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ?                 
'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ?                 
'C5 H9 N O2'        115.130 
PTR 'L-peptide linking' n O-PHOSPHOTYROSINE                                                                      PHOSPHONOTYROSINE 
'C9 H12 N O6 P'     261.168 
SER 'L-peptide linking' y SERINE                                                                                 ?                 
'C3 H7 N O3'        105.093 
SO4 non-polymer         . 'SULFATE ION'                                                                          ?                 
'O4 S -2'           96.063  
THR 'L-peptide linking' y THREONINE                                                                              ?                 
'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ?                 
'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ?                 
'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ?                 
'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MJA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.39 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         63.71 
_exptl_crystal.description                 'hexagonal plates' 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;18 % PEG3350, 0.1-0.2 M ammonium sulfate, 0.1 M PCTP (Sodium propionate, Sodium cacodylate trihydrate, Bis-Tris propane) buffer pH 6-9
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-06-18 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9795 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9795 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            46.46 
_reflns.entry_id                         5MJA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.14 
_reflns.d_resolution_low                 76.89 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       52668 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             100 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  19.7 
_reflns.pdbx_Rmerge_I_obs                0.108 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.2 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     1.00 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.14 
_reflns_shell.d_res_low                   2.20 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        100 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                2.164 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             19.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.62 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            1.08530 
_refine.aniso_B[1][2]                            0.00000 
_refine.aniso_B[1][3]                            0.00000 
_refine.aniso_B[2][2]                            1.08530 
_refine.aniso_B[2][3]                            0.00000 
_refine.aniso_B[3][3]                            -2.17060 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               52.05 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.926 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MJA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.14 
_refine.ls_d_res_low                             76.89 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     52480 
_refine.ls_number_reflns_R_free                  2569 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.7 
_refine.ls_percent_reflns_R_free                 4.900 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.202 
_refine.ls_R_factor_R_free                       0.236 
_refine.ls_R_factor_R_free_error                 0.000 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.200 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '3ZFX chain A' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   0.152 
_refine.pdbx_overall_SU_R_free_Blow_DPI          0.155 
_refine.pdbx_overall_SU_R_Blow_DPI               0.168 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             0.162 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_analyze.entry_id                        5MJA 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.Luzzati_coordinate_error_free   ? 
_refine_analyze.Luzzati_coordinate_error_obs    0.29 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.Luzzati_d_res_low_obs           ? 
_refine_analyze.Luzzati_sigma_a_free            ? 
_refine_analyze.Luzzati_sigma_a_free_details    ? 
_refine_analyze.Luzzati_sigma_a_obs             ? 
_refine_analyze.Luzzati_sigma_a_obs_details     ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.RG_d_res_high                   ? 
_refine_analyze.RG_d_res_low                    ? 
_refine_analyze.RG_free                         ? 
_refine_analyze.RG_work                         ? 
_refine_analyze.RG_free_work_ratio              ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        4322 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         122 
_refine_hist.number_atoms_solvent             340 
_refine_hist.number_atoms_total               4784 
_refine_hist.d_res_high                       2.14 
_refine_hist.d_res_low                        76.89 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.010 ? 4537 ? t_bond_d                  2.00  HARMONIC     
'X-RAY DIFFRACTION' ? 1.05  ? 6135 ? t_angle_deg               2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 1580 ? t_dihedral_angle_d        2.00  SINUSOIDAL   
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_incorr_chiral_ct        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_pseud_angle             ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 105  ? t_trig_c_planes           2.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 651  ? t_gen_planes              5.00  HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? 4537 ? t_it                      20.00 HARMONIC     
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_nbd                     ?     ?            
'X-RAY DIFFRACTION' ? 3.45  ? ?    ? t_omega_torsion           ?     ?            
'X-RAY DIFFRACTION' ? 16.96 ? ?    ? t_other_torsion           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_improper_torsion        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 569  ? t_chiral_improper_torsion 5.00  SEMIHARMONIC 
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_sum_occupancies         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_distance        ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_angle           ?     ?            
'X-RAY DIFFRACTION' ? ?     ? ?    ? t_utility_torsion         ?     ?            
'X-RAY DIFFRACTION' ? ?     ? 5513 ? t_ideal_dist_contact      4.00  SEMIHARMONIC 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.14 
_refine_ls_shell.d_res_low                        2.20 
_refine_ls_shell.number_reflns_all                3807 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             183 
_refine_ls_shell.number_reflns_R_work             3624 
_refine_ls_shell.percent_reflns_obs               99.15 
_refine_ls_shell.percent_reflns_R_free            4.81 
_refine_ls_shell.R_factor_all                     0.285 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.319 
_refine_ls_shell.R_factor_R_free_error            0.000 
_refine_ls_shell.R_factor_R_work                  0.283 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5MJA 
_struct.title                        'Kinase domain of human EphB1 bound to a quinazoline-based inhibitor' 
_struct.pdbx_descriptor              'Ephrin type-B receptor 1 (E.C.2.7.10.1)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MJA 
_struct_keywords.text            'Receptor tyrosine kinase, kinase domain, Inhibitor, TRANSFERASE' 
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 2 ? 
F N N 3 ? 
G N N 4 ? 
H N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 24  ? SER A 26  ? ASP A 615 SER A 617 5 ? 3  
HELX_P HELX_P2  AA2 SER A 67  ? GLY A 82  ? SER A 658 GLY A 673 1 ? 16 
HELX_P HELX_P3  AA3 ALA A 113 ? GLN A 120 ? ALA A 704 GLN A 711 1 ? 8  
HELX_P HELX_P4  AA4 THR A 126 ? MET A 147 ? THR A 717 MET A 738 1 ? 22 
HELX_P HELX_P5  AA5 ALA A 155 ? ARG A 157 ? ALA A 746 ARG A 748 5 ? 3  
HELX_P HELX_P6  AA6 PRO A 196 ? THR A 200 ? PRO A 787 THR A 791 5 ? 5  
HELX_P HELX_P7  AA7 ALA A 201 ? ARG A 208 ? ALA A 792 ARG A 799 1 ? 8  
HELX_P HELX_P8  AA8 THR A 211 ? SER A 228 ? THR A 802 SER A 819 1 ? 18 
HELX_P HELX_P9  AA9 SER A 238 ? GLN A 248 ? SER A 829 GLN A 839 1 ? 11 
HELX_P HELX_P10 AB1 PRO A 259 ? TRP A 270 ? PRO A 850 TRP A 861 1 ? 12 
HELX_P HELX_P11 AB2 ASP A 273 ? ARG A 277 ? ASP A 864 ARG A 868 5 ? 5  
HELX_P HELX_P12 AB3 ARG A 279 ? ASN A 293 ? ARG A 870 ASN A 884 1 ? 15 
HELX_P HELX_P13 AB4 PRO A 294 ? LYS A 298 ? PRO A 885 LYS A 889 5 ? 5  
HELX_P HELX_P14 AB5 ASP B 24  ? SER B 26  ? ASP B 615 SER B 617 5 ? 3  
HELX_P HELX_P15 AB6 SER B 67  ? GLY B 82  ? SER B 658 GLY B 673 1 ? 16 
HELX_P HELX_P16 AB7 LEU B 114 ? GLN B 120 ? LEU B 705 GLN B 711 1 ? 7  
HELX_P HELX_P17 AB8 THR B 126 ? MET B 147 ? THR B 717 MET B 738 1 ? 22 
HELX_P HELX_P18 AB9 ALA B 155 ? ARG B 157 ? ALA B 746 ARG B 748 5 ? 3  
HELX_P HELX_P19 AC1 PRO B 196 ? THR B 200 ? PRO B 787 THR B 791 5 ? 5  
HELX_P HELX_P20 AC2 ALA B 201 ? ARG B 208 ? ALA B 792 ARG B 799 1 ? 8  
HELX_P HELX_P21 AC3 THR B 211 ? SER B 228 ? THR B 802 SER B 819 1 ? 18 
HELX_P HELX_P22 AC4 SER B 238 ? GLN B 248 ? SER B 829 GLN B 839 1 ? 11 
HELX_P HELX_P23 AC5 PRO B 259 ? TRP B 270 ? PRO B 850 TRP B 861 1 ? 12 
HELX_P HELX_P24 AC6 ASP B 273 ? ARG B 277 ? ASP B 864 ARG B 868 5 ? 5  
HELX_P HELX_P25 AC7 ARG B 279 ? ASN B 293 ? ARG B 870 ASN B 884 1 ? 15 
HELX_P HELX_P26 AC8 PRO B 294 ? LYS B 298 ? PRO B 885 LYS B 889 5 ? 5  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale both ? A ILE 55  C ? ? ? 1_555 A PTR 56  N ? ? A ILE 646 A PTR 647 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale2 covale both ? A PTR 56  C ? ? ? 1_555 A VAL 57  N ? ? A PTR 647 A VAL 648 1_555 ? ? ? ? ? ? ? 1.329 ? 
covale3 covale both ? A THR 186 C ? ? ? 1_555 A PTR 187 N ? ? A THR 777 A PTR 778 1_555 ? ? ? ? ? ? ? 1.331 ? 
covale4 covale both ? A PTR 187 C ? ? ? 1_555 A THR 188 N ? ? A PTR 778 A THR 779 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale5 covale both ? B ILE 55  C ? ? ? 1_555 B PTR 56  N ? ? B ILE 646 B PTR 647 1_555 ? ? ? ? ? ? ? 1.340 ? 
covale6 covale both ? B PTR 56  C ? ? ? 1_555 B VAL 57  N ? ? B PTR 647 B VAL 648 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale7 covale both ? B THR 186 C ? ? ? 1_555 B PTR 187 N ? ? B THR 777 B PTR 778 1_555 ? ? ? ? ? ? ? 1.328 ? 
covale8 covale both ? B PTR 187 C ? ? ? 1_555 B THR 188 N ? ? B PTR 778 B THR 779 1_555 ? ? ? ? ? ? ? 1.331 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 ARG 100 A . ? ARG 691 A PRO 101 A ? PRO 692 A 1 -5.26 
2 ARG 100 B . ? ARG 691 B PRO 101 B ? PRO 692 B 1 9.22  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 5 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 5 ? 
AA6 ? 3 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA5 4 5 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 28  ? ALA A 36  ? VAL A 619 ALA A 627 
AA1 2 GLU A 41  ? LEU A 47  ? GLU A 632 LEU A 638 
AA1 3 ILE A 55  ? THR A 61  ? ILE A 646 THR A 652 
AA1 4 MET A 103 ? GLU A 107 ? MET A 694 GLU A 698 
AA1 5 LEU A 92  ? VAL A 96  ? LEU A 683 VAL A 687 
AA2 1 TYR A 149 ? VAL A 150 ? TYR A 740 VAL A 741 
AA2 2 ARG A 176 ? TYR A 177 ? ARG A 767 TYR A 768 
AA3 1 ILE A 159 ? VAL A 161 ? ILE A 750 VAL A 752 
AA3 2 CYS A 167 ? VAL A 169 ? CYS A 758 VAL A 760 
AA4 1 PTR A 187 ? THR A 188 ? PTR A 778 THR A 779 
AA4 2 LYS A 209 ? PHE A 210 ? LYS A 800 PHE A 801 
AA5 1 VAL B 28  ? ALA B 36  ? VAL B 619 ALA B 627 
AA5 2 GLU B 41  ? LEU B 47  ? GLU B 632 LEU B 638 
AA5 3 ILE B 55  ? THR B 61  ? ILE B 646 THR B 652 
AA5 4 MET B 103 ? GLU B 107 ? MET B 694 GLU B 698 
AA5 5 LEU B 92  ? VAL B 96  ? LEU B 683 VAL B 687 
AA6 1 GLY B 112 ? ALA B 113 ? GLY B 703 ALA B 704 
AA6 2 ILE B 159 ? VAL B 161 ? ILE B 750 VAL B 752 
AA6 3 CYS B 167 ? VAL B 169 ? CYS B 758 VAL B 760 
AA7 1 TYR B 149 ? VAL B 150 ? TYR B 740 VAL B 741 
AA7 2 ARG B 176 ? TYR B 177 ? ARG B 767 TYR B 768 
AA8 1 PTR B 187 ? THR B 188 ? PTR B 778 THR B 779 
AA8 2 LYS B 209 ? PHE B 210 ? LYS B 800 PHE B 801 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ILE A 34  ? N ILE A 625 O VAL A 42  ? O VAL A 633 
AA1 2 3 N TYR A 43  ? N TYR A 634 O ILE A 59  ? O ILE A 650 
AA1 3 4 N LYS A 60  ? N LYS A 651 O ILE A 104 ? O ILE A 695 
AA1 4 5 O ILE A 105 ? O ILE A 696 N GLU A 93  ? N GLU A 684 
AA2 1 2 N VAL A 150 ? N VAL A 741 O ARG A 176 ? O ARG A 767 
AA3 1 2 N LEU A 160 ? N LEU A 751 O LYS A 168 ? O LYS A 759 
AA4 1 2 N PTR A 187 ? N PTR A 778 O PHE A 210 ? O PHE A 801 
AA5 1 2 N ILE B 34  ? N ILE B 625 O VAL B 42  ? O VAL B 633 
AA5 2 3 N LEU B 47  ? N LEU B 638 O ILE B 55  ? O ILE B 646 
AA5 3 4 N LYS B 60  ? N LYS B 651 O ILE B 104 ? O ILE B 695 
AA5 4 5 O ILE B 105 ? O ILE B 696 N GLU B 93  ? N GLU B 684 
AA6 1 2 N GLY B 112 ? N GLY B 703 O VAL B 161 ? O VAL B 752 
AA6 2 3 N LEU B 160 ? N LEU B 751 O LYS B 168 ? O LYS B 759 
AA7 1 2 N VAL B 150 ? N VAL B 741 O ARG B 176 ? O ARG B 767 
AA8 1 2 N PTR B 187 ? N PTR B 778 O PHE B 210 ? O PHE B 801 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 7O3 901 ? 12 'binding site for residue 7O3 A 901' 
AC2 Software A SO4 902 ? 4  'binding site for residue SO4 A 902' 
AC3 Software B 7O3 901 ? 13 'binding site for residue 7O3 B 901' 
AC4 Software B SO4 902 ? 5  'binding site for residue SO4 B 902' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 VAL A 42  ? VAL A 633  . ? 1_555 ? 
2  AC1 12 ALA A 58  ? ALA A 649  . ? 1_555 ? 
3  AC1 12 LYS A 60  ? LYS A 651  . ? 1_555 ? 
4  AC1 12 GLU A 77  ? GLU A 668  . ? 1_555 ? 
5  AC1 12 THR A 106 ? THR A 697  . ? 1_555 ? 
6  AC1 12 GLU A 107 ? GLU A 698  . ? 1_555 ? 
7  AC1 12 MET A 109 ? MET A 700  . ? 1_555 ? 
8  AC1 12 GLY A 112 ? GLY A 703  . ? 1_555 ? 
9  AC1 12 LEU A 160 ? LEU A 751  . ? 1_555 ? 
10 AC1 12 SER A 170 ? SER A 761  . ? 1_555 ? 
11 AC1 12 ASP A 171 ? ASP A 762  . ? 1_555 ? 
12 AC1 12 HOH G .   ? HOH A 1044 . ? 1_555 ? 
13 AC2 4  ASP A 288 ? ASP A 879  . ? 1_555 ? 
14 AC2 4  ARG A 292 ? ARG A 883  . ? 1_555 ? 
15 AC2 4  HOH G .   ? HOH A 1030 . ? 1_555 ? 
16 AC2 4  LYS B 52  ? LYS B 643  . ? 1_555 ? 
17 AC3 13 ALA B 58  ? ALA B 649  . ? 1_555 ? 
18 AC3 13 LYS B 60  ? LYS B 651  . ? 1_555 ? 
19 AC3 13 GLU B 77  ? GLU B 668  . ? 1_555 ? 
20 AC3 13 THR B 106 ? THR B 697  . ? 1_555 ? 
21 AC3 13 GLU B 107 ? GLU B 698  . ? 1_555 ? 
22 AC3 13 MET B 109 ? MET B 700  . ? 1_555 ? 
23 AC3 13 GLU B 110 ? GLU B 701  . ? 1_555 ? 
24 AC3 13 GLY B 112 ? GLY B 703  . ? 1_555 ? 
25 AC3 13 LEU B 160 ? LEU B 751  . ? 1_555 ? 
26 AC3 13 SER B 170 ? SER B 761  . ? 1_555 ? 
27 AC3 13 ASP B 171 ? ASP B 762  . ? 1_555 ? 
28 AC3 13 HOH H .   ? HOH B 1091 . ? 1_555 ? 
29 AC3 13 HOH H .   ? HOH B 1136 . ? 1_555 ? 
30 AC4 5  ARG A 91  ? ARG A 682  . ? 1_555 ? 
31 AC4 5  GLU A 107 ? GLU A 698  . ? 1_555 ? 
32 AC4 5  LYS A 168 ? LYS A 759  . ? 1_555 ? 
33 AC4 5  ARG B 87  ? ARG B 678  . ? 1_555 ? 
34 AC4 5  HOH H .   ? HOH B 1102 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5MJA 
_atom_sites.fract_transf_matrix[1][1]   0.009823 
_atom_sites.fract_transf_matrix[1][2]   0.005671 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011342 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.006364 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . GLU A 1 18  ? -11.430 31.059 -25.704 1.00 64.48  ? 609  GLU A N   1 
ATOM   2    C  CA  . GLU A 1 18  ? -12.176 32.319 -25.805 1.00 62.76  ? 609  GLU A CA  1 
ATOM   3    C  C   . GLU A 1 18  ? -12.384 33.006 -24.441 1.00 61.05  ? 609  GLU A C   1 
ATOM   4    O  O   . GLU A 1 18  ? -12.740 32.344 -23.466 1.00 62.32  ? 609  GLU A O   1 
ATOM   5    C  CB  . GLU A 1 18  ? -13.507 32.117 -26.545 1.00 64.75  ? 609  GLU A CB  1 
ATOM   6    N  N   . PHE A 1 19  ? -12.144 34.328 -24.384 1.00 51.03  ? 610  PHE A N   1 
ATOM   7    C  CA  . PHE A 1 19  ? -12.275 35.159 -23.174 1.00 47.01  ? 610  PHE A CA  1 
ATOM   8    C  C   . PHE A 1 19  ? -13.514 36.036 -23.288 1.00 47.67  ? 610  PHE A C   1 
ATOM   9    O  O   . PHE A 1 19  ? -13.652 36.777 -24.271 1.00 46.41  ? 610  PHE A O   1 
ATOM   10   C  CB  . PHE A 1 19  ? -11.033 36.053 -22.989 1.00 47.64  ? 610  PHE A CB  1 
ATOM   11   C  CG  . PHE A 1 19  ? -9.738  35.332 -22.729 1.00 49.56  ? 610  PHE A CG  1 
ATOM   12   C  CD1 . PHE A 1 19  ? -9.261  35.179 -21.437 1.00 52.55  ? 610  PHE A CD1 1 
ATOM   13   C  CD2 . PHE A 1 19  ? -8.975  34.832 -23.780 1.00 53.66  ? 610  PHE A CD2 1 
ATOM   14   C  CE1 . PHE A 1 19  ? -8.067  34.497 -21.192 1.00 54.20  ? 610  PHE A CE1 1 
ATOM   15   C  CE2 . PHE A 1 19  ? -7.783  34.140 -23.534 1.00 57.73  ? 610  PHE A CE2 1 
ATOM   16   C  CZ  . PHE A 1 19  ? -7.329  33.990 -22.242 1.00 55.21  ? 610  PHE A CZ  1 
ATOM   17   N  N   . ALA A 1 20  ? -14.416 35.942 -22.279 1.00 42.82  ? 611  ALA A N   1 
ATOM   18   C  CA  . ALA A 1 20  ? -15.671 36.698 -22.225 1.00 42.04  ? 611  ALA A CA  1 
ATOM   19   C  C   . ALA A 1 20  ? -15.372 38.202 -22.206 1.00 43.32  ? 611  ALA A C   1 
ATOM   20   O  O   . ALA A 1 20  ? -16.152 39.003 -22.711 1.00 41.22  ? 611  ALA A O   1 
ATOM   21   C  CB  . ALA A 1 20  ? -16.464 36.301 -20.983 1.00 41.75  ? 611  ALA A CB  1 
ATOM   22   N  N   . LYS A 1 21  ? -14.238 38.570 -21.611 1.00 40.16  ? 612  LYS A N   1 
ATOM   23   C  CA  . LYS A 1 21  ? -13.847 39.975 -21.519 1.00 39.86  ? 612  LYS A CA  1 
ATOM   24   C  C   . LYS A 1 21  ? -12.874 40.413 -22.640 1.00 44.82  ? 612  LYS A C   1 
ATOM   25   O  O   . LYS A 1 21  ? -12.226 41.449 -22.517 1.00 45.05  ? 612  LYS A O   1 
ATOM   26   C  CB  . LYS A 1 21  ? -13.339 40.317 -20.120 1.00 40.76  ? 612  LYS A CB  1 
ATOM   27   C  CG  . LYS A 1 21  ? -14.501 40.441 -19.143 1.00 42.92  ? 612  LYS A CG  1 
ATOM   28   C  CD  . LYS A 1 21  ? -14.024 40.545 -17.716 1.00 42.43  ? 612  LYS A CD  1 
ATOM   29   C  CE  . LYS A 1 21  ? -15.182 40.735 -16.755 1.00 46.84  ? 612  LYS A CE  1 
ATOM   30   N  NZ  . LYS A 1 21  ? -14.694 40.790 -15.356 1.00 49.29  ? 612  LYS A NZ  1 
ATOM   31   N  N   . GLU A 1 22  ? -12.853 39.683 -23.773 1.00 43.05  ? 613  GLU A N   1 
ATOM   32   C  CA  . GLU A 1 22  ? -12.065 40.080 -24.948 1.00 42.35  ? 613  GLU A CA  1 
ATOM   33   C  C   . GLU A 1 22  ? -12.548 41.466 -25.417 1.00 46.19  ? 613  GLU A C   1 
ATOM   34   O  O   . GLU A 1 22  ? -13.758 41.708 -25.483 1.00 46.60  ? 613  GLU A O   1 
ATOM   35   C  CB  . GLU A 1 22  ? -12.223 39.066 -26.095 1.00 44.00  ? 613  GLU A CB  1 
ATOM   36   C  CG  . GLU A 1 22  ? -11.267 39.305 -27.261 1.00 44.74  ? 613  GLU A CG  1 
ATOM   37   C  CD  . GLU A 1 22  ? -9.849  38.794 -27.103 1.00 52.01  ? 613  GLU A CD  1 
ATOM   38   O  OE1 . GLU A 1 22  ? -9.622  37.845 -26.321 1.00 44.65  ? 613  GLU A OE1 1 
ATOM   39   O  OE2 . GLU A 1 22  ? -8.965  39.306 -27.819 1.00 52.32  ? 613  GLU A OE2 1 
ATOM   40   N  N   . ILE A 1 23  ? -11.606 42.372 -25.696 1.00 43.27  ? 614  ILE A N   1 
ATOM   41   C  CA  . ILE A 1 23  ? -11.919 43.727 -26.175 1.00 44.15  ? 614  ILE A CA  1 
ATOM   42   C  C   . ILE A 1 23  ? -11.174 44.024 -27.459 1.00 50.10  ? 614  ILE A C   1 
ATOM   43   O  O   . ILE A 1 23  ? -10.046 43.573 -27.637 1.00 49.38  ? 614  ILE A O   1 
ATOM   44   C  CB  . ILE A 1 23  ? -11.692 44.854 -25.111 1.00 45.98  ? 614  ILE A CB  1 
ATOM   45   C  CG1 . ILE A 1 23  ? -10.266 44.889 -24.550 1.00 46.19  ? 614  ILE A CG1 1 
ATOM   46   C  CG2 . ILE A 1 23  ? -12.695 44.801 -23.982 1.00 44.57  ? 614  ILE A CG2 1 
ATOM   47   C  CD1 . ILE A 1 23  ? -9.588  46.095 -24.857 1.00 53.42  ? 614  ILE A CD1 1 
ATOM   48   N  N   . ASP A 1 24  ? -11.775 44.811 -28.336 1.00 49.05  ? 615  ASP A N   1 
ATOM   49   C  CA  . ASP A 1 24  ? -11.091 45.257 -29.541 1.00 51.11  ? 615  ASP A CA  1 
ATOM   50   C  C   . ASP A 1 24  ? -9.949  46.214 -29.082 1.00 54.97  ? 615  ASP A C   1 
ATOM   51   O  O   . ASP A 1 24  ? -10.177 47.017 -28.181 1.00 51.45  ? 615  ASP A O   1 
ATOM   52   C  CB  . ASP A 1 24  ? -12.086 46.013 -30.434 1.00 54.49  ? 615  ASP A CB  1 
ATOM   53   C  CG  . ASP A 1 24  ? -11.512 46.385 -31.783 1.00 70.16  ? 615  ASP A CG  1 
ATOM   54   O  OD1 . ASP A 1 24  ? -10.760 47.371 -31.853 1.00 69.68  ? 615  ASP A OD1 1 
ATOM   55   O  OD2 . ASP A 1 24  ? -11.769 45.650 -32.755 1.00 84.67  ? 615  ASP A OD2 1 
ATOM   56   N  N   . VAL A 1 25  ? -8.734  46.115 -29.682 1.00 55.48  ? 616  VAL A N   1 
ATOM   57   C  CA  . VAL A 1 25  ? -7.572  46.984 -29.360 1.00 55.55  ? 616  VAL A CA  1 
ATOM   58   C  C   . VAL A 1 25  ? -7.868  48.471 -29.416 1.00 61.65  ? 616  VAL A C   1 
ATOM   59   O  O   . VAL A 1 25  ? -7.256  49.223 -28.656 1.00 63.01  ? 616  VAL A O   1 
ATOM   60   C  CB  . VAL A 1 25  ? -6.258  46.725 -30.150 1.00 60.51  ? 616  VAL A CB  1 
ATOM   61   C  CG1 . VAL A 1 25  ? -5.313  45.807 -29.397 1.00 59.29  ? 616  VAL A CG1 1 
ATOM   62   C  CG2 . VAL A 1 25  ? -6.488  46.292 -31.598 1.00 61.34  ? 616  VAL A CG2 1 
ATOM   63   N  N   . SER A 1 26  ? -8.780  48.904 -30.310 1.00 58.88  ? 617  SER A N   1 
ATOM   64   C  CA  . SER A 1 26  ? -9.135  50.320 -30.467 1.00 58.80  ? 617  SER A CA  1 
ATOM   65   C  C   . SER A 1 26  ? -9.755  50.925 -29.222 1.00 61.98  ? 617  SER A C   1 
ATOM   66   O  O   . SER A 1 26  ? -9.778  52.154 -29.093 1.00 63.50  ? 617  SER A O   1 
ATOM   67   C  CB  . SER A 1 26  ? -10.022 50.530 -31.693 1.00 62.30  ? 617  SER A CB  1 
ATOM   68   O  OG  . SER A 1 26  ? -11.326 50.001 -31.516 1.00 70.62  ? 617  SER A OG  1 
ATOM   69   N  N   . PHE A 1 27  ? -10.237 50.068 -28.292 1.00 55.38  ? 618  PHE A N   1 
ATOM   70   C  CA  . PHE A 1 27  ? -10.871 50.498 -27.047 1.00 53.10  ? 618  PHE A CA  1 
ATOM   71   C  C   . PHE A 1 27  ? -9.843  50.971 -26.024 1.00 53.76  ? 618  PHE A C   1 
ATOM   72   O  O   . PHE A 1 27  ? -10.205 51.680 -25.088 1.00 52.06  ? 618  PHE A O   1 
ATOM   73   C  CB  . PHE A 1 27  ? -11.727 49.352 -26.454 1.00 53.81  ? 618  PHE A CB  1 
ATOM   74   C  CG  . PHE A 1 27  ? -12.839 48.791 -27.327 1.00 56.28  ? 618  PHE A CG  1 
ATOM   75   C  CD1 . PHE A 1 27  ? -13.208 49.422 -28.515 1.00 61.06  ? 618  PHE A CD1 1 
ATOM   76   C  CD2 . PHE A 1 27  ? -13.536 47.648 -26.945 1.00 57.07  ? 618  PHE A CD2 1 
ATOM   77   C  CE1 . PHE A 1 27  ? -14.225 48.898 -29.318 1.00 62.70  ? 618  PHE A CE1 1 
ATOM   78   C  CE2 . PHE A 1 27  ? -14.557 47.131 -27.744 1.00 60.80  ? 618  PHE A CE2 1 
ATOM   79   C  CZ  . PHE A 1 27  ? -14.897 47.762 -28.923 1.00 60.69  ? 618  PHE A CZ  1 
ATOM   80   N  N   . VAL A 1 28  ? -8.578  50.556 -26.178 1.00 51.34  ? 619  VAL A N   1 
ATOM   81   C  CA  . VAL A 1 28  ? -7.510  50.924 -25.243 1.00 51.90  ? 619  VAL A CA  1 
ATOM   82   C  C   . VAL A 1 28  ? -6.548  51.931 -25.790 1.00 56.44  ? 619  VAL A C   1 
ATOM   83   O  O   . VAL A 1 28  ? -6.093  51.796 -26.915 1.00 57.15  ? 619  VAL A O   1 
ATOM   84   C  CB  . VAL A 1 28  ? -6.713  49.746 -24.638 1.00 56.66  ? 619  VAL A CB  1 
ATOM   85   C  CG1 . VAL A 1 28  ? -6.881  49.685 -23.131 1.00 55.71  ? 619  VAL A CG1 1 
ATOM   86   C  CG2 . VAL A 1 28  ? -7.064  48.414 -25.287 1.00 57.04  ? 619  VAL A CG2 1 
ATOM   87   N  N   . LYS A 1 29  ? -6.168  52.887 -24.935 1.00 53.92  ? 620  LYS A N   1 
ATOM   88   C  CA  . LYS A 1 29  ? -5.161  53.913 -25.189 1.00 55.73  ? 620  LYS A CA  1 
ATOM   89   C  C   . LYS A 1 29  ? -4.099  53.738 -24.097 1.00 61.14  ? 620  LYS A C   1 
ATOM   90   O  O   . LYS A 1 29  ? -4.397  53.876 -22.905 1.00 59.95  ? 620  LYS A O   1 
ATOM   91   C  CB  . LYS A 1 29  ? -5.783  55.322 -25.163 1.00 58.88  ? 620  LYS A CB  1 
ATOM   92   C  CG  . LYS A 1 29  ? -4.811  56.441 -25.524 1.00 82.64  ? 620  LYS A CG  1 
ATOM   93   N  N   . ILE A 1 30  ? -2.888  53.357 -24.506 1.00 59.11  ? 621  ILE A N   1 
ATOM   94   C  CA  . ILE A 1 30  ? -1.763  53.131 -23.604 1.00 58.20  ? 621  ILE A CA  1 
ATOM   95   C  C   . ILE A 1 30  ? -1.058  54.455 -23.324 1.00 61.74  ? 621  ILE A C   1 
ATOM   96   O  O   . ILE A 1 30  ? -0.694  55.182 -24.265 1.00 62.24  ? 621  ILE A O   1 
ATOM   97   C  CB  . ILE A 1 30  ? -0.793  52.056 -24.158 1.00 62.10  ? 621  ILE A CB  1 
ATOM   98   C  CG1 . ILE A 1 30  ? -1.518  50.696 -24.363 1.00 62.74  ? 621  ILE A CG1 1 
ATOM   99   C  CG2 . ILE A 1 30  ? 0.395   51.880 -23.223 1.00 62.83  ? 621  ILE A CG2 1 
ATOM   100  C  CD1 . ILE A 1 30  ? -0.813  49.707 -25.319 1.00 72.91  ? 621  ILE A CD1 1 
ATOM   101  N  N   . GLU A 1 31  ? -0.872  54.766 -22.029 1.00 54.66  ? 622  GLU A N   1 
ATOM   102  C  CA  . GLU A 1 31  ? -0.161  55.969 -21.610 1.00 54.30  ? 622  GLU A CA  1 
ATOM   103  C  C   . GLU A 1 31  ? 1.181   55.603 -20.931 1.00 57.57  ? 622  GLU A C   1 
ATOM   104  O  O   . GLU A 1 31  ? 1.886   54.733 -21.446 1.00 59.02  ? 622  GLU A O   1 
ATOM   105  C  CB  . GLU A 1 31  ? -1.067  56.903 -20.792 1.00 54.70  ? 622  GLU A CB  1 
ATOM   106  C  CG  . GLU A 1 31  ? -2.152  57.496 -21.674 1.00 61.96  ? 622  GLU A CG  1 
ATOM   107  C  CD  . GLU A 1 31  ? -3.211  58.371 -21.037 1.00 81.43  ? 622  GLU A CD  1 
ATOM   108  O  OE1 . GLU A 1 31  ? -3.370  58.348 -19.791 1.00 77.64  ? 622  GLU A OE1 1 
ATOM   109  O  OE2 . GLU A 1 31  ? -3.908  59.064 -21.813 1.00 68.18  ? 622  GLU A OE2 1 
ATOM   110  N  N   . GLU A 1 32  ? 1.535   56.234 -19.810 1.00 53.33  ? 623  GLU A N   1 
ATOM   111  C  CA  . GLU A 1 32  ? 2.832   56.054 -19.161 1.00 53.74  ? 623  GLU A CA  1 
ATOM   112  C  C   . GLU A 1 32  ? 3.046   54.690 -18.470 1.00 54.30  ? 623  GLU A C   1 
ATOM   113  O  O   . GLU A 1 32  ? 2.086   54.058 -18.030 1.00 52.11  ? 623  GLU A O   1 
ATOM   114  C  CB  . GLU A 1 32  ? 3.106   57.219 -18.172 1.00 55.57  ? 623  GLU A CB  1 
ATOM   115  C  CG  . GLU A 1 32  ? 2.386   57.108 -16.831 1.00 64.29  ? 623  GLU A CG  1 
ATOM   116  C  CD  . GLU A 1 32  ? 1.084   57.867 -16.654 1.00 78.57  ? 623  GLU A CD  1 
ATOM   117  O  OE1 . GLU A 1 32  ? 0.295   57.960 -17.625 1.00 59.88  ? 623  GLU A OE1 1 
ATOM   118  O  OE2 . GLU A 1 32  ? 0.829   58.314 -15.511 1.00 70.24  ? 623  GLU A OE2 1 
ATOM   119  N  N   . VAL A 1 33  ? 4.326   54.274 -18.348 1.00 51.11  ? 624  VAL A N   1 
ATOM   120  C  CA  . VAL A 1 33  ? 4.723   53.063 -17.634 1.00 51.05  ? 624  VAL A CA  1 
ATOM   121  C  C   . VAL A 1 33  ? 4.508   53.351 -16.138 1.00 57.40  ? 624  VAL A C   1 
ATOM   122  O  O   . VAL A 1 33  ? 4.896   54.411 -15.667 1.00 59.02  ? 624  VAL A O   1 
ATOM   123  C  CB  . VAL A 1 33  ? 6.185   52.624 -17.939 1.00 55.57  ? 624  VAL A CB  1 
ATOM   124  C  CG1 . VAL A 1 33  ? 6.668   51.549 -16.966 1.00 54.23  ? 624  VAL A CG1 1 
ATOM   125  C  CG2 . VAL A 1 33  ? 6.354   52.159 -19.377 1.00 56.16  ? 624  VAL A CG2 1 
ATOM   126  N  N   . ILE A 1 34  ? 3.844   52.438 -15.419 1.00 52.89  ? 625  ILE A N   1 
ATOM   127  C  CA  . ILE A 1 34  ? 3.565   52.589 -13.985 1.00 52.40  ? 625  ILE A CA  1 
ATOM   128  C  C   . ILE A 1 34  ? 4.201   51.466 -13.152 1.00 58.47  ? 625  ILE A C   1 
ATOM   129  O  O   . ILE A 1 34  ? 4.223   51.540 -11.918 1.00 58.30  ? 625  ILE A O   1 
ATOM   130  C  CB  . ILE A 1 34  ? 2.048   52.758 -13.682 1.00 53.38  ? 625  ILE A CB  1 
ATOM   131  C  CG1 . ILE A 1 34  ? 1.218   51.538 -14.183 1.00 50.15  ? 625  ILE A CG1 1 
ATOM   132  C  CG2 . ILE A 1 34  ? 1.530   54.113 -14.227 1.00 54.58  ? 625  ILE A CG2 1 
ATOM   133  C  CD1 . ILE A 1 34  ? -0.278  51.530 -13.727 1.00 44.34  ? 625  ILE A CD1 1 
ATOM   134  N  N   . GLY A 1 35  ? 4.697   50.442 -13.836 1.00 54.76  ? 626  GLY A N   1 
ATOM   135  C  CA  . GLY A 1 35  ? 5.348   49.318 -13.188 1.00 54.94  ? 626  GLY A CA  1 
ATOM   136  C  C   . GLY A 1 35  ? 5.993   48.347 -14.146 1.00 61.69  ? 626  GLY A C   1 
ATOM   137  O  O   . GLY A 1 35  ? 5.992   48.547 -15.370 1.00 59.61  ? 626  GLY A O   1 
ATOM   138  N  N   . ALA A 1 36  ? 6.565   47.290 -13.568 1.00 63.25  ? 627  ALA A N   1 
ATOM   139  C  CA  . ALA A 1 36  ? 7.196   46.198 -14.304 1.00 65.31  ? 627  ALA A CA  1 
ATOM   140  C  C   . ALA A 1 36  ? 6.517   44.887 -13.908 1.00 69.39  ? 627  ALA A C   1 
ATOM   141  O  O   . ALA A 1 36  ? 5.956   44.787 -12.823 1.00 67.62  ? 627  ALA A O   1 
ATOM   142  C  CB  . ALA A 1 36  ? 8.686   46.148 -14.005 1.00 67.86  ? 627  ALA A CB  1 
ATOM   143  N  N   . GLY A 1 37  ? 6.491   43.948 -14.845 1.00 68.53  ? 628  GLY A N   1 
ATOM   144  C  CA  . GLY A 1 37  ? 5.946   42.603 -14.702 1.00 68.03  ? 628  GLY A CA  1 
ATOM   145  C  C   . GLY A 1 37  ? 6.960   41.582 -15.200 1.00 74.08  ? 628  GLY A C   1 
ATOM   146  O  O   . GLY A 1 37  ? 8.014   41.959 -15.726 1.00 75.48  ? 628  GLY A O   1 
ATOM   147  N  N   . GLU A 1 38  ? 6.664   40.286 -15.027 1.00 70.33  ? 629  GLU A N   1 
ATOM   148  C  CA  . GLU A 1 38  ? 7.532   39.178 -15.447 1.00 71.39  ? 629  GLU A CA  1 
ATOM   149  C  C   . GLU A 1 38  ? 7.738   39.138 -16.979 1.00 74.72  ? 629  GLU A C   1 
ATOM   150  O  O   . GLU A 1 38  ? 8.846   38.876 -17.463 1.00 76.20  ? 629  GLU A O   1 
ATOM   151  C  CB  . GLU A 1 38  ? 6.928   37.839 -14.963 1.00 72.25  ? 629  GLU A CB  1 
ATOM   152  C  CG  . GLU A 1 38  ? 7.853   36.644 -15.154 1.00 86.58  ? 629  GLU A CG  1 
ATOM   153  C  CD  . GLU A 1 38  ? 7.285   35.266 -14.877 1.00 107.09 ? 629  GLU A CD  1 
ATOM   154  O  OE1 . GLU A 1 38  ? 6.147   35.175 -14.361 1.00 90.43  ? 629  GLU A OE1 1 
ATOM   155  O  OE2 . GLU A 1 38  ? 7.989   34.272 -15.173 1.00 106.75 ? 629  GLU A OE2 1 
ATOM   156  N  N   . PHE A 1 39  ? 6.648   39.402 -17.721 1.00 68.43  ? 630  PHE A N   1 
ATOM   157  C  CA  . PHE A 1 39  ? 6.559   39.304 -19.179 1.00 67.30  ? 630  PHE A CA  1 
ATOM   158  C  C   . PHE A 1 39  ? 6.666   40.638 -19.942 1.00 63.75  ? 630  PHE A C   1 
ATOM   159  O  O   . PHE A 1 39  ? 6.728   40.635 -21.167 1.00 60.47  ? 630  PHE A O   1 
ATOM   160  C  CB  . PHE A 1 39  ? 5.241   38.577 -19.533 1.00 68.29  ? 630  PHE A CB  1 
ATOM   161  C  CG  . PHE A 1 39  ? 5.102   37.201 -18.923 1.00 69.84  ? 630  PHE A CG  1 
ATOM   162  C  CD1 . PHE A 1 39  ? 5.786   36.110 -19.458 1.00 74.57  ? 630  PHE A CD1 1 
ATOM   163  C  CD2 . PHE A 1 39  ? 4.307   36.999 -17.802 1.00 70.27  ? 630  PHE A CD2 1 
ATOM   164  C  CE1 . PHE A 1 39  ? 5.668   34.843 -18.884 1.00 75.44  ? 630  PHE A CE1 1 
ATOM   165  C  CE2 . PHE A 1 39  ? 4.180   35.729 -17.236 1.00 73.50  ? 630  PHE A CE2 1 
ATOM   166  C  CZ  . PHE A 1 39  ? 4.871   34.663 -17.774 1.00 73.41  ? 630  PHE A CZ  1 
ATOM   167  N  N   . GLY A 1 40  ? 6.650   41.744 -19.208 1.00 57.63  ? 631  GLY A N   1 
ATOM   168  C  CA  . GLY A 1 40  ? 6.672   43.075 -19.777 1.00 57.41  ? 631  GLY A CA  1 
ATOM   169  C  C   . GLY A 1 40  ? 6.251   44.143 -18.797 1.00 60.02  ? 631  GLY A C   1 
ATOM   170  O  O   . GLY A 1 40  ? 6.115   43.884 -17.601 1.00 59.96  ? 631  GLY A O   1 
ATOM   171  N  N   . GLU A 1 41  ? 6.019   45.343 -19.303 1.00 56.01  ? 632  GLU A N   1 
ATOM   172  C  CA  . GLU A 1 41  ? 5.672   46.497 -18.477 1.00 55.29  ? 632  GLU A CA  1 
ATOM   173  C  C   . GLU A 1 41  ? 4.193   46.586 -18.126 1.00 53.94  ? 632  GLU A C   1 
ATOM   174  O  O   . GLU A 1 41  ? 3.351   45.947 -18.758 1.00 53.20  ? 632  GLU A O   1 
ATOM   175  C  CB  . GLU A 1 41  ? 6.116   47.809 -19.155 1.00 58.57  ? 632  GLU A CB  1 
ATOM   176  C  CG  . GLU A 1 41  ? 7.593   47.872 -19.523 1.00 75.47  ? 632  GLU A CG  1 
ATOM   177  C  CD  . GLU A 1 41  ? 7.955   47.411 -20.922 1.00 94.06  ? 632  GLU A CD  1 
ATOM   178  O  OE1 . GLU A 1 41  ? 7.223   46.584 -21.517 1.00 82.05  ? 632  GLU A OE1 1 
ATOM   179  O  OE2 . GLU A 1 41  ? 9.015   47.858 -21.406 1.00 98.26  ? 632  GLU A OE2 1 
ATOM   180  N  N   . VAL A 1 42  ? 3.903   47.385 -17.097 1.00 47.93  ? 633  VAL A N   1 
ATOM   181  C  CA  . VAL A 1 42  ? 2.559   47.733 -16.658 1.00 45.82  ? 633  VAL A CA  1 
ATOM   182  C  C   . VAL A 1 42  ? 2.430   49.213 -16.965 1.00 50.15  ? 633  VAL A C   1 
ATOM   183  O  O   . VAL A 1 42  ? 3.319   50.003 -16.614 1.00 51.06  ? 633  VAL A O   1 
ATOM   184  C  CB  . VAL A 1 42  ? 2.239   47.399 -15.181 1.00 47.61  ? 633  VAL A CB  1 
ATOM   185  C  CG1 . VAL A 1 42  ? 0.773   47.740 -14.858 1.00 46.05  ? 633  VAL A CG1 1 
ATOM   186  C  CG2 . VAL A 1 42  ? 2.526   45.922 -14.886 1.00 46.67  ? 633  VAL A CG2 1 
ATOM   187  N  N   . TYR A 1 43  ? 1.373   49.571 -17.694 1.00 44.85  ? 634  TYR A N   1 
ATOM   188  C  CA  . TYR A 1 43  ? 1.116   50.946 -18.098 1.00 45.23  ? 634  TYR A CA  1 
ATOM   189  C  C   . TYR A 1 43  ? -0.191  51.448 -17.542 1.00 46.15  ? 634  TYR A C   1 
ATOM   190  O  O   . TYR A 1 43  ? -1.108  50.651 -17.328 1.00 41.77  ? 634  TYR A O   1 
ATOM   191  C  CB  . TYR A 1 43  ? 0.988   51.027 -19.615 1.00 48.05  ? 634  TYR A CB  1 
ATOM   192  C  CG  . TYR A 1 43  ? 2.192   50.567 -20.389 1.00 54.17  ? 634  TYR A CG  1 
ATOM   193  C  CD1 . TYR A 1 43  ? 2.352   49.226 -20.733 1.00 56.12  ? 634  TYR A CD1 1 
ATOM   194  C  CD2 . TYR A 1 43  ? 3.102   51.486 -20.905 1.00 57.98  ? 634  TYR A CD2 1 
ATOM   195  C  CE1 . TYR A 1 43  ? 3.434   48.801 -21.498 1.00 60.37  ? 634  TYR A CE1 1 
ATOM   196  C  CE2 . TYR A 1 43  ? 4.178   51.074 -21.690 1.00 61.20  ? 634  TYR A CE2 1 
ATOM   197  C  CZ  . TYR A 1 43  ? 4.347   49.728 -21.970 1.00 73.00  ? 634  TYR A CZ  1 
ATOM   198  O  OH  . TYR A 1 43  ? 5.400   49.311 -22.741 1.00 81.83  ? 634  TYR A OH  1 
ATOM   199  N  N   . LYS A 1 44  ? -0.311  52.776 -17.394 1.00 44.91  ? 635  LYS A N   1 
ATOM   200  C  CA  . LYS A 1 44  ? -1.587  53.407 -17.088 1.00 44.33  ? 635  LYS A CA  1 
ATOM   201  C  C   . LYS A 1 44  ? -2.201  53.580 -18.487 1.00 48.46  ? 635  LYS A C   1 
ATOM   202  O  O   . LYS A 1 44  ? -1.479  53.725 -19.474 1.00 47.15  ? 635  LYS A O   1 
ATOM   203  C  CB  . LYS A 1 44  ? -1.427  54.781 -16.417 1.00 47.59  ? 635  LYS A CB  1 
ATOM   204  C  CG  . LYS A 1 44  ? -2.758  55.308 -15.858 1.00 42.95  ? 635  LYS A CG  1 
ATOM   205  C  CD  . LYS A 1 44  ? -2.626  56.663 -15.219 1.00 50.38  ? 635  LYS A CD  1 
ATOM   206  C  CE  . LYS A 1 44  ? -3.970  57.153 -14.745 1.00 53.04  ? 635  LYS A CE  1 
ATOM   207  N  NZ  . LYS A 1 44  ? -3.868  58.458 -14.053 1.00 60.71  ? 635  LYS A NZ  1 
ATOM   208  N  N   . GLY A 1 45  ? -3.515  53.529 -18.561 1.00 45.83  ? 636  GLY A N   1 
ATOM   209  C  CA  . GLY A 1 45  ? -4.209  53.687 -19.824 1.00 45.70  ? 636  GLY A CA  1 
ATOM   210  C  C   . GLY A 1 45  ? -5.630  54.139 -19.645 1.00 50.23  ? 636  GLY A C   1 
ATOM   211  O  O   . GLY A 1 45  ? -6.087  54.390 -18.523 1.00 49.55  ? 636  GLY A O   1 
ATOM   212  N  N   . ARG A 1 46  ? -6.327  54.246 -20.771 1.00 47.69  ? 637  ARG A N   1 
ATOM   213  C  CA  . ARG A 1 46  ? -7.728  54.647 -20.819 1.00 46.70  ? 637  ARG A CA  1 
ATOM   214  C  C   . ARG A 1 46  ? -8.492  53.600 -21.589 1.00 47.18  ? 637  ARG A C   1 
ATOM   215  O  O   . ARG A 1 46  ? -8.036  53.129 -22.633 1.00 46.52  ? 637  ARG A O   1 
ATOM   216  C  CB  . ARG A 1 46  ? -7.893  56.027 -21.473 1.00 47.48  ? 637  ARG A CB  1 
ATOM   217  C  CG  . ARG A 1 46  ? -7.379  57.197 -20.629 1.00 59.55  ? 637  ARG A CG  1 
ATOM   218  C  CD  . ARG A 1 46  ? -7.218  58.443 -21.489 1.00 73.72  ? 637  ARG A CD  1 
ATOM   219  N  NE  . ARG A 1 46  ? -6.477  59.501 -20.799 1.00 91.17  ? 637  ARG A NE  1 
ATOM   220  C  CZ  . ARG A 1 46  ? -7.030  60.489 -20.098 1.00 108.44 ? 637  ARG A CZ  1 
ATOM   221  N  NH1 . ARG A 1 46  ? -8.352  60.575 -19.985 1.00 92.12  ? 637  ARG A NH1 1 
ATOM   222  N  NH2 . ARG A 1 46  ? -6.265  61.400 -19.507 1.00 98.38  ? 637  ARG A NH2 1 
ATOM   223  N  N   . LEU A 1 47  ? -9.621  53.192 -21.046 1.00 43.42  ? 638  LEU A N   1 
ATOM   224  C  CA  . LEU A 1 47  ? -10.466 52.193 -21.679 1.00 43.17  ? 638  LEU A CA  1 
ATOM   225  C  C   . LEU A 1 47  ? -11.807 52.804 -22.012 1.00 48.66  ? 638  LEU A C   1 
ATOM   226  O  O   . LEU A 1 47  ? -12.480 53.336 -21.120 1.00 47.62  ? 638  LEU A O   1 
ATOM   227  C  CB  . LEU A 1 47  ? -10.637 50.924 -20.802 1.00 40.83  ? 638  LEU A CB  1 
ATOM   228  C  CG  . LEU A 1 47  ? -11.591 49.829 -21.350 1.00 44.27  ? 638  LEU A CG  1 
ATOM   229  C  CD1 . LEU A 1 47  ? -10.968 49.086 -22.522 1.00 44.55  ? 638  LEU A CD1 1 
ATOM   230  C  CD2 . LEU A 1 47  ? -11.968 48.809 -20.261 1.00 44.62  ? 638  LEU A CD2 1 
ATOM   231  N  N   . LYS A 1 48  ? -12.185 52.734 -23.308 1.00 47.15  ? 639  LYS A N   1 
ATOM   232  C  CA  . LYS A 1 48  ? -13.478 53.217 -23.770 1.00 49.39  ? 639  LYS A CA  1 
ATOM   233  C  C   . LYS A 1 48  ? -14.308 52.115 -24.386 1.00 55.24  ? 639  LYS A C   1 
ATOM   234  O  O   . LYS A 1 48  ? -14.056 51.670 -25.510 1.00 54.58  ? 639  LYS A O   1 
ATOM   235  C  CB  . LYS A 1 48  ? -13.410 54.440 -24.681 1.00 55.21  ? 639  LYS A CB  1 
ATOM   236  C  CG  . LYS A 1 48  ? -14.490 55.421 -24.264 1.00 63.70  ? 639  LYS A CG  1 
ATOM   237  C  CD  . LYS A 1 48  ? -15.283 55.939 -25.406 1.00 65.10  ? 639  LYS A CD  1 
ATOM   238  C  CE  . LYS A 1 48  ? -16.664 56.340 -24.968 1.00 64.64  ? 639  LYS A CE  1 
ATOM   239  N  NZ  . LYS A 1 48  ? -17.633 55.234 -25.172 1.00 71.98  ? 639  LYS A NZ  1 
ATOM   240  N  N   . LEU A 1 49  ? -15.267 51.636 -23.601 1.00 53.24  ? 640  LEU A N   1 
ATOM   241  C  CA  . LEU A 1 49  ? -16.182 50.602 -24.047 1.00 54.19  ? 640  LEU A CA  1 
ATOM   242  C  C   . LEU A 1 49  ? -17.322 51.305 -24.774 1.00 61.83  ? 640  LEU A C   1 
ATOM   243  O  O   . LEU A 1 49  ? -17.629 52.451 -24.433 1.00 60.26  ? 640  LEU A O   1 
ATOM   244  C  CB  . LEU A 1 49  ? -16.684 49.763 -22.856 1.00 52.62  ? 640  LEU A CB  1 
ATOM   245  C  CG  . LEU A 1 49  ? -15.651 48.899 -22.114 1.00 55.87  ? 640  LEU A CG  1 
ATOM   246  C  CD1 . LEU A 1 49  ? -16.329 47.976 -21.143 1.00 54.78  ? 640  LEU A CD1 1 
ATOM   247  C  CD2 . LEU A 1 49  ? -14.762 48.087 -23.077 1.00 57.26  ? 640  LEU A CD2 1 
ATOM   248  N  N   . PRO A 1 50  ? -17.919 50.689 -25.823 1.00 64.21  ? 641  PRO A N   1 
ATOM   249  C  CA  . PRO A 1 50  ? -19.003 51.377 -26.561 1.00 66.03  ? 641  PRO A CA  1 
ATOM   250  C  C   . PRO A 1 50  ? -20.173 51.814 -25.677 1.00 66.56  ? 641  PRO A C   1 
ATOM   251  O  O   . PRO A 1 50  ? -20.646 51.027 -24.867 1.00 64.93  ? 641  PRO A O   1 
ATOM   252  C  CB  . PRO A 1 50  ? -19.441 50.329 -27.598 1.00 69.14  ? 641  PRO A CB  1 
ATOM   253  C  CG  . PRO A 1 50  ? -18.995 48.990 -27.013 1.00 71.49  ? 641  PRO A CG  1 
ATOM   254  C  CD  . PRO A 1 50  ? -17.677 49.336 -26.376 1.00 66.18  ? 641  PRO A CD  1 
ATOM   255  N  N   . GLY A 1 51  ? -20.565 53.083 -25.794 1.00 62.98  ? 642  GLY A N   1 
ATOM   256  C  CA  . GLY A 1 51  ? -21.670 53.679 -25.045 1.00 62.21  ? 642  GLY A CA  1 
ATOM   257  C  C   . GLY A 1 51  ? -21.453 53.832 -23.553 1.00 63.25  ? 642  GLY A C   1 
ATOM   258  O  O   . GLY A 1 51  ? -22.415 54.057 -22.811 1.00 63.41  ? 642  GLY A O   1 
ATOM   259  N  N   . LYS A 1 52  ? -20.187 53.717 -23.102 1.00 56.87  ? 643  LYS A N   1 
ATOM   260  C  CA  . LYS A 1 52  ? -19.801 53.817 -21.687 1.00 54.47  ? 643  LYS A CA  1 
ATOM   261  C  C   . LYS A 1 52  ? -18.768 54.904 -21.529 1.00 58.08  ? 643  LYS A C   1 
ATOM   262  O  O   . LYS A 1 52  ? -17.956 55.120 -22.429 1.00 56.90  ? 643  LYS A O   1 
ATOM   263  C  CB  . LYS A 1 52  ? -19.198 52.495 -21.176 1.00 53.51  ? 643  LYS A CB  1 
ATOM   264  C  CG  . LYS A 1 52  ? -20.111 51.288 -21.308 1.00 62.44  ? 643  LYS A CG  1 
ATOM   265  C  CD  . LYS A 1 52  ? -20.458 50.694 -19.983 1.00 66.27  ? 643  LYS A CD  1 
ATOM   266  C  CE  . LYS A 1 52  ? -19.393 49.805 -19.417 1.00 66.45  ? 643  LYS A CE  1 
ATOM   267  N  NZ  . LYS A 1 52  ? -19.456 49.801 -17.931 1.00 75.55  ? 643  LYS A NZ  1 
ATOM   268  N  N   . ARG A 1 53  ? -18.787 55.581 -20.381 1.00 55.30  ? 644  ARG A N   1 
ATOM   269  C  CA  . ARG A 1 53  ? -17.819 56.628 -20.052 1.00 56.23  ? 644  ARG A CA  1 
ATOM   270  C  C   . ARG A 1 53  ? -16.412 55.968 -20.037 1.00 58.08  ? 644  ARG A C   1 
ATOM   271  O  O   . ARG A 1 53  ? -16.263 54.811 -19.610 1.00 55.37  ? 644  ARG A O   1 
ATOM   272  C  CB  . ARG A 1 53  ? -18.106 57.227 -18.640 1.00 59.44  ? 644  ARG A CB  1 
ATOM   273  C  CG  . ARG A 1 53  ? -19.591 57.462 -18.265 1.00 73.97  ? 644  ARG A CG  1 
ATOM   274  C  CD  . ARG A 1 53  ? -20.173 56.344 -17.393 1.00 81.77  ? 644  ARG A CD  1 
ATOM   275  N  NE  . ARG A 1 53  ? -20.948 55.365 -18.168 1.00 85.28  ? 644  ARG A NE  1 
ATOM   276  C  CZ  . ARG A 1 53  ? -21.338 54.174 -17.716 1.00 94.55  ? 644  ARG A CZ  1 
ATOM   277  N  NH1 . ARG A 1 53  ? -21.023 53.786 -16.487 1.00 79.85  ? 644  ARG A NH1 1 
ATOM   278  N  NH2 . ARG A 1 53  ? -22.040 53.362 -18.492 1.00 83.36  ? 644  ARG A NH2 1 
ATOM   279  N  N   . GLU A 1 54  ? -15.409 56.682 -20.541 1.00 53.79  ? 645  GLU A N   1 
ATOM   280  C  CA  . GLU A 1 54  ? -14.030 56.231 -20.509 1.00 52.19  ? 645  GLU A CA  1 
ATOM   281  C  C   . GLU A 1 54  ? -13.566 56.123 -19.038 1.00 54.37  ? 645  GLU A C   1 
ATOM   282  O  O   . GLU A 1 54  ? -13.964 56.927 -18.180 1.00 55.01  ? 645  GLU A O   1 
ATOM   283  C  CB  . GLU A 1 54  ? -13.153 57.237 -21.239 1.00 54.42  ? 645  GLU A CB  1 
ATOM   284  C  CG  . GLU A 1 54  ? -11.777 56.718 -21.585 1.00 63.37  ? 645  GLU A CG  1 
ATOM   285  C  CD  . GLU A 1 54  ? -10.907 57.786 -22.212 1.00 81.74  ? 645  GLU A CD  1 
ATOM   286  O  OE1 . GLU A 1 54  ? -10.510 58.725 -21.483 1.00 66.11  ? 645  GLU A OE1 1 
ATOM   287  O  OE2 . GLU A 1 54  ? -10.619 57.687 -23.429 1.00 64.77  ? 645  GLU A OE2 1 
ATOM   288  N  N   . ILE A 1 55  ? -12.768 55.094 -18.749 1.00 47.32  ? 646  ILE A N   1 
ATOM   289  C  CA  . ILE A 1 55  ? -12.214 54.880 -17.413 1.00 44.09  ? 646  ILE A CA  1 
ATOM   290  C  C   . ILE A 1 55  ? -10.698 54.785 -17.486 1.00 45.24  ? 646  ILE A C   1 
ATOM   291  O  O   . ILE A 1 55  ? -10.159 54.490 -18.543 1.00 43.69  ? 646  ILE A O   1 
ATOM   292  C  CB  . ILE A 1 55  ? -12.837 53.640 -16.720 1.00 44.74  ? 646  ILE A CB  1 
ATOM   293  C  CG1 . ILE A 1 55  ? -12.613 52.334 -17.532 1.00 42.39  ? 646  ILE A CG1 1 
ATOM   294  C  CG2 . ILE A 1 55  ? -14.325 53.868 -16.376 1.00 45.71  ? 646  ILE A CG2 1 
ATOM   295  C  CD1 . ILE A 1 55  ? -12.760 51.033 -16.703 1.00 37.32  ? 646  ILE A CD1 1 
HETATM 296  N  N   . PTR A 1 56  ? -10.014 55.041 -16.373 1.00 44.30  ? 647  PTR A N   1 
HETATM 297  C  CA  . PTR A 1 56  ? -8.581  54.837 -16.280 1.00 45.80  ? 647  PTR A CA  1 
HETATM 298  C  C   . PTR A 1 56  ? -8.409  53.348 -15.990 1.00 45.91  ? 647  PTR A C   1 
HETATM 299  O  O   . PTR A 1 56  ? -9.239  52.744 -15.293 1.00 43.80  ? 647  PTR A O   1 
HETATM 300  C  CB  . PTR A 1 56  ? -7.870  55.581 -15.147 1.00 52.45  ? 647  PTR A CB  1 
HETATM 301  C  CG  . PTR A 1 56  ? -7.703  57.025 -15.571 1.00 61.78  ? 647  PTR A CG  1 
HETATM 302  C  CD1 . PTR A 1 56  ? -8.390  58.006 -14.804 1.00 65.51  ? 647  PTR A CD1 1 
HETATM 303  C  CD2 . PTR A 1 56  ? -6.902  57.413 -16.703 1.00 65.89  ? 647  PTR A CD2 1 
HETATM 304  C  CE1 . PTR A 1 56  ? -8.269  59.352 -15.161 1.00 69.91  ? 647  PTR A CE1 1 
HETATM 305  C  CE2 . PTR A 1 56  ? -6.786  58.771 -17.038 1.00 70.91  ? 647  PTR A CE2 1 
HETATM 306  C  CZ  . PTR A 1 56  ? -7.450  59.759 -16.264 1.00 74.72  ? 647  PTR A CZ  1 
HETATM 307  O  OH  . PTR A 1 56  ? -7.328  61.084 -16.688 1.00 83.30  ? 647  PTR A OH  1 
HETATM 308  P  P   . PTR A 1 56  ? -6.800  62.179 -15.697 1.00 89.80  ? 647  PTR A P   1 
HETATM 309  O  O1P . PTR A 1 56  ? -6.623  63.494 -16.498 1.00 92.81  ? 647  PTR A O1P 1 
HETATM 310  O  O2P . PTR A 1 56  ? -5.434  61.701 -15.121 1.00 89.86  ? 647  PTR A O2P 1 
HETATM 311  O  O3P . PTR A 1 56  ? -7.846  62.500 -14.586 1.00 90.08  ? 647  PTR A O3P 1 
ATOM   312  N  N   . VAL A 1 57  ? -7.377  52.745 -16.572 1.00 41.22  ? 648  VAL A N   1 
ATOM   313  C  CA  . VAL A 1 57  ? -7.059  51.325 -16.371 1.00 38.61  ? 648  VAL A CA  1 
ATOM   314  C  C   . VAL A 1 57  ? -5.559  51.119 -16.196 1.00 39.61  ? 648  VAL A C   1 
ATOM   315  O  O   . VAL A 1 57  ? -4.770  51.990 -16.550 1.00 40.34  ? 648  VAL A O   1 
ATOM   316  C  CB  . VAL A 1 57  ? -7.572  50.441 -17.557 1.00 40.90  ? 648  VAL A CB  1 
ATOM   317  C  CG1 . VAL A 1 57  ? -9.088  50.230 -17.494 1.00 40.19  ? 648  VAL A CG1 1 
ATOM   318  C  CG2 . VAL A 1 57  ? -7.103  50.976 -18.921 1.00 40.94  ? 648  VAL A CG2 1 
ATOM   319  N  N   . ALA A 1 58  ? -5.167  49.930 -15.725 1.00 34.38  ? 649  ALA A N   1 
ATOM   320  C  CA  . ALA A 1 58  ? -3.766  49.519 -15.742 1.00 34.22  ? 649  ALA A CA  1 
ATOM   321  C  C   . ALA A 1 58  ? -3.668  48.422 -16.829 1.00 39.05  ? 649  ALA A C   1 
ATOM   322  O  O   . ALA A 1 58  ? -4.625  47.685 -17.044 1.00 39.00  ? 649  ALA A O   1 
ATOM   323  C  CB  . ALA A 1 58  ? -3.327  49.005 -14.402 1.00 33.32  ? 649  ALA A CB  1 
ATOM   324  N  N   . ILE A 1 59  ? -2.561  48.368 -17.562 1.00 39.16  ? 650  ILE A N   1 
ATOM   325  C  CA  . ILE A 1 59  ? -2.396  47.438 -18.675 1.00 39.08  ? 650  ILE A CA  1 
ATOM   326  C  C   . ILE A 1 59  ? -1.109  46.623 -18.577 1.00 44.56  ? 650  ILE A C   1 
ATOM   327  O  O   . ILE A 1 59  ? -0.023  47.184 -18.697 1.00 44.94  ? 650  ILE A O   1 
ATOM   328  C  CB  . ILE A 1 59  ? -2.483  48.201 -20.045 1.00 42.50  ? 650  ILE A CB  1 
ATOM   329  C  CG1 . ILE A 1 59  ? -3.747  49.085 -20.134 1.00 41.74  ? 650  ILE A CG1 1 
ATOM   330  C  CG2 . ILE A 1 59  ? -2.393  47.212 -21.227 1.00 43.66  ? 650  ILE A CG2 1 
ATOM   331  C  CD1 . ILE A 1 59  ? -3.634  50.243 -21.087 1.00 48.26  ? 650  ILE A CD1 1 
ATOM   332  N  N   . LYS A 1 60  ? -1.234  45.298 -18.421 1.00 41.00  ? 651  LYS A N   1 
ATOM   333  C  CA  . LYS A 1 60  ? -0.088  44.392 -18.421 1.00 41.47  ? 651  LYS A CA  1 
ATOM   334  C  C   . LYS A 1 60  ? 0.142   43.991 -19.864 1.00 46.68  ? 651  LYS A C   1 
ATOM   335  O  O   . LYS A 1 60  ? -0.806  43.595 -20.531 1.00 45.02  ? 651  LYS A O   1 
ATOM   336  C  CB  . LYS A 1 60  ? -0.352  43.143 -17.590 1.00 42.60  ? 651  LYS A CB  1 
ATOM   337  C  CG  . LYS A 1 60  ? 0.427   43.103 -16.295 1.00 50.11  ? 651  LYS A CG  1 
ATOM   338  C  CD  . LYS A 1 60  ? 0.364   41.723 -15.675 1.00 49.79  ? 651  LYS A CD  1 
ATOM   339  C  CE  . LYS A 1 60  ? 0.905   41.748 -14.273 1.00 55.02  ? 651  LYS A CE  1 
ATOM   340  N  NZ  . LYS A 1 60  ? 0.839   40.385 -13.708 1.00 53.15  ? 651  LYS A NZ  1 
ATOM   341  N  N   . THR A 1 61  ? 1.383   44.153 -20.363 1.00 45.09  ? 652  THR A N   1 
ATOM   342  C  CA  . THR A 1 61  ? 1.751   43.797 -21.733 1.00 47.06  ? 652  THR A CA  1 
ATOM   343  C  C   . THR A 1 61  ? 2.783   42.679 -21.732 1.00 51.20  ? 652  THR A C   1 
ATOM   344  O  O   . THR A 1 61  ? 3.452   42.441 -20.721 1.00 50.17  ? 652  THR A O   1 
ATOM   345  C  CB  . THR A 1 61  ? 2.278   45.018 -22.501 1.00 59.07  ? 652  THR A CB  1 
ATOM   346  O  OG1 . THR A 1 61  ? 3.326   45.597 -21.731 1.00 57.31  ? 652  THR A OG1 1 
ATOM   347  C  CG2 . THR A 1 61  ? 1.182   46.046 -22.804 1.00 57.16  ? 652  THR A CG2 1 
ATOM   348  N  N   . LEU A 1 62  ? 2.900   41.993 -22.867 1.00 47.67  ? 653  LEU A N   1 
ATOM   349  C  CA  . LEU A 1 62  ? 3.835   40.899 -23.081 1.00 47.30  ? 653  LEU A CA  1 
ATOM   350  C  C   . LEU A 1 62  ? 4.753   41.363 -24.202 1.00 48.57  ? 653  LEU A C   1 
ATOM   351  O  O   . LEU A 1 62  ? 4.297   41.661 -25.306 1.00 49.25  ? 653  LEU A O   1 
ATOM   352  C  CB  . LEU A 1 62  ? 3.045   39.621 -23.434 1.00 47.12  ? 653  LEU A CB  1 
ATOM   353  C  CG  . LEU A 1 62  ? 3.802   38.357 -23.815 1.00 53.22  ? 653  LEU A CG  1 
ATOM   354  C  CD1 . LEU A 1 62  ? 4.551   37.796 -22.658 1.00 53.61  ? 653  LEU A CD1 1 
ATOM   355  C  CD2 . LEU A 1 62  ? 2.846   37.301 -24.288 1.00 54.21  ? 653  LEU A CD2 1 
ATOM   356  N  N   . LYS A 1 63  ? 6.038   41.518 -23.878 1.00 44.06  ? 654  LYS A N   1 
ATOM   357  C  CA  . LYS A 1 63  ? 7.065   42.030 -24.777 1.00 43.75  ? 654  LYS A CA  1 
ATOM   358  C  C   . LYS A 1 63  ? 7.121   41.292 -26.100 1.00 47.45  ? 654  LYS A C   1 
ATOM   359  O  O   . LYS A 1 63  ? 6.939   40.070 -26.135 1.00 46.66  ? 654  LYS A O   1 
ATOM   360  C  CB  . LYS A 1 63  ? 8.430   42.061 -24.087 1.00 46.22  ? 654  LYS A CB  1 
ATOM   361  C  CG  . LYS A 1 63  ? 8.508   43.082 -22.956 1.00 49.98  ? 654  LYS A CG  1 
ATOM   362  C  CD  . LYS A 1 63  ? 9.759   42.909 -22.107 1.00 46.46  ? 654  LYS A CD  1 
ATOM   363  C  CE  . LYS A 1 63  ? 10.211  44.237 -21.555 1.00 64.26  ? 654  LYS A CE  1 
ATOM   364  N  NZ  . LYS A 1 63  ? 11.353  44.090 -20.613 1.00 77.82  ? 654  LYS A NZ  1 
ATOM   365  N  N   . ALA A 1 64  ? 7.341   42.052 -27.207 1.00 45.19  ? 655  ALA A N   1 
ATOM   366  C  CA  . ALA A 1 64  ? 7.417   41.481 -28.543 1.00 46.78  ? 655  ALA A CA  1 
ATOM   367  C  C   . ALA A 1 64  ? 8.598   40.504 -28.616 1.00 52.35  ? 655  ALA A C   1 
ATOM   368  O  O   . ALA A 1 64  ? 9.642   40.748 -28.016 1.00 51.46  ? 655  ALA A O   1 
ATOM   369  C  CB  . ALA A 1 64  ? 7.567   42.586 -29.583 1.00 49.47  ? 655  ALA A CB  1 
ATOM   370  N  N   . GLY A 1 65  ? 8.396   39.405 -29.322 1.00 50.03  ? 656  GLY A N   1 
ATOM   371  C  CA  . GLY A 1 65  ? 9.389   38.353 -29.469 1.00 52.22  ? 656  GLY A CA  1 
ATOM   372  C  C   . GLY A 1 65  ? 9.248   37.290 -28.401 1.00 53.88  ? 656  GLY A C   1 
ATOM   373  O  O   . GLY A 1 65  ? 10.166  36.508 -28.175 1.00 53.31  ? 656  GLY A O   1 
ATOM   374  N  N   . TYR A 1 66  ? 8.095   37.253 -27.741 1.00 50.44  ? 657  TYR A N   1 
ATOM   375  C  CA  . TYR A 1 66  ? 7.786   36.273 -26.707 1.00 50.51  ? 657  TYR A CA  1 
ATOM   376  C  C   . TYR A 1 66  ? 7.711   34.857 -27.285 1.00 55.51  ? 657  TYR A C   1 
ATOM   377  O  O   . TYR A 1 66  ? 7.420   34.690 -28.480 1.00 55.31  ? 657  TYR A O   1 
ATOM   378  C  CB  . TYR A 1 66  ? 6.472   36.633 -26.005 1.00 51.76  ? 657  TYR A CB  1 
ATOM   379  C  CG  . TYR A 1 66  ? 5.265   36.736 -26.917 1.00 56.53  ? 657  TYR A CG  1 
ATOM   380  C  CD1 . TYR A 1 66  ? 4.567   35.597 -27.323 1.00 59.08  ? 657  TYR A CD1 1 
ATOM   381  C  CD2 . TYR A 1 66  ? 4.786   37.974 -27.332 1.00 58.53  ? 657  TYR A CD2 1 
ATOM   382  C  CE1 . TYR A 1 66  ? 3.457   35.686 -28.163 1.00 61.00  ? 657  TYR A CE1 1 
ATOM   383  C  CE2 . TYR A 1 66  ? 3.646   38.079 -28.128 1.00 60.30  ? 657  TYR A CE2 1 
ATOM   384  C  CZ  . TYR A 1 66  ? 2.986   36.932 -28.546 1.00 70.29  ? 657  TYR A CZ  1 
ATOM   385  O  OH  . TYR A 1 66  ? 1.869   37.035 -29.343 1.00 72.30  ? 657  TYR A OH  1 
ATOM   386  N  N   . SER A 1 67  ? 7.980   33.836 -26.440 1.00 52.58  ? 658  SER A N   1 
ATOM   387  C  CA  . SER A 1 67  ? 7.882   32.429 -26.860 1.00 52.96  ? 658  SER A CA  1 
ATOM   388  C  C   . SER A 1 67  ? 6.415   32.042 -26.677 1.00 55.10  ? 658  SER A C   1 
ATOM   389  O  O   . SER A 1 67  ? 5.676   32.781 -26.024 1.00 50.97  ? 658  SER A O   1 
ATOM   390  C  CB  . SER A 1 67  ? 8.779   31.535 -26.003 1.00 55.70  ? 658  SER A CB  1 
ATOM   391  O  OG  . SER A 1 67  ? 8.343   31.486 -24.649 1.00 60.60  ? 658  SER A OG  1 
ATOM   392  N  N   . GLU A 1 68  ? 5.989   30.905 -27.256 1.00 55.00  ? 659  GLU A N   1 
ATOM   393  C  CA  . GLU A 1 68  ? 4.620   30.431 -27.127 1.00 55.33  ? 659  GLU A CA  1 
ATOM   394  C  C   . GLU A 1 68  ? 4.262   30.069 -25.682 1.00 57.93  ? 659  GLU A C   1 
ATOM   395  O  O   . GLU A 1 68  ? 3.130   30.322 -25.254 1.00 54.00  ? 659  GLU A O   1 
ATOM   396  C  CB  . GLU A 1 68  ? 4.315   29.291 -28.105 1.00 59.40  ? 659  GLU A CB  1 
ATOM   397  C  CG  . GLU A 1 68  ? 3.893   29.805 -29.479 1.00 80.86  ? 659  GLU A CG  1 
ATOM   398  C  CD  . GLU A 1 68  ? 2.788   30.857 -29.474 1.00 111.77 ? 659  GLU A CD  1 
ATOM   399  O  OE1 . GLU A 1 68  ? 1.683   30.561 -28.958 1.00 110.68 ? 659  GLU A OE1 1 
ATOM   400  O  OE2 . GLU A 1 68  ? 3.043   31.993 -29.941 1.00 102.58 ? 659  GLU A OE2 1 
ATOM   401  N  N   . LYS A 1 69  ? 5.259   29.561 -24.921 1.00 56.06  ? 660  LYS A N   1 
ATOM   402  C  CA  . LYS A 1 69  ? 5.152   29.206 -23.510 1.00 54.31  ? 660  LYS A CA  1 
ATOM   403  C  C   . LYS A 1 69  ? 4.916   30.475 -22.723 1.00 53.17  ? 660  LYS A C   1 
ATOM   404  O  O   . LYS A 1 69  ? 4.062   30.488 -21.840 1.00 52.35  ? 660  LYS A O   1 
ATOM   405  C  CB  . LYS A 1 69  ? 6.438   28.495 -23.017 1.00 59.22  ? 660  LYS A CB  1 
ATOM   406  C  CG  . LYS A 1 69  ? 6.257   27.758 -21.677 1.00 80.09  ? 660  LYS A CG  1 
ATOM   407  C  CD  . LYS A 1 69  ? 7.094   28.327 -20.540 1.00 94.16  ? 660  LYS A CD  1 
ATOM   408  C  CE  . LYS A 1 69  ? 8.439   27.648 -20.375 1.00 109.92 ? 660  LYS A CE  1 
ATOM   409  N  NZ  . LYS A 1 69  ? 9.257   28.286 -19.303 1.00 117.95 ? 660  LYS A NZ  1 
ATOM   410  N  N   . GLN A 1 70  ? 5.672   31.549 -23.049 1.00 47.33  ? 661  GLN A N   1 
ATOM   411  C  CA  . GLN A 1 70  ? 5.531   32.834 -22.387 1.00 44.47  ? 661  GLN A CA  1 
ATOM   412  C  C   . GLN A 1 70  ? 4.126   33.419 -22.559 1.00 46.46  ? 661  GLN A C   1 
ATOM   413  O  O   . GLN A 1 70  ? 3.600   33.989 -21.621 1.00 43.51  ? 661  GLN A O   1 
ATOM   414  C  CB  . GLN A 1 70  ? 6.582   33.820 -22.863 1.00 46.48  ? 661  GLN A CB  1 
ATOM   415  C  CG  . GLN A 1 70  ? 7.935   33.589 -22.216 1.00 49.98  ? 661  GLN A CG  1 
ATOM   416  C  CD  . GLN A 1 70  ? 9.004   34.478 -22.792 1.00 55.80  ? 661  GLN A CD  1 
ATOM   417  O  OE1 . GLN A 1 70  ? 9.181   34.602 -24.008 1.00 49.67  ? 661  GLN A OE1 1 
ATOM   418  N  NE2 . GLN A 1 70  ? 9.772   35.083 -21.924 1.00 49.49  ? 661  GLN A NE2 1 
ATOM   419  N  N   . ARG A 1 71  ? 3.558   33.308 -23.765 1.00 46.13  ? 662  ARG A N   1 
ATOM   420  C  CA  . ARG A 1 71  ? 2.219   33.773 -24.110 1.00 45.64  ? 662  ARG A CA  1 
ATOM   421  C  C   . ARG A 1 71  ? 1.169   32.990 -23.309 1.00 49.74  ? 662  ARG A C   1 
ATOM   422  O  O   . ARG A 1 71  ? 0.278   33.597 -22.709 1.00 49.32  ? 662  ARG A O   1 
ATOM   423  C  CB  . ARG A 1 71  ? 1.981   33.604 -25.622 1.00 45.34  ? 662  ARG A CB  1 
ATOM   424  C  CG  . ARG A 1 71  ? 0.677   34.241 -26.091 1.00 47.08  ? 662  ARG A CG  1 
ATOM   425  C  CD  . ARG A 1 71  ? 0.299   33.775 -27.477 1.00 54.75  ? 662  ARG A CD  1 
ATOM   426  N  NE  . ARG A 1 71  ? -1.109  34.048 -27.778 1.00 66.65  ? 662  ARG A NE  1 
ATOM   427  C  CZ  . ARG A 1 71  ? -1.554  35.145 -28.368 1.00 71.41  ? 662  ARG A CZ  1 
ATOM   428  N  NH1 . ARG A 1 71  ? -0.705  36.085 -28.764 1.00 62.14  ? 662  ARG A NH1 1 
ATOM   429  N  NH2 . ARG A 1 71  ? -2.845  35.297 -28.605 1.00 54.37  ? 662  ARG A NH2 1 
ATOM   430  N  N   . ARG A 1 72  ? 1.300   31.655 -23.282 1.00 47.64  ? 663  ARG A N   1 
ATOM   431  C  CA  . ARG A 1 72  ? 0.422   30.727 -22.549 1.00 47.68  ? 663  ARG A CA  1 
ATOM   432  C  C   . ARG A 1 72  ? 0.430   31.054 -21.055 1.00 50.02  ? 663  ARG A C   1 
ATOM   433  O  O   . ARG A 1 72  ? -0.642  31.121 -20.450 1.00 49.61  ? 663  ARG A O   1 
ATOM   434  C  CB  . ARG A 1 72  ? 0.886   29.287 -22.770 1.00 50.41  ? 663  ARG A CB  1 
ATOM   435  C  CG  . ARG A 1 72  ? -0.219  28.336 -23.197 1.00 69.62  ? 663  ARG A CG  1 
ATOM   436  C  CD  . ARG A 1 72  ? 0.294   26.906 -23.354 1.00 80.41  ? 663  ARG A CD  1 
ATOM   437  N  NE  . ARG A 1 72  ? 1.259   26.762 -24.450 1.00 84.32  ? 663  ARG A NE  1 
ATOM   438  C  CZ  . ARG A 1 72  ? 2.537   26.432 -24.291 1.00 94.43  ? 663  ARG A CZ  1 
ATOM   439  N  NH1 . ARG A 1 72  ? 3.026   26.198 -23.077 1.00 80.32  ? 663  ARG A NH1 1 
ATOM   440  N  NH2 . ARG A 1 72  ? 3.337   26.331 -25.342 1.00 81.87  ? 663  ARG A NH2 1 
ATOM   441  N  N   . ASP A 1 73  ? 1.634   31.272 -20.472 1.00 46.14  ? 664  ASP A N   1 
ATOM   442  C  CA  . ASP A 1 73  ? 1.793   31.605 -19.055 1.00 45.77  ? 664  ASP A CA  1 
ATOM   443  C  C   . ASP A 1 73  ? 1.200   32.956 -18.737 1.00 48.10  ? 664  ASP A C   1 
ATOM   444  O  O   . ASP A 1 73  ? 0.533   33.090 -17.723 1.00 46.77  ? 664  ASP A O   1 
ATOM   445  C  CB  . ASP A 1 73  ? 3.266   31.544 -18.617 1.00 48.61  ? 664  ASP A CB  1 
ATOM   446  C  CG  . ASP A 1 73  ? 3.897   30.164 -18.693 1.00 58.70  ? 664  ASP A CG  1 
ATOM   447  O  OD1 . ASP A 1 73  ? 3.153   29.173 -18.780 1.00 57.60  ? 664  ASP A OD1 1 
ATOM   448  O  OD2 . ASP A 1 73  ? 5.138   30.079 -18.659 1.00 69.30  ? 664  ASP A OD2 1 
ATOM   449  N  N   . PHE A 1 74  ? 1.432   33.954 -19.618 1.00 44.96  ? 665  PHE A N   1 
ATOM   450  C  CA  . PHE A 1 74  ? 0.915   35.315 -19.480 1.00 42.83  ? 665  PHE A CA  1 
ATOM   451  C  C   . PHE A 1 74  ? -0.608  35.282 -19.426 1.00 47.34  ? 665  PHE A C   1 
ATOM   452  O  O   . PHE A 1 74  ? -1.195  35.833 -18.507 1.00 46.38  ? 665  PHE A O   1 
ATOM   453  C  CB  . PHE A 1 74  ? 1.396   36.204 -20.661 1.00 44.11  ? 665  PHE A CB  1 
ATOM   454  C  CG  . PHE A 1 74  ? 0.877   37.630 -20.668 1.00 42.66  ? 665  PHE A CG  1 
ATOM   455  C  CD1 . PHE A 1 74  ? 1.377   38.582 -19.773 1.00 43.32  ? 665  PHE A CD1 1 
ATOM   456  C  CD2 . PHE A 1 74  ? -0.100  38.025 -21.567 1.00 42.61  ? 665  PHE A CD2 1 
ATOM   457  C  CE1 . PHE A 1 74  ? 0.881   39.897 -19.761 1.00 42.99  ? 665  PHE A CE1 1 
ATOM   458  C  CE2 . PHE A 1 74  ? -0.559  39.356 -21.585 1.00 43.69  ? 665  PHE A CE2 1 
ATOM   459  C  CZ  . PHE A 1 74  ? -0.053  40.284 -20.692 1.00 40.77  ? 665  PHE A CZ  1 
ATOM   460  N  N   . LEU A 1 75  ? -1.237  34.599 -20.398 1.00 45.27  ? 666  LEU A N   1 
ATOM   461  C  CA  . LEU A 1 75  ? -2.681  34.515 -20.520 1.00 43.97  ? 666  LEU A CA  1 
ATOM   462  C  C   . LEU A 1 75  ? -3.351  33.626 -19.487 1.00 51.57  ? 666  LEU A C   1 
ATOM   463  O  O   . LEU A 1 75  ? -4.547  33.819 -19.225 1.00 50.17  ? 666  LEU A O   1 
ATOM   464  C  CB  . LEU A 1 75  ? -3.089  34.118 -21.940 1.00 44.27  ? 666  LEU A CB  1 
ATOM   465  C  CG  . LEU A 1 75  ? -2.824  35.204 -23.011 1.00 47.62  ? 666  LEU A CG  1 
ATOM   466  C  CD1 . LEU A 1 75  ? -3.198  34.701 -24.363 1.00 47.26  ? 666  LEU A CD1 1 
ATOM   467  C  CD2 . LEU A 1 75  ? -3.568  36.517 -22.689 1.00 48.50  ? 666  LEU A CD2 1 
ATOM   468  N  N   . SER A 1 76  ? -2.599  32.673 -18.865 1.00 49.62  ? 667  SER A N   1 
ATOM   469  C  CA  . SER A 1 76  ? -3.175  31.828 -17.824 1.00 47.99  ? 667  SER A CA  1 
ATOM   470  C  C   . SER A 1 76  ? -3.579  32.694 -16.637 1.00 48.35  ? 667  SER A C   1 
ATOM   471  O  O   . SER A 1 76  ? -4.568  32.371 -15.976 1.00 47.20  ? 667  SER A O   1 
ATOM   472  C  CB  . SER A 1 76  ? -2.246  30.681 -17.426 1.00 53.78  ? 667  SER A CB  1 
ATOM   473  O  OG  . SER A 1 76  ? -1.255  31.082 -16.493 1.00 67.38  ? 667  SER A OG  1 
ATOM   474  N  N   . GLU A 1 77  ? -2.862  33.830 -16.413 1.00 44.49  ? 668  GLU A N   1 
ATOM   475  C  CA  . GLU A 1 77  ? -3.223  34.773 -15.367 1.00 43.40  ? 668  GLU A CA  1 
ATOM   476  C  C   . GLU A 1 77  ? -4.594  35.385 -15.663 1.00 45.01  ? 668  GLU A C   1 
ATOM   477  O  O   . GLU A 1 77  ? -5.422  35.408 -14.779 1.00 43.83  ? 668  GLU A O   1 
ATOM   478  C  CB  . GLU A 1 77  ? -2.173  35.877 -15.142 1.00 44.72  ? 668  GLU A CB  1 
ATOM   479  C  CG  . GLU A 1 77  ? -2.472  36.607 -13.841 1.00 51.31  ? 668  GLU A CG  1 
ATOM   480  C  CD  . GLU A 1 77  ? -1.862  37.961 -13.545 1.00 61.94  ? 668  GLU A CD  1 
ATOM   481  O  OE1 . GLU A 1 77  ? -1.118  38.512 -14.388 1.00 46.29  ? 668  GLU A OE1 1 
ATOM   482  O  OE2 . GLU A 1 77  ? -2.147  38.472 -12.441 1.00 45.17  ? 668  GLU A OE2 1 
ATOM   483  N  N   . ALA A 1 78  ? -4.828  35.835 -16.906 1.00 41.85  ? 669  ALA A N   1 
ATOM   484  C  CA  . ALA A 1 78  ? -6.088  36.427 -17.339 1.00 41.10  ? 669  ALA A CA  1 
ATOM   485  C  C   . ALA A 1 78  ? -7.240  35.420 -17.218 1.00 45.74  ? 669  ALA A C   1 
ATOM   486  O  O   . ALA A 1 78  ? -8.360  35.820 -16.864 1.00 45.49  ? 669  ALA A O   1 
ATOM   487  C  CB  . ALA A 1 78  ? -5.958  36.886 -18.775 1.00 42.62  ? 669  ALA A CB  1 
ATOM   488  N  N   . SER A 1 79  ? -6.960  34.116 -17.517 1.00 42.26  ? 670  SER A N   1 
ATOM   489  C  CA  . SER A 1 79  ? -7.955  33.050 -17.394 1.00 42.43  ? 670  SER A CA  1 
ATOM   490  C  C   . SER A 1 79  ? -8.391  32.854 -15.941 1.00 46.25  ? 670  SER A C   1 
ATOM   491  O  O   . SER A 1 79  ? -9.583  32.697 -15.686 1.00 44.87  ? 670  SER A O   1 
ATOM   492  C  CB  . SER A 1 79  ? -7.428  31.745 -17.968 1.00 46.43  ? 670  SER A CB  1 
ATOM   493  O  OG  . SER A 1 79  ? -7.481  31.816 -19.379 1.00 61.69  ? 670  SER A OG  1 
ATOM   494  N  N   . ILE A 1 80  ? -7.430  32.868 -14.992 1.00 43.92  ? 671  ILE A N   1 
ATOM   495  C  CA  . ILE A 1 80  ? -7.732  32.724 -13.561 1.00 43.97  ? 671  ILE A CA  1 
ATOM   496  C  C   . ILE A 1 80  ? -8.527  33.949 -13.087 1.00 46.27  ? 671  ILE A C   1 
ATOM   497  O  O   . ILE A 1 80  ? -9.592  33.794 -12.505 1.00 44.74  ? 671  ILE A O   1 
ATOM   498  C  CB  . ILE A 1 80  ? -6.441  32.466 -12.715 1.00 46.84  ? 671  ILE A CB  1 
ATOM   499  C  CG1 . ILE A 1 80  ? -5.870  31.054 -13.009 1.00 48.20  ? 671  ILE A CG1 1 
ATOM   500  C  CG2 . ILE A 1 80  ? -6.710  32.650 -11.208 1.00 45.57  ? 671  ILE A CG2 1 
ATOM   501  C  CD1 . ILE A 1 80  ? -4.320  30.910 -12.898 1.00 55.59  ? 671  ILE A CD1 1 
ATOM   502  N  N   . MET A 1 81  ? -8.028  35.146 -13.402 1.00 43.17  ? 672  MET A N   1 
ATOM   503  C  CA  . MET A 1 81  ? -8.620  36.448 -13.040 1.00 42.57  ? 672  MET A CA  1 
ATOM   504  C  C   . MET A 1 81  ? -10.049 36.607 -13.507 1.00 41.41  ? 672  MET A C   1 
ATOM   505  O  O   . MET A 1 81  ? -10.846 37.192 -12.785 1.00 39.11  ? 672  MET A O   1 
ATOM   506  C  CB  . MET A 1 81  ? -7.823  37.596 -13.682 1.00 46.04  ? 672  MET A CB  1 
ATOM   507  C  CG  . MET A 1 81  ? -6.496  37.843 -13.072 1.00 51.48  ? 672  MET A CG  1 
ATOM   508  S  SD  . MET A 1 81  ? -5.700  39.305 -13.797 1.00 56.71  ? 672  MET A SD  1 
ATOM   509  C  CE  . MET A 1 81  ? -6.751  40.544 -13.210 1.00 51.30  ? 672  MET A CE  1 
ATOM   510  N  N   . GLY A 1 82  ? -10.314 36.215 -14.754 1.00 36.61  ? 673  GLY A N   1 
ATOM   511  C  CA  . GLY A 1 82  ? -11.629 36.281 -15.371 1.00 36.97  ? 673  GLY A CA  1 
ATOM   512  C  C   . GLY A 1 82  ? -12.665 35.410 -14.682 1.00 40.73  ? 673  GLY A C   1 
ATOM   513  O  O   . GLY A 1 82  ? -13.852 35.530 -14.966 1.00 41.51  ? 673  GLY A O   1 
ATOM   514  N  N   . GLN A 1 83  ? -12.235 34.520 -13.793 1.00 36.88  ? 674  GLN A N   1 
ATOM   515  C  CA  . GLN A 1 83  ? -13.164 33.654 -13.045 1.00 38.34  ? 674  GLN A CA  1 
ATOM   516  C  C   . GLN A 1 83  ? -13.638 34.359 -11.759 1.00 42.94  ? 674  GLN A C   1 
ATOM   517  O  O   . GLN A 1 83  ? -14.544 33.874 -11.104 1.00 42.60  ? 674  GLN A O   1 
ATOM   518  C  CB  . GLN A 1 83  ? -12.478 32.323 -12.680 1.00 39.86  ? 674  GLN A CB  1 
ATOM   519  C  CG  . GLN A 1 83  ? -12.308 31.383 -13.877 1.00 53.59  ? 674  GLN A CG  1 
ATOM   520  C  CD  . GLN A 1 83  ? -11.557 30.154 -13.483 1.00 87.40  ? 674  GLN A CD  1 
ATOM   521  O  OE1 . GLN A 1 83  ? -12.022 29.351 -12.664 1.00 87.69  ? 674  GLN A OE1 1 
ATOM   522  N  NE2 . GLN A 1 83  ? -10.372 29.978 -14.056 1.00 88.06  ? 674  GLN A NE2 1 
ATOM   523  N  N   . PHE A 1 84  ? -13.012 35.499 -11.404 1.00 39.04  ? 675  PHE A N   1 
ATOM   524  C  CA  . PHE A 1 84  ? -13.281 36.198 -10.152 1.00 37.20  ? 675  PHE A CA  1 
ATOM   525  C  C   . PHE A 1 84  ? -14.066 37.461 -10.300 1.00 36.19  ? 675  PHE A C   1 
ATOM   526  O  O   . PHE A 1 84  ? -13.875 38.184 -11.272 1.00 33.16  ? 675  PHE A O   1 
ATOM   527  C  CB  . PHE A 1 84  ? -11.965 36.468 -9.396  1.00 37.83  ? 675  PHE A CB  1 
ATOM   528  C  CG  . PHE A 1 84  ? -11.101 35.244 -9.150  1.00 39.69  ? 675  PHE A CG  1 
ATOM   529  C  CD1 . PHE A 1 84  ? -11.673 34.019 -8.817  1.00 44.07  ? 675  PHE A CD1 1 
ATOM   530  C  CD2 . PHE A 1 84  ? -9.719  35.332 -9.186  1.00 41.01  ? 675  PHE A CD2 1 
ATOM   531  C  CE1 . PHE A 1 84  ? -10.875 32.902 -8.562  1.00 45.80  ? 675  PHE A CE1 1 
ATOM   532  C  CE2 . PHE A 1 84  ? -8.923  34.220 -8.914  1.00 44.62  ? 675  PHE A CE2 1 
ATOM   533  C  CZ  . PHE A 1 84  ? -9.501  33.013 -8.600  1.00 44.35  ? 675  PHE A CZ  1 
ATOM   534  N  N   . ASP A 1 85  ? -14.983 37.717 -9.337  1.00 32.86  ? 676  ASP A N   1 
ATOM   535  C  CA  . ASP A 1 85  ? -15.783 38.953 -9.327  1.00 32.49  ? 676  ASP A CA  1 
ATOM   536  C  C   . ASP A 1 85  ? -16.034 39.360 -7.902  1.00 36.10  ? 676  ASP A C   1 
ATOM   537  O  O   . ASP A 1 85  ? -17.118 39.152 -7.360  1.00 37.10  ? 676  ASP A O   1 
ATOM   538  C  CB  . ASP A 1 85  ? -17.083 38.814 -10.126 1.00 35.24  ? 676  ASP A CB  1 
ATOM   539  C  CG  . ASP A 1 85  ? -17.763 40.124 -10.508 1.00 41.27  ? 676  ASP A CG  1 
ATOM   540  O  OD1 . ASP A 1 85  ? -17.155 41.201 -10.298 1.00 43.65  ? 676  ASP A OD1 1 
ATOM   541  O  OD2 . ASP A 1 85  ? -18.889 40.070 -11.022 1.00 43.58  ? 676  ASP A OD2 1 
ATOM   542  N  N   . HIS A 1 86  ? -14.995 39.893 -7.267  1.00 31.90  ? 677  HIS A N   1 
ATOM   543  C  CA  . HIS A 1 86  ? -15.039 40.299 -5.861  1.00 29.27  ? 677  HIS A CA  1 
ATOM   544  C  C   . HIS A 1 86  ? -14.359 41.656 -5.722  1.00 34.22  ? 677  HIS A C   1 
ATOM   545  O  O   . HIS A 1 86  ? -13.356 41.917 -6.387  1.00 33.55  ? 677  HIS A O   1 
ATOM   546  C  CB  . HIS A 1 86  ? -14.326 39.245 -4.989  1.00 28.39  ? 677  HIS A CB  1 
ATOM   547  C  CG  . HIS A 1 86  ? -14.544 39.446 -3.526  1.00 31.78  ? 677  HIS A CG  1 
ATOM   548  N  ND1 . HIS A 1 86  ? -13.726 40.286 -2.775  1.00 33.53  ? 677  HIS A ND1 1 
ATOM   549  C  CD2 . HIS A 1 86  ? -15.519 38.965 -2.725  1.00 33.10  ? 677  HIS A CD2 1 
ATOM   550  C  CE1 . HIS A 1 86  ? -14.210 40.246 -1.546  1.00 32.66  ? 677  HIS A CE1 1 
ATOM   551  N  NE2 . HIS A 1 86  ? -15.277 39.457 -1.467  1.00 32.70  ? 677  HIS A NE2 1 
ATOM   552  N  N   . ARG A 1 87  ? -14.865 42.485 -4.813  1.00 33.15  ? 678  ARG A N   1 
ATOM   553  C  CA  . ARG A 1 87  ? -14.352 43.833 -4.487  1.00 32.68  ? 678  ARG A CA  1 
ATOM   554  C  C   . ARG A 1 87  ? -12.856 43.835 -4.113  1.00 33.90  ? 678  ARG A C   1 
ATOM   555  O  O   . ARG A 1 87  ? -12.135 44.810 -4.391  1.00 31.70  ? 678  ARG A O   1 
ATOM   556  C  CB  . ARG A 1 87  ? -15.181 44.410 -3.306  1.00 34.48  ? 678  ARG A CB  1 
ATOM   557  C  CG  . ARG A 1 87  ? -14.773 45.822 -2.821  1.00 53.20  ? 678  ARG A CG  1 
ATOM   558  C  CD  . ARG A 1 87  ? -15.729 46.328 -1.759  1.00 74.65  ? 678  ARG A CD  1 
ATOM   559  N  NE  . ARG A 1 87  ? -15.810 47.788 -1.751  1.00 98.57  ? 678  ARG A NE  1 
ATOM   560  C  CZ  . ARG A 1 87  ? -15.157 48.567 -0.892  1.00 114.88 ? 678  ARG A CZ  1 
ATOM   561  N  NH1 . ARG A 1 87  ? -14.380 48.033 0.042   1.00 101.34 ? 678  ARG A NH1 1 
ATOM   562  N  NH2 . ARG A 1 87  ? -15.287 49.886 -0.952  1.00 100.29 ? 678  ARG A NH2 1 
ATOM   563  N  N   . ASN A 1 88  ? -12.390 42.744 -3.490  1.00 29.98  ? 679  ASN A N   1 
ATOM   564  C  CA  . ASN A 1 88  ? -11.007 42.647 -3.012  1.00 29.10  ? 679  ASN A CA  1 
ATOM   565  C  C   . ASN A 1 88  ? -10.128 41.729 -3.824  1.00 31.24  ? 679  ASN A C   1 
ATOM   566  O  O   . ASN A 1 88  ? -9.070  41.313 -3.367  1.00 31.24  ? 679  ASN A O   1 
ATOM   567  C  CB  . ASN A 1 88  ? -10.964 42.289 -1.537  1.00 30.96  ? 679  ASN A CB  1 
ATOM   568  C  CG  . ASN A 1 88  ? -11.702 43.315 -0.708  1.00 37.32  ? 679  ASN A CG  1 
ATOM   569  O  OD1 . ASN A 1 88  ? -12.754 43.025 -0.147  1.00 33.63  ? 679  ASN A OD1 1 
ATOM   570  N  ND2 . ASN A 1 88  ? -11.181 44.541 -0.639  1.00 27.97  ? 679  ASN A ND2 1 
ATOM   571  N  N   . ILE A 1 89  ? -10.527 41.509 -5.061  1.00 27.96  ? 680  ILE A N   1 
ATOM   572  C  CA  . ILE A 1 89  ? -9.794  40.792 -6.091  1.00 28.16  ? 680  ILE A CA  1 
ATOM   573  C  C   . ILE A 1 89  ? -9.750  41.776 -7.260  1.00 32.58  ? 680  ILE A C   1 
ATOM   574  O  O   . ILE A 1 89  ? -10.796 42.286 -7.656  1.00 32.00  ? 680  ILE A O   1 
ATOM   575  C  CB  . ILE A 1 89  ? -10.421 39.432 -6.518  1.00 30.09  ? 680  ILE A CB  1 
ATOM   576  C  CG1 . ILE A 1 89  ? -10.621 38.465 -5.305  1.00 29.34  ? 680  ILE A CG1 1 
ATOM   577  C  CG2 . ILE A 1 89  ? -9.556  38.783 -7.650  1.00 29.27  ? 680  ILE A CG2 1 
ATOM   578  C  CD1 . ILE A 1 89  ? -9.430  37.812 -4.798  1.00 34.94  ? 680  ILE A CD1 1 
ATOM   579  N  N   . ILE A 1 90  ? -8.545  42.074 -7.768  1.00 29.79  ? 681  ILE A N   1 
ATOM   580  C  CA  . ILE A 1 90  ? -8.344  43.019 -8.874  1.00 31.96  ? 681  ILE A CA  1 
ATOM   581  C  C   . ILE A 1 90  ? -9.229  42.635 -10.071 1.00 35.72  ? 681  ILE A C   1 
ATOM   582  O  O   . ILE A 1 90  ? -9.239  41.464 -10.485 1.00 35.79  ? 681  ILE A O   1 
ATOM   583  C  CB  . ILE A 1 90  ? -6.815  43.154 -9.184  1.00 35.89  ? 681  ILE A CB  1 
ATOM   584  C  CG1 . ILE A 1 90  ? -6.518  44.426 -9.935  1.00 36.41  ? 681  ILE A CG1 1 
ATOM   585  C  CG2 . ILE A 1 90  ? -6.190  41.923 -9.873  1.00 39.27  ? 681  ILE A CG2 1 
ATOM   586  C  CD1 . ILE A 1 90  ? -6.428  45.529 -9.019  1.00 45.90  ? 681  ILE A CD1 1 
ATOM   587  N  N   . ARG A 1 91  ? -10.059 43.590 -10.531 1.00 30.59  ? 682  ARG A N   1 
ATOM   588  C  CA  . ARG A 1 91  ? -11.044 43.375 -11.599 1.00 29.94  ? 682  ARG A CA  1 
ATOM   589  C  C   . ARG A 1 91  ? -10.415 43.302 -12.993 1.00 35.07  ? 682  ARG A C   1 
ATOM   590  O  O   . ARG A 1 91  ? -9.650  44.174 -13.362 1.00 34.73  ? 682  ARG A O   1 
ATOM   591  C  CB  . ARG A 1 91  ? -12.116 44.489 -11.518 1.00 26.08  ? 682  ARG A CB  1 
ATOM   592  C  CG  . ARG A 1 91  ? -13.240 44.472 -12.549 1.00 35.86  ? 682  ARG A CG  1 
ATOM   593  C  CD  . ARG A 1 91  ? -14.349 45.464 -12.170 1.00 40.46  ? 682  ARG A CD  1 
ATOM   594  N  NE  . ARG A 1 91  ? -13.884 46.863 -12.057 1.00 38.98  ? 682  ARG A NE  1 
ATOM   595  C  CZ  . ARG A 1 91  ? -13.884 47.600 -10.946 1.00 52.43  ? 682  ARG A CZ  1 
ATOM   596  N  NH1 . ARG A 1 91  ? -14.296 47.082 -9.793  1.00 37.51  ? 682  ARG A NH1 1 
ATOM   597  N  NH2 . ARG A 1 91  ? -13.461 48.859 -10.978 1.00 43.13  ? 682  ARG A NH2 1 
ATOM   598  N  N   . LEU A 1 92  ? -10.791 42.286 -13.778 1.00 33.07  ? 683  LEU A N   1 
ATOM   599  C  CA  . LEU A 1 92  ? -10.395 42.181 -15.164 1.00 32.14  ? 683  LEU A CA  1 
ATOM   600  C  C   . LEU A 1 92  ? -11.396 43.025 -15.964 1.00 36.29  ? 683  LEU A C   1 
ATOM   601  O  O   . LEU A 1 92  ? -12.584 42.757 -15.930 1.00 37.30  ? 683  LEU A O   1 
ATOM   602  C  CB  . LEU A 1 92  ? -10.420 40.712 -15.632 1.00 32.08  ? 683  LEU A CB  1 
ATOM   603  C  CG  . LEU A 1 92  ? -9.892  40.457 -17.052 1.00 35.57  ? 683  LEU A CG  1 
ATOM   604  C  CD1 . LEU A 1 92  ? -8.404  40.684 -17.131 1.00 34.31  ? 683  LEU A CD1 1 
ATOM   605  C  CD2 . LEU A 1 92  ? -10.197 39.015 -17.497 1.00 36.21  ? 683  LEU A CD2 1 
ATOM   606  N  N   . GLU A 1 93  ? -10.925 44.071 -16.636 1.00 32.81  ? 684  GLU A N   1 
ATOM   607  C  CA  . GLU A 1 93  ? -11.756 44.950 -17.469 1.00 33.53  ? 684  GLU A CA  1 
ATOM   608  C  C   . GLU A 1 93  ? -11.794 44.445 -18.894 1.00 39.45  ? 684  GLU A C   1 
ATOM   609  O  O   . GLU A 1 93  ? -12.819 44.550 -19.565 1.00 39.75  ? 684  GLU A O   1 
ATOM   610  C  CB  . GLU A 1 93  ? -11.233 46.398 -17.440 1.00 35.08  ? 684  GLU A CB  1 
ATOM   611  C  CG  . GLU A 1 93  ? -11.242 47.014 -16.056 1.00 41.90  ? 684  GLU A CG  1 
ATOM   612  C  CD  . GLU A 1 93  ? -12.589 47.348 -15.437 1.00 56.54  ? 684  GLU A CD  1 
ATOM   613  O  OE1 . GLU A 1 93  ? -13.642 47.069 -16.054 1.00 39.61  ? 684  GLU A OE1 1 
ATOM   614  O  OE2 . GLU A 1 93  ? -12.585 47.871 -14.303 1.00 53.05  ? 684  GLU A OE2 1 
ATOM   615  N  N   . GLY A 1 94  ? -10.684 43.868 -19.331 1.00 38.11  ? 685  GLY A N   1 
ATOM   616  C  CA  . GLY A 1 94  ? -10.557 43.322 -20.673 1.00 38.81  ? 685  GLY A CA  1 
ATOM   617  C  C   . GLY A 1 94  ? -9.265  42.597 -20.915 1.00 42.39  ? 685  GLY A C   1 
ATOM   618  O  O   . GLY A 1 94  ? -8.341  42.683 -20.114 1.00 41.00  ? 685  GLY A O   1 
ATOM   619  N  N   . VAL A 1 95  ? -9.229  41.824 -22.004 1.00 41.78  ? 686  VAL A N   1 
ATOM   620  C  CA  . VAL A 1 95  ? -8.049  41.114 -22.494 1.00 42.64  ? 686  VAL A CA  1 
ATOM   621  C  C   . VAL A 1 95  ? -7.972  41.322 -23.996 1.00 46.75  ? 686  VAL A C   1 
ATOM   622  O  O   . VAL A 1 95  ? -8.999  41.502 -24.663 1.00 46.12  ? 686  VAL A O   1 
ATOM   623  C  CB  . VAL A 1 95  ? -7.926  39.601 -22.134 1.00 47.72  ? 686  VAL A CB  1 
ATOM   624  C  CG1 . VAL A 1 95  ? -7.815  39.387 -20.645 1.00 46.54  ? 686  VAL A CG1 1 
ATOM   625  C  CG2 . VAL A 1 95  ? -9.064  38.785 -22.712 1.00 48.26  ? 686  VAL A CG2 1 
ATOM   626  N  N   . VAL A 1 96  ? -6.749  41.337 -24.521 1.00 43.16  ? 687  VAL A N   1 
ATOM   627  C  CA  . VAL A 1 96  ? -6.505  41.416 -25.965 1.00 43.52  ? 687  VAL A CA  1 
ATOM   628  C  C   . VAL A 1 96  ? -5.705  40.161 -26.276 1.00 48.71  ? 687  VAL A C   1 
ATOM   629  O  O   . VAL A 1 96  ? -4.605  39.993 -25.743 1.00 48.11  ? 687  VAL A O   1 
ATOM   630  C  CB  . VAL A 1 96  ? -5.797  42.721 -26.409 1.00 46.94  ? 687  VAL A CB  1 
ATOM   631  C  CG1 . VAL A 1 96  ? -5.392  42.637 -27.882 1.00 47.80  ? 687  VAL A CG1 1 
ATOM   632  C  CG2 . VAL A 1 96  ? -6.685  43.937 -26.164 1.00 45.73  ? 687  VAL A CG2 1 
ATOM   633  N  N   . THR A 1 97  ? -6.317  39.211 -27.003 1.00 47.61  ? 688  THR A N   1 
ATOM   634  C  CA  . THR A 1 97  ? -5.672  37.941 -27.361 1.00 48.09  ? 688  THR A CA  1 
ATOM   635  C  C   . THR A 1 97  ? -5.778  37.675 -28.847 1.00 54.42  ? 688  THR A C   1 
ATOM   636  O  O   . THR A 1 97  ? -4.918  36.999 -29.386 1.00 55.94  ? 688  THR A O   1 
ATOM   637  C  CB  . THR A 1 97  ? -6.221  36.746 -26.543 1.00 49.82  ? 688  THR A CB  1 
ATOM   638  O  OG1 . THR A 1 97  ? -7.499  36.345 -27.046 1.00 49.29  ? 688  THR A OG1 1 
ATOM   639  C  CG2 . THR A 1 97  ? -6.285  37.015 -25.046 1.00 47.50  ? 688  THR A CG2 1 
ATOM   640  N  N   . LYS A 1 98  ? -6.850  38.161 -29.492 1.00 52.38  ? 689  LYS A N   1 
ATOM   641  C  CA  . LYS A 1 98  ? -7.139  37.960 -30.919 1.00 55.30  ? 689  LYS A CA  1 
ATOM   642  C  C   . LYS A 1 98  ? -6.472  39.028 -31.789 1.00 62.49  ? 689  LYS A C   1 
ATOM   643  O  O   . LYS A 1 98  ? -6.546  38.960 -33.020 1.00 65.47  ? 689  LYS A O   1 
ATOM   644  C  CB  . LYS A 1 98  ? -8.672  37.910 -31.178 1.00 57.85  ? 689  LYS A CB  1 
ATOM   645  C  CG  . LYS A 1 98  ? -9.467  36.884 -30.351 1.00 67.11  ? 689  LYS A CG  1 
ATOM   646  C  CD  . LYS A 1 98  ? -9.287  35.441 -30.810 1.00 81.52  ? 689  LYS A CD  1 
ATOM   647  C  CE  . LYS A 1 98  ? -9.923  34.453 -29.860 1.00 96.52  ? 689  LYS A CE  1 
ATOM   648  N  NZ  . LYS A 1 98  ? -9.102  34.238 -28.635 1.00 103.07 ? 689  LYS A NZ  1 
ATOM   649  N  N   . SER A 1 99  ? -5.840  40.020 -31.151 1.00 58.69  ? 690  SER A N   1 
ATOM   650  C  CA  . SER A 1 99  ? -5.109  41.090 -31.833 1.00 59.88  ? 690  SER A CA  1 
ATOM   651  C  C   . SER A 1 99  ? -3.751  41.286 -31.158 1.00 61.14  ? 690  SER A C   1 
ATOM   652  O  O   . SER A 1 99  ? -3.443  40.622 -30.163 1.00 59.79  ? 690  SER A O   1 
ATOM   653  C  CB  . SER A 1 99  ? -5.889  42.402 -31.799 1.00 64.84  ? 690  SER A CB  1 
ATOM   654  O  OG  . SER A 1 99  ? -7.256  42.268 -31.441 1.00 75.54  ? 690  SER A OG  1 
ATOM   655  N  N   . ARG A 1 100 ? -2.959  42.201 -31.699 1.00 57.88  ? 691  ARG A N   1 
ATOM   656  C  CA  . ARG A 1 100 ? -1.635  42.487 -31.180 1.00 57.55  ? 691  ARG A CA  1 
ATOM   657  C  C   . ARG A 1 100 ? -1.522  43.948 -30.731 1.00 59.53  ? 691  ARG A C   1 
ATOM   658  O  O   . ARG A 1 100 ? -1.994  44.839 -31.447 1.00 60.64  ? 691  ARG A O   1 
ATOM   659  C  CB  . ARG A 1 100 ? -0.559  42.202 -32.236 1.00 59.54  ? 691  ARG A CB  1 
ATOM   660  C  CG  . ARG A 1 100 ? -0.649  40.864 -32.953 1.00 71.53  ? 691  ARG A CG  1 
ATOM   661  C  CD  . ARG A 1 100 ? 0.244   40.864 -34.189 1.00 79.50  ? 691  ARG A CD  1 
ATOM   662  N  NE  . ARG A 1 100 ? -0.178  41.846 -35.198 1.00 79.42  ? 691  ARG A NE  1 
ATOM   663  C  CZ  . ARG A 1 100 ? 0.463   42.073 -36.342 1.00 86.20  ? 691  ARG A CZ  1 
ATOM   664  N  NH1 . ARG A 1 100 ? 1.565   41.396 -36.641 1.00 70.25  ? 691  ARG A NH1 1 
ATOM   665  N  NH2 . ARG A 1 100 ? 0.002   42.971 -37.200 1.00 72.21  ? 691  ARG A NH2 1 
ATOM   666  N  N   . PRO A 1 101 ? -0.787  44.234 -29.633 1.00 52.63  ? 692  PRO A N   1 
ATOM   667  C  CA  . PRO A 1 101 ? -0.131  43.293 -28.704 1.00 51.51  ? 692  PRO A CA  1 
ATOM   668  C  C   . PRO A 1 101 ? -1.110  42.643 -27.731 1.00 55.01  ? 692  PRO A C   1 
ATOM   669  O  O   . PRO A 1 101 ? -2.151  43.223 -27.442 1.00 53.63  ? 692  PRO A O   1 
ATOM   670  C  CB  . PRO A 1 101 ? 0.846   44.200 -27.942 1.00 52.93  ? 692  PRO A CB  1 
ATOM   671  C  CG  . PRO A 1 101 ? 0.165   45.529 -27.904 1.00 56.47  ? 692  PRO A CG  1 
ATOM   672  C  CD  . PRO A 1 101 ? -0.573  45.636 -29.223 1.00 53.65  ? 692  PRO A CD  1 
ATOM   673  N  N   . VAL A 1 102 ? -0.757  41.474 -27.176 1.00 51.89  ? 693  VAL A N   1 
ATOM   674  C  CA  . VAL A 1 102 ? -1.583  40.837 -26.159 1.00 50.41  ? 693  VAL A CA  1 
ATOM   675  C  C   . VAL A 1 102 ? -1.493  41.645 -24.851 1.00 50.41  ? 693  VAL A C   1 
ATOM   676  O  O   . VAL A 1 102 ? -0.411  42.095 -24.476 1.00 46.18  ? 693  VAL A O   1 
ATOM   677  C  CB  . VAL A 1 102 ? -1.372  39.323 -25.979 1.00 56.07  ? 693  VAL A CB  1 
ATOM   678  C  CG1 . VAL A 1 102 ? -1.701  38.586 -27.274 1.00 58.29  ? 693  VAL A CG1 1 
ATOM   679  C  CG2 . VAL A 1 102 ? 0.039   39.008 -25.519 1.00 56.42  ? 693  VAL A CG2 1 
ATOM   680  N  N   . MET A 1 103 ? -2.671  41.903 -24.233 1.00 47.54  ? 694  MET A N   1 
ATOM   681  C  CA  . MET A 1 103 ? -2.833  42.748 -23.048 1.00 46.00  ? 694  MET A CA  1 
ATOM   682  C  C   . MET A 1 103 ? -3.757  42.139 -22.013 1.00 44.33  ? 694  MET A C   1 
ATOM   683  O  O   . MET A 1 103 ? -4.715  41.454 -22.368 1.00 42.20  ? 694  MET A O   1 
ATOM   684  C  CB  . MET A 1 103 ? -3.486  44.090 -23.445 1.00 49.19  ? 694  MET A CB  1 
ATOM   685  C  CG  . MET A 1 103 ? -2.782  44.845 -24.534 1.00 56.40  ? 694  MET A CG  1 
ATOM   686  S  SD  . MET A 1 103 ? -3.567  46.439 -24.837 1.00 62.35  ? 694  MET A SD  1 
ATOM   687  C  CE  . MET A 1 103 ? -3.038  46.758 -26.429 1.00 61.68  ? 694  MET A CE  1 
ATOM   688  N  N   . ILE A 1 104 ? -3.523  42.488 -20.737 1.00 38.42  ? 695  ILE A N   1 
ATOM   689  C  CA  . ILE A 1 104 ? -4.396  42.179 -19.602 1.00 36.97  ? 695  ILE A CA  1 
ATOM   690  C  C   . ILE A 1 104 ? -4.732  43.553 -19.044 1.00 40.13  ? 695  ILE A C   1 
ATOM   691  O  O   . ILE A 1 104 ? -3.828  44.316 -18.671 1.00 40.24  ? 695  ILE A O   1 
ATOM   692  C  CB  . ILE A 1 104 ? -3.786  41.221 -18.555 1.00 39.18  ? 695  ILE A CB  1 
ATOM   693  C  CG1 . ILE A 1 104 ? -3.601  39.798 -19.172 1.00 39.91  ? 695  ILE A CG1 1 
ATOM   694  C  CG2 . ILE A 1 104 ? -4.674  41.185 -17.293 1.00 37.72  ? 695  ILE A CG2 1 
ATOM   695  C  CD1 . ILE A 1 104 ? -2.695  38.840 -18.372 1.00 41.15  ? 695  ILE A CD1 1 
ATOM   696  N  N   . ILE A 1 105 ? -6.021  43.905 -19.066 1.00 34.43  ? 696  ILE A N   1 
ATOM   697  C  CA  . ILE A 1 105 ? -6.497  45.228 -18.639 1.00 33.08  ? 696  ILE A CA  1 
ATOM   698  C  C   . ILE A 1 105 ? -7.311  45.116 -17.353 1.00 36.75  ? 696  ILE A C   1 
ATOM   699  O  O   . ILE A 1 105 ? -8.309  44.404 -17.299 1.00 36.81  ? 696  ILE A O   1 
ATOM   700  C  CB  . ILE A 1 105 ? -7.263  45.940 -19.774 1.00 35.74  ? 696  ILE A CB  1 
ATOM   701  C  CG1 . ILE A 1 105 ? -6.405  46.033 -21.051 1.00 37.86  ? 696  ILE A CG1 1 
ATOM   702  C  CG2 . ILE A 1 105 ? -7.728  47.308 -19.351 1.00 32.87  ? 696  ILE A CG2 1 
ATOM   703  C  CD1 . ILE A 1 105 ? -7.106  45.687 -22.222 1.00 44.39  ? 696  ILE A CD1 1 
ATOM   704  N  N   . THR A 1 106 ? -6.860  45.806 -16.323 1.00 33.50  ? 697  THR A N   1 
ATOM   705  C  CA  . THR A 1 106 ? -7.496  45.789 -15.018 1.00 32.76  ? 697  THR A CA  1 
ATOM   706  C  C   . THR A 1 106 ? -7.884  47.184 -14.590 1.00 36.80  ? 697  THR A C   1 
ATOM   707  O  O   . THR A 1 106 ? -7.461  48.161 -15.198 1.00 37.27  ? 697  THR A O   1 
ATOM   708  C  CB  . THR A 1 106 ? -6.534  45.139 -13.970 1.00 42.11  ? 697  THR A CB  1 
ATOM   709  O  OG1 . THR A 1 106 ? -5.377  45.970 -13.795 1.00 39.00  ? 697  THR A OG1 1 
ATOM   710  C  CG2 . THR A 1 106 ? -6.093  43.738 -14.367 1.00 36.87  ? 697  THR A CG2 1 
ATOM   711  N  N   . GLU A 1 107 ? -8.671  47.278 -13.519 1.00 35.55  ? 698  GLU A N   1 
ATOM   712  C  CA  . GLU A 1 107 ? -9.058  48.540 -12.896 1.00 34.30  ? 698  GLU A CA  1 
ATOM   713  C  C   . GLU A 1 107 ? -7.770  49.222 -12.425 1.00 38.22  ? 698  GLU A C   1 
ATOM   714  O  O   . GLU A 1 107 ? -6.852  48.542 -11.957 1.00 37.80  ? 698  GLU A O   1 
ATOM   715  C  CB  . GLU A 1 107 ? -10.004 48.271 -11.690 1.00 34.27  ? 698  GLU A CB  1 
ATOM   716  C  CG  . GLU A 1 107 ? -9.387  47.440 -10.565 1.00 34.42  ? 698  GLU A CG  1 
ATOM   717  C  CD  . GLU A 1 107 ? -10.327 47.103 -9.419  1.00 43.84  ? 698  GLU A CD  1 
ATOM   718  O  OE1 . GLU A 1 107 ? -10.905 48.031 -8.816  1.00 45.66  ? 698  GLU A OE1 1 
ATOM   719  O  OE2 . GLU A 1 107 ? -10.466 45.907 -9.102  1.00 38.15  ? 698  GLU A OE2 1 
ATOM   720  N  N   . PHE A 1 108 ? -7.701  50.553 -12.557 1.00 35.79  ? 699  PHE A N   1 
ATOM   721  C  CA  . PHE A 1 108 ? -6.523  51.306 -12.162 1.00 35.44  ? 699  PHE A CA  1 
ATOM   722  C  C   . PHE A 1 108 ? -6.451  51.442 -10.633 1.00 38.50  ? 699  PHE A C   1 
ATOM   723  O  O   . PHE A 1 108 ? -7.435  51.843 -10.013 1.00 41.16  ? 699  PHE A O   1 
ATOM   724  C  CB  . PHE A 1 108 ? -6.498  52.663 -12.873 1.00 37.44  ? 699  PHE A CB  1 
ATOM   725  C  CG  . PHE A 1 108 ? -5.356  53.563 -12.444 1.00 39.78  ? 699  PHE A CG  1 
ATOM   726  C  CD1 . PHE A 1 108 ? -4.032  53.209 -12.699 1.00 41.44  ? 699  PHE A CD1 1 
ATOM   727  C  CD2 . PHE A 1 108 ? -5.607  54.774 -11.797 1.00 41.35  ? 699  PHE A CD2 1 
ATOM   728  C  CE1 . PHE A 1 108 ? -2.981  54.041 -12.298 1.00 42.89  ? 699  PHE A CE1 1 
ATOM   729  C  CE2 . PHE A 1 108 ? -4.552  55.604 -11.398 1.00 44.33  ? 699  PHE A CE2 1 
ATOM   730  C  CZ  . PHE A 1 108 ? -3.251  55.232 -11.652 1.00 42.07  ? 699  PHE A CZ  1 
ATOM   731  N  N   . MET A 1 109 ? -5.304  51.077 -10.034 1.00 32.93  ? 700  MET A N   1 
ATOM   732  C  CA  . MET A 1 109 ? -5.094  51.170 -8.585  1.00 32.95  ? 700  MET A CA  1 
ATOM   733  C  C   . MET A 1 109 ? -4.103  52.269 -8.322  1.00 39.33  ? 700  MET A C   1 
ATOM   734  O  O   . MET A 1 109 ? -2.892  52.080 -8.453  1.00 39.10  ? 700  MET A O   1 
ATOM   735  C  CB  . MET A 1 109 ? -4.671  49.834 -7.971  1.00 33.72  ? 700  MET A CB  1 
ATOM   736  C  CG  . MET A 1 109 ? -5.695  48.721 -8.256  1.00 35.43  ? 700  MET A CG  1 
ATOM   737  S  SD  . MET A 1 109 ? -7.269  48.886 -7.380  1.00 37.87  ? 700  MET A SD  1 
ATOM   738  C  CE  . MET A 1 109 ? -6.744  48.353 -5.792  1.00 33.86  ? 700  MET A CE  1 
ATOM   739  N  N   . GLU A 1 110 ? -4.626  53.439 -7.990  1.00 39.17  ? 701  GLU A N   1 
ATOM   740  C  CA  . GLU A 1 110 ? -3.801  54.640 -7.820  1.00 41.41  ? 701  GLU A CA  1 
ATOM   741  C  C   . GLU A 1 110 ? -2.570  54.493 -6.922  1.00 44.34  ? 701  GLU A C   1 
ATOM   742  O  O   . GLU A 1 110 ? -1.515  55.056 -7.232  1.00 43.96  ? 701  GLU A O   1 
ATOM   743  C  CB  . GLU A 1 110 ? -4.653  55.798 -7.324  1.00 44.13  ? 701  GLU A CB  1 
ATOM   744  C  CG  . GLU A 1 110 ? -4.152  57.123 -7.865  1.00 61.82  ? 701  GLU A CG  1 
ATOM   745  C  CD  . GLU A 1 110 ? -4.239  58.316 -6.927  1.00 95.36  ? 701  GLU A CD  1 
ATOM   746  O  OE1 . GLU A 1 110 ? -5.195  58.385 -6.118  1.00 86.31  ? 701  GLU A OE1 1 
ATOM   747  O  OE2 . GLU A 1 110 ? -3.356  59.200 -7.019  1.00 100.25 ? 701  GLU A OE2 1 
ATOM   748  N  N   . ASN A 1 111 ? -2.692  53.735 -5.820  1.00 39.72  ? 702  ASN A N   1 
ATOM   749  C  CA  . ASN A 1 111 ? -1.579  53.649 -4.878  1.00 39.16  ? 702  ASN A CA  1 
ATOM   750  C  C   . ASN A 1 111 ? -0.622  52.460 -5.082  1.00 40.92  ? 702  ASN A C   1 
ATOM   751  O  O   . ASN A 1 111 ? 0.312   52.309 -4.302  1.00 39.94  ? 702  ASN A O   1 
ATOM   752  C  CB  . ASN A 1 111 ? -2.130  53.712 -3.451  1.00 37.70  ? 702  ASN A CB  1 
ATOM   753  C  CG  . ASN A 1 111 ? -2.597  55.118 -3.122  1.00 40.44  ? 702  ASN A CG  1 
ATOM   754  O  OD1 . ASN A 1 111 ? -1.923  56.097 -3.392  1.00 36.98  ? 702  ASN A OD1 1 
ATOM   755  N  ND2 . ASN A 1 111 ? -3.767  55.258 -2.527  1.00 32.35  ? 702  ASN A ND2 1 
ATOM   756  N  N   . GLY A 1 112 ? -0.805  51.683 -6.152  1.00 39.82  ? 703  GLY A N   1 
ATOM   757  C  CA  . GLY A 1 112 ? 0.083   50.563 -6.495  1.00 39.09  ? 703  GLY A CA  1 
ATOM   758  C  C   . GLY A 1 112 ? 0.221   49.489 -5.429  1.00 39.65  ? 703  GLY A C   1 
ATOM   759  O  O   . GLY A 1 112 ? -0.723  49.268 -4.678  1.00 38.36  ? 703  GLY A O   1 
ATOM   760  N  N   . ALA A 1 113 ? 1.399   48.824 -5.348  1.00 35.95  ? 704  ALA A N   1 
ATOM   761  C  CA  . ALA A 1 113 ? 1.693   47.746 -4.382  1.00 37.31  ? 704  ALA A CA  1 
ATOM   762  C  C   . ALA A 1 113 ? 1.619   48.247 -2.945  1.00 42.87  ? 704  ALA A C   1 
ATOM   763  O  O   . ALA A 1 113 ? 2.112   49.339 -2.648  1.00 42.16  ? 704  ALA A O   1 
ATOM   764  C  CB  . ALA A 1 113 ? 3.053   47.099 -4.647  1.00 38.19  ? 704  ALA A CB  1 
ATOM   765  N  N   . LEU A 1 114 ? 0.993   47.437 -2.070  1.00 37.85  ? 705  LEU A N   1 
ATOM   766  C  CA  . LEU A 1 114 ? 0.757   47.770 -0.674  1.00 37.38  ? 705  LEU A CA  1 
ATOM   767  C  C   . LEU A 1 114 ? 2.027   47.983 0.147   1.00 42.00  ? 705  LEU A C   1 
ATOM   768  O  O   . LEU A 1 114 ? 2.083   48.935 0.929   1.00 42.02  ? 705  LEU A O   1 
ATOM   769  C  CB  . LEU A 1 114 ? -0.162  46.710 -0.031  1.00 36.06  ? 705  LEU A CB  1 
ATOM   770  C  CG  . LEU A 1 114 ? -0.483  46.852 1.469   1.00 40.20  ? 705  LEU A CG  1 
ATOM   771  C  CD1 . LEU A 1 114 ? -1.237  48.158 1.773   1.00 39.15  ? 705  LEU A CD1 1 
ATOM   772  C  CD2 . LEU A 1 114 ? -1.258  45.646 1.949   1.00 42.14  ? 705  LEU A CD2 1 
ATOM   773  N  N   . ASP A 1 115 ? 3.044   47.119 -0.033  1.00 38.53  ? 706  ASP A N   1 
ATOM   774  C  CA  . ASP A 1 115 ? 4.298   47.218 0.715   1.00 38.49  ? 706  ASP A CA  1 
ATOM   775  C  C   . ASP A 1 115 ? 5.013   48.550 0.523   1.00 42.06  ? 706  ASP A C   1 
ATOM   776  O  O   . ASP A 1 115 ? 5.413   49.161 1.515   1.00 41.98  ? 706  ASP A O   1 
ATOM   777  C  CB  . ASP A 1 115 ? 5.238   46.024 0.413   1.00 39.76  ? 706  ASP A CB  1 
ATOM   778  C  CG  . ASP A 1 115 ? 5.881   46.024 -0.972  1.00 46.14  ? 706  ASP A CG  1 
ATOM   779  O  OD1 . ASP A 1 115 ? 5.161   46.299 -1.972  1.00 41.88  ? 706  ASP A OD1 1 
ATOM   780  O  OD2 . ASP A 1 115 ? 7.106   45.824 -1.051  1.00 53.04  ? 706  ASP A OD2 1 
ATOM   781  N  N   . SER A 1 116 ? 5.176   49.005 -0.739  1.00 39.30  ? 707  SER A N   1 
ATOM   782  C  CA  . SER A 1 116 ? 5.865   50.272 -1.013  1.00 40.26  ? 707  SER A CA  1 
ATOM   783  C  C   . SER A 1 116 ? 4.982   51.459 -0.722  1.00 41.94  ? 707  SER A C   1 
ATOM   784  O  O   . SER A 1 116 ? 5.488   52.486 -0.314  1.00 42.62  ? 707  SER A O   1 
ATOM   785  C  CB  . SER A 1 116 ? 6.426   50.321 -2.434  1.00 44.59  ? 707  SER A CB  1 
ATOM   786  O  OG  . SER A 1 116 ? 5.423   49.984 -3.375  1.00 52.23  ? 707  SER A OG  1 
ATOM   787  N  N   . PHE A 1 117 ? 3.650   51.309 -0.865  1.00 38.05  ? 708  PHE A N   1 
ATOM   788  C  CA  . PHE A 1 117 ? 2.722   52.389 -0.529  1.00 36.29  ? 708  PHE A CA  1 
ATOM   789  C  C   . PHE A 1 117 ? 2.854   52.728 0.971   1.00 42.09  ? 708  PHE A C   1 
ATOM   790  O  O   . PHE A 1 117 ? 2.937   53.898 1.323   1.00 42.44  ? 708  PHE A O   1 
ATOM   791  C  CB  . PHE A 1 117 ? 1.280   51.965 -0.836  1.00 35.78  ? 708  PHE A CB  1 
ATOM   792  C  CG  . PHE A 1 117 ? 0.241   52.914 -0.297  1.00 36.23  ? 708  PHE A CG  1 
ATOM   793  C  CD1 . PHE A 1 117 ? 0.152   54.211 -0.775  1.00 37.87  ? 708  PHE A CD1 1 
ATOM   794  C  CD2 . PHE A 1 117 ? -0.660  52.505 0.682   1.00 35.47  ? 708  PHE A CD2 1 
ATOM   795  C  CE1 . PHE A 1 117 ? -0.821  55.085 -0.286  1.00 39.66  ? 708  PHE A CE1 1 
ATOM   796  C  CE2 . PHE A 1 117 ? -1.621  53.387 1.179   1.00 38.17  ? 708  PHE A CE2 1 
ATOM   797  C  CZ  . PHE A 1 117 ? -1.722  54.656 0.668   1.00 36.75  ? 708  PHE A CZ  1 
ATOM   798  N  N   . LEU A 1 118 ? 2.901   51.702 1.828   1.00 39.61  ? 709  LEU A N   1 
ATOM   799  C  CA  . LEU A 1 118 ? 3.036   51.870 3.279   1.00 41.08  ? 709  LEU A CA  1 
ATOM   800  C  C   . LEU A 1 118 ? 4.388   52.437 3.691   1.00 44.77  ? 709  LEU A C   1 
ATOM   801  O  O   . LEU A 1 118 ? 4.443   53.302 4.570   1.00 42.95  ? 709  LEU A O   1 
ATOM   802  C  CB  . LEU A 1 118 ? 2.729   50.545 3.998   1.00 40.80  ? 709  LEU A CB  1 
ATOM   803  C  CG  . LEU A 1 118 ? 1.240   50.131 3.998   1.00 45.39  ? 709  LEU A CG  1 
ATOM   804  C  CD1 . LEU A 1 118 ? 1.062   48.827 4.698   1.00 46.95  ? 709  LEU A CD1 1 
ATOM   805  C  CD2 . LEU A 1 118 ? 0.349   51.187 4.654   1.00 46.91  ? 709  LEU A CD2 1 
ATOM   806  N  N   . ARG A 1 119 ? 5.475   51.998 3.026   1.00 42.44  ? 710  ARG A N   1 
ATOM   807  C  CA  . ARG A 1 119 ? 6.812   52.527 3.335   1.00 44.16  ? 710  ARG A CA  1 
ATOM   808  C  C   . ARG A 1 119 ? 6.907   54.005 3.016   1.00 47.92  ? 710  ARG A C   1 
ATOM   809  O  O   . ARG A 1 119 ? 7.546   54.735 3.766   1.00 50.56  ? 710  ARG A O   1 
ATOM   810  C  CB  . ARG A 1 119 ? 7.912   51.752 2.587   1.00 45.05  ? 710  ARG A CB  1 
ATOM   811  C  CG  . ARG A 1 119 ? 8.158   50.362 3.133   1.00 43.72  ? 710  ARG A CG  1 
ATOM   812  C  CD  . ARG A 1 119 ? 9.424   49.733 2.566   1.00 45.92  ? 710  ARG A CD  1 
ATOM   813  N  NE  . ARG A 1 119 ? 9.300   49.409 1.144   1.00 50.20  ? 710  ARG A NE  1 
ATOM   814  C  CZ  . ARG A 1 119 ? 8.871   48.242 0.670   1.00 58.78  ? 710  ARG A CZ  1 
ATOM   815  N  NH1 . ARG A 1 119 ? 8.480   47.277 1.503   1.00 39.44  ? 710  ARG A NH1 1 
ATOM   816  N  NH2 . ARG A 1 119 ? 8.797   48.040 -0.637  1.00 45.71  ? 710  ARG A NH2 1 
ATOM   817  N  N   . GLN A 1 120 ? 6.245   54.439 1.923   1.00 43.18  ? 711  GLN A N   1 
ATOM   818  C  CA  . GLN A 1 120 ? 6.206   55.835 1.461   1.00 43.10  ? 711  GLN A CA  1 
ATOM   819  C  C   . GLN A 1 120 ? 5.211   56.677 2.274   1.00 45.39  ? 711  GLN A C   1 
ATOM   820  O  O   . GLN A 1 120 ? 5.114   57.878 2.055   1.00 45.47  ? 711  GLN A O   1 
ATOM   821  C  CB  . GLN A 1 120 ? 5.793   55.872 -0.006  1.00 43.15  ? 711  GLN A CB  1 
ATOM   822  C  CG  . GLN A 1 120 ? 6.880   55.471 -0.982  1.00 60.49  ? 711  GLN A CG  1 
ATOM   823  C  CD  . GLN A 1 120 ? 6.376   55.555 -2.404  1.00 82.50  ? 711  GLN A CD  1 
ATOM   824  O  OE1 . GLN A 1 120 ? 6.239   54.545 -3.094  1.00 73.10  ? 711  GLN A OE1 1 
ATOM   825  N  NE2 . GLN A 1 120 ? 6.078   56.766 -2.875  1.00 85.66  ? 711  GLN A NE2 1 
ATOM   826  N  N   . ASN A 1 121 ? 4.442   56.037 3.165   1.00 41.86  ? 712  ASN A N   1 
ATOM   827  C  CA  . ASN A 1 121 ? 3.402   56.684 3.966   1.00 42.04  ? 712  ASN A CA  1 
ATOM   828  C  C   . ASN A 1 121 ? 3.478   56.206 5.419   1.00 47.84  ? 712  ASN A C   1 
ATOM   829  O  O   . ASN A 1 121 ? 2.454   55.920 6.059   1.00 48.30  ? 712  ASN A O   1 
ATOM   830  C  CB  . ASN A 1 121 ? 2.046   56.353 3.370   1.00 37.14  ? 712  ASN A CB  1 
ATOM   831  C  CG  . ASN A 1 121 ? 1.779   57.083 2.084   1.00 50.21  ? 712  ASN A CG  1 
ATOM   832  O  OD1 . ASN A 1 121 ? 1.344   58.230 2.081   1.00 45.18  ? 712  ASN A OD1 1 
ATOM   833  N  ND2 . ASN A 1 121 ? 2.034   56.435 0.956   1.00 38.60  ? 712  ASN A ND2 1 
ATOM   834  N  N   . ASP A 1 122 ? 4.705   56.123 5.935   1.00 45.04  ? 713  ASP A N   1 
ATOM   835  C  CA  . ASP A 1 122 ? 4.995   55.630 7.274   1.00 45.89  ? 713  ASP A CA  1 
ATOM   836  C  C   . ASP A 1 122 ? 4.291   56.486 8.361   1.00 48.86  ? 713  ASP A C   1 
ATOM   837  O  O   . ASP A 1 122 ? 4.424   57.713 8.359   1.00 48.09  ? 713  ASP A O   1 
ATOM   838  C  CB  . ASP A 1 122 ? 6.523   55.533 7.465   1.00 49.89  ? 713  ASP A CB  1 
ATOM   839  C  CG  . ASP A 1 122 ? 7.014   54.865 8.737   1.00 60.73  ? 713  ASP A CG  1 
ATOM   840  O  OD1 . ASP A 1 122 ? 6.237   54.099 9.353   1.00 59.79  ? 713  ASP A OD1 1 
ATOM   841  O  OD2 . ASP A 1 122 ? 8.186   55.065 9.087   1.00 71.99  ? 713  ASP A OD2 1 
ATOM   842  N  N   . GLY A 1 123 ? 3.439   55.826 9.161   1.00 45.19  ? 714  GLY A N   1 
ATOM   843  C  CA  . GLY A 1 123 ? 2.635   56.451 10.212  1.00 45.52  ? 714  GLY A CA  1 
ATOM   844  C  C   . GLY A 1 123 ? 1.504   57.361 9.730   1.00 48.99  ? 714  GLY A C   1 
ATOM   845  O  O   . GLY A 1 123 ? 0.975   58.164 10.512  1.00 49.30  ? 714  GLY A O   1 
ATOM   846  N  N   . GLN A 1 124 ? 1.104   57.245 8.446   1.00 43.78  ? 715  GLN A N   1 
ATOM   847  C  CA  . GLN A 1 124 ? 0.052   58.095 7.847   1.00 42.73  ? 715  GLN A CA  1 
ATOM   848  C  C   . GLN A 1 124 ? -1.352  57.664 8.236   1.00 45.28  ? 715  GLN A C   1 
ATOM   849  O  O   . GLN A 1 124 ? -2.292  58.452 8.115   1.00 44.33  ? 715  GLN A O   1 
ATOM   850  C  CB  . GLN A 1 124 ? 0.122   58.023 6.306   1.00 41.98  ? 715  GLN A CB  1 
ATOM   851  C  CG  . GLN A 1 124 ? 1.141   58.934 5.653   1.00 44.88  ? 715  GLN A CG  1 
ATOM   852  C  CD  . GLN A 1 124 ? 0.824   60.390 5.685   1.00 47.39  ? 715  GLN A CD  1 
ATOM   853  O  OE1 . GLN A 1 124 ? -0.314  60.805 5.485   1.00 44.56  ? 715  GLN A OE1 1 
ATOM   854  N  NE2 . GLN A 1 124 ? 1.848   61.210 5.890   1.00 44.01  ? 715  GLN A NE2 1 
ATOM   855  N  N   . PHE A 1 125 ? -1.498  56.389 8.612   1.00 40.22  ? 716  PHE A N   1 
ATOM   856  C  CA  . PHE A 1 125 ? -2.778  55.743 8.840   1.00 38.56  ? 716  PHE A CA  1 
ATOM   857  C  C   . PHE A 1 125 ? -2.955  55.264 10.262  1.00 44.18  ? 716  PHE A C   1 
ATOM   858  O  O   . PHE A 1 125 ? -1.993  54.862 10.900  1.00 44.28  ? 716  PHE A O   1 
ATOM   859  C  CB  . PHE A 1 125 ? -2.971  54.596 7.819   1.00 37.34  ? 716  PHE A CB  1 
ATOM   860  C  CG  . PHE A 1 125 ? -2.731  55.067 6.388   1.00 37.72  ? 716  PHE A CG  1 
ATOM   861  C  CD1 . PHE A 1 125 ? -3.524  56.077 5.822   1.00 38.42  ? 716  PHE A CD1 1 
ATOM   862  C  CD2 . PHE A 1 125 ? -1.660  54.564 5.637   1.00 38.92  ? 716  PHE A CD2 1 
ATOM   863  C  CE1 . PHE A 1 125 ? -3.238  56.592 4.545   1.00 37.80  ? 716  PHE A CE1 1 
ATOM   864  C  CE2 . PHE A 1 125 ? -1.395  55.052 4.336   1.00 40.62  ? 716  PHE A CE2 1 
ATOM   865  C  CZ  . PHE A 1 125 ? -2.180  56.066 3.803   1.00 38.73  ? 716  PHE A CZ  1 
ATOM   866  N  N   . THR A 1 126 ? -4.200  55.286 10.735  1.00 40.66  ? 717  THR A N   1 
ATOM   867  C  CA  . THR A 1 126 ? -4.584  54.828 12.071  1.00 41.59  ? 717  THR A CA  1 
ATOM   868  C  C   . THR A 1 126 ? -4.660  53.287 12.083  1.00 44.20  ? 717  THR A C   1 
ATOM   869  O  O   . THR A 1 126 ? -4.684  52.665 11.020  1.00 43.49  ? 717  THR A O   1 
ATOM   870  C  CB  . THR A 1 126 ? -5.946  55.456 12.494  1.00 44.74  ? 717  THR A CB  1 
ATOM   871  O  OG1 . THR A 1 126 ? -6.968  54.962 11.641  1.00 44.73  ? 717  THR A OG1 1 
ATOM   872  C  CG2 . THR A 1 126 ? -5.964  56.989 12.446  1.00 38.67  ? 717  THR A CG2 1 
ATOM   873  N  N   . VAL A 1 127 ? -4.710  52.685 13.286  1.00 41.76  ? 718  VAL A N   1 
ATOM   874  C  CA  . VAL A 1 127 ? -4.848  51.238 13.497  1.00 41.12  ? 718  VAL A CA  1 
ATOM   875  C  C   . VAL A 1 127 ? -6.134  50.770 12.794  1.00 43.26  ? 718  VAL A C   1 
ATOM   876  O  O   . VAL A 1 127 ? -6.092  49.782 12.089  1.00 42.08  ? 718  VAL A O   1 
ATOM   877  C  CB  . VAL A 1 127 ? -4.819  50.859 15.023  1.00 46.55  ? 718  VAL A CB  1 
ATOM   878  C  CG1 . VAL A 1 127 ? -5.349  49.436 15.283  1.00 45.32  ? 718  VAL A CG1 1 
ATOM   879  C  CG2 . VAL A 1 127 ? -3.406  51.011 15.596  1.00 47.21  ? 718  VAL A CG2 1 
ATOM   880  N  N   . ILE A 1 128 ? -7.255  51.503 12.958  1.00 40.26  ? 719  ILE A N   1 
ATOM   881  C  CA  . ILE A 1 128 ? -8.531  51.140 12.326  1.00 39.03  ? 719  ILE A CA  1 
ATOM   882  C  C   . ILE A 1 128 ? -8.424  51.167 10.782  1.00 41.94  ? 719  ILE A C   1 
ATOM   883  O  O   . ILE A 1 128 ? -8.980  50.288 10.110  1.00 38.06  ? 719  ILE A O   1 
ATOM   884  C  CB  . ILE A 1 128 ? -9.746  51.957 12.866  1.00 42.04  ? 719  ILE A CB  1 
ATOM   885  C  CG1 . ILE A 1 128 ? -10.272 51.371 14.204  1.00 43.36  ? 719  ILE A CG1 1 
ATOM   886  C  CG2 . ILE A 1 128 ? -10.881 51.968 11.812  1.00 40.12  ? 719  ILE A CG2 1 
ATOM   887  C  CD1 . ILE A 1 128 ? -10.810 52.440 15.188  1.00 53.79  ? 719  ILE A CD1 1 
ATOM   888  N  N   . GLN A 1 129 ? -7.685  52.141 10.229  1.00 40.46  ? 720  GLN A N   1 
ATOM   889  C  CA  . GLN A 1 129 ? -7.479  52.199 8.772   1.00 38.30  ? 720  GLN A CA  1 
ATOM   890  C  C   . GLN A 1 129 ? -6.679  50.975 8.314   1.00 41.77  ? 720  GLN A C   1 
ATOM   891  O  O   . GLN A 1 129 ? -7.083  50.331 7.349   1.00 41.73  ? 720  GLN A O   1 
ATOM   892  C  CB  . GLN A 1 129 ? -6.802  53.510 8.333   1.00 39.01  ? 720  GLN A CB  1 
ATOM   893  C  CG  . GLN A 1 129 ? -7.778  54.689 8.372   1.00 36.99  ? 720  GLN A CG  1 
ATOM   894  C  CD  . GLN A 1 129 ? -7.126  56.055 8.321   1.00 49.77  ? 720  GLN A CD  1 
ATOM   895  O  OE1 . GLN A 1 129 ? -5.923  56.215 8.471   1.00 46.11  ? 720  GLN A OE1 1 
ATOM   896  N  NE2 . GLN A 1 129 ? -7.927  57.089 8.142   1.00 46.14  ? 720  GLN A NE2 1 
ATOM   897  N  N   . LEU A 1 130 ? -5.597  50.616 9.043   1.00 36.97  ? 721  LEU A N   1 
ATOM   898  C  CA  . LEU A 1 130 ? -4.770  49.443 8.724   1.00 35.59  ? 721  LEU A CA  1 
ATOM   899  C  C   . LEU A 1 130 ? -5.585  48.150 8.831   1.00 37.12  ? 721  LEU A C   1 
ATOM   900  O  O   . LEU A 1 130 ? -5.484  47.296 7.949   1.00 35.22  ? 721  LEU A O   1 
ATOM   901  C  CB  . LEU A 1 130 ? -3.493  49.398 9.596   1.00 37.05  ? 721  LEU A CB  1 
ATOM   902  C  CG  . LEU A 1 130 ? -2.541  50.613 9.452   1.00 41.40  ? 721  LEU A CG  1 
ATOM   903  C  CD1 . LEU A 1 130 ? -1.467  50.597 10.558  1.00 40.32  ? 721  LEU A CD1 1 
ATOM   904  C  CD2 . LEU A 1 130 ? -1.925  50.701 8.056   1.00 41.25  ? 721  LEU A CD2 1 
ATOM   905  N  N   . VAL A 1 131 ? -6.444  48.047 9.871   1.00 34.29  ? 722  VAL A N   1 
ATOM   906  C  CA  . VAL A 1 131 ? -7.331  46.890 10.100  1.00 35.24  ? 722  VAL A CA  1 
ATOM   907  C  C   . VAL A 1 131 ? -8.355  46.759 8.942   1.00 38.69  ? 722  VAL A C   1 
ATOM   908  O  O   . VAL A 1 131 ? -8.588  45.655 8.461   1.00 39.02  ? 722  VAL A O   1 
ATOM   909  C  CB  . VAL A 1 131 ? -7.975  46.910 11.523  1.00 39.75  ? 722  VAL A CB  1 
ATOM   910  C  CG1 . VAL A 1 131 ? -9.150  45.921 11.651  1.00 38.35  ? 722  VAL A CG1 1 
ATOM   911  C  CG2 . VAL A 1 131 ? -6.903  46.639 12.581  1.00 40.66  ? 722  VAL A CG2 1 
ATOM   912  N  N   . GLY A 1 132 ? -8.879  47.891 8.472   1.00 33.71  ? 723  GLY A N   1 
ATOM   913  C  CA  . GLY A 1 132 ? -9.777  47.943 7.329   1.00 32.40  ? 723  GLY A CA  1 
ATOM   914  C  C   . GLY A 1 132 ? -9.115  47.397 6.072   1.00 35.50  ? 723  GLY A C   1 
ATOM   915  O  O   . GLY A 1 132 ? -9.747  46.662 5.313   1.00 35.50  ? 723  GLY A O   1 
ATOM   916  N  N   . MET A 1 133 ? -7.837  47.722 5.858   1.00 33.69  ? 724  MET A N   1 
ATOM   917  C  CA  . MET A 1 133 ? -7.032  47.215 4.720   1.00 34.02  ? 724  MET A CA  1 
ATOM   918  C  C   . MET A 1 133 ? -6.856  45.685 4.812   1.00 36.79  ? 724  MET A C   1 
ATOM   919  O  O   . MET A 1 133 ? -7.003  44.993 3.805   1.00 34.98  ? 724  MET A O   1 
ATOM   920  C  CB  . MET A 1 133 ? -5.654  47.870 4.662   1.00 36.98  ? 724  MET A CB  1 
ATOM   921  C  CG  . MET A 1 133 ? -5.681  49.366 4.421   1.00 43.04  ? 724  MET A CG  1 
ATOM   922  S  SD  . MET A 1 133 ? -3.955  49.960 4.425   1.00 50.30  ? 724  MET A SD  1 
ATOM   923  C  CE  . MET A 1 133 ? -4.189  51.613 4.825   1.00 48.42  ? 724  MET A CE  1 
ATOM   924  N  N   . LEU A 1 134 ? -6.564  45.173 6.028   1.00 32.97  ? 725  LEU A N   1 
ATOM   925  C  CA  . LEU A 1 134 ? -6.411  43.754 6.317   1.00 31.89  ? 725  LEU A CA  1 
ATOM   926  C  C   . LEU A 1 134 ? -7.705  42.976 6.170   1.00 35.75  ? 725  LEU A C   1 
ATOM   927  O  O   . LEU A 1 134 ? -7.684  41.822 5.732   1.00 35.50  ? 725  LEU A O   1 
ATOM   928  C  CB  . LEU A 1 134 ? -5.810  43.561 7.729   1.00 34.07  ? 725  LEU A CB  1 
ATOM   929  C  CG  . LEU A 1 134 ? -4.329  43.991 7.890   1.00 36.84  ? 725  LEU A CG  1 
ATOM   930  C  CD1 . LEU A 1 134 ? -3.903  43.869 9.324   1.00 38.96  ? 725  LEU A CD1 1 
ATOM   931  C  CD2 . LEU A 1 134 ? -3.413  43.119 7.002   1.00 36.68  ? 725  LEU A CD2 1 
ATOM   932  N  N   . ARG A 1 135 ? -8.835  43.597 6.529   1.00 33.65  ? 726  ARG A N   1 
ATOM   933  C  CA  . ARG A 1 135 ? -10.160 42.986 6.421   1.00 34.12  ? 726  ARG A CA  1 
ATOM   934  C  C   . ARG A 1 135 ? -10.511 42.751 4.933   1.00 36.61  ? 726  ARG A C   1 
ATOM   935  O  O   . ARG A 1 135 ? -11.027 41.687 4.579   1.00 35.36  ? 726  ARG A O   1 
ATOM   936  C  CB  . ARG A 1 135 ? -11.224 43.833 7.173   1.00 34.31  ? 726  ARG A CB  1 
ATOM   937  C  CG  . ARG A 1 135 ? -12.580 43.137 7.336   1.00 41.14  ? 726  ARG A CG  1 
ATOM   938  C  CD  . ARG A 1 135 ? -13.517 43.329 6.133   1.00 39.55  ? 726  ARG A CD  1 
ATOM   939  N  NE  . ARG A 1 135 ? -14.782 42.645 6.385   1.00 39.64  ? 726  ARG A NE  1 
ATOM   940  C  CZ  . ARG A 1 135 ? -15.610 42.168 5.455   1.00 43.85  ? 726  ARG A CZ  1 
ATOM   941  N  NH1 . ARG A 1 135 ? -15.359 42.358 4.170   1.00 33.85  ? 726  ARG A NH1 1 
ATOM   942  N  NH2 . ARG A 1 135 ? -16.719 41.544 5.809   1.00 30.06  ? 726  ARG A NH2 1 
ATOM   943  N  N   . GLY A 1 136 ? -10.196 43.735 4.090   1.00 34.04  ? 727  GLY A N   1 
ATOM   944  C  CA  . GLY A 1 136 ? -10.386 43.650 2.641   1.00 31.86  ? 727  GLY A CA  1 
ATOM   945  C  C   . GLY A 1 136 ? -9.554  42.538 2.038   1.00 33.91  ? 727  GLY A C   1 
ATOM   946  O  O   . GLY A 1 136 ? -10.082 41.702 1.299   1.00 32.87  ? 727  GLY A O   1 
ATOM   947  N  N   . ILE A 1 137 ? -8.272  42.440 2.427   1.00 31.44  ? 728  ILE A N   1 
ATOM   948  C  CA  . ILE A 1 137 ? -7.395  41.345 1.955   1.00 31.19  ? 728  ILE A CA  1 
ATOM   949  C  C   . ILE A 1 137 ? -7.963  39.956 2.348   1.00 36.75  ? 728  ILE A C   1 
ATOM   950  O  O   . ILE A 1 137 ? -8.046  39.057 1.507   1.00 35.86  ? 728  ILE A O   1 
ATOM   951  C  CB  . ILE A 1 137 ? -5.913  41.520 2.397   1.00 33.71  ? 728  ILE A CB  1 
ATOM   952  C  CG1 . ILE A 1 137 ? -5.337  42.842 1.869   1.00 33.59  ? 728  ILE A CG1 1 
ATOM   953  C  CG2 . ILE A 1 137 ? -5.059  40.324 1.927   1.00 31.52  ? 728  ILE A CG2 1 
ATOM   954  C  CD1 . ILE A 1 137 ? -4.093  43.364 2.639   1.00 35.42  ? 728  ILE A CD1 1 
ATOM   955  N  N   . ALA A 1 138 ? -8.371  39.808 3.621   1.00 34.54  ? 729  ALA A N   1 
ATOM   956  C  CA  . ALA A 1 138 ? -8.957  38.572 4.152   1.00 34.91  ? 729  ALA A CA  1 
ATOM   957  C  C   . ALA A 1 138 ? -10.264 38.197 3.406   1.00 37.41  ? 729  ALA A C   1 
ATOM   958  O  O   . ALA A 1 138 ? -10.494 37.018 3.134   1.00 36.15  ? 729  ALA A O   1 
ATOM   959  C  CB  . ALA A 1 138 ? -9.228  38.731 5.647   1.00 36.42  ? 729  ALA A CB  1 
ATOM   960  N  N   . ALA A 1 139 ? -11.106 39.209 3.063   1.00 34.29  ? 730  ALA A N   1 
ATOM   961  C  CA  . ALA A 1 139 ? -12.355 39.028 2.306   1.00 31.94  ? 730  ALA A CA  1 
ATOM   962  C  C   . ALA A 1 139 ? -12.045 38.530 0.873   1.00 35.19  ? 730  ALA A C   1 
ATOM   963  O  O   . ALA A 1 139 ? -12.723 37.628 0.382   1.00 34.03  ? 730  ALA A O   1 
ATOM   964  C  CB  . ALA A 1 139 ? -13.133 40.336 2.255   1.00 32.17  ? 730  ALA A CB  1 
ATOM   965  N  N   . GLY A 1 140 ? -11.009 39.097 0.242   1.00 31.90  ? 731  GLY A N   1 
ATOM   966  C  CA  . GLY A 1 140 ? -10.563 38.690 -1.089  1.00 31.09  ? 731  GLY A CA  1 
ATOM   967  C  C   . GLY A 1 140 ? -10.062 37.258 -1.073  1.00 34.89  ? 731  GLY A C   1 
ATOM   968  O  O   . GLY A 1 140 ? -10.407 36.459 -1.956  1.00 33.42  ? 731  GLY A O   1 
ATOM   969  N  N   . MET A 1 141 ? -9.304  36.913 -0.012  1.00 28.48  ? 732  MET A N   1 
ATOM   970  C  CA  . MET A 1 141 ? -8.773  35.580 0.192   1.00 29.30  ? 732  MET A CA  1 
ATOM   971  C  C   . MET A 1 141 ? -9.832  34.567 0.572   1.00 35.16  ? 732  MET A C   1 
ATOM   972  O  O   . MET A 1 141 ? -9.725  33.420 0.173   1.00 35.73  ? 732  MET A O   1 
ATOM   973  C  CB  . MET A 1 141 ? -7.605  35.589 1.202   1.00 31.88  ? 732  MET A CB  1 
ATOM   974  C  CG  . MET A 1 141 ? -6.323  36.273 0.660   1.00 34.72  ? 732  MET A CG  1 
ATOM   975  S  SD  . MET A 1 141 ? -5.673  35.590 -0.889  1.00 39.44  ? 732  MET A SD  1 
ATOM   976  C  CE  . MET A 1 141 ? -5.537  33.770 -0.472  1.00 35.85  ? 732  MET A CE  1 
ATOM   977  N  N   . LYS A 1 142 ? -10.885 34.988 1.279   1.00 32.92  ? 733  LYS A N   1 
ATOM   978  C  CA  . LYS A 1 142 ? -12.011 34.110 1.609   1.00 32.78  ? 733  LYS A CA  1 
ATOM   979  C  C   . LYS A 1 142 ? -12.687 33.694 0.305   1.00 37.63  ? 733  LYS A C   1 
ATOM   980  O  O   . LYS A 1 142 ? -12.991 32.518 0.115   1.00 37.76  ? 733  LYS A O   1 
ATOM   981  C  CB  . LYS A 1 142 ? -13.011 34.847 2.520   1.00 33.57  ? 733  LYS A CB  1 
ATOM   982  C  CG  . LYS A 1 142 ? -14.250 34.031 2.876   1.00 37.73  ? 733  LYS A CG  1 
ATOM   983  C  CD  . LYS A 1 142 ? -15.275 34.875 3.597   1.00 41.10  ? 733  LYS A CD  1 
ATOM   984  C  CE  . LYS A 1 142 ? -16.434 34.046 4.108   1.00 46.29  ? 733  LYS A CE  1 
ATOM   985  N  NZ  . LYS A 1 142 ? -17.325 33.545 3.027   1.00 40.34  ? 733  LYS A NZ  1 
ATOM   986  N  N   . TYR A 1 143 ? -12.872 34.660 -0.609  1.00 33.97  ? 734  TYR A N   1 
ATOM   987  C  CA  . TYR A 1 143 ? -13.520 34.428 -1.887  1.00 33.33  ? 734  TYR A CA  1 
ATOM   988  C  C   . TYR A 1 143 ? -12.672 33.481 -2.738  1.00 37.98  ? 734  TYR A C   1 
ATOM   989  O  O   . TYR A 1 143 ? -13.202 32.504 -3.272  1.00 37.75  ? 734  TYR A O   1 
ATOM   990  C  CB  . TYR A 1 143 ? -13.740 35.781 -2.598  1.00 32.32  ? 734  TYR A CB  1 
ATOM   991  C  CG  . TYR A 1 143 ? -14.333 35.666 -3.986  1.00 33.88  ? 734  TYR A CG  1 
ATOM   992  C  CD1 . TYR A 1 143 ? -13.520 35.675 -5.116  1.00 34.11  ? 734  TYR A CD1 1 
ATOM   993  C  CD2 . TYR A 1 143 ? -15.717 35.589 -4.176  1.00 35.62  ? 734  TYR A CD2 1 
ATOM   994  C  CE1 . TYR A 1 143 ? -14.061 35.636 -6.401  1.00 29.40  ? 734  TYR A CE1 1 
ATOM   995  C  CE2 . TYR A 1 143 ? -16.266 35.523 -5.462  1.00 36.51  ? 734  TYR A CE2 1 
ATOM   996  C  CZ  . TYR A 1 143 ? -15.429 35.580 -6.570  1.00 36.12  ? 734  TYR A CZ  1 
ATOM   997  O  OH  . TYR A 1 143 ? -15.920 35.557 -7.851  1.00 33.04  ? 734  TYR A OH  1 
ATOM   998  N  N   . LEU A 1 144 ? -11.367 33.785 -2.867  1.00 35.01  ? 735  LEU A N   1 
ATOM   999  C  CA  . LEU A 1 144 ? -10.391 33.020 -3.638  1.00 35.42  ? 735  LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 144 ? -10.331 31.577 -3.159  1.00 37.48  ? 735  LEU A C   1 
ATOM   1001 O  O   . LEU A 1 144 ? -10.456 30.649 -3.954  1.00 37.06  ? 735  LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 144 ? -9.011  33.713 -3.544  1.00 36.17  ? 735  LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 144 ? -7.878  33.194 -4.448  1.00 42.66  ? 735  LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 144 ? -6.982  34.320 -4.874  1.00 44.19  ? 735  LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 144 ? -7.006  32.217 -3.706  1.00 44.52  ? 735  LEU A CD2 1 
ATOM   1006 N  N   . SER A 1 145 ? -10.176 31.384 -1.855  1.00 37.53  ? 736  SER A N   1 
ATOM   1007 C  CA  . SER A 1 145 ? -10.100 30.042 -1.279  1.00 38.85  ? 736  SER A CA  1 
ATOM   1008 C  C   . SER A 1 145 ? -11.416 29.286 -1.399  1.00 44.15  ? 736  SER A C   1 
ATOM   1009 O  O   . SER A 1 145 ? -11.404 28.092 -1.669  1.00 43.22  ? 736  SER A O   1 
ATOM   1010 C  CB  . SER A 1 145 ? -9.619  30.099 0.169   1.00 43.35  ? 736  SER A CB  1 
ATOM   1011 O  OG  . SER A 1 145 ? -10.526 30.784 1.017   1.00 49.91  ? 736  SER A OG  1 
ATOM   1012 N  N   . GLU A 1 146 ? -12.556 29.987 -1.283  1.00 42.24  ? 737  GLU A N   1 
ATOM   1013 C  CA  . GLU A 1 146 ? -13.856 29.329 -1.423  1.00 42.68  ? 737  GLU A CA  1 
ATOM   1014 C  C   . GLU A 1 146 ? -14.188 29.045 -2.913  1.00 47.18  ? 737  GLU A C   1 
ATOM   1015 O  O   . GLU A 1 146 ? -15.057 28.224 -3.173  1.00 48.72  ? 737  GLU A O   1 
ATOM   1016 C  CB  . GLU A 1 146 ? -14.954 30.074 -0.660  1.00 44.02  ? 737  GLU A CB  1 
ATOM   1017 C  CG  . GLU A 1 146 ? -14.818 29.835 0.847   1.00 50.96  ? 737  GLU A CG  1 
ATOM   1018 C  CD  . GLU A 1 146 ? -15.593 30.731 1.802   1.00 63.78  ? 737  GLU A CD  1 
ATOM   1019 O  OE1 . GLU A 1 146 ? -16.391 31.577 1.333   1.00 47.75  ? 737  GLU A OE1 1 
ATOM   1020 O  OE2 . GLU A 1 146 ? -15.399 30.577 3.031   1.00 47.97  ? 737  GLU A OE2 1 
ATOM   1021 N  N   . MET A 1 147 ? -13.432 29.642 -3.877  1.00 42.86  ? 738  MET A N   1 
ATOM   1022 C  CA  . MET A 1 147 ? -13.508 29.356 -5.319  1.00 43.66  ? 738  MET A CA  1 
ATOM   1023 C  C   . MET A 1 147 ? -12.583 28.127 -5.611  1.00 46.00  ? 738  MET A C   1 
ATOM   1024 O  O   . MET A 1 147 ? -12.381 27.756 -6.764  1.00 45.41  ? 738  MET A O   1 
ATOM   1025 C  CB  . MET A 1 147 ? -13.030 30.556 -6.173  1.00 46.31  ? 738  MET A CB  1 
ATOM   1026 C  CG  . MET A 1 147 ? -13.977 31.735 -6.199  1.00 52.79  ? 738  MET A CG  1 
ATOM   1027 S  SD  . MET A 1 147 ? -15.484 31.484 -7.163  1.00 60.29  ? 738  MET A SD  1 
ATOM   1028 C  CE  . MET A 1 147 ? -14.800 31.479 -8.794  1.00 56.56  ? 738  MET A CE  1 
ATOM   1029 N  N   . ASN A 1 148 ? -11.967 27.570 -4.555  1.00 42.83  ? 739  ASN A N   1 
ATOM   1030 C  CA  . ASN A 1 148 ? -11.077 26.405 -4.547  1.00 44.08  ? 739  ASN A CA  1 
ATOM   1031 C  C   . ASN A 1 148 ? -9.707  26.660 -5.196  1.00 45.91  ? 739  ASN A C   1 
ATOM   1032 O  O   . ASN A 1 148 ? -9.119  25.777 -5.820  1.00 44.85  ? 739  ASN A O   1 
ATOM   1033 C  CB  . ASN A 1 148 ? -11.761 25.146 -5.114  1.00 47.12  ? 739  ASN A CB  1 
ATOM   1034 C  CG  . ASN A 1 148 ? -12.399 24.367 -3.993  1.00 82.42  ? 739  ASN A CG  1 
ATOM   1035 O  OD1 . ASN A 1 148 ? -13.561 24.604 -3.632  1.00 79.26  ? 739  ASN A OD1 1 
ATOM   1036 N  ND2 . ASN A 1 148 ? -11.603 23.529 -3.314  1.00 75.65  ? 739  ASN A ND2 1 
ATOM   1037 N  N   . TYR A 1 149 ? -9.177  27.848 -4.943  1.00 42.46  ? 740  TYR A N   1 
ATOM   1038 C  CA  . TYR A 1 149 ? -7.874  28.266 -5.412  1.00 41.68  ? 740  TYR A CA  1 
ATOM   1039 C  C   . TYR A 1 149 ? -6.912  28.464 -4.262  1.00 45.21  ? 740  TYR A C   1 
ATOM   1040 O  O   . TYR A 1 149 ? -7.330  28.844 -3.164  1.00 45.43  ? 740  TYR A O   1 
ATOM   1041 C  CB  . TYR A 1 149 ? -7.998  29.580 -6.181  1.00 41.90  ? 740  TYR A CB  1 
ATOM   1042 C  CG  . TYR A 1 149 ? -8.376  29.371 -7.622  1.00 44.09  ? 740  TYR A CG  1 
ATOM   1043 C  CD1 . TYR A 1 149 ? -9.702  29.456 -8.034  1.00 45.51  ? 740  TYR A CD1 1 
ATOM   1044 C  CD2 . TYR A 1 149 ? -7.413  29.068 -8.576  1.00 46.26  ? 740  TYR A CD2 1 
ATOM   1045 C  CE1 . TYR A 1 149 ? -10.061 29.218 -9.361  1.00 46.12  ? 740  TYR A CE1 1 
ATOM   1046 C  CE2 . TYR A 1 149 ? -7.760  28.815 -9.898  1.00 47.67  ? 740  TYR A CE2 1 
ATOM   1047 C  CZ  . TYR A 1 149 ? -9.085  28.901 -10.288 1.00 55.22  ? 740  TYR A CZ  1 
ATOM   1048 O  OH  . TYR A 1 149 ? -9.408  28.674 -11.601 1.00 63.58  ? 740  TYR A OH  1 
ATOM   1049 N  N   . VAL A 1 150 ? -5.617  28.225 -4.536  1.00 40.33  ? 741  VAL A N   1 
ATOM   1050 C  CA  . VAL A 1 150 ? -4.493  28.527 -3.665  1.00 39.56  ? 741  VAL A CA  1 
ATOM   1051 C  C   . VAL A 1 150 ? -3.676  29.586 -4.431  1.00 42.51  ? 741  VAL A C   1 
ATOM   1052 O  O   . VAL A 1 150 ? -3.411  29.416 -5.623  1.00 41.82  ? 741  VAL A O   1 
ATOM   1053 C  CB  . VAL A 1 150 ? -3.672  27.285 -3.196  1.00 43.40  ? 741  VAL A CB  1 
ATOM   1054 C  CG1 . VAL A 1 150 ? -2.996  26.537 -4.359  1.00 43.71  ? 741  VAL A CG1 1 
ATOM   1055 C  CG2 . VAL A 1 150 ? -2.660  27.682 -2.140  1.00 43.33  ? 741  VAL A CG2 1 
ATOM   1056 N  N   . HIS A 1 151 ? -3.369  30.707 -3.776  1.00 39.18  ? 742  HIS A N   1 
ATOM   1057 C  CA  . HIS A 1 151 ? -2.647  31.821 -4.394  1.00 36.94  ? 742  HIS A CA  1 
ATOM   1058 C  C   . HIS A 1 151 ? -1.156  31.519 -4.512  1.00 41.36  ? 742  HIS A C   1 
ATOM   1059 O  O   . HIS A 1 151 ? -0.564  31.738 -5.583  1.00 40.43  ? 742  HIS A O   1 
ATOM   1060 C  CB  . HIS A 1 151 ? -2.904  33.130 -3.612  1.00 35.24  ? 742  HIS A CB  1 
ATOM   1061 C  CG  . HIS A 1 151 ? -2.425  34.346 -4.330  1.00 36.84  ? 742  HIS A CG  1 
ATOM   1062 N  ND1 . HIS A 1 151 ? -1.092  34.713 -4.320  1.00 38.15  ? 742  HIS A ND1 1 
ATOM   1063 C  CD2 . HIS A 1 151 ? -3.119  35.231 -5.078  1.00 36.70  ? 742  HIS A CD2 1 
ATOM   1064 C  CE1 . HIS A 1 151 ? -1.018  35.815 -5.048  1.00 36.66  ? 742  HIS A CE1 1 
ATOM   1065 N  NE2 . HIS A 1 151 ? -2.215  36.162 -5.526  1.00 36.34  ? 742  HIS A NE2 1 
ATOM   1066 N  N   . ARG A 1 152 ? -0.542  31.083 -3.378  1.00 40.10  ? 743  ARG A N   1 
ATOM   1067 C  CA  . ARG A 1 152 ? 0.868   30.687 -3.199  1.00 41.05  ? 743  ARG A CA  1 
ATOM   1068 C  C   . ARG A 1 152 ? 1.876   31.853 -3.207  1.00 46.76  ? 743  ARG A C   1 
ATOM   1069 O  O   . ARG A 1 152 ? 3.059   31.642 -2.941  1.00 48.11  ? 743  ARG A O   1 
ATOM   1070 C  CB  . ARG A 1 152 ? 1.289   29.621 -4.224  1.00 38.04  ? 743  ARG A CB  1 
ATOM   1071 C  CG  . ARG A 1 152 ? 0.397   28.393 -4.268  1.00 42.18  ? 743  ARG A CG  1 
ATOM   1072 C  CD  . ARG A 1 152 ? 1.095   27.241 -4.985  1.00 50.78  ? 743  ARG A CD  1 
ATOM   1073 N  NE  . ARG A 1 152 ? 1.384   27.546 -6.381  1.00 54.57  ? 743  ARG A NE  1 
ATOM   1074 C  CZ  . ARG A 1 152 ? 2.510   27.236 -7.015  1.00 62.87  ? 743  ARG A CZ  1 
ATOM   1075 N  NH1 . ARG A 1 152 ? 3.492   26.616 -6.376  1.00 49.56  ? 743  ARG A NH1 1 
ATOM   1076 N  NH2 . ARG A 1 152 ? 2.661   27.538 -8.291  1.00 51.66  ? 743  ARG A NH2 1 
ATOM   1077 N  N   . ASP A 1 153 ? 1.424   33.069 -3.508  1.00 43.30  ? 744  ASP A N   1 
ATOM   1078 C  CA  . ASP A 1 153 ? 2.292   34.237 -3.588  1.00 42.27  ? 744  ASP A CA  1 
ATOM   1079 C  C   . ASP A 1 153 ? 1.664   35.423 -2.844  1.00 44.52  ? 744  ASP A C   1 
ATOM   1080 O  O   . ASP A 1 153 ? 1.816   36.575 -3.259  1.00 44.23  ? 744  ASP A O   1 
ATOM   1081 C  CB  . ASP A 1 153 ? 2.525   34.565 -5.076  1.00 44.00  ? 744  ASP A CB  1 
ATOM   1082 C  CG  . ASP A 1 153 ? 3.844   35.244 -5.417  1.00 47.93  ? 744  ASP A CG  1 
ATOM   1083 O  OD1 . ASP A 1 153 ? 4.677   35.424 -4.499  1.00 45.11  ? 744  ASP A OD1 1 
ATOM   1084 O  OD2 . ASP A 1 153 ? 4.030   35.617 -6.607  1.00 52.81  ? 744  ASP A OD2 1 
ATOM   1085 N  N   . LEU A 1 154 ? 0.946   35.146 -1.746  1.00 39.95  ? 745  LEU A N   1 
ATOM   1086 C  CA  . LEU A 1 154 ? 0.311   36.195 -0.953  1.00 38.36  ? 745  LEU A CA  1 
ATOM   1087 C  C   . LEU A 1 154 ? 1.345   36.956 -0.114  1.00 42.44  ? 745  LEU A C   1 
ATOM   1088 O  O   . LEU A 1 154 ? 1.941   36.413 0.809   1.00 44.21  ? 745  LEU A O   1 
ATOM   1089 C  CB  . LEU A 1 154 ? -0.858  35.620 -0.122  1.00 37.41  ? 745  LEU A CB  1 
ATOM   1090 C  CG  . LEU A 1 154 ? -1.666  36.616 0.726   1.00 39.27  ? 745  LEU A CG  1 
ATOM   1091 C  CD1 . LEU A 1 154 ? -2.356  37.676 -0.143  1.00 37.76  ? 745  LEU A CD1 1 
ATOM   1092 C  CD2 . LEU A 1 154 ? -2.655  35.886 1.583   1.00 39.28  ? 745  LEU A CD2 1 
ATOM   1093 N  N   . ALA A 1 155 ? 1.597   38.194 -0.506  1.00 39.02  ? 746  ALA A N   1 
ATOM   1094 C  CA  . ALA A 1 155 ? 2.583   39.108 0.068   1.00 39.14  ? 746  ALA A CA  1 
ATOM   1095 C  C   . ALA A 1 155 ? 2.043   40.491 -0.135  1.00 39.52  ? 746  ALA A C   1 
ATOM   1096 O  O   . ALA A 1 155 ? 1.303   40.696 -1.104  1.00 37.40  ? 746  ALA A O   1 
ATOM   1097 C  CB  . ALA A 1 155 ? 3.915   38.966 -0.678  1.00 40.49  ? 746  ALA A CB  1 
ATOM   1098 N  N   . ALA A 1 156 ? 2.432   41.462 0.727   1.00 35.53  ? 747  ALA A N   1 
ATOM   1099 C  CA  . ALA A 1 156 ? 1.959   42.854 0.580   1.00 33.03  ? 747  ALA A CA  1 
ATOM   1100 C  C   . ALA A 1 156 ? 2.329   43.424 -0.815  1.00 35.90  ? 747  ALA A C   1 
ATOM   1101 O  O   . ALA A 1 156 ? 1.558   44.179 -1.380  1.00 34.07  ? 747  ALA A O   1 
ATOM   1102 C  CB  . ALA A 1 156 ? 2.516   43.736 1.706   1.00 33.36  ? 747  ALA A CB  1 
ATOM   1103 N  N   . ARG A 1 157 ? 3.458   42.996 -1.394  1.00 35.29  ? 748  ARG A N   1 
ATOM   1104 C  CA  . ARG A 1 157 ? 3.888   43.423 -2.747  1.00 36.34  ? 748  ARG A CA  1 
ATOM   1105 C  C   . ARG A 1 157 ? 2.926   42.958 -3.869  1.00 39.74  ? 748  ARG A C   1 
ATOM   1106 O  O   . ARG A 1 157 ? 2.967   43.512 -4.967  1.00 39.54  ? 748  ARG A O   1 
ATOM   1107 C  CB  . ARG A 1 157 ? 5.334   42.959 -3.029  1.00 38.92  ? 748  ARG A CB  1 
ATOM   1108 C  CG  . ARG A 1 157 ? 5.456   41.442 -3.162  1.00 47.22  ? 748  ARG A CG  1 
ATOM   1109 C  CD  . ARG A 1 157 ? 6.871   40.977 -3.419  1.00 60.90  ? 748  ARG A CD  1 
ATOM   1110 N  NE  . ARG A 1 157 ? 7.100   39.727 -2.696  1.00 75.18  ? 748  ARG A NE  1 
ATOM   1111 C  CZ  . ARG A 1 157 ? 6.809   38.517 -3.165  1.00 97.32  ? 748  ARG A CZ  1 
ATOM   1112 N  NH1 . ARG A 1 157 ? 7.007   37.446 -2.415  1.00 92.41  ? 748  ARG A NH1 1 
ATOM   1113 N  NH2 . ARG A 1 157 ? 6.319   38.371 -4.388  1.00 88.58  ? 748  ARG A NH2 1 
ATOM   1114 N  N   . ASN A 1 158 ? 2.080   41.938 -3.587  1.00 36.68  ? 749  ASN A N   1 
ATOM   1115 C  CA  . ASN A 1 158 ? 1.116   41.384 -4.540  1.00 35.77  ? 749  ASN A CA  1 
ATOM   1116 C  C   . ASN A 1 158 ? -0.319  41.851 -4.245  1.00 39.08  ? 749  ASN A C   1 
ATOM   1117 O  O   . ASN A 1 158 ? -1.278  41.343 -4.812  1.00 38.72  ? 749  ASN A O   1 
ATOM   1118 C  CB  . ASN A 1 158 ? 1.271   39.846 -4.608  1.00 33.37  ? 749  ASN A CB  1 
ATOM   1119 C  CG  . ASN A 1 158 ? 2.574   39.470 -5.272  1.00 41.50  ? 749  ASN A CG  1 
ATOM   1120 O  OD1 . ASN A 1 158 ? 3.177   40.258 -5.983  1.00 42.23  ? 749  ASN A OD1 1 
ATOM   1121 N  ND2 . ASN A 1 158 ? 3.089   38.304 -5.010  1.00 40.78  ? 749  ASN A ND2 1 
ATOM   1122 N  N   . ILE A 1 159 ? -0.439  42.862 -3.389  1.00 34.95  ? 750  ILE A N   1 
ATOM   1123 C  CA  . ILE A 1 159 ? -1.699  43.503 -3.041  1.00 34.22  ? 750  ILE A CA  1 
ATOM   1124 C  C   . ILE A 1 159 ? -1.664  44.942 -3.589  1.00 38.27  ? 750  ILE A C   1 
ATOM   1125 O  O   . ILE A 1 159 ? -0.668  45.637 -3.420  1.00 38.41  ? 750  ILE A O   1 
ATOM   1126 C  CB  . ILE A 1 159 ? -2.014  43.379 -1.512  1.00 36.42  ? 750  ILE A CB  1 
ATOM   1127 C  CG1 . ILE A 1 159 ? -2.370  41.893 -1.194  1.00 37.26  ? 750  ILE A CG1 1 
ATOM   1128 C  CG2 . ILE A 1 159 ? -3.197  44.287 -1.136  1.00 34.65  ? 750  ILE A CG2 1 
ATOM   1129 C  CD1 . ILE A 1 159 ? -1.859  41.427 0.068   1.00 48.41  ? 750  ILE A CD1 1 
ATOM   1130 N  N   . LEU A 1 160 ? -2.711  45.340 -4.313  1.00 34.38  ? 751  LEU A N   1 
ATOM   1131 C  CA  . LEU A 1 160 ? -2.816  46.668 -4.904  1.00 34.39  ? 751  LEU A CA  1 
ATOM   1132 C  C   . LEU A 1 160 ? -3.796  47.517 -4.097  1.00 37.93  ? 751  LEU A C   1 
ATOM   1133 O  O   . LEU A 1 160 ? -4.706  46.963 -3.481  1.00 35.33  ? 751  LEU A O   1 
ATOM   1134 C  CB  . LEU A 1 160 ? -3.201  46.585 -6.397  1.00 33.42  ? 751  LEU A CB  1 
ATOM   1135 C  CG  . LEU A 1 160 ? -2.117  45.923 -7.302  1.00 37.14  ? 751  LEU A CG  1 
ATOM   1136 C  CD1 . LEU A 1 160 ? -2.670  45.614 -8.651  1.00 36.93  ? 751  LEU A CD1 1 
ATOM   1137 C  CD2 . LEU A 1 160 ? -0.946  46.856 -7.530  1.00 40.73  ? 751  LEU A CD2 1 
ATOM   1138 N  N   . VAL A 1 161 ? -3.571  48.842 -4.027  1.00 34.56  ? 752  VAL A N   1 
ATOM   1139 C  CA  . VAL A 1 161 ? -4.335  49.776 -3.170  1.00 32.47  ? 752  VAL A CA  1 
ATOM   1140 C  C   . VAL A 1 161 ? -4.884  50.896 -4.010  1.00 33.55  ? 752  VAL A C   1 
ATOM   1141 O  O   . VAL A 1 161 ? -4.142  51.480 -4.759  1.00 32.69  ? 752  VAL A O   1 
ATOM   1142 C  CB  . VAL A 1 161 ? -3.429  50.367 -2.024  1.00 36.21  ? 752  VAL A CB  1 
ATOM   1143 C  CG1 . VAL A 1 161 ? -4.250  51.129 -0.965  1.00 35.25  ? 752  VAL A CG1 1 
ATOM   1144 C  CG2 . VAL A 1 161 ? -2.561  49.306 -1.367  1.00 36.11  ? 752  VAL A CG2 1 
ATOM   1145 N  N   . ASN A 1 162 ? -6.168  51.190 -3.897  1.00 30.36  ? 753  ASN A N   1 
ATOM   1146 C  CA  . ASN A 1 162 ? -6.751  52.298 -4.628  1.00 31.85  ? 753  ASN A CA  1 
ATOM   1147 C  C   . ASN A 1 162 ? -6.675  53.575 -3.756  1.00 38.17  ? 753  ASN A C   1 
ATOM   1148 O  O   . ASN A 1 162 ? -6.135  53.533 -2.633  1.00 37.00  ? 753  ASN A O   1 
ATOM   1149 C  CB  . ASN A 1 162 ? -8.176  51.976 -5.147  1.00 29.38  ? 753  ASN A CB  1 
ATOM   1150 C  CG  . ASN A 1 162 ? -9.285  51.964 -4.115  1.00 44.98  ? 753  ASN A CG  1 
ATOM   1151 O  OD1 . ASN A 1 162 ? -9.126  52.320 -2.939  1.00 41.00  ? 753  ASN A OD1 1 
ATOM   1152 N  ND2 . ASN A 1 162 ? -10.462 51.600 -4.557  1.00 38.91  ? 753  ASN A ND2 1 
ATOM   1153 N  N   . SER A 1 163 ? -7.200  54.704 -4.275  1.00 36.29  ? 754  SER A N   1 
ATOM   1154 C  CA  . SER A 1 163 ? -7.121  56.005 -3.601  1.00 36.01  ? 754  SER A CA  1 
ATOM   1155 C  C   . SER A 1 163 ? -7.832  56.040 -2.231  1.00 40.54  ? 754  SER A C   1 
ATOM   1156 O  O   . SER A 1 163 ? -7.481  56.861 -1.384  1.00 41.91  ? 754  SER A O   1 
ATOM   1157 C  CB  . SER A 1 163 ? -7.615  57.112 -4.523  1.00 40.00  ? 754  SER A CB  1 
ATOM   1158 O  OG  . SER A 1 163 ? -8.985  56.898 -4.809  1.00 49.06  ? 754  SER A OG  1 
ATOM   1159 N  N   . ASN A 1 164 ? -8.776  55.110 -1.996  1.00 37.45  ? 755  ASN A N   1 
ATOM   1160 C  CA  . ASN A 1 164 ? -9.537  55.033 -0.752  1.00 36.57  ? 755  ASN A CA  1 
ATOM   1161 C  C   . ASN A 1 164 ? -9.105  53.905 0.146   1.00 38.00  ? 755  ASN A C   1 
ATOM   1162 O  O   . ASN A 1 164 ? -9.841  53.534 1.058   1.00 37.07  ? 755  ASN A O   1 
ATOM   1163 C  CB  . ASN A 1 164 ? -11.040 54.995 -1.027  1.00 37.67  ? 755  ASN A CB  1 
ATOM   1164 C  CG  . ASN A 1 164 ? -11.556 56.340 -1.494  1.00 48.85  ? 755  ASN A CG  1 
ATOM   1165 O  OD1 . ASN A 1 164 ? -11.344 57.395 -0.861  1.00 49.09  ? 755  ASN A OD1 1 
ATOM   1166 N  ND2 . ASN A 1 164 ? -12.216 56.342 -2.637  1.00 39.17  ? 755  ASN A ND2 1 
ATOM   1167 N  N   . LEU A 1 165 ? -7.871  53.410 -0.060  1.00 34.60  ? 756  LEU A N   1 
ATOM   1168 C  CA  . LEU A 1 165 ? -7.233  52.352 0.742   1.00 34.88  ? 756  LEU A CA  1 
ATOM   1169 C  C   . LEU A 1 165 ? -7.914  50.991 0.618   1.00 38.37  ? 756  LEU A C   1 
ATOM   1170 O  O   . LEU A 1 165 ? -7.707  50.127 1.482   1.00 35.44  ? 756  LEU A O   1 
ATOM   1171 C  CB  . LEU A 1 165 ? -7.075  52.727 2.240   1.00 36.09  ? 756  LEU A CB  1 
ATOM   1172 C  CG  . LEU A 1 165 ? -6.398  54.051 2.563   1.00 41.25  ? 756  LEU A CG  1 
ATOM   1173 C  CD1 . LEU A 1 165 ? -6.475  54.354 4.065   1.00 41.29  ? 756  LEU A CD1 1 
ATOM   1174 C  CD2 . LEU A 1 165 ? -4.958  54.040 2.109   1.00 43.46  ? 756  LEU A CD2 1 
ATOM   1175 N  N   . VAL A 1 166 ? -8.716  50.784 -0.452  1.00 33.09  ? 757  VAL A N   1 
ATOM   1176 C  CA  . VAL A 1 166 ? -9.321  49.475 -0.698  1.00 32.33  ? 757  VAL A CA  1 
ATOM   1177 C  C   . VAL A 1 166 ? -8.198  48.596 -1.280  1.00 35.57  ? 757  VAL A C   1 
ATOM   1178 O  O   . VAL A 1 166 ? -7.535  48.996 -2.241  1.00 33.46  ? 757  VAL A O   1 
ATOM   1179 C  CB  . VAL A 1 166 ? -10.598 49.537 -1.581  1.00 34.00  ? 757  VAL A CB  1 
ATOM   1180 C  CG1 . VAL A 1 166 ? -11.156 48.116 -1.861  1.00 33.40  ? 757  VAL A CG1 1 
ATOM   1181 C  CG2 . VAL A 1 166 ? -11.649 50.447 -0.920  1.00 32.76  ? 757  VAL A CG2 1 
ATOM   1182 N  N   . CYS A 1 167 ? -7.927  47.456 -0.611  1.00 31.78  ? 758  CYS A N   1 
ATOM   1183 C  CA  . CYS A 1 167 ? -6.819  46.572 -0.970  1.00 31.32  ? 758  CYS A CA  1 
ATOM   1184 C  C   . CYS A 1 167 ? -7.341  45.392 -1.724  1.00 34.65  ? 758  CYS A C   1 
ATOM   1185 O  O   . CYS A 1 167 ? -8.364  44.837 -1.366  1.00 32.76  ? 758  CYS A O   1 
ATOM   1186 C  CB  . CYS A 1 167 ? -6.026  46.139 0.259   1.00 30.84  ? 758  CYS A CB  1 
ATOM   1187 S  SG  . CYS A 1 167 ? -5.184  47.490 1.105   1.00 34.74  ? 758  CYS A SG  1 
ATOM   1188 N  N   . LYS A 1 168 ? -6.627  45.022 -2.784  1.00 33.07  ? 759  LYS A N   1 
ATOM   1189 C  CA  . LYS A 1 168 ? -7.052  43.965 -3.684  1.00 32.96  ? 759  LYS A CA  1 
ATOM   1190 C  C   . LYS A 1 168 ? -5.962  42.987 -4.003  1.00 36.01  ? 759  LYS A C   1 
ATOM   1191 O  O   . LYS A 1 168 ? -4.867  43.381 -4.408  1.00 35.86  ? 759  LYS A O   1 
ATOM   1192 C  CB  . LYS A 1 168 ? -7.640  44.578 -4.973  1.00 33.22  ? 759  LYS A CB  1 
ATOM   1193 C  CG  . LYS A 1 168 ? -8.835  45.487 -4.679  1.00 32.46  ? 759  LYS A CG  1 
ATOM   1194 C  CD  . LYS A 1 168 ? -9.457  46.074 -5.914  1.00 31.73  ? 759  LYS A CD  1 
ATOM   1195 C  CE  . LYS A 1 168 ? -10.344 47.250 -5.518  1.00 33.96  ? 759  LYS A CE  1 
ATOM   1196 N  NZ  . LYS A 1 168 ? -11.649 47.166 -6.240  1.00 33.12  ? 759  LYS A NZ  1 
ATOM   1197 N  N   . VAL A 1 169 ? -6.293  41.694 -3.864  1.00 32.46  ? 760  VAL A N   1 
ATOM   1198 C  CA  . VAL A 1 169 ? -5.404  40.609 -4.237  1.00 32.83  ? 760  VAL A CA  1 
ATOM   1199 C  C   . VAL A 1 169 ? -5.104  40.690 -5.735  1.00 35.23  ? 760  VAL A C   1 
ATOM   1200 O  O   . VAL A 1 169 ? -6.000  40.887 -6.548  1.00 33.45  ? 760  VAL A O   1 
ATOM   1201 C  CB  . VAL A 1 169 ? -5.936  39.215 -3.833  1.00 35.69  ? 760  VAL A CB  1 
ATOM   1202 C  CG1 . VAL A 1 169 ? -4.895  38.150 -4.157  1.00 35.84  ? 760  VAL A CG1 1 
ATOM   1203 C  CG2 . VAL A 1 169 ? -6.273  39.181 -2.343  1.00 35.52  ? 760  VAL A CG2 1 
ATOM   1204 N  N   . SER A 1 170 ? -3.827  40.526 -6.082  1.00 35.27  ? 761  SER A N   1 
ATOM   1205 C  CA  . SER A 1 170 ? -3.350  40.612 -7.463  1.00 36.58  ? 761  SER A CA  1 
ATOM   1206 C  C   . SER A 1 170 ? -2.292  39.513 -7.697  1.00 40.85  ? 761  SER A C   1 
ATOM   1207 O  O   . SER A 1 170 ? -2.054  38.705 -6.787  1.00 39.89  ? 761  SER A O   1 
ATOM   1208 C  CB  . SER A 1 170 ? -2.777  42.015 -7.671  1.00 40.64  ? 761  SER A CB  1 
ATOM   1209 O  OG  . SER A 1 170 ? -2.169  42.204 -8.929  1.00 57.57  ? 761  SER A OG  1 
ATOM   1210 N  N   . ASP A 1 171 ? -1.666  39.482 -8.902  1.00 38.97  ? 762  ASP A N   1 
ATOM   1211 C  CA  . ASP A 1 171 ? -0.583  38.569 -9.298  1.00 40.97  ? 762  ASP A CA  1 
ATOM   1212 C  C   . ASP A 1 171 ? -0.968  37.083 -9.148  1.00 41.53  ? 762  ASP A C   1 
ATOM   1213 O  O   . ASP A 1 171 ? -0.521  36.393 -8.238  1.00 39.42  ? 762  ASP A O   1 
ATOM   1214 C  CB  . ASP A 1 171 ? 0.710   38.902 -8.527  1.00 45.83  ? 762  ASP A CB  1 
ATOM   1215 C  CG  . ASP A 1 171 ? 2.009   38.705 -9.304  1.00 75.13  ? 762  ASP A CG  1 
ATOM   1216 O  OD1 . ASP A 1 171 ? 2.311   37.552 -9.678  1.00 78.77  ? 762  ASP A OD1 1 
ATOM   1217 O  OD2 . ASP A 1 171 ? 2.753   39.695 -9.478  1.00 86.85  ? 762  ASP A OD2 1 
ATOM   1218 N  N   . PHE A 1 172 ? -1.810  36.607 -10.060 1.00 38.33  ? 763  PHE A N   1 
ATOM   1219 C  CA  . PHE A 1 172 ? -2.343  35.257 -10.027 1.00 38.55  ? 763  PHE A CA  1 
ATOM   1220 C  C   . PHE A 1 172 ? -1.515  34.199 -10.785 1.00 46.33  ? 763  PHE A C   1 
ATOM   1221 O  O   . PHE A 1 172 ? -1.978  33.071 -10.911 1.00 47.99  ? 763  PHE A O   1 
ATOM   1222 C  CB  . PHE A 1 172 ? -3.805  35.279 -10.496 1.00 38.40  ? 763  PHE A CB  1 
ATOM   1223 C  CG  . PHE A 1 172 ? -4.652  36.126 -9.572  1.00 37.75  ? 763  PHE A CG  1 
ATOM   1224 C  CD1 . PHE A 1 172 ? -4.993  37.439 -9.915  1.00 38.71  ? 763  PHE A CD1 1 
ATOM   1225 C  CD2 . PHE A 1 172 ? -5.050  35.645 -8.334  1.00 37.55  ? 763  PHE A CD2 1 
ATOM   1226 C  CE1 . PHE A 1 172 ? -5.766  38.227 -9.066  1.00 38.08  ? 763  PHE A CE1 1 
ATOM   1227 C  CE2 . PHE A 1 172 ? -5.823  36.441 -7.475  1.00 39.14  ? 763  PHE A CE2 1 
ATOM   1228 C  CZ  . PHE A 1 172 ? -6.172  37.723 -7.848  1.00 37.11  ? 763  PHE A CZ  1 
ATOM   1229 N  N   . GLY A 1 173 ? -0.294  34.543 -11.207 1.00 44.06  ? 764  GLY A N   1 
ATOM   1230 C  CA  . GLY A 1 173 ? 0.632   33.655 -11.923 1.00 45.18  ? 764  GLY A CA  1 
ATOM   1231 C  C   . GLY A 1 173 ? 0.873   32.301 -11.275 1.00 51.28  ? 764  GLY A C   1 
ATOM   1232 O  O   . GLY A 1 173 ? 0.781   31.261 -11.935 1.00 52.85  ? 764  GLY A O   1 
ATOM   1233 N  N   . LEU A 1 174 ? 1.136   32.300 -9.961  1.00 45.59  ? 765  LEU A N   1 
ATOM   1234 C  CA  . LEU A 1 174 ? 1.363   31.077 -9.204  1.00 44.11  ? 765  LEU A CA  1 
ATOM   1235 C  C   . LEU A 1 174 ? 0.065   30.412 -8.688  1.00 46.37  ? 765  LEU A C   1 
ATOM   1236 O  O   . LEU A 1 174 ? 0.138   29.320 -8.108  1.00 47.06  ? 765  LEU A O   1 
ATOM   1237 C  CB  . LEU A 1 174 ? 2.360   31.343 -8.061  1.00 44.13  ? 765  LEU A CB  1 
ATOM   1238 C  CG  . LEU A 1 174 ? 3.767   31.729 -8.502  1.00 49.31  ? 765  LEU A CG  1 
ATOM   1239 C  CD1 . LEU A 1 174 ? 4.594   32.195 -7.332  1.00 50.65  ? 765  LEU A CD1 1 
ATOM   1240 C  CD2 . LEU A 1 174 ? 4.463   30.581 -9.210  1.00 50.02  ? 765  LEU A CD2 1 
ATOM   1241 N  N   . SER A 1 175 ? -1.116  31.042 -8.912  1.00 40.75  ? 766  SER A N   1 
ATOM   1242 C  CA  . SER A 1 175 ? -2.397  30.505 -8.424  1.00 40.57  ? 766  SER A CA  1 
ATOM   1243 C  C   . SER A 1 175 ? -2.759  29.177 -9.051  1.00 48.32  ? 766  SER A C   1 
ATOM   1244 O  O   . SER A 1 175 ? -2.473  28.956 -10.229 1.00 49.88  ? 766  SER A O   1 
ATOM   1245 C  CB  . SER A 1 175 ? -3.543  31.509 -8.556  1.00 41.60  ? 766  SER A CB  1 
ATOM   1246 O  OG  . SER A 1 175 ? -3.365  32.589 -7.658  1.00 47.72  ? 766  SER A OG  1 
ATOM   1247 N  N   . ARG A 1 176 ? -3.329  28.265 -8.244  1.00 44.88  ? 767  ARG A N   1 
ATOM   1248 C  CA  . ARG A 1 176 ? -3.689  26.931 -8.725  1.00 45.43  ? 767  ARG A CA  1 
ATOM   1249 C  C   . ARG A 1 176 ? -5.043  26.457 -8.199  1.00 49.49  ? 767  ARG A C   1 
ATOM   1250 O  O   . ARG A 1 176 ? -5.348  26.639 -7.014  1.00 44.89  ? 767  ARG A O   1 
ATOM   1251 C  CB  . ARG A 1 176 ? -2.600  25.903 -8.371  1.00 43.64  ? 767  ARG A CB  1 
ATOM   1252 C  CG  . ARG A 1 176 ? -1.203  26.162 -8.949  1.00 46.26  ? 767  ARG A CG  1 
ATOM   1253 C  CD  . ARG A 1 176 ? -1.082  25.886 -10.437 1.00 51.40  ? 767  ARG A CD  1 
ATOM   1254 N  NE  . ARG A 1 176 ? 0.286   26.135 -10.911 1.00 57.80  ? 767  ARG A NE  1 
ATOM   1255 C  CZ  . ARG A 1 176 ? 0.739   27.296 -11.383 1.00 67.50  ? 767  ARG A CZ  1 
ATOM   1256 N  NH1 . ARG A 1 176 ? -0.065  28.349 -11.467 1.00 55.21  ? 767  ARG A NH1 1 
ATOM   1257 N  NH2 . ARG A 1 176 ? 1.997   27.410 -11.783 1.00 60.59  ? 767  ARG A NH2 1 
ATOM   1258 N  N   . TYR A 1 177 ? -5.830  25.803 -9.077  1.00 51.03  ? 768  TYR A N   1 
ATOM   1259 C  CA  . TYR A 1 177 ? -7.117  25.195 -8.714  1.00 52.96  ? 768  TYR A CA  1 
ATOM   1260 C  C   . TYR A 1 177 ? -6.821  23.912 -7.936  1.00 56.53  ? 768  TYR A C   1 
ATOM   1261 O  O   . TYR A 1 177 ? -6.039  23.098 -8.405  1.00 57.29  ? 768  TYR A O   1 
ATOM   1262 C  CB  . TYR A 1 177 ? -7.954  24.894 -9.974  1.00 55.87  ? 768  TYR A CB  1 
ATOM   1263 C  CG  . TYR A 1 177 ? -9.371  24.460 -9.671  1.00 60.40  ? 768  TYR A CG  1 
ATOM   1264 C  CD1 . TYR A 1 177 ? -10.332 25.382 -9.257  1.00 61.65  ? 768  TYR A CD1 1 
ATOM   1265 C  CD2 . TYR A 1 177 ? -9.756  23.128 -9.798  1.00 63.83  ? 768  TYR A CD2 1 
ATOM   1266 C  CE1 . TYR A 1 177 ? -11.637 24.987 -8.966  1.00 62.82  ? 768  TYR A CE1 1 
ATOM   1267 C  CE2 . TYR A 1 177 ? -11.060 22.720 -9.511  1.00 65.52  ? 768  TYR A CE2 1 
ATOM   1268 C  CZ  . TYR A 1 177 ? -12.001 23.658 -9.109  1.00 74.35  ? 768  TYR A CZ  1 
ATOM   1269 O  OH  . TYR A 1 177 ? -13.296 23.279 -8.827  1.00 80.47  ? 768  TYR A OH  1 
ATOM   1270 N  N   . LEU A 1 178 ? -7.387  23.761 -6.728  1.00 52.13  ? 769  LEU A N   1 
ATOM   1271 C  CA  . LEU A 1 178 ? -7.124  22.595 -5.882  1.00 68.77  ? 769  LEU A CA  1 
ATOM   1272 C  C   . LEU A 1 178 ? -7.929  21.351 -6.287  1.00 107.02 ? 769  LEU A C   1 
ATOM   1273 O  O   . LEU A 1 178 ? -9.157  21.385 -6.346  1.00 71.37  ? 769  LEU A O   1 
ATOM   1274 C  CB  . LEU A 1 178 ? -7.316  22.918 -4.389  1.00 68.11  ? 769  LEU A CB  1 
ATOM   1275 C  CG  . LEU A 1 178 ? -6.477  24.049 -3.803  1.00 70.98  ? 769  LEU A CG  1 
ATOM   1276 C  CD1 . LEU A 1 178 ? -7.178  24.679 -2.618  1.00 70.48  ? 769  LEU A CD1 1 
ATOM   1277 C  CD2 . LEU A 1 178 ? -5.115  23.570 -3.401  1.00 71.90  ? 769  LEU A CD2 1 
ATOM   1278 N  N   . PRO A 1 185 ? -7.651  18.998 -0.067  1.00 61.83  ? 776  PRO A N   1 
ATOM   1279 C  CA  . PRO A 1 185 ? -7.420  19.861 -1.236  1.00 59.70  ? 776  PRO A CA  1 
ATOM   1280 C  C   . PRO A 1 185 ? -6.043  20.516 -1.166  1.00 61.97  ? 776  PRO A C   1 
ATOM   1281 O  O   . PRO A 1 185 ? -5.809  21.441 -0.389  1.00 60.94  ? 776  PRO A O   1 
ATOM   1282 C  CB  . PRO A 1 185 ? -8.590  20.861 -1.213  1.00 59.96  ? 776  PRO A CB  1 
ATOM   1283 C  CG  . PRO A 1 185 ? -9.349  20.600 0.071   1.00 65.64  ? 776  PRO A CG  1 
ATOM   1284 C  CD  . PRO A 1 185 ? -8.534  19.647 0.916   1.00 63.29  ? 776  PRO A CD  1 
ATOM   1285 N  N   . THR A 1 186 ? -5.124  19.976 -1.968  1.00 58.91  ? 777  THR A N   1 
ATOM   1286 C  CA  . THR A 1 186 ? -3.717  20.333 -2.007  1.00 58.82  ? 777  THR A CA  1 
ATOM   1287 C  C   . THR A 1 186 ? -3.210  20.462 -3.441  1.00 61.97  ? 777  THR A C   1 
ATOM   1288 O  O   . THR A 1 186 ? -3.608  19.698 -4.328  1.00 63.15  ? 777  THR A O   1 
ATOM   1289 C  CB  . THR A 1 186 ? -2.926  19.207 -1.283  1.00 67.43  ? 777  THR A CB  1 
ATOM   1290 O  OG1 . THR A 1 186 ? -3.398  19.083 0.060   1.00 68.01  ? 777  THR A OG1 1 
ATOM   1291 C  CG2 . THR A 1 186 ? -1.402  19.417 -1.283  1.00 64.14  ? 777  THR A CG2 1 
HETATM 1292 N  N   . PTR A 1 187 ? -2.281  21.394 -3.639  1.00 55.24  ? 778  PTR A N   1 
HETATM 1293 C  CA  . PTR A 1 187 ? -1.557  21.559 -4.884  1.00 54.31  ? 778  PTR A CA  1 
HETATM 1294 C  C   . PTR A 1 187 ? -0.123  21.137 -4.539  1.00 58.50  ? 778  PTR A C   1 
HETATM 1295 O  O   . PTR A 1 187 ? 0.498   21.752 -3.658  1.00 58.05  ? 778  PTR A O   1 
HETATM 1296 C  CB  . PTR A 1 187 ? -1.723  22.945 -5.585  1.00 51.44  ? 778  PTR A CB  1 
HETATM 1297 C  CG  . PTR A 1 187 ? -0.696  23.036 -6.720  1.00 51.37  ? 778  PTR A CG  1 
HETATM 1298 C  CD1 . PTR A 1 187 ? -0.877  22.488 -8.042  1.00 52.05  ? 778  PTR A CD1 1 
HETATM 1299 C  CD2 . PTR A 1 187 ? 0.498   23.702 -6.368  1.00 51.55  ? 778  PTR A CD2 1 
HETATM 1300 C  CE1 . PTR A 1 187 ? 0.193   22.622 -8.989  1.00 53.92  ? 778  PTR A CE1 1 
HETATM 1301 C  CE2 . PTR A 1 187 ? 1.504   23.832 -7.265  1.00 54.62  ? 778  PTR A CE2 1 
HETATM 1302 C  CZ  . PTR A 1 187 ? 1.390   23.312 -8.581  1.00 57.78  ? 778  PTR A CZ  1 
HETATM 1303 O  OH  . PTR A 1 187 ? 2.598   23.603 -9.224  1.00 65.42  ? 778  PTR A OH  1 
HETATM 1304 P  P   . PTR A 1 187 ? 2.920   23.432 -10.670 1.00 70.78  ? 778  PTR A P   1 
HETATM 1305 O  O1P . PTR A 1 187 ? 1.675   23.346 -11.622 1.00 71.84  ? 778  PTR A O1P 1 
HETATM 1306 O  O2P . PTR A 1 187 ? 3.818   22.216 -10.671 1.00 74.38  ? 778  PTR A O2P 1 
HETATM 1307 O  O3P . PTR A 1 187 ? 3.704   24.643 -11.039 1.00 70.05  ? 778  PTR A O3P 1 
ATOM   1308 N  N   . THR A 1 188 ? 0.391   20.091 -5.206  1.00 55.18  ? 779  THR A N   1 
ATOM   1309 C  CA  . THR A 1 188 ? 1.761   19.613 -4.987  1.00 56.79  ? 779  THR A CA  1 
ATOM   1310 C  C   . THR A 1 188 ? 2.658   20.141 -6.103  1.00 63.13  ? 779  THR A C   1 
ATOM   1311 O  O   . THR A 1 188 ? 2.493   19.775 -7.272  1.00 63.97  ? 779  THR A O   1 
ATOM   1312 C  CB  . THR A 1 188 ? 1.830   18.091 -4.758  1.00 63.32  ? 779  THR A CB  1 
ATOM   1313 O  OG1 . THR A 1 188 ? 0.957   17.746 -3.682  1.00 65.63  ? 779  THR A OG1 1 
ATOM   1314 C  CG2 . THR A 1 188 ? 3.246   17.615 -4.423  1.00 59.87  ? 779  THR A CG2 1 
ATOM   1315 N  N   . SER A 1 189 ? 3.545   21.077 -5.738  1.00 60.31  ? 780  SER A N   1 
ATOM   1316 C  CA  . SER A 1 189 ? 4.472   21.738 -6.656  1.00 60.49  ? 780  SER A CA  1 
ATOM   1317 C  C   . SER A 1 189 ? 5.597   20.822 -7.158  1.00 67.83  ? 780  SER A C   1 
ATOM   1318 O  O   . SER A 1 189 ? 5.849   19.758 -6.584  1.00 68.84  ? 780  SER A O   1 
ATOM   1319 C  CB  . SER A 1 189 ? 5.057   22.996 -6.018  1.00 61.36  ? 780  SER A CB  1 
ATOM   1320 O  OG  . SER A 1 189 ? 5.718   23.771 -7.004  1.00 67.28  ? 780  SER A OG  1 
ATOM   1321 N  N   . SER A 1 190 ? 6.261   21.256 -8.245  1.00 65.22  ? 781  SER A N   1 
ATOM   1322 C  CA  . SER A 1 190 ? 7.386   20.565 -8.885  1.00 83.07  ? 781  SER A CA  1 
ATOM   1323 C  C   . SER A 1 190 ? 8.646   21.445 -8.839  1.00 114.21 ? 781  SER A C   1 
ATOM   1324 O  O   . SER A 1 190 ? 8.661   22.487 -8.174  1.00 81.62  ? 781  SER A O   1 
ATOM   1325 C  CB  . SER A 1 190 ? 7.036   20.201 -10.327 1.00 85.71  ? 781  SER A CB  1 
ATOM   1326 O  OG  . SER A 1 190 ? 6.518   21.310 -11.048 1.00 89.18  ? 781  SER A OG  1 
ATOM   1327 N  N   . PRO A 1 196 ? 9.391   32.495 -2.805  1.00 60.59  ? 787  PRO A N   1 
ATOM   1328 C  CA  . PRO A 1 196 ? 8.667   33.428 -1.905  1.00 58.66  ? 787  PRO A CA  1 
ATOM   1329 C  C   . PRO A 1 196 ? 8.737   32.948 -0.441  1.00 59.50  ? 787  PRO A C   1 
ATOM   1330 O  O   . PRO A 1 196 ? 7.783   33.086 0.338   1.00 56.94  ? 787  PRO A O   1 
ATOM   1331 C  CB  . PRO A 1 196 ? 7.230   33.422 -2.471  1.00 59.21  ? 787  PRO A CB  1 
ATOM   1332 C  CG  . PRO A 1 196 ? 7.089   32.066 -3.185  1.00 64.41  ? 787  PRO A CG  1 
ATOM   1333 C  CD  . PRO A 1 196 ? 8.496   31.493 -3.425  1.00 62.27  ? 787  PRO A CD  1 
ATOM   1334 N  N   . VAL A 1 197 ? 9.914   32.395 -0.085  1.00 57.03  ? 788  VAL A N   1 
ATOM   1335 C  CA  . VAL A 1 197 ? 10.309  31.711 1.152   1.00 56.75  ? 788  VAL A CA  1 
ATOM   1336 C  C   . VAL A 1 197 ? 9.805   32.369 2.470   1.00 57.88  ? 788  VAL A C   1 
ATOM   1337 O  O   . VAL A 1 197 ? 9.155   31.664 3.247   1.00 56.73  ? 788  VAL A O   1 
ATOM   1338 C  CB  . VAL A 1 197 ? 11.853  31.474 1.169   1.00 61.95  ? 788  VAL A CB  1 
ATOM   1339 C  CG1 . VAL A 1 197 ? 12.352  30.984 2.528   1.00 62.59  ? 788  VAL A CG1 1 
ATOM   1340 C  CG2 . VAL A 1 197 ? 12.259  30.493 0.069   1.00 62.61  ? 788  VAL A CG2 1 
ATOM   1341 N  N   . ARG A 1 198 ? 10.099  33.665 2.738   1.00 53.90  ? 789  ARG A N   1 
ATOM   1342 C  CA  . ARG A 1 198 ? 9.707   34.271 4.022   1.00 53.70  ? 789  ARG A CA  1 
ATOM   1343 C  C   . ARG A 1 198 ? 8.177   34.505 4.183   1.00 54.43  ? 789  ARG A C   1 
ATOM   1344 O  O   . ARG A 1 198 ? 7.735   34.807 5.290   1.00 53.81  ? 789  ARG A O   1 
ATOM   1345 C  CB  . ARG A 1 198 ? 10.521  35.535 4.375   1.00 54.89  ? 789  ARG A CB  1 
ATOM   1346 C  CG  . ARG A 1 198 ? 10.408  36.720 3.448   1.00 56.79  ? 789  ARG A CG  1 
ATOM   1347 C  CD  . ARG A 1 198 ? 11.558  37.695 3.636   1.00 61.32  ? 789  ARG A CD  1 
ATOM   1348 N  NE  . ARG A 1 198 ? 12.814  37.073 3.274   1.00 72.43  ? 789  ARG A NE  1 
ATOM   1349 C  CZ  . ARG A 1 198 ? 13.944  37.186 3.951   1.00 84.70  ? 789  ARG A CZ  1 
ATOM   1350 N  NH1 . ARG A 1 198 ? 14.007  37.953 5.033   1.00 72.22  ? 789  ARG A NH1 1 
ATOM   1351 N  NH2 . ARG A 1 198 ? 15.029  36.555 3.540   1.00 76.04  ? 789  ARG A NH2 1 
ATOM   1352 N  N   . TRP A 1 199 ? 7.385   34.292 3.115   1.00 49.43  ? 790  TRP A N   1 
ATOM   1353 C  CA  . TRP A 1 199 ? 5.922   34.371 3.127   1.00 47.15  ? 790  TRP A CA  1 
ATOM   1354 C  C   . TRP A 1 199 ? 5.286   32.964 3.103   1.00 48.51  ? 790  TRP A C   1 
ATOM   1355 O  O   . TRP A 1 199 ? 4.081   32.848 3.272   1.00 47.46  ? 790  TRP A O   1 
ATOM   1356 C  CB  . TRP A 1 199 ? 5.424   35.144 1.904   1.00 45.14  ? 790  TRP A CB  1 
ATOM   1357 C  CG  . TRP A 1 199 ? 5.628   36.626 2.016   1.00 45.93  ? 790  TRP A CG  1 
ATOM   1358 C  CD1 . TRP A 1 199 ? 4.754   37.536 2.530   1.00 48.00  ? 790  TRP A CD1 1 
ATOM   1359 C  CD2 . TRP A 1 199 ? 6.781   37.368 1.594   1.00 46.36  ? 790  TRP A CD2 1 
ATOM   1360 N  NE1 . TRP A 1 199 ? 5.302   38.799 2.482   1.00 47.00  ? 790  TRP A NE1 1 
ATOM   1361 C  CE2 . TRP A 1 199 ? 6.551   38.725 1.918   1.00 49.87  ? 790  TRP A CE2 1 
ATOM   1362 C  CE3 . TRP A 1 199 ? 7.998   37.016 0.975   1.00 48.87  ? 790  TRP A CE3 1 
ATOM   1363 C  CZ2 . TRP A 1 199 ? 7.497   39.739 1.657   1.00 49.66  ? 790  TRP A CZ2 1 
ATOM   1364 C  CZ3 . TRP A 1 199 ? 8.930   38.019 0.704   1.00 51.05  ? 790  TRP A CZ3 1 
ATOM   1365 C  CH2 . TRP A 1 199 ? 8.681   39.361 1.050   1.00 51.23  ? 790  TRP A CH2 1 
ATOM   1366 N  N   . THR A 1 200 ? 6.086   31.913 2.882   1.00 43.83  ? 791  THR A N   1 
ATOM   1367 C  CA  . THR A 1 200 ? 5.620   30.538 2.705   1.00 43.21  ? 791  THR A CA  1 
ATOM   1368 C  C   . THR A 1 200 ? 5.579   29.727 3.993   1.00 48.24  ? 791  THR A C   1 
ATOM   1369 O  O   . THR A 1 200 ? 6.523   29.779 4.787   1.00 49.06  ? 791  THR A O   1 
ATOM   1370 C  CB  . THR A 1 200 ? 6.465   29.868 1.618   1.00 51.48  ? 791  THR A CB  1 
ATOM   1371 O  OG1 . THR A 1 200 ? 6.435   30.714 0.468   1.00 49.12  ? 791  THR A OG1 1 
ATOM   1372 C  CG2 . THR A 1 200 ? 5.952   28.462 1.233   1.00 47.14  ? 791  THR A CG2 1 
ATOM   1373 N  N   . ALA A 1 201 ? 4.474   28.964 4.186   1.00 44.83  ? 792  ALA A N   1 
ATOM   1374 C  CA  . ALA A 1 201 ? 4.265   28.079 5.344   1.00 47.17  ? 792  ALA A CA  1 
ATOM   1375 C  C   . ALA A 1 201 ? 5.389   27.038 5.414   1.00 52.58  ? 792  ALA A C   1 
ATOM   1376 O  O   . ALA A 1 201 ? 5.851   26.610 4.352   1.00 50.66  ? 792  ALA A O   1 
ATOM   1377 C  CB  . ALA A 1 201 ? 2.925   27.372 5.226   1.00 47.16  ? 792  ALA A CB  1 
ATOM   1378 N  N   . PRO A 1 202 ? 5.815   26.591 6.626   1.00 52.91  ? 793  PRO A N   1 
ATOM   1379 C  CA  . PRO A 1 202 ? 6.925   25.631 6.705   1.00 54.74  ? 793  PRO A CA  1 
ATOM   1380 C  C   . PRO A 1 202 ? 6.688   24.307 6.003   1.00 60.84  ? 793  PRO A C   1 
ATOM   1381 O  O   . PRO A 1 202 ? 7.653   23.748 5.495   1.00 64.25  ? 793  PRO A O   1 
ATOM   1382 C  CB  . PRO A 1 202 ? 7.145   25.438 8.214   1.00 58.32  ? 793  PRO A CB  1 
ATOM   1383 C  CG  . PRO A 1 202 ? 5.920   25.937 8.872   1.00 61.66  ? 793  PRO A CG  1 
ATOM   1384 C  CD  . PRO A 1 202 ? 5.367   26.999 7.971   1.00 54.91  ? 793  PRO A CD  1 
ATOM   1385 N  N   . GLU A 1 203 ? 5.431   23.797 5.982   1.00 55.84  ? 794  GLU A N   1 
ATOM   1386 C  CA  . GLU A 1 203 ? 5.110   22.521 5.329   1.00 56.94  ? 794  GLU A CA  1 
ATOM   1387 C  C   . GLU A 1 203 ? 5.126   22.661 3.819   1.00 61.59  ? 794  GLU A C   1 
ATOM   1388 O  O   . GLU A 1 203 ? 5.379   21.674 3.127   1.00 63.64  ? 794  GLU A O   1 
ATOM   1389 C  CB  . GLU A 1 203 ? 3.780   21.905 5.844   1.00 57.92  ? 794  GLU A CB  1 
ATOM   1390 C  CG  . GLU A 1 203 ? 2.492   22.593 5.375   1.00 59.44  ? 794  GLU A CG  1 
ATOM   1391 C  CD  . GLU A 1 203 ? 2.082   23.912 6.012   1.00 66.57  ? 794  GLU A CD  1 
ATOM   1392 O  OE1 . GLU A 1 203 ? 2.794   24.386 6.929   1.00 52.55  ? 794  GLU A OE1 1 
ATOM   1393 O  OE2 . GLU A 1 203 ? 1.053   24.484 5.574   1.00 51.40  ? 794  GLU A OE2 1 
ATOM   1394 N  N   . ALA A 1 204 ? 4.844   23.874 3.314   1.00 55.17  ? 795  ALA A N   1 
ATOM   1395 C  CA  . ALA A 1 204 ? 4.855   24.163 1.893   1.00 54.13  ? 795  ALA A CA  1 
ATOM   1396 C  C   . ALA A 1 204 ? 6.292   24.284 1.408   1.00 60.13  ? 795  ALA A C   1 
ATOM   1397 O  O   . ALA A 1 204 ? 6.582   23.882 0.282   1.00 59.86  ? 795  ALA A O   1 
ATOM   1398 C  CB  . ALA A 1 204 ? 4.057   25.434 1.601   1.00 52.41  ? 795  ALA A CB  1 
ATOM   1399 N  N   . ILE A 1 205 ? 7.207   24.775 2.276   1.00 58.63  ? 796  ILE A N   1 
ATOM   1400 C  CA  . ILE A 1 205 ? 8.640   24.828 1.958   1.00 59.64  ? 796  ILE A CA  1 
ATOM   1401 C  C   . ILE A 1 205 ? 9.172   23.384 1.960   1.00 64.26  ? 796  ILE A C   1 
ATOM   1402 O  O   . ILE A 1 205 ? 9.842   22.967 1.011   1.00 64.64  ? 796  ILE A O   1 
ATOM   1403 C  CB  . ILE A 1 205 ? 9.458   25.727 2.944   1.00 62.37  ? 796  ILE A CB  1 
ATOM   1404 C  CG1 . ILE A 1 205 ? 8.967   27.199 2.938   1.00 59.67  ? 796  ILE A CG1 1 
ATOM   1405 C  CG2 . ILE A 1 205 ? 10.972  25.630 2.642   1.00 63.67  ? 796  ILE A CG2 1 
ATOM   1406 C  CD1 . ILE A 1 205 ? 9.602   28.144 3.993   1.00 58.90  ? 796  ILE A CD1 1 
ATOM   1407 N  N   . ALA A 1 206 ? 8.869   22.633 3.025   1.00 62.42  ? 797  ALA A N   1 
ATOM   1408 C  CA  . ALA A 1 206 ? 9.372   21.279 3.202   1.00 64.40  ? 797  ALA A CA  1 
ATOM   1409 C  C   . ALA A 1 206 ? 8.838   20.258 2.201   1.00 68.42  ? 797  ALA A C   1 
ATOM   1410 O  O   . ALA A 1 206 ? 9.600   19.415 1.737   1.00 69.54  ? 797  ALA A O   1 
ATOM   1411 C  CB  . ALA A 1 206 ? 9.113   20.809 4.630   1.00 66.48  ? 797  ALA A CB  1 
ATOM   1412 N  N   . TYR A 1 207 ? 7.547   20.335 1.861   1.00 64.41  ? 798  TYR A N   1 
ATOM   1413 C  CA  . TYR A 1 207 ? 6.943   19.317 1.011   1.00 64.69  ? 798  TYR A CA  1 
ATOM   1414 C  C   . TYR A 1 207 ? 6.394   19.810 -0.324  1.00 66.57  ? 798  TYR A C   1 
ATOM   1415 O  O   . TYR A 1 207 ? 5.933   18.991 -1.117  1.00 67.08  ? 798  TYR A O   1 
ATOM   1416 C  CB  . TYR A 1 207 ? 5.844   18.577 1.805   1.00 66.13  ? 798  TYR A CB  1 
ATOM   1417 C  CG  . TYR A 1 207 ? 6.280   18.170 3.196   1.00 70.24  ? 798  TYR A CG  1 
ATOM   1418 C  CD1 . TYR A 1 207 ? 7.337   17.284 3.383   1.00 75.57  ? 798  TYR A CD1 1 
ATOM   1419 C  CD2 . TYR A 1 207 ? 5.640   18.674 4.327   1.00 69.98  ? 798  TYR A CD2 1 
ATOM   1420 C  CE1 . TYR A 1 207 ? 7.755   16.912 4.659   1.00 78.63  ? 798  TYR A CE1 1 
ATOM   1421 C  CE2 . TYR A 1 207 ? 6.064   18.329 5.612   1.00 72.46  ? 798  TYR A CE2 1 
ATOM   1422 C  CZ  . TYR A 1 207 ? 7.112   17.428 5.771   1.00 84.72  ? 798  TYR A CZ  1 
ATOM   1423 O  OH  . TYR A 1 207 ? 7.537   17.022 7.018   1.00 85.54  ? 798  TYR A OH  1 
ATOM   1424 N  N   . ARG A 1 208 ? 6.413   21.122 -0.581  1.00 61.22  ? 799  ARG A N   1 
ATOM   1425 C  CA  . ARG A 1 208 ? 5.854   21.688 -1.825  1.00 59.36  ? 799  ARG A CA  1 
ATOM   1426 C  C   . ARG A 1 208 ? 4.325   21.429 -1.887  1.00 59.80  ? 799  ARG A C   1 
ATOM   1427 O  O   . ARG A 1 208 ? 3.740   21.352 -2.968  1.00 58.52  ? 799  ARG A O   1 
ATOM   1428 C  CB  . ARG A 1 208 ? 6.633   21.190 -3.079  1.00 62.87  ? 799  ARG A CB  1 
ATOM   1429 C  CG  . ARG A 1 208 ? 8.078   21.679 -3.082  1.00 72.06  ? 799  ARG A CG  1 
ATOM   1430 C  CD  . ARG A 1 208 ? 9.037   20.909 -3.968  1.00 85.16  ? 799  ARG A CD  1 
ATOM   1431 N  NE  . ARG A 1 208 ? 10.403  21.414 -3.769  1.00 95.34  ? 799  ARG A NE  1 
ATOM   1432 C  CZ  . ARG A 1 208 ? 11.369  21.397 -4.684  1.00 110.38 ? 799  ARG A CZ  1 
ATOM   1433 N  NH1 . ARG A 1 208 ? 11.147  20.879 -5.888  1.00 96.49  ? 799  ARG A NH1 1 
ATOM   1434 N  NH2 . ARG A 1 208 ? 12.566  21.898 -4.403  1.00 97.83  ? 799  ARG A NH2 1 
ATOM   1435 N  N   . LYS A 1 209 ? 3.693   21.315 -0.692  1.00 54.89  ? 800  LYS A N   1 
ATOM   1436 C  CA  . LYS A 1 209 ? 2.265   21.073 -0.492  1.00 53.27  ? 800  LYS A CA  1 
ATOM   1437 C  C   . LYS A 1 209 ? 1.566   22.386 -0.134  1.00 55.37  ? 800  LYS A C   1 
ATOM   1438 O  O   . LYS A 1 209 ? 1.740   22.923 0.960   1.00 55.28  ? 800  LYS A O   1 
ATOM   1439 C  CB  . LYS A 1 209 ? 2.036   19.997 0.582   1.00 57.19  ? 800  LYS A CB  1 
ATOM   1440 C  CG  . LYS A 1 209 ? 2.413   18.573 0.130   1.00 64.55  ? 800  LYS A CG  1 
ATOM   1441 N  N   . PHE A 1 210 ? 0.817   22.933 -1.082  1.00 50.91  ? 801  PHE A N   1 
ATOM   1442 C  CA  . PHE A 1 210 ? 0.122   24.206 -0.868  1.00 48.45  ? 801  PHE A CA  1 
ATOM   1443 C  C   . PHE A 1 210 ? -1.381  23.990 -0.694  1.00 50.77  ? 801  PHE A C   1 
ATOM   1444 O  O   . PHE A 1 210 ? -1.992  23.226 -1.442  1.00 49.27  ? 801  PHE A O   1 
ATOM   1445 C  CB  . PHE A 1 210 ? 0.411   25.168 -2.012  1.00 48.77  ? 801  PHE A CB  1 
ATOM   1446 C  CG  . PHE A 1 210 ? 1.880   25.424 -2.192  1.00 51.82  ? 801  PHE A CG  1 
ATOM   1447 C  CD1 . PHE A 1 210 ? 2.666   24.558 -2.945  1.00 56.64  ? 801  PHE A CD1 1 
ATOM   1448 C  CD2 . PHE A 1 210 ? 2.481   26.550 -1.637  1.00 54.74  ? 801  PHE A CD2 1 
ATOM   1449 C  CE1 . PHE A 1 210 ? 4.038   24.781 -3.106  1.00 59.19  ? 801  PHE A CE1 1 
ATOM   1450 C  CE2 . PHE A 1 210 ? 3.859   26.779 -1.805  1.00 59.14  ? 801  PHE A CE2 1 
ATOM   1451 C  CZ  . PHE A 1 210 ? 4.626   25.898 -2.553  1.00 58.65  ? 801  PHE A CZ  1 
ATOM   1452 N  N   . THR A 1 211 ? -1.956  24.628 0.332   1.00 45.49  ? 802  THR A N   1 
ATOM   1453 C  CA  . THR A 1 211 ? -3.375  24.534 0.640   1.00 44.24  ? 802  THR A CA  1 
ATOM   1454 C  C   . THR A 1 211 ? -3.852  25.950 0.987   1.00 47.55  ? 802  THR A C   1 
ATOM   1455 O  O   . THR A 1 211 ? -3.049  26.892 1.016   1.00 46.40  ? 802  THR A O   1 
ATOM   1456 C  CB  . THR A 1 211 ? -3.608  23.596 1.835   1.00 52.72  ? 802  THR A CB  1 
ATOM   1457 O  OG1 . THR A 1 211 ? -2.978  24.152 2.982   1.00 55.93  ? 802  THR A OG1 1 
ATOM   1458 C  CG2 . THR A 1 211 ? -3.137  22.162 1.596   1.00 51.75  ? 802  THR A CG2 1 
ATOM   1459 N  N   . SER A 1 212 ? -5.147  26.092 1.304   1.00 44.01  ? 803  SER A N   1 
ATOM   1460 C  CA  . SER A 1 212 ? -5.718  27.360 1.781   1.00 42.66  ? 803  SER A CA  1 
ATOM   1461 C  C   . SER A 1 212 ? -5.062  27.726 3.124   1.00 44.40  ? 803  SER A C   1 
ATOM   1462 O  O   . SER A 1 212 ? -4.831  28.902 3.382   1.00 42.26  ? 803  SER A O   1 
ATOM   1463 C  CB  . SER A 1 212 ? -7.222  27.210 1.960   1.00 46.28  ? 803  SER A CB  1 
ATOM   1464 O  OG  . SER A 1 212 ? -7.821  27.529 0.719   1.00 60.34  ? 803  SER A OG  1 
ATOM   1465 N  N   . ALA A 1 213 ? -4.726  26.712 3.946   1.00 43.08  ? 804  ALA A N   1 
ATOM   1466 C  CA  . ALA A 1 213 ? -4.040  26.879 5.235   1.00 44.36  ? 804  ALA A CA  1 
ATOM   1467 C  C   . ALA A 1 213 ? -2.618  27.450 5.074   1.00 48.86  ? 804  ALA A C   1 
ATOM   1468 O  O   . ALA A 1 213 ? -2.171  28.203 5.939   1.00 50.75  ? 804  ALA A O   1 
ATOM   1469 C  CB  . ALA A 1 213 ? -4.013  25.569 5.998   1.00 46.45  ? 804  ALA A CB  1 
ATOM   1470 N  N   . SER A 1 214 ? -1.921  27.137 3.964   1.00 44.44  ? 805  SER A N   1 
ATOM   1471 C  CA  . SER A 1 214 ? -0.592  27.712 3.723   1.00 43.48  ? 805  SER A CA  1 
ATOM   1472 C  C   . SER A 1 214 ? -0.731  29.183 3.260   1.00 45.98  ? 805  SER A C   1 
ATOM   1473 O  O   . SER A 1 214 ? 0.113   30.014 3.603   1.00 45.87  ? 805  SER A O   1 
ATOM   1474 C  CB  . SER A 1 214 ? 0.248   26.849 2.781   1.00 45.89  ? 805  SER A CB  1 
ATOM   1475 O  OG  . SER A 1 214 ? -0.310  26.671 1.489   1.00 49.10  ? 805  SER A OG  1 
ATOM   1476 N  N   . ASP A 1 215 ? -1.852  29.521 2.578   1.00 40.92  ? 806  ASP A N   1 
ATOM   1477 C  CA  . ASP A 1 215 ? -2.174  30.911 2.194   1.00 38.16  ? 806  ASP A CA  1 
ATOM   1478 C  C   . ASP A 1 215 ? -2.493  31.727 3.457   1.00 41.22  ? 806  ASP A C   1 
ATOM   1479 O  O   . ASP A 1 215 ? -2.149  32.909 3.529   1.00 41.35  ? 806  ASP A O   1 
ATOM   1480 C  CB  . ASP A 1 215 ? -3.358  30.981 1.218   1.00 37.80  ? 806  ASP A CB  1 
ATOM   1481 C  CG  . ASP A 1 215 ? -3.031  30.852 -0.261  1.00 42.07  ? 806  ASP A CG  1 
ATOM   1482 O  OD1 . ASP A 1 215 ? -1.834  30.875 -0.612  1.00 42.29  ? 806  ASP A OD1 1 
ATOM   1483 O  OD2 . ASP A 1 215 ? -3.975  30.813 -1.071  1.00 46.52  ? 806  ASP A OD2 1 
ATOM   1484 N  N   . VAL A 1 216 ? -3.127  31.091 4.457   1.00 36.56  ? 807  VAL A N   1 
ATOM   1485 C  CA  . VAL A 1 216 ? -3.426  31.716 5.753   1.00 36.85  ? 807  VAL A CA  1 
ATOM   1486 C  C   . VAL A 1 216 ? -2.098  32.103 6.452   1.00 42.92  ? 807  VAL A C   1 
ATOM   1487 O  O   . VAL A 1 216 ? -2.020  33.173 7.054   1.00 41.98  ? 807  VAL A O   1 
ATOM   1488 C  CB  . VAL A 1 216 ? -4.332  30.807 6.638   1.00 40.69  ? 807  VAL A CB  1 
ATOM   1489 C  CG1 . VAL A 1 216 ? -4.300  31.224 8.109   1.00 40.68  ? 807  VAL A CG1 1 
ATOM   1490 C  CG2 . VAL A 1 216 ? -5.767  30.787 6.105   1.00 39.06  ? 807  VAL A CG2 1 
ATOM   1491 N  N   . TRP A 1 217 ? -1.058  31.238 6.354   1.00 42.11  ? 808  TRP A N   1 
ATOM   1492 C  CA  . TRP A 1 217 ? 0.260   31.539 6.914   1.00 42.48  ? 808  TRP A CA  1 
ATOM   1493 C  C   . TRP A 1 217 ? 0.778   32.827 6.260   1.00 46.09  ? 808  TRP A C   1 
ATOM   1494 O  O   . TRP A 1 217 ? 1.163   33.745 6.976   1.00 46.12  ? 808  TRP A O   1 
ATOM   1495 C  CB  . TRP A 1 217 ? 1.249   30.384 6.706   1.00 42.19  ? 808  TRP A CB  1 
ATOM   1496 C  CG  . TRP A 1 217 ? 2.642   30.696 7.175   1.00 43.92  ? 808  TRP A CG  1 
ATOM   1497 C  CD1 . TRP A 1 217 ? 3.542   31.546 6.591   1.00 46.38  ? 808  TRP A CD1 1 
ATOM   1498 C  CD2 . TRP A 1 217 ? 3.271   30.191 8.352   1.00 45.36  ? 808  TRP A CD2 1 
ATOM   1499 N  NE1 . TRP A 1 217 ? 4.688   31.608 7.340   1.00 47.98  ? 808  TRP A NE1 1 
ATOM   1500 C  CE2 . TRP A 1 217 ? 4.559   30.773 8.420   1.00 50.52  ? 808  TRP A CE2 1 
ATOM   1501 C  CE3 . TRP A 1 217 ? 2.898   29.250 9.326   1.00 47.59  ? 808  TRP A CE3 1 
ATOM   1502 C  CZ2 . TRP A 1 217 ? 5.464   30.473 9.445   1.00 51.39  ? 808  TRP A CZ2 1 
ATOM   1503 C  CZ3 . TRP A 1 217 ? 3.799   28.951 10.341  1.00 50.97  ? 808  TRP A CZ3 1 
ATOM   1504 C  CH2 . TRP A 1 217 ? 5.053   29.579 10.409  1.00 52.18  ? 808  TRP A CH2 1 
ATOM   1505 N  N   . SER A 1 218 ? 0.766   32.890 4.906   1.00 41.81  ? 809  SER A N   1 
ATOM   1506 C  CA  . SER A 1 218 ? 1.183   34.052 4.118   1.00 40.74  ? 809  SER A CA  1 
ATOM   1507 C  C   . SER A 1 218 ? 0.401   35.279 4.556   1.00 44.72  ? 809  SER A C   1 
ATOM   1508 O  O   . SER A 1 218 ? 1.003   36.342 4.712   1.00 44.24  ? 809  SER A O   1 
ATOM   1509 C  CB  . SER A 1 218 ? 0.953   33.815 2.630   1.00 41.85  ? 809  SER A CB  1 
ATOM   1510 O  OG  . SER A 1 218 ? 1.609   32.648 2.163   1.00 44.17  ? 809  SER A OG  1 
ATOM   1511 N  N   . TYR A 1 219 ? -0.937  35.122 4.789   1.00 38.81  ? 810  TYR A N   1 
ATOM   1512 C  CA  . TYR A 1 219 ? -1.797  36.211 5.259   1.00 36.71  ? 810  TYR A CA  1 
ATOM   1513 C  C   . TYR A 1 219 ? -1.293  36.794 6.593   1.00 41.30  ? 810  TYR A C   1 
ATOM   1514 O  O   . TYR A 1 219 ? -1.237  38.005 6.731   1.00 42.15  ? 810  TYR A O   1 
ATOM   1515 C  CB  . TYR A 1 219 ? -3.288  35.795 5.303   1.00 35.78  ? 810  TYR A CB  1 
ATOM   1516 C  CG  . TYR A 1 219 ? -4.168  36.912 5.816   1.00 36.11  ? 810  TYR A CG  1 
ATOM   1517 C  CD1 . TYR A 1 219 ? -4.625  37.914 4.961   1.00 36.55  ? 810  TYR A CD1 1 
ATOM   1518 C  CD2 . TYR A 1 219 ? -4.455  37.031 7.174   1.00 36.83  ? 810  TYR A CD2 1 
ATOM   1519 C  CE1 . TYR A 1 219 ? -5.352  38.997 5.442   1.00 35.80  ? 810  TYR A CE1 1 
ATOM   1520 C  CE2 . TYR A 1 219 ? -5.205  38.099 7.661   1.00 37.55  ? 810  TYR A CE2 1 
ATOM   1521 C  CZ  . TYR A 1 219 ? -5.640  39.083 6.794   1.00 39.15  ? 810  TYR A CZ  1 
ATOM   1522 O  OH  . TYR A 1 219 ? -6.375  40.120 7.277   1.00 34.68  ? 810  TYR A OH  1 
ATOM   1523 N  N   . GLY A 1 220 ? -0.904  35.926 7.531   1.00 39.60  ? 811  GLY A N   1 
ATOM   1524 C  CA  . GLY A 1 220 ? -0.321  36.315 8.804   1.00 40.47  ? 811  GLY A CA  1 
ATOM   1525 C  C   . GLY A 1 220 ? 0.914   37.173 8.618   1.00 43.72  ? 811  GLY A C   1 
ATOM   1526 O  O   . GLY A 1 220 ? 1.103   38.146 9.348   1.00 43.94  ? 811  GLY A O   1 
ATOM   1527 N  N   . ILE A 1 221 ? 1.736   36.835 7.618   1.00 39.77  ? 812  ILE A N   1 
ATOM   1528 C  CA  . ILE A 1 221 ? 2.935   37.601 7.254   1.00 40.84  ? 812  ILE A CA  1 
ATOM   1529 C  C   . ILE A 1 221 ? 2.530   38.986 6.717   1.00 44.63  ? 812  ILE A C   1 
ATOM   1530 O  O   . ILE A 1 221 ? 3.140   39.982 7.099   1.00 45.32  ? 812  ILE A O   1 
ATOM   1531 C  CB  . ILE A 1 221 ? 3.891   36.812 6.290   1.00 44.21  ? 812  ILE A CB  1 
ATOM   1532 C  CG1 . ILE A 1 221 ? 4.352   35.445 6.894   1.00 44.99  ? 812  ILE A CG1 1 
ATOM   1533 C  CG2 . ILE A 1 221 ? 5.112   37.662 5.883   1.00 46.45  ? 812  ILE A CG2 1 
ATOM   1534 C  CD1 . ILE A 1 221 ? 5.378   35.528 8.106   1.00 40.29  ? 812  ILE A CD1 1 
ATOM   1535 N  N   . VAL A 1 222 ? 1.489   39.044 5.858   1.00 39.61  ? 813  VAL A N   1 
ATOM   1536 C  CA  . VAL A 1 222 ? 0.934   40.293 5.310   1.00 38.81  ? 813  VAL A CA  1 
ATOM   1537 C  C   . VAL A 1 222 ? 0.438   41.201 6.455   1.00 40.32  ? 813  VAL A C   1 
ATOM   1538 O  O   . VAL A 1 222 ? 0.681   42.407 6.409   1.00 41.25  ? 813  VAL A O   1 
ATOM   1539 C  CB  . VAL A 1 222 ? -0.161  40.040 4.238   1.00 40.93  ? 813  VAL A CB  1 
ATOM   1540 C  CG1 . VAL A 1 222 ? -0.814  41.342 3.781   1.00 38.89  ? 813  VAL A CG1 1 
ATOM   1541 C  CG2 . VAL A 1 222 ? 0.406   39.283 3.044   1.00 40.61  ? 813  VAL A CG2 1 
ATOM   1542 N  N   . MET A 1 223 ? -0.234  40.627 7.468   1.00 34.09  ? 814  MET A N   1 
ATOM   1543 C  CA  . MET A 1 223 ? -0.687  41.376 8.649   1.00 34.53  ? 814  MET A CA  1 
ATOM   1544 C  C   . MET A 1 223 ? 0.530   42.053 9.292   1.00 42.60  ? 814  MET A C   1 
ATOM   1545 O  O   . MET A 1 223 ? 0.482   43.241 9.595   1.00 44.52  ? 814  MET A O   1 
ATOM   1546 C  CB  . MET A 1 223 ? -1.331  40.457 9.696   1.00 36.67  ? 814  MET A CB  1 
ATOM   1547 C  CG  . MET A 1 223 ? -2.643  39.872 9.300   1.00 37.91  ? 814  MET A CG  1 
ATOM   1548 S  SD  . MET A 1 223 ? -3.270  38.845 10.662  1.00 42.33  ? 814  MET A SD  1 
ATOM   1549 C  CE  . MET A 1 223 ? -3.588  40.096 11.905  1.00 39.09  ? 814  MET A CE  1 
ATOM   1550 N  N   . TRP A 1 224 ? 1.629   41.307 9.462   1.00 40.80  ? 815  TRP A N   1 
ATOM   1551 C  CA  . TRP A 1 224 ? 2.864   41.834 10.040  1.00 42.37  ? 815  TRP A CA  1 
ATOM   1552 C  C   . TRP A 1 224 ? 3.426   42.966 9.178   1.00 47.04  ? 815  TRP A C   1 
ATOM   1553 O  O   . TRP A 1 224 ? 3.782   44.007 9.727   1.00 48.32  ? 815  TRP A O   1 
ATOM   1554 C  CB  . TRP A 1 224 ? 3.896   40.709 10.269  1.00 42.20  ? 815  TRP A CB  1 
ATOM   1555 C  CG  . TRP A 1 224 ? 5.077   41.130 11.093  1.00 44.75  ? 815  TRP A CG  1 
ATOM   1556 C  CD1 . TRP A 1 224 ? 5.230   40.977 12.440  1.00 48.85  ? 815  TRP A CD1 1 
ATOM   1557 C  CD2 . TRP A 1 224 ? 6.291   41.721 10.615  1.00 45.68  ? 815  TRP A CD2 1 
ATOM   1558 N  NE1 . TRP A 1 224 ? 6.470   41.425 12.830  1.00 49.73  ? 815  TRP A NE1 1 
ATOM   1559 C  CE2 . TRP A 1 224 ? 7.136   41.905 11.733  1.00 51.26  ? 815  TRP A CE2 1 
ATOM   1560 C  CE3 . TRP A 1 224 ? 6.755   42.116 9.345   1.00 46.53  ? 815  TRP A CE3 1 
ATOM   1561 C  CZ2 . TRP A 1 224 ? 8.407   42.484 11.625  1.00 52.53  ? 815  TRP A CZ2 1 
ATOM   1562 C  CZ3 . TRP A 1 224 ? 8.009   42.703 9.245   1.00 49.67  ? 815  TRP A CZ3 1 
ATOM   1563 C  CH2 . TRP A 1 224 ? 8.819   42.880 10.371  1.00 52.11  ? 815  TRP A CH2 1 
ATOM   1564 N  N   . GLU A 1 225 ? 3.439   42.794 7.832   1.00 41.63  ? 816  GLU A N   1 
ATOM   1565 C  CA  . GLU A 1 225 ? 3.901   43.824 6.891   1.00 40.52  ? 816  GLU A CA  1 
ATOM   1566 C  C   . GLU A 1 225 ? 3.076   45.124 7.029   1.00 42.84  ? 816  GLU A C   1 
ATOM   1567 O  O   . GLU A 1 225 ? 3.651   46.219 7.044   1.00 41.91  ? 816  GLU A O   1 
ATOM   1568 C  CB  . GLU A 1 225 ? 3.809   43.310 5.434   1.00 40.42  ? 816  GLU A CB  1 
ATOM   1569 C  CG  . GLU A 1 225 ? 4.792   42.195 5.104   1.00 43.06  ? 816  GLU A CG  1 
ATOM   1570 C  CD  . GLU A 1 225 ? 4.708   41.801 3.646   1.00 50.46  ? 816  GLU A CD  1 
ATOM   1571 O  OE1 . GLU A 1 225 ? 3.820   40.994 3.303   1.00 44.12  ? 816  GLU A OE1 1 
ATOM   1572 O  OE2 . GLU A 1 225 ? 5.452   42.383 2.828   1.00 44.78  ? 816  GLU A OE2 1 
ATOM   1573 N  N   . VAL A 1 226 ? 1.730   44.988 7.111   1.00 38.53  ? 817  VAL A N   1 
ATOM   1574 C  CA  . VAL A 1 226 ? 0.791   46.119 7.211   1.00 37.65  ? 817  VAL A CA  1 
ATOM   1575 C  C   . VAL A 1 226 ? 0.968   46.868 8.533   1.00 43.07  ? 817  VAL A C   1 
ATOM   1576 O  O   . VAL A 1 226 ? 1.135   48.089 8.520   1.00 43.34  ? 817  VAL A O   1 
ATOM   1577 C  CB  . VAL A 1 226 ? -0.681  45.709 6.933   1.00 38.98  ? 817  VAL A CB  1 
ATOM   1578 C  CG1 . VAL A 1 226 ? -1.669  46.848 7.227   1.00 37.96  ? 817  VAL A CG1 1 
ATOM   1579 C  CG2 . VAL A 1 226 ? -0.841  45.228 5.494   1.00 37.48  ? 817  VAL A CG2 1 
ATOM   1580 N  N   . MET A 1 227 ? 0.994   46.135 9.666   1.00 40.86  ? 818  MET A N   1 
ATOM   1581 C  CA  . MET A 1 227 ? 1.144   46.769 10.993  1.00 40.69  ? 818  MET A CA  1 
ATOM   1582 C  C   . MET A 1 227 ? 2.528   47.390 11.222  1.00 45.29  ? 818  MET A C   1 
ATOM   1583 O  O   . MET A 1 227 ? 2.681   48.197 12.142  1.00 47.16  ? 818  MET A O   1 
ATOM   1584 C  CB  . MET A 1 227 ? 0.767   45.796 12.119  1.00 42.75  ? 818  MET A CB  1 
ATOM   1585 C  CG  . MET A 1 227 ? -0.670  45.272 12.011  1.00 43.66  ? 818  MET A CG  1 
ATOM   1586 S  SD  . MET A 1 227 ? -1.986  46.510 11.614  1.00 45.27  ? 818  MET A SD  1 
ATOM   1587 C  CE  . MET A 1 227 ? -1.965  47.609 13.138  1.00 44.27  ? 818  MET A CE  1 
ATOM   1588 N  N   . SER A 1 228 ? 3.507   47.075 10.321  1.00 41.74  ? 819  SER A N   1 
ATOM   1589 C  CA  . SER A 1 228 ? 4.910   47.537 10.294  1.00 42.01  ? 819  SER A CA  1 
ATOM   1590 C  C   . SER A 1 228 ? 5.146   48.581 9.197   1.00 47.30  ? 819  SER A C   1 
ATOM   1591 O  O   . SER A 1 228 ? 6.298   48.954 8.962   1.00 49.02  ? 819  SER A O   1 
ATOM   1592 C  CB  . SER A 1 228 ? 5.855   46.373 10.011  1.00 43.80  ? 819  SER A CB  1 
ATOM   1593 O  OG  . SER A 1 228 ? 5.779   45.335 10.968  1.00 51.51  ? 819  SER A OG  1 
ATOM   1594 N  N   . PHE A 1 229 ? 4.080   49.045 8.516   1.00 42.36  ? 820  PHE A N   1 
ATOM   1595 C  CA  . PHE A 1 229 ? 4.182   50.019 7.421   1.00 41.51  ? 820  PHE A CA  1 
ATOM   1596 C  C   . PHE A 1 229 ? 5.185   49.556 6.334   1.00 47.74  ? 820  PHE A C   1 
ATOM   1597 O  O   . PHE A 1 229 ? 6.044   50.314 5.891   1.00 47.99  ? 820  PHE A O   1 
ATOM   1598 C  CB  . PHE A 1 229 ? 4.459   51.452 7.939   1.00 42.96  ? 820  PHE A CB  1 
ATOM   1599 C  CG  . PHE A 1 229 ? 3.223   52.095 8.522   1.00 42.93  ? 820  PHE A CG  1 
ATOM   1600 C  CD1 . PHE A 1 229 ? 2.334   52.807 7.708   1.00 42.15  ? 820  PHE A CD1 1 
ATOM   1601 C  CD2 . PHE A 1 229 ? 2.955   52.019 9.890   1.00 44.93  ? 820  PHE A CD2 1 
ATOM   1602 C  CE1 . PHE A 1 229 ? 1.184   53.401 8.242   1.00 42.03  ? 820  PHE A CE1 1 
ATOM   1603 C  CE2 . PHE A 1 229 ? 1.803   52.618 10.427  1.00 46.89  ? 820  PHE A CE2 1 
ATOM   1604 C  CZ  . PHE A 1 229 ? 0.915   53.288 9.596   1.00 42.87  ? 820  PHE A CZ  1 
ATOM   1605 N  N   . GLY A 1 230 ? 5.064   48.289 5.954   1.00 45.80  ? 821  GLY A N   1 
ATOM   1606 C  CA  . GLY A 1 230 ? 5.891   47.688 4.917   1.00 46.65  ? 821  GLY A CA  1 
ATOM   1607 C  C   . GLY A 1 230 ? 7.312   47.316 5.269   1.00 54.18  ? 821  GLY A C   1 
ATOM   1608 O  O   . GLY A 1 230 ? 8.153   47.304 4.374   1.00 56.81  ? 821  GLY A O   1 
ATOM   1609 N  N   . GLU A 1 231 ? 7.596   46.958 6.535   1.00 50.60  ? 822  GLU A N   1 
ATOM   1610 C  CA  . GLU A 1 231 ? 8.915   46.450 6.891   1.00 51.54  ? 822  GLU A CA  1 
ATOM   1611 C  C   . GLU A 1 231 ? 9.033   45.047 6.246   1.00 53.03  ? 822  GLU A C   1 
ATOM   1612 O  O   . GLU A 1 231 ? 8.023   44.337 6.115   1.00 48.13  ? 822  GLU A O   1 
ATOM   1613 C  CB  . GLU A 1 231 ? 9.076   46.359 8.414   1.00 54.68  ? 822  GLU A CB  1 
ATOM   1614 C  CG  . GLU A 1 231 ? 10.417  45.835 8.916   1.00 73.69  ? 822  GLU A CG  1 
ATOM   1615 C  CD  . GLU A 1 231 ? 11.625  46.661 8.532   1.00 104.85 ? 822  GLU A CD  1 
ATOM   1616 O  OE1 . GLU A 1 231 ? 12.284  46.323 7.522   1.00 106.84 ? 822  GLU A OE1 1 
ATOM   1617 O  OE2 . GLU A 1 231 ? 11.904  47.657 9.239   1.00 103.03 ? 822  GLU A OE2 1 
ATOM   1618 N  N   . ARG A 1 232 ? 10.258  44.677 5.810   1.00 51.26  ? 823  ARG A N   1 
ATOM   1619 C  CA  . ARG A 1 232 ? 10.515  43.380 5.207   1.00 50.23  ? 823  ARG A CA  1 
ATOM   1620 C  C   . ARG A 1 232 ? 10.409  42.319 6.289   1.00 53.12  ? 823  ARG A C   1 
ATOM   1621 O  O   . ARG A 1 232 ? 11.111  42.417 7.291   1.00 52.72  ? 823  ARG A O   1 
ATOM   1622 C  CB  . ARG A 1 232 ? 11.928  43.333 4.588   1.00 51.28  ? 823  ARG A CB  1 
ATOM   1623 C  CG  . ARG A 1 232 ? 12.205  42.069 3.783   1.00 54.81  ? 823  ARG A CG  1 
ATOM   1624 C  CD  . ARG A 1 232 ? 13.662  42.002 3.389   1.00 68.26  ? 823  ARG A CD  1 
ATOM   1625 N  NE  . ARG A 1 232 ? 13.962  40.843 2.554   1.00 75.26  ? 823  ARG A NE  1 
ATOM   1626 C  CZ  . ARG A 1 232 ? 15.124  40.198 2.571   1.00 105.86 ? 823  ARG A CZ  1 
ATOM   1627 N  NH1 . ARG A 1 232 ? 16.096  40.583 3.394   1.00 99.38  ? 823  ARG A NH1 1 
ATOM   1628 N  NH2 . ARG A 1 232 ? 15.324  39.163 1.769   1.00 101.50 ? 823  ARG A NH2 1 
ATOM   1629 N  N   . PRO A 1 233 ? 9.571   41.278 6.082   1.00 49.38  ? 824  PRO A N   1 
ATOM   1630 C  CA  . PRO A 1 233 ? 9.510   40.174 7.059   1.00 49.21  ? 824  PRO A CA  1 
ATOM   1631 C  C   . PRO A 1 233 ? 10.892  39.587 7.334   1.00 54.16  ? 824  PRO A C   1 
ATOM   1632 O  O   . PRO A 1 233 ? 11.659  39.349 6.393   1.00 53.52  ? 824  PRO A O   1 
ATOM   1633 C  CB  . PRO A 1 233 ? 8.617   39.136 6.365   1.00 49.27  ? 824  PRO A CB  1 
ATOM   1634 C  CG  . PRO A 1 233 ? 7.803   39.928 5.414   1.00 52.53  ? 824  PRO A CG  1 
ATOM   1635 C  CD  . PRO A 1 233 ? 8.689   41.023 4.926   1.00 48.76  ? 824  PRO A CD  1 
ATOM   1636 N  N   . TYR A 1 234 ? 11.211  39.372 8.623   1.00 51.67  ? 825  TYR A N   1 
ATOM   1637 C  CA  . TYR A 1 234 ? 12.472  38.785 9.121   1.00 54.22  ? 825  TYR A CA  1 
ATOM   1638 C  C   . TYR A 1 234 ? 13.683  39.664 8.841   1.00 65.66  ? 825  TYR A C   1 
ATOM   1639 O  O   . TYR A 1 234 ? 14.818  39.227 9.028   1.00 67.72  ? 825  TYR A O   1 
ATOM   1640 C  CB  . TYR A 1 234 ? 12.700  37.334 8.639   1.00 53.57  ? 825  TYR A CB  1 
ATOM   1641 C  CG  . TYR A 1 234 ? 11.497  36.442 8.858   1.00 52.50  ? 825  TYR A CG  1 
ATOM   1642 C  CD1 . TYR A 1 234 ? 10.516  36.304 7.877   1.00 51.19  ? 825  TYR A CD1 1 
ATOM   1643 C  CD2 . TYR A 1 234 ? 11.339  35.728 10.041  1.00 54.25  ? 825  TYR A CD2 1 
ATOM   1644 C  CE1 . TYR A 1 234 ? 9.382   35.518 8.087   1.00 50.43  ? 825  TYR A CE1 1 
ATOM   1645 C  CE2 . TYR A 1 234 ? 10.227  34.901 10.243  1.00 53.85  ? 825  TYR A CE2 1 
ATOM   1646 C  CZ  . TYR A 1 234 ? 9.248   34.808 9.267   1.00 57.48  ? 825  TYR A CZ  1 
ATOM   1647 O  OH  . TYR A 1 234 ? 8.138   34.022 9.476   1.00 56.63  ? 825  TYR A OH  1 
ATOM   1648 N  N   . TRP A 1 235 ? 13.427  40.928 8.459   1.00 66.21  ? 826  TRP A N   1 
ATOM   1649 C  CA  . TRP A 1 235 ? 14.410  41.981 8.212   1.00 69.49  ? 826  TRP A CA  1 
ATOM   1650 C  C   . TRP A 1 235 ? 15.510  41.527 7.248   1.00 75.48  ? 826  TRP A C   1 
ATOM   1651 O  O   . TRP A 1 235 ? 15.188  41.185 6.112   1.00 74.30  ? 826  TRP A O   1 
ATOM   1652 C  CB  . TRP A 1 235 ? 14.961  42.535 9.546   1.00 71.44  ? 826  TRP A CB  1 
ATOM   1653 C  CG  . TRP A 1 235 ? 13.899  42.951 10.526  1.00 72.96  ? 826  TRP A CG  1 
ATOM   1654 C  CD1 . TRP A 1 235 ? 13.275  44.162 10.594  1.00 75.33  ? 826  TRP A CD1 1 
ATOM   1655 C  CD2 . TRP A 1 235 ? 13.330  42.147 11.569  1.00 73.53  ? 826  TRP A CD2 1 
ATOM   1656 N  NE1 . TRP A 1 235 ? 12.374  44.174 11.635  1.00 74.80  ? 826  TRP A NE1 1 
ATOM   1657 C  CE2 . TRP A 1 235 ? 12.384  42.950 12.248  1.00 76.83  ? 826  TRP A CE2 1 
ATOM   1658 C  CE3 . TRP A 1 235 ? 13.562  40.834 12.028  1.00 76.08  ? 826  TRP A CE3 1 
ATOM   1659 C  CZ2 . TRP A 1 235 ? 11.640  42.474 13.332  1.00 76.45  ? 826  TRP A CZ2 1 
ATOM   1660 C  CZ3 . TRP A 1 235 ? 12.810  40.358 13.090  1.00 77.86  ? 826  TRP A CZ3 1 
ATOM   1661 C  CH2 . TRP A 1 235 ? 11.866  41.176 13.734  1.00 77.80  ? 826  TRP A CH2 1 
ATOM   1662 N  N   . ASP A 1 236 ? 16.767  41.479 7.700   1.00 74.40  ? 827  ASP A N   1 
ATOM   1663 C  CA  . ASP A 1 236 ? 17.917  41.103 6.885   1.00 76.38  ? 827  ASP A CA  1 
ATOM   1664 C  C   . ASP A 1 236 ? 18.290  39.595 6.950   1.00 80.73  ? 827  ASP A C   1 
ATOM   1665 O  O   . ASP A 1 236 ? 19.310  39.207 6.366   1.00 82.65  ? 827  ASP A O   1 
ATOM   1666 C  CB  . ASP A 1 236 ? 19.130  41.998 7.225   1.00 81.24  ? 827  ASP A CB  1 
ATOM   1667 C  CG  . ASP A 1 236 ? 19.542  42.090 8.695   1.00 101.91 ? 827  ASP A CG  1 
ATOM   1668 O  OD1 . ASP A 1 236 ? 19.011  41.299 9.522   1.00 103.03 ? 827  ASP A OD1 1 
ATOM   1669 O  OD2 . ASP A 1 236 ? 20.416  42.933 9.015   1.00 112.14 ? 827  ASP A OD2 1 
ATOM   1670 N  N   . MET A 1 237 ? 17.481  38.752 7.648   1.00 74.06  ? 828  MET A N   1 
ATOM   1671 C  CA  . MET A 1 237 ? 17.744  37.303 7.741   1.00 73.12  ? 828  MET A CA  1 
ATOM   1672 C  C   . MET A 1 237 ? 17.714  36.710 6.334   1.00 74.84  ? 828  MET A C   1 
ATOM   1673 O  O   . MET A 1 237 ? 16.889  37.126 5.519   1.00 72.72  ? 828  MET A O   1 
ATOM   1674 C  CB  . MET A 1 237 ? 16.681  36.581 8.596   1.00 74.22  ? 828  MET A CB  1 
ATOM   1675 C  CG  . MET A 1 237 ? 16.849  36.750 10.085  1.00 79.02  ? 828  MET A CG  1 
ATOM   1676 S  SD  . MET A 1 237 ? 15.467  36.002 11.005  1.00 81.91  ? 828  MET A SD  1 
ATOM   1677 C  CE  . MET A 1 237 ? 15.328  37.106 12.388  1.00 79.63  ? 828  MET A CE  1 
ATOM   1678 N  N   . SER A 1 238 ? 18.599  35.748 6.035   1.00 71.47  ? 829  SER A N   1 
ATOM   1679 C  CA  . SER A 1 238 ? 18.574  35.107 4.713   1.00 69.68  ? 829  SER A CA  1 
ATOM   1680 C  C   . SER A 1 238 ? 17.378  34.138 4.645   1.00 69.53  ? 829  SER A C   1 
ATOM   1681 O  O   . SER A 1 238 ? 16.798  33.806 5.682   1.00 67.67  ? 829  SER A O   1 
ATOM   1682 C  CB  . SER A 1 238 ? 19.875  34.354 4.451   1.00 74.34  ? 829  SER A CB  1 
ATOM   1683 O  OG  . SER A 1 238 ? 19.979  33.220 5.295   1.00 82.17  ? 829  SER A OG  1 
ATOM   1684 N  N   . ASN A 1 239 ? 17.035  33.670 3.432   1.00 64.76  ? 830  ASN A N   1 
ATOM   1685 C  CA  . ASN A 1 239 ? 15.963  32.699 3.209   1.00 63.09  ? 830  ASN A CA  1 
ATOM   1686 C  C   . ASN A 1 239 ? 16.205  31.441 4.046   1.00 68.58  ? 830  ASN A C   1 
ATOM   1687 O  O   . ASN A 1 239 ? 15.276  30.943 4.694   1.00 67.75  ? 830  ASN A O   1 
ATOM   1688 C  CB  . ASN A 1 239 ? 15.851  32.360 1.721   1.00 61.96  ? 830  ASN A CB  1 
ATOM   1689 C  CG  . ASN A 1 239 ? 15.135  33.404 0.906   1.00 80.16  ? 830  ASN A CG  1 
ATOM   1690 O  OD1 . ASN A 1 239 ? 14.354  34.202 1.425   1.00 74.15  ? 830  ASN A OD1 1 
ATOM   1691 N  ND2 . ASN A 1 239 ? 15.339  33.394 -0.402  1.00 72.43  ? 830  ASN A ND2 1 
ATOM   1692 N  N   . GLN A 1 240 ? 17.474  30.988 4.084   1.00 66.23  ? 831  GLN A N   1 
ATOM   1693 C  CA  . GLN A 1 240 ? 17.965  29.842 4.845   1.00 67.96  ? 831  GLN A CA  1 
ATOM   1694 C  C   . GLN A 1 240 ? 17.807  30.078 6.359   1.00 72.27  ? 831  GLN A C   1 
ATOM   1695 O  O   . GLN A 1 240 ? 17.375  29.164 7.072   1.00 73.31  ? 831  GLN A O   1 
ATOM   1696 C  CB  . GLN A 1 240 ? 19.425  29.571 4.469   1.00 71.82  ? 831  GLN A CB  1 
ATOM   1697 C  CG  . GLN A 1 240 ? 19.959  28.229 4.958   1.00 101.37 ? 831  GLN A CG  1 
ATOM   1698 C  CD  . GLN A 1 240 ? 21.406  27.995 4.563   1.00 134.63 ? 831  GLN A CD  1 
ATOM   1699 O  OE1 . GLN A 1 240 ? 21.940  28.589 3.612   1.00 132.95 ? 831  GLN A OE1 1 
ATOM   1700 N  NE2 . GLN A 1 240 ? 22.075  27.108 5.284   1.00 131.32 ? 831  GLN A NE2 1 
ATOM   1701 N  N   . ASP A 1 241 ? 18.161  31.296 6.842   1.00 67.56  ? 832  ASP A N   1 
ATOM   1702 C  CA  . ASP A 1 241 ? 18.009  31.695 8.246   1.00 67.99  ? 832  ASP A CA  1 
ATOM   1703 C  C   . ASP A 1 241 ? 16.516  31.638 8.620   1.00 67.80  ? 832  ASP A C   1 
ATOM   1704 O  O   . ASP A 1 241 ? 16.184  31.159 9.707   1.00 66.97  ? 832  ASP A O   1 
ATOM   1705 C  CB  . ASP A 1 241 ? 18.521  33.135 8.484   1.00 70.68  ? 832  ASP A CB  1 
ATOM   1706 C  CG  . ASP A 1 241 ? 20.022  33.368 8.414   1.00 87.84  ? 832  ASP A CG  1 
ATOM   1707 O  OD1 . ASP A 1 241 ? 20.793  32.392 8.607   1.00 90.97  ? 832  ASP A OD1 1 
ATOM   1708 O  OD2 . ASP A 1 241 ? 20.430  34.532 8.186   1.00 95.47  ? 832  ASP A OD2 1 
ATOM   1709 N  N   . VAL A 1 242 ? 15.623  32.108 7.705   1.00 61.00  ? 833  VAL A N   1 
ATOM   1710 C  CA  . VAL A 1 242 ? 14.168  32.098 7.902   1.00 58.22  ? 833  VAL A CA  1 
ATOM   1711 C  C   . VAL A 1 242 ? 13.675  30.644 8.062   1.00 62.88  ? 833  VAL A C   1 
ATOM   1712 O  O   . VAL A 1 242 ? 13.035  30.339 9.072   1.00 61.48  ? 833  VAL A O   1 
ATOM   1713 C  CB  . VAL A 1 242 ? 13.405  32.906 6.816   1.00 59.91  ? 833  VAL A CB  1 
ATOM   1714 C  CG1 . VAL A 1 242 ? 11.887  32.755 6.961   1.00 57.77  ? 833  VAL A CG1 1 
ATOM   1715 C  CG2 . VAL A 1 242 ? 13.792  34.380 6.859   1.00 59.33  ? 833  VAL A CG2 1 
ATOM   1716 N  N   . ILE A 1 243 ? 14.037  29.745 7.112   1.00 62.09  ? 834  ILE A N   1 
ATOM   1717 C  CA  . ILE A 1 243 ? 13.701  28.308 7.150   1.00 63.17  ? 834  ILE A CA  1 
ATOM   1718 C  C   . ILE A 1 243 ? 14.103  27.702 8.500   1.00 70.51  ? 834  ILE A C   1 
ATOM   1719 O  O   . ILE A 1 243 ? 13.266  27.072 9.144   1.00 71.07  ? 834  ILE A O   1 
ATOM   1720 C  CB  . ILE A 1 243 ? 14.308  27.532 5.938   1.00 66.69  ? 834  ILE A CB  1 
ATOM   1721 C  CG1 . ILE A 1 243 ? 13.673  28.009 4.613   1.00 64.75  ? 834  ILE A CG1 1 
ATOM   1722 C  CG2 . ILE A 1 243 ? 14.173  25.998 6.104   1.00 68.99  ? 834  ILE A CG2 1 
ATOM   1723 C  CD1 . ILE A 1 243 ? 14.412  27.591 3.344   1.00 69.64  ? 834  ILE A CD1 1 
ATOM   1724 N  N   . ASN A 1 244 ? 15.356  27.952 8.946   1.00 68.96  ? 835  ASN A N   1 
ATOM   1725 C  CA  . ASN A 1 244 ? 15.894  27.451 10.209  1.00 71.93  ? 835  ASN A CA  1 
ATOM   1726 C  C   . ASN A 1 244 ? 15.175  27.992 11.431  1.00 74.50  ? 835  ASN A C   1 
ATOM   1727 O  O   . ASN A 1 244 ? 14.859  27.213 12.329  1.00 75.11  ? 835  ASN A O   1 
ATOM   1728 C  CB  . ASN A 1 244 ? 17.409  27.715 10.313  1.00 81.47  ? 835  ASN A CB  1 
ATOM   1729 C  CG  . ASN A 1 244 ? 18.260  26.954 9.324   1.00 123.75 ? 835  ASN A CG  1 
ATOM   1730 O  OD1 . ASN A 1 244 ? 17.806  26.037 8.623   1.00 125.60 ? 835  ASN A OD1 1 
ATOM   1731 N  ND2 . ASN A 1 244 ? 19.525  27.325 9.238   1.00 118.46 ? 835  ASN A ND2 1 
ATOM   1732 N  N   . ALA A 1 245 ? 14.932  29.323 11.477  1.00 69.66  ? 836  ALA A N   1 
ATOM   1733 C  CA  . ALA A 1 245 ? 14.259  29.997 12.595  1.00 68.97  ? 836  ALA A CA  1 
ATOM   1734 C  C   . ALA A 1 245 ? 12.856  29.442 12.808  1.00 70.47  ? 836  ALA A C   1 
ATOM   1735 O  O   . ALA A 1 245 ? 12.511  29.091 13.939  1.00 70.34  ? 836  ALA A O   1 
ATOM   1736 C  CB  . ALA A 1 245 ? 14.211  31.505 12.365  1.00 68.30  ? 836  ALA A CB  1 
ATOM   1737 N  N   . ILE A 1 246 ? 12.076  29.314 11.703  1.00 65.12  ? 837  ILE A N   1 
ATOM   1738 C  CA  . ILE A 1 246 ? 10.709  28.766 11.663  1.00 63.54  ? 837  ILE A CA  1 
ATOM   1739 C  C   . ILE A 1 246 ? 10.701  27.293 12.140  1.00 71.24  ? 837  ILE A C   1 
ATOM   1740 O  O   . ILE A 1 246 ? 9.806   26.901 12.899  1.00 71.43  ? 837  ILE A O   1 
ATOM   1741 C  CB  . ILE A 1 246 ? 10.058  29.002 10.255  1.00 63.34  ? 837  ILE A CB  1 
ATOM   1742 C  CG1 . ILE A 1 246 ? 9.905   30.514 9.935   1.00 61.42  ? 837  ILE A CG1 1 
ATOM   1743 C  CG2 . ILE A 1 246 ? 8.743   28.239 10.057  1.00 61.93  ? 837  ILE A CG2 1 
ATOM   1744 C  CD1 . ILE A 1 246 ? 9.140   31.361 10.948  1.00 66.46  ? 837  ILE A CD1 1 
ATOM   1745 N  N   . GLU A 1 247 ? 11.729  26.509 11.746  1.00 70.53  ? 838  GLU A N   1 
ATOM   1746 C  CA  . GLU A 1 247 ? 11.898  25.129 12.196  1.00 73.45  ? 838  GLU A CA  1 
ATOM   1747 C  C   . GLU A 1 247 ? 12.173  25.094 13.715  1.00 78.96  ? 838  GLU A C   1 
ATOM   1748 O  O   . GLU A 1 247 ? 11.736  24.154 14.376  1.00 79.89  ? 838  GLU A O   1 
ATOM   1749 C  CB  . GLU A 1 247 ? 13.032  24.428 11.427  1.00 77.14  ? 838  GLU A CB  1 
ATOM   1750 C  CG  . GLU A 1 247 ? 12.662  23.983 10.018  1.00 89.83  ? 838  GLU A CG  1 
ATOM   1751 C  CD  . GLU A 1 247 ? 13.791  23.553 9.089   1.00 111.03 ? 838  GLU A CD  1 
ATOM   1752 O  OE1 . GLU A 1 247 ? 14.983  23.648 9.469   1.00 106.23 ? 838  GLU A OE1 1 
ATOM   1753 O  OE2 . GLU A 1 247 ? 13.471  23.123 7.959   1.00 101.84 ? 838  GLU A OE2 1 
ATOM   1754 N  N   . GLN A 1 248 ? 12.851  26.140 14.264  1.00 75.98  ? 839  GLN A N   1 
ATOM   1755 C  CA  . GLN A 1 248 ? 13.174  26.272 15.693  1.00 77.96  ? 839  GLN A CA  1 
ATOM   1756 C  C   . GLN A 1 248 ? 12.067  26.994 16.486  1.00 81.29  ? 839  GLN A C   1 
ATOM   1757 O  O   . GLN A 1 248 ? 12.304  27.467 17.602  1.00 82.42  ? 839  GLN A O   1 
ATOM   1758 C  CB  . GLN A 1 248 ? 14.547  26.939 15.892  1.00 81.09  ? 839  GLN A CB  1 
ATOM   1759 N  N   . ASP A 1 249 ? 10.852  27.067 15.892  1.00 75.81  ? 840  ASP A N   1 
ATOM   1760 C  CA  . ASP A 1 249 ? 9.636   27.644 16.457  1.00 73.76  ? 840  ASP A CA  1 
ATOM   1761 C  C   . ASP A 1 249 ? 9.734   29.164 16.707  1.00 74.09  ? 840  ASP A C   1 
ATOM   1762 O  O   . ASP A 1 249 ? 8.979   29.702 17.533  1.00 74.43  ? 840  ASP A O   1 
ATOM   1763 C  CB  . ASP A 1 249 ? 9.180   26.870 17.725  1.00 77.91  ? 840  ASP A CB  1 
ATOM   1764 C  CG  . ASP A 1 249 ? 8.929   25.387 17.501  1.00 91.73  ? 840  ASP A CG  1 
ATOM   1765 O  OD1 . ASP A 1 249 ? 8.227   25.044 16.529  1.00 91.33  ? 840  ASP A OD1 1 
ATOM   1766 O  OD2 . ASP A 1 249 ? 9.404   24.574 18.321  1.00 101.02 ? 840  ASP A OD2 1 
ATOM   1767 N  N   . TYR A 1 250 ? 10.619  29.866 15.969  1.00 66.87  ? 841  TYR A N   1 
ATOM   1768 C  CA  . TYR A 1 250 ? 10.670  31.329 16.065  1.00 64.46  ? 841  TYR A CA  1 
ATOM   1769 C  C   . TYR A 1 250 ? 9.457   31.879 15.292  1.00 65.58  ? 841  TYR A C   1 
ATOM   1770 O  O   . TYR A 1 250 ? 9.081   31.316 14.256  1.00 64.62  ? 841  TYR A O   1 
ATOM   1771 C  CB  . TYR A 1 250 ? 11.984  31.896 15.475  1.00 64.83  ? 841  TYR A CB  1 
ATOM   1772 C  CG  . TYR A 1 250 ? 11.996  33.398 15.246  1.00 63.48  ? 841  TYR A CG  1 
ATOM   1773 C  CD1 . TYR A 1 250 ? 12.487  34.270 16.216  1.00 66.05  ? 841  TYR A CD1 1 
ATOM   1774 C  CD2 . TYR A 1 250 ? 11.546  33.943 14.049  1.00 61.70  ? 841  TYR A CD2 1 
ATOM   1775 C  CE1 . TYR A 1 250 ? 12.520  35.650 16.000  1.00 64.53  ? 841  TYR A CE1 1 
ATOM   1776 C  CE2 . TYR A 1 250 ? 11.537  35.321 13.836  1.00 61.69  ? 841  TYR A CE2 1 
ATOM   1777 C  CZ  . TYR A 1 250 ? 12.039  36.171 14.806  1.00 69.09  ? 841  TYR A CZ  1 
ATOM   1778 O  OH  . TYR A 1 250 ? 12.066  37.520 14.554  1.00 67.13  ? 841  TYR A OH  1 
ATOM   1779 N  N   . ARG A 1 251 ? 8.858   32.968 15.802  1.00 60.99  ? 842  ARG A N   1 
ATOM   1780 C  CA  . ARG A 1 251 ? 7.766   33.713 15.168  1.00 58.69  ? 842  ARG A CA  1 
ATOM   1781 C  C   . ARG A 1 251 ? 8.102   35.193 15.265  1.00 64.10  ? 842  ARG A C   1 
ATOM   1782 O  O   . ARG A 1 251 ? 8.690   35.614 16.265  1.00 66.17  ? 842  ARG A O   1 
ATOM   1783 C  CB  . ARG A 1 251 ? 6.390   33.436 15.832  1.00 55.40  ? 842  ARG A CB  1 
ATOM   1784 C  CG  . ARG A 1 251 ? 5.884   32.010 15.674  1.00 57.71  ? 842  ARG A CG  1 
ATOM   1785 C  CD  . ARG A 1 251 ? 5.706   31.609 14.223  1.00 53.57  ? 842  ARG A CD  1 
ATOM   1786 N  NE  . ARG A 1 251 ? 5.124   30.276 14.099  1.00 56.45  ? 842  ARG A NE  1 
ATOM   1787 C  CZ  . ARG A 1 251 ? 5.820   29.147 13.990  1.00 71.74  ? 842  ARG A CZ  1 
ATOM   1788 N  NH1 . ARG A 1 251 ? 7.149   29.171 14.002  1.00 64.19  ? 842  ARG A NH1 1 
ATOM   1789 N  NH2 . ARG A 1 251 ? 5.194   27.986 13.880  1.00 58.32  ? 842  ARG A NH2 1 
ATOM   1790 N  N   . LEU A 1 252 ? 7.759   35.977 14.227  1.00 58.06  ? 843  LEU A N   1 
ATOM   1791 C  CA  . LEU A 1 252 ? 8.000   37.427 14.200  1.00 57.26  ? 843  LEU A CA  1 
ATOM   1792 C  C   . LEU A 1 252 ? 7.352   38.095 15.422  1.00 61.29  ? 843  LEU A C   1 
ATOM   1793 O  O   . LEU A 1 252 ? 6.242   37.712 15.825  1.00 60.19  ? 843  LEU A O   1 
ATOM   1794 C  CB  . LEU A 1 252 ? 7.478   38.070 12.887  1.00 55.08  ? 843  LEU A CB  1 
ATOM   1795 C  CG  . LEU A 1 252 ? 8.323   37.817 11.641  1.00 58.59  ? 843  LEU A CG  1 
ATOM   1796 C  CD1 . LEU A 1 252 ? 7.514   38.010 10.386  1.00 55.64  ? 843  LEU A CD1 1 
ATOM   1797 C  CD2 . LEU A 1 252 ? 9.600   38.670 11.650  1.00 62.02  ? 843  LEU A CD2 1 
ATOM   1798 N  N   . PRO A 1 253 ? 8.047   39.061 16.061  1.00 58.76  ? 844  PRO A N   1 
ATOM   1799 C  CA  . PRO A 1 253 ? 7.458   39.710 17.238  1.00 58.87  ? 844  PRO A CA  1 
ATOM   1800 C  C   . PRO A 1 253 ? 6.379   40.709 16.827  1.00 60.36  ? 844  PRO A C   1 
ATOM   1801 O  O   . PRO A 1 253 ? 6.297   41.037 15.635  1.00 58.40  ? 844  PRO A O   1 
ATOM   1802 C  CB  . PRO A 1 253 ? 8.671   40.400 17.885  1.00 62.28  ? 844  PRO A CB  1 
ATOM   1803 C  CG  . PRO A 1 253 ? 9.563   40.719 16.762  1.00 65.51  ? 844  PRO A CG  1 
ATOM   1804 C  CD  . PRO A 1 253 ? 9.374   39.632 15.737  1.00 60.35  ? 844  PRO A CD  1 
ATOM   1805 N  N   . PRO A 1 254 ? 5.564   41.244 17.764  1.00 57.84  ? 845  PRO A N   1 
ATOM   1806 C  CA  . PRO A 1 254 ? 4.570   42.248 17.347  1.00 56.03  ? 845  PRO A CA  1 
ATOM   1807 C  C   . PRO A 1 254 ? 5.214   43.543 16.866  1.00 59.83  ? 845  PRO A C   1 
ATOM   1808 O  O   . PRO A 1 254 ? 6.120   44.034 17.539  1.00 61.82  ? 845  PRO A O   1 
ATOM   1809 C  CB  . PRO A 1 254 ? 3.724   42.492 18.605  1.00 58.74  ? 845  PRO A CB  1 
ATOM   1810 C  CG  . PRO A 1 254 ? 4.516   41.964 19.725  1.00 65.70  ? 845  PRO A CG  1 
ATOM   1811 C  CD  . PRO A 1 254 ? 5.510   40.981 19.218  1.00 61.56  ? 845  PRO A CD  1 
ATOM   1812 N  N   . PRO A 1 255 ? 4.760   44.115 15.722  1.00 54.27  ? 846  PRO A N   1 
ATOM   1813 C  CA  . PRO A 1 255 ? 5.279   45.431 15.295  1.00 54.45  ? 846  PRO A CA  1 
ATOM   1814 C  C   . PRO A 1 255 ? 5.016   46.500 16.371  1.00 61.04  ? 846  PRO A C   1 
ATOM   1815 O  O   . PRO A 1 255 ? 4.194   46.281 17.272  1.00 59.21  ? 846  PRO A O   1 
ATOM   1816 C  CB  . PRO A 1 255 ? 4.478   45.724 14.014  1.00 53.46  ? 846  PRO A CB  1 
ATOM   1817 C  CG  . PRO A 1 255 ? 4.042   44.354 13.532  1.00 56.96  ? 846  PRO A CG  1 
ATOM   1818 C  CD  . PRO A 1 255 ? 3.703   43.643 14.802  1.00 53.41  ? 846  PRO A CD  1 
ATOM   1819 N  N   . MET A 1 256 ? 5.729   47.637 16.301  1.00 61.96  ? 847  MET A N   1 
ATOM   1820 C  CA  . MET A 1 256 ? 5.590   48.743 17.255  1.00 65.00  ? 847  MET A CA  1 
ATOM   1821 C  C   . MET A 1 256 ? 4.121   49.177 17.374  1.00 64.12  ? 847  MET A C   1 
ATOM   1822 O  O   . MET A 1 256 ? 3.455   49.377 16.357  1.00 60.98  ? 847  MET A O   1 
ATOM   1823 C  CB  . MET A 1 256 ? 6.476   49.927 16.817  1.00 69.81  ? 847  MET A CB  1 
ATOM   1824 C  CG  . MET A 1 256 ? 6.645   51.015 17.866  1.00 77.52  ? 847  MET A CG  1 
ATOM   1825 S  SD  . MET A 1 256 ? 7.695   50.474 19.207  1.00 87.39  ? 847  MET A SD  1 
ATOM   1826 C  CE  . MET A 1 256 ? 6.780   51.146 20.635  1.00 85.93  ? 847  MET A CE  1 
ATOM   1827 N  N   . ASP A 1 257 ? 3.624   49.249 18.629  1.00 61.23  ? 848  ASP A N   1 
ATOM   1828 C  CA  . ASP A 1 257 ? 2.270   49.687 19.013  1.00 61.27  ? 848  ASP A CA  1 
ATOM   1829 C  C   . ASP A 1 257 ? 1.121   48.812 18.482  1.00 60.51  ? 848  ASP A C   1 
ATOM   1830 O  O   . ASP A 1 257 ? -0.040  49.212 18.592  1.00 60.08  ? 848  ASP A O   1 
ATOM   1831 C  CB  . ASP A 1 257 ? 2.031   51.170 18.632  1.00 63.71  ? 848  ASP A CB  1 
ATOM   1832 C  CG  . ASP A 1 257 ? 3.164   52.097 19.024  1.00 78.30  ? 848  ASP A CG  1 
ATOM   1833 O  OD1 . ASP A 1 257 ? 3.537   52.111 20.230  1.00 82.23  ? 848  ASP A OD1 1 
ATOM   1834 O  OD2 . ASP A 1 257 ? 3.691   52.800 18.127  1.00 82.56  ? 848  ASP A OD2 1 
ATOM   1835 N  N   . CYS A 1 258 ? 1.428   47.616 17.962  1.00 54.33  ? 849  CYS A N   1 
ATOM   1836 C  CA  . CYS A 1 258 ? 0.432   46.688 17.423  1.00 52.16  ? 849  CYS A CA  1 
ATOM   1837 C  C   . CYS A 1 258 ? -0.460  46.142 18.553  1.00 56.20  ? 849  CYS A C   1 
ATOM   1838 O  O   . CYS A 1 258 ? 0.083   45.599 19.521  1.00 57.46  ? 849  CYS A O   1 
ATOM   1839 C  CB  . CYS A 1 258 ? 1.132   45.554 16.679  1.00 51.17  ? 849  CYS A CB  1 
ATOM   1840 S  SG  . CYS A 1 258 ? 0.026   44.283 16.030  1.00 52.94  ? 849  CYS A SG  1 
ATOM   1841 N  N   . PRO A 1 259 ? -1.818  46.259 18.449  1.00 50.78  ? 850  PRO A N   1 
ATOM   1842 C  CA  . PRO A 1 259 ? -2.693  45.667 19.481  1.00 51.17  ? 850  PRO A CA  1 
ATOM   1843 C  C   . PRO A 1 259 ? -2.420  44.161 19.657  1.00 56.12  ? 850  PRO A C   1 
ATOM   1844 O  O   . PRO A 1 259 ? -2.105  43.465 18.689  1.00 54.44  ? 850  PRO A O   1 
ATOM   1845 C  CB  . PRO A 1 259 ? -4.108  45.922 18.934  1.00 51.29  ? 850  PRO A CB  1 
ATOM   1846 C  CG  . PRO A 1 259 ? -3.954  47.095 18.050  1.00 54.39  ? 850  PRO A CG  1 
ATOM   1847 C  CD  . PRO A 1 259 ? -2.624  46.896 17.391  1.00 49.67  ? 850  PRO A CD  1 
ATOM   1848 N  N   . ALA A 1 260 ? -2.484  43.682 20.905  1.00 54.74  ? 851  ALA A N   1 
ATOM   1849 C  CA  . ALA A 1 260 ? -2.224  42.297 21.295  1.00 54.85  ? 851  ALA A CA  1 
ATOM   1850 C  C   . ALA A 1 260 ? -3.098  41.325 20.504  1.00 56.64  ? 851  ALA A C   1 
ATOM   1851 O  O   . ALA A 1 260 ? -2.578  40.316 20.029  1.00 55.41  ? 851  ALA A O   1 
ATOM   1852 C  CB  . ALA A 1 260 ? -2.455  42.125 22.795  1.00 57.72  ? 851  ALA A CB  1 
ATOM   1853 N  N   . ALA A 1 261 ? -4.402  41.672 20.312  1.00 52.37  ? 852  ALA A N   1 
ATOM   1854 C  CA  . ALA A 1 261 ? -5.369  40.858 19.576  1.00 51.43  ? 852  ALA A CA  1 
ATOM   1855 C  C   . ALA A 1 261 ? -4.956  40.635 18.128  1.00 52.39  ? 852  ALA A C   1 
ATOM   1856 O  O   . ALA A 1 261 ? -5.153  39.533 17.633  1.00 51.98  ? 852  ALA A O   1 
ATOM   1857 C  CB  . ALA A 1 261 ? -6.755  41.474 19.648  1.00 51.96  ? 852  ALA A CB  1 
ATOM   1858 N  N   . LEU A 1 262 ? -4.378  41.654 17.463  1.00 47.36  ? 853  LEU A N   1 
ATOM   1859 C  CA  . LEU A 1 262 ? -3.881  41.545 16.092  1.00 46.15  ? 853  LEU A CA  1 
ATOM   1860 C  C   . LEU A 1 262 ? -2.635  40.687 16.027  1.00 50.55  ? 853  LEU A C   1 
ATOM   1861 O  O   . LEU A 1 262 ? -2.533  39.869 15.127  1.00 48.60  ? 853  LEU A O   1 
ATOM   1862 C  CB  . LEU A 1 262 ? -3.613  42.919 15.454  1.00 45.83  ? 853  LEU A CB  1 
ATOM   1863 C  CG  . LEU A 1 262 ? -4.819  43.671 14.930  1.00 49.07  ? 853  LEU A CG  1 
ATOM   1864 C  CD1 . LEU A 1 262 ? -4.461  45.109 14.685  1.00 49.36  ? 853  LEU A CD1 1 
ATOM   1865 C  CD2 . LEU A 1 262 ? -5.387  42.996 13.650  1.00 47.80  ? 853  LEU A CD2 1 
ATOM   1866 N  N   . HIS A 1 263 ? -1.699  40.825 16.990  1.00 50.07  ? 854  HIS A N   1 
ATOM   1867 C  CA  . HIS A 1 263 ? -0.527  39.949 16.991  1.00 50.76  ? 854  HIS A CA  1 
ATOM   1868 C  C   . HIS A 1 263 ? -0.947  38.498 17.282  1.00 55.27  ? 854  HIS A C   1 
ATOM   1869 O  O   . HIS A 1 263 ? -0.400  37.576 16.671  1.00 55.22  ? 854  HIS A O   1 
ATOM   1870 C  CB  . HIS A 1 263 ? 0.576   40.424 17.947  1.00 53.81  ? 854  HIS A CB  1 
ATOM   1871 C  CG  . HIS A 1 263 ? 1.804   39.553 17.896  1.00 57.82  ? 854  HIS A CG  1 
ATOM   1872 N  ND1 . HIS A 1 263 ? 2.268   38.890 19.024  1.00 61.65  ? 854  HIS A ND1 1 
ATOM   1873 C  CD2 . HIS A 1 263 ? 2.603   39.232 16.846  1.00 58.49  ? 854  HIS A CD2 1 
ATOM   1874 C  CE1 . HIS A 1 263 ? 3.330   38.204 18.626  1.00 61.17  ? 854  HIS A CE1 1 
ATOM   1875 N  NE2 . HIS A 1 263 ? 3.575   38.386 17.326  1.00 59.88  ? 854  HIS A NE2 1 
ATOM   1876 N  N   . GLN A 1 264 ? -1.945  38.298 18.173  1.00 50.79  ? 855  GLN A N   1 
ATOM   1877 C  CA  . GLN A 1 264 ? -2.466  36.965 18.467  1.00 51.01  ? 855  GLN A CA  1 
ATOM   1878 C  C   . GLN A 1 264 ? -3.063  36.341 17.199  1.00 53.34  ? 855  GLN A C   1 
ATOM   1879 O  O   . GLN A 1 264 ? -2.815  35.165 16.936  1.00 52.55  ? 855  GLN A O   1 
ATOM   1880 C  CB  . GLN A 1 264 ? -3.492  36.978 19.613  1.00 53.81  ? 855  GLN A CB  1 
ATOM   1881 C  CG  . GLN A 1 264 ? -3.883  35.569 20.097  1.00 66.83  ? 855  GLN A CG  1 
ATOM   1882 C  CD  . GLN A 1 264 ? -2.695  34.691 20.467  1.00 74.75  ? 855  GLN A CD  1 
ATOM   1883 O  OE1 . GLN A 1 264 ? -1.867  35.045 21.321  1.00 68.92  ? 855  GLN A OE1 1 
ATOM   1884 N  NE2 . GLN A 1 264 ? -2.565  33.549 19.794  1.00 61.61  ? 855  GLN A NE2 1 
ATOM   1885 N  N   . LEU A 1 265 ? -3.783  37.138 16.383  1.00 48.04  ? 856  LEU A N   1 
ATOM   1886 C  CA  . LEU A 1 265 ? -4.312  36.662 15.102  1.00 46.30  ? 856  LEU A CA  1 
ATOM   1887 C  C   . LEU A 1 265 ? -3.152  36.253 14.164  1.00 48.64  ? 856  LEU A C   1 
ATOM   1888 O  O   . LEU A 1 265 ? -3.261  35.221 13.493  1.00 48.38  ? 856  LEU A O   1 
ATOM   1889 C  CB  . LEU A 1 265 ? -5.269  37.690 14.456  1.00 44.69  ? 856  LEU A CB  1 
ATOM   1890 C  CG  . LEU A 1 265 ? -5.962  37.313 13.112  1.00 46.95  ? 856  LEU A CG  1 
ATOM   1891 C  CD1 . LEU A 1 265 ? -6.709  36.005 13.196  1.00 46.01  ? 856  LEU A CD1 1 
ATOM   1892 C  CD2 . LEU A 1 265 ? -6.916  38.427 12.640  1.00 47.96  ? 856  LEU A CD2 1 
ATOM   1893 N  N   . MET A 1 266 ? -2.022  37.012 14.178  1.00 42.89  ? 857  MET A N   1 
ATOM   1894 C  CA  . MET A 1 266 ? -0.818  36.659 13.398  1.00 42.46  ? 857  MET A CA  1 
ATOM   1895 C  C   . MET A 1 266 ? -0.271  35.293 13.878  1.00 49.14  ? 857  MET A C   1 
ATOM   1896 O  O   . MET A 1 266 ? 0.018   34.426 13.051  1.00 48.53  ? 857  MET A O   1 
ATOM   1897 C  CB  . MET A 1 266 ? 0.290   37.707 13.547  1.00 44.82  ? 857  MET A CB  1 
ATOM   1898 C  CG  . MET A 1 266 ? -0.028  39.006 12.869  1.00 46.63  ? 857  MET A CG  1 
ATOM   1899 S  SD  . MET A 1 266 ? 1.288   40.191 13.210  1.00 50.19  ? 857  MET A SD  1 
ATOM   1900 C  CE  . MET A 1 266 ? 0.347   41.736 13.173  1.00 45.14  ? 857  MET A CE  1 
ATOM   1901 N  N   . LEU A 1 267 ? -0.177  35.098 15.209  1.00 47.48  ? 858  LEU A N   1 
ATOM   1902 C  CA  . LEU A 1 267 ? 0.300   33.846 15.810  1.00 48.92  ? 858  LEU A CA  1 
ATOM   1903 C  C   . LEU A 1 267 ? -0.597  32.664 15.475  1.00 52.95  ? 858  LEU A C   1 
ATOM   1904 O  O   . LEU A 1 267 ? -0.085  31.553 15.289  1.00 53.77  ? 858  LEU A O   1 
ATOM   1905 C  CB  . LEU A 1 267 ? 0.480   33.969 17.333  1.00 50.48  ? 858  LEU A CB  1 
ATOM   1906 C  CG  . LEU A 1 267 ? 1.537   34.956 17.828  1.00 54.55  ? 858  LEU A CG  1 
ATOM   1907 C  CD1 . LEU A 1 267 ? 1.555   34.975 19.344  1.00 56.66  ? 858  LEU A CD1 1 
ATOM   1908 C  CD2 . LEU A 1 267 ? 2.957   34.658 17.233  1.00 55.09  ? 858  LEU A CD2 1 
ATOM   1909 N  N   . ASP A 1 268 ? -1.920  32.901 15.388  1.00 47.76  ? 859  ASP A N   1 
ATOM   1910 C  CA  . ASP A 1 268 ? -2.905  31.886 15.006  1.00 47.58  ? 859  ASP A CA  1 
ATOM   1911 C  C   . ASP A 1 268 ? -2.686  31.440 13.559  1.00 52.55  ? 859  ASP A C   1 
ATOM   1912 O  O   . ASP A 1 268 ? -2.816  30.255 13.268  1.00 53.61  ? 859  ASP A O   1 
ATOM   1913 C  CB  . ASP A 1 268 ? -4.337  32.425 15.149  1.00 47.59  ? 859  ASP A CB  1 
ATOM   1914 C  CG  . ASP A 1 268 ? -4.757  32.756 16.556  1.00 53.50  ? 859  ASP A CG  1 
ATOM   1915 O  OD1 . ASP A 1 268 ? -4.061  32.332 17.502  1.00 55.98  ? 859  ASP A OD1 1 
ATOM   1916 O  OD2 . ASP A 1 268 ? -5.764  33.476 16.716  1.00 57.53  ? 859  ASP A OD2 1 
ATOM   1917 N  N   . CYS A 1 269 ? -2.372  32.395 12.661  1.00 47.49  ? 860  CYS A N   1 
ATOM   1918 C  CA  . CYS A 1 269 ? -2.109  32.170 11.236  1.00 46.27  ? 860  CYS A CA  1 
ATOM   1919 C  C   . CYS A 1 269 ? -0.805  31.387 11.089  1.00 51.09  ? 860  CYS A C   1 
ATOM   1920 O  O   . CYS A 1 269 ? -0.619  30.684 10.087  1.00 49.16  ? 860  CYS A O   1 
ATOM   1921 C  CB  . CYS A 1 269 ? -2.031  33.502 10.478  1.00 44.51  ? 860  CYS A CB  1 
ATOM   1922 S  SG  . CYS A 1 269 ? -3.616  34.372 10.268  1.00 46.21  ? 860  CYS A SG  1 
ATOM   1923 N  N   . TRP A 1 270 ? 0.114   31.547 12.066  1.00 49.67  ? 861  TRP A N   1 
ATOM   1924 C  CA  . TRP A 1 270 ? 1.423   30.907 12.046  1.00 50.96  ? 861  TRP A CA  1 
ATOM   1925 C  C   . TRP A 1 270 ? 1.549   29.647 12.899  1.00 56.16  ? 861  TRP A C   1 
ATOM   1926 O  O   . TRP A 1 270 ? 2.666   29.261 13.246  1.00 57.28  ? 861  TRP A O   1 
ATOM   1927 C  CB  . TRP A 1 270 ? 2.544   31.889 12.405  1.00 50.68  ? 861  TRP A CB  1 
ATOM   1928 C  CG  . TRP A 1 270 ? 2.604   33.162 11.603  1.00 49.97  ? 861  TRP A CG  1 
ATOM   1929 C  CD1 . TRP A 1 270 ? 2.334   33.324 10.273  1.00 51.34  ? 861  TRP A CD1 1 
ATOM   1930 C  CD2 . TRP A 1 270 ? 3.089   34.421 12.071  1.00 50.01  ? 861  TRP A CD2 1 
ATOM   1931 N  NE1 . TRP A 1 270 ? 2.564   34.626 9.900   1.00 50.15  ? 861  TRP A NE1 1 
ATOM   1932 C  CE2 . TRP A 1 270 ? 3.047   35.319 10.982  1.00 52.47  ? 861  TRP A CE2 1 
ATOM   1933 C  CE3 . TRP A 1 270 ? 3.536   34.884 13.322  1.00 52.67  ? 861  TRP A CE3 1 
ATOM   1934 C  CZ2 . TRP A 1 270 ? 3.417   36.659 11.106  1.00 51.83  ? 861  TRP A CZ2 1 
ATOM   1935 C  CZ3 . TRP A 1 270 ? 3.902   36.209 13.443  1.00 54.41  ? 861  TRP A CZ3 1 
ATOM   1936 C  CH2 . TRP A 1 270 ? 3.859   37.079 12.341  1.00 53.62  ? 861  TRP A CH2 1 
ATOM   1937 N  N   . GLN A 1 271 ? 0.439   28.969 13.197  1.00 52.79  ? 862  GLN A N   1 
ATOM   1938 C  CA  . GLN A 1 271 ? 0.512   27.718 13.958  1.00 54.69  ? 862  GLN A CA  1 
ATOM   1939 C  C   . GLN A 1 271 ? 1.209   26.643 13.111  1.00 59.40  ? 862  GLN A C   1 
ATOM   1940 O  O   . GLN A 1 271 ? 0.965   26.571 11.901  1.00 56.83  ? 862  GLN A O   1 
ATOM   1941 C  CB  . GLN A 1 271 ? -0.878  27.267 14.417  1.00 55.57  ? 862  GLN A CB  1 
ATOM   1942 C  CG  . GLN A 1 271 ? -1.339  28.024 15.666  1.00 67.21  ? 862  GLN A CG  1 
ATOM   1943 C  CD  . GLN A 1 271 ? -2.788  27.785 15.989  1.00 94.15  ? 862  GLN A CD  1 
ATOM   1944 O  OE1 . GLN A 1 271 ? -3.127  27.001 16.884  1.00 93.94  ? 862  GLN A OE1 1 
ATOM   1945 N  NE2 . GLN A 1 271 ? -3.679  28.481 15.287  1.00 84.60  ? 862  GLN A NE2 1 
ATOM   1946 N  N   . LYS A 1 272 ? 2.145   25.881 13.725  1.00 58.33  ? 863  LYS A N   1 
ATOM   1947 C  CA  . LYS A 1 272 ? 2.902   24.815 13.051  1.00 58.74  ? 863  LYS A CA  1 
ATOM   1948 C  C   . LYS A 1 272 ? 1.932   23.831 12.371  1.00 61.93  ? 863  LYS A C   1 
ATOM   1949 O  O   . LYS A 1 272 ? 2.099   23.541 11.187  1.00 59.82  ? 863  LYS A O   1 
ATOM   1950 C  CB  . LYS A 1 272 ? 3.833   24.095 14.034  1.00 62.03  ? 863  LYS A CB  1 
ATOM   1951 C  CG  . LYS A 1 272 ? 4.810   23.133 13.368  1.00 72.85  ? 863  LYS A CG  1 
ATOM   1952 C  CD  . LYS A 1 272 ? 5.625   22.373 14.407  1.00 79.47  ? 863  LYS A CD  1 
ATOM   1953 C  CE  . LYS A 1 272 ? 6.454   21.275 13.787  1.00 93.33  ? 863  LYS A CE  1 
ATOM   1954 N  NZ  . LYS A 1 272 ? 7.361   20.640 14.780  1.00 105.98 ? 863  LYS A NZ  1 
ATOM   1955 N  N   . ASP A 1 273 ? 0.914   23.352 13.117  1.00 59.50  ? 864  ASP A N   1 
ATOM   1956 C  CA  . ASP A 1 273 ? -0.117  22.472 12.585  1.00 58.80  ? 864  ASP A CA  1 
ATOM   1957 C  C   . ASP A 1 273 ? -1.065  23.314 11.747  1.00 58.30  ? 864  ASP A C   1 
ATOM   1958 O  O   . ASP A 1 273 ? -1.807  24.144 12.286  1.00 55.53  ? 864  ASP A O   1 
ATOM   1959 C  CB  . ASP A 1 273 ? -0.878  21.745 13.722  1.00 62.94  ? 864  ASP A CB  1 
ATOM   1960 C  CG  . ASP A 1 273 ? -1.898  20.690 13.280  1.00 74.90  ? 864  ASP A CG  1 
ATOM   1961 O  OD1 . ASP A 1 273 ? -2.126  20.546 12.049  1.00 74.44  ? 864  ASP A OD1 1 
ATOM   1962 O  OD2 . ASP A 1 273 ? -2.461  20.005 14.161  1.00 82.05  ? 864  ASP A OD2 1 
ATOM   1963 N  N   . ARG A 1 274 ? -1.043  23.081 10.418  1.00 53.86  ? 865  ARG A N   1 
ATOM   1964 C  CA  . ARG A 1 274 ? -1.872  23.788 9.442   1.00 50.76  ? 865  ARG A CA  1 
ATOM   1965 C  C   . ARG A 1 274 ? -3.366  23.661 9.744   1.00 55.14  ? 865  ARG A C   1 
ATOM   1966 O  O   . ARG A 1 274 ? -4.105  24.591 9.449   1.00 53.85  ? 865  ARG A O   1 
ATOM   1967 C  CB  . ARG A 1 274 ? -1.540  23.353 8.000   1.00 49.47  ? 865  ARG A CB  1 
ATOM   1968 C  CG  . ARG A 1 274 ? -2.003  21.935 7.659   1.00 61.16  ? 865  ARG A CG  1 
ATOM   1969 C  CD  . ARG A 1 274 ? -1.517  21.440 6.320   1.00 75.12  ? 865  ARG A CD  1 
ATOM   1970 N  NE  . ARG A 1 274 ? -2.426  20.434 5.762   1.00 88.18  ? 865  ARG A NE  1 
ATOM   1971 C  CZ  . ARG A 1 274 ? -2.379  19.132 6.037   1.00 114.66 ? 865  ARG A CZ  1 
ATOM   1972 N  NH1 . ARG A 1 274 ? -1.469  18.654 6.880   1.00 110.96 ? 865  ARG A NH1 1 
ATOM   1973 N  NH2 . ARG A 1 274 ? -3.248  18.299 5.478   1.00 105.45 ? 865  ARG A NH2 1 
ATOM   1974 N  N   . ASN A 1 275 ? -3.803  22.541 10.360  1.00 54.00  ? 866  ASN A N   1 
ATOM   1975 C  CA  . ASN A 1 275 ? -5.204  22.299 10.718  1.00 54.50  ? 866  ASN A CA  1 
ATOM   1976 C  C   . ASN A 1 275 ? -5.661  23.191 11.870  1.00 58.78  ? 866  ASN A C   1 
ATOM   1977 O  O   . ASN A 1 275 ? -6.861  23.426 12.023  1.00 58.00  ? 866  ASN A O   1 
ATOM   1978 C  CB  . ASN A 1 275 ? -5.434  20.817 11.076  1.00 56.22  ? 866  ASN A CB  1 
ATOM   1979 C  CG  . ASN A 1 275 ? -5.171  19.867 9.936   1.00 80.82  ? 866  ASN A CG  1 
ATOM   1980 O  OD1 . ASN A 1 275 ? -5.628  20.052 8.794   1.00 68.76  ? 866  ASN A OD1 1 
ATOM   1981 N  ND2 . ASN A 1 275 ? -4.454  18.804 10.239  1.00 79.49  ? 866  ASN A ND2 1 
ATOM   1982 N  N   . SER A 1 276 ? -4.706  23.686 12.670  1.00 55.95  ? 867  SER A N   1 
ATOM   1983 C  CA  . SER A 1 276 ? -4.975  24.567 13.802  1.00 56.09  ? 867  SER A CA  1 
ATOM   1984 C  C   . SER A 1 276 ? -5.134  26.038 13.387  1.00 57.94  ? 867  SER A C   1 
ATOM   1985 O  O   . SER A 1 276 ? -5.632  26.844 14.178  1.00 58.50  ? 867  SER A O   1 
ATOM   1986 C  CB  . SER A 1 276 ? -3.885  24.410 14.855  1.00 60.79  ? 867  SER A CB  1 
ATOM   1987 O  OG  . SER A 1 276 ? -3.860  23.067 15.314  1.00 72.21  ? 867  SER A OG  1 
ATOM   1988 N  N   . ARG A 1 277 ? -4.740  26.385 12.148  1.00 51.59  ? 868  ARG A N   1 
ATOM   1989 C  CA  . ARG A 1 277 ? -4.843  27.755 11.642  1.00 49.76  ? 868  ARG A CA  1 
ATOM   1990 C  C   . ARG A 1 277 ? -6.284  28.154 11.390  1.00 52.49  ? 868  ARG A C   1 
ATOM   1991 O  O   . ARG A 1 277 ? -7.071  27.296 10.987  1.00 52.73  ? 868  ARG A O   1 
ATOM   1992 C  CB  . ARG A 1 277 ? -4.022  27.928 10.356  1.00 48.18  ? 868  ARG A CB  1 
ATOM   1993 C  CG  . ARG A 1 277 ? -2.538  27.715 10.568  1.00 53.95  ? 868  ARG A CG  1 
ATOM   1994 C  CD  . ARG A 1 277 ? -1.737  27.725 9.283   1.00 54.15  ? 868  ARG A CD  1 
ATOM   1995 N  NE  . ARG A 1 277 ? -0.438  27.098 9.537   1.00 55.11  ? 868  ARG A NE  1 
ATOM   1996 C  CZ  . ARG A 1 277 ? 0.329   26.513 8.623   1.00 64.48  ? 868  ARG A CZ  1 
ATOM   1997 N  NH1 . ARG A 1 277 ? -0.039  26.496 7.351   1.00 45.67  ? 868  ARG A NH1 1 
ATOM   1998 N  NH2 . ARG A 1 277 ? 1.458   25.918 8.977   1.00 51.40  ? 868  ARG A NH2 1 
ATOM   1999 N  N   . PRO A 1 278 ? -6.676  29.436 11.592  1.00 49.71  ? 869  PRO A N   1 
ATOM   2000 C  CA  . PRO A 1 278 ? -8.056  29.818 11.253  1.00 48.02  ? 869  PRO A CA  1 
ATOM   2001 C  C   . PRO A 1 278 ? -8.230  29.791 9.735   1.00 48.93  ? 869  PRO A C   1 
ATOM   2002 O  O   . PRO A 1 278 ? -7.266  29.951 8.985   1.00 47.51  ? 869  PRO A O   1 
ATOM   2003 C  CB  . PRO A 1 278 ? -8.184  31.245 11.807  1.00 48.73  ? 869  PRO A CB  1 
ATOM   2004 C  CG  . PRO A 1 278 ? -6.800  31.767 11.831  1.00 52.44  ? 869  PRO A CG  1 
ATOM   2005 C  CD  . PRO A 1 278 ? -5.889  30.606 12.046  1.00 50.06  ? 869  PRO A CD  1 
ATOM   2006 N  N   . ARG A 1 279 ? -9.456  29.566 9.289   1.00 45.51  ? 870  ARG A N   1 
ATOM   2007 C  CA  . ARG A 1 279 ? -9.810  29.612 7.879   1.00 44.34  ? 870  ARG A CA  1 
ATOM   2008 C  C   . ARG A 1 279 ? -10.049 31.093 7.575   1.00 45.32  ? 870  ARG A C   1 
ATOM   2009 O  O   . ARG A 1 279 ? -10.274 31.860 8.509   1.00 44.04  ? 870  ARG A O   1 
ATOM   2010 C  CB  . ARG A 1 279 ? -11.081 28.770 7.618   1.00 45.56  ? 870  ARG A CB  1 
ATOM   2011 C  CG  . ARG A 1 279 ? -10.820 27.263 7.678   1.00 55.83  ? 870  ARG A CG  1 
ATOM   2012 C  CD  . ARG A 1 279 ? -11.982 26.433 7.174   1.00 75.05  ? 870  ARG A CD  1 
ATOM   2013 N  NE  . ARG A 1 279 ? -11.719 24.998 7.326   1.00 106.53 ? 870  ARG A NE  1 
ATOM   2014 C  CZ  . ARG A 1 279 ? -12.655 24.054 7.446   1.00 131.32 ? 870  ARG A CZ  1 
ATOM   2015 N  NH1 . ARG A 1 279 ? -13.945 24.379 7.433   1.00 123.20 ? 870  ARG A NH1 1 
ATOM   2016 N  NH2 . ARG A 1 279 ? -12.309 22.780 7.588   1.00 118.56 ? 870  ARG A NH2 1 
ATOM   2017 N  N   . PHE A 1 280 ? -10.011 31.502 6.289   1.00 40.58  ? 871  PHE A N   1 
ATOM   2018 C  CA  . PHE A 1 280 ? -10.231 32.896 5.918   1.00 38.25  ? 871  PHE A CA  1 
ATOM   2019 C  C   . PHE A 1 280 ? -11.605 33.450 6.379   1.00 42.54  ? 871  PHE A C   1 
ATOM   2020 O  O   . PHE A 1 280 ? -11.669 34.627 6.739   1.00 40.43  ? 871  PHE A O   1 
ATOM   2021 C  CB  . PHE A 1 280 ? -9.990  33.114 4.423   1.00 37.90  ? 871  PHE A CB  1 
ATOM   2022 C  CG  . PHE A 1 280 ? -8.516  33.215 4.082   1.00 37.79  ? 871  PHE A CG  1 
ATOM   2023 C  CD1 . PHE A 1 280 ? -7.744  34.284 4.548   1.00 38.42  ? 871  PHE A CD1 1 
ATOM   2024 C  CD2 . PHE A 1 280 ? -7.908  32.263 3.269   1.00 37.75  ? 871  PHE A CD2 1 
ATOM   2025 C  CE1 . PHE A 1 280 ? -6.375  34.361 4.260   1.00 38.98  ? 871  PHE A CE1 1 
ATOM   2026 C  CE2 . PHE A 1 280 ? -6.550  32.368 2.936   1.00 40.27  ? 871  PHE A CE2 1 
ATOM   2027 C  CZ  . PHE A 1 280 ? -5.789  33.417 3.442   1.00 37.59  ? 871  PHE A CZ  1 
ATOM   2028 N  N   . ALA A 1 281 ? -12.662 32.588 6.480   1.00 39.64  ? 872  ALA A N   1 
ATOM   2029 C  CA  . ALA A 1 281 ? -13.986 33.031 6.947   1.00 39.71  ? 872  ALA A CA  1 
ATOM   2030 C  C   . ALA A 1 281 ? -13.921 33.505 8.405   1.00 43.13  ? 872  ALA A C   1 
ATOM   2031 O  O   . ALA A 1 281 ? -14.552 34.500 8.763   1.00 43.10  ? 872  ALA A O   1 
ATOM   2032 C  CB  . ALA A 1 281 ? -15.010 31.912 6.788   1.00 41.34  ? 872  ALA A CB  1 
ATOM   2033 N  N   . GLU A 1 282 ? -13.117 32.816 9.222   1.00 39.78  ? 873  GLU A N   1 
ATOM   2034 C  CA  . GLU A 1 282 ? -12.900 33.153 10.617  1.00 40.97  ? 873  GLU A CA  1 
ATOM   2035 C  C   . GLU A 1 282 ? -12.103 34.423 10.740  1.00 40.79  ? 873  GLU A C   1 
ATOM   2036 O  O   . GLU A 1 282 ? -12.385 35.230 11.616  1.00 39.28  ? 873  GLU A O   1 
ATOM   2037 C  CB  . GLU A 1 282 ? -12.132 32.051 11.346  1.00 44.13  ? 873  GLU A CB  1 
ATOM   2038 C  CG  . GLU A 1 282 ? -12.887 30.754 11.536  1.00 62.09  ? 873  GLU A CG  1 
ATOM   2039 C  CD  . GLU A 1 282 ? -11.964 29.703 12.128  1.00 81.14  ? 873  GLU A CD  1 
ATOM   2040 O  OE1 . GLU A 1 282 ? -11.538 28.801 11.367  1.00 47.25  ? 873  GLU A OE1 1 
ATOM   2041 O  OE2 . GLU A 1 282 ? -11.555 29.866 13.304  1.00 74.85  ? 873  GLU A OE2 1 
ATOM   2042 N  N   . ILE A 1 283 ? -11.069 34.571 9.910   1.00 38.14  ? 874  ILE A N   1 
ATOM   2043 C  CA  . ILE A 1 283 ? -10.218 35.758 9.899   1.00 37.87  ? 874  ILE A CA  1 
ATOM   2044 C  C   . ILE A 1 283 ? -11.091 37.001 9.651   1.00 41.63  ? 874  ILE A C   1 
ATOM   2045 O  O   . ILE A 1 283 ? -11.036 37.958 10.430  1.00 42.15  ? 874  ILE A O   1 
ATOM   2046 C  CB  . ILE A 1 283 ? -9.042  35.604 8.895   1.00 39.70  ? 874  ILE A CB  1 
ATOM   2047 C  CG1 . ILE A 1 283 ? -8.046  34.499 9.388   1.00 40.74  ? 874  ILE A CG1 1 
ATOM   2048 C  CG2 . ILE A 1 283 ? -8.333  36.939 8.717   1.00 39.48  ? 874  ILE A CG2 1 
ATOM   2049 C  CD1 . ILE A 1 283 ? -7.075  33.997 8.352   1.00 45.40  ? 874  ILE A CD1 1 
ATOM   2050 N  N   . VAL A 1 284 ? -11.979 36.925 8.645   1.00 36.99  ? 875  VAL A N   1 
ATOM   2051 C  CA  . VAL A 1 284 ? -12.903 38.022 8.337   1.00 35.73  ? 875  VAL A CA  1 
ATOM   2052 C  C   . VAL A 1 284 ? -13.789 38.358 9.559   1.00 40.04  ? 875  VAL A C   1 
ATOM   2053 O  O   . VAL A 1 284 ? -13.919 39.532 9.940   1.00 38.48  ? 875  VAL A O   1 
ATOM   2054 C  CB  . VAL A 1 284 ? -13.755 37.701 7.083   1.00 37.40  ? 875  VAL A CB  1 
ATOM   2055 C  CG1 . VAL A 1 284 ? -14.842 38.761 6.872   1.00 36.67  ? 875  VAL A CG1 1 
ATOM   2056 C  CG2 . VAL A 1 284 ? -12.875 37.570 5.847   1.00 35.07  ? 875  VAL A CG2 1 
ATOM   2057 N  N   . ASN A 1 285 ? -14.380 37.317 10.172  1.00 37.59  ? 876  ASN A N   1 
ATOM   2058 C  CA  . ASN A 1 285 ? -15.252 37.482 11.333  1.00 39.65  ? 876  ASN A CA  1 
ATOM   2059 C  C   . ASN A 1 285 ? -14.545 38.149 12.497  1.00 42.20  ? 876  ASN A C   1 
ATOM   2060 O  O   . ASN A 1 285 ? -15.121 39.021 13.123  1.00 42.67  ? 876  ASN A O   1 
ATOM   2061 C  CB  . ASN A 1 285 ? -15.850 36.133 11.766  1.00 43.26  ? 876  ASN A CB  1 
ATOM   2062 C  CG  . ASN A 1 285 ? -16.881 35.609 10.807  1.00 52.71  ? 876  ASN A CG  1 
ATOM   2063 O  OD1 . ASN A 1 285 ? -17.404 36.332 9.955   1.00 41.88  ? 876  ASN A OD1 1 
ATOM   2064 N  ND2 . ASN A 1 285 ? -17.214 34.337 10.948  1.00 48.14  ? 876  ASN A ND2 1 
ATOM   2065 N  N   . THR A 1 286 ? -13.298 37.755 12.750  1.00 38.76  ? 877  THR A N   1 
ATOM   2066 C  CA  . THR A 1 286 ? -12.444 38.292 13.801  1.00 41.43  ? 877  THR A CA  1 
ATOM   2067 C  C   . THR A 1 286 ? -12.175 39.771 13.581  1.00 44.80  ? 877  THR A C   1 
ATOM   2068 O  O   . THR A 1 286 ? -12.329 40.547 14.521  1.00 44.49  ? 877  THR A O   1 
ATOM   2069 C  CB  . THR A 1 286 ? -11.158 37.464 13.918  1.00 44.56  ? 877  THR A CB  1 
ATOM   2070 O  OG1 . THR A 1 286 ? -11.556 36.138 14.232  1.00 48.05  ? 877  THR A OG1 1 
ATOM   2071 C  CG2 . THR A 1 286 ? -10.216 37.988 14.994  1.00 41.28  ? 877  THR A CG2 1 
ATOM   2072 N  N   . LEU A 1 287 ? -11.786 40.150 12.348  1.00 40.04  ? 878  LEU A N   1 
ATOM   2073 C  CA  . LEU A 1 287 ? -11.519 41.535 11.973  1.00 39.84  ? 878  LEU A CA  1 
ATOM   2074 C  C   . LEU A 1 287 ? -12.792 42.389 12.043  1.00 44.03  ? 878  LEU A C   1 
ATOM   2075 O  O   . LEU A 1 287 ? -12.728 43.525 12.506  1.00 43.84  ? 878  LEU A O   1 
ATOM   2076 C  CB  . LEU A 1 287 ? -10.863 41.607 10.571  1.00 38.45  ? 878  LEU A CB  1 
ATOM   2077 C  CG  . LEU A 1 287 ? -9.468  41.004 10.487  1.00 41.87  ? 878  LEU A CG  1 
ATOM   2078 C  CD1 . LEU A 1 287 ? -9.018  40.927 9.062   1.00 40.93  ? 878  LEU A CD1 1 
ATOM   2079 C  CD2 . LEU A 1 287 ? -8.441  41.734 11.400  1.00 39.81  ? 878  LEU A CD2 1 
ATOM   2080 N  N   . ASP A 1 288 ? -13.951 41.819 11.644  1.00 40.93  ? 879  ASP A N   1 
ATOM   2081 C  CA  . ASP A 1 288 ? -15.261 42.473 11.738  1.00 40.91  ? 879  ASP A CA  1 
ATOM   2082 C  C   . ASP A 1 288 ? -15.654 42.769 13.175  1.00 46.24  ? 879  ASP A C   1 
ATOM   2083 O  O   . ASP A 1 288 ? -16.195 43.840 13.445  1.00 46.95  ? 879  ASP A O   1 
ATOM   2084 C  CB  . ASP A 1 288 ? -16.344 41.668 11.018  1.00 41.88  ? 879  ASP A CB  1 
ATOM   2085 C  CG  . ASP A 1 288 ? -16.337 41.845 9.508   1.00 46.24  ? 879  ASP A CG  1 
ATOM   2086 O  OD1 . ASP A 1 288 ? -15.641 42.759 9.018   1.00 50.01  ? 879  ASP A OD1 1 
ATOM   2087 O  OD2 . ASP A 1 288 ? -17.014 41.065 8.819   1.00 43.46  ? 879  ASP A OD2 1 
ATOM   2088 N  N   . LYS A 1 289 ? -15.329 41.857 14.108  1.00 42.70  ? 880  LYS A N   1 
ATOM   2089 C  CA  . LYS A 1 289 ? -15.605 42.069 15.524  1.00 43.63  ? 880  LYS A CA  1 
ATOM   2090 C  C   . LYS A 1 289 ? -14.688 43.141 16.100  1.00 46.08  ? 880  LYS A C   1 
ATOM   2091 O  O   . LYS A 1 289 ? -15.152 43.941 16.900  1.00 45.45  ? 880  LYS A O   1 
ATOM   2092 C  CB  . LYS A 1 289 ? -15.492 40.768 16.340  1.00 46.55  ? 880  LYS A CB  1 
ATOM   2093 C  CG  . LYS A 1 289 ? -16.594 39.752 16.060  1.00 55.23  ? 880  LYS A CG  1 
ATOM   2094 C  CD  . LYS A 1 289 ? -16.220 38.395 16.642  1.00 73.59  ? 880  LYS A CD  1 
ATOM   2095 C  CE  . LYS A 1 289 ? -17.246 37.332 16.335  1.00 91.46  ? 880  LYS A CE  1 
ATOM   2096 N  NZ  . LYS A 1 289 ? -16.724 35.965 16.603  1.00 102.07 ? 880  LYS A NZ  1 
ATOM   2097 N  N   . MET A 1 290 ? -13.404 43.192 15.680  1.00 43.84  ? 881  MET A N   1 
ATOM   2098 C  CA  . MET A 1 290 ? -12.434 44.189 16.183  1.00 43.90  ? 881  MET A CA  1 
ATOM   2099 C  C   . MET A 1 290 ? -12.863 45.588 15.769  1.00 48.63  ? 881  MET A C   1 
ATOM   2100 O  O   . MET A 1 290 ? -12.851 46.503 16.599  1.00 49.28  ? 881  MET A O   1 
ATOM   2101 C  CB  . MET A 1 290 ? -11.023 43.919 15.646  1.00 44.56  ? 881  MET A CB  1 
ATOM   2102 C  CG  . MET A 1 290 ? -10.347 42.747 16.237  1.00 47.50  ? 881  MET A CG  1 
ATOM   2103 S  SD  . MET A 1 290 ? -8.810  42.496 15.324  1.00 49.34  ? 881  MET A SD  1 
ATOM   2104 C  CE  . MET A 1 290 ? -8.177  41.024 16.149  1.00 46.41  ? 881  MET A CE  1 
ATOM   2105 N  N   . ILE A 1 291 ? -13.277 45.736 14.489  1.00 44.97  ? 882  ILE A N   1 
ATOM   2106 C  CA  . ILE A 1 291 ? -13.776 46.992 13.907  1.00 45.04  ? 882  ILE A CA  1 
ATOM   2107 C  C   . ILE A 1 291 ? -14.976 47.525 14.720  1.00 51.10  ? 882  ILE A C   1 
ATOM   2108 O  O   . ILE A 1 291 ? -15.113 48.741 14.904  1.00 53.33  ? 882  ILE A O   1 
ATOM   2109 C  CB  . ILE A 1 291 ? -14.085 46.795 12.381  1.00 46.34  ? 882  ILE A CB  1 
ATOM   2110 C  CG1 . ILE A 1 291 ? -12.766 46.797 11.553  1.00 45.15  ? 882  ILE A CG1 1 
ATOM   2111 C  CG2 . ILE A 1 291 ? -15.084 47.830 11.841  1.00 48.01  ? 882  ILE A CG2 1 
ATOM   2112 C  CD1 . ILE A 1 291 ? -12.833 46.067 10.133  1.00 49.55  ? 882  ILE A CD1 1 
ATOM   2113 N  N   . ARG A 1 292 ? -15.791 46.612 15.262  1.00 46.10  ? 883  ARG A N   1 
ATOM   2114 C  CA  . ARG A 1 292 ? -16.982 46.941 16.054  1.00 46.95  ? 883  ARG A CA  1 
ATOM   2115 C  C   . ARG A 1 292 ? -16.743 46.978 17.569  1.00 52.94  ? 883  ARG A C   1 
ATOM   2116 O  O   . ARG A 1 292 ? -17.579 47.503 18.291  1.00 53.85  ? 883  ARG A O   1 
ATOM   2117 C  CB  . ARG A 1 292 ? -18.135 46.005 15.691  1.00 43.33  ? 883  ARG A CB  1 
ATOM   2118 C  CG  . ARG A 1 292 ? -18.720 46.357 14.327  1.00 44.01  ? 883  ARG A CG  1 
ATOM   2119 C  CD  . ARG A 1 292 ? -19.368 45.160 13.635  1.00 44.45  ? 883  ARG A CD  1 
ATOM   2120 N  NE  . ARG A 1 292 ? -19.827 45.479 12.279  1.00 43.61  ? 883  ARG A NE  1 
ATOM   2121 C  CZ  . ARG A 1 292 ? -19.038 45.499 11.207  1.00 49.59  ? 883  ARG A CZ  1 
ATOM   2122 N  NH1 . ARG A 1 292 ? -17.740 45.242 11.322  1.00 42.38  ? 883  ARG A NH1 1 
ATOM   2123 N  NH2 . ARG A 1 292 ? -19.534 45.805 10.021  1.00 38.07  ? 883  ARG A NH2 1 
ATOM   2124 N  N   . ASN A 1 293 ? -15.606 46.453 18.048  1.00 51.25  ? 884  ASN A N   1 
ATOM   2125 C  CA  . ASN A 1 293 ? -15.287 46.466 19.474  1.00 54.10  ? 884  ASN A CA  1 
ATOM   2126 C  C   . ASN A 1 293 ? -13.958 47.208 19.736  1.00 57.95  ? 884  ASN A C   1 
ATOM   2127 O  O   . ASN A 1 293 ? -12.886 46.593 19.723  1.00 54.90  ? 884  ASN A O   1 
ATOM   2128 C  CB  . ASN A 1 293 ? -15.334 45.051 20.065  1.00 57.10  ? 884  ASN A CB  1 
ATOM   2129 C  CG  . ASN A 1 293 ? -14.960 44.961 21.533  1.00 85.78  ? 884  ASN A CG  1 
ATOM   2130 O  OD1 . ASN A 1 293 ? -14.277 44.029 21.946  1.00 85.42  ? 884  ASN A OD1 1 
ATOM   2131 N  ND2 . ASN A 1 293 ? -15.409 45.904 22.363  1.00 73.97  ? 884  ASN A ND2 1 
ATOM   2132 N  N   . PRO A 1 294 ? -14.024 48.549 19.942  1.00 59.55  ? 885  PRO A N   1 
ATOM   2133 C  CA  . PRO A 1 294 ? -12.786 49.332 20.141  1.00 61.05  ? 885  PRO A CA  1 
ATOM   2134 C  C   . PRO A 1 294 ? -11.873 48.869 21.283  1.00 68.55  ? 885  PRO A C   1 
ATOM   2135 O  O   . PRO A 1 294 ? -10.660 49.047 21.184  1.00 69.01  ? 885  PRO A O   1 
ATOM   2136 C  CB  . PRO A 1 294 ? -13.285 50.766 20.356  1.00 63.72  ? 885  PRO A CB  1 
ATOM   2137 C  CG  . PRO A 1 294 ? -14.730 50.656 20.600  1.00 68.27  ? 885  PRO A CG  1 
ATOM   2138 C  CD  . PRO A 1 294 ? -15.217 49.425 19.943  1.00 61.84  ? 885  PRO A CD  1 
ATOM   2139 N  N   . ALA A 1 295 ? -12.442 48.258 22.338  1.00 67.20  ? 886  ALA A N   1 
ATOM   2140 C  CA  . ALA A 1 295 ? -11.688 47.730 23.476  1.00 69.44  ? 886  ALA A CA  1 
ATOM   2141 C  C   . ALA A 1 295 ? -10.718 46.617 23.031  1.00 74.21  ? 886  ALA A C   1 
ATOM   2142 O  O   . ALA A 1 295 ? -9.615  46.528 23.569  1.00 75.19  ? 886  ALA A O   1 
ATOM   2143 C  CB  . ALA A 1 295 ? -12.642 47.206 24.537  1.00 71.59  ? 886  ALA A CB  1 
ATOM   2144 N  N   . SER A 1 296 ? -11.115 45.801 22.023  1.00 68.67  ? 887  SER A N   1 
ATOM   2145 C  CA  . SER A 1 296 ? -10.295 44.711 21.487  1.00 67.38  ? 887  SER A CA  1 
ATOM   2146 C  C   . SER A 1 296 ? -8.995  45.189 20.803  1.00 73.05  ? 887  SER A C   1 
ATOM   2147 O  O   . SER A 1 296 ? -8.053  44.412 20.721  1.00 72.80  ? 887  SER A O   1 
ATOM   2148 C  CB  . SER A 1 296 ? -11.116 43.815 20.561  1.00 67.57  ? 887  SER A CB  1 
ATOM   2149 O  OG  . SER A 1 296 ? -11.323 44.398 19.287  1.00 71.02  ? 887  SER A OG  1 
ATOM   2150 N  N   . LEU A 1 297 ? -8.931  46.451 20.336  1.00 71.40  ? 888  LEU A N   1 
ATOM   2151 C  CA  . LEU A 1 297 ? -7.729  46.995 19.682  1.00 70.71  ? 888  LEU A CA  1 
ATOM   2152 C  C   . LEU A 1 297 ? -7.012  48.037 20.580  1.00 80.70  ? 888  LEU A C   1 
ATOM   2153 O  O   . LEU A 1 297 ? -6.221  48.846 20.082  1.00 81.26  ? 888  LEU A O   1 
ATOM   2154 C  CB  . LEU A 1 297 ? -8.128  47.639 18.335  1.00 68.11  ? 888  LEU A CB  1 
ATOM   2155 C  CG  . LEU A 1 297 ? -8.658  46.717 17.234  1.00 69.71  ? 888  LEU A CG  1 
ATOM   2156 C  CD1 . LEU A 1 297 ? -9.175  47.533 16.052  1.00 68.21  ? 888  LEU A CD1 1 
ATOM   2157 C  CD2 . LEU A 1 297 ? -7.598  45.752 16.778  1.00 68.74  ? 888  LEU A CD2 1 
ATOM   2158 N  N   . LYS A 1 298 ? -7.396  48.084 21.881  1.00 81.10  ? 889  LYS A N   1 
ATOM   2159 C  CA  . LYS A 1 298 ? -6.929  49.070 22.874  1.00 84.34  ? 889  LYS A CA  1 
ATOM   2160 C  C   . LYS A 1 298 ? -5.868  48.555 23.868  1.00 91.96  ? 889  LYS A C   1 
ATOM   2161 O  O   . LYS A 1 298 ? -5.565  49.246 24.844  1.00 94.39  ? 889  LYS A O   1 
ATOM   2162 C  CB  . LYS A 1 298 ? -8.130  49.670 23.638  1.00 88.29  ? 889  LYS A CB  1 
ATOM   2163 N  N   . THR A 1 299 ? -5.301  47.364 23.620  1.00 88.96  ? 890  THR A N   1 
ATOM   2164 C  CA  . THR A 1 299 ? -4.245  46.778 24.456  1.00 90.96  ? 890  THR A CA  1 
ATOM   2165 C  C   . THR A 1 299 ? -3.112  46.239 23.583  1.00 93.41  ? 890  THR A C   1 
ATOM   2166 O  O   . THR A 1 299 ? -3.363  45.423 22.705  1.00 89.94  ? 890  THR A O   1 
ATOM   2167 C  CB  . THR A 1 299 ? -4.794  45.753 25.474  1.00 102.67 ? 890  THR A CB  1 
ATOM   2168 O  OG1 . THR A 1 299 ? -6.004  45.165 24.988  1.00 104.37 ? 890  THR A OG1 1 
ATOM   2169 C  CG2 . THR A 1 299 ? -5.036  46.371 26.836  1.00 103.90 ? 890  THR A CG2 1 
ATOM   2170 N  N   . VAL A 1 300 ? -1.879  46.740 23.804  1.00 92.12  ? 891  VAL A N   1 
ATOM   2171 C  CA  . VAL A 1 300 ? -0.641  46.373 23.088  1.00 91.25  ? 891  VAL A CA  1 
ATOM   2172 C  C   . VAL A 1 300 ? -0.045  45.115 23.787  1.00 97.10  ? 891  VAL A C   1 
ATOM   2173 O  O   . VAL A 1 300 ? -0.460  44.793 24.906  1.00 98.14  ? 891  VAL A O   1 
ATOM   2174 C  CB  . VAL A 1 300 ? 0.352   47.588 23.050  1.00 95.70  ? 891  VAL A CB  1 
ATOM   2175 C  CG1 . VAL A 1 300 ? 1.573   47.308 22.176  1.00 94.73  ? 891  VAL A CG1 1 
ATOM   2176 C  CG2 . VAL A 1 300 ? -0.343  48.866 22.577  1.00 94.64  ? 891  VAL A CG2 1 
ATOM   2177 N  N   . ALA A 1 301 ? 0.891   44.398 23.115  1.00 93.70  ? 892  ALA A N   1 
ATOM   2178 C  CA  . ALA A 1 301 ? 1.560   43.176 23.598  1.00 128.46 ? 892  ALA A CA  1 
ATOM   2179 C  C   . ALA A 1 301 ? 2.160   43.268 25.011  1.00 153.23 ? 892  ALA A C   1 
ATOM   2180 O  O   . ALA A 1 301 ? 2.423   42.243 25.647  1.00 111.64 ? 892  ALA A O   1 
ATOM   2181 C  CB  . ALA A 1 301 ? 2.631   42.757 22.614  1.00 128.36 ? 892  ALA A CB  1 
ATOM   2182 N  N   . GLU B 1 18  ? -24.528 33.952 17.717  1.00 66.02  ? 609  GLU B N   1 
ATOM   2183 C  CA  . GLU B 1 18  ? -23.681 35.144 17.684  1.00 64.96  ? 609  GLU B CA  1 
ATOM   2184 C  C   . GLU B 1 18  ? -23.397 35.653 16.247  1.00 65.67  ? 609  GLU B C   1 
ATOM   2185 O  O   . GLU B 1 18  ? -23.055 34.871 15.354  1.00 64.75  ? 609  GLU B O   1 
ATOM   2186 C  CB  . GLU B 1 18  ? -22.378 34.915 18.458  1.00 67.15  ? 609  GLU B CB  1 
ATOM   2187 N  N   . PHE B 1 19  ? -23.556 36.972 16.039  1.00 58.63  ? 610  PHE B N   1 
ATOM   2188 C  CA  . PHE B 1 19  ? -23.357 37.655 14.761  1.00 54.66  ? 610  PHE B CA  1 
ATOM   2189 C  C   . PHE B 1 19  ? -22.059 38.466 14.822  1.00 54.26  ? 610  PHE B C   1 
ATOM   2190 O  O   . PHE B 1 19  ? -21.898 39.306 15.714  1.00 53.85  ? 610  PHE B O   1 
ATOM   2191 C  CB  . PHE B 1 19  ? -24.545 38.587 14.456  1.00 56.53  ? 610  PHE B CB  1 
ATOM   2192 C  CG  . PHE B 1 19  ? -25.893 37.925 14.251  1.00 58.58  ? 610  PHE B CG  1 
ATOM   2193 C  CD1 . PHE B 1 19  ? -26.376 37.669 12.969  1.00 61.11  ? 610  PHE B CD1 1 
ATOM   2194 C  CD2 . PHE B 1 19  ? -26.693 37.586 15.337  1.00 62.43  ? 610  PHE B CD2 1 
ATOM   2195 C  CE1 . PHE B 1 19  ? -27.632 37.063 12.778  1.00 62.22  ? 610  PHE B CE1 1 
ATOM   2196 C  CE2 . PHE B 1 19  ? -27.933 36.959 15.146  1.00 65.87  ? 610  PHE B CE2 1 
ATOM   2197 C  CZ  . PHE B 1 19  ? -28.401 36.720 13.868  1.00 62.53  ? 610  PHE B CZ  1 
ATOM   2198 N  N   . ALA B 1 20  ? -21.116 38.194 13.886  1.00 47.03  ? 611  ALA B N   1 
ATOM   2199 C  CA  . ALA B 1 20  ? -19.823 38.899 13.792  1.00 45.54  ? 611  ALA B CA  1 
ATOM   2200 C  C   . ALA B 1 20  ? -20.053 40.384 13.529  1.00 45.59  ? 611  ALA B C   1 
ATOM   2201 O  O   . ALA B 1 20  ? -19.229 41.207 13.918  1.00 42.34  ? 611  ALA B O   1 
ATOM   2202 C  CB  . ALA B 1 20  ? -18.989 38.320 12.660  1.00 45.02  ? 611  ALA B CB  1 
ATOM   2203 N  N   . LYS B 1 21  ? -21.178 40.724 12.860  1.00 41.41  ? 612  LYS B N   1 
ATOM   2204 C  CA  . LYS B 1 21  ? -21.513 42.109 12.573  1.00 41.05  ? 612  LYS B CA  1 
ATOM   2205 C  C   . LYS B 1 21  ? -22.459 42.734 13.634  1.00 46.37  ? 612  LYS B C   1 
ATOM   2206 O  O   . LYS B 1 21  ? -23.066 43.767 13.369  1.00 47.24  ? 612  LYS B O   1 
ATOM   2207 C  CB  . LYS B 1 21  ? -22.031 42.253 11.140  1.00 41.06  ? 612  LYS B CB  1 
ATOM   2208 C  CG  . LYS B 1 21  ? -20.877 42.201 10.160  1.00 43.36  ? 612  LYS B CG  1 
ATOM   2209 C  CD  . LYS B 1 21  ? -21.355 42.144 8.728   1.00 52.71  ? 612  LYS B CD  1 
ATOM   2210 C  CE  . LYS B 1 21  ? -20.202 42.171 7.741   1.00 46.18  ? 612  LYS B CE  1 
ATOM   2211 N  NZ  . LYS B 1 21  ? -20.699 42.142 6.341   1.00 56.10  ? 612  LYS B NZ  1 
ATOM   2212 N  N   . GLU B 1 22  ? -22.513 42.154 14.860  1.00 41.73  ? 613  GLU B N   1 
ATOM   2213 C  CA  . GLU B 1 22  ? -23.286 42.724 15.976  1.00 41.41  ? 613  GLU B CA  1 
ATOM   2214 C  C   . GLU B 1 22  ? -22.705 44.117 16.271  1.00 46.12  ? 613  GLU B C   1 
ATOM   2215 O  O   . GLU B 1 22  ? -21.475 44.291 16.323  1.00 43.45  ? 613  GLU B O   1 
ATOM   2216 C  CB  . GLU B 1 22  ? -23.202 41.847 17.236  1.00 42.64  ? 613  GLU B CB  1 
ATOM   2217 C  CG  . GLU B 1 22  ? -24.141 42.285 18.360  1.00 47.53  ? 613  GLU B CG  1 
ATOM   2218 C  CD  . GLU B 1 22  ? -25.593 41.854 18.264  1.00 66.05  ? 613  GLU B CD  1 
ATOM   2219 O  OE1 . GLU B 1 22  ? -25.870 40.836 17.585  1.00 62.80  ? 613  GLU B OE1 1 
ATOM   2220 O  OE2 . GLU B 1 22  ? -26.447 42.496 18.922  1.00 60.82  ? 613  GLU B OE2 1 
ATOM   2221 N  N   . ILE B 1 23  ? -23.593 45.106 16.432  1.00 44.78  ? 614  ILE B N   1 
ATOM   2222 C  CA  . ILE B 1 23  ? -23.163 46.471 16.712  1.00 45.64  ? 614  ILE B CA  1 
ATOM   2223 C  C   . ILE B 1 23  ? -23.841 46.991 17.958  1.00 53.23  ? 614  ILE B C   1 
ATOM   2224 O  O   . ILE B 1 23  ? -25.012 46.673 18.210  1.00 55.71  ? 614  ILE B O   1 
ATOM   2225 C  CB  . ILE B 1 23  ? -23.341 47.469 15.508  1.00 47.24  ? 614  ILE B CB  1 
ATOM   2226 C  CG1 . ILE B 1 23  ? -24.794 47.527 14.985  1.00 48.42  ? 614  ILE B CG1 1 
ATOM   2227 C  CG2 . ILE B 1 23  ? -22.364 47.209 14.381  1.00 43.97  ? 614  ILE B CG2 1 
ATOM   2228 C  CD1 . ILE B 1 23  ? -25.358 48.773 15.122  1.00 52.62  ? 614  ILE B CD1 1 
ATOM   2229 N  N   . ASP B 1 24  ? -23.125 47.841 18.701  1.00 49.43  ? 615  ASP B N   1 
ATOM   2230 C  CA  . ASP B 1 24  ? -23.688 48.532 19.840  1.00 51.88  ? 615  ASP B CA  1 
ATOM   2231 C  C   . ASP B 1 24  ? -24.788 49.476 19.289  1.00 55.90  ? 615  ASP B C   1 
ATOM   2232 O  O   . ASP B 1 24  ? -24.550 50.113 18.261  1.00 53.13  ? 615  ASP B O   1 
ATOM   2233 C  CB  . ASP B 1 24  ? -22.593 49.341 20.539  1.00 55.23  ? 615  ASP B CB  1 
ATOM   2234 C  CG  . ASP B 1 24  ? -23.074 49.946 21.845  1.00 72.04  ? 615  ASP B CG  1 
ATOM   2235 O  OD1 . ASP B 1 24  ? -23.771 50.981 21.796  1.00 73.14  ? 615  ASP B OD1 1 
ATOM   2236 O  OD2 . ASP B 1 24  ? -22.819 49.341 22.909  1.00 81.14  ? 615  ASP B OD2 1 
ATOM   2237 N  N   . VAL B 1 25  ? -25.988 49.546 19.941  1.00 55.16  ? 616  VAL B N   1 
ATOM   2238 C  CA  . VAL B 1 25  ? -27.109 50.425 19.506  1.00 55.88  ? 616  VAL B CA  1 
ATOM   2239 C  C   . VAL B 1 25  ? -26.692 51.895 19.321  1.00 58.55  ? 616  VAL B C   1 
ATOM   2240 O  O   . VAL B 1 25  ? -27.262 52.555 18.456  1.00 60.04  ? 616  VAL B O   1 
ATOM   2241 C  CB  . VAL B 1 25  ? -28.410 50.354 20.352  1.00 62.35  ? 616  VAL B CB  1 
ATOM   2242 C  CG1 . VAL B 1 25  ? -29.431 49.390 19.748  1.00 61.87  ? 616  VAL B CG1 1 
ATOM   2243 C  CG2 . VAL B 1 25  ? -28.123 50.045 21.815  1.00 64.00  ? 616  VAL B CG2 1 
ATOM   2244 N  N   . SER B 1 26  ? -25.713 52.396 20.105  1.00 52.84  ? 617  SER B N   1 
ATOM   2245 C  CA  . SER B 1 26  ? -25.235 53.782 20.006  1.00 52.92  ? 617  SER B CA  1 
ATOM   2246 C  C   . SER B 1 26  ? -24.574 54.119 18.650  1.00 56.76  ? 617  SER B C   1 
ATOM   2247 O  O   . SER B 1 26  ? -24.445 55.299 18.315  1.00 56.94  ? 617  SER B O   1 
ATOM   2248 C  CB  . SER B 1 26  ? -24.292 54.126 21.155  1.00 57.30  ? 617  SER B CB  1 
ATOM   2249 O  OG  . SER B 1 26  ? -23.028 53.489 21.041  1.00 64.23  ? 617  SER B OG  1 
ATOM   2250 N  N   . PHE B 1 27  ? -24.132 53.094 17.880  1.00 51.87  ? 618  PHE B N   1 
ATOM   2251 C  CA  . PHE B 1 27  ? -23.524 53.313 16.557  1.00 48.98  ? 618  PHE B CA  1 
ATOM   2252 C  C   . PHE B 1 27  ? -24.583 53.717 15.520  1.00 53.55  ? 618  PHE B C   1 
ATOM   2253 O  O   . PHE B 1 27  ? -24.225 54.354 14.531  1.00 52.06  ? 618  PHE B O   1 
ATOM   2254 C  CB  . PHE B 1 27  ? -22.728 52.079 16.072  1.00 48.01  ? 618  PHE B CB  1 
ATOM   2255 C  CG  . PHE B 1 27  ? -21.539 51.632 16.900  1.00 48.16  ? 618  PHE B CG  1 
ATOM   2256 C  CD1 . PHE B 1 27  ? -21.067 52.408 17.957  1.00 52.19  ? 618  PHE B CD1 1 
ATOM   2257 C  CD2 . PHE B 1 27  ? -20.917 50.417 16.651  1.00 47.76  ? 618  PHE B CD2 1 
ATOM   2258 C  CE1 . PHE B 1 27  ? -19.981 51.980 18.736  1.00 52.35  ? 618  PHE B CE1 1 
ATOM   2259 C  CE2 . PHE B 1 27  ? -19.829 49.996 17.427  1.00 49.97  ? 618  PHE B CE2 1 
ATOM   2260 C  CZ  . PHE B 1 27  ? -19.368 50.782 18.462  1.00 48.94  ? 618  PHE B CZ  1 
ATOM   2261 N  N   . VAL B 1 28  ? -25.887 53.385 15.757  1.00 52.83  ? 619  VAL B N   1 
ATOM   2262 C  CA  . VAL B 1 28  ? -26.978 53.695 14.820  1.00 52.61  ? 619  VAL B CA  1 
ATOM   2263 C  C   . VAL B 1 28  ? -27.856 54.828 15.250  1.00 58.99  ? 619  VAL B C   1 
ATOM   2264 O  O   . VAL B 1 28  ? -28.280 54.886 16.399  1.00 60.84  ? 619  VAL B O   1 
ATOM   2265 C  CB  . VAL B 1 28  ? -27.896 52.505 14.407  1.00 54.94  ? 619  VAL B CB  1 
ATOM   2266 C  CG1 . VAL B 1 28  ? -27.790 52.218 12.922  1.00 52.75  ? 619  VAL B CG1 1 
ATOM   2267 C  CG2 . VAL B 1 28  ? -27.697 51.273 15.270  1.00 54.75  ? 619  VAL B CG2 1 
ATOM   2268 N  N   . LYS B 1 29  ? -28.232 55.661 14.276  1.00 56.03  ? 620  LYS B N   1 
ATOM   2269 C  CA  . LYS B 1 29  ? -29.170 56.763 14.438  1.00 57.10  ? 620  LYS B CA  1 
ATOM   2270 C  C   . LYS B 1 29  ? -30.276 56.498 13.411  1.00 60.14  ? 620  LYS B C   1 
ATOM   2271 O  O   . LYS B 1 29  ? -30.011 56.470 12.205  1.00 58.41  ? 620  LYS B O   1 
ATOM   2272 C  CB  . LYS B 1 29  ? -28.468 58.111 14.209  1.00 60.25  ? 620  LYS B CB  1 
ATOM   2273 C  CG  . LYS B 1 29  ? -29.355 59.323 14.470  1.00 81.07  ? 620  LYS B CG  1 
ATOM   2274 N  N   . ILE B 1 30  ? -31.490 56.218 13.898  1.00 58.16  ? 621  ILE B N   1 
ATOM   2275 C  CA  . ILE B 1 30  ? -32.654 55.960 13.053  1.00 57.92  ? 621  ILE B CA  1 
ATOM   2276 C  C   . ILE B 1 30  ? -33.295 57.293 12.654  1.00 64.25  ? 621  ILE B C   1 
ATOM   2277 O  O   . ILE B 1 30  ? -33.572 58.130 13.517  1.00 67.24  ? 621  ILE B O   1 
ATOM   2278 C  CB  . ILE B 1 30  ? -33.679 55.013 13.736  1.00 61.22  ? 621  ILE B CB  1 
ATOM   2279 C  CG1 . ILE B 1 30  ? -33.033 53.676 14.120  1.00 60.38  ? 621  ILE B CG1 1 
ATOM   2280 C  CG2 . ILE B 1 30  ? -34.930 54.803 12.861  1.00 59.92  ? 621  ILE B CG2 1 
ATOM   2281 C  CD1 . ILE B 1 30  ? -33.823 52.891 15.227  1.00 66.71  ? 621  ILE B CD1 1 
ATOM   2282 N  N   . GLU B 1 31  ? -33.524 57.477 11.348  1.00 59.54  ? 622  GLU B N   1 
ATOM   2283 C  CA  . GLU B 1 31  ? -34.167 58.670 10.820  1.00 60.78  ? 622  GLU B CA  1 
ATOM   2284 C  C   . GLU B 1 31  ? -35.552 58.314 10.228  1.00 66.61  ? 622  GLU B C   1 
ATOM   2285 O  O   . GLU B 1 31  ? -36.286 57.546 10.855  1.00 67.72  ? 622  GLU B O   1 
ATOM   2286 C  CB  . GLU B 1 31  ? -33.232 59.447 9.873   1.00 61.03  ? 622  GLU B CB  1 
ATOM   2287 C  CG  . GLU B 1 31  ? -32.055 60.048 10.629  1.00 67.56  ? 622  GLU B CG  1 
ATOM   2288 C  CD  . GLU B 1 31  ? -30.962 60.769 9.862   1.00 87.43  ? 622  GLU B CD  1 
ATOM   2289 O  OE1 . GLU B 1 31  ? -30.857 60.597 8.625   1.00 74.08  ? 622  GLU B OE1 1 
ATOM   2290 O  OE2 . GLU B 1 31  ? -30.188 61.499 10.520  1.00 87.05  ? 622  GLU B OE2 1 
ATOM   2291 N  N   . GLU B 1 32  ? -35.916 58.853 9.060   1.00 63.44  ? 623  GLU B N   1 
ATOM   2292 C  CA  . GLU B 1 32  ? -37.250 58.688 8.466   1.00 63.49  ? 623  GLU B CA  1 
ATOM   2293 C  C   . GLU B 1 32  ? -37.569 57.282 7.931   1.00 65.57  ? 623  GLU B C   1 
ATOM   2294 O  O   . GLU B 1 32  ? -36.668 56.542 7.536   1.00 63.02  ? 623  GLU B O   1 
ATOM   2295 C  CB  . GLU B 1 32  ? -37.481 59.751 7.362   1.00 65.36  ? 623  GLU B CB  1 
ATOM   2296 C  CG  . GLU B 1 32  ? -36.804 59.452 6.020   1.00 70.65  ? 623  GLU B CG  1 
ATOM   2297 C  CD  . GLU B 1 32  ? -35.464 60.099 5.726   1.00 83.66  ? 623  GLU B CD  1 
ATOM   2298 O  OE1 . GLU B 1 32  ? -34.643 60.255 6.660   1.00 75.05  ? 623  GLU B OE1 1 
ATOM   2299 O  OE2 . GLU B 1 32  ? -35.212 60.398 4.536   1.00 77.62  ? 623  GLU B OE2 1 
ATOM   2300 N  N   . VAL B 1 33  ? -38.871 56.944 7.887   1.00 62.99  ? 624  VAL B N   1 
ATOM   2301 C  CA  . VAL B 1 33  ? -39.381 55.697 7.305   1.00 61.39  ? 624  VAL B CA  1 
ATOM   2302 C  C   . VAL B 1 33  ? -39.201 55.806 5.788   1.00 62.77  ? 624  VAL B C   1 
ATOM   2303 O  O   . VAL B 1 33  ? -39.523 56.841 5.204   1.00 62.72  ? 624  VAL B O   1 
ATOM   2304 C  CB  . VAL B 1 33  ? -40.853 55.356 7.724   1.00 67.46  ? 624  VAL B CB  1 
ATOM   2305 C  CG1 . VAL B 1 33  ? -41.768 56.571 7.730   1.00 70.03  ? 624  VAL B CG1 1 
ATOM   2306 C  CG2 . VAL B 1 33  ? -41.443 54.221 6.889   1.00 66.09  ? 624  VAL B CG2 1 
ATOM   2307 N  N   . ILE B 1 34  ? -38.616 54.774 5.162   1.00 57.75  ? 625  ILE B N   1 
ATOM   2308 C  CA  . ILE B 1 34  ? -38.364 54.754 3.713   1.00 55.97  ? 625  ILE B CA  1 
ATOM   2309 C  C   . ILE B 1 34  ? -39.097 53.613 3.017   1.00 63.11  ? 625  ILE B C   1 
ATOM   2310 O  O   . ILE B 1 34  ? -39.150 53.565 1.783   1.00 63.01  ? 625  ILE B O   1 
ATOM   2311 C  CB  . ILE B 1 34  ? -36.851 54.778 3.365   1.00 55.71  ? 625  ILE B CB  1 
ATOM   2312 C  CG1 . ILE B 1 34  ? -36.095 53.561 3.987   1.00 53.39  ? 625  ILE B CG1 1 
ATOM   2313 C  CG2 . ILE B 1 34  ? -36.234 56.140 3.739   1.00 55.86  ? 625  ILE B CG2 1 
ATOM   2314 C  CD1 . ILE B 1 34  ? -34.614 53.366 3.509   1.00 53.72  ? 625  ILE B CD1 1 
ATOM   2315 N  N   . GLY B 1 35  ? -39.636 52.701 3.811   1.00 61.73  ? 626  GLY B N   1 
ATOM   2316 C  CA  . GLY B 1 35  ? -40.367 51.561 3.288   1.00 61.70  ? 626  GLY B CA  1 
ATOM   2317 C  C   . GLY B 1 35  ? -41.053 50.744 4.353   1.00 68.68  ? 626  GLY B C   1 
ATOM   2318 O  O   . GLY B 1 35  ? -41.012 51.069 5.546   1.00 68.46  ? 626  GLY B O   1 
ATOM   2319 N  N   . ALA B 1 36  ? -41.701 49.674 3.897   1.00 68.39  ? 627  ALA B N   1 
ATOM   2320 C  CA  . ALA B 1 36  ? -42.394 48.710 4.748   1.00 70.00  ? 627  ALA B CA  1 
ATOM   2321 C  C   . ALA B 1 36  ? -41.801 47.334 4.464   1.00 73.30  ? 627  ALA B C   1 
ATOM   2322 O  O   . ALA B 1 36  ? -41.293 47.091 3.360   1.00 71.27  ? 627  ALA B O   1 
ATOM   2323 C  CB  . ALA B 1 36  ? -43.891 48.724 4.462   1.00 71.98  ? 627  ALA B CB  1 
ATOM   2324 N  N   . GLY B 1 37  ? -41.802 46.492 5.490   1.00 70.14  ? 628  GLY B N   1 
ATOM   2325 C  CA  . GLY B 1 37  ? -41.310 45.120 5.450   1.00 68.49  ? 628  GLY B CA  1 
ATOM   2326 C  C   . GLY B 1 37  ? -42.343 44.189 6.050   1.00 73.36  ? 628  GLY B C   1 
ATOM   2327 O  O   . GLY B 1 37  ? -43.369 44.649 6.558   1.00 73.39  ? 628  GLY B O   1 
ATOM   2328 N  N   . GLU B 1 38  ? -42.082 42.875 5.992   1.00 70.36  ? 629  GLU B N   1 
ATOM   2329 C  CA  . GLU B 1 38  ? -42.983 41.848 6.518   1.00 71.41  ? 629  GLU B CA  1 
ATOM   2330 C  C   . GLU B 1 38  ? -43.190 41.954 8.044   1.00 74.36  ? 629  GLU B C   1 
ATOM   2331 O  O   . GLU B 1 38  ? -44.314 41.781 8.541   1.00 75.34  ? 629  GLU B O   1 
ATOM   2332 C  CB  . GLU B 1 38  ? -42.445 40.449 6.149   1.00 72.06  ? 629  GLU B CB  1 
ATOM   2333 C  CG  . GLU B 1 38  ? -43.425 39.318 6.444   1.00 86.01  ? 629  GLU B CG  1 
ATOM   2334 C  CD  . GLU B 1 38  ? -42.911 37.898 6.285   1.00 103.50 ? 629  GLU B CD  1 
ATOM   2335 O  OE1 . GLU B 1 38  ? -41.772 37.715 5.794   1.00 89.54  ? 629  GLU B OE1 1 
ATOM   2336 O  OE2 . GLU B 1 38  ? -43.661 36.964 6.650   1.00 95.59  ? 629  GLU B OE2 1 
ATOM   2337 N  N   . PHE B 1 39  ? -42.092 42.254 8.764   1.00 68.36  ? 630  PHE B N   1 
ATOM   2338 C  CA  . PHE B 1 39  ? -42.015 42.295 10.226  1.00 68.37  ? 630  PHE B CA  1 
ATOM   2339 C  C   . PHE B 1 39  ? -42.038 43.693 10.857  1.00 69.77  ? 630  PHE B C   1 
ATOM   2340 O  O   . PHE B 1 39  ? -42.112 43.814 12.086  1.00 70.37  ? 630  PHE B O   1 
ATOM   2341 C  CB  . PHE B 1 39  ? -40.752 41.536 10.669  1.00 69.48  ? 630  PHE B CB  1 
ATOM   2342 C  CG  . PHE B 1 39  ? -40.680 40.103 10.182  1.00 70.23  ? 630  PHE B CG  1 
ATOM   2343 C  CD1 . PHE B 1 39  ? -41.422 39.100 10.805  1.00 74.28  ? 630  PHE B CD1 1 
ATOM   2344 C  CD2 . PHE B 1 39  ? -39.892 39.761 9.084   1.00 70.24  ? 630  PHE B CD2 1 
ATOM   2345 C  CE1 . PHE B 1 39  ? -41.369 37.781 10.345  1.00 74.25  ? 630  PHE B CE1 1 
ATOM   2346 C  CE2 . PHE B 1 39  ? -39.824 38.435 8.638   1.00 71.92  ? 630  PHE B CE2 1 
ATOM   2347 C  CZ  . PHE B 1 39  ? -40.570 37.457 9.266   1.00 70.99  ? 630  PHE B CZ  1 
ATOM   2348 N  N   . GLY B 1 40  ? -41.966 44.724 10.023  1.00 63.22  ? 631  GLY B N   1 
ATOM   2349 C  CA  . GLY B 1 40  ? -41.934 46.105 10.484  1.00 63.59  ? 631  GLY B CA  1 
ATOM   2350 C  C   . GLY B 1 40  ? -41.484 47.059 9.408   1.00 65.88  ? 631  GLY B C   1 
ATOM   2351 O  O   . GLY B 1 40  ? -41.423 46.687 8.240   1.00 63.00  ? 631  GLY B O   1 
ATOM   2352 N  N   . GLU B 1 41  ? -41.160 48.291 9.791   1.00 64.51  ? 632  GLU B N   1 
ATOM   2353 C  CA  . GLU B 1 41  ? -40.761 49.332 8.849   1.00 64.32  ? 632  GLU B CA  1 
ATOM   2354 C  C   . GLU B 1 41  ? -39.287 49.285 8.472   1.00 67.28  ? 632  GLU B C   1 
ATOM   2355 O  O   . GLU B 1 41  ? -38.472 48.655 9.157   1.00 67.93  ? 632  GLU B O   1 
ATOM   2356 C  CB  . GLU B 1 41  ? -41.103 50.727 9.404   1.00 68.02  ? 632  GLU B CB  1 
ATOM   2357 C  CG  . GLU B 1 41  ? -42.565 50.924 9.784   1.00 82.35  ? 632  GLU B CG  1 
ATOM   2358 C  CD  . GLU B 1 41  ? -42.919 50.637 11.233  1.00 116.18 ? 632  GLU B CD  1 
ATOM   2359 O  OE1 . GLU B 1 41  ? -42.223 49.827 11.889  1.00 111.06 ? 632  GLU B OE1 1 
ATOM   2360 O  OE2 . GLU B 1 41  ? -43.927 51.209 11.706  1.00 119.60 ? 632  GLU B OE2 1 
ATOM   2361 N  N   . VAL B 1 42  ? -38.964 49.943 7.356   1.00 60.73  ? 633  VAL B N   1 
ATOM   2362 C  CA  . VAL B 1 42  ? -37.614 50.151 6.871   1.00 57.97  ? 633  VAL B CA  1 
ATOM   2363 C  C   . VAL B 1 42  ? -37.379 51.644 7.020   1.00 58.74  ? 633  VAL B C   1 
ATOM   2364 O  O   . VAL B 1 42  ? -38.213 52.451 6.598   1.00 58.37  ? 633  VAL B O   1 
ATOM   2365 C  CB  . VAL B 1 42  ? -37.347 49.641 5.429   1.00 60.35  ? 633  VAL B CB  1 
ATOM   2366 C  CG1 . VAL B 1 42  ? -35.877 49.836 5.047   1.00 57.70  ? 633  VAL B CG1 1 
ATOM   2367 C  CG2 . VAL B 1 42  ? -37.739 48.170 5.290   1.00 59.83  ? 633  VAL B CG2 1 
ATOM   2368 N  N   . TYR B 1 43  ? -36.277 52.003 7.684   1.00 53.39  ? 634  TYR B N   1 
ATOM   2369 C  CA  . TYR B 1 43  ? -35.910 53.389 7.928   1.00 53.41  ? 634  TYR B CA  1 
ATOM   2370 C  C   . TYR B 1 43  ? -34.592 53.735 7.298   1.00 54.81  ? 634  TYR B C   1 
ATOM   2371 O  O   . TYR B 1 43  ? -33.739 52.862 7.157   1.00 53.31  ? 634  TYR B O   1 
ATOM   2372 C  CB  . TYR B 1 43  ? -35.735 53.625 9.428   1.00 56.23  ? 634  TYR B CB  1 
ATOM   2373 C  CG  . TYR B 1 43  ? -36.956 53.342 10.272  1.00 60.69  ? 634  TYR B CG  1 
ATOM   2374 C  CD1 . TYR B 1 43  ? -37.218 52.060 10.747  1.00 62.75  ? 634  TYR B CD1 1 
ATOM   2375 C  CD2 . TYR B 1 43  ? -37.786 54.373 10.697  1.00 63.29  ? 634  TYR B CD2 1 
ATOM   2376 C  CE1 . TYR B 1 43  ? -38.318 51.801 11.566  1.00 65.72  ? 634  TYR B CE1 1 
ATOM   2377 C  CE2 . TYR B 1 43  ? -38.881 54.126 11.528  1.00 66.03  ? 634  TYR B CE2 1 
ATOM   2378 C  CZ  . TYR B 1 43  ? -39.148 52.835 11.952  1.00 72.72  ? 634  TYR B CZ  1 
ATOM   2379 O  OH  . TYR B 1 43  ? -40.219 52.582 12.777  1.00 77.91  ? 634  TYR B OH  1 
ATOM   2380 N  N   . LYS B 1 44  ? -34.387 55.029 6.992   1.00 51.18  ? 635  LYS B N   1 
ATOM   2381 C  CA  . LYS B 1 44  ? -33.083 55.528 6.596   1.00 50.18  ? 635  LYS B CA  1 
ATOM   2382 C  C   . LYS B 1 44  ? -32.400 55.806 7.936   1.00 54.53  ? 635  LYS B C   1 
ATOM   2383 O  O   . LYS B 1 44  ? -33.071 56.121 8.919   1.00 56.19  ? 635  LYS B O   1 
ATOM   2384 C  CB  . LYS B 1 44  ? -33.177 56.837 5.787   1.00 51.89  ? 635  LYS B CB  1 
ATOM   2385 C  CG  . LYS B 1 44  ? -31.843 57.199 5.134   1.00 51.42  ? 635  LYS B CG  1 
ATOM   2386 C  CD  . LYS B 1 44  ? -31.898 58.474 4.340   1.00 57.08  ? 635  LYS B CD  1 
ATOM   2387 C  CE  . LYS B 1 44  ? -30.540 58.802 3.780   1.00 74.16  ? 635  LYS B CE  1 
ATOM   2388 N  NZ  . LYS B 1 44  ? -30.574 60.023 2.939   1.00 87.64  ? 635  LYS B NZ  1 
ATOM   2389 N  N   . GLY B 1 45  ? -31.087 55.672 7.974   1.00 48.88  ? 636  GLY B N   1 
ATOM   2390 C  CA  . GLY B 1 45  ? -30.330 55.932 9.182   1.00 48.22  ? 636  GLY B CA  1 
ATOM   2391 C  C   . GLY B 1 45  ? -28.892 56.270 8.912   1.00 48.60  ? 636  GLY B C   1 
ATOM   2392 O  O   . GLY B 1 45  ? -28.480 56.360 7.759   1.00 45.29  ? 636  GLY B O   1 
ATOM   2393 N  N   . ARG B 1 46  ? -28.118 56.450 9.992   1.00 46.79  ? 637  ARG B N   1 
ATOM   2394 C  CA  . ARG B 1 46  ? -26.691 56.761 9.930   1.00 45.61  ? 637  ARG B CA  1 
ATOM   2395 C  C   . ARG B 1 46  ? -25.965 55.776 10.813  1.00 49.51  ? 637  ARG B C   1 
ATOM   2396 O  O   . ARG B 1 46  ? -26.406 55.495 11.934  1.00 49.11  ? 637  ARG B O   1 
ATOM   2397 C  CB  . ARG B 1 46  ? -26.403 58.191 10.391  1.00 48.08  ? 637  ARG B CB  1 
ATOM   2398 C  CG  . ARG B 1 46  ? -26.889 59.280 9.439   1.00 52.83  ? 637  ARG B CG  1 
ATOM   2399 C  CD  . ARG B 1 46  ? -26.921 60.625 10.145  1.00 60.57  ? 637  ARG B CD  1 
ATOM   2400 N  NE  . ARG B 1 46  ? -27.632 61.636 9.362   1.00 72.94  ? 637  ARG B NE  1 
ATOM   2401 C  CZ  . ARG B 1 46  ? -27.052 62.503 8.534   1.00 85.41  ? 637  ARG B CZ  1 
ATOM   2402 N  NH1 . ARG B 1 46  ? -25.733 62.496 8.370   1.00 67.40  ? 637  ARG B NH1 1 
ATOM   2403 N  NH2 . ARG B 1 46  ? -27.786 63.380 7.860   1.00 69.24  ? 637  ARG B NH2 1 
ATOM   2404 N  N   . LEU B 1 47  ? -24.881 55.204 10.278  1.00 44.13  ? 638  LEU B N   1 
ATOM   2405 C  CA  . LEU B 1 47  ? -24.074 54.255 11.023  1.00 43.35  ? 638  LEU B CA  1 
ATOM   2406 C  C   . LEU B 1 47  ? -22.668 54.803 11.202  1.00 47.89  ? 638  LEU B C   1 
ATOM   2407 O  O   . LEU B 1 47  ? -22.004 55.131 10.206  1.00 46.06  ? 638  LEU B O   1 
ATOM   2408 C  CB  . LEU B 1 47  ? -24.033 52.872 10.333  1.00 40.84  ? 638  LEU B CB  1 
ATOM   2409 C  CG  . LEU B 1 47  ? -23.138 51.816 11.011  1.00 43.99  ? 638  LEU B CG  1 
ATOM   2410 C  CD1 . LEU B 1 47  ? -23.765 51.297 12.330  1.00 45.79  ? 638  LEU B CD1 1 
ATOM   2411 C  CD2 . LEU B 1 47  ? -22.891 50.650 10.087  1.00 40.94  ? 638  LEU B CD2 1 
ATOM   2412 N  N   . LYS B 1 48  ? -22.221 54.904 12.479  1.00 45.39  ? 639  LYS B N   1 
ATOM   2413 C  CA  . LYS B 1 48  ? -20.865 55.343 12.787  1.00 44.73  ? 639  LYS B CA  1 
ATOM   2414 C  C   . LYS B 1 48  ? -20.073 54.285 13.519  1.00 47.35  ? 639  LYS B C   1 
ATOM   2415 O  O   . LYS B 1 48  ? -20.272 54.042 14.712  1.00 47.43  ? 639  LYS B O   1 
ATOM   2416 C  CB  . LYS B 1 48  ? -20.781 56.696 13.503  1.00 48.10  ? 639  LYS B CB  1 
ATOM   2417 C  CG  . LYS B 1 48  ? -19.646 57.504 12.870  1.00 52.57  ? 639  LYS B CG  1 
ATOM   2418 C  CD  . LYS B 1 48  ? -18.731 58.112 13.855  1.00 61.03  ? 639  LYS B CD  1 
ATOM   2419 C  CE  . LYS B 1 48  ? -17.368 58.334 13.263  1.00 51.82  ? 639  LYS B CE  1 
ATOM   2420 N  NZ  . LYS B 1 48  ? -16.466 57.201 13.588  1.00 55.18  ? 639  LYS B NZ  1 
ATOM   2421 N  N   . LEU B 1 49  ? -19.199 53.625 12.780  1.00 43.58  ? 640  LEU B N   1 
ATOM   2422 C  CA  . LEU B 1 49  ? -18.332 52.599 13.333  1.00 42.79  ? 640  LEU B CA  1 
ATOM   2423 C  C   . LEU B 1 49  ? -17.095 53.311 13.859  1.00 48.26  ? 640  LEU B C   1 
ATOM   2424 O  O   . LEU B 1 49  ? -16.724 54.335 13.293  1.00 47.44  ? 640  LEU B O   1 
ATOM   2425 C  CB  . LEU B 1 49  ? -17.969 51.552 12.272  1.00 40.82  ? 640  LEU B CB  1 
ATOM   2426 C  CG  . LEU B 1 49  ? -19.112 50.670 11.732  1.00 44.77  ? 640  LEU B CG  1 
ATOM   2427 C  CD1 . LEU B 1 49  ? -18.552 49.570 10.831  1.00 42.25  ? 640  LEU B CD1 1 
ATOM   2428 C  CD2 . LEU B 1 49  ? -20.022 50.093 12.873  1.00 45.69  ? 640  LEU B CD2 1 
ATOM   2429 N  N   . PRO B 1 50  ? -16.480 52.852 14.972  1.00 48.58  ? 641  PRO B N   1 
ATOM   2430 C  CA  . PRO B 1 50  ? -15.306 53.578 15.510  1.00 49.86  ? 641  PRO B CA  1 
ATOM   2431 C  C   . PRO B 1 50  ? -14.160 53.712 14.505  1.00 50.95  ? 641  PRO B C   1 
ATOM   2432 O  O   . PRO B 1 50  ? -13.824 52.748 13.815  1.00 50.24  ? 641  PRO B O   1 
ATOM   2433 C  CB  . PRO B 1 50  ? -14.921 52.779 16.762  1.00 52.73  ? 641  PRO B CB  1 
ATOM   2434 C  CG  . PRO B 1 50  ? -15.580 51.464 16.593  1.00 56.46  ? 641  PRO B CG  1 
ATOM   2435 C  CD  . PRO B 1 50  ? -16.810 51.666 15.793  1.00 51.01  ? 641  PRO B CD  1 
ATOM   2436 N  N   . GLY B 1 51  ? -13.650 54.934 14.383  1.00 46.26  ? 642  GLY B N   1 
ATOM   2437 C  CA  . GLY B 1 51  ? -12.561 55.311 13.490  1.00 45.10  ? 642  GLY B CA  1 
ATOM   2438 C  C   . GLY B 1 51  ? -12.872 55.240 12.007  1.00 47.00  ? 642  GLY B C   1 
ATOM   2439 O  O   . GLY B 1 51  ? -11.958 55.279 11.184  1.00 46.79  ? 642  GLY B O   1 
ATOM   2440 N  N   . LYS B 1 52  ? -14.160 55.166 11.657  1.00 42.44  ? 643  LYS B N   1 
ATOM   2441 C  CA  . LYS B 1 52  ? -14.635 55.086 10.268  1.00 40.36  ? 643  LYS B CA  1 
ATOM   2442 C  C   . LYS B 1 52  ? -15.606 56.219 9.996   1.00 43.92  ? 643  LYS B C   1 
ATOM   2443 O  O   . LYS B 1 52  ? -16.340 56.615 10.892  1.00 45.37  ? 643  LYS B O   1 
ATOM   2444 C  CB  . LYS B 1 52  ? -15.370 53.763 10.024  1.00 39.60  ? 643  LYS B CB  1 
ATOM   2445 C  CG  . LYS B 1 52  ? -14.540 52.517 10.275  1.00 46.52  ? 643  LYS B CG  1 
ATOM   2446 C  CD  . LYS B 1 52  ? -14.370 51.730 9.018   1.00 55.62  ? 643  LYS B CD  1 
ATOM   2447 C  CE  . LYS B 1 52  ? -15.550 50.872 8.655   1.00 57.60  ? 643  LYS B CE  1 
ATOM   2448 N  NZ  . LYS B 1 52  ? -15.526 50.560 7.208   1.00 52.00  ? 643  LYS B NZ  1 
ATOM   2449 N  N   . ARG B 1 53  ? -15.646 56.712 8.757   1.00 40.75  ? 644  ARG B N   1 
ATOM   2450 C  CA  . ARG B 1 53  ? -16.584 57.753 8.363   1.00 40.46  ? 644  ARG B CA  1 
ATOM   2451 C  C   . ARG B 1 53  ? -17.987 57.222 8.526   1.00 42.75  ? 644  ARG B C   1 
ATOM   2452 O  O   . ARG B 1 53  ? -18.269 56.043 8.246   1.00 39.70  ? 644  ARG B O   1 
ATOM   2453 C  CB  . ARG B 1 53  ? -16.408 58.131 6.890   1.00 42.49  ? 644  ARG B CB  1 
ATOM   2454 C  CG  . ARG B 1 53  ? -15.118 58.844 6.560   1.00 47.06  ? 644  ARG B CG  1 
ATOM   2455 C  CD  . ARG B 1 53  ? -14.957 58.875 5.052   1.00 42.19  ? 644  ARG B CD  1 
ATOM   2456 N  NE  . ARG B 1 53  ? -13.760 59.620 4.662   1.00 45.93  ? 644  ARG B NE  1 
ATOM   2457 C  CZ  . ARG B 1 53  ? -13.353 59.782 3.408   1.00 51.89  ? 644  ARG B CZ  1 
ATOM   2458 N  NH1 . ARG B 1 53  ? -14.071 59.303 2.404   1.00 42.21  ? 644  ARG B NH1 1 
ATOM   2459 N  NH2 . ARG B 1 53  ? -12.253 60.464 3.146   1.00 34.60  ? 644  ARG B NH2 1 
ATOM   2460 N  N   . GLU B 1 54  ? -18.880 58.097 8.974   1.00 41.57  ? 645  GLU B N   1 
ATOM   2461 C  CA  . GLU B 1 54  ? -20.288 57.759 9.085   1.00 41.52  ? 645  GLU B CA  1 
ATOM   2462 C  C   . GLU B 1 54  ? -20.817 57.474 7.672   1.00 44.94  ? 645  GLU B C   1 
ATOM   2463 O  O   . GLU B 1 54  ? -20.374 58.081 6.682   1.00 43.53  ? 645  GLU B O   1 
ATOM   2464 C  CB  . GLU B 1 54  ? -21.053 58.933 9.693   1.00 44.73  ? 645  GLU B CB  1 
ATOM   2465 C  CG  . GLU B 1 54  ? -22.448 58.580 10.170  1.00 56.73  ? 645  GLU B CG  1 
ATOM   2466 C  CD  . GLU B 1 54  ? -23.205 59.789 10.663  1.00 76.34  ? 645  GLU B CD  1 
ATOM   2467 O  OE1 . GLU B 1 54  ? -23.578 60.636 9.817   1.00 59.59  ? 645  GLU B OE1 1 
ATOM   2468 O  OE2 . GLU B 1 54  ? -23.411 59.896 11.895  1.00 78.49  ? 645  GLU B OE2 1 
ATOM   2469 N  N   . ILE B 1 55  ? -21.718 56.513 7.580   1.00 41.12  ? 646  ILE B N   1 
ATOM   2470 C  CA  . ILE B 1 55  ? -22.350 56.166 6.320   1.00 39.62  ? 646  ILE B CA  1 
ATOM   2471 C  C   . ILE B 1 55  ? -23.866 56.204 6.498   1.00 44.52  ? 646  ILE B C   1 
ATOM   2472 O  O   . ILE B 1 55  ? -24.361 56.053 7.623   1.00 43.76  ? 646  ILE B O   1 
ATOM   2473 C  CB  . ILE B 1 55  ? -21.875 54.789 5.778   1.00 40.35  ? 646  ILE B CB  1 
ATOM   2474 C  CG1 . ILE B 1 55  ? -22.142 53.659 6.796   1.00 39.38  ? 646  ILE B CG1 1 
ATOM   2475 C  CG2 . ILE B 1 55  ? -20.402 54.847 5.320   1.00 41.67  ? 646  ILE B CG2 1 
ATOM   2476 C  CD1 . ILE B 1 55  ? -22.139 52.261 6.187   1.00 41.00  ? 646  ILE B CD1 1 
HETATM 2477 N  N   . PTR B 1 56  ? -24.593 56.385 5.387   1.00 40.39  ? 647  PTR B N   1 
HETATM 2478 C  CA  . PTR B 1 56  ? -26.032 56.295 5.406   1.00 42.00  ? 647  PTR B CA  1 
HETATM 2479 C  C   . PTR B 1 56  ? -26.326 54.811 5.328   1.00 43.59  ? 647  PTR B C   1 
HETATM 2480 O  O   . PTR B 1 56  ? -25.569 54.057 4.692   1.00 41.25  ? 647  PTR B O   1 
HETATM 2481 C  CB  . PTR B 1 56  ? -26.757 56.973 4.248   1.00 45.59  ? 647  PTR B CB  1 
HETATM 2482 C  CG  . PTR B 1 56  ? -26.770 58.475 4.476   1.00 49.75  ? 647  PTR B CG  1 
HETATM 2483 C  CD1 . PTR B 1 56  ? -26.042 59.283 3.573   1.00 50.86  ? 647  PTR B CD1 1 
HETATM 2484 C  CD2 . PTR B 1 56  ? -27.489 59.042 5.551   1.00 53.01  ? 647  PTR B CD2 1 
HETATM 2485 C  CE1 . PTR B 1 56  ? -26.065 60.672 3.746   1.00 54.79  ? 647  PTR B CE1 1 
HETATM 2486 C  CE2 . PTR B 1 56  ? -27.504 60.441 5.716   1.00 56.71  ? 647  PTR B CE2 1 
HETATM 2487 C  CZ  . PTR B 1 56  ? -26.800 61.276 4.808   1.00 58.55  ? 647  PTR B CZ  1 
HETATM 2488 O  OH  . PTR B 1 56  ? -26.796 62.659 5.065   1.00 65.28  ? 647  PTR B OH  1 
HETATM 2489 P  P   . PTR B 1 56  ? -27.310 63.659 3.969   0.50 67.37  ? 647  PTR B P   1 
HETATM 2490 O  O1P . PTR B 1 56  ? -26.319 63.734 2.780   0.50 65.83  ? 647  PTR B O1P 1 
HETATM 2491 O  O2P . PTR B 1 56  ? -27.355 65.057 4.605   0.50 70.21  ? 647  PTR B O2P 1 
HETATM 2492 O  O3P . PTR B 1 56  ? -28.715 63.231 3.514   0.50 66.30  ? 647  PTR B O3P 1 
ATOM   2493 N  N   . VAL B 1 57  ? -27.382 54.370 6.023   1.00 39.14  ? 648  VAL B N   1 
ATOM   2494 C  CA  . VAL B 1 57  ? -27.791 52.956 6.018   1.00 37.44  ? 648  VAL B CA  1 
ATOM   2495 C  C   . VAL B 1 57  ? -29.316 52.838 5.903   1.00 43.32  ? 648  VAL B C   1 
ATOM   2496 O  O   . VAL B 1 57  ? -30.030 53.806 6.153   1.00 42.37  ? 648  VAL B O   1 
ATOM   2497 C  CB  . VAL B 1 57  ? -27.311 52.203 7.293   1.00 38.96  ? 648  VAL B CB  1 
ATOM   2498 C  CG1 . VAL B 1 57  ? -25.826 51.880 7.238   1.00 37.68  ? 648  VAL B CG1 1 
ATOM   2499 C  CG2 . VAL B 1 57  ? -27.692 52.945 8.578   1.00 39.95  ? 648  VAL B CG2 1 
ATOM   2500 N  N   . ALA B 1 58  ? -29.799 51.627 5.593   1.00 40.54  ? 649  ALA B N   1 
ATOM   2501 C  CA  . ALA B 1 58  ? -31.219 51.317 5.683   1.00 41.12  ? 649  ALA B CA  1 
ATOM   2502 C  C   . ALA B 1 58  ? -31.358 50.375 6.886   1.00 45.69  ? 649  ALA B C   1 
ATOM   2503 O  O   . ALA B 1 58  ? -30.451 49.601 7.178   1.00 42.89  ? 649  ALA B O   1 
ATOM   2504 C  CB  . ALA B 1 58  ? -31.724 50.660 4.424   1.00 40.38  ? 649  ALA B CB  1 
ATOM   2505 N  N   . ILE B 1 59  ? -32.450 50.508 7.641   1.00 47.02  ? 650  ILE B N   1 
ATOM   2506 C  CA  . ILE B 1 59  ? -32.641 49.747 8.872   1.00 47.77  ? 650  ILE B CA  1 
ATOM   2507 C  C   . ILE B 1 59  ? -33.985 49.018 8.881   1.00 53.71  ? 650  ILE B C   1 
ATOM   2508 O  O   . ILE B 1 59  ? -35.027 49.663 8.932   1.00 55.48  ? 650  ILE B O   1 
ATOM   2509 C  CB  . ILE B 1 59  ? -32.454 50.658 10.127  1.00 51.68  ? 650  ILE B CB  1 
ATOM   2510 C  CG1 . ILE B 1 59  ? -31.120 51.444 10.088  1.00 50.90  ? 650  ILE B CG1 1 
ATOM   2511 C  CG2 . ILE B 1 59  ? -32.590 49.851 11.432  1.00 53.16  ? 650  ILE B CG2 1 
ATOM   2512 C  CD1 . ILE B 1 59  ? -31.096 52.708 10.877  1.00 57.33  ? 650  ILE B CD1 1 
ATOM   2513 N  N   . LYS B 1 60  ? -33.957 47.679 8.860   1.00 50.11  ? 651  LYS B N   1 
ATOM   2514 C  CA  . LYS B 1 60  ? -35.167 46.866 8.975   1.00 50.33  ? 651  LYS B CA  1 
ATOM   2515 C  C   . LYS B 1 60  ? -35.373 46.663 10.464  1.00 57.61  ? 651  LYS B C   1 
ATOM   2516 O  O   . LYS B 1 60  ? -34.430 46.297 11.170  1.00 56.82  ? 651  LYS B O   1 
ATOM   2517 C  CB  . LYS B 1 60  ? -35.004 45.517 8.268   1.00 50.66  ? 651  LYS B CB  1 
ATOM   2518 C  CG  . LYS B 1 60  ? -35.816 45.372 7.000   1.00 54.92  ? 651  LYS B CG  1 
ATOM   2519 C  CD  . LYS B 1 60  ? -35.788 43.936 6.490   1.00 52.19  ? 651  LYS B CD  1 
ATOM   2520 C  CE  . LYS B 1 60  ? -36.342 43.866 5.078   1.00 54.48  ? 651  LYS B CE  1 
ATOM   2521 N  NZ  . LYS B 1 60  ? -36.282 42.498 4.459   1.00 51.82  ? 651  LYS B NZ  1 
ATOM   2522 N  N   . THR B 1 61  ? -36.585 46.956 10.955  1.00 59.26  ? 652  THR B N   1 
ATOM   2523 C  CA  . THR B 1 61  ? -36.958 46.795 12.371  1.00 61.51  ? 652  THR B CA  1 
ATOM   2524 C  C   . THR B 1 61  ? -38.075 45.769 12.520  1.00 66.85  ? 652  THR B C   1 
ATOM   2525 O  O   . THR B 1 61  ? -38.794 45.478 11.568  1.00 66.05  ? 652  THR B O   1 
ATOM   2526 C  CB  . THR B 1 61  ? -37.381 48.121 12.992  1.00 72.82  ? 652  THR B CB  1 
ATOM   2527 O  OG1 . THR B 1 61  ? -38.425 48.665 12.187  1.00 75.34  ? 652  THR B OG1 1 
ATOM   2528 C  CG2 . THR B 1 61  ? -36.208 49.112 13.143  1.00 71.12  ? 652  THR B CG2 1 
ATOM   2529 N  N   . LEU B 1 62  ? -38.187 45.197 13.714  1.00 67.07  ? 653  LEU B N   1 
ATOM   2530 C  CA  . LEU B 1 62  ? -39.213 44.209 14.032  1.00 69.06  ? 653  LEU B CA  1 
ATOM   2531 C  C   . LEU B 1 62  ? -40.221 44.867 14.998  1.00 77.39  ? 653  LEU B C   1 
ATOM   2532 O  O   . LEU B 1 62  ? -39.826 45.286 16.092  1.00 78.25  ? 653  LEU B O   1 
ATOM   2533 C  CB  . LEU B 1 62  ? -38.535 42.952 14.620  1.00 68.77  ? 653  LEU B CB  1 
ATOM   2534 C  CG  . LEU B 1 62  ? -39.374 41.766 15.123  1.00 73.99  ? 653  LEU B CG  1 
ATOM   2535 C  CD1 . LEU B 1 62  ? -40.169 41.112 14.020  1.00 73.11  ? 653  LEU B CD1 1 
ATOM   2536 C  CD2 . LEU B 1 62  ? -38.481 40.716 15.718  1.00 75.21  ? 653  LEU B CD2 1 
ATOM   2537 N  N   . LYS B 1 63  ? -41.500 45.030 14.550  1.00 76.18  ? 654  LYS B N   1 
ATOM   2538 C  CA  . LYS B 1 63  ? -42.594 45.640 15.337  1.00 79.26  ? 654  LYS B CA  1 
ATOM   2539 C  C   . LYS B 1 63  ? -42.694 45.050 16.750  1.00 85.45  ? 654  LYS B C   1 
ATOM   2540 O  O   . LYS B 1 63  ? -42.521 43.837 16.926  1.00 83.53  ? 654  LYS B O   1 
ATOM   2541 C  CB  . LYS B 1 63  ? -43.949 45.534 14.610  1.00 81.96  ? 654  LYS B CB  1 
ATOM   2542 C  CG  . LYS B 1 63  ? -44.151 46.617 13.559  1.00 100.02 ? 654  LYS B CG  1 
ATOM   2543 C  CD  . LYS B 1 63  ? -45.208 46.224 12.525  1.00 112.60 ? 654  LYS B CD  1 
ATOM   2544 C  CE  . LYS B 1 63  ? -45.335 47.233 11.401  1.00 119.85 ? 654  LYS B CE  1 
ATOM   2545 N  NZ  . LYS B 1 63  ? -45.350 46.577 10.062  1.00 122.67 ? 654  LYS B NZ  1 
ATOM   2546 N  N   . ALA B 1 64  ? -42.919 45.927 17.753  1.00 85.62  ? 655  ALA B N   1 
ATOM   2547 C  CA  . ALA B 1 64  ? -43.035 45.557 19.168  1.00 88.24  ? 655  ALA B CA  1 
ATOM   2548 C  C   . ALA B 1 64  ? -44.215 44.614 19.372  1.00 94.74  ? 655  ALA B C   1 
ATOM   2549 O  O   . ALA B 1 64  ? -45.253 44.770 18.712  1.00 94.12  ? 655  ALA B O   1 
ATOM   2550 C  CB  . ALA B 1 64  ? -43.196 46.802 20.030  1.00 91.02  ? 655  ALA B CB  1 
ATOM   2551 N  N   . GLY B 1 65  ? -44.014 43.622 20.240  1.00 93.59  ? 656  GLY B N   1 
ATOM   2552 C  CA  . GLY B 1 65  ? -45.014 42.605 20.541  1.00 95.53  ? 656  GLY B CA  1 
ATOM   2553 C  C   . GLY B 1 65  ? -44.924 41.415 19.610  1.00 98.91  ? 656  GLY B C   1 
ATOM   2554 O  O   . GLY B 1 65  ? -45.881 40.642 19.486  1.00 99.58  ? 656  GLY B O   1 
ATOM   2555 N  N   . TYR B 1 66  ? -43.765 41.266 18.947  1.00 93.11  ? 657  TYR B N   1 
ATOM   2556 C  CA  . TYR B 1 66  ? -43.483 40.175 18.021  1.00 90.90  ? 657  TYR B CA  1 
ATOM   2557 C  C   . TYR B 1 66  ? -43.453 38.834 18.754  1.00 94.45  ? 657  TYR B C   1 
ATOM   2558 O  O   . TYR B 1 66  ? -43.148 38.787 19.955  1.00 95.14  ? 657  TYR B O   1 
ATOM   2559 C  CB  . TYR B 1 66  ? -42.145 40.419 17.300  1.00 90.12  ? 657  TYR B CB  1 
ATOM   2560 C  CG  . TYR B 1 66  ? -40.942 40.577 18.212  1.00 93.64  ? 657  TYR B CG  1 
ATOM   2561 C  CD1 . TYR B 1 66  ? -40.268 39.465 18.708  1.00 96.23  ? 657  TYR B CD1 1 
ATOM   2562 C  CD2 . TYR B 1 66  ? -40.431 41.839 18.516  1.00 95.27  ? 657  TYR B CD2 1 
ATOM   2563 C  CE1 . TYR B 1 66  ? -39.148 39.603 19.529  1.00 99.10  ? 657  TYR B CE1 1 
ATOM   2564 C  CE2 . TYR B 1 66  ? -39.281 41.987 19.296  1.00 96.90  ? 657  TYR B CE2 1 
ATOM   2565 C  CZ  . TYR B 1 66  ? -38.643 40.865 19.804  1.00 107.12 ? 657  TYR B CZ  1 
ATOM   2566 O  OH  . TYR B 1 66  ? -37.515 40.998 20.585  1.00 109.39 ? 657  TYR B OH  1 
ATOM   2567 N  N   . SER B 1 67  ? -43.759 37.745 18.029  1.00 89.64  ? 658  SER B N   1 
ATOM   2568 C  CA  . SER B 1 67  ? -43.698 36.391 18.568  1.00 90.23  ? 658  SER B CA  1 
ATOM   2569 C  C   . SER B 1 67  ? -42.245 35.936 18.447  1.00 93.21  ? 658  SER B C   1 
ATOM   2570 O  O   . SER B 1 67  ? -41.469 36.564 17.708  1.00 91.33  ? 658  SER B O   1 
ATOM   2571 C  CB  . SER B 1 67  ? -44.622 35.457 17.788  1.00 93.31  ? 658  SER B CB  1 
ATOM   2572 O  OG  . SER B 1 67  ? -44.185 35.251 16.455  1.00 96.46  ? 658  SER B OG  1 
ATOM   2573 N  N   . GLU B 1 68  ? -41.868 34.859 19.161  1.00 90.08  ? 659  GLU B N   1 
ATOM   2574 C  CA  . GLU B 1 68  ? -40.508 34.327 19.091  1.00 88.51  ? 659  GLU B CA  1 
ATOM   2575 C  C   . GLU B 1 68  ? -40.167 33.785 17.708  1.00 88.33  ? 659  GLU B C   1 
ATOM   2576 O  O   . GLU B 1 68  ? -39.026 33.928 17.261  1.00 86.72  ? 659  GLU B O   1 
ATOM   2577 C  CB  . GLU B 1 68  ? -40.247 33.302 20.200  1.00 91.93  ? 659  GLU B CB  1 
ATOM   2578 C  CG  . GLU B 1 68  ? -39.807 33.945 21.509  1.00 105.58 ? 659  GLU B CG  1 
ATOM   2579 C  CD  . GLU B 1 68  ? -38.666 34.941 21.391  1.00 122.38 ? 659  GLU B CD  1 
ATOM   2580 O  OE1 . GLU B 1 68  ? -37.572 34.552 20.919  1.00 113.39 ? 659  GLU B OE1 1 
ATOM   2581 O  OE2 . GLU B 1 68  ? -38.884 36.125 21.732  1.00 115.13 ? 659  GLU B OE2 1 
ATOM   2582 N  N   . LYS B 1 69  ? -41.182 33.227 17.016  1.00 83.54  ? 660  LYS B N   1 
ATOM   2583 C  CA  . LYS B 1 69  ? -41.090 32.699 15.657  1.00 80.88  ? 660  LYS B CA  1 
ATOM   2584 C  C   . LYS B 1 69  ? -40.808 33.853 14.698  1.00 81.91  ? 660  LYS B C   1 
ATOM   2585 O  O   . LYS B 1 69  ? -39.951 33.717 13.833  1.00 79.72  ? 660  LYS B O   1 
ATOM   2586 C  CB  . LYS B 1 69  ? -42.391 31.957 15.269  1.00 83.71  ? 660  LYS B CB  1 
ATOM   2587 C  CG  . LYS B 1 69  ? -42.345 31.169 13.948  1.00 99.75  ? 660  LYS B CG  1 
ATOM   2588 C  CD  . LYS B 1 69  ? -41.323 30.015 13.912  1.00 114.19 ? 660  LYS B CD  1 
ATOM   2589 C  CE  . LYS B 1 69  ? -41.837 28.718 14.487  1.00 129.37 ? 660  LYS B CE  1 
ATOM   2590 N  NZ  . LYS B 1 69  ? -40.821 27.640 14.390  1.00 138.17 ? 660  LYS B NZ  1 
ATOM   2591 N  N   . GLN B 1 70  ? -41.508 35.002 14.870  1.00 78.39  ? 661  GLN B N   1 
ATOM   2592 C  CA  . GLN B 1 70  ? -41.327 36.207 14.051  1.00 76.22  ? 661  GLN B CA  1 
ATOM   2593 C  C   . GLN B 1 70  ? -39.889 36.725 14.162  1.00 76.98  ? 661  GLN B C   1 
ATOM   2594 O  O   . GLN B 1 70  ? -39.278 37.029 13.135  1.00 73.92  ? 661  GLN B O   1 
ATOM   2595 C  CB  . GLN B 1 70  ? -42.328 37.296 14.457  1.00 78.50  ? 661  GLN B CB  1 
ATOM   2596 C  CG  . GLN B 1 70  ? -43.658 37.187 13.725  1.00 83.32  ? 661  GLN B CG  1 
ATOM   2597 C  CD  . GLN B 1 70  ? -44.713 38.094 14.310  1.00 89.07  ? 661  GLN B CD  1 
ATOM   2598 O  OE1 . GLN B 1 70  ? -44.837 38.258 15.529  1.00 81.25  ? 661  GLN B OE1 1 
ATOM   2599 N  NE2 . GLN B 1 70  ? -45.525 38.677 13.449  1.00 74.64  ? 661  GLN B NE2 1 
ATOM   2600 N  N   . ARG B 1 71  ? -39.345 36.756 15.408  1.00 73.46  ? 662  ARG B N   1 
ATOM   2601 C  CA  . ARG B 1 71  ? -37.979 37.177 15.717  1.00 72.18  ? 662  ARG B CA  1 
ATOM   2602 C  C   . ARG B 1 71  ? -36.961 36.270 15.009  1.00 74.71  ? 662  ARG B C   1 
ATOM   2603 O  O   . ARG B 1 71  ? -36.056 36.772 14.351  1.00 73.07  ? 662  ARG B O   1 
ATOM   2604 C  CB  . ARG B 1 71  ? -37.749 37.190 17.239  1.00 72.27  ? 662  ARG B CB  1 
ATOM   2605 C  CG  . ARG B 1 71  ? -36.432 37.829 17.643  1.00 76.44  ? 662  ARG B CG  1 
ATOM   2606 C  CD  . ARG B 1 71  ? -36.055 37.481 19.056  1.00 78.97  ? 662  ARG B CD  1 
ATOM   2607 N  NE  . ARG B 1 71  ? -35.007 38.374 19.543  1.00 86.04  ? 662  ARG B NE  1 
ATOM   2608 C  CZ  . ARG B 1 71  ? -33.709 38.084 19.592  1.00 98.26  ? 662  ARG B CZ  1 
ATOM   2609 N  NH1 . ARG B 1 71  ? -33.264 36.916 19.149  1.00 82.36  ? 662  ARG B NH1 1 
ATOM   2610 N  NH2 . ARG B 1 71  ? -32.846 38.963 20.077  1.00 82.79  ? 662  ARG B NH2 1 
ATOM   2611 N  N   . ARG B 1 72  ? -37.148 34.942 15.122  1.00 72.11  ? 663  ARG B N   1 
ATOM   2612 C  CA  . ARG B 1 72  ? -36.319 33.906 14.504  1.00 70.33  ? 663  ARG B CA  1 
ATOM   2613 C  C   . ARG B 1 72  ? -36.316 34.063 12.986  1.00 69.47  ? 663  ARG B C   1 
ATOM   2614 O  O   . ARG B 1 72  ? -35.242 34.005 12.378  1.00 65.91  ? 663  ARG B O   1 
ATOM   2615 C  CB  . ARG B 1 72  ? -36.852 32.510 14.875  1.00 74.12  ? 663  ARG B CB  1 
ATOM   2616 C  CG  . ARG B 1 72  ? -35.784 31.540 15.362  1.00 91.33  ? 663  ARG B CG  1 
ATOM   2617 C  CD  . ARG B 1 72  ? -36.369 30.186 15.728  1.00 104.14 ? 663  ARG B CD  1 
ATOM   2618 N  N   . ASP B 1 73  ? -37.517 34.266 12.383  1.00 65.03  ? 664  ASP B N   1 
ATOM   2619 C  CA  . ASP B 1 73  ? -37.665 34.433 10.933  1.00 63.39  ? 664  ASP B CA  1 
ATOM   2620 C  C   . ASP B 1 73  ? -37.009 35.709 10.455  1.00 61.83  ? 664  ASP B C   1 
ATOM   2621 O  O   . ASP B 1 73  ? -36.339 35.682 9.430   1.00 59.64  ? 664  ASP B O   1 
ATOM   2622 C  CB  . ASP B 1 73  ? -39.139 34.389 10.500  1.00 66.59  ? 664  ASP B CB  1 
ATOM   2623 C  CG  . ASP B 1 73  ? -39.839 33.057 10.746  1.00 81.74  ? 664  ASP B CG  1 
ATOM   2624 O  OD1 . ASP B 1 73  ? -39.132 32.036 10.934  1.00 81.59  ? 664  ASP B OD1 1 
ATOM   2625 O  OD2 . ASP B 1 73  ? -41.092 33.037 10.747  1.00 90.04  ? 664  ASP B OD2 1 
ATOM   2626 N  N   . PHE B 1 74  ? -37.178 36.812 11.216  1.00 56.54  ? 665  PHE B N   1 
ATOM   2627 C  CA  . PHE B 1 74  ? -36.601 38.127 10.934  1.00 54.12  ? 665  PHE B CA  1 
ATOM   2628 C  C   . PHE B 1 74  ? -35.081 38.021 10.877  1.00 58.59  ? 665  PHE B C   1 
ATOM   2629 O  O   . PHE B 1 74  ? -34.479 38.437 9.884   1.00 57.13  ? 665  PHE B O   1 
ATOM   2630 C  CB  . PHE B 1 74  ? -37.035 39.150 12.016  1.00 55.96  ? 665  PHE B CB  1 
ATOM   2631 C  CG  . PHE B 1 74  ? -36.455 40.542 11.899  1.00 55.70  ? 665  PHE B CG  1 
ATOM   2632 C  CD1 . PHE B 1 74  ? -36.895 41.414 10.913  1.00 55.91  ? 665  PHE B CD1 1 
ATOM   2633 C  CD2 . PHE B 1 74  ? -35.472 40.983 12.784  1.00 56.60  ? 665  PHE B CD2 1 
ATOM   2634 C  CE1 . PHE B 1 74  ? -36.359 42.694 10.809  1.00 55.57  ? 665  PHE B CE1 1 
ATOM   2635 C  CE2 . PHE B 1 74  ? -34.937 42.269 12.681  1.00 58.09  ? 665  PHE B CE2 1 
ATOM   2636 C  CZ  . PHE B 1 74  ? -35.393 43.119 11.704  1.00 55.37  ? 665  PHE B CZ  1 
ATOM   2637 N  N   . LEU B 1 75  ? -34.482 37.419 11.924  1.00 55.59  ? 666  LEU B N   1 
ATOM   2638 C  CA  . LEU B 1 75  ? -33.043 37.282 12.055  1.00 54.83  ? 666  LEU B CA  1 
ATOM   2639 C  C   . LEU B 1 75  ? -32.430 36.251 11.125  1.00 58.14  ? 666  LEU B C   1 
ATOM   2640 O  O   . LEU B 1 75  ? -31.232 36.349 10.857  1.00 57.94  ? 666  LEU B O   1 
ATOM   2641 C  CB  . LEU B 1 75  ? -32.639 37.029 13.510  1.00 56.30  ? 666  LEU B CB  1 
ATOM   2642 C  CG  . LEU B 1 75  ? -32.843 38.221 14.468  1.00 62.15  ? 666  LEU B CG  1 
ATOM   2643 C  CD1 . LEU B 1 75  ? -32.498 37.845 15.886  1.00 63.76  ? 666  LEU B CD1 1 
ATOM   2644 C  CD2 . LEU B 1 75  ? -32.035 39.441 14.035  1.00 61.54  ? 666  LEU B CD2 1 
ATOM   2645 N  N   . SER B 1 76  ? -33.226 35.283 10.613  1.00 54.35  ? 667  SER B N   1 
ATOM   2646 C  CA  . SER B 1 76  ? -32.691 34.286 9.680   1.00 53.04  ? 667  SER B CA  1 
ATOM   2647 C  C   . SER B 1 76  ? -32.260 34.991 8.391   1.00 53.08  ? 667  SER B C   1 
ATOM   2648 O  O   . SER B 1 76  ? -31.300 34.548 7.766   1.00 52.04  ? 667  SER B O   1 
ATOM   2649 C  CB  . SER B 1 76  ? -33.681 33.149 9.409   1.00 56.94  ? 667  SER B CB  1 
ATOM   2650 O  OG  . SER B 1 76  ? -34.666 33.480 8.443   1.00 65.35  ? 667  SER B OG  1 
ATOM   2651 N  N   . GLU B 1 77  ? -32.922 36.122 8.030   1.00 48.72  ? 668  GLU B N   1 
ATOM   2652 C  CA  . GLU B 1 77  ? -32.526 36.890 6.847   1.00 46.91  ? 668  GLU B CA  1 
ATOM   2653 C  C   . GLU B 1 77  ? -31.127 37.483 7.089   1.00 49.86  ? 668  GLU B C   1 
ATOM   2654 O  O   . GLU B 1 77  ? -30.297 37.384 6.206   1.00 49.12  ? 668  GLU B O   1 
ATOM   2655 C  CB  . GLU B 1 77  ? -33.532 37.995 6.475   1.00 48.01  ? 668  GLU B CB  1 
ATOM   2656 C  CG  . GLU B 1 77  ? -33.238 38.532 5.076   1.00 49.53  ? 668  GLU B CG  1 
ATOM   2657 C  CD  . GLU B 1 77  ? -33.787 39.871 4.616   1.00 52.28  ? 668  GLU B CD  1 
ATOM   2658 O  OE1 . GLU B 1 77  ? -34.491 40.550 5.394   1.00 49.35  ? 668  GLU B OE1 1 
ATOM   2659 O  OE2 . GLU B 1 77  ? -33.539 40.226 3.442   1.00 47.35  ? 668  GLU B OE2 1 
ATOM   2660 N  N   . ALA B 1 78  ? -30.862 38.045 8.288   1.00 45.19  ? 669  ALA B N   1 
ATOM   2661 C  CA  . ALA B 1 78  ? -29.557 38.593 8.688   1.00 43.81  ? 669  ALA B CA  1 
ATOM   2662 C  C   . ALA B 1 78  ? -28.464 37.505 8.694   1.00 47.63  ? 669  ALA B C   1 
ATOM   2663 O  O   . ALA B 1 78  ? -27.335 37.783 8.289   1.00 45.17  ? 669  ALA B O   1 
ATOM   2664 C  CB  . ALA B 1 78  ? -29.657 39.225 10.068  1.00 45.82  ? 669  ALA B CB  1 
ATOM   2665 N  N   . SER B 1 79  ? -28.788 36.259 9.145   1.00 44.56  ? 670  SER B N   1 
ATOM   2666 C  CA  . SER B 1 79  ? -27.807 35.169 9.125   1.00 43.87  ? 670  SER B CA  1 
ATOM   2667 C  C   . SER B 1 79  ? -27.384 34.807 7.686   1.00 48.51  ? 670  SER B C   1 
ATOM   2668 O  O   . SER B 1 79  ? -26.191 34.564 7.451   1.00 47.97  ? 670  SER B O   1 
ATOM   2669 C  CB  . SER B 1 79  ? -28.342 33.940 9.849   1.00 47.92  ? 670  SER B CB  1 
ATOM   2670 O  OG  . SER B 1 79  ? -28.844 34.339 11.113  1.00 62.33  ? 670  SER B OG  1 
ATOM   2671 N  N   . ILE B 1 80  ? -28.357 34.773 6.729   1.00 44.87  ? 671  ILE B N   1 
ATOM   2672 C  CA  . ILE B 1 80  ? -28.084 34.487 5.305   1.00 44.02  ? 671  ILE B CA  1 
ATOM   2673 C  C   . ILE B 1 80  ? -27.204 35.609 4.732   1.00 44.28  ? 671  ILE B C   1 
ATOM   2674 O  O   . ILE B 1 80  ? -26.145 35.336 4.179   1.00 44.71  ? 671  ILE B O   1 
ATOM   2675 C  CB  . ILE B 1 80  ? -29.408 34.249 4.492   1.00 47.60  ? 671  ILE B CB  1 
ATOM   2676 C  CG1 . ILE B 1 80  ? -30.097 32.944 4.931   1.00 49.65  ? 671  ILE B CG1 1 
ATOM   2677 C  CG2 . ILE B 1 80  ? -29.159 34.236 2.975   1.00 46.45  ? 671  ILE B CG2 1 
ATOM   2678 C  CD1 . ILE B 1 80  ? -31.605 32.846 4.575   1.00 65.27  ? 671  ILE B CD1 1 
ATOM   2679 N  N   . MET B 1 81  ? -27.620 36.865 4.916   1.00 39.85  ? 672  MET B N   1 
ATOM   2680 C  CA  . MET B 1 81  ? -26.909 38.078 4.441   1.00 38.57  ? 672  MET B CA  1 
ATOM   2681 C  C   . MET B 1 81  ? -25.479 38.162 4.952   1.00 42.46  ? 672  MET B C   1 
ATOM   2682 O  O   . MET B 1 81  ? -24.572 38.593 4.222   1.00 40.70  ? 672  MET B O   1 
ATOM   2683 C  CB  . MET B 1 81  ? -27.655 39.334 4.914   1.00 40.85  ? 672  MET B CB  1 
ATOM   2684 C  CG  . MET B 1 81  ? -29.006 39.502 4.280   1.00 44.10  ? 672  MET B CG  1 
ATOM   2685 S  SD  . MET B 1 81  ? -29.808 41.041 4.774   1.00 47.93  ? 672  MET B SD  1 
ATOM   2686 C  CE  . MET B 1 81  ? -28.597 42.197 4.197   1.00 42.10  ? 672  MET B CE  1 
ATOM   2687 N  N   . GLY B 1 82  ? -25.298 37.774 6.215   1.00 40.31  ? 673  GLY B N   1 
ATOM   2688 C  CA  . GLY B 1 82  ? -23.996 37.796 6.867   1.00 40.53  ? 673  GLY B CA  1 
ATOM   2689 C  C   . GLY B 1 82  ? -23.016 36.822 6.267   1.00 44.70  ? 673  GLY B C   1 
ATOM   2690 O  O   . GLY B 1 82  ? -21.824 36.941 6.521   1.00 45.91  ? 673  GLY B O   1 
ATOM   2691 N  N   . GLN B 1 83  ? -23.504 35.843 5.493   1.00 42.08  ? 674  GLN B N   1 
ATOM   2692 C  CA  . GLN B 1 83  ? -22.653 34.849 4.817   1.00 42.64  ? 674  GLN B CA  1 
ATOM   2693 C  C   . GLN B 1 83  ? -22.154 35.376 3.464   1.00 46.10  ? 674  GLN B C   1 
ATOM   2694 O  O   . GLN B 1 83  ? -21.270 34.768 2.861   1.00 47.07  ? 674  GLN B O   1 
ATOM   2695 C  CB  . GLN B 1 83  ? -23.441 33.545 4.607   1.00 44.57  ? 674  GLN B CB  1 
ATOM   2696 C  CG  . GLN B 1 83  ? -23.571 32.737 5.906   1.00 64.02  ? 674  GLN B CG  1 
ATOM   2697 C  CD  . GLN B 1 83  ? -24.424 31.521 5.707   1.00 92.85  ? 674  GLN B CD  1 
ATOM   2698 O  OE1 . GLN B 1 83  ? -24.105 30.617 4.913   1.00 92.69  ? 674  GLN B OE1 1 
ATOM   2699 N  NE2 . GLN B 1 83  ? -25.529 31.465 6.442   1.00 85.02  ? 674  GLN B NE2 1 
ATOM   2700 N  N   . PHE B 1 84  ? -22.719 36.513 2.986   1.00 38.26  ? 675  PHE B N   1 
ATOM   2701 C  CA  . PHE B 1 84  ? -22.387 37.030 1.665   1.00 36.58  ? 675  PHE B CA  1 
ATOM   2702 C  C   . PHE B 1 84  ? -21.525 38.270 1.681   1.00 39.04  ? 675  PHE B C   1 
ATOM   2703 O  O   . PHE B 1 84  ? -21.652 39.098 2.582   1.00 39.32  ? 675  PHE B O   1 
ATOM   2704 C  CB  . PHE B 1 84  ? -23.665 37.281 0.864   1.00 37.34  ? 675  PHE B CB  1 
ATOM   2705 C  CG  . PHE B 1 84  ? -24.632 36.124 0.754   1.00 37.79  ? 675  PHE B CG  1 
ATOM   2706 C  CD1 . PHE B 1 84  ? -24.168 34.812 0.634   1.00 38.39  ? 675  PHE B CD1 1 
ATOM   2707 C  CD2 . PHE B 1 84  ? -26.003 36.352 0.684   1.00 38.78  ? 675  PHE B CD2 1 
ATOM   2708 C  CE1 . PHE B 1 84  ? -25.056 33.751 0.491   1.00 39.24  ? 675  PHE B CE1 1 
ATOM   2709 C  CE2 . PHE B 1 84  ? -26.887 35.295 0.501   1.00 41.42  ? 675  PHE B CE2 1 
ATOM   2710 C  CZ  . PHE B 1 84  ? -26.407 34.000 0.403   1.00 39.72  ? 675  PHE B CZ  1 
ATOM   2711 N  N   . ASP B 1 85  ? -20.600 38.370 0.717   1.00 33.52  ? 676  ASP B N   1 
ATOM   2712 C  CA  . ASP B 1 85  ? -19.739 39.555 0.584   1.00 33.31  ? 676  ASP B CA  1 
ATOM   2713 C  C   . ASP B 1 85  ? -19.480 39.791 -0.888  1.00 36.32  ? 676  ASP B C   1 
ATOM   2714 O  O   . ASP B 1 85  ? -18.402 39.469 -1.402  1.00 34.36  ? 676  ASP B O   1 
ATOM   2715 C  CB  . ASP B 1 85  ? -18.418 39.423 1.373   1.00 35.16  ? 676  ASP B CB  1 
ATOM   2716 C  CG  . ASP B 1 85  ? -17.680 40.751 1.604   1.00 42.35  ? 676  ASP B CG  1 
ATOM   2717 O  OD1 . ASP B 1 85  ? -18.226 41.808 1.254   1.00 43.41  ? 676  ASP B OD1 1 
ATOM   2718 O  OD2 . ASP B 1 85  ? -16.594 40.731 2.200   1.00 49.26  ? 676  ASP B OD2 1 
ATOM   2719 N  N   . HIS B 1 86  ? -20.509 40.308 -1.575  1.00 32.77  ? 677  HIS B N   1 
ATOM   2720 C  CA  . HIS B 1 86  ? -20.468 40.555 -3.013  1.00 30.02  ? 677  HIS B CA  1 
ATOM   2721 C  C   . HIS B 1 86  ? -21.069 41.919 -3.313  1.00 32.99  ? 677  HIS B C   1 
ATOM   2722 O  O   . HIS B 1 86  ? -22.016 42.325 -2.660  1.00 32.31  ? 677  HIS B O   1 
ATOM   2723 C  CB  . HIS B 1 86  ? -21.238 39.448 -3.752  1.00 28.67  ? 677  HIS B CB  1 
ATOM   2724 C  CG  . HIS B 1 86  ? -20.994 39.451 -5.228  1.00 30.79  ? 677  HIS B CG  1 
ATOM   2725 N  ND1 . HIS B 1 86  ? -21.750 40.229 -6.076  1.00 31.64  ? 677  HIS B ND1 1 
ATOM   2726 C  CD2 . HIS B 1 86  ? -20.032 38.824 -5.948  1.00 32.72  ? 677  HIS B CD2 1 
ATOM   2727 C  CE1 . HIS B 1 86  ? -21.262 40.031 -7.286  1.00 31.26  ? 677  HIS B CE1 1 
ATOM   2728 N  NE2 . HIS B 1 86  ? -20.228 39.185 -7.263  1.00 32.45  ? 677  HIS B NE2 1 
ATOM   2729 N  N   . ARG B 1 87  ? -20.552 42.594 -4.331  1.00 30.90  ? 678  ARG B N   1 
ATOM   2730 C  CA  . ARG B 1 87  ? -20.985 43.916 -4.812  1.00 31.60  ? 678  ARG B CA  1 
ATOM   2731 C  C   . ARG B 1 87  ? -22.494 43.948 -5.183  1.00 34.80  ? 678  ARG B C   1 
ATOM   2732 O  O   . ARG B 1 87  ? -23.119 44.986 -5.027  1.00 33.43  ? 678  ARG B O   1 
ATOM   2733 C  CB  . ARG B 1 87  ? -20.115 44.300 -6.062  1.00 31.10  ? 678  ARG B CB  1 
ATOM   2734 C  CG  . ARG B 1 87  ? -20.550 45.574 -6.811  1.00 42.14  ? 678  ARG B CG  1 
ATOM   2735 C  CD  . ARG B 1 87  ? -19.689 45.937 -8.038  1.00 59.93  ? 678  ARG B CD  1 
ATOM   2736 N  NE  . ARG B 1 87  ? -18.243 45.810 -7.792  1.00 82.75  ? 678  ARG B NE  1 
ATOM   2737 C  CZ  . ARG B 1 87  ? -17.460 46.733 -7.232  1.00 97.47  ? 678  ARG B CZ  1 
ATOM   2738 N  NH1 . ARG B 1 87  ? -17.960 47.912 -6.871  1.00 86.98  ? 678  ARG B NH1 1 
ATOM   2739 N  NH2 . ARG B 1 87  ? -16.171 46.487 -7.041  1.00 79.10  ? 678  ARG B NH2 1 
ATOM   2740 N  N   . ASN B 1 88  ? -23.036 42.863 -5.757  1.00 32.74  ? 679  ASN B N   1 
ATOM   2741 C  CA  . ASN B 1 88  ? -24.428 42.832 -6.219  1.00 32.06  ? 679  ASN B CA  1 
ATOM   2742 C  C   . ASN B 1 88  ? -25.368 42.040 -5.300  1.00 32.33  ? 679  ASN B C   1 
ATOM   2743 O  O   . ASN B 1 88  ? -26.448 41.594 -5.702  1.00 30.30  ? 679  ASN B O   1 
ATOM   2744 C  CB  . ASN B 1 88  ? -24.471 42.359 -7.655  1.00 32.49  ? 679  ASN B CB  1 
ATOM   2745 C  CG  . ASN B 1 88  ? -23.631 43.241 -8.563  1.00 41.38  ? 679  ASN B CG  1 
ATOM   2746 O  OD1 . ASN B 1 88  ? -22.510 42.884 -8.939  1.00 33.71  ? 679  ASN B OD1 1 
ATOM   2747 N  ND2 . ASN B 1 88  ? -24.146 44.421 -8.897  1.00 28.71  ? 679  ASN B ND2 1 
ATOM   2748 N  N   . ILE B 1 89  ? -24.966 41.935 -4.033  1.00 30.44  ? 680  ILE B N   1 
ATOM   2749 C  CA  . ILE B 1 89  ? -25.753 41.373 -2.949  1.00 29.98  ? 680  ILE B CA  1 
ATOM   2750 C  C   . ILE B 1 89  ? -25.743 42.428 -1.864  1.00 36.50  ? 680  ILE B C   1 
ATOM   2751 O  O   . ILE B 1 89  ? -24.681 42.884 -1.472  1.00 34.42  ? 680  ILE B O   1 
ATOM   2752 C  CB  . ILE B 1 89  ? -25.305 39.987 -2.445  1.00 32.79  ? 680  ILE B CB  1 
ATOM   2753 C  CG1 . ILE B 1 89  ? -25.543 38.927 -3.557  1.00 32.74  ? 680  ILE B CG1 1 
ATOM   2754 C  CG2 . ILE B 1 89  ? -26.108 39.613 -1.147  1.00 32.42  ? 680  ILE B CG2 1 
ATOM   2755 C  CD1 . ILE B 1 89  ? -24.838 37.725 -3.384  1.00 42.41  ? 680  ILE B CD1 1 
ATOM   2756 N  N   . ILE B 1 90  ? -26.928 42.837 -1.425  1.00 36.71  ? 681  ILE B N   1 
ATOM   2757 C  CA  . ILE B 1 90  ? -27.111 43.858 -0.391  1.00 38.20  ? 681  ILE B CA  1 
ATOM   2758 C  C   . ILE B 1 90  ? -26.251 43.507 0.856   1.00 38.35  ? 681  ILE B C   1 
ATOM   2759 O  O   . ILE B 1 90  ? -26.314 42.400 1.376   1.00 36.71  ? 681  ILE B O   1 
ATOM   2760 C  CB  . ILE B 1 90  ? -28.628 44.108 -0.128  1.00 43.34  ? 681  ILE B CB  1 
ATOM   2761 C  CG1 . ILE B 1 90  ? -28.875 45.456 0.447   1.00 46.96  ? 681  ILE B CG1 1 
ATOM   2762 C  CG2 . ILE B 1 90  ? -29.327 43.040 0.680   1.00 44.10  ? 681  ILE B CG2 1 
ATOM   2763 C  CD1 . ILE B 1 90  ? -28.933 46.416 -0.606  1.00 58.24  ? 681  ILE B CD1 1 
ATOM   2764 N  N   . ARG B 1 91  ? -25.349 44.415 1.209   1.00 34.62  ? 682  ARG B N   1 
ATOM   2765 C  CA  . ARG B 1 91  ? -24.363 44.261 2.282   1.00 36.63  ? 682  ARG B CA  1 
ATOM   2766 C  C   . ARG B 1 91  ? -24.973 44.409 3.683   1.00 43.65  ? 682  ARG B C   1 
ATOM   2767 O  O   . ARG B 1 91  ? -25.703 45.368 3.948   1.00 45.18  ? 682  ARG B O   1 
ATOM   2768 C  CB  . ARG B 1 91  ? -23.232 45.302 2.054   1.00 40.40  ? 682  ARG B CB  1 
ATOM   2769 C  CG  . ARG B 1 91  ? -22.103 45.373 3.064   1.00 47.18  ? 682  ARG B CG  1 
ATOM   2770 C  CD  . ARG B 1 91  ? -20.948 46.241 2.541   1.00 48.37  ? 682  ARG B CD  1 
ATOM   2771 N  NE  . ARG B 1 91  ? -21.334 47.637 2.259   1.00 57.72  ? 682  ARG B NE  1 
ATOM   2772 C  CZ  . ARG B 1 91  ? -21.309 48.219 1.052   1.00 72.51  ? 682  ARG B CZ  1 
ATOM   2773 N  NH1 . ARG B 1 91  ? -20.910 47.539 -0.015  1.00 51.19  ? 682  ARG B NH1 1 
ATOM   2774 N  NH2 . ARG B 1 91  ? -21.678 49.491 0.910   1.00 58.69  ? 682  ARG B NH2 1 
ATOM   2775 N  N   . LEU B 1 92  ? -24.616 43.491 4.592   1.00 37.87  ? 683  LEU B N   1 
ATOM   2776 C  CA  . LEU B 1 92  ? -24.996 43.589 5.984   1.00 37.33  ? 683  LEU B CA  1 
ATOM   2777 C  C   . LEU B 1 92  ? -23.943 44.471 6.674   1.00 40.89  ? 683  LEU B C   1 
ATOM   2778 O  O   . LEU B 1 92  ? -22.773 44.121 6.686   1.00 40.47  ? 683  LEU B O   1 
ATOM   2779 C  CB  . LEU B 1 92  ? -25.018 42.210 6.636   1.00 36.97  ? 683  LEU B CB  1 
ATOM   2780 C  CG  . LEU B 1 92  ? -25.524 42.186 8.098   1.00 42.75  ? 683  LEU B CG  1 
ATOM   2781 C  CD1 . LEU B 1 92  ? -27.017 42.526 8.166   1.00 41.88  ? 683  LEU B CD1 1 
ATOM   2782 C  CD2 . LEU B 1 92  ? -25.261 40.810 8.747   1.00 44.10  ? 683  LEU B CD2 1 
ATOM   2783 N  N   . GLU B 1 93  ? -24.351 45.621 7.205   1.00 38.08  ? 684  GLU B N   1 
ATOM   2784 C  CA  . GLU B 1 93  ? -23.460 46.557 7.898   1.00 37.22  ? 684  GLU B CA  1 
ATOM   2785 C  C   . GLU B 1 93  ? -23.411 46.255 9.381   1.00 42.93  ? 684  GLU B C   1 
ATOM   2786 O  O   . GLU B 1 93  ? -22.369 46.393 10.007  1.00 42.94  ? 684  GLU B O   1 
ATOM   2787 C  CB  . GLU B 1 93  ? -23.919 48.003 7.667   1.00 38.61  ? 684  GLU B CB  1 
ATOM   2788 C  CG  . GLU B 1 93  ? -23.911 48.417 6.204   1.00 38.30  ? 684  GLU B CG  1 
ATOM   2789 C  CD  . GLU B 1 93  ? -22.556 48.567 5.528   1.00 50.97  ? 684  GLU B CD  1 
ATOM   2790 O  OE1 . GLU B 1 93  ? -21.501 48.298 6.149   1.00 48.44  ? 684  GLU B OE1 1 
ATOM   2791 O  OE2 . GLU B 1 93  ? -22.564 48.952 4.341   1.00 47.10  ? 684  GLU B OE2 1 
ATOM   2792 N  N   . GLY B 1 94  ? -24.539 45.822 9.919   1.00 41.02  ? 685  GLY B N   1 
ATOM   2793 C  CA  . GLY B 1 94  ? -24.663 45.477 11.320  1.00 42.47  ? 685  GLY B CA  1 
ATOM   2794 C  C   . GLY B 1 94  ? -25.994 44.853 11.664  1.00 47.09  ? 685  GLY B C   1 
ATOM   2795 O  O   . GLY B 1 94  ? -26.936 44.869 10.860  1.00 43.75  ? 685  GLY B O   1 
ATOM   2796 N  N   . VAL B 1 95  ? -26.054 44.252 12.855  1.00 46.74  ? 686  VAL B N   1 
ATOM   2797 C  CA  . VAL B 1 95  ? -27.272 43.699 13.428  1.00 48.26  ? 686  VAL B CA  1 
ATOM   2798 C  C   . VAL B 1 95  ? -27.320 44.097 14.898  1.00 52.82  ? 686  VAL B C   1 
ATOM   2799 O  O   . VAL B 1 95  ? -26.278 44.291 15.529  1.00 51.87  ? 686  VAL B O   1 
ATOM   2800 C  CB  . VAL B 1 95  ? -27.489 42.170 13.249  1.00 53.41  ? 686  VAL B CB  1 
ATOM   2801 C  CG1 . VAL B 1 95  ? -27.662 41.777 11.788  1.00 52.22  ? 686  VAL B CG1 1 
ATOM   2802 C  CG2 . VAL B 1 95  ? -26.375 41.364 13.907  1.00 53.87  ? 686  VAL B CG2 1 
ATOM   2803 N  N   . VAL B 1 96  ? -28.536 44.256 15.426  1.00 51.51  ? 687  VAL B N   1 
ATOM   2804 C  CA  . VAL B 1 96  ? -28.780 44.515 16.849  1.00 53.60  ? 687  VAL B CA  1 
ATOM   2805 C  C   . VAL B 1 96  ? -29.665 43.344 17.294  1.00 61.57  ? 687  VAL B C   1 
ATOM   2806 O  O   . VAL B 1 96  ? -30.777 43.187 16.796  1.00 60.77  ? 687  VAL B O   1 
ATOM   2807 C  CB  . VAL B 1 96  ? -29.393 45.907 17.145  1.00 57.32  ? 687  VAL B CB  1 
ATOM   2808 C  CG1 . VAL B 1 96  ? -29.813 46.023 18.607  1.00 59.17  ? 687  VAL B CG1 1 
ATOM   2809 C  CG2 . VAL B 1 96  ? -28.405 47.020 16.768  1.00 55.72  ? 687  VAL B CG2 1 
ATOM   2810 N  N   . THR B 1 97  ? -29.108 42.436 18.101  1.00 61.74  ? 688  THR B N   1 
ATOM   2811 C  CA  . THR B 1 97  ? -29.836 41.250 18.572  1.00 63.07  ? 688  THR B CA  1 
ATOM   2812 C  C   . THR B 1 97  ? -29.767 41.138 20.091  1.00 71.89  ? 688  THR B C   1 
ATOM   2813 O  O   . THR B 1 97  ? -30.668 40.573 20.699  1.00 72.36  ? 688  THR B O   1 
ATOM   2814 C  CB  . THR B 1 97  ? -29.341 39.944 17.895  1.00 63.11  ? 688  THR B CB  1 
ATOM   2815 O  OG1 . THR B 1 97  ? -28.082 39.549 18.440  1.00 64.05  ? 688  THR B OG1 1 
ATOM   2816 C  CG2 . THR B 1 97  ? -29.268 40.030 16.391  1.00 57.49  ? 688  THR B CG2 1 
ATOM   2817 N  N   . LYS B 1 98  ? -28.671 41.645 20.691  1.00 71.39  ? 689  LYS B N   1 
ATOM   2818 C  CA  . LYS B 1 98  ? -28.405 41.598 22.129  1.00 73.78  ? 689  LYS B CA  1 
ATOM   2819 C  C   . LYS B 1 98  ? -29.068 42.774 22.879  1.00 84.51  ? 689  LYS B C   1 
ATOM   2820 O  O   . LYS B 1 98  ? -29.093 42.787 24.113  1.00 85.66  ? 689  LYS B O   1 
ATOM   2821 C  CB  . LYS B 1 98  ? -26.879 41.531 22.407  1.00 74.36  ? 689  LYS B CB  1 
ATOM   2822 C  CG  . LYS B 1 98  ? -26.117 40.381 21.719  1.00 76.05  ? 689  LYS B CG  1 
ATOM   2823 C  CD  . LYS B 1 98  ? -26.373 38.992 22.323  1.00 85.52  ? 689  LYS B CD  1 
ATOM   2824 C  CE  . LYS B 1 98  ? -25.779 37.870 21.496  1.00 97.92  ? 689  LYS B CE  1 
ATOM   2825 N  NZ  . LYS B 1 98  ? -26.594 37.559 20.283  1.00 108.02 ? 689  LYS B NZ  1 
ATOM   2826 N  N   . SER B 1 99  ? -29.613 43.748 22.127  1.00 84.26  ? 690  SER B N   1 
ATOM   2827 C  CA  . SER B 1 99  ? -30.299 44.946 22.644  1.00 86.77  ? 690  SER B CA  1 
ATOM   2828 C  C   . SER B 1 99  ? -31.694 45.067 21.982  1.00 90.80  ? 690  SER B C   1 
ATOM   2829 O  O   . SER B 1 99  ? -31.979 44.318 21.047  1.00 88.91  ? 690  SER B O   1 
ATOM   2830 C  CB  . SER B 1 99  ? -29.440 46.196 22.406  1.00 91.32  ? 690  SER B CB  1 
ATOM   2831 O  OG  . SER B 1 99  ? -30.202 47.393 22.346  1.00 101.18 ? 690  SER B OG  1 
ATOM   2832 N  N   . ARG B 1 100 ? -32.586 45.968 22.497  1.00 89.02  ? 691  ARG B N   1 
ATOM   2833 C  CA  . ARG B 1 100 ? -33.942 46.231 21.956  1.00 88.48  ? 691  ARG B CA  1 
ATOM   2834 C  C   . ARG B 1 100 ? -34.095 47.699 21.455  1.00 91.99  ? 691  ARG B C   1 
ATOM   2835 O  O   . ARG B 1 100 ? -33.658 48.615 22.154  1.00 92.78  ? 691  ARG B O   1 
ATOM   2836 C  CB  . ARG B 1 100 ? -35.040 45.832 22.936  1.00 90.10  ? 691  ARG B CB  1 
ATOM   2837 C  CG  . ARG B 1 100 ? -36.143 45.015 22.276  1.00 99.07  ? 691  ARG B CG  1 
ATOM   2838 C  CD  . ARG B 1 100 ? -36.537 43.791 23.092  1.00 114.17 ? 691  ARG B CD  1 
ATOM   2839 N  NE  . ARG B 1 100 ? -37.355 44.120 24.266  1.00 126.25 ? 691  ARG B NE  1 
ATOM   2840 C  CZ  . ARG B 1 100 ? -36.971 43.947 25.530  1.00 141.56 ? 691  ARG B CZ  1 
ATOM   2841 N  NH1 . ARG B 1 100 ? -35.775 43.440 25.806  1.00 129.14 ? 691  ARG B NH1 1 
ATOM   2842 N  NH2 . ARG B 1 100 ? -37.783 44.272 26.526  1.00 129.07 ? 691  ARG B NH2 1 
ATOM   2843 N  N   . PRO B 1 101 ? -34.570 47.945 20.200  1.00 86.57  ? 692  PRO B N   1 
ATOM   2844 C  CA  . PRO B 1 101 ? -35.157 46.980 19.259  1.00 83.48  ? 692  PRO B CA  1 
ATOM   2845 C  C   . PRO B 1 101 ? -34.158 46.212 18.407  1.00 79.72  ? 692  PRO B C   1 
ATOM   2846 O  O   . PRO B 1 101 ? -33.065 46.710 18.127  1.00 77.84  ? 692  PRO B O   1 
ATOM   2847 C  CB  . PRO B 1 101 ? -36.059 47.869 18.397  1.00 85.31  ? 692  PRO B CB  1 
ATOM   2848 C  CG  . PRO B 1 101 ? -35.280 49.157 18.290  1.00 90.49  ? 692  PRO B CG  1 
ATOM   2849 C  CD  . PRO B 1 101 ? -34.645 49.325 19.659  1.00 88.14  ? 692  PRO B CD  1 
ATOM   2850 N  N   . VAL B 1 102 ? -34.566 45.012 17.967  1.00 72.53  ? 693  VAL B N   1 
ATOM   2851 C  CA  . VAL B 1 102 ? -33.757 44.210 17.055  1.00 69.78  ? 693  VAL B CA  1 
ATOM   2852 C  C   . VAL B 1 102 ? -33.778 44.866 15.678  1.00 68.26  ? 693  VAL B C   1 
ATOM   2853 O  O   . VAL B 1 102 ? -34.829 45.337 15.231  1.00 67.77  ? 693  VAL B O   1 
ATOM   2854 C  CB  . VAL B 1 102 ? -34.063 42.691 17.036  1.00 74.10  ? 693  VAL B CB  1 
ATOM   2855 C  CG1 . VAL B 1 102 ? -33.784 42.075 18.399  1.00 75.67  ? 693  VAL B CG1 1 
ATOM   2856 C  CG2 . VAL B 1 102 ? -35.492 42.406 16.606  1.00 74.78  ? 693  VAL B CG2 1 
ATOM   2857 N  N   . MET B 1 103 ? -32.594 44.992 15.066  1.00 60.89  ? 694  MET B N   1 
ATOM   2858 C  CA  . MET B 1 103 ? -32.390 45.681 13.789  1.00 57.81  ? 694  MET B CA  1 
ATOM   2859 C  C   . MET B 1 103 ? -31.526 44.889 12.844  1.00 54.73  ? 694  MET B C   1 
ATOM   2860 O  O   . MET B 1 103 ? -30.603 44.217 13.283  1.00 53.76  ? 694  MET B O   1 
ATOM   2861 C  CB  . MET B 1 103 ? -31.665 47.023 14.024  1.00 60.66  ? 694  MET B CB  1 
ATOM   2862 C  CG  . MET B 1 103 ? -32.314 47.939 15.028  1.00 66.62  ? 694  MET B CG  1 
ATOM   2863 S  SD  . MET B 1 103 ? -31.370 49.471 15.162  1.00 71.67  ? 694  MET B SD  1 
ATOM   2864 C  CE  . MET B 1 103 ? -31.859 50.019 16.802  1.00 71.51  ? 694  MET B CE  1 
ATOM   2865 N  N   . ILE B 1 104 ? -31.786 45.032 11.539  1.00 48.93  ? 695  ILE B N   1 
ATOM   2866 C  CA  . ILE B 1 104 ? -30.962 44.525 10.438  1.00 45.53  ? 695  ILE B CA  1 
ATOM   2867 C  C   . ILE B 1 104 ? -30.546 45.783 9.670   1.00 48.33  ? 695  ILE B C   1 
ATOM   2868 O  O   . ILE B 1 104 ? -31.407 46.500 9.140   1.00 48.21  ? 695  ILE B O   1 
ATOM   2869 C  CB  . ILE B 1 104 ? -31.652 43.467 9.551   1.00 47.26  ? 695  ILE B CB  1 
ATOM   2870 C  CG1 . ILE B 1 104 ? -32.012 42.200 10.399  1.00 48.07  ? 695  ILE B CG1 1 
ATOM   2871 C  CG2 . ILE B 1 104 ? -30.759 43.115 8.320   1.00 44.06  ? 695  ILE B CG2 1 
ATOM   2872 C  CD1 . ILE B 1 104 ? -32.821 41.173 9.669   1.00 55.41  ? 695  ILE B CD1 1 
ATOM   2873 N  N   . ILE B 1 105 ? -29.235 46.086 9.678   1.00 43.48  ? 696  ILE B N   1 
ATOM   2874 C  CA  . ILE B 1 105 ? -28.680 47.295 9.069   1.00 41.27  ? 696  ILE B CA  1 
ATOM   2875 C  C   . ILE B 1 105 ? -27.902 46.948 7.813   1.00 41.71  ? 696  ILE B C   1 
ATOM   2876 O  O   . ILE B 1 105 ? -26.947 46.172 7.858   1.00 40.16  ? 696  ILE B O   1 
ATOM   2877 C  CB  . ILE B 1 105 ? -27.841 48.097 10.103  1.00 44.12  ? 696  ILE B CB  1 
ATOM   2878 C  CG1 . ILE B 1 105 ? -28.652 48.418 11.364  1.00 44.91  ? 696  ILE B CG1 1 
ATOM   2879 C  CG2 . ILE B 1 105 ? -27.295 49.358 9.506   1.00 43.73  ? 696  ILE B CG2 1 
ATOM   2880 C  CD1 . ILE B 1 105 ? -27.948 48.205 12.578  1.00 46.02  ? 696  ILE B CD1 1 
ATOM   2881 N  N   . THR B 1 106 ? -28.332 47.525 6.691   1.00 37.00  ? 697  THR B N   1 
ATOM   2882 C  CA  . THR B 1 106 ? -27.735 47.295 5.386   1.00 36.24  ? 697  THR B CA  1 
ATOM   2883 C  C   . THR B 1 106 ? -27.274 48.600 4.768   1.00 41.26  ? 697  THR B C   1 
ATOM   2884 O  O   . THR B 1 106 ? -27.624 49.669 5.249   1.00 43.48  ? 697  THR B O   1 
ATOM   2885 C  CB  . THR B 1 106 ? -28.736 46.576 4.443   1.00 45.81  ? 697  THR B CB  1 
ATOM   2886 O  OG1 . THR B 1 106 ? -29.850 47.426 4.157   1.00 44.90  ? 697  THR B OG1 1 
ATOM   2887 C  CG2 . THR B 1 106 ? -29.230 45.275 5.015   1.00 45.41  ? 697  THR B CG2 1 
ATOM   2888 N  N   . GLU B 1 107 ? -26.501 48.512 3.685   1.00 36.51  ? 698  GLU B N   1 
ATOM   2889 C  CA  . GLU B 1 107 ? -26.080 49.668 2.900   1.00 36.40  ? 698  GLU B CA  1 
ATOM   2890 C  C   . GLU B 1 107 ? -27.344 50.363 2.354   1.00 41.32  ? 698  GLU B C   1 
ATOM   2891 O  O   . GLU B 1 107 ? -28.310 49.688 1.981   1.00 42.40  ? 698  GLU B O   1 
ATOM   2892 C  CB  . GLU B 1 107 ? -25.152 49.226 1.748   1.00 36.54  ? 698  GLU B CB  1 
ATOM   2893 C  CG  . GLU B 1 107 ? -25.815 48.301 0.744   1.00 44.19  ? 698  GLU B CG  1 
ATOM   2894 C  CD  . GLU B 1 107 ? -24.899 47.773 -0.335  1.00 52.36  ? 698  GLU B CD  1 
ATOM   2895 O  OE1 . GLU B 1 107 ? -24.289 48.586 -1.062  1.00 39.16  ? 698  GLU B OE1 1 
ATOM   2896 O  OE2 . GLU B 1 107 ? -24.816 46.536 -0.472  1.00 43.81  ? 698  GLU B OE2 1 
ATOM   2897 N  N   . PHE B 1 108 ? -27.349 51.696 2.324   1.00 37.79  ? 699  PHE B N   1 
ATOM   2898 C  CA  . PHE B 1 108 ? -28.489 52.465 1.863   1.00 38.00  ? 699  PHE B CA  1 
ATOM   2899 C  C   . PHE B 1 108 ? -28.607 52.435 0.331   1.00 44.01  ? 699  PHE B C   1 
ATOM   2900 O  O   . PHE B 1 108 ? -27.624 52.692 -0.358  1.00 44.25  ? 699  PHE B O   1 
ATOM   2901 C  CB  . PHE B 1 108 ? -28.403 53.904 2.407   1.00 39.72  ? 699  PHE B CB  1 
ATOM   2902 C  CG  . PHE B 1 108 ? -29.483 54.840 1.933   1.00 39.94  ? 699  PHE B CG  1 
ATOM   2903 C  CD1 . PHE B 1 108 ? -30.815 54.614 2.258   1.00 41.60  ? 699  PHE B CD1 1 
ATOM   2904 C  CD2 . PHE B 1 108 ? -29.169 55.946 1.156   1.00 41.65  ? 699  PHE B CD2 1 
ATOM   2905 C  CE1 . PHE B 1 108 ? -31.819 55.460 1.790   1.00 42.34  ? 699  PHE B CE1 1 
ATOM   2906 C  CE2 . PHE B 1 108 ? -30.174 56.810 0.712   1.00 45.56  ? 699  PHE B CE2 1 
ATOM   2907 C  CZ  . PHE B 1 108 ? -31.496 56.553 1.023   1.00 42.73  ? 699  PHE B CZ  1 
ATOM   2908 N  N   . MET B 1 109 ? -29.800 52.089 -0.200  1.00 38.93  ? 700  MET B N   1 
ATOM   2909 C  CA  . MET B 1 109 ? -29.995 52.018 -1.653  1.00 37.86  ? 700  MET B CA  1 
ATOM   2910 C  C   . MET B 1 109 ? -30.978 53.103 -2.055  1.00 44.45  ? 700  MET B C   1 
ATOM   2911 O  O   . MET B 1 109 ? -32.177 52.870 -2.055  1.00 46.15  ? 700  MET B O   1 
ATOM   2912 C  CB  . MET B 1 109 ? -30.477 50.623 -2.078  1.00 37.59  ? 700  MET B CB  1 
ATOM   2913 C  CG  . MET B 1 109 ? -29.609 49.479 -1.565  1.00 37.65  ? 700  MET B CG  1 
ATOM   2914 S  SD  . MET B 1 109 ? -27.963 49.358 -2.297  1.00 38.64  ? 700  MET B SD  1 
ATOM   2915 C  CE  . MET B 1 109 ? -28.383 48.856 -3.941  1.00 33.87  ? 700  MET B CE  1 
ATOM   2916 N  N   . GLU B 1 110 ? -30.464 54.301 -2.344  1.00 44.51  ? 701  GLU B N   1 
ATOM   2917 C  CA  . GLU B 1 110 ? -31.202 55.541 -2.646  1.00 46.73  ? 701  GLU B CA  1 
ATOM   2918 C  C   . GLU B 1 110 ? -32.349 55.415 -3.618  1.00 51.42  ? 701  GLU B C   1 
ATOM   2919 O  O   . GLU B 1 110 ? -33.378 56.055 -3.406  1.00 53.01  ? 701  GLU B O   1 
ATOM   2920 C  CB  . GLU B 1 110 ? -30.255 56.631 -3.154  1.00 49.15  ? 701  GLU B CB  1 
ATOM   2921 C  CG  . GLU B 1 110 ? -30.720 58.034 -2.785  1.00 68.33  ? 701  GLU B CG  1 
ATOM   2922 C  CD  . GLU B 1 110 ? -30.387 59.118 -3.781  1.00 101.91 ? 701  GLU B CD  1 
ATOM   2923 O  OE1 . GLU B 1 110 ? -29.306 59.044 -4.406  1.00 90.12  ? 701  GLU B OE1 1 
ATOM   2924 O  OE2 . GLU B 1 110 ? -31.202 60.058 -3.921  1.00 109.67 ? 701  GLU B OE2 1 
ATOM   2925 N  N   . ASN B 1 111 ? -32.181 54.609 -4.681  1.00 44.90  ? 702  ASN B N   1 
ATOM   2926 C  CA  . ASN B 1 111 ? -33.183 54.497 -5.738  1.00 43.37  ? 702  ASN B CA  1 
ATOM   2927 C  C   . ASN B 1 111 ? -34.227 53.386 -5.509  1.00 45.30  ? 702  ASN B C   1 
ATOM   2928 O  O   . ASN B 1 111 ? -35.101 53.224 -6.350  1.00 44.22  ? 702  ASN B O   1 
ATOM   2929 C  CB  . ASN B 1 111 ? -32.470 54.375 -7.085  1.00 37.64  ? 702  ASN B CB  1 
ATOM   2930 C  CG  . ASN B 1 111 ? -31.841 55.696 -7.470  1.00 43.65  ? 702  ASN B CG  1 
ATOM   2931 O  OD1 . ASN B 1 111 ? -32.481 56.740 -7.383  1.00 41.29  ? 702  ASN B OD1 1 
ATOM   2932 N  ND2 . ASN B 1 111 ? -30.596 55.709 -7.884  1.00 39.34  ? 702  ASN B ND2 1 
ATOM   2933 N  N   . GLY B 1 112 ? -34.160 52.687 -4.364  1.00 40.52  ? 703  GLY B N   1 
ATOM   2934 C  CA  . GLY B 1 112 ? -35.125 51.656 -3.977  1.00 40.12  ? 703  GLY B CA  1 
ATOM   2935 C  C   . GLY B 1 112 ? -35.245 50.503 -4.950  1.00 42.98  ? 703  GLY B C   1 
ATOM   2936 O  O   . GLY B 1 112 ? -34.270 50.155 -5.610  1.00 39.94  ? 703  GLY B O   1 
ATOM   2937 N  N   . ALA B 1 113 ? -36.457 49.908 -5.045  1.00 41.44  ? 704  ALA B N   1 
ATOM   2938 C  CA  . ALA B 1 113 ? -36.765 48.759 -5.912  1.00 40.52  ? 704  ALA B CA  1 
ATOM   2939 C  C   . ALA B 1 113 ? -36.563 49.100 -7.382  1.00 44.67  ? 704  ALA B C   1 
ATOM   2940 O  O   . ALA B 1 113 ? -36.929 50.196 -7.835  1.00 46.71  ? 704  ALA B O   1 
ATOM   2941 C  CB  . ALA B 1 113 ? -38.194 48.267 -5.673  1.00 42.03  ? 704  ALA B CB  1 
ATOM   2942 N  N   . LEU B 1 114 ? -35.966 48.164 -8.117  1.00 37.67  ? 705  LEU B N   1 
ATOM   2943 C  CA  . LEU B 1 114 ? -35.621 48.333 -9.521  1.00 37.24  ? 705  LEU B CA  1 
ATOM   2944 C  C   . LEU B 1 114 ? -36.830 48.543 -10.443 1.00 41.84  ? 705  LEU B C   1 
ATOM   2945 O  O   . LEU B 1 114 ? -36.764 49.424 -11.313 1.00 42.37  ? 705  LEU B O   1 
ATOM   2946 C  CB  . LEU B 1 114 ? -34.739 47.151 -9.999  1.00 34.92  ? 705  LEU B CB  1 
ATOM   2947 C  CG  . LEU B 1 114 ? -34.373 47.100 -11.485 1.00 37.73  ? 705  LEU B CG  1 
ATOM   2948 C  CD1 . LEU B 1 114 ? -33.561 48.336 -11.914 1.00 37.91  ? 705  LEU B CD1 1 
ATOM   2949 C  CD2 . LEU B 1 114 ? -33.647 45.838 -11.779 1.00 37.72  ? 705  LEU B CD2 1 
ATOM   2950 N  N   . ASP B 1 115 ? -37.918 47.765 -10.246 1.00 37.21  ? 706  ASP B N   1 
ATOM   2951 C  CA  . ASP B 1 115 ? -39.127 47.866 -11.078 1.00 37.81  ? 706  ASP B CA  1 
ATOM   2952 C  C   . ASP B 1 115 ? -39.729 49.287 -11.072 1.00 43.19  ? 706  ASP B C   1 
ATOM   2953 O  O   . ASP B 1 115 ? -40.028 49.822 -12.147 1.00 41.73  ? 706  ASP B O   1 
ATOM   2954 C  CB  . ASP B 1 115 ? -40.173 46.794 -10.685 1.00 39.72  ? 706  ASP B CB  1 
ATOM   2955 C  CG  . ASP B 1 115 ? -40.864 46.999 -9.347  1.00 46.43  ? 706  ASP B CG  1 
ATOM   2956 O  OD1 . ASP B 1 115 ? -40.173 47.321 -8.362  1.00 47.81  ? 706  ASP B OD1 1 
ATOM   2957 O  OD2 . ASP B 1 115 ? -42.099 46.898 -9.301  1.00 53.79  ? 706  ASP B OD2 1 
ATOM   2958 N  N   . SER B 1 116 ? -39.894 49.900 -9.871  1.00 41.24  ? 707  SER B N   1 
ATOM   2959 C  CA  . SER B 1 116 ? -40.481 51.249 -9.778  1.00 42.83  ? 707  SER B CA  1 
ATOM   2960 C  C   . SER B 1 116 ? -39.477 52.319 -10.151 1.00 46.89  ? 707  SER B C   1 
ATOM   2961 O  O   . SER B 1 116 ? -39.873 53.338 -10.696 1.00 49.32  ? 707  SER B O   1 
ATOM   2962 C  CB  . SER B 1 116 ? -41.107 51.519 -8.415  1.00 46.01  ? 707  SER B CB  1 
ATOM   2963 O  OG  . SER B 1 116 ? -40.202 51.203 -7.375  1.00 57.88  ? 707  SER B OG  1 
ATOM   2964 N  N   . PHE B 1 117 ? -38.178 52.077 -9.929  1.00 40.47  ? 708  PHE B N   1 
ATOM   2965 C  CA  . PHE B 1 117 ? -37.138 53.025 -10.333 1.00 39.76  ? 708  PHE B CA  1 
ATOM   2966 C  C   . PHE B 1 117 ? -37.145 53.205 -11.858 1.00 46.51  ? 708  PHE B C   1 
ATOM   2967 O  O   . PHE B 1 117 ? -37.117 54.332 -12.340 1.00 48.21  ? 708  PHE B O   1 
ATOM   2968 C  CB  . PHE B 1 117 ? -35.762 52.565 -9.840  1.00 39.53  ? 708  PHE B CB  1 
ATOM   2969 C  CG  . PHE B 1 117 ? -34.617 53.386 -10.371 1.00 40.49  ? 708  PHE B CG  1 
ATOM   2970 C  CD1 . PHE B 1 117 ? -34.484 54.732 -10.030 1.00 43.38  ? 708  PHE B CD1 1 
ATOM   2971 C  CD2 . PHE B 1 117 ? -33.662 52.816 -11.196 1.00 41.29  ? 708  PHE B CD2 1 
ATOM   2972 C  CE1 . PHE B 1 117 ? -33.427 55.489 -10.515 1.00 44.26  ? 708  PHE B CE1 1 
ATOM   2973 C  CE2 . PHE B 1 117 ? -32.586 53.575 -11.672 1.00 44.85  ? 708  PHE B CE2 1 
ATOM   2974 C  CZ  . PHE B 1 117 ? -32.483 54.909 -11.330 1.00 43.74  ? 708  PHE B CZ  1 
ATOM   2975 N  N   . LEU B 1 118 ? -37.216 52.089 -12.611 1.00 42.98  ? 709  LEU B N   1 
ATOM   2976 C  CA  . LEU B 1 118 ? -37.299 52.084 -14.071 1.00 42.30  ? 709  LEU B CA  1 
ATOM   2977 C  C   . LEU B 1 118 ? -38.586 52.719 -14.586 1.00 47.40  ? 709  LEU B C   1 
ATOM   2978 O  O   . LEU B 1 118 ? -38.512 53.454 -15.563 1.00 47.19  ? 709  LEU B O   1 
ATOM   2979 C  CB  . LEU B 1 118 ? -37.147 50.672 -14.645 1.00 40.58  ? 709  LEU B CB  1 
ATOM   2980 C  CG  . LEU B 1 118 ? -35.814 49.972 -14.412 1.00 41.82  ? 709  LEU B CG  1 
ATOM   2981 C  CD1 . LEU B 1 118 ? -35.893 48.566 -14.877 1.00 39.24  ? 709  LEU B CD1 1 
ATOM   2982 C  CD2 . LEU B 1 118 ? -34.663 50.696 -15.113 1.00 41.11  ? 709  LEU B CD2 1 
ATOM   2983 N  N   . ARG B 1 119 ? -39.755 52.450 -13.947 1.00 46.09  ? 710  ARG B N   1 
ATOM   2984 C  CA  . ARG B 1 119 ? -41.045 53.054 -14.355 1.00 47.35  ? 710  ARG B CA  1 
ATOM   2985 C  C   . ARG B 1 119 ? -41.025 54.578 -14.177 1.00 54.45  ? 710  ARG B C   1 
ATOM   2986 O  O   . ARG B 1 119 ? -41.611 55.292 -14.979 1.00 54.78  ? 710  ARG B O   1 
ATOM   2987 C  CB  . ARG B 1 119 ? -42.237 52.456 -13.598 1.00 46.01  ? 710  ARG B CB  1 
ATOM   2988 C  CG  . ARG B 1 119 ? -42.591 51.034 -14.007 1.00 52.84  ? 710  ARG B CG  1 
ATOM   2989 C  CD  . ARG B 1 119 ? -43.936 50.592 -13.419 1.00 54.05  ? 710  ARG B CD  1 
ATOM   2990 N  NE  . ARG B 1 119 ? -43.884 50.424 -11.962 1.00 51.52  ? 710  ARG B NE  1 
ATOM   2991 C  CZ  . ARG B 1 119 ? -43.583 49.286 -11.338 1.00 62.17  ? 710  ARG B CZ  1 
ATOM   2992 N  NH1 . ARG B 1 119 ? -43.304 48.189 -12.034 1.00 43.95  ? 710  ARG B NH1 1 
ATOM   2993 N  NH2 . ARG B 1 119 ? -43.566 49.234 -10.012 1.00 47.46  ? 710  ARG B NH2 1 
ATOM   2994 N  N   . GLN B 1 120 ? -40.339 55.073 -13.144 1.00 53.62  ? 711  GLN B N   1 
ATOM   2995 C  CA  . GLN B 1 120 ? -40.195 56.506 -12.840 1.00 56.42  ? 711  GLN B CA  1 
ATOM   2996 C  C   . GLN B 1 120 ? -39.122 57.165 -13.714 1.00 62.37  ? 711  GLN B C   1 
ATOM   2997 O  O   . GLN B 1 120 ? -38.936 58.381 -13.655 1.00 63.69  ? 711  GLN B O   1 
ATOM   2998 C  CB  . GLN B 1 120 ? -39.795 56.686 -11.365 1.00 57.88  ? 711  GLN B CB  1 
ATOM   2999 C  CG  . GLN B 1 120 ? -40.945 56.509 -10.383 1.00 92.80  ? 711  GLN B CG  1 
ATOM   3000 C  CD  . GLN B 1 120 ? -40.472 56.705 -8.964  1.00 122.75 ? 711  GLN B CD  1 
ATOM   3001 O  OE1 . GLN B 1 120 ? -40.453 55.768 -8.158  1.00 119.65 ? 711  GLN B OE1 1 
ATOM   3002 N  NE2 . GLN B 1 120 ? -40.053 57.923 -8.630  1.00 118.36 ? 711  GLN B NE2 1 
ATOM   3003 N  N   . ASN B 1 121 ? -38.399 56.362 -14.506 1.00 58.60  ? 712  ASN B N   1 
ATOM   3004 C  CA  . ASN B 1 121 ? -37.305 56.818 -15.358 1.00 58.61  ? 712  ASN B CA  1 
ATOM   3005 C  C   . ASN B 1 121 ? -37.441 56.203 -16.762 1.00 63.88  ? 712  ASN B C   1 
ATOM   3006 O  O   . ASN B 1 121 ? -36.446 55.819 -17.373 1.00 65.52  ? 712  ASN B O   1 
ATOM   3007 C  CB  . ASN B 1 121 ? -35.982 56.415 -14.667 1.00 58.75  ? 712  ASN B CB  1 
ATOM   3008 C  CG  . ASN B 1 121 ? -35.666 57.268 -13.460 1.00 74.42  ? 712  ASN B CG  1 
ATOM   3009 O  OD1 . ASN B 1 121 ? -35.111 58.354 -13.598 1.00 71.30  ? 712  ASN B OD1 1 
ATOM   3010 N  ND2 . ASN B 1 121 ? -36.016 56.813 -12.259 1.00 57.06  ? 712  ASN B ND2 1 
ATOM   3011 N  N   . ASP B 1 122 ? -38.686 56.093 -17.248 1.00 59.41  ? 713  ASP B N   1 
ATOM   3012 C  CA  . ASP B 1 122 ? -39.079 55.469 -18.515 1.00 59.18  ? 713  ASP B CA  1 
ATOM   3013 C  C   . ASP B 1 122 ? -38.414 56.131 -19.704 1.00 60.34  ? 713  ASP B C   1 
ATOM   3014 O  O   . ASP B 1 122 ? -38.503 57.341 -19.869 1.00 59.65  ? 713  ASP B O   1 
ATOM   3015 C  CB  . ASP B 1 122 ? -40.622 55.412 -18.643 1.00 62.42  ? 713  ASP B CB  1 
ATOM   3016 C  CG  . ASP B 1 122 ? -41.189 54.549 -19.767 1.00 75.48  ? 713  ASP B CG  1 
ATOM   3017 O  OD1 . ASP B 1 122 ? -40.474 53.650 -20.247 1.00 75.25  ? 713  ASP B OD1 1 
ATOM   3018 O  OD2 . ASP B 1 122 ? -42.360 54.765 -20.147 1.00 85.18  ? 713  ASP B OD2 1 
ATOM   3019 N  N   . GLY B 1 123 ? -37.671 55.319 -20.450 1.00 56.63  ? 714  GLY B N   1 
ATOM   3020 C  CA  . GLY B 1 123 ? -36.887 55.701 -21.618 1.00 57.00  ? 714  GLY B CA  1 
ATOM   3021 C  C   . GLY B 1 123 ? -35.658 56.521 -21.323 1.00 62.47  ? 714  GLY B C   1 
ATOM   3022 O  O   . GLY B 1 123 ? -35.016 56.975 -22.261 1.00 65.45  ? 714  GLY B O   1 
ATOM   3023 N  N   . GLN B 1 124 ? -35.321 56.741 -20.051 1.00 59.55  ? 715  GLN B N   1 
ATOM   3024 C  CA  . GLN B 1 124 ? -34.191 57.603 -19.679 1.00 60.21  ? 715  GLN B CA  1 
ATOM   3025 C  C   . GLN B 1 124 ? -32.820 56.900 -19.598 1.00 62.18  ? 715  GLN B C   1 
ATOM   3026 O  O   . GLN B 1 124 ? -31.816 57.579 -19.365 1.00 63.64  ? 715  GLN B O   1 
ATOM   3027 C  CB  . GLN B 1 124 ? -34.494 58.359 -18.371 1.00 62.52  ? 715  GLN B CB  1 
ATOM   3028 C  CG  . GLN B 1 124 ? -35.588 59.423 -18.496 1.00 76.80  ? 715  GLN B CG  1 
ATOM   3029 C  CD  . GLN B 1 124 ? -35.231 60.473 -19.517 1.00 98.26  ? 715  GLN B CD  1 
ATOM   3030 O  OE1 . GLN B 1 124 ? -34.236 61.197 -19.381 1.00 94.70  ? 715  GLN B OE1 1 
ATOM   3031 N  NE2 . GLN B 1 124 ? -36.008 60.530 -20.590 1.00 93.06  ? 715  GLN B NE2 1 
ATOM   3032 N  N   . PHE B 1 125 ? -32.768 55.563 -19.739 1.00 54.28  ? 716  PHE B N   1 
ATOM   3033 C  CA  . PHE B 1 125 ? -31.497 54.824 -19.762 1.00 50.89  ? 716  PHE B CA  1 
ATOM   3034 C  C   . PHE B 1 125 ? -31.317 54.151 -21.105 1.00 52.61  ? 716  PHE B C   1 
ATOM   3035 O  O   . PHE B 1 125 ? -32.294 53.707 -21.699 1.00 50.79  ? 716  PHE B O   1 
ATOM   3036 C  CB  . PHE B 1 125 ? -31.391 53.787 -18.626 1.00 49.86  ? 716  PHE B CB  1 
ATOM   3037 C  CG  . PHE B 1 125 ? -31.536 54.374 -17.245 1.00 51.29  ? 716  PHE B CG  1 
ATOM   3038 C  CD1 . PHE B 1 125 ? -30.582 55.253 -16.741 1.00 54.24  ? 716  PHE B CD1 1 
ATOM   3039 C  CD2 . PHE B 1 125 ? -32.617 54.038 -16.439 1.00 51.63  ? 716  PHE B CD2 1 
ATOM   3040 C  CE1 . PHE B 1 125 ? -30.731 55.818 -15.486 1.00 55.49  ? 716  PHE B CE1 1 
ATOM   3041 C  CE2 . PHE B 1 125 ? -32.765 54.608 -15.180 1.00 54.29  ? 716  PHE B CE2 1 
ATOM   3042 C  CZ  . PHE B 1 125 ? -31.825 55.496 -14.715 1.00 53.71  ? 716  PHE B CZ  1 
ATOM   3043 N  N   . THR B 1 126 ? -30.068 54.064 -21.571 1.00 49.10  ? 717  THR B N   1 
ATOM   3044 C  CA  . THR B 1 126 ? -29.715 53.416 -22.837 1.00 49.66  ? 717  THR B CA  1 
ATOM   3045 C  C   . THR B 1 126 ? -29.701 51.887 -22.643 1.00 51.22  ? 717  THR B C   1 
ATOM   3046 O  O   . THR B 1 126 ? -29.699 51.407 -21.504 1.00 48.39  ? 717  THR B O   1 
ATOM   3047 C  CB  . THR B 1 126 ? -28.325 53.910 -23.336 1.00 56.77  ? 717  THR B CB  1 
ATOM   3048 O  OG1 . THR B 1 126 ? -27.324 53.496 -22.401 1.00 59.17  ? 717  THR B OG1 1 
ATOM   3049 C  CG2 . THR B 1 126 ? -28.266 55.421 -23.553 1.00 48.41  ? 717  THR B CG2 1 
ATOM   3050 N  N   . VAL B 1 127 ? -29.664 51.135 -23.762 1.00 48.32  ? 718  VAL B N   1 
ATOM   3051 C  CA  . VAL B 1 127 ? -29.572 49.680 -23.791 1.00 46.97  ? 718  VAL B CA  1 
ATOM   3052 C  C   . VAL B 1 127 ? -28.324 49.242 -23.012 1.00 50.39  ? 718  VAL B C   1 
ATOM   3053 O  O   . VAL B 1 127 ? -28.427 48.343 -22.196 1.00 49.57  ? 718  VAL B O   1 
ATOM   3054 C  CB  . VAL B 1 127 ? -29.576 49.152 -25.260 1.00 51.01  ? 718  VAL B CB  1 
ATOM   3055 C  CG1 . VAL B 1 127 ? -29.055 47.717 -25.346 1.00 49.95  ? 718  VAL B CG1 1 
ATOM   3056 C  CG2 . VAL B 1 127 ? -30.965 49.252 -25.875 1.00 51.24  ? 718  VAL B CG2 1 
ATOM   3057 N  N   . ILE B 1 128 ? -27.167 49.893 -23.231 1.00 48.72  ? 719  ILE B N   1 
ATOM   3058 C  CA  . ILE B 1 128 ? -25.929 49.542 -22.530 1.00 48.16  ? 719  ILE B CA  1 
ATOM   3059 C  C   . ILE B 1 128 ? -26.055 49.756 -21.012 1.00 48.89  ? 719  ILE B C   1 
ATOM   3060 O  O   . ILE B 1 128 ? -25.565 48.925 -20.233 1.00 47.56  ? 719  ILE B O   1 
ATOM   3061 C  CB  . ILE B 1 128 ? -24.663 50.220 -23.148 1.00 53.32  ? 719  ILE B CB  1 
ATOM   3062 C  CG1 . ILE B 1 128 ? -23.389 49.618 -22.564 1.00 54.04  ? 719  ILE B CG1 1 
ATOM   3063 C  CG2 . ILE B 1 128 ? -24.642 51.712 -23.033 1.00 55.92  ? 719  ILE B CG2 1 
ATOM   3064 C  CD1 . ILE B 1 128 ? -22.791 48.505 -23.434 1.00 68.01  ? 719  ILE B CD1 1 
ATOM   3065 N  N   . GLN B 1 129 ? -26.761 50.828 -20.591 1.00 44.85  ? 720  GLN B N   1 
ATOM   3066 C  CA  . GLN B 1 129 ? -26.979 51.081 -19.170 1.00 43.17  ? 720  GLN B CA  1 
ATOM   3067 C  C   . GLN B 1 129 ? -27.841 49.968 -18.572 1.00 43.87  ? 720  GLN B C   1 
ATOM   3068 O  O   . GLN B 1 129 ? -27.481 49.414 -17.534 1.00 43.43  ? 720  GLN B O   1 
ATOM   3069 C  CB  . GLN B 1 129 ? -27.578 52.478 -18.943 1.00 45.41  ? 720  GLN B CB  1 
ATOM   3070 C  CG  . GLN B 1 129 ? -26.542 53.585 -19.147 1.00 49.74  ? 720  GLN B CG  1 
ATOM   3071 C  CD  . GLN B 1 129 ? -27.121 54.978 -19.259 1.00 70.08  ? 720  GLN B CD  1 
ATOM   3072 O  OE1 . GLN B 1 129 ? -28.311 55.193 -19.470 1.00 58.01  ? 720  GLN B OE1 1 
ATOM   3073 N  NE2 . GLN B 1 129 ? -26.275 55.969 -19.133 1.00 77.76  ? 720  GLN B NE2 1 
ATOM   3074 N  N   . LEU B 1 130 ? -28.924 49.578 -19.276 1.00 38.80  ? 721  LEU B N   1 
ATOM   3075 C  CA  . LEU B 1 130 ? -29.826 48.519 -18.820 1.00 37.36  ? 721  LEU B CA  1 
ATOM   3076 C  C   . LEU B 1 130 ? -29.106 47.162 -18.765 1.00 41.17  ? 721  LEU B C   1 
ATOM   3077 O  O   . LEU B 1 130 ? -29.289 46.425 -17.801 1.00 38.46  ? 721  LEU B O   1 
ATOM   3078 C  CB  . LEU B 1 130 ? -31.083 48.446 -19.689 1.00 37.25  ? 721  LEU B CB  1 
ATOM   3079 C  CG  . LEU B 1 130 ? -31.965 49.701 -19.707 1.00 42.10  ? 721  LEU B CG  1 
ATOM   3080 C  CD1 . LEU B 1 130 ? -32.998 49.634 -20.829 1.00 42.43  ? 721  LEU B CD1 1 
ATOM   3081 C  CD2 . LEU B 1 130 ? -32.613 49.979 -18.326 1.00 39.56  ? 721  LEU B CD2 1 
ATOM   3082 N  N   . VAL B 1 131 ? -28.235 46.879 -19.767 1.00 39.04  ? 722  VAL B N   1 
ATOM   3083 C  CA  . VAL B 1 131 ? -27.432 45.657 -19.829 1.00 38.29  ? 722  VAL B CA  1 
ATOM   3084 C  C   . VAL B 1 131 ? -26.449 45.604 -18.632 1.00 40.81  ? 722  VAL B C   1 
ATOM   3085 O  O   . VAL B 1 131 ? -26.302 44.552 -18.006 1.00 38.34  ? 722  VAL B O   1 
ATOM   3086 C  CB  . VAL B 1 131 ? -26.768 45.462 -21.214 1.00 42.71  ? 722  VAL B CB  1 
ATOM   3087 C  CG1 . VAL B 1 131 ? -25.702 44.366 -21.171 1.00 42.03  ? 722  VAL B CG1 1 
ATOM   3088 C  CG2 . VAL B 1 131 ? -27.817 45.135 -22.267 1.00 42.67  ? 722  VAL B CG2 1 
ATOM   3089 N  N   . GLY B 1 132 ? -25.854 46.752 -18.293 1.00 37.13  ? 723  GLY B N   1 
ATOM   3090 C  CA  . GLY B 1 132 ? -24.979 46.892 -17.138 1.00 34.50  ? 723  GLY B CA  1 
ATOM   3091 C  C   . GLY B 1 132 ? -25.698 46.531 -15.853 1.00 35.43  ? 723  GLY B C   1 
ATOM   3092 O  O   . GLY B 1 132 ? -25.137 45.842 -15.015 1.00 35.41  ? 723  GLY B O   1 
ATOM   3093 N  N   . MET B 1 133 ? -26.949 46.966 -15.700 1.00 34.03  ? 724  MET B N   1 
ATOM   3094 C  CA  . MET B 1 133 ? -27.804 46.651 -14.529 1.00 33.50  ? 724  MET B CA  1 
ATOM   3095 C  C   . MET B 1 133 ? -28.098 45.142 -14.455 1.00 38.24  ? 724  MET B C   1 
ATOM   3096 O  O   . MET B 1 133 ? -28.047 44.561 -13.367 1.00 38.95  ? 724  MET B O   1 
ATOM   3097 C  CB  . MET B 1 133 ? -29.135 47.399 -14.597 1.00 36.19  ? 724  MET B CB  1 
ATOM   3098 C  CG  . MET B 1 133 ? -29.005 48.886 -14.519 1.00 40.10  ? 724  MET B CG  1 
ATOM   3099 S  SD  . MET B 1 133 ? -30.666 49.579 -14.615 1.00 44.48  ? 724  MET B SD  1 
ATOM   3100 C  CE  . MET B 1 133 ? -30.226 51.165 -15.163 1.00 43.30  ? 724  MET B CE  1 
ATOM   3101 N  N   . LEU B 1 134 ? -28.402 44.514 -15.617 1.00 34.21  ? 725  LEU B N   1 
ATOM   3102 C  CA  . LEU B 1 134 ? -28.653 43.073 -15.729 1.00 34.17  ? 725  LEU B CA  1 
ATOM   3103 C  C   . LEU B 1 134 ? -27.410 42.228 -15.443 1.00 38.13  ? 725  LEU B C   1 
ATOM   3104 O  O   . LEU B 1 134 ? -27.533 41.140 -14.874 1.00 36.54  ? 725  LEU B O   1 
ATOM   3105 C  CB  . LEU B 1 134 ? -29.214 42.742 -17.117 1.00 34.58  ? 725  LEU B CB  1 
ATOM   3106 C  CG  . LEU B 1 134 ? -30.637 43.221 -17.372 1.00 37.35  ? 725  LEU B CG  1 
ATOM   3107 C  CD1 . LEU B 1 134 ? -31.020 42.951 -18.787 1.00 36.92  ? 725  LEU B CD1 1 
ATOM   3108 C  CD2 . LEU B 1 134 ? -31.610 42.504 -16.451 1.00 39.07  ? 725  LEU B CD2 1 
ATOM   3109 N  N   . ARG B 1 135 ? -26.224 42.725 -15.844 1.00 35.02  ? 726  ARG B N   1 
ATOM   3110 C  CA  . ARG B 1 135 ? -24.952 42.054 -15.627 1.00 33.71  ? 726  ARG B CA  1 
ATOM   3111 C  C   . ARG B 1 135 ? -24.644 42.003 -14.114 1.00 35.77  ? 726  ARG B C   1 
ATOM   3112 O  O   . ARG B 1 135 ? -24.199 40.960 -13.627 1.00 33.14  ? 726  ARG B O   1 
ATOM   3113 C  CB  . ARG B 1 135 ? -23.838 42.727 -16.449 1.00 33.92  ? 726  ARG B CB  1 
ATOM   3114 C  CG  . ARG B 1 135 ? -22.524 41.940 -16.461 1.00 41.23  ? 726  ARG B CG  1 
ATOM   3115 C  CD  . ARG B 1 135 ? -21.593 42.280 -15.297 1.00 39.84  ? 726  ARG B CD  1 
ATOM   3116 N  NE  . ARG B 1 135 ? -20.366 41.514 -15.419 1.00 36.93  ? 726  ARG B NE  1 
ATOM   3117 C  CZ  . ARG B 1 135 ? -19.595 41.115 -14.421 1.00 46.26  ? 726  ARG B CZ  1 
ATOM   3118 N  NH1 . ARG B 1 135 ? -19.867 41.479 -13.174 1.00 32.18  ? 726  ARG B NH1 1 
ATOM   3119 N  NH2 . ARG B 1 135 ? -18.516 40.388 -14.664 1.00 40.09  ? 726  ARG B NH2 1 
ATOM   3120 N  N   . GLY B 1 136 ? -24.924 43.105 -13.401 1.00 32.93  ? 727  GLY B N   1 
ATOM   3121 C  CA  . GLY B 1 136 ? -24.778 43.184 -11.953 1.00 31.63  ? 727  GLY B CA  1 
ATOM   3122 C  C   . GLY B 1 136 ? -25.690 42.202 -11.242 1.00 34.59  ? 727  GLY B C   1 
ATOM   3123 O  O   . GLY B 1 136 ? -25.233 41.447 -10.392 1.00 34.99  ? 727  GLY B O   1 
ATOM   3124 N  N   . ILE B 1 137 ? -26.972 42.132 -11.649 1.00 31.84  ? 728  ILE B N   1 
ATOM   3125 C  CA  . ILE B 1 137 ? -27.919 41.163 -11.087 1.00 31.03  ? 728  ILE B CA  1 
ATOM   3126 C  C   . ILE B 1 137 ? -27.421 39.703 -11.301 1.00 34.91  ? 728  ILE B C   1 
ATOM   3127 O  O   . ILE B 1 137 ? -27.421 38.908 -10.361 1.00 35.10  ? 728  ILE B O   1 
ATOM   3128 C  CB  . ILE B 1 137 ? -29.376 41.367 -11.610 1.00 33.44  ? 728  ILE B CB  1 
ATOM   3129 C  CG1 . ILE B 1 137 ? -29.880 42.783 -11.253 1.00 33.47  ? 728  ILE B CG1 1 
ATOM   3130 C  CG2 . ILE B 1 137 ? -30.305 40.243 -11.025 1.00 32.08  ? 728  ILE B CG2 1 
ATOM   3131 C  CD1 . ILE B 1 137 ? -31.017 43.282 -12.069 1.00 34.54  ? 728  ILE B CD1 1 
ATOM   3132 N  N   . ALA B 1 138 ? -26.994 39.382 -12.533 1.00 31.97  ? 729  ALA B N   1 
ATOM   3133 C  CA  . ALA B 1 138 ? -26.476 38.052 -12.902 1.00 31.83  ? 729  ALA B CA  1 
ATOM   3134 C  C   . ALA B 1 138 ? -25.231 37.690 -12.075 1.00 35.26  ? 729  ALA B C   1 
ATOM   3135 O  O   . ALA B 1 138 ? -25.112 36.539 -11.643 1.00 35.58  ? 729  ALA B O   1 
ATOM   3136 C  CB  . ALA B 1 138 ? -26.162 38.010 -14.389 1.00 32.29  ? 729  ALA B CB  1 
ATOM   3137 N  N   . ALA B 1 139 ? -24.328 38.685 -11.820 1.00 32.12  ? 730  ALA B N   1 
ATOM   3138 C  CA  . ALA B 1 139 ? -23.114 38.529 -11.013 1.00 30.88  ? 730  ALA B CA  1 
ATOM   3139 C  C   . ALA B 1 139 ? -23.476 38.215 -9.551  1.00 33.18  ? 730  ALA B C   1 
ATOM   3140 O  O   . ALA B 1 139 ? -22.863 37.332 -8.948  1.00 33.40  ? 730  ALA B O   1 
ATOM   3141 C  CB  . ALA B 1 139 ? -22.247 39.784 -11.102 1.00 30.74  ? 730  ALA B CB  1 
ATOM   3142 N  N   . GLY B 1 140 ? -24.474 38.919 -9.010  1.00 29.45  ? 731  GLY B N   1 
ATOM   3143 C  CA  . GLY B 1 140 ? -24.969 38.679 -7.655  1.00 28.77  ? 731  GLY B CA  1 
ATOM   3144 C  C   . GLY B 1 140 ? -25.592 37.297 -7.543  1.00 33.55  ? 731  GLY B C   1 
ATOM   3145 O  O   . GLY B 1 140 ? -25.361 36.589 -6.564  1.00 32.04  ? 731  GLY B O   1 
ATOM   3146 N  N   . MET B 1 141 ? -26.341 36.883 -8.591  1.00 32.51  ? 732  MET B N   1 
ATOM   3147 C  CA  . MET B 1 141 ? -26.972 35.557 -8.666  1.00 30.98  ? 732  MET B CA  1 
ATOM   3148 C  C   . MET B 1 141 ? -25.965 34.445 -8.871  1.00 31.82  ? 732  MET B C   1 
ATOM   3149 O  O   . MET B 1 141 ? -26.153 33.363 -8.328  1.00 32.52  ? 732  MET B O   1 
ATOM   3150 C  CB  . MET B 1 141 ? -28.096 35.509 -9.706  1.00 31.82  ? 732  MET B CB  1 
ATOM   3151 C  CG  . MET B 1 141 ? -29.358 36.294 -9.270  1.00 33.48  ? 732  MET B CG  1 
ATOM   3152 S  SD  . MET B 1 141 ? -30.076 35.804 -7.659  1.00 34.64  ? 732  MET B SD  1 
ATOM   3153 C  CE  . MET B 1 141 ? -30.325 33.967 -7.907  1.00 30.42  ? 732  MET B CE  1 
ATOM   3154 N  N   . LYS B 1 142 ? -24.889 34.712 -9.598  1.00 28.14  ? 733  LYS B N   1 
ATOM   3155 C  CA  . LYS B 1 142 ? -23.806 33.728 -9.780  1.00 28.81  ? 733  LYS B CA  1 
ATOM   3156 C  C   . LYS B 1 142 ? -23.180 33.434 -8.424  1.00 33.78  ? 733  LYS B C   1 
ATOM   3157 O  O   . LYS B 1 142 ? -22.962 32.279 -8.074  1.00 36.30  ? 733  LYS B O   1 
ATOM   3158 C  CB  . LYS B 1 142 ? -22.748 34.297 -10.749 1.00 31.81  ? 733  LYS B CB  1 
ATOM   3159 C  CG  . LYS B 1 142 ? -21.526 33.393 -10.941 1.00 29.12  ? 733  LYS B CG  1 
ATOM   3160 C  CD  . LYS B 1 142 ? -20.434 34.100 -11.729 1.00 29.88  ? 733  LYS B CD  1 
ATOM   3161 C  CE  . LYS B 1 142 ? -19.315 33.135 -12.096 1.00 35.69  ? 733  LYS B CE  1 
ATOM   3162 N  NZ  . LYS B 1 142 ? -18.477 32.757 -10.928 1.00 38.30  ? 733  LYS B NZ  1 
ATOM   3163 N  N   . TYR B 1 143 ? -22.921 34.494 -7.653  1.00 31.90  ? 734  TYR B N   1 
ATOM   3164 C  CA  . TYR B 1 143 ? -22.338 34.411 -6.327  1.00 30.88  ? 734  TYR B CA  1 
ATOM   3165 C  C   . TYR B 1 143 ? -23.290 33.668 -5.388  1.00 34.05  ? 734  TYR B C   1 
ATOM   3166 O  O   . TYR B 1 143 ? -22.864 32.735 -4.740  1.00 31.60  ? 734  TYR B O   1 
ATOM   3167 C  CB  . TYR B 1 143 ? -21.999 35.821 -5.803  1.00 30.90  ? 734  TYR B CB  1 
ATOM   3168 C  CG  . TYR B 1 143 ? -21.407 35.829 -4.404  1.00 31.63  ? 734  TYR B CG  1 
ATOM   3169 C  CD1 . TYR B 1 143 ? -22.227 35.892 -3.277  1.00 33.45  ? 734  TYR B CD1 1 
ATOM   3170 C  CD2 . TYR B 1 143 ? -20.030 35.761 -4.206  1.00 31.29  ? 734  TYR B CD2 1 
ATOM   3171 C  CE1 . TYR B 1 143 ? -21.692 35.900 -1.990  1.00 33.35  ? 734  TYR B CE1 1 
ATOM   3172 C  CE2 . TYR B 1 143 ? -19.485 35.751 -2.921  1.00 32.67  ? 734  TYR B CE2 1 
ATOM   3173 C  CZ  . TYR B 1 143 ? -20.321 35.839 -1.817  1.00 37.55  ? 734  TYR B CZ  1 
ATOM   3174 O  OH  . TYR B 1 143 ? -19.802 35.893 -0.550  1.00 38.58  ? 734  TYR B OH  1 
ATOM   3175 N  N   . LEU B 1 144 ? -24.572 34.056 -5.330  1.00 32.02  ? 735  LEU B N   1 
ATOM   3176 C  CA  . LEU B 1 144 ? -25.539 33.399 -4.457  1.00 31.92  ? 735  LEU B CA  1 
ATOM   3177 C  C   . LEU B 1 144 ? -25.690 31.877 -4.788  1.00 36.18  ? 735  LEU B C   1 
ATOM   3178 O  O   . LEU B 1 144 ? -25.556 31.037 -3.887  1.00 36.24  ? 735  LEU B O   1 
ATOM   3179 C  CB  . LEU B 1 144 ? -26.874 34.163 -4.504  1.00 32.16  ? 735  LEU B CB  1 
ATOM   3180 C  CG  . LEU B 1 144 ? -27.997 33.668 -3.581  1.00 38.94  ? 735  LEU B CG  1 
ATOM   3181 C  CD1 . LEU B 1 144 ? -28.768 34.831 -3.022  1.00 41.01  ? 735  LEU B CD1 1 
ATOM   3182 C  CD2 . LEU B 1 144 ? -29.008 32.863 -4.347  1.00 40.84  ? 735  LEU B CD2 1 
ATOM   3183 N  N   . SER B 1 145 ? -25.897 31.533 -6.074  1.00 32.92  ? 736  SER B N   1 
ATOM   3184 C  CA  . SER B 1 145 ? -26.037 30.142 -6.514  1.00 33.49  ? 736  SER B CA  1 
ATOM   3185 C  C   . SER B 1 145 ? -24.766 29.317 -6.280  1.00 37.73  ? 736  SER B C   1 
ATOM   3186 O  O   . SER B 1 145 ? -24.862 28.160 -5.889  1.00 38.19  ? 736  SER B O   1 
ATOM   3187 C  CB  . SER B 1 145 ? -26.487 30.054 -7.967  1.00 34.40  ? 736  SER B CB  1 
ATOM   3188 O  OG  . SER B 1 145 ? -25.520 30.601 -8.842  1.00 43.09  ? 736  SER B OG  1 
ATOM   3189 N  N   . GLU B 1 146 ? -23.589 29.915 -6.455  1.00 35.68  ? 737  GLU B N   1 
ATOM   3190 C  CA  . GLU B 1 146 ? -22.331 29.205 -6.204  1.00 35.95  ? 737  GLU B CA  1 
ATOM   3191 C  C   . GLU B 1 146 ? -22.041 29.062 -4.689  1.00 41.90  ? 737  GLU B C   1 
ATOM   3192 O  O   . GLU B 1 146 ? -21.240 28.213 -4.329  1.00 43.12  ? 737  GLU B O   1 
ATOM   3193 C  CB  . GLU B 1 146 ? -21.161 29.804 -7.005  1.00 36.57  ? 737  GLU B CB  1 
ATOM   3194 C  CG  . GLU B 1 146 ? -21.272 29.429 -8.473  1.00 41.39  ? 737  GLU B CG  1 
ATOM   3195 C  CD  . GLU B 1 146 ? -20.410 30.175 -9.478  1.00 47.87  ? 737  GLU B CD  1 
ATOM   3196 O  OE1 . GLU B 1 146 ? -19.603 31.040 -9.076  1.00 41.89  ? 737  GLU B OE1 1 
ATOM   3197 O  OE2 . GLU B 1 146 ? -20.541 29.882 -10.685 1.00 37.07  ? 737  GLU B OE2 1 
ATOM   3198 N  N   . MET B 1 147 ? -22.755 29.819 -3.810  1.00 40.13  ? 738  MET B N   1 
ATOM   3199 C  CA  . MET B 1 147 ? -22.717 29.677 -2.347  1.00 41.53  ? 738  MET B CA  1 
ATOM   3200 C  C   . MET B 1 147 ? -23.735 28.564 -1.940  1.00 43.38  ? 738  MET B C   1 
ATOM   3201 O  O   . MET B 1 147 ? -23.973 28.325 -0.755  1.00 42.49  ? 738  MET B O   1 
ATOM   3202 C  CB  . MET B 1 147 ? -23.088 30.995 -1.635  1.00 45.15  ? 738  MET B CB  1 
ATOM   3203 C  CG  . MET B 1 147 ? -22.035 32.084 -1.725  1.00 51.04  ? 738  MET B CG  1 
ATOM   3204 S  SD  . MET B 1 147 ? -20.550 31.810 -0.728  1.00 58.77  ? 738  MET B SD  1 
ATOM   3205 C  CE  . MET B 1 147 ? -21.212 32.061 0.881   1.00 56.03  ? 738  MET B CE  1 
ATOM   3206 N  N   . ASN B 1 148 ? -24.372 27.931 -2.946  1.00 41.00  ? 739  ASN B N   1 
ATOM   3207 C  CA  . ASN B 1 148 ? -25.336 26.833 -2.859  1.00 41.09  ? 739  ASN B CA  1 
ATOM   3208 C  C   . ASN B 1 148 ? -26.692 27.246 -2.281  1.00 42.44  ? 739  ASN B C   1 
ATOM   3209 O  O   . ASN B 1 148 ? -27.343 26.462 -1.581  1.00 41.12  ? 739  ASN B O   1 
ATOM   3210 C  CB  . ASN B 1 148 ? -24.751 25.596 -2.143  1.00 49.66  ? 739  ASN B CB  1 
ATOM   3211 C  CG  . ASN B 1 148 ? -24.140 24.656 -3.150  1.00 83.88  ? 739  ASN B CG  1 
ATOM   3212 O  OD1 . ASN B 1 148 ? -22.952 24.779 -3.496  1.00 72.78  ? 739  ASN B OD1 1 
ATOM   3213 N  ND2 . ASN B 1 148 ? -24.979 23.789 -3.733  1.00 79.93  ? 739  ASN B ND2 1 
ATOM   3214 N  N   . TYR B 1 149 ? -27.155 28.451 -2.663  1.00 37.95  ? 740  TYR B N   1 
ATOM   3215 C  CA  . TYR B 1 149 ? -28.478 28.974 -2.304  1.00 37.46  ? 740  TYR B CA  1 
ATOM   3216 C  C   . TYR B 1 149 ? -29.408 29.100 -3.512  1.00 39.75  ? 740  TYR B C   1 
ATOM   3217 O  O   . TYR B 1 149 ? -28.976 29.308 -4.653  1.00 39.73  ? 740  TYR B O   1 
ATOM   3218 C  CB  . TYR B 1 149 ? -28.358 30.348 -1.630  1.00 38.35  ? 740  TYR B CB  1 
ATOM   3219 C  CG  . TYR B 1 149 ? -27.936 30.256 -0.184  1.00 41.71  ? 740  TYR B CG  1 
ATOM   3220 C  CD1 . TYR B 1 149 ? -26.588 30.250 0.171   1.00 43.76  ? 740  TYR B CD1 1 
ATOM   3221 C  CD2 . TYR B 1 149 ? -28.883 30.166 0.835   1.00 43.28  ? 740  TYR B CD2 1 
ATOM   3222 C  CE1 . TYR B 1 149 ? -26.191 30.150 1.507   1.00 44.71  ? 740  TYR B CE1 1 
ATOM   3223 C  CE2 . TYR B 1 149 ? -28.498 30.059 2.172   1.00 45.05  ? 740  TYR B CE2 1 
ATOM   3224 C  CZ  . TYR B 1 149 ? -27.150 30.057 2.501   1.00 49.61  ? 740  TYR B CZ  1 
ATOM   3225 O  OH  . TYR B 1 149 ? -26.772 29.981 3.806   1.00 52.25  ? 740  TYR B OH  1 
ATOM   3226 N  N   . VAL B 1 150 ? -30.693 28.962 -3.242  1.00 34.90  ? 741  VAL B N   1 
ATOM   3227 C  CA  . VAL B 1 150 ? -31.777 29.234 -4.182  1.00 33.67  ? 741  VAL B CA  1 
ATOM   3228 C  C   . VAL B 1 150 ? -32.519 30.433 -3.554  1.00 38.03  ? 741  VAL B C   1 
ATOM   3229 O  O   . VAL B 1 150 ? -32.790 30.419 -2.349  1.00 37.78  ? 741  VAL B O   1 
ATOM   3230 C  CB  . VAL B 1 150 ? -32.673 28.005 -4.514  1.00 36.85  ? 741  VAL B CB  1 
ATOM   3231 C  CG1 . VAL B 1 150 ? -33.407 27.466 -3.284  1.00 36.26  ? 741  VAL B CG1 1 
ATOM   3232 C  CG2 . VAL B 1 150 ? -33.654 28.331 -5.630  1.00 37.20  ? 741  VAL B CG2 1 
ATOM   3233 N  N   . HIS B 1 151 ? -32.752 31.482 -4.335  1.00 32.84  ? 742  HIS B N   1 
ATOM   3234 C  CA  . HIS B 1 151 ? -33.413 32.691 -3.874  1.00 31.94  ? 742  HIS B CA  1 
ATOM   3235 C  C   . HIS B 1 151 ? -34.917 32.505 -3.745  1.00 38.14  ? 742  HIS B C   1 
ATOM   3236 O  O   . HIS B 1 151 ? -35.500 32.889 -2.724  1.00 37.84  ? 742  HIS B O   1 
ATOM   3237 C  CB  . HIS B 1 151 ? -33.059 33.885 -4.793  1.00 31.76  ? 742  HIS B CB  1 
ATOM   3238 C  CG  . HIS B 1 151 ? -33.460 35.210 -4.222  1.00 34.45  ? 742  HIS B CG  1 
ATOM   3239 N  ND1 . HIS B 1 151 ? -34.756 35.671 -4.322  1.00 36.68  ? 742  HIS B ND1 1 
ATOM   3240 C  CD2 . HIS B 1 151 ? -32.731 36.119 -3.535  1.00 35.32  ? 742  HIS B CD2 1 
ATOM   3241 C  CE1 . HIS B 1 151 ? -34.773 36.844 -3.707  1.00 35.25  ? 742  HIS B CE1 1 
ATOM   3242 N  NE2 . HIS B 1 151 ? -33.584 37.148 -3.207  1.00 34.95  ? 742  HIS B NE2 1 
ATOM   3243 N  N   . ARG B 1 152 ? -35.552 31.969 -4.825  1.00 35.58  ? 743  ARG B N   1 
ATOM   3244 C  CA  . ARG B 1 152 ? -36.982 31.653 -4.978  1.00 36.07  ? 743  ARG B CA  1 
ATOM   3245 C  C   . ARG B 1 152 ? -37.903 32.887 -5.150  1.00 40.43  ? 743  ARG B C   1 
ATOM   3246 O  O   . ARG B 1 152 ? -39.085 32.728 -5.418  1.00 38.90  ? 743  ARG B O   1 
ATOM   3247 C  CB  . ARG B 1 152 ? -37.504 30.754 -3.838  1.00 33.66  ? 743  ARG B CB  1 
ATOM   3248 C  CG  . ARG B 1 152 ? -36.697 29.474 -3.646  1.00 37.31  ? 743  ARG B CG  1 
ATOM   3249 C  CD  . ARG B 1 152 ? -37.464 28.473 -2.820  1.00 41.58  ? 743  ARG B CD  1 
ATOM   3250 N  NE  . ARG B 1 152 ? -37.691 28.949 -1.463  1.00 48.14  ? 743  ARG B NE  1 
ATOM   3251 C  CZ  . ARG B 1 152 ? -38.809 28.759 -0.782  1.00 51.38  ? 743  ARG B CZ  1 
ATOM   3252 N  NH1 . ARG B 1 152 ? -39.825 28.112 -1.332  1.00 48.05  ? 743  ARG B NH1 1 
ATOM   3253 N  NH2 . ARG B 1 152 ? -38.918 29.210 0.461   1.00 41.76  ? 743  ARG B NH2 1 
ATOM   3254 N  N   . ASP B 1 153 ? -37.362 34.103 -5.006  1.00 35.62  ? 744  ASP B N   1 
ATOM   3255 C  CA  . ASP B 1 153 ? -38.148 35.322 -5.096  1.00 34.43  ? 744  ASP B CA  1 
ATOM   3256 C  C   . ASP B 1 153 ? -37.419 36.364 -5.960  1.00 35.58  ? 744  ASP B C   1 
ATOM   3257 O  O   . ASP B 1 153 ? -37.487 37.567 -5.693  1.00 34.74  ? 744  ASP B O   1 
ATOM   3258 C  CB  . ASP B 1 153 ? -38.404 35.838 -3.667  1.00 37.17  ? 744  ASP B CB  1 
ATOM   3259 C  CG  . ASP B 1 153 ? -39.688 36.620 -3.441  1.00 47.80  ? 744  ASP B CG  1 
ATOM   3260 O  OD1 . ASP B 1 153 ? -40.498 36.742 -4.407  1.00 47.99  ? 744  ASP B OD1 1 
ATOM   3261 O  OD2 . ASP B 1 153 ? -39.874 37.139 -2.306  1.00 51.43  ? 744  ASP B OD2 1 
ATOM   3262 N  N   . LEU B 1 154 ? -36.722 35.898 -7.006  1.00 32.64  ? 745  LEU B N   1 
ATOM   3263 C  CA  . LEU B 1 154 ? -35.990 36.802 -7.903  1.00 31.01  ? 745  LEU B CA  1 
ATOM   3264 C  C   . LEU B 1 154 ? -36.987 37.499 -8.875  1.00 34.15  ? 745  LEU B C   1 
ATOM   3265 O  O   . LEU B 1 154 ? -37.604 36.865 -9.735  1.00 31.24  ? 745  LEU B O   1 
ATOM   3266 C  CB  . LEU B 1 154 ? -34.867 36.061 -8.624  1.00 30.07  ? 745  LEU B CB  1 
ATOM   3267 C  CG  . LEU B 1 154 ? -33.976 36.888 -9.572  1.00 34.67  ? 745  LEU B CG  1 
ATOM   3268 C  CD1 . LEU B 1 154 ? -33.215 38.027 -8.822  1.00 34.30  ? 745  LEU B CD1 1 
ATOM   3269 C  CD2 . LEU B 1 154 ? -33.012 35.993 -10.291 1.00 33.62  ? 745  LEU B CD2 1 
ATOM   3270 N  N   . ALA B 1 155 ? -37.154 38.809 -8.666  1.00 31.61  ? 746  ALA B N   1 
ATOM   3271 C  CA  . ALA B 1 155 ? -38.059 39.708 -9.373  1.00 31.50  ? 746  ALA B CA  1 
ATOM   3272 C  C   . ALA B 1 155 ? -37.427 41.084 -9.305  1.00 36.47  ? 746  ALA B C   1 
ATOM   3273 O  O   . ALA B 1 155 ? -36.693 41.355 -8.346  1.00 35.90  ? 746  ALA B O   1 
ATOM   3274 C  CB  . ALA B 1 155 ? -39.424 39.716 -8.664  1.00 32.28  ? 746  ALA B CB  1 
ATOM   3275 N  N   . ALA B 1 156 ? -37.722 41.979 -10.288 1.00 35.05  ? 747  ALA B N   1 
ATOM   3276 C  CA  . ALA B 1 156 ? -37.158 43.360 -10.287 1.00 34.61  ? 747  ALA B CA  1 
ATOM   3277 C  C   . ALA B 1 156 ? -37.527 44.123 -9.010  1.00 37.13  ? 747  ALA B C   1 
ATOM   3278 O  O   . ALA B 1 156 ? -36.723 44.888 -8.510  1.00 36.32  ? 747  ALA B O   1 
ATOM   3279 C  CB  . ALA B 1 156 ? -37.599 44.137 -11.519 1.00 35.55  ? 747  ALA B CB  1 
ATOM   3280 N  N   . ARG B 1 157 ? -38.696 43.838 -8.435  1.00 35.59  ? 748  ARG B N   1 
ATOM   3281 C  CA  . ARG B 1 157 ? -39.153 44.425 -7.162  1.00 36.42  ? 748  ARG B CA  1 
ATOM   3282 C  C   . ARG B 1 157 ? -38.272 44.029 -5.946  1.00 40.50  ? 748  ARG B C   1 
ATOM   3283 O  O   . ARG B 1 157 ? -38.313 44.707 -4.926  1.00 40.59  ? 748  ARG B O   1 
ATOM   3284 C  CB  . ARG B 1 157 ? -40.627 44.078 -6.906  1.00 36.50  ? 748  ARG B CB  1 
ATOM   3285 C  CG  . ARG B 1 157 ? -40.849 42.601 -6.582  1.00 40.06  ? 748  ARG B CG  1 
ATOM   3286 C  CD  . ARG B 1 157 ? -42.300 42.214 -6.365  1.00 42.75  ? 748  ARG B CD  1 
ATOM   3287 N  NE  . ARG B 1 157 ? -42.564 40.885 -6.933  1.00 52.34  ? 748  ARG B NE  1 
ATOM   3288 C  CZ  . ARG B 1 157 ? -42.362 39.733 -6.302  1.00 70.76  ? 748  ARG B CZ  1 
ATOM   3289 N  NH1 . ARG B 1 157 ? -42.604 38.584 -6.915  1.00 49.35  ? 748  ARG B NH1 1 
ATOM   3290 N  NH2 . ARG B 1 157 ? -41.926 39.720 -5.044  1.00 76.26  ? 748  ARG B NH2 1 
ATOM   3291 N  N   . ASN B 1 158 ? -37.469 42.935 -6.065  1.00 35.80  ? 749  ASN B N   1 
ATOM   3292 C  CA  . ASN B 1 158 ? -36.595 42.445 -4.999  1.00 34.59  ? 749  ASN B CA  1 
ATOM   3293 C  C   . ASN B 1 158 ? -35.119 42.794 -5.265  1.00 37.94  ? 749  ASN B C   1 
ATOM   3294 O  O   . ASN B 1 158 ? -34.210 42.298 -4.598  1.00 38.52  ? 749  ASN B O   1 
ATOM   3295 C  CB  . ASN B 1 158 ? -36.830 40.941 -4.729  1.00 31.15  ? 749  ASN B CB  1 
ATOM   3296 C  CG  . ASN B 1 158 ? -38.167 40.723 -4.076  1.00 48.93  ? 749  ASN B CG  1 
ATOM   3297 O  OD1 . ASN B 1 158 ? -38.742 41.625 -3.480  1.00 41.30  ? 749  ASN B OD1 1 
ATOM   3298 N  ND2 . ASN B 1 158 ? -38.736 39.553 -4.225  1.00 40.72  ? 749  ASN B ND2 1 
ATOM   3299 N  N   . ILE B 1 159 ? -34.905 43.669 -6.250  1.00 34.09  ? 750  ILE B N   1 
ATOM   3300 C  CA  . ILE B 1 159 ? -33.603 44.205 -6.608  1.00 32.95  ? 750  ILE B CA  1 
ATOM   3301 C  C   . ILE B 1 159 ? -33.559 45.686 -6.203  1.00 37.63  ? 750  ILE B C   1 
ATOM   3302 O  O   . ILE B 1 159 ? -34.492 46.427 -6.503  1.00 37.56  ? 750  ILE B O   1 
ATOM   3303 C  CB  . ILE B 1 159 ? -33.229 43.895 -8.086  1.00 35.02  ? 750  ILE B CB  1 
ATOM   3304 C  CG1 . ILE B 1 159 ? -32.952 42.341 -8.209  1.00 36.02  ? 750  ILE B CG1 1 
ATOM   3305 C  CG2 . ILE B 1 159 ? -31.963 44.696 -8.500  1.00 31.66  ? 750  ILE B CG2 1 
ATOM   3306 C  CD1 . ILE B 1 159 ? -33.462 41.774 -9.437  1.00 50.31  ? 750  ILE B CD1 1 
ATOM   3307 N  N   . LEU B 1 160 ? -32.536 46.073 -5.425  1.00 35.77  ? 751  LEU B N   1 
ATOM   3308 C  CA  . LEU B 1 160 ? -32.375 47.447 -4.957  1.00 36.36  ? 751  LEU B CA  1 
ATOM   3309 C  C   . LEU B 1 160 ? -31.323 48.133 -5.773  1.00 38.69  ? 751  LEU B C   1 
ATOM   3310 O  O   . LEU B 1 160 ? -30.431 47.484 -6.322  1.00 37.47  ? 751  LEU B O   1 
ATOM   3311 C  CB  . LEU B 1 160 ? -32.093 47.519 -3.450  1.00 36.12  ? 751  LEU B CB  1 
ATOM   3312 C  CG  . LEU B 1 160 ? -33.232 47.028 -2.528  1.00 39.54  ? 751  LEU B CG  1 
ATOM   3313 C  CD1 . LEU B 1 160 ? -32.711 46.792 -1.123  1.00 39.20  ? 751  LEU B CD1 1 
ATOM   3314 C  CD2 . LEU B 1 160 ? -34.432 48.006 -2.509  1.00 38.99  ? 751  LEU B CD2 1 
ATOM   3315 N  N   . VAL B 1 161 ? -31.502 49.447 -5.945  1.00 36.85  ? 752  VAL B N   1 
ATOM   3316 C  CA  . VAL B 1 161 ? -30.635 50.272 -6.787  1.00 36.48  ? 752  VAL B CA  1 
ATOM   3317 C  C   . VAL B 1 161 ? -30.064 51.407 -5.940  1.00 41.97  ? 752  VAL B C   1 
ATOM   3318 O  O   . VAL B 1 161 ? -30.798 52.128 -5.261  1.00 41.07  ? 752  VAL B O   1 
ATOM   3319 C  CB  . VAL B 1 161 ? -31.399 50.829 -8.036  1.00 39.57  ? 752  VAL B CB  1 
ATOM   3320 C  CG1 . VAL B 1 161 ? -30.435 51.432 -9.063  1.00 38.67  ? 752  VAL B CG1 1 
ATOM   3321 C  CG2 . VAL B 1 161 ? -32.273 49.765 -8.691  1.00 38.17  ? 752  VAL B CG2 1 
ATOM   3322 N  N   . ASN B 1 162 ? -28.758 51.595 -6.024  1.00 39.73  ? 753  ASN B N   1 
ATOM   3323 C  CA  . ASN B 1 162 ? -28.143 52.670 -5.266  1.00 40.00  ? 753  ASN B CA  1 
ATOM   3324 C  C   . ASN B 1 162 ? -27.995 53.921 -6.154  1.00 46.01  ? 753  ASN B C   1 
ATOM   3325 O  O   . ASN B 1 162 ? -28.396 53.908 -7.329  1.00 45.14  ? 753  ASN B O   1 
ATOM   3326 C  CB  . ASN B 1 162 ? -26.821 52.185 -4.602  1.00 33.46  ? 753  ASN B CB  1 
ATOM   3327 C  CG  . ASN B 1 162 ? -25.653 51.978 -5.517  1.00 41.88  ? 753  ASN B CG  1 
ATOM   3328 O  OD1 . ASN B 1 162 ? -25.643 52.336 -6.707  1.00 39.71  ? 753  ASN B OD1 1 
ATOM   3329 N  ND2 . ASN B 1 162 ? -24.608 51.440 -4.948  1.00 37.59  ? 753  ASN B ND2 1 
ATOM   3330 N  N   . SER B 1 163 ? -27.432 54.996 -5.596  1.00 44.73  ? 754  SER B N   1 
ATOM   3331 C  CA  . SER B 1 163 ? -27.258 56.275 -6.301  1.00 46.13  ? 754  SER B CA  1 
ATOM   3332 C  C   . SER B 1 163 ? -26.354 56.195 -7.527  1.00 49.31  ? 754  SER B C   1 
ATOM   3333 O  O   . SER B 1 163 ? -26.440 57.062 -8.386  1.00 48.58  ? 754  SER B O   1 
ATOM   3334 C  CB  . SER B 1 163 ? -26.747 57.343 -5.337  1.00 49.22  ? 754  SER B CB  1 
ATOM   3335 O  OG  . SER B 1 163 ? -25.479 56.977 -4.820  1.00 56.75  ? 754  SER B OG  1 
ATOM   3336 N  N   . ASN B 1 164 ? -25.515 55.150 -7.625  1.00 45.48  ? 755  ASN B N   1 
ATOM   3337 C  CA  . ASN B 1 164 ? -24.634 54.964 -8.773  1.00 44.79  ? 755  ASN B CA  1 
ATOM   3338 C  C   . ASN B 1 164 ? -25.145 53.921 -9.768  1.00 48.14  ? 755  ASN B C   1 
ATOM   3339 O  O   . ASN B 1 164 ? -24.379 53.476 -10.624 1.00 48.94  ? 755  ASN B O   1 
ATOM   3340 C  CB  . ASN B 1 164 ? -23.210 54.673 -8.299  1.00 44.31  ? 755  ASN B CB  1 
ATOM   3341 C  CG  . ASN B 1 164 ? -22.540 55.907 -7.733  1.00 71.00  ? 755  ASN B CG  1 
ATOM   3342 O  OD1 . ASN B 1 164 ? -22.487 56.968 -8.359  1.00 76.05  ? 755  ASN B OD1 1 
ATOM   3343 N  ND2 . ASN B 1 164 ? -22.056 55.814 -6.518  1.00 58.71  ? 755  ASN B ND2 1 
ATOM   3344 N  N   . LEU B 1 165 ? -26.453 53.558 -9.675  1.00 43.55  ? 756  LEU B N   1 
ATOM   3345 C  CA  . LEU B 1 165 ? -27.180 52.614 -10.551 1.00 42.00  ? 756  LEU B CA  1 
ATOM   3346 C  C   . LEU B 1 165 ? -26.726 51.184 -10.394 1.00 41.60  ? 756  LEU B C   1 
ATOM   3347 O  O   . LEU B 1 165 ? -26.993 50.367 -11.281 1.00 41.78  ? 756  LEU B O   1 
ATOM   3348 C  CB  . LEU B 1 165 ? -27.144 53.055 -12.052 1.00 43.10  ? 756  LEU B CB  1 
ATOM   3349 C  CG  . LEU B 1 165 ? -27.604 54.481 -12.408 1.00 49.11  ? 756  LEU B CG  1 
ATOM   3350 C  CD1 . LEU B 1 165 ? -27.372 54.776 -13.881 1.00 50.40  ? 756  LEU B CD1 1 
ATOM   3351 C  CD2 . LEU B 1 165 ? -29.044 54.670 -12.122 1.00 51.45  ? 756  LEU B CD2 1 
ATOM   3352 N  N   . VAL B 1 166 ? -26.044 50.872 -9.268  1.00 37.24  ? 757  VAL B N   1 
ATOM   3353 C  CA  . VAL B 1 166 ? -25.580 49.519 -8.980  1.00 35.24  ? 757  VAL B CA  1 
ATOM   3354 C  C   . VAL B 1 166 ? -26.798 48.756 -8.468  1.00 37.67  ? 757  VAL B C   1 
ATOM   3355 O  O   . VAL B 1 166 ? -27.464 49.224 -7.550  1.00 36.02  ? 757  VAL B O   1 
ATOM   3356 C  CB  . VAL B 1 166 ? -24.343 49.454 -8.022  1.00 38.35  ? 757  VAL B CB  1 
ATOM   3357 C  CG1 . VAL B 1 166 ? -23.914 48.018 -7.783  1.00 35.55  ? 757  VAL B CG1 1 
ATOM   3358 C  CG2 . VAL B 1 166 ? -23.166 50.235 -8.620  1.00 38.31  ? 757  VAL B CG2 1 
ATOM   3359 N  N   . CYS B 1 167 ? -27.114 47.616 -9.115  1.00 34.59  ? 758  CYS B N   1 
ATOM   3360 C  CA  . CYS B 1 167 ? -28.258 46.776 -8.764  1.00 34.23  ? 758  CYS B CA  1 
ATOM   3361 C  C   . CYS B 1 167 ? -27.844 45.619 -7.901  1.00 36.64  ? 758  CYS B C   1 
ATOM   3362 O  O   . CYS B 1 167 ? -26.861 44.950 -8.187  1.00 35.88  ? 758  CYS B O   1 
ATOM   3363 C  CB  . CYS B 1 167 ? -28.976 46.299 -10.014 1.00 34.23  ? 758  CYS B CB  1 
ATOM   3364 S  SG  . CYS B 1 167 ? -29.655 47.641 -10.990 1.00 38.75  ? 758  CYS B SG  1 
ATOM   3365 N  N   . LYS B 1 168 ? -28.578 45.411 -6.814  1.00 32.44  ? 759  LYS B N   1 
ATOM   3366 C  CA  . LYS B 1 168 ? -28.234 44.361 -5.869  1.00 30.17  ? 759  LYS B CA  1 
ATOM   3367 C  C   . LYS B 1 168 ? -29.423 43.503 -5.488  1.00 33.76  ? 759  LYS B C   1 
ATOM   3368 O  O   . LYS B 1 168 ? -30.529 43.995 -5.272  1.00 32.30  ? 759  LYS B O   1 
ATOM   3369 C  CB  . LYS B 1 168 ? -27.582 44.973 -4.609  1.00 31.17  ? 759  LYS B CB  1 
ATOM   3370 C  CG  . LYS B 1 168 ? -26.521 46.038 -4.928  1.00 28.19  ? 759  LYS B CG  1 
ATOM   3371 C  CD  . LYS B 1 168 ? -25.648 46.379 -3.754  1.00 31.80  ? 759  LYS B CD  1 
ATOM   3372 C  CE  . LYS B 1 168 ? -24.740 47.506 -4.191  1.00 35.21  ? 759  LYS B CE  1 
ATOM   3373 N  NZ  . LYS B 1 168 ? -23.467 47.479 -3.430  1.00 31.97  ? 759  LYS B NZ  1 
ATOM   3374 N  N   . VAL B 1 169 ? -29.162 42.222 -5.353  1.00 32.63  ? 760  VAL B N   1 
ATOM   3375 C  CA  . VAL B 1 169 ? -30.135 41.237 -4.903  1.00 33.12  ? 760  VAL B CA  1 
ATOM   3376 C  C   . VAL B 1 169 ? -30.446 41.493 -3.432  1.00 36.15  ? 760  VAL B C   1 
ATOM   3377 O  O   . VAL B 1 169 ? -29.542 41.735 -2.620  1.00 34.58  ? 760  VAL B O   1 
ATOM   3378 C  CB  . VAL B 1 169 ? -29.650 39.778 -5.146  1.00 36.22  ? 760  VAL B CB  1 
ATOM   3379 C  CG1 . VAL B 1 169 ? -30.738 38.783 -4.743  1.00 36.43  ? 760  VAL B CG1 1 
ATOM   3380 C  CG2 . VAL B 1 169 ? -29.261 39.559 -6.609  1.00 35.75  ? 760  VAL B CG2 1 
ATOM   3381 N  N   . SER B 1 170 ? -31.728 41.453 -3.092  1.00 33.51  ? 761  SER B N   1 
ATOM   3382 C  CA  . SER B 1 170 ? -32.154 41.638 -1.704  1.00 34.36  ? 761  SER B CA  1 
ATOM   3383 C  C   . SER B 1 170 ? -33.305 40.685 -1.410  1.00 38.99  ? 761  SER B C   1 
ATOM   3384 O  O   . SER B 1 170 ? -33.587 39.809 -2.228  1.00 37.90  ? 761  SER B O   1 
ATOM   3385 C  CB  . SER B 1 170 ? -32.539 43.093 -1.438  1.00 35.47  ? 761  SER B CB  1 
ATOM   3386 O  OG  . SER B 1 170 ? -33.762 43.415 -2.064  1.00 39.38  ? 761  SER B OG  1 
ATOM   3387 N  N   . ASP B 1 171 ? -33.945 40.840 -0.240  1.00 39.38  ? 762  ASP B N   1 
ATOM   3388 C  CA  . ASP B 1 171 ? -35.106 40.060 0.225   1.00 39.85  ? 762  ASP B CA  1 
ATOM   3389 C  C   . ASP B 1 171 ? -34.791 38.553 0.281   1.00 41.36  ? 762  ASP B C   1 
ATOM   3390 O  O   . ASP B 1 171 ? -35.252 37.776 -0.575  1.00 39.79  ? 762  ASP B O   1 
ATOM   3391 C  CB  . ASP B 1 171 ? -36.334 40.382 -0.663  1.00 42.73  ? 762  ASP B CB  1 
ATOM   3392 C  CG  . ASP B 1 171 ? -37.657 40.347 0.077   1.00 63.08  ? 762  ASP B CG  1 
ATOM   3393 O  OD1 . ASP B 1 171 ? -38.019 39.274 0.595   1.00 64.54  ? 762  ASP B OD1 1 
ATOM   3394 O  OD2 . ASP B 1 171 ? -38.353 41.382 0.093   1.00 78.11  ? 762  ASP B OD2 1 
ATOM   3395 N  N   . PHE B 1 172 ? -33.977 38.156 1.276   1.00 36.81  ? 763  PHE B N   1 
ATOM   3396 C  CA  . PHE B 1 172 ? -33.500 36.780 1.411   1.00 36.18  ? 763  PHE B CA  1 
ATOM   3397 C  C   . PHE B 1 172 ? -34.365 35.873 2.286   1.00 42.48  ? 763  PHE B C   1 
ATOM   3398 O  O   . PHE B 1 172 ? -33.957 34.745 2.543   1.00 43.70  ? 763  PHE B O   1 
ATOM   3399 C  CB  . PHE B 1 172 ? -32.037 36.768 1.887   1.00 36.83  ? 763  PHE B CB  1 
ATOM   3400 C  CG  . PHE B 1 172 ? -31.137 37.447 0.886   1.00 37.78  ? 763  PHE B CG  1 
ATOM   3401 C  CD1 . PHE B 1 172 ? -30.731 38.759 1.077   1.00 40.75  ? 763  PHE B CD1 1 
ATOM   3402 C  CD2 . PHE B 1 172 ? -30.758 36.802 -0.285  1.00 38.20  ? 763  PHE B CD2 1 
ATOM   3403 C  CE1 . PHE B 1 172 ? -29.934 39.390 0.137   1.00 40.04  ? 763  PHE B CE1 1 
ATOM   3404 C  CE2 . PHE B 1 172 ? -29.943 37.438 -1.216  1.00 40.34  ? 763  PHE B CE2 1 
ATOM   3405 C  CZ  . PHE B 1 172 ? -29.543 38.724 -1.004  1.00 37.84  ? 763  PHE B CZ  1 
ATOM   3406 N  N   . GLY B 1 173 ? -35.564 36.322 2.634   1.00 40.72  ? 764  GLY B N   1 
ATOM   3407 C  CA  . GLY B 1 173 ? -36.533 35.572 3.436   1.00 42.71  ? 764  GLY B CA  1 
ATOM   3408 C  C   . GLY B 1 173 ? -36.858 34.178 2.919   1.00 48.57  ? 764  GLY B C   1 
ATOM   3409 O  O   . GLY B 1 173 ? -36.814 33.211 3.683   1.00 48.41  ? 764  GLY B O   1 
ATOM   3410 N  N   . LEU B 1 174 ? -37.112 34.051 1.602   1.00 45.29  ? 765  LEU B N   1 
ATOM   3411 C  CA  . LEU B 1 174 ? -37.413 32.767 0.961   1.00 44.30  ? 765  LEU B CA  1 
ATOM   3412 C  C   . LEU B 1 174 ? -36.155 31.973 0.541   1.00 44.31  ? 765  LEU B C   1 
ATOM   3413 O  O   . LEU B 1 174 ? -36.281 30.824 0.084   1.00 43.73  ? 765  LEU B O   1 
ATOM   3414 C  CB  . LEU B 1 174 ? -38.361 32.986 -0.238  1.00 44.06  ? 765  LEU B CB  1 
ATOM   3415 C  CG  . LEU B 1 174 ? -39.750 33.504 0.128   1.00 49.97  ? 765  LEU B CG  1 
ATOM   3416 C  CD1 . LEU B 1 174 ? -40.546 33.837 -1.112  1.00 49.30  ? 765  LEU B CD1 1 
ATOM   3417 C  CD2 . LEU B 1 174 ? -40.509 32.485 0.996   1.00 53.52  ? 765  LEU B CD2 1 
ATOM   3418 N  N   . SER B 1 175 ? -34.946 32.560 0.714   1.00 37.99  ? 766  SER B N   1 
ATOM   3419 C  CA  . SER B 1 175 ? -33.701 31.902 0.295   1.00 36.64  ? 766  SER B CA  1 
ATOM   3420 C  C   . SER B 1 175 ? -33.402 30.654 1.081   1.00 42.40  ? 766  SER B C   1 
ATOM   3421 O  O   . SER B 1 175 ? -33.669 30.604 2.284   1.00 42.43  ? 766  SER B O   1 
ATOM   3422 C  CB  . SER B 1 175 ? -32.500 32.846 0.305   1.00 37.02  ? 766  SER B CB  1 
ATOM   3423 O  OG  . SER B 1 175 ? -32.639 33.835 -0.703  1.00 38.91  ? 766  SER B OG  1 
ATOM   3424 N  N   . ARG B 1 176 ? -32.893 29.613 0.389   1.00 39.46  ? 767  ARG B N   1 
ATOM   3425 C  CA  . ARG B 1 176 ? -32.628 28.327 1.044   1.00 39.81  ? 767  ARG B CA  1 
ATOM   3426 C  C   . ARG B 1 176 ? -31.332 27.699 0.599   1.00 44.46  ? 767  ARG B C   1 
ATOM   3427 O  O   . ARG B 1 176 ? -31.028 27.695 -0.596  1.00 41.90  ? 767  ARG B O   1 
ATOM   3428 C  CB  . ARG B 1 176 ? -33.792 27.339 0.793   1.00 36.38  ? 767  ARG B CB  1 
ATOM   3429 C  CG  . ARG B 1 176 ? -35.154 27.763 1.308   1.00 45.06  ? 767  ARG B CG  1 
ATOM   3430 C  CD  . ARG B 1 176 ? -35.266 27.660 2.829   1.00 38.32  ? 767  ARG B CD  1 
ATOM   3431 N  NE  . ARG B 1 176 ? -36.607 28.034 3.258   1.00 40.96  ? 767  ARG B NE  1 
ATOM   3432 C  CZ  . ARG B 1 176 ? -36.989 29.259 3.588   1.00 52.95  ? 767  ARG B CZ  1 
ATOM   3433 N  NH1 . ARG B 1 176 ? -36.123 30.259 3.562   1.00 44.11  ? 767  ARG B NH1 1 
ATOM   3434 N  NH2 . ARG B 1 176 ? -38.242 29.493 3.953   1.00 51.27  ? 767  ARG B NH2 1 
ATOM   3435 N  N   . TYR B 1 177 ? -30.602 27.094 1.560   1.00 46.05  ? 768  TYR B N   1 
ATOM   3436 C  CA  . TYR B 1 177 ? -29.367 26.356 1.306   1.00 47.73  ? 768  TYR B CA  1 
ATOM   3437 C  C   . TYR B 1 177 ? -29.758 25.007 0.690   1.00 51.33  ? 768  TYR B C   1 
ATOM   3438 O  O   . TYR B 1 177 ? -30.610 24.311 1.244   1.00 53.27  ? 768  TYR B O   1 
ATOM   3439 C  CB  . TYR B 1 177 ? -28.580 26.149 2.615   1.00 51.91  ? 768  TYR B CB  1 
ATOM   3440 C  CG  . TYR B 1 177 ? -27.198 25.567 2.404   1.00 55.35  ? 768  TYR B CG  1 
ATOM   3441 C  CD1 . TYR B 1 177 ? -26.158 26.351 1.910   1.00 55.72  ? 768  TYR B CD1 1 
ATOM   3442 C  CD2 . TYR B 1 177 ? -26.929 24.229 2.691   1.00 58.11  ? 768  TYR B CD2 1 
ATOM   3443 C  CE1 . TYR B 1 177 ? -24.893 25.816 1.680   1.00 55.10  ? 768  TYR B CE1 1 
ATOM   3444 C  CE2 . TYR B 1 177 ? -25.659 23.684 2.480   1.00 59.38  ? 768  TYR B CE2 1 
ATOM   3445 C  CZ  . TYR B 1 177 ? -24.644 24.484 1.976   1.00 66.08  ? 768  TYR B CZ  1 
ATOM   3446 O  OH  . TYR B 1 177 ? -23.388 23.964 1.769   1.00 67.44  ? 768  TYR B OH  1 
ATOM   3447 N  N   . LEU B 1 178 ? -29.193 24.668 -0.483  1.00 46.13  ? 769  LEU B N   1 
ATOM   3448 C  CA  . LEU B 1 178 ? -29.547 23.442 -1.204  1.00 49.94  ? 769  LEU B CA  1 
ATOM   3449 C  C   . LEU B 1 178 ? -28.853 22.197 -0.648  1.00 98.25  ? 769  LEU B C   1 
ATOM   3450 O  O   . LEU B 1 178 ? -27.626 22.139 -0.563  1.00 68.24  ? 769  LEU B O   1 
ATOM   3451 C  CB  . LEU B 1 178 ? -29.311 23.590 -2.721  1.00 48.97  ? 769  LEU B CB  1 
ATOM   3452 C  CG  . LEU B 1 178 ? -30.062 24.713 -3.452  1.00 52.96  ? 769  LEU B CG  1 
ATOM   3453 C  CD1 . LEU B 1 178 ? -29.315 25.148 -4.675  1.00 52.43  ? 769  LEU B CD1 1 
ATOM   3454 C  CD2 . LEU B 1 178 ? -31.458 24.297 -3.843  1.00 57.61  ? 769  LEU B CD2 1 
ATOM   3455 N  N   . PRO B 1 185 ? -29.279 19.342 -6.759  1.00 52.51  ? 776  PRO B N   1 
ATOM   3456 C  CA  . PRO B 1 185 ? -29.420 20.217 -5.570  1.00 50.08  ? 776  PRO B CA  1 
ATOM   3457 C  C   . PRO B 1 185 ? -30.741 20.977 -5.694  1.00 49.18  ? 776  PRO B C   1 
ATOM   3458 O  O   . PRO B 1 185 ? -30.914 21.811 -6.566  1.00 46.63  ? 776  PRO B O   1 
ATOM   3459 C  CB  . PRO B 1 185 ? -28.164 21.105 -5.608  1.00 50.12  ? 776  PRO B CB  1 
ATOM   3460 C  CG  . PRO B 1 185 ? -27.379 20.669 -6.836  1.00 55.57  ? 776  PRO B CG  1 
ATOM   3461 C  CD  . PRO B 1 185 ? -28.316 19.901 -7.726  1.00 52.79  ? 776  PRO B CD  1 
ATOM   3462 N  N   . THR B 1 186 ? -31.695 20.603 -4.861  1.00 46.06  ? 777  THR B N   1 
ATOM   3463 C  CA  . THR B 1 186 ? -33.076 21.039 -4.890  1.00 45.68  ? 777  THR B CA  1 
ATOM   3464 C  C   . THR B 1 186 ? -33.574 21.361 -3.488  1.00 50.57  ? 777  THR B C   1 
ATOM   3465 O  O   . THR B 1 186 ? -33.242 20.670 -2.516  1.00 50.56  ? 777  THR B O   1 
ATOM   3466 C  CB  . THR B 1 186 ? -33.940 19.862 -5.468  1.00 49.62  ? 777  THR B CB  1 
ATOM   3467 O  OG1 . THR B 1 186 ? -33.495 19.535 -6.782  1.00 53.07  ? 777  THR B OG1 1 
ATOM   3468 C  CG2 . THR B 1 186 ? -35.450 20.159 -5.505  1.00 45.97  ? 777  THR B CG2 1 
HETATM 3469 N  N   . PTR B 1 187 ? -34.436 22.369 -3.416  1.00 45.07  ? 778  PTR B N   1 
HETATM 3470 C  CA  . PTR B 1 187 ? -35.159 22.726 -2.214  1.00 43.84  ? 778  PTR B CA  1 
HETATM 3471 C  C   . PTR B 1 187 ? -36.623 22.354 -2.517  1.00 44.00  ? 778  PTR B C   1 
HETATM 3472 O  O   . PTR B 1 187 ? -37.215 22.888 -3.456  1.00 42.88  ? 778  PTR B O   1 
HETATM 3473 C  CB  . PTR B 1 187 ? -34.907 24.164 -1.681  1.00 42.93  ? 778  PTR B CB  1 
HETATM 3474 C  CG  . PTR B 1 187 ? -35.882 24.432 -0.562  1.00 43.96  ? 778  PTR B CG  1 
HETATM 3475 C  CD1 . PTR B 1 187 ? -35.692 24.029 0.813   1.00 45.15  ? 778  PTR B CD1 1 
HETATM 3476 C  CD2 . PTR B 1 187 ? -37.055 25.118 -0.988  1.00 44.45  ? 778  PTR B CD2 1 
HETATM 3477 C  CE1 . PTR B 1 187 ? -36.704 24.314 1.750   1.00 48.26  ? 778  PTR B CE1 1 
HETATM 3478 C  CE2 . PTR B 1 187 ? -38.039 25.400 -0.098  1.00 45.99  ? 778  PTR B CE2 1 
HETATM 3479 C  CZ  . PTR B 1 187 ? -37.899 25.027 1.263   1.00 50.94  ? 778  PTR B CZ  1 
HETATM 3480 O  OH  . PTR B 1 187 ? -39.058 25.441 1.906   1.00 58.70  ? 778  PTR B OH  1 
HETATM 3481 P  P   . PTR B 1 187 ? -39.310 25.427 3.413   1.00 63.65  ? 778  PTR B P   1 
HETATM 3482 O  O1P . PTR B 1 187 ? -40.057 26.740 3.582   1.00 65.97  ? 778  PTR B O1P 1 
HETATM 3483 O  O2P . PTR B 1 187 ? -40.160 24.222 3.679   1.00 65.83  ? 778  PTR B O2P 1 
HETATM 3484 O  O3P . PTR B 1 187 ? -38.098 25.423 4.312   1.00 63.88  ? 778  PTR B O3P 1 
ATOM   3485 N  N   . THR B 1 188 ? -37.188 21.439 -1.732  1.00 40.71  ? 779  THR B N   1 
ATOM   3486 C  CA  . THR B 1 188 ? -38.571 20.992 -1.872  1.00 40.74  ? 779  THR B CA  1 
ATOM   3487 C  C   . THR B 1 188 ? -39.421 21.678 -0.789  1.00 44.62  ? 779  THR B C   1 
ATOM   3488 O  O   . THR B 1 188 ? -39.211 21.452 0.410   1.00 44.63  ? 779  THR B O   1 
ATOM   3489 C  CB  . THR B 1 188 ? -38.642 19.438 -1.814  1.00 42.56  ? 779  THR B CB  1 
ATOM   3490 O  OG1 . THR B 1 188 ? -37.842 18.893 -2.862  1.00 42.91  ? 779  THR B OG1 1 
ATOM   3491 C  CG2 . THR B 1 188 ? -40.065 18.898 -1.981  1.00 38.72  ? 779  THR B CG2 1 
ATOM   3492 N  N   . SER B 1 189 ? -40.403 22.485 -1.204  1.00 40.08  ? 780  SER B N   1 
ATOM   3493 C  CA  . SER B 1 189 ? -41.285 23.105 -0.227  1.00 39.49  ? 780  SER B CA  1 
ATOM   3494 C  C   . SER B 1 189 ? -42.542 22.255 -0.111  1.00 44.14  ? 780  SER B C   1 
ATOM   3495 O  O   . SER B 1 189 ? -42.675 21.245 -0.811  1.00 44.73  ? 780  SER B O   1 
ATOM   3496 C  CB  . SER B 1 189 ? -41.619 24.538 -0.632  1.00 41.54  ? 780  SER B CB  1 
ATOM   3497 O  OG  . SER B 1 189 ? -42.687 24.578 -1.568  1.00 47.39  ? 780  SER B OG  1 
ATOM   3498 N  N   . SER B 1 190 ? -43.469 22.626 0.778   1.00 40.88  ? 781  SER B N   1 
ATOM   3499 C  CA  . SER B 1 190 ? -44.731 21.886 0.816   1.00 41.39  ? 781  SER B CA  1 
ATOM   3500 C  C   . SER B 1 190 ? -45.457 22.175 -0.539  1.00 42.21  ? 781  SER B C   1 
ATOM   3501 O  O   . SER B 1 190 ? -45.250 23.236 -1.127  1.00 40.37  ? 781  SER B O   1 
ATOM   3502 C  CB  . SER B 1 190 ? -45.566 22.261 2.036   1.00 43.85  ? 781  SER B CB  1 
ATOM   3503 O  OG  . SER B 1 190 ? -45.746 23.663 2.061   1.00 58.34  ? 781  SER B OG  1 
ATOM   3504 N  N   . LEU B 1 191 ? -46.165 21.173 -1.089  1.00 38.63  ? 782  LEU B N   1 
ATOM   3505 C  CA  . LEU B 1 191 ? -46.820 21.242 -2.393  1.00 37.95  ? 782  LEU B CA  1 
ATOM   3506 C  C   . LEU B 1 191 ? -47.785 22.443 -2.532  1.00 44.80  ? 782  LEU B C   1 
ATOM   3507 O  O   . LEU B 1 191 ? -47.871 23.037 -3.606  1.00 45.22  ? 782  LEU B O   1 
ATOM   3508 C  CB  . LEU B 1 191 ? -47.520 19.885 -2.721  1.00 38.78  ? 782  LEU B CB  1 
ATOM   3509 C  CG  . LEU B 1 191 ? -47.928 19.697 -4.202  1.00 42.27  ? 782  LEU B CG  1 
ATOM   3510 C  CD1 . LEU B 1 191 ? -46.716 19.815 -5.161  1.00 42.66  ? 782  LEU B CD1 1 
ATOM   3511 C  CD2 . LEU B 1 191 ? -48.694 18.403 -4.405  1.00 43.31  ? 782  LEU B CD2 1 
ATOM   3512 N  N   . GLY B 1 192 ? -48.437 22.821 -1.436  1.00 44.09  ? 783  GLY B N   1 
ATOM   3513 C  CA  . GLY B 1 192 ? -49.363 23.950 -1.386  1.00 44.33  ? 783  GLY B CA  1 
ATOM   3514 C  C   . GLY B 1 192 ? -48.750 25.323 -1.188  1.00 46.74  ? 783  GLY B C   1 
ATOM   3515 O  O   . GLY B 1 192 ? -49.485 26.300 -1.102  1.00 47.84  ? 783  GLY B O   1 
ATOM   3516 N  N   . GLY B 1 193 ? -47.426 25.397 -1.082  1.00 42.97  ? 784  GLY B N   1 
ATOM   3517 C  CA  . GLY B 1 193 ? -46.695 26.641 -0.861  1.00 42.48  ? 784  GLY B CA  1 
ATOM   3518 C  C   . GLY B 1 193 ? -46.943 27.699 -1.923  1.00 47.80  ? 784  GLY B C   1 
ATOM   3519 O  O   . GLY B 1 193 ? -46.894 27.404 -3.117  1.00 45.14  ? 784  GLY B O   1 
ATOM   3520 N  N   . LYS B 1 194 ? -47.234 28.940 -1.480  1.00 46.57  ? 785  LYS B N   1 
ATOM   3521 C  CA  . LYS B 1 194 ? -47.535 30.079 -2.339  1.00 45.61  ? 785  LYS B CA  1 
ATOM   3522 C  C   . LYS B 1 194 ? -46.284 30.540 -3.027  1.00 47.36  ? 785  LYS B C   1 
ATOM   3523 O  O   . LYS B 1 194 ? -45.229 30.597 -2.395  1.00 47.85  ? 785  LYS B O   1 
ATOM   3524 C  CB  . LYS B 1 194 ? -48.135 31.236 -1.527  1.00 48.44  ? 785  LYS B CB  1 
ATOM   3525 C  CG  . LYS B 1 194 ? -49.032 32.153 -2.342  1.00 51.86  ? 785  LYS B CG  1 
ATOM   3526 C  CD  . LYS B 1 194 ? -49.833 33.106 -1.471  1.00 61.67  ? 785  LYS B CD  1 
ATOM   3527 C  CE  . LYS B 1 194 ? -50.848 33.841 -2.323  1.00 82.69  ? 785  LYS B CE  1 
ATOM   3528 N  NZ  . LYS B 1 194 ? -51.722 34.743 -1.527  1.00 97.34  ? 785  LYS B NZ  1 
ATOM   3529 N  N   . ILE B 1 195 ? -46.392 30.842 -4.328  1.00 41.62  ? 786  ILE B N   1 
ATOM   3530 C  CA  . ILE B 1 195 ? -45.274 31.309 -5.175  1.00 39.67  ? 786  ILE B CA  1 
ATOM   3531 C  C   . ILE B 1 195 ? -45.644 32.563 -5.986  1.00 43.38  ? 786  ILE B C   1 
ATOM   3532 O  O   . ILE B 1 195 ? -46.834 32.770 -6.257  1.00 44.15  ? 786  ILE B O   1 
ATOM   3533 C  CB  . ILE B 1 195 ? -44.786 30.175 -6.140  1.00 42.12  ? 786  ILE B CB  1 
ATOM   3534 C  CG1 . ILE B 1 195 ? -45.965 29.538 -6.899  1.00 43.46  ? 786  ILE B CG1 1 
ATOM   3535 C  CG2 . ILE B 1 195 ? -43.986 29.117 -5.387  1.00 41.72  ? 786  ILE B CG2 1 
ATOM   3536 C  CD1 . ILE B 1 195 ? -45.731 29.155 -8.233  1.00 43.81  ? 786  ILE B CD1 1 
ATOM   3537 N  N   . PRO B 1 196 ? -44.647 33.377 -6.446  1.00 39.37  ? 787  PRO B N   1 
ATOM   3538 C  CA  . PRO B 1 196 ? -44.967 34.483 -7.389  1.00 37.89  ? 787  PRO B CA  1 
ATOM   3539 C  C   . PRO B 1 196 ? -45.012 33.847 -8.800  1.00 41.74  ? 787  PRO B C   1 
ATOM   3540 O  O   . PRO B 1 196 ? -44.000 33.739 -9.492  1.00 42.31  ? 787  PRO B O   1 
ATOM   3541 C  CB  . PRO B 1 196 ? -43.773 35.444 -7.206  1.00 37.87  ? 787  PRO B CB  1 
ATOM   3542 C  CG  . PRO B 1 196 ? -42.649 34.580 -6.749  1.00 41.13  ? 787  PRO B CG  1 
ATOM   3543 C  CD  . PRO B 1 196 ? -43.185 33.268 -6.228  1.00 38.55  ? 787  PRO B CD  1 
ATOM   3544 N  N   . VAL B 1 197 ? -46.175 33.338 -9.183  1.00 39.90  ? 788  VAL B N   1 
ATOM   3545 C  CA  . VAL B 1 197 ? -46.423 32.544 -10.401 1.00 39.65  ? 788  VAL B CA  1 
ATOM   3546 C  C   . VAL B 1 197 ? -45.704 33.061 -11.668 1.00 43.32  ? 788  VAL B C   1 
ATOM   3547 O  O   . VAL B 1 197 ? -45.044 32.259 -12.332 1.00 42.43  ? 788  VAL B O   1 
ATOM   3548 C  CB  . VAL B 1 197 ? -47.950 32.340 -10.662 1.00 42.57  ? 788  VAL B CB  1 
ATOM   3549 C  CG1 . VAL B 1 197 ? -48.229 31.774 -12.054 1.00 42.16  ? 788  VAL B CG1 1 
ATOM   3550 C  CG2 . VAL B 1 197 ? -48.572 31.449 -9.584  1.00 42.30  ? 788  VAL B CG2 1 
ATOM   3551 N  N   . ARG B 1 198 ? -45.832 34.361 -12.004 1.00 39.25  ? 789  ARG B N   1 
ATOM   3552 C  CA  . ARG B 1 198 ? -45.310 34.826 -13.283 1.00 39.05  ? 789  ARG B CA  1 
ATOM   3553 C  C   . ARG B 1 198 ? -43.775 34.968 -13.336 1.00 40.95  ? 789  ARG B C   1 
ATOM   3554 O  O   . ARG B 1 198 ? -43.245 35.131 -14.440 1.00 38.15  ? 789  ARG B O   1 
ATOM   3555 C  CB  . ARG B 1 198 ? -46.033 36.082 -13.796 1.00 40.60  ? 789  ARG B CB  1 
ATOM   3556 C  CG  . ARG B 1 198 ? -45.897 37.340 -12.960 1.00 46.91  ? 789  ARG B CG  1 
ATOM   3557 C  CD  . ARG B 1 198 ? -46.994 38.331 -13.300 1.00 44.66  ? 789  ARG B CD  1 
ATOM   3558 N  NE  . ARG B 1 198 ? -48.315 37.780 -12.988 1.00 47.04  ? 789  ARG B NE  1 
ATOM   3559 C  CZ  . ARG B 1 198 ? -49.394 37.880 -13.762 1.00 61.79  ? 789  ARG B CZ  1 
ATOM   3560 N  NH1 . ARG B 1 198 ? -49.342 38.561 -14.905 1.00 44.41  ? 789  ARG B NH1 1 
ATOM   3561 N  NH2 . ARG B 1 198 ? -50.538 37.323 -13.388 1.00 43.50  ? 789  ARG B NH2 1 
ATOM   3562 N  N   . TRP B 1 199 ? -43.073 34.819 -12.181 1.00 38.74  ? 790  TRP B N   1 
ATOM   3563 C  CA  . TRP B 1 199 ? -41.598 34.806 -12.099 1.00 38.17  ? 790  TRP B CA  1 
ATOM   3564 C  C   . TRP B 1 199 ? -41.076 33.374 -11.906 1.00 39.90  ? 790  TRP B C   1 
ATOM   3565 O  O   . TRP B 1 199 ? -39.883 33.161 -11.990 1.00 39.86  ? 790  TRP B O   1 
ATOM   3566 C  CB  . TRP B 1 199 ? -41.102 35.667 -10.920 1.00 36.11  ? 790  TRP B CB  1 
ATOM   3567 C  CG  . TRP B 1 199 ? -41.203 37.137 -11.186 1.00 36.69  ? 790  TRP B CG  1 
ATOM   3568 C  CD1 . TRP B 1 199 ? -40.244 37.946 -11.725 1.00 38.36  ? 790  TRP B CD1 1 
ATOM   3569 C  CD2 . TRP B 1 199 ? -42.331 37.975 -10.909 1.00 37.44  ? 790  TRP B CD2 1 
ATOM   3570 N  NE1 . TRP B 1 199 ? -40.724 39.230 -11.845 1.00 37.60  ? 790  TRP B NE1 1 
ATOM   3571 C  CE2 . TRP B 1 199 ? -42.003 39.278 -11.356 1.00 40.07  ? 790  TRP B CE2 1 
ATOM   3572 C  CE3 . TRP B 1 199 ? -43.600 37.748 -10.325 1.00 39.84  ? 790  TRP B CE3 1 
ATOM   3573 C  CZ2 . TRP B 1 199 ? -42.906 40.348 -11.270 1.00 40.66  ? 790  TRP B CZ2 1 
ATOM   3574 C  CZ3 . TRP B 1 199 ? -44.484 38.819 -10.208 1.00 42.04  ? 790  TRP B CZ3 1 
ATOM   3575 C  CH2 . TRP B 1 199 ? -44.142 40.096 -10.694 1.00 42.59  ? 790  TRP B CH2 1 
ATOM   3576 N  N   . THR B 1 200 ? -41.971 32.403 -11.658 1.00 38.68  ? 791  THR B N   1 
ATOM   3577 C  CA  . THR B 1 200 ? -41.613 31.018 -11.301 1.00 37.67  ? 791  THR B CA  1 
ATOM   3578 C  C   . THR B 1 200 ? -41.562 30.073 -12.495 1.00 40.74  ? 791  THR B C   1 
ATOM   3579 O  O   . THR B 1 200 ? -42.450 30.093 -13.331 1.00 40.71  ? 791  THR B O   1 
ATOM   3580 C  CB  . THR B 1 200 ? -42.558 30.522 -10.191 1.00 42.08  ? 791  THR B CB  1 
ATOM   3581 O  OG1 . THR B 1 200 ? -42.514 31.489 -9.139  1.00 39.22  ? 791  THR B OG1 1 
ATOM   3582 C  CG2 . THR B 1 200 ? -42.152 29.156 -9.620  1.00 37.42  ? 791  THR B CG2 1 
ATOM   3583 N  N   . ALA B 1 201 ? -40.506 29.236 -12.552 1.00 37.64  ? 792  ALA B N   1 
ATOM   3584 C  CA  . ALA B 1 201 ? -40.286 28.230 -13.592 1.00 36.48  ? 792  ALA B CA  1 
ATOM   3585 C  C   . ALA B 1 201 ? -41.463 27.239 -13.608 1.00 41.26  ? 792  ALA B C   1 
ATOM   3586 O  O   . ALA B 1 201 ? -42.011 26.944 -12.541 1.00 41.10  ? 792  ALA B O   1 
ATOM   3587 C  CB  . ALA B 1 201 ? -38.992 27.481 -13.316 1.00 36.12  ? 792  ALA B CB  1 
ATOM   3588 N  N   . PRO B 1 202 ? -41.829 26.665 -14.779 1.00 37.00  ? 793  PRO B N   1 
ATOM   3589 C  CA  . PRO B 1 202 ? -42.987 25.751 -14.808 1.00 39.20  ? 793  PRO B CA  1 
ATOM   3590 C  C   . PRO B 1 202 ? -42.861 24.494 -13.944 1.00 43.02  ? 793  PRO B C   1 
ATOM   3591 O  O   . PRO B 1 202 ? -43.876 24.025 -13.441 1.00 40.97  ? 793  PRO B O   1 
ATOM   3592 C  CB  . PRO B 1 202 ? -43.168 25.429 -16.300 1.00 41.36  ? 793  PRO B CB  1 
ATOM   3593 C  CG  . PRO B 1 202 ? -41.884 25.812 -16.944 1.00 43.33  ? 793  PRO B CG  1 
ATOM   3594 C  CD  . PRO B 1 202 ? -41.310 26.920 -16.138 1.00 37.21  ? 793  PRO B CD  1 
ATOM   3595 N  N   . GLU B 1 203 ? -41.639 23.949 -13.779 1.00 40.81  ? 794  GLU B N   1 
ATOM   3596 C  CA  . GLU B 1 203 ? -41.422 22.764 -12.943 1.00 40.22  ? 794  GLU B CA  1 
ATOM   3597 C  C   . GLU B 1 203 ? -41.479 23.120 -11.439 1.00 42.36  ? 794  GLU B C   1 
ATOM   3598 O  O   . GLU B 1 203 ? -41.774 22.261 -10.619 1.00 41.58  ? 794  GLU B O   1 
ATOM   3599 C  CB  . GLU B 1 203 ? -40.101 22.034 -13.316 1.00 41.46  ? 794  GLU B CB  1 
ATOM   3600 C  CG  . GLU B 1 203 ? -38.805 22.718 -12.884 1.00 45.00  ? 794  GLU B CG  1 
ATOM   3601 C  CD  . GLU B 1 203 ? -38.310 23.914 -13.676 1.00 47.45  ? 794  GLU B CD  1 
ATOM   3602 O  OE1 . GLU B 1 203 ? -38.956 24.322 -14.667 1.00 36.39  ? 794  GLU B OE1 1 
ATOM   3603 O  OE2 . GLU B 1 203 ? -37.278 24.481 -13.267 1.00 39.94  ? 794  GLU B OE2 1 
ATOM   3604 N  N   . ALA B 1 204 ? -41.178 24.384 -11.086 1.00 38.64  ? 795  ALA B N   1 
ATOM   3605 C  CA  . ALA B 1 204 ? -41.236 24.838 -9.690  1.00 37.69  ? 795  ALA B CA  1 
ATOM   3606 C  C   . ALA B 1 204 ? -42.708 25.087 -9.321  1.00 42.34  ? 795  ALA B C   1 
ATOM   3607 O  O   . ALA B 1 204 ? -43.098 24.852 -8.170  1.00 41.70  ? 795  ALA B O   1 
ATOM   3608 C  CB  . ALA B 1 204 ? -40.373 26.070 -9.484  1.00 36.33  ? 795  ALA B CB  1 
ATOM   3609 N  N   . ILE B 1 205 ? -43.562 25.461 -10.335 1.00 38.14  ? 796  ILE B N   1 
ATOM   3610 C  CA  . ILE B 1 205 ? -45.011 25.603 -10.124 1.00 37.40  ? 796  ILE B CA  1 
ATOM   3611 C  C   . ILE B 1 205 ? -45.594 24.177 -9.983  1.00 41.02  ? 796  ILE B C   1 
ATOM   3612 O  O   . ILE B 1 205 ? -46.355 23.900 -9.055  1.00 40.09  ? 796  ILE B O   1 
ATOM   3613 C  CB  . ILE B 1 205 ? -45.714 26.384 -11.277 1.00 40.40  ? 796  ILE B CB  1 
ATOM   3614 C  CG1 . ILE B 1 205 ? -45.150 27.847 -11.406 1.00 39.66  ? 796  ILE B CG1 1 
ATOM   3615 C  CG2 . ILE B 1 205 ? -47.268 26.331 -11.163 1.00 39.82  ? 796  ILE B CG2 1 
ATOM   3616 C  CD1 . ILE B 1 205 ? -45.673 28.690 -12.575 1.00 41.03  ? 796  ILE B CD1 1 
ATOM   3617 N  N   . ALA B 1 206 ? -45.227 23.273 -10.906 1.00 37.54  ? 797  ALA B N   1 
ATOM   3618 C  CA  . ALA B 1 206 ? -45.769 21.908 -10.920 1.00 39.02  ? 797  ALA B CA  1 
ATOM   3619 C  C   . ALA B 1 206 ? -45.339 21.048 -9.734  1.00 44.87  ? 797  ALA B C   1 
ATOM   3620 O  O   . ALA B 1 206 ? -46.155 20.292 -9.208  1.00 45.15  ? 797  ALA B O   1 
ATOM   3621 C  CB  . ALA B 1 206 ? -45.410 21.212 -12.223 1.00 39.52  ? 797  ALA B CB  1 
ATOM   3622 N  N   . TYR B 1 207 ? -44.068 21.176 -9.292  1.00 40.79  ? 798  TYR B N   1 
ATOM   3623 C  CA  . TYR B 1 207 ? -43.580 20.277 -8.250  1.00 41.62  ? 798  TYR B CA  1 
ATOM   3624 C  C   . TYR B 1 207 ? -43.197 20.950 -6.946  1.00 43.41  ? 798  TYR B C   1 
ATOM   3625 O  O   . TYR B 1 207 ? -42.908 20.236 -5.990  1.00 42.32  ? 798  TYR B O   1 
ATOM   3626 C  CB  . TYR B 1 207 ? -42.407 19.435 -8.822  1.00 42.62  ? 798  TYR B CB  1 
ATOM   3627 C  CG  . TYR B 1 207 ? -42.740 18.810 -10.167 1.00 43.21  ? 798  TYR B CG  1 
ATOM   3628 C  CD1 . TYR B 1 207 ? -43.814 17.934 -10.304 1.00 45.21  ? 798  TYR B CD1 1 
ATOM   3629 C  CD2 . TYR B 1 207 ? -42.001 19.120 -11.307 1.00 42.70  ? 798  TYR B CD2 1 
ATOM   3630 C  CE1 . TYR B 1 207 ? -44.143 17.375 -11.537 1.00 48.19  ? 798  TYR B CE1 1 
ATOM   3631 C  CE2 . TYR B 1 207 ? -42.331 18.574 -12.551 1.00 44.27  ? 798  TYR B CE2 1 
ATOM   3632 C  CZ  . TYR B 1 207 ? -43.391 17.686 -12.655 1.00 55.26  ? 798  TYR B CZ  1 
ATOM   3633 O  OH  . TYR B 1 207 ? -43.739 17.129 -13.860 1.00 60.24  ? 798  TYR B OH  1 
ATOM   3634 N  N   . ARG B 1 208 ? -43.261 22.308 -6.871  1.00 39.15  ? 799  ARG B N   1 
ATOM   3635 C  CA  . ARG B 1 208 ? -42.842 23.076 -5.685  1.00 37.29  ? 799  ARG B CA  1 
ATOM   3636 C  C   . ARG B 1 208 ? -41.433 22.636 -5.248  1.00 40.53  ? 799  ARG B C   1 
ATOM   3637 O  O   . ARG B 1 208 ? -41.176 22.369 -4.084  1.00 40.09  ? 799  ARG B O   1 
ATOM   3638 C  CB  . ARG B 1 208 ? -43.882 23.014 -4.549  1.00 34.18  ? 799  ARG B CB  1 
ATOM   3639 C  CG  . ARG B 1 208 ? -44.670 24.308 -4.403  1.00 38.26  ? 799  ARG B CG  1 
ATOM   3640 C  CD  . ARG B 1 208 ? -45.676 24.521 -5.523  1.00 42.98  ? 799  ARG B CD  1 
ATOM   3641 N  NE  . ARG B 1 208 ? -46.491 25.707 -5.275  1.00 40.80  ? 799  ARG B NE  1 
ATOM   3642 C  CZ  . ARG B 1 208 ? -47.451 26.144 -6.076  1.00 48.78  ? 799  ARG B CZ  1 
ATOM   3643 N  NH1 . ARG B 1 208 ? -47.728 25.502 -7.206  1.00 38.09  ? 799  ARG B NH1 1 
ATOM   3644 N  NH2 . ARG B 1 208 ? -48.163 27.209 -5.742  1.00 40.15  ? 799  ARG B NH2 1 
ATOM   3645 N  N   . LYS B 1 209 ? -40.545 22.536 -6.230  1.00 38.03  ? 800  LYS B N   1 
ATOM   3646 C  CA  . LYS B 1 209 ? -39.133 22.156 -6.118  1.00 36.75  ? 800  LYS B CA  1 
ATOM   3647 C  C   . LYS B 1 209 ? -38.389 23.214 -6.861  1.00 41.42  ? 800  LYS B C   1 
ATOM   3648 O  O   . LYS B 1 209 ? -38.695 23.523 -8.024  1.00 41.70  ? 800  LYS B O   1 
ATOM   3649 C  CB  . LYS B 1 209 ? -38.871 20.778 -6.720  1.00 39.37  ? 800  LYS B CB  1 
ATOM   3650 C  CG  . LYS B 1 209 ? -39.396 19.644 -5.847  1.00 45.66  ? 800  LYS B CG  1 
ATOM   3651 C  CD  . LYS B 1 209 ? -39.194 18.311 -6.512  1.00 49.42  ? 800  LYS B CD  1 
ATOM   3652 C  CE  . LYS B 1 209 ? -39.658 17.169 -5.631  1.00 49.46  ? 800  LYS B CE  1 
ATOM   3653 N  NZ  . LYS B 1 209 ? -38.598 16.737 -4.682  1.00 48.02  ? 800  LYS B NZ  1 
ATOM   3654 N  N   . PHE B 1 210 ? -37.415 23.785 -6.173  1.00 37.28  ? 801  PHE B N   1 
ATOM   3655 C  CA  . PHE B 1 210 ? -36.646 24.943 -6.585  1.00 35.52  ? 801  PHE B CA  1 
ATOM   3656 C  C   . PHE B 1 210 ? -35.168 24.616 -6.689  1.00 39.21  ? 801  PHE B C   1 
ATOM   3657 O  O   . PHE B 1 210 ? -34.621 23.930 -5.832  1.00 39.64  ? 801  PHE B O   1 
ATOM   3658 C  CB  . PHE B 1 210 ? -36.893 26.070 -5.563  1.00 35.82  ? 801  PHE B CB  1 
ATOM   3659 C  CG  . PHE B 1 210 ? -38.357 26.417 -5.443  1.00 37.55  ? 801  PHE B CG  1 
ATOM   3660 C  CD1 . PHE B 1 210 ? -39.200 25.692 -4.591  1.00 42.03  ? 801  PHE B CD1 1 
ATOM   3661 C  CD2 . PHE B 1 210 ? -38.900 27.468 -6.181  1.00 38.78  ? 801  PHE B CD2 1 
ATOM   3662 C  CE1 . PHE B 1 210 ? -40.560 25.996 -4.514  1.00 43.21  ? 801  PHE B CE1 1 
ATOM   3663 C  CE2 . PHE B 1 210 ? -40.252 27.771 -6.104  1.00 42.33  ? 801  PHE B CE2 1 
ATOM   3664 C  CZ  . PHE B 1 210 ? -41.077 27.038 -5.273  1.00 41.85  ? 801  PHE B CZ  1 
ATOM   3665 N  N   . THR B 1 211 ? -34.529 25.100 -7.759  1.00 35.53  ? 802  THR B N   1 
ATOM   3666 C  CA  . THR B 1 211 ? -33.107 24.867 -8.024  1.00 35.63  ? 802  THR B CA  1 
ATOM   3667 C  C   . THR B 1 211 ? -32.531 26.171 -8.527  1.00 38.56  ? 802  THR B C   1 
ATOM   3668 O  O   . THR B 1 211 ? -33.281 27.138 -8.707  1.00 36.45  ? 802  THR B O   1 
ATOM   3669 C  CB  . THR B 1 211 ? -32.924 23.755 -9.105  1.00 39.85  ? 802  THR B CB  1 
ATOM   3670 O  OG1 . THR B 1 211 ? -33.466 24.199 -10.343 1.00 39.76  ? 802  THR B OG1 1 
ATOM   3671 C  CG2 . THR B 1 211 ? -33.542 22.400 -8.711  1.00 42.72  ? 802  THR B CG2 1 
ATOM   3672 N  N   . SER B 1 212 ? -31.213 26.191 -8.810  1.00 34.34  ? 803  SER B N   1 
ATOM   3673 C  CA  . SER B 1 212 ? -30.539 27.334 -9.416  1.00 34.04  ? 803  SER B CA  1 
ATOM   3674 C  C   . SER B 1 212 ? -31.118 27.575 -10.820 1.00 35.57  ? 803  SER B C   1 
ATOM   3675 O  O   . SER B 1 212 ? -31.257 28.725 -11.217 1.00 33.74  ? 803  SER B O   1 
ATOM   3676 C  CB  . SER B 1 212 ? -29.035 27.075 -9.515  1.00 39.21  ? 803  SER B CB  1 
ATOM   3677 O  OG  . SER B 1 212 ? -28.455 27.540 -8.308  1.00 54.62  ? 803  SER B OG  1 
ATOM   3678 N  N   . ALA B 1 213 ? -31.513 26.480 -11.532 1.00 32.24  ? 804  ALA B N   1 
ATOM   3679 C  CA  . ALA B 1 213 ? -32.106 26.550 -12.874 1.00 33.13  ? 804  ALA B CA  1 
ATOM   3680 C  C   . ALA B 1 213 ? -33.489 27.222 -12.855 1.00 38.21  ? 804  ALA B C   1 
ATOM   3681 O  O   . ALA B 1 213 ? -33.844 27.882 -13.824 1.00 39.89  ? 804  ALA B O   1 
ATOM   3682 C  CB  . ALA B 1 213 ? -32.184 25.169 -13.495 1.00 34.80  ? 804  ALA B CB  1 
ATOM   3683 N  N   . SER B 1 214 ? -34.251 27.092 -11.756 1.00 35.09  ? 805  SER B N   1 
ATOM   3684 C  CA  . SER B 1 214 ? -35.553 27.766 -11.632 1.00 34.08  ? 805  SER B CA  1 
ATOM   3685 C  C   . SER B 1 214 ? -35.332 29.266 -11.323 1.00 36.65  ? 805  SER B C   1 
ATOM   3686 O  O   . SER B 1 214 ? -36.110 30.096 -11.797 1.00 36.28  ? 805  SER B O   1 
ATOM   3687 C  CB  . SER B 1 214 ? -36.483 27.061 -10.627 1.00 35.15  ? 805  SER B CB  1 
ATOM   3688 O  OG  . SER B 1 214 ? -36.007 27.012 -9.294  1.00 40.24  ? 805  SER B OG  1 
ATOM   3689 N  N   . ASP B 1 215 ? -34.226 29.614 -10.612 1.00 32.72  ? 806  ASP B N   1 
ATOM   3690 C  CA  . ASP B 1 215 ? -33.820 31.017 -10.368 1.00 31.61  ? 806  ASP B CA  1 
ATOM   3691 C  C   . ASP B 1 215 ? -33.387 31.657 -11.702 1.00 32.16  ? 806  ASP B C   1 
ATOM   3692 O  O   . ASP B 1 215 ? -33.657 32.831 -11.927 1.00 32.37  ? 806  ASP B O   1 
ATOM   3693 C  CB  . ASP B 1 215 ? -32.676 31.121 -9.351  1.00 33.00  ? 806  ASP B CB  1 
ATOM   3694 C  CG  . ASP B 1 215 ? -33.053 31.194 -7.875  1.00 38.01  ? 806  ASP B CG  1 
ATOM   3695 O  OD1 . ASP B 1 215 ? -34.269 31.327 -7.563  1.00 37.26  ? 806  ASP B OD1 1 
ATOM   3696 O  OD2 . ASP B 1 215 ? -32.138 31.187 -7.039  1.00 37.63  ? 806  ASP B OD2 1 
ATOM   3697 N  N   . VAL B 1 216 ? -32.754 30.874 -12.596 1.00 29.66  ? 807  VAL B N   1 
ATOM   3698 C  CA  . VAL B 1 216 ? -32.370 31.321 -13.953 1.00 29.12  ? 807  VAL B CA  1 
ATOM   3699 C  C   . VAL B 1 216 ? -33.632 31.709 -14.746 1.00 34.26  ? 807  VAL B C   1 
ATOM   3700 O  O   . VAL B 1 216 ? -33.620 32.718 -15.463 1.00 35.41  ? 807  VAL B O   1 
ATOM   3701 C  CB  . VAL B 1 216 ? -31.492 30.271 -14.686 1.00 32.65  ? 807  VAL B CB  1 
ATOM   3702 C  CG1 . VAL B 1 216 ? -31.435 30.522 -16.209 1.00 30.89  ? 807  VAL B CG1 1 
ATOM   3703 C  CG2 . VAL B 1 216 ? -30.075 30.233 -14.081 1.00 32.41  ? 807  VAL B CG2 1 
ATOM   3704 N  N   . TRP B 1 217 ? -34.718 30.932 -14.603 1.00 31.40  ? 808  TRP B N   1 
ATOM   3705 C  CA  . TRP B 1 217 ? -35.982 31.257 -15.268 1.00 31.77  ? 808  TRP B CA  1 
ATOM   3706 C  C   . TRP B 1 217 ? -36.444 32.631 -14.785 1.00 35.83  ? 808  TRP B C   1 
ATOM   3707 O  O   . TRP B 1 217 ? -36.751 33.481 -15.620 1.00 35.34  ? 808  TRP B O   1 
ATOM   3708 C  CB  . TRP B 1 217 ? -37.057 30.194 -14.997 1.00 30.67  ? 808  TRP B CB  1 
ATOM   3709 C  CG  . TRP B 1 217 ? -38.403 30.542 -15.586 1.00 32.17  ? 808  TRP B CG  1 
ATOM   3710 C  CD1 . TRP B 1 217 ? -39.273 31.498 -15.138 1.00 35.35  ? 808  TRP B CD1 1 
ATOM   3711 C  CD2 . TRP B 1 217 ? -39.008 29.960 -16.748 1.00 32.65  ? 808  TRP B CD2 1 
ATOM   3712 N  NE1 . TRP B 1 217 ? -40.383 31.547 -15.952 1.00 36.06  ? 808  TRP B NE1 1 
ATOM   3713 C  CE2 . TRP B 1 217 ? -40.256 30.601 -16.938 1.00 37.78  ? 808  TRP B CE2 1 
ATOM   3714 C  CE3 . TRP B 1 217 ? -38.663 28.894 -17.598 1.00 34.46  ? 808  TRP B CE3 1 
ATOM   3715 C  CZ2 . TRP B 1 217 ? -41.130 30.253 -17.984 1.00 37.76  ? 808  TRP B CZ2 1 
ATOM   3716 C  CZ3 . TRP B 1 217 ? -39.537 28.546 -18.623 1.00 37.14  ? 808  TRP B CZ3 1 
ATOM   3717 C  CH2 . TRP B 1 217 ? -40.733 29.241 -18.830 1.00 38.24  ? 808  TRP B CH2 1 
ATOM   3718 N  N   . SER B 1 218 ? -36.486 32.846 -13.440 1.00 32.23  ? 809  SER B N   1 
ATOM   3719 C  CA  . SER B 1 218 ? -36.865 34.117 -12.791 1.00 31.29  ? 809  SER B CA  1 
ATOM   3720 C  C   . SER B 1 218 ? -35.991 35.232 -13.318 1.00 35.43  ? 809  SER B C   1 
ATOM   3721 O  O   . SER B 1 218 ? -36.504 36.315 -13.605 1.00 34.93  ? 809  SER B O   1 
ATOM   3722 C  CB  . SER B 1 218 ? -36.713 34.031 -11.270 1.00 33.21  ? 809  SER B CB  1 
ATOM   3723 O  OG  . SER B 1 218 ? -37.469 32.963 -10.718 1.00 37.27  ? 809  SER B OG  1 
ATOM   3724 N  N   . TYR B 1 219 ? -34.652 34.968 -13.462 1.00 30.39  ? 810  TYR B N   1 
ATOM   3725 C  CA  . TYR B 1 219 ? -33.715 35.950 -14.005 1.00 29.08  ? 810  TYR B CA  1 
ATOM   3726 C  C   . TYR B 1 219 ? -34.126 36.412 -15.427 1.00 34.27  ? 810  TYR B C   1 
ATOM   3727 O  O   . TYR B 1 219 ? -34.101 37.606 -15.704 1.00 32.04  ? 810  TYR B O   1 
ATOM   3728 C  CB  . TYR B 1 219 ? -32.250 35.437 -13.950 1.00 29.11  ? 810  TYR B CB  1 
ATOM   3729 C  CG  . TYR B 1 219 ? -31.284 36.432 -14.537 1.00 29.45  ? 810  TYR B CG  1 
ATOM   3730 C  CD1 . TYR B 1 219 ? -30.802 37.501 -13.778 1.00 31.34  ? 810  TYR B CD1 1 
ATOM   3731 C  CD2 . TYR B 1 219 ? -30.957 36.393 -15.889 1.00 30.10  ? 810  TYR B CD2 1 
ATOM   3732 C  CE1 . TYR B 1 219 ? -30.001 38.493 -14.351 1.00 30.39  ? 810  TYR B CE1 1 
ATOM   3733 C  CE2 . TYR B 1 219 ? -30.125 37.351 -16.458 1.00 31.38  ? 810  TYR B CE2 1 
ATOM   3734 C  CZ  . TYR B 1 219 ? -29.659 38.404 -15.688 1.00 36.70  ? 810  TYR B CZ  1 
ATOM   3735 O  OH  . TYR B 1 219 ? -28.858 39.340 -16.285 1.00 32.42  ? 810  TYR B OH  1 
ATOM   3736 N  N   . GLY B 1 220 ? -34.530 35.464 -16.288 1.00 32.39  ? 811  GLY B N   1 
ATOM   3737 C  CA  . GLY B 1 220 ? -35.024 35.754 -17.620 1.00 32.42  ? 811  GLY B CA  1 
ATOM   3738 C  C   . GLY B 1 220 ? -36.204 36.708 -17.583 1.00 35.48  ? 811  GLY B C   1 
ATOM   3739 O  O   . GLY B 1 220 ? -36.311 37.614 -18.421 1.00 36.19  ? 811  GLY B O   1 
ATOM   3740 N  N   . ILE B 1 221 ? -37.083 36.531 -16.597 1.00 31.67  ? 812  ILE B N   1 
ATOM   3741 C  CA  . ILE B 1 221 ? -38.247 37.400 -16.379 1.00 32.07  ? 812  ILE B CA  1 
ATOM   3742 C  C   . ILE B 1 221 ? -37.781 38.808 -15.959 1.00 35.57  ? 812  ILE B C   1 
ATOM   3743 O  O   . ILE B 1 221 ? -38.308 39.795 -16.467 1.00 37.13  ? 812  ILE B O   1 
ATOM   3744 C  CB  . ILE B 1 221 ? -39.282 36.773 -15.383 1.00 34.79  ? 812  ILE B CB  1 
ATOM   3745 C  CG1 . ILE B 1 221 ? -39.799 35.381 -15.875 1.00 35.37  ? 812  ILE B CG1 1 
ATOM   3746 C  CG2 . ILE B 1 221 ? -40.453 37.731 -15.119 1.00 34.93  ? 812  ILE B CG2 1 
ATOM   3747 C  CD1 . ILE B 1 221 ? -40.763 35.420 -17.176 1.00 33.03  ? 812  ILE B CD1 1 
ATOM   3748 N  N   . VAL B 1 222 ? -36.789 38.893 -15.057 1.00 30.98  ? 813  VAL B N   1 
ATOM   3749 C  CA  . VAL B 1 222 ? -36.179 40.162 -14.623 1.00 31.30  ? 813  VAL B CA  1 
ATOM   3750 C  C   . VAL B 1 222 ? -35.578 40.896 -15.827 1.00 34.73  ? 813  VAL B C   1 
ATOM   3751 O  O   . VAL B 1 222 ? -35.732 42.108 -15.917 1.00 35.55  ? 813  VAL B O   1 
ATOM   3752 C  CB  . VAL B 1 222 ? -35.133 39.961 -13.483 1.00 33.50  ? 813  VAL B CB  1 
ATOM   3753 C  CG1 . VAL B 1 222 ? -34.392 41.268 -13.143 1.00 32.37  ? 813  VAL B CG1 1 
ATOM   3754 C  CG2 . VAL B 1 222 ? -35.803 39.382 -12.245 1.00 32.03  ? 813  VAL B CG2 1 
ATOM   3755 N  N   . MET B 1 223 ? -34.908 40.169 -16.754 1.00 31.87  ? 814  MET B N   1 
ATOM   3756 C  CA  . MET B 1 223 ? -34.355 40.762 -17.984 1.00 32.53  ? 814  MET B CA  1 
ATOM   3757 C  C   . MET B 1 223 ? -35.492 41.458 -18.738 1.00 36.20  ? 814  MET B C   1 
ATOM   3758 O  O   . MET B 1 223 ? -35.357 42.607 -19.136 1.00 34.64  ? 814  MET B O   1 
ATOM   3759 C  CB  . MET B 1 223 ? -33.735 39.695 -18.910 1.00 34.03  ? 814  MET B CB  1 
ATOM   3760 C  CG  . MET B 1 223 ? -32.485 39.054 -18.379 1.00 35.10  ? 814  MET B CG  1 
ATOM   3761 S  SD  . MET B 1 223 ? -31.871 37.826 -19.580 1.00 38.63  ? 814  MET B SD  1 
ATOM   3762 C  CE  . MET B 1 223 ? -31.392 38.919 -20.963 1.00 36.71  ? 814  MET B CE  1 
ATOM   3763 N  N   . TRP B 1 224 ? -36.629 40.773 -18.869 1.00 31.92  ? 815  TRP B N   1 
ATOM   3764 C  CA  . TRP B 1 224 ? -37.774 41.320 -19.565 1.00 33.83  ? 815  TRP B CA  1 
ATOM   3765 C  C   . TRP B 1 224 ? -38.306 42.567 -18.842 1.00 37.39  ? 815  TRP B C   1 
ATOM   3766 O  O   . TRP B 1 224 ? -38.584 43.562 -19.504 1.00 36.48  ? 815  TRP B O   1 
ATOM   3767 C  CB  . TRP B 1 224 ? -38.858 40.246 -19.751 1.00 32.94  ? 815  TRP B CB  1 
ATOM   3768 C  CG  . TRP B 1 224 ? -39.948 40.684 -20.691 1.00 34.69  ? 815  TRP B CG  1 
ATOM   3769 C  CD1 . TRP B 1 224 ? -40.026 40.434 -22.028 1.00 37.84  ? 815  TRP B CD1 1 
ATOM   3770 C  CD2 . TRP B 1 224 ? -41.150 41.387 -20.341 1.00 35.60  ? 815  TRP B CD2 1 
ATOM   3771 N  NE1 . TRP B 1 224 ? -41.203 40.933 -22.534 1.00 38.11  ? 815  TRP B NE1 1 
ATOM   3772 C  CE2 . TRP B 1 224 ? -41.905 41.539 -21.524 1.00 39.97  ? 815  TRP B CE2 1 
ATOM   3773 C  CE3 . TRP B 1 224 ? -41.666 41.906 -19.133 1.00 36.87  ? 815  TRP B CE3 1 
ATOM   3774 C  CZ2 . TRP B 1 224 ? -43.152 42.180 -21.537 1.00 40.49  ? 815  TRP B CZ2 1 
ATOM   3775 C  CZ3 . TRP B 1 224 ? -42.883 42.570 -19.154 1.00 39.14  ? 815  TRP B CZ3 1 
ATOM   3776 C  CH2 . TRP B 1 224 ? -43.609 42.708 -20.341 1.00 40.96  ? 815  TRP B CH2 1 
ATOM   3777 N  N   . GLU B 1 225 ? -38.392 42.529 -17.483 1.00 33.90  ? 816  GLU B N   1 
ATOM   3778 C  CA  . GLU B 1 225 ? -38.827 43.679 -16.671 1.00 34.17  ? 816  GLU B CA  1 
ATOM   3779 C  C   . GLU B 1 225 ? -37.918 44.897 -16.875 1.00 39.53  ? 816  GLU B C   1 
ATOM   3780 O  O   . GLU B 1 225 ? -38.408 46.018 -17.002 1.00 40.14  ? 816  GLU B O   1 
ATOM   3781 C  CB  . GLU B 1 225 ? -38.844 43.319 -15.178 1.00 34.41  ? 816  GLU B CB  1 
ATOM   3782 C  CG  . GLU B 1 225 ? -39.902 42.306 -14.782 1.00 30.96  ? 816  GLU B CG  1 
ATOM   3783 C  CD  . GLU B 1 225 ? -39.913 42.069 -13.291 1.00 39.45  ? 816  GLU B CD  1 
ATOM   3784 O  OE1 . GLU B 1 225 ? -39.106 41.226 -12.827 1.00 30.49  ? 816  GLU B OE1 1 
ATOM   3785 O  OE2 . GLU B 1 225 ? -40.658 42.786 -12.581 1.00 35.64  ? 816  GLU B OE2 1 
ATOM   3786 N  N   . VAL B 1 226 ? -36.588 44.673 -16.876 1.00 36.33  ? 817  VAL B N   1 
ATOM   3787 C  CA  . VAL B 1 226 ? -35.580 45.721 -17.046 1.00 34.37  ? 817  VAL B CA  1 
ATOM   3788 C  C   . VAL B 1 226 ? -35.658 46.341 -18.424 1.00 37.20  ? 817  VAL B C   1 
ATOM   3789 O  O   . VAL B 1 226 ? -35.761 47.576 -18.530 1.00 35.70  ? 817  VAL B O   1 
ATOM   3790 C  CB  . VAL B 1 226 ? -34.143 45.249 -16.684 1.00 36.29  ? 817  VAL B CB  1 
ATOM   3791 C  CG1 . VAL B 1 226 ? -33.090 46.307 -17.039 1.00 35.77  ? 817  VAL B CG1 1 
ATOM   3792 C  CG2 . VAL B 1 226 ? -34.043 44.895 -15.217 1.00 35.15  ? 817  VAL B CG2 1 
ATOM   3793 N  N   . MET B 1 227 ? -35.684 45.499 -19.485 1.00 35.21  ? 818  MET B N   1 
ATOM   3794 C  CA  . MET B 1 227 ? -35.716 46.019 -20.869 1.00 35.83  ? 818  MET B CA  1 
ATOM   3795 C  C   . MET B 1 227 ? -37.036 46.701 -21.217 1.00 44.11  ? 818  MET B C   1 
ATOM   3796 O  O   . MET B 1 227 ? -37.073 47.478 -22.162 1.00 46.89  ? 818  MET B O   1 
ATOM   3797 C  CB  . MET B 1 227 ? -35.341 44.933 -21.896 1.00 37.00  ? 818  MET B CB  1 
ATOM   3798 C  CG  . MET B 1 227 ? -33.968 44.290 -21.652 1.00 38.98  ? 818  MET B CG  1 
ATOM   3799 S  SD  . MET B 1 227 ? -32.627 45.441 -21.336 1.00 42.17  ? 818  MET B SD  1 
ATOM   3800 C  CE  . MET B 1 227 ? -32.508 46.304 -22.995 1.00 39.48  ? 818  MET B CE  1 
ATOM   3801 N  N   . SER B 1 228 ? -38.114 46.429 -20.475 1.00 40.90  ? 819  SER B N   1 
ATOM   3802 C  CA  . SER B 1 228 ? -39.415 47.057 -20.772 1.00 40.88  ? 819  SER B CA  1 
ATOM   3803 C  C   . SER B 1 228 ? -39.676 48.242 -19.853 1.00 43.87  ? 819  SER B C   1 
ATOM   3804 O  O   . SER B 1 228 ? -40.774 48.769 -19.851 1.00 46.68  ? 819  SER B O   1 
ATOM   3805 C  CB  . SER B 1 228 ? -40.531 46.024 -20.654 1.00 42.37  ? 819  SER B CB  1 
ATOM   3806 O  OG  . SER B 1 228 ? -40.619 45.480 -19.345 1.00 46.10  ? 819  SER B OG  1 
ATOM   3807 N  N   . PHE B 1 229 ? -38.654 48.682 -19.095 1.00 39.28  ? 820  PHE B N   1 
ATOM   3808 C  CA  . PHE B 1 229 ? -38.712 49.771 -18.113 1.00 38.90  ? 820  PHE B CA  1 
ATOM   3809 C  C   . PHE B 1 229 ? -39.785 49.524 -17.028 1.00 43.75  ? 820  PHE B C   1 
ATOM   3810 O  O   . PHE B 1 229 ? -40.582 50.410 -16.724 1.00 44.60  ? 820  PHE B O   1 
ATOM   3811 C  CB  . PHE B 1 229 ? -38.845 51.155 -18.773 1.00 41.87  ? 820  PHE B CB  1 
ATOM   3812 C  CG  . PHE B 1 229 ? -37.549 51.705 -19.335 1.00 43.02  ? 820  PHE B CG  1 
ATOM   3813 C  CD1 . PHE B 1 229 ? -36.649 52.381 -18.518 1.00 44.29  ? 820  PHE B CD1 1 
ATOM   3814 C  CD2 . PHE B 1 229 ? -37.252 51.581 -20.689 1.00 46.44  ? 820  PHE B CD2 1 
ATOM   3815 C  CE1 . PHE B 1 229 ? -35.467 52.911 -19.041 1.00 46.95  ? 820  PHE B CE1 1 
ATOM   3816 C  CE2 . PHE B 1 229 ? -36.083 52.132 -21.223 1.00 49.57  ? 820  PHE B CE2 1 
ATOM   3817 C  CZ  . PHE B 1 229 ? -35.195 52.792 -20.397 1.00 48.11  ? 820  PHE B CZ  1 
ATOM   3818 N  N   . GLY B 1 230 ? -39.767 48.318 -16.448 1.00 39.60  ? 821  GLY B N   1 
ATOM   3819 C  CA  . GLY B 1 230 ? -40.649 47.928 -15.350 1.00 38.85  ? 821  GLY B CA  1 
ATOM   3820 C  C   . GLY B 1 230 ? -42.085 47.598 -15.688 1.00 44.07  ? 821  GLY B C   1 
ATOM   3821 O  O   . GLY B 1 230 ? -42.992 47.824 -14.879 1.00 43.11  ? 821  GLY B O   1 
ATOM   3822 N  N   . GLU B 1 231 ? -42.319 47.034 -16.873 1.00 40.68  ? 822  GLU B N   1 
ATOM   3823 C  CA  . GLU B 1 231 ? -43.646 46.577 -17.222 1.00 40.41  ? 822  GLU B CA  1 
ATOM   3824 C  C   . GLU B 1 231 ? -43.889 45.267 -16.430 1.00 45.30  ? 822  GLU B C   1 
ATOM   3825 O  O   . GLU B 1 231 ? -42.942 44.516 -16.174 1.00 43.17  ? 822  GLU B O   1 
ATOM   3826 C  CB  . GLU B 1 231 ? -43.747 46.328 -18.735 1.00 41.85  ? 822  GLU B CB  1 
ATOM   3827 C  CG  . GLU B 1 231 ? -45.108 45.864 -19.243 1.00 55.01  ? 822  GLU B CG  1 
ATOM   3828 C  CD  . GLU B 1 231 ? -46.277 46.796 -18.995 1.00 70.66  ? 822  GLU B CD  1 
ATOM   3829 O  OE1 . GLU B 1 231 ? -47.004 46.582 -17.999 1.00 61.61  ? 822  GLU B OE1 1 
ATOM   3830 O  OE2 . GLU B 1 231 ? -46.448 47.757 -19.777 1.00 68.40  ? 822  GLU B OE2 1 
ATOM   3831 N  N   . ARG B 1 232 ? -45.149 45.014 -16.033 1.00 43.17  ? 823  ARG B N   1 
ATOM   3832 C  CA  . ARG B 1 232 ? -45.518 43.799 -15.328 1.00 41.91  ? 823  ARG B CA  1 
ATOM   3833 C  C   . ARG B 1 232 ? -45.413 42.620 -16.299 1.00 45.14  ? 823  ARG B C   1 
ATOM   3834 O  O   . ARG B 1 232 ? -46.051 42.654 -17.352 1.00 46.36  ? 823  ARG B O   1 
ATOM   3835 C  CB  . ARG B 1 232 ? -46.961 43.879 -14.784 1.00 40.80  ? 823  ARG B CB  1 
ATOM   3836 C  CG  . ARG B 1 232 ? -47.362 42.683 -13.904 1.00 46.01  ? 823  ARG B CG  1 
ATOM   3837 C  CD  . ARG B 1 232 ? -48.850 42.728 -13.588 1.00 57.08  ? 823  ARG B CD  1 
ATOM   3838 N  NE  . ARG B 1 232 ? -49.275 41.652 -12.694 1.00 67.15  ? 823  ARG B NE  1 
ATOM   3839 C  CZ  . ARG B 1 232 ? -50.473 41.070 -12.734 1.00 90.73  ? 823  ARG B CZ  1 
ATOM   3840 N  NH1 . ARG B 1 232 ? -51.369 41.436 -13.644 1.00 80.67  ? 823  ARG B NH1 1 
ATOM   3841 N  NH2 . ARG B 1 232 ? -50.781 40.112 -11.868 1.00 78.56  ? 823  ARG B NH2 1 
ATOM   3842 N  N   . PRO B 1 233 ? -44.651 41.560 -15.946 1.00 38.43  ? 824  PRO B N   1 
ATOM   3843 C  CA  . PRO B 1 233 ? -44.603 40.370 -16.818 1.00 38.77  ? 824  PRO B CA  1 
ATOM   3844 C  C   . PRO B 1 233 ? -45.995 39.831 -17.124 1.00 45.15  ? 824  PRO B C   1 
ATOM   3845 O  O   . PRO B 1 233 ? -46.821 39.707 -16.215 1.00 45.84  ? 824  PRO B O   1 
ATOM   3846 C  CB  . PRO B 1 233 ? -43.799 39.354 -15.984 1.00 39.22  ? 824  PRO B CB  1 
ATOM   3847 C  CG  . PRO B 1 233 ? -43.004 40.192 -15.040 1.00 41.33  ? 824  PRO B CG  1 
ATOM   3848 C  CD  . PRO B 1 233 ? -43.853 41.368 -14.719 1.00 36.89  ? 824  PRO B CD  1 
ATOM   3849 N  N   . TYR B 1 234 ? -46.252 39.524 -18.414 1.00 42.52  ? 825  TYR B N   1 
ATOM   3850 C  CA  . TYR B 1 234 ? -47.505 38.971 -18.947 1.00 43.15  ? 825  TYR B CA  1 
ATOM   3851 C  C   . TYR B 1 234 ? -48.666 39.932 -18.819 1.00 48.98  ? 825  TYR B C   1 
ATOM   3852 O  O   . TYR B 1 234 ? -49.813 39.539 -19.044 1.00 51.32  ? 825  TYR B O   1 
ATOM   3853 C  CB  . TYR B 1 234 ? -47.850 37.575 -18.354 1.00 42.81  ? 825  TYR B CB  1 
ATOM   3854 C  CG  . TYR B 1 234 ? -46.695 36.609 -18.419 1.00 40.78  ? 825  TYR B CG  1 
ATOM   3855 C  CD1 . TYR B 1 234 ? -45.795 36.496 -17.359 1.00 40.69  ? 825  TYR B CD1 1 
ATOM   3856 C  CD2 . TYR B 1 234 ? -46.516 35.782 -19.524 1.00 40.71  ? 825  TYR B CD2 1 
ATOM   3857 C  CE1 . TYR B 1 234 ? -44.703 35.643 -17.430 1.00 40.88  ? 825  TYR B CE1 1 
ATOM   3858 C  CE2 . TYR B 1 234 ? -45.456 34.882 -19.582 1.00 40.96  ? 825  TYR B CE2 1 
ATOM   3859 C  CZ  . TYR B 1 234 ? -44.541 34.831 -18.538 1.00 44.27  ? 825  TYR B CZ  1 
ATOM   3860 O  OH  . TYR B 1 234 ? -43.476 33.979 -18.583 1.00 38.61  ? 825  TYR B OH  1 
ATOM   3861 N  N   . TRP B 1 235 ? -48.358 41.208 -18.525 1.00 45.77  ? 826  TRP B N   1 
ATOM   3862 C  CA  . TRP B 1 235 ? -49.304 42.330 -18.433 1.00 47.00  ? 826  TRP B CA  1 
ATOM   3863 C  C   . TRP B 1 235 ? -50.473 42.012 -17.500 1.00 53.13  ? 826  TRP B C   1 
ATOM   3864 O  O   . TRP B 1 235 ? -50.246 41.752 -16.328 1.00 53.45  ? 826  TRP B O   1 
ATOM   3865 C  CB  . TRP B 1 235 ? -49.763 42.780 -19.846 1.00 46.31  ? 826  TRP B CB  1 
ATOM   3866 C  CG  . TRP B 1 235 ? -48.635 43.056 -20.800 1.00 46.53  ? 826  TRP B CG  1 
ATOM   3867 C  CD1 . TRP B 1 235 ? -47.947 44.228 -20.940 1.00 49.13  ? 826  TRP B CD1 1 
ATOM   3868 C  CD2 . TRP B 1 235 ? -48.048 42.131 -21.726 1.00 45.45  ? 826  TRP B CD2 1 
ATOM   3869 N  NE1 . TRP B 1 235 ? -47.002 44.106 -21.928 1.00 47.64  ? 826  TRP B NE1 1 
ATOM   3870 C  CE2 . TRP B 1 235 ? -47.046 42.829 -22.434 1.00 48.99  ? 826  TRP B CE2 1 
ATOM   3871 C  CE3 . TRP B 1 235 ? -48.323 40.800 -22.082 1.00 46.55  ? 826  TRP B CE3 1 
ATOM   3872 C  CZ2 . TRP B 1 235 ? -46.273 42.221 -23.440 1.00 47.81  ? 826  TRP B CZ2 1 
ATOM   3873 C  CZ3 . TRP B 1 235 ? -47.541 40.190 -23.055 1.00 47.78  ? 826  TRP B CZ3 1 
ATOM   3874 C  CH2 . TRP B 1 235 ? -46.533 40.902 -23.728 1.00 47.90  ? 826  TRP B CH2 1 
ATOM   3875 N  N   . ASP B 1 236 ? -51.708 42.010 -18.017 1.00 52.91  ? 827  ASP B N   1 
ATOM   3876 C  CA  . ASP B 1 236 ? -52.931 41.749 -17.268 1.00 52.93  ? 827  ASP B CA  1 
ATOM   3877 C  C   . ASP B 1 236 ? -53.372 40.276 -17.250 1.00 56.47  ? 827  ASP B C   1 
ATOM   3878 O  O   . ASP B 1 236 ? -54.450 39.993 -16.715 1.00 57.09  ? 827  ASP B O   1 
ATOM   3879 C  CB  . ASP B 1 236 ? -54.073 42.658 -17.795 1.00 56.14  ? 827  ASP B CB  1 
ATOM   3880 C  CG  . ASP B 1 236 ? -53.952 44.129 -17.443 1.00 59.02  ? 827  ASP B CG  1 
ATOM   3881 O  OD1 . ASP B 1 236 ? -53.235 44.453 -16.477 1.00 56.55  ? 827  ASP B OD1 1 
ATOM   3882 O  OD2 . ASP B 1 236 ? -54.617 44.949 -18.102 1.00 66.90  ? 827  ASP B OD2 1 
ATOM   3883 N  N   . MET B 1 237 ? -52.559 39.336 -17.821 1.00 51.54  ? 828  MET B N   1 
ATOM   3884 C  CA  . MET B 1 237 ? -52.896 37.898 -17.820 1.00 50.73  ? 828  MET B CA  1 
ATOM   3885 C  C   . MET B 1 237 ? -53.004 37.408 -16.389 1.00 53.49  ? 828  MET B C   1 
ATOM   3886 O  O   . MET B 1 237 ? -52.232 37.843 -15.538 1.00 52.72  ? 828  MET B O   1 
ATOM   3887 C  CB  . MET B 1 237 ? -51.831 37.055 -18.541 1.00 51.70  ? 828  MET B CB  1 
ATOM   3888 C  CG  . MET B 1 237 ? -51.901 37.118 -20.054 1.00 55.86  ? 828  MET B CG  1 
ATOM   3889 S  SD  . MET B 1 237 ? -50.502 36.280 -20.844 1.00 58.82  ? 828  MET B SD  1 
ATOM   3890 C  CE  . MET B 1 237 ? -50.924 34.586 -20.626 1.00 55.46  ? 828  MET B CE  1 
ATOM   3891 N  N   . SER B 1 238 ? -53.966 36.523 -16.108 1.00 51.22  ? 829  SER B N   1 
ATOM   3892 C  CA  . SER B 1 238 ? -54.093 35.978 -14.751 1.00 49.33  ? 829  SER B CA  1 
ATOM   3893 C  C   . SER B 1 238 ? -52.969 34.949 -14.517 1.00 49.87  ? 829  SER B C   1 
ATOM   3894 O  O   . SER B 1 238 ? -52.331 34.504 -15.473 1.00 45.43  ? 829  SER B O   1 
ATOM   3895 C  CB  . SER B 1 238 ? -55.453 35.326 -14.563 1.00 50.39  ? 829  SER B CB  1 
ATOM   3896 O  OG  . SER B 1 238 ? -55.564 34.158 -15.357 1.00 56.35  ? 829  SER B OG  1 
ATOM   3897 N  N   . ASN B 1 239 ? -52.757 34.553 -13.253 1.00 48.42  ? 830  ASN B N   1 
ATOM   3898 C  CA  . ASN B 1 239 ? -51.780 33.541 -12.863 1.00 46.46  ? 830  ASN B CA  1 
ATOM   3899 C  C   . ASN B 1 239 ? -52.031 32.235 -13.627 1.00 49.69  ? 830  ASN B C   1 
ATOM   3900 O  O   . ASN B 1 239 ? -51.095 31.632 -14.158 1.00 49.09  ? 830  ASN B O   1 
ATOM   3901 C  CB  . ASN B 1 239 ? -51.837 33.328 -11.357 1.00 44.32  ? 830  ASN B CB  1 
ATOM   3902 C  CG  . ASN B 1 239 ? -51.045 34.345 -10.578 1.00 60.64  ? 830  ASN B CG  1 
ATOM   3903 O  OD1 . ASN B 1 239 ? -50.177 35.083 -11.098 1.00 52.69  ? 830  ASN B OD1 1 
ATOM   3904 N  ND2 . ASN B 1 239 ? -51.295 34.351 -9.282  1.00 53.60  ? 830  ASN B ND2 1 
ATOM   3905 N  N   . GLN B 1 240 ? -53.312 31.870 -13.756 1.00 47.14  ? 831  GLN B N   1 
ATOM   3906 C  CA  . GLN B 1 240 ? -53.820 30.700 -14.462 1.00 46.82  ? 831  GLN B CA  1 
ATOM   3907 C  C   . GLN B 1 240 ? -53.507 30.797 -15.965 1.00 50.88  ? 831  GLN B C   1 
ATOM   3908 O  O   . GLN B 1 240 ? -53.070 29.802 -16.554 1.00 48.64  ? 831  GLN B O   1 
ATOM   3909 C  CB  . GLN B 1 240 ? -55.337 30.574 -14.213 1.00 48.93  ? 831  GLN B CB  1 
ATOM   3910 C  CG  . GLN B 1 240 ? -55.925 29.251 -14.650 1.00 55.99  ? 831  GLN B CG  1 
ATOM   3911 C  CD  . GLN B 1 240 ? -57.393 29.123 -14.325 1.00 82.97  ? 831  GLN B CD  1 
ATOM   3912 O  OE1 . GLN B 1 240 ? -57.967 29.867 -13.504 1.00 75.44  ? 831  GLN B OE1 1 
ATOM   3913 N  NE2 . GLN B 1 240 ? -58.038 28.176 -14.984 1.00 77.96  ? 831  GLN B NE2 1 
ATOM   3914 N  N   . ASP B 1 241 ? -53.748 31.991 -16.580 1.00 49.71  ? 832  ASP B N   1 
ATOM   3915 C  CA  . ASP B 1 241 ? -53.431 32.281 -17.986 1.00 50.08  ? 832  ASP B CA  1 
ATOM   3916 C  C   . ASP B 1 241 ? -51.925 32.107 -18.206 1.00 51.65  ? 832  ASP B C   1 
ATOM   3917 O  O   . ASP B 1 241 ? -51.531 31.522 -19.207 1.00 53.69  ? 832  ASP B O   1 
ATOM   3918 C  CB  . ASP B 1 241 ? -53.818 33.729 -18.367 1.00 53.08  ? 832  ASP B CB  1 
ATOM   3919 C  CG  . ASP B 1 241 ? -55.303 34.046 -18.462 1.00 62.67  ? 832  ASP B CG  1 
ATOM   3920 O  OD1 . ASP B 1 241 ? -56.101 33.105 -18.683 1.00 64.20  ? 832  ASP B OD1 1 
ATOM   3921 O  OD2 . ASP B 1 241 ? -55.661 35.243 -18.340 1.00 63.94  ? 832  ASP B OD2 1 
ATOM   3922 N  N   . VAL B 1 242 ? -51.094 32.596 -17.268 1.00 46.58  ? 833  VAL B N   1 
ATOM   3923 C  CA  . VAL B 1 242 ? -49.627 32.485 -17.318 1.00 44.35  ? 833  VAL B CA  1 
ATOM   3924 C  C   . VAL B 1 242 ? -49.213 30.987 -17.323 1.00 49.87  ? 833  VAL B C   1 
ATOM   3925 O  O   . VAL B 1 242 ? -48.500 30.559 -18.243 1.00 50.72  ? 833  VAL B O   1 
ATOM   3926 C  CB  . VAL B 1 242 ? -48.916 33.338 -16.221 1.00 46.07  ? 833  VAL B CB  1 
ATOM   3927 C  CG1 . VAL B 1 242 ? -47.396 33.097 -16.211 1.00 44.16  ? 833  VAL B CG1 1 
ATOM   3928 C  CG2 . VAL B 1 242 ? -49.210 34.834 -16.415 1.00 45.83  ? 833  VAL B CG2 1 
ATOM   3929 N  N   . ILE B 1 243 ? -49.722 30.185 -16.348 1.00 44.64  ? 834  ILE B N   1 
ATOM   3930 C  CA  . ILE B 1 243 ? -49.458 28.735 -16.263 1.00 43.96  ? 834  ILE B CA  1 
ATOM   3931 C  C   . ILE B 1 243 ? -49.804 28.033 -17.604 1.00 50.02  ? 834  ILE B C   1 
ATOM   3932 O  O   . ILE B 1 243 ? -48.977 27.293 -18.145 1.00 49.09  ? 834  ILE B O   1 
ATOM   3933 C  CB  . ILE B 1 243 ? -50.188 28.095 -15.044 1.00 46.81  ? 834  ILE B CB  1 
ATOM   3934 C  CG1 . ILE B 1 243 ? -49.632 28.649 -13.716 1.00 45.37  ? 834  ILE B CG1 1 
ATOM   3935 C  CG2 . ILE B 1 243 ? -50.101 26.558 -15.080 1.00 47.85  ? 834  ILE B CG2 1 
ATOM   3936 C  CD1 . ILE B 1 243 ? -50.506 28.356 -12.497 1.00 48.83  ? 834  ILE B CD1 1 
ATOM   3937 N  N   . ASN B 1 244 ? -50.991 28.339 -18.161 1.00 48.75  ? 835  ASN B N   1 
ATOM   3938 C  CA  . ASN B 1 244 ? -51.472 27.776 -19.418 1.00 50.40  ? 835  ASN B CA  1 
ATOM   3939 C  C   . ASN B 1 244 ? -50.659 28.185 -20.625 1.00 53.76  ? 835  ASN B C   1 
ATOM   3940 O  O   . ASN B 1 244 ? -50.372 27.329 -21.457 1.00 54.56  ? 835  ASN B O   1 
ATOM   3941 C  CB  . ASN B 1 244 ? -52.960 28.104 -19.653 1.00 54.52  ? 835  ASN B CB  1 
ATOM   3942 C  CG  . ASN B 1 244 ? -53.917 27.469 -18.676 1.00 68.27  ? 835  ASN B CG  1 
ATOM   3943 O  OD1 . ASN B 1 244 ? -53.569 26.595 -17.873 1.00 62.44  ? 835  ASN B OD1 1 
ATOM   3944 N  ND2 . ASN B 1 244 ? -55.152 27.911 -18.720 1.00 65.19  ? 835  ASN B ND2 1 
ATOM   3945 N  N   . ALA B 1 245 ? -50.318 29.482 -20.747 1.00 49.16  ? 836  ALA B N   1 
ATOM   3946 C  CA  . ALA B 1 245 ? -49.539 30.004 -21.867 1.00 48.77  ? 836  ALA B CA  1 
ATOM   3947 C  C   . ALA B 1 245 ? -48.148 29.398 -21.914 1.00 52.92  ? 836  ALA B C   1 
ATOM   3948 O  O   . ALA B 1 245 ? -47.677 29.069 -23.013 1.00 53.02  ? 836  ALA B O   1 
ATOM   3949 C  CB  . ALA B 1 245 ? -49.451 31.511 -21.801 1.00 49.17  ? 836  ALA B CB  1 
ATOM   3950 N  N   . ILE B 1 246 ? -47.495 29.232 -20.734 1.00 48.06  ? 837  ILE B N   1 
ATOM   3951 C  CA  . ILE B 1 246 ? -46.167 28.614 -20.648 1.00 46.54  ? 837  ILE B CA  1 
ATOM   3952 C  C   . ILE B 1 246 ? -46.281 27.157 -21.107 1.00 54.17  ? 837  ILE B C   1 
ATOM   3953 O  O   . ILE B 1 246 ? -45.482 26.725 -21.954 1.00 52.88  ? 837  ILE B O   1 
ATOM   3954 C  CB  . ILE B 1 246 ? -45.482 28.789 -19.256 1.00 46.49  ? 837  ILE B CB  1 
ATOM   3955 C  CG1 . ILE B 1 246 ? -45.182 30.285 -18.927 1.00 44.13  ? 837  ILE B CG1 1 
ATOM   3956 C  CG2 . ILE B 1 246 ? -44.227 27.904 -19.097 1.00 46.55  ? 837  ILE B CG2 1 
ATOM   3957 C  CD1 . ILE B 1 246 ? -44.434 31.143 -19.998 1.00 48.02  ? 837  ILE B CD1 1 
ATOM   3958 N  N   . GLU B 1 247 ? -47.335 26.443 -20.628 1.00 53.74  ? 838  GLU B N   1 
ATOM   3959 C  CA  . GLU B 1 247 ? -47.610 25.051 -21.014 1.00 55.86  ? 838  GLU B CA  1 
ATOM   3960 C  C   . GLU B 1 247 ? -47.807 24.928 -22.535 1.00 61.42  ? 838  GLU B C   1 
ATOM   3961 O  O   . GLU B 1 247 ? -47.419 23.914 -23.106 1.00 61.82  ? 838  GLU B O   1 
ATOM   3962 C  CB  . GLU B 1 247 ? -48.832 24.476 -20.262 1.00 58.63  ? 838  GLU B CB  1 
ATOM   3963 C  CG  . GLU B 1 247 ? -48.580 24.117 -18.799 1.00 72.19  ? 838  GLU B CG  1 
ATOM   3964 C  CD  . GLU B 1 247 ? -47.604 22.981 -18.541 1.00 108.07 ? 838  GLU B CD  1 
ATOM   3965 O  OE1 . GLU B 1 247 ? -47.869 21.861 -19.036 1.00 113.29 ? 838  GLU B OE1 1 
ATOM   3966 O  OE2 . GLU B 1 247 ? -46.577 23.208 -17.855 1.00 100.69 ? 838  GLU B OE2 1 
ATOM   3967 N  N   . GLN B 1 248 ? -48.347 25.982 -23.191 1.00 58.48  ? 839  GLN B N   1 
ATOM   3968 C  CA  . GLN B 1 248 ? -48.579 26.023 -24.644 1.00 59.88  ? 839  GLN B CA  1 
ATOM   3969 C  C   . GLN B 1 248 ? -47.372 26.578 -25.426 1.00 63.62  ? 839  GLN B C   1 
ATOM   3970 O  O   . GLN B 1 248 ? -47.486 26.946 -26.601 1.00 64.08  ? 839  GLN B O   1 
ATOM   3971 C  CB  . GLN B 1 248 ? -49.892 26.776 -25.000 1.00 62.21  ? 839  GLN B CB  1 
ATOM   3972 C  CG  . GLN B 1 248 ? -51.211 26.174 -24.458 1.00 76.81  ? 839  GLN B CG  1 
ATOM   3973 C  CD  . GLN B 1 248 ? -51.290 24.666 -24.529 1.00 104.82 ? 839  GLN B CD  1 
ATOM   3974 O  OE1 . GLN B 1 248 ? -51.086 24.045 -25.584 1.00 103.78 ? 839  GLN B OE1 1 
ATOM   3975 N  NE2 . GLN B 1 248 ? -51.593 24.044 -23.398 1.00 98.44  ? 839  GLN B NE2 1 
ATOM   3976 N  N   . ASP B 1 249 ? -46.214 26.631 -24.755 1.00 58.68  ? 840  ASP B N   1 
ATOM   3977 C  CA  . ASP B 1 249 ? -44.923 27.086 -25.255 1.00 57.51  ? 840  ASP B CA  1 
ATOM   3978 C  C   . ASP B 1 249 ? -44.917 28.578 -25.636 1.00 59.47  ? 840  ASP B C   1 
ATOM   3979 O  O   . ASP B 1 249 ? -44.067 29.004 -26.422 1.00 58.97  ? 840  ASP B O   1 
ATOM   3980 C  CB  . ASP B 1 249 ? -44.384 26.182 -26.390 1.00 60.69  ? 840  ASP B CB  1 
ATOM   3981 C  CG  . ASP B 1 249 ? -44.256 24.705 -26.017 1.00 72.64  ? 840  ASP B CG  1 
ATOM   3982 O  OD1 . ASP B 1 249 ? -43.668 24.401 -24.943 1.00 70.16  ? 840  ASP B OD1 1 
ATOM   3983 O  OD2 . ASP B 1 249 ? -44.719 23.851 -26.809 1.00 83.62  ? 840  ASP B OD2 1 
ATOM   3984 N  N   . TYR B 1 250 ? -45.827 29.388 -25.037 1.00 53.30  ? 841  TYR B N   1 
ATOM   3985 C  CA  . TYR B 1 250 ? -45.796 30.843 -25.233 1.00 50.88  ? 841  TYR B CA  1 
ATOM   3986 C  C   . TYR B 1 250 ? -44.619 31.365 -24.390 1.00 50.62  ? 841  TYR B C   1 
ATOM   3987 O  O   . TYR B 1 250 ? -44.385 30.859 -23.292 1.00 49.16  ? 841  TYR B O   1 
ATOM   3988 C  CB  . TYR B 1 250 ? -47.102 31.517 -24.749 1.00 50.81  ? 841  TYR B CB  1 
ATOM   3989 C  CG  . TYR B 1 250 ? -47.038 33.035 -24.618 1.00 50.61  ? 841  TYR B CG  1 
ATOM   3990 C  CD1 . TYR B 1 250 ? -47.419 33.862 -25.671 1.00 52.68  ? 841  TYR B CD1 1 
ATOM   3991 C  CD2 . TYR B 1 250 ? -46.618 33.641 -23.430 1.00 49.49  ? 841  TYR B CD2 1 
ATOM   3992 C  CE1 . TYR B 1 250 ? -47.386 35.250 -25.550 1.00 53.30  ? 841  TYR B CE1 1 
ATOM   3993 C  CE2 . TYR B 1 250 ? -46.534 35.031 -23.316 1.00 49.44  ? 841  TYR B CE2 1 
ATOM   3994 C  CZ  . TYR B 1 250 ? -46.934 35.831 -24.376 1.00 58.32  ? 841  TYR B CZ  1 
ATOM   3995 O  OH  . TYR B 1 250 ? -46.892 37.204 -24.271 1.00 57.13  ? 841  TYR B OH  1 
ATOM   3996 N  N   . ARG B 1 251 ? -43.903 32.378 -24.912 1.00 44.69  ? 842  ARG B N   1 
ATOM   3997 C  CA  . ARG B 1 251 ? -42.828 33.102 -24.241 1.00 43.28  ? 842  ARG B CA  1 
ATOM   3998 C  C   . ARG B 1 251 ? -43.050 34.589 -24.500 1.00 46.01  ? 842  ARG B C   1 
ATOM   3999 O  O   . ARG B 1 251 ? -43.516 34.955 -25.579 1.00 45.70  ? 842  ARG B O   1 
ATOM   4000 C  CB  . ARG B 1 251 ? -41.431 32.668 -24.735 1.00 40.74  ? 842  ARG B CB  1 
ATOM   4001 C  CG  . ARG B 1 251 ? -41.054 31.216 -24.408 1.00 40.86  ? 842  ARG B CG  1 
ATOM   4002 C  CD  . ARG B 1 251 ? -41.040 30.945 -22.900 1.00 42.04  ? 842  ARG B CD  1 
ATOM   4003 N  NE  . ARG B 1 251 ? -40.568 29.592 -22.602 1.00 46.93  ? 842  ARG B NE  1 
ATOM   4004 C  CZ  . ARG B 1 251 ? -41.355 28.534 -22.446 1.00 54.30  ? 842  ARG B CZ  1 
ATOM   4005 N  NH1 . ARG B 1 251 ? -42.668 28.650 -22.578 1.00 44.53  ? 842  ARG B NH1 1 
ATOM   4006 N  NH2 . ARG B 1 251 ? -40.833 27.347 -22.166 1.00 39.22  ? 842  ARG B NH2 1 
ATOM   4007 N  N   . LEU B 1 252 ? -42.732 35.443 -23.512 1.00 41.55  ? 843  LEU B N   1 
ATOM   4008 C  CA  . LEU B 1 252 ? -42.887 36.903 -23.627 1.00 40.17  ? 843  LEU B CA  1 
ATOM   4009 C  C   . LEU B 1 252 ? -42.133 37.424 -24.849 1.00 45.58  ? 843  LEU B C   1 
ATOM   4010 O  O   . LEU B 1 252 ? -41.037 36.937 -25.135 1.00 44.83  ? 843  LEU B O   1 
ATOM   4011 C  CB  . LEU B 1 252 ? -42.393 37.626 -22.347 1.00 37.92  ? 843  LEU B CB  1 
ATOM   4012 C  CG  . LEU B 1 252 ? -43.330 37.532 -21.125 1.00 40.61  ? 843  LEU B CG  1 
ATOM   4013 C  CD1 . LEU B 1 252 ? -42.570 37.800 -19.823 1.00 36.76  ? 843  LEU B CD1 1 
ATOM   4014 C  CD2 . LEU B 1 252 ? -44.552 38.457 -21.283 1.00 43.17  ? 843  LEU B CD2 1 
ATOM   4015 N  N   . PRO B 1 253 ? -42.717 38.370 -25.610 1.00 43.01  ? 844  PRO B N   1 
ATOM   4016 C  CA  . PRO B 1 253 ? -42.022 38.867 -26.807 1.00 43.38  ? 844  PRO B CA  1 
ATOM   4017 C  C   . PRO B 1 253 ? -40.894 39.828 -26.422 1.00 47.30  ? 844  PRO B C   1 
ATOM   4018 O  O   . PRO B 1 253 ? -40.850 40.266 -25.273 1.00 45.74  ? 844  PRO B O   1 
ATOM   4019 C  CB  . PRO B 1 253 ? -43.142 39.589 -27.578 1.00 45.88  ? 844  PRO B CB  1 
ATOM   4020 C  CG  . PRO B 1 253 ? -44.068 40.057 -26.545 1.00 50.52  ? 844  PRO B CG  1 
ATOM   4021 C  CD  . PRO B 1 253 ? -44.025 39.038 -25.431 1.00 45.06  ? 844  PRO B CD  1 
ATOM   4022 N  N   . PRO B 1 254 ? -40.007 40.229 -27.357 1.00 44.79  ? 845  PRO B N   1 
ATOM   4023 C  CA  . PRO B 1 254 ? -38.974 41.193 -26.986 1.00 44.14  ? 845  PRO B CA  1 
ATOM   4024 C  C   . PRO B 1 254 ? -39.537 42.589 -26.684 1.00 48.39  ? 845  PRO B C   1 
ATOM   4025 O  O   . PRO B 1 254 ? -40.354 43.097 -27.442 1.00 49.65  ? 845  PRO B O   1 
ATOM   4026 C  CB  . PRO B 1 254 ? -38.051 41.243 -28.220 1.00 46.44  ? 845  PRO B CB  1 
ATOM   4027 C  CG  . PRO B 1 254 ? -38.779 40.670 -29.303 1.00 51.00  ? 845  PRO B CG  1 
ATOM   4028 C  CD  . PRO B 1 254 ? -39.893 39.826 -28.774 1.00 47.42  ? 845  PRO B CD  1 
ATOM   4029 N  N   . PRO B 1 255 ? -39.109 43.234 -25.584 1.00 42.16  ? 846  PRO B N   1 
ATOM   4030 C  CA  . PRO B 1 255 ? -39.553 44.612 -25.322 1.00 41.84  ? 846  PRO B CA  1 
ATOM   4031 C  C   . PRO B 1 255 ? -39.075 45.581 -26.422 1.00 47.97  ? 846  PRO B C   1 
ATOM   4032 O  O   . PRO B 1 255 ? -38.209 45.231 -27.225 1.00 47.34  ? 846  PRO B O   1 
ATOM   4033 C  CB  . PRO B 1 255 ? -38.866 44.939 -23.982 1.00 41.95  ? 846  PRO B CB  1 
ATOM   4034 C  CG  . PRO B 1 255 ? -38.587 43.600 -23.347 1.00 43.98  ? 846  PRO B CG  1 
ATOM   4035 C  CD  . PRO B 1 255 ? -38.195 42.758 -24.528 1.00 41.02  ? 846  PRO B CD  1 
ATOM   4036 N  N   . MET B 1 256 ? -39.657 46.798 -26.471 1.00 45.30  ? 847  MET B N   1 
ATOM   4037 C  CA  . MET B 1 256 ? -39.309 47.841 -27.439 1.00 46.65  ? 847  MET B CA  1 
ATOM   4038 C  C   . MET B 1 256 ? -37.801 48.128 -27.407 1.00 54.28  ? 847  MET B C   1 
ATOM   4039 O  O   . MET B 1 256 ? -37.225 48.265 -26.325 1.00 51.31  ? 847  MET B O   1 
ATOM   4040 C  CB  . MET B 1 256 ? -40.094 49.134 -27.147 1.00 48.93  ? 847  MET B CB  1 
ATOM   4041 C  CG  . MET B 1 256 ? -40.059 50.142 -28.301 1.00 52.97  ? 847  MET B CG  1 
ATOM   4042 S  SD  . MET B 1 256 ? -40.960 49.576 -29.773 1.00 56.68  ? 847  MET B SD  1 
ATOM   4043 C  CE  . MET B 1 256 ? -42.626 49.845 -29.256 1.00 53.00  ? 847  MET B CE  1 
ATOM   4044 N  N   . ASP B 1 257 ? -37.164 48.157 -28.586 1.00 54.37  ? 848  ASP B N   1 
ATOM   4045 C  CA  . ASP B 1 257 ? -35.728 48.449 -28.781 1.00 56.43  ? 848  ASP B CA  1 
ATOM   4046 C  C   . ASP B 1 257 ? -34.766 47.438 -28.124 1.00 56.96  ? 848  ASP B C   1 
ATOM   4047 O  O   . ASP B 1 257 ? -33.568 47.696 -28.048 1.00 58.46  ? 848  ASP B O   1 
ATOM   4048 C  CB  . ASP B 1 257 ? -35.376 49.895 -28.355 1.00 60.58  ? 848  ASP B CB  1 
ATOM   4049 C  CG  . ASP B 1 257 ? -36.345 50.945 -28.875 1.00 81.58  ? 848  ASP B CG  1 
ATOM   4050 O  OD1 . ASP B 1 257 ? -36.554 51.007 -30.114 1.00 86.55  ? 848  ASP B OD1 1 
ATOM   4051 O  OD2 . ASP B 1 257 ? -36.923 51.684 -28.043 1.00 87.97  ? 848  ASP B OD2 1 
ATOM   4052 N  N   . CYS B 1 258 ? -35.274 46.273 -27.726 1.00 48.96  ? 849  CYS B N   1 
ATOM   4053 C  CA  . CYS B 1 258 ? -34.471 45.204 -27.158 1.00 45.27  ? 849  CYS B CA  1 
ATOM   4054 C  C   . CYS B 1 258 ? -33.655 44.507 -28.256 1.00 51.55  ? 849  CYS B C   1 
ATOM   4055 O  O   . CYS B 1 258 ? -34.236 44.007 -29.219 1.00 52.77  ? 849  CYS B O   1 
ATOM   4056 C  CB  . CYS B 1 258 ? -35.332 44.208 -26.386 1.00 42.61  ? 849  CYS B CB  1 
ATOM   4057 S  SG  . CYS B 1 258 ? -34.385 42.871 -25.609 1.00 44.01  ? 849  CYS B SG  1 
ATOM   4058 N  N   . PRO B 1 259 ? -32.320 44.410 -28.108 1.00 47.39  ? 850  PRO B N   1 
ATOM   4059 C  CA  . PRO B 1 259 ? -31.522 43.708 -29.128 1.00 48.04  ? 850  PRO B CA  1 
ATOM   4060 C  C   . PRO B 1 259 ? -31.908 42.234 -29.209 1.00 50.76  ? 850  PRO B C   1 
ATOM   4061 O  O   . PRO B 1 259 ? -32.272 41.646 -28.184 1.00 48.19  ? 850  PRO B O   1 
ATOM   4062 C  CB  . PRO B 1 259 ? -30.083 43.889 -28.627 1.00 48.85  ? 850  PRO B CB  1 
ATOM   4063 C  CG  . PRO B 1 259 ? -30.130 45.006 -27.649 1.00 51.44  ? 850  PRO B CG  1 
ATOM   4064 C  CD  . PRO B 1 259 ? -31.472 44.912 -27.010 1.00 46.82  ? 850  PRO B CD  1 
ATOM   4065 N  N   . ALA B 1 260 ? -31.886 41.657 -30.426 1.00 48.27  ? 851  ALA B N   1 
ATOM   4066 C  CA  . ALA B 1 260 ? -32.272 40.258 -30.663 1.00 48.28  ? 851  ALA B CA  1 
ATOM   4067 C  C   . ALA B 1 260 ? -31.481 39.261 -29.802 1.00 50.93  ? 851  ALA B C   1 
ATOM   4068 O  O   . ALA B 1 260 ? -32.068 38.336 -29.233 1.00 50.25  ? 851  ALA B O   1 
ATOM   4069 C  CB  . ALA B 1 260 ? -32.146 39.916 -32.137 1.00 50.55  ? 851  ALA B CB  1 
ATOM   4070 N  N   . ALA B 1 261 ? -30.167 39.495 -29.659 1.00 48.20  ? 852  ALA B N   1 
ATOM   4071 C  CA  . ALA B 1 261 ? -29.260 38.678 -28.848 1.00 46.52  ? 852  ALA B CA  1 
ATOM   4072 C  C   . ALA B 1 261 ? -29.679 38.643 -27.371 1.00 46.67  ? 852  ALA B C   1 
ATOM   4073 O  O   . ALA B 1 261 ? -29.569 37.608 -26.702 1.00 43.93  ? 852  ALA B O   1 
ATOM   4074 C  CB  . ALA B 1 261 ? -27.834 39.207 -28.966 1.00 47.30  ? 852  ALA B CB  1 
ATOM   4075 N  N   . LEU B 1 262 ? -30.153 39.785 -26.874 1.00 43.14  ? 853  LEU B N   1 
ATOM   4076 C  CA  . LEU B 1 262 ? -30.595 39.917 -25.500 1.00 41.24  ? 853  LEU B CA  1 
ATOM   4077 C  C   . LEU B 1 262 ? -31.917 39.176 -25.255 1.00 42.59  ? 853  LEU B C   1 
ATOM   4078 O  O   . LEU B 1 262 ? -32.037 38.498 -24.234 1.00 41.67  ? 853  LEU B O   1 
ATOM   4079 C  CB  . LEU B 1 262 ? -30.694 41.388 -25.151 1.00 41.80  ? 853  LEU B CB  1 
ATOM   4080 C  CG  . LEU B 1 262 ? -30.796 41.740 -23.676 1.00 45.45  ? 853  LEU B CG  1 
ATOM   4081 C  CD1 . LEU B 1 262 ? -29.581 41.138 -22.858 1.00 43.02  ? 853  LEU B CD1 1 
ATOM   4082 C  CD2 . LEU B 1 262 ? -30.769 43.219 -23.552 1.00 46.40  ? 853  LEU B CD2 1 
ATOM   4083 N  N   . HIS B 1 263 ? -32.873 39.244 -26.214 1.00 39.41  ? 854  HIS B N   1 
ATOM   4084 C  CA  . HIS B 1 263 ? -34.121 38.494 -26.134 1.00 38.61  ? 854  HIS B CA  1 
ATOM   4085 C  C   . HIS B 1 263 ? -33.818 36.994 -26.271 1.00 41.33  ? 854  HIS B C   1 
ATOM   4086 O  O   . HIS B 1 263 ? -34.457 36.190 -25.594 1.00 40.57  ? 854  HIS B O   1 
ATOM   4087 C  CB  . HIS B 1 263 ? -35.143 38.960 -27.185 1.00 40.70  ? 854  HIS B CB  1 
ATOM   4088 C  CG  . HIS B 1 263 ? -36.435 38.196 -27.122 1.00 43.86  ? 854  HIS B CG  1 
ATOM   4089 N  ND1 . HIS B 1 263 ? -36.896 37.461 -28.202 1.00 45.96  ? 854  HIS B ND1 1 
ATOM   4090 C  CD2 . HIS B 1 263 ? -37.300 38.052 -26.093 1.00 44.45  ? 854  HIS B CD2 1 
ATOM   4091 C  CE1 . HIS B 1 263 ? -38.020 36.904 -27.801 1.00 45.17  ? 854  HIS B CE1 1 
ATOM   4092 N  NE2 . HIS B 1 263 ? -38.304 37.232 -26.538 1.00 44.93  ? 854  HIS B NE2 1 
ATOM   4093 N  N   . GLN B 1 264 ? -32.826 36.615 -27.115 1.00 39.75  ? 855  GLN B N   1 
ATOM   4094 C  CA  . GLN B 1 264 ? -32.417 35.209 -27.254 1.00 40.46  ? 855  GLN B CA  1 
ATOM   4095 C  C   . GLN B 1 264 ? -31.904 34.690 -25.898 1.00 40.96  ? 855  GLN B C   1 
ATOM   4096 O  O   . GLN B 1 264 ? -32.246 33.580 -25.517 1.00 40.83  ? 855  GLN B O   1 
ATOM   4097 C  CB  . GLN B 1 264 ? -31.383 35.006 -28.382 1.00 43.19  ? 855  GLN B CB  1 
ATOM   4098 C  CG  . GLN B 1 264 ? -31.068 33.523 -28.673 1.00 49.76  ? 855  GLN B CG  1 
ATOM   4099 C  CD  . GLN B 1 264 ? -32.292 32.704 -28.980 1.00 56.27  ? 855  GLN B CD  1 
ATOM   4100 O  OE1 . GLN B 1 264 ? -33.044 33.000 -29.902 1.00 55.45  ? 855  GLN B OE1 1 
ATOM   4101 N  NE2 . GLN B 1 264 ? -32.530 31.658 -28.195 1.00 49.27  ? 855  GLN B NE2 1 
ATOM   4102 N  N   . LEU B 1 265 ? -31.167 35.521 -25.149 1.00 37.06  ? 856  LEU B N   1 
ATOM   4103 C  CA  . LEU B 1 265 ? -30.717 35.157 -23.804 1.00 36.39  ? 856  LEU B CA  1 
ATOM   4104 C  C   . LEU B 1 265 ? -31.953 34.926 -22.858 1.00 40.53  ? 856  LEU B C   1 
ATOM   4105 O  O   . LEU B 1 265 ? -31.950 33.966 -22.069 1.00 38.53  ? 856  LEU B O   1 
ATOM   4106 C  CB  . LEU B 1 265 ? -29.723 36.176 -23.234 1.00 34.40  ? 856  LEU B CB  1 
ATOM   4107 C  CG  . LEU B 1 265 ? -29.181 35.904 -21.805 1.00 36.40  ? 856  LEU B CG  1 
ATOM   4108 C  CD1 . LEU B 1 265 ? -28.524 34.535 -21.692 1.00 34.61  ? 856  LEU B CD1 1 
ATOM   4109 C  CD2 . LEU B 1 265 ? -28.226 36.986 -21.388 1.00 36.95  ? 856  LEU B CD2 1 
ATOM   4110 N  N   . MET B 1 266 ? -33.019 35.762 -22.998 1.00 36.23  ? 857  MET B N   1 
ATOM   4111 C  CA  . MET B 1 266 ? -34.267 35.580 -22.230 1.00 35.76  ? 857  MET B CA  1 
ATOM   4112 C  C   . MET B 1 266 ? -34.887 34.218 -22.590 1.00 40.14  ? 857  MET B C   1 
ATOM   4113 O  O   . MET B 1 266 ? -35.268 33.469 -21.687 1.00 40.83  ? 857  MET B O   1 
ATOM   4114 C  CB  . MET B 1 266 ? -35.285 36.688 -22.535 1.00 38.14  ? 857  MET B CB  1 
ATOM   4115 C  CG  . MET B 1 266 ? -34.908 38.035 -21.988 1.00 40.10  ? 857  MET B CG  1 
ATOM   4116 S  SD  . MET B 1 266 ? -36.126 39.276 -22.495 1.00 43.83  ? 857  MET B SD  1 
ATOM   4117 C  CE  . MET B 1 266 ? -35.106 40.730 -22.557 1.00 39.70  ? 857  MET B CE  1 
ATOM   4118 N  N   . LEU B 1 267 ? -34.948 33.886 -23.903 1.00 36.56  ? 858  LEU B N   1 
ATOM   4119 C  CA  . LEU B 1 267 ? -35.483 32.613 -24.392 1.00 38.09  ? 858  LEU B CA  1 
ATOM   4120 C  C   . LEU B 1 267 ? -34.688 31.415 -23.892 1.00 41.50  ? 858  LEU B C   1 
ATOM   4121 O  O   . LEU B 1 267 ? -35.281 30.365 -23.617 1.00 42.32  ? 858  LEU B O   1 
ATOM   4122 C  CB  . LEU B 1 267 ? -35.605 32.581 -25.923 1.00 39.81  ? 858  LEU B CB  1 
ATOM   4123 C  CG  . LEU B 1 267 ? -36.543 33.612 -26.572 1.00 45.20  ? 858  LEU B CG  1 
ATOM   4124 C  CD1 . LEU B 1 267 ? -36.524 33.476 -28.112 1.00 45.63  ? 858  LEU B CD1 1 
ATOM   4125 C  CD2 . LEU B 1 267 ? -37.976 33.479 -26.043 1.00 44.75  ? 858  LEU B CD2 1 
ATOM   4126 N  N   . ASP B 1 268 ? -33.349 31.574 -23.768 1.00 35.57  ? 859  ASP B N   1 
ATOM   4127 C  CA  . ASP B 1 268 ? -32.460 30.534 -23.237 1.00 35.80  ? 859  ASP B CA  1 
ATOM   4128 C  C   . ASP B 1 268 ? -32.765 30.259 -21.756 1.00 39.68  ? 859  ASP B C   1 
ATOM   4129 O  O   . ASP B 1 268 ? -32.729 29.105 -21.343 1.00 39.69  ? 859  ASP B O   1 
ATOM   4130 C  CB  . ASP B 1 268 ? -30.995 30.950 -23.364 1.00 36.49  ? 859  ASP B CB  1 
ATOM   4131 C  CG  . ASP B 1 268 ? -30.507 31.086 -24.796 1.00 42.47  ? 859  ASP B CG  1 
ATOM   4132 O  OD1 . ASP B 1 268 ? -31.212 30.612 -25.721 1.00 44.37  ? 859  ASP B OD1 1 
ATOM   4133 O  OD2 . ASP B 1 268 ? -29.456 31.696 -24.996 1.00 44.13  ? 859  ASP B OD2 1 
ATOM   4134 N  N   . CYS B 1 269 ? -33.047 31.327 -20.970 1.00 35.28  ? 860  CYS B N   1 
ATOM   4135 C  CA  . CYS B 1 269 ? -33.398 31.275 -19.542 1.00 34.37  ? 860  CYS B CA  1 
ATOM   4136 C  C   . CYS B 1 269 ? -34.750 30.593 -19.380 1.00 38.37  ? 860  CYS B C   1 
ATOM   4137 O  O   . CYS B 1 269 ? -35.030 30.014 -18.319 1.00 35.61  ? 860  CYS B O   1 
ATOM   4138 C  CB  . CYS B 1 269 ? -33.424 32.679 -18.927 1.00 33.86  ? 860  CYS B CB  1 
ATOM   4139 S  SG  . CYS B 1 269 ? -31.783 33.454 -18.751 1.00 37.51  ? 860  CYS B SG  1 
ATOM   4140 N  N   . TRP B 1 270 ? -35.609 30.710 -20.419 1.00 36.66  ? 861  TRP B N   1 
ATOM   4141 C  CA  . TRP B 1 270 ? -36.956 30.168 -20.395 1.00 36.56  ? 861  TRP B CA  1 
ATOM   4142 C  C   . TRP B 1 270 ? -37.132 28.839 -21.127 1.00 43.41  ? 861  TRP B C   1 
ATOM   4143 O  O   . TRP B 1 270 ? -38.261 28.495 -21.485 1.00 43.78  ? 861  TRP B O   1 
ATOM   4144 C  CB  . TRP B 1 270 ? -37.997 31.176 -20.889 1.00 34.98  ? 861  TRP B CB  1 
ATOM   4145 C  CG  . TRP B 1 270 ? -37.997 32.526 -20.236 1.00 34.47  ? 861  TRP B CG  1 
ATOM   4146 C  CD1 . TRP B 1 270 ? -37.772 32.810 -18.917 1.00 36.06  ? 861  TRP B CD1 1 
ATOM   4147 C  CD2 . TRP B 1 270 ? -38.375 33.768 -20.860 1.00 34.35  ? 861  TRP B CD2 1 
ATOM   4148 N  NE1 . TRP B 1 270 ? -37.944 34.159 -18.687 1.00 34.69  ? 861  TRP B NE1 1 
ATOM   4149 C  CE2 . TRP B 1 270 ? -38.307 34.772 -19.867 1.00 37.43  ? 861  TRP B CE2 1 
ATOM   4150 C  CE3 . TRP B 1 270 ? -38.715 34.140 -22.180 1.00 35.14  ? 861  TRP B CE3 1 
ATOM   4151 C  CZ2 . TRP B 1 270 ? -38.566 36.122 -20.155 1.00 36.28  ? 861  TRP B CZ2 1 
ATOM   4152 C  CZ3 . TRP B 1 270 ? -38.953 35.473 -22.464 1.00 35.95  ? 861  TRP B CZ3 1 
ATOM   4153 C  CH2 . TRP B 1 270 ? -38.913 36.444 -21.455 1.00 36.12  ? 861  TRP B CH2 1 
ATOM   4154 N  N   . GLN B 1 271 ? -36.061 28.062 -21.303 1.00 41.48  ? 862  GLN B N   1 
ATOM   4155 C  CA  . GLN B 1 271 ? -36.195 26.745 -21.925 1.00 42.86  ? 862  GLN B CA  1 
ATOM   4156 C  C   . GLN B 1 271 ? -37.002 25.823 -21.003 1.00 46.55  ? 862  GLN B C   1 
ATOM   4157 O  O   . GLN B 1 271 ? -36.817 25.866 -19.780 1.00 45.46  ? 862  GLN B O   1 
ATOM   4158 C  CB  . GLN B 1 271 ? -34.811 26.153 -22.247 1.00 44.92  ? 862  GLN B CB  1 
ATOM   4159 C  CG  . GLN B 1 271 ? -34.247 26.724 -23.555 1.00 59.85  ? 862  GLN B CG  1 
ATOM   4160 C  CD  . GLN B 1 271 ? -32.810 26.356 -23.768 1.00 94.65  ? 862  GLN B CD  1 
ATOM   4161 O  OE1 . GLN B 1 271 ? -32.486 25.462 -24.557 1.00 95.54  ? 862  GLN B OE1 1 
ATOM   4162 N  NE2 . GLN B 1 271 ? -31.912 27.063 -23.096 1.00 89.80  ? 862  GLN B NE2 1 
ATOM   4163 N  N   . LYS B 1 272 ? -37.956 25.064 -21.582 1.00 44.00  ? 863  LYS B N   1 
ATOM   4164 C  CA  . LYS B 1 272 ? -38.814 24.123 -20.853 1.00 43.15  ? 863  LYS B CA  1 
ATOM   4165 C  C   . LYS B 1 272 ? -37.952 23.155 -20.022 1.00 46.49  ? 863  LYS B C   1 
ATOM   4166 O  O   . LYS B 1 272 ? -38.181 23.020 -18.828 1.00 44.64  ? 863  LYS B O   1 
ATOM   4167 C  CB  . LYS B 1 272 ? -39.723 23.363 -21.822 1.00 45.10  ? 863  LYS B CB  1 
ATOM   4168 C  CG  . LYS B 1 272 ? -40.811 22.555 -21.147 1.00 56.13  ? 863  LYS B CG  1 
ATOM   4169 C  CD  . LYS B 1 272 ? -41.645 21.818 -22.163 1.00 67.83  ? 863  LYS B CD  1 
ATOM   4170 C  CE  . LYS B 1 272 ? -42.651 20.884 -21.534 1.00 80.18  ? 863  LYS B CE  1 
ATOM   4171 N  NZ  . LYS B 1 272 ? -43.384 20.112 -22.574 1.00 84.78  ? 863  LYS B NZ  1 
ATOM   4172 N  N   . ASP B 1 273 ? -36.938 22.538 -20.646 1.00 45.70  ? 864  ASP B N   1 
ATOM   4173 C  CA  . ASP B 1 273 ? -35.998 21.652 -19.977 1.00 45.81  ? 864  ASP B CA  1 
ATOM   4174 C  C   . ASP B 1 273 ? -35.025 22.511 -19.174 1.00 47.32  ? 864  ASP B C   1 
ATOM   4175 O  O   . ASP B 1 273 ? -34.199 23.222 -19.754 1.00 46.53  ? 864  ASP B O   1 
ATOM   4176 C  CB  . ASP B 1 273 ? -35.244 20.767 -20.993 1.00 48.55  ? 864  ASP B CB  1 
ATOM   4177 C  CG  . ASP B 1 273 ? -34.334 19.690 -20.395 1.00 60.24  ? 864  ASP B CG  1 
ATOM   4178 O  OD1 . ASP B 1 273 ? -34.167 19.660 -19.144 1.00 59.67  ? 864  ASP B OD1 1 
ATOM   4179 O  OD2 . ASP B 1 273 ? -33.797 18.874 -21.173 1.00 69.41  ? 864  ASP B OD2 1 
ATOM   4180 N  N   . ARG B 1 274 ? -35.122 22.418 -17.840 1.00 43.34  ? 865  ARG B N   1 
ATOM   4181 C  CA  . ARG B 1 274 ? -34.282 23.155 -16.899 1.00 42.93  ? 865  ARG B CA  1 
ATOM   4182 C  C   . ARG B 1 274 ? -32.788 22.901 -17.113 1.00 47.28  ? 865  ARG B C   1 
ATOM   4183 O  O   . ARG B 1 274 ? -31.998 23.804 -16.875 1.00 45.98  ? 865  ARG B O   1 
ATOM   4184 C  CB  . ARG B 1 274 ? -34.701 22.897 -15.433 1.00 43.85  ? 865  ARG B CB  1 
ATOM   4185 C  CG  . ARG B 1 274 ? -34.350 21.494 -14.917 1.00 53.86  ? 865  ARG B CG  1 
ATOM   4186 C  CD  . ARG B 1 274 ? -34.867 21.220 -13.521 1.00 65.10  ? 865  ARG B CD  1 
ATOM   4187 N  NE  . ARG B 1 274 ? -34.020 20.271 -12.800 1.00 83.93  ? 865  ARG B NE  1 
ATOM   4188 C  CZ  . ARG B 1 274 ? -34.128 18.947 -12.880 1.00 108.96 ? 865  ARG B CZ  1 
ATOM   4189 N  NH1 . ARG B 1 274 ? -35.048 18.393 -13.664 1.00 100.66 ? 865  ARG B NH1 1 
ATOM   4190 N  NH2 . ARG B 1 274 ? -33.315 18.168 -12.183 1.00 100.35 ? 865  ARG B NH2 1 
ATOM   4191 N  N   . ASN B 1 275 ? -32.413 21.692 -17.593 1.00 45.43  ? 866  ASN B N   1 
ATOM   4192 C  CA  . ASN B 1 275 ? -31.017 21.308 -17.865 1.00 45.66  ? 866  ASN B CA  1 
ATOM   4193 C  C   . ASN B 1 275 ? -30.449 22.025 -19.081 1.00 48.28  ? 866  ASN B C   1 
ATOM   4194 O  O   . ASN B 1 275 ? -29.234 22.135 -19.215 1.00 48.97  ? 866  ASN B O   1 
ATOM   4195 C  CB  . ASN B 1 275 ? -30.885 19.790 -18.041 1.00 49.13  ? 866  ASN B CB  1 
ATOM   4196 C  CG  . ASN B 1 275 ? -31.277 18.988 -16.822 1.00 70.87  ? 866  ASN B CG  1 
ATOM   4197 O  OD1 . ASN B 1 275 ? -30.837 19.260 -15.698 1.00 62.28  ? 866  ASN B OD1 1 
ATOM   4198 N  ND2 . ASN B 1 275 ? -32.085 17.959 -17.030 1.00 63.98  ? 866  ASN B ND2 1 
ATOM   4199 N  N   . SER B 1 276 ? -31.326 22.523 -19.954 1.00 44.05  ? 867  SER B N   1 
ATOM   4200 C  CA  . SER B 1 276 ? -30.942 23.255 -21.159 1.00 43.68  ? 867  SER B CA  1 
ATOM   4201 C  C   . SER B 1 276 ? -30.702 24.749 -20.882 1.00 46.25  ? 867  SER B C   1 
ATOM   4202 O  O   . SER B 1 276 ? -30.110 25.429 -21.714 1.00 48.31  ? 867  SER B O   1 
ATOM   4203 C  CB  . SER B 1 276 ? -31.998 23.064 -22.243 1.00 48.63  ? 867  SER B CB  1 
ATOM   4204 O  OG  . SER B 1 276 ? -32.122 21.689 -22.565 1.00 61.64  ? 867  SER B OG  1 
ATOM   4205 N  N   . ARG B 1 277 ? -31.116 25.249 -19.707 1.00 39.86  ? 868  ARG B N   1 
ATOM   4206 C  CA  . ARG B 1 277 ? -30.950 26.658 -19.347 1.00 37.44  ? 868  ARG B CA  1 
ATOM   4207 C  C   . ARG B 1 277 ? -29.489 26.984 -19.066 1.00 41.29  ? 868  ARG B C   1 
ATOM   4208 O  O   . ARG B 1 277 ? -28.773 26.132 -18.513 1.00 40.57  ? 868  ARG B O   1 
ATOM   4209 C  CB  . ARG B 1 277 ? -31.807 27.025 -18.126 1.00 35.72  ? 868  ARG B CB  1 
ATOM   4210 C  CG  . ARG B 1 277 ? -33.296 26.889 -18.390 1.00 36.00  ? 868  ARG B CG  1 
ATOM   4211 C  CD  . ARG B 1 277 ? -34.139 27.104 -17.158 1.00 40.42  ? 868  ARG B CD  1 
ATOM   4212 N  NE  . ARG B 1 277 ? -35.464 26.537 -17.413 1.00 42.18  ? 868  ARG B NE  1 
ATOM   4213 C  CZ  . ARG B 1 277 ? -36.295 26.102 -16.478 1.00 44.91  ? 868  ARG B CZ  1 
ATOM   4214 N  NH1 . ARG B 1 277 ? -35.977 26.211 -15.191 1.00 34.55  ? 868  ARG B NH1 1 
ATOM   4215 N  NH2 . ARG B 1 277 ? -37.438 25.530 -16.819 1.00 34.49  ? 868  ARG B NH2 1 
ATOM   4216 N  N   . PRO B 1 278 ? -29.016 28.218 -19.382 1.00 36.24  ? 869  PRO B N   1 
ATOM   4217 C  CA  . PRO B 1 278 ? -27.647 28.552 -19.017 1.00 35.96  ? 869  PRO B CA  1 
ATOM   4218 C  C   . PRO B 1 278 ? -27.546 28.692 -17.484 1.00 39.93  ? 869  PRO B C   1 
ATOM   4219 O  O   . PRO B 1 278 ? -28.531 28.977 -16.813 1.00 38.12  ? 869  PRO B O   1 
ATOM   4220 C  CB  . PRO B 1 278 ? -27.401 29.890 -19.728 1.00 36.70  ? 869  PRO B CB  1 
ATOM   4221 C  CG  . PRO B 1 278 ? -28.740 30.502 -19.864 1.00 41.04  ? 869  PRO B CG  1 
ATOM   4222 C  CD  . PRO B 1 278 ? -29.709 29.368 -20.012 1.00 37.52  ? 869  PRO B CD  1 
ATOM   4223 N  N   . ARG B 1 279 ? -26.361 28.447 -16.947 1.00 36.29  ? 870  ARG B N   1 
ATOM   4224 C  CA  . ARG B 1 279 ? -26.063 28.642 -15.536 1.00 34.68  ? 870  ARG B CA  1 
ATOM   4225 C  C   . ARG B 1 279 ? -25.730 30.139 -15.407 1.00 37.54  ? 870  ARG B C   1 
ATOM   4226 O  O   . ARG B 1 279 ? -25.419 30.768 -16.419 1.00 36.48  ? 870  ARG B O   1 
ATOM   4227 C  CB  . ARG B 1 279 ? -24.847 27.774 -15.129 1.00 32.55  ? 870  ARG B CB  1 
ATOM   4228 C  CG  . ARG B 1 279 ? -25.224 26.284 -15.013 1.00 47.81  ? 870  ARG B CG  1 
ATOM   4229 C  CD  . ARG B 1 279 ? -24.147 25.445 -14.372 1.00 66.72  ? 870  ARG B CD  1 
ATOM   4230 N  NE  . ARG B 1 279 ? -24.646 24.103 -14.054 1.00 95.01  ? 870  ARG B NE  1 
ATOM   4231 C  CZ  . ARG B 1 279 ? -23.870 23.049 -13.814 1.00 119.82 ? 870  ARG B CZ  1 
ATOM   4232 N  NH1 . ARG B 1 279 ? -22.546 23.162 -13.863 1.00 114.05 ? 870  ARG B NH1 1 
ATOM   4233 N  NH2 . ARG B 1 279 ? -24.410 21.870 -13.533 1.00 105.06 ? 870  ARG B NH2 1 
ATOM   4234 N  N   . PHE B 1 280 ? -25.788 30.702 -14.183 1.00 32.00  ? 871  PHE B N   1 
ATOM   4235 C  CA  . PHE B 1 280 ? -25.498 32.113 -13.969 1.00 31.11  ? 871  PHE B CA  1 
ATOM   4236 C  C   . PHE B 1 280 ? -24.075 32.530 -14.448 1.00 37.38  ? 871  PHE B C   1 
ATOM   4237 O  O   . PHE B 1 280 ? -23.927 33.655 -14.927 1.00 36.65  ? 871  PHE B O   1 
ATOM   4238 C  CB  . PHE B 1 280 ? -25.772 32.534 -12.522 1.00 31.15  ? 871  PHE B CB  1 
ATOM   4239 C  CG  . PHE B 1 280 ? -27.253 32.748 -12.253 1.00 32.05  ? 871  PHE B CG  1 
ATOM   4240 C  CD1 . PHE B 1 280 ? -27.946 33.780 -12.873 1.00 33.57  ? 871  PHE B CD1 1 
ATOM   4241 C  CD2 . PHE B 1 280 ? -27.948 31.920 -11.366 1.00 32.82  ? 871  PHE B CD2 1 
ATOM   4242 C  CE1 . PHE B 1 280 ? -29.312 33.964 -12.634 1.00 34.01  ? 871  PHE B CE1 1 
ATOM   4243 C  CE2 . PHE B 1 280 ? -29.309 32.135 -11.092 1.00 35.01  ? 871  PHE B CE2 1 
ATOM   4244 C  CZ  . PHE B 1 280 ? -29.982 33.145 -11.741 1.00 32.69  ? 871  PHE B CZ  1 
ATOM   4245 N  N   . ALA B 1 281 ? -23.075 31.607 -14.426 1.00 33.04  ? 872  ALA B N   1 
ATOM   4246 C  CA  . ALA B 1 281 ? -21.713 31.926 -14.883 1.00 33.29  ? 872  ALA B CA  1 
ATOM   4247 C  C   . ALA B 1 281 ? -21.707 32.220 -16.380 1.00 41.04  ? 872  ALA B C   1 
ATOM   4248 O  O   . ALA B 1 281 ? -21.020 33.136 -16.830 1.00 41.51  ? 872  ALA B O   1 
ATOM   4249 C  CB  . ALA B 1 281 ? -20.749 30.789 -14.553 1.00 33.65  ? 872  ALA B CB  1 
ATOM   4250 N  N   . GLU B 1 282 ? -22.519 31.482 -17.140 1.00 39.12  ? 873  GLU B N   1 
ATOM   4251 C  CA  . GLU B 1 282 ? -22.681 31.661 -18.574 1.00 39.72  ? 873  GLU B CA  1 
ATOM   4252 C  C   . GLU B 1 282 ? -23.413 32.948 -18.875 1.00 40.71  ? 873  GLU B C   1 
ATOM   4253 O  O   . GLU B 1 282 ? -23.075 33.638 -19.834 1.00 41.79  ? 873  GLU B O   1 
ATOM   4254 C  CB  . GLU B 1 282 ? -23.477 30.518 -19.188 1.00 41.89  ? 873  GLU B CB  1 
ATOM   4255 C  CG  . GLU B 1 282 ? -22.780 29.175 -19.191 1.00 59.22  ? 873  GLU B CG  1 
ATOM   4256 C  CD  . GLU B 1 282 ? -23.726 28.089 -19.667 1.00 75.04  ? 873  GLU B CD  1 
ATOM   4257 O  OE1 . GLU B 1 282 ? -24.213 27.311 -18.811 1.00 44.74  ? 873  GLU B OE1 1 
ATOM   4258 O  OE2 . GLU B 1 282 ? -24.075 28.104 -20.872 1.00 65.61  ? 873  GLU B OE2 1 
ATOM   4259 N  N   . ILE B 1 283 ? -24.435 33.254 -18.084 1.00 34.55  ? 874  ILE B N   1 
ATOM   4260 C  CA  . ILE B 1 283 ? -25.226 34.478 -18.239 1.00 33.50  ? 874  ILE B CA  1 
ATOM   4261 C  C   . ILE B 1 283 ? -24.295 35.685 -18.122 1.00 36.36  ? 874  ILE B C   1 
ATOM   4262 O  O   . ILE B 1 283 ? -24.284 36.542 -19.008 1.00 35.44  ? 874  ILE B O   1 
ATOM   4263 C  CB  . ILE B 1 283 ? -26.437 34.513 -17.267 1.00 34.29  ? 874  ILE B CB  1 
ATOM   4264 C  CG1 . ILE B 1 283 ? -27.473 33.404 -17.657 1.00 35.25  ? 874  ILE B CG1 1 
ATOM   4265 C  CG2 . ILE B 1 283 ? -27.072 35.888 -17.283 1.00 32.02  ? 874  ILE B CG2 1 
ATOM   4266 C  CD1 . ILE B 1 283 ? -28.485 33.084 -16.629 1.00 32.29  ? 874  ILE B CD1 1 
ATOM   4267 N  N   . VAL B 1 284 ? -23.459 35.695 -17.080 1.00 33.56  ? 875  VAL B N   1 
ATOM   4268 C  CA  . VAL B 1 284 ? -22.475 36.763 -16.870 1.00 34.00  ? 875  VAL B CA  1 
ATOM   4269 C  C   . VAL B 1 284 ? -21.545 36.902 -18.080 1.00 38.58  ? 875  VAL B C   1 
ATOM   4270 O  O   . VAL B 1 284 ? -21.357 38.017 -18.587 1.00 38.54  ? 875  VAL B O   1 
ATOM   4271 C  CB  . VAL B 1 284 ? -21.674 36.551 -15.548 1.00 35.83  ? 875  VAL B CB  1 
ATOM   4272 C  CG1 . VAL B 1 284 ? -20.548 37.575 -15.412 1.00 35.36  ? 875  VAL B CG1 1 
ATOM   4273 C  CG2 . VAL B 1 284 ? -22.604 36.627 -14.346 1.00 34.56  ? 875  VAL B CG2 1 
ATOM   4274 N  N   . ASN B 1 285 ? -20.994 35.765 -18.555 1.00 35.81  ? 876  ASN B N   1 
ATOM   4275 C  CA  . ASN B 1 285 ? -20.070 35.745 -19.696 1.00 37.20  ? 876  ASN B CA  1 
ATOM   4276 C  C   . ASN B 1 285 ? -20.704 36.308 -20.959 1.00 40.40  ? 876  ASN B C   1 
ATOM   4277 O  O   . ASN B 1 285 ? -20.060 37.068 -21.678 1.00 40.55  ? 876  ASN B O   1 
ATOM   4278 C  CB  . ASN B 1 285 ? -19.532 34.342 -19.948 1.00 36.20  ? 876  ASN B CB  1 
ATOM   4279 C  CG  . ASN B 1 285 ? -18.577 33.883 -18.882 1.00 49.14  ? 876  ASN B CG  1 
ATOM   4280 O  OD1 . ASN B 1 285 ? -18.077 34.671 -18.059 1.00 36.13  ? 876  ASN B OD1 1 
ATOM   4281 N  ND2 . ASN B 1 285 ? -18.319 32.581 -18.870 1.00 42.88  ? 876  ASN B ND2 1 
ATOM   4282 N  N   . THR B 1 286 ? -21.957 35.951 -21.200 1.00 37.70  ? 877  THR B N   1 
ATOM   4283 C  CA  . THR B 1 286 ? -22.742 36.400 -22.359 1.00 38.14  ? 877  THR B CA  1 
ATOM   4284 C  C   . THR B 1 286 ? -22.950 37.907 -22.313 1.00 40.48  ? 877  THR B C   1 
ATOM   4285 O  O   . THR B 1 286 ? -22.726 38.563 -23.316 1.00 40.62  ? 877  THR B O   1 
ATOM   4286 C  CB  . THR B 1 286 ? -24.051 35.630 -22.429 1.00 39.41  ? 877  THR B CB  1 
ATOM   4287 O  OG1 . THR B 1 286 ? -23.719 34.246 -22.567 1.00 44.78  ? 877  THR B OG1 1 
ATOM   4288 C  CG2 . THR B 1 286 ? -24.919 36.068 -23.592 1.00 33.67  ? 877  THR B CG2 1 
ATOM   4289 N  N   . LEU B 1 287 ? -23.368 38.440 -21.137 1.00 36.31  ? 878  LEU B N   1 
ATOM   4290 C  CA  . LEU B 1 287 ? -23.562 39.872 -20.921 1.00 35.95  ? 878  LEU B CA  1 
ATOM   4291 C  C   . LEU B 1 287 ? -22.251 40.641 -21.041 1.00 38.62  ? 878  LEU B C   1 
ATOM   4292 O  O   . LEU B 1 287 ? -22.246 41.714 -21.625 1.00 38.83  ? 878  LEU B O   1 
ATOM   4293 C  CB  . LEU B 1 287 ? -24.253 40.146 -19.576 1.00 34.39  ? 878  LEU B CB  1 
ATOM   4294 C  CG  . LEU B 1 287 ? -25.679 39.636 -19.462 1.00 37.88  ? 878  LEU B CG  1 
ATOM   4295 C  CD1 . LEU B 1 287 ? -26.171 39.782 -18.064 1.00 35.67  ? 878  LEU B CD1 1 
ATOM   4296 C  CD2 . LEU B 1 287 ? -26.617 40.329 -20.475 1.00 40.63  ? 878  LEU B CD2 1 
ATOM   4297 N  N   . ASP B 1 288 ? -21.132 40.061 -20.548 1.00 37.26  ? 879  ASP B N   1 
ATOM   4298 C  CA  . ASP B 1 288 ? -19.795 40.637 -20.662 1.00 36.48  ? 879  ASP B CA  1 
ATOM   4299 C  C   . ASP B 1 288 ? -19.349 40.762 -22.116 1.00 41.96  ? 879  ASP B C   1 
ATOM   4300 O  O   . ASP B 1 288 ? -18.733 41.762 -22.471 1.00 40.92  ? 879  ASP B O   1 
ATOM   4301 C  CB  . ASP B 1 288 ? -18.774 39.850 -19.834 1.00 37.93  ? 879  ASP B CB  1 
ATOM   4302 C  CG  . ASP B 1 288 ? -18.801 40.221 -18.353 1.00 42.19  ? 879  ASP B CG  1 
ATOM   4303 O  OD1 . ASP B 1 288 ? -19.462 41.213 -18.004 1.00 41.54  ? 879  ASP B OD1 1 
ATOM   4304 O  OD2 . ASP B 1 288 ? -18.193 39.491 -17.542 1.00 38.25  ? 879  ASP B OD2 1 
ATOM   4305 N  N   . LYS B 1 289 ? -19.703 39.779 -22.964 1.00 41.12  ? 880  LYS B N   1 
ATOM   4306 C  CA  . LYS B 1 289 ? -19.342 39.823 -24.384 1.00 42.92  ? 880  LYS B CA  1 
ATOM   4307 C  C   . LYS B 1 289 ? -20.184 40.877 -25.095 1.00 46.97  ? 880  LYS B C   1 
ATOM   4308 O  O   . LYS B 1 289 ? -19.653 41.587 -25.943 1.00 49.90  ? 880  LYS B O   1 
ATOM   4309 C  CB  . LYS B 1 289 ? -19.512 38.454 -25.070 1.00 45.78  ? 880  LYS B CB  1 
ATOM   4310 C  CG  . LYS B 1 289 ? -18.493 37.406 -24.646 1.00 60.22  ? 880  LYS B CG  1 
ATOM   4311 C  CD  . LYS B 1 289 ? -18.939 36.006 -25.068 1.00 75.86  ? 880  LYS B CD  1 
ATOM   4312 C  CE  . LYS B 1 289 ? -17.991 34.924 -24.612 1.00 94.64  ? 880  LYS B CE  1 
ATOM   4313 N  NZ  . LYS B 1 289 ? -18.599 33.573 -24.740 1.00 109.45 ? 880  LYS B NZ  1 
ATOM   4314 N  N   . MET B 1 290 ? -21.472 41.011 -24.704 1.00 40.48  ? 881  MET B N   1 
ATOM   4315 C  CA  . MET B 1 290 ? -22.404 41.988 -25.282 1.00 40.57  ? 881  MET B CA  1 
ATOM   4316 C  C   . MET B 1 290 ? -21.963 43.411 -25.015 1.00 44.31  ? 881  MET B C   1 
ATOM   4317 O  O   . MET B 1 290 ? -21.996 44.249 -25.916 1.00 45.71  ? 881  MET B O   1 
ATOM   4318 C  CB  . MET B 1 290 ? -23.830 41.768 -24.769 1.00 42.28  ? 881  MET B CB  1 
ATOM   4319 C  CG  . MET B 1 290 ? -24.513 40.604 -25.383 1.00 47.23  ? 881  MET B CG  1 
ATOM   4320 S  SD  . MET B 1 290 ? -26.110 40.407 -24.561 1.00 51.74  ? 881  MET B SD  1 
ATOM   4321 C  CE  . MET B 1 290 ? -26.684 38.940 -25.348 1.00 49.67  ? 881  MET B CE  1 
ATOM   4322 N  N   . ILE B 1 291 ? -21.505 43.668 -23.792 1.00 40.74  ? 882  ILE B N   1 
ATOM   4323 C  CA  . ILE B 1 291 ? -20.981 44.961 -23.332 1.00 41.45  ? 882  ILE B CA  1 
ATOM   4324 C  C   . ILE B 1 291 ? -19.738 45.372 -24.141 1.00 47.64  ? 882  ILE B C   1 
ATOM   4325 O  O   . ILE B 1 291 ? -19.543 46.553 -24.412 1.00 48.66  ? 882  ILE B O   1 
ATOM   4326 C  CB  . ILE B 1 291 ? -20.754 44.914 -21.791 1.00 42.68  ? 882  ILE B CB  1 
ATOM   4327 C  CG1 . ILE B 1 291 ? -22.078 45.050 -21.062 1.00 41.72  ? 882  ILE B CG1 1 
ATOM   4328 C  CG2 . ILE B 1 291 ? -19.744 45.975 -21.290 1.00 43.22  ? 882  ILE B CG2 1 
ATOM   4329 C  CD1 . ILE B 1 291 ? -22.057 44.503 -19.541 1.00 43.12  ? 882  ILE B CD1 1 
ATOM   4330 N  N   . ARG B 1 292 ? -18.933 44.381 -24.554 1.00 45.82  ? 883  ARG B N   1 
ATOM   4331 C  CA  . ARG B 1 292 ? -17.693 44.583 -25.297 1.00 46.66  ? 883  ARG B CA  1 
ATOM   4332 C  C   . ARG B 1 292 ? -17.834 44.478 -26.816 1.00 54.50  ? 883  ARG B C   1 
ATOM   4333 O  O   . ARG B 1 292 ? -16.909 44.845 -27.530 1.00 57.04  ? 883  ARG B O   1 
ATOM   4334 C  CB  . ARG B 1 292 ? -16.617 43.625 -24.767 1.00 44.46  ? 883  ARG B CB  1 
ATOM   4335 C  CG  . ARG B 1 292 ? -16.100 44.091 -23.412 1.00 46.98  ? 883  ARG B CG  1 
ATOM   4336 C  CD  . ARG B 1 292 ? -15.521 42.969 -22.582 1.00 37.63  ? 883  ARG B CD  1 
ATOM   4337 N  NE  . ARG B 1 292 ? -15.113 43.438 -21.249 1.00 43.24  ? 883  ARG B NE  1 
ATOM   4338 C  CZ  . ARG B 1 292 ? -15.958 43.571 -20.235 1.00 47.63  ? 883  ARG B CZ  1 
ATOM   4339 N  NH1 . ARG B 1 292 ? -17.241 43.313 -20.401 1.00 36.79  ? 883  ARG B NH1 1 
ATOM   4340 N  NH2 . ARG B 1 292 ? -15.529 43.990 -19.051 1.00 42.14  ? 883  ARG B NH2 1 
ATOM   4341 N  N   . ASN B 1 293 ? -18.955 43.971 -27.314 1.00 53.62  ? 884  ASN B N   1 
ATOM   4342 C  CA  . ASN B 1 293 ? -19.167 43.822 -28.752 1.00 56.01  ? 884  ASN B CA  1 
ATOM   4343 C  C   . ASN B 1 293 ? -20.397 44.621 -29.203 1.00 60.35  ? 884  ASN B C   1 
ATOM   4344 O  O   . ASN B 1 293 ? -21.499 44.095 -29.182 1.00 57.12  ? 884  ASN B O   1 
ATOM   4345 C  CB  . ASN B 1 293 ? -19.187 42.345 -29.194 1.00 60.04  ? 884  ASN B CB  1 
ATOM   4346 C  CG  . ASN B 1 293 ? -19.516 42.090 -30.660 1.00 97.23  ? 884  ASN B CG  1 
ATOM   4347 O  OD1 . ASN B 1 293 ? -19.188 42.860 -31.583 1.00 103.49 ? 884  ASN B OD1 1 
ATOM   4348 N  ND2 . ASN B 1 293 ? -20.191 40.986 -30.906 1.00 88.75  ? 884  ASN B ND2 1 
ATOM   4349 N  N   . PRO B 1 294 ? -20.194 45.906 -29.607 1.00 61.59  ? 885  PRO B N   1 
ATOM   4350 C  CA  . PRO B 1 294 ? -21.325 46.767 -30.007 1.00 63.56  ? 885  PRO B CA  1 
ATOM   4351 C  C   . PRO B 1 294 ? -22.260 46.217 -31.084 1.00 69.22  ? 885  PRO B C   1 
ATOM   4352 O  O   . PRO B 1 294 ? -23.458 46.508 -31.031 1.00 68.29  ? 885  PRO B O   1 
ATOM   4353 C  CB  . PRO B 1 294 ? -20.642 48.069 -30.459 1.00 66.91  ? 885  PRO B CB  1 
ATOM   4354 C  CG  . PRO B 1 294 ? -19.202 47.724 -30.658 1.00 70.73  ? 885  PRO B CG  1 
ATOM   4355 C  CD  . PRO B 1 294 ? -18.927 46.661 -29.648 1.00 64.07  ? 885  PRO B CD  1 
ATOM   4356 N  N   . ALA B 1 295 ? -21.733 45.409 -32.025 1.00 67.98  ? 886  ALA B N   1 
ATOM   4357 C  CA  . ALA B 1 295 ? -22.524 44.797 -33.096 1.00 70.50  ? 886  ALA B CA  1 
ATOM   4358 C  C   . ALA B 1 295 ? -23.599 43.865 -32.527 1.00 76.98  ? 886  ALA B C   1 
ATOM   4359 O  O   . ALA B 1 295 ? -24.721 43.835 -33.043 1.00 78.49  ? 886  ALA B O   1 
ATOM   4360 C  CB  . ALA B 1 295 ? -21.615 44.026 -34.042 1.00 72.81  ? 886  ALA B CB  1 
ATOM   4361 N  N   . SER B 1 296 ? -23.268 43.141 -31.438 1.00 72.48  ? 887  SER B N   1 
ATOM   4362 C  CA  . SER B 1 296 ? -24.179 42.195 -30.792 1.00 71.19  ? 887  SER B CA  1 
ATOM   4363 C  C   . SER B 1 296 ? -25.419 42.848 -30.163 1.00 75.62  ? 887  SER B C   1 
ATOM   4364 O  O   . SER B 1 296 ? -26.421 42.160 -29.983 1.00 75.36  ? 887  SER B O   1 
ATOM   4365 C  CB  . SER B 1 296 ? -23.442 41.329 -29.774 1.00 71.50  ? 887  SER B CB  1 
ATOM   4366 O  OG  . SER B 1 296 ? -23.214 42.033 -28.568 1.00 74.62  ? 887  SER B OG  1 
ATOM   4367 N  N   . LEU B 1 297 ? -25.356 44.154 -29.832 1.00 71.24  ? 888  LEU B N   1 
ATOM   4368 C  CA  . LEU B 1 297 ? -26.468 44.898 -29.249 1.00 70.34  ? 888  LEU B CA  1 
ATOM   4369 C  C   . LEU B 1 297 ? -27.185 45.852 -30.241 1.00 81.74  ? 888  LEU B C   1 
ATOM   4370 O  O   . LEU B 1 297 ? -27.811 46.820 -29.800 1.00 81.64  ? 888  LEU B O   1 
ATOM   4371 C  CB  . LEU B 1 297 ? -26.039 45.640 -27.971 1.00 68.46  ? 888  LEU B CB  1 
ATOM   4372 C  CG  . LEU B 1 297 ? -25.622 44.762 -26.763 1.00 70.65  ? 888  LEU B CG  1 
ATOM   4373 C  CD1 . LEU B 1 297 ? -25.151 45.603 -25.637 1.00 69.18  ? 888  LEU B CD1 1 
ATOM   4374 C  CD2 . LEU B 1 297 ? -26.763 43.831 -26.264 1.00 69.85  ? 888  LEU B CD2 1 
ATOM   4375 N  N   . LYS B 1 298 ? -27.237 45.492 -31.545 1.00 83.10  ? 889  LYS B N   1 
ATOM   4376 C  CA  . LYS B 1 298 ? -27.954 46.263 -32.574 1.00 85.79  ? 889  LYS B CA  1 
ATOM   4377 C  C   . LYS B 1 298 ? -29.499 46.183 -32.397 1.00 91.20  ? 889  LYS B C   1 
ATOM   4378 O  O   . LYS B 1 298 ? -30.033 45.153 -31.965 1.00 89.55  ? 889  LYS B O   1 
ATOM   4379 C  CB  . LYS B 1 298 ? -27.536 45.819 -33.992 1.00 90.02  ? 889  LYS B CB  1 
ATOM   4380 N  N   . THR B 1 299 ? -30.195 47.285 -32.756 1.00 90.21  ? 890  THR B N   1 
ATOM   4381 C  CA  . THR B 1 299 ? -31.652 47.488 -32.677 1.00 121.05 ? 890  THR B CA  1 
ATOM   4382 C  C   . THR B 1 299 ? -32.473 46.374 -33.334 1.00 146.06 ? 890  THR B C   1 
ATOM   4383 O  O   . THR B 1 299 ? -33.585 46.083 -32.890 1.00 105.46 ? 890  THR B O   1 
ATOM   4384 C  CB  . THR B 1 299 ? -32.034 48.863 -33.257 1.00 130.00 ? 890  THR B CB  1 
ATOM   4385 O  OG1 . THR B 1 299 ? -31.494 48.991 -34.575 1.00 130.64 ? 890  THR B OG1 1 
ATOM   4386 C  CG2 . THR B 1 299 ? -31.573 50.027 -32.381 1.00 127.55 ? 890  THR B CG2 1 
HETATM 4387 C  C1  . 7O3 C 2 .   ? 0.312   47.834 -11.209 1.00 46.90  ? 901  7O3 A C1  1 
HETATM 4388 C  C2  . 7O3 C 2 .   ? -1.101  47.829 -11.336 1.00 47.56  ? 901  7O3 A C2  1 
HETATM 4389 C  C3  . 7O3 C 2 .   ? -1.820  48.989 -10.939 1.00 46.32  ? 901  7O3 A C3  1 
HETATM 4390 C  C7  . 7O3 C 2 .   ? 1.952   53.179 -8.897  1.00 58.58  ? 901  7O3 A C7  1 
HETATM 4391 C  C8  . 7O3 C 2 .   ? -3.794  47.950 -11.428 1.00 45.95  ? 901  7O3 A C8  1 
HETATM 4392 C  C9  . 7O3 C 2 .   ? -1.904  46.726 -11.809 1.00 44.94  ? 901  7O3 A C9  1 
HETATM 4393 C  C10 . 7O3 C 2 .   ? -1.786  44.326 -12.643 1.00 45.66  ? 901  7O3 A C10 1 
HETATM 4394 C  C11 . 7O3 C 2 .   ? -1.700  43.203 -11.819 1.00 44.02  ? 901  7O3 A C11 1 
HETATM 4395 C  C12 . 7O3 C 2 .   ? -2.124  41.958 -12.276 1.00 44.38  ? 901  7O3 A C12 1 
HETATM 4396 C  C13 . 7O3 C 2 .   ? -2.666  41.823 -13.549 1.00 40.67  ? 901  7O3 A C13 1 
HETATM 4397 C  C14 . 7O3 C 2 .   ? -2.715  42.915 -14.394 1.00 40.47  ? 901  7O3 A C14 1 
HETATM 4398 C  C15 . 7O3 C 2 .   ? -2.285  44.157 -13.943 1.00 44.63  ? 901  7O3 A C15 1 
HETATM 4399 CL CL1 . 7O3 C 2 .   ? -2.356  45.510 -15.026 1.00 45.53  ? 901  7O3 A CL1 1 
HETATM 4400 O  O1  . 7O3 C 2 .   ? -2.056  40.891 -11.429 1.00 46.34  ? 901  7O3 A O1  1 
HETATM 4401 N  N3  . 7O3 C 2 .   ? -1.294  45.584 -12.228 1.00 46.16  ? 901  7O3 A N3  1 
HETATM 4402 N  N2  . 7O3 C 2 .   ? -3.240  46.807 -11.863 1.00 46.35  ? 901  7O3 A N2  1 
HETATM 4403 N  N1  . 7O3 C 2 .   ? -3.188  49.055 -10.987 1.00 45.42  ? 901  7O3 A N1  1 
HETATM 4404 C  C4  . 7O3 C 2 .   ? -1.111  50.093 -10.407 1.00 47.00  ? 901  7O3 A C4  1 
HETATM 4405 C  C5  . 7O3 C 2 .   ? 0.270   50.081 -10.348 1.00 49.19  ? 901  7O3 A C5  1 
HETATM 4406 C  C   . 7O3 C 2 .   ? 0.966   48.932 -10.736 1.00 47.52  ? 901  7O3 A C   1 
HETATM 4407 N  N   . 7O3 C 2 .   ? 1.106   51.105 -9.813  1.00 50.79  ? 901  7O3 A N   1 
HETATM 4408 C  C6  . 7O3 C 2 .   ? 0.859   52.430 -9.637  1.00 58.56  ? 901  7O3 A C6  1 
HETATM 4409 O  O   . 7O3 C 2 .   ? -0.154  53.022 -10.026 1.00 60.78  ? 901  7O3 A O   1 
HETATM 4410 CL CL  . 7O3 C 2 .   ? 3.030   52.174 -7.914  0.10 57.51  ? 901  7O3 A CL  1 
HETATM 4411 S  S   . SO4 D 3 .   ? -17.000 46.274 7.539   1.00 115.91 ? 902  SO4 A S   1 
HETATM 4412 O  O1  . SO4 D 3 .   ? -15.979 47.111 6.903   1.00 116.91 ? 902  SO4 A O1  1 
HETATM 4413 O  O2  . SO4 D 3 .   ? -17.449 45.256 6.581   1.00 115.68 ? 902  SO4 A O2  1 
HETATM 4414 O  O3  . SO4 D 3 .   ? -16.418 45.632 8.733   1.00 113.01 ? 902  SO4 A O3  1 
HETATM 4415 O  O4  . SO4 D 3 .   ? -18.148 47.114 7.908   1.00 115.46 ? 902  SO4 A O4  1 
HETATM 4416 C  C1  . 7O3 E 2 .   ? -35.662 49.517 1.206   1.00 52.34  ? 901  7O3 B C1  1 
HETATM 4417 C  C2  . 7O3 E 2 .   ? -34.249 49.404 1.307   1.00 51.82  ? 901  7O3 B C2  1 
HETATM 4418 C  C3  . 7O3 E 2 .   ? -33.449 50.450 0.770   1.00 51.96  ? 901  7O3 B C3  1 
HETATM 4419 C  C7  . 7O3 E 2 .   ? -36.817 54.768 -1.664  1.00 56.35  ? 901  7O3 B C7  1 
HETATM 4420 C  C8  . 7O3 E 2 .   ? -31.551 49.359 1.420   1.00 51.41  ? 901  7O3 B C8  1 
HETATM 4421 C  C9  . 7O3 E 2 .   ? -33.521 48.322 1.940   1.00 51.74  ? 901  7O3 B C9  1 
HETATM 4422 C  C10 . 7O3 E 2 .   ? -33.754 46.008 2.940   1.00 47.84  ? 901  7O3 B C10 1 
HETATM 4423 C  C11 . 7O3 E 2 .   ? -33.880 44.824 2.206   1.00 47.55  ? 901  7O3 B C11 1 
HETATM 4424 C  C12 . 7O3 E 2 .   ? -33.453 43.614 2.746   1.00 46.50  ? 901  7O3 B C12 1 
HETATM 4425 C  C13 . 7O3 E 2 .   ? -32.900 43.566 4.021   1.00 45.07  ? 901  7O3 B C13 1 
HETATM 4426 C  C14 . 7O3 E 2 .   ? -32.769 44.729 4.758   1.00 44.91  ? 901  7O3 B C14 1 
HETATM 4427 C  C15 . 7O3 E 2 .   ? -33.189 45.935 4.223   1.00 46.91  ? 901  7O3 B C15 1 
HETATM 4428 CL CL1 . 7O3 E 2 .   ? -33.106 47.357 5.212   1.00 49.03  ? 901  7O3 B CL1 1 
HETATM 4429 O  O1  . 7O3 E 2 .   ? -33.537 42.474 1.998   1.00 48.61  ? 901  7O3 B O1  1 
HETATM 4430 N  N3  . 7O3 E 2 .   ? -34.204 47.246 2.439   1.00 49.53  ? 901  7O3 B N3  1 
HETATM 4431 N  N2  . 7O3 E 2 .   ? -32.179 48.309 1.974   1.00 51.92  ? 901  7O3 B N2  1 
HETATM 4432 N  N1  . 7O3 E 2 .   ? -32.080 50.451 0.866   1.00 49.13  ? 901  7O3 B N1  1 
HETATM 4433 C  C4  . 7O3 E 2 .   ? -34.080 51.561 0.158   1.00 53.00  ? 901  7O3 B C4  1 
HETATM 4434 C  C5  . 7O3 E 2 .   ? -35.459 51.644 0.091   1.00 54.16  ? 901  7O3 B C5  1 
HETATM 4435 C  C   . 7O3 E 2 .   ? -36.236 50.594 0.592   1.00 51.82  ? 901  7O3 B C   1 
HETATM 4436 N  N   . 7O3 E 2 .   ? -36.172 52.670 -0.599  1.00 57.89  ? 901  7O3 B N   1 
HETATM 4437 C  C6  . 7O3 E 2 .   ? -35.820 53.963 -0.851  1.00 59.11  ? 901  7O3 B C6  1 
HETATM 4438 O  O   . 7O3 E 2 .   ? -34.792 54.506 -0.442  1.00 58.92  ? 901  7O3 B O   1 
HETATM 4439 CL CL  . 7O3 E 2 .   ? -37.580 53.970 -3.044  0.10 54.32  ? 901  7O3 B CL  1 
HETATM 4440 S  S   . SO4 F 3 .   ? -14.346 49.419 -6.334  1.00 103.03 ? 902  SO4 B S   1 
HETATM 4441 O  O1  . SO4 F 3 .   ? -13.651 50.618 -6.827  1.00 103.99 ? 902  SO4 B O1  1 
HETATM 4442 O  O2  . SO4 F 3 .   ? -14.033 48.310 -7.230  1.00 103.27 ? 902  SO4 B O2  1 
HETATM 4443 O  O3  . SO4 F 3 .   ? -13.920 49.132 -4.944  1.00 100.26 ? 902  SO4 B O3  1 
HETATM 4444 O  O4  . SO4 F 3 .   ? -15.789 49.629 -6.379  1.00 102.97 ? 902  SO4 B O4  1 
HETATM 4445 O  O   . HOH G 4 .   ? -16.719 33.057 -0.773  1.00 42.39  ? 1001 HOH A O   1 
HETATM 4446 O  O   . HOH G 4 .   ? 7.270   32.895 6.997   1.00 45.42  ? 1002 HOH A O   1 
HETATM 4447 O  O   . HOH G 4 .   ? -12.519 50.255 -13.243 1.00 43.84  ? 1003 HOH A O   1 
HETATM 4448 O  O   . HOH G 4 .   ? -10.378 51.796 -13.144 1.00 40.07  ? 1004 HOH A O   1 
HETATM 4449 O  O   . HOH G 4 .   ? -9.279  41.490 -29.218 1.00 47.72  ? 1005 HOH A O   1 
HETATM 4450 O  O   . HOH G 4 .   ? 5.669   42.048 0.245   1.00 46.19  ? 1006 HOH A O   1 
HETATM 4451 O  O   . HOH G 4 .   ? -12.036 52.682 2.208   1.00 54.80  ? 1007 HOH A O   1 
HETATM 4452 O  O   . HOH G 4 .   ? -5.538  44.163 21.465  1.00 61.51  ? 1008 HOH A O   1 
HETATM 4453 O  O   . HOH G 4 .   ? -18.522 35.188 -8.061  1.00 36.61  ? 1009 HOH A O   1 
HETATM 4454 O  O   . HOH G 4 .   ? -0.667  54.757 13.187  1.00 50.37  ? 1010 HOH A O   1 
HETATM 4455 O  O   . HOH G 4 .   ? -15.805 40.070 -25.110 1.00 43.34  ? 1011 HOH A O   1 
HETATM 4456 O  O   . HOH G 4 .   ? 1.040   37.040 -11.955 1.00 52.81  ? 1012 HOH A O   1 
HETATM 4457 O  O   . HOH G 4 .   ? 7.270   57.221 4.669   1.00 47.74  ? 1013 HOH A O   1 
HETATM 4458 O  O   . HOH G 4 .   ? 7.012   31.962 -18.995 1.00 62.01  ? 1014 HOH A O   1 
HETATM 4459 O  O   . HOH G 4 .   ? -6.501  29.687 -0.759  1.00 38.24  ? 1015 HOH A O   1 
HETATM 4460 O  O   . HOH G 4 .   ? -11.887 33.037 -17.018 1.00 62.44  ? 1016 HOH A O   1 
HETATM 4461 O  O   . HOH G 4 .   ? -12.416 46.938 5.329   1.00 46.97  ? 1017 HOH A O   1 
HETATM 4462 O  O   . HOH G 4 .   ? -7.213  37.872 18.140  1.00 59.59  ? 1018 HOH A O   1 
HETATM 4463 O  O   . HOH G 4 .   ? -16.920 35.082 -10.699 1.00 38.96  ? 1019 HOH A O   1 
HETATM 4464 O  O   . HOH G 4 .   ? -9.007  51.251 5.694   1.00 37.10  ? 1020 HOH A O   1 
HETATM 4465 O  O   . HOH G 4 .   ? -18.360 38.741 9.100   1.00 44.67  ? 1021 HOH A O   1 
HETATM 4466 O  O   . HOH G 4 .   ? -11.400 28.996 2.849   1.00 50.98  ? 1022 HOH A O   1 
HETATM 4467 O  O   . HOH G 4 .   ? 8.715   30.982 5.829   1.00 53.84  ? 1023 HOH A O   1 
HETATM 4468 O  O   . HOH G 4 .   ? 3.488   55.038 19.637  1.00 59.14  ? 1024 HOH A O   1 
HETATM 4469 O  O   . HOH G 4 .   ? -13.169 59.354 -0.450  1.00 49.21  ? 1025 HOH A O   1 
HETATM 4470 O  O   . HOH G 4 .   ? -12.362 44.509 -7.762  1.00 31.64  ? 1026 HOH A O   1 
HETATM 4471 O  O   . HOH G 4 .   ? -10.501 35.509 -18.503 1.00 48.91  ? 1027 HOH A O   1 
HETATM 4472 O  O   . HOH G 4 .   ? 7.056   25.918 14.239  1.00 66.92  ? 1028 HOH A O   1 
HETATM 4473 O  O   . HOH G 4 .   ? -14.621 42.181 -10.301 1.00 38.30  ? 1029 HOH A O   1 
HETATM 4474 O  O   . HOH G 4 .   ? -20.094 45.827 6.335   1.00 60.85  ? 1030 HOH A O   1 
HETATM 4475 O  O   . HOH G 4 .   ? -17.614 30.304 4.584   1.00 64.66  ? 1031 HOH A O   1 
HETATM 4476 O  O   . HOH G 4 .   ? -9.066  44.238 -31.933 1.00 60.16  ? 1032 HOH A O   1 
HETATM 4477 O  O   . HOH G 4 .   ? -17.523 43.352 18.097  1.00 47.92  ? 1033 HOH A O   1 
HETATM 4478 O  O   . HOH G 4 .   ? -10.975 39.372 -11.161 1.00 39.08  ? 1034 HOH A O   1 
HETATM 4479 O  O   . HOH G 4 .   ? -7.439  35.215 17.982  1.00 71.62  ? 1035 HOH A O   1 
HETATM 4480 O  O   . HOH G 4 .   ? 7.029   44.558 3.294   1.00 46.81  ? 1036 HOH A O   1 
HETATM 4481 O  O   . HOH G 4 .   ? -12.025 49.098 16.738  1.00 54.68  ? 1037 HOH A O   1 
HETATM 4482 O  O   . HOH G 4 .   ? -19.732 37.570 -11.724 1.00 34.70  ? 1038 HOH A O   1 
HETATM 4483 O  O   . HOH G 4 .   ? -9.545  49.717 3.459   1.00 40.09  ? 1039 HOH A O   1 
HETATM 4484 O  O   . HOH G 4 .   ? -17.546 53.437 -17.628 1.00 45.81  ? 1040 HOH A O   1 
HETATM 4485 O  O   . HOH G 4 .   ? -13.054 30.363 4.420   1.00 44.80  ? 1041 HOH A O   1 
HETATM 4486 O  O   . HOH G 4 .   ? 6.432   46.466 -4.387  1.00 49.15  ? 1042 HOH A O   1 
HETATM 4487 O  O   . HOH G 4 .   ? -15.624 48.342 -14.662 1.00 63.38  ? 1043 HOH A O   1 
HETATM 4488 O  O   . HOH G 4 .   ? 0.251   55.486 -11.146 1.00 62.77  ? 1044 HOH A O   1 
HETATM 4489 O  O   . HOH G 4 .   ? -0.381  23.441 3.475   1.00 57.36  ? 1045 HOH A O   1 
HETATM 4490 O  O   . HOH G 4 .   ? 0.187   37.634 -16.629 1.00 48.03  ? 1046 HOH A O   1 
HETATM 4491 O  O   . HOH G 4 .   ? -6.728  25.323 9.090   1.00 47.84  ? 1047 HOH A O   1 
HETATM 4492 O  O   . HOH G 4 .   ? 0.199   28.796 -0.181  1.00 40.12  ? 1048 HOH A O   1 
HETATM 4493 O  O   . HOH G 4 .   ? -18.765 35.751 2.233   1.00 48.23  ? 1049 HOH A O   1 
HETATM 4494 O  O   . HOH G 4 .   ? 2.178   29.725 1.797   1.00 43.10  ? 1050 HOH A O   1 
HETATM 4495 O  O   . HOH G 4 .   ? 2.264   34.993 -8.635  1.00 54.94  ? 1051 HOH A O   1 
HETATM 4496 O  O   . HOH G 4 .   ? -0.781  33.662 -7.563  1.00 37.36  ? 1052 HOH A O   1 
HETATM 4497 O  O   . HOH G 4 .   ? -12.487 46.583 1.451   1.00 34.79  ? 1053 HOH A O   1 
HETATM 4498 O  O   . HOH G 4 .   ? 9.584   43.565 -17.348 1.00 75.22  ? 1054 HOH A O   1 
HETATM 4499 O  O   . HOH G 4 .   ? 6.550   35.293 -7.716  1.00 64.85  ? 1055 HOH A O   1 
HETATM 4500 O  O   . HOH G 4 .   ? -11.096 35.525 -26.718 1.00 50.25  ? 1056 HOH A O   1 
HETATM 4501 O  O   . HOH G 4 .   ? -6.971  23.711 0.712   1.00 47.55  ? 1057 HOH A O   1 
HETATM 4502 O  O   . HOH G 4 .   ? -0.247  55.501 -26.989 1.00 62.32  ? 1058 HOH A O   1 
HETATM 4503 O  O   . HOH G 4 .   ? -11.448 50.326 8.796   1.00 40.94  ? 1059 HOH A O   1 
HETATM 4504 O  O   . HOH G 4 .   ? 0.536   32.451 -0.415  1.00 38.07  ? 1060 HOH A O   1 
HETATM 4505 O  O   . HOH G 4 .   ? -11.412 55.804 -14.069 1.00 53.34  ? 1061 HOH A O   1 
HETATM 4506 O  O   . HOH G 4 .   ? 9.546   30.878 -20.339 1.00 58.75  ? 1062 HOH A O   1 
HETATM 4507 O  O   . HOH G 4 .   ? -15.210 52.528 -20.933 1.00 50.81  ? 1063 HOH A O   1 
HETATM 4508 O  O   . HOH G 4 .   ? 6.275   48.801 -5.782  1.00 58.23  ? 1064 HOH A O   1 
HETATM 4509 O  O   . HOH G 4 .   ? -16.248 42.219 -13.488 1.00 63.46  ? 1065 HOH A O   1 
HETATM 4510 O  O   . HOH G 4 .   ? 10.371  30.339 -23.046 1.00 51.92  ? 1066 HOH A O   1 
HETATM 4511 O  O   . HOH G 4 .   ? 0.534   43.006 -8.662  1.00 49.71  ? 1067 HOH A O   1 
HETATM 4512 O  O   . HOH G 4 .   ? -6.420  27.724 7.447   1.00 45.62  ? 1068 HOH A O   1 
HETATM 4513 O  O   . HOH G 4 .   ? -13.885 43.960 2.351   1.00 54.35  ? 1069 HOH A O   1 
HETATM 4514 O  O   . HOH G 4 .   ? 3.085   51.708 -4.398  1.00 49.59  ? 1070 HOH A O   1 
HETATM 4515 O  O   . HOH G 4 .   ? -15.515 37.381 0.835   1.00 33.41  ? 1071 HOH A O   1 
HETATM 4516 O  O   . HOH G 4 .   ? 3.117   26.631 16.286  1.00 67.14  ? 1072 HOH A O   1 
HETATM 4517 O  O   . HOH G 4 .   ? 3.671   30.717 -0.188  1.00 58.18  ? 1073 HOH A O   1 
HETATM 4518 O  O   . HOH G 4 .   ? -2.624  59.990 -16.098 1.00 77.78  ? 1074 HOH A O   1 
HETATM 4519 O  O   . HOH G 4 .   ? 5.169   26.870 -9.450  1.00 52.57  ? 1075 HOH A O   1 
HETATM 4520 O  O   . HOH G 4 .   ? -12.703 40.696 -9.068  1.00 35.38  ? 1076 HOH A O   1 
HETATM 4521 O  O   . HOH G 4 .   ? -16.845 54.382 -27.783 1.00 57.74  ? 1077 HOH A O   1 
HETATM 4522 O  O   . HOH G 4 .   ? 6.692   34.431 11.908  1.00 48.28  ? 1078 HOH A O   1 
HETATM 4523 O  O   . HOH G 4 .   ? -9.363  29.328 4.543   1.00 41.87  ? 1079 HOH A O   1 
HETATM 4524 O  O   . HOH G 4 .   ? 2.658   31.151 16.009  1.00 56.09  ? 1080 HOH A O   1 
HETATM 4525 O  O   . HOH G 4 .   ? 3.364   42.397 -7.882  1.00 59.95  ? 1081 HOH A O   1 
HETATM 4526 O  O   . HOH G 4 .   ? -10.102 54.624 -6.150  1.00 63.75  ? 1082 HOH A O   1 
HETATM 4527 O  O   . HOH G 4 .   ? 4.618   59.717 6.296   1.00 45.94  ? 1083 HOH A O   1 
HETATM 4528 O  O   . HOH G 4 .   ? -15.997 39.093 -13.418 1.00 55.39  ? 1084 HOH A O   1 
HETATM 4529 O  O   . HOH G 4 .   ? -4.796  57.898 -1.961  1.00 45.18  ? 1085 HOH A O   1 
HETATM 4530 O  O   . HOH G 4 .   ? 8.114   52.105 6.848   1.00 59.23  ? 1086 HOH A O   1 
HETATM 4531 O  O   . HOH G 4 .   ? -12.904 40.600 -12.705 1.00 37.73  ? 1087 HOH A O   1 
HETATM 4532 O  O   . HOH G 4 .   ? 6.141   36.417 -30.441 1.00 54.16  ? 1088 HOH A O   1 
HETATM 4533 O  O   . HOH G 4 .   ? -14.474 36.708 -17.554 1.00 40.18  ? 1089 HOH A O   1 
HETATM 4534 O  O   . HOH G 4 .   ? -16.822 35.268 7.097   1.00 51.00  ? 1090 HOH A O   1 
HETATM 4535 O  O   . HOH G 4 .   ? -12.068 39.869 17.348  1.00 62.12  ? 1091 HOH A O   1 
HETATM 4536 O  O   . HOH G 4 .   ? -14.810 44.369 -8.844  1.00 43.73  ? 1092 HOH A O   1 
HETATM 4537 O  O   . HOH G 4 .   ? -19.388 43.012 -9.746  1.00 64.05  ? 1093 HOH A O   1 
HETATM 4538 O  O   . HOH G 4 .   ? -2.278  47.744 -31.207 1.00 50.25  ? 1094 HOH A O   1 
HETATM 4539 O  O   . HOH G 4 .   ? 7.880   44.915 -26.691 1.00 38.40  ? 1095 HOH A O   1 
HETATM 4540 O  O   . HOH G 4 .   ? 5.165   44.917 -6.375  1.00 55.82  ? 1096 HOH A O   1 
HETATM 4541 O  O   . HOH G 4 .   ? -14.256 33.722 -20.316 1.00 45.45  ? 1097 HOH A O   1 
HETATM 4542 O  O   . HOH G 4 .   ? -1.820  38.116 -30.623 1.00 72.11  ? 1098 HOH A O   1 
HETATM 4543 O  O   . HOH G 4 .   ? -17.208 41.682 -3.164  1.00 33.57  ? 1099 HOH A O   1 
HETATM 4544 O  O   . HOH G 4 .   ? -9.592  54.599 -24.973 1.00 56.12  ? 1100 HOH A O   1 
HETATM 4545 O  O   . HOH G 4 .   ? -9.442  46.776 1.873   1.00 34.63  ? 1101 HOH A O   1 
HETATM 4546 O  O   . HOH G 4 .   ? -15.060 44.465 -15.675 1.00 56.31  ? 1102 HOH A O   1 
HETATM 4547 O  O   . HOH G 4 .   ? -12.521 59.105 -3.768  1.00 56.67  ? 1103 HOH A O   1 
HETATM 4548 O  O   . HOH G 4 .   ? -20.031 55.118 -27.936 1.00 67.78  ? 1104 HOH A O   1 
HETATM 4549 O  O   . HOH G 4 .   ? -7.556  54.104 -7.628  1.00 48.63  ? 1105 HOH A O   1 
HETATM 4550 O  O   . HOH G 4 .   ? 10.607  41.071 -18.581 1.00 67.63  ? 1106 HOH A O   1 
HETATM 4551 O  O   . HOH G 4 .   ? 6.532   55.525 -20.024 1.00 59.30  ? 1107 HOH A O   1 
HETATM 4552 O  O   . HOH G 4 .   ? -12.619 37.003 -19.541 1.00 42.34  ? 1108 HOH A O   1 
HETATM 4553 O  O   . HOH G 4 .   ? -15.820 32.933 13.297  1.00 54.26  ? 1109 HOH A O   1 
HETATM 4554 O  O   . HOH G 4 .   ? 1.033   40.218 -29.361 1.00 44.30  ? 1110 HOH A O   1 
HETATM 4555 O  O   . HOH G 4 .   ? 1.103   56.429 -3.958  1.00 54.17  ? 1111 HOH A O   1 
HETATM 4556 O  O   . HOH G 4 .   ? -9.366  28.047 14.553  1.00 75.12  ? 1112 HOH A O   1 
HETATM 4557 O  O   . HOH G 4 .   ? -9.752  30.944 -21.335 1.00 68.26  ? 1113 HOH A O   1 
HETATM 4558 O  O   . HOH G 4 .   ? 3.795   40.562 -17.182 1.00 59.94  ? 1114 HOH A O   1 
HETATM 4559 O  O   . HOH G 4 .   ? -4.722  26.017 -12.006 1.00 61.22  ? 1115 HOH A O   1 
HETATM 4560 O  O   . HOH G 4 .   ? -14.333 34.816 14.898  1.00 62.96  ? 1116 HOH A O   1 
HETATM 4561 O  O   . HOH G 4 .   ? 5.275   38.223 -7.873  1.00 70.18  ? 1117 HOH A O   1 
HETATM 4562 O  O   . HOH G 4 .   ? 2.512   57.633 -1.936  1.00 56.27  ? 1118 HOH A O   1 
HETATM 4563 O  O   . HOH G 4 .   ? 1.468   44.688 -10.951 1.00 48.94  ? 1119 HOH A O   1 
HETATM 4564 O  O   . HOH G 4 .   ? -1.333  18.729 -7.527  1.00 54.49  ? 1120 HOH A O   1 
HETATM 4565 O  O   . HOH G 4 .   ? -0.515  31.122 20.223  1.00 63.55  ? 1121 HOH A O   1 
HETATM 4566 O  O   . HOH G 4 .   ? -14.089 52.796 -0.331  1.00 65.67  ? 1122 HOH A O   1 
HETATM 4567 O  O   . HOH G 4 .   ? -10.112 53.391 -10.891 1.00 76.78  ? 1123 HOH A O   1 
HETATM 4568 O  O   . HOH G 4 .   ? 10.015  36.012 -18.480 1.00 74.10  ? 1124 HOH A O   1 
HETATM 4569 O  O   . HOH G 4 .   ? 4.014   34.983 -10.740 1.00 62.96  ? 1125 HOH A O   1 
HETATM 4570 O  O   . HOH G 4 .   ? -14.796 33.578 -17.421 1.00 69.86  ? 1126 HOH A O   1 
HETATM 4571 O  O   . HOH G 4 .   ? -7.440  53.884 15.257  1.00 45.67  ? 1127 HOH A O   1 
HETATM 4572 O  O   . HOH G 4 .   ? -7.804  27.076 5.184   1.00 49.30  ? 1128 HOH A O   1 
HETATM 4573 O  O   . HOH G 4 .   ? 3.243   42.969 -12.119 1.00 66.71  ? 1129 HOH A O   1 
HETATM 4574 O  O   . HOH G 4 .   ? -19.596 52.456 -13.704 1.00 71.06  ? 1130 HOH A O   1 
HETATM 4575 O  O   . HOH G 4 .   ? -13.279 52.836 -3.099  1.00 67.59  ? 1131 HOH A O   1 
HETATM 4576 O  O   . HOH G 4 .   ? -13.467 41.701 19.291  1.00 57.34  ? 1132 HOH A O   1 
HETATM 4577 O  O   . HOH G 4 .   ? -5.015  55.153 15.726  1.00 53.79  ? 1133 HOH A O   1 
HETATM 4578 O  O   . HOH G 4 .   ? -16.136 50.700 -18.649 1.00 56.29  ? 1134 HOH A O   1 
HETATM 4579 O  O   . HOH G 4 .   ? -18.752 28.968 1.147   1.00 68.07  ? 1135 HOH A O   1 
HETATM 4580 O  O   . HOH G 4 .   ? -10.741 51.000 18.211  1.00 61.35  ? 1136 HOH A O   1 
HETATM 4581 O  O   . HOH G 4 .   ? -15.881 57.166 -15.145 1.00 80.01  ? 1137 HOH A O   1 
HETATM 4582 O  O   . HOH G 4 .   ? -0.788  57.869 -12.175 1.00 72.72  ? 1138 HOH A O   1 
HETATM 4583 O  O   . HOH G 4 .   ? -9.086  55.958 14.472  1.00 43.38  ? 1139 HOH A O   1 
HETATM 4584 O  O   . HOH G 4 .   ? -17.695 54.753 -15.188 1.00 65.63  ? 1140 HOH A O   1 
HETATM 4585 O  O   . HOH G 4 .   ? 9.909   51.774 -1.805  1.00 58.42  ? 1141 HOH A O   1 
HETATM 4586 O  O   . HOH G 4 .   ? -3.760  60.131 -2.958  1.00 66.75  ? 1142 HOH A O   1 
HETATM 4587 O  O   . HOH G 4 .   ? -14.453 28.061 6.275   1.00 57.82  ? 1143 HOH A O   1 
HETATM 4588 O  O   . HOH G 4 .   ? -7.614  30.138 15.327  1.00 69.17  ? 1144 HOH A O   1 
HETATM 4589 O  O   . HOH G 4 .   ? -14.857 28.683 9.061   1.00 58.68  ? 1145 HOH A O   1 
HETATM 4590 O  O   . HOH G 4 .   ? -18.995 33.442 7.341   1.00 73.56  ? 1146 HOH A O   1 
HETATM 4591 O  O   . HOH G 4 .   ? -10.996 52.638 7.296   1.00 42.88  ? 1147 HOH A O   1 
HETATM 4592 O  O   . HOH G 4 .   ? -12.959 58.232 -14.329 1.00 75.96  ? 1148 HOH A O   1 
HETATM 4593 O  O   . HOH G 4 .   ? 2.816   46.569 -8.633  1.00 65.26  ? 1149 HOH A O   1 
HETATM 4594 O  O   . HOH G 4 .   ? -9.639  39.256 18.704  1.00 65.88  ? 1150 HOH A O   1 
HETATM 4595 O  O   . HOH G 4 .   ? 12.410  37.815 -1.571  1.00 55.88  ? 1151 HOH A O   1 
HETATM 4596 O  O   . HOH G 4 .   ? -12.126 50.339 3.574   1.00 81.68  ? 1152 HOH A O   1 
HETATM 4597 O  O   . HOH H 4 .   ? -28.674 41.710 -31.070 1.00 42.59  ? 1001 HOH B O   1 
HETATM 4598 O  O   . HOH H 4 .   ? -17.149 37.159 -17.513 1.00 38.20  ? 1002 HOH B O   1 
HETATM 4599 O  O   . HOH H 4 .   ? -39.796 22.626 -16.865 1.00 52.96  ? 1003 HOH B O   1 
HETATM 4600 O  O   . HOH H 4 .   ? -35.714 23.473 -11.473 1.00 38.01  ? 1004 HOH B O   1 
HETATM 4601 O  O   . HOH H 4 .   ? -27.641 33.432 -25.628 1.00 54.28  ? 1005 HOH B O   1 
HETATM 4602 O  O   . HOH H 4 .   ? -41.068 42.727 -10.005 1.00 36.67  ? 1006 HOH B O   1 
HETATM 4603 O  O   . HOH H 4 .   ? -22.384 51.153 2.927   1.00 38.83  ? 1007 HOH B O   1 
HETATM 4604 O  O   . HOH H 4 .   ? -38.861 45.145 8.967   1.00 55.74  ? 1008 HOH B O   1 
HETATM 4605 O  O   . HOH H 4 .   ? -15.885 38.419 3.250   1.00 35.91  ? 1009 HOH B O   1 
HETATM 4606 O  O   . HOH H 4 .   ? -19.181 32.786 -7.136  1.00 36.96  ? 1010 HOH B O   1 
HETATM 4607 O  O   . HOH H 4 .   ? -44.402 31.227 -14.729 1.00 32.39  ? 1011 HOH B O   1 
HETATM 4608 O  O   . HOH H 4 .   ? -24.826 51.047 -1.903  1.00 50.67  ? 1012 HOH B O   1 
HETATM 4609 O  O   . HOH H 4 .   ? -17.164 35.624 -0.300  1.00 41.96  ? 1013 HOH B O   1 
HETATM 4610 O  O   . HOH H 4 .   ? -35.774 24.548 5.295   1.00 59.34  ? 1014 HOH B O   1 
HETATM 4611 O  O   . HOH H 4 .   ? -41.406 28.532 2.129   1.00 57.51  ? 1015 HOH B O   1 
HETATM 4612 O  O   . HOH H 4 .   ? -19.162 55.459 16.691  1.00 69.57  ? 1016 HOH B O   1 
HETATM 4613 O  O   . HOH H 4 .   ? -41.636 47.849 -6.184  1.00 51.38  ? 1017 HOH B O   1 
HETATM 4614 O  O   . HOH H 4 .   ? -42.899 33.062 -16.103 1.00 38.14  ? 1018 HOH B O   1 
HETATM 4615 O  O   . HOH H 4 .   ? -35.894 44.304 -0.711  1.00 49.68  ? 1019 HOH B O   1 
HETATM 4616 O  O   . HOH H 4 .   ? -25.555 49.099 -13.155 1.00 40.35  ? 1020 HOH B O   1 
HETATM 4617 O  O   . HOH H 4 .   ? -27.690 35.702 -26.858 1.00 45.82  ? 1021 HOH B O   1 
HETATM 4618 O  O   . HOH H 4 .   ? -41.151 31.202 -4.646  1.00 64.83  ? 1022 HOH B O   1 
HETATM 4619 O  O   . HOH H 4 .   ? -29.679 23.779 -7.906  1.00 42.33  ? 1023 HOH B O   1 
HETATM 4620 O  O   . HOH H 4 .   ? -9.467  56.040 11.837  1.00 35.30  ? 1024 HOH B O   1 
HETATM 4621 O  O   . HOH H 4 .   ? -18.241 29.052 -11.797 1.00 66.92  ? 1025 HOH B O   1 
HETATM 4622 O  O   . HOH H 4 .   ? -25.798 50.269 -15.617 1.00 53.32  ? 1026 HOH B O   1 
HETATM 4623 O  O   . HOH H 4 .   ? -25.939 44.920 20.031  1.00 48.93  ? 1027 HOH B O   1 
HETATM 4624 O  O   . HOH H 4 .   ? -36.567 33.044 -8.182  1.00 32.37  ? 1028 HOH B O   1 
HETATM 4625 O  O   . HOH H 4 .   ? -24.821 38.415 18.124  1.00 62.09  ? 1029 HOH B O   1 
HETATM 4626 O  O   . HOH H 4 .   ? -37.340 22.027 -9.808  1.00 43.90  ? 1030 HOH B O   1 
HETATM 4627 O  O   . HOH H 4 .   ? -22.487 45.998 -14.555 1.00 48.14  ? 1031 HOH B O   1 
HETATM 4628 O  O   . HOH H 4 .   ? -16.929 43.470 -7.505  1.00 47.60  ? 1032 HOH B O   1 
HETATM 4629 O  O   . HOH H 4 .   ? -37.109 42.968 1.893   1.00 60.56  ? 1033 HOH B O   1 
HETATM 4630 O  O   . HOH H 4 .   ? -36.266 29.205 -7.736  1.00 32.62  ? 1034 HOH B O   1 
HETATM 4631 O  O   . HOH H 4 .   ? -23.962 34.727 8.977   1.00 63.30  ? 1035 HOH B O   1 
HETATM 4632 O  O   . HOH H 4 .   ? -20.188 36.955 -9.121  1.00 28.33  ? 1036 HOH B O   1 
HETATM 4633 O  O   . HOH H 4 .   ? -38.441 43.629 -1.416  1.00 63.76  ? 1037 HOH B O   1 
HETATM 4634 O  O   . HOH H 4 .   ? -54.816 47.362 -16.888 1.00 66.09  ? 1038 HOH B O   1 
HETATM 4635 O  O   . HOH H 4 .   ? -29.417 24.509 -16.440 1.00 38.64  ? 1039 HOH B O   1 
HETATM 4636 O  O   . HOH H 4 .   ? -29.681 29.949 -7.194  1.00 32.18  ? 1040 HOH B O   1 
HETATM 4637 O  O   . HOH H 4 .   ? -41.215 50.274 -5.032  1.00 57.80  ? 1041 HOH B O   1 
HETATM 4638 O  O   . HOH H 4 .   ? -24.672 28.618 -10.496 1.00 39.20  ? 1042 HOH B O   1 
HETATM 4639 O  O   . HOH H 4 .   ? -19.369 42.544 16.282  1.00 46.24  ? 1043 HOH B O   1 
HETATM 4640 O  O   . HOH H 4 .   ? -24.232 54.636 -4.211  1.00 43.55  ? 1044 HOH B O   1 
HETATM 4641 O  O   . HOH H 4 .   ? -38.101 49.332 -23.869 1.00 51.96  ? 1045 HOH B O   1 
HETATM 4642 O  O   . HOH H 4 .   ? -14.540 43.931 -28.511 1.00 58.39  ? 1046 HOH B O   1 
HETATM 4643 O  O   . HOH H 4 .   ? -35.144 34.884 -0.893  1.00 37.55  ? 1047 HOH B O   1 
HETATM 4644 O  O   . HOH H 4 .   ? -35.072 18.787 -1.796  1.00 49.30  ? 1048 HOH B O   1 
HETATM 4645 O  O   . HOH H 4 .   ? -19.828 32.830 4.121   1.00 45.97  ? 1049 HOH B O   1 
HETATM 4646 O  O   . HOH H 4 .   ? -19.260 58.155 4.194   1.00 52.54  ? 1050 HOH B O   1 
HETATM 4647 O  O   . HOH H 4 .   ? -24.554 40.468 2.156   1.00 43.71  ? 1051 HOH B O   1 
HETATM 4648 O  O   . HOH H 4 .   ? -50.502 28.731 -0.388  1.00 50.84  ? 1052 HOH B O   1 
HETATM 4649 O  O   . HOH H 4 .   ? -18.475 43.734 -17.646 1.00 50.23  ? 1053 HOH B O   1 
HETATM 4650 O  O   . HOH H 4 .   ? -35.836 40.232 7.752   1.00 46.22  ? 1054 HOH B O   1 
HETATM 4651 O  O   . HOH H 4 .   ? -38.507 29.982 -10.487 1.00 38.59  ? 1055 HOH B O   1 
HETATM 4652 O  O   . HOH H 4 .   ? -35.329 19.403 -8.807  1.00 60.97  ? 1056 HOH B O   1 
HETATM 4653 O  O   . HOH H 4 .   ? -22.812 37.583 -25.869 1.00 47.68  ? 1057 HOH B O   1 
HETATM 4654 O  O   . HOH H 4 .   ? -22.038 46.812 -26.873 1.00 49.29  ? 1058 HOH B O   1 
HETATM 4655 O  O   . HOH H 4 .   ? -36.742 38.911 2.992   1.00 57.52  ? 1059 HOH B O   1 
HETATM 4656 O  O   . HOH H 4 .   ? -41.023 21.646 3.321   1.00 72.72  ? 1060 HOH B O   1 
HETATM 4657 O  O   . HOH H 4 .   ? -37.783 52.794 -6.712  1.00 56.38  ? 1061 HOH B O   1 
HETATM 4658 O  O   . HOH H 4 .   ? -41.800 45.018 -13.688 1.00 45.23  ? 1062 HOH B O   1 
HETATM 4659 O  O   . HOH H 4 .   ? -37.740 29.584 -24.542 1.00 42.26  ? 1063 HOH B O   1 
HETATM 4660 O  O   . HOH H 4 .   ? -16.106 31.694 -11.844 1.00 41.15  ? 1064 HOH B O   1 
HETATM 4661 O  O   . HOH H 4 .   ? -53.344 31.372 -21.279 1.00 62.70  ? 1065 HOH B O   1 
HETATM 4662 O  O   . HOH H 4 .   ? -41.395 42.182 -2.964  1.00 52.97  ? 1066 HOH B O   1 
HETATM 4663 O  O   . HOH H 4 .   ? -42.037 39.580 -2.280  1.00 73.53  ? 1067 HOH B O   1 
HETATM 4664 O  O   . HOH H 4 .   ? -28.912 58.265 -8.730  1.00 57.72  ? 1068 HOH B O   1 
HETATM 4665 O  O   . HOH H 4 .   ? -35.003 47.713 -24.761 1.00 61.19  ? 1069 HOH B O   1 
HETATM 4666 O  O   . HOH H 4 .   ? -32.872 23.715 2.735   1.00 61.44  ? 1070 HOH B O   1 
HETATM 4667 O  O   . HOH H 4 .   ? -22.879 29.700 -12.167 1.00 36.46  ? 1071 HOH B O   1 
HETATM 4668 O  O   . HOH H 4 .   ? -37.380 44.590 -29.802 1.00 56.05  ? 1072 HOH B O   1 
HETATM 4669 O  O   . HOH H 4 .   ? -27.607 30.775 -23.132 1.00 49.11  ? 1073 HOH B O   1 
HETATM 4670 O  O   . HOH H 4 .   ? -22.813 41.459 0.026   1.00 31.91  ? 1074 HOH B O   1 
HETATM 4671 O  O   . HOH H 4 .   ? -44.477 35.841 -28.043 1.00 49.33  ? 1075 HOH B O   1 
HETATM 4672 O  O   . HOH H 4 .   ? -19.394 53.988 9.765   1.00 35.34  ? 1076 HOH B O   1 
HETATM 4673 O  O   . HOH H 4 .   ? -19.300 43.444 4.298   1.00 61.92  ? 1077 HOH B O   1 
HETATM 4674 O  O   . HOH H 4 .   ? -24.257 53.018 2.448   1.00 50.58  ? 1078 HOH B O   1 
HETATM 4675 O  O   . HOH H 4 .   ? -23.085 56.640 3.042   1.00 52.11  ? 1079 HOH B O   1 
HETATM 4676 O  O   . HOH H 4 .   ? -29.648 26.986 -15.185 1.00 39.63  ? 1080 HOH B O   1 
HETATM 4677 O  O   . HOH H 4 .   ? -38.375 25.484 -24.323 1.00 58.61  ? 1081 HOH B O   1 
HETATM 4678 O  O   . HOH H 4 .   ? -23.736 57.212 16.383  1.00 59.97  ? 1082 HOH B O   1 
HETATM 4679 O  O   . HOH H 4 .   ? -35.210 37.104 -30.423 1.00 57.17  ? 1083 HOH B O   1 
HETATM 4680 O  O   . HOH H 4 .   ? -28.410 29.564 6.053   1.00 71.49  ? 1084 HOH B O   1 
HETATM 4681 O  O   . HOH H 4 .   ? -35.730 20.342 0.410   1.00 43.70  ? 1085 HOH B O   1 
HETATM 4682 O  O   . HOH H 4 .   ? -22.745 28.572 1.769   1.00 62.11  ? 1086 HOH B O   1 
HETATM 4683 O  O   . HOH H 4 .   ? -16.979 54.466 6.289   1.00 35.31  ? 1087 HOH B O   1 
HETATM 4684 O  O   . HOH H 4 .   ? -25.181 31.410 16.643  1.00 84.54  ? 1088 HOH B O   1 
HETATM 4685 O  O   . HOH H 4 .   ? -20.115 32.036 -4.701  1.00 56.01  ? 1089 HOH B O   1 
HETATM 4686 O  O   . HOH H 4 .   ? -40.227 14.671 -3.593  1.00 62.17  ? 1090 HOH B O   1 
HETATM 4687 O  O   . HOH H 4 .   ? -38.487 51.243 -3.560  1.00 54.35  ? 1091 HOH B O   1 
HETATM 4688 O  O   . HOH H 4 .   ? -26.707 28.889 -12.188 1.00 37.70  ? 1092 HOH B O   1 
HETATM 4689 O  O   . HOH H 4 .   ? -43.090 27.334 -2.202  1.00 51.49  ? 1093 HOH B O   1 
HETATM 4690 O  O   . HOH H 4 .   ? -26.201 26.506 -21.921 1.00 55.98  ? 1094 HOH B O   1 
HETATM 4691 O  O   . HOH H 4 .   ? -16.402 43.935 0.674   1.00 69.83  ? 1095 HOH B O   1 
HETATM 4692 O  O   . HOH H 4 .   ? -35.298 31.811 -31.215 1.00 75.29  ? 1096 HOH B O   1 
HETATM 4693 O  O   . HOH H 4 .   ? -31.540 27.316 4.261   1.00 54.43  ? 1097 HOH B O   1 
HETATM 4694 O  O   . HOH H 4 .   ? -42.861 25.304 -22.319 1.00 49.79  ? 1098 HOH B O   1 
HETATM 4695 O  O   . HOH H 4 .   ? -23.278 49.706 -18.654 1.00 57.12  ? 1099 HOH B O   1 
HETATM 4696 O  O   . HOH H 4 .   ? -46.472 24.646 -14.543 1.00 41.81  ? 1100 HOH B O   1 
HETATM 4697 O  O   . HOH H 4 .   ? -18.681 33.989 -15.303 1.00 44.33  ? 1101 HOH B O   1 
HETATM 4698 O  O   . HOH H 4 .   ? -10.808 50.814 -7.392  1.00 64.42  ? 1102 HOH B O   1 
HETATM 4699 O  O   . HOH H 4 .   ? -53.240 25.299 -15.282 1.00 63.59  ? 1103 HOH B O   1 
HETATM 4700 O  O   . HOH H 4 .   ? -17.037 57.128 16.453  1.00 54.75  ? 1104 HOH B O   1 
HETATM 4701 O  O   . HOH H 4 .   ? -47.308 29.551 1.378   1.00 54.54  ? 1105 HOH B O   1 
HETATM 4702 O  O   . HOH H 4 .   ? -27.427 54.737 -2.449  1.00 43.27  ? 1106 HOH B O   1 
HETATM 4703 O  O   . HOH H 4 .   ? -19.908 40.093 17.720  1.00 56.19  ? 1107 HOH B O   1 
HETATM 4704 O  O   . HOH H 4 .   ? -22.584 38.887 11.055  1.00 43.41  ? 1108 HOH B O   1 
HETATM 4705 O  O   . HOH H 4 .   ? -11.205 55.399 8.345   1.00 44.05  ? 1109 HOH B O   1 
HETATM 4706 O  O   . HOH H 4 .   ? -21.116 38.650 8.807   1.00 45.53  ? 1110 HOH B O   1 
HETATM 4707 O  O   . HOH H 4 .   ? -41.867 34.074 -21.055 1.00 36.70  ? 1111 HOH B O   1 
HETATM 4708 O  O   . HOH H 4 .   ? -43.193 25.030 2.606   1.00 53.67  ? 1112 HOH B O   1 
HETATM 4709 O  O   . HOH H 4 .   ? -37.844 36.413 -0.095  1.00 53.97  ? 1113 HOH B O   1 
HETATM 4710 O  O   . HOH H 4 .   ? -46.564 26.643 -16.570 1.00 56.89  ? 1114 HOH B O   1 
HETATM 4711 O  O   . HOH H 4 .   ? -38.088 47.766 -31.375 1.00 61.05  ? 1115 HOH B O   1 
HETATM 4712 O  O   . HOH H 4 .   ? -18.178 41.648 -5.837  1.00 41.19  ? 1116 HOH B O   1 
HETATM 4713 O  O   . HOH H 4 .   ? -19.882 31.003 -20.844 1.00 46.35  ? 1117 HOH B O   1 
HETATM 4714 O  O   . HOH H 4 .   ? -19.192 48.821 4.353   1.00 62.38  ? 1118 HOH B O   1 
HETATM 4715 O  O   . HOH H 4 .   ? -37.926 19.123 -13.843 1.00 57.28  ? 1119 HOH B O   1 
HETATM 4716 O  O   . HOH H 4 .   ? -14.372 57.052 16.343  1.00 61.76  ? 1120 HOH B O   1 
HETATM 4717 O  O   . HOH H 4 .   ? -44.008 45.654 -7.381  1.00 59.77  ? 1121 HOH B O   1 
HETATM 4718 O  O   . HOH H 4 .   ? -21.228 43.818 -11.916 1.00 50.49  ? 1122 HOH B O   1 
HETATM 4719 O  O   . HOH H 4 .   ? -25.399 46.664 -11.368 1.00 38.23  ? 1123 HOH B O   1 
HETATM 4720 O  O   . HOH H 4 .   ? -15.470 56.668 2.150   1.00 58.29  ? 1124 HOH B O   1 
HETATM 4721 O  O   . HOH H 4 .   ? -13.201 48.679 7.485   1.00 48.70  ? 1125 HOH B O   1 
HETATM 4722 O  O   . HOH H 4 .   ? -33.468 52.109 -23.967 1.00 67.58  ? 1126 HOH B O   1 
HETATM 4723 O  O   . HOH H 4 .   ? -27.499 24.048 -13.077 1.00 59.75  ? 1127 HOH B O   1 
HETATM 4724 O  O   . HOH H 4 .   ? -47.518 36.256 -10.280 1.00 43.78  ? 1128 HOH B O   1 
HETATM 4725 O  O   . HOH H 4 .   ? -48.675 34.857 -7.817  1.00 50.49  ? 1129 HOH B O   1 
HETATM 4726 O  O   . HOH H 4 .   ? -26.856 51.295 -25.915 1.00 59.79  ? 1130 HOH B O   1 
HETATM 4727 O  O   . HOH H 4 .   ? -26.283 24.743 -19.608 1.00 61.55  ? 1131 HOH B O   1 
HETATM 4728 O  O   . HOH H 4 .   ? -36.081 23.021 -23.540 1.00 59.10  ? 1132 HOH B O   1 
HETATM 4729 O  O   . HOH H 4 .   ? -24.425 57.345 13.892  1.00 48.45  ? 1133 HOH B O   1 
HETATM 4730 O  O   . HOH H 4 .   ? -48.255 35.255 -5.145  1.00 69.28  ? 1134 HOH B O   1 
HETATM 4731 O  O   . HOH H 4 .   ? -13.428 55.811 6.817   1.00 46.35  ? 1135 HOH B O   1 
HETATM 4732 O  O   . HOH H 4 .   ? -36.774 46.034 1.219   1.00 49.14  ? 1136 HOH B O   1 
HETATM 4733 O  O   . HOH H 4 .   ? -34.729 29.475 -28.414 1.00 68.80  ? 1137 HOH B O   1 
HETATM 4734 O  O   . HOH H 4 .   ? -22.661 46.133 -11.027 1.00 33.25  ? 1138 HOH B O   1 
HETATM 4735 O  O   . HOH H 4 .   ? -38.201 41.356 6.649   1.00 57.27  ? 1139 HOH B O   1 
HETATM 4736 O  O   . HOH H 4 .   ? -21.314 35.983 11.674  1.00 57.34  ? 1140 HOH B O   1 
HETATM 4737 O  O   . HOH H 4 .   ? -43.283 36.594 -2.897  1.00 67.58  ? 1141 HOH B O   1 
HETATM 4738 O  O   . HOH H 4 .   ? -43.952 45.075 -11.806 1.00 61.11  ? 1142 HOH B O   1 
HETATM 4739 O  O   . HOH H 4 .   ? -21.804 39.261 -27.809 1.00 56.61  ? 1143 HOH B O   1 
HETATM 4740 O  O   . HOH H 4 .   ? -40.128 36.130 -7.892  1.00 55.12  ? 1144 HOH B O   1 
HETATM 4741 O  O   . HOH H 4 .   ? -30.000 23.673 -10.940 1.00 60.85  ? 1145 HOH B O   1 
HETATM 4742 O  O   . HOH H 4 .   ? -39.465 41.853 4.034   1.00 64.73  ? 1146 HOH B O   1 
HETATM 4743 O  O   . HOH H 4 .   ? -29.777 52.739 -26.643 1.00 47.97  ? 1147 HOH B O   1 
HETATM 4744 O  O   . HOH H 4 .   ? -15.798 50.121 3.944   1.00 62.89  ? 1148 HOH B O   1 
HETATM 4745 O  O   . HOH H 4 .   ? -16.867 32.310 -22.212 1.00 67.21  ? 1149 HOH B O   1 
HETATM 4746 O  O   . HOH H 4 .   ? -37.634 20.880 -16.317 1.00 60.79  ? 1150 HOH B O   1 
HETATM 4747 O  O   . HOH H 4 .   ? -38.658 30.705 -8.014  1.00 51.35  ? 1151 HOH B O   1 
HETATM 4748 O  O   . HOH H 4 .   ? -38.879 44.935 2.615   1.00 62.53  ? 1152 HOH B O   1 
HETATM 4749 O  O   . HOH H 4 .   ? -27.262 24.642 -7.092  1.00 55.43  ? 1153 HOH B O   1 
HETATM 4750 O  O   . HOH H 4 .   ? -20.679 34.983 9.036   1.00 66.92  ? 1154 HOH B O   1 
HETATM 4751 O  O   . HOH H 4 .   ? -28.365 26.819 -12.779 1.00 42.58  ? 1155 HOH B O   1 
HETATM 4752 O  O   . HOH H 4 .   ? -44.106 32.463 -28.308 1.00 72.39  ? 1156 HOH B O   1 
HETATM 4753 O  O   . HOH H 4 .   ? -44.402 52.363 -8.913  1.00 59.25  ? 1157 HOH B O   1 
HETATM 4754 O  O   . HOH H 4 .   ? -41.957 19.365 2.052   1.00 55.79  ? 1158 HOH B O   1 
HETATM 4755 O  O   . HOH H 4 .   ? -43.667 23.631 -19.768 1.00 50.98  ? 1159 HOH B O   1 
HETATM 4756 O  O   . HOH H 4 .   ? -18.322 52.109 5.640   1.00 61.62  ? 1160 HOH B O   1 
HETATM 4757 O  O   . HOH H 4 .   ? -24.928 54.897 0.602   1.00 64.14  ? 1161 HOH B O   1 
HETATM 4758 O  O   . HOH H 4 .   ? -12.926 52.288 5.360   1.00 68.50  ? 1162 HOH B O   1 
HETATM 4759 O  O   . HOH H 4 .   ? -19.776 51.793 2.992   1.00 59.80  ? 1163 HOH B O   1 
HETATM 4760 O  O   . HOH H 4 .   ? -17.149 61.276 9.396   1.00 53.02  ? 1164 HOH B O   1 
HETATM 4761 O  O   . HOH H 4 .   ? -18.117 30.057 -3.975  1.00 56.26  ? 1165 HOH B O   1 
HETATM 4762 O  O   . HOH H 4 .   ? -30.069 31.136 8.120   1.00 66.04  ? 1166 HOH B O   1 
HETATM 4763 O  O   . HOH H 4 .   ? -32.101 55.598 -24.849 1.00 67.59  ? 1167 HOH B O   1 
HETATM 4764 O  O   . HOH H 4 .   ? -18.829 51.838 8.249   1.00 42.76  ? 1168 HOH B O   1 
HETATM 4765 O  O   . HOH H 4 .   ? -19.371 29.157 -17.927 1.00 70.64  ? 1169 HOH B O   1 
HETATM 4766 O  O   . HOH H 4 .   ? -28.009 28.121 -23.171 1.00 59.64  ? 1170 HOH B O   1 
HETATM 4767 O  O   . HOH H 4 .   ? -40.729 34.806 -28.166 1.00 52.79  ? 1171 HOH B O   1 
HETATM 4768 O  O   . HOH H 4 .   ? -10.809 55.776 16.673  1.00 63.23  ? 1172 HOH B O   1 
HETATM 4769 O  O   . HOH H 4 .   ? -18.676 27.803 -1.581  1.00 75.19  ? 1173 HOH B O   1 
HETATM 4770 O  O   . HOH H 4 .   ? -26.732 57.218 -1.221  1.00 65.44  ? 1174 HOH B O   1 
HETATM 4771 O  O   . HOH H 4 .   ? -19.882 26.338 -9.318  1.00 58.76  ? 1175 HOH B O   1 
HETATM 4772 O  O   . HOH H 4 .   ? -25.391 53.570 -25.841 1.00 63.39  ? 1176 HOH B O   1 
HETATM 4773 O  O   . HOH H 4 .   ? -42.728 21.794 -16.960 1.00 68.94  ? 1177 HOH B O   1 
HETATM 4774 O  O   . HOH H 4 .   ? -18.146 44.980 -12.273 1.00 63.88  ? 1178 HOH B O   1 
HETATM 4775 O  O   . HOH H 4 .   ? -21.522 27.119 -13.654 1.00 62.17  ? 1179 HOH B O   1 
HETATM 4776 O  O   . HOH H 4 .   ? -23.790 44.732 21.651  1.00 62.55  ? 1180 HOH B O   1 
HETATM 4777 O  O   . HOH H 4 .   ? -17.829 36.161 -13.226 1.00 51.17  ? 1181 HOH B O   1 
HETATM 4778 O  O   . HOH H 4 .   ? -35.608 39.847 -31.457 1.00 65.67  ? 1182 HOH B O   1 
HETATM 4779 O  O   . HOH H 4 .   ? -25.301 31.984 -26.388 1.00 70.43  ? 1183 HOH B O   1 
HETATM 4780 O  O   . HOH H 4 .   ? -11.879 53.906 18.307  1.00 61.23  ? 1184 HOH B O   1 
HETATM 4781 O  O   . HOH H 4 .   ? -17.599 56.034 3.731   1.00 53.85  ? 1185 HOH B O   1 
HETATM 4782 O  O   . HOH H 4 .   ? -37.791 29.279 -27.335 1.00 70.38  ? 1186 HOH B O   1 
HETATM 4783 O  O   . HOH H 4 .   ? -25.108 36.667 -27.447 1.00 58.67  ? 1187 HOH B O   1 
HETATM 4784 O  O   . HOH H 4 .   ? -21.433 54.622 1.850   1.00 72.17  ? 1188 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 18  ? 0.8850 0.8223 0.7425 -0.1275 0.0905  -0.0915 609 GLU A N   
2    C CA  . GLU A 18  ? 0.8587 0.8141 0.7119 -0.1312 0.0814  -0.0744 609 GLU A CA  
3    C C   . GLU A 18  ? 0.8254 0.7883 0.7060 -0.1221 0.0752  -0.0591 609 GLU A C   
4    O O   . GLU A 18  ? 0.8385 0.7944 0.7352 -0.1188 0.0707  -0.0587 609 GLU A O   
5    C CB  . GLU A 18  ? 0.8899 0.8485 0.7217 -0.1448 0.0690  -0.0732 609 GLU A CB  
6    N N   . PHE A 19  ? 0.6930 0.6688 0.5772 -0.1185 0.0752  -0.0467 610 PHE A N   
7    C CA  . PHE A 19  ? 0.6321 0.6149 0.5391 -0.1097 0.0700  -0.0331 610 PHE A CA  
8    C C   . PHE A 19  ? 0.6382 0.6332 0.5399 -0.1136 0.0576  -0.0191 610 PHE A C   
9    O O   . PHE A 19  ? 0.6258 0.6275 0.5099 -0.1191 0.0562  -0.0141 610 PHE A O   
10   C CB  . PHE A 19  ? 0.6355 0.6220 0.5525 -0.1023 0.0790  -0.0302 610 PHE A CB  
11   C CG  . PHE A 19  ? 0.6583 0.6373 0.5874 -0.0959 0.0908  -0.0423 610 PHE A CG  
12   C CD1 . PHE A 19  ? 0.6888 0.6650 0.6429 -0.0855 0.0903  -0.0409 610 PHE A CD1 
13   C CD2 . PHE A 19  ? 0.7157 0.6918 0.6314 -0.0995 0.1024  -0.0551 610 PHE A CD2 
14   C CE1 . PHE A 19  ? 0.7071 0.6777 0.6745 -0.0785 0.0998  -0.0514 610 PHE A CE1 
15   C CE2 . PHE A 19  ? 0.7643 0.7350 0.6943 -0.0918 0.1134  -0.0667 610 PHE A CE2 
16   C CZ  . PHE A 19  ? 0.7241 0.6926 0.6811 -0.0811 0.1115  -0.0642 610 PHE A CZ  
17   N N   . ALA A 20  ? 0.5705 0.5689 0.4877 -0.1105 0.0488  -0.0123 611 ALA A N   
18   C CA  . ALA A 20  ? 0.5558 0.5679 0.4736 -0.1120 0.0369  0.0006  611 ALA A CA  
19   C C   . ALA A 20  ? 0.5689 0.5876 0.4894 -0.1056 0.0366  0.0122  611 ALA A C   
20   O O   . ALA A 20  ? 0.5416 0.5699 0.4546 -0.1078 0.0285  0.0222  611 ALA A O   
21   C CB  . ALA A 20  ? 0.5446 0.5597 0.4819 -0.1081 0.0312  0.0046  611 ALA A CB  
22   N N   . LYS A 21  ? 0.5270 0.5397 0.4590 -0.0977 0.0449  0.0108  612 LYS A N   
23   C CA  . LYS A 21  ? 0.5210 0.5366 0.4567 -0.0924 0.0450  0.0208  612 LYS A CA  
24   C C   . LYS A 21  ? 0.5900 0.6031 0.5100 -0.0978 0.0533  0.0193  612 LYS A C   
25   O O   . LYS A 21  ? 0.5914 0.6039 0.5163 -0.0945 0.0561  0.0258  612 LYS A O   
26   C CB  . LYS A 21  ? 0.5259 0.5386 0.4842 -0.0814 0.0466  0.0223  612 LYS A CB  
27   C CG  . LYS A 21  ? 0.5474 0.5662 0.5173 -0.0760 0.0375  0.0289  612 LYS A CG  
28   C CD  . LYS A 21  ? 0.5361 0.5513 0.5246 -0.0660 0.0393  0.0284  612 LYS A CD  
29   C CE  . LYS A 21  ? 0.5861 0.6091 0.5843 -0.0604 0.0320  0.0350  612 LYS A CE  
30   N NZ  . LYS A 21  ? 0.6139 0.6327 0.6263 -0.0511 0.0337  0.0339  612 LYS A NZ  
31   N N   . GLU A 22  ? 0.5747 0.5868 0.4740 -0.1072 0.0569  0.0113  613 GLU A N   
32   C CA  . GLU A 22  ? 0.5724 0.5844 0.4525 -0.1137 0.0654  0.0103  613 GLU A CA  
33   C C   . GLU A 22  ? 0.6225 0.6394 0.4931 -0.1154 0.0579  0.0269  613 GLU A C   
34   O O   . GLU A 22  ? 0.6273 0.6494 0.4940 -0.1161 0.0452  0.0353  613 GLU A O   
35   C CB  . GLU A 22  ? 0.6021 0.6123 0.4574 -0.1238 0.0685  -0.0012 613 GLU A CB  
36   C CG  . GLU A 22  ? 0.6183 0.6288 0.4530 -0.1302 0.0807  -0.0048 613 GLU A CG  
37   C CD  . GLU A 22  ? 0.7078 0.7149 0.5534 -0.1263 0.0972  -0.0176 613 GLU A CD  
38   O OE1 . GLU A 22  ? 0.6108 0.6119 0.4739 -0.1200 0.0993  -0.0281 613 GLU A OE1 
39   O OE2 . GLU A 22  ? 0.7138 0.7246 0.5497 -0.1300 0.1082  -0.0171 613 GLU A OE2 
40   N N   . ILE A 23  ? 0.5865 0.6018 0.4556 -0.1159 0.0654  0.0323  614 ILE A N   
41   C CA  . ILE A 23  ? 0.6008 0.6167 0.4600 -0.1179 0.0591  0.0489  614 ILE A CA  
42   C C   . ILE A 23  ? 0.6843 0.7002 0.5191 -0.1280 0.0686  0.0504  614 ILE A C   
43   O O   . ILE A 23  ? 0.6748 0.6907 0.5106 -0.1304 0.0830  0.0399  614 ILE A O   
44   C CB  . ILE A 23  ? 0.6177 0.6293 0.5001 -0.1086 0.0561  0.0585  614 ILE A CB  
45   C CG1 . ILE A 23  ? 0.6158 0.6241 0.5150 -0.1064 0.0686  0.0516  614 ILE A CG1 
46   C CG2 . ILE A 23  ? 0.5931 0.6063 0.4939 -0.0989 0.0452  0.0603  614 ILE A CG2 
47   C CD1 . ILE A 23  ? 0.7093 0.7137 0.6067 -0.1097 0.0720  0.0619  614 ILE A CD1 
48   N N   . ASP A 24  ? 0.6778 0.6944 0.4913 -0.1336 0.0610  0.0641  615 ASP A N   
49   C CA  . ASP A 24  ? 0.7127 0.7289 0.5005 -0.1439 0.0698  0.0687  615 ASP A CA  
50   C C   . ASP A 24  ? 0.7575 0.7689 0.5624 -0.1420 0.0792  0.0748  615 ASP A C   
51   O O   . ASP A 24  ? 0.7079 0.7139 0.5330 -0.1342 0.0713  0.0836  615 ASP A O   
52   C CB  . ASP A 24  ? 0.7636 0.7803 0.5265 -0.1489 0.0564  0.0855  615 ASP A CB  
53   C CG  . ASP A 24  ? 0.9731 0.9896 0.7030 -0.1612 0.0648  0.0912  615 ASP A CG  
54   O OD1 . ASP A 24  ? 0.9681 0.9794 0.6999 -0.1632 0.0714  0.1018  615 ASP A OD1 
55   O OD2 . ASP A 24  ? 1.1646 1.1860 0.8665 -0.1696 0.0657  0.0839  615 ASP A OD2 
56   N N   . VAL A 25  ? 0.7654 0.7795 0.5631 -0.1493 0.0960  0.0692  616 VAL A N   
57   C CA  . VAL A 25  ? 0.7614 0.7736 0.5754 -0.1504 0.1058  0.0747  616 VAL A CA  
58   C C   . VAL A 25  ? 0.8429 0.8457 0.6537 -0.1520 0.0968  0.0957  616 VAL A C   
59   O O   . VAL A 25  ? 0.8544 0.8517 0.6880 -0.1490 0.0981  0.1000  616 VAL A O   
60   C CB  . VAL A 25  ? 0.8244 0.8447 0.6299 -0.1596 0.1262  0.0674  616 VAL A CB  
61   C CG1 . VAL A 25  ? 0.7975 0.8247 0.6303 -0.1532 0.1377  0.0491  616 VAL A CG1 
62   C CG2 . VAL A 25  ? 0.8468 0.8713 0.6126 -0.1702 0.1313  0.0660  616 VAL A CG2 
63   N N   . SER A 26  ? 0.8181 0.8179 0.6010 -0.1568 0.0869  0.1088  617 SER A N   
64   C CA  . SER A 26  ? 0.8228 0.8110 0.6002 -0.1578 0.0772  0.1303  617 SER A CA  
65   C C   . SER A 26  ? 0.8568 0.8362 0.6618 -0.1446 0.0639  0.1350  617 SER A C   
66   O O   . SER A 26  ? 0.8792 0.8456 0.6880 -0.1436 0.0583  0.1500  617 SER A O   
67   C CB  . SER A 26  ? 0.8791 0.8673 0.6205 -0.1645 0.0679  0.1430  617 SER A CB  
68   O OG  . SER A 26  ? 0.9832 0.9762 0.7238 -0.1573 0.0526  0.1404  617 SER A OG  
69   N N   . PHE A 27  ? 0.7650 0.7503 0.5888 -0.1345 0.0595  0.1218  618 PHE A N   
70   C CA  . PHE A 27  ? 0.7296 0.7092 0.5787 -0.1213 0.0483  0.1238  618 PHE A CA  
71   C C   . PHE A 27  ? 0.7318 0.7042 0.6067 -0.1178 0.0550  0.1199  618 PHE A C   
72   O O   . PHE A 27  ? 0.7074 0.6710 0.5996 -0.1082 0.0464  0.1239  618 PHE A O   
73   C CB  . PHE A 27  ? 0.7321 0.7219 0.5903 -0.1138 0.0427  0.1115  618 PHE A CB  
74   C CG  . PHE A 27  ? 0.7678 0.7664 0.6044 -0.1174 0.0340  0.1135  618 PHE A CG  
75   C CD1 . PHE A 27  ? 0.8377 0.8347 0.6477 -0.1246 0.0283  0.1277  618 PHE A CD1 
76   C CD2 . PHE A 27  ? 0.7724 0.7806 0.6153 -0.1142 0.0303  0.1020  618 PHE A CD2 
77   C CE1 . PHE A 27  ? 0.8620 0.8685 0.6519 -0.1286 0.0187  0.1293  618 PHE A CE1 
78   C CE2 . PHE A 27  ? 0.8230 0.8401 0.6472 -0.1190 0.0211  0.1034  618 PHE A CE2 
79   C CZ  . PHE A 27  ? 0.8303 0.8473 0.6283 -0.1260 0.0149  0.1166  618 PHE A CZ  
80   N N   . VAL A 28  ? 0.6982 0.6756 0.5769 -0.1249 0.0699  0.1109  619 VAL A N   
81   C CA  . VAL A 28  ? 0.6979 0.6717 0.6024 -0.1229 0.0758  0.1063  619 VAL A CA  
82   C C   . VAL A 28  ? 0.7586 0.7262 0.6597 -0.1338 0.0834  0.1164  619 VAL A C   
83   O O   . VAL A 28  ? 0.7720 0.7457 0.6536 -0.1451 0.0933  0.1193  619 VAL A O   
84   C CB  . VAL A 28  ? 0.7482 0.7337 0.6709 -0.1199 0.0855  0.0879  619 VAL A CB  
85   C CG1 . VAL A 28  ? 0.7289 0.7110 0.6769 -0.1075 0.0777  0.0818  619 VAL A CG1 
86   C CG2 . VAL A 28  ? 0.7546 0.7507 0.6620 -0.1216 0.0899  0.0775  619 VAL A CG2 
87   N N   . LYS A 29  ? 0.7239 0.6800 0.6447 -0.1311 0.0796  0.1207  620 LYS A N   
88   C CA  . LYS A 29  ? 0.7482 0.6966 0.6725 -0.1419 0.0860  0.1297  620 LYS A CA  
89   C C   . LYS A 29  ? 0.8045 0.7585 0.7600 -0.1399 0.0913  0.1171  620 LYS A C   
90   O O   . LYS A 29  ? 0.7858 0.7331 0.7590 -0.1291 0.0819  0.1119  620 LYS A O   
91   C CB  . LYS A 29  ? 0.7978 0.7231 0.7163 -0.1408 0.0736  0.1471  620 LYS A CB  
92   C CG  . LYS A 29  ? 1.1021 1.0161 1.0219 -0.1542 0.0795  0.1587  620 LYS A CG  
93   N N   . ILE A 30  ? 0.7718 0.7405 0.7337 -0.1496 0.1064  0.1113  621 ILE A N   
94   C CA  . ILE A 30  ? 0.7468 0.7251 0.7394 -0.1487 0.1118  0.0998  621 ILE A CA  
95   C C   . ILE A 30  ? 0.7912 0.7577 0.7967 -0.1574 0.1102  0.1093  621 ILE A C   
96   O O   . ILE A 30  ? 0.8029 0.7659 0.7961 -0.1711 0.1169  0.1219  621 ILE A O   
97   C CB  . ILE A 30  ? 0.7867 0.7887 0.7840 -0.1535 0.1288  0.0882  621 ILE A CB  
98   C CG1 . ILE A 30  ? 0.7967 0.8064 0.7808 -0.1449 0.1293  0.0774  621 ILE A CG1 
99   C CG2 . ILE A 30  ? 0.7805 0.7942 0.8125 -0.1518 0.1328  0.0775  621 ILE A CG2 
100  C CD1 . ILE A 30  ? 0.9222 0.9503 0.8979 -0.1509 0.1469  0.0683  621 ILE A CD1 
101  N N   . GLU A 31  ? 0.6961 0.6557 0.7250 -0.1503 0.1012  0.1035  622 GLU A N   
102  C CA  . GLU A 31  ? 0.6906 0.6380 0.7347 -0.1586 0.0984  0.1096  622 GLU A CA  
103  C C   . GLU A 31  ? 0.7153 0.6815 0.7906 -0.1620 0.1049  0.0974  622 GLU A C   
104  O O   . GLU A 31  ? 0.7240 0.7139 0.8047 -0.1657 0.1184  0.0908  622 GLU A O   
105  C CB  . GLU A 31  ? 0.7052 0.6256 0.7475 -0.1497 0.0817  0.1145  622 GLU A CB  
106  C CG  . GLU A 31  ? 0.8122 0.7150 0.8269 -0.1500 0.0766  0.1304  622 GLU A CG  
107  C CD  . GLU A 31  ? 1.0688 0.9458 1.0796 -0.1386 0.0608  0.1359  622 GLU A CD  
108  O OE1 . GLU A 31  ? 1.0169 0.8895 1.0434 -0.1276 0.0530  0.1252  622 GLU A OE1 
109  O OE2 . GLU A 31  ? 0.9127 0.7742 0.9037 -0.1402 0.0563  0.1511  622 GLU A OE2 
110  N N   . GLU A 32  ? 0.6579 0.6147 0.7537 -0.1603 0.0954  0.0938  623 GLU A N   
111  C CA  . GLU A 32  ? 0.6468 0.6213 0.7737 -0.1648 0.0991  0.0840  623 GLU A CA  
112  C C   . GLU A 32  ? 0.6417 0.6376 0.7837 -0.1521 0.1001  0.0680  623 GLU A C   
113  O O   . GLU A 32  ? 0.6194 0.6098 0.7506 -0.1380 0.0931  0.0632  623 GLU A O   
114  C CB  . GLU A 32  ? 0.6716 0.6268 0.8129 -0.1681 0.0866  0.0851  623 GLU A CB  
115  C CG  . GLU A 32  ? 0.7855 0.7283 0.9289 -0.1516 0.0715  0.0758  623 GLU A CG  
116  C CD  . GLU A 32  ? 0.9834 0.8962 1.1059 -0.1434 0.0601  0.0826  623 GLU A CD  
117  O OE1 . GLU A 32  ? 0.7566 0.6619 0.8567 -0.1434 0.0628  0.0933  623 GLU A OE1 
118  O OE2 . GLU A 32  ? 0.8807 0.7788 1.0091 -0.1357 0.0481  0.0764  623 GLU A OE2 
119  N N   . VAL A 33  ? 0.5844 0.6046 0.7530 -0.1573 0.1083  0.0606  624 VAL A N   
120  C CA  . VAL A 33  ? 0.5707 0.6107 0.7581 -0.1457 0.1083  0.0463  624 VAL A CA  
121  C C   . VAL A 33  ? 0.6518 0.6794 0.8496 -0.1366 0.0910  0.0409  624 VAL A C   
122  O O   . VAL A 33  ? 0.6725 0.6899 0.8801 -0.1444 0.0838  0.0440  624 VAL A O   
123  C CB  . VAL A 33  ? 0.6082 0.6791 0.8239 -0.1531 0.1216  0.0406  624 VAL A CB  
124  C CG1 . VAL A 33  ? 0.5776 0.6659 0.8171 -0.1399 0.1177  0.0269  624 VAL A CG1 
125  C CG2 . VAL A 33  ? 0.6154 0.7002 0.8181 -0.1599 0.1403  0.0434  624 VAL A CG2 
126  N N   . ILE A 34  ? 0.5967 0.6231 0.7897 -0.1209 0.0843  0.0333  625 ILE A N   
127  C CA  . ILE A 34  ? 0.5922 0.6080 0.7909 -0.1112 0.0688  0.0277  625 ILE A CA  
128  C C   . ILE A 34  ? 0.6557 0.6909 0.8749 -0.1018 0.0668  0.0165  625 ILE A C   
129  O O   . ILE A 34  ? 0.6527 0.6833 0.8790 -0.0951 0.0543  0.0113  625 ILE A O   
130  C CB  . ILE A 34  ? 0.6208 0.6138 0.7935 -0.1010 0.0602  0.0309  625 ILE A CB  
131  C CG1 . ILE A 34  ? 0.5829 0.5823 0.7404 -0.0922 0.0660  0.0293  625 ILE A CG1 
132  C CG2 . ILE A 34  ? 0.6487 0.6193 0.8060 -0.1090 0.0580  0.0422  625 ILE A CG2 
133  C CD1 . ILE A 34  ? 0.5217 0.5044 0.6587 -0.0810 0.0570  0.0313  625 ILE A CD1 
134  N N   . GLY A 35  ? 0.5994 0.6550 0.8264 -0.1009 0.0789  0.0128  626 GLY A N   
135  C CA  . GLY A 35  ? 0.5887 0.6626 0.8364 -0.0912 0.0781  0.0032  626 GLY A CA  
136  C C   . GLY A 35  ? 0.6639 0.7590 0.9209 -0.0914 0.0940  -0.0009 626 GLY A C   
137  O O   . GLY A 35  ? 0.6402 0.7380 0.8865 -0.1004 0.1069  0.0035  626 GLY A O   
138  N N   . ALA A 36  ? 0.6721 0.7823 0.9489 -0.0809 0.0928  -0.0094 627 ALA A N   
139  C CA  . ALA A 36  ? 0.6876 0.8175 0.9762 -0.0771 0.1070  -0.0159 627 ALA A CA  
140  C C   . ALA A 36  ? 0.7454 0.8671 1.0241 -0.0617 0.1034  -0.0215 627 ALA A C   
141  O O   . ALA A 36  ? 0.7288 0.8379 1.0025 -0.0539 0.0892  -0.0210 627 ALA A O   
142  C CB  . ALA A 36  ? 0.6976 0.8553 1.0254 -0.0786 0.1094  -0.0207 627 ALA A CB  
143  N N   . GLY A 37  ? 0.7348 0.8616 1.0074 -0.0588 0.1168  -0.0265 628 GLY A N   
144  C CA  . GLY A 37  ? 0.7340 0.8528 0.9981 -0.0460 0.1163  -0.0326 628 GLY A CA  
145  C C   . GLY A 37  ? 0.7970 0.9351 1.0827 -0.0399 0.1291  -0.0425 628 GLY A C   
146  O O   . GLY A 37  ? 0.8005 0.9605 1.1069 -0.0462 0.1396  -0.0442 628 GLY A O   
147  N N   . GLU A 38  ? 0.7531 0.8834 1.0356 -0.0276 0.1287  -0.0491 629 GLU A N   
148  C CA  . GLU A 38  ? 0.7554 0.8997 1.0576 -0.0186 0.1402  -0.0598 629 GLU A CA  
149  C C   . GLU A 38  ? 0.7980 0.9512 1.0898 -0.0264 0.1608  -0.0651 629 GLU A C   
150  O O   . GLU A 38  ? 0.8011 0.9772 1.1169 -0.0245 0.1739  -0.0723 629 GLU A O   
151  C CB  . GLU A 38  ? 0.7751 0.9009 1.0691 -0.0049 0.1341  -0.0645 629 GLU A CB  
152  C CG  . GLU A 38  ? 0.9448 1.0816 1.2631 0.0079  0.1426  -0.0757 629 GLU A CG  
153  C CD  . GLU A 38  ? 1.2150 1.3302 1.5237 0.0202  0.1389  -0.0808 629 GLU A CD  
154  O OE1 . GLU A 38  ? 1.0193 1.1120 1.3044 0.0192  0.1277  -0.0746 629 GLU A OE1 
155  O OE2 . GLU A 38  ? 1.2031 1.3239 1.5290 0.0311  0.1475  -0.0910 629 GLU A OE2 
156  N N   . PHE A 39  ? 0.7360 0.8721 0.9918 -0.0350 0.1632  -0.0613 630 PHE A N   
157  C CA  . PHE A 39  ? 0.7276 0.8665 0.9629 -0.0429 0.1804  -0.0655 630 PHE A CA  
158  C C   . PHE A 39  ? 0.6834 0.8304 0.9083 -0.0596 0.1870  -0.0562 630 PHE A C   
159  O O   . PHE A 39  ? 0.6458 0.7980 0.8538 -0.0672 0.2021  -0.0587 630 PHE A O   
160  C CB  . PHE A 39  ? 0.7600 0.8742 0.9607 -0.0413 0.1773  -0.0677 630 PHE A CB  
161  C CG  . PHE A 39  ? 0.7808 0.8838 0.9889 -0.0266 0.1722  -0.0765 630 PHE A CG  
162  C CD1 . PHE A 39  ? 0.8354 0.9443 1.0538 -0.0182 0.1852  -0.0904 630 PHE A CD1 
163  C CD2 . PHE A 39  ? 0.7931 0.8790 0.9979 -0.0209 0.1550  -0.0708 630 PHE A CD2 
164  C CE1 . PHE A 39  ? 0.8486 0.9437 1.0741 -0.0045 0.1799  -0.0977 630 PHE A CE1 
165  C CE2 . PHE A 39  ? 0.8362 0.9099 1.0468 -0.0084 0.1503  -0.0772 630 PHE A CE2 
166  C CZ  . PHE A 39  ? 0.8303 0.9075 1.0516 -0.0002 0.1621  -0.0902 630 PHE A CZ  
167  N N   . GLY A 40  ? 0.6035 0.7495 0.8366 -0.0652 0.1752  -0.0455 631 GLY A N   
168  C CA  . GLY A 40  ? 0.6032 0.7515 0.8267 -0.0810 0.1785  -0.0347 631 GLY A CA  
169  C C   . GLY A 40  ? 0.6402 0.7758 0.8647 -0.0841 0.1611  -0.0241 631 GLY A C   
170  O O   . GLY A 40  ? 0.6375 0.7670 0.8738 -0.0743 0.1472  -0.0257 631 GLY A O   
171  N N   . GLU A 41  ? 0.5960 0.7259 0.8064 -0.0976 0.1617  -0.0132 632 GLU A N   
172  C CA  . GLU A 41  ? 0.5914 0.7074 0.8022 -0.1016 0.1466  -0.0036 632 GLU A CA  
173  C C   . GLU A 41  ? 0.5919 0.6824 0.7751 -0.0963 0.1336  0.0013  632 GLU A C   
174  O O   . GLU A 41  ? 0.5929 0.6759 0.7524 -0.0937 0.1368  0.0001  632 GLU A O   
175  C CB  . GLU A 41  ? 0.6325 0.7511 0.8418 -0.1186 0.1526  0.0069  632 GLU A CB  
176  C CG  . GLU A 41  ? 0.8274 0.9742 1.0659 -0.1266 0.1665  0.0038  632 GLU A CG  
177  C CD  . GLU A 41  ? 1.0606 1.2233 1.2898 -0.1321 0.1877  0.0009  632 GLU A CD  
178  O OE1 . GLU A 41  ? 0.9200 1.0743 1.1231 -0.1263 0.1920  -0.0032 632 GLU A OE1 
179  O OE2 . GLU A 41  ? 1.0997 1.2848 1.3488 -0.1424 0.2005  0.0018  632 GLU A OE2 
180  N N   . VAL A 42  ? 0.5184 0.5968 0.7060 -0.0949 0.1189  0.0061  633 VAL A N   
181  C CA  . VAL A 42  ? 0.5065 0.5625 0.6719 -0.0904 0.1064  0.0117  633 VAL A CA  
182  C C   . VAL A 42  ? 0.5679 0.6124 0.7253 -0.1016 0.1037  0.0230  633 VAL A C   
183  O O   . VAL A 42  ? 0.5717 0.6203 0.7480 -0.1085 0.1023  0.0244  633 VAL A O   
184  C CB  . VAL A 42  ? 0.5285 0.5780 0.7024 -0.0781 0.0923  0.0072  633 VAL A CB  
185  C CG1 . VAL A 42  ? 0.5233 0.5527 0.6736 -0.0734 0.0823  0.0128  633 VAL A CG1 
186  C CG2 . VAL A 42  ? 0.5095 0.5697 0.6939 -0.0676 0.0951  -0.0027 633 VAL A CG2 
187  N N   . TYR A 43  ? 0.5145 0.5450 0.6446 -0.1041 0.1032  0.0312  634 TYR A N   
188  C CA  . TYR A 43  ? 0.5279 0.5438 0.6470 -0.1137 0.1001  0.0435  634 TYR A CA  
189  C C   . TYR A 43  ? 0.5517 0.5464 0.6555 -0.1060 0.0865  0.0487  634 TYR A C   
190  O O   . TYR A 43  ? 0.5000 0.4936 0.5934 -0.0961 0.0828  0.0452  634 TYR A O   
191  C CB  . TYR A 43  ? 0.5698 0.5881 0.6679 -0.1240 0.1116  0.0511  634 TYR A CB  
192  C CG  . TYR A 43  ? 0.6363 0.6766 0.7452 -0.1325 0.1283  0.0466  634 TYR A CG  
193  C CD1 . TYR A 43  ? 0.6559 0.7113 0.7651 -0.1266 0.1375  0.0354  634 TYR A CD1 
194  C CD2 . TYR A 43  ? 0.6805 0.7257 0.7967 -0.1471 0.1361  0.0542  634 TYR A CD2 
195  C CE1 . TYR A 43  ? 0.6994 0.7761 0.8183 -0.1331 0.1544  0.0303  634 TYR A CE1 
196  C CE2 . TYR A 43  ? 0.7104 0.7788 0.8363 -0.1552 0.1534  0.0504  634 TYR A CE2 
197  C CZ  . TYR A 43  ? 0.8537 0.9385 0.9814 -0.1473 0.1628  0.0377  634 TYR A CZ  
198  O OH  . TYR A 43  ? 0.9543 1.0629 1.0921 -0.1537 0.1811  0.0326  634 TYR A OH  
199  N N   . LYS A 44  ? 0.5422 0.5201 0.6440 -0.1109 0.0798  0.0575  635 LYS A N   
200  C CA  . LYS A 44  ? 0.5470 0.5043 0.6331 -0.1037 0.0684  0.0639  635 LYS A CA  
201  C C   . LYS A 44  ? 0.6084 0.5625 0.6705 -0.1101 0.0735  0.0752  635 LYS A C   
202  O O   . LYS A 44  ? 0.5905 0.5516 0.6494 -0.1224 0.0839  0.0800  635 LYS A O   
203  C CB  . LYS A 44  ? 0.5925 0.5302 0.6855 -0.1062 0.0594  0.0683  635 LYS A CB  
204  C CG  . LYS A 44  ? 0.5444 0.4624 0.6252 -0.0944 0.0475  0.0713  635 LYS A CG  
205  C CD  . LYS A 44  ? 0.6443 0.5396 0.7304 -0.0957 0.0387  0.0739  635 LYS A CD  
206  C CE  . LYS A 44  ? 0.6877 0.5653 0.7623 -0.0822 0.0286  0.0761  635 LYS A CE  
207  N NZ  . LYS A 44  ? 0.7917 0.6442 0.8708 -0.0817 0.0198  0.0763  635 LYS A NZ  
208  N N   . GLY A 45  ? 0.5833 0.5290 0.6288 -0.1017 0.0662  0.0793  636 GLY A N   
209  C CA  . GLY A 45  ? 0.5906 0.5334 0.6123 -0.1066 0.0680  0.0904  636 GLY A CA  
210  C C   . GLY A 45  ? 0.6564 0.5858 0.6664 -0.0967 0.0558  0.0974  636 GLY A C   
211  O O   . GLY A 45  ? 0.6470 0.5687 0.6670 -0.0858 0.0471  0.0932  636 GLY A O   
212  N N   . ARG A 46  ? 0.6320 0.5598 0.6204 -0.1004 0.0552  0.1082  637 ARG A N   
213  C CA  . ARG A 46  ? 0.6261 0.5448 0.6034 -0.0914 0.0436  0.1166  637 ARG A CA  
214  C C   . ARG A 46  ? 0.6325 0.5662 0.5938 -0.0913 0.0446  0.1155  637 ARG A C   
215  O O   . ARG A 46  ? 0.6259 0.5683 0.5733 -0.1020 0.0533  0.1163  637 ARG A O   
216  C CB  . ARG A 46  ? 0.6464 0.5453 0.6122 -0.0963 0.0386  0.1337  637 ARG A CB  
217  C CG  . ARG A 46  ? 0.8011 0.6796 0.7820 -0.0952 0.0345  0.1351  637 ARG A CG  
218  C CD  . ARG A 46  ? 0.9912 0.8498 0.9599 -0.1048 0.0330  0.1527  637 ARG A CD  
219  N NE  . ARG A 46  ? 1.2142 1.0525 1.1974 -0.1079 0.0309  0.1530  637 ARG A NE  
220  C CZ  . ARG A 46  ? 1.4390 1.2538 1.4275 -0.0980 0.0198  0.1557  637 ARG A CZ  
221  N NH1 . ARG A 46  ? 1.2357 1.0464 1.2179 -0.0831 0.0102  0.1591  637 ARG A NH1 
222  N NH2 . ARG A 46  ? 1.3139 1.1095 1.3147 -0.1028 0.0182  0.1544  637 ARG A NH2 
223  N N   . LEU A 47  ? 0.5829 0.5206 0.5465 -0.0799 0.0363  0.1125  638 LEU A N   
224  C CA  . LEU A 47  ? 0.5795 0.5311 0.5298 -0.0801 0.0351  0.1109  638 LEU A CA  
225  C C   . LEU A 47  ? 0.6533 0.6013 0.5942 -0.0741 0.0228  0.1232  638 LEU A C   
226  O O   . LEU A 47  ? 0.6379 0.5801 0.5914 -0.0621 0.0146  0.1245  638 LEU A O   
227  C CB  . LEU A 47  ? 0.5416 0.5057 0.5042 -0.0737 0.0369  0.0961  638 LEU A CB  
228  C CG  . LEU A 47  ? 0.5846 0.5619 0.5354 -0.0745 0.0345  0.0934  638 LEU A CG  
229  C CD1 . LEU A 47  ? 0.5918 0.5755 0.5256 -0.0866 0.0440  0.0897  638 LEU A CD1 
230  C CD2 . LEU A 47  ? 0.5816 0.5668 0.5469 -0.0667 0.0337  0.0820  638 LEU A CD2 
231  N N   . LYS A 48  ? 0.6403 0.5924 0.5589 -0.0819 0.0213  0.1320  639 LYS A N   
232  C CA  . LYS A 48  ? 0.6718 0.6239 0.5810 -0.0767 0.0083  0.1446  639 LYS A CA  
233  C C   . LYS A 48  ? 0.7437 0.7140 0.6410 -0.0794 0.0052  0.1410  639 LYS A C   
234  O O   . LYS A 48  ? 0.7410 0.7164 0.6163 -0.0910 0.0093  0.1421  639 LYS A O   
235  C CB  . LYS A 48  ? 0.7559 0.6929 0.6491 -0.0817 0.0041  0.1627  639 LYS A CB  
236  C CG  . LYS A 48  ? 0.8637 0.7910 0.7655 -0.0680 -0.0099 0.1735  639 LYS A CG  
237  C CD  . LYS A 48  ? 0.8885 0.8148 0.7704 -0.0697 -0.0205 0.1909  639 LYS A CD  
238  C CE  . LYS A 48  ? 0.8772 0.8071 0.7716 -0.0535 -0.0349 0.1965  639 LYS A CE  
239  N NZ  . LYS A 48  ? 0.9621 0.9179 0.8551 -0.0527 -0.0395 0.1908  639 LYS A NZ  
240  N N   . LEU A 49  ? 0.7103 0.6907 0.6221 -0.0694 -0.0013 0.1356  640 LEU A N   
241  C CA  . LEU A 49  ? 0.7188 0.7169 0.6232 -0.0720 -0.0060 0.1321  640 LEU A CA  
242  C C   . LEU A 49  ? 0.8177 0.8191 0.7126 -0.0692 -0.0202 0.1478  640 LEU A C   
243  O O   . LEU A 49  ? 0.7981 0.7895 0.7020 -0.0594 -0.0268 0.1582  640 LEU A O   
244  C CB  . LEU A 49  ? 0.6885 0.6971 0.6138 -0.0640 -0.0060 0.1204  640 LEU A CB  
245  C CG  . LEU A 49  ? 0.7271 0.7336 0.6619 -0.0659 0.0061  0.1053  640 LEU A CG  
246  C CD1 . LEU A 49  ? 0.7046 0.7219 0.6549 -0.0598 0.0046  0.0965  640 LEU A CD1 
247  C CD2 . LEU A 49  ? 0.7504 0.7575 0.6677 -0.0791 0.0159  0.0982  640 LEU A CD2 
248  N N   . PRO A 50  ? 0.8500 0.8639 0.7257 -0.0777 -0.0255 0.1499  641 PRO A N   
249  C CA  . PRO A 50  ? 0.8744 0.8933 0.7411 -0.0749 -0.0410 0.1662  641 PRO A CA  
250  C C   . PRO A 50  ? 0.8699 0.8969 0.7622 -0.0589 -0.0519 0.1706  641 PRO A C   
251  O O   . PRO A 50  ? 0.8388 0.8792 0.7491 -0.0546 -0.0506 0.1598  641 PRO A O   
252  C CB  . PRO A 50  ? 0.9156 0.9503 0.7610 -0.0872 -0.0445 0.1622  641 PRO A CB  
253  C CG  . PRO A 50  ? 0.9408 0.9811 0.7944 -0.0914 -0.0330 0.1421  641 PRO A CG  
254  C CD  . PRO A 50  ? 0.8764 0.9002 0.7380 -0.0897 -0.0190 0.1372  641 PRO A CD  
255  N N   . GLY A 51  ? 0.8271 0.8444 0.7217 -0.0497 -0.0613 0.1862  642 GLY A N   
256  C CA  . GLY A 51  ? 0.8069 0.8309 0.7258 -0.0325 -0.0715 0.1916  642 GLY A CA  
257  C C   . GLY A 51  ? 0.8134 0.8318 0.7581 -0.0206 -0.0639 0.1810  642 GLY A C   
258  O O   . GLY A 51  ? 0.8046 0.8339 0.7708 -0.0065 -0.0697 0.1813  642 GLY A O   
259  N N   . LYS A 52  ? 0.7385 0.7412 0.6812 -0.0260 -0.0508 0.1715  643 LYS A N   
260  C CA  . LYS A 52  ? 0.7036 0.6993 0.6668 -0.0167 -0.0434 0.1604  643 LYS A CA  
261  C C   . LYS A 52  ? 0.7593 0.7276 0.7201 -0.0164 -0.0392 0.1638  643 LYS A C   
262  O O   . LYS A 52  ? 0.7539 0.7113 0.6967 -0.0284 -0.0358 0.1694  643 LYS A O   
263  C CB  . LYS A 52  ? 0.6874 0.6924 0.6532 -0.0244 -0.0324 0.1440  643 LYS A CB  
264  C CG  . LYS A 52  ? 0.7917 0.8213 0.7593 -0.0277 -0.0354 0.1393  643 LYS A CG  
265  C CD  . LYS A 52  ? 0.8301 0.8697 0.8182 -0.0199 -0.0315 0.1286  643 LYS A CD  
266  C CE  . LYS A 52  ? 0.8343 0.8679 0.8224 -0.0261 -0.0197 0.1152  643 LYS A CE  
267  N NZ  . LYS A 52  ? 0.9432 0.9773 0.9501 -0.0152 -0.0161 0.1079  643 LYS A NZ  
268  N N   . ARG A 53  ? 0.7217 0.6792 0.7002 -0.0034 -0.0389 0.1599  644 ARG A N   
269  C CA  . ARG A 53  ? 0.7425 0.6725 0.7216 -0.0030 -0.0357 0.1611  644 ARG A CA  
270  C C   . ARG A 53  ? 0.7687 0.6961 0.7420 -0.0174 -0.0234 0.1511  644 ARG A C   
271  O O   . ARG A 53  ? 0.7275 0.6707 0.7054 -0.0202 -0.0171 0.1388  644 ARG A O   
272  C CB  . ARG A 53  ? 0.7793 0.7009 0.7783 0.0135  -0.0365 0.1536  644 ARG A CB  
273  C CG  . ARG A 53  ? 0.9545 0.8890 0.9668 0.0307  -0.0452 0.1569  644 ARG A CG  
274  C CD  . ARG A 53  ? 1.0404 1.0010 1.0654 0.0351  -0.0409 0.1445  644 ARG A CD  
275  N NE  . ARG A 53  ? 1.0774 1.0645 1.0983 0.0285  -0.0443 0.1481  644 ARG A NE  
276  C CZ  . ARG A 53  ? 1.1850 1.1947 1.2126 0.0261  -0.0402 0.1389  644 ARG A CZ  
277  N NH1 . ARG A 53  ? 0.9955 1.0055 1.0330 0.0302  -0.0323 0.1264  644 ARG A NH1 
278  N NH2 . ARG A 53  ? 1.0376 1.0689 1.0609 0.0189  -0.0445 0.1424  644 ARG A NH2 
279  N N   . GLU A 54  ? 0.7238 0.6322 0.6878 -0.0268 -0.0201 0.1573  645 GLU A N   
280  C CA  . GLU A 54  ? 0.7046 0.6112 0.6671 -0.0393 -0.0085 0.1487  645 GLU A CA  
281  C C   . GLU A 54  ? 0.7267 0.6305 0.7086 -0.0321 -0.0048 0.1341  645 GLU A C   
282  O O   . GLU A 54  ? 0.7352 0.6269 0.7278 -0.0200 -0.0104 0.1335  645 GLU A O   
283  C CB  . GLU A 54  ? 0.7431 0.6292 0.6954 -0.0497 -0.0065 0.1599  645 GLU A CB  
284  C CG  . GLU A 54  ? 0.8563 0.7466 0.8047 -0.0653 0.0063  0.1539  645 GLU A CG  
285  C CD  . GLU A 54  ? 1.0980 0.9689 1.0387 -0.0766 0.0091  0.1656  645 GLU A CD  
286  O OE1 . GLU A 54  ? 0.9025 0.7537 0.8555 -0.0736 0.0066  0.1658  645 GLU A OE1 
287  O OE2 . GLU A 54  ? 0.8882 0.7630 0.8099 -0.0893 0.0140  0.1742  645 GLU A OE2 
288  N N   . ILE A 55  ? 0.6322 0.5478 0.6179 -0.0387 0.0042  0.1220  646 ILE A N   
289  C CA  . ILE A 55  ? 0.5864 0.5009 0.5881 -0.0336 0.0074  0.1087  646 ILE A CA  
290  C C   . ILE A 55  ? 0.6009 0.5122 0.6056 -0.0454 0.0161  0.1036  646 ILE A C   
291  O O   . ILE A 55  ? 0.5830 0.4993 0.5776 -0.0572 0.0222  0.1075  646 ILE A O   
292  C CB  . ILE A 55  ? 0.5861 0.5199 0.5940 -0.0271 0.0083  0.0986  646 ILE A CB  
293  C CG1 . ILE A 55  ? 0.5538 0.5039 0.5531 -0.0372 0.0147  0.0953  646 ILE A CG1 
294  C CG2 . ILE A 55  ? 0.5957 0.5345 0.6066 -0.0140 0.0001  0.1026  646 ILE A CG2 
295  C CD1 . ILE A 55  ? 0.4821 0.4461 0.4896 -0.0336 0.0177  0.0834  646 ILE A CD1 
296  N N   . PTR A 56  ? 0.5868 0.4911 0.6054 -0.0423 0.0165  0.0949  647 PTR A N   
297  C CA  . PTR A 56  ? 0.6026 0.5087 0.6291 -0.0524 0.0240  0.0886  647 PTR A CA  
298  C C   . PTR A 56  ? 0.5958 0.5220 0.6267 -0.0515 0.0295  0.0776  647 PTR A C   
299  O O   . PTR A 56  ? 0.5663 0.4991 0.5991 -0.0416 0.0260  0.0727  647 PTR A O   
300  C CB  . PTR A 56  ? 0.6866 0.5794 0.7269 -0.0501 0.0209  0.0822  647 PTR A CB  
301  C CG  . PTR A 56  ? 0.8135 0.6835 0.8503 -0.0551 0.0171  0.0927  647 PTR A CG  
302  C CD1 . PTR A 56  ? 0.8668 0.7173 0.9052 -0.0438 0.0080  0.0931  647 PTR A CD1 
303  C CD2 . PTR A 56  ? 0.8684 0.7353 0.8997 -0.0704 0.0230  0.1021  647 PTR A CD2 
304  C CE1 . PTR A 56  ? 0.9320 0.7572 0.9672 -0.0476 0.0037  0.1029  647 PTR A CE1 
305  C CE2 . PTR A 56  ? 0.9414 0.7840 0.9690 -0.0754 0.0188  0.1131  647 PTR A CE2 
306  C CZ  . PTR A 56  ? 0.9964 0.8163 1.0263 -0.0640 0.0086  0.1136  647 PTR A CZ  
307  O OH  . PTR A 56  ? 1.1156 0.9085 1.1411 -0.0693 0.0043  0.1254  647 PTR A OH  
308  P P   . PTR A 56  ? 1.2027 0.9696 1.2397 -0.0692 -0.0015 0.1195  647 PTR A P   
309  O O1P . PTR A 56  ? 1.2532 0.9906 1.2827 -0.0787 -0.0046 0.1359  647 PTR A O1P 
310  O O2P . PTR A 56  ? 1.1939 0.9744 1.2462 -0.0801 0.0044  0.1072  647 PTR A O2P 
311  O O3P . PTR A 56  ? 1.2093 0.9647 1.2486 -0.0490 -0.0105 0.1112  647 PTR A O3P 
312  N N   . VAL A 57  ? 0.5326 0.4685 0.5649 -0.0617 0.0386  0.0744  648 VAL A N   
313  C CA  . VAL A 57  ? 0.4924 0.4447 0.5299 -0.0609 0.0444  0.0639  648 VAL A CA  
314  C C   . VAL A 57  ? 0.4982 0.4566 0.5504 -0.0674 0.0517  0.0569  648 VAL A C   
315  O O   . VAL A 57  ? 0.5081 0.4610 0.5636 -0.0759 0.0543  0.0615  648 VAL A O   
316  C CB  . VAL A 57  ? 0.5233 0.4859 0.5448 -0.0655 0.0491  0.0659  648 VAL A CB  
317  C CG1 . VAL A 57  ? 0.5170 0.4806 0.5295 -0.0579 0.0412  0.0695  648 VAL A CG1 
318  C CG2 . VAL A 57  ? 0.5287 0.4896 0.5374 -0.0778 0.0552  0.0744  648 VAL A CG2 
319  N N   . ALA A 58  ? 0.4249 0.3952 0.4862 -0.0639 0.0551  0.0466  649 ALA A N   
320  C CA  . ALA A 58  ? 0.4143 0.3950 0.4909 -0.0692 0.0630  0.0399  649 ALA A CA  
321  C C   . ALA A 58  ? 0.4744 0.4668 0.5425 -0.0735 0.0734  0.0367  649 ALA A C   
322  O O   . ALA A 58  ? 0.4778 0.4707 0.5333 -0.0697 0.0719  0.0360  649 ALA A O   
323  C CB  . ALA A 58  ? 0.3959 0.3805 0.4897 -0.0611 0.0586  0.0308  649 ALA A CB  
324  N N   . ILE A 59  ? 0.4707 0.4726 0.5447 -0.0821 0.0841  0.0350  650 ILE A N   
325  C CA  . ILE A 59  ? 0.4696 0.4816 0.5335 -0.0865 0.0954  0.0309  650 ILE A CA  
326  C C   . ILE A 59  ? 0.5274 0.5545 0.6114 -0.0860 0.1053  0.0201  650 ILE A C   
327  O O   . ILE A 59  ? 0.5247 0.5597 0.6232 -0.0925 0.1112  0.0209  650 ILE A O   
328  C CB  . ILE A 59  ? 0.5203 0.5301 0.5643 -0.0984 0.1013  0.0410  650 ILE A CB  
329  C CG1 . ILE A 59  ? 0.5216 0.5164 0.5479 -0.0974 0.0900  0.0530  650 ILE A CG1 
330  C CG2 . ILE A 59  ? 0.5367 0.5566 0.5656 -0.1031 0.1132  0.0354  650 ILE A CG2 
331  C CD1 . ILE A 59  ? 0.6108 0.5987 0.6241 -0.1083 0.0921  0.0662  650 ILE A CD1 
332  N N   . LYS A 60  ? 0.4804 0.5116 0.5658 -0.0788 0.1073  0.0104  651 LYS A N   
333  C CA  . LYS A 60  ? 0.4755 0.5205 0.5797 -0.0761 0.1169  -0.0004 651 LYS A CA  
334  C C   . LYS A 60  ? 0.5440 0.5961 0.6333 -0.0836 0.1314  -0.0036 651 LYS A C   
335  O O   . LYS A 60  ? 0.5336 0.5785 0.5985 -0.0852 0.1311  -0.0030 651 LYS A O   
336  C CB  . LYS A 60  ? 0.4884 0.5308 0.5995 -0.0643 0.1120  -0.0088 651 LYS A CB  
337  C CG  . LYS A 60  ? 0.5730 0.6200 0.7110 -0.0567 0.1055  -0.0117 651 LYS A CG  
338  C CD  . LYS A 60  ? 0.5673 0.6126 0.7120 -0.0457 0.1034  -0.0198 651 LYS A CD  
339  C CE  . LYS A 60  ? 0.6254 0.6732 0.7919 -0.0376 0.0936  -0.0204 651 LYS A CE  
340  N NZ  . LYS A 60  ? 0.6017 0.6453 0.7726 -0.0271 0.0911  -0.0263 651 LYS A NZ  
341  N N   . THR A 61  ? 0.5140 0.5816 0.6176 -0.0890 0.1441  -0.0067 652 THR A N   
342  C CA  . THR A 61  ? 0.5405 0.6173 0.6302 -0.0962 0.1603  -0.0108 652 THR A CA  
343  C C   . THR A 61  ? 0.5810 0.6728 0.6916 -0.0892 0.1718  -0.0253 652 THR A C   
344  O O   . THR A 61  ? 0.5559 0.6543 0.6959 -0.0809 0.1676  -0.0295 652 THR A O   
345  C CB  . THR A 61  ? 0.6919 0.7753 0.7773 -0.1101 0.1679  -0.0005 652 THR A CB  
346  O OG1 . THR A 61  ? 0.6555 0.7492 0.7728 -0.1107 0.1671  0.0006  652 THR A OG1 
347  C CG2 . THR A 61  ? 0.6821 0.7484 0.7412 -0.1169 0.1580  0.0141  652 THR A CG2 
348  N N   . LEU A 62  ? 0.5398 0.6367 0.6346 -0.0920 0.1860  -0.0333 653 LEU A N   
349  C CA  . LEU A 62  ? 0.5251 0.6354 0.6367 -0.0846 0.1993  -0.0485 653 LEU A CA  
350  C C   . LEU A 62  ? 0.5350 0.6646 0.6457 -0.0951 0.2183  -0.0488 653 LEU A C   
351  O O   . LEU A 62  ? 0.5553 0.6815 0.6344 -0.1055 0.2251  -0.0452 653 LEU A O   
352  C CB  . LEU A 62  ? 0.5346 0.6309 0.6249 -0.0785 0.1995  -0.0592 653 LEU A CB  
353  C CG  . LEU A 62  ? 0.6060 0.7098 0.7063 -0.0701 0.2136  -0.0768 653 LEU A CG  
354  C CD1 . LEU A 62  ? 0.5965 0.7058 0.7345 -0.0562 0.2092  -0.0822 653 LEU A CD1 
355  C CD2 . LEU A 62  ? 0.6340 0.7192 0.7064 -0.0681 0.2123  -0.0858 653 LEU A CD2 
356  N N   . LYS A 63  ? 0.4592 0.6102 0.6047 -0.0935 0.2261  -0.0517 654 LYS A N   
357  C CA  . LYS A 63  ? 0.4454 0.6194 0.5974 -0.1041 0.2449  -0.0509 654 LYS A CA  
358  C C   . LYS A 63  ? 0.4984 0.6778 0.6265 -0.1062 0.2639  -0.0617 654 LYS A C   
359  O O   . LYS A 63  ? 0.4917 0.6648 0.6162 -0.0947 0.2661  -0.0760 654 LYS A O   
360  C CB  . LYS A 63  ? 0.4527 0.6518 0.6518 -0.0995 0.2492  -0.0549 654 LYS A CB  
361  C CG  . LYS A 63  ? 0.4946 0.6905 0.7137 -0.1024 0.2320  -0.0430 654 LYS A CG  
362  C CD  . LYS A 63  ? 0.4263 0.6461 0.6930 -0.0955 0.2321  -0.0486 654 LYS A CD  
363  C CE  . LYS A 63  ? 0.6440 0.8694 0.9284 -0.1070 0.2237  -0.0364 654 LYS A CE  
364  N NZ  . LYS A 63  ? 0.7923 1.0409 1.1235 -0.1006 0.2198  -0.0414 654 LYS A NZ  
365  N N   . ALA A 64  ? 0.4730 0.6620 0.5819 -0.1215 0.2775  -0.0545 655 ALA A N   
366  C CA  . ALA A 64  ? 0.5003 0.6955 0.5817 -0.1255 0.2967  -0.0641 655 ALA A CA  
367  C C   . ALA A 64  ? 0.5530 0.7715 0.6644 -0.1146 0.3147  -0.0826 655 ALA A C   
368  O O   . ALA A 64  ? 0.5208 0.7606 0.6738 -0.1115 0.3179  -0.0824 655 ALA A O   
369  C CB  . ALA A 64  ? 0.5393 0.7425 0.5977 -0.1446 0.3077  -0.0505 655 ALA A CB  
370  N N   . GLY A 65  ? 0.5322 0.7457 0.6229 -0.1083 0.3251  -0.0987 656 GLY A N   
371  C CA  . GLY A 65  ? 0.5459 0.7773 0.6611 -0.0954 0.3423  -0.1185 656 GLY A CA  
372  C C   . GLY A 65  ? 0.5636 0.7814 0.7023 -0.0761 0.3290  -0.1288 656 GLY A C   
373  O O   . GLY A 65  ? 0.5406 0.7733 0.7118 -0.0624 0.3385  -0.1424 656 GLY A O   
374  N N   . TYR A 66  ? 0.5345 0.7244 0.6576 -0.0748 0.3070  -0.1217 657 TYR A N   
375  C CA  . TYR A 66  ? 0.5357 0.7085 0.6751 -0.0585 0.2926  -0.1287 657 TYR A CA  
376  C C   . TYR A 66  ? 0.6068 0.7687 0.7337 -0.0481 0.3028  -0.1494 657 TYR A C   
377  O O   . TYR A 66  ? 0.6169 0.7756 0.7090 -0.0559 0.3153  -0.1567 657 TYR A O   
378  C CB  . TYR A 66  ? 0.5663 0.7132 0.6871 -0.0620 0.2689  -0.1156 657 TYR A CB  
379  C CG  . TYR A 66  ? 0.6489 0.7776 0.7214 -0.0733 0.2666  -0.1127 657 TYR A CG  
380  C CD1 . TYR A 66  ? 0.6955 0.8049 0.7443 -0.0689 0.2663  -0.1259 657 TYR A CD1 
381  C CD2 . TYR A 66  ? 0.6812 0.8105 0.7321 -0.0885 0.2629  -0.0964 657 TYR A CD2 
382  C CE1 . TYR A 66  ? 0.7392 0.8340 0.7445 -0.0800 0.2628  -0.1235 657 TYR A CE1 
383  C CE2 . TYR A 66  ? 0.7232 0.8369 0.7310 -0.0981 0.2585  -0.0926 657 TYR A CE2 
384  C CZ  . TYR A 66  ? 0.8626 0.9605 0.8479 -0.0941 0.2582  -0.1064 657 TYR A CZ  
385  O OH  . TYR A 66  ? 0.9062 0.9909 0.8499 -0.1044 0.2525  -0.1028 657 TYR A OH  
386  N N   . SER A 67  ? 0.5632 0.7177 0.7170 -0.0306 0.2968  -0.1589 658 SER A N   
387  C CA  . SER A 67  ? 0.5767 0.7150 0.7208 -0.0193 0.3041  -0.1788 658 SER A CA  
388  C C   . SER A 67  ? 0.6264 0.7302 0.7371 -0.0231 0.2865  -0.1758 658 SER A C   
389  O O   . SER A 67  ? 0.5780 0.6748 0.6838 -0.0300 0.2691  -0.1590 658 SER A O   
390  C CB  . SER A 67  ? 0.5951 0.7381 0.7832 0.0013  0.3037  -0.1881 658 SER A CB  
391  O OG  . SER A 67  ? 0.6571 0.7850 0.8604 0.0076  0.2808  -0.1772 658 SER A OG  
392  N N   . GLU A 68  ? 0.6393 0.7224 0.7279 -0.0190 0.2912  -0.1923 659 GLU A N   
393  C CA  . GLU A 68  ? 0.6638 0.7155 0.7228 -0.0235 0.2752  -0.1910 659 GLU A CA  
394  C C   . GLU A 68  ? 0.6942 0.7304 0.7763 -0.0138 0.2552  -0.1827 659 GLU A C   
395  O O   . GLU A 68  ? 0.6551 0.6760 0.7206 -0.0212 0.2384  -0.1711 659 GLU A O   
396  C CB  . GLU A 68  ? 0.7312 0.7639 0.7618 -0.0225 0.2851  -0.2120 659 GLU A CB  
397  C CG  . GLU A 68  ? 1.0160 1.0533 1.0030 -0.0393 0.2945  -0.2138 659 GLU A CG  
398  C CD  . GLU A 68  ? 1.4165 1.4513 1.3790 -0.0555 0.2786  -0.1934 659 GLU A CD  
399  O OE1 . GLU A 68  ? 1.4129 1.4262 1.3662 -0.0573 0.2601  -0.1881 659 GLU A OE1 
400  O OE2 . GLU A 68  ? 1.2960 1.3507 1.2507 -0.0660 0.2845  -0.1821 659 GLU A OE2 
401  N N   . LYS A 69  ? 0.6549 0.6984 0.7766 0.0027  0.2572  -0.1873 660 LYS A N   
402  C CA  . LYS A 69  ? 0.6283 0.6602 0.7749 0.0135  0.2397  -0.1792 660 LYS A CA  
403  C C   . LYS A 69  ? 0.6072 0.6517 0.7613 0.0058  0.2265  -0.1587 660 LYS A C   
404  O O   . LYS A 69  ? 0.6035 0.6320 0.7534 0.0051  0.2089  -0.1481 660 LYS A O   
405  C CB  . LYS A 69  ? 0.6733 0.7153 0.8614 0.0330  0.2461  -0.1886 660 LYS A CB  
406  C CG  . LYS A 69  ? 0.9378 0.9602 1.1452 0.0459  0.2283  -0.1832 660 LYS A CG  
407  C CD  . LYS A 69  ? 1.0958 1.1398 1.3422 0.0539  0.2196  -0.1714 660 LYS A CD  
408  C CE  . LYS A 69  ? 1.2772 1.3358 1.5633 0.0728  0.2282  -0.1820 660 LYS A CE  
409  N NZ  . LYS A 69  ? 1.3582 1.4413 1.6819 0.0786  0.2185  -0.1701 660 LYS A NZ  
410  N N   . GLN A 70  ? 0.5202 0.5929 0.6851 -0.0005 0.2355  -0.1533 661 GLN A N   
411  C CA  . GLN A 70  ? 0.4782 0.5617 0.6497 -0.0086 0.2241  -0.1351 661 GLN A CA  
412  C C   . GLN A 70  ? 0.5209 0.5879 0.6564 -0.0220 0.2130  -0.1242 661 GLN A C   
413  O O   . GLN A 70  ? 0.4842 0.5458 0.6230 -0.0233 0.1972  -0.1111 661 GLN A O   
414  C CB  . GLN A 70  ? 0.4881 0.6024 0.6756 -0.0148 0.2372  -0.1323 661 GLN A CB  
415  C CG  . GLN A 70  ? 0.5098 0.6457 0.7434 -0.0017 0.2411  -0.1368 661 GLN A CG  
416  C CD  . GLN A 70  ? 0.5666 0.7356 0.8179 -0.0090 0.2563  -0.1354 661 GLN A CD  
417  O OE1 . GLN A 70  ? 0.4915 0.6701 0.7257 -0.0170 0.2745  -0.1415 661 GLN A OE1 
418  N NE2 . GLN A 70  ? 0.4687 0.6566 0.7549 -0.0069 0.2494  -0.1276 661 GLN A NE2 
419  N N   . ARG A 71  ? 0.5302 0.5908 0.6318 -0.0317 0.2215  -0.1298 662 ARG A N   
420  C CA  . ARG A 71  ? 0.5402 0.5871 0.6068 -0.0442 0.2117  -0.1208 662 ARG A CA  
421  C C   . ARG A 71  ? 0.6020 0.6247 0.6633 -0.0396 0.1954  -0.1197 662 ARG A C   
422  O O   . ARG A 71  ? 0.6005 0.6178 0.6556 -0.0442 0.1809  -0.1061 662 ARG A O   
423  C CB  . ARG A 71  ? 0.5482 0.5943 0.5803 -0.0541 0.2248  -0.1299 662 ARG A CB  
424  C CG  . ARG A 71  ? 0.5850 0.6217 0.5820 -0.0679 0.2143  -0.1188 662 ARG A CG  
425  C CD  . ARG A 71  ? 0.6964 0.7272 0.6564 -0.0763 0.2237  -0.1300 662 ARG A CD  
426  N NE  . ARG A 71  ? 0.8616 0.8805 0.7904 -0.0872 0.2097  -0.1212 662 ARG A NE  
427  C CZ  . ARG A 71  ? 0.9265 0.9527 0.8341 -0.0990 0.2071  -0.1078 662 ARG A CZ  
428  N NH1 . ARG A 71  ? 0.8018 0.8456 0.7136 -0.1032 0.2184  -0.1015 662 ARG A NH1 
429  N NH2 . ARG A 71  ? 0.7222 0.7386 0.6048 -0.1070 0.1933  -0.1003 662 ARG A NH2 
430  N N   . ARG A 72  ? 0.5789 0.5873 0.6439 -0.0303 0.1985  -0.1339 663 ARG A N   
431  C CA  . ARG A 72  ? 0.5887 0.5726 0.6505 -0.0261 0.1850  -0.1342 663 ARG A CA  
432  C C   . ARG A 72  ? 0.6096 0.5947 0.6960 -0.0191 0.1708  -0.1207 663 ARG A C   
433  O O   . ARG A 72  ? 0.6117 0.5851 0.6880 -0.0230 0.1570  -0.1110 663 ARG A O   
434  C CB  . ARG A 72  ? 0.6262 0.5952 0.6939 -0.0154 0.1930  -0.1523 663 ARG A CB  
435  C CG  . ARG A 72  ? 0.8878 0.8298 0.9277 -0.0212 0.1880  -0.1599 663 ARG A CG  
436  C CD  . ARG A 72  ? 1.0283 0.9515 1.0754 -0.0097 0.1954  -0.1784 663 ARG A CD  
437  N NE  . ARG A 72  ? 1.0747 1.0091 1.1199 -0.0065 0.2153  -0.1950 663 ARG A NE  
438  C CZ  . ARG A 72  ? 1.1892 1.1342 1.2643 0.0086  0.2264  -0.2035 663 ARG A CZ  
439  N NH1 . ARG A 72  ? 0.9994 0.9442 1.1081 0.0219  0.2179  -0.1965 663 ARG A NH1 
440  N NH2 . ARG A 72  ? 1.0272 0.9845 1.0990 0.0107  0.2460  -0.2190 663 ARG A NH2 
441  N N   . ASP A 73  ? 0.5446 0.5454 0.6630 -0.0090 0.1742  -0.1203 664 ASP A N   
442  C CA  . ASP A 73  ? 0.5311 0.5350 0.6729 -0.0021 0.1609  -0.1087 664 ASP A CA  
443  C C   . ASP A 73  ? 0.5608 0.5726 0.6941 -0.0121 0.1521  -0.0935 664 ASP A C   
444  O O   . ASP A 73  ? 0.5468 0.5501 0.6802 -0.0108 0.1382  -0.0838 664 ASP A O   
445  C CB  . ASP A 73  ? 0.5489 0.5708 0.7272 0.0099  0.1663  -0.1126 664 ASP A CB  
446  C CG  . ASP A 73  ? 0.6750 0.6877 0.8677 0.0239  0.1726  -0.1266 664 ASP A CG  
447  O OD1 . ASP A 73  ? 0.6750 0.6625 0.8509 0.0251  0.1696  -0.1318 664 ASP A OD1 
448  O OD2 . ASP A 73  ? 0.7935 0.8242 1.0155 0.0337  0.1804  -0.1324 664 ASP A OD2 
449  N N   . PHE A 74  ? 0.5188 0.5458 0.6437 -0.0220 0.1607  -0.0915 665 PHE A N   
450  C CA  . PHE A 74  ? 0.4929 0.5256 0.6089 -0.0316 0.1535  -0.0774 665 PHE A CA  
451  C C   . PHE A 74  ? 0.5643 0.5803 0.6542 -0.0373 0.1425  -0.0709 665 PHE A C   
452  O O   . PHE A 74  ? 0.5525 0.5652 0.6446 -0.0367 0.1300  -0.0603 665 PHE A O   
453  C CB  . PHE A 74  ? 0.5068 0.5551 0.6141 -0.0421 0.1664  -0.0768 665 PHE A CB  
454  C CG  . PHE A 74  ? 0.4911 0.5422 0.5875 -0.0524 0.1596  -0.0621 665 PHE A CG  
455  C CD1 . PHE A 74  ? 0.4897 0.5490 0.6074 -0.0513 0.1529  -0.0533 665 PHE A CD1 
456  C CD2 . PHE A 74  ? 0.5032 0.5476 0.5681 -0.0628 0.1589  -0.0571 665 PHE A CD2 
457  C CE1 . PHE A 74  ? 0.4893 0.5474 0.5968 -0.0599 0.1462  -0.0403 665 PHE A CE1 
458  C CE2 . PHE A 74  ? 0.5195 0.5649 0.5755 -0.0708 0.1523  -0.0429 665 PHE A CE2 
459  C CZ  . PHE A 74  ? 0.4735 0.5247 0.5510 -0.0691 0.1466  -0.0350 665 PHE A CZ  
460  N N   . LEU A 75  ? 0.5493 0.5554 0.6151 -0.0426 0.1471  -0.0783 666 LEU A N   
461  C CA  . LEU A 75  ? 0.5452 0.5387 0.5868 -0.0495 0.1374  -0.0732 666 LEU A CA  
462  C C   . LEU A 75  ? 0.6447 0.6229 0.6918 -0.0434 0.1264  -0.0724 666 LEU A C   
463  O O   . LEU A 75  ? 0.6331 0.6057 0.6676 -0.0484 0.1161  -0.0642 666 LEU A O   
464  C CB  . LEU A 75  ? 0.5597 0.5492 0.5732 -0.0586 0.1452  -0.0818 666 LEU A CB  
465  C CG  . LEU A 75  ? 0.6024 0.6058 0.6011 -0.0683 0.1534  -0.0778 666 LEU A CG  
466  C CD1 . LEU A 75  ? 0.6094 0.6082 0.5779 -0.0768 0.1605  -0.0873 666 LEU A CD1 
467  C CD2 . LEU A 75  ? 0.6138 0.6215 0.6076 -0.0739 0.1423  -0.0603 666 LEU A CD2 
468  N N   . SER A 76  ? 0.6155 0.5876 0.6821 -0.0325 0.1283  -0.0798 667 SER A N   
469  C CA  . SER A 76  ? 0.5987 0.5548 0.6700 -0.0271 0.1179  -0.0772 667 SER A CA  
470  C C   . SER A 76  ? 0.5988 0.5605 0.6778 -0.0256 0.1061  -0.0626 667 SER A C   
471  O O   . SER A 76  ? 0.5897 0.5414 0.6623 -0.0269 0.0968  -0.0564 667 SER A O   
472  C CB  . SER A 76  ? 0.6685 0.6159 0.7589 -0.0148 0.1217  -0.0867 667 SER A CB  
473  O OG  . SER A 76  ? 0.8282 0.7869 0.9450 -0.0049 0.1190  -0.0818 667 SER A OG  
474  N N   . GLU A 77  ? 0.5403 0.5181 0.6318 -0.0242 0.1070  -0.0574 668 GLU A N   
475  C CA  . GLU A 77  ? 0.5233 0.5057 0.6198 -0.0232 0.0964  -0.0453 668 GLU A CA  
476  C C   . GLU A 77  ? 0.5514 0.5319 0.6267 -0.0322 0.0910  -0.0374 668 GLU A C   
477  O O   . GLU A 77  ? 0.5387 0.5146 0.6120 -0.0307 0.0818  -0.0303 668 GLU A O   
478  C CB  . GLU A 77  ? 0.5292 0.5272 0.6427 -0.0216 0.0981  -0.0425 668 GLU A CB  
479  C CG  . GLU A 77  ? 0.6106 0.6090 0.7301 -0.0182 0.0861  -0.0327 668 GLU A CG  
480  C CD  . GLU A 77  ? 0.7379 0.7478 0.8676 -0.0198 0.0841  -0.0277 668 GLU A CD  
481  O OE1 . GLU A 77  ? 0.5346 0.5548 0.6693 -0.0247 0.0926  -0.0301 668 GLU A OE1 
482  O OE2 . GLU A 77  ? 0.5253 0.5333 0.6575 -0.0166 0.0741  -0.0214 668 GLU A OE2 
483  N N   . ALA A 78  ? 0.5152 0.5001 0.5746 -0.0411 0.0969  -0.0387 669 ALA A N   
484  C CA  . ALA A 78  ? 0.5121 0.4972 0.5521 -0.0493 0.0914  -0.0311 669 ALA A CA  
485  C C   . ALA A 78  ? 0.5780 0.5525 0.6075 -0.0515 0.0857  -0.0321 669 ALA A C   
486  O O   . ALA A 78  ? 0.5762 0.5522 0.6000 -0.0539 0.0772  -0.0233 669 ALA A O   
487  C CB  . ALA A 78  ? 0.5349 0.5256 0.5587 -0.0582 0.0993  -0.0332 669 ALA A CB  
488  N N   . SER A 79  ? 0.5377 0.5018 0.5662 -0.0508 0.0905  -0.0430 670 SER A N   
489  C CA  . SER A 79  ? 0.5468 0.4984 0.5668 -0.0543 0.0854  -0.0448 670 SER A CA  
490  C C   . SER A 79  ? 0.5926 0.5402 0.6245 -0.0485 0.0767  -0.0365 670 SER A C   
491  O O   . SER A 79  ? 0.5781 0.5242 0.6027 -0.0537 0.0699  -0.0306 670 SER A O   
492  C CB  . SER A 79  ? 0.6029 0.5410 0.6204 -0.0538 0.0928  -0.0590 670 SER A CB  
493  O OG  . SER A 79  ? 0.8018 0.7422 0.7997 -0.0626 0.0990  -0.0663 670 SER A OG  
494  N N   . ILE A 80  ? 0.5571 0.5046 0.6070 -0.0381 0.0768  -0.0356 671 ILE A N   
495  C CA  . ILE A 80  ? 0.5559 0.5001 0.6147 -0.0323 0.0688  -0.0273 671 ILE A CA  
496  C C   . ILE A 80  ? 0.5822 0.5384 0.6376 -0.0341 0.0627  -0.0165 671 ILE A C   
497  O O   . ILE A 80  ? 0.5646 0.5199 0.6153 -0.0363 0.0570  -0.0098 671 ILE A O   
498  C CB  . ILE A 80  ? 0.5865 0.5288 0.6644 -0.0206 0.0692  -0.0291 671 ILE A CB  
499  C CG1 . ILE A 80  ? 0.6075 0.5342 0.6898 -0.0168 0.0735  -0.0387 671 ILE A CG1 
500  C CG2 . ILE A 80  ? 0.5683 0.5109 0.6521 -0.0149 0.0602  -0.0190 671 ILE A CG2 
501  C CD1 . ILE A 80  ? 0.6931 0.6236 0.7955 -0.0061 0.0785  -0.0455 671 ILE A CD1 
502  N N   . MET A 81  ? 0.5385 0.5055 0.5962 -0.0335 0.0646  -0.0151 672 MET A N   
503  C CA  . MET A 81  ? 0.5285 0.5048 0.5841 -0.0337 0.0595  -0.0062 672 MET A CA  
504  C C   . MET A 81  ? 0.5173 0.4967 0.5593 -0.0407 0.0560  -0.0011 672 MET A C   
505  O O   . MET A 81  ? 0.4864 0.4708 0.5289 -0.0385 0.0503  0.0065  672 MET A O   
506  C CB  . MET A 81  ? 0.5692 0.5531 0.6270 -0.0349 0.0636  -0.0066 672 MET A CB  
507  C CG  . MET A 81  ? 0.6318 0.6179 0.7064 -0.0284 0.0651  -0.0094 672 MET A CG  
508  S SD  . MET A 81  ? 0.6939 0.6893 0.7715 -0.0326 0.0694  -0.0077 672 MET A SD  
509  C CE  . MET A 81  ? 0.6279 0.6230 0.6981 -0.0324 0.0605  0.0025  672 MET A CE  
510  N N   . GLY A 82  ? 0.4608 0.4392 0.4910 -0.0489 0.0594  -0.0056 673 GLY A N   
511  C CA  . GLY A 82  ? 0.4680 0.4511 0.4854 -0.0568 0.0551  -0.0016 673 GLY A CA  
512  C C   . GLY A 82  ? 0.5162 0.4969 0.5346 -0.0587 0.0500  0.0011  673 GLY A C   
513  O O   . GLY A 82  ? 0.5255 0.5139 0.5379 -0.0645 0.0451  0.0061  673 GLY A O   
514  N N   . GLN A 83  ? 0.4680 0.4387 0.4946 -0.0541 0.0509  -0.0013 674 GLN A N   
515  C CA  . GLN A 83  ? 0.4873 0.4544 0.5150 -0.0568 0.0468  0.0027  674 GLN A CA  
516  C C   . GLN A 83  ? 0.5401 0.5164 0.5749 -0.0502 0.0427  0.0126  674 GLN A C   
517  O O   . GLN A 83  ? 0.5350 0.5131 0.5706 -0.0528 0.0399  0.0180  674 GLN A O   
518  C CB  . GLN A 83  ? 0.5112 0.4603 0.5428 -0.0548 0.0493  -0.0032 674 GLN A CB  
519  C CG  . GLN A 83  ? 0.6920 0.6294 0.7149 -0.0622 0.0531  -0.0142 674 GLN A CG  
520  C CD  . GLN A 83  ? 1.1248 1.0426 1.1536 -0.0577 0.0556  -0.0203 674 GLN A CD  
521  O OE1 . GLN A 83  ? 1.1307 1.0386 1.1623 -0.0585 0.0520  -0.0155 674 GLN A OE1 
522  N NE2 . GLN A 83  ? 1.1342 1.0462 1.1657 -0.0526 0.0622  -0.0304 674 GLN A NE2 
523  N N   . PHE A 84  ? 0.4873 0.4692 0.5269 -0.0423 0.0429  0.0144  675 PHE A N   
524  C CA  . PHE A 84  ? 0.4601 0.4484 0.5048 -0.0349 0.0396  0.0212  675 PHE A CA  
525  C C   . PHE A 84  ? 0.4436 0.4447 0.4867 -0.0338 0.0371  0.0265  675 PHE A C   
526  O O   . PHE A 84  ? 0.4055 0.4091 0.4454 -0.0358 0.0376  0.0254  675 PHE A O   
527  C CB  . PHE A 84  ? 0.4676 0.4501 0.5197 -0.0261 0.0401  0.0187  675 PHE A CB  
528  C CG  . PHE A 84  ? 0.4938 0.4638 0.5504 -0.0244 0.0417  0.0141  675 PHE A CG  
529  C CD1 . PHE A 84  ? 0.5530 0.5147 0.6069 -0.0278 0.0410  0.0160  675 PHE A CD1 
530  C CD2 . PHE A 84  ? 0.5089 0.4755 0.5740 -0.0191 0.0436  0.0086  675 PHE A CD2 
531  C CE1 . PHE A 84  ? 0.5781 0.5255 0.6365 -0.0249 0.0417  0.0125  675 PHE A CE1 
532  C CE2 . PHE A 84  ? 0.5560 0.5118 0.6277 -0.0155 0.0444  0.0048  675 PHE A CE2 
533  C CZ  . PHE A 84  ? 0.5576 0.5024 0.6253 -0.0178 0.0432  0.0068  675 PHE A CZ  
534  N N   . ASP A 85  ? 0.3980 0.4074 0.4431 -0.0303 0.0346  0.0328  676 ASP A N   
535  C CA  . ASP A 85  ? 0.3891 0.4106 0.4349 -0.0264 0.0322  0.0377  676 ASP A CA  
536  C C   . ASP A 85  ? 0.4325 0.4577 0.4814 -0.0177 0.0316  0.0407  676 ASP A C   
537  O O   . ASP A 85  ? 0.4412 0.4772 0.4914 -0.0178 0.0317  0.0454  676 ASP A O   
538  C CB  . ASP A 85  ? 0.4202 0.4541 0.4645 -0.0336 0.0300  0.0417  676 ASP A CB  
539  C CG  . ASP A 85  ? 0.4924 0.5376 0.5380 -0.0294 0.0267  0.0464  676 ASP A CG  
540  O OD1 . ASP A 85  ? 0.5240 0.5642 0.5702 -0.0219 0.0266  0.0460  676 ASP A OD1 
541  O OD2 . ASP A 85  ? 0.5169 0.5754 0.5636 -0.0338 0.0237  0.0507  676 ASP A OD2 
542  N N   . HIS A 86  ? 0.3816 0.3988 0.4315 -0.0107 0.0314  0.0376  677 HIS A N   
543  C CA  . HIS A 86  ? 0.3480 0.3664 0.3976 -0.0022 0.0305  0.0387  677 HIS A CA  
544  C C   . HIS A 86  ? 0.4119 0.4258 0.4626 0.0045  0.0284  0.0355  677 HIS A C   
545  O O   . HIS A 86  ? 0.4050 0.4117 0.4581 0.0023  0.0280  0.0320  677 HIS A O   
546  C CB  . HIS A 86  ? 0.3402 0.3499 0.3885 -0.0018 0.0306  0.0378  677 HIS A CB  
547  C CG  . HIS A 86  ? 0.3837 0.3959 0.4277 0.0052  0.0297  0.0400  677 HIS A CG  
548  N ND1 . HIS A 86  ? 0.4080 0.4154 0.4505 0.0128  0.0267  0.0362  677 HIS A ND1 
549  C CD2 . HIS A 86  ? 0.3994 0.4191 0.4392 0.0050  0.0318  0.0454  677 HIS A CD2 
550  C CE1 . HIS A 86  ? 0.3982 0.4094 0.4335 0.0174  0.0270  0.0388  677 HIS A CE1 
551  N NE2 . HIS A 86  ? 0.3966 0.4157 0.4301 0.0130  0.0307  0.0448  677 HIS A NE2 
552  N N   . ARG A 87  ? 0.3976 0.4155 0.4465 0.0124  0.0274  0.0362  678 ARG A N   
553  C CA  . ARG A 87  ? 0.3939 0.4051 0.4427 0.0192  0.0247  0.0325  678 ARG A CA  
554  C C   . ARG A 87  ? 0.4126 0.4127 0.4628 0.0191  0.0222  0.0272  678 ARG A C   
555  O O   . ARG A 87  ? 0.3862 0.3792 0.4392 0.0198  0.0199  0.0241  678 ARG A O   
556  C CB  . ARG A 87  ? 0.4163 0.4329 0.4610 0.0284  0.0251  0.0324  678 ARG A CB  
557  C CG  . ARG A 87  ? 0.6570 0.6644 0.7000 0.0363  0.0220  0.0272  678 ARG A CG  
558  C CD  . ARG A 87  ? 0.9283 0.9421 0.9662 0.0460  0.0239  0.0260  678 ARG A CD  
559  N NE  . ARG A 87  ? 1.2338 1.2393 1.2721 0.0538  0.0217  0.0219  678 ARG A NE  
560  C CZ  . ARG A 87  ? 1.4465 1.4396 1.4788 0.0592  0.0186  0.0143  678 ARG A CZ  
561  N NH1 . ARG A 87  ? 1.2784 1.2683 1.3036 0.0579  0.0168  0.0105  678 ARG A NH1 
562  N NH2 . ARG A 87  ? 1.2650 1.2477 1.2978 0.0659  0.0165  0.0105  678 ARG A NH2 
563  N N   . ASN A 88  ? 0.3637 0.3626 0.4129 0.0182  0.0220  0.0269  679 ASN A N   
564  C CA  . ASN A 88  ? 0.3538 0.3454 0.4065 0.0193  0.0184  0.0225  679 ASN A CA  
565  C C   . ASN A 88  ? 0.3791 0.3682 0.4397 0.0137  0.0200  0.0214  679 ASN A C   
566  O O   . ASN A 88  ? 0.3785 0.3642 0.4442 0.0152  0.0171  0.0188  679 ASN A O   
567  C CB  . ASN A 88  ? 0.3800 0.3709 0.4254 0.0248  0.0153  0.0227  679 ASN A CB  
568  C CG  . ASN A 88  ? 0.4628 0.4558 0.4995 0.0313  0.0147  0.0214  679 ASN A CG  
569  O OD1 . ASN A 88  ? 0.4162 0.4161 0.4455 0.0337  0.0179  0.0250  679 ASN A OD1 
570  N ND2 . ASN A 88  ? 0.3459 0.3329 0.3838 0.0341  0.0111  0.0158  679 ASN A ND2 
571  N N   . ILE A 89  ? 0.3365 0.3277 0.3983 0.0076  0.0242  0.0227  680 ILE A N   
572  C CA  . ILE A 89  ? 0.3378 0.3269 0.4054 0.0020  0.0276  0.0201  680 ILE A CA  
573  C C   . ILE A 89  ? 0.3931 0.3836 0.4611 -0.0023 0.0298  0.0197  680 ILE A C   
574  O O   . ILE A 89  ? 0.3865 0.3805 0.4486 -0.0034 0.0298  0.0236  680 ILE A O   
575  C CB  . ILE A 89  ? 0.3636 0.3521 0.4278 -0.0027 0.0307  0.0218  680 ILE A CB  
576  C CG1 . ILE A 89  ? 0.3560 0.3412 0.4177 0.0008  0.0284  0.0248  680 ILE A CG1 
577  C CG2 . ILE A 89  ? 0.3526 0.3374 0.4219 -0.0075 0.0351  0.0166  680 ILE A CG2 
578  C CD1 . ILE A 89  ? 0.4270 0.4055 0.4953 0.0046  0.0263  0.0221  680 ILE A CD1 
579  N N   . ILE A 90  ? 0.3557 0.3446 0.4315 -0.0046 0.0313  0.0158  681 ILE A N   
580  C CA  . ILE A 90  ? 0.3832 0.3725 0.4587 -0.0099 0.0339  0.0165  681 ILE A CA  
581  C C   . ILE A 90  ? 0.4330 0.4249 0.4991 -0.0159 0.0376  0.0193  681 ILE A C   
582  O O   . ILE A 90  ? 0.4343 0.4267 0.4990 -0.0190 0.0411  0.0167  681 ILE A O   
583  C CB  . ILE A 90  ? 0.4288 0.4187 0.5161 -0.0125 0.0366  0.0118  681 ILE A CB  
584  C CG1 . ILE A 90  ? 0.4359 0.4246 0.5231 -0.0178 0.0379  0.0141  681 ILE A CG1 
585  C CG2 . ILE A 90  ? 0.4691 0.4618 0.5611 -0.0153 0.0430  0.0072  681 ILE A CG2 
586  C CD1 . ILE A 90  ? 0.5568 0.5405 0.6468 -0.0139 0.0314  0.0147  681 ILE A CD1 
587  N N   . ARG A 91  ? 0.3700 0.3628 0.4295 -0.0170 0.0358  0.0247  682 ARG A N   
588  C CA  . ARG A 91  ? 0.3635 0.3605 0.4134 -0.0224 0.0367  0.0286  682 ARG A CA  
589  C C   . ARG A 91  ? 0.4303 0.4270 0.4753 -0.0309 0.0420  0.0271  682 ARG A C   
590  O O   . ARG A 91  ? 0.4263 0.4201 0.4731 -0.0329 0.0437  0.0280  682 ARG A O   
591  C CB  . ARG A 91  ? 0.3152 0.3139 0.3616 -0.0185 0.0317  0.0356  682 ARG A CB  
592  C CG  . ARG A 91  ? 0.4397 0.4452 0.4777 -0.0228 0.0300  0.0412  682 ARG A CG  
593  C CD  . ARG A 91  ? 0.4963 0.5054 0.5356 -0.0155 0.0244  0.0477  682 ARG A CD  
594  N NE  . ARG A 91  ? 0.4803 0.4794 0.5213 -0.0111 0.0223  0.0500  682 ARG A NE  
595  C CZ  . ARG A 91  ? 0.6506 0.6444 0.6970 -0.0020 0.0201  0.0484  682 ARG A CZ  
596  N NH1 . ARG A 91  ? 0.4586 0.4579 0.5085 0.0041  0.0202  0.0449  682 ARG A NH1 
597  N NH2 . ARG A 91  ? 0.5367 0.5186 0.5837 0.0004  0.0178  0.0500  682 ARG A NH2 
598  N N   . LEU A 92  ? 0.4066 0.4058 0.4441 -0.0367 0.0448  0.0249  683 LEU A N   
599  C CA  . LEU A 92  ? 0.3978 0.3975 0.4260 -0.0450 0.0502  0.0231  683 LEU A CA  
600  C C   . LEU A 92  ? 0.4532 0.4561 0.4696 -0.0486 0.0456  0.0317  683 LEU A C   
601  O O   . LEU A 92  ? 0.4657 0.4734 0.4780 -0.0485 0.0404  0.0350  683 LEU A O   
602  C CB  . LEU A 92  ? 0.3988 0.3978 0.4222 -0.0494 0.0542  0.0156  683 LEU A CB  
603  C CG  . LEU A 92  ? 0.4468 0.4460 0.4587 -0.0578 0.0616  0.0109  683 LEU A CG  
604  C CD1 . LEU A 92  ? 0.4278 0.4268 0.4492 -0.0567 0.0696  0.0061  683 LEU A CD1 
605  C CD2 . LEU A 92  ? 0.4585 0.4544 0.4629 -0.0621 0.0639  0.0027  683 LEU A CD2 
606  N N   . GLU A 93  ? 0.4113 0.4118 0.4234 -0.0516 0.0470  0.0363  684 GLU A N   
607  C CA  . GLU A 93  ? 0.4241 0.4258 0.4241 -0.0545 0.0420  0.0461  684 GLU A CA  
608  C C   . GLU A 93  ? 0.5039 0.5087 0.4863 -0.0648 0.0455  0.0453  684 GLU A C   
609  O O   . GLU A 93  ? 0.5101 0.5195 0.4808 -0.0678 0.0395  0.0512  684 GLU A O   
610  C CB  . GLU A 93  ? 0.4453 0.4395 0.4482 -0.0530 0.0409  0.0530  684 GLU A CB  
611  C CG  . GLU A 93  ? 0.5284 0.5178 0.5457 -0.0430 0.0365  0.0528  684 GLU A CG  
612  C CD  . GLU A 93  ? 0.7125 0.7045 0.7313 -0.0346 0.0284  0.0578  684 GLU A CD  
613  O OE1 . GLU A 93  ? 0.4980 0.4978 0.5090 -0.0364 0.0248  0.0622  684 GLU A OE1 
614  O OE2 . GLU A 93  ? 0.6665 0.6542 0.6950 -0.0260 0.0256  0.0565  684 GLU A OE2 
615  N N   . GLY A 94  ? 0.4877 0.4914 0.4688 -0.0697 0.0552  0.0372  685 GLY A N   
616  C CA  . GLY A 94  ? 0.5020 0.5080 0.4645 -0.0794 0.0608  0.0338  685 GLY A CA  
617  C C   . GLY A 94  ? 0.5463 0.5520 0.5123 -0.0818 0.0730  0.0225  685 GLY A C   
618  O O   . GLY A 94  ? 0.5229 0.5277 0.5072 -0.0765 0.0767  0.0191  685 GLY A O   
619  N N   . VAL A 95  ? 0.5437 0.5509 0.4926 -0.0892 0.0788  0.0158  686 VAL A N   
620  C CA  . VAL A 95  ? 0.5543 0.5624 0.5036 -0.0916 0.0922  0.0040  686 VAL A CA  
621  C C   . VAL A 95  ? 0.6140 0.6250 0.5375 -0.1022 0.0985  0.0047  686 VAL A C   
622  O O   . VAL A 95  ? 0.6127 0.6238 0.5159 -0.1078 0.0909  0.0108  686 VAL A O   
623  C CB  . VAL A 95  ? 0.6177 0.6218 0.5737 -0.0878 0.0954  -0.0101 686 VAL A CB  
624  C CG1 . VAL A 95  ? 0.5956 0.5968 0.5759 -0.0775 0.0905  -0.0101 686 VAL A CG1 
625  C CG2 . VAL A 95  ? 0.6320 0.6326 0.5690 -0.0934 0.0900  -0.0135 686 VAL A CG2 
626  N N   . VAL A 96  ? 0.5667 0.5819 0.4912 -0.1051 0.1122  -0.0009 687 VAL A N   
627  C CA  . VAL A 96  ? 0.5787 0.5977 0.4769 -0.1155 0.1213  -0.0020 687 VAL A CA  
628  C C   . VAL A 96  ? 0.6436 0.6640 0.5432 -0.1143 0.1346  -0.0203 687 VAL A C   
629  O O   . VAL A 96  ? 0.6267 0.6514 0.5499 -0.1083 0.1434  -0.0265 687 VAL A O   
630  C CB  . VAL A 96  ? 0.6213 0.6449 0.5174 -0.1214 0.1271  0.0096  687 VAL A CB  
631  C CG1 . VAL A 96  ? 0.6398 0.6686 0.5077 -0.1323 0.1394  0.0071  687 VAL A CG1 
632  C CG2 . VAL A 96  ? 0.6087 0.6271 0.5018 -0.1215 0.1129  0.0274  687 VAL A CG2 
633  N N   . THR A 97  ? 0.6385 0.6544 0.5158 -0.1185 0.1344  -0.0297 688 THR A N   
634  C CA  . THR A 97  ? 0.6460 0.6595 0.5217 -0.1168 0.1466  -0.0488 688 THR A CA  
635  C C   . THR A 97  ? 0.7377 0.7523 0.5778 -0.1274 0.1542  -0.0555 688 THR A C   
636  O O   . THR A 97  ? 0.7575 0.7739 0.5941 -0.1269 0.1694  -0.0702 688 THR A O   
637  C CB  . THR A 97  ? 0.6679 0.6700 0.5550 -0.1099 0.1389  -0.0580 688 THR A CB  
638  O OG1 . THR A 97  ? 0.6713 0.6670 0.5344 -0.1174 0.1284  -0.0581 688 THR A OG1 
639  C CG2 . THR A 97  ? 0.6289 0.6297 0.5463 -0.1002 0.1297  -0.0500 688 THR A CG2 
640  N N   . LYS A 98  ? 0.7210 0.7347 0.5347 -0.1363 0.1432  -0.0454 689 LYS A N   
641  C CA  . LYS A 98  ? 0.7707 0.7851 0.5453 -0.1477 0.1469  -0.0501 689 LYS A CA  
642  C C   . LYS A 98  ? 0.8638 0.8881 0.6224 -0.1551 0.1571  -0.0402 689 LYS A C   
643  O O   . LYS A 98  ? 0.9125 0.9388 0.6363 -0.1649 0.1626  -0.0435 689 LYS A O   
644  C CB  . LYS A 98  ? 0.8111 0.8214 0.5657 -0.1539 0.1280  -0.0435 689 LYS A CB  
645  C CG  . LYS A 98  ? 0.9264 0.9278 0.6956 -0.1493 0.1172  -0.0514 689 LYS A CG  
646  C CD  . LYS A 98  ? 1.1163 1.1075 0.8736 -0.1513 0.1247  -0.0738 689 LYS A CD  
647  C CE  . LYS A 98  ? 1.3035 1.2838 1.0799 -0.1465 0.1154  -0.0800 689 LYS A CE  
648  N NZ  . LYS A 98  ? 1.3756 1.3528 1.1879 -0.1334 0.1214  -0.0816 689 LYS A NZ  
649  N N   . SER A 99  ? 0.8059 0.8356 0.5884 -0.1513 0.1592  -0.0279 690 SER A N   
650  C CA  . SER A 99  ? 0.8215 0.8597 0.5940 -0.1589 0.1693  -0.0167 690 SER A CA  
651  C C   . SER A 99  ? 0.8234 0.8697 0.6299 -0.1530 0.1829  -0.0199 690 SER A C   
652  O O   . SER A 99  ? 0.7970 0.8419 0.6329 -0.1423 0.1828  -0.0301 690 SER A O   
653  C CB  . SER A 99  ? 0.8876 0.9227 0.6533 -0.1627 0.1542  0.0064  690 SER A CB  
654  O OG  . SER A 99  ? 1.0267 1.0550 0.7884 -0.1600 0.1348  0.0108  690 SER A OG  
655  N N   . ARG A 100 ? 0.7804 0.8357 0.5831 -0.1606 0.1938  -0.0104 691 ARG A N   
656  C CA  . ARG A 100 ? 0.7617 0.8282 0.5966 -0.1575 0.2069  -0.0123 691 ARG A CA  
657  C C   . ARG A 100 ? 0.7829 0.8483 0.6307 -0.1614 0.2000  0.0083  691 ARG A C   
658  O O   . ARG A 100 ? 0.8069 0.8682 0.6291 -0.1712 0.1959  0.0239  691 ARG A O   
659  C CB  . ARG A 100 ? 0.7860 0.8671 0.6090 -0.1643 0.2304  -0.0219 691 ARG A CB  
660  C CG  . ARG A 100 ? 0.9448 1.0253 0.7477 -0.1623 0.2398  -0.0430 691 ARG A CG  
661  C CD  . ARG A 100 ? 1.0478 1.1430 0.8297 -0.1714 0.2630  -0.0490 691 ARG A CD  
662  N NE  . ARG A 100 ? 1.0596 1.1544 0.8034 -0.1864 0.2615  -0.0317 691 ARG A NE  
663  C CZ  . ARG A 100 ? 1.1499 1.2568 0.8683 -0.1973 0.2802  -0.0317 691 ARG A CZ  
664  N NH1 . ARG A 100 ? 0.9393 1.0618 0.6679 -0.1945 0.3032  -0.0492 691 ARG A NH1 
665  N NH2 . ARG A 100 ? 0.9858 1.0898 0.6681 -0.2108 0.2764  -0.0138 691 ARG A NH2 
666  N N   . PRO A 101 ? 0.6813 0.7508 0.5676 -0.1548 0.1999  0.0084  692 PRO A N   
667  C CA  . PRO A 101 ? 0.6540 0.7293 0.5737 -0.1426 0.2035  -0.0074 692 PRO A CA  
668  C C   . PRO A 101 ? 0.7004 0.7623 0.6275 -0.1314 0.1867  -0.0116 692 PRO A C   
669  O O   . PRO A 101 ? 0.6895 0.7404 0.6077 -0.1317 0.1710  0.0002  692 PRO A O   
670  C CB  . PRO A 101 ? 0.6582 0.7417 0.6113 -0.1429 0.2053  0.0001  692 PRO A CB  
671  C CG  . PRO A 101 ? 0.7109 0.7825 0.6522 -0.1499 0.1926  0.0200  692 PRO A CG  
672  C CD  . PRO A 101 ? 0.6909 0.7578 0.5896 -0.1596 0.1942  0.0263  692 PRO A CD  
673  N N   . VAL A 102 ? 0.6542 0.7176 0.5996 -0.1211 0.1900  -0.0275 693 VAL A N   
674  C CA  . VAL A 102 ? 0.6364 0.6877 0.5912 -0.1110 0.1751  -0.0305 693 VAL A CA  
675  C C   . VAL A 102 ? 0.6277 0.6777 0.6100 -0.1054 0.1640  -0.0205 693 VAL A C   
676  O O   . VAL A 102 ? 0.5627 0.6230 0.5688 -0.1047 0.1702  -0.0198 693 VAL A O   
677  C CB  . VAL A 102 ? 0.7065 0.7551 0.6689 -0.1022 0.1802  -0.0489 693 VAL A CB  
678  C CG1 . VAL A 102 ? 0.7466 0.7921 0.6761 -0.1086 0.1885  -0.0591 693 VAL A CG1 
679  C CG2 . VAL A 102 ? 0.6960 0.7570 0.6909 -0.0945 0.1917  -0.0578 693 VAL A CG2 
680  N N   . MET A 103 ? 0.5969 0.6353 0.5740 -0.1026 0.1476  -0.0124 694 MET A N   
681  C CA  . MET A 103 ? 0.5724 0.6068 0.5684 -0.0977 0.1357  -0.0028 694 MET A CA  
682  C C   . MET A 103 ? 0.5526 0.5779 0.5540 -0.0884 0.1228  -0.0045 694 MET A C   
683  O O   . MET A 103 ? 0.5332 0.5531 0.5171 -0.0892 0.1187  -0.0069 694 MET A O   
684  C CB  . MET A 103 ? 0.6199 0.6490 0.5998 -0.1050 0.1286  0.0134  694 MET A CB  
685  C CG  . MET A 103 ? 0.7130 0.7483 0.6818 -0.1165 0.1398  0.0194  694 MET A CG  
686  S SD  . MET A 103 ? 0.7974 0.8218 0.7499 -0.1232 0.1289  0.0402  694 MET A SD  
687  C CE  . MET A 103 ? 0.7956 0.8264 0.7217 -0.1378 0.1429  0.0452  694 MET A CE  
688  N N   . ILE A 104 ? 0.4704 0.4945 0.4947 -0.0809 0.1156  -0.0021 695 ILE A N   
689  C CA  . ILE A 104 ? 0.4529 0.4693 0.4827 -0.0726 0.1031  -0.0009 695 ILE A CA  
690  C C   . ILE A 104 ? 0.4931 0.5057 0.5260 -0.0724 0.0941  0.0109  695 ILE A C   
691  O O   . ILE A 104 ? 0.4885 0.5038 0.5364 -0.0729 0.0956  0.0129  695 ILE A O   
692  C CB  . ILE A 104 ? 0.4734 0.4905 0.5249 -0.0629 0.1030  -0.0100 695 ILE A CB  
693  C CG1 . ILE A 104 ? 0.4845 0.5010 0.5310 -0.0622 0.1114  -0.0222 695 ILE A CG1 
694  C CG2 . ILE A 104 ? 0.4559 0.4656 0.5115 -0.0556 0.0901  -0.0056 695 ILE A CG2 
695  C CD1 . ILE A 104 ? 0.4922 0.5096 0.5616 -0.0524 0.1136  -0.0314 695 ILE A CD1 
696  N N   . ILE A 105 ? 0.4276 0.4343 0.4464 -0.0722 0.0849  0.0185  696 ILE A N   
697  C CA  . ILE A 105 ? 0.4122 0.4131 0.4315 -0.0708 0.0762  0.0295  696 ILE A CA  
698  C C   . ILE A 105 ? 0.4573 0.4544 0.4848 -0.0609 0.0660  0.0298  696 ILE A C   
699  O O   . ILE A 105 ? 0.4601 0.4581 0.4805 -0.0587 0.0621  0.0290  696 ILE A O   
700  C CB  . ILE A 105 ? 0.4539 0.4523 0.4516 -0.0778 0.0740  0.0398  696 ILE A CB  
701  C CG1 . ILE A 105 ? 0.4830 0.4859 0.4696 -0.0886 0.0855  0.0398  696 ILE A CG1 
702  C CG2 . ILE A 105 ? 0.4198 0.4098 0.4194 -0.0750 0.0651  0.0510  696 ILE A CG2 
703  C CD1 . ILE A 105 ? 0.5734 0.5778 0.5354 -0.0949 0.0861  0.0420  696 ILE A CD1 
704  N N   . THR A 106 ? 0.4124 0.4060 0.4544 -0.0558 0.0622  0.0306  697 THR A N   
705  C CA  . THR A 106 ? 0.4018 0.3922 0.4506 -0.0464 0.0538  0.0303  697 THR A CA  
706  C C   . THR A 106 ? 0.4557 0.4380 0.5046 -0.0434 0.0468  0.0375  697 THR A C   
707  O O   . THR A 106 ? 0.4640 0.4414 0.5108 -0.0491 0.0482  0.0427  697 THR A O   
708  C CB  . THR A 106 ? 0.5138 0.5066 0.5795 -0.0413 0.0548  0.0219  697 THR A CB  
709  O OG1 . THR A 106 ? 0.4705 0.4630 0.5483 -0.0437 0.0560  0.0214  697 THR A OG1 
710  C CG2 . THR A 106 ? 0.4451 0.4434 0.5125 -0.0425 0.0618  0.0142  697 THR A CG2 
711  N N   . GLU A 107 ? 0.4398 0.4198 0.4912 -0.0345 0.0399  0.0376  698 GLU A N   
712  C CA  . GLU A 107 ? 0.4266 0.3974 0.4794 -0.0290 0.0333  0.0419  698 GLU A CA  
713  C C   . GLU A 107 ? 0.4747 0.4391 0.5384 -0.0312 0.0336  0.0385  698 GLU A C   
714  O O   . GLU A 107 ? 0.4642 0.4342 0.5380 -0.0317 0.0362  0.0314  698 GLU A O   
715  C CB  . GLU A 107 ? 0.4251 0.3977 0.4794 -0.0184 0.0281  0.0397  698 GLU A CB  
716  C CG  . GLU A 107 ? 0.4232 0.3990 0.4857 -0.0148 0.0286  0.0318  698 GLU A CG  
717  C CD  . GLU A 107 ? 0.5420 0.5205 0.6031 -0.0057 0.0249  0.0307  698 GLU A CD  
718  O OE1 . GLU A 107 ? 0.5672 0.5406 0.6270 0.0010  0.0208  0.0320  698 GLU A OE1 
719  O OE2 . GLU A 107 ? 0.4677 0.4527 0.5290 -0.0053 0.0267  0.0285  698 GLU A OE2 
720  N N   . PHE A 108 ? 0.4482 0.4007 0.5110 -0.0327 0.0303  0.0437  699 PHE A N   
721  C CA  . PHE A 108 ? 0.4425 0.3881 0.5160 -0.0369 0.0297  0.0409  699 PHE A CA  
722  C C   . PHE A 108 ? 0.4802 0.4216 0.5609 -0.0282 0.0230  0.0334  699 PHE A C   
723  O O   . PHE A 108 ? 0.5181 0.4529 0.5928 -0.0192 0.0178  0.0339  699 PHE A O   
724  C CB  . PHE A 108 ? 0.4743 0.4054 0.5430 -0.0428 0.0282  0.0498  699 PHE A CB  
725  C CG  . PHE A 108 ? 0.5031 0.4249 0.5834 -0.0487 0.0265  0.0474  699 PHE A CG  
726  C CD1 . PHE A 108 ? 0.5164 0.4491 0.6090 -0.0583 0.0327  0.0438  699 PHE A CD1 
727  C CD2 . PHE A 108 ? 0.5295 0.4321 0.6097 -0.0448 0.0186  0.0481  699 PHE A CD2 
728  C CE1 . PHE A 108 ? 0.5325 0.4589 0.6381 -0.0652 0.0304  0.0417  699 PHE A CE1 
729  C CE2 . PHE A 108 ? 0.5668 0.4597 0.6577 -0.0519 0.0160  0.0452  699 PHE A CE2 
730  C CZ  . PHE A 108 ? 0.5295 0.4353 0.6336 -0.0627 0.0216  0.0424  699 PHE A CZ  
731  N N   . MET A 109 ? 0.4035 0.3506 0.4970 -0.0305 0.0233  0.0263  700 MET A N   
732  C CA  . MET A 109 ? 0.4032 0.3472 0.5017 -0.0234 0.0161  0.0189  700 MET A CA  
733  C C   . MET A 109 ? 0.4839 0.4186 0.5917 -0.0296 0.0120  0.0166  700 MET A C   
734  O O   . MET A 109 ? 0.4736 0.4168 0.5954 -0.0372 0.0139  0.0139  700 MET A O   
735  C CB  . MET A 109 ? 0.4063 0.3640 0.5111 -0.0199 0.0170  0.0131  700 MET A CB  
736  C CG  . MET A 109 ? 0.4287 0.3934 0.5241 -0.0154 0.0209  0.0155  700 MET A CG  
737  S SD  . MET A 109 ? 0.4657 0.4254 0.5479 -0.0044 0.0161  0.0170  700 MET A SD  
738  C CE  . MET A 109 ? 0.4128 0.3749 0.4987 0.0019  0.0108  0.0097  700 MET A CE  
739  N N   . GLU A 110 ? 0.4902 0.4071 0.5911 -0.0267 0.0064  0.0177  701 GLU A N   
740  C CA  . GLU A 110 ? 0.5208 0.4238 0.6289 -0.0341 0.0018  0.0162  701 GLU A CA  
741  C C   . GLU A 110 ? 0.5510 0.4606 0.6733 -0.0378 -0.0029 0.0073  701 GLU A C   
742  O O   . GLU A 110 ? 0.5421 0.4511 0.6771 -0.0494 -0.0030 0.0076  701 GLU A O   
743  C CB  . GLU A 110 ? 0.5662 0.4466 0.6639 -0.0270 -0.0048 0.0159  701 GLU A CB  
744  C CG  . GLU A 110 ? 0.7957 0.6567 0.8963 -0.0370 -0.0067 0.0205  701 GLU A CG  
745  C CD  . GLU A 110 ? 1.2299 1.0661 1.3274 -0.0331 -0.0158 0.0142  701 GLU A CD  
746  O OE1 . GLU A 110 ? 1.1206 0.9506 1.2082 -0.0193 -0.0193 0.0090  701 GLU A OE1 
747  O OE2 . GLU A 110 ? 1.2937 1.1165 1.3988 -0.0443 -0.0190 0.0141  701 GLU A OE2 
748  N N   . ASN A 111 ? 0.4904 0.4075 0.6111 -0.0287 -0.0072 0.0002  702 ASN A N   
749  C CA  . ASN A 111 ? 0.4773 0.4005 0.6103 -0.0312 -0.0142 -0.0079 702 ASN A CA  
750  C C   . ASN A 111 ? 0.4865 0.4328 0.6356 -0.0341 -0.0105 -0.0087 702 ASN A C   
751  O O   . ASN A 111 ? 0.4674 0.4215 0.6285 -0.0353 -0.0173 -0.0147 702 ASN A O   
752  C CB  . ASN A 111 ? 0.4654 0.3810 0.5859 -0.0203 -0.0227 -0.0154 702 ASN A CB  
753  C CG  . ASN A 111 ? 0.5115 0.4030 0.6222 -0.0191 -0.0280 -0.0184 702 ASN A CG  
754  O OD1 . ASN A 111 ? 0.4689 0.3489 0.5873 -0.0288 -0.0312 -0.0190 702 ASN A OD1 
755  N ND2 . ASN A 111 ? 0.4175 0.3000 0.5115 -0.0073 -0.0288 -0.0204 702 ASN A ND2 
756  N N   . GLY A 112 ? 0.4688 0.4255 0.6188 -0.0355 -0.0003 -0.0030 703 GLY A N   
757  C CA  . GLY A 112 ? 0.4474 0.4245 0.6132 -0.0374 0.0050  -0.0043 703 GLY A CA  
758  C C   . GLY A 112 ? 0.4506 0.4367 0.6191 -0.0279 -0.0005 -0.0092 703 GLY A C   
759  O O   . GLY A 112 ? 0.4422 0.4206 0.5947 -0.0191 -0.0046 -0.0096 703 GLY A O   
760  N N   . ALA A 113 ? 0.3913 0.3943 0.5804 -0.0293 -0.0007 -0.0124 704 ALA A N   
761  C CA  . ALA A 113 ? 0.4040 0.4158 0.5980 -0.0202 -0.0069 -0.0157 704 ALA A CA  
762  C C   . ALA A 113 ? 0.4797 0.4836 0.6658 -0.0160 -0.0206 -0.0196 704 ALA A C   
763  O O   . ALA A 113 ? 0.4704 0.4699 0.6615 -0.0224 -0.0271 -0.0229 704 ALA A O   
764  C CB  . ALA A 113 ? 0.3992 0.4314 0.6206 -0.0223 -0.0050 -0.0182 704 ALA A CB  
765  N N   . LEU A 114 ? 0.4214 0.4228 0.5938 -0.0058 -0.0247 -0.0193 705 LEU A N   
766  C CA  . LEU A 114 ? 0.4225 0.4164 0.5814 -0.0006 -0.0364 -0.0228 705 LEU A CA  
767  C C   . LEU A 114 ? 0.4729 0.4756 0.6472 -0.0029 -0.0488 -0.0281 705 LEU A C   
768  O O   . LEU A 114 ? 0.4788 0.4726 0.6452 -0.0049 -0.0581 -0.0334 705 LEU A O   
769  C CB  . LEU A 114 ? 0.4123 0.4041 0.5536 0.0095  -0.0361 -0.0195 705 LEU A CB  
770  C CG  . LEU A 114 ? 0.4727 0.4585 0.5961 0.0159  -0.0468 -0.0223 705 LEU A CG  
771  C CD1 . LEU A 114 ? 0.4700 0.4411 0.5766 0.0153  -0.0480 -0.0266 705 LEU A CD1 
772  C CD2 . LEU A 114 ? 0.5018 0.4880 0.6112 0.0239  -0.0446 -0.0168 705 LEU A CD2 
773  N N   . ASP A 115 ? 0.4157 0.4360 0.6124 -0.0024 -0.0494 -0.0274 706 ASP A N   
774  C CA  . ASP A 115 ? 0.4047 0.4378 0.6201 -0.0041 -0.0621 -0.0316 706 ASP A CA  
775  C C   . ASP A 115 ? 0.4454 0.4788 0.6738 -0.0164 -0.0659 -0.0364 706 ASP A C   
776  O O   . ASP A 115 ? 0.4459 0.4769 0.6722 -0.0184 -0.0797 -0.0418 706 ASP A O   
777  C CB  . ASP A 115 ? 0.4054 0.4590 0.6463 0.0001  -0.0607 -0.0295 706 ASP A CB  
778  C CG  . ASP A 115 ? 0.4735 0.5404 0.7392 -0.0070 -0.0478 -0.0291 706 ASP A CG  
779  O OD1 . ASP A 115 ? 0.4260 0.4837 0.6814 -0.0112 -0.0350 -0.0268 706 ASP A OD1 
780  O OD2 . ASP A 115 ? 0.5442 0.6315 0.8394 -0.0087 -0.0506 -0.0311 706 ASP A OD2 
781  N N   . SER A 116 ? 0.4058 0.4412 0.6463 -0.0254 -0.0542 -0.0343 707 SER A N   
782  C CA  . SER A 116 ? 0.4138 0.4483 0.6676 -0.0391 -0.0567 -0.0372 707 SER A CA  
783  C C   . SER A 116 ? 0.4520 0.4601 0.6814 -0.0415 -0.0598 -0.0393 707 SER A C   
784  O O   . SER A 116 ? 0.4614 0.4629 0.6952 -0.0500 -0.0689 -0.0443 707 SER A O   
785  C CB  . SER A 116 ? 0.4576 0.5045 0.7323 -0.0485 -0.0427 -0.0332 707 SER A CB  
786  O OG  . SER A 116 ? 0.5632 0.6005 0.8209 -0.0454 -0.0292 -0.0277 707 SER A OG  
787  N N   . PHE A 117 ? 0.4163 0.4090 0.6204 -0.0336 -0.0531 -0.0360 708 PHE A N   
788  C CA  . PHE A 117 ? 0.4099 0.3779 0.5912 -0.0329 -0.0559 -0.0384 708 PHE A CA  
789  C C   . PHE A 117 ? 0.4891 0.4503 0.6596 -0.0291 -0.0711 -0.0472 708 PHE A C   
790  O O   . PHE A 117 ? 0.5004 0.4458 0.6663 -0.0349 -0.0779 -0.0532 708 PHE A O   
791  C CB  . PHE A 117 ? 0.4137 0.3726 0.5731 -0.0232 -0.0468 -0.0333 708 PHE A CB  
792  C CG  . PHE A 117 ? 0.4346 0.3709 0.5711 -0.0185 -0.0499 -0.0366 708 PHE A CG  
793  C CD1 . PHE A 117 ? 0.4614 0.3801 0.5973 -0.0255 -0.0494 -0.0370 708 PHE A CD1 
794  C CD2 . PHE A 117 ? 0.4332 0.3656 0.5490 -0.0068 -0.0525 -0.0391 708 PHE A CD2 
795  C CE1 . PHE A 117 ? 0.4980 0.3947 0.6140 -0.0192 -0.0519 -0.0408 708 PHE A CE1 
796  C CE2 . PHE A 117 ? 0.4803 0.3936 0.5764 -0.0012 -0.0539 -0.0433 708 PHE A CE2 
797  C CZ  . PHE A 117 ? 0.4680 0.3634 0.5648 -0.0065 -0.0535 -0.0444 708 PHE A CZ  
798  N N   . LEU A 118 ? 0.4557 0.4279 0.6213 -0.0200 -0.0766 -0.0479 709 LEU A N   
799  C CA  . LEU A 118 ? 0.4803 0.4482 0.6323 -0.0161 -0.0912 -0.0556 709 LEU A CA  
800  C C   . LEU A 118 ? 0.5179 0.4937 0.6895 -0.0263 -0.1045 -0.0621 709 LEU A C   
801  O O   . LEU A 118 ? 0.5034 0.4660 0.6626 -0.0289 -0.1157 -0.0710 709 LEU A O   
802  C CB  . LEU A 118 ? 0.4773 0.4548 0.6181 -0.0043 -0.0931 -0.0520 709 LEU A CB  
803  C CG  . LEU A 118 ? 0.5472 0.5145 0.6628 0.0054  -0.0830 -0.0475 709 LEU A CG  
804  C CD1 . LEU A 118 ? 0.5667 0.5433 0.6737 0.0145  -0.0852 -0.0428 709 LEU A CD1 
805  C CD2 . LEU A 118 ? 0.5817 0.5290 0.6717 0.0083  -0.0850 -0.0544 709 LEU A CD2 
806  N N   . ARG A 119 ? 0.4706 0.4682 0.6737 -0.0327 -0.1029 -0.0584 710 ARG A N   
807  C CA  . ARG A 119 ? 0.4802 0.4901 0.7076 -0.0438 -0.1152 -0.0639 710 ARG A CA  
808  C C   . ARG A 119 ? 0.5334 0.5255 0.7617 -0.0572 -0.1161 -0.0687 710 ARG A C   
809  O O   . ARG A 119 ? 0.5669 0.5558 0.7984 -0.0649 -0.1305 -0.0769 710 ARG A O   
810  C CB  . ARG A 119 ? 0.4694 0.5090 0.7334 -0.0473 -0.1107 -0.0588 710 ARG A CB  
811  C CG  . ARG A 119 ? 0.4450 0.5026 0.7136 -0.0348 -0.1153 -0.0558 710 ARG A CG  
812  C CD  . ARG A 119 ? 0.4492 0.5374 0.7580 -0.0377 -0.1138 -0.0533 710 ARG A CD  
813  N NE  . ARG A 119 ? 0.4976 0.5913 0.8186 -0.0395 -0.0941 -0.0478 710 ARG A NE  
814  C CZ  . ARG A 119 ? 0.6061 0.7033 0.9241 -0.0287 -0.0834 -0.0426 710 ARG A CZ  
815  N NH1 . ARG A 119 ? 0.3669 0.4612 0.6704 -0.0155 -0.0902 -0.0408 710 ARG A NH1 
816  N NH2 . ARG A 119 ? 0.4360 0.5377 0.7632 -0.0318 -0.0661 -0.0391 710 ARG A NH2 
817  N N   . GLN A 120 ? 0.4792 0.4581 0.7033 -0.0601 -0.1016 -0.0632 711 GLN A N   
818  C CA  . GLN A 120 ? 0.4855 0.4432 0.7089 -0.0723 -0.1007 -0.0650 711 GLN A CA  
819  C C   . GLN A 120 ? 0.5355 0.4620 0.7272 -0.0664 -0.1067 -0.0725 711 GLN A C   
820  O O   . GLN A 120 ? 0.5453 0.4490 0.7334 -0.0746 -0.1078 -0.0753 711 GLN A O   
821  C CB  . GLN A 120 ? 0.4854 0.4409 0.7131 -0.0757 -0.0833 -0.0548 711 GLN A CB  
822  C CG  . GLN A 120 ? 0.6854 0.6674 0.9454 -0.0859 -0.0756 -0.0489 711 GLN A CG  
823  C CD  . GLN A 120 ? 0.9667 0.9437 1.2241 -0.0893 -0.0587 -0.0391 711 GLN A CD  
824  O OE1 . GLN A 120 ? 0.8418 0.8338 1.1018 -0.0833 -0.0475 -0.0336 711 GLN A OE1 
825  N NE2 . GLN A 120 ? 1.0168 0.9707 1.2673 -0.0989 -0.0571 -0.0367 711 GLN A NE2 
826  N N   . ASN A 121 ? 0.4991 0.4238 0.6674 -0.0517 -0.1095 -0.0754 712 ASN A N   
827  C CA  . ASN A 121 ? 0.5206 0.4192 0.6576 -0.0433 -0.1127 -0.0829 712 ASN A CA  
828  C C   . ASN A 121 ? 0.5977 0.5016 0.7183 -0.0356 -0.1253 -0.0910 712 ASN A C   
829  O O   . ASN A 121 ? 0.6151 0.5112 0.7088 -0.0229 -0.1229 -0.0928 712 ASN A O   
830  C CB  . ASN A 121 ? 0.4661 0.3577 0.5873 -0.0321 -0.0982 -0.0754 712 ASN A CB  
831  C CG  . ASN A 121 ? 0.6331 0.5123 0.7621 -0.0388 -0.0882 -0.0686 712 ASN A CG  
832  O OD1 . ASN A 121 ? 0.5814 0.4349 0.7002 -0.0403 -0.0896 -0.0727 712 ASN A OD1 
833  N ND2 . ASN A 121 ? 0.4747 0.3709 0.6210 -0.0429 -0.0780 -0.0581 712 ASN A ND2 
834  N N   . ASP A 122 ? 0.5519 0.4705 0.6889 -0.0437 -0.1388 -0.0954 713 ASP A N   
835  C CA  . ASP A 122 ? 0.5643 0.4912 0.6881 -0.0381 -0.1531 -0.1017 713 ASP A CA  
836  C C   . ASP A 122 ? 0.6224 0.5228 0.7112 -0.0335 -0.1602 -0.1146 713 ASP A C   
837  O O   . ASP A 122 ? 0.6203 0.4995 0.7074 -0.0420 -0.1646 -0.1236 713 ASP A O   
838  C CB  . ASP A 122 ? 0.5978 0.5467 0.7510 -0.0495 -0.1673 -0.1037 713 ASP A CB  
839  C CG  . ASP A 122 ? 0.7332 0.6965 0.8779 -0.0441 -0.1838 -0.1074 713 ASP A CG  
840  O OD1 . ASP A 122 ? 0.7301 0.6923 0.8495 -0.0305 -0.1816 -0.1045 713 ASP A OD1 
841  O OD2 . ASP A 122 ? 0.8646 0.8418 1.0289 -0.0539 -0.1990 -0.1120 713 ASP A OD2 
842  N N   . GLY A 123 ? 0.5853 0.4856 0.6460 -0.0197 -0.1586 -0.1146 714 GLY A N   
843  C CA  . GLY A 123 ? 0.6088 0.4874 0.6333 -0.0124 -0.1621 -0.1264 714 GLY A CA  
844  C C   . GLY A 123 ? 0.6655 0.5184 0.6775 -0.0079 -0.1496 -0.1295 714 GLY A C   
845  O O   . GLY A 123 ? 0.6852 0.5164 0.6714 -0.0035 -0.1528 -0.1423 714 GLY A O   
846  N N   . GLN A 124 ? 0.5932 0.4478 0.6225 -0.0082 -0.1354 -0.1182 715 GLN A N   
847  C CA  . GLN A 124 ? 0.5902 0.4219 0.6113 -0.0036 -0.1241 -0.1186 715 GLN A CA  
848  C C   . GLN A 124 ? 0.6313 0.4618 0.6274 0.0128  -0.1137 -0.1174 715 GLN A C   
849  O O   . GLN A 124 ? 0.6296 0.4404 0.6142 0.0197  -0.1070 -0.1214 715 GLN A O   
850  C CB  . GLN A 124 ? 0.5705 0.4074 0.6174 -0.0099 -0.1132 -0.1053 715 GLN A CB  
851  C CG  . GLN A 124 ? 0.6025 0.4308 0.6719 -0.0263 -0.1185 -0.1063 715 GLN A CG  
852  C CD  . GLN A 124 ? 0.6488 0.4432 0.7084 -0.0289 -0.1212 -0.1153 715 GLN A CD  
853  O OE1 . GLN A 124 ? 0.6238 0.4007 0.6686 -0.0185 -0.1130 -0.1149 715 GLN A OE1 
854  N NE2 . GLN A 124 ? 0.6059 0.3902 0.6760 -0.0432 -0.1331 -0.1231 715 GLN A NE2 
855  N N   . PHE A 125 ? 0.5617 0.4140 0.5525 0.0189  -0.1115 -0.1104 716 PHE A N   
856  C CA  . PHE A 125 ? 0.5452 0.4026 0.5175 0.0322  -0.1000 -0.1056 716 PHE A CA  
857  C C   . PHE A 125 ? 0.6238 0.4861 0.5687 0.0394  -0.1055 -0.1116 716 PHE A C   
858  O O   . PHE A 125 ? 0.6220 0.4934 0.5671 0.0344  -0.1180 -0.1133 716 PHE A O   
859  C CB  . PHE A 125 ? 0.5172 0.3941 0.5074 0.0323  -0.0896 -0.0894 716 PHE A CB  
860  C CG  . PHE A 125 ? 0.5152 0.3881 0.5299 0.0242  -0.0842 -0.0834 716 PHE A CG  
861  C CD1 . PHE A 125 ? 0.5313 0.3854 0.5431 0.0267  -0.0778 -0.0849 716 PHE A CD1 
862  C CD2 . PHE A 125 ? 0.5171 0.4042 0.5573 0.0142  -0.0861 -0.0765 716 PHE A CD2 
863  C CE1 . PHE A 125 ? 0.5187 0.3671 0.5504 0.0181  -0.0742 -0.0787 716 PHE A CE1 
864  C CE2 . PHE A 125 ? 0.5331 0.4167 0.5935 0.0056  -0.0806 -0.0711 716 PHE A CE2 
865  C CZ  . PHE A 125 ? 0.5178 0.3814 0.5725 0.0070  -0.0750 -0.0717 716 PHE A CZ  
866  N N   . THR A 126 ? 0.5882 0.4464 0.5102 0.0511  -0.0960 -0.1138 717 THR A N   
867  C CA  . THR A 126 ? 0.6085 0.4717 0.5001 0.0587  -0.0979 -0.1184 717 THR A CA  
868  C C   . THR A 126 ? 0.6331 0.5194 0.5269 0.0601  -0.0943 -0.1030 717 THR A C   
869  O O   . THR A 126 ? 0.6131 0.5093 0.5300 0.0573  -0.0876 -0.0908 717 THR A O   
870  C CB  . THR A 126 ? 0.6596 0.5119 0.5284 0.0711  -0.0864 -0.1263 717 THR A CB  
871  O OG1 . THR A 126 ? 0.6522 0.5148 0.5323 0.0764  -0.0712 -0.1139 717 THR A OG1 
872  C CG2 . THR A 126 ? 0.5924 0.4179 0.4590 0.0716  -0.0892 -0.1416 717 THR A CG2 
873  N N   . VAL A 127 ? 0.6084 0.5016 0.4767 0.0641  -0.0987 -0.1038 718 VAL A N   
874  C CA  . VAL A 127 ? 0.5953 0.5065 0.4606 0.0660  -0.0960 -0.0892 718 VAL A CA  
875  C C   . VAL A 127 ? 0.6188 0.5363 0.4885 0.0715  -0.0776 -0.0792 718 VAL A C   
876  O O   . VAL A 127 ? 0.5945 0.5231 0.4812 0.0691  -0.0735 -0.0659 718 VAL A O   
877  C CB  . VAL A 127 ? 0.6745 0.5887 0.5052 0.0697  -0.1036 -0.0921 718 VAL A CB  
878  C CG1 . VAL A 127 ? 0.6570 0.5860 0.4790 0.0732  -0.0968 -0.0758 718 VAL A CG1 
879  C CG2 . VAL A 127 ? 0.6827 0.5963 0.5146 0.0628  -0.1244 -0.0980 718 VAL A CG2 
880  N N   . ILE A 128 ? 0.5879 0.4983 0.4436 0.0790  -0.0671 -0.0864 719 ILE A N   
881  C CA  . ILE A 128 ? 0.5676 0.4864 0.4289 0.0843  -0.0506 -0.0776 719 ILE A CA  
882  C C   . ILE A 128 ? 0.5936 0.5127 0.4872 0.0792  -0.0469 -0.0702 719 ILE A C   
883  O O   . ILE A 128 ? 0.5367 0.4680 0.4413 0.0786  -0.0383 -0.0578 719 ILE A O   
884  C CB  . ILE A 128 ? 0.6140 0.5277 0.4556 0.0951  -0.0401 -0.0876 719 ILE A CB  
885  C CG1 . ILE A 128 ? 0.6383 0.5615 0.4478 0.1005  -0.0362 -0.0878 719 ILE A CG1 
886  C CG2 . ILE A 128 ? 0.5816 0.5018 0.4411 0.0992  -0.0259 -0.0803 719 ILE A CG2 
887  C CD1 . ILE A 128 ? 0.7831 0.6959 0.5649 0.1101  -0.0328 -0.1055 719 ILE A CD1 
888  N N   . GLN A 129 ? 0.5746 0.4802 0.4824 0.0743  -0.0539 -0.0774 720 GLN A N   
889  C CA  . GLN A 129 ? 0.5378 0.4437 0.4738 0.0683  -0.0507 -0.0701 720 GLN A CA  
890  C C   . GLN A 129 ? 0.5718 0.4917 0.5236 0.0611  -0.0537 -0.0589 720 GLN A C   
891  O O   . GLN A 129 ? 0.5640 0.4924 0.5293 0.0598  -0.0453 -0.0487 720 GLN A O   
892  C CB  . GLN A 129 ? 0.5493 0.4369 0.4959 0.0631  -0.0575 -0.0791 720 GLN A CB  
893  C CG  . GLN A 129 ? 0.5324 0.4039 0.4693 0.0715  -0.0517 -0.0875 720 GLN A CG  
894  C CD  . GLN A 129 ? 0.7010 0.5490 0.6411 0.0671  -0.0603 -0.0990 720 GLN A CD  
895  O OE1 . GLN A 129 ? 0.6537 0.4979 0.6003 0.0573  -0.0717 -0.1029 720 GLN A OE1 
896  N NE2 . GLN A 129 ? 0.6619 0.4932 0.5981 0.0746  -0.0554 -0.1048 720 GLN A NE2 
897  N N   . LEU A 130 ? 0.5109 0.4336 0.4602 0.0574  -0.0657 -0.0611 721 LEU A N   
898  C CA  . LEU A 130 ? 0.4837 0.4195 0.4489 0.0527  -0.0694 -0.0514 721 LEU A CA  
899  C C   . LEU A 130 ? 0.5022 0.4485 0.4595 0.0571  -0.0610 -0.0398 721 LEU A C   
900  O O   . LEU A 130 ? 0.4700 0.4236 0.4446 0.0542  -0.0564 -0.0306 721 LEU A O   
901  C CB  . LEU A 130 ? 0.5021 0.4397 0.4661 0.0493  -0.0856 -0.0563 721 LEU A CB  
902  C CG  . LEU A 130 ? 0.5563 0.4848 0.5321 0.0421  -0.0953 -0.0673 721 LEU A CG  
903  C CD1 . LEU A 130 ? 0.5437 0.4754 0.5130 0.0396  -0.1128 -0.0734 721 LEU A CD1 
904  C CD2 . LEU A 130 ? 0.5423 0.4746 0.5503 0.0341  -0.0918 -0.0628 721 LEU A CD2 
905  N N   . VAL A 131 ? 0.4753 0.4217 0.4060 0.0636  -0.0580 -0.0408 722 VAL A N   
906  C CA  . VAL A 131 ? 0.4874 0.4433 0.4082 0.0667  -0.0493 -0.0295 722 VAL A CA  
907  C C   . VAL A 131 ? 0.5253 0.4852 0.4596 0.0665  -0.0356 -0.0235 722 VAL A C   
908  O O   . VAL A 131 ? 0.5244 0.4915 0.4668 0.0640  -0.0307 -0.0127 722 VAL A O   
909  C CB  . VAL A 131 ? 0.5553 0.5117 0.4432 0.0728  -0.0485 -0.0323 722 VAL A CB  
910  C CG1 . VAL A 131 ? 0.5372 0.5037 0.4160 0.0749  -0.0361 -0.0206 722 VAL A CG1 
911  C CG2 . VAL A 131 ? 0.5716 0.5268 0.4463 0.0717  -0.0636 -0.0339 722 VAL A CG2 
912  N N   . GLY A 132 ? 0.4631 0.4169 0.4007 0.0687  -0.0309 -0.0306 723 GLY A N   
913  C CA  . GLY A 132 ? 0.4408 0.3984 0.3920 0.0685  -0.0203 -0.0255 723 GLY A CA  
914  C C   . GLY A 132 ? 0.4716 0.4313 0.4461 0.0607  -0.0210 -0.0189 723 GLY A C   
915  O O   . GLY A 132 ? 0.4665 0.4338 0.4486 0.0587  -0.0135 -0.0105 723 GLY A O   
916  N N   . MET A 133 ? 0.4468 0.4008 0.4325 0.0558  -0.0299 -0.0232 724 MET A N   
917  C CA  . MET A 133 ? 0.4423 0.3998 0.4504 0.0486  -0.0301 -0.0183 724 MET A CA  
918  C C   . MET A 133 ? 0.4737 0.4400 0.4840 0.0478  -0.0296 -0.0096 724 MET A C   
919  O O   . MET A 133 ? 0.4455 0.4159 0.4678 0.0444  -0.0234 -0.0036 724 MET A O   
920  C CB  . MET A 133 ? 0.4772 0.4301 0.4977 0.0435  -0.0397 -0.0248 724 MET A CB  
921  C CG  . MET A 133 ? 0.5579 0.4985 0.5787 0.0422  -0.0410 -0.0327 724 MET A CG  
922  S SD  . MET A 133 ? 0.6452 0.5832 0.6829 0.0334  -0.0531 -0.0393 724 MET A SD  
923  C CE  . MET A 133 ? 0.6313 0.5501 0.6583 0.0340  -0.0572 -0.0503 724 MET A CE  
924  N N   . LEU A 134 ? 0.4295 0.3969 0.4265 0.0511  -0.0364 -0.0091 725 LEU A N   
925  C CA  . LEU A 134 ? 0.4145 0.3867 0.4106 0.0515  -0.0375 -0.0002 725 LEU A CA  
926  C C   . LEU A 134 ? 0.4650 0.4405 0.4527 0.0521  -0.0268 0.0082  725 LEU A C   
927  O O   . LEU A 134 ? 0.4589 0.4359 0.4542 0.0497  -0.0242 0.0159  725 LEU A O   
928  C CB  . LEU A 134 ? 0.4476 0.4190 0.4281 0.0550  -0.0488 -0.0010 725 LEU A CB  
929  C CG  . LEU A 134 ? 0.4782 0.4499 0.4716 0.0531  -0.0620 -0.0074 725 LEU A CG  
930  C CD1 . LEU A 134 ? 0.5115 0.4830 0.4858 0.0566  -0.0740 -0.0082 725 LEU A CD1 
931  C CD2 . LEU A 134 ? 0.4655 0.4427 0.4856 0.0504  -0.0631 -0.0025 725 LEU A CD2 
932  N N   . ARG A 135 ? 0.4429 0.4195 0.4163 0.0553  -0.0204 0.0062  726 ARG A N   
933  C CA  . ARG A 135 ? 0.4487 0.4319 0.4159 0.0552  -0.0099 0.0137  726 ARG A CA  
934  C C   . ARG A 135 ? 0.4730 0.4588 0.4591 0.0501  -0.0033 0.0170  726 ARG A C   
935  O O   . ARG A 135 ? 0.4552 0.4447 0.4438 0.0464  0.0017  0.0251  726 ARG A O   
936  C CB  . ARG A 135 ? 0.4556 0.4423 0.4059 0.0611  -0.0044 0.0093  726 ARG A CB  
937  C CG  . ARG A 135 ? 0.5408 0.5385 0.4840 0.0610  0.0064  0.0177  726 ARG A CG  
938  C CD  . ARG A 135 ? 0.5130 0.5179 0.4720 0.0589  0.0147  0.0198  726 ARG A CD  
939  N NE  . ARG A 135 ? 0.5114 0.5294 0.4653 0.0577  0.0242  0.0279  726 ARG A NE  
940  C CZ  . ARG A 135 ? 0.5574 0.5844 0.5242 0.0526  0.0303  0.0341  726 ARG A CZ  
941  N NH1 . ARG A 135 ? 0.4263 0.4500 0.4097 0.0491  0.0285  0.0329  726 ARG A NH1 
942  N NH2 . ARG A 135 ? 0.3796 0.4200 0.3424 0.0504  0.0384  0.0416  726 ARG A NH2 
943  N N   . GLY A 136 ? 0.4377 0.4203 0.4355 0.0492  -0.0039 0.0108  727 GLY A N   
944  C CA  . GLY A 136 ? 0.4044 0.3886 0.4175 0.0440  0.0011  0.0132  727 GLY A CA  
945  C C   . GLY A 136 ? 0.4269 0.4101 0.4515 0.0388  -0.0003 0.0168  727 GLY A C   
946  O O   . GLY A 136 ? 0.4113 0.3974 0.4402 0.0347  0.0052  0.0221  727 GLY A O   
947  N N   . ILE A 137 ? 0.3951 0.3747 0.4247 0.0394  -0.0080 0.0138  728 ILE A N   
948  C CA  . ILE A 137 ? 0.3879 0.3671 0.4303 0.0367  -0.0094 0.0164  728 ILE A CA  
949  C C   . ILE A 137 ? 0.4611 0.4393 0.4959 0.0369  -0.0072 0.0247  728 ILE A C   
950  O O   . ILE A 137 ? 0.4478 0.4244 0.4905 0.0332  -0.0027 0.0277  728 ILE A O   
951  C CB  . ILE A 137 ? 0.4167 0.3955 0.4687 0.0384  -0.0190 0.0119  728 ILE A CB  
952  C CG1 . ILE A 137 ? 0.4118 0.3907 0.4736 0.0355  -0.0204 0.0045  728 ILE A CG1 
953  C CG2 . ILE A 137 ? 0.3837 0.3632 0.4508 0.0379  -0.0197 0.0146  728 ILE A CG2 
954  C CD1 . ILE A 137 ? 0.4327 0.4126 0.5006 0.0365  -0.0316 -0.0011 728 ILE A CD1 
955  N N   . ALA A 138 ? 0.4388 0.4168 0.4567 0.0407  -0.0100 0.0282  729 ALA A N   
956  C CA  . ALA A 138 ? 0.4475 0.4235 0.4554 0.0400  -0.0081 0.0377  729 ALA A CA  
957  C C   . ALA A 138 ? 0.4778 0.4576 0.4859 0.0345  0.0021  0.0420  729 ALA A C   
958  O O   . ALA A 138 ? 0.4626 0.4381 0.4727 0.0304  0.0045  0.0484  729 ALA A O   
959  C CB  . ALA A 138 ? 0.4733 0.4503 0.4601 0.0444  -0.0118 0.0404  729 ALA A CB  
960  N N   . ALA A 139 ? 0.4363 0.4236 0.4432 0.0345  0.0073  0.0384  730 ALA A N   
961  C CA  . ALA A 139 ? 0.4033 0.3976 0.4126 0.0296  0.0155  0.0420  730 ALA A CA  
962  C C   . ALA A 139 ? 0.4409 0.4317 0.4646 0.0233  0.0171  0.0409  730 ALA A C   
963  O O   . ALA A 139 ? 0.4254 0.4169 0.4505 0.0172  0.0211  0.0458  730 ALA A O   
964  C CB  . ALA A 139 ? 0.4040 0.4068 0.4115 0.0332  0.0188  0.0377  730 ALA A CB  
965  N N   . GLY A 140 ? 0.3972 0.3841 0.4307 0.0243  0.0140  0.0344  731 GLY A N   
966  C CA  . GLY A 140 ? 0.3839 0.3679 0.4292 0.0190  0.0163  0.0321  731 GLY A CA  
967  C C   . GLY A 140 ? 0.4338 0.4097 0.4823 0.0173  0.0155  0.0347  731 GLY A C   
968  O O   . GLY A 140 ? 0.4152 0.3881 0.4667 0.0114  0.0196  0.0355  731 GLY A O   
969  N N   . MET A 141 ? 0.3548 0.3259 0.4012 0.0227  0.0095  0.0364  732 MET A N   
970  C CA  . MET A 141 ? 0.3675 0.3288 0.4169 0.0233  0.0072  0.0400  732 MET A CA  
971  C C   . MET A 141 ? 0.4469 0.4034 0.4857 0.0191  0.0100  0.0488  732 MET A C   
972  O O   . MET A 141 ? 0.4563 0.4023 0.4991 0.0162  0.0110  0.0509  732 MET A O   
973  C CB  . MET A 141 ? 0.4003 0.3592 0.4516 0.0309  -0.0019 0.0400  732 MET A CB  
974  C CG  . MET A 141 ? 0.4292 0.3926 0.4972 0.0334  -0.0048 0.0314  732 MET A CG  
975  S SD  . MET A 141 ? 0.4837 0.4445 0.5706 0.0305  0.0016  0.0259  732 MET A SD  
976  C CE  . MET A 141 ? 0.4431 0.3889 0.5300 0.0339  -0.0008 0.0326  732 MET A CE  
977  N N   . LYS A 142 ? 0.4202 0.3844 0.4463 0.0182  0.0120  0.0534  733 LYS A N   
978  C CA  . LYS A 142 ? 0.4217 0.3850 0.4390 0.0122  0.0161  0.0624  733 LYS A CA  
979  C C   . LYS A 142 ? 0.4803 0.4441 0.5055 0.0035  0.0217  0.0608  733 LYS A C   
980  O O   . LYS A 142 ? 0.4852 0.4392 0.5102 -0.0028 0.0230  0.0655  733 LYS A O   
981  C CB  . LYS A 142 ? 0.4314 0.4079 0.4360 0.0135  0.0191  0.0659  733 LYS A CB  
982  C CG  . LYS A 142 ? 0.4854 0.4655 0.4828 0.0060  0.0249  0.0758  733 LYS A CG  
983  C CD  . LYS A 142 ? 0.5254 0.5228 0.5136 0.0082  0.0300  0.0773  733 LYS A CD  
984  C CE  . LYS A 142 ? 0.5912 0.5949 0.5726 0.0004  0.0362  0.0883  733 LYS A CE  
985  N NZ  . LYS A 142 ? 0.5099 0.5192 0.5035 -0.0100 0.0407  0.0898  733 LYS A NZ  
986  N N   . TYR A 143 ? 0.4287 0.4021 0.4598 0.0028  0.0241  0.0541  734 TYR A N   
987  C CA  . TYR A 143 ? 0.4180 0.3939 0.4545 -0.0055 0.0282  0.0520  734 TYR A CA  
988  C C   . TYR A 143 ? 0.4795 0.4408 0.5227 -0.0083 0.0278  0.0475  734 TYR A C   
989  O O   . TYR A 143 ? 0.4789 0.4337 0.5217 -0.0163 0.0299  0.0489  734 TYR A O   
990  C CB  . TYR A 143 ? 0.3999 0.3879 0.4400 -0.0040 0.0294  0.0468  734 TYR A CB  
991  C CG  . TYR A 143 ? 0.4172 0.4090 0.4611 -0.0122 0.0322  0.0447  734 TYR A CG  
992  C CD1 . TYR A 143 ? 0.4208 0.4062 0.4692 -0.0140 0.0325  0.0379  734 TYR A CD1 
993  C CD2 . TYR A 143 ? 0.4357 0.4393 0.4784 -0.0183 0.0343  0.0495  734 TYR A CD2 
994  C CE1 . TYR A 143 ? 0.3597 0.3489 0.4082 -0.0217 0.0345  0.0358  734 TYR A CE1 
995  C CE2 . TYR A 143 ? 0.4446 0.4528 0.4898 -0.0262 0.0350  0.0476  734 TYR A CE2 
996  C CZ  . TYR A 143 ? 0.4420 0.4422 0.4884 -0.0277 0.0348  0.0406  734 TYR A CZ  
997  O OH  . TYR A 143 ? 0.4018 0.4063 0.4473 -0.0356 0.0350  0.0385  734 TYR A OH  
998  N N   . LEU A 144 ? 0.4412 0.3979 0.4912 -0.0017 0.0253  0.0414  735 LEU A N   
999  C CA  . LEU A 144 ? 0.4474 0.3925 0.5060 -0.0015 0.0259  0.0354  735 LEU A CA  
1000 C C   . LEU A 144 ? 0.4794 0.4082 0.5364 -0.0020 0.0242  0.0402  735 LEU A C   
1001 O O   . LEU A 144 ? 0.4773 0.3951 0.5357 -0.0075 0.0270  0.0374  735 LEU A O   
1002 C CB  . LEU A 144 ? 0.4526 0.4006 0.5210 0.0066  0.0232  0.0298  735 LEU A CB  
1003 C CG  . LEU A 144 ? 0.5328 0.4745 0.6135 0.0082  0.0256  0.0218  735 LEU A CG  
1004 C CD1 . LEU A 144 ? 0.5455 0.4981 0.6356 0.0106  0.0264  0.0156  735 LEU A CD1 
1005 C CD2 . LEU A 144 ? 0.5578 0.4887 0.6452 0.0157  0.0208  0.0237  735 LEU A CD2 
1006 N N   . SER A 145 ? 0.4826 0.4085 0.5349 0.0033  0.0193  0.0477  736 SER A N   
1007 C CA  . SER A 145 ? 0.5061 0.4144 0.5556 0.0033  0.0166  0.0547  736 SER A CA  
1008 C C   . SER A 145 ? 0.5776 0.4810 0.6189 -0.0080 0.0203  0.0610  736 SER A C   
1009 O O   . SER A 145 ? 0.5715 0.4567 0.6139 -0.0119 0.0204  0.0622  736 SER A O   
1010 C CB  . SER A 145 ? 0.5654 0.4728 0.6091 0.0114  0.0096  0.0625  736 SER A CB  
1011 O OG  . SER A 145 ? 0.6486 0.5685 0.6792 0.0095  0.0103  0.0685  736 SER A OG  
1012 N N   . GLU A 146 ? 0.5501 0.4700 0.5849 -0.0136 0.0236  0.0643  737 GLU A N   
1013 C CA  . GLU A 146 ? 0.5572 0.4772 0.5873 -0.0256 0.0272  0.0704  737 GLU A CA  
1014 C C   . GLU A 146 ? 0.6130 0.5308 0.6488 -0.0343 0.0301  0.0620  737 GLU A C   
1015 O O   . GLU A 146 ? 0.6350 0.5475 0.6688 -0.0455 0.0316  0.0655  737 GLU A O   
1016 C CB  . GLU A 146 ? 0.5696 0.5101 0.5928 -0.0275 0.0299  0.0773  737 GLU A CB  
1017 C CG  . GLU A 146 ? 0.6623 0.5992 0.6747 -0.0227 0.0276  0.0874  737 GLU A CG  
1018 C CD  . GLU A 146 ? 0.8209 0.7780 0.8245 -0.0204 0.0307  0.0922  737 GLU A CD  
1019 O OE1 . GLU A 146 ? 0.6103 0.5860 0.6180 -0.0222 0.0349  0.0885  737 GLU A OE1 
1020 O OE2 . GLU A 146 ? 0.6257 0.5797 0.6174 -0.0162 0.0288  0.0996  737 GLU A OE2 
1021 N N   . MET A 147 ? 0.5553 0.4758 0.5974 -0.0301 0.0308  0.0512  738 MET A N   
1022 C CA  . MET A 147 ? 0.5659 0.4824 0.6105 -0.0372 0.0334  0.0421  738 MET A CA  
1023 C C   . MET A 147 ? 0.6028 0.4945 0.6507 -0.0353 0.0331  0.0368  738 MET A C   
1024 O O   . MET A 147 ? 0.5973 0.4817 0.6463 -0.0392 0.0358  0.0271  738 MET A O   
1025 C CB  . MET A 147 ? 0.5939 0.5237 0.6420 -0.0331 0.0351  0.0338  738 MET A CB  
1026 C CG  . MET A 147 ? 0.6697 0.6208 0.7155 -0.0351 0.0354  0.0372  738 MET A CG  
1027 S SD  . MET A 147 ? 0.7627 0.7231 0.8050 -0.0493 0.0363  0.0383  738 MET A SD  
1028 C CE  . MET A 147 ? 0.7180 0.6722 0.7590 -0.0525 0.0382  0.0263  738 MET A CE  
1029 N N   . ASN A 148 ? 0.5663 0.4455 0.6154 -0.0279 0.0296  0.0430  739 ASN A N   
1030 C CA  . ASN A 148 ? 0.5888 0.4435 0.6427 -0.0230 0.0279  0.0404  739 ASN A CA  
1031 C C   . ASN A 148 ? 0.6082 0.4627 0.6736 -0.0127 0.0294  0.0287  739 ASN A C   
1032 O O   . ASN A 148 ? 0.5988 0.4359 0.6694 -0.0107 0.0313  0.0209  739 ASN A O   
1033 C CB  . ASN A 148 ? 0.6354 0.4697 0.6851 -0.0343 0.0293  0.0394  739 ASN A CB  
1034 C CG  . ASN A 148 ? 1.0887 0.9108 1.1320 -0.0385 0.0258  0.0538  739 ASN A CG  
1035 O OD1 . ASN A 148 ? 1.0466 0.8814 1.0833 -0.0479 0.0267  0.0625  739 ASN A OD1 
1036 N ND2 . ASN A 148 ? 1.0093 0.8097 1.0552 -0.0302 0.0218  0.0580  739 ASN A ND2 
1037 N N   . TYR A 149 ? 0.5567 0.4301 0.6266 -0.0058 0.0286  0.0278  740 TYR A N   
1038 C CA  . TYR A 149 ? 0.5407 0.4194 0.6234 0.0032  0.0300  0.0185  740 TYR A CA  
1039 C C   . TYR A 149 ? 0.5819 0.4631 0.6726 0.0149  0.0232  0.0236  740 TYR A C   
1040 O O   . TYR A 149 ? 0.5856 0.4720 0.6685 0.0156  0.0181  0.0331  740 TYR A O   
1041 C CB  . TYR A 149 ? 0.5370 0.4359 0.6190 -0.0004 0.0341  0.0132  740 TYR A CB  
1042 C CG  . TYR A 149 ? 0.5668 0.4638 0.6447 -0.0090 0.0408  0.0043  740 TYR A CG  
1043 C CD1 . TYR A 149 ? 0.5876 0.4879 0.6536 -0.0204 0.0416  0.0070  740 TYR A CD1 
1044 C CD2 . TYR A 149 ? 0.5931 0.4860 0.6787 -0.0059 0.0463  -0.0071 740 TYR A CD2 
1045 C CE1 . TYR A 149 ? 0.5981 0.4961 0.6580 -0.0290 0.0462  -0.0012 740 TYR A CE1 
1046 C CE2 . TYR A 149 ? 0.6145 0.5042 0.6925 -0.0142 0.0525  -0.0160 740 TYR A CE2 
1047 C CZ  . TYR A 149 ? 0.7140 0.6058 0.7782 -0.0260 0.0517  -0.0129 740 TYR A CZ  
1048 O OH  . TYR A 149 ? 0.8238 0.7131 0.8789 -0.0347 0.0564  -0.0220 740 TYR A OH  
1049 N N   . VAL A 150 ? 0.5156 0.3947 0.6221 0.0243  0.0233  0.0165  741 VAL A N   
1050 C CA  . VAL A 150 ? 0.4994 0.3855 0.6182 0.0357  0.0163  0.0189  741 VAL A CA  
1051 C C   . VAL A 150 ? 0.5259 0.4316 0.6576 0.0372  0.0208  0.0090  741 VAL A C   
1052 O O   . VAL A 150 ? 0.5153 0.4209 0.6529 0.0351  0.0292  -0.0008 741 VAL A O   
1053 C CB  . VAL A 150 ? 0.5503 0.4189 0.6797 0.0463  0.0111  0.0212  741 VAL A CB  
1054 C CG1 . VAL A 150 ? 0.5525 0.4123 0.6959 0.0500  0.0184  0.0090  741 VAL A CG1 
1055 C CG2 . VAL A 150 ? 0.5424 0.4213 0.6825 0.0571  0.0012  0.0260  741 VAL A CG2 
1056 N N   . HIS A 151 ? 0.4778 0.3994 0.6114 0.0391  0.0157  0.0117  742 HIS A N   
1057 C CA  . HIS A 151 ? 0.4395 0.3792 0.5848 0.0385  0.0193  0.0042  742 HIS A CA  
1058 C C   . HIS A 151 ? 0.4854 0.4311 0.6550 0.0478  0.0185  -0.0017 742 HIS A C   
1059 O O   . HIS A 151 ? 0.4667 0.4212 0.6481 0.0465  0.0271  -0.0107 742 HIS A O   
1060 C CB  . HIS A 151 ? 0.4165 0.3680 0.5546 0.0366  0.0135  0.0086  742 HIS A CB  
1061 C CG  . HIS A 151 ? 0.4291 0.3956 0.5753 0.0328  0.0176  0.0023  742 HIS A CG  
1062 N ND1 . HIS A 151 ? 0.4348 0.4130 0.6016 0.0372  0.0157  -0.0024 742 HIS A ND1 
1063 C CD2 . HIS A 151 ? 0.4288 0.3999 0.5656 0.0246  0.0233  0.0009  742 HIS A CD2 
1064 C CE1 . HIS A 151 ? 0.4120 0.4004 0.5803 0.0306  0.0208  -0.0061 742 HIS A CE1 
1065 N NE2 . HIS A 151 ? 0.4159 0.3992 0.5657 0.0234  0.0252  -0.0040 742 HIS A NE2 
1066 N N   . ARG A 152 ? 0.4677 0.4110 0.6450 0.0573  0.0079  0.0040  743 ARG A N   
1067 C CA  . ARG A 152 ? 0.4688 0.4190 0.6719 0.0686  0.0038  0.0009  743 ARG A CA  
1068 C C   . ARG A 152 ? 0.5269 0.5015 0.7481 0.0689  0.0018  -0.0037 743 ARG A C   
1069 O O   . ARG A 152 ? 0.5327 0.5176 0.7776 0.0780  -0.0033 -0.0055 743 ARG A O   
1070 C CB  . ARG A 152 ? 0.4293 0.3709 0.6451 0.0731  0.0131  -0.0075 743 ARG A CB  
1071 C CG  . ARG A 152 ? 0.4959 0.4107 0.6961 0.0723  0.0144  -0.0041 743 ARG A CG  
1072 C CD  . ARG A 152 ? 0.6030 0.5068 0.8195 0.0810  0.0204  -0.0126 743 ARG A CD  
1073 N NE  . ARG A 152 ? 0.6455 0.5595 0.8685 0.0769  0.0343  -0.0261 743 ARG A NE  
1074 C CZ  . ARG A 152 ? 0.7402 0.6622 0.9866 0.0859  0.0410  -0.0365 743 ARG A CZ  
1075 N NH1 . ARG A 152 ? 0.5643 0.4858 0.8330 0.1007  0.0341  -0.0349 743 ARG A NH1 
1076 N NH2 . ARG A 152 ? 0.5947 0.5259 0.8422 0.0806  0.0548  -0.0482 743 ARG A NH2 
1077 N N   . ASP A 153 ? 0.4834 0.4670 0.6950 0.0591  0.0053  -0.0052 744 ASP A N   
1078 C CA  . ASP A 153 ? 0.4582 0.4623 0.6855 0.0567  0.0041  -0.0092 744 ASP A CA  
1079 C C   . ASP A 153 ? 0.4920 0.4975 0.7022 0.0505  -0.0028 -0.0049 744 ASP A C   
1080 O O   . ASP A 153 ? 0.4840 0.4997 0.6970 0.0435  0.0001  -0.0083 744 ASP A O   
1081 C CB  . ASP A 153 ? 0.4746 0.4872 0.7100 0.0503  0.0187  -0.0177 744 ASP A CB  
1082 C CG  . ASP A 153 ? 0.5078 0.5430 0.7705 0.0500  0.0207  -0.0233 744 ASP A CG  
1083 O OD1 . ASP A 153 ? 0.4631 0.5089 0.7420 0.0555  0.0095  -0.0215 744 ASP A OD1 
1084 O OD2 . ASP A 153 ? 0.5654 0.6086 0.8325 0.0435  0.0333  -0.0292 744 ASP A OD2 
1085 N N   . LEU A 154 ? 0.4439 0.4384 0.6356 0.0531  -0.0113 0.0027  745 LEU A N   
1086 C CA  . LEU A 154 ? 0.4296 0.4244 0.6034 0.0490  -0.0172 0.0058  745 LEU A CA  
1087 C C   . LEU A 154 ? 0.4731 0.4803 0.6589 0.0515  -0.0288 0.0041  745 LEU A C   
1088 O O   . LEU A 154 ? 0.4935 0.5018 0.6844 0.0589  -0.0396 0.0076  745 LEU A O   
1089 C CB  . LEU A 154 ? 0.4306 0.4112 0.5796 0.0501  -0.0201 0.0141  745 LEU A CB  
1090 C CG  . LEU A 154 ? 0.4611 0.4417 0.5892 0.0471  -0.0242 0.0166  745 LEU A CG  
1091 C CD1 . LEU A 154 ? 0.4428 0.4262 0.5659 0.0393  -0.0155 0.0124  745 LEU A CD1 
1092 C CD2 . LEU A 154 ? 0.4720 0.4417 0.5787 0.0488  -0.0262 0.0254  745 LEU A CD2 
1093 N N   . ALA A 155 ? 0.4249 0.4413 0.6162 0.0447  -0.0269 -0.0011 746 ALA A N   
1094 C CA  . ALA A 155 ? 0.4180 0.4467 0.6225 0.0436  -0.0368 -0.0046 746 ALA A CA  
1095 C C   . ALA A 155 ? 0.4275 0.4538 0.6202 0.0350  -0.0343 -0.0074 746 ALA A C   
1096 O O   . ALA A 155 ? 0.4050 0.4261 0.5901 0.0298  -0.0229 -0.0075 746 ALA A O   
1097 C CB  . ALA A 155 ? 0.4184 0.4641 0.6560 0.0439  -0.0337 -0.0095 746 ALA A CB  
1098 N N   . ALA A 156 ? 0.3763 0.4057 0.5678 0.0331  -0.0453 -0.0099 747 ALA A N   
1099 C CA  . ALA A 156 ? 0.3501 0.3740 0.5309 0.0255  -0.0438 -0.0132 747 ALA A CA  
1100 C C   . ALA A 156 ? 0.3790 0.4088 0.5760 0.0168  -0.0328 -0.0159 747 ALA A C   
1101 O O   . ALA A 156 ? 0.3630 0.3840 0.5477 0.0116  -0.0263 -0.0155 747 ALA A O   
1102 C CB  . ALA A 156 ? 0.3541 0.3798 0.5336 0.0244  -0.0582 -0.0174 747 ALA A CB  
1103 N N   . ARG A 157 ? 0.3573 0.4022 0.5812 0.0160  -0.0301 -0.0178 748 ARG A N   
1104 C CA  . ARG A 157 ? 0.3629 0.4158 0.6020 0.0075  -0.0181 -0.0198 748 ARG A CA  
1105 C C   . ARG A 157 ? 0.4135 0.4579 0.6386 0.0065  -0.0040 -0.0172 748 ARG A C   
1106 O O   . ARG A 157 ? 0.4092 0.4559 0.6373 -0.0017 0.0058  -0.0177 748 ARG A O   
1107 C CB  . ARG A 157 ? 0.3774 0.4517 0.6499 0.0083  -0.0175 -0.0229 748 ARG A CB  
1108 C CG  . ARG A 157 ? 0.4792 0.5564 0.7586 0.0189  -0.0138 -0.0221 748 ARG A CG  
1109 C CD  . ARG A 157 ? 0.6331 0.7328 0.9478 0.0220  -0.0131 -0.0257 748 ARG A CD  
1110 N NE  . ARG A 157 ? 0.8124 0.9115 1.1324 0.0354  -0.0207 -0.0238 748 ARG A NE  
1111 C CZ  . ARG A 157 ? 1.0959 1.1879 1.4139 0.0431  -0.0127 -0.0234 748 ARG A CZ  
1112 N NH1 . ARG A 157 ? 1.0337 1.1220 1.3555 0.0551  -0.0212 -0.0204 748 ARG A NH1 
1113 N NH2 . ARG A 157 ? 0.9892 1.0763 1.3001 0.0385  0.0032  -0.0260 748 ARG A NH2 
1114 N N   . ASN A 158 ? 0.3831 0.4179 0.5928 0.0138  -0.0036 -0.0142 749 ASN A N   
1115 C CA  . ASN A 158 ? 0.3788 0.4056 0.5747 0.0126  0.0076  -0.0123 749 ASN A CA  
1116 C C   . ASN A 158 ? 0.4339 0.4473 0.6037 0.0116  0.0064  -0.0082 749 ASN A C   
1117 O O   . ASN A 158 ? 0.4358 0.4427 0.5926 0.0110  0.0129  -0.0057 749 ASN A O   
1118 C CB  . ASN A 158 ? 0.3466 0.3731 0.5482 0.0201  0.0102  -0.0125 749 ASN A CB  
1119 C CG  . ASN A 158 ? 0.4357 0.4769 0.6642 0.0210  0.0157  -0.0176 749 ASN A CG  
1120 O OD1 . ASN A 158 ? 0.4375 0.4894 0.6776 0.0138  0.0213  -0.0205 749 ASN A OD1 
1121 N ND2 . ASN A 158 ? 0.4220 0.4648 0.6625 0.0299  0.0141  -0.0187 749 ASN A ND2 
1122 N N   . ILE A 159 ? 0.3849 0.3949 0.5481 0.0113  -0.0019 -0.0082 750 ILE A N   
1123 C CA  . ILE A 159 ? 0.3865 0.3858 0.5279 0.0115  -0.0030 -0.0056 750 ILE A CA  
1124 C C   . ILE A 159 ? 0.4386 0.4349 0.5806 0.0044  -0.0016 -0.0070 750 ILE A C   
1125 O O   . ILE A 159 ? 0.4347 0.4349 0.5898 0.0007  -0.0062 -0.0104 750 ILE A O   
1126 C CB  . ILE A 159 ? 0.4199 0.4149 0.5490 0.0186  -0.0130 -0.0050 750 ILE A CB  
1127 C CG1 . ILE A 159 ? 0.4325 0.4266 0.5567 0.0242  -0.0121 -0.0006 750 ILE A CG1 
1128 C CG2 . ILE A 159 ? 0.4071 0.3931 0.5164 0.0193  -0.0133 -0.0043 750 ILE A CG2 
1129 C CD1 . ILE A 159 ? 0.5737 0.5686 0.6970 0.0304  -0.0223 0.0002  750 ILE A CD1 
1130 N N   . LEU A 160 ? 0.3956 0.3856 0.5252 0.0020  0.0045  -0.0037 751 LEU A N   
1131 C CA  . LEU A 160 ? 0.3982 0.3821 0.5262 -0.0041 0.0058  -0.0030 751 LEU A CA  
1132 C C   . LEU A 160 ? 0.4520 0.4247 0.5644 0.0008  0.0004  -0.0029 751 LEU A C   
1133 O O   . LEU A 160 ? 0.4233 0.3952 0.5238 0.0076  -0.0002 -0.0015 751 LEU A O   
1134 C CB  . LEU A 160 ? 0.3864 0.3715 0.5120 -0.0100 0.0158  0.0013  751 LEU A CB  
1135 C CG  . LEU A 160 ? 0.4245 0.4210 0.5655 -0.0154 0.0232  -0.0005 751 LEU A CG  
1136 C CD1 . LEU A 160 ? 0.4245 0.4215 0.5571 -0.0202 0.0327  0.0028  751 LEU A CD1 
1137 C CD2 . LEU A 160 ? 0.4634 0.4641 0.6201 -0.0229 0.0228  -0.0023 751 LEU A CD2 
1138 N N   . VAL A 161 ? 0.4121 0.3757 0.5252 -0.0025 -0.0034 -0.0048 752 VAL A N   
1139 C CA  . VAL A 161 ? 0.3944 0.3453 0.4941 0.0031  -0.0090 -0.0072 752 VAL A CA  
1140 C C   . VAL A 161 ? 0.4133 0.3526 0.5090 0.0001  -0.0063 -0.0035 752 VAL A C   
1141 O O   . VAL A 161 ? 0.4001 0.3369 0.5052 -0.0088 -0.0050 -0.0020 752 VAL A O   
1142 C CB  . VAL A 161 ? 0.4419 0.3885 0.5452 0.0029  -0.0193 -0.0150 752 VAL A CB  
1143 C CG1 . VAL A 161 ? 0.4399 0.3735 0.5260 0.0107  -0.0245 -0.0197 752 VAL A CG1 
1144 C CG2 . VAL A 161 ? 0.4335 0.3931 0.5453 0.0043  -0.0235 -0.0172 752 VAL A CG2 
1145 N N   . ASN A 162 ? 0.3791 0.3124 0.4618 0.0073  -0.0052 -0.0013 753 ASN A N   
1146 C CA  . ASN A 162 ? 0.4034 0.3244 0.4824 0.0065  -0.0041 0.0029  753 ASN A CA  
1147 C C   . ASN A 162 ? 0.4907 0.3938 0.5659 0.0100  -0.0113 -0.0037 753 ASN A C   
1148 O O   . ASN A 162 ? 0.4765 0.3787 0.5508 0.0121  -0.0170 -0.0119 753 ASN A O   
1149 C CB  . ASN A 162 ? 0.3733 0.2990 0.4438 0.0124  0.0006  0.0095  753 ASN A CB  
1150 C CG  . ASN A 162 ? 0.5740 0.5003 0.6349 0.0244  -0.0008 0.0065  753 ASN A CG  
1151 O OD1 . ASN A 162 ? 0.5271 0.4472 0.5836 0.0298  -0.0052 -0.0011 753 ASN A OD1 
1152 N ND2 . ASN A 162 ? 0.4956 0.4301 0.5528 0.0285  0.0031  0.0123  753 ASN A ND2 
1153 N N   . SER A 163 ? 0.4732 0.3605 0.5451 0.0108  -0.0117 -0.0002 754 SER A N   
1154 C CA  . SER A 163 ? 0.4781 0.3437 0.5464 0.0136  -0.0183 -0.0068 754 SER A CA  
1155 C C   . SER A 163 ? 0.5402 0.4033 0.5968 0.0267  -0.0212 -0.0160 754 SER A C   
1156 O O   . SER A 163 ? 0.5642 0.4116 0.6167 0.0282  -0.0275 -0.0254 754 SER A O   
1157 C CB  . SER A 163 ? 0.5348 0.3829 0.6019 0.0130  -0.0178 0.0005  754 SER A CB  
1158 O OG  . SER A 163 ? 0.6500 0.5038 0.7104 0.0235  -0.0142 0.0059  754 SER A OG  
1159 N N   . ASN A 164 ? 0.4976 0.3768 0.5484 0.0349  -0.0163 -0.0137 755 ASN A N   
1160 C CA  . ASN A 164 ? 0.4899 0.3707 0.5288 0.0469  -0.0166 -0.0209 755 ASN A CA  
1161 C C   . ASN A 164 ? 0.5044 0.3998 0.5396 0.0463  -0.0174 -0.0244 755 ASN A C   
1162 O O   . ASN A 164 ? 0.4942 0.3962 0.5182 0.0552  -0.0154 -0.0274 755 ASN A O   
1163 C CB  . ASN A 164 ? 0.5028 0.3905 0.5380 0.0572  -0.0106 -0.0156 755 ASN A CB  
1164 C CG  . ASN A 164 ? 0.6504 0.5192 0.6864 0.0626  -0.0121 -0.0148 755 ASN A CG  
1165 O OD1 . ASN A 164 ? 0.6619 0.5103 0.6931 0.0668  -0.0167 -0.0238 755 ASN A OD1 
1166 N ND2 . ASN A 164 ? 0.5243 0.3979 0.5659 0.0622  -0.0091 -0.0040 755 ASN A ND2 
1167 N N   . LEU A 165 ? 0.4566 0.3568 0.5012 0.0362  -0.0206 -0.0239 756 LEU A N   
1168 C CA  . LEU A 165 ? 0.4563 0.3689 0.4999 0.0353  -0.0234 -0.0262 756 LEU A CA  
1169 C C   . LEU A 165 ? 0.4957 0.4251 0.5371 0.0381  -0.0168 -0.0190 756 LEU A C   
1170 O O   . LEU A 165 ? 0.4578 0.3950 0.4937 0.0402  -0.0189 -0.0200 756 LEU A O   
1171 C CB  . LEU A 165 ? 0.4786 0.3843 0.5084 0.0409  -0.0306 -0.0368 756 LEU A CB  
1172 C CG  . LEU A 165 ? 0.5503 0.4371 0.5801 0.0377  -0.0387 -0.0462 756 LEU A CG  
1173 C CD1 . LEU A 165 ? 0.5590 0.4394 0.5704 0.0444  -0.0452 -0.0576 756 LEU A CD1 
1174 C CD2 . LEU A 165 ? 0.5715 0.4608 0.6191 0.0252  -0.0442 -0.0455 756 LEU A CD2 
1175 N N   . VAL A 166 ? 0.4260 0.3602 0.4711 0.0375  -0.0097 -0.0113 757 VAL A N   
1176 C CA  . VAL A 166 ? 0.4117 0.3606 0.4562 0.0377  -0.0039 -0.0046 757 VAL A CA  
1177 C C   . VAL A 166 ? 0.4469 0.4015 0.5030 0.0294  -0.0042 -0.0026 757 VAL A C   
1178 O O   . VAL A 166 ? 0.4177 0.3695 0.4840 0.0224  -0.0035 -0.0016 757 VAL A O   
1179 C CB  . VAL A 166 ? 0.4314 0.3849 0.4757 0.0396  0.0023  0.0021  757 VAL A CB  
1180 C CG1 . VAL A 166 ? 0.4188 0.3869 0.4632 0.0375  0.0074  0.0084  757 VAL A CG1 
1181 C CG2 . VAL A 166 ? 0.4199 0.3690 0.4557 0.0500  0.0026  -0.0009 757 VAL A CG2 
1182 N N   . CYS A 167 ? 0.3970 0.3591 0.4515 0.0306  -0.0053 -0.0022 758 CYS A N   
1183 C CA  . CYS A 167 ? 0.3854 0.3528 0.4519 0.0254  -0.0061 -0.0014 758 CYS A CA  
1184 C C   . CYS A 167 ? 0.4247 0.3990 0.4927 0.0234  0.0008  0.0046  758 CYS A C   
1185 O O   . CYS A 167 ? 0.4030 0.3802 0.4614 0.0267  0.0035  0.0082  758 CYS A O   
1186 C CB  . CYS A 167 ? 0.3792 0.3481 0.4444 0.0285  -0.0138 -0.0047 758 CYS A CB  
1187 S SG  . CYS A 167 ? 0.4316 0.3922 0.4963 0.0284  -0.0240 -0.0137 758 CYS A SG  
1188 N N   . LYS A 168 ? 0.3998 0.3769 0.4799 0.0173  0.0041  0.0052  759 LYS A N   
1189 C CA  . LYS A 168 ? 0.3967 0.3781 0.4776 0.0142  0.0108  0.0090  759 LYS A CA  
1190 C C   . LYS A 168 ? 0.4301 0.4148 0.5232 0.0120  0.0119  0.0072  759 LYS A C   
1191 O O   . LYS A 168 ? 0.4233 0.4102 0.5289 0.0089  0.0116  0.0038  759 LYS A O   
1192 C CB  . LYS A 168 ? 0.4005 0.3816 0.4800 0.0091  0.0160  0.0116  759 LYS A CB  
1193 C CG  . LYS A 168 ? 0.3951 0.3736 0.4646 0.0132  0.0147  0.0140  759 LYS A CG  
1194 C CD  . LYS A 168 ? 0.3865 0.3647 0.4545 0.0092  0.0180  0.0181  759 LYS A CD  
1195 C CE  . LYS A 168 ? 0.4182 0.3919 0.4803 0.0153  0.0153  0.0193  759 LYS A CE  
1196 N NZ  . LYS A 168 ? 0.4067 0.3870 0.4647 0.0155  0.0179  0.0254  759 LYS A NZ  
1197 N N   . VAL A 169 ? 0.3860 0.3709 0.4764 0.0136  0.0137  0.0095  760 VAL A N   
1198 C CA  . VAL A 169 ? 0.3865 0.3726 0.4883 0.0132  0.0156  0.0076  760 VAL A CA  
1199 C C   . VAL A 169 ? 0.4138 0.4027 0.5221 0.0067  0.0236  0.0050  760 VAL A C   
1200 O O   . VAL A 169 ? 0.3946 0.3827 0.4938 0.0021  0.0281  0.0071  760 VAL A O   
1201 C CB  . VAL A 169 ? 0.4263 0.4078 0.5221 0.0157  0.0159  0.0112  760 VAL A CB  
1202 C CG1 . VAL A 169 ? 0.4241 0.4044 0.5333 0.0173  0.0172  0.0082  760 VAL A CG1 
1203 C CG2 . VAL A 169 ? 0.4280 0.4075 0.5143 0.0214  0.0087  0.0150  760 VAL A CG2 
1204 N N   . SER A 170 ? 0.4075 0.4011 0.5316 0.0063  0.0251  0.0005  761 SER A N   
1205 C CA  . SER A 170 ? 0.4204 0.4186 0.5509 0.0001  0.0339  -0.0026 761 SER A CA  
1206 C C   . SER A 170 ? 0.4680 0.4702 0.6140 0.0032  0.0375  -0.0077 761 SER A C   
1207 O O   . SER A 170 ? 0.4551 0.4547 0.6059 0.0104  0.0319  -0.0074 761 SER A O   
1208 C CB  . SER A 170 ? 0.4683 0.4710 0.6051 -0.0045 0.0332  -0.0030 761 SER A CB  
1209 O OG  . SER A 170 ? 0.6785 0.6872 0.8218 -0.0113 0.0420  -0.0052 761 SER A OG  
1210 N N   . ASP A 171 ? 0.4396 0.4481 0.5931 -0.0015 0.0470  -0.0122 762 ASP A N   
1211 C CA  . ASP A 171 ? 0.4570 0.4717 0.6278 0.0021  0.0528  -0.0187 762 ASP A CA  
1212 C C   . ASP A 171 ? 0.4692 0.4732 0.6357 0.0080  0.0530  -0.0203 762 ASP A C   
1213 O O   . ASP A 171 ? 0.4398 0.4417 0.6164 0.0164  0.0467  -0.0199 762 ASP A O   
1214 C CB  . ASP A 171 ? 0.5069 0.5333 0.7012 0.0066  0.0471  -0.0203 762 ASP A CB  
1215 C CG  . ASP A 171 ? 0.8655 0.9068 1.0824 0.0064  0.0560  -0.0269 762 ASP A CG  
1216 O OD1 . ASP A 171 ? 0.9097 0.9502 1.1332 0.0121  0.0618  -0.0320 762 ASP A OD1 
1217 O OD2 . ASP A 171 ? 1.0055 1.0594 1.2349 0.0008  0.0573  -0.0272 762 ASP A OD2 
1218 N N   . PHE A 172 ? 0.4364 0.4328 0.5871 0.0030  0.0595  -0.0216 763 PHE A N   
1219 C CA  . PHE A 172 ? 0.4460 0.4290 0.5898 0.0059  0.0598  -0.0231 763 PHE A CA  
1220 C C   . PHE A 172 ? 0.5416 0.5228 0.6961 0.0096  0.0683  -0.0327 763 PHE A C   
1221 O O   . PHE A 172 ? 0.5697 0.5366 0.7172 0.0110  0.0692  -0.0351 763 PHE A O   
1222 C CB  . PHE A 172 ? 0.4540 0.4296 0.5752 -0.0021 0.0603  -0.0196 763 PHE A CB  
1223 C CG  . PHE A 172 ? 0.4481 0.4249 0.5612 -0.0027 0.0519  -0.0106 763 PHE A CG  
1224 C CD1 . PHE A 172 ? 0.4599 0.4439 0.5672 -0.0077 0.0519  -0.0075 763 PHE A CD1 
1225 C CD2 . PHE A 172 ? 0.4483 0.4187 0.5598 0.0026  0.0443  -0.0054 763 PHE A CD2 
1226 C CE1 . PHE A 172 ? 0.4540 0.4384 0.5546 -0.0066 0.0450  -0.0008 763 PHE A CE1 
1227 C CE2 . PHE A 172 ? 0.4704 0.4432 0.5737 0.0027  0.0382  0.0015  763 PHE A CE2 
1228 C CZ  . PHE A 172 ? 0.4439 0.4236 0.5425 -0.0012 0.0387  0.0030  763 PHE A CZ  
1229 N N   . GLY A 173 ? 0.5021 0.4974 0.6746 0.0116  0.0744  -0.0383 764 GLY A N   
1230 C CA  . GLY A 173 ? 0.5109 0.5084 0.6972 0.0168  0.0841  -0.0486 764 GLY A CA  
1231 C C   . GLY A 173 ? 0.5895 0.5738 0.7851 0.0282  0.0800  -0.0508 764 GLY A C   
1232 O O   . GLY A 173 ? 0.6149 0.5870 0.8060 0.0300  0.0867  -0.0586 764 GLY A O   
1233 N N   . LEU A 174 ? 0.5138 0.4982 0.7201 0.0356  0.0680  -0.0437 765 LEU A N   
1234 C CA  . LEU A 174 ? 0.4969 0.4677 0.7115 0.0468  0.0617  -0.0427 765 LEU A CA  
1235 C C   . LEU A 174 ? 0.5406 0.4887 0.7326 0.0438  0.0554  -0.0356 765 LEU A C   
1236 O O   . LEU A 174 ? 0.5534 0.4858 0.7489 0.0517  0.0505  -0.0336 765 LEU A O   
1237 C CB  . LEU A 174 ? 0.4857 0.4687 0.7224 0.0563  0.0512  -0.0379 765 LEU A CB  
1238 C CG  . LEU A 174 ? 0.5339 0.5402 0.7993 0.0606  0.0570  -0.0452 765 LEU A CG  
1239 C CD1 . LEU A 174 ? 0.5395 0.5602 0.8245 0.0669  0.0441  -0.0395 765 LEU A CD1 
1240 C CD2 . LEU A 174 ? 0.5388 0.5418 0.8198 0.0701  0.0664  -0.0554 765 LEU A CD2 
1241 N N   . SER A 175 ? 0.4771 0.4238 0.6472 0.0324  0.0557  -0.0314 766 SER A N   
1242 C CA  . SER A 175 ? 0.4869 0.4168 0.6377 0.0280  0.0505  -0.0241 766 SER A CA  
1243 C C   . SER A 175 ? 0.5940 0.5037 0.7384 0.0269  0.0552  -0.0298 766 SER A C   
1244 O O   . SER A 175 ? 0.6135 0.5233 0.7584 0.0247  0.0649  -0.0406 766 SER A O   
1245 C CB  . SER A 175 ? 0.5038 0.4403 0.6366 0.0173  0.0500  -0.0189 766 SER A CB  
1246 O OG  . SER A 175 ? 0.5761 0.5248 0.7123 0.0193  0.0433  -0.0126 766 SER A OG  
1247 N N   . ARG A 176 ? 0.5586 0.4501 0.6966 0.0283  0.0485  -0.0227 767 ARG A N   
1248 C CA  . ARG A 176 ? 0.5754 0.4433 0.7074 0.0267  0.0515  -0.0275 767 ARG A CA  
1249 C C   . ARG A 176 ? 0.6376 0.4911 0.7520 0.0177  0.0462  -0.0178 767 ARG A C   
1250 O O   . ARG A 176 ? 0.5796 0.4345 0.6916 0.0193  0.0383  -0.0056 767 ARG A O   
1251 C CB  . ARG A 176 ? 0.5512 0.4058 0.7010 0.0407  0.0498  -0.0307 767 ARG A CB  
1252 C CG  . ARG A 176 ? 0.5721 0.4419 0.7437 0.0506  0.0565  -0.0415 767 ARG A CG  
1253 C CD  . ARG A 176 ? 0.6389 0.5066 0.8076 0.0469  0.0697  -0.0570 767 ARG A CD  
1254 N NE  . ARG A 176 ? 0.7064 0.5917 0.8980 0.0567  0.0772  -0.0665 767 ARG A NE  
1255 C CZ  . ARG A 176 ? 0.8185 0.7302 1.0160 0.0531  0.0827  -0.0687 767 ARG A CZ  
1256 N NH1 . ARG A 176 ? 0.6650 0.5865 0.8462 0.0409  0.0811  -0.0623 767 ARG A NH1 
1257 N NH2 . ARG A 176 ? 0.7177 0.6461 0.9384 0.0617  0.0900  -0.0770 767 ARG A NH2 
1258 N N   . TYR A 177 ? 0.6657 0.5056 0.7677 0.0078  0.0506  -0.0235 768 TYR A N   
1259 C CA  . TYR A 177 ? 0.6995 0.5254 0.7873 -0.0026 0.0464  -0.0153 768 TYR A CA  
1260 C C   . TYR A 177 ? 0.7520 0.5516 0.8444 0.0040  0.0415  -0.0106 768 TYR A C   
1261 O O   . TYR A 177 ? 0.7642 0.5477 0.8650 0.0112  0.0446  -0.0203 768 TYR A O   
1262 C CB  . TYR A 177 ? 0.7427 0.5629 0.8172 -0.0159 0.0516  -0.0243 768 TYR A CB  
1263 C CG  . TYR A 177 ? 0.8068 0.6192 0.8687 -0.0292 0.0473  -0.0156 768 TYR A CG  
1264 C CD1 . TYR A 177 ? 0.8179 0.6508 0.8738 -0.0361 0.0445  -0.0056 768 TYR A CD1 
1265 C CD2 . TYR A 177 ? 0.8611 0.6458 0.9183 -0.0349 0.0462  -0.0177 768 TYR A CD2 
1266 C CE1 . TYR A 177 ? 0.8367 0.6664 0.8840 -0.0485 0.0413  0.0026  768 TYR A CE1 
1267 C CE2 . TYR A 177 ? 0.8876 0.6668 0.9352 -0.0489 0.0424  -0.0091 768 TYR A CE2 
1268 C CZ  . TYR A 177 ? 0.9925 0.7964 1.0359 -0.0558 0.0402  0.0010  768 TYR A CZ  
1269 O OH  . TYR A 177 ? 1.0725 0.8755 1.1094 -0.0697 0.0373  0.0097  768 TYR A OH  
1270 N N   . LEU A 178 ? 0.6993 0.4948 0.7866 0.0025  0.0342  0.0044  769 LEU A N   
1271 C CA  . LEU A 178 ? 0.9178 0.6875 1.0077 0.0085  0.0284  0.0121  769 LEU A CA  
1272 C C   . LEU A 178 ? 1.4149 1.1558 1.4955 -0.0023 0.0294  0.0109  769 LEU A C   
1273 O O   . LEU A 178 ? 0.9667 0.7101 1.0349 -0.0173 0.0299  0.0152  769 LEU A O   
1274 C CB  . LEU A 178 ? 0.9085 0.6849 0.9944 0.0112  0.0203  0.0293  769 LEU A CB  
1275 C CG  . LEU A 178 ? 0.9338 0.7347 1.0283 0.0218  0.0171  0.0308  769 LEU A CG  
1276 C CD1 . LEU A 178 ? 0.9276 0.7403 1.0100 0.0184  0.0119  0.0448  769 LEU A CD1 
1277 C CD2 . LEU A 178 ? 0.9426 0.7357 1.0535 0.0379  0.0121  0.0298  769 LEU A CD2 
1278 N N   . PRO A 185 ? 0.8682 0.5499 0.9310 0.0187  -0.0094 0.0911  776 PRO A N   
1279 C CA  . PRO A 185 ? 0.8307 0.5344 0.9033 0.0191  -0.0018 0.0724  776 PRO A CA  
1280 C C   . PRO A 185 ? 0.8482 0.5686 0.9375 0.0364  -0.0049 0.0656  776 PRO A C   
1281 O O   . PRO A 185 ? 0.8283 0.5711 0.9160 0.0408  -0.0092 0.0715  776 PRO A O   
1282 C CB  . PRO A 185 ? 0.8293 0.5595 0.8894 0.0052  0.0028  0.0749  776 PRO A CB  
1283 C CG  . PRO A 185 ? 0.9077 0.6338 0.9525 -0.0008 -0.0016 0.0945  776 PRO A CG  
1284 C CD  . PRO A 185 ? 0.8860 0.5864 0.9325 0.0102  -0.0105 0.1051  776 PRO A CD  
1285 N N   . THR A 186 ? 0.8080 0.5166 0.9137 0.0463  -0.0026 0.0529  777 THR A N   
1286 C CA  . THR A 186 ? 0.7953 0.5175 0.9220 0.0633  -0.0049 0.0457  777 THR A CA  
1287 C C   . THR A 186 ? 0.8288 0.5572 0.9688 0.0654  0.0057  0.0253  777 THR A C   
1288 O O   . THR A 186 ? 0.8519 0.5597 0.9879 0.0595  0.0122  0.0163  777 THR A O   
1289 C CB  . THR A 186 ? 0.9097 0.6062 1.0460 0.0778  -0.0145 0.0543  777 THR A CB  
1290 O OG1 . THR A 186 ? 0.9244 0.6148 1.0449 0.0751  -0.0242 0.0745  777 THR A OG1 
1291 C CG2 . THR A 186 ? 0.8545 0.5654 1.0172 0.0972  -0.0181 0.0474  777 THR A CG2 
1292 N N   . PTR A 187 ? 0.7290 0.4851 0.8847 0.0737  0.0072  0.0179  778 PTR A N   
1293 C CA  . PTR A 187 ? 0.7090 0.4746 0.8798 0.0780  0.0174  -0.0003 778 PTR A CA  
1294 C C   . PTR A 187 ? 0.7533 0.5194 0.9502 0.0978  0.0125  -0.0018 778 PTR A C   
1295 O O   . PTR A 187 ? 0.7380 0.5230 0.9445 0.1051  0.0037  0.0062  778 PTR A O   
1296 C CB  . PTR A 187 ? 0.6632 0.4600 0.8311 0.0692  0.0251  -0.0079 778 PTR A CB  
1297 C CG  . PTR A 187 ? 0.6525 0.4604 0.8389 0.0764  0.0353  -0.0250 778 PTR A CG  
1298 C CD1 . PTR A 187 ? 0.6667 0.4626 0.8485 0.0719  0.0470  -0.0401 778 PTR A CD1 
1299 C CD2 . PTR A 187 ? 0.6392 0.4714 0.8480 0.0876  0.0325  -0.0254 778 PTR A CD2 
1300 C CE1 . PTR A 187 ? 0.6799 0.4895 0.8795 0.0800  0.0574  -0.0555 778 PTR A CE1 
1301 C CE2 . PTR A 187 ? 0.6668 0.5133 0.8954 0.0945  0.0420  -0.0393 778 PTR A CE2 
1302 C CZ  . PTR A 187 ? 0.7117 0.5479 0.9359 0.0913  0.0553  -0.0544 778 PTR A CZ  
1303 O OH  . PTR A 187 ? 0.7934 0.6510 1.0414 0.1003  0.0639  -0.0660 778 PTR A OH  
1304 P P   . PTR A 187 ? 0.8596 0.7203 1.1094 0.0995  0.0805  -0.0842 778 PTR A P   
1305 O O1P . PTR A 187 ? 0.8887 0.7343 1.1066 0.0826  0.0875  -0.0898 778 PTR A O1P 
1306 O O2P . PTR A 187 ? 0.9031 0.7486 1.1746 0.1176  0.0822  -0.0921 778 PTR A O2P 
1307 O O3P . PTR A 187 ? 0.8331 0.7305 1.0979 0.0983  0.0869  -0.0873 778 PTR A O3P 
1308 N N   . THR A 188 ? 0.7140 0.4596 0.9228 0.1068  0.0174  -0.0123 779 THR A N   
1309 C CA  . THR A 188 ? 0.7245 0.4712 0.9620 0.1274  0.0138  -0.0152 779 THR A CA  
1310 C C   . THR A 188 ? 0.7898 0.5617 1.0472 0.1326  0.0264  -0.0336 779 THR A C   
1311 O O   . THR A 188 ? 0.8050 0.5673 1.0583 0.1289  0.0391  -0.0488 779 THR A O   
1312 C CB  . THR A 188 ? 0.8199 0.5261 1.0598 0.1371  0.0092  -0.0124 779 THR A CB  
1313 O OG1 . THR A 188 ? 0.8628 0.5489 1.0820 0.1296  -0.0019 0.0068  779 THR A OG1 
1314 C CG2 . THR A 188 ? 0.7648 0.4734 1.0367 0.1606  0.0037  -0.0137 779 THR A CG2 
1315 N N   . SER A 189 ? 0.7363 0.5422 1.0129 0.1388  0.0232  -0.0320 780 SER A N   
1316 C CA  . SER A 189 ? 0.7214 0.5574 1.0194 0.1425  0.0347  -0.0467 780 SER A CA  
1317 C C   . SER A 189 ? 0.8062 0.6379 1.1332 0.1613  0.0405  -0.0589 780 SER A C   
1318 O O   . SER A 189 ? 0.8244 0.6317 1.1594 0.1744  0.0322  -0.0537 780 SER A O   
1319 C CB  . SER A 189 ? 0.7164 0.5881 1.0269 0.1421  0.0278  -0.0401 780 SER A CB  
1320 O OG  . SER A 189 ? 0.7766 0.6771 1.1028 0.1404  0.0407  -0.0531 780 SER A OG  
1321 N N   . SER A 190 ? 0.7600 0.6155 1.1024 0.1626  0.0554  -0.0747 781 SER A N   
1322 C CA  . SER A 190 ? 0.9751 0.8340 1.3473 0.1803  0.0648  -0.0892 781 SER A CA  
1323 C C   . SER A 190 ? 1.3431 1.2468 1.7498 0.1878  0.0668  -0.0917 781 SER A C   
1324 O O   . SER A 190 ? 0.9223 0.8494 1.3295 0.1802  0.0581  -0.0811 781 SER A O   
1325 C CB  . SER A 190 ? 1.0177 0.8636 1.3754 0.1743  0.0835  -0.1080 781 SER A CB  
1326 O OG  . SER A 190 ? 1.0621 0.9268 1.3996 0.1552  0.0925  -0.1111 781 SER A OG  
1327 N N   . PRO A 196 ? 0.6025 0.6965 1.0030 0.1078  -0.0180 -0.0249 787 PRO A N   
1328 C CA  . PRO A 196 ? 0.5890 0.6766 0.9630 0.0981  -0.0290 -0.0181 787 PRO A CA  
1329 C C   . PRO A 196 ? 0.6041 0.6843 0.9724 0.1074  -0.0491 -0.0083 787 PRO A C   
1330 O O   . PRO A 196 ? 0.5881 0.6506 0.9247 0.1037  -0.0561 -0.0012 787 PRO A O   
1331 C CB  . PRO A 196 ? 0.6157 0.6796 0.9545 0.0892  -0.0180 -0.0174 787 PRO A CB  
1332 C CG  . PRO A 196 ? 0.6859 0.7347 1.0267 0.0974  -0.0080 -0.0204 787 PRO A CG  
1333 C CD  . PRO A 196 ? 0.6396 0.7068 1.0198 0.1100  -0.0073 -0.0259 787 PRO A CD  
1334 N N   . VAL A 197 ? 0.5569 0.6527 0.9572 0.1198  -0.0581 -0.0080 788 VAL A N   
1335 C CA  . VAL A 197 ? 0.5533 0.6458 0.9570 0.1322  -0.0775 0.0013  788 VAL A CA  
1336 C C   . VAL A 197 ? 0.5794 0.6656 0.9543 0.1264  -0.0941 0.0096  788 VAL A C   
1337 O O   . VAL A 197 ? 0.5804 0.6445 0.9307 0.1313  -0.1017 0.0194  788 VAL A O   
1338 C CB  . VAL A 197 ? 0.5938 0.7155 1.0444 0.1439  -0.0846 -0.0017 788 VAL A CB  
1339 C CG1 . VAL A 197 ? 0.6005 0.7228 1.0550 0.1556  -0.1082 0.0089  788 VAL A CG1 
1340 C CG2 . VAL A 197 ? 0.5941 0.7158 1.0691 0.1544  -0.0692 -0.0088 788 VAL A CG2 
1341 N N   . ARG A 198 ? 0.5224 0.6264 0.8992 0.1160  -0.0996 0.0058  789 ARG A N   
1342 C CA  . ARG A 198 ? 0.5306 0.6290 0.8805 0.1118  -0.1159 0.0118  789 ARG A CA  
1343 C C   . ARG A 198 ? 0.5634 0.6359 0.8688 0.1038  -0.1091 0.0152  789 ARG A C   
1344 O O   . ARG A 198 ? 0.5669 0.6317 0.8460 0.1023  -0.1210 0.0206  789 ARG A O   
1345 C CB  . ARG A 198 ? 0.5325 0.6553 0.8976 0.1036  -0.1261 0.0061  789 ARG A CB  
1346 C CG  . ARG A 198 ? 0.5526 0.6833 0.9216 0.0891  -0.1127 -0.0032 789 ARG A CG  
1347 C CD  . ARG A 198 ? 0.5915 0.7498 0.9886 0.0826  -0.1227 -0.0089 789 ARG A CD  
1348 N NE  . ARG A 198 ? 0.7088 0.8927 1.1505 0.0914  -0.1238 -0.0104 789 ARG A NE  
1349 C CZ  . ARG A 198 ? 0.8467 1.0552 1.3163 0.0947  -0.1410 -0.0103 789 ARG A CZ  
1350 N NH1 . ARG A 198 ? 0.6928 0.9029 1.1485 0.0884  -0.1594 -0.0095 789 ARG A NH1 
1351 N NH2 . ARG A 198 ? 0.7146 0.9476 1.2271 0.1043  -0.1400 -0.0117 789 ARG A NH2 
1352 N N   . TRP A 199 ? 0.5068 0.5670 0.8042 0.0995  -0.0906 0.0121  790 TRP A N   
1353 C CA  . TRP A 199 ? 0.4975 0.5358 0.7581 0.0928  -0.0830 0.0155  790 TRP A CA  
1354 C C   . TRP A 199 ? 0.5259 0.5424 0.7748 0.0997  -0.0792 0.0230  790 TRP A C   
1355 O O   . TRP A 199 ? 0.5282 0.5273 0.7477 0.0948  -0.0748 0.0278  790 TRP A O   
1356 C CB  . TRP A 199 ? 0.4720 0.5119 0.7311 0.0818  -0.0662 0.0075  790 TRP A CB  
1357 C CG  . TRP A 199 ? 0.4778 0.5301 0.7372 0.0723  -0.0692 0.0021  790 TRP A CG  
1358 C CD1 . TRP A 199 ? 0.5159 0.5599 0.7481 0.0653  -0.0713 0.0027  790 TRP A CD1 
1359 C CD2 . TRP A 199 ? 0.4659 0.5405 0.7552 0.0685  -0.0699 -0.0049 790 TRP A CD2 
1360 N NE1 . TRP A 199 ? 0.4958 0.5523 0.7378 0.0577  -0.0744 -0.0038 790 TRP A NE1 
1361 C CE2 . TRP A 199 ? 0.5139 0.5898 0.7910 0.0585  -0.0739 -0.0080 790 TRP A CE2 
1362 C CE3 . TRP A 199 ? 0.4787 0.5732 0.8052 0.0726  -0.0672 -0.0091 790 TRP A CE3 
1363 C CZ2 . TRP A 199 ? 0.4973 0.5918 0.7976 0.0509  -0.0761 -0.0143 790 TRP A CZ2 
1364 C CZ3 . TRP A 199 ? 0.4908 0.6074 0.8415 0.0651  -0.0683 -0.0152 790 TRP A CZ3 
1365 C CH2 . TRP A 199 ? 0.4978 0.6135 0.8351 0.0536  -0.0731 -0.0173 790 TRP A CH2 
1366 N N   . THR A 200 ? 0.4586 0.4756 0.7313 0.1109  -0.0809 0.0240  791 THR A N   
1367 C CA  . THR A 200 ? 0.4606 0.4546 0.7266 0.1176  -0.0767 0.0297  791 THR A CA  
1368 C C   . THR A 200 ? 0.5334 0.5134 0.7862 0.1261  -0.0925 0.0433  791 THR A C   
1369 O O   . THR A 200 ? 0.5349 0.5277 0.8015 0.1340  -0.1080 0.0469  791 THR A O   
1370 C CB  . THR A 200 ? 0.5526 0.5523 0.8512 0.1254  -0.0675 0.0214  791 THR A CB  
1371 O OG1 . THR A 200 ? 0.5159 0.5290 0.8216 0.1156  -0.0527 0.0100  791 THR A OG1 
1372 C CG2 . THR A 200 ? 0.5090 0.4814 0.8009 0.1313  -0.0610 0.0244  791 THR A CG2 
1373 N N   . ALA A 201 ? 0.5078 0.4619 0.7337 0.1238  -0.0888 0.0517  792 ALA A N   
1374 C CA  . ALA A 201 ? 0.5491 0.4852 0.7578 0.1302  -0.1015 0.0669  792 ALA A CA  
1375 C C   . ALA A 201 ? 0.6091 0.5428 0.8459 0.1462  -0.1104 0.0701  792 ALA A C   
1376 O O   . ALA A 201 ? 0.5759 0.5106 0.8382 0.1511  -0.1005 0.0608  792 ALA A O   
1377 C CB  . ALA A 201 ? 0.5669 0.4765 0.7485 0.1233  -0.0922 0.0736  792 ALA A CB  
1378 N N   . PRO A 202 ? 0.6161 0.5460 0.8481 0.1551  -0.1288 0.0832  793 PRO A N   
1379 C CA  . PRO A 202 ? 0.6298 0.5587 0.8913 0.1722  -0.1388 0.0868  793 PRO A CA  
1380 C C   . PRO A 202 ? 0.7142 0.6153 0.9821 0.1788  -0.1297 0.0880  793 PRO A C   
1381 O O   . PRO A 202 ? 0.7446 0.6503 1.0464 0.1921  -0.1298 0.0826  793 PRO A O   
1382 C CB  . PRO A 202 ? 0.6815 0.6077 0.9266 0.1779  -0.1607 0.1032  793 PRO A CB  
1383 C CG  . PRO A 202 ? 0.7416 0.6581 0.9432 0.1640  -0.1587 0.1096  793 PRO A CG  
1384 C CD  . PRO A 202 ? 0.6527 0.5812 0.8525 0.1507  -0.1416 0.0946  793 PRO A CD  
1385 N N   . GLU A 203 ? 0.6706 0.5434 0.9076 0.1697  -0.1218 0.0946  794 GLU A N   
1386 C CA  . GLU A 203 ? 0.6938 0.5361 0.9337 0.1738  -0.1135 0.0953  794 GLU A CA  
1387 C C   . GLU A 203 ? 0.7447 0.5927 1.0026 0.1703  -0.0946 0.0765  794 GLU A C   
1388 O O   . GLU A 203 ? 0.7713 0.6018 1.0448 0.1787  -0.0887 0.0715  794 GLU A O   
1389 C CB  . GLU A 203 ? 0.7291 0.5403 0.9313 0.1635  -0.1121 0.1094  794 GLU A CB  
1390 C CG  . GLU A 203 ? 0.7557 0.5688 0.9337 0.1445  -0.0973 0.1038  794 GLU A CG  
1391 C CD  . GLU A 203 ? 0.8448 0.6811 1.0036 0.1347  -0.0996 0.1046  794 GLU A CD  
1392 O OE1 . GLU A 203 ? 0.6613 0.5133 0.8222 0.1411  -0.1138 0.1093  794 GLU A OE1 
1393 O OE2 . GLU A 203 ? 0.6573 0.4961 0.7995 0.1210  -0.0875 0.0998  794 GLU A OE2 
1394 N N   . ALA A 204 ? 0.6572 0.5280 0.9111 0.1582  -0.0853 0.0661  795 ALA A N   
1395 C CA  . ALA A 204 ? 0.6367 0.5159 0.9041 0.1534  -0.0677 0.0491  795 ALA A CA  
1396 C C   . ALA A 204 ? 0.6915 0.5942 0.9989 0.1661  -0.0677 0.0386  795 ALA A C   
1397 O O   . ALA A 204 ? 0.6831 0.5836 1.0077 0.1698  -0.0548 0.0264  795 ALA A O   
1398 C CB  . ALA A 204 ? 0.6160 0.5104 0.8650 0.1367  -0.0595 0.0440  795 ALA A CB  
1399 N N   . ILE A 205 ? 0.6597 0.5851 0.9827 0.1732  -0.0826 0.0433  796 ILE A N   
1400 C CA  . ILE A 205 ? 0.6498 0.6011 1.0151 0.1861  -0.0848 0.0352  796 ILE A CA  
1401 C C   . ILE A 205 ? 0.7087 0.6402 1.0927 0.2047  -0.0886 0.0385  796 ILE A C   
1402 O O   . ILE A 205 ? 0.7020 0.6392 1.1146 0.2137  -0.0778 0.0263  796 ILE A O   
1403 C CB  . ILE A 205 ? 0.6706 0.6516 1.0476 0.1878  -0.1022 0.0401  796 ILE A CB  
1404 C CG1 . ILE A 205 ? 0.6364 0.6346 0.9962 0.1700  -0.0983 0.0355  796 ILE A CG1 
1405 C CG2 . ILE A 205 ? 0.6614 0.6707 1.0869 0.2023  -0.1056 0.0331  796 ILE A CG2 
1406 C CD1 . ILE A 205 ? 0.6167 0.6399 0.9814 0.1686  -0.1161 0.0394  796 ILE A CD1 
1407 N N   . ALA A 206 ? 0.6990 0.6067 1.0660 0.2104  -0.1036 0.0549  797 ALA A N   
1408 C CA  . ALA A 206 ? 0.7261 0.6117 1.1091 0.2288  -0.1106 0.0610  797 ALA A CA  
1409 C C   . ALA A 206 ? 0.7892 0.6422 1.1684 0.2299  -0.0948 0.0534  797 ALA A C   
1410 O O   . ALA A 206 ? 0.7960 0.6425 1.2036 0.2465  -0.0927 0.0474  797 ALA A O   
1411 C CB  . ALA A 206 ? 0.7662 0.6329 1.1268 0.2323  -0.1309 0.0827  797 ALA A CB  
1412 N N   . TYR A 207 ? 0.7562 0.5895 1.1015 0.2125  -0.0841 0.0530  798 TYR A N   
1413 C CA  . TYR A 207 ? 0.7738 0.5729 1.1114 0.2115  -0.0715 0.0468  798 TYR A CA  
1414 C C   . TYR A 207 ? 0.7976 0.6029 1.1289 0.1977  -0.0509 0.0292  798 TYR A C   
1415 O O   . TYR A 207 ? 0.8150 0.5934 1.1403 0.1963  -0.0403 0.0216  798 TYR A O   
1416 C CB  . TYR A 207 ? 0.8160 0.5775 1.1190 0.2042  -0.0790 0.0645  798 TYR A CB  
1417 C CG  . TYR A 207 ? 0.8707 0.6253 1.1730 0.2155  -0.1002 0.0845  798 TYR A CG  
1418 C CD1 . TYR A 207 ? 0.9316 0.6773 1.2623 0.2374  -0.1098 0.0873  798 TYR A CD1 
1419 C CD2 . TYR A 207 ? 0.8763 0.6339 1.1490 0.2051  -0.1107 0.1006  798 TYR A CD2 
1420 C CE1 . TYR A 207 ? 0.9728 0.7125 1.3021 0.2482  -0.1308 0.1070  798 TYR A CE1 
1421 C CE2 . TYR A 207 ? 0.9106 0.6630 1.1796 0.2151  -0.1308 0.1194  798 TYR A CE2 
1422 C CZ  . TYR A 207 ? 1.0599 0.8025 1.3567 0.2364  -0.1415 0.1233  798 TYR A CZ  
1423 O OH  . TYR A 207 ? 1.0740 0.8097 1.3666 0.2470  -0.1627 0.1432  798 TYR A OH  
1424 N N   . ARG A 208 ? 0.7190 0.5573 1.0498 0.1871  -0.0457 0.0229  799 ARG A N   
1425 C CA  . ARG A 208 ? 0.6960 0.5415 1.0180 0.1731  -0.0273 0.0081  799 ARG A CA  
1426 C C   . ARG A 208 ? 0.7233 0.5411 1.0079 0.1568  -0.0232 0.0135  799 ARG A C   
1427 O O   . ARG A 208 ? 0.7127 0.5231 0.9878 0.1474  -0.0092 0.0022  799 ARG A O   
1428 C CB  . ARG A 208 ? 0.7306 0.5791 1.0790 0.1829  -0.0130 -0.0101 799 ARG A CB  
1429 C CG  . ARG A 208 ? 0.8219 0.7069 1.2090 0.1956  -0.0148 -0.0160 799 ARG A CG  
1430 C CD  . ARG A 208 ? 0.9770 0.8628 1.3958 0.2121  -0.0046 -0.0304 799 ARG A CD  
1431 N NE  . ARG A 208 ? 1.0799 1.0042 1.5384 0.2243  -0.0090 -0.0328 799 ARG A NE  
1432 C CZ  . ARG A 208 ? 1.2522 1.1993 1.7426 0.2332  0.0044  -0.0483 799 ARG A CZ  
1433 N NH1 . ARG A 208 ? 1.0824 1.0161 1.5676 0.2321  0.0234  -0.0638 799 ARG A NH1 
1434 N NH2 . ARG A 208 ? 1.0681 1.0530 1.5959 0.2427  -0.0010 -0.0487 799 ARG A NH2 
1435 N N   . LYS A 209 ? 0.6724 0.4774 0.9359 0.1531  -0.0359 0.0311  800 LYS A N   
1436 C CA  . LYS A 209 ? 0.6705 0.4529 0.9005 0.1378  -0.0341 0.0394  800 LYS A CA  
1437 C C   . LYS A 209 ? 0.6957 0.5011 0.9069 0.1237  -0.0339 0.0430  800 LYS A C   
1438 O O   . LYS A 209 ? 0.6922 0.5097 0.8983 0.1255  -0.0453 0.0536  800 LYS A O   
1439 C CB  . LYS A 209 ? 0.7338 0.4862 0.9528 0.1431  -0.0468 0.0572  800 LYS A CB  
1440 C CG  . LYS A 209 ? 0.8335 0.5534 1.0659 0.1548  -0.0457 0.0540  800 LYS A CG  
1441 N N   . PHE A 210 ? 0.6405 0.4521 0.8417 0.1105  -0.0211 0.0333  801 PHE A N   
1442 C CA  . PHE A 210 ? 0.6078 0.4402 0.7928 0.0981  -0.0199 0.0353  801 PHE A CA  
1443 C C   . PHE A 210 ? 0.6519 0.4687 0.8085 0.0840  -0.0172 0.0432  801 PHE A C   
1444 O O   . PHE A 210 ? 0.6412 0.4388 0.7920 0.0778  -0.0097 0.0392  801 PHE A O   
1445 C CB  . PHE A 210 ? 0.6007 0.4561 0.7963 0.0937  -0.0087 0.0203  801 PHE A CB  
1446 C CG  . PHE A 210 ? 0.6229 0.4975 0.8486 0.1060  -0.0101 0.0127  801 PHE A CG  
1447 C CD1 . PHE A 210 ? 0.6793 0.5468 0.9261 0.1162  -0.0043 0.0030  801 PHE A CD1 
1448 C CD2 . PHE A 210 ? 0.6482 0.5491 0.8825 0.1071  -0.0168 0.0142  801 PHE A CD2 
1449 C CE1 . PHE A 210 ? 0.6939 0.5830 0.9720 0.1281  -0.0048 -0.0039 801 PHE A CE1 
1450 C CE2 . PHE A 210 ? 0.6867 0.6082 0.9521 0.1174  -0.0184 0.0075  801 PHE A CE2 
1451 C CZ  . PHE A 210 ? 0.6744 0.5916 0.9625 0.1279  -0.0118 -0.0013 801 PHE A CZ  
1452 N N   . THR A 211 ? 0.5880 0.4132 0.7273 0.0790  -0.0235 0.0544  802 THR A N   
1453 C CA  . THR A 211 ? 0.5835 0.3999 0.6977 0.0659  -0.0209 0.0632  802 THR A CA  
1454 C C   . THR A 211 ? 0.6206 0.4620 0.7240 0.0596  -0.0202 0.0634  802 THR A C   
1455 O O   . THR A 211 ? 0.5958 0.4571 0.7102 0.0650  -0.0228 0.0574  802 THR A O   
1456 C CB  . THR A 211 ? 0.7020 0.4975 0.8035 0.0682  -0.0302 0.0802  802 THR A CB  
1457 O OG1 . THR A 211 ? 0.7388 0.5477 0.8387 0.0762  -0.0413 0.0877  802 THR A OG1 
1458 C CG2 . THR A 211 ? 0.6961 0.4623 0.8080 0.0757  -0.0325 0.0815  802 THR A CG2 
1459 N N   . SER A 212 ? 0.5831 0.4235 0.6657 0.0485  -0.0169 0.0705  803 SER A N   
1460 C CA  . SER A 212 ? 0.5630 0.4243 0.6335 0.0438  -0.0163 0.0716  803 SER A CA  
1461 C C   . SER A 212 ? 0.5845 0.4522 0.6503 0.0524  -0.0277 0.0790  803 SER A C   
1462 O O   . SER A 212 ? 0.5513 0.4375 0.6168 0.0538  -0.0296 0.0743  803 SER A O   
1463 C CB  . SER A 212 ? 0.6162 0.4746 0.6677 0.0318  -0.0107 0.0793  803 SER A CB  
1464 O OG  . SER A 212 ? 0.7908 0.6556 0.8464 0.0236  -0.0014 0.0697  803 SER A OG  
1465 N N   . ALA A 213 ? 0.5746 0.4256 0.6368 0.0582  -0.0360 0.0902  804 ALA A N   
1466 C CA  . ALA A 213 ? 0.5914 0.4465 0.6477 0.0668  -0.0489 0.0984  804 ALA A CA  
1467 C C   . ALA A 213 ? 0.6360 0.5055 0.7152 0.0773  -0.0560 0.0889  804 ALA A C   
1468 O O   . ALA A 213 ? 0.6570 0.5399 0.7314 0.0810  -0.0651 0.0902  804 ALA A O   
1469 C CB  . ALA A 213 ? 0.6286 0.4602 0.6762 0.0702  -0.0563 0.1137  804 ALA A CB  
1470 N N   . SER A 214 ? 0.5721 0.4405 0.6760 0.0813  -0.0514 0.0786  805 SER A N   
1471 C CA  . SER A 214 ? 0.5456 0.4317 0.6746 0.0899  -0.0562 0.0693  805 SER A CA  
1472 C C   . SER A 214 ? 0.5698 0.4778 0.6993 0.0828  -0.0502 0.0587  805 SER A C   
1473 O O   . SER A 214 ? 0.5593 0.4846 0.6990 0.0865  -0.0574 0.0548  805 SER A O   
1474 C CB  . SER A 214 ? 0.5698 0.4486 0.7252 0.0979  -0.0527 0.0622  805 SER A CB  
1475 O OG  . SER A 214 ? 0.6116 0.4850 0.7690 0.0906  -0.0381 0.0526  805 SER A OG  
1476 N N   . ASP A 215 ? 0.5102 0.4169 0.6274 0.0720  -0.0385 0.0554  806 ASP A N   
1477 C CA  . ASP A 215 ? 0.4706 0.3944 0.5848 0.0652  -0.0333 0.0476  806 ASP A CA  
1478 C C   . ASP A 215 ? 0.5133 0.4442 0.6088 0.0647  -0.0412 0.0531  806 ASP A C   
1479 O O   . ASP A 215 ? 0.5092 0.4543 0.6078 0.0639  -0.0432 0.0465  806 ASP A O   
1480 C CB  . ASP A 215 ? 0.4703 0.3906 0.5752 0.0549  -0.0205 0.0446  806 ASP A CB  
1481 C CG  . ASP A 215 ? 0.5186 0.4400 0.6398 0.0528  -0.0110 0.0340  806 ASP A CG  
1482 O OD1 . ASP A 215 ? 0.5121 0.4405 0.6543 0.0592  -0.0122 0.0276  806 ASP A OD1 
1483 O OD2 . ASP A 215 ? 0.5789 0.4968 0.6919 0.0443  -0.0021 0.0319  806 ASP A OD2 
1484 N N   . VAL A 216 ? 0.4648 0.3846 0.5399 0.0649  -0.0453 0.0648  807 VAL A N   
1485 C CA  . VAL A 216 ? 0.4737 0.3990 0.5274 0.0652  -0.0525 0.0702  807 VAL A CA  
1486 C C   . VAL A 216 ? 0.5444 0.4786 0.6079 0.0734  -0.0667 0.0682  807 VAL A C   
1487 O O   . VAL A 216 ? 0.5318 0.4769 0.5864 0.0726  -0.0715 0.0642  807 VAL A O   
1488 C CB  . VAL A 216 ? 0.5349 0.4465 0.5647 0.0630  -0.0530 0.0846  807 VAL A CB  
1489 C CG1 . VAL A 216 ? 0.5407 0.4567 0.5481 0.0659  -0.0627 0.0911  807 VAL A CG1 
1490 C CG2 . VAL A 216 ? 0.5184 0.4280 0.5375 0.0529  -0.0395 0.0855  807 VAL A CG2 
1491 N N   . TRP A 217 ? 0.5290 0.4590 0.6120 0.0814  -0.0738 0.0705  808 TRP A N   
1492 C CA  . TRP A 217 ? 0.5248 0.4665 0.6226 0.0893  -0.0881 0.0686  808 TRP A CA  
1493 C C   . TRP A 217 ? 0.5587 0.5191 0.6732 0.0857  -0.0851 0.0547  808 TRP A C   
1494 O O   . TRP A 217 ? 0.5571 0.5284 0.6667 0.0853  -0.0944 0.0518  808 TRP A O   
1495 C CB  . TRP A 217 ? 0.5152 0.4510 0.6368 0.0995  -0.0939 0.0722  808 TRP A CB  
1496 C CG  . TRP A 217 ? 0.5247 0.4768 0.6672 0.1079  -0.1087 0.0698  808 TRP A CG  
1497 C CD1 . TRP A 217 ? 0.5402 0.5131 0.7090 0.1076  -0.1085 0.0578  808 TRP A CD1 
1498 C CD2 . TRP A 217 ? 0.5447 0.4953 0.6834 0.1167  -0.1265 0.0804  808 TRP A CD2 
1499 N NE1 . TRP A 217 ? 0.5512 0.5371 0.7346 0.1153  -0.1254 0.0596  808 TRP A NE1 
1500 C CE2 . TRP A 217 ? 0.5938 0.5665 0.7592 0.1217  -0.1373 0.0734  808 TRP A CE2 
1501 C CE3 . TRP A 217 ? 0.5865 0.5191 0.7026 0.1207  -0.1348 0.0962  808 TRP A CE3 
1502 C CZ2 . TRP A 217 ? 0.6012 0.5798 0.7714 0.1311  -0.1573 0.0812  808 TRP A CZ2 
1503 C CZ3 . TRP A 217 ? 0.6272 0.5637 0.7457 0.1303  -0.1543 0.1047  808 TRP A CZ3 
1504 C CH2 . TRP A 217 ? 0.6259 0.5859 0.7710 0.1355  -0.1659 0.0969  808 TRP A CH2 
1505 N N   . SER A 218 ? 0.4979 0.4606 0.6300 0.0821  -0.0723 0.0464  809 SER A N   
1506 C CA  . SER A 218 ? 0.4740 0.4522 0.6215 0.0771  -0.0673 0.0347  809 SER A CA  
1507 C C   . SER A 218 ? 0.5309 0.5118 0.6566 0.0700  -0.0667 0.0324  809 SER A C   
1508 O O   . SER A 218 ? 0.5185 0.5111 0.6512 0.0681  -0.0720 0.0257  809 SER A O   
1509 C CB  . SER A 218 ? 0.4847 0.4610 0.6445 0.0730  -0.0519 0.0286  809 SER A CB  
1510 O OG  . SER A 218 ? 0.5090 0.4810 0.6883 0.0802  -0.0506 0.0287  809 SER A OG  
1511 N N   . TYR A 219 ? 0.4682 0.4382 0.5682 0.0663  -0.0604 0.0378  810 TYR A N   
1512 C CA  . TYR A 219 ? 0.4481 0.4200 0.5268 0.0615  -0.0587 0.0356  810 TYR A CA  
1513 C C   . TYR A 219 ? 0.5085 0.4849 0.5758 0.0649  -0.0727 0.0356  810 TYR A C   
1514 O O   . TYR A 219 ? 0.5183 0.5005 0.5826 0.0620  -0.0744 0.0277  810 TYR A O   
1515 C CB  . TYR A 219 ? 0.4468 0.4094 0.5034 0.0578  -0.0492 0.0423  810 TYR A CB  
1516 C CG  . TYR A 219 ? 0.4564 0.4227 0.4930 0.0550  -0.0469 0.0394  810 TYR A CG  
1517 C CD1 . TYR A 219 ? 0.4590 0.4297 0.5000 0.0504  -0.0387 0.0318  810 TYR A CD1 
1518 C CD2 . TYR A 219 ? 0.4737 0.4389 0.4869 0.0577  -0.0534 0.0436  810 TYR A CD2 
1519 C CE1 . TYR A 219 ? 0.4542 0.4272 0.4791 0.0497  -0.0371 0.0282  810 TYR A CE1 
1520 C CE2 . TYR A 219 ? 0.4876 0.4561 0.4829 0.0565  -0.0506 0.0390  810 TYR A CE2 
1521 C CZ  . TYR A 219 ? 0.5043 0.4763 0.5068 0.0531  -0.0426 0.0310  810 TYR A CZ  
1522 O OH  . TYR A 219 ? 0.4525 0.4263 0.4388 0.0536  -0.0399 0.0260  810 TYR A OH  
1523 N N   . GLY A 220 ? 0.4905 0.4628 0.5514 0.0708  -0.0831 0.0442  811 GLY A N   
1524 C CA  . GLY A 220 ? 0.5038 0.4806 0.5532 0.0743  -0.0985 0.0450  811 GLY A CA  
1525 C C   . GLY A 220 ? 0.5327 0.5232 0.6053 0.0741  -0.1072 0.0349  811 GLY A C   
1526 O O   . GLY A 220 ? 0.5376 0.5328 0.5991 0.0723  -0.1157 0.0292  811 GLY A O   
1527 N N   . ILE A 221 ? 0.4696 0.4669 0.5746 0.0753  -0.1044 0.0320  812 ILE A N   
1528 C CA  . ILE A 221 ? 0.4685 0.4818 0.6012 0.0736  -0.1102 0.0227  812 ILE A CA  
1529 C C   . ILE A 221 ? 0.5171 0.5322 0.6465 0.0644  -0.1023 0.0128  812 ILE A C   
1530 O O   . ILE A 221 ? 0.5218 0.5447 0.6553 0.0609  -0.1113 0.0059  812 ILE A O   
1531 C CB  . ILE A 221 ? 0.4963 0.5182 0.6653 0.0780  -0.1070 0.0222  812 ILE A CB  
1532 C CG1 . ILE A 221 ? 0.5060 0.5238 0.6796 0.0890  -0.1166 0.0324  812 ILE A CG1 
1533 C CG2 . ILE A 221 ? 0.5078 0.5499 0.7074 0.0747  -0.1115 0.0130  812 ILE A CG2 
1534 C CD1 . ILE A 221 ? 0.4413 0.4703 0.6191 0.0947  -0.1384 0.0354  812 ILE A CD1 
1535 N N   . VAL A 222 ? 0.4589 0.4657 0.5804 0.0604  -0.0867 0.0126  813 VAL A N   
1536 C CA  . VAL A 222 ? 0.4509 0.4565 0.5672 0.0529  -0.0787 0.0052  813 VAL A CA  
1537 C C   . VAL A 222 ? 0.4806 0.4810 0.5703 0.0523  -0.0860 0.0023  813 VAL A C   
1538 O O   . VAL A 222 ? 0.4912 0.4930 0.5832 0.0474  -0.0884 -0.0060 813 VAL A O   
1539 C CB  . VAL A 222 ? 0.4818 0.4801 0.5932 0.0498  -0.0623 0.0072  813 VAL A CB  
1540 C CG1 . VAL A 222 ? 0.4594 0.4551 0.5631 0.0436  -0.0558 0.0014  813 VAL A CG1 
1541 C CG2 . VAL A 222 ? 0.4679 0.4709 0.6042 0.0496  -0.0547 0.0072  813 VAL A CG2 
1542 N N   . MET A 223 ? 0.4125 0.4062 0.4767 0.0569  -0.0891 0.0089  814 MET A N   
1543 C CA  . MET A 223 ? 0.4288 0.4182 0.4648 0.0575  -0.0955 0.0057  814 MET A CA  
1544 C C   . MET A 223 ? 0.5262 0.5226 0.5699 0.0566  -0.1118 -0.0015 814 MET A C   
1545 O O   . MET A 223 ? 0.5544 0.5481 0.5891 0.0530  -0.1149 -0.0110 814 MET A O   
1546 C CB  . MET A 223 ? 0.4666 0.4507 0.4761 0.0625  -0.0976 0.0157  814 MET A CB  
1547 C CG  . MET A 223 ? 0.4881 0.4661 0.4863 0.0620  -0.0828 0.0226  814 MET A CG  
1548 S SD  . MET A 223 ? 0.5566 0.5289 0.5229 0.0661  -0.0863 0.0355  814 MET A SD  
1549 C CE  . MET A 223 ? 0.5256 0.4987 0.4608 0.0668  -0.0914 0.0266  814 MET A CE  
1550 N N   . TRP A 224 ? 0.4943 0.4997 0.5564 0.0597  -0.1227 0.0027  815 TRP A N   
1551 C CA  . TRP A 224 ? 0.5068 0.5225 0.5807 0.0584  -0.1397 -0.0032 815 TRP A CA  
1552 C C   . TRP A 224 ? 0.5559 0.5777 0.6538 0.0500  -0.1369 -0.0139 815 TRP A C   
1553 O O   . TRP A 224 ? 0.5738 0.5958 0.6664 0.0452  -0.1466 -0.0227 815 TRP A O   
1554 C CB  . TRP A 224 ? 0.4945 0.5208 0.5883 0.0648  -0.1510 0.0047  815 TRP A CB  
1555 C CG  . TRP A 224 ? 0.5197 0.5586 0.6221 0.0644  -0.1715 0.0005  815 TRP A CG  
1556 C CD1 . TRP A 224 ? 0.5797 0.6178 0.6585 0.0680  -0.1880 0.0038  815 TRP A CD1 
1557 C CD2 . TRP A 224 ? 0.5141 0.5699 0.6517 0.0593  -0.1782 -0.0072 815 TRP A CD2 
1558 N NE1 . TRP A 224 ? 0.5795 0.6331 0.6771 0.0658  -0.2059 -0.0017 815 TRP A NE1 
1559 C CE2 . TRP A 224 ? 0.5824 0.6477 0.7175 0.0600  -0.2000 -0.0086 815 TRP A CE2 
1560 C CE3 . TRP A 224 ? 0.5107 0.5758 0.6816 0.0534  -0.1677 -0.0126 815 TRP A CE3 
1561 C CZ2 . TRP A 224 ? 0.5814 0.6661 0.7485 0.0546  -0.2121 -0.0156 815 TRP A CZ2 
1562 C CZ3 . TRP A 224 ? 0.5339 0.6178 0.7355 0.0478  -0.1782 -0.0191 815 TRP A CZ3 
1563 C CH2 . TRP A 224 ? 0.5616 0.6558 0.7628 0.0483  -0.2003 -0.0206 815 TRP A CH2 
1564 N N   . GLU A 225 ? 0.4786 0.5034 0.5998 0.0475  -0.1233 -0.0131 816 GLU A N   
1565 C CA  . GLU A 225 ? 0.4558 0.4854 0.5984 0.0386  -0.1184 -0.0211 816 GLU A CA  
1566 C C   . GLU A 225 ? 0.4973 0.5128 0.6177 0.0332  -0.1150 -0.0283 816 GLU A C   
1567 O O   . GLU A 225 ? 0.4825 0.4987 0.6111 0.0258  -0.1211 -0.0366 816 GLU A O   
1568 C CB  . GLU A 225 ? 0.4466 0.4796 0.6097 0.0375  -0.1021 -0.0179 816 GLU A CB  
1569 C CG  . GLU A 225 ? 0.4658 0.5133 0.6569 0.0427  -0.1039 -0.0136 816 GLU A CG  
1570 C CD  . GLU A 225 ? 0.5529 0.6029 0.7613 0.0408  -0.0870 -0.0129 816 GLU A CD  
1571 O OE1 . GLU A 225 ? 0.4806 0.5200 0.6757 0.0447  -0.0775 -0.0079 816 GLU A OE1 
1572 O OE2 . GLU A 225 ? 0.4692 0.5308 0.7016 0.0340  -0.0828 -0.0178 816 GLU A OE2 
1573 N N   . VAL A 226 ? 0.4557 0.4582 0.5499 0.0370  -0.1052 -0.0252 817 VAL A N   
1574 C CA  . VAL A 226 ? 0.4561 0.4449 0.5296 0.0348  -0.1002 -0.0314 817 VAL A CA  
1575 C C   . VAL A 226 ? 0.5333 0.5167 0.5865 0.0352  -0.1139 -0.0395 817 VAL A C   
1576 O O   . VAL A 226 ? 0.5391 0.5152 0.5925 0.0295  -0.1170 -0.0491 817 VAL A O   
1577 C CB  . VAL A 226 ? 0.4817 0.4627 0.5366 0.0393  -0.0861 -0.0257 817 VAL A CB  
1578 C CG1 . VAL A 226 ? 0.4801 0.4484 0.5136 0.0397  -0.0821 -0.0324 817 VAL A CG1 
1579 C CG2 . VAL A 226 ? 0.4551 0.4397 0.5293 0.0367  -0.0733 -0.0203 817 VAL A CG2 
1580 N N   . MET A 227 ? 0.5104 0.4964 0.5456 0.0412  -0.1229 -0.0358 818 MET A N   
1581 C CA  . MET A 227 ? 0.5180 0.4990 0.5289 0.0417  -0.1365 -0.0438 818 MET A CA  
1582 C C   . MET A 227 ? 0.5677 0.5561 0.5971 0.0349  -0.1530 -0.0517 818 MET A C   
1583 O O   . MET A 227 ? 0.5996 0.5816 0.6106 0.0328  -0.1643 -0.0615 818 MET A O   
1584 C CB  . MET A 227 ? 0.5527 0.5348 0.5368 0.0493  -0.1412 -0.0360 818 MET A CB  
1585 C CG  . MET A 227 ? 0.5731 0.5487 0.5373 0.0544  -0.1249 -0.0288 818 MET A CG  
1586 S SD  . MET A 227 ? 0.6022 0.5651 0.5526 0.0539  -0.1097 -0.0382 818 MET A SD  
1587 C CE  . MET A 227 ? 0.6043 0.5579 0.5200 0.0554  -0.1215 -0.0526 818 MET A CE  
1588 N N   . SER A 228 ? 0.5056 0.5078 0.5724 0.0307  -0.1534 -0.0484 819 SER A N   
1589 C CA  . SER A 228 ? 0.4954 0.5106 0.5902 0.0230  -0.1670 -0.0540 819 SER A CA  
1590 C C   . SER A 228 ? 0.5561 0.5685 0.6726 0.0125  -0.1591 -0.0601 819 SER A C   
1591 O O   . SER A 228 ? 0.5643 0.5894 0.7088 0.0043  -0.1674 -0.0637 819 SER A O   
1592 C CB  . SER A 228 ? 0.5013 0.5371 0.6258 0.0266  -0.1710 -0.0450 819 SER A CB  
1593 O OG  . SER A 228 ? 0.6034 0.6420 0.7118 0.0360  -0.1803 -0.0374 819 SER A OG  
1594 N N   . PHE A 229 ? 0.5025 0.4995 0.6076 0.0124  -0.1434 -0.0602 820 PHE A N   
1595 C CA  . PHE A 229 ? 0.4877 0.4792 0.6102 0.0028  -0.1351 -0.0637 820 PHE A CA  
1596 C C   . PHE A 229 ? 0.5470 0.5585 0.7085 -0.0027 -0.1308 -0.0583 820 PHE A C   
1597 O O   . PHE A 229 ? 0.5408 0.5577 0.7250 -0.0137 -0.1337 -0.0625 820 PHE A O   
1598 C CB  . PHE A 229 ? 0.5130 0.4909 0.6282 -0.0057 -0.1455 -0.0761 820 PHE A CB  
1599 C CG  . PHE A 229 ? 0.5325 0.4870 0.6117 0.0000  -0.1420 -0.0820 820 PHE A CG  
1600 C CD1 . PHE A 229 ? 0.5296 0.4677 0.6042 -0.0004 -0.1285 -0.0820 820 PHE A CD1 
1601 C CD2 . PHE A 229 ? 0.5693 0.5188 0.6191 0.0063  -0.1522 -0.0878 820 PHE A CD2 
1602 C CE1 . PHE A 229 ? 0.5447 0.4631 0.5891 0.0066  -0.1248 -0.0880 820 PHE A CE1 
1603 C CE2 . PHE A 229 ? 0.6116 0.5413 0.6288 0.0125  -0.1473 -0.0944 820 PHE A CE2 
1604 C CZ  . PHE A 229 ? 0.5660 0.4809 0.5822 0.0133  -0.1333 -0.0946 820 PHE A CZ  
1605 N N   . GLY A 230 ? 0.5166 0.5386 0.6849 0.0049  -0.1235 -0.0495 821 GLY A N   
1606 C CA  . GLY A 230 ? 0.5098 0.5504 0.7123 0.0024  -0.1168 -0.0450 821 GLY A CA  
1607 C C   . GLY A 230 ? 0.5878 0.6514 0.8195 0.0013  -0.1297 -0.0458 821 GLY A C   
1608 O O   . GLY A 230 ? 0.6049 0.6849 0.8688 -0.0045 -0.1243 -0.0454 821 GLY A O   
1609 N N   . GLU A 231 ? 0.5447 0.6117 0.7663 0.0072  -0.1463 -0.0463 822 GLU A N   
1610 C CA  . GLU A 231 ? 0.5387 0.6300 0.7896 0.0085  -0.1600 -0.0455 822 GLU A CA  
1611 C C   . GLU A 231 ? 0.5479 0.6504 0.8164 0.0187  -0.1503 -0.0367 822 GLU A C   
1612 O O   . GLU A 231 ? 0.4978 0.5861 0.7449 0.0263  -0.1404 -0.0310 822 GLU A O   
1613 C CB  . GLU A 231 ? 0.5856 0.6758 0.8162 0.0132  -0.1808 -0.0469 822 GLU A CB  
1614 C CG  . GLU A 231 ? 0.8080 0.9241 1.0676 0.0155  -0.1983 -0.0453 822 GLU A CG  
1615 C CD  . GLU A 231 ? 1.1836 1.3198 1.4802 0.0028  -0.2048 -0.0522 822 GLU A CD  
1616 O OE1 . GLU A 231 ? 1.1901 1.3453 1.5239 0.0015  -0.1950 -0.0498 822 GLU A OE1 
1617 O OE2 . GLU A 231 ? 1.1645 1.2974 1.4526 -0.0063 -0.2191 -0.0606 822 GLU A OE2 
1618 N N   . ARG A 232 ? 0.5037 0.6316 0.8125 0.0183  -0.1528 -0.0363 823 ARG A N   
1619 C CA  . ARG A 232 ? 0.4804 0.6190 0.8091 0.0288  -0.1444 -0.0300 823 ARG A CA  
1620 C C   . ARG A 232 ? 0.5229 0.6581 0.8374 0.0422  -0.1576 -0.0231 823 ARG A C   
1621 O O   . ARG A 232 ? 0.5127 0.6587 0.8317 0.0435  -0.1772 -0.0236 823 ARG A O   
1622 C CB  . ARG A 232 ? 0.4670 0.6367 0.8445 0.0258  -0.1446 -0.0324 823 ARG A CB  
1623 C CG  . ARG A 232 ? 0.5008 0.6808 0.9008 0.0368  -0.1326 -0.0281 823 ARG A CG  
1624 C CD  . ARG A 232 ? 0.6432 0.8576 1.0927 0.0360  -0.1349 -0.0309 823 ARG A CD  
1625 N NE  . ARG A 232 ? 0.7209 0.9452 1.1932 0.0473  -0.1217 -0.0288 823 ARG A NE  
1626 C CZ  . ARG A 232 ? 1.0860 1.3378 1.5982 0.0562  -0.1273 -0.0286 823 ARG A CZ  
1627 N NH1 . ARG A 232 ? 0.9890 1.2634 1.5236 0.0545  -0.1471 -0.0294 823 ARG A NH1 
1628 N NH2 . ARG A 232 ? 1.0227 1.2802 1.5535 0.0671  -0.1136 -0.0282 823 ARG A NH2 
1629 N N   . PRO A 233 ? 0.4862 0.6065 0.7837 0.0517  -0.1477 -0.0160 824 PRO A N   
1630 C CA  . PRO A 233 ? 0.4897 0.6053 0.7747 0.0642  -0.1596 -0.0073 824 PRO A CA  
1631 C C   . PRO A 233 ? 0.5322 0.6722 0.8536 0.0717  -0.1737 -0.0053 824 PRO A C   
1632 O O   . PRO A 233 ? 0.5056 0.6635 0.8645 0.0726  -0.1655 -0.0079 824 PRO A O   
1633 C CB  . PRO A 233 ? 0.4993 0.5988 0.7740 0.0708  -0.1430 -0.0012 824 PRO A CB  
1634 C CG  . PRO A 233 ? 0.5470 0.6371 0.8117 0.0608  -0.1255 -0.0066 824 PRO A CG  
1635 C CD  . PRO A 233 ? 0.4849 0.5924 0.7753 0.0506  -0.1261 -0.0151 824 PRO A CD  
1636 N N   . TYR A 234 ? 0.5035 0.6457 0.8141 0.0771  -0.1947 -0.0007 825 TYR A N   
1637 C CA  . TYR A 234 ? 0.5175 0.6829 0.8597 0.0859  -0.2126 0.0030  825 TYR A CA  
1638 C C   . TYR A 234 ? 0.6394 0.8346 1.0210 0.0770  -0.2190 -0.0060 825 TYR A C   
1639 O O   . TYR A 234 ? 0.6452 0.8655 1.0623 0.0838  -0.2315 -0.0040 825 TYR A O   
1640 C CB  . TYR A 234 ? 0.5021 0.6683 0.8649 0.1010  -0.2065 0.0111  825 TYR A CB  
1641 C CG  . TYR A 234 ? 0.5111 0.6468 0.8367 0.1077  -0.1995 0.0204  825 TYR A CG  
1642 C CD1 . TYR A 234 ? 0.5045 0.6226 0.8179 0.1042  -0.1770 0.0186  825 TYR A CD1 
1643 C CD2 . TYR A 234 ? 0.5447 0.6696 0.8468 0.1165  -0.2157 0.0316  825 TYR A CD2 
1644 C CE1 . TYR A 234 ? 0.5147 0.6062 0.7951 0.1084  -0.1707 0.0271  825 TYR A CE1 
1645 C CE2 . TYR A 234 ? 0.5601 0.6573 0.8287 0.1209  -0.2085 0.0412  825 TYR A CE2 
1646 C CZ  . TYR A 234 ? 0.6147 0.6958 0.8736 0.1164  -0.1860 0.0385  825 TYR A CZ  
1647 O OH  . TYR A 234 ? 0.6229 0.6784 0.8504 0.1190  -0.1792 0.0479  825 TYR A OH  
1648 N N   . TRP A 235 ? 0.6496 0.8416 1.0246 0.0617  -0.2117 -0.0152 826 TRP A N   
1649 C CA  . TRP A 235 ? 0.6728 0.8884 1.0793 0.0489  -0.2169 -0.0241 826 TRP A CA  
1650 C C   . TRP A 235 ? 0.7207 0.9668 1.1807 0.0520  -0.2094 -0.0244 826 TRP A C   
1651 O O   . TRP A 235 ? 0.7045 0.9465 1.1720 0.0538  -0.1878 -0.0242 826 TRP A O   
1652 C CB  . TRP A 235 ? 0.6972 0.9209 1.0963 0.0449  -0.2439 -0.0266 826 TRP A CB  
1653 C CG  . TRP A 235 ? 0.7441 0.9388 1.0892 0.0429  -0.2503 -0.0274 826 TRP A CG  
1654 C CD1 . TRP A 235 ? 0.7886 0.9658 1.1080 0.0303  -0.2465 -0.0363 826 TRP A CD1 
1655 C CD2 . TRP A 235 ? 0.7679 0.9478 1.0780 0.0545  -0.2604 -0.0188 826 TRP A CD2 
1656 N NE1 . TRP A 235 ? 0.8055 0.9599 1.0768 0.0339  -0.2534 -0.0351 826 TRP A NE1 
1657 C CE2 . TRP A 235 ? 0.8330 0.9892 1.0970 0.0478  -0.2617 -0.0240 826 TRP A CE2 
1658 C CE3 . TRP A 235 ? 0.7978 0.9818 1.1110 0.0698  -0.2692 -0.0069 826 TRP A CE3 
1659 C CZ2 . TRP A 235 ? 0.8486 0.9873 1.0690 0.0553  -0.2695 -0.0177 826 TRP A CZ2 
1660 C CZ3 . TRP A 235 ? 0.8416 1.0058 1.1108 0.0765  -0.2776 0.0008  826 TRP A CZ3 
1661 C CH2 . TRP A 235 ? 0.8631 1.0064 1.0863 0.0689  -0.2773 -0.0046 826 TRP A CH2 
1662 N N   . ASP A 236 ? 0.6845 0.9616 1.1807 0.0535  -0.2269 -0.0250 827 ASP A N   
1663 C CA  . ASP A 236 ? 0.6797 0.9912 1.2311 0.0569  -0.2210 -0.0260 827 ASP A CA  
1664 C C   . ASP A 236 ? 0.7257 1.0455 1.2962 0.0786  -0.2237 -0.0179 827 ASP A C   
1665 O O   . ASP A 236 ? 0.7234 1.0744 1.3425 0.0842  -0.2201 -0.0192 827 ASP A O   
1666 C CB  . ASP A 236 ? 0.7183 1.0632 1.3052 0.0448  -0.2377 -0.0318 827 ASP A CB  
1667 C CG  . ASP A 236 ? 0.9813 1.3320 1.5588 0.0466  -0.2688 -0.0300 827 ASP A CG  
1668 O OD1 . ASP A 236 ? 1.0119 1.3441 1.5588 0.0602  -0.2788 -0.0222 827 ASP A OD1 
1669 O OD2 . ASP A 236 ? 1.0953 1.4695 1.6959 0.0338  -0.2835 -0.0359 827 ASP A OD2 
1670 N N   . MET A 237 ? 0.6626 0.9550 1.1965 0.0908  -0.2295 -0.0094 828 MET A N   
1671 C CA  . MET A 237 ? 0.6453 0.9392 1.1937 0.1115  -0.2325 -0.0006 828 MET A CA  
1672 C C   . MET A 237 ? 0.6593 0.9543 1.2300 0.1166  -0.2062 -0.0038 828 MET A C   
1673 O O   . MET A 237 ? 0.6451 0.9225 1.1953 0.1068  -0.1861 -0.0084 828 MET A O   
1674 C CB  . MET A 237 ? 0.6873 0.9459 1.1868 0.1202  -0.2390 0.0096  828 MET A CB  
1675 C CG  . MET A 237 ? 0.7550 1.0138 1.2335 0.1209  -0.2669 0.0152  828 MET A CG  
1676 S SD  . MET A 237 ? 0.8266 1.0429 1.2427 0.1280  -0.2698 0.0275  828 MET A SD  
1677 C CE  . MET A 237 ? 0.8104 1.0253 1.1899 0.1164  -0.2924 0.0251  828 MET A CE  
1678 N N   . SER A 238 ? 0.5961 0.9114 1.2080 0.1323  -0.2063 -0.0018 829 SER A N   
1679 C CA  . SER A 238 ? 0.5672 0.8821 1.1981 0.1387  -0.1810 -0.0062 829 SER A CA  
1680 C C   . SER A 238 ? 0.5923 0.8658 1.1836 0.1476  -0.1719 -0.0001 829 SER A C   
1681 O O   . SER A 238 ? 0.5872 0.8383 1.1456 0.1520  -0.1869 0.0092  829 SER A O   
1682 C CB  . SER A 238 ? 0.5961 0.9450 1.2836 0.1545  -0.1836 -0.0070 829 SER A CB  
1683 O OG  . SER A 238 ? 0.6993 1.0375 1.3851 0.1743  -0.2000 0.0033  829 SER A OG  
1684 N N   . ASN A 239 ? 0.5339 0.7982 1.1287 0.1496  -0.1476 -0.0053 830 ASN A N   
1685 C CA  . ASN A 239 ? 0.5358 0.7628 1.0986 0.1569  -0.1375 -0.0010 830 ASN A CA  
1686 C C   . ASN A 239 ? 0.6072 0.8242 1.1744 0.1767  -0.1535 0.0094  830 ASN A C   
1687 O O   . ASN A 239 ? 0.6202 0.8050 1.1490 0.1792  -0.1594 0.0187  830 ASN A O   
1688 C CB  . ASN A 239 ? 0.5178 0.7436 1.0928 0.1570  -0.1107 -0.0103 830 ASN A CB  
1689 C CG  . ASN A 239 ? 0.7572 0.9778 1.3106 0.1377  -0.0939 -0.0169 830 ASN A CG  
1690 O OD1 . ASN A 239 ? 0.6970 0.9034 1.2168 0.1256  -0.0997 -0.0138 830 ASN A OD1 
1691 N ND2 . ASN A 239 ? 0.6505 0.8808 1.2207 0.1350  -0.0721 -0.0259 830 ASN A ND2 
1692 N N   . GLN A 240 ? 0.5518 0.7979 1.1666 0.1905  -0.1616 0.0087  831 GLN A N   
1693 C CA  . GLN A 240 ? 0.5705 0.8129 1.1988 0.2113  -0.1789 0.0188  831 GLN A CA  
1694 C C   . GLN A 240 ? 0.6363 0.8720 1.2376 0.2096  -0.2063 0.0311  831 GLN A C   
1695 O O   . GLN A 240 ? 0.6663 0.8748 1.2444 0.2204  -0.2168 0.0433  831 GLN A O   
1696 C CB  . GLN A 240 ? 0.5852 0.8679 1.2756 0.2246  -0.1808 0.0136  831 GLN A CB  
1697 C CG  . GLN A 240 ? 0.9547 1.2316 1.6654 0.2498  -0.1940 0.0227  831 GLN A CG  
1698 C CD  . GLN A 240 ? 1.3398 1.6599 2.1155 0.2642  -0.1947 0.0166  831 GLN A CD  
1699 O OE1 . GLN A 240 ? 1.2982 1.6484 2.1048 0.2571  -0.1773 0.0037  831 GLN A OE1 
1700 N NE2 . GLN A 240 ? 1.2886 1.6137 2.0874 0.2852  -0.2148 0.0264  831 GLN A NE2 
1701 N N   . ASP A 241 ? 0.5683 0.8275 1.1712 0.1956  -0.2177 0.0279  832 ASP A N   
1702 C CA  . ASP A 241 ? 0.5850 0.8396 1.1589 0.1915  -0.2429 0.0368  832 ASP A CA  
1703 C C   . ASP A 241 ? 0.6168 0.8292 1.1299 0.1844  -0.2378 0.0428  832 ASP A C   
1704 O O   . ASP A 241 ? 0.6218 0.8166 1.1062 0.1902  -0.2547 0.0552  832 ASP A O   
1705 C CB  . ASP A 241 ? 0.6062 0.8896 1.1898 0.1743  -0.2515 0.0284  832 ASP A CB  
1706 C CG  . ASP A 241 ? 0.7885 1.1185 1.4306 0.1780  -0.2624 0.0240  832 ASP A CG  
1707 O OD1 . ASP A 241 ? 0.8130 1.1562 1.4871 0.1972  -0.2727 0.0304  832 ASP A OD1 
1708 O OD2 . ASP A 241 ? 0.8723 1.2259 1.5294 0.1616  -0.2612 0.0146  832 ASP A OD2 
1709 N N   . VAL A 242 ? 0.5421 0.7395 1.0362 0.1719  -0.2143 0.0347  833 VAL A N   
1710 C CA  . VAL A 242 ? 0.5365 0.6978 0.9779 0.1645  -0.2064 0.0391  833 VAL A CA  
1711 C C   . VAL A 242 ? 0.6098 0.7421 1.0373 0.1788  -0.2057 0.0508  833 VAL A C   
1712 O O   . VAL A 242 ? 0.6112 0.7225 1.0023 0.1798  -0.2172 0.0624  833 VAL A O   
1713 C CB  . VAL A 242 ? 0.5637 0.7189 0.9936 0.1492  -0.1825 0.0281  833 VAL A CB  
1714 C CG1 . VAL A 242 ? 0.5650 0.6849 0.9453 0.1436  -0.1736 0.0332  833 VAL A CG1 
1715 C CG2 . VAL A 242 ? 0.5469 0.7240 0.9833 0.1341  -0.1861 0.0190  833 VAL A CG2 
1716 N N   . ILE A 243 ? 0.5903 0.7217 1.0472 0.1899  -0.1929 0.0477  834 ILE A N   
1717 C CA  . ILE A 243 ? 0.6159 0.7186 1.0657 0.2042  -0.1919 0.0574  834 ILE A CA  
1718 C C   . ILE A 243 ? 0.7118 0.8108 1.1564 0.2164  -0.2182 0.0732  834 ILE A C   
1719 O O   . ILE A 243 ? 0.7415 0.8095 1.1492 0.2175  -0.2228 0.0858  834 ILE A O   
1720 C CB  . ILE A 243 ? 0.6452 0.7533 1.1352 0.2162  -0.1764 0.0489  834 ILE A CB  
1721 C CG1 . ILE A 243 ? 0.6242 0.7284 1.1078 0.2031  -0.1497 0.0354  834 ILE A CG1 
1722 C CG2 . ILE A 243 ? 0.6851 0.7633 1.1731 0.2335  -0.1798 0.0592  834 ILE A CG2 
1723 C CD1 . ILE A 243 ? 0.6672 0.7868 1.1919 0.2113  -0.1329 0.0231  834 ILE A CD1 
1724 N N   . ASN A 244 ? 0.6694 0.8014 1.1495 0.2239  -0.2358 0.0729  835 ASN A N   
1725 C CA  . ASN A 244 ? 0.7065 0.8406 1.1858 0.2359  -0.2635 0.0876  835 ASN A CA  
1726 C C   . ASN A 244 ? 0.7601 0.8816 1.1890 0.2248  -0.2778 0.0967  835 ASN A C   
1727 O O   . ASN A 244 ? 0.7840 0.8829 1.1867 0.2324  -0.2911 0.1128  835 ASN A O   
1728 C CB  . ASN A 244 ? 0.7952 0.9730 1.3271 0.2445  -0.2787 0.0834  835 ASN A CB  
1729 C CG  . ASN A 244 ? 1.3086 1.5002 1.8933 0.2616  -0.2692 0.0780  835 ASN A CG  
1730 O OD1 . ASN A 244 ? 1.3410 1.5069 1.9242 0.2692  -0.2522 0.0771  835 ASN A OD1 
1731 N ND2 . ASN A 244 ? 1.2111 1.4449 1.8449 0.2678  -0.2799 0.0732  835 ASN A ND2 
1732 N N   . ALA A 245 ? 0.6990 0.8342 1.1138 0.2070  -0.2751 0.0865  836 ALA A N   
1733 C CA  . ALA A 245 ? 0.7095 0.8348 1.0762 0.1958  -0.2871 0.0916  836 ALA A CA  
1734 C C   . ALA A 245 ? 0.7578 0.8440 1.0757 0.1928  -0.2765 0.1011  836 ALA A C   
1735 O O   . ALA A 245 ? 0.7726 0.8439 1.0562 0.1950  -0.2913 0.1149  836 ALA A O   
1736 C CB  . ALA A 245 ? 0.6959 0.8393 1.0600 0.1780  -0.2821 0.0765  836 ALA A CB  
1737 N N   . ILE A 246 ? 0.6959 0.7666 1.0119 0.1877  -0.2511 0.0943  837 ILE A N   
1738 C CA  . ILE A 246 ? 0.7007 0.7367 0.9770 0.1834  -0.2377 0.1016  837 ILE A CA  
1739 C C   . ILE A 246 ? 0.8079 0.8200 1.0791 0.1978  -0.2465 0.1192  837 ILE A C   
1740 O O   . ILE A 246 ? 0.8322 0.8198 1.0621 0.1946  -0.2491 0.1322  837 ILE A O   
1741 C CB  . ILE A 246 ? 0.6980 0.7281 0.9804 0.1747  -0.2103 0.0888  837 ILE A CB  
1742 C CG1 . ILE A 246 ? 0.6687 0.7170 0.9478 0.1593  -0.2032 0.0745  837 ILE A CG1 
1743 C CG2 . ILE A 246 ? 0.7023 0.6982 0.9525 0.1714  -0.1964 0.0962  837 ILE A CG2 
1744 C CD1 . ILE A 246 ? 0.7490 0.7915 0.9847 0.1486  -0.2099 0.0770  837 ILE A CD1 
1745 N N   . GLU A 247 ? 0.7823 0.8021 1.0955 0.2137  -0.2516 0.1201  838 GLU A N   
1746 C CA  . GLU A 247 ? 0.8265 0.8238 1.1403 0.2296  -0.2624 0.1367  838 GLU A CA  
1747 C C   . GLU A 247 ? 0.9035 0.9024 1.1943 0.2335  -0.2896 0.1531  838 GLU A C   
1748 O O   . GLU A 247 ? 0.9333 0.9039 1.1984 0.2390  -0.2970 0.1710  838 GLU A O   
1749 C CB  . GLU A 247 ? 0.8512 0.8605 1.2193 0.2474  -0.2622 0.1317  838 GLU A CB  
1750 C CG  . GLU A 247 ? 1.0112 1.0070 1.3950 0.2474  -0.2362 0.1199  838 GLU A CG  
1751 C CD  . GLU A 247 ? 1.2552 1.2694 1.6941 0.2629  -0.2310 0.1093  838 GLU A CD  
1752 O OE1 . GLU A 247 ? 1.1730 1.2164 1.6469 0.2746  -0.2475 0.1102  838 GLU A OE1 
1753 O OE2 . GLU A 247 ? 1.1405 1.1410 1.5880 0.2632  -0.2098 0.0994  838 GLU A OE2 
1754 N N   . GLN A 248 ? 0.8530 0.8838 1.1501 0.2290  -0.3044 0.1472  839 GLN A N   
1755 C CA  . GLN A 248 ? 0.8838 0.9204 1.1578 0.2310  -0.3314 0.1601  839 GLN A CA  
1756 C C   . GLN A 248 ? 0.9495 0.9735 1.1657 0.2144  -0.3295 0.1622  839 GLN A C   
1757 O O   . GLN A 248 ? 0.9681 1.0020 1.1616 0.2119  -0.3496 0.1673  839 GLN A O   
1758 C CB  . GLN A 248 ? 0.8967 0.9745 1.2097 0.2353  -0.3505 0.1525  839 GLN A CB  
1759 N N   . ASP A 249 ? 0.8948 0.8980 1.0878 0.2036  -0.3052 0.1578  840 ASP A N   
1760 C CA  . ASP A 249 ? 0.8907 0.8802 1.0316 0.1889  -0.2978 0.1590  840 ASP A CA  
1761 C C   . ASP A 249 ? 0.8899 0.9030 1.0223 0.1767  -0.3006 0.1436  840 ASP A C   
1762 O O   . ASP A 249 ? 0.9113 0.9176 0.9992 0.1674  -0.3020 0.1455  840 ASP A O   
1763 C CB  . ASP A 249 ? 0.9650 0.9321 1.0631 0.1922  -0.3115 0.1814  840 ASP A CB  
1764 C CG  . ASP A 249 ? 1.1487 1.0864 1.2504 0.2021  -0.3077 0.1976  840 ASP A CG  
1765 O OD1 . ASP A 249 ? 1.1469 1.0687 1.2547 0.1982  -0.2856 0.1925  840 ASP A OD1 
1766 O OD2 . ASP A 249 ? 1.2709 1.1998 1.3674 0.2133  -0.3273 0.2156  840 ASP A OD2 
1767 N N   . TYR A 250 ? 0.7756 0.8154 0.9499 0.1760  -0.2998 0.1278  841 TYR A N   
1768 C CA  . TYR A 250 ? 0.7408 0.7992 0.9092 0.1630  -0.3004 0.1121  841 TYR A CA  
1769 C C   . TYR A 250 ? 0.7656 0.8102 0.9158 0.1508  -0.2740 0.1025  841 TYR A C   
1770 O O   . TYR A 250 ? 0.7519 0.7860 0.9173 0.1526  -0.2556 0.1017  841 TYR A O   
1771 C CB  . TYR A 250 ? 0.7171 0.8083 0.9378 0.1643  -0.3068 0.0993  841 TYR A CB  
1772 C CG  . TYR A 250 ? 0.6948 0.8015 0.9157 0.1492  -0.3023 0.0816  841 TYR A CG  
1773 C CD1 . TYR A 250 ? 0.7261 0.8479 0.9356 0.1433  -0.3228 0.0773  841 TYR A CD1 
1774 C CD2 . TYR A 250 ? 0.6687 0.7741 0.9015 0.1406  -0.2784 0.0693  841 TYR A CD2 
1775 C CE1 . TYR A 250 ? 0.7027 0.8356 0.9134 0.1290  -0.3192 0.0606  841 TYR A CE1 
1776 C CE2 . TYR A 250 ? 0.6651 0.7813 0.8974 0.1268  -0.2745 0.0543  841 TYR A CE2 
1777 C CZ  . TYR A 250 ? 0.7578 0.8871 0.9803 0.1211  -0.2948 0.0498  841 TYR A CZ  
1778 O OH  . TYR A 250 ? 0.7298 0.8670 0.9538 0.1072  -0.2912 0.0346  841 TYR A OH  
1779 N N   . ARG A 251 ? 0.7183 0.7630 0.8360 0.1392  -0.2731 0.0948  842 ARG A N   
1780 C CA  . ARG A 251 ? 0.6976 0.7333 0.7990 0.1278  -0.2509 0.0845  842 ARG A CA  
1781 C C   . ARG A 251 ? 0.7601 0.8122 0.8633 0.1179  -0.2553 0.0683  842 ARG A C   
1782 O O   . ARG A 251 ? 0.7864 0.8485 0.8792 0.1175  -0.2756 0.0676  842 ARG A O   
1783 C CB  . ARG A 251 ? 0.6805 0.6929 0.7317 0.1243  -0.2429 0.0938  842 ARG A CB  
1784 C CG  . ARG A 251 ? 0.7181 0.7101 0.7647 0.1310  -0.2359 0.1098  842 ARG A CG  
1785 C CD  . ARG A 251 ? 0.6568 0.6445 0.7343 0.1313  -0.2165 0.1046  842 ARG A CD  
1786 N NE  . ARG A 251 ? 0.7034 0.6681 0.7732 0.1360  -0.2099 0.1189  842 ARG A NE  
1787 C CZ  . ARG A 251 ? 0.8918 0.8503 0.9836 0.1477  -0.2179 0.1285  842 ARG A CZ  
1788 N NH1 . ARG A 251 ? 0.7789 0.7560 0.9040 0.1569  -0.2329 0.1256  842 ARG A NH1 
1789 N NH2 . ARG A 251 ? 0.7335 0.6672 0.8153 0.1503  -0.2111 0.1410  842 ARG A NH2 
1790 N N   . LEU A 252 ? 0.6786 0.7326 0.7948 0.1095  -0.2373 0.0554  843 LEU A N   
1791 C CA  . LEU A 252 ? 0.6640 0.7293 0.7824 0.0990  -0.2395 0.0399  843 LEU A CA  
1792 C C   . LEU A 252 ? 0.7341 0.7897 0.8050 0.0943  -0.2473 0.0380  843 LEU A C   
1793 O O   . LEU A 252 ? 0.7381 0.7760 0.7730 0.0954  -0.2388 0.0452  843 LEU A O   
1794 C CB  . LEU A 252 ? 0.6326 0.6953 0.7649 0.0911  -0.2168 0.0294  843 LEU A CB  
1795 C CG  . LEU A 252 ? 0.6558 0.7336 0.8366 0.0926  -0.2095 0.0261  843 LEU A CG  
1796 C CD1 . LEU A 252 ? 0.6206 0.6891 0.8043 0.0873  -0.1855 0.0214  843 LEU A CD1 
1797 C CD2 . LEU A 252 ? 0.6806 0.7830 0.8929 0.0876  -0.2226 0.0166  843 LEU A CD2 
1798 N N   . PRO A 253 ? 0.6985 0.7660 0.7681 0.0888  -0.2640 0.0282  844 PRO A N   
1799 C CA  . PRO A 253 ? 0.7189 0.7764 0.7413 0.0848  -0.2713 0.0243  844 PRO A CA  
1800 C C   . PRO A 253 ? 0.7486 0.7929 0.7520 0.0768  -0.2522 0.0127  844 PRO A C   
1801 O O   . PRO A 253 ? 0.7143 0.7599 0.7448 0.0730  -0.2372 0.0068  844 PRO A O   
1802 C CB  . PRO A 253 ? 0.7524 0.8277 0.7862 0.0809  -0.2957 0.0160  844 PRO A CB  
1803 C CG  . PRO A 253 ? 0.7702 0.8628 0.8563 0.0773  -0.2924 0.0089  844 PRO A CG  
1804 C CD  . PRO A 253 ? 0.6972 0.7879 0.8079 0.0852  -0.2762 0.0192  844 PRO A CD  
1805 N N   . PRO A 254 ? 0.7359 0.7680 0.6939 0.0745  -0.2521 0.0086  845 PRO A N   
1806 C CA  . PRO A 254 ? 0.7214 0.7418 0.6656 0.0686  -0.2344 -0.0033 845 PRO A CA  
1807 C C   . PRO A 254 ? 0.7604 0.7863 0.7268 0.0598  -0.2382 -0.0200 845 PRO A C   
1808 O O   . PRO A 254 ? 0.7825 0.8167 0.7497 0.0563  -0.2580 -0.0268 845 PRO A O   
1809 C CB  . PRO A 254 ? 0.7772 0.7861 0.6687 0.0696  -0.2359 -0.0044 845 PRO A CB  
1810 C CG  . PRO A 254 ? 0.8675 0.8836 0.7452 0.0728  -0.2591 0.0024  845 PRO A CG  
1811 C CD  . PRO A 254 ? 0.7977 0.8265 0.7148 0.0777  -0.2678 0.0143  845 PRO A CD  
1812 N N   . PRO A 255 ? 0.6858 0.7067 0.6696 0.0554  -0.2203 -0.0263 846 PRO A N   
1813 C CA  . PRO A 255 ? 0.6818 0.7040 0.6830 0.0457  -0.2229 -0.0415 846 PRO A CA  
1814 C C   . PRO A 255 ? 0.7811 0.7918 0.7462 0.0419  -0.2322 -0.0549 846 PRO A C   
1815 O O   . PRO A 255 ? 0.7746 0.7757 0.6995 0.0472  -0.2308 -0.0529 846 PRO A O   
1816 C CB  . PRO A 255 ? 0.6680 0.6818 0.6814 0.0436  -0.2000 -0.0425 846 PRO A CB  
1817 C CG  . PRO A 255 ? 0.7094 0.7256 0.7290 0.0513  -0.1889 -0.0274 846 PRO A CG  
1818 C CD  . PRO A 255 ? 0.6771 0.6897 0.6626 0.0581  -0.1975 -0.0197 846 PRO A CD  
1819 N N   . MET A 256 ? 0.7880 0.7995 0.7666 0.0324  -0.2415 -0.0687 847 MET A N   
1820 C CA  . MET A 256 ? 0.8415 0.8399 0.7882 0.0278  -0.2514 -0.0841 847 MET A CA  
1821 C C   . MET A 256 ? 0.8492 0.8267 0.7604 0.0324  -0.2336 -0.0888 847 MET A C   
1822 O O   . MET A 256 ? 0.8074 0.7781 0.7313 0.0327  -0.2150 -0.0875 847 MET A O   
1823 C CB  . MET A 256 ? 0.8934 0.8924 0.8668 0.0152  -0.2595 -0.0977 847 MET A CB  
1824 C CG  . MET A 256 ? 1.0047 0.9913 0.9493 0.0089  -0.2749 -0.1149 847 MET A CG  
1825 S SD  . MET A 256 ? 1.1280 1.1320 1.0603 0.0092  -0.3043 -0.1132 847 MET A SD  
1826 C CE  . MET A 256 ? 1.1395 1.1195 1.0059 0.0118  -0.3080 -0.1278 847 MET A CE  
1827 N N   . ASP A 257 ? 0.8301 0.7995 0.6968 0.0365  -0.2394 -0.0933 848 ASP A N   
1828 C CA  . ASP A 257 ? 0.8490 0.8012 0.6779 0.0419  -0.2243 -0.0995 848 ASP A CA  
1829 C C   . ASP A 257 ? 0.8399 0.7928 0.6666 0.0499  -0.2025 -0.0854 848 ASP A C   
1830 O O   . ASP A 257 ? 0.8457 0.7874 0.6496 0.0542  -0.1874 -0.0902 848 ASP A O   
1831 C CB  . ASP A 257 ? 0.8851 0.8197 0.7158 0.0366  -0.2194 -0.1177 848 ASP A CB  
1832 C CG  . ASP A 257 ? 1.0687 1.0009 0.9055 0.0262  -0.2404 -0.1324 848 ASP A CG  
1833 O OD1 . ASP A 257 ? 1.1277 1.0608 0.9358 0.0259  -0.2571 -0.1385 848 ASP A OD1 
1834 O OD2 . ASP A 257 ? 1.1126 1.0421 0.9822 0.0176  -0.2405 -0.1375 848 ASP A OD2 
1835 N N   . CYS A 258 ? 0.7495 0.7155 0.5992 0.0520  -0.2014 -0.0685 849 CYS A N   
1836 C CA  . CYS A 258 ? 0.7217 0.6884 0.5716 0.0578  -0.1825 -0.0546 849 CYS A CA  
1837 C C   . CYS A 258 ? 0.7885 0.7521 0.5947 0.0640  -0.1790 -0.0487 849 CYS A C   
1838 O O   . CYS A 258 ? 0.8088 0.7771 0.5972 0.0653  -0.1943 -0.0434 849 CYS A O   
1839 C CB  . CYS A 258 ? 0.6935 0.6726 0.5780 0.0583  -0.1845 -0.0400 849 CYS A CB  
1840 S SG  . CYS A 258 ? 0.7159 0.6943 0.6013 0.0639  -0.1642 -0.0229 849 CYS A SG  
1841 N N   . PRO A 259 ? 0.7279 0.6851 0.5167 0.0678  -0.1593 -0.0486 850 PRO A N   
1842 C CA  . PRO A 259 ? 0.7461 0.7033 0.4950 0.0727  -0.1536 -0.0414 850 PRO A CA  
1843 C C   . PRO A 259 ? 0.8056 0.7702 0.5565 0.0742  -0.1582 -0.0207 850 PRO A C   
1844 O O   . PRO A 259 ? 0.7718 0.7405 0.5561 0.0734  -0.1556 -0.0109 850 PRO A O   
1845 C CB  . PRO A 259 ? 0.7496 0.7035 0.4957 0.0758  -0.1301 -0.0427 850 PRO A CB  
1846 C CG  . PRO A 259 ? 0.7829 0.7301 0.5534 0.0733  -0.1277 -0.0567 850 PRO A CG  
1847 C CD  . PRO A 259 ? 0.7100 0.6617 0.5154 0.0677  -0.1415 -0.0539 850 PRO A CD  
1848 N N   . ALA A 260 ? 0.8002 0.7654 0.5144 0.0764  -0.1660 -0.0146 851 ALA A N   
1849 C CA  . ALA A 260 ? 0.8020 0.7710 0.5109 0.0782  -0.1727 0.0058  851 ALA A CA  
1850 C C   . ALA A 260 ? 0.8201 0.7888 0.5430 0.0789  -0.1542 0.0207  851 ALA A C   
1851 O O   . ALA A 260 ? 0.7963 0.7663 0.5429 0.0795  -0.1589 0.0341  851 ALA A O   
1852 C CB  . ALA A 260 ? 0.8556 0.8234 0.5141 0.0798  -0.1796 0.0092  851 ALA A CB  
1853 N N   . ALA A 261 ? 0.7704 0.7377 0.4816 0.0790  -0.1335 0.0172  852 ALA A N   
1854 C CA  . ALA A 261 ? 0.7542 0.7224 0.4775 0.0783  -0.1154 0.0298  852 ALA A CA  
1855 C C   . ALA A 261 ? 0.7510 0.7194 0.5200 0.0765  -0.1132 0.0308  852 ALA A C   
1856 O O   . ALA A 261 ? 0.7419 0.7094 0.5239 0.0756  -0.1081 0.0451  852 ALA A O   
1857 C CB  . ALA A 261 ? 0.7660 0.7363 0.4720 0.0791  -0.0956 0.0231  852 ALA A CB  
1858 N N   . LEU A 262 ? 0.6796 0.6483 0.4715 0.0754  -0.1171 0.0160  853 LEU A N   
1859 C CA  . LEU A 262 ? 0.6500 0.6200 0.4836 0.0732  -0.1152 0.0158  853 LEU A CA  
1860 C C   . LEU A 262 ? 0.6981 0.6709 0.5516 0.0740  -0.1303 0.0242  853 LEU A C   
1861 O O   . LEU A 262 ? 0.6650 0.6380 0.5436 0.0738  -0.1252 0.0324  853 LEU A O   
1862 C CB  . LEU A 262 ? 0.6407 0.6097 0.4909 0.0709  -0.1146 -0.0013 853 LEU A CB  
1863 C CG  . LEU A 262 ? 0.6839 0.6501 0.5304 0.0711  -0.0972 -0.0081 853 LEU A CG  
1864 C CD1 . LEU A 262 ? 0.6868 0.6479 0.5408 0.0694  -0.1007 -0.0250 853 LEU A CD1 
1865 C CD2 . LEU A 262 ? 0.6590 0.6276 0.5297 0.0694  -0.0832 0.0010  853 LEU A CD2 
1866 N N   . HIS A 263 ? 0.6950 0.6702 0.5373 0.0753  -0.1492 0.0222  854 HIS A N   
1867 C CA  . HIS A 263 ? 0.6954 0.6751 0.5581 0.0777  -0.1645 0.0314  854 HIS A CA  
1868 C C   . HIS A 263 ? 0.7580 0.7324 0.6096 0.0812  -0.1618 0.0510  854 HIS A C   
1869 O O   . HIS A 263 ? 0.7484 0.7228 0.6270 0.0837  -0.1641 0.0598  854 HIS A O   
1870 C CB  . HIS A 263 ? 0.7348 0.7203 0.5893 0.0781  -0.1872 0.0255  854 HIS A CB  
1871 C CG  . HIS A 263 ? 0.7745 0.7677 0.6548 0.0819  -0.2035 0.0350  854 HIS A CG  
1872 N ND1 . HIS A 263 ? 0.8295 0.8236 0.6893 0.0862  -0.2209 0.0459  854 HIS A ND1 
1873 C CD2 . HIS A 263 ? 0.7658 0.7665 0.6902 0.0827  -0.2041 0.0354  854 HIS A CD2 
1874 C CE1 . HIS A 263 ? 0.8093 0.8114 0.7035 0.0903  -0.2321 0.0525  854 HIS A CE1 
1875 N NE2 . HIS A 263 ? 0.7781 0.7851 0.7121 0.0885  -0.2219 0.0458  854 HIS A NE2 
1876 N N   . GLN A 264 ? 0.7160 0.6851 0.5286 0.0811  -0.1556 0.0575  855 GLN A N   
1877 C CA  . GLN A 264 ? 0.7255 0.6876 0.5251 0.0825  -0.1514 0.0770  855 GLN A CA  
1878 C C   . GLN A 264 ? 0.7474 0.7056 0.5735 0.0804  -0.1347 0.0818  855 GLN A C   
1879 O O   . GLN A 264 ? 0.7355 0.6871 0.5740 0.0822  -0.1370 0.0952  855 GLN A O   
1880 C CB  . GLN A 264 ? 0.7774 0.7369 0.5303 0.0811  -0.1451 0.0822  855 GLN A CB  
1881 C CG  . GLN A 264 ? 0.9505 0.9019 0.6869 0.0811  -0.1438 0.1048  855 GLN A CG  
1882 C CD  . GLN A 264 ? 1.0497 0.9968 0.7936 0.0861  -0.1647 0.1170  855 GLN A CD  
1883 O OE1 . GLN A 264 ? 0.9792 0.9306 0.7090 0.0889  -0.1831 0.1144  855 GLN A OE1 
1884 N NE2 . GLN A 264 ? 0.8779 0.8167 0.6463 0.0876  -0.1631 0.1297  855 GLN A NE2 
1885 N N   . LEU A 265 ? 0.6761 0.6374 0.5118 0.0769  -0.1194 0.0702  856 LEU A N   
1886 C CA  . LEU A 265 ? 0.6465 0.6053 0.5073 0.0741  -0.1049 0.0728  856 LEU A CA  
1887 C C   . LEU A 265 ? 0.6634 0.6226 0.5623 0.0762  -0.1122 0.0717  856 LEU A C   
1888 O O   . LEU A 265 ? 0.6572 0.6100 0.5712 0.0761  -0.1070 0.0806  856 LEU A O   
1889 C CB  . LEU A 265 ? 0.6240 0.5874 0.4868 0.0707  -0.0893 0.0609  856 LEU A CB  
1890 C CG  . LEU A 265 ? 0.6453 0.6077 0.5308 0.0668  -0.0741 0.0627  856 LEU A CG  
1891 C CD1 . LEU A 265 ? 0.6382 0.5946 0.5154 0.0643  -0.0671 0.0787  856 LEU A CD1 
1892 C CD2 . LEU A 265 ? 0.6566 0.6247 0.5409 0.0648  -0.0611 0.0519  856 LEU A CD2 
1893 N N   . MET A 266 ? 0.5831 0.5497 0.4968 0.0780  -0.1248 0.0612  857 MET A N   
1894 C CA  . MET A 266 ? 0.5638 0.5348 0.5147 0.0806  -0.1322 0.0599  857 MET A CA  
1895 C C   . MET A 266 ? 0.6499 0.6152 0.6020 0.0867  -0.1429 0.0752  857 MET A C   
1896 O O   . MET A 266 ? 0.6350 0.5966 0.6122 0.0893  -0.1394 0.0799  857 MET A O   
1897 C CB  . MET A 266 ? 0.5854 0.5676 0.5498 0.0803  -0.1454 0.0473  857 MET A CB  
1898 C CG  . MET A 266 ? 0.6052 0.5905 0.5759 0.0744  -0.1359 0.0327  857 MET A CG  
1899 S SD  . MET A 266 ? 0.6422 0.6385 0.6263 0.0721  -0.1533 0.0191  857 MET A SD  
1900 C CE  . MET A 266 ? 0.5869 0.5768 0.5516 0.0663  -0.1431 0.0046  857 MET A CE  
1901 N N   . LEU A 267 ? 0.6392 0.6025 0.5625 0.0894  -0.1556 0.0832  858 LEU A N   
1902 C CA  . LEU A 267 ? 0.6610 0.6170 0.5807 0.0957  -0.1676 0.0998  858 LEU A CA  
1903 C C   . LEU A 267 ? 0.7190 0.6593 0.6335 0.0947  -0.1549 0.1136  858 LEU A C   
1904 O O   . LEU A 267 ? 0.7270 0.6587 0.6572 0.1003  -0.1607 0.1242  858 LEU A O   
1905 C CB  . LEU A 267 ? 0.6923 0.6492 0.5765 0.0975  -0.1836 0.1059  858 LEU A CB  
1906 C CG  . LEU A 267 ? 0.7373 0.7085 0.6266 0.0987  -0.2015 0.0941  858 LEU A CG  
1907 C CD1 . LEU A 267 ? 0.7782 0.7483 0.6263 0.0998  -0.2165 0.1009  858 LEU A CD1 
1908 C CD2 . LEU A 267 ? 0.7259 0.7072 0.6600 0.1046  -0.2142 0.0928  858 LEU A CD2 
1909 N N   . ASP A 268 ? 0.6612 0.5979 0.5555 0.0876  -0.1381 0.1132  859 ASP A N   
1910 C CA  . ASP A 268 ? 0.6648 0.5881 0.5549 0.0839  -0.1246 0.1249  859 ASP A CA  
1911 C C   . ASP A 268 ? 0.7167 0.6363 0.6437 0.0840  -0.1168 0.1202  859 ASP A C   
1912 O O   . ASP A 268 ? 0.7330 0.6380 0.6660 0.0846  -0.1145 0.1311  859 ASP A O   
1913 C CB  . ASP A 268 ? 0.6721 0.5983 0.5379 0.0760  -0.1081 0.1228  859 ASP A CB  
1914 C CG  . ASP A 268 ? 0.7593 0.6884 0.5849 0.0754  -0.1117 0.1276  859 ASP A CG  
1915 O OD1 . ASP A 268 ? 0.7970 0.7221 0.6080 0.0798  -0.1274 0.1369  859 ASP A OD1 
1916 O OD2 . ASP A 268 ? 0.8138 0.7499 0.6221 0.0710  -0.0991 0.1215  859 ASP A OD2 
1917 N N   . CYS A 269 ? 0.6410 0.5726 0.5906 0.0829  -0.1124 0.1039  860 CYS A N   
1918 C CA  . CYS A 269 ? 0.6147 0.5458 0.5975 0.0825  -0.1041 0.0969  860 CYS A CA  
1919 C C   . CYS A 269 ? 0.6679 0.5968 0.6763 0.0914  -0.1162 0.1001  860 CYS A C   
1920 O O   . CYS A 269 ? 0.6380 0.5604 0.6696 0.0929  -0.1098 0.0990  860 CYS A O   
1921 C CB  . CYS A 269 ? 0.5832 0.5283 0.5795 0.0788  -0.0981 0.0803  860 CYS A CB  
1922 S SG  . CYS A 269 ? 0.6108 0.5583 0.5865 0.0702  -0.0814 0.0753  860 CYS A SG  
1923 N N   . TRP A 270 ? 0.6489 0.5843 0.6539 0.0976  -0.1337 0.1028  861 TRP A N   
1924 C CA  . TRP A 270 ? 0.6557 0.5933 0.6872 0.1076  -0.1475 0.1058  861 TRP A CA  
1925 C C   . TRP A 270 ? 0.7311 0.6527 0.7499 0.1145  -0.1586 0.1242  861 TRP A C   
1926 O O   . TRP A 270 ? 0.7385 0.6643 0.7735 0.1242  -0.1746 0.1282  861 TRP A O   
1927 C CB  . TRP A 270 ? 0.6409 0.5991 0.6854 0.1102  -0.1617 0.0962  861 TRP A CB  
1928 C CG  . TRP A 270 ? 0.6223 0.5950 0.6815 0.1033  -0.1530 0.0791  861 TRP A CG  
1929 C CD1 . TRP A 270 ? 0.6329 0.6062 0.7116 0.0991  -0.1367 0.0706  861 TRP A CD1 
1930 C CD2 . TRP A 270 ? 0.6185 0.6062 0.6756 0.1000  -0.1621 0.0688  861 TRP A CD2 
1931 N NE1 . TRP A 270 ? 0.6103 0.5975 0.6978 0.0932  -0.1344 0.0571  861 TRP A NE1 
1932 C CE2 . TRP A 270 ? 0.6407 0.6363 0.7165 0.0935  -0.1499 0.0553  861 TRP A CE2 
1933 C CE3 . TRP A 270 ? 0.6560 0.6500 0.6951 0.1011  -0.1798 0.0696  861 TRP A CE3 
1934 C CZ2 . TRP A 270 ? 0.6279 0.6354 0.7059 0.0879  -0.1545 0.0432  861 TRP A CZ2 
1935 C CZ3 . TRP A 270 ? 0.6733 0.6797 0.7145 0.0955  -0.1846 0.0560  861 TRP A CZ3 
1936 C CH2 . TRP A 270 ? 0.6544 0.6668 0.7160 0.0890  -0.1721 0.0431  861 TRP A CH2 
1937 N N   . GLN A 271 ? 0.7032 0.6069 0.6957 0.1097  -0.1504 0.1360  862 GLN A N   
1938 C CA  . GLN A 271 ? 0.7379 0.6227 0.7173 0.1152  -0.1602 0.1554  862 GLN A CA  
1939 C C   . GLN A 271 ? 0.7902 0.6632 0.8037 0.1241  -0.1613 0.1572  862 GLN A C   
1940 O O   . GLN A 271 ? 0.7515 0.6224 0.7853 0.1211  -0.1469 0.1471  862 GLN A O   
1941 C CB  . GLN A 271 ? 0.7660 0.6350 0.7103 0.1059  -0.1496 0.1678  862 GLN A CB  
1942 C CG  . GLN A 271 ? 0.9232 0.8014 0.8292 0.1015  -0.1538 0.1711  862 GLN A CG  
1943 C CD  . GLN A 271 ? 1.2777 1.1471 1.1526 0.0910  -0.1393 0.1801  862 GLN A CD  
1944 O OE1 . GLN A 271 ? 1.2883 1.1443 1.1368 0.0897  -0.1433 0.1984  862 GLN A OE1 
1945 N NE2 . GLN A 271 ? 1.1529 1.0311 1.0304 0.0829  -0.1222 0.1682  862 GLN A NE2 
1946 N N   . LYS A 272 ? 0.7762 0.6431 0.7970 0.1359  -0.1790 0.1686  863 LYS A N   
1947 C CA  . LYS A 272 ? 0.7744 0.6293 0.8281 0.1473  -0.1818 0.1708  863 LYS A CA  
1948 C C   . LYS A 272 ? 0.8258 0.6529 0.8743 0.1417  -0.1662 0.1758  863 LYS A C   
1949 O O   . LYS A 272 ? 0.7912 0.6149 0.8669 0.1434  -0.1556 0.1648  863 LYS A O   
1950 C CB  . LYS A 272 ? 0.8175 0.6669 0.8724 0.1607  -0.2043 0.1864  863 LYS A CB  
1951 C CG  . LYS A 272 ? 0.9438 0.7854 1.0386 0.1757  -0.2090 0.1863  863 LYS A CG  
1952 C CD  . LYS A 272 ? 1.0307 0.8644 1.1243 0.1896  -0.2324 0.2047  863 LYS A CD  
1953 C CE  . LYS A 272 ? 1.1983 1.0186 1.3293 0.2059  -0.2360 0.2065  863 LYS A CE  
1954 N NZ  . LYS A 272 ? 1.3599 1.1745 1.4922 0.2209  -0.2607 0.2249  863 LYS A NZ  
1955 N N   . ASP A 273 ? 0.8131 0.6216 0.8260 0.1337  -0.1643 0.1918  864 ASP A N   
1956 C CA  . ASP A 273 ? 0.8154 0.5983 0.8205 0.1253  -0.1502 0.1975  864 ASP A CA  
1957 C C   . ASP A 273 ? 0.8053 0.6012 0.8085 0.1120  -0.1311 0.1825  864 ASP A C   
1958 O O   . ASP A 273 ? 0.7743 0.5831 0.7525 0.1029  -0.1268 0.1825  864 ASP A O   
1959 C CB  . ASP A 273 ? 0.8871 0.6490 0.8551 0.1197  -0.1545 0.2207  864 ASP A CB  
1960 C CG  . ASP A 273 ? 1.0510 0.7838 1.0112 0.1099  -0.1421 0.2295  864 ASP A CG  
1961 O OD1 . ASP A 273 ? 1.0394 0.7678 1.0212 0.1067  -0.1295 0.2162  864 ASP A OD1 
1962 O OD2 . ASP A 273 ? 1.1570 0.8712 1.0891 0.1047  -0.1452 0.2497  864 ASP A OD2 
1963 N N   . ARG A 274 ? 0.7418 0.5337 0.7711 0.1116  -0.1199 0.1695  865 ARG A N   
1964 C CA  . ARG A 274 ? 0.6982 0.5011 0.7292 0.1000  -0.1027 0.1552  865 ARG A CA  
1965 C C   . ARG A 274 ? 0.7662 0.5610 0.7677 0.0853  -0.0925 0.1642  865 ARG A C   
1966 O O   . ARG A 274 ? 0.7465 0.5583 0.7411 0.0763  -0.0823 0.1556  865 ARG A O   
1967 C CB  . ARG A 274 ? 0.6741 0.4705 0.7349 0.1025  -0.0937 0.1418  865 ARG A CB  
1968 C CG  . ARG A 274 ? 0.8336 0.5969 0.8932 0.1004  -0.0896 0.1497  865 ARG A CG  
1969 C CD  . ARG A 274 ? 1.0038 0.7588 1.0916 0.1053  -0.0824 0.1354  865 ARG A CD  
1970 N NE  . ARG A 274 ? 1.1811 0.9078 1.2614 0.0960  -0.0734 0.1382  865 ARG A NE  
1971 C CZ  . ARG A 274 ? 1.5282 1.2220 1.6066 0.0999  -0.0789 0.1500  865 ARG A CZ  
1972 N NH1 . ARG A 274 ? 1.4824 1.1679 1.5656 0.1142  -0.0936 0.1614  865 ARG A NH1 
1973 N NH2 . ARG A 274 ? 1.4222 1.0906 1.4938 0.0892  -0.0704 0.1509  865 ARG A NH2 
1974 N N   . ASN A 275 ? 0.7656 0.5354 0.7506 0.0828  -0.0954 0.1822  866 ASN A N   
1975 C CA  . ASN A 275 ? 0.7833 0.5459 0.7417 0.0679  -0.0857 0.1930  866 ASN A CA  
1976 C C   . ASN A 275 ? 0.8405 0.6225 0.7702 0.0641  -0.0872 0.1987  866 ASN A C   
1977 O O   . ASN A 275 ? 0.8347 0.6227 0.7463 0.0518  -0.0757 0.2018  866 ASN A O   
1978 C CB  . ASN A 275 ? 0.8194 0.5478 0.7690 0.0658  -0.0893 0.2118  866 ASN A CB  
1979 C CG  . ASN A 275 ? 1.1304 0.8356 1.1049 0.0680  -0.0860 0.2053  866 ASN A CG  
1980 O OD1 . ASN A 275 ? 0.9721 0.6812 0.9591 0.0607  -0.0737 0.1910  866 ASN A OD1 
1981 N ND2 . ASN A 275 ? 1.1202 0.7991 1.1009 0.0784  -0.0972 0.2159  866 ASN A ND2 
1982 N N   . SER A 276 ? 0.8024 0.5951 0.7284 0.0747  -0.1012 0.1995  867 SER A N   
1983 C CA  . SER A 276 ? 0.8080 0.6181 0.7053 0.0727  -0.1043 0.2027  867 SER A CA  
1984 C C   . SER A 276 ? 0.8204 0.6577 0.7231 0.0706  -0.0969 0.1831  867 SER A C   
1985 O O   . SER A 276 ? 0.8311 0.6824 0.7093 0.0671  -0.0950 0.1828  867 SER A O   
1986 C CB  . SER A 276 ? 0.8708 0.6790 0.7598 0.0841  -0.1243 0.2123  867 SER A CB  
1987 O OG  . SER A 276 ? 1.0271 0.8080 0.9084 0.0859  -0.1311 0.2325  867 SER A OG  
1988 N N   . ARG A 277 ? 0.7277 0.5713 0.6612 0.0726  -0.0921 0.1670  868 ARG A N   
1989 C CA  . ARG A 277 ? 0.6945 0.5607 0.6353 0.0705  -0.0855 0.1493  868 ARG A CA  
1990 C C   . ARG A 277 ? 0.7315 0.6039 0.6590 0.0590  -0.0692 0.1474  868 ARG A C   
1991 O O   . ARG A 277 ? 0.7389 0.5987 0.6659 0.0516  -0.0606 0.1545  868 ARG A O   
1992 C CB  . ARG A 277 ? 0.6614 0.5316 0.6377 0.0750  -0.0843 0.1346  868 ARG A CB  
1993 C CG  . ARG A 277 ? 0.7280 0.5991 0.7229 0.0873  -0.0998 0.1341  868 ARG A CG  
1994 C CD  . ARG A 277 ? 0.7171 0.5924 0.7479 0.0917  -0.0964 0.1207  868 ARG A CD  
1995 N NE  . ARG A 277 ? 0.7239 0.5960 0.7739 0.1043  -0.1107 0.1244  868 ARG A NE  
1996 C CZ  . ARG A 277 ? 0.8338 0.7018 0.9143 0.1114  -0.1093 0.1185  868 ARG A CZ  
1997 N NH1 . ARG A 277 ? 0.5918 0.4581 0.6853 0.1062  -0.0945 0.1078  868 ARG A NH1 
1998 N NH2 . ARG A 277 ? 0.6630 0.5290 0.7609 0.1242  -0.1230 0.1234  868 ARG A NH2 
1999 N N   . PRO A 278 ? 0.6931 0.5846 0.6110 0.0571  -0.0648 0.1375  869 PRO A N   
2000 C CA  . PRO A 278 ? 0.6717 0.5712 0.5817 0.0476  -0.0491 0.1352  869 PRO A CA  
2001 C C   . PRO A 278 ? 0.6744 0.5738 0.6108 0.0439  -0.0404 0.1254  869 PRO A C   
2002 O O   . PRO A 278 ? 0.6490 0.5483 0.6077 0.0491  -0.0449 0.1159  869 PRO A O   
2003 C CB  . PRO A 278 ? 0.6789 0.5967 0.5759 0.0499  -0.0488 0.1250  869 PRO A CB  
2004 C CG  . PRO A 278 ? 0.7206 0.6411 0.6306 0.0584  -0.0623 0.1163  869 PRO A CG  
2005 C CD  . PRO A 278 ? 0.6932 0.5992 0.6096 0.0635  -0.0739 0.1271  869 PRO A CD  
2006 N N   . ARG A 279 ? 0.6316 0.5321 0.5653 0.0343  -0.0281 0.1280  870 ARG A N   
2007 C CA  . ARG A 279 ? 0.6095 0.5118 0.5634 0.0292  -0.0195 0.1188  870 ARG A CA  
2008 C C   . ARG A 279 ? 0.6143 0.5368 0.5708 0.0305  -0.0151 0.1058  870 ARG A C   
2009 O O   . ARG A 279 ? 0.6003 0.5330 0.5401 0.0331  -0.0160 0.1058  870 ARG A O   
2010 C CB  . ARG A 279 ? 0.6283 0.5252 0.5775 0.0174  -0.0097 0.1277  870 ARG A CB  
2011 C CG  . ARG A 279 ? 0.7665 0.6384 0.7162 0.0152  -0.0139 0.1394  870 ARG A CG  
2012 C CD  . ARG A 279 ? 1.0123 0.8771 0.9624 0.0017  -0.0048 0.1455  870 ARG A CD  
2013 N NE  . ARG A 279 ? 1.4204 1.2573 1.3699 -0.0005 -0.0094 0.1569  870 ARG A NE  
2014 C CZ  . ARG A 279 ? 1.7407 1.5658 1.6830 -0.0130 -0.0044 0.1686  870 ARG A CZ  
2015 N NH1 . ARG A 279 ? 1.6339 1.4765 1.5705 -0.0246 0.0058  0.1707  870 ARG A NH1 
2016 N NH2 . ARG A 279 ? 1.5890 1.3848 1.5308 -0.0140 -0.0098 0.1787  870 ARG A NH2 
2017 N N   . PHE A 280 ? 0.5465 0.4734 0.5220 0.0286  -0.0103 0.0949  871 PHE A N   
2018 C CA  . PHE A 280 ? 0.5106 0.4535 0.4894 0.0297  -0.0066 0.0838  871 PHE A CA  
2019 C C   . PHE A 280 ? 0.5654 0.5214 0.5295 0.0259  0.0018  0.0864  871 PHE A C   
2020 O O   . PHE A 280 ? 0.5371 0.5037 0.4954 0.0304  0.0019  0.0795  871 PHE A O   
2021 C CB  . PHE A 280 ? 0.4989 0.4427 0.4985 0.0274  -0.0029 0.0741  871 PHE A CB  
2022 C CG  . PHE A 280 ? 0.4936 0.4334 0.5087 0.0338  -0.0103 0.0672  871 PHE A CG  
2023 C CD1 . PHE A 280 ? 0.4988 0.4466 0.5145 0.0397  -0.0167 0.0608  871 PHE A CD1 
2024 C CD2 . PHE A 280 ? 0.4918 0.4207 0.5217 0.0336  -0.0105 0.0662  871 PHE A CD2 
2025 C CE1 . PHE A 280 ? 0.5002 0.4477 0.5330 0.0446  -0.0235 0.0549  871 PHE A CE1 
2026 C CE2 . PHE A 280 ? 0.5179 0.4470 0.5650 0.0401  -0.0160 0.0594  871 PHE A CE2 
2027 C CZ  . PHE A 280 ? 0.4797 0.4194 0.5291 0.0451  -0.0225 0.0544  871 PHE A CZ  
2028 N N   . ALA A 281 ? 0.5311 0.4862 0.4888 0.0179  0.0086  0.0964  872 ALA A N   
2029 C CA  . ALA A 281 ? 0.5305 0.5015 0.4769 0.0143  0.0177  0.0997  872 ALA A CA  
2030 C C   . ALA A 281 ? 0.5797 0.5554 0.5036 0.0204  0.0155  0.1024  872 ALA A C   
2031 O O   . ALA A 281 ? 0.5768 0.5674 0.4934 0.0234  0.0210  0.0972  872 ALA A O   
2032 C CB  . ALA A 281 ? 0.5519 0.5210 0.4980 0.0031  0.0245  0.1109  872 ALA A CB  
2033 N N   . GLU A 282 ? 0.5455 0.5079 0.4581 0.0229  0.0070  0.1099  873 GLU A N   
2034 C CA  . GLU A 282 ? 0.5679 0.5326 0.4562 0.0283  0.0027  0.1130  873 GLU A CA  
2035 C C   . GLU A 282 ? 0.5637 0.5331 0.4528 0.0372  -0.0041 0.0989  873 GLU A C   
2036 O O   . GLU A 282 ? 0.5478 0.5261 0.4186 0.0410  -0.0027 0.0950  873 GLU A O   
2037 C CB  . GLU A 282 ? 0.6169 0.5648 0.4948 0.0292  -0.0073 0.1254  873 GLU A CB  
2038 C CG  . GLU A 282 ? 0.8496 0.7888 0.7207 0.0199  -0.0018 0.1418  873 GLU A CG  
2039 C CD  . GLU A 282 ? 1.1001 1.0188 0.9639 0.0226  -0.0139 0.1538  873 GLU A CD  
2040 O OE1 . GLU A 282 ? 0.6705 0.5729 0.5518 0.0210  -0.0172 0.1565  873 GLU A OE1 
2041 O OE2 . GLU A 282 ? 1.0279 0.9466 0.8695 0.0277  -0.0212 0.1587  873 GLU A OE2 
2042 N N   . ILE A 283 ? 0.5254 0.4886 0.4352 0.0400  -0.0115 0.0913  874 ILE A N   
2043 C CA  . ILE A 283 ? 0.5192 0.4860 0.4338 0.0464  -0.0185 0.0780  874 ILE A CA  
2044 C C   . ILE A 283 ? 0.5632 0.5420 0.4764 0.0469  -0.0095 0.0683  874 ILE A C   
2045 O O   . ILE A 283 ? 0.5733 0.5563 0.4720 0.0518  -0.0118 0.0613  874 ILE A O   
2046 C CB  . ILE A 283 ? 0.5358 0.4962 0.4764 0.0476  -0.0253 0.0727  874 ILE A CB  
2047 C CG1 . ILE A 283 ? 0.5525 0.5017 0.4936 0.0507  -0.0365 0.0814  874 ILE A CG1 
2048 C CG2 . ILE A 283 ? 0.5285 0.4945 0.4770 0.0514  -0.0300 0.0589  874 ILE A CG2 
2049 C CD1 . ILE A 283 ? 0.6045 0.5477 0.5727 0.0518  -0.0399 0.0784  874 ILE A CD1 
2050 N N   . VAL A 284 ? 0.4982 0.4823 0.4248 0.0419  0.0006  0.0686  875 VAL A N   
2051 C CA  . VAL A 284 ? 0.4779 0.4739 0.4058 0.0433  0.0090  0.0611  875 VAL A CA  
2052 C C   . VAL A 284 ? 0.5371 0.5427 0.4415 0.0463  0.0150  0.0629  875 VAL A C   
2053 O O   . VAL A 284 ? 0.5183 0.5285 0.4153 0.0526  0.0159  0.0528  875 VAL A O   
2054 C CB  . VAL A 284 ? 0.4913 0.4929 0.4367 0.0368  0.0175  0.0634  875 VAL A CB  
2055 C CG1 . VAL A 284 ? 0.4769 0.4927 0.4238 0.0393  0.0258  0.0578  875 VAL A CG1 
2056 C CG2 . VAL A 284 ? 0.4578 0.4510 0.4236 0.0346  0.0128  0.0591  875 VAL A CG2 
2057 N N   . ASN A 285 ? 0.5095 0.5169 0.4018 0.0415  0.0195  0.0755  876 ASN A N   
2058 C CA  . ASN A 285 ? 0.5397 0.5580 0.4088 0.0431  0.0272  0.0788  876 ASN A CA  
2059 C C   . ASN A 285 ? 0.5811 0.5952 0.4271 0.0507  0.0197  0.0723  876 ASN A C   
2060 O O   . ASN A 285 ? 0.5885 0.6121 0.4206 0.0559  0.0258  0.0650  876 ASN A O   
2061 C CB  . ASN A 285 ? 0.5882 0.6071 0.4484 0.0346  0.0325  0.0955  876 ASN A CB  
2062 C CG  . ASN A 285 ? 0.6986 0.7263 0.5779 0.0260  0.0421  0.1008  876 ASN A CG  
2063 O OD1 . ASN A 285 ? 0.5524 0.5906 0.4484 0.0273  0.0469  0.0927  876 ASN A OD1 
2064 N ND2 . ASN A 285 ? 0.6432 0.6662 0.5198 0.0166  0.0444  0.1151  876 ASN A ND2 
2065 N N   . THR A 286 ? 0.5429 0.5434 0.3864 0.0516  0.0060  0.0740  877 THR A N   
2066 C CA  . THR A 286 ? 0.5852 0.5808 0.4082 0.0576  -0.0047 0.0681  877 THR A CA  
2067 C C   . THR A 286 ? 0.6257 0.6226 0.4537 0.0635  -0.0068 0.0502  877 THR A C   
2068 O O   . THR A 286 ? 0.6285 0.6279 0.4341 0.0685  -0.0066 0.0424  877 THR A O   
2069 C CB  . THR A 286 ? 0.6279 0.6107 0.4543 0.0572  -0.0198 0.0748  877 THR A CB  
2070 O OG1 . THR A 286 ? 0.6762 0.6551 0.4944 0.0520  -0.0170 0.0919  877 THR A OG1 
2071 C CG2 . THR A 286 ? 0.5943 0.5735 0.4006 0.0626  -0.0335 0.0689  877 THR A CG2 
2072 N N   . LEU A 287 ? 0.5571 0.5512 0.4131 0.0627  -0.0085 0.0440  878 LEU A N   
2073 C CA  . LEU A 287 ? 0.5524 0.5451 0.4163 0.0669  -0.0105 0.0286  878 LEU A CA  
2074 C C   . LEU A 287 ? 0.6045 0.6063 0.4620 0.0709  0.0023  0.0224  878 LEU A C   
2075 O O   . LEU A 287 ? 0.6065 0.6056 0.4536 0.0768  0.0007  0.0099  878 LEU A O   
2076 C CB  . LEU A 287 ? 0.5261 0.5143 0.4207 0.0636  -0.0139 0.0263  878 LEU A CB  
2077 C CG  . LEU A 287 ? 0.5685 0.5494 0.4731 0.0618  -0.0268 0.0288  878 LEU A CG  
2078 C CD1 . LEU A 287 ? 0.5475 0.5267 0.4811 0.0581  -0.0262 0.0276  878 LEU A CD1 
2079 C CD2 . LEU A 287 ? 0.5477 0.5243 0.4407 0.0653  -0.0401 0.0200  878 LEU A CD2 
2080 N N   . ASP A 288 ? 0.5595 0.5724 0.4230 0.0680  0.0147  0.0310  879 ASP A N   
2081 C CA  . ASP A 288 ? 0.5559 0.5820 0.4164 0.0724  0.0277  0.0271  879 ASP A CA  
2082 C C   . ASP A 288 ? 0.6319 0.6630 0.4620 0.0779  0.0320  0.0238  879 ASP A C   
2083 O O   . ASP A 288 ? 0.6415 0.6767 0.4657 0.0859  0.0378  0.0123  879 ASP A O   
2084 C CB  . ASP A 288 ? 0.5588 0.5981 0.4341 0.0663  0.0385  0.0384  879 ASP A CB  
2085 C CG  . ASP A 288 ? 0.6051 0.6431 0.5087 0.0634  0.0376  0.0371  879 ASP A CG  
2086 O OD1 . ASP A 288 ? 0.6534 0.6818 0.5651 0.0671  0.0310  0.0272  879 ASP A OD1 
2087 O OD2 . ASP A 288 ? 0.5628 0.6090 0.4794 0.0565  0.0432  0.0461  879 ASP A OD2 
2088 N N   . LYS A 289 ? 0.5946 0.6238 0.4039 0.0744  0.0285  0.0332  880 LYS A N   
2089 C CA  . LYS A 289 ? 0.6162 0.6496 0.3918 0.0787  0.0319  0.0307  880 LYS A CA  
2090 C C   . LYS A 289 ? 0.6563 0.6774 0.4172 0.0853  0.0205  0.0148  880 LYS A C   
2091 O O   . LYS A 289 ? 0.6540 0.6788 0.3940 0.0921  0.0264  0.0042  880 LYS A O   
2092 C CB  . LYS A 289 ? 0.6599 0.6931 0.4158 0.0721  0.0302  0.0473  880 LYS A CB  
2093 C CG  . LYS A 289 ? 0.7628 0.8089 0.5268 0.0646  0.0435  0.0628  880 LYS A CG  
2094 C CD  . LYS A 289 ? 1.0028 1.0417 0.7516 0.0570  0.0385  0.0806  880 LYS A CD  
2095 C CE  . LYS A 289 ? 1.2230 1.2719 0.9803 0.0474  0.0508  0.0964  880 LYS A CE  
2096 N NZ  . LYS A 289 ? 1.3644 1.3995 1.1144 0.0394  0.0433  0.1141  880 LYS A NZ  
2097 N N   . MET A 290 ? 0.6285 0.6358 0.4014 0.0832  0.0048  0.0120  881 MET A N   
2098 C CA  . MET A 290 ? 0.6369 0.6324 0.3988 0.0872  -0.0081 -0.0030 881 MET A CA  
2099 C C   . MET A 290 ? 0.6949 0.6879 0.4650 0.0936  -0.0026 -0.0193 881 MET A C   
2100 O O   . MET A 290 ? 0.7121 0.7000 0.4603 0.0995  -0.0039 -0.0331 881 MET A O   
2101 C CB  . MET A 290 ? 0.6423 0.6277 0.4232 0.0827  -0.0247 -0.0014 881 MET A CB  
2102 C CG  . MET A 290 ? 0.6832 0.6673 0.4541 0.0790  -0.0343 0.0118  881 MET A CG  
2103 S SD  . MET A 290 ? 0.6983 0.6748 0.5014 0.0753  -0.0506 0.0124  881 MET A SD  
2104 C CE  . MET A 290 ? 0.6665 0.6415 0.4555 0.0736  -0.0616 0.0294  881 MET A CE  
2105 N N   . ILE A 291 ? 0.6376 0.6332 0.4378 0.0925  0.0036  -0.0175 882 ILE A N   
2106 C CA  . ILE A 291 ? 0.6356 0.6280 0.4477 0.0987  0.0090  -0.0298 882 ILE A CA  
2107 C C   . ILE A 291 ? 0.7159 0.7176 0.5082 0.1079  0.0225  -0.0367 882 ILE A C   
2108 O O   . ILE A 291 ? 0.7488 0.7419 0.5355 0.1158  0.0231  -0.0521 882 ILE A O   
2109 C CB  . ILE A 291 ? 0.6395 0.6360 0.4850 0.0949  0.0134  -0.0224 882 ILE A CB  
2110 C CG1 . ILE A 291 ? 0.6222 0.6064 0.4869 0.0882  0.0003  -0.0223 882 ILE A CG1 
2111 C CG2 . ILE A 291 ? 0.6563 0.6555 0.5124 0.1025  0.0228  -0.0299 882 ILE A CG2 
2112 C CD1 . ILE A 291 ? 0.6669 0.6561 0.5598 0.0814  0.0032  -0.0112 882 ILE A CD1 
2113 N N   . ARG A 292 ? 0.6509 0.6692 0.4316 0.1066  0.0332  -0.0257 883 ARG A N   
2114 C CA  . ARG A 292 ? 0.6629 0.6952 0.4259 0.1145  0.0485  -0.0302 883 ARG A CA  
2115 C C   . ARG A 292 ? 0.7529 0.7828 0.4757 0.1172  0.0471  -0.0361 883 ARG A C   
2116 O O   . ARG A 292 ? 0.7674 0.8062 0.4725 0.1255  0.0593  -0.0446 883 ARG A O   
2117 C CB  . ARG A 292 ? 0.6053 0.6601 0.3810 0.1105  0.0628  -0.0149 883 ARG A CB  
2118 C CG  . ARG A 292 ? 0.6003 0.6607 0.4111 0.1117  0.0670  -0.0140 883 ARG A CG  
2119 C CD  . ARG A 292 ? 0.5943 0.6710 0.4237 0.1021  0.0735  0.0035  883 ARG A CD  
2120 N NE  . ARG A 292 ? 0.5714 0.6526 0.4328 0.1024  0.0748  0.0043  883 ARG A NE  
2121 C CZ  . ARG A 292 ? 0.6460 0.7130 0.5254 0.0976  0.0641  0.0050  883 ARG A CZ  
2122 N NH1 . ARG A 292 ? 0.5631 0.6120 0.4352 0.0929  0.0515  0.0044  883 ARG A NH1 
2123 N NH2 . ARG A 292 ? 0.4899 0.5620 0.3946 0.0978  0.0658  0.0062  883 ARG A NH2 
2124 N N   . ASN A 293 ? 0.7401 0.7588 0.4484 0.1108  0.0322  -0.0321 884 ASN A N   
2125 C CA  . ASN A 293 ? 0.7905 0.8063 0.4585 0.1125  0.0282  -0.0370 884 ASN A CA  
2126 C C   . ASN A 293 ? 0.8488 0.8442 0.5087 0.1127  0.0086  -0.0507 884 ASN A C   
2127 O O   . ASN A 293 ? 0.8116 0.8003 0.4739 0.1058  -0.0068 -0.0430 884 ASN A O   
2128 C CB  . ASN A 293 ? 0.8310 0.8559 0.4824 0.1049  0.0292  -0.0172 884 ASN A CB  
2129 C CG  . ASN A 293 ? 1.2102 1.2321 0.8170 0.1056  0.0237  -0.0196 884 ASN A CG  
2130 O OD1 . ASN A 293 ? 1.2109 1.2292 0.8054 0.0991  0.0130  -0.0062 884 ASN A OD1 
2131 N ND2 . ASN A 293 ? 1.0690 1.0921 0.6494 0.1139  0.0309  -0.0363 884 ASN A ND2 
2132 N N   . PRO A 294 ? 0.8749 0.8602 0.5276 0.1206  0.0090  -0.0714 885 PRO A N   
2133 C CA  . PRO A 294 ? 0.9024 0.8677 0.5495 0.1192  -0.0098 -0.0856 885 PRO A CA  
2134 C C   . PRO A 294 ? 1.0092 0.9711 0.6242 0.1147  -0.0247 -0.0843 885 PRO A C   
2135 O O   . PRO A 294 ? 1.0165 0.9670 0.6384 0.1095  -0.0434 -0.0880 885 PRO A O   
2136 C CB  . PRO A 294 ? 0.9425 0.8976 0.5809 0.1294  -0.0034 -0.1077 885 PRO A CB  
2137 C CG  . PRO A 294 ? 0.9970 0.9695 0.6276 0.1375  0.0185  -0.1056 885 PRO A CG  
2138 C CD  . PRO A 294 ? 0.9021 0.8931 0.5544 0.1314  0.0262  -0.0830 885 PRO A CD  
2139 N N   . ALA A 295 ? 0.9998 0.9727 0.5807 0.1161  -0.0168 -0.0780 886 ALA A N   
2140 C CA  . ALA A 295 ? 1.0403 1.0113 0.5867 0.1120  -0.0305 -0.0741 886 ALA A CA  
2141 C C   . ALA A 295 ? 1.0941 1.0653 0.6602 0.1033  -0.0456 -0.0551 886 ALA A C   
2142 O O   . ALA A 295 ? 1.1129 1.0773 0.6667 0.0999  -0.0652 -0.0562 886 ALA A O   
2143 C CB  . ALA A 295 ? 1.0757 1.0603 0.5842 0.1145  -0.0157 -0.0676 886 ALA A CB  
2144 N N   . SER A 296 ? 1.0105 0.9896 0.6089 0.1002  -0.0371 -0.0390 887 SER A N   
2145 C CA  . SER A 296 ? 0.9870 0.9656 0.6075 0.0934  -0.0487 -0.0217 887 SER A CA  
2146 C C   . SER A 296 ? 1.0530 1.0213 0.7012 0.0909  -0.0667 -0.0295 887 SER A C   
2147 O O   . SER A 296 ? 1.0467 1.0142 0.7053 0.0868  -0.0806 -0.0187 887 SER A O   
2148 C CB  . SER A 296 ? 0.9778 0.9656 0.6238 0.0906  -0.0340 -0.0055 887 SER A CB  
2149 O OG  . SER A 296 ? 1.0100 0.9967 0.6919 0.0914  -0.0282 -0.0121 887 SER A OG  
2150 N N   . LEU A 297 ? 1.0305 0.9912 0.6912 0.0933  -0.0664 -0.0476 888 LEU A N   
2151 C CA  . LEU A 297 ? 1.0158 0.9677 0.7031 0.0894  -0.0821 -0.0553 888 LEU A CA  
2152 C C   . LEU A 297 ? 1.1536 1.0949 0.8178 0.0897  -0.0968 -0.0740 888 LEU A C   
2153 O O   . LEU A 297 ? 1.1570 1.0894 0.8412 0.0864  -0.1071 -0.0851 888 LEU A O   
2154 C CB  . LEU A 297 ? 0.9725 0.9213 0.6941 0.0898  -0.0719 -0.0601 888 LEU A CB  
2155 C CG  . LEU A 297 ? 0.9804 0.9384 0.7297 0.0878  -0.0604 -0.0440 888 LEU A CG  
2156 C CD1 . LEU A 297 ? 0.9538 0.9087 0.7291 0.0892  -0.0503 -0.0504 888 LEU A CD1 
2157 C CD2 . LEU A 297 ? 0.9604 0.9204 0.7310 0.0819  -0.0722 -0.0320 888 LEU A CD2 
2158 N N   . LYS A 298 ? 1.1730 1.1148 0.7937 0.0933  -0.0960 -0.0786 889 LYS A N   
2159 C CA  . LYS A 298 ? 1.2277 1.1588 0.8180 0.0941  -0.1078 -0.0982 889 LYS A CA  
2160 C C   . LYS A 298 ? 1.3311 1.2640 0.8990 0.0896  -0.1296 -0.0940 889 LYS A C   
2161 O O   . LYS A 298 ? 1.3752 1.3007 0.9103 0.0899  -0.1396 -0.1093 889 LYS A O   
2162 C CB  . LYS A 298 ? 1.2902 1.2198 0.8448 0.1022  -0.0910 -0.1102 889 LYS A CB  
2163 N N   . THR A 299 ? 1.2844 1.2263 0.8695 0.0859  -0.1377 -0.0740 890 THR A N   
2164 C CA  . THR A 299 ? 1.3137 1.2589 0.8834 0.0826  -0.1599 -0.0669 890 THR A CA  
2165 C C   . THR A 299 ? 1.3282 1.2781 0.9426 0.0782  -0.1738 -0.0569 890 THR A C   
2166 O O   . THR A 299 ? 1.2733 1.2282 0.9157 0.0786  -0.1639 -0.0422 890 THR A O   
2167 C CB  . THR A 299 ? 1.4728 1.4246 1.0036 0.0849  -0.1558 -0.0507 890 THR A CB  
2168 O OG1 . THR A 299 ? 1.4905 1.4475 1.0276 0.0874  -0.1320 -0.0390 890 THR A OG1 
2169 C CG2 . THR A 299 ? 1.5075 1.4553 0.9849 0.0868  -0.1587 -0.0641 890 THR A CG2 
2170 N N   . VAL A 300 ? 1.3098 1.2587 0.9318 0.0738  -0.1961 -0.0664 891 VAL A N   
2171 C CA  . VAL A 300 ? 1.2819 1.2382 0.9470 0.0696  -0.2113 -0.0600 891 VAL A CA  
2172 C C   . VAL A 300 ? 1.3564 1.3219 1.0112 0.0713  -0.2267 -0.0413 891 VAL A C   
2173 O O   . VAL A 300 ? 1.3846 1.3489 0.9955 0.0737  -0.2287 -0.0369 891 VAL A O   
2174 C CB  . VAL A 300 ? 1.3353 1.2875 1.0133 0.0631  -0.2278 -0.0799 891 VAL A CB  
2175 C CG1 . VAL A 300 ? 1.3027 1.2657 1.0309 0.0583  -0.2399 -0.0743 891 VAL A CG1 
2176 C CG2 . VAL A 300 ? 1.3267 1.2648 1.0045 0.0624  -0.2135 -0.0984 891 VAL A CG2 
2177 N N   . ALA A 301 ? 1.2968 1.2716 0.9917 0.0705  -0.2367 -0.0299 892 ALA A N   
2178 C CA  . ALA A 301 ? 1.7344 1.7173 1.4291 0.0735  -0.2524 -0.0111 892 ALA A CA  
2179 C C   . ALA A 301 ? 2.0605 2.0453 1.7163 0.0732  -0.2751 -0.0127 892 ALA A C   
2180 O O   . ALA A 301 ? 1.5361 1.5252 1.1804 0.0768  -0.2870 0.0048  892 ALA A O   
2181 C CB  . ALA A 301 ? 1.7118 1.7052 1.4600 0.0729  -0.2617 -0.0064 892 ALA A CB  
2182 N N   . GLU B 18  ? 0.9162 0.9367 0.6555 -0.0430 0.0284  0.1467  609 GLU B N   
2183 C CA  . GLU B 18  ? 0.9042 0.9227 0.6412 -0.0358 0.0263  0.1300  609 GLU B CA  
2184 C C   . GLU B 18  ? 0.9060 0.9165 0.6725 -0.0252 0.0262  0.1189  609 GLU B C   
2185 O O   . GLU B 18  ? 0.8905 0.8918 0.6777 -0.0227 0.0188  0.1257  609 GLU B O   
2186 C CB  . GLU B 18  ? 0.9396 0.9512 0.6607 -0.0387 0.0102  0.1359  609 GLU B CB  
2187 N N   . PHE B 19  ? 0.8149 0.8295 0.5831 -0.0194 0.0343  0.1015  610 PHE B N   
2188 C CA  . PHE B 19  ? 0.7585 0.7673 0.5512 -0.0106 0.0352  0.0909  610 PHE B CA  
2189 C C   . PHE B 19  ? 0.7565 0.7582 0.5469 -0.0073 0.0259  0.0817  610 PHE B C   
2190 O O   . PHE B 19  ? 0.7563 0.7614 0.5284 -0.0085 0.0277  0.0725  610 PHE B O   
2191 C CB  . PHE B 19  ? 0.7771 0.7946 0.5762 -0.0067 0.0503  0.0792  610 PHE B CB  
2192 C CG  . PHE B 19  ? 0.7976 0.8243 0.6037 -0.0093 0.0603  0.0864  610 PHE B CG  
2193 C CD1 . PHE B 19  ? 0.8220 0.8467 0.6533 -0.0054 0.0621  0.0879  610 PHE B CD1 
2194 C CD2 . PHE B 19  ? 0.8486 0.8878 0.6358 -0.0165 0.0682  0.0913  610 PHE B CD2 
2195 C CE1 . PHE B 19  ? 0.8303 0.8644 0.6694 -0.0084 0.0708  0.0944  610 PHE B CE1 
2196 C CE2 . PHE B 19  ? 0.8860 0.9353 0.6814 -0.0200 0.0774  0.0985  610 PHE B CE2 
2197 C CZ  . PHE B 19  ? 0.8358 0.8821 0.6577 -0.0157 0.0785  0.0997  610 PHE B CZ  
2198 N N   . ALA B 20  ? 0.6615 0.6546 0.4708 -0.0036 0.0161  0.0836  611 ALA B N   
2199 C CA  . ALA B 20  ? 0.6436 0.6314 0.4552 -0.0011 0.0069  0.0758  611 ALA B CA  
2200 C C   . ALA B 20  ? 0.6432 0.6315 0.4575 0.0028  0.0145  0.0601  611 ALA B C   
2201 O O   . ALA B 20  ? 0.6052 0.5907 0.4129 0.0028  0.0093  0.0516  611 ALA B O   
2202 C CB  . ALA B 20  ? 0.6310 0.6132 0.4662 0.0023  -0.0018 0.0797  611 ALA B CB  
2203 N N   . LYS B 21  ? 0.5856 0.5769 0.4111 0.0061  0.0259  0.0565  612 LYS B N   
2204 C CA  . LYS B 21  ? 0.5795 0.5699 0.4104 0.0104  0.0325  0.0426  612 LYS B CA  
2205 C C   . LYS B 21  ? 0.6503 0.6477 0.4639 0.0099  0.0429  0.0339  612 LYS B C   
2206 O O   . LYS B 21  ? 0.6588 0.6562 0.4801 0.0146  0.0501  0.0226  612 LYS B O   
2207 C CB  . LYS B 21  ? 0.5718 0.5610 0.4273 0.0149  0.0367  0.0429  612 LYS B CB  
2208 C CG  . LYS B 21  ? 0.5979 0.5812 0.4684 0.0157  0.0270  0.0450  612 LYS B CG  
2209 C CD  . LYS B 21  ? 0.7089 0.6930 0.6011 0.0186  0.0303  0.0472  612 LYS B CD  
2210 C CE  . LYS B 21  ? 0.6224 0.6036 0.5285 0.0186  0.0221  0.0476  612 LYS B CE  
2211 N NZ  . LYS B 21  ? 0.7411 0.7247 0.6657 0.0205  0.0255  0.0494  612 LYS B NZ  
2212 N N   . GLU B 22  ? 0.5972 0.6010 0.3873 0.0041  0.0428  0.0385  613 GLU B N   
2213 C CA  . GLU B 22  ? 0.5964 0.6099 0.3670 0.0025  0.0528  0.0288  613 GLU B CA  
2214 C C   . GLU B 22  ? 0.6594 0.6669 0.4260 0.0057  0.0507  0.0113  613 GLU B C   
2215 O O   . GLU B 22  ? 0.6293 0.6284 0.3933 0.0043  0.0389  0.0108  613 GLU B O   
2216 C CB  . GLU B 22  ? 0.6185 0.6399 0.3618 -0.0062 0.0507  0.0383  613 GLU B CB  
2217 C CG  . GLU B 22  ? 0.6826 0.7185 0.4049 -0.0089 0.0634  0.0291  613 GLU B CG  
2218 C CD  . GLU B 22  ? 0.9108 0.9602 0.6386 -0.0096 0.0777  0.0330  613 GLU B CD  
2219 O OE1 . GLU B 22  ? 0.8657 0.9136 0.6070 -0.0112 0.0760  0.0481  613 GLU B OE1 
2220 O OE2 . GLU B 22  ? 0.8432 0.9059 0.5617 -0.0091 0.0903  0.0206  613 GLU B OE2 
2221 N N   . ILE B 23  ? 0.6403 0.6520 0.4090 0.0102  0.0618  -0.0033 614 ILE B N   
2222 C CA  . ILE B 23  ? 0.6542 0.6587 0.4211 0.0135  0.0601  -0.0214 614 ILE B CA  
2223 C C   . ILE B 23  ? 0.7536 0.7692 0.4996 0.0127  0.0700  -0.0357 614 ILE B C   
2224 O O   . ILE B 23  ? 0.7810 0.8106 0.5252 0.0130  0.0824  -0.0353 614 ILE B O   
2225 C CB  . ILE B 23  ? 0.6686 0.6622 0.4640 0.0215  0.0608  -0.0287 614 ILE B CB  
2226 C CG1 . ILE B 23  ? 0.6755 0.6771 0.4871 0.0272  0.0735  -0.0298 614 ILE B CG1 
2227 C CG2 . ILE B 23  ? 0.6251 0.6081 0.4373 0.0210  0.0497  -0.0181 614 ILE B CG2 
2228 C CD1 . ILE B 23  ? 0.7270 0.7265 0.5459 0.0338  0.0796  -0.0473 614 ILE B CD1 
2229 N N   . ASP B 24  ? 0.7119 0.7225 0.4438 0.0116  0.0649  -0.0498 615 ASP B N   
2230 C CA  . ASP B 24  ? 0.7458 0.7663 0.4590 0.0116  0.0742  -0.0680 615 ASP B CA  
2231 C C   . ASP B 24  ? 0.7890 0.8093 0.5256 0.0217  0.0858  -0.0823 615 ASP B C   
2232 O O   . ASP B 24  ? 0.7507 0.7559 0.5122 0.0276  0.0806  -0.0840 615 ASP B O   
2233 C CB  . ASP B 24  ? 0.7962 0.8079 0.4942 0.0090  0.0642  -0.0814 615 ASP B CB  
2234 C CG  . ASP B 24  ? 1.0133 1.0370 0.6869 0.0076  0.0731  -0.1011 615 ASP B CG  
2235 O OD1 . ASP B 24  ? 1.0236 1.0462 0.7090 0.0153  0.0819  -0.1205 615 ASP B OD1 
2236 O OD2 . ASP B 24  ? 1.1348 1.1703 0.7779 -0.0011 0.0716  -0.0969 615 ASP B OD2 
2237 N N   . VAL B 25  ? 0.7760 0.8140 0.5059 0.0235  0.1009  -0.0918 616 VAL B N   
2238 C CA  . VAL B 25  ? 0.7763 0.8166 0.5303 0.0340  0.1121  -0.1065 616 VAL B CA  
2239 C C   . VAL B 25  ? 0.8117 0.8339 0.5789 0.0413  0.1067  -0.1262 616 VAL B C   
2240 O O   . VAL B 25  ? 0.8236 0.8381 0.6197 0.0504  0.1087  -0.1307 616 VAL B O   
2241 C CB  . VAL B 25  ? 0.8530 0.9181 0.5980 0.0349  0.1298  -0.1171 616 VAL B CB  
2242 C CG1 . VAL B 25  ? 0.8376 0.9166 0.5964 0.0345  0.1382  -0.1006 616 VAL B CG1 
2243 C CG2 . VAL B 25  ? 0.8820 0.9613 0.5884 0.0254  0.1323  -0.1223 616 VAL B CG2 
2244 N N   . SER B 26  ? 0.7485 0.7633 0.4958 0.0371  0.0988  -0.1371 617 SER B N   
2245 C CA  . SER B 26  ? 0.7521 0.7480 0.5108 0.0425  0.0924  -0.1559 617 SER B CA  
2246 C C   . SER B 26  ? 0.7988 0.7727 0.5850 0.0450  0.0803  -0.1452 617 SER B C   
2247 O O   . SER B 26  ? 0.8007 0.7581 0.6047 0.0508  0.0763  -0.1584 617 SER B O   
2248 C CB  . SER B 26  ? 0.8177 0.8116 0.5478 0.0356  0.0854  -0.1683 617 SER B CB  
2249 O OG  . SER B 26  ? 0.9113 0.8983 0.6307 0.0268  0.0712  -0.1515 617 SER B OG  
2250 N N   . PHE B 27  ? 0.7358 0.7094 0.5256 0.0403  0.0743  -0.1217 618 PHE B N   
2251 C CA  . PHE B 27  ? 0.6966 0.6534 0.5110 0.0415  0.0641  -0.1108 618 PHE B CA  
2252 C C   . PHE B 27  ? 0.7456 0.6997 0.5896 0.0505  0.0703  -0.1099 618 PHE B C   
2253 O O   . PHE B 27  ? 0.7249 0.6633 0.5900 0.0527  0.0626  -0.1070 618 PHE B O   
2254 C CB  . PHE B 27  ? 0.6850 0.6442 0.4949 0.0343  0.0564  -0.0883 618 PHE B CB  
2255 C CG  . PHE B 27  ? 0.6946 0.6548 0.4803 0.0257  0.0470  -0.0858 618 PHE B CG  
2256 C CD1 . PHE B 27  ? 0.7526 0.7098 0.5206 0.0235  0.0440  -0.1030 618 PHE B CD1 
2257 C CD2 . PHE B 27  ? 0.6897 0.6543 0.4707 0.0201  0.0406  -0.0668 618 PHE B CD2 
2258 C CE1 . PHE B 27  ? 0.7613 0.7208 0.5068 0.0152  0.0342  -0.0999 618 PHE B CE1 
2259 C CE2 . PHE B 27  ? 0.7240 0.6900 0.4845 0.0128  0.0306  -0.0638 618 PHE B CE2 
2260 C CZ  . PHE B 27  ? 0.7177 0.6816 0.4602 0.0102  0.0272  -0.0798 618 PHE B CZ  
2261 N N   . VAL B 28  ? 0.7302 0.7007 0.5762 0.0552  0.0837  -0.1124 619 VAL B N   
2262 C CA  . VAL B 28  ? 0.7177 0.6885 0.5926 0.0639  0.0893  -0.1110 619 VAL B CA  
2263 C C   . VAL B 28  ? 0.7947 0.7656 0.6811 0.0735  0.0969  -0.1330 619 VAL B C   
2264 O O   . VAL B 28  ? 0.8192 0.8034 0.6890 0.0740  0.1062  -0.1480 619 VAL B O   
2265 C CB  . VAL B 28  ? 0.7399 0.7284 0.6192 0.0631  0.0974  -0.0951 619 VAL B CB  
2266 C CG1 . VAL B 28  ? 0.7078 0.6878 0.6085 0.0633  0.0902  -0.0777 619 VAL B CG1 
2267 C CG2 . VAL B 28  ? 0.7418 0.7456 0.5929 0.0541  0.1009  -0.0867 619 VAL B CG2 
2268 N N   . LYS B 29  ? 0.7515 0.7095 0.6679 0.0815  0.0935  -0.1342 620 LYS B N   
2269 C CA  . LYS B 29  ? 0.7591 0.7151 0.6953 0.0930  0.0994  -0.1538 620 LYS B CA  
2270 C C   . LYS B 29  ? 0.7859 0.7500 0.7491 0.0994  0.1037  -0.1425 620 LYS B C   
2271 O O   . LYS B 29  ? 0.7625 0.7151 0.7417 0.0984  0.0946  -0.1263 620 LYS B O   
2272 C CB  . LYS B 29  ? 0.8038 0.7327 0.7527 0.0960  0.0876  -0.1648 620 LYS B CB  
2273 C CG  . LYS B 29  ? 1.0619 0.9858 1.0327 0.1087  0.0921  -0.1875 620 LYS B CG  
2274 N N   . ILE B 30  ? 0.7523 0.7386 0.7188 0.1047  0.1178  -0.1501 621 ILE B N   
2275 C CA  . ILE B 30  ? 0.7370 0.7343 0.7296 0.1110  0.1227  -0.1413 621 ILE B CA  
2276 C C   . ILE B 30  ? 0.8100 0.7958 0.8354 0.1243  0.1204  -0.1554 621 ILE B C   
2277 O O   . ILE B 30  ? 0.8471 0.8334 0.8742 0.1315  0.1259  -0.1790 621 ILE B O   
2278 C CB  . ILE B 30  ? 0.7713 0.7999 0.7549 0.1097  0.1388  -0.1419 621 ILE B CB  
2279 C CG1 . ILE B 30  ? 0.7682 0.8057 0.7202 0.0961  0.1393  -0.1265 621 ILE B CG1 
2280 C CG2 . ILE B 30  ? 0.7407 0.7818 0.7542 0.1162  0.1433  -0.1336 621 ILE B CG2 
2281 C CD1 . ILE B 30  ? 0.8447 0.9117 0.7783 0.0922  0.1552  -0.1314 621 ILE B CD1 
2282 N N   . GLU B 31  ? 0.7453 0.7206 0.7964 0.1276  0.1118  -0.1410 622 GLU B N   
2283 C CA  . GLU B 31  ? 0.7536 0.7169 0.8390 0.1401  0.1072  -0.1498 622 GLU B CA  
2284 C C   . GLU B 31  ? 0.8123 0.7955 0.9232 0.1473  0.1141  -0.1436 622 GLU B C   
2285 O O   . GLU B 31  ? 0.8200 0.8300 0.9230 0.1468  0.1280  -0.1472 622 GLU B O   
2286 C CB  . GLU B 31  ? 0.7636 0.6961 0.8592 0.1379  0.0897  -0.1402 622 GLU B CB  
2287 C CG  . GLU B 31  ? 0.8586 0.7726 0.9357 0.1334  0.0840  -0.1530 622 GLU B CG  
2288 C CD  . GLU B 31  ? 1.1181 1.0031 1.2006 0.1281  0.0672  -0.1438 622 GLU B CD  
2289 O OE1 . GLU B 31  ? 0.9468 0.8260 1.0417 0.1249  0.0589  -0.1230 622 GLU B OE1 
2290 O OE2 . GLU B 31  ? 1.1217 0.9909 1.1950 0.1263  0.0625  -0.1578 622 GLU B OE2 
2291 N N   . GLU B 32  ? 0.7660 0.7376 0.9067 0.1532  0.1041  -0.1337 623 GLU B N   
2292 C CA  . GLU B 32  ? 0.7514 0.7404 0.9205 0.1613  0.1083  -0.1290 623 GLU B CA  
2293 C C   . GLU B 32  ? 0.7736 0.7833 0.9343 0.1526  0.1126  -0.1085 623 GLU B C   
2294 O O   . GLU B 32  ? 0.7504 0.7540 0.8901 0.1408  0.1071  -0.0924 623 GLU B O   
2295 C CB  . GLU B 32  ? 0.7707 0.7388 0.9738 0.1697  0.0938  -0.1235 623 GLU B CB  
2296 C CG  . GLU B 32  ? 0.8429 0.7972 1.0441 0.1602  0.0797  -0.0971 623 GLU B CG  
2297 C CD  . GLU B 32  ? 1.0210 0.9456 1.2121 0.1534  0.0660  -0.0922 623 GLU B CD  
2298 O OE1 . GLU B 32  ? 0.9217 0.8385 1.0913 0.1496  0.0683  -0.1045 623 GLU B OE1 
2299 O OE2 . GLU B 32  ? 0.9451 0.8557 1.1484 0.1506  0.0529  -0.0749 623 GLU B OE2 
2300 N N   . VAL B 33  ? 0.7264 0.7606 0.9064 0.1587  0.1218  -0.1099 624 VAL B N   
2301 C CA  . VAL B 33  ? 0.6999 0.7540 0.8787 0.1517  0.1252  -0.0916 624 VAL B CA  
2302 C C   . VAL B 33  ? 0.7171 0.7563 0.9116 0.1502  0.1096  -0.0718 624 VAL B C   
2303 O O   . VAL B 33  ? 0.7115 0.7384 0.9331 0.1597  0.1008  -0.0738 624 VAL B O   
2304 C CB  . VAL B 33  ? 0.7600 0.8464 0.9569 0.1581  0.1397  -0.0996 624 VAL B CB  
2305 C CG1 . VAL B 33  ? 0.7801 0.8673 1.0135 0.1747  0.1398  -0.1161 624 VAL B CG1 
2306 C CG2 . VAL B 33  ? 0.7349 0.8385 0.9375 0.1514  0.1399  -0.0796 624 VAL B CG2 
2307 N N   . ILE B 34  ? 0.6595 0.6986 0.8361 0.1380  0.1055  -0.0529 625 ILE B N   
2308 C CA  . ILE B 34  ? 0.6374 0.6653 0.8238 0.1343  0.0916  -0.0338 625 ILE B CA  
2309 C C   . ILE B 34  ? 0.7194 0.7678 0.9109 0.1294  0.0939  -0.0195 625 ILE B C   
2310 O O   . ILE B 34  ? 0.7158 0.7602 0.9182 0.1272  0.0835  -0.0047 625 ILE B O   
2311 C CB  . ILE B 34  ? 0.6489 0.6547 0.8131 0.1246  0.0816  -0.0253 625 ILE B CB  
2312 C CG1 . ILE B 34  ? 0.6277 0.6409 0.7598 0.1135  0.0883  -0.0224 625 ILE B CG1 
2313 C CG2 . ILE B 34  ? 0.6576 0.6397 0.8252 0.1299  0.0752  -0.0374 625 ILE B CG2 
2314 C CD1 . ILE B 34  ? 0.6441 0.6403 0.7567 0.1032  0.0784  -0.0120 625 ILE B CD1 
2315 N N   . GLY B 35  ? 0.6975 0.7679 0.8801 0.1268  0.1072  -0.0236 626 GLY B N   
2316 C CA  . GLY B 35  ? 0.6887 0.7794 0.8761 0.1213  0.1104  -0.0115 626 GLY B CA  
2317 C C   . GLY B 35  ? 0.7716 0.8866 0.9512 0.1188  0.1262  -0.0181 626 GLY B C   
2318 O O   . GLY B 35  ? 0.7710 0.8896 0.9405 0.1217  0.1357  -0.0330 626 GLY B O   
2319 N N   . ALA B 36  ? 0.7605 0.8930 0.9448 0.1126  0.1286  -0.0067 627 ALA B N   
2320 C CA  . ALA B 36  ? 0.7750 0.9321 0.9525 0.1073  0.1425  -0.0084 627 ALA B CA  
2321 C C   . ALA B 36  ? 0.8247 0.9795 0.9807 0.0933  0.1397  0.0072  627 ALA B C   
2322 O O   . ALA B 36  ? 0.8032 0.9452 0.9596 0.0896  0.1280  0.0189  627 ALA B O   
2323 C CB  . ALA B 36  ? 0.7811 0.9634 0.9903 0.1131  0.1480  -0.0098 627 ALA B CB  
2324 N N   . GLY B 37  ? 0.7873 0.9536 0.9239 0.0856  0.1501  0.0064  628 GLY B N   
2325 C CA  . GLY B 37  ? 0.7735 0.9385 0.8904 0.0726  0.1485  0.0200  628 GLY B CA  
2326 C C   . GLY B 37  ? 0.8257 1.0167 0.9450 0.0661  0.1604  0.0228  628 GLY B C   
2327 O O   . GLY B 37  ? 0.8141 1.0257 0.9489 0.0718  0.1709  0.0131  628 GLY B O   
2328 N N   . GLU B 38  ? 0.7924 0.9830 0.8979 0.0540  0.1587  0.0360  629 GLU B N   
2329 C CA  . GLU B 38  ? 0.7979 1.0111 0.9042 0.0449  0.1685  0.0419  629 GLU B CA  
2330 C C   . GLU B 38  ? 0.8357 1.0639 0.9257 0.0428  0.1827  0.0333  629 GLU B C   
2331 O O   . GLU B 38  ? 0.8355 1.0905 0.9365 0.0411  0.1949  0.0307  629 GLU B O   
2332 C CB  . GLU B 38  ? 0.8138 1.0170 0.9070 0.0323  0.1612  0.0578  629 GLU B CB  
2333 C CG  . GLU B 38  ? 0.9816 1.2059 1.0805 0.0216  0.1686  0.0668  629 GLU B CG  
2334 C CD  . GLU B 38  ? 1.2112 1.4247 1.2966 0.0087  0.1619  0.0816  629 GLU B CD  
2335 O OE1 . GLU B 38  ? 1.0460 1.2359 1.1202 0.0087  0.1505  0.0850  629 GLU B OE1 
2336 O OE2 . GLU B 38  ? 1.1050 1.3341 1.1927 -0.0015 0.1679  0.0897  629 GLU B OE2 
2337 N N   . PHE B 39  ? 0.7738 0.9861 0.8375 0.0426  0.1810  0.0287  630 PHE B N   
2338 C CA  . PHE B 39  ? 0.7780 1.0010 0.8188 0.0389  0.1922  0.0214  630 PHE B CA  
2339 C C   . PHE B 39  ? 0.7945 1.0200 0.8366 0.0506  0.1984  0.0007  630 PHE B C   
2340 O O   . PHE B 39  ? 0.8039 1.0422 0.8278 0.0480  0.2092  -0.0081 630 PHE B O   
2341 C CB  . PHE B 39  ? 0.8088 1.0133 0.8179 0.0291  0.1847  0.0314  630 PHE B CB  
2342 C CG  . PHE B 39  ? 0.8202 1.0208 0.8274 0.0175  0.1784  0.0506  630 PHE B CG  
2343 C CD1 . PHE B 39  ? 0.8667 1.0865 0.8692 0.0060  0.1868  0.0600  630 PHE B CD1 
2344 C CD2 . PHE B 39  ? 0.8262 1.0048 0.8378 0.0179  0.1641  0.0588  630 PHE B CD2 
2345 C CE1 . PHE B 39  ? 0.8681 1.0821 0.8711 -0.0047 0.1799  0.0773  630 PHE B CE1 
2346 C CE2 . PHE B 39  ? 0.8490 1.0232 0.8604 0.0079  0.1580  0.0743  630 PHE B CE2 
2347 C CZ  . PHE B 39  ? 0.8329 1.0236 0.8408 -0.0031 0.1654  0.0834  630 PHE B CZ  
2348 N N   . GLY B 40  ? 0.7088 0.9218 0.7716 0.0627  0.1913  -0.0069 631 GLY B N   
2349 C CA  . GLY B 40  ? 0.7127 0.9229 0.7805 0.0748  0.1946  -0.0268 631 GLY B CA  
2350 C C   . GLY B 40  ? 0.7436 0.9304 0.8289 0.0849  0.1812  -0.0288 631 GLY B C   
2351 O O   . GLY B 40  ? 0.7062 0.8843 0.8033 0.0833  0.1711  -0.0155 631 GLY B O   
2352 N N   . GLU B 41  ? 0.7294 0.9058 0.8160 0.0946  0.1807  -0.0453 632 GLU B N   
2353 C CA  . GLU B 41  ? 0.7287 0.8823 0.8329 0.1040  0.1680  -0.0476 632 GLU B CA  
2354 C C   . GLU B 41  ? 0.7822 0.9079 0.8661 0.0984  0.1548  -0.0392 632 GLU B C   
2355 O O   . GLU B 41  ? 0.8013 0.9233 0.8564 0.0894  0.1556  -0.0362 632 GLU B O   
2356 C CB  . GLU B 41  ? 0.7710 0.9241 0.8892 0.1173  0.1724  -0.0699 632 GLU B CB  
2357 C CG  . GLU B 41  ? 0.9346 1.1171 1.0772 0.1251  0.1860  -0.0817 632 GLU B CG  
2358 C CD  . GLU B 41  ? 1.3610 1.5682 1.4851 0.1211  0.2034  -0.0941 632 GLU B CD  
2359 O OE1 . GLU B 41  ? 1.3080 1.5137 1.3981 0.1090  0.2054  -0.0878 632 GLU B OE1 
2360 O OE2 . GLU B 41  ? 1.3900 1.6199 1.5344 0.1298  0.2152  -0.1099 632 GLU B OE2 
2361 N N   . VAL B 42  ? 0.7000 0.8072 0.8001 0.1033  0.1422  -0.0348 633 VAL B N   
2362 C CA  . VAL B 42  ? 0.6779 0.7597 0.7649 0.0995  0.1295  -0.0286 633 VAL B CA  
2363 C C   . VAL B 42  ? 0.6896 0.7554 0.7868 0.1093  0.1253  -0.0432 633 VAL B C   
2364 O O   . VAL B 42  ? 0.6751 0.7427 0.7999 0.1194  0.1245  -0.0485 633 VAL B O   
2365 C CB  . VAL B 42  ? 0.7082 0.7822 0.8028 0.0947  0.1182  -0.0105 633 VAL B CB  
2366 C CG1 . VAL B 42  ? 0.6874 0.7385 0.7666 0.0897  0.1068  -0.0055 633 VAL B CG1 
2367 C CG2 . VAL B 42  ? 0.6981 0.7883 0.7868 0.0858  0.1225  0.0018  633 VAL B CG2 
2368 N N   . TYR B 43  ? 0.6340 0.6846 0.7099 0.1066  0.1225  -0.0501 634 TYR B N   
2369 C CA  . TYR B 43  ? 0.6379 0.6708 0.7209 0.1144  0.1177  -0.0647 634 TYR B CA  
2370 C C   . TYR B 43  ? 0.6664 0.6743 0.7418 0.1094  0.1037  -0.0570 634 TYR B C   
2371 O O   . TYR B 43  ? 0.6546 0.6606 0.7102 0.0994  0.1004  -0.0455 634 TYR B O   
2372 C CB  . TYR B 43  ? 0.6784 0.7164 0.7418 0.1150  0.1272  -0.0834 634 TYR B CB  
2373 C CG  . TYR B 43  ? 0.7243 0.7900 0.7914 0.1189  0.1432  -0.0941 634 TYR B CG  
2374 C CD1 . TYR B 43  ? 0.7495 0.8360 0.7988 0.1097  0.1523  -0.0854 634 TYR B CD1 
2375 C CD2 . TYR B 43  ? 0.7487 0.8199 0.8359 0.1312  0.1496  -0.1143 634 TYR B CD2 
2376 C CE1 . TYR B 43  ? 0.7772 0.8913 0.8286 0.1116  0.1679  -0.0949 634 TYR B CE1 
2377 C CE2 . TYR B 43  ? 0.7729 0.8729 0.8632 0.1344  0.1658  -0.1259 634 TYR B CE2 
2378 C CZ  . TYR B 43  ? 0.8562 0.9786 0.9281 0.1239  0.1752  -0.1155 634 TYR B CZ  
2379 O OH  . TYR B 43  ? 0.9110 1.0639 0.9853 0.1255  0.1918  -0.1260 634 TYR B OH  
2380 N N   . LYS B 44  ? 0.6215 0.6103 0.7127 0.1161  0.0955  -0.0641 635 LYS B N   
2381 C CA  . LYS B 44  ? 0.6193 0.5846 0.7027 0.1108  0.0831  -0.0597 635 LYS B CA  
2382 C C   . LYS B 44  ? 0.6833 0.6443 0.7444 0.1092  0.0871  -0.0761 635 LYS B C   
2383 O O   . LYS B 44  ? 0.7010 0.6718 0.7622 0.1157  0.0969  -0.0934 635 LYS B O   
2384 C CB  . LYS B 44  ? 0.6388 0.5844 0.7484 0.1176  0.0722  -0.0603 635 LYS B CB  
2385 C CG  . LYS B 44  ? 0.6423 0.5664 0.7449 0.1092  0.0589  -0.0502 635 LYS B CG  
2386 C CD  . LYS B 44  ? 0.7128 0.6162 0.8400 0.1141  0.0471  -0.0482 635 LYS B CD  
2387 C CE  . LYS B 44  ? 0.9381 0.8231 1.0566 0.1038  0.0351  -0.0379 635 LYS B CE  
2388 N NZ  . LYS B 44  ? 1.1079 0.9722 1.2499 0.1064  0.0224  -0.0325 635 LYS B NZ  
2389 N N   . GLY B 45  ? 0.6221 0.5708 0.6644 0.1003  0.0795  -0.0711 636 GLY B N   
2390 C CA  . GLY B 45  ? 0.6227 0.5666 0.6429 0.0975  0.0809  -0.0852 636 GLY B CA  
2391 C C   . GLY B 45  ? 0.6369 0.5614 0.6483 0.0899  0.0685  -0.0804 636 GLY B C   
2392 O O   . GLY B 45  ? 0.5944 0.5095 0.6170 0.0866  0.0594  -0.0661 636 GLY B O   
2393 N N   . ARG B 46  ? 0.6222 0.5426 0.6130 0.0864  0.0682  -0.0926 637 ARG B N   
2394 C CA  . ARG B 46  ? 0.6159 0.5202 0.5970 0.0784  0.0568  -0.0901 637 ARG B CA  
2395 C C   . ARG B 46  ? 0.6713 0.5865 0.6232 0.0704  0.0589  -0.0887 637 ARG B C   
2396 O O   . ARG B 46  ? 0.6675 0.5951 0.6034 0.0717  0.0678  -0.0998 637 ARG B O   
2397 C CB  . ARG B 46  ? 0.6514 0.5363 0.6391 0.0822  0.0514  -0.1082 637 ARG B CB  
2398 C CG  . ARG B 46  ? 0.7068 0.5752 0.7254 0.0890  0.0451  -0.1073 637 ARG B CG  
2399 C CD  . ARG B 46  ? 0.8078 0.6592 0.8343 0.0954  0.0425  -0.1297 637 ARG B CD  
2400 N NE  . ARG B 46  ? 0.9588 0.7954 1.0173 0.1042  0.0373  -0.1301 637 ARG B NE  
2401 C CZ  . ARG B 46  ? 1.1192 0.9325 1.1933 0.1010  0.0238  -0.1222 637 ARG B CZ  
2402 N NH1 . ARG B 46  ? 0.8985 0.7024 0.9599 0.0891  0.0149  -0.1144 637 ARG B NH1 
2403 N NH2 . ARG B 46  ? 0.9089 0.7092 1.0126 0.1093  0.0185  -0.1214 637 ARG B NH2 
2404 N N   . LEU B 47  ? 0.6063 0.5187 0.5517 0.0618  0.0507  -0.0743 638 LEU B N   
2405 C CA  . LEU B 47  ? 0.6019 0.5229 0.5223 0.0542  0.0500  -0.0709 638 LEU B CA  
2406 C C   . LEU B 47  ? 0.6661 0.5737 0.5798 0.0477  0.0386  -0.0741 638 LEU B C   
2407 O O   . LEU B 47  ? 0.6417 0.5393 0.5692 0.0445  0.0301  -0.0654 638 LEU B O   
2408 C CB  . LEU B 47  ? 0.5666 0.4995 0.4858 0.0499  0.0507  -0.0517 638 LEU B CB  
2409 C CG  . LEU B 47  ? 0.6116 0.5519 0.5081 0.0424  0.0478  -0.0459 638 LEU B CG  
2410 C CD1 . LEU B 47  ? 0.6370 0.5905 0.5124 0.0425  0.0568  -0.0528 638 LEU B CD1 
2411 C CD2 . LEU B 47  ? 0.5690 0.5158 0.4708 0.0387  0.0454  -0.0280 638 LEU B CD2 
2412 N N   . LYS B 48  ? 0.6411 0.5502 0.5333 0.0451  0.0384  -0.0864 639 LYS B N   
2413 C CA  . LYS B 48  ? 0.6389 0.5376 0.5231 0.0382  0.0272  -0.0901 639 LYS B CA  
2414 C C   . LYS B 48  ? 0.6761 0.5862 0.5367 0.0311  0.0243  -0.0841 639 LYS B C   
2415 O O   . LYS B 48  ? 0.6816 0.6001 0.5204 0.0304  0.0286  -0.0929 639 LYS B O   
2416 C CB  . LYS B 48  ? 0.6863 0.5712 0.5700 0.0405  0.0247  -0.1112 639 LYS B CB  
2417 C CG  . LYS B 48  ? 0.7447 0.6118 0.6411 0.0350  0.0116  -0.1089 639 LYS B CG  
2418 C CD  . LYS B 48  ? 0.8590 0.7188 0.7411 0.0297  0.0042  -0.1230 639 LYS B CD  
2419 C CE  . LYS B 48  ? 0.7428 0.5942 0.6320 0.0205  -0.0087 -0.1139 639 LYS B CE  
2420 N NZ  . LYS B 48  ? 0.7861 0.6523 0.6582 0.0136  -0.0122 -0.1039 639 LYS B NZ  
2421 N N   . LEU B 49  ? 0.6262 0.5377 0.4918 0.0258  0.0171  -0.0687 640 LEU B N   
2422 C CA  . LEU B 49  ? 0.6190 0.5398 0.4670 0.0195  0.0120  -0.0613 640 LEU B CA  
2423 C C   . LEU B 49  ? 0.6932 0.6056 0.5348 0.0138  0.0010  -0.0698 640 LEU B C   
2424 O O   . LEU B 49  ? 0.6819 0.5815 0.5391 0.0131  -0.0041 -0.0742 640 LEU B O   
2425 C CB  . LEU B 49  ? 0.5882 0.5153 0.4474 0.0175  0.0094  -0.0428 640 LEU B CB  
2426 C CG  . LEU B 49  ? 0.6333 0.5693 0.4985 0.0219  0.0190  -0.0332 640 LEU B CG  
2427 C CD1 . LEU B 49  ? 0.5965 0.5384 0.4705 0.0191  0.0149  -0.0174 640 LEU B CD1 
2428 C CD2 . LEU B 49  ? 0.6479 0.5945 0.4935 0.0234  0.0279  -0.0366 640 LEU B CD2 
2429 N N   . PRO B 50  ? 0.7026 0.6218 0.5215 0.0091  -0.0035 -0.0724 641 PRO B N   
2430 C CA  . PRO B 50  ? 0.7231 0.6351 0.5362 0.0031  -0.0149 -0.0816 641 PRO B CA  
2431 C C   . PRO B 50  ? 0.7319 0.6390 0.5647 -0.0015 -0.0251 -0.0725 641 PRO B C   
2432 O O   . PRO B 50  ? 0.7175 0.6329 0.5583 -0.0024 -0.0264 -0.0574 641 PRO B O   
2433 C CB  . PRO B 50  ? 0.7648 0.6885 0.5501 -0.0013 -0.0183 -0.0811 641 PRO B CB  
2434 C CG  . PRO B 50  ? 0.8092 0.7449 0.5910 0.0009  -0.0114 -0.0661 641 PRO B CG  
2435 C CD  . PRO B 50  ? 0.7357 0.6693 0.5333 0.0080  0.0005  -0.0661 641 PRO B CD  
2436 N N   . GLY B 51  ? 0.6740 0.5678 0.5161 -0.0043 -0.0313 -0.0825 642 GLY B N   
2437 C CA  . GLY B 51  ? 0.6545 0.5437 0.5156 -0.0103 -0.0406 -0.0760 642 GLY B CA  
2438 C C   . GLY B 51  ? 0.6712 0.5595 0.5552 -0.0085 -0.0367 -0.0632 642 GLY B C   
2439 O O   . GLY B 51  ? 0.6630 0.5532 0.5616 -0.0142 -0.0430 -0.0548 642 GLY B O   
2440 N N   . LYS B 52  ? 0.6126 0.4995 0.5004 -0.0010 -0.0264 -0.0621 643 LYS B N   
2441 C CA  . LYS B 52  ? 0.5797 0.4666 0.4874 0.0011  -0.0224 -0.0501 643 LYS B CA  
2442 C C   . LYS B 52  ? 0.6258 0.4981 0.5447 0.0064  -0.0185 -0.0575 643 LYS B C   
2443 O O   . LYS B 52  ? 0.6487 0.5167 0.5584 0.0118  -0.0138 -0.0709 643 LYS B O   
2444 C CB  . LYS B 52  ? 0.5665 0.4676 0.4703 0.0057  -0.0142 -0.0397 643 LYS B CB  
2445 C CG  . LYS B 52  ? 0.6527 0.5675 0.5475 0.0022  -0.0182 -0.0317 643 LYS B CG  
2446 C CD  . LYS B 52  ? 0.7601 0.6837 0.6697 0.0015  -0.0174 -0.0177 643 LYS B CD  
2447 C CE  . LYS B 52  ? 0.7828 0.7126 0.6931 0.0074  -0.0079 -0.0111 643 LYS B CE  
2448 N NZ  . LYS B 52  ? 0.7043 0.6390 0.6324 0.0066  -0.0069 -0.0005 643 LYS B NZ  
2449 N N   . ARG B 53  ? 0.5812 0.4469 0.5203 0.0049  -0.0205 -0.0489 644 ARG B N   
2450 C CA  . ARG B 53  ? 0.5777 0.4287 0.5309 0.0102  -0.0185 -0.0533 644 ARG B CA  
2451 C C   . ARG B 53  ? 0.6052 0.4636 0.5557 0.0201  -0.0074 -0.0546 644 ARG B C   
2452 O O   . ARG B 53  ? 0.5629 0.4368 0.5088 0.0211  -0.0019 -0.0445 644 ARG B O   
2453 C CB  . ARG B 53  ? 0.5981 0.4445 0.5717 0.0058  -0.0227 -0.0390 644 ARG B CB  
2454 C CG  . ARG B 53  ? 0.6562 0.4951 0.6368 -0.0051 -0.0333 -0.0362 644 ARG B CG  
2455 C CD  . ARG B 53  ? 0.5882 0.4299 0.5850 -0.0107 -0.0353 -0.0190 644 ARG B CD  
2456 N NE  . ARG B 53  ? 0.6349 0.4702 0.6401 -0.0225 -0.0450 -0.0153 644 ARG B NE  
2457 C CZ  . ARG B 53  ? 0.7050 0.5440 0.7227 -0.0307 -0.0480 -0.0005 644 ARG B CZ  
2458 N NH1 . ARG B 53  ? 0.5778 0.4253 0.6007 -0.0280 -0.0428 0.0113  644 ARG B NH1 
2459 N NH2 . ARG B 53  ? 0.4850 0.3195 0.5100 -0.0424 -0.0564 0.0024  644 ARG B NH2 
2460 N N   . GLU B 54  ? 0.5922 0.4398 0.5474 0.0274  -0.0042 -0.0677 645 GLU B N   
2461 C CA  . GLU B 54  ? 0.5885 0.4438 0.5454 0.0371  0.0066  -0.0700 645 GLU B CA  
2462 C C   . GLU B 54  ? 0.6246 0.4835 0.5995 0.0382  0.0076  -0.0531 645 GLU B C   
2463 O O   . GLU B 54  ? 0.6052 0.4540 0.5947 0.0338  -0.0001 -0.0443 645 GLU B O   
2464 C CB  . GLU B 54  ? 0.6310 0.4730 0.5955 0.0451  0.0085  -0.0885 645 GLU B CB  
2465 C CG  . GLU B 54  ? 0.7795 0.6335 0.7426 0.0552  0.0211  -0.0958 645 GLU B CG  
2466 C CD  . GLU B 54  ? 1.0280 0.8696 1.0030 0.0643  0.0230  -0.1153 645 GLU B CD  
2467 O OE1 . GLU B 54  ? 0.8125 0.6397 0.8121 0.0684  0.0180  -0.1125 645 GLU B OE1 
2468 O OE2 . GLU B 54  ? 1.0584 0.9054 1.0185 0.0674  0.0291  -0.1335 645 GLU B OE2 
2469 N N   . ILE B 55  ? 0.5720 0.4461 0.5443 0.0429  0.0166  -0.0478 646 ILE B N   
2470 C CA  . ILE B 55  ? 0.5461 0.4256 0.5337 0.0443  0.0180  -0.0333 646 ILE B CA  
2471 C C   . ILE B 55  ? 0.6037 0.4885 0.5994 0.0545  0.0270  -0.0387 646 ILE B C   
2472 O O   . ILE B 55  ? 0.5956 0.4867 0.5802 0.0590  0.0346  -0.0513 646 ILE B O   
2473 C CB  . ILE B 55  ? 0.5526 0.4478 0.5325 0.0384  0.0189  -0.0190 646 ILE B CB  
2474 C CG1 . ILE B 55  ? 0.5420 0.4512 0.5032 0.0399  0.0265  -0.0224 646 ILE B CG1 
2475 C CG2 . ILE B 55  ? 0.5709 0.4627 0.5494 0.0288  0.0097  -0.0126 646 ILE B CG2 
2476 C CD1 . ILE B 55  ? 0.5583 0.4820 0.5175 0.0370  0.0288  -0.0087 646 ILE B CD1 
2477 N N   . PTR B 56  ? 0.5451 0.4295 0.5600 0.0576  0.0262  -0.0290 647 PTR B N   
2478 C CA  . PTR B 56  ? 0.5591 0.4518 0.5847 0.0669  0.0343  -0.0319 647 PTR B CA  
2479 C C   . PTR B 56  ? 0.5761 0.4890 0.5911 0.0644  0.0414  -0.0227 647 PTR B C   
2480 O O   . PTR B 56  ? 0.5470 0.4640 0.5562 0.0569  0.0376  -0.0104 647 PTR B O   
2481 C CB  . PTR B 56  ? 0.5986 0.4845 0.6492 0.0711  0.0295  -0.0239 647 PTR B CB  
2482 C CG  . PTR B 56  ? 0.6537 0.5184 0.7183 0.0760  0.0232  -0.0350 647 PTR B CG  
2483 C CD1 . PTR B 56  ? 0.6700 0.5176 0.7449 0.0699  0.0109  -0.0253 647 PTR B CD1 
2484 C CD2 . PTR B 56  ? 0.6945 0.5572 0.7623 0.0858  0.0293  -0.0547 647 PTR B CD2 
2485 C CE1 . PTR B 56  ? 0.7221 0.5476 0.8121 0.0741  0.0037  -0.0346 647 PTR B CE1 
2486 C CE2 . PTR B 56  ? 0.7433 0.5845 0.8268 0.0911  0.0225  -0.0661 647 PTR B CE2 
2487 C CZ  . PTR B 56  ? 0.7694 0.5902 0.8649 0.0853  0.0089  -0.0556 647 PTR B CZ  
2488 O OH  . PTR B 56  ? 0.8572 0.6543 0.9687 0.0901  0.0013  -0.0676 647 PTR B OH  
2489 P P   . PTR B 56  ? 0.8794 0.6592 1.0211 0.0941  -0.0096 -0.0573 647 PTR B P   
2490 O O1P . PTR B 56  ? 0.8629 0.6344 1.0038 0.0802  -0.0212 -0.0346 647 PTR B O1P 
2491 O O2P . PTR B 56  ? 0.9186 0.6730 1.0761 0.1012  -0.0160 -0.0760 647 PTR B O2P 
2492 O O3P . PTR B 56  ? 0.8555 0.6514 1.0123 0.1041  -0.0032 -0.0524 647 PTR B O3P 
2493 N N   . VAL B 57  ? 0.5162 0.4422 0.5288 0.0703  0.0518  -0.0294 648 VAL B N   
2494 C CA  . VAL B 57  ? 0.4914 0.4359 0.4952 0.0677  0.0587  -0.0206 648 VAL B CA  
2495 C C   . VAL B 57  ? 0.5568 0.5139 0.5752 0.0751  0.0672  -0.0218 648 VAL B C   
2496 O O   . VAL B 57  ? 0.5415 0.4950 0.5734 0.0834  0.0695  -0.0329 648 VAL B O   
2497 C CB  . VAL B 57  ? 0.5166 0.4685 0.4950 0.0635  0.0633  -0.0260 648 VAL B CB  
2498 C CG1 . VAL B 57  ? 0.5072 0.4521 0.4724 0.0552  0.0546  -0.0204 648 VAL B CG1 
2499 C CG2 . VAL B 57  ? 0.5318 0.4831 0.5031 0.0687  0.0694  -0.0446 648 VAL B CG2 
2500 N N   . ALA B 58  ? 0.5171 0.4897 0.5337 0.0723  0.0718  -0.0114 649 ALA B N   
2501 C CA  . ALA B 58  ? 0.5153 0.5038 0.5431 0.0778  0.0811  -0.0128 649 ALA B CA  
2502 C C   . ALA B 58  ? 0.5754 0.5778 0.5828 0.0743  0.0907  -0.0164 649 ALA B C   
2503 O O   . ALA B 58  ? 0.5468 0.5478 0.5350 0.0668  0.0880  -0.0108 649 ALA B O   
2504 C CB  . ALA B 58  ? 0.4989 0.4948 0.5406 0.0760  0.0787  0.0018  649 ALA B CB  
2505 N N   . ILE B 59  ? 0.5864 0.6024 0.5977 0.0797  0.1015  -0.0262 650 ILE B N   
2506 C CA  . ILE B 59  ? 0.5980 0.6286 0.5886 0.0756  0.1112  -0.0300 650 ILE B CA  
2507 C C   . ILE B 59  ? 0.6626 0.7153 0.6629 0.0762  0.1217  -0.0262 650 ILE B C   
2508 O O   . ILE B 59  ? 0.6759 0.7377 0.6944 0.0844  0.1283  -0.0356 650 ILE B O   
2509 C CB  . ILE B 59  ? 0.6524 0.6804 0.6309 0.0792  0.1156  -0.0493 650 ILE B CB  
2510 C CG1 . ILE B 59  ? 0.6525 0.6580 0.6233 0.0778  0.1042  -0.0533 650 ILE B CG1 
2511 C CG2 . ILE B 59  ? 0.6739 0.7188 0.6272 0.0732  0.1255  -0.0521 650 ILE B CG2 
2512 C CD1 . ILE B 59  ? 0.7364 0.7341 0.7077 0.0842  0.1056  -0.0737 650 ILE B CD1 
2513 N N   . LYS B 60  ? 0.6177 0.6791 0.6072 0.0676  0.1229  -0.0128 651 LYS B N   
2514 C CA  . LYS B 60  ? 0.6111 0.6941 0.6073 0.0658  0.1328  -0.0080 651 LYS B CA  
2515 C C   . LYS B 60  ? 0.7057 0.8023 0.6808 0.0624  0.1437  -0.0162 651 LYS B C   
2516 O O   . LYS B 60  ? 0.7062 0.7962 0.6562 0.0559  0.1407  -0.0145 651 LYS B O   
2517 C CB  . LYS B 60  ? 0.6155 0.6994 0.6101 0.0573  0.1280  0.0100  651 LYS B CB  
2518 C CG  . LYS B 60  ? 0.6592 0.7478 0.6796 0.0599  0.1257  0.0173  651 LYS B CG  
2519 C CD  . LYS B 60  ? 0.6244 0.7166 0.6420 0.0508  0.1228  0.0325  651 LYS B CD  
2520 C CE  . LYS B 60  ? 0.6450 0.7389 0.6860 0.0528  0.1176  0.0393  651 LYS B CE  
2521 N NZ  . LYS B 60  ? 0.6112 0.7067 0.6511 0.0442  0.1136  0.0524  651 LYS B NZ  
2522 N N   . THR B 61  ? 0.7164 0.8331 0.7019 0.0668  0.1562  -0.0256 652 THR B N   
2523 C CA  . THR B 61  ? 0.7452 0.8804 0.7115 0.0631  0.1689  -0.0344 652 THR B CA  
2524 C C   . THR B 61  ? 0.8030 0.9633 0.7738 0.0569  0.1794  -0.0254 652 THR B C   
2525 O O   . THR B 61  ? 0.7831 0.9486 0.7777 0.0586  0.1784  -0.0175 652 THR B O   
2526 C CB  . THR B 61  ? 0.8844 1.0243 0.8579 0.0736  0.1764  -0.0574 652 THR B CB  
2527 O OG1 . THR B 61  ? 0.9026 1.0492 0.9107 0.0837  0.1786  -0.0614 652 THR B OG1 
2528 C CG2 . THR B 61  ? 0.8744 0.9899 0.8380 0.0774  0.1667  -0.0678 652 THR B CG2 
2529 N N   . LEU B 62  ? 0.8085 0.9844 0.7554 0.0484  0.1886  -0.0256 653 LEU B N   
2530 C CA  . LEU B 62  ? 0.8249 1.0262 0.7729 0.0401  0.1994  -0.0165 653 LEU B CA  
2531 C C   . LEU B 62  ? 0.9204 1.1491 0.8709 0.0443  0.2167  -0.0348 653 LEU B C   
2532 O O   . LEU B 62  ? 0.9380 1.1703 0.8647 0.0429  0.2218  -0.0465 653 LEU B O   
2533 C CB  . LEU B 62  ? 0.8323 1.0303 0.7505 0.0253  0.1956  0.0005  653 LEU B CB  
2534 C CG  . LEU B 62  ? 0.8927 1.1138 0.8049 0.0128  0.2050  0.0136  653 LEU B CG  
2535 C CD1 . LEU B 62  ? 0.8708 1.0961 0.8108 0.0119  0.2032  0.0256  653 LEU B CD1 
2536 C CD2 . LEU B 62  ? 0.9213 1.1330 0.8032 -0.0003 0.1979  0.0294  653 LEU B CD2 
2537 N N   . LYS B 63  ? 0.8882 1.1369 0.8693 0.0502  0.2252  -0.0386 654 LYS B N   
2538 C CA  . LYS B 63  ? 0.9140 1.1927 0.9047 0.0555  0.2426  -0.0571 654 LYS B CA  
2539 C C   . LYS B 63  ? 0.9955 1.2967 0.9544 0.0430  0.2555  -0.0576 654 LYS B C   
2540 O O   . LYS B 63  ? 0.9767 1.2798 0.9174 0.0284  0.2537  -0.0377 654 LYS B O   
2541 C CB  . LYS B 63  ? 0.9289 1.2287 0.9567 0.0601  0.2487  -0.0552 654 LYS B CB  
2542 C CG  . LYS B 63  ? 1.1507 1.4370 1.2127 0.0764  0.2406  -0.0642 654 LYS B CG  
2543 C CD  . LYS B 63  ? 1.2937 1.5942 1.3902 0.0783  0.2404  -0.0547 654 LYS B CD  
2544 C CE  . LYS B 63  ? 1.3803 1.6647 1.5088 0.0931  0.2292  -0.0595 654 LYS B CE  
2545 N NZ  . LYS B 63  ? 1.4152 1.6889 1.5567 0.0890  0.2164  -0.0394 654 LYS B NZ  
2546 N N   . ALA B 64  ? 0.9950 1.3117 0.9465 0.0485  0.2676  -0.0805 655 ALA B N   
2547 C CA  . ALA B 64  ? 1.0307 1.3720 0.9501 0.0371  0.2812  -0.0846 655 ALA B CA  
2548 C C   . ALA B 64  ? 1.0992 1.4747 1.0258 0.0267  0.2948  -0.0733 655 ALA B C   
2549 O O   . ALA B 64  ? 1.0745 1.4646 1.0369 0.0338  0.2999  -0.0758 655 ALA B O   
2550 C CB  . ALA B 64  ? 1.0627 1.4160 0.9796 0.0474  0.2922  -0.1151 655 ALA B CB  
2551 N N   . GLY B 65  ? 1.0920 1.4787 0.9851 0.0092  0.2989  -0.0594 656 GLY B N   
2552 C CA  . GLY B 65  ? 1.1058 1.5238 1.0001 -0.0046 0.3109  -0.0454 656 GLY B CA  
2553 C C   . GLY B 65  ? 1.1508 1.5529 1.0543 -0.0134 0.2984  -0.0173 656 GLY B C   
2554 O O   . GLY B 65  ? 1.1474 1.5719 1.0645 -0.0222 0.3060  -0.0056 656 GLY B O   
2555 N N   . TYR B 66  ? 1.0922 1.4563 0.9892 -0.0113 0.2791  -0.0074 657 TYR B N   
2556 C CA  . TYR B 66  ? 1.0683 1.4128 0.9726 -0.0184 0.2652  0.0169  657 TYR B CA  
2557 C C   . TYR B 66  ? 1.1191 1.4721 0.9974 -0.0387 0.2665  0.0388  657 TYR B C   
2558 O O   . TYR B 66  ? 1.1354 1.4984 0.9812 -0.0473 0.2725  0.0376  657 TYR B O   
2559 C CB  . TYR B 66  ? 1.0732 1.3778 0.9731 -0.0113 0.2458  0.0193  657 TYR B CB  
2560 C CG  . TYR B 66  ? 1.1347 1.4250 0.9980 -0.0150 0.2403  0.0170  657 TYR B CG  
2561 C CD1 . TYR B 66  ? 1.1795 1.4616 1.0152 -0.0297 0.2329  0.0369  657 TYR B CD1 
2562 C CD2 . TYR B 66  ? 1.1597 1.4425 1.0177 -0.0035 0.2404  -0.0045 657 TYR B CD2 
2563 C CE1 . TYR B 66  ? 1.2309 1.5007 1.0338 -0.0332 0.2264  0.0357  657 TYR B CE1 
2564 C CE2 . TYR B 66  ? 1.1958 1.4649 1.0210 -0.0072 0.2338  -0.0066 657 TYR B CE2 
2565 C CZ  . TYR B 66  ? 1.3363 1.5998 1.1338 -0.0220 0.2267  0.0137  657 TYR B CZ  
2566 O OH  . TYR B 66  ? 1.3798 1.6311 1.1455 -0.0258 0.2191  0.0123  657 TYR B OH  
2567 N N   . SER B 67  ? 1.0551 1.4033 0.9475 -0.0470 0.2601  0.0592  658 SER B N   
2568 C CA  . SER B 67  ? 1.0686 1.4192 0.9406 -0.0664 0.2580  0.0829  658 SER B CA  
2569 C C   . SER B 67  ? 1.1255 1.4395 0.9764 -0.0685 0.2388  0.0947  658 SER B C   
2570 O O   . SER B 67  ? 1.1072 1.3966 0.9665 -0.0554 0.2278  0.0861  658 SER B O   
2571 C CB  . SER B 67  ? 1.0959 1.4545 0.9949 -0.0737 0.2580  0.0980  658 SER B CB  
2572 O OG  . SER B 67  ? 1.1386 1.4684 1.0580 -0.0665 0.2418  0.1035  658 SER B OG  
2573 N N   . GLU B 68  ? 1.0955 1.4066 0.9205 -0.0850 0.2343  0.1147  659 GLU B N   
2574 C CA  . GLU B 68  ? 1.0926 1.3705 0.8998 -0.0873 0.2154  0.1272  659 GLU B CA  
2575 C C   . GLU B 68  ? 1.0906 1.3420 0.9235 -0.0823 0.2003  0.1358  659 GLU B C   
2576 O O   . GLU B 68  ? 1.0804 1.3043 0.9103 -0.0750 0.1860  0.1346  659 GLU B O   
2577 C CB  . GLU B 68  ? 1.1454 1.4268 0.9207 -0.1062 0.2131  0.1478  659 GLU B CB  
2578 C CG  . GLU B 68  ? 1.3265 1.6190 1.0662 -0.1086 0.2190  0.1385  659 GLU B CG  
2579 C CD  . GLU B 68  ? 1.5488 1.8198 1.2813 -0.0942 0.2097  0.1220  659 GLU B CD  
2580 O OE1 . GLU B 68  ? 1.4450 1.6858 1.1774 -0.0918 0.1916  0.1312  659 GLU B OE1 
2581 O OE2 . GLU B 68  ? 1.4532 1.7382 1.1830 -0.0851 0.2207  0.0990  659 GLU B OE2 
2582 N N   . LYS B 69  ? 1.0178 1.2794 0.8769 -0.0858 0.2042  0.1425  660 LYS B N   
2583 C CA  . LYS B 69  ? 0.9819 1.2236 0.8675 -0.0819 0.1920  0.1489  660 LYS B CA  
2584 C C   . LYS B 69  ? 0.9921 1.2240 0.8963 -0.0635 0.1892  0.1301  660 LYS B C   
2585 O O   . LYS B 69  ? 0.9706 1.1768 0.8815 -0.0578 0.1750  0.1320  660 LYS B O   
2586 C CB  . LYS B 69  ? 1.0039 1.2643 0.9123 -0.0910 0.1988  0.1584  660 LYS B CB  
2587 C CG  . LYS B 69  ? 1.2055 1.4461 1.1386 -0.0905 0.1855  0.1672  660 LYS B CG  
2588 C CD  . LYS B 69  ? 1.4021 1.6134 1.3230 -0.0986 0.1685  0.1846  660 LYS B CD  
2589 C CE  . LYS B 69  ? 1.5943 1.8115 1.5095 -0.1177 0.1688  0.2059  660 LYS B CE  
2590 N NZ  . LYS B 69  ? 1.7188 1.9050 1.6260 -0.1236 0.1506  0.2217  660 LYS B NZ  
2591 N N   . GLN B 70  ? 0.9377 1.1903 0.8506 -0.0543 0.2025  0.1120  661 GLN B N   
2592 C CA  . GLN B 70  ? 0.9069 1.1512 0.8378 -0.0371 0.2001  0.0945  661 GLN B CA  
2593 C C   . GLN B 70  ? 0.9315 1.1500 0.8434 -0.0308 0.1890  0.0891  661 GLN B C   
2594 O O   . GLN B 70  ? 0.8953 1.0933 0.8199 -0.0221 0.1780  0.0865  661 GLN B O   
2595 C CB  . GLN B 70  ? 0.9230 1.1946 0.8651 -0.0292 0.2164  0.0761  661 GLN B CB  
2596 C CG  . GLN B 70  ? 0.9661 1.2581 0.9414 -0.0280 0.2232  0.0765  661 GLN B CG  
2597 C CD  . GLN B 70  ? 1.0248 1.3484 1.0110 -0.0218 0.2408  0.0592  661 GLN B CD  
2598 O OE1 . GLN B 70  ? 0.9269 1.2681 0.8922 -0.0266 0.2526  0.0533  661 GLN B OE1 
2599 N NE2 . GLN B 70  ? 0.8278 1.1606 0.8477 -0.0111 0.2427  0.0506  661 GLN B NE2 
2600 N N   . ARG B 71  ? 0.8966 1.1173 0.7774 -0.0366 0.1916  0.0887  662 ARG B N   
2601 C CA  . ARG B 71  ? 0.8944 1.0937 0.7543 -0.0328 0.1813  0.0845  662 ARG B CA  
2602 C C   . ARG B 71  ? 0.9355 1.1075 0.7958 -0.0357 0.1636  0.0996  662 ARG B C   
2603 O O   . ARG B 71  ? 0.9195 1.0718 0.7848 -0.0268 0.1535  0.0936  662 ARG B O   
2604 C CB  . ARG B 71  ? 0.9031 1.1140 0.7288 -0.0413 0.1875  0.0837  662 ARG B CB  
2605 C CG  . ARG B 71  ? 0.9689 1.1613 0.7740 -0.0366 0.1780  0.0759  662 ARG B CG  
2606 C CD  . ARG B 71  ? 1.0104 1.2107 0.7792 -0.0482 0.1794  0.0817  662 ARG B CD  
2607 N NE  . ARG B 71  ? 1.1098 1.2991 0.8604 -0.0424 0.1739  0.0681  662 ARG B NE  
2608 C CZ  . ARG B 71  ? 1.2764 1.4436 1.0134 -0.0439 0.1580  0.0756  662 ARG B CZ  
2609 N NH1 . ARG B 71  ? 1.0788 1.2311 0.8194 -0.0498 0.1456  0.0959  662 ARG B NH1 
2610 N NH2 . ARG B 71  ? 1.0881 1.2482 0.8093 -0.0392 0.1539  0.0620  662 ARG B NH2 
2611 N N   . ARG B 72  ? 0.9037 1.0755 0.7607 -0.0481 0.1601  0.1188  663 ARG B N   
2612 C CA  . ARG B 72  ? 0.8881 1.0361 0.7480 -0.0517 0.1440  0.1335  663 ARG B CA  
2613 C C   . ARG B 72  ? 0.8713 1.0079 0.7602 -0.0421 0.1379  0.1286  663 ARG B C   
2614 O O   . ARG B 72  ? 0.8327 0.9481 0.7235 -0.0371 0.1252  0.1285  663 ARG B O   
2615 C CB  . ARG B 72  ? 0.9354 1.0885 0.7922 -0.0670 0.1436  0.1538  663 ARG B CB  
2616 C CG  . ARG B 72  ? 1.1660 1.2996 1.0044 -0.0750 0.1292  0.1699  663 ARG B CG  
2617 C CD  . ARG B 72  ? 1.3277 1.4650 1.1644 -0.0908 0.1282  0.1910  663 ARG B CD  
2618 N N   . ASP B 73  ? 0.8022 0.9548 0.7139 -0.0399 0.1469  0.1245  664 ASP B N   
2619 C CA  . ASP B 73  ? 0.7748 0.9201 0.7135 -0.0319 0.1417  0.1203  664 ASP B CA  
2620 C C   . ASP B 73  ? 0.7572 0.8931 0.6991 -0.0186 0.1388  0.1052  664 ASP B C   
2621 O O   . ASP B 73  ? 0.7316 0.8511 0.6833 -0.0139 0.1283  0.1051  664 ASP B O   
2622 C CB  . ASP B 73  ? 0.8004 0.9674 0.7621 -0.0331 0.1517  0.1197  664 ASP B CB  
2623 C CG  . ASP B 73  ? 0.9889 1.1641 0.9527 -0.0473 0.1532  0.1358  664 ASP B CG  
2624 O OD1 . ASP B 73  ? 0.9964 1.1552 0.9485 -0.0554 0.1433  0.1487  664 ASP B OD1 
2625 O OD2 . ASP B 73  ? 1.0815 1.2795 1.0600 -0.0505 0.1637  0.1356  664 ASP B OD2 
2626 N N   . PHE B 74  ? 0.6895 0.8359 0.6228 -0.0132 0.1480  0.0923  665 PHE B N   
2627 C CA  . PHE B 74  ? 0.6610 0.7983 0.5967 -0.0013 0.1457  0.0774  665 PHE B CA  
2628 C C   . PHE B 74  ? 0.7303 0.8444 0.6515 -0.0011 0.1325  0.0800  665 PHE B C   
2629 O O   . PHE B 74  ? 0.7126 0.8129 0.6453 0.0055  0.1242  0.0767  665 PHE B O   
2630 C CB  . PHE B 74  ? 0.6826 0.8353 0.6085 0.0025  0.1581  0.0630  665 PHE B CB  
2631 C CG  . PHE B 74  ? 0.6823 0.8244 0.6095 0.0140  0.1556  0.0469  665 PHE B CG  
2632 C CD1 . PHE B 74  ? 0.6768 0.8176 0.6298 0.0244  0.1552  0.0387  665 PHE B CD1 
2633 C CD2 . PHE B 74  ? 0.7047 0.8379 0.6078 0.0137  0.1528  0.0406  665 PHE B CD2 
2634 C CE1 . PHE B 74  ? 0.6757 0.8048 0.6309 0.0341  0.1519  0.0251  665 PHE B CE1 
2635 C CE2 . PHE B 74  ? 0.7264 0.8488 0.6319 0.0234  0.1499  0.0257  665 PHE B CE2 
2636 C CZ  . PHE B 74  ? 0.6840 0.8039 0.6158 0.0334  0.1496  0.0182  665 PHE B CZ  
2637 N N   . LEU B 75  ? 0.7014 0.8127 0.5980 -0.0091 0.1303  0.0870  666 LEU B N   
2638 C CA  . LEU B 75  ? 0.7030 0.7951 0.5853 -0.0093 0.1178  0.0896  666 LEU B CA  
2639 C C   . LEU B 75  ? 0.7464 0.8234 0.6392 -0.0115 0.1054  0.1011  666 LEU B C   
2640 O O   . LEU B 75  ? 0.7501 0.8117 0.6397 -0.0085 0.0949  0.0999  666 LEU B O   
2641 C CB  . LEU B 75  ? 0.7303 0.8259 0.5830 -0.0170 0.1186  0.0934  666 LEU B CB  
2642 C CG  . LEU B 75  ? 0.8053 0.9128 0.6435 -0.0137 0.1286  0.0778  666 LEU B CG  
2643 C CD1 . LEU B 75  ? 0.8343 0.9473 0.6410 -0.0232 0.1290  0.0832  666 LEU B CD1 
2644 C CD2 . LEU B 75  ? 0.8002 0.8947 0.6432 -0.0031 0.1235  0.0630  666 LEU B CD2 
2645 N N   . SER B 76  ? 0.6924 0.7740 0.5986 -0.0168 0.1065  0.1111  667 SER B N   
2646 C CA  . SER B 76  ? 0.6768 0.7439 0.5947 -0.0184 0.0948  0.1199  667 SER B CA  
2647 C C   . SER B 76  ? 0.6743 0.7337 0.6090 -0.0090 0.0901  0.1103  667 SER B C   
2648 O O   . SER B 76  ? 0.6644 0.7101 0.6029 -0.0078 0.0795  0.1124  667 SER B O   
2649 C CB  . SER B 76  ? 0.7201 0.7935 0.6497 -0.0265 0.0968  0.1312  667 SER B CB  
2650 O OG  . SER B 76  ? 0.8161 0.8992 0.7678 -0.0227 0.1022  0.1259  667 SER B OG  
2651 N N   . GLU B 77  ? 0.6126 0.6813 0.5572 -0.0022 0.0978  0.0998  668 GLU B N   
2652 C CA  . GLU B 77  ? 0.5872 0.6491 0.5460 0.0057  0.0931  0.0922  668 GLU B CA  
2653 C C   . GLU B 77  ? 0.6330 0.6818 0.5795 0.0091  0.0860  0.0869  668 GLU B C   
2654 O O   . GLU B 77  ? 0.6246 0.6636 0.5780 0.0111  0.0776  0.0869  668 GLU B O   
2655 C CB  . GLU B 77  ? 0.5926 0.6660 0.5654 0.0122  0.1013  0.0835  668 GLU B CB  
2656 C CG  . GLU B 77  ? 0.6088 0.6754 0.5978 0.0178  0.0948  0.0802  668 GLU B CG  
2657 C CD  . GLU B 77  ? 0.6379 0.7089 0.6398 0.0259  0.0981  0.0714  668 GLU B CD  
2658 O OE1 . GLU B 77  ? 0.5977 0.6782 0.5993 0.0291  0.1069  0.0650  668 GLU B OE1 
2659 O OE2 . GLU B 77  ? 0.5733 0.6389 0.5868 0.0288  0.0918  0.0712  668 GLU B OE2 
2660 N N   . ALA B 78  ? 0.5795 0.6296 0.5078 0.0091  0.0895  0.0822  669 ALA B N   
2661 C CA  . ALA B 78  ? 0.5701 0.6091 0.4854 0.0112  0.0826  0.0771  669 ALA B CA  
2662 C C   . ALA B 78  ? 0.6239 0.6521 0.5335 0.0068  0.0713  0.0864  669 ALA B C   
2663 O O   . ALA B 78  ? 0.5954 0.6140 0.5067 0.0096  0.0630  0.0833  669 ALA B O   
2664 C CB  . ALA B 78  ? 0.6002 0.6450 0.4955 0.0104  0.0889  0.0707  669 ALA B CB  
2665 N N   . SER B 79  ? 0.5861 0.6162 0.4908 -0.0003 0.0706  0.0981  670 SER B N   
2666 C CA  . SER B 79  ? 0.5818 0.6005 0.4846 -0.0036 0.0588  0.1072  670 SER B CA  
2667 C C   . SER B 79  ? 0.6358 0.6477 0.5598 0.0000  0.0521  0.1061  670 SER B C   
2668 O O   . SER B 79  ? 0.6315 0.6342 0.5570 0.0018  0.0423  0.1058  670 SER B O   
2669 C CB  . SER B 79  ? 0.6348 0.6556 0.5303 -0.0124 0.0588  0.1209  670 SER B CB  
2670 O OG  . SER B 79  ? 0.8205 0.8517 0.6960 -0.0165 0.0669  0.1211  670 SER B OG  
2671 N N   . ILE B 80  ? 0.5821 0.6002 0.5224 0.0009  0.0575  0.1051  671 ILE B N   
2672 C CA  . ILE B 80  ? 0.5663 0.5809 0.5253 0.0036  0.0524  0.1028  671 ILE B CA  
2673 C C   . ILE B 80  ? 0.5698 0.5818 0.5308 0.0096  0.0500  0.0932  671 ILE B C   
2674 O O   . ILE B 80  ? 0.5757 0.5815 0.5414 0.0110  0.0421  0.0917  671 ILE B O   
2675 C CB  . ILE B 80  ? 0.6036 0.6272 0.5778 0.0023  0.0583  0.1041  671 ILE B CB  
2676 C CG1 . ILE B 80  ? 0.6292 0.6536 0.6039 -0.0052 0.0585  0.1148  671 ILE B CG1 
2677 C CG2 . ILE B 80  ? 0.5839 0.6063 0.5747 0.0052  0.0539  0.0996  671 ILE B CG2 
2678 C CD1 . ILE B 80  ? 0.8189 0.8560 0.8052 -0.0079 0.0666  0.1166  671 ILE B CD1 
2679 N N   . MET B 81  ? 0.5130 0.5299 0.4710 0.0130  0.0566  0.0867  672 MET B N   
2680 C CA  . MET B 81  ? 0.4973 0.5109 0.4574 0.0176  0.0545  0.0784  672 MET B CA  
2681 C C   . MET B 81  ? 0.5525 0.5582 0.5025 0.0175  0.0470  0.0767  672 MET B C   
2682 O O   . MET B 81  ? 0.5292 0.5316 0.4854 0.0193  0.0418  0.0728  672 MET B O   
2683 C CB  . MET B 81  ? 0.5257 0.5438 0.4828 0.0210  0.0624  0.0719  672 MET B CB  
2684 C CG  . MET B 81  ? 0.5592 0.5864 0.5301 0.0226  0.0690  0.0723  672 MET B CG  
2685 S SD  . MET B 81  ? 0.6058 0.6375 0.5779 0.0287  0.0771  0.0626  672 MET B SD  
2686 C CE  . MET B 81  ? 0.5355 0.5550 0.5090 0.0320  0.0693  0.0567  672 MET B CE  
2687 N N   . GLY B 82  ? 0.5312 0.5351 0.4654 0.0148  0.0462  0.0799  673 GLY B N   
2688 C CA  . GLY B 82  ? 0.5398 0.5371 0.4633 0.0142  0.0381  0.0792  673 GLY B CA  
2689 C C   . GLY B 82  ? 0.5909 0.5835 0.5240 0.0139  0.0284  0.0831  673 GLY B C   
2690 O O   . GLY B 82  ? 0.6086 0.5972 0.5385 0.0145  0.0208  0.0812  673 GLY B O   
2691 N N   . GLN B 83  ? 0.5531 0.5466 0.4990 0.0130  0.0283  0.0878  674 GLN B N   
2692 C CA  . GLN B 83  ? 0.5575 0.5470 0.5157 0.0135  0.0195  0.0895  674 GLN B CA  
2693 C C   . GLN B 83  ? 0.5952 0.5885 0.5677 0.0166  0.0191  0.0814  674 GLN B C   
2694 O O   . GLN B 83  ? 0.6043 0.5969 0.5875 0.0179  0.0126  0.0795  674 GLN B O   
2695 C CB  . GLN B 83  ? 0.5799 0.5679 0.5457 0.0106  0.0193  0.0969  674 GLN B CB  
2696 C CG  . GLN B 83  ? 0.8323 0.8150 0.7852 0.0061  0.0160  0.1075  674 GLN B CG  
2697 C CD  . GLN B 83  ? 1.1954 1.1759 1.1566 0.0020  0.0158  0.1156  674 GLN B CD  
2698 O OE1 . GLN B 83  ? 1.1900 1.1652 1.1668 0.0031  0.0093  0.1155  674 GLN B OE1 
2699 N NE2 . GLN B 83  ? 1.0979 1.0831 1.0494 -0.0032 0.0231  0.1223  674 GLN B NE2 
2700 N N   . PHE B 84  ? 0.4942 0.4923 0.4674 0.0177  0.0259  0.0769  675 PHE B N   
2701 C CA  . PHE B 84  ? 0.4674 0.4701 0.4525 0.0189  0.0258  0.0715  675 PHE B CA  
2702 C C   . PHE B 84  ? 0.4998 0.5021 0.4815 0.0198  0.0244  0.0662  675 PHE B C   
2703 O O   . PHE B 84  ? 0.5082 0.5069 0.4790 0.0203  0.0264  0.0649  675 PHE B O   
2704 C CB  . PHE B 84  ? 0.4728 0.4811 0.4649 0.0187  0.0323  0.0722  675 PHE B CB  
2705 C CG  . PHE B 84  ? 0.4762 0.4861 0.4734 0.0168  0.0340  0.0772  675 PHE B CG  
2706 C CD1 . PHE B 84  ? 0.4831 0.4898 0.4858 0.0156  0.0283  0.0791  675 PHE B CD1 
2707 C CD2 . PHE B 84  ? 0.4865 0.5014 0.4857 0.0163  0.0407  0.0795  675 PHE B CD2 
2708 C CE1 . PHE B 84  ? 0.4919 0.4985 0.5006 0.0130  0.0290  0.0837  675 PHE B CE1 
2709 C CE2 . PHE B 84  ? 0.5168 0.5343 0.5226 0.0134  0.0419  0.0841  675 PHE B CE2 
2710 C CZ  . PHE B 84  ? 0.4956 0.5080 0.5055 0.0114  0.0359  0.0864  675 PHE B CZ  
2711 N N   . ASP B 85  ? 0.4253 0.4318 0.4166 0.0195  0.0208  0.0626  676 ASP B N   
2712 C CA  . ASP B 85  ? 0.4228 0.4297 0.4131 0.0187  0.0191  0.0584  676 ASP B CA  
2713 C C   . ASP B 85  ? 0.4542 0.4697 0.4562 0.0169  0.0196  0.0564  676 ASP B C   
2714 O O   . ASP B 85  ? 0.4249 0.4467 0.4341 0.0157  0.0158  0.0533  676 ASP B O   
2715 C CB  . ASP B 85  ? 0.4483 0.4529 0.4347 0.0187  0.0122  0.0564  676 ASP B CB  
2716 C CG  . ASP B 85  ? 0.5412 0.5441 0.5237 0.0171  0.0104  0.0524  676 ASP B CG  
2717 O OD1 . ASP B 85  ? 0.5555 0.5566 0.5374 0.0164  0.0145  0.0515  676 ASP B OD1 
2718 O OD2 . ASP B 85  ? 0.6295 0.6319 0.6100 0.0165  0.0043  0.0504  676 ASP B OD2 
2719 N N   . HIS B 86  ? 0.4078 0.4253 0.4122 0.0163  0.0242  0.0584  677 HIS B N   
2720 C CA  . HIS B 86  ? 0.3670 0.3936 0.3801 0.0134  0.0248  0.0582  677 HIS B CA  
2721 C C   . HIS B 86  ? 0.4057 0.4298 0.4180 0.0125  0.0267  0.0607  677 HIS B C   
2722 O O   . HIS B 86  ? 0.4004 0.4180 0.4092 0.0154  0.0295  0.0622  677 HIS B O   
2723 C CB  . HIS B 86  ? 0.3457 0.3785 0.3653 0.0134  0.0265  0.0591  677 HIS B CB  
2724 C CG  . HIS B 86  ? 0.3661 0.4109 0.3929 0.0097  0.0263  0.0575  677 HIS B CG  
2725 N ND1 . HIS B 86  ? 0.3751 0.4239 0.4030 0.0072  0.0281  0.0612  677 HIS B ND1 
2726 C CD2 . HIS B 86  ? 0.3852 0.4398 0.4181 0.0079  0.0245  0.0522  677 HIS B CD2 
2727 C CE1 . HIS B 86  ? 0.3648 0.4259 0.3969 0.0030  0.0274  0.0590  677 HIS B CE1 
2728 N NE2 . HIS B 86  ? 0.3772 0.4430 0.4127 0.0034  0.0259  0.0526  677 HIS B NE2 
2729 N N   . ARG B 87  ? 0.3759 0.4058 0.3924 0.0082  0.0251  0.0614  678 ARG B N   
2730 C CA  . ARG B 87  ? 0.3853 0.4121 0.4032 0.0062  0.0248  0.0654  678 ARG B CA  
2731 C C   . ARG B 87  ? 0.4245 0.4516 0.4460 0.0087  0.0275  0.0697  678 ARG B C   
2732 O O   . ARG B 87  ? 0.4091 0.4291 0.4321 0.0105  0.0273  0.0721  678 ARG B O   
2733 C CB  . ARG B 87  ? 0.3743 0.4114 0.3961 -0.0009 0.0224  0.0673  678 ARG B CB  
2734 C CG  . ARG B 87  ? 0.5141 0.5489 0.5383 -0.0047 0.0205  0.0742  678 ARG B CG  
2735 C CD  . ARG B 87  ? 0.7347 0.7817 0.7607 -0.0138 0.0184  0.0776  678 ARG B CD  
2736 N NE  . ARG B 87  ? 1.0222 1.0739 1.0479 -0.0171 0.0175  0.0726  678 ARG B NE  
2737 C CZ  . ARG B 87  ? 1.2116 1.2552 1.2367 -0.0197 0.0144  0.0727  678 ARG B CZ  
2738 N NH1 . ARG B 87  ? 1.0838 1.1124 1.1085 -0.0192 0.0118  0.0770  678 ARG B NH1 
2739 N NH2 . ARG B 87  ? 0.9760 1.0268 1.0026 -0.0226 0.0134  0.0678  678 ARG B NH2 
2740 N N   . ASN B 88  ? 0.3946 0.4304 0.4192 0.0086  0.0292  0.0701  679 ASN B N   
2741 C CA  . ASN B 88  ? 0.3832 0.4220 0.4129 0.0100  0.0310  0.0742  679 ASN B CA  
2742 C C   . ASN B 88  ? 0.3877 0.4237 0.4170 0.0145  0.0349  0.0732  679 ASN B C   
2743 O O   . ASN B 88  ? 0.3582 0.3999 0.3931 0.0149  0.0366  0.0757  679 ASN B O   
2744 C CB  . ASN B 88  ? 0.3829 0.4348 0.4166 0.0049  0.0295  0.0760  679 ASN B CB  
2745 C CG  . ASN B 88  ? 0.4943 0.5509 0.5271 -0.0011 0.0263  0.0787  679 ASN B CG  
2746 O OD1 . ASN B 88  ? 0.3953 0.4592 0.4265 -0.0050 0.0257  0.0749  679 ASN B OD1 
2747 N ND2 . ASN B 88  ? 0.3344 0.3870 0.3694 -0.0019 0.0239  0.0854  679 ASN B ND2 
2748 N N   . ILE B 89  ? 0.3687 0.3968 0.3910 0.0172  0.0362  0.0701  680 ILE B N   
2749 C CA  . ILE B 89  ? 0.3649 0.3903 0.3841 0.0203  0.0402  0.0699  680 ILE B CA  
2750 C C   . ILE B 89  ? 0.4523 0.4692 0.4651 0.0237  0.0420  0.0672  680 ILE B C   
2751 O O   . ILE B 89  ? 0.4299 0.4410 0.4368 0.0230  0.0390  0.0642  680 ILE B O   
2752 C CB  . ILE B 89  ? 0.4018 0.4269 0.4172 0.0192  0.0394  0.0693  680 ILE B CB  
2753 C CG1 . ILE B 89  ? 0.3956 0.4286 0.4196 0.0165  0.0381  0.0703  680 ILE B CG1 
2754 C CG2 . ILE B 89  ? 0.4003 0.4222 0.4095 0.0211  0.0439  0.0709  680 ILE B CG2 
2755 C CD1 . ILE B 89  ? 0.5185 0.5502 0.5425 0.0156  0.0350  0.0684  680 ILE B CD1 
2756 N N   . ILE B 90  ? 0.4538 0.4714 0.4695 0.0272  0.0467  0.0672  681 ILE B N   
2757 C CA  . ILE B 90  ? 0.4765 0.4873 0.4876 0.0313  0.0494  0.0623  681 ILE B CA  
2758 C C   . ILE B 90  ? 0.4852 0.4908 0.4813 0.0304  0.0493  0.0587  681 ILE B C   
2759 O O   . ILE B 90  ? 0.4653 0.4740 0.4555 0.0287  0.0508  0.0610  681 ILE B O   
2760 C CB  . ILE B 90  ? 0.5372 0.5536 0.5561 0.0357  0.0558  0.0619  681 ILE B CB  
2761 C CG1 . ILE B 90  ? 0.5847 0.5945 0.6052 0.0410  0.0573  0.0554  681 ILE B CG1 
2762 C CG2 . ILE B 90  ? 0.5460 0.5695 0.5602 0.0350  0.0618  0.0629  681 ILE B CG2 
2763 C CD1 . ILE B 90  ? 0.7246 0.7309 0.7575 0.0420  0.0522  0.0580  681 ILE B CD1 
2764 N N   . ARG B 91  ? 0.4423 0.4398 0.4333 0.0306  0.0459  0.0541  682 ARG B N   
2765 C CA  . ARG B 91  ? 0.4740 0.4665 0.4512 0.0291  0.0436  0.0505  682 ARG B CA  
2766 C C   . ARG B 91  ? 0.5669 0.5587 0.5327 0.0316  0.0492  0.0457  682 ARG B C   
2767 O O   . ARG B 91  ? 0.5858 0.5762 0.5546 0.0356  0.0534  0.0402  682 ARG B O   
2768 C CB  . ARG B 91  ? 0.5242 0.5090 0.5019 0.0276  0.0376  0.0469  682 ARG B CB  
2769 C CG  . ARG B 91  ? 0.6157 0.5956 0.5812 0.0257  0.0333  0.0426  682 ARG B CG  
2770 C CD  . ARG B 91  ? 0.6308 0.6060 0.6009 0.0224  0.0268  0.0410  682 ARG B CD  
2771 N NE  . ARG B 91  ? 0.7496 0.7170 0.7263 0.0237  0.0268  0.0381  682 ARG B NE  
2772 C CZ  . ARG B 91  ? 0.9331 0.9002 0.9216 0.0215  0.0244  0.0427  682 ARG B CZ  
2773 N NH1 . ARG B 91  ? 0.6582 0.6347 0.6523 0.0176  0.0229  0.0490  682 ARG B NH1 
2774 N NH2 . ARG B 91  ? 0.7591 0.7167 0.7542 0.0229  0.0231  0.0408  682 ARG B NH2 
2775 N N   . LEU B 92  ? 0.4976 0.4908 0.4505 0.0291  0.0487  0.0474  683 LEU B N   
2776 C CA  . LEU B 92  ? 0.4954 0.4896 0.4334 0.0297  0.0535  0.0432  683 LEU B CA  
2777 C C   . LEU B 92  ? 0.5468 0.5327 0.4743 0.0293  0.0485  0.0355  683 LEU B C   
2778 O O   . LEU B 92  ? 0.5438 0.5265 0.4673 0.0262  0.0409  0.0377  683 LEU B O   
2779 C CB  . LEU B 92  ? 0.4929 0.4915 0.4205 0.0257  0.0536  0.0505  683 LEU B CB  
2780 C CG  . LEU B 92  ? 0.5706 0.5735 0.4802 0.0244  0.0594  0.0479  683 LEU B CG  
2781 C CD1 . LEU B 92  ? 0.5545 0.5667 0.4700 0.0272  0.0705  0.0448  683 LEU B CD1 
2782 C CD2 . LEU B 92  ? 0.5910 0.5957 0.4889 0.0188  0.0562  0.0579  683 LEU B CD2 
2783 N N   . GLU B 93  ? 0.5129 0.4957 0.4382 0.0327  0.0524  0.0258  684 GLU B N   
2784 C CA  . GLU B 93  ? 0.5080 0.4824 0.4240 0.0322  0.0478  0.0167  684 GLU B CA  
2785 C C   . GLU B 93  ? 0.5864 0.5643 0.4803 0.0301  0.0499  0.0125  684 GLU B C   
2786 O O   . GLU B 93  ? 0.5920 0.5655 0.4740 0.0269  0.0432  0.0097  684 GLU B O   
2787 C CB  . GLU B 93  ? 0.5243 0.4916 0.4509 0.0370  0.0497  0.0071  684 GLU B CB  
2788 C CG  . GLU B 93  ? 0.5152 0.4784 0.4617 0.0377  0.0460  0.0128  684 GLU B CG  
2789 C CD  . GLU B 93  ? 0.6767 0.6339 0.6261 0.0327  0.0365  0.0166  684 GLU B CD  
2790 O OE1 . GLU B 93  ? 0.6489 0.6049 0.5866 0.0289  0.0317  0.0150  684 GLU B OE1 
2791 O OE2 . GLU B 93  ? 0.6234 0.5788 0.5874 0.0321  0.0338  0.0216  684 GLU B OE2 
2792 N N   . GLY B 94  ? 0.5608 0.5483 0.4494 0.0311  0.0592  0.0127  685 GLY B N   
2793 C CA  . GLY B 94  ? 0.5845 0.5785 0.4505 0.0280  0.0628  0.0100  685 GLY B CA  
2794 C C   . GLY B 94  ? 0.6392 0.6468 0.5034 0.0278  0.0738  0.0133  685 GLY B C   
2795 O O   . GLY B 94  ? 0.5894 0.6012 0.4715 0.0315  0.0793  0.0152  685 GLY B O   
2796 N N   . VAL B 95  ? 0.6394 0.6549 0.4815 0.0225  0.0765  0.0154  686 VAL B N   
2797 C CA  . VAL B 95  ? 0.6554 0.6863 0.4919 0.0204  0.0878  0.0181  686 VAL B CA  
2798 C C   . VAL B 95  ? 0.7190 0.7579 0.5302 0.0175  0.0930  0.0083  686 VAL B C   
2799 O O   . VAL B 95  ? 0.7148 0.7470 0.5091 0.0145  0.0850  0.0056  686 VAL B O   
2800 C CB  . VAL B 95  ? 0.7192 0.7548 0.5554 0.0140  0.0864  0.0360  686 VAL B CB  
2801 C CG1 . VAL B 95  ? 0.6973 0.7282 0.5588 0.0169  0.0834  0.0433  686 VAL B CG1 
2802 C CG2 . VAL B 95  ? 0.7332 0.7632 0.5506 0.0072  0.0759  0.0455  686 VAL B CG2 
2803 N N   . VAL B 96  ? 0.6977 0.7524 0.5069 0.0183  0.1065  0.0021  687 VAL B N   
2804 C CA  . VAL B 96  ? 0.7284 0.7959 0.5123 0.0146  0.1142  -0.0074 687 VAL B CA  
2805 C C   . VAL B 96  ? 0.8262 0.9114 0.6017 0.0067  0.1224  0.0058  687 VAL B C   
2806 O O   . VAL B 96  ? 0.8067 0.9022 0.6002 0.0092  0.1315  0.0074  687 VAL B O   
2807 C CB  . VAL B 96  ? 0.7720 0.8443 0.5618 0.0229  0.1237  -0.0303 687 VAL B CB  
2808 C CG1 . VAL B 96  ? 0.7983 0.8887 0.5613 0.0182  0.1340  -0.0407 687 VAL B CG1 
2809 C CG2 . VAL B 96  ? 0.7560 0.8082 0.5530 0.0287  0.1136  -0.0415 687 VAL B CG2 
2810 N N   . THR B 97  ? 0.8361 0.9230 0.5869 -0.0034 0.1169  0.0180  688 THR B N   
2811 C CA  . THR B 97  ? 0.8513 0.9529 0.5922 -0.0131 0.1227  0.0336  688 THR B CA  
2812 C C   . THR B 97  ? 0.9702 1.0854 0.6759 -0.0224 0.1265  0.0325  688 THR B C   
2813 O O   . THR B 97  ? 0.9732 1.1076 0.6687 -0.0300 0.1370  0.0386  688 THR B O   
2814 C CB  . THR B 97  ? 0.8533 0.9426 0.6019 -0.0179 0.1106  0.0555  688 THR B CB  
2815 O OG1 . THR B 97  ? 0.8754 0.9537 0.6045 -0.0230 0.0968  0.0631  688 THR B OG1 
2816 C CG2 . THR B 97  ? 0.7759 0.8523 0.5559 -0.0097 0.1058  0.0560  688 THR B CG2 
2817 N N   . LYS B 98  ? 0.9731 1.0792 0.6600 -0.0228 0.1173  0.0255  689 LYS B N   
2818 C CA  . LYS B 98  ? 1.0117 1.1292 0.6623 -0.0321 0.1180  0.0241  689 LYS B CA  
2819 C C   . LYS B 98  ? 1.1454 1.2795 0.7860 -0.0285 0.1329  -0.0007 689 LYS B C   
2820 O O   . LYS B 98  ? 1.1653 1.3148 0.7747 -0.0368 0.1375  -0.0044 689 LYS B O   
2821 C CB  . LYS B 98  ? 1.0295 1.1303 0.6654 -0.0346 0.0996  0.0286  689 LYS B CB  
2822 C CG  . LYS B 98  ? 1.0527 1.1374 0.6995 -0.0371 0.0841  0.0511  689 LYS B CG  
2823 C CD  . LYS B 98  ? 1.1755 1.2677 0.8061 -0.0494 0.0818  0.0743  689 LYS B CD  
2824 C CE  . LYS B 98  ? 1.3321 1.4076 0.9808 -0.0497 0.0678  0.0941  689 LYS B CE  
2825 N NZ  . LYS B 98  ? 1.4503 1.5236 1.1304 -0.0442 0.0745  0.0964  689 LYS B NZ  
2826 N N   . SER B 99  ? 1.1340 1.2656 0.8017 -0.0163 0.1401  -0.0177 690 SER B N   
2827 C CA  . SER B 99  ? 1.1617 1.3064 0.8287 -0.0098 0.1538  -0.0438 690 SER B CA  
2828 C C   . SER B 99  ? 1.1987 1.3568 0.8946 -0.0029 0.1683  -0.0478 690 SER B C   
2829 O O   . SER B 99  ? 1.1695 1.3236 0.8850 -0.0032 0.1658  -0.0308 690 SER B O   
2830 C CB  . SER B 99  ? 1.2236 1.3485 0.8978 -0.0006 0.1452  -0.0623 690 SER B CB  
2831 O OG  . SER B 99  ? 1.3415 1.4720 1.0308 0.0098  0.1565  -0.0868 690 SER B OG  
2832 N N   . ARG B 100 ? 1.1694 1.3450 0.8682 0.0031  0.1835  -0.0706 691 ARG B N   
2833 C CA  . ARG B 100 ? 1.1475 1.3384 0.8760 0.0111  0.1975  -0.0777 691 ARG B CA  
2834 C C   . ARG B 100 ? 1.1867 1.3669 0.9414 0.0271  0.1985  -0.1021 691 ARG B C   
2835 O O   . ARG B 100 ? 1.2024 1.3791 0.9437 0.0301  0.1984  -0.1222 691 ARG B O   
2836 C CB  . ARG B 100 ? 1.1613 1.3869 0.8752 0.0036  0.2158  -0.0805 691 ARG B CB  
2837 C CG  . ARG B 100 ? 1.2624 1.5025 0.9993 0.0017  0.2237  -0.0654 691 ARG B CG  
2838 C CD  . ARG B 100 ? 1.4545 1.7170 1.1664 -0.0151 0.2306  -0.0473 691 ARG B CD  
2839 N NE  . ARG B 100 ? 1.6022 1.8982 1.2966 -0.0191 0.2493  -0.0632 691 ARG B NE  
2840 C CZ  . ARG B 100 ? 1.8054 2.1136 1.4598 -0.0310 0.2517  -0.0634 691 ARG B CZ  
2841 N NH1 . ARG B 100 ? 1.6631 1.9518 1.2918 -0.0396 0.2355  -0.0476 691 ARG B NH1 
2842 N NH2 . ARG B 100 ? 1.6408 1.9823 1.2808 -0.0345 0.2702  -0.0794 691 ARG B NH2 
2843 N N   . PRO B 101 ? 1.1089 1.2800 0.9004 0.0370  0.1966  -0.0996 692 PRO B N   
2844 C CA  . PRO B 101 ? 1.0620 1.2368 0.8731 0.0347  0.1965  -0.0787 692 PRO B CA  
2845 C C   . PRO B 101 ? 1.0220 1.1737 0.8335 0.0299  0.1798  -0.0568 692 PRO B C   
2846 O O   . PRO B 101 ? 1.0065 1.1353 0.8158 0.0327  0.1672  -0.0593 692 PRO B O   
2847 C CB  . PRO B 101 ? 1.0720 1.2479 0.9215 0.0488  0.2014  -0.0911 692 PRO B CB  
2848 C CG  . PRO B 101 ? 1.1437 1.2969 0.9974 0.0582  0.1928  -0.1084 692 PRO B CG  
2849 C CD  . PRO B 101 ? 1.1247 1.2821 0.9423 0.0516  0.1948  -0.1196 692 PRO B CD  
2850 N N   . VAL B 102 ? 0.9270 1.0852 0.7434 0.0229  0.1801  -0.0363 693 VAL B N   
2851 C CA  . VAL B 102 ? 0.8972 1.0356 0.7185 0.0193  0.1654  -0.0168 693 VAL B CA  
2852 C C   . VAL B 102 ? 0.8723 0.9958 0.7256 0.0302  0.1593  -0.0198 693 VAL B C   
2853 O O   . VAL B 102 ? 0.8547 0.9885 0.7316 0.0376  0.1675  -0.0271 693 VAL B O   
2854 C CB  . VAL B 102 ? 0.9511 1.0978 0.7667 0.0078  0.1654  0.0056  693 VAL B CB  
2855 C CG1 . VAL B 102 ? 0.9792 1.1363 0.7598 -0.0042 0.1677  0.0112  693 VAL B CG1 
2856 C CG2 . VAL B 102 ? 0.9458 1.1119 0.7839 0.0088  0.1772  0.0080  693 VAL B CG2 
2857 N N   . MET B 103 ? 0.7866 0.8870 0.6402 0.0313  0.1450  -0.0154 694 MET B N   
2858 C CA  . MET B 103 ? 0.7441 0.8287 0.6236 0.0399  0.1375  -0.0174 694 MET B CA  
2859 C C   . MET B 103 ? 0.7089 0.7786 0.5919 0.0358  0.1247  -0.0009 694 MET B C   
2860 O O   . MET B 103 ? 0.7050 0.7688 0.5688 0.0289  0.1177  0.0068  694 MET B O   
2861 C CB  . MET B 103 ? 0.7858 0.8562 0.6629 0.0462  0.1329  -0.0342 694 MET B CB  
2862 C CG  . MET B 103 ? 0.8589 0.9412 0.7311 0.0511  0.1442  -0.0546 694 MET B CG  
2863 S SD  . MET B 103 ? 0.9299 0.9907 0.8023 0.0580  0.1359  -0.0734 694 MET B SD  
2864 C CE  . MET B 103 ? 0.9296 1.0078 0.7799 0.0583  0.1490  -0.0959 694 MET B CE  
2865 N N   . ILE B 104 ? 0.6290 0.6930 0.5371 0.0406  0.1209  0.0034  695 ILE B N   
2866 C CA  . ILE B 104 ? 0.5881 0.6383 0.5036 0.0385  0.1091  0.0152  695 ILE B CA  
2867 C C   . ILE B 104 ? 0.6232 0.6597 0.5533 0.0459  0.1032  0.0069  695 ILE B C   
2868 O O   . ILE B 104 ? 0.6142 0.6538 0.5639 0.0527  0.1071  0.0015  695 ILE B O   
2869 C CB  . ILE B 104 ? 0.6029 0.6600 0.5329 0.0357  0.1097  0.0287  695 ILE B CB  
2870 C CG1 . ILE B 104 ? 0.6144 0.6830 0.5292 0.0269  0.1145  0.0383  695 ILE B CG1 
2871 C CG2 . ILE B 104 ? 0.5639 0.6073 0.5029 0.0348  0.0978  0.0371  695 ILE B CG2 
2872 C CD1 . ILE B 104 ? 0.6998 0.7763 0.6293 0.0234  0.1160  0.0501  695 ILE B CD1 
2873 N N   . ILE B 105 ? 0.5697 0.5917 0.4908 0.0441  0.0935  0.0059  696 ILE B N   
2874 C CA  . ILE B 105 ? 0.5427 0.5505 0.4749 0.0489  0.0869  -0.0011 696 ILE B CA  
2875 C C   . ILE B 105 ? 0.5479 0.5472 0.4898 0.0462  0.0771  0.0101  696 ILE B C   
2876 O O   . ILE B 105 ? 0.5325 0.5292 0.4640 0.0406  0.0711  0.0170  696 ILE B O   
2877 C CB  . ILE B 105 ? 0.5871 0.5865 0.5025 0.0485  0.0842  -0.0133 696 ILE B CB  
2878 C CG1 . ILE B 105 ? 0.5972 0.6079 0.5013 0.0508  0.0952  -0.0261 696 ILE B CG1 
2879 C CG2 . ILE B 105 ? 0.5832 0.5669 0.5114 0.0525  0.0771  -0.0201 696 ILE B CG2 
2880 C CD1 . ILE B 105 ? 0.6198 0.6314 0.4975 0.0454  0.0941  -0.0303 696 ILE B CD1 
2881 N N   . THR B 106 ? 0.4823 0.4787 0.4449 0.0502  0.0754  0.0116  697 THR B N   
2882 C CA  . THR B 106 ? 0.4710 0.4622 0.4436 0.0475  0.0673  0.0213  697 THR B CA  
2883 C C   . THR B 106 ? 0.5353 0.5139 0.5186 0.0499  0.0609  0.0175  697 THR B C   
2884 O O   . THR B 106 ? 0.5640 0.5371 0.5511 0.0551  0.0628  0.0074  697 THR B O   
2885 C CB  . THR B 106 ? 0.5841 0.5857 0.5709 0.0478  0.0702  0.0303  697 THR B CB  
2886 O OG1 . THR B 106 ? 0.5660 0.5704 0.5694 0.0544  0.0740  0.0262  697 THR B OG1 
2887 C CG2 . THR B 106 ? 0.5780 0.5912 0.5563 0.0444  0.0760  0.0351  697 THR B CG2 
2888 N N   . GLU B 107 ? 0.4747 0.4491 0.4635 0.0458  0.0533  0.0256  698 GLU B N   
2889 C CA  . GLU B 107 ? 0.4732 0.4367 0.4732 0.0459  0.0465  0.0257  698 GLU B CA  
2890 C C   . GLU B 107 ? 0.5293 0.4932 0.5474 0.0523  0.0486  0.0257  698 GLU B C   
2891 O O   . GLU B 107 ? 0.5369 0.5124 0.5617 0.0540  0.0531  0.0306  698 GLU B O   
2892 C CB  . GLU B 107 ? 0.4738 0.4385 0.4762 0.0392  0.0398  0.0357  698 GLU B CB  
2893 C CG  . GLU B 107 ? 0.5643 0.5407 0.5741 0.0381  0.0417  0.0449  698 GLU B CG  
2894 C CD  . GLU B 107 ? 0.6661 0.6463 0.6770 0.0315  0.0363  0.0523  698 GLU B CD  
2895 O OE1 . GLU B 107 ? 0.4989 0.4738 0.5151 0.0283  0.0307  0.0549  698 GLU B OE1 
2896 O OE2 . GLU B 107 ? 0.5562 0.5451 0.5634 0.0292  0.0378  0.0553  698 GLU B OE2 
2897 N N   . PHE B 108 ? 0.4857 0.4370 0.5131 0.0558  0.0447  0.0203  699 PHE B N   
2898 C CA  . PHE B 108 ? 0.4823 0.4322 0.5294 0.0629  0.0450  0.0199  699 PHE B CA  
2899 C C   . PHE B 108 ? 0.5535 0.5053 0.6133 0.0596  0.0384  0.0341  699 PHE B C   
2900 O O   . PHE B 108 ? 0.5596 0.5046 0.6171 0.0528  0.0310  0.0408  699 PHE B O   
2901 C CB  . PHE B 108 ? 0.5073 0.4406 0.5611 0.0681  0.0416  0.0086  699 PHE B CB  
2902 C CG  . PHE B 108 ? 0.5037 0.4325 0.5813 0.0765  0.0398  0.0076  699 PHE B CG  
2903 C CD1 . PHE B 108 ? 0.5170 0.4589 0.6047 0.0847  0.0481  0.0026  699 PHE B CD1 
2904 C CD2 . PHE B 108 ? 0.5263 0.4387 0.6176 0.0759  0.0291  0.0126  699 PHE B CD2 
2905 C CE1 . PHE B 108 ? 0.5191 0.4581 0.6317 0.0932  0.0455  0.0020  699 PHE B CE1 
2906 C CE2 . PHE B 108 ? 0.5696 0.4768 0.6848 0.0841  0.0257  0.0129  699 PHE B CE2 
2907 C CZ  . PHE B 108 ? 0.5254 0.4462 0.6518 0.0934  0.0337  0.0072  699 PHE B CZ  
2908 N N   . MET B 109 ? 0.4813 0.4442 0.5538 0.0635  0.0413  0.0389  700 MET B N   
2909 C CA  . MET B 109 ? 0.4631 0.4297 0.5459 0.0597  0.0348  0.0524  700 MET B CA  
2910 C C   . MET B 109 ? 0.5410 0.5022 0.6457 0.0672  0.0306  0.0533  700 MET B C   
2911 O O   . MET B 109 ? 0.5548 0.5269 0.6716 0.0733  0.0349  0.0524  700 MET B O   
2912 C CB  . MET B 109 ? 0.4548 0.4392 0.5344 0.0566  0.0393  0.0586  700 MET B CB  
2913 C CG  . MET B 109 ? 0.4603 0.4491 0.5210 0.0508  0.0431  0.0570  700 MET B CG  
2914 S SD  . MET B 109 ? 0.4781 0.4618 0.5284 0.0411  0.0356  0.0628  700 MET B SD  
2915 C CE  . MET B 109 ? 0.4108 0.4062 0.4699 0.0365  0.0317  0.0747  700 MET B CE  
2916 N N   . GLU B 110 ? 0.5453 0.4894 0.6565 0.0667  0.0219  0.0548  701 GLU B N   
2917 C CA  . GLU B 110 ? 0.5696 0.5027 0.7030 0.0741  0.0153  0.0552  701 GLU B CA  
2918 C C   . GLU B 110 ? 0.6197 0.5635 0.7704 0.0771  0.0123  0.0653  701 GLU B C   
2919 O O   . GLU B 110 ? 0.6336 0.5761 0.8044 0.0875  0.0121  0.0603  701 GLU B O   
2920 C CB  . GLU B 110 ? 0.6063 0.5194 0.7417 0.0685  0.0038  0.0612  701 GLU B CB  
2921 C CG  . GLU B 110 ? 0.8489 0.7434 1.0039 0.0778  -0.0016 0.0538  701 GLU B CG  
2922 C CD  . GLU B 110 ? 1.2760 1.1529 1.4431 0.0733  -0.0160 0.0666  701 GLU B CD  
2923 O OE1 . GLU B 110 ? 1.1317 1.0060 1.2864 0.0609  -0.0211 0.0771  701 GLU B OE1 
2924 O OE2 . GLU B 110 ? 1.3703 1.2363 1.5604 0.0820  -0.0224 0.0662  701 GLU B OE2 
2925 N N   . ASN B 111 ? 0.5355 0.4907 0.6798 0.0685  0.0095  0.0786  702 ASN B N   
2926 C CA  . ASN B 111 ? 0.5076 0.4735 0.6668 0.0694  0.0046  0.0898  702 ASN B CA  
2927 C C   . ASN B 111 ? 0.5241 0.5109 0.6861 0.0730  0.0137  0.0865  702 ASN B C   
2928 O O   . ASN B 111 ? 0.5026 0.5001 0.6773 0.0736  0.0097  0.0951  702 ASN B O   
2929 C CB  . ASN B 111 ? 0.4372 0.4044 0.5883 0.0574  -0.0042 0.1055  702 ASN B CB  
2930 C CG  . ASN B 111 ? 0.5182 0.4656 0.6746 0.0546  -0.0152 0.1121  702 ASN B CG  
2931 O OD1 . ASN B 111 ? 0.4858 0.4214 0.6616 0.0625  -0.0214 0.1122  702 ASN B OD1 
2932 N ND2 . ASN B 111 ? 0.4701 0.4133 0.6114 0.0435  -0.0183 0.1176  702 ASN B ND2 
2933 N N   . GLY B 112 ? 0.4654 0.4577 0.6163 0.0750  0.0251  0.0748  703 GLY B N   
2934 C CA  . GLY B 112 ? 0.4533 0.4646 0.6066 0.0775  0.0345  0.0714  703 GLY B CA  
2935 C C   . GLY B 112 ? 0.4863 0.5119 0.6348 0.0693  0.0331  0.0819  703 GLY B C   
2936 O O   . GLY B 112 ? 0.4534 0.4759 0.5882 0.0605  0.0287  0.0882  703 GLY B O   
2937 N N   . ALA B 113 ? 0.4571 0.4995 0.6180 0.0721  0.0370  0.0827  704 ALA B N   
2938 C CA  . ALA B 113 ? 0.4412 0.4984 0.6000 0.0649  0.0359  0.0909  704 ALA B CA  
2939 C C   . ALA B 113 ? 0.4932 0.5491 0.6550 0.0595  0.0238  0.1031  704 ALA B C   
2940 O O   . ALA B 113 ? 0.5160 0.5661 0.6927 0.0640  0.0158  0.1079  704 ALA B O   
2941 C CB  . ALA B 113 ? 0.4488 0.5240 0.6241 0.0694  0.0416  0.0890  704 ALA B CB  
2942 N N   . LEU B 114 ? 0.4074 0.4688 0.5551 0.0498  0.0222  0.1079  705 LEU B N   
2943 C CA  . LEU B 114 ? 0.4023 0.4653 0.5474 0.0423  0.0120  0.1188  705 LEU B CA  
2944 C C   . LEU B 114 ? 0.4508 0.5251 0.6138 0.0438  0.0046  0.1274  705 LEU B C   
2945 O O   . LEU B 114 ? 0.4575 0.5272 0.6252 0.0421  -0.0058 0.1371  705 LEU B O   
2946 C CB  . LEU B 114 ? 0.3770 0.4462 0.5035 0.0323  0.0139  0.1186  705 LEU B CB  
2947 C CG  . LEU B 114 ? 0.4121 0.4883 0.5331 0.0230  0.0053  0.1279  705 LEU B CG  
2948 C CD1 . LEU B 114 ? 0.4194 0.4838 0.5372 0.0203  -0.0021 0.1348  705 LEU B CD1 
2949 C CD2 . LEU B 114 ? 0.4145 0.4982 0.5206 0.0154  0.0089  0.1237  705 LEU B CD2 
2950 N N   . ASP B 115 ? 0.3837 0.4729 0.5571 0.0463  0.0093  0.1247  706 ASP B N   
2951 C CA  . ASP B 115 ? 0.3807 0.4832 0.5726 0.0476  0.0021  0.1323  706 ASP B CA  
2952 C C   . ASP B 115 ? 0.4442 0.5396 0.6573 0.0571  -0.0050 0.1361  706 ASP B C   
2953 O O   . ASP B 115 ? 0.4224 0.5198 0.6435 0.0550  -0.0172 0.1476  706 ASP B O   
2954 C CB  . ASP B 115 ? 0.3960 0.5159 0.5971 0.0486  0.0094  0.1275  706 ASP B CB  
2955 C CG  . ASP B 115 ? 0.4761 0.5976 0.6903 0.0585  0.0195  0.1181  706 ASP B CG  
2956 O OD1 . ASP B 115 ? 0.5010 0.6101 0.7055 0.0618  0.0262  0.1105  706 ASP B OD1 
2957 O OD2 . ASP B 115 ? 0.5574 0.6941 0.7920 0.0628  0.0206  0.1181  706 ASP B OD2 
2958 N N   . SER B 116 ? 0.4193 0.5063 0.6414 0.0674  0.0019  0.1262  707 SER B N   
2959 C CA  . SER B 116 ? 0.4344 0.5133 0.6797 0.0780  -0.0047 0.1273  707 SER B CA  
2960 C C   . SER B 116 ? 0.4954 0.5528 0.7334 0.0757  -0.0139 0.1334  707 SER B C   
2961 O O   . SER B 116 ? 0.5226 0.5733 0.7778 0.0797  -0.0255 0.1417  707 SER B O   
2962 C CB  . SER B 116 ? 0.4697 0.5497 0.7289 0.0899  0.0062  0.1128  707 SER B CB  
2963 O OG  . SER B 116 ? 0.6298 0.7010 0.8684 0.0882  0.0167  0.1024  707 SER B OG  
2964 N N   . PHE B 117 ? 0.4255 0.4729 0.6392 0.0682  -0.0101 0.1308  708 PHE B N   
2965 C CA  . PHE B 117 ? 0.4253 0.4541 0.6312 0.0636  -0.0188 0.1376  708 PHE B CA  
2966 C C   . PHE B 117 ? 0.5095 0.5428 0.7149 0.0548  -0.0322 0.1552  708 PHE B C   
2967 O O   . PHE B 117 ? 0.5318 0.5527 0.7474 0.0556  -0.0437 0.1649  708 PHE B O   
2968 C CB  . PHE B 117 ? 0.4331 0.4549 0.6138 0.0565  -0.0117 0.1314  708 PHE B CB  
2969 C CG  . PHE B 117 ? 0.4534 0.4600 0.6248 0.0490  -0.0202 0.1393  708 PHE B CG  
2970 C CD1 . PHE B 117 ? 0.4930 0.4795 0.6758 0.0545  -0.0263 0.1392  708 PHE B CD1 
2971 C CD2 . PHE B 117 ? 0.4679 0.4806 0.6202 0.0363  -0.0218 0.1462  708 PHE B CD2 
2972 C CE1 . PHE B 117 ? 0.5114 0.4838 0.6863 0.0461  -0.0343 0.1476  708 PHE B CE1 
2973 C CE2 . PHE B 117 ? 0.5197 0.5208 0.6637 0.0281  -0.0287 0.1539  708 PHE B CE2 
2974 C CZ  . PHE B 117 ? 0.5087 0.4894 0.6639 0.0326  -0.0352 0.1553  708 PHE B CZ  
2975 N N   . LEU B 118 ? 0.4625 0.5138 0.6566 0.0461  -0.0311 0.1593  709 LEU B N   
2976 C CA  . LEU B 118 ? 0.4520 0.5123 0.6428 0.0366  -0.0427 0.1746  709 LEU B CA  
2977 C C   . LEU B 118 ? 0.5068 0.5717 0.7226 0.0430  -0.0536 0.1840  709 LEU B C   
2978 O O   . LEU B 118 ? 0.5047 0.5659 0.7223 0.0379  -0.0670 0.1991  709 LEU B O   
2979 C CB  . LEU B 118 ? 0.4295 0.5087 0.6038 0.0271  -0.0379 0.1730  709 LEU B CB  
2980 C CG  . LEU B 118 ? 0.4538 0.5310 0.6042 0.0195  -0.0295 0.1657  709 LEU B CG  
2981 C CD1 . LEU B 118 ? 0.4187 0.5137 0.5587 0.0127  -0.0253 0.1620  709 LEU B CD1 
2982 C CD2 . LEU B 118 ? 0.4519 0.5207 0.5892 0.0102  -0.0362 0.1747  709 LEU B CD2 
2983 N N   . ARG B 119 ? 0.4804 0.5545 0.7163 0.0538  -0.0485 0.1760  710 ARG B N   
2984 C CA  . ARG B 119 ? 0.4848 0.5651 0.7491 0.0617  -0.0588 0.1835  710 ARG B CA  
2985 C C   . ARG B 119 ? 0.5760 0.6350 0.8577 0.0700  -0.0683 0.1880  710 ARG B C   
2986 O O   . ARG B 119 ? 0.5749 0.6331 0.8732 0.0715  -0.0831 0.2016  710 ARG B O   
2987 C CB  . ARG B 119 ? 0.4561 0.5523 0.7395 0.0714  -0.0496 0.1722  710 ARG B CB  
2988 C CG  . ARG B 119 ? 0.5384 0.6567 0.8124 0.0631  -0.0448 0.1714  710 ARG B CG  
2989 C CD  . ARG B 119 ? 0.5398 0.6759 0.8380 0.0719  -0.0385 0.1638  710 ARG B CD  
2990 N NE  . ARG B 119 ? 0.5086 0.6413 0.8076 0.0793  -0.0227 0.1480  710 ARG B NE  
2991 C CZ  . ARG B 119 ? 0.6470 0.7858 0.9295 0.0742  -0.0098 0.1393  710 ARG B CZ  
2992 N NH1 . ARG B 119 ? 0.4189 0.5663 0.6846 0.0624  -0.0107 0.1433  710 ARG B NH1 
2993 N NH2 . ARG B 119 ? 0.4613 0.5977 0.7443 0.0806  0.0034  0.1264  710 ARG B NH2 
2994 N N   . GLN B 120 ? 0.5726 0.6137 0.8509 0.0752  -0.0609 0.1768  711 GLN B N   
2995 C CA  . GLN B 120 ? 0.6106 0.6281 0.9048 0.0830  -0.0690 0.1781  711 GLN B CA  
2996 C C   . GLN B 120 ? 0.6964 0.6981 0.9753 0.0710  -0.0809 0.1937  711 GLN B C   
2997 O O   . GLN B 120 ? 0.7161 0.6963 1.0075 0.0750  -0.0904 0.1982  711 GLN B O   
2998 C CB  . GLN B 120 ? 0.6336 0.6393 0.9264 0.0914  -0.0558 0.1584  711 GLN B CB  
2999 C CG  . GLN B 120 ? 1.0646 1.0821 1.3792 0.1057  -0.0457 0.1430  711 GLN B CG  
3000 C CD  . GLN B 120 ? 1.4495 1.4560 1.7586 0.1121  -0.0331 0.1239  711 GLN B CD  
3001 O OE1 . GLN B 120 ? 1.4108 1.4292 1.7064 0.1112  -0.0184 0.1123  711 GLN B OE1 
3002 N NE2 . GLN B 120 ? 1.3987 1.3816 1.7169 0.1179  -0.0393 0.1208  711 GLN B NE2 
3003 N N   . ASN B 121 ? 0.6538 0.6665 0.9064 0.0560  -0.0800 0.2013  712 ASN B N   
3004 C CA  . ASN B 121 ? 0.6631 0.6664 0.8976 0.0422  -0.0888 0.2155  712 ASN B CA  
3005 C C   . ASN B 121 ? 0.7273 0.7505 0.9494 0.0294  -0.0961 0.2307  712 ASN B C   
3006 O O   . ASN B 121 ? 0.7546 0.7829 0.9520 0.0154  -0.0950 0.2357  712 ASN B O   
3007 C CB  . ASN B 121 ? 0.6746 0.6720 0.8857 0.0365  -0.0764 0.2040  712 ASN B CB  
3008 C CG  . ASN B 121 ? 0.8775 0.8522 1.0980 0.0461  -0.0730 0.1924  712 ASN B CG  
3009 O OD1 . ASN B 121 ? 0.8434 0.7983 1.0674 0.0435  -0.0823 0.1999  712 ASN B OD1 
3010 N ND2 . ASN B 121 ? 0.6553 0.6325 0.8804 0.0567  -0.0601 0.1739  712 ASN B ND2 
3011 N N   . ASP B 122 ? 0.6605 0.6966 0.9004 0.0344  -0.1034 0.2367  713 ASP B N   
3012 C CA  . ASP B 122 ? 0.6533 0.7107 0.8846 0.0240  -0.1110 0.2492  713 ASP B CA  
3013 C C   . ASP B 122 ? 0.6740 0.7272 0.8913 0.0098  -0.1249 0.2698  713 ASP B C   
3014 O O   . ASP B 122 ? 0.6665 0.7020 0.8979 0.0121  -0.1379 0.2825  713 ASP B O   
3015 C CB  . ASP B 122 ? 0.6809 0.7510 0.9397 0.0342  -0.1175 0.2513  713 ASP B CB  
3016 C CG  . ASP B 122 ? 0.8405 0.9361 1.0914 0.0247  -0.1231 0.2595  713 ASP B CG  
3017 O OD1 . ASP B 122 ? 0.8428 0.9498 1.0665 0.0122  -0.1169 0.2571  713 ASP B OD1 
3018 O OD2 . ASP B 122 ? 0.9528 1.0576 1.2262 0.0303  -0.1339 0.2672  713 ASP B OD2 
3019 N N   . GLY B 123 ? 0.6312 0.7000 0.8204 -0.0052 -0.1211 0.2718  714 GLY B N   
3020 C CA  . GLY B 123 ? 0.6418 0.7131 0.8107 -0.0221 -0.1306 0.2895  714 GLY B CA  
3021 C C   . GLY B 123 ? 0.7207 0.7719 0.8810 -0.0273 -0.1298 0.2924  714 GLY B C   
3022 O O   . GLY B 123 ? 0.7628 0.8153 0.9086 -0.0418 -0.1383 0.3089  714 GLY B O   
3023 N N   . GLN B 124 ? 0.6866 0.7205 0.8554 -0.0167 -0.1201 0.2772  715 GLN B N   
3024 C CA  . GLN B 124 ? 0.7037 0.7166 0.8673 -0.0210 -0.1204 0.2793  715 GLN B CA  
3025 C C   . GLN B 124 ? 0.7349 0.7559 0.8718 -0.0321 -0.1077 0.2705  715 GLN B C   
3026 O O   . GLN B 124 ? 0.7600 0.7664 0.8918 -0.0378 -0.1083 0.2731  715 GLN B O   
3027 C CB  . GLN B 124 ? 0.7333 0.7217 0.9205 -0.0044 -0.1187 0.2681  715 GLN B CB  
3028 C CG  . GLN B 124 ? 0.9089 0.8836 1.1254 0.0055  -0.1344 0.2794  715 GLN B CG  
3029 C CD  . GLN B 124 ? 1.1851 1.1483 1.4001 -0.0066 -0.1520 0.3040  715 GLN B CD  
3030 O OE1 . GLN B 124 ? 1.1481 1.0934 1.3566 -0.0136 -0.1540 0.3080  715 GLN B OE1 
3031 N NE2 . GLN B 124 ? 1.1139 1.0886 1.3332 -0.0109 -0.1656 0.3220  715 GLN B NE2 
3032 N N   . PHE B 125 ? 0.6322 0.6755 0.7546 -0.0349 -0.0967 0.2594  716 PHE B N   
3033 C CA  . PHE B 125 ? 0.5935 0.6470 0.6930 -0.0449 -0.0855 0.2508  716 PHE B CA  
3034 C C   . PHE B 125 ? 0.6132 0.6923 0.6934 -0.0596 -0.0874 0.2585  716 PHE B C   
3035 O O   . PHE B 125 ? 0.5847 0.6774 0.6679 -0.0588 -0.0919 0.2620  716 PHE B O   
3036 C CB  . PHE B 125 ? 0.5801 0.6355 0.6787 -0.0352 -0.0701 0.2283  716 PHE B CB  
3037 C CG  . PHE B 125 ? 0.6005 0.6334 0.7149 -0.0214 -0.0667 0.2186  716 PHE B CG  
3038 C CD1 . PHE B 125 ? 0.6443 0.6586 0.7579 -0.0233 -0.0678 0.2191  716 PHE B CD1 
3039 C CD2 . PHE B 125 ? 0.6000 0.6320 0.7299 -0.0073 -0.0623 0.2082  716 PHE B CD2 
3040 C CE1 . PHE B 125 ? 0.6623 0.6565 0.7896 -0.0110 -0.0651 0.2087  716 PHE B CE1 
3041 C CE2 . PHE B 125 ? 0.6353 0.6488 0.7786 0.0049  -0.0587 0.1982  716 PHE B CE2 
3042 C CZ  . PHE B 125 ? 0.6350 0.6293 0.7764 0.0032  -0.0603 0.1980  716 PHE B CZ  
3043 N N   . THR B 126 ? 0.5725 0.6598 0.6335 -0.0732 -0.0836 0.2600  717 THR B N   
3044 C CA  . THR B 126 ? 0.5775 0.6916 0.6177 -0.0884 -0.0834 0.2648  717 THR B CA  
3045 C C   . THR B 126 ? 0.5938 0.7256 0.6267 -0.0848 -0.0705 0.2444  717 THR B C   
3046 O O   . THR B 126 ? 0.5584 0.6805 0.5997 -0.0729 -0.0614 0.2286  717 THR B O   
3047 C CB  . THR B 126 ? 0.6715 0.7897 0.6956 -0.1042 -0.0825 0.2722  717 THR B CB  
3048 O OG1 . THR B 126 ? 0.7041 0.8178 0.7263 -0.1003 -0.0696 0.2549  717 THR B OG1 
3049 C CG2 . THR B 126 ? 0.5698 0.6688 0.6009 -0.1096 -0.0961 0.2938  717 THR B CG2 
3050 N N   . VAL B 127 ? 0.5539 0.7113 0.5708 -0.0958 -0.0702 0.2449  718 VAL B N   
3051 C CA  . VAL B 127 ? 0.5335 0.7086 0.5427 -0.0947 -0.0595 0.2261  718 VAL B CA  
3052 C C   . VAL B 127 ? 0.5793 0.7511 0.5842 -0.0931 -0.0468 0.2104  718 VAL B C   
3053 O O   . VAL B 127 ? 0.5679 0.7369 0.5785 -0.0833 -0.0383 0.1941  718 VAL B O   
3054 C CB  . VAL B 127 ? 0.5812 0.7848 0.5719 -0.1093 -0.0626 0.2299  718 VAL B CB  
3055 C CG1 . VAL B 127 ? 0.5652 0.7868 0.5460 -0.1105 -0.0504 0.2085  718 VAL B CG1 
3056 C CG2 . VAL B 127 ? 0.5804 0.7889 0.5774 -0.1083 -0.0745 0.2410  718 VAL B CG2 
3057 N N   . ILE B 128 ? 0.5609 0.7331 0.5569 -0.1028 -0.0461 0.2164  719 ILE B N   
3058 C CA  . ILE B 128 ? 0.5552 0.7261 0.5485 -0.1018 -0.0351 0.2024  719 ILE B CA  
3059 C C   . ILE B 128 ? 0.5680 0.7129 0.5768 -0.0868 -0.0321 0.1948  719 ILE B C   
3060 O O   . ILE B 128 ? 0.5510 0.6955 0.5608 -0.0803 -0.0227 0.1783  719 ILE B O   
3061 C CB  . ILE B 128 ? 0.6214 0.8017 0.6028 -0.1171 -0.0350 0.2109  719 ILE B CB  
3062 C CG1 . ILE B 128 ? 0.6296 0.8148 0.6090 -0.1163 -0.0233 0.1942  719 ILE B CG1 
3063 C CG2 . ILE B 128 ? 0.6588 0.8202 0.6457 -0.1210 -0.0451 0.2301  719 ILE B CG2 
3064 C CD1 . ILE B 128 ? 0.8005 1.0164 0.7669 -0.1247 -0.0155 0.1828  719 ILE B CD1 
3065 N N   . GLN B 129 ? 0.5195 0.6436 0.5408 -0.0809 -0.0405 0.2061  720 GLN B N   
3066 C CA  . GLN B 129 ? 0.5012 0.6024 0.5364 -0.0668 -0.0377 0.1980  720 GLN B CA  
3067 C C   . GLN B 129 ? 0.5072 0.6113 0.5484 -0.0553 -0.0314 0.1845  720 GLN B C   
3068 O O   . GLN B 129 ? 0.5032 0.6012 0.5459 -0.0480 -0.0230 0.1707  720 GLN B O   
3069 C CB  . GLN B 129 ? 0.5323 0.6119 0.5812 -0.0627 -0.0483 0.2116  720 GLN B CB  
3070 C CG  . GLN B 129 ? 0.5916 0.6618 0.6366 -0.0729 -0.0532 0.2223  720 GLN B CG  
3071 C CD  . GLN B 129 ? 0.8515 0.9017 0.9096 -0.0719 -0.0666 0.2390  720 GLN B CD  
3072 O OE1 . GLN B 129 ? 0.6960 0.7428 0.7653 -0.0654 -0.0740 0.2457  720 GLN B OE1 
3073 N NE2 . GLN B 129 ? 0.9533 0.9893 1.0120 -0.0783 -0.0706 0.2460  720 GLN B NE2 
3074 N N   . LEU B 130 ? 0.4384 0.5537 0.4821 -0.0553 -0.0358 0.1889  721 LEU B N   
3075 C CA  . LEU B 130 ? 0.4164 0.5360 0.4669 -0.0462 -0.0308 0.1778  721 LEU B CA  
3076 C C   . LEU B 130 ? 0.4640 0.5961 0.5040 -0.0485 -0.0209 0.1623  721 LEU B C   
3077 O O   . LEU B 130 ? 0.4298 0.5562 0.4753 -0.0398 -0.0141 0.1506  721 LEU B O   
3078 C CB  . LEU B 130 ? 0.4097 0.5401 0.4655 -0.0474 -0.0390 0.1865  721 LEU B CB  
3079 C CG  . LEU B 130 ? 0.4703 0.5883 0.5411 -0.0428 -0.0500 0.2013  721 LEU B CG  
3080 C CD1 . LEU B 130 ? 0.4687 0.6016 0.5418 -0.0473 -0.0601 0.2124  721 LEU B CD1 
3081 C CD2 . LEU B 130 ? 0.4378 0.5381 0.5272 -0.0273 -0.0463 0.1940  721 LEU B CD2 
3082 N N   . VAL B 131 ? 0.4362 0.5852 0.4619 -0.0604 -0.0203 0.1624  722 VAL B N   
3083 C CA  . VAL B 131 ? 0.4252 0.5869 0.4428 -0.0627 -0.0116 0.1470  722 VAL B CA  
3084 C C   . VAL B 131 ? 0.4608 0.6093 0.4807 -0.0567 -0.0045 0.1375  722 VAL B C   
3085 O O   . VAL B 131 ? 0.4288 0.5768 0.4510 -0.0507 0.0019  0.1242  722 VAL B O   
3086 C CB  . VAL B 131 ? 0.4784 0.6637 0.4809 -0.0767 -0.0122 0.1483  722 VAL B CB  
3087 C CG1 . VAL B 131 ? 0.4677 0.6646 0.4648 -0.0779 -0.0027 0.1308  722 VAL B CG1 
3088 C CG2 . VAL B 131 ? 0.4740 0.6740 0.4734 -0.0814 -0.0183 0.1532  722 VAL B CG2 
3089 N N   . GLY B 132 ? 0.4179 0.5546 0.4383 -0.0582 -0.0068 0.1452  723 GLY B N   
3090 C CA  . GLY B 132 ? 0.3881 0.5114 0.4111 -0.0530 -0.0020 0.1379  723 GLY B CA  
3091 C C   . GLY B 132 ? 0.4021 0.5099 0.4344 -0.0398 0.0010  0.1307  723 GLY B C   
3092 O O   . GLY B 132 ? 0.4029 0.5075 0.4349 -0.0352 0.0069  0.1195  723 GLY B O   
3093 N N   . MET B 133 ? 0.3840 0.4839 0.4251 -0.0341 -0.0032 0.1371  724 MET B N   
3094 C CA  . MET B 133 ? 0.3779 0.4665 0.4284 -0.0223 0.0003  0.1308  724 MET B CA  
3095 C C   . MET B 133 ? 0.4349 0.5338 0.4842 -0.0204 0.0059  0.1208  724 MET B C   
3096 O O   . MET B 133 ? 0.4457 0.5374 0.4967 -0.0139 0.0114  0.1123  724 MET B O   
3097 C CB  . MET B 133 ? 0.4098 0.4929 0.4723 -0.0173 -0.0054 0.1397  724 MET B CB  
3098 C CG  . MET B 133 ? 0.4624 0.5314 0.5298 -0.0172 -0.0120 0.1491  724 MET B CG  
3099 S SD  . MET B 133 ? 0.5133 0.5779 0.5989 -0.0093 -0.0190 0.1575  724 MET B SD  
3100 C CE  . MET B 133 ? 0.5017 0.5539 0.5897 -0.0146 -0.0299 0.1720  724 MET B CE  
3101 N N   . LEU B 134 ? 0.3795 0.4950 0.4255 -0.0269 0.0037  0.1221  725 LEU B N   
3102 C CA  . LEU B 134 ? 0.3757 0.5010 0.4215 -0.0266 0.0075  0.1123  725 LEU B CA  
3103 C C   . LEU B 134 ? 0.4274 0.5545 0.4669 -0.0276 0.0131  0.1008  725 LEU B C   
3104 O O   . LEU B 134 ? 0.4069 0.5320 0.4495 -0.0234 0.0169  0.0920  725 LEU B O   
3105 C CB  . LEU B 134 ? 0.3760 0.5189 0.4189 -0.0342 0.0028  0.1158  725 LEU B CB  
3106 C CG  . LEU B 134 ? 0.4078 0.5512 0.4601 -0.0320 -0.0033 0.1256  725 LEU B CG  
3107 C CD1 . LEU B 134 ? 0.3980 0.5599 0.4449 -0.0410 -0.0090 0.1294  725 LEU B CD1 
3108 C CD2 . LEU B 134 ? 0.4276 0.5657 0.4912 -0.0237 0.0003  0.1202  725 LEU B CD2 
3109 N N   . ARG B 135 ? 0.3890 0.5204 0.4213 -0.0335 0.0131  0.1013  726 ARG B N   
3110 C CA  . ARG B 135 ? 0.3722 0.5075 0.4010 -0.0344 0.0177  0.0905  726 ARG B CA  
3111 C C   . ARG B 135 ? 0.4028 0.5207 0.4357 -0.0257 0.0206  0.0864  726 ARG B C   
3112 O O   . ARG B 135 ? 0.3691 0.4866 0.4035 -0.0224 0.0238  0.0766  726 ARG B O   
3113 C CB  . ARG B 135 ? 0.3735 0.5202 0.3950 -0.0437 0.0171  0.0935  726 ARG B CB  
3114 C CG  . ARG B 135 ? 0.4631 0.6201 0.4832 -0.0453 0.0220  0.0809  726 ARG B CG  
3115 C CD  . ARG B 135 ? 0.4488 0.5930 0.4720 -0.0406 0.0237  0.0783  726 ARG B CD  
3116 N NE  . ARG B 135 ? 0.4074 0.5641 0.4319 -0.0419 0.0276  0.0663  726 ARG B NE  
3117 C CZ  . ARG B 135 ? 0.5263 0.6755 0.5559 -0.0359 0.0291  0.0590  726 ARG B CZ  
3118 N NH1 . ARG B 135 ? 0.3541 0.4832 0.3852 -0.0292 0.0276  0.0625  726 ARG B NH1 
3119 N NH2 . ARG B 135 ? 0.4423 0.6052 0.4757 -0.0367 0.0320  0.0477  726 ARG B NH2 
3120 N N   . GLY B 136 ? 0.3710 0.4745 0.4057 -0.0222 0.0189  0.0936  727 GLY B N   
3121 C CA  . GLY B 136 ? 0.3592 0.4469 0.3958 -0.0146 0.0214  0.0900  727 GLY B CA  
3122 C C   . GLY B 136 ? 0.3965 0.4804 0.4372 -0.0081 0.0242  0.0858  727 GLY B C   
3123 O O   . GLY B 136 ? 0.4035 0.4826 0.4433 -0.0047 0.0270  0.0793  727 GLY B O   
3124 N N   . ILE B 137 ? 0.3588 0.4464 0.4047 -0.0074 0.0231  0.0903  728 ILE B N   
3125 C CA  . ILE B 137 ? 0.3471 0.4336 0.3982 -0.0030 0.0258  0.0873  728 ILE B CA  
3126 C C   . ILE B 137 ? 0.3947 0.4872 0.4444 -0.0052 0.0272  0.0790  728 ILE B C   
3127 O O   . ILE B 137 ? 0.3991 0.4846 0.4499 -0.0015 0.0298  0.0751  728 ILE B O   
3128 C CB  . ILE B 137 ? 0.3731 0.4654 0.4322 -0.0027 0.0237  0.0936  728 ILE B CB  
3129 C CG1 . ILE B 137 ? 0.3746 0.4588 0.4384 0.0015  0.0219  0.1005  728 ILE B CG1 
3130 C CG2 . ILE B 137 ? 0.3536 0.4467 0.4186 0.0002  0.0270  0.0903  728 ILE B CG2 
3131 C CD1 . ILE B 137 ? 0.3828 0.4740 0.4554 0.0010  0.0171  0.1083  728 ILE B CD1 
3132 N N   . ALA B 138 ? 0.3539 0.4593 0.4014 -0.0113 0.0252  0.0763  729 ALA B N   
3133 C CA  . ALA B 138 ? 0.3497 0.4619 0.3979 -0.0131 0.0260  0.0663  729 ALA B CA  
3134 C C   . ALA B 138 ? 0.3958 0.5009 0.4429 -0.0099 0.0278  0.0598  729 ALA B C   
3135 O O   . ALA B 138 ? 0.3998 0.5010 0.4510 -0.0072 0.0282  0.0534  729 ALA B O   
3136 C CB  . ALA B 138 ? 0.3509 0.4805 0.3955 -0.0206 0.0242  0.0636  729 ALA B CB  
3137 N N   . ALA B 139 ? 0.3584 0.4610 0.4010 -0.0103 0.0280  0.0621  730 ALA B N   
3138 C CA  . ALA B 139 ? 0.3448 0.4417 0.3868 -0.0075 0.0286  0.0570  730 ALA B CA  
3139 C C   . ALA B 139 ? 0.3791 0.4601 0.4215 -0.0011 0.0293  0.0583  730 ALA B C   
3140 O O   . ALA B 139 ? 0.3825 0.4595 0.4271 0.0017  0.0287  0.0530  730 ALA B O   
3141 C CB  . ALA B 139 ? 0.3441 0.4421 0.3818 -0.0107 0.0280  0.0605  730 ALA B CB  
3142 N N   . GLY B 140 ? 0.3348 0.4083 0.3759 0.0011  0.0303  0.0652  731 GLY B N   
3143 C CA  . GLY B 140 ? 0.3306 0.3922 0.3704 0.0061  0.0320  0.0667  731 GLY B CA  
3144 C C   . GLY B 140 ? 0.3895 0.4514 0.4340 0.0065  0.0325  0.0650  731 GLY B C   
3145 O O   . GLY B 140 ? 0.3734 0.4273 0.4165 0.0089  0.0324  0.0641  731 GLY B O   
3146 N N   . MET B 141 ? 0.3714 0.4425 0.4213 0.0035  0.0319  0.0649  732 MET B N   
3147 C CA  . MET B 141 ? 0.3498 0.4214 0.4058 0.0026  0.0314  0.0628  732 MET B CA  
3148 C C   . MET B 141 ? 0.3596 0.4309 0.4186 0.0024  0.0288  0.0545  732 MET B C   
3149 O O   . MET B 141 ? 0.3694 0.4334 0.4326 0.0033  0.0275  0.0536  732 MET B O   
3150 C CB  . MET B 141 ? 0.3553 0.4372 0.4165 -0.0010 0.0308  0.0646  732 MET B CB  
3151 C CG  . MET B 141 ? 0.3759 0.4572 0.4392 0.0008  0.0331  0.0727  732 MET B CG  
3152 S SD  . MET B 141 ? 0.3934 0.4649 0.4577 0.0040  0.0373  0.0762  732 MET B SD  
3153 C CE  . MET B 141 ? 0.3377 0.4090 0.4092 -0.0002 0.0348  0.0728  732 MET B CE  
3154 N N   . LYS B 142 ? 0.3108 0.3898 0.3687 0.0011  0.0278  0.0487  733 LYS B N   
3155 C CA  . LYS B 142 ? 0.3169 0.3974 0.3802 0.0022  0.0256  0.0388  733 LYS B CA  
3156 C C   . LYS B 142 ? 0.3845 0.4515 0.4474 0.0069  0.0239  0.0404  733 LYS B C   
3157 O O   . LYS B 142 ? 0.4163 0.4767 0.4861 0.0090  0.0208  0.0369  733 LYS B O   
3158 C CB  . LYS B 142 ? 0.3507 0.4454 0.4125 -0.0005 0.0263  0.0329  733 LYS B CB  
3159 C CG  . LYS B 142 ? 0.3125 0.4116 0.3823 0.0016  0.0247  0.0211  733 LYS B CG  
3160 C CD  . LYS B 142 ? 0.3174 0.4327 0.3854 -0.0017 0.0266  0.0162  733 LYS B CD  
3161 C CE  . LYS B 142 ? 0.3843 0.5085 0.4632 0.0007  0.0258  0.0020  733 LYS B CE  
3162 N NZ  . LYS B 142 ? 0.4191 0.5318 0.5045 0.0072  0.0225  0.0011  733 LYS B NZ  
3163 N N   . TYR B 143 ? 0.3650 0.4272 0.4199 0.0082  0.0252  0.0461  734 TYR B N   
3164 C CA  . TYR B 143 ? 0.3571 0.4078 0.4086 0.0117  0.0233  0.0484  734 TYR B CA  
3165 C C   . TYR B 143 ? 0.4011 0.4411 0.4515 0.0126  0.0232  0.0544  734 TYR B C   
3166 O O   . TYR B 143 ? 0.3718 0.4039 0.4250 0.0144  0.0193  0.0542  734 TYR B O   
3167 C CB  . TYR B 143 ? 0.3608 0.4098 0.4033 0.0119  0.0249  0.0521  734 TYR B CB  
3168 C CG  . TYR B 143 ? 0.3756 0.4138 0.4122 0.0149  0.0226  0.0541  734 TYR B CG  
3169 C CD1 . TYR B 143 ? 0.4044 0.4333 0.4333 0.0160  0.0243  0.0603  734 TYR B CD1 
3170 C CD2 . TYR B 143 ? 0.3702 0.4096 0.4090 0.0161  0.0186  0.0496  734 TYR B CD2 
3171 C CE1 . TYR B 143 ? 0.4085 0.4290 0.4296 0.0178  0.0218  0.0623  734 TYR B CE1 
3172 C CE2 . TYR B 143 ? 0.3929 0.4230 0.4256 0.0184  0.0151  0.0520  734 TYR B CE2 
3173 C CZ  . TYR B 143 ? 0.4613 0.4817 0.4838 0.0189  0.0166  0.0585  734 TYR B CZ  
3174 O OH  . TYR B 143 ? 0.4798 0.4926 0.4936 0.0201  0.0132  0.0609  734 TYR B OH  
3175 N N   . LEU B 144 ? 0.3761 0.4166 0.4238 0.0111  0.0272  0.0602  735 LEU B N   
3176 C CA  . LEU B 144 ? 0.3775 0.4109 0.4244 0.0106  0.0283  0.0664  735 LEU B CA  
3177 C C   . LEU B 144 ? 0.4291 0.4596 0.4860 0.0089  0.0243  0.0644  735 LEU B C   
3178 O O   . LEU B 144 ? 0.4334 0.4537 0.4900 0.0090  0.0212  0.0682  735 LEU B O   
3179 C CB  . LEU B 144 ? 0.3794 0.4178 0.4249 0.0095  0.0337  0.0713  735 LEU B CB  
3180 C CG  . LEU B 144 ? 0.4665 0.5017 0.5113 0.0081  0.0368  0.0780  735 LEU B CG  
3181 C CD1 . LEU B 144 ? 0.4931 0.5318 0.5332 0.0099  0.0428  0.0811  735 LEU B CD1 
3182 C CD2 . LEU B 144 ? 0.4853 0.5258 0.5407 0.0044  0.0364  0.0787  735 LEU B CD2 
3183 N N   . SER B 145 ? 0.3821 0.4210 0.4475 0.0069  0.0235  0.0583  736 SER B N   
3184 C CA  . SER B 145 ? 0.3866 0.4227 0.4630 0.0052  0.0193  0.0539  736 SER B CA  
3185 C C   . SER B 145 ? 0.4410 0.4696 0.5231 0.0087  0.0134  0.0479  736 SER B C   
3186 O O   . SER B 145 ? 0.4479 0.4659 0.5374 0.0085  0.0087  0.0490  736 SER B O   
3187 C CB  . SER B 145 ? 0.3920 0.4404 0.4744 0.0021  0.0197  0.0470  736 SER B CB  
3188 O OG  . SER B 145 ? 0.4991 0.5579 0.5801 0.0030  0.0200  0.0390  736 SER B OG  
3189 N N   . GLU B 146 ? 0.4139 0.4477 0.4940 0.0118  0.0132  0.0424  737 GLU B N   
3190 C CA  . GLU B 146 ? 0.4164 0.4453 0.5044 0.0160  0.0074  0.0363  737 GLU B CA  
3191 C C   . GLU B 146 ? 0.4983 0.5130 0.5806 0.0181  0.0036  0.0458  737 GLU B C   
3192 O O   . GLU B 146 ? 0.5134 0.5205 0.6043 0.0214  -0.0033 0.0435  737 GLU B O   
3193 C CB  . GLU B 146 ? 0.4189 0.4614 0.5091 0.0177  0.0086  0.0262  737 GLU B CB  
3194 C CG  . GLU B 146 ? 0.4729 0.5288 0.5709 0.0155  0.0102  0.0149  737 GLU B CG  
3195 C CD  . GLU B 146 ? 0.5491 0.6236 0.6462 0.0143  0.0137  0.0064  737 GLU B CD  
3196 O OE1 . GLU B 146 ? 0.4740 0.5513 0.5662 0.0152  0.0146  0.0088  737 GLU B OE1 
3197 O OE2 . GLU B 146 ? 0.4067 0.4941 0.5078 0.0115  0.0154  -0.0028 737 GLU B OE2 
3198 N N   . MET B 147 ? 0.4816 0.4931 0.5502 0.0160  0.0077  0.0562  738 MET B N   
3199 C CA  . MET B 147 ? 0.5061 0.5060 0.5658 0.0162  0.0051  0.0660  738 MET B CA  
3200 C C   . MET B 147 ? 0.5315 0.5221 0.5946 0.0124  0.0033  0.0737  738 MET B C   
3201 O O   . MET B 147 ? 0.5259 0.5080 0.5806 0.0104  0.0018  0.0839  738 MET B O   
3202 C CB  . MET B 147 ? 0.5564 0.5589 0.6001 0.0153  0.0113  0.0715  738 MET B CB  
3203 C CG  . MET B 147 ? 0.6307 0.6385 0.6699 0.0179  0.0116  0.0663  738 MET B CG  
3204 S SD  . MET B 147 ? 0.7316 0.7323 0.7691 0.0212  0.0030  0.0665  738 MET B SD  
3205 C CE  . MET B 147 ? 0.7059 0.6978 0.7250 0.0188  0.0043  0.0777  738 MET B CE  
3206 N N   . ASN B 148 ? 0.4966 0.4902 0.5712 0.0103  0.0036  0.0691  739 ASN B N   
3207 C CA  . ASN B 148 ? 0.4979 0.4840 0.5794 0.0057  0.0014  0.0745  739 ASN B CA  
3208 C C   . ASN B 148 ? 0.5170 0.5062 0.5893 0.0004  0.0084  0.0850  739 ASN B C   
3209 O O   . ASN B 148 ? 0.5028 0.4842 0.5756 -0.0043 0.0066  0.0944  739 ASN B O   
3210 C CB  . ASN B 148 ? 0.6096 0.5793 0.6981 0.0064  -0.0084 0.0788  739 ASN B CB  
3211 C CG  . ASN B 148 ? 1.0374 1.0047 1.1448 0.0095  -0.0149 0.0664  739 ASN B CG  
3212 O OD1 . ASN B 148 ? 0.8938 0.8647 1.0070 0.0155  -0.0176 0.0563  739 ASN B OD1 
3213 N ND2 . ASN B 148 ? 0.9850 0.9489 1.1029 0.0052  -0.0162 0.0651  739 ASN B ND2 
3214 N N   . TYR B 149 ? 0.4580 0.4598 0.5242 0.0010  0.0160  0.0829  740 TYR B N   
3215 C CA  . TYR B 149 ? 0.4513 0.4599 0.5123 -0.0026 0.0235  0.0899  740 TYR B CA  
3216 C C   . TYR B 149 ? 0.4734 0.4932 0.5438 -0.0047 0.0262  0.0857  740 TYR B C   
3217 O O   . TYR B 149 ? 0.4694 0.4953 0.5447 -0.0029 0.0246  0.0770  740 TYR B O   
3218 C CB  . TYR B 149 ? 0.4655 0.4787 0.5130 0.0005  0.0293  0.0914  740 TYR B CB  
3219 C CG  . TYR B 149 ? 0.5150 0.5197 0.5500 0.0002  0.0283  0.0983  740 TYR B CG  
3220 C CD1 . TYR B 149 ? 0.5449 0.5422 0.5754 0.0037  0.0223  0.0960  740 TYR B CD1 
3221 C CD2 . TYR B 149 ? 0.5368 0.5430 0.5645 -0.0041 0.0334  0.1073  740 TYR B CD2 
3222 C CE1 . TYR B 149 ? 0.5636 0.5538 0.5815 0.0028  0.0202  0.1031  740 TYR B CE1 
3223 C CE2 . TYR B 149 ? 0.5660 0.5660 0.5798 -0.0056 0.0323  0.1141  740 TYR B CE2 
3224 C CZ  . TYR B 149 ? 0.6285 0.6199 0.6368 -0.0021 0.0251  0.1123  740 TYR B CZ  
3225 O OH  . TYR B 149 ? 0.6686 0.6548 0.6620 -0.0041 0.0231  0.1194  740 TYR B OH  
3226 N N   . VAL B 150 ? 0.4095 0.4339 0.4825 -0.0093 0.0303  0.0924  741 VAL B N   
3227 C CA  . VAL B 150 ? 0.3870 0.4240 0.4684 -0.0116 0.0332  0.0907  741 VAL B CA  
3228 C C   . VAL B 150 ? 0.4413 0.4874 0.5164 -0.0098 0.0413  0.0954  741 VAL B C   
3229 O O   . VAL B 150 ? 0.4411 0.4849 0.5094 -0.0111 0.0453  0.1021  741 VAL B O   
3230 C CB  . VAL B 150 ? 0.4233 0.4597 0.5173 -0.0185 0.0302  0.0929  741 VAL B CB  
3231 C CG1 . VAL B 150 ? 0.4175 0.4502 0.5100 -0.0239 0.0330  0.1043  741 VAL B CG1 
3232 C CG2 . VAL B 150 ? 0.4199 0.4708 0.5229 -0.0206 0.0316  0.0897  741 VAL B CG2 
3233 N N   . HIS B 151 ? 0.3715 0.4276 0.4485 -0.0068 0.0434  0.0917  742 HIS B N   
3234 C CA  . HIS B 151 ? 0.3585 0.4224 0.4328 -0.0035 0.0500  0.0942  742 HIS B CA  
3235 C C   . HIS B 151 ? 0.4299 0.5051 0.5143 -0.0070 0.0545  0.0990  742 HIS B C   
3236 O O   . HIS B 151 ? 0.4256 0.5050 0.5072 -0.0063 0.0614  0.1026  742 HIS B O   
3237 C CB  . HIS B 151 ? 0.3546 0.4232 0.4289 0.0008  0.0488  0.0896  742 HIS B CB  
3238 C CG  . HIS B 151 ? 0.3884 0.4605 0.4601 0.0057  0.0541  0.0908  742 HIS B CG  
3239 N ND1 . HIS B 151 ? 0.4094 0.4928 0.4914 0.0065  0.0579  0.0932  742 HIS B ND1 
3240 C CD2 . HIS B 151 ? 0.4049 0.4705 0.4667 0.0102  0.0558  0.0888  742 HIS B CD2 
3241 C CE1 . HIS B 151 ? 0.3926 0.4755 0.4712 0.0121  0.0619  0.0920  742 HIS B CE1 
3242 N NE2 . HIS B 151 ? 0.3968 0.4686 0.4626 0.0141  0.0608  0.0892  742 HIS B NE2 
3243 N N   . ARG B 152 ? 0.3910 0.4732 0.4878 -0.0109 0.0508  0.0981  743 ARG B N   
3244 C CA  . ARG B 152 ? 0.3885 0.4833 0.4986 -0.0154 0.0532  0.1020  743 ARG B CA  
3245 C C   . ARG B 152 ? 0.4364 0.5457 0.5539 -0.0109 0.0576  0.1027  743 ARG B C   
3246 O O   . ARG B 152 ? 0.4082 0.5306 0.5393 -0.0139 0.0587  0.1052  743 ARG B O   
3247 C CB  . ARG B 152 ? 0.3586 0.4516 0.4688 -0.0212 0.0572  0.1089  743 ARG B CB  
3248 C CG  . ARG B 152 ? 0.4114 0.4885 0.5176 -0.0258 0.0512  0.1098  743 ARG B CG  
3249 C CD  . ARG B 152 ? 0.4641 0.5412 0.5745 -0.0342 0.0532  0.1186  743 ARG B CD  
3250 N NE  . ARG B 152 ? 0.5494 0.6302 0.6495 -0.0339 0.0616  0.1247  743 ARG B NE  
3251 C CZ  . ARG B 152 ? 0.5850 0.6776 0.6896 -0.0400 0.0684  0.1318  743 ARG B CZ  
3252 N NH1 . ARG B 152 ? 0.5346 0.6358 0.6554 -0.0470 0.0673  0.1345  743 ARG B NH1 
3253 N NH2 . ARG B 152 ? 0.4655 0.5628 0.5585 -0.0398 0.0766  0.1358  743 ARG B NH2 
3254 N N   . ASP B 153 ? 0.3787 0.4856 0.4891 -0.0038 0.0592  0.1002  744 ASP B N   
3255 C CA  . ASP B 153 ? 0.3572 0.4749 0.4760 0.0017  0.0623  0.1004  744 ASP B CA  
3256 C C   . ASP B 153 ? 0.3744 0.4879 0.4896 0.0064  0.0570  0.0977  744 ASP B C   
3257 O O   . ASP B 153 ? 0.3635 0.4771 0.4795 0.0128  0.0591  0.0970  744 ASP B O   
3258 C CB  . ASP B 153 ? 0.3931 0.5117 0.5074 0.0055  0.0714  0.1005  744 ASP B CB  
3259 C CG  . ASP B 153 ? 0.5175 0.6520 0.6467 0.0097  0.0773  0.1006  744 ASP B CG  
3260 O OD1 . ASP B 153 ? 0.5110 0.6564 0.6561 0.0096  0.0734  0.1021  744 ASP B OD1 
3261 O OD2 . ASP B 153 ? 0.5639 0.7008 0.6894 0.0134  0.0855  0.0985  744 ASP B OD2 
3262 N N   . LEU B 154 ? 0.3395 0.4497 0.4512 0.0028  0.0500  0.0959  745 LEU B N   
3263 C CA  . LEU B 154 ? 0.3209 0.4291 0.4281 0.0050  0.0449  0.0945  745 LEU B CA  
3264 C C   . LEU B 154 ? 0.3524 0.4732 0.4722 0.0056  0.0411  0.0983  745 LEU B C   
3265 O O   . LEU B 154 ? 0.3097 0.4402 0.4370 0.0007  0.0370  0.0992  745 LEU B O   
3266 C CB  . LEU B 154 ? 0.3135 0.4167 0.4123 0.0007  0.0401  0.0903  745 LEU B CB  
3267 C CG  . LEU B 154 ? 0.3739 0.4771 0.4662 0.0009  0.0356  0.0891  745 LEU B CG  
3268 C CD1 . LEU B 154 ? 0.3751 0.4686 0.4597 0.0063  0.0380  0.0895  745 LEU B CD1 
3269 C CD2 . LEU B 154 ? 0.3628 0.4654 0.4493 -0.0036 0.0321  0.0830  745 LEU B CD2 
3270 N N   . ALA B 155 ? 0.3193 0.4393 0.4423 0.0119  0.0418  0.1003  746 ALA B N   
3271 C CA  . ALA B 155 ? 0.3103 0.4397 0.4468 0.0146  0.0374  0.1048  746 ALA B CA  
3272 C C   . ALA B 155 ? 0.3778 0.4976 0.5104 0.0200  0.0355  0.1058  746 ALA B C   
3273 O O   . ALA B 155 ? 0.3775 0.4859 0.5007 0.0232  0.0403  0.1018  746 ALA B O   
3274 C CB  . ALA B 155 ? 0.3112 0.4511 0.4642 0.0183  0.0429  0.1057  746 ALA B CB  
3275 N N   . ALA B 156 ? 0.3561 0.4798 0.4959 0.0207  0.0277  0.1115  747 ALA B N   
3276 C CA  . ALA B 156 ? 0.3547 0.4675 0.4927 0.0251  0.0243  0.1139  747 ALA B CA  
3277 C C   . ALA B 156 ? 0.3863 0.4925 0.5319 0.0345  0.0307  0.1096  747 ALA B C   
3278 O O   . ALA B 156 ? 0.3829 0.4758 0.5212 0.0374  0.0314  0.1071  747 ALA B O   
3279 C CB  . ALA B 156 ? 0.3619 0.4804 0.5086 0.0239  0.0139  0.1228  747 ALA B CB  
3280 N N   . ARG B 157 ? 0.3587 0.4752 0.5182 0.0385  0.0361  0.1075  748 ARG B N   
3281 C CA  . ARG B 157 ? 0.3674 0.4820 0.5343 0.0472  0.0441  0.1012  748 ARG B CA  
3282 C C   . ARG B 157 ? 0.4283 0.5332 0.5771 0.0464  0.0525  0.0941  748 ARG B C   
3283 O O   . ARG B 157 ? 0.4308 0.5310 0.5804 0.0529  0.0582  0.0878  748 ARG B O   
3284 C CB  . ARG B 157 ? 0.3559 0.4885 0.5424 0.0500  0.0487  0.1007  748 ARG B CB  
3285 C CG  . ARG B 157 ? 0.4000 0.5417 0.5805 0.0425  0.0548  0.1001  748 ARG B CG  
3286 C CD  . ARG B 157 ? 0.4206 0.5822 0.6213 0.0434  0.0593  0.1005  748 ARG B CD  
3287 N NE  . ARG B 157 ? 0.5399 0.7098 0.7392 0.0335  0.0573  0.1044  748 ARG B NE  
3288 C CZ  . ARG B 157 ? 0.7767 0.9461 0.9657 0.0270  0.0634  0.1031  748 ARG B CZ  
3289 N NH1 . ARG B 157 ? 0.5033 0.6783 0.6934 0.0183  0.0600  0.1062  748 ARG B NH1 
3290 N NH2 . ARG B 157 ? 0.8524 1.0152 1.0300 0.0288  0.0723  0.0989  748 ARG B NH2 
3291 N N   . ASN B 158 ? 0.3751 0.4772 0.5081 0.0386  0.0526  0.0947  749 ASN B N   
3292 C CA  . ASN B 158 ? 0.3683 0.4615 0.4844 0.0372  0.0584  0.0898  749 ASN B CA  
3293 C C   . ASN B 158 ? 0.4202 0.4994 0.5217 0.0352  0.0534  0.0891  749 ASN B C   
3294 O O   . ASN B 158 ? 0.4348 0.5066 0.5221 0.0330  0.0557  0.0860  749 ASN B O   
3295 C CB  . ASN B 158 ? 0.3238 0.4237 0.4361 0.0308  0.0622  0.0908  749 ASN B CB  
3296 C CG  . ASN B 158 ? 0.5403 0.6537 0.6650 0.0326  0.0695  0.0906  749 ASN B CG  
3297 O OD1 . ASN B 158 ? 0.4399 0.5569 0.5726 0.0395  0.0741  0.0870  749 ASN B OD1 
3298 N ND2 . ASN B 158 ? 0.4321 0.5545 0.5607 0.0263  0.0706  0.0938  749 ASN B ND2 
3299 N N   . ILE B 159 ? 0.3709 0.4474 0.4768 0.0354  0.0460  0.0929  750 ILE B N   
3300 C CA  . ILE B 159 ? 0.3638 0.4294 0.4588 0.0329  0.0411  0.0932  750 ILE B CA  
3301 C C   . ILE B 159 ? 0.4250 0.4801 0.5248 0.0392  0.0396  0.0918  750 ILE B C   
3302 O O   . ILE B 159 ? 0.4181 0.4760 0.5331 0.0438  0.0370  0.0946  750 ILE B O   
3303 C CB  . ILE B 159 ? 0.3886 0.4601 0.4819 0.0256  0.0338  0.0990  750 ILE B CB  
3304 C CG1 . ILE B 159 ? 0.4016 0.4793 0.4878 0.0201  0.0361  0.0963  750 ILE B CG1 
3305 C CG2 . ILE B 159 ? 0.3520 0.4144 0.4364 0.0226  0.0289  0.1004  750 ILE B CG2 
3306 C CD1 . ILE B 159 ? 0.5769 0.6666 0.6681 0.0149  0.0317  0.0998  750 ILE B CD1 
3307 N N   . LEU B 160 ? 0.4092 0.4523 0.4977 0.0398  0.0411  0.0867  751 LEU B N   
3308 C CA  . LEU B 160 ? 0.4194 0.4502 0.5118 0.0453  0.0393  0.0836  751 LEU B CA  
3309 C C   . LEU B 160 ? 0.4533 0.4754 0.5415 0.0401  0.0311  0.0887  751 LEU B C   
3310 O O   . LEU B 160 ? 0.4402 0.4654 0.5180 0.0328  0.0294  0.0912  751 LEU B O   
3311 C CB  . LEU B 160 ? 0.4216 0.4457 0.5050 0.0493  0.0463  0.0735  751 LEU B CB  
3312 C CG  . LEU B 160 ? 0.4600 0.4943 0.5478 0.0541  0.0555  0.0684  751 LEU B CG  
3313 C CD1 . LEU B 160 ? 0.4623 0.4924 0.5347 0.0546  0.0620  0.0600  751 LEU B CD1 
3314 C CD2 . LEU B 160 ? 0.4453 0.4827 0.5533 0.0627  0.0563  0.0660  751 LEU B CD2 
3315 N N   . VAL B 161 ? 0.4298 0.4421 0.5282 0.0438  0.0257  0.0907  752 VAL B N   
3316 C CA  . VAL B 161 ? 0.4286 0.4323 0.5253 0.0379  0.0170  0.0979  752 VAL B CA  
3317 C C   . VAL B 161 ? 0.5040 0.4899 0.6006 0.0414  0.0156  0.0917  752 VAL B C   
3318 O O   . VAL B 161 ? 0.4912 0.4702 0.5989 0.0502  0.0169  0.0858  752 VAL B O   
3319 C CB  . VAL B 161 ? 0.4619 0.4693 0.5722 0.0370  0.0085  0.1096  752 VAL B CB  
3320 C CG1 . VAL B 161 ? 0.4540 0.4564 0.5589 0.0275  -0.0003 0.1196  752 VAL B CG1 
3321 C CG2 . VAL B 161 ? 0.4372 0.4628 0.5504 0.0353  0.0101  0.1133  752 VAL B CG2 
3322 N N   . ASN B 162 ? 0.4816 0.4608 0.5671 0.0344  0.0128  0.0925  753 ASN B N   
3323 C CA  . ASN B 162 ? 0.4908 0.4527 0.5762 0.0363  0.0104  0.0866  753 ASN B CA  
3324 C C   . ASN B 162 ? 0.5674 0.5178 0.6631 0.0328  -0.0003 0.0965  753 ASN B C   
3325 O O   . ASN B 162 ? 0.5521 0.5096 0.6533 0.0288  -0.0056 0.1086  753 ASN B O   
3326 C CB  . ASN B 162 ? 0.4140 0.3747 0.4827 0.0312  0.0133  0.0803  753 ASN B CB  
3327 C CG  . ASN B 162 ? 0.5215 0.4868 0.5830 0.0202  0.0090  0.0878  753 ASN B CG  
3328 O OD1 . ASN B 162 ? 0.4915 0.4596 0.5579 0.0144  0.0031  0.0986  753 ASN B OD1 
3329 N ND2 . ASN B 162 ? 0.4704 0.4375 0.5203 0.0170  0.0115  0.0820  753 ASN B ND2 
3330 N N   . SER B 163 ? 0.5565 0.4888 0.6544 0.0336  -0.0042 0.0920  754 SER B N   
3331 C CA  . SER B 163 ? 0.5755 0.4930 0.6842 0.0300  -0.0154 0.1016  754 SER B CA  
3332 C C   . SER B 163 ? 0.6161 0.5400 0.7174 0.0161  -0.0211 0.1158  754 SER B C   
3333 O O   . SER B 163 ? 0.6065 0.5229 0.7165 0.0116  -0.0308 0.1284  754 SER B O   
3334 C CB  . SER B 163 ? 0.6207 0.5171 0.7323 0.0329  -0.0180 0.0916  754 SER B CB  
3335 O OG  . SER B 163 ? 0.7212 0.6185 0.8165 0.0259  -0.0150 0.0862  754 SER B OG  
3336 N N   . ASN B 164 ? 0.5678 0.5064 0.6537 0.0093  -0.0154 0.1141  755 ASN B N   
3337 C CA  . ASN B 164 ? 0.5581 0.5074 0.6364 -0.0039 -0.0188 0.1253  755 ASN B CA  
3338 C C   . ASN B 164 ? 0.5946 0.5649 0.6694 -0.0066 -0.0164 0.1314  755 ASN B C   
3339 O O   . ASN B 164 ? 0.6032 0.5872 0.6692 -0.0170 -0.0164 0.1369  755 ASN B O   
3340 C CB  . ASN B 164 ? 0.5551 0.5066 0.6218 -0.0103 -0.0157 0.1187  755 ASN B CB  
3341 C CG  . ASN B 164 ? 0.8985 0.8301 0.9691 -0.0125 -0.0215 0.1169  755 ASN B CG  
3342 O OD1 . ASN B 164 ? 0.9634 0.8846 1.0416 -0.0182 -0.0301 0.1277  755 ASN B OD1 
3343 N ND2 . ASN B 164 ? 0.7467 0.6717 0.8124 -0.0082 -0.0177 0.1037  755 ASN B ND2 
3344 N N   . LEU B 165 ? 0.5328 0.5066 0.6152 0.0024  -0.0142 0.1300  756 LEU B N   
3345 C CA  . LEU B 165 ? 0.5073 0.4998 0.5888 0.0009  -0.0128 0.1349  756 LEU B CA  
3346 C C   . LEU B 165 ? 0.5011 0.5086 0.5708 -0.0009 -0.0044 0.1268  756 LEU B C   
3347 O O   . LEU B 165 ? 0.4991 0.5227 0.5657 -0.0051 -0.0038 0.1303  756 LEU B O   
3348 C CB  . LEU B 165 ? 0.5189 0.5182 0.6004 -0.0096 -0.0217 0.1511  756 LEU B CB  
3349 C CG  . LEU B 165 ? 0.5958 0.5795 0.6905 -0.0091 -0.0328 0.1629  756 LEU B CG  
3350 C CD1 . LEU B 165 ? 0.6106 0.6036 0.7007 -0.0221 -0.0413 0.1802  756 LEU B CD1 
3351 C CD2 . LEU B 165 ? 0.6213 0.6012 0.7323 0.0030  -0.0344 0.1618  756 LEU B CD2 
3352 N N   . VAL B 166 ? 0.4498 0.4518 0.5134 0.0022  0.0013  0.1157  757 VAL B N   
3353 C CA  . VAL B 166 ? 0.4237 0.4371 0.4779 0.0015  0.0082  0.1080  757 VAL B CA  
3354 C C   . VAL B 166 ? 0.4519 0.4691 0.5104 0.0096  0.0132  0.1036  757 VAL B C   
3355 O O   . VAL B 166 ? 0.4322 0.4400 0.4964 0.0176  0.0152  0.0994  757 VAL B O   
3356 C CB  . VAL B 166 ? 0.4679 0.4750 0.5142 0.0008  0.0107  0.0996  757 VAL B CB  
3357 C CG1 . VAL B 166 ? 0.4310 0.4494 0.4701 0.0006  0.0160  0.0929  757 VAL B CG1 
3358 C CG2 . VAL B 166 ? 0.4686 0.4741 0.5127 -0.0085 0.0055  0.1047  757 VAL B CG2 
3359 N N   . CYS B 167 ? 0.4085 0.4405 0.4652 0.0070  0.0153  0.1044  758 CYS B N   
3360 C CA  . CYS B 167 ? 0.4005 0.4382 0.4619 0.0126  0.0198  0.1014  758 CYS B CA  
3361 C C   . CYS B 167 ? 0.4331 0.4722 0.4870 0.0139  0.0259  0.0931  758 CYS B C   
3362 O O   . CYS B 167 ? 0.4242 0.4679 0.4710 0.0091  0.0259  0.0907  758 CYS B O   
3363 C CB  . CYS B 167 ? 0.3944 0.4461 0.4600 0.0086  0.0169  0.1077  758 CYS B CB  
3364 S SG  . CYS B 167 ? 0.4488 0.4988 0.5245 0.0075  0.0080  0.1199  758 CYS B SG  
3365 N N   . LYS B 168 ? 0.3805 0.4159 0.4364 0.0205  0.0308  0.0889  759 LYS B N   
3366 C CA  . LYS B 168 ? 0.3544 0.3894 0.4026 0.0214  0.0357  0.0829  759 LYS B CA  
3367 C C   . LYS B 168 ? 0.3960 0.4376 0.4490 0.0241  0.0405  0.0826  759 LYS B C   
3368 O O   . LYS B 168 ? 0.3741 0.4173 0.4358 0.0285  0.0425  0.0837  759 LYS B O   
3369 C CB  . LYS B 168 ? 0.3735 0.3966 0.4145 0.0247  0.0373  0.0774  759 LYS B CB  
3370 C CG  . LYS B 168 ? 0.3389 0.3546 0.3777 0.0217  0.0321  0.0781  759 LYS B CG  
3371 C CD  . LYS B 168 ? 0.3908 0.3962 0.4212 0.0232  0.0327  0.0717  759 LYS B CD  
3372 C CE  . LYS B 168 ? 0.4361 0.4346 0.4670 0.0191  0.0269  0.0733  759 LYS B CE  
3373 N NZ  . LYS B 168 ? 0.3996 0.3935 0.4214 0.0171  0.0259  0.0679  759 LYS B NZ  
3374 N N   . VAL B 169 ? 0.3820 0.4272 0.4304 0.0215  0.0421  0.0810  760 VAL B N   
3375 C CA  . VAL B 169 ? 0.3854 0.4359 0.4370 0.0221  0.0464  0.0814  760 VAL B CA  
3376 C C   . VAL B 169 ? 0.4271 0.4725 0.4741 0.0264  0.0521  0.0786  760 VAL B C   
3377 O O   . VAL B 169 ? 0.4135 0.4505 0.4500 0.0272  0.0522  0.0752  760 VAL B O   
3378 C CB  . VAL B 169 ? 0.4248 0.4778 0.4735 0.0176  0.0451  0.0805  760 VAL B CB  
3379 C CG1 . VAL B 169 ? 0.4244 0.4820 0.4778 0.0169  0.0487  0.0823  760 VAL B CG1 
3380 C CG2 . VAL B 169 ? 0.4154 0.4755 0.4675 0.0132  0.0402  0.0807  760 VAL B CG2 
3381 N N   . SER B 170 ? 0.3887 0.4410 0.4434 0.0288  0.0570  0.0795  761 SER B N   
3382 C CA  . SER B 170 ? 0.4014 0.4528 0.4514 0.0322  0.0640  0.0761  761 SER B CA  
3383 C C   . SER B 170 ? 0.4543 0.5169 0.5102 0.0302  0.0693  0.0790  761 SER B C   
3384 O O   . SER B 170 ? 0.4366 0.5045 0.4988 0.0260  0.0665  0.0832  761 SER B O   
3385 C CB  . SER B 170 ? 0.4142 0.4632 0.4701 0.0388  0.0656  0.0719  761 SER B CB  
3386 O OG  . SER B 170 ? 0.4549 0.5135 0.5280 0.0417  0.0662  0.0742  761 SER B OG  
3387 N N   . ASP B 171 ? 0.4586 0.5255 0.5121 0.0325  0.0771  0.0764  762 ASP B N   
3388 C CA  . ASP B 171 ? 0.4584 0.5383 0.5175 0.0299  0.0839  0.0792  762 ASP B CA  
3389 C C   . ASP B 171 ? 0.4805 0.5585 0.5327 0.0220  0.0818  0.0853  762 ASP B C   
3390 O O   . ASP B 171 ? 0.4554 0.5385 0.5179 0.0180  0.0789  0.0895  762 ASP B O   
3391 C CB  . ASP B 171 ? 0.4837 0.5760 0.5639 0.0323  0.0842  0.0807  762 ASP B CB  
3392 C CG  . ASP B 171 ? 0.7330 0.8412 0.8227 0.0335  0.0937  0.0796  762 ASP B CG  
3393 O OD1 . ASP B 171 ? 0.7505 0.8652 0.8365 0.0271  0.0979  0.0837  762 ASP B OD1 
3394 O OD2 . ASP B 171 ? 0.9169 1.0316 1.0193 0.0408  0.0966  0.0748  762 ASP B OD2 
3395 N N   . PHE B 172 ? 0.4311 0.5010 0.4666 0.0197  0.0821  0.0855  763 PHE B N   
3396 C CA  . PHE B 172 ? 0.4271 0.4915 0.4563 0.0130  0.0782  0.0915  763 PHE B CA  
3397 C C   . PHE B 172 ? 0.5049 0.5771 0.5321 0.0069  0.0841  0.0976  763 PHE B C   
3398 O O   . PHE B 172 ? 0.5243 0.5899 0.5461 0.0011  0.0800  0.1037  763 PHE B O   
3399 C CB  . PHE B 172 ? 0.4448 0.4958 0.4588 0.0133  0.0728  0.0899  763 PHE B CB  
3400 C CG  . PHE B 172 ? 0.4576 0.5025 0.4752 0.0170  0.0666  0.0853  763 PHE B CG  
3401 C CD1 . PHE B 172 ? 0.4977 0.5393 0.5112 0.0220  0.0673  0.0795  763 PHE B CD1 
3402 C CD2 . PHE B 172 ? 0.4607 0.5043 0.4864 0.0149  0.0603  0.0863  763 PHE B CD2 
3403 C CE1 . PHE B 172 ? 0.4891 0.5261 0.5061 0.0237  0.0616  0.0768  763 PHE B CE1 
3404 C CE2 . PHE B 172 ? 0.4878 0.5288 0.5159 0.0170  0.0555  0.0824  763 PHE B CE2 
3405 C CZ  . PHE B 172 ? 0.4588 0.4966 0.4825 0.0209  0.0561  0.0787  763 PHE B CZ  
3406 N N   . GLY B 173 ? 0.4754 0.5621 0.5097 0.0080  0.0929  0.0965  764 GLY B N   
3407 C CA  . GLY B 173 ? 0.4968 0.5952 0.5309 0.0014  0.1001  0.1024  764 GLY B CA  
3408 C C   . GLY B 173 ? 0.5684 0.6663 0.6108 -0.0070 0.0956  0.1112  764 GLY B C   
3409 O O   . GLY B 173 ? 0.5702 0.6656 0.6038 -0.0147 0.0959  0.1190  764 GLY B O   
3410 N N   . LEU B 174 ? 0.5212 0.6199 0.5797 -0.0060 0.0903  0.1102  765 LEU B N   
3411 C CA  . LEU B 174 ? 0.5059 0.6032 0.5742 -0.0136 0.0849  0.1162  765 LEU B CA  
3412 C C   . LEU B 174 ? 0.5142 0.5931 0.5764 -0.0150 0.0745  0.1167  765 LEU B C   
3413 O O   . LEU B 174 ? 0.5057 0.5803 0.5754 -0.0211 0.0692  0.1206  765 LEU B O   
3414 C CB  . LEU B 174 ? 0.4922 0.6015 0.5806 -0.0125 0.0839  0.1140  765 LEU B CB  
3415 C CG  . LEU B 174 ? 0.5562 0.6860 0.6564 -0.0120 0.0934  0.1144  765 LEU B CG  
3416 C CD1 . LEU B 174 ? 0.5374 0.6781 0.6575 -0.0097 0.0903  0.1123  765 LEU B CD1 
3417 C CD2 . LEU B 174 ? 0.5983 0.7362 0.6990 -0.0220 0.0990  0.1226  765 LEU B CD2 
3418 N N   . SER B 175 ? 0.4417 0.5100 0.4917 -0.0094 0.0715  0.1122  766 SER B N   
3419 C CA  . SER B 175 ? 0.4307 0.4840 0.4773 -0.0094 0.0620  0.1110  766 SER B CA  
3420 C C   . SER B 175 ? 0.5089 0.5523 0.5500 -0.0157 0.0582  0.1188  766 SER B C   
3421 O O   . SER B 175 ? 0.5123 0.5574 0.5426 -0.0190 0.0629  0.1250  766 SER B O   
3422 C CB  . SER B 175 ? 0.4411 0.4877 0.4779 -0.0027 0.0598  0.1046  766 SER B CB  
3423 O OG  . SER B 175 ? 0.4604 0.5133 0.5046 0.0020  0.0603  0.0986  766 SER B OG  
3424 N N   . ARG B 176 ? 0.4723 0.5057 0.5214 -0.0178 0.0495  0.1185  767 ARG B N   
3425 C CA  . ARG B 176 ? 0.4813 0.5026 0.5286 -0.0238 0.0436  0.1268  767 ARG B CA  
3426 C C   . ARG B 176 ? 0.5441 0.5507 0.5943 -0.0205 0.0331  0.1225  767 ARG B C   
3427 O O   . ARG B 176 ? 0.5079 0.5155 0.5685 -0.0172 0.0298  0.1133  767 ARG B O   
3428 C CB  . ARG B 176 ? 0.4324 0.4571 0.4927 -0.0322 0.0438  0.1330  767 ARG B CB  
3429 C CG  . ARG B 176 ? 0.5367 0.5782 0.5971 -0.0367 0.0544  0.1382  767 ARG B CG  
3430 C CD  . ARG B 176 ? 0.4563 0.4984 0.5012 -0.0418 0.0591  0.1485  767 ARG B CD  
3431 N NE  . ARG B 176 ? 0.4823 0.5440 0.5299 -0.0461 0.0703  0.1518  767 ARG B NE  
3432 C CZ  . ARG B 176 ? 0.6308 0.7071 0.6740 -0.0406 0.0801  0.1460  767 ARG B CZ  
3433 N NH1 . ARG B 176 ? 0.5233 0.5952 0.5574 -0.0313 0.0796  0.1375  767 ARG B NH1 
3434 N NH2 . ARG B 176 ? 0.6011 0.6967 0.6501 -0.0444 0.0902  0.1482  767 ARG B NH2 
3435 N N   . TYR B 177 ? 0.5712 0.5653 0.6133 -0.0220 0.0274  0.1293  768 TYR B N   
3436 C CA  . TYR B 177 ? 0.5954 0.5751 0.6429 -0.0186 0.0163  0.1261  768 TYR B CA  
3437 C C   . TYR B 177 ? 0.6381 0.6096 0.7027 -0.0234 0.0097  0.1274  768 TYR B C   
3438 O O   . TYR B 177 ? 0.6632 0.6320 0.7287 -0.0316 0.0099  0.1384  768 TYR B O   
3439 C CB  . TYR B 177 ? 0.6562 0.6258 0.6903 -0.0191 0.0113  0.1348  768 TYR B CB  
3440 C CG  . TYR B 177 ? 0.7017 0.6583 0.7429 -0.0138 -0.0004 0.1306  768 TYR B CG  
3441 C CD1 . TYR B 177 ? 0.7052 0.6656 0.7462 -0.0059 -0.0010 0.1193  768 TYR B CD1 
3442 C CD2 . TYR B 177 ? 0.7390 0.6799 0.7889 -0.0168 -0.0111 0.1379  768 TYR B CD2 
3443 C CE1 . TYR B 177 ? 0.6973 0.6488 0.7475 -0.0006 -0.0111 0.1142  768 TYR B CE1 
3444 C CE2 . TYR B 177 ? 0.7556 0.6853 0.8154 -0.0106 -0.0223 0.1329  768 TYR B CE2 
3445 C CZ  . TYR B 177 ? 0.8379 0.7744 0.8982 -0.0023 -0.0218 0.1205  768 TYR B CZ  
3446 O OH  . TYR B 177 ? 0.8539 0.7824 0.9260 0.0041  -0.0321 0.1146  768 TYR B OH  
3447 N N   . LEU B 178 ? 0.5686 0.5373 0.6470 -0.0190 0.0042  0.1156  769 LEU B N   
3448 C CA  . LEU B 178 ? 0.6135 0.5744 0.7094 -0.0228 -0.0023 0.1133  769 LEU B CA  
3449 C C   . LEU B 178 ? 1.2299 1.1706 1.3327 -0.0236 -0.0140 0.1189  769 LEU B C   
3450 O O   . LEU B 178 ? 0.8520 0.7856 0.9551 -0.0169 -0.0202 0.1147  769 LEU B O   
3451 C CB  . LEU B 178 ? 0.5949 0.5636 0.7021 -0.0184 -0.0026 0.0969  769 LEU B CB  
3452 C CG  . LEU B 178 ? 0.6404 0.6282 0.7436 -0.0184 0.0067  0.0923  769 LEU B CG  
3453 C CD1 . LEU B 178 ? 0.6299 0.6253 0.7369 -0.0128 0.0060  0.0777  769 LEU B CD1 
3454 C CD2 . LEU B 178 ? 0.6945 0.6883 0.8062 -0.0259 0.0090  0.0957  769 LEU B CD2 
3455 N N   . PRO B 185 ? 0.6235 0.5692 0.8025 -0.0222 -0.0304 0.0504  776 PRO B N   
3456 C CA  . PRO B 185 ? 0.5975 0.5458 0.7594 -0.0228 -0.0243 0.0670  776 PRO B CA  
3457 C C   . PRO B 185 ? 0.5834 0.5480 0.7374 -0.0291 -0.0152 0.0736  776 PRO B C   
3458 O O   . PRO B 185 ? 0.5467 0.5280 0.6969 -0.0274 -0.0097 0.0654  776 PRO B O   
3459 C CB  . PRO B 185 ? 0.5986 0.5539 0.7517 -0.0134 -0.0218 0.0599  776 PRO B CB  
3460 C CG  . PRO B 185 ? 0.6622 0.6210 0.8282 -0.0083 -0.0255 0.0398  776 PRO B CG  
3461 C CD  . PRO B 185 ? 0.6230 0.5819 0.8009 -0.0146 -0.0279 0.0332  776 PRO B CD  
3462 N N   . THR B 186 ? 0.5455 0.5053 0.6991 -0.0371 -0.0144 0.0883  777 THR B N   
3463 C CA  . THR B 186 ? 0.5365 0.5109 0.6881 -0.0442 -0.0070 0.0952  777 THR B CA  
3464 C C   . THR B 186 ? 0.6020 0.5770 0.7422 -0.0484 -0.0014 0.1126  777 THR B C   
3465 O O   . THR B 186 ? 0.6077 0.5674 0.7459 -0.0512 -0.0062 0.1228  777 THR B O   
3466 C CB  . THR B 186 ? 0.5823 0.5515 0.7515 -0.0530 -0.0130 0.0936  777 THR B CB  
3467 O OG1 . THR B 186 ? 0.6226 0.5924 0.8014 -0.0495 -0.0181 0.0755  777 THR B OG1 
3468 C CG2 . THR B 186 ? 0.5300 0.5154 0.7011 -0.0614 -0.0064 0.1011  777 THR B CG2 
3469 N N   . PTR B 187 ? 0.5285 0.5221 0.6621 -0.0494 0.0086  0.1157  778 PTR B N   
3470 C CA  . PTR B 187 ? 0.5138 0.5137 0.6381 -0.0543 0.0161  0.1298  778 PTR B CA  
3471 C C   . PTR B 187 ? 0.5078 0.5191 0.6447 -0.0637 0.0189  0.1339  778 PTR B C   
3472 O O   . PTR B 187 ? 0.4866 0.5127 0.6301 -0.0623 0.0218  0.1263  778 PTR B O   
3473 C CB  . PTR B 187 ? 0.5039 0.5153 0.6119 -0.0472 0.0252  0.1296  778 PTR B CB  
3474 C CG  . PTR B 187 ? 0.5158 0.5375 0.6171 -0.0533 0.0340  0.1418  778 PTR B CG  
3475 C CD1 . PTR B 187 ? 0.5374 0.5512 0.6266 -0.0582 0.0343  0.1544  778 PTR B CD1 
3476 C CD2 . PTR B 187 ? 0.5129 0.5549 0.6210 -0.0543 0.0421  0.1398  778 PTR B CD2 
3477 C CE1 . PTR B 187 ? 0.5741 0.6022 0.6572 -0.0648 0.0442  0.1641  778 PTR B CE1 
3478 C CE2 . PTR B 187 ? 0.5287 0.5844 0.6341 -0.0594 0.0513  0.1485  778 PTR B CE2 
3479 C CZ  . PTR B 187 ? 0.5976 0.6478 0.6900 -0.0648 0.0535  0.1599  778 PTR B CZ  
3480 O OH  . PTR B 187 ? 0.6892 0.7595 0.7817 -0.0696 0.0647  0.1654  778 PTR B OH  
3481 P P   . PTR B 187 ? 0.7549 0.8312 0.8321 -0.0763 0.0724  0.1768  778 PTR B P   
3482 O O1P . PTR B 187 ? 0.7764 0.8766 0.8536 -0.0704 0.0854  0.1699  778 PTR B O1P 
3483 O O2P . PTR B 187 ? 0.7790 0.8567 0.8656 -0.0908 0.0712  0.1897  778 PTR B O2P 
3484 O O3P . PTR B 187 ? 0.7701 0.8308 0.8264 -0.0738 0.0684  0.1802  778 PTR B O3P 
3485 N N   . THR B 188 ? 0.4671 0.4720 0.6076 -0.0740 0.0174  0.1467  779 THR B N   
3486 C CA  . THR B 188 ? 0.4596 0.4755 0.6131 -0.0848 0.0199  0.1526  779 THR B CA  
3487 C C   . THR B 188 ? 0.5057 0.5395 0.6502 -0.0888 0.0321  0.1639  779 THR B C   
3488 O O   . THR B 188 ? 0.5118 0.5394 0.6445 -0.0929 0.0338  0.1757  779 THR B O   
3489 C CB  . THR B 188 ? 0.4849 0.4811 0.6509 -0.0949 0.0092  0.1590  779 THR B CB  
3490 O OG1 . THR B 188 ? 0.4912 0.4728 0.6665 -0.0896 -0.0013 0.1451  779 THR B OG1 
3491 C CG2 . THR B 188 ? 0.4277 0.4348 0.6087 -0.1079 0.0108  0.1656  779 THR B CG2 
3492 N N   . SER B 189 ? 0.4384 0.4953 0.5891 -0.0879 0.0404  0.1603  780 SER B N   
3493 C CA  . SER B 189 ? 0.4262 0.5026 0.5717 -0.0913 0.0527  0.1688  780 SER B CA  
3494 C C   . SER B 189 ? 0.4768 0.5628 0.6376 -0.1054 0.0540  0.1783  780 SER B C   
3495 O O   . SER B 189 ? 0.4832 0.5586 0.6578 -0.1119 0.0445  0.1777  780 SER B O   
3496 C CB  . SER B 189 ? 0.4454 0.5419 0.5911 -0.0813 0.0609  0.1596  780 SER B CB  
3497 O OG  . SER B 189 ? 0.5079 0.6199 0.6728 -0.0839 0.0607  0.1557  780 SER B OG  
3498 N N   . SER B 190 ? 0.4292 0.5358 0.5883 -0.1109 0.0657  0.1865  781 SER B N   
3499 C CA  . SER B 190 ? 0.4256 0.5453 0.6017 -0.1249 0.0676  0.1952  781 SER B CA  
3500 C C   . SER B 190 ? 0.4244 0.5580 0.6214 -0.1219 0.0653  0.1843  781 SER B C   
3501 O O   . SER B 190 ? 0.3991 0.5402 0.5946 -0.1095 0.0672  0.1733  781 SER B O   
3502 C CB  . SER B 190 ? 0.4508 0.5937 0.6215 -0.1315 0.0818  0.2051  781 SER B CB  
3503 O OG  . SER B 190 ? 0.6287 0.7916 0.7964 -0.1195 0.0923  0.1954  781 SER B OG  
3504 N N   . LEU B 191 ? 0.3731 0.5062 0.5885 -0.1334 0.0588  0.1876  782 LEU B N   
3505 C CA  . LEU B 191 ? 0.3544 0.4987 0.5890 -0.1327 0.0540  0.1781  782 LEU B CA  
3506 C C   . LEU B 191 ? 0.4275 0.6038 0.6708 -0.1268 0.0644  0.1744  782 LEU B C   
3507 O O   . LEU B 191 ? 0.4282 0.6112 0.6786 -0.1189 0.0605  0.1641  782 LEU B O   
3508 C CB  . LEU B 191 ? 0.3602 0.4998 0.6135 -0.1486 0.0459  0.1838  782 LEU B CB  
3509 C CG  . LEU B 191 ? 0.3974 0.5407 0.6680 -0.1485 0.0366  0.1721  782 LEU B CG  
3510 C CD1 . LEU B 191 ? 0.4122 0.5356 0.6732 -0.1371 0.0273  0.1579  782 LEU B CD1 
3511 C CD2 . LEU B 191 ? 0.4054 0.5452 0.6951 -0.1653 0.0292  0.1778  782 LEU B CD2 
3512 N N   . GLY B 192 ? 0.4127 0.6079 0.6546 -0.1299 0.0771  0.1824  783 GLY B N   
3513 C CA  . GLY B 192 ? 0.4019 0.6281 0.6542 -0.1237 0.0877  0.1786  783 GLY B CA  
3514 C C   . GLY B 192 ? 0.4365 0.6644 0.6749 -0.1073 0.0937  0.1704  783 GLY B C   
3515 O O   . GLY B 192 ? 0.4392 0.6912 0.6872 -0.1010 0.1024  0.1667  783 GLY B O   
3516 N N   . GLY B 193 ? 0.4041 0.6069 0.6216 -0.1007 0.0889  0.1675  784 GLY B N   
3517 C CA  . GLY B 193 ? 0.4035 0.6042 0.6064 -0.0863 0.0933  0.1600  784 GLY B CA  
3518 C C   . GLY B 193 ? 0.4636 0.6750 0.6777 -0.0751 0.0911  0.1501  784 GLY B C   
3519 O O   . GLY B 193 ? 0.4287 0.6349 0.6514 -0.0755 0.0809  0.1461  784 GLY B O   
3520 N N   . LYS B 194 ? 0.4427 0.6694 0.6572 -0.0654 0.1005  0.1459  785 LYS B N   
3521 C CA  . LYS B 194 ? 0.4231 0.6604 0.6494 -0.0542 0.0987  0.1381  785 LYS B CA  
3522 C C   . LYS B 194 ? 0.4574 0.6731 0.6691 -0.0458 0.0901  0.1322  785 LYS B C   
3523 O O   . LYS B 194 ? 0.4760 0.6746 0.6674 -0.0433 0.0912  0.1317  785 LYS B O   
3524 C CB  . LYS B 194 ? 0.4509 0.7077 0.6819 -0.0459 0.1110  0.1347  785 LYS B CB  
3525 C CG  . LYS B 194 ? 0.4799 0.7561 0.7346 -0.0378 0.1096  0.1299  785 LYS B CG  
3526 C CD  . LYS B 194 ? 0.5929 0.8920 0.8585 -0.0306 0.1225  0.1258  785 LYS B CD  
3527 C CE  . LYS B 194 ? 0.8427 1.1622 1.1370 -0.0238 0.1192  0.1226  785 LYS B CE  
3528 N NZ  . LYS B 194 ? 1.0145 1.3590 1.3251 -0.0160 0.1317  0.1171  785 LYS B NZ  
3529 N N   . ILE B 195 ? 0.3806 0.5985 0.6024 -0.0425 0.0811  0.1283  786 ILE B N   
3530 C CA  . ILE B 195 ? 0.3655 0.5667 0.5751 -0.0357 0.0727  0.1228  786 ILE B CA  
3531 C C   . ILE B 195 ? 0.4054 0.6175 0.6253 -0.0265 0.0698  0.1194  786 ILE B C   
3532 O O   . ILE B 195 ? 0.4015 0.6340 0.6420 -0.0269 0.0705  0.1210  786 ILE B O   
3533 C CB  . ILE B 195 ? 0.4016 0.5900 0.6087 -0.0433 0.0619  0.1217  786 ILE B CB  
3534 C CG1 . ILE B 195 ? 0.4065 0.6104 0.6342 -0.0516 0.0572  0.1235  786 ILE B CG1 
3535 C CG2 . ILE B 195 ? 0.4073 0.5769 0.6009 -0.0492 0.0622  0.1242  786 ILE B CG2 
3536 C CD1 . ILE B 195 ? 0.4115 0.6120 0.6409 -0.0540 0.0461  0.1187  786 ILE B CD1 
3537 N N   . PRO B 196 ? 0.3630 0.5625 0.5705 -0.0189 0.0654  0.1155  787 PRO B N   
3538 C CA  . PRO B 196 ? 0.3382 0.5459 0.5555 -0.0119 0.0598  0.1144  787 PRO B CA  
3539 C C   . PRO B 196 ? 0.3852 0.5947 0.6059 -0.0186 0.0484  0.1145  787 PRO B C   
3540 O O   . PRO B 196 ? 0.4014 0.5983 0.6081 -0.0194 0.0421  0.1116  787 PRO B O   
3541 C CB  . PRO B 196 ? 0.3492 0.5406 0.5492 -0.0038 0.0598  0.1112  787 PRO B CB  
3542 C CG  . PRO B 196 ? 0.4027 0.5766 0.5835 -0.0084 0.0607  0.1098  787 PRO B CG  
3543 C CD  . PRO B 196 ? 0.3674 0.5449 0.5526 -0.0176 0.0638  0.1129  787 PRO B CD  
3544 N N   . VAL B 197 ? 0.3501 0.5764 0.5893 -0.0244 0.0462  0.1170  788 VAL B N   
3545 C CA  . VAL B 197 ? 0.3438 0.5745 0.5880 -0.0327 0.0359  0.1163  788 VAL B CA  
3546 C C   . VAL B 197 ? 0.3954 0.6211 0.6294 -0.0305 0.0259  0.1138  788 VAL B C   
3547 O O   . VAL B 197 ? 0.3906 0.6077 0.6139 -0.0366 0.0204  0.1094  788 VAL B O   
3548 C CB  . VAL B 197 ? 0.3645 0.6188 0.6342 -0.0371 0.0344  0.1198  788 VAL B CB  
3549 C CG1 . VAL B 197 ? 0.3557 0.6161 0.6301 -0.0448 0.0220  0.1184  788 VAL B CG1 
3550 C CG2 . VAL B 197 ? 0.3566 0.6160 0.6346 -0.0438 0.0433  0.1225  788 VAL B CG2 
3551 N N   . ARG B 198 ? 0.3408 0.5722 0.5784 -0.0224 0.0236  0.1164  789 ARG B N   
3552 C CA  . ARG B 198 ? 0.3417 0.5717 0.5705 -0.0227 0.0133  0.1164  789 ARG B CA  
3553 C C   . ARG B 198 ? 0.3798 0.5911 0.5850 -0.0213 0.0139  0.1124  789 ARG B C   
3554 O O   . ARG B 198 ? 0.3476 0.5589 0.5430 -0.0241 0.0062  0.1115  789 ARG B O   
3555 C CB  . ARG B 198 ? 0.3525 0.5951 0.5951 -0.0164 0.0076  0.1225  789 ARG B CB  
3556 C CG  . ARG B 198 ? 0.4334 0.6702 0.6787 -0.0049 0.0134  0.1244  789 ARG B CG  
3557 C CD  . ARG B 198 ? 0.3922 0.6444 0.6603 0.0013  0.0079  0.1302  789 ARG B CD  
3558 N NE  . ARG B 198 ? 0.4083 0.6798 0.6994 -0.0006 0.0108  0.1306  789 ARG B NE  
3559 C CZ  . ARG B 198 ? 0.5819 0.8725 0.8935 -0.0019 0.0021  0.1351  789 ARG B CZ  
3560 N NH1 . ARG B 198 ? 0.3613 0.6537 0.6724 -0.0011 -0.0108 0.1407  789 ARG B NH1 
3561 N NH2 . ARG B 198 ? 0.3369 0.6459 0.6700 -0.0045 0.0058  0.1349  789 ARG B NH2 
3562 N N   . TRP B 199 ? 0.3596 0.5569 0.5555 -0.0182 0.0228  0.1099  790 TRP B N   
3563 C CA  . TRP B 199 ? 0.3648 0.5450 0.5403 -0.0172 0.0237  0.1056  790 TRP B CA  
3564 C C   . TRP B 199 ? 0.3920 0.5632 0.5608 -0.0237 0.0246  0.1001  790 TRP B C   
3565 O O   . TRP B 199 ? 0.4001 0.5594 0.5549 -0.0236 0.0240  0.0953  790 TRP B O   
3566 C CB  . TRP B 199 ? 0.3442 0.5141 0.5138 -0.0089 0.0314  0.1064  790 TRP B CB  
3567 C CG  . TRP B 199 ? 0.3496 0.5219 0.5226 -0.0018 0.0290  0.1100  790 TRP B CG  
3568 C CD1 . TRP B 199 ? 0.3772 0.5416 0.5386 0.0002  0.0247  0.1104  790 TRP B CD1 
3569 C CD2 . TRP B 199 ? 0.3495 0.5326 0.5405 0.0043  0.0303  0.1139  790 TRP B CD2 
3570 N NE1 . TRP B 199 ? 0.3633 0.5309 0.5342 0.0066  0.0221  0.1154  790 TRP B NE1 
3571 C CE2 . TRP B 199 ? 0.3845 0.5636 0.5745 0.0100  0.0253  0.1170  790 TRP B CE2 
3572 C CE3 . TRP B 199 ? 0.3691 0.5660 0.5786 0.0052  0.0352  0.1150  790 TRP B CE3 
3573 C CZ2 . TRP B 199 ? 0.3834 0.5699 0.5915 0.0177  0.0239  0.1206  790 TRP B CZ2 
3574 C CZ3 . TRP B 199 ? 0.3876 0.5945 0.6152 0.0132  0.0353  0.1176  790 TRP B CZ3 
3575 C CH2 . TRP B 199 ? 0.3966 0.5976 0.6241 0.0198  0.0291  0.1201  790 TRP B CH2 
3576 N N   . THR B 200 ? 0.3706 0.5476 0.5513 -0.0295 0.0254  0.1009  791 THR B N   
3577 C CA  . THR B 200 ? 0.3624 0.5287 0.5402 -0.0357 0.0258  0.0972  791 THR B CA  
3578 C C   . THR B 200 ? 0.4002 0.5684 0.5795 -0.0433 0.0172  0.0907  791 THR B C   
3579 O O   . THR B 200 ? 0.3916 0.5744 0.5810 -0.0473 0.0120  0.0913  791 THR B O   
3580 C CB  . THR B 200 ? 0.4132 0.5832 0.6024 -0.0387 0.0322  0.1029  791 THR B CB  
3581 O OG1 . THR B 200 ? 0.3783 0.5479 0.5639 -0.0311 0.0406  0.1066  791 THR B OG1 
3582 C CG2 . THR B 200 ? 0.3601 0.5158 0.5460 -0.0451 0.0324  0.1019  791 THR B CG2 
3583 N N   . ALA B 201 ? 0.3688 0.5225 0.5388 -0.0451 0.0155  0.0835  792 ALA B N   
3584 C CA  . ALA B 201 ? 0.3541 0.5070 0.5248 -0.0516 0.0081  0.0740  792 ALA B CA  
3585 C C   . ALA B 201 ? 0.4075 0.5656 0.5946 -0.0601 0.0052  0.0755  792 ALA B C   
3586 O O   . ALA B 201 ? 0.4040 0.5590 0.5987 -0.0615 0.0101  0.0829  792 ALA B O   
3587 C CB  . ALA B 201 ? 0.3584 0.4933 0.5205 -0.0502 0.0081  0.0664  792 ALA B CB  
3588 N N   . PRO B 202 ? 0.3491 0.5155 0.5412 -0.0668 -0.0027 0.0683  793 PRO B N   
3589 C CA  . PRO B 202 ? 0.3695 0.5414 0.5786 -0.0758 -0.0063 0.0698  793 PRO B CA  
3590 C C   . PRO B 202 ? 0.4218 0.5760 0.6368 -0.0805 -0.0054 0.0697  793 PRO B C   
3591 O O   . PRO B 202 ? 0.3897 0.5481 0.6187 -0.0869 -0.0045 0.0768  793 PRO B O   
3592 C CB  . PRO B 202 ? 0.3930 0.5759 0.6026 -0.0817 -0.0158 0.0599  793 PRO B CB  
3593 C CG  . PRO B 202 ? 0.4254 0.6040 0.6171 -0.0768 -0.0165 0.0511  793 PRO B CG  
3594 C CD  . PRO B 202 ? 0.3524 0.5263 0.5349 -0.0674 -0.0088 0.0592  793 PRO B CD  
3595 N N   . GLU B 203 ? 0.4032 0.5386 0.6090 -0.0777 -0.0061 0.0625  794 GLU B N   
3596 C CA  . GLU B 203 ? 0.4002 0.5161 0.6118 -0.0816 -0.0069 0.0636  794 GLU B CA  
3597 C C   . GLU B 203 ? 0.4301 0.5405 0.6387 -0.0787 0.0016  0.0775  794 GLU B C   
3598 O O   . GLU B 203 ? 0.4214 0.5215 0.6371 -0.0847 0.0017  0.0842  794 GLU B O   
3599 C CB  . GLU B 203 ? 0.4239 0.5222 0.6294 -0.0787 -0.0118 0.0503  794 GLU B CB  
3600 C CG  . GLU B 203 ? 0.4762 0.5669 0.6668 -0.0685 -0.0071 0.0496  794 GLU B CG  
3601 C CD  . GLU B 203 ? 0.5067 0.6114 0.6847 -0.0625 -0.0049 0.0450  794 GLU B CD  
3602 O OE1 . GLU B 203 ? 0.3606 0.4824 0.5396 -0.0657 -0.0074 0.0427  794 GLU B OE1 
3603 O OE2 . GLU B 203 ? 0.4173 0.5160 0.5842 -0.0551 -0.0012 0.0450  794 GLU B OE2 
3604 N N   . ALA B 204 ? 0.3845 0.5015 0.5821 -0.0701 0.0084  0.0816  795 ALA B N   
3605 C CA  . ALA B 204 ? 0.3749 0.4891 0.5679 -0.0671 0.0169  0.0927  795 ALA B CA  
3606 C C   . ALA B 204 ? 0.4235 0.5556 0.6295 -0.0720 0.0217  0.1019  795 ALA B C   
3607 O O   . ALA B 204 ? 0.4153 0.5458 0.6232 -0.0754 0.0275  0.1112  795 ALA B O   
3608 C CB  . ALA B 204 ? 0.3628 0.4769 0.5408 -0.0565 0.0217  0.0919  795 ALA B CB  
3609 N N   . ILE B 205 ? 0.3608 0.5114 0.5770 -0.0736 0.0184  0.0994  796 ILE B N   
3610 C CA  . ILE B 205 ? 0.3392 0.5095 0.5721 -0.0786 0.0216  0.1069  796 ILE B CA  
3611 C C   . ILE B 205 ? 0.3824 0.5480 0.6281 -0.0912 0.0178  0.1091  796 ILE B C   
3612 O O   . ILE B 205 ? 0.3659 0.5372 0.6202 -0.0970 0.0236  0.1185  796 ILE B O   
3613 C CB  . ILE B 205 ? 0.3677 0.5585 0.6090 -0.0767 0.0171  0.1041  796 ILE B CB  
3614 C CG1 . ILE B 205 ? 0.3612 0.5549 0.5910 -0.0647 0.0201  0.1037  796 ILE B CG1 
3615 C CG2 . ILE B 205 ? 0.3457 0.5583 0.6089 -0.0830 0.0185  0.1106  796 ILE B CG2 
3616 C CD1 . ILE B 205 ? 0.3706 0.5819 0.6065 -0.0624 0.0139  0.1026  796 ILE B CD1 
3617 N N   . ALA B 206 ? 0.3413 0.4967 0.5885 -0.0961 0.0079  0.1001  797 ALA B N   
3618 C CA  . ALA B 206 ? 0.3575 0.5064 0.6186 -0.1085 0.0022  0.1008  797 ALA B CA  
3619 C C   . ALA B 206 ? 0.4394 0.5676 0.6978 -0.1125 0.0044  0.1081  797 ALA B C   
3620 O O   . ALA B 206 ? 0.4384 0.5677 0.7095 -0.1234 0.0046  0.1166  797 ALA B O   
3621 C CB  . ALA B 206 ? 0.3654 0.5078 0.6282 -0.1117 -0.0091 0.0867  797 ALA B CB  
3622 N N   . TYR B 207 ? 0.3991 0.5093 0.6413 -0.1044 0.0057  0.1061  798 TYR B N   
3623 C CA  . TYR B 207 ? 0.4177 0.5064 0.6573 -0.1084 0.0051  0.1133  798 TYR B CA  
3624 C C   . TYR B 207 ? 0.4456 0.5328 0.6710 -0.1030 0.0147  0.1236  798 TYR B C   
3625 O O   . TYR B 207 ? 0.4379 0.5097 0.6605 -0.1077 0.0142  0.1324  798 TYR B O   
3626 C CB  . TYR B 207 ? 0.4390 0.5041 0.6762 -0.1059 -0.0049 0.1014  798 TYR B CB  
3627 C CG  . TYR B 207 ? 0.4415 0.5091 0.6911 -0.1110 -0.0141 0.0884  798 TYR B CG  
3628 C CD1 . TYR B 207 ? 0.4603 0.5300 0.7274 -0.1238 -0.0188 0.0918  798 TYR B CD1 
3629 C CD2 . TYR B 207 ? 0.4365 0.5063 0.6797 -0.1039 -0.0180 0.0724  798 TYR B CD2 
3630 C CE1 . TYR B 207 ? 0.4934 0.5661 0.7714 -0.1290 -0.0278 0.0788  798 TYR B CE1 
3631 C CE2 . TYR B 207 ? 0.4517 0.5261 0.7042 -0.1092 -0.0262 0.0594  798 TYR B CE2 
3632 C CZ  . TYR B 207 ? 0.5850 0.6599 0.8549 -0.1215 -0.0315 0.0621  798 TYR B CZ  
3633 O OH  . TYR B 207 ? 0.6435 0.7230 0.9224 -0.1275 -0.0403 0.0485  798 TYR B OH  
3634 N N   . ARG B 208 ? 0.3889 0.4925 0.6061 -0.0940 0.0229  0.1233  799 ARG B N   
3635 C CA  . ARG B 208 ? 0.3705 0.4735 0.5728 -0.0879 0.0320  0.1303  799 ARG B CA  
3636 C C   . ARG B 208 ? 0.4243 0.5025 0.6130 -0.0840 0.0276  0.1290  799 ARG B C   
3637 O O   . ARG B 208 ? 0.4244 0.4937 0.6050 -0.0864 0.0305  0.1386  799 ARG B O   
3638 C CB  . ARG B 208 ? 0.3253 0.4410 0.5323 -0.0957 0.0409  0.1434  799 ARG B CB  
3639 C CG  . ARG B 208 ? 0.3677 0.5089 0.5772 -0.0900 0.0510  0.1436  799 ARG B CG  
3640 C CD  . ARG B 208 ? 0.4150 0.5751 0.6430 -0.0917 0.0480  0.1390  799 ARG B CD  
3641 N NE  . ARG B 208 ? 0.3774 0.5616 0.6113 -0.0857 0.0572  0.1401  799 ARG B NE  
3642 C CZ  . ARG B 208 ? 0.4661 0.6706 0.7169 -0.0852 0.0558  0.1375  799 ARG B CZ  
3643 N NH1 . ARG B 208 ? 0.3269 0.5317 0.5886 -0.0911 0.0456  0.1337  799 ARG B NH1 
3644 N NH2 . ARG B 208 ? 0.3473 0.5727 0.6054 -0.0788 0.0640  0.1384  799 ARG B NH2 
3645 N N   . LYS B 209 ? 0.3963 0.4652 0.5834 -0.0784 0.0203  0.1169  800 LYS B N   
3646 C CA  . LYS B 209 ? 0.3901 0.4380 0.5682 -0.0730 0.0149  0.1119  800 LYS B CA  
3647 C C   . LYS B 209 ? 0.4501 0.5045 0.6192 -0.0626 0.0162  0.1013  800 LYS B C   
3648 O O   . LYS B 209 ? 0.4480 0.5141 0.6221 -0.0620 0.0142  0.0929  800 LYS B O   
3649 C CB  . LYS B 209 ? 0.4247 0.4561 0.6149 -0.0783 0.0039  0.1056  800 LYS B CB  
3650 C CG  . LYS B 209 ? 0.5059 0.5250 0.7041 -0.0891 0.0009  0.1182  800 LYS B CG  
3651 C CD  . LYS B 209 ? 0.5543 0.5560 0.7673 -0.0942 -0.0110 0.1107  800 LYS B CD  
3652 C CE  . LYS B 209 ? 0.5571 0.5435 0.7787 -0.1057 -0.0156 0.1247  800 LYS B CE  
3653 N NZ  . LYS B 209 ? 0.5489 0.5130 0.7627 -0.1023 -0.0198 0.1315  800 LYS B NZ  
3654 N N   . PHE B 210 ? 0.4047 0.4521 0.5599 -0.0553 0.0191  0.1026  801 PHE B N   
3655 C CA  . PHE B 210 ? 0.3839 0.4371 0.5286 -0.0459 0.0217  0.0956  801 PHE B CA  
3656 C C   . PHE B 210 ? 0.4375 0.4757 0.5765 -0.0405 0.0163  0.0881  801 PHE B C   
3657 O O   . PHE B 210 ? 0.4487 0.4714 0.5858 -0.0410 0.0134  0.0928  801 PHE B O   
3658 C CB  . PHE B 210 ? 0.3886 0.4494 0.5229 -0.0422 0.0309  0.1038  801 PHE B CB  
3659 C CG  . PHE B 210 ? 0.4020 0.4801 0.5447 -0.0465 0.0368  0.1100  801 PHE B CG  
3660 C CD1 . PHE B 210 ? 0.4565 0.5355 0.6048 -0.0548 0.0395  0.1198  801 PHE B CD1 
3661 C CD2 . PHE B 210 ? 0.4108 0.5054 0.5571 -0.0427 0.0394  0.1065  801 PHE B CD2 
3662 C CE1 . PHE B 210 ? 0.4617 0.5597 0.6204 -0.0589 0.0454  0.1246  801 PHE B CE1 
3663 C CE2 . PHE B 210 ? 0.4463 0.5582 0.6038 -0.0458 0.0440  0.1115  801 PHE B CE2 
3664 C CZ  . PHE B 210 ? 0.4371 0.5517 0.6012 -0.0537 0.0476  0.1198  801 PHE B CZ  
3665 N N   . THR B 211 ? 0.3896 0.4337 0.5267 -0.0357 0.0146  0.0767  802 THR B N   
3666 C CA  . THR B 211 ? 0.3951 0.4297 0.5290 -0.0301 0.0103  0.0672  802 THR B CA  
3667 C C   . THR B 211 ? 0.4318 0.4779 0.5555 -0.0243 0.0143  0.0627  802 THR B C   
3668 O O   . THR B 211 ? 0.4018 0.4607 0.5224 -0.0246 0.0189  0.0669  802 THR B O   
3669 C CB  . THR B 211 ? 0.4457 0.4768 0.5917 -0.0328 0.0028  0.0545  802 THR B CB  
3670 O OG1 . THR B 211 ? 0.4385 0.4865 0.5855 -0.0349 0.0035  0.0475  802 THR B OG1 
3671 C CG2 . THR B 211 ? 0.4822 0.5000 0.6410 -0.0397 -0.0027 0.0588  802 THR B CG2 
3672 N N   . SER B 212 ? 0.3808 0.4230 0.5011 -0.0192 0.0119  0.0539  803 SER B N   
3673 C CA  . SER B 212 ? 0.3763 0.4294 0.4879 -0.0152 0.0148  0.0491  803 SER B CA  
3674 C C   . SER B 212 ? 0.3895 0.4585 0.5035 -0.0190 0.0143  0.0431  803 SER B C   
3675 O O   . SER B 212 ? 0.3649 0.4452 0.4720 -0.0183 0.0174  0.0458  803 SER B O   
3676 C CB  . SER B 212 ? 0.4436 0.4916 0.5547 -0.0104 0.0120  0.0398  803 SER B CB  
3677 O OG  . SER B 212 ? 0.6442 0.6836 0.7476 -0.0063 0.0137  0.0473  803 SER B OG  
3678 N N   . ALA B 213 ? 0.3438 0.4130 0.4679 -0.0235 0.0096  0.0355  804 ALA B N   
3679 C CA  . ALA B 213 ? 0.3494 0.4341 0.4752 -0.0282 0.0078  0.0291  804 ALA B CA  
3680 C C   . ALA B 213 ? 0.4103 0.5048 0.5369 -0.0318 0.0099  0.0401  804 ALA B C   
3681 O O   . ALA B 213 ? 0.4275 0.5372 0.5509 -0.0339 0.0093  0.0391  804 ALA B O   
3682 C CB  . ALA B 213 ? 0.3681 0.4490 0.5051 -0.0321 0.0019  0.0172  804 ALA B CB  
3683 N N   . SER B 214 ? 0.3717 0.4591 0.5026 -0.0324 0.0123  0.0510  805 SER B N   
3684 C CA  . SER B 214 ? 0.3540 0.4525 0.4883 -0.0346 0.0152  0.0608  805 SER B CA  
3685 C C   . SER B 214 ? 0.3881 0.4917 0.5128 -0.0286 0.0202  0.0667  805 SER B C   
3686 O O   . SER B 214 ? 0.3784 0.4949 0.5052 -0.0289 0.0205  0.0708  805 SER B O   
3687 C CB  . SER B 214 ? 0.3665 0.4592 0.5099 -0.0385 0.0168  0.0692  805 SER B CB  
3688 O OG  . SER B 214 ? 0.4370 0.5171 0.5747 -0.0354 0.0207  0.0756  805 SER B OG  
3689 N N   . ASP B 215 ? 0.3448 0.4383 0.4602 -0.0232 0.0228  0.0666  806 ASP B N   
3690 C CA  . ASP B 215 ? 0.3330 0.4290 0.4392 -0.0178 0.0265  0.0703  806 ASP B CA  
3691 C C   . ASP B 215 ? 0.3377 0.4445 0.4396 -0.0185 0.0234  0.0654  806 ASP B C   
3692 O O   . ASP B 215 ? 0.3390 0.4526 0.4383 -0.0168 0.0244  0.0707  806 ASP B O   
3693 C CB  . ASP B 215 ? 0.3579 0.4408 0.4554 -0.0131 0.0287  0.0702  806 ASP B CB  
3694 C CG  . ASP B 215 ? 0.4244 0.4998 0.5199 -0.0113 0.0334  0.0781  806 ASP B CG  
3695 O OD1 . ASP B 215 ? 0.4108 0.4927 0.5122 -0.0130 0.0366  0.0840  806 ASP B OD1 
3696 O OD2 . ASP B 215 ? 0.4256 0.4906 0.5134 -0.0083 0.0340  0.0782  806 ASP B OD2 
3697 N N   . VAL B 216 ? 0.3055 0.4143 0.4072 -0.0215 0.0196  0.0554  807 VAL B N   
3698 C CA  . VAL B 216 ? 0.2960 0.4183 0.3923 -0.0243 0.0169  0.0501  807 VAL B CA  
3699 C C   . VAL B 216 ? 0.3552 0.4911 0.4555 -0.0287 0.0140  0.0553  807 VAL B C   
3700 O O   . VAL B 216 ? 0.3683 0.5143 0.4628 -0.0296 0.0126  0.0592  807 VAL B O   
3701 C CB  . VAL B 216 ? 0.3402 0.4637 0.4368 -0.0266 0.0143  0.0358  807 VAL B CB  
3702 C CG1 . VAL B 216 ? 0.3137 0.4554 0.4047 -0.0320 0.0116  0.0297  807 VAL B CG1 
3703 C CG2 . VAL B 216 ? 0.3415 0.4556 0.4343 -0.0214 0.0165  0.0312  807 VAL B CG2 
3704 N N   . TRP B 217 ? 0.3152 0.4516 0.4262 -0.0317 0.0124  0.0565  808 TRP B N   
3705 C CA  . TRP B 217 ? 0.3131 0.4634 0.4307 -0.0356 0.0090  0.0619  808 TRP B CA  
3706 C C   . TRP B 217 ? 0.3637 0.5162 0.4816 -0.0306 0.0116  0.0734  808 TRP B C   
3707 O O   . TRP B 217 ? 0.3543 0.5179 0.4705 -0.0318 0.0078  0.0777  808 TRP B O   
3708 C CB  . TRP B 217 ? 0.2949 0.4446 0.4259 -0.0398 0.0076  0.0619  808 TRP B CB  
3709 C CG  . TRP B 217 ? 0.3055 0.4708 0.4458 -0.0434 0.0038  0.0679  808 TRP B CG  
3710 C CD1 . TRP B 217 ? 0.3415 0.5129 0.4887 -0.0399 0.0059  0.0786  808 TRP B CD1 
3711 C CD2 . TRP B 217 ? 0.3060 0.4838 0.4508 -0.0510 -0.0033 0.0628  808 TRP B CD2 
3712 N NE1 . TRP B 217 ? 0.3419 0.5292 0.4990 -0.0445 0.0001  0.0814  808 TRP B NE1 
3713 C CE2 . TRP B 217 ? 0.3631 0.5545 0.5179 -0.0519 -0.0058 0.0722  808 TRP B CE2 
3714 C CE3 . TRP B 217 ? 0.3293 0.5080 0.4721 -0.0571 -0.0080 0.0501  808 TRP B CE3 
3715 C CZ2 . TRP B 217 ? 0.3556 0.5622 0.5170 -0.0592 -0.0136 0.0705  808 TRP B CZ2 
3716 C CZ3 . TRP B 217 ? 0.3567 0.5499 0.5048 -0.0646 -0.0151 0.0473  808 TRP B CZ3 
3717 C CH2 . TRP B 217 ? 0.3631 0.5704 0.5196 -0.0659 -0.0183 0.0580  808 TRP B CH2 
3718 N N   . SER B 218 ? 0.3209 0.4627 0.4408 -0.0252 0.0176  0.0782  809 SER B N   
3719 C CA  . SER B 218 ? 0.3085 0.4505 0.4301 -0.0192 0.0210  0.0866  809 SER B CA  
3720 C C   . SER B 218 ? 0.3645 0.5061 0.4757 -0.0170 0.0192  0.0875  809 SER B C   
3721 O O   . SER B 218 ? 0.3551 0.5025 0.4697 -0.0148 0.0171  0.0943  809 SER B O   
3722 C CB  . SER B 218 ? 0.3370 0.4670 0.4577 -0.0146 0.0282  0.0882  809 SER B CB  
3723 O OG  . SER B 218 ? 0.3856 0.5156 0.5149 -0.0181 0.0301  0.0889  809 SER B OG  
3724 N N   . TYR B 219 ? 0.3066 0.4417 0.4064 -0.0177 0.0196  0.0810  810 TYR B N   
3725 C CA  . TYR B 219 ? 0.2930 0.4291 0.3828 -0.0174 0.0181  0.0819  810 TYR B CA  
3726 C C   . TYR B 219 ? 0.3541 0.5051 0.4429 -0.0229 0.0117  0.0853  810 TYR B C   
3727 O O   . TYR B 219 ? 0.3261 0.4787 0.4125 -0.0219 0.0093  0.0930  810 TYR B O   
3728 C CB  . TYR B 219 ? 0.2984 0.4287 0.3790 -0.0179 0.0198  0.0732  810 TYR B CB  
3729 C CG  . TYR B 219 ? 0.3047 0.4385 0.3756 -0.0192 0.0187  0.0745  810 TYR B CG  
3730 C CD1 . TYR B 219 ? 0.3329 0.4573 0.4005 -0.0147 0.0209  0.0797  810 TYR B CD1 
3731 C CD2 . TYR B 219 ? 0.3103 0.4580 0.3754 -0.0259 0.0152  0.0715  810 TYR B CD2 
3732 C CE1 . TYR B 219 ? 0.3225 0.4499 0.3825 -0.0172 0.0191  0.0826  810 TYR B CE1 
3733 C CE2 . TYR B 219 ? 0.3279 0.4806 0.3840 -0.0288 0.0143  0.0747  810 TYR B CE2 
3734 C CZ  . TYR B 219 ? 0.3994 0.5413 0.4537 -0.0246 0.0160  0.0809  810 TYR B CZ  
3735 O OH  . TYR B 219 ? 0.3463 0.4930 0.3925 -0.0289 0.0144  0.0849  810 TYR B OH  
3736 N N   . GLY B 220 ? 0.3262 0.4874 0.4169 -0.0288 0.0082  0.0799  811 GLY B N   
3737 C CA  . GLY B 220 ? 0.3220 0.4991 0.4109 -0.0351 0.0013  0.0829  811 GLY B CA  
3738 C C   . GLY B 220 ? 0.3561 0.5373 0.4548 -0.0327 -0.0024 0.0952  811 GLY B C   
3739 O O   . GLY B 220 ? 0.3635 0.5529 0.4586 -0.0353 -0.0083 0.1029  811 GLY B O   
3740 N N   . ILE B 221 ? 0.3050 0.4812 0.4171 -0.0276 0.0010  0.0974  812 ILE B N   
3741 C CA  . ILE B 221 ? 0.3041 0.4847 0.4298 -0.0233 -0.0013 0.1073  812 ILE B CA  
3742 C C   . ILE B 221 ? 0.3523 0.5239 0.4753 -0.0170 -0.0004 0.1139  812 ILE B C   
3743 O O   . ILE B 221 ? 0.3683 0.5451 0.4971 -0.0158 -0.0067 0.1228  812 ILE B O   
3744 C CB  . ILE B 221 ? 0.3334 0.5139 0.4747 -0.0202 0.0037  0.1066  812 ILE B CB  
3745 C CG1 . ILE B 221 ? 0.3365 0.5251 0.4822 -0.0279 0.0013  0.1008  812 ILE B CG1 
3746 C CG2 . ILE B 221 ? 0.3273 0.5146 0.4852 -0.0145 0.0022  0.1151  812 ILE B CG2 
3747 C CD1 . ILE B 221 ? 0.2984 0.5054 0.4511 -0.0339 -0.0087 0.1043  812 ILE B CD1 
3748 N N   . VAL B 222 ? 0.3015 0.4592 0.4164 -0.0132 0.0062  0.1097  813 VAL B N   
3749 C CA  . VAL B 222 ? 0.3103 0.4575 0.4214 -0.0081 0.0070  0.1141  813 VAL B CA  
3750 C C   . VAL B 222 ? 0.3554 0.5072 0.4571 -0.0137 -0.0003 0.1197  813 VAL B C   
3751 O O   . VAL B 222 ? 0.3656 0.5139 0.4711 -0.0110 -0.0045 0.1282  813 VAL B O   
3752 C CB  . VAL B 222 ? 0.3458 0.4787 0.4483 -0.0046 0.0147  0.1075  813 VAL B CB  
3753 C CG1 . VAL B 222 ? 0.3367 0.4589 0.4344 -0.0008 0.0144  0.1109  813 VAL B CG1 
3754 C CG2 . VAL B 222 ? 0.3258 0.4549 0.4363 0.0002  0.0215  0.1045  813 VAL B CG2 
3755 N N   . MET B 223 ? 0.3202 0.4804 0.4102 -0.0218 -0.0019 0.1148  814 MET B N   
3756 C CA  . MET B 223 ? 0.3294 0.4982 0.4084 -0.0294 -0.0082 0.1202  814 MET B CA  
3757 C C   . MET B 223 ? 0.3701 0.5479 0.4574 -0.0308 -0.0175 0.1321  814 MET B C   
3758 O O   . MET B 223 ? 0.3515 0.5275 0.4371 -0.0319 -0.0233 0.1428  814 MET B O   
3759 C CB  . MET B 223 ? 0.3482 0.5294 0.4155 -0.0379 -0.0079 0.1107  814 MET B CB  
3760 C CG  . MET B 223 ? 0.3663 0.5408 0.4264 -0.0370 -0.0005 0.0993  814 MET B CG  
3761 S SD  . MET B 223 ? 0.4089 0.6003 0.4588 -0.0461 -0.0007 0.0860  814 MET B SD  
3762 C CE  . MET B 223 ? 0.3841 0.5913 0.4193 -0.0561 -0.0062 0.0952  814 MET B CE  
3763 N N   . TRP B 224 ? 0.3094 0.4961 0.4074 -0.0307 -0.0195 0.1307  815 TRP B N   
3764 C CA  . TRP B 224 ? 0.3266 0.5236 0.4350 -0.0316 -0.0292 0.1415  815 TRP B CA  
3765 C C   . TRP B 224 ? 0.3702 0.5568 0.4937 -0.0219 -0.0307 0.1506  815 TRP B C   
3766 O O   . TRP B 224 ? 0.3569 0.5457 0.4835 -0.0229 -0.0402 0.1626  815 TRP B O   
3767 C CB  . TRP B 224 ? 0.3078 0.5171 0.4267 -0.0335 -0.0304 0.1368  815 TRP B CB  
3768 C CG  . TRP B 224 ? 0.3221 0.5459 0.4500 -0.0366 -0.0421 0.1473  815 TRP B CG  
3769 C CD1 . TRP B 224 ? 0.3603 0.5998 0.4779 -0.0468 -0.0508 0.1495  815 TRP B CD1 
3770 C CD2 . TRP B 224 ? 0.3258 0.5513 0.4757 -0.0291 -0.0466 0.1561  815 TRP B CD2 
3771 N NE1 . TRP B 224 ? 0.3554 0.6057 0.4869 -0.0466 -0.0615 0.1605  815 TRP B NE1 
3772 C CE2 . TRP B 224 ? 0.3746 0.6165 0.5275 -0.0353 -0.0592 0.1647  815 TRP B CE2 
3773 C CE3 . TRP B 224 ? 0.3389 0.5550 0.5071 -0.0176 -0.0411 0.1568  815 TRP B CE3 
3774 C CZ2 . TRP B 224 ? 0.3713 0.6201 0.5469 -0.0298 -0.0672 0.1745  815 TRP B CZ2 
3775 C CZ3 . TRP B 224 ? 0.3577 0.5812 0.5484 -0.0119 -0.0479 0.1652  815 TRP B CZ3 
3776 C CH2 . TRP B 224 ? 0.3739 0.6132 0.5693 -0.0175 -0.0612 0.1742  815 TRP B CH2 
3777 N N   . GLU B 225 ? 0.3269 0.5018 0.4592 -0.0129 -0.0217 0.1447  816 GLU B N   
3778 C CA  . GLU B 225 ? 0.3289 0.4936 0.4758 -0.0027 -0.0216 0.1498  816 GLU B CA  
3779 C C   . GLU B 225 ? 0.4036 0.5561 0.5422 -0.0029 -0.0258 0.1567  816 GLU B C   
3780 O O   . GLU B 225 ? 0.4087 0.5572 0.5593 0.0015  -0.0331 0.1660  816 GLU B O   
3781 C CB  . GLU B 225 ? 0.3333 0.4889 0.4851 0.0051  -0.0097 0.1402  816 GLU B CB  
3782 C CG  . GLU B 225 ? 0.2820 0.4485 0.4459 0.0059  -0.0053 0.1354  816 GLU B CG  
3783 C CD  . GLU B 225 ? 0.3912 0.5495 0.5582 0.0125  0.0061  0.1280  816 GLU B CD  
3784 O OE1 . GLU B 225 ? 0.2844 0.4363 0.4379 0.0093  0.0123  0.1213  816 GLU B OE1 
3785 O OE2 . GLU B 225 ? 0.3378 0.4961 0.5204 0.0210  0.0086  0.1288  816 GLU B OE2 
3786 N N   . VAL B 226 ? 0.3713 0.5178 0.4912 -0.0081 -0.0215 0.1519  817 VAL B N   
3787 C CA  . VAL B 226 ? 0.3531 0.4888 0.4640 -0.0103 -0.0246 0.1579  817 VAL B CA  
3788 C C   . VAL B 226 ? 0.3875 0.5319 0.4942 -0.0187 -0.0364 0.1714  817 VAL B C   
3789 O O   . VAL B 226 ? 0.3691 0.5044 0.4828 -0.0166 -0.0439 0.1824  817 VAL B O   
3790 C CB  . VAL B 226 ? 0.3849 0.5151 0.4789 -0.0140 -0.0167 0.1489  817 VAL B CB  
3791 C CG1 . VAL B 226 ? 0.3840 0.5064 0.4688 -0.0188 -0.0207 0.1561  817 VAL B CG1 
3792 C CG2 . VAL B 226 ? 0.3729 0.4917 0.4707 -0.0054 -0.0070 0.1384  817 VAL B CG2 
3793 N N   . MET B 227 ? 0.3598 0.5219 0.4560 -0.0283 -0.0389 0.1708  818 MET B N   
3794 C CA  . MET B 227 ? 0.3667 0.5400 0.4548 -0.0385 -0.0503 0.1840  818 MET B CA  
3795 C C   . MET B 227 ? 0.4647 0.6409 0.5704 -0.0347 -0.0618 0.1967  818 MET B C   
3796 O O   . MET B 227 ? 0.4998 0.6800 0.6016 -0.0414 -0.0731 0.2113  818 MET B O   
3797 C CB  . MET B 227 ? 0.3807 0.5736 0.4515 -0.0500 -0.0493 0.1776  818 MET B CB  
3798 C CG  . MET B 227 ? 0.4113 0.6031 0.4667 -0.0535 -0.0388 0.1648  818 MET B CG  
3799 S SD  . MET B 227 ? 0.4590 0.6370 0.5064 -0.0552 -0.0372 0.1709  818 MET B SD  
3800 C CE  . MET B 227 ? 0.4244 0.6176 0.4579 -0.0703 -0.0496 0.1892  818 MET B CE  
3801 N N   . SER B 228 ? 0.4177 0.5929 0.5434 -0.0245 -0.0595 0.1920  819 SER B N   
3802 C CA  . SER B 228 ? 0.4090 0.5889 0.5554 -0.0197 -0.0706 0.2031  819 SER B CA  
3803 C C   . SER B 228 ? 0.4465 0.6083 0.6122 -0.0073 -0.0714 0.2067  819 SER B C   
3804 O O   . SER B 228 ? 0.4739 0.6379 0.6617 0.0000  -0.0790 0.2132  819 SER B O   
3805 C CB  . SER B 228 ? 0.4187 0.6134 0.5777 -0.0172 -0.0683 0.1959  819 SER B CB  
3806 O OG  . SER B 228 ? 0.4656 0.6532 0.6327 -0.0087 -0.0552 0.1827  819 SER B OG  
3807 N N   . PHE B 229 ? 0.3967 0.5410 0.5547 -0.0047 -0.0642 0.2019  820 PHE B N   
3808 C CA  . PHE B 229 ? 0.3931 0.5182 0.5668 0.0068  -0.0635 0.2017  820 PHE B CA  
3809 C C   . PHE B 229 ? 0.4466 0.5732 0.6425 0.0199  -0.0562 0.1915  820 PHE B C   
3810 O O   . PHE B 229 ? 0.4515 0.5727 0.6703 0.0300  -0.0614 0.1950  820 PHE B O   
3811 C CB  . PHE B 229 ? 0.4307 0.5467 0.6134 0.0065  -0.0786 0.2188  820 PHE B CB  
3812 C CG  . PHE B 229 ? 0.4550 0.5622 0.6172 -0.0046 -0.0824 0.2271  820 PHE B CG  
3813 C CD1 . PHE B 229 ? 0.4786 0.5655 0.6385 -0.0014 -0.0777 0.2230  820 PHE B CD1 
3814 C CD2 . PHE B 229 ? 0.4996 0.6201 0.6451 -0.0188 -0.0908 0.2393  820 PHE B CD2 
3815 C CE1 . PHE B 229 ? 0.5203 0.6005 0.6632 -0.0126 -0.0814 0.2314  820 PHE B CE1 
3816 C CE2 . PHE B 229 ? 0.5471 0.6620 0.6744 -0.0301 -0.0939 0.2480  820 PHE B CE2 
3817 C CZ  . PHE B 229 ? 0.5354 0.6301 0.6623 -0.0271 -0.0891 0.2443  820 PHE B CZ  
3818 N N   . GLY B 230 ? 0.3937 0.5279 0.5831 0.0195  -0.0443 0.1789  821 GLY B N   
3819 C CA  . GLY B 230 ? 0.3773 0.5152 0.5836 0.0294  -0.0351 0.1687  821 GLY B CA  
3820 C C   . GLY B 230 ? 0.4304 0.5865 0.6576 0.0320  -0.0393 0.1715  821 GLY B C   
3821 O O   . GLY B 230 ? 0.4100 0.5690 0.6590 0.0424  -0.0350 0.1667  821 GLY B O   
3822 N N   . GLU B 231 ? 0.3845 0.5552 0.6059 0.0224  -0.0474 0.1783  822 GLU B N   
3823 C CA  . GLU B 231 ? 0.3684 0.5582 0.6086 0.0232  -0.0517 0.1804  822 GLU B CA  
3824 C C   . GLU B 231 ? 0.4281 0.6257 0.6674 0.0224  -0.0384 0.1675  822 GLU B C   
3825 O O   . GLU B 231 ? 0.4101 0.6014 0.6287 0.0168  -0.0305 0.1603  822 GLU B O   
3826 C CB  . GLU B 231 ? 0.3854 0.5884 0.6165 0.0117  -0.0648 0.1907  822 GLU B CB  
3827 C CG  . GLU B 231 ? 0.5385 0.7628 0.7887 0.0111  -0.0717 0.1938  822 GLU B CG  
3828 C CD  . GLU B 231 ? 0.7247 0.9528 1.0075 0.0228  -0.0787 0.2002  822 GLU B CD  
3829 O OE1 . GLU B 231 ? 0.6019 0.8345 0.9046 0.0317  -0.0694 0.1915  822 GLU B OE1 
3830 O OE2 . GLU B 231 ? 0.6944 0.9213 0.9834 0.0231  -0.0934 0.2139  822 GLU B OE2 
3831 N N   . ARG B 232 ? 0.3885 0.6000 0.6517 0.0278  -0.0364 0.1653  823 ARG B N   
3832 C CA  . ARG B 232 ? 0.3692 0.5895 0.6339 0.0257  -0.0251 0.1557  823 ARG B CA  
3833 C C   . ARG B 232 ? 0.4111 0.6416 0.6625 0.0128  -0.0295 0.1559  823 ARG B C   
3834 O O   . ARG B 232 ? 0.4195 0.6636 0.6783 0.0085  -0.0411 0.1632  823 ARG B O   
3835 C CB  . ARG B 232 ? 0.3395 0.5758 0.6352 0.0335  -0.0226 0.1544  823 ARG B CB  
3836 C CG  . ARG B 232 ? 0.4017 0.6469 0.6997 0.0306  -0.0097 0.1455  823 ARG B CG  
3837 C CD  . ARG B 232 ? 0.5242 0.7905 0.8540 0.0360  -0.0084 0.1454  823 ARG B CD  
3838 N NE  . ARG B 232 ? 0.6476 0.9233 0.9804 0.0323  0.0043  0.1383  823 ARG B NE  
3839 C CZ  . ARG B 232 ? 0.9316 1.2296 1.2860 0.0295  0.0047  0.1388  823 ARG B CZ  
3840 N NH1 . ARG B 232 ? 0.7921 1.1058 1.1673 0.0304  -0.0075 0.1454  823 ARG B NH1 
3841 N NH2 . ARG B 232 ? 0.7748 1.0799 1.1304 0.0249  0.0166  0.1335  823 ARG B NH2 
3842 N N   . PRO B 233 ? 0.3342 0.5587 0.5672 0.0066  -0.0209 0.1474  824 PRO B N   
3843 C CA  . PRO B 233 ? 0.3388 0.5726 0.5616 -0.0050 -0.0248 0.1450  824 PRO B CA  
3844 C C   . PRO B 233 ? 0.4060 0.6597 0.6499 -0.0075 -0.0291 0.1466  824 PRO B C   
3845 O O   . PRO B 233 ? 0.4066 0.6660 0.6692 -0.0022 -0.0221 0.1446  824 PRO B O   
3846 C CB  . PRO B 233 ? 0.3529 0.5757 0.5617 -0.0075 -0.0133 0.1348  824 PRO B CB  
3847 C CG  . PRO B 233 ? 0.3873 0.5935 0.5897 0.0006  -0.0063 0.1337  824 PRO B CG  
3848 C CD  . PRO B 233 ? 0.3233 0.5327 0.5457 0.0102  -0.0082 0.1394  824 PRO B CD  
3849 N N   . TYR B 234 ? 0.3697 0.6356 0.6102 -0.0161 -0.0406 0.1502  825 TYR B N   
3850 C CA  . TYR B 234 ? 0.3648 0.6511 0.6235 -0.0207 -0.0475 0.1521  825 TYR B CA  
3851 C C   . TYR B 234 ? 0.4254 0.7232 0.7123 -0.0119 -0.0527 0.1605  825 TYR B C   
3852 O O   . TYR B 234 ? 0.4421 0.7584 0.7493 -0.0140 -0.0571 0.1619  825 TYR B O   
3853 C CB  . TYR B 234 ? 0.3578 0.6477 0.6211 -0.0261 -0.0391 0.1428  825 TYR B CB  
3854 C CG  . TYR B 234 ? 0.3446 0.6215 0.5834 -0.0332 -0.0345 0.1336  825 TYR B CG  
3855 C CD1 . TYR B 234 ? 0.3530 0.6120 0.5811 -0.0289 -0.0229 0.1284  825 TYR B CD1 
3856 C CD2 . TYR B 234 ? 0.3454 0.6286 0.5728 -0.0440 -0.0421 0.1293  825 TYR B CD2 
3857 C CE1 . TYR B 234 ? 0.3660 0.6132 0.5742 -0.0343 -0.0196 0.1201  825 TYR B CE1 
3858 C CE2 . TYR B 234 ? 0.3589 0.6307 0.5668 -0.0494 -0.0378 0.1191  825 TYR B CE2 
3859 C CZ  . TYR B 234 ? 0.4098 0.6634 0.6091 -0.0441 -0.0269 0.1150  825 TYR B CZ  
3860 O OH  . TYR B 234 ? 0.3472 0.5897 0.5301 -0.0482 -0.0235 0.1051  825 TYR B OH  
3861 N N   . TRP B 235 ? 0.3876 0.6745 0.6769 -0.0022 -0.0533 0.1660  826 TRP B N   
3862 C CA  . TRP B 235 ? 0.3916 0.6858 0.7085 0.0084  -0.0596 0.1738  826 TRP B CA  
3863 C C   . TRP B 235 ? 0.4549 0.7635 0.8004 0.0144  -0.0513 0.1686  826 TRP B C   
3864 O O   . TRP B 235 ? 0.4618 0.7633 0.8056 0.0180  -0.0367 0.1602  826 TRP B O   
3865 C CB  . TRP B 235 ? 0.3775 0.6837 0.6984 0.0038  -0.0785 0.1861  826 TRP B CB  
3866 C CG  . TRP B 235 ? 0.3936 0.6892 0.6850 -0.0042 -0.0860 0.1917  826 TRP B CG  
3867 C CD1 . TRP B 235 ? 0.4341 0.7146 0.7179 0.0000  -0.0907 0.1999  826 TRP B CD1 
3868 C CD2 . TRP B 235 ? 0.3870 0.6873 0.6527 -0.0182 -0.0890 0.1888  826 TRP B CD2 
3869 N NE1 . TRP B 235 ? 0.4257 0.7035 0.6808 -0.0114 -0.0964 0.2037  826 TRP B NE1 
3870 C CE2 . TRP B 235 ? 0.4425 0.7331 0.6859 -0.0222 -0.0952 0.1962  826 TRP B CE2 
3871 C CE3 . TRP B 235 ? 0.3983 0.7112 0.6592 -0.0281 -0.0880 0.1806  826 TRP B CE3 
3872 C CZ2 . TRP B 235 ? 0.4354 0.7304 0.6509 -0.0354 -0.0985 0.1941  826 TRP B CZ2 
3873 C CZ3 . TRP B 235 ? 0.4224 0.7370 0.6561 -0.0403 -0.0917 0.1774  826 TRP B CZ3 
3874 C CH2 . TRP B 235 ? 0.4339 0.7409 0.6450 -0.0437 -0.0964 0.1838  826 TRP B CH2 
3875 N N   . ASP B 236 ? 0.4364 0.7665 0.8073 0.0145  -0.0606 0.1738  827 ASP B N   
3876 C CA  . ASP B 236 ? 0.4201 0.7691 0.8219 0.0193  -0.0539 0.1699  827 ASP B CA  
3877 C C   . ASP B 236 ? 0.4606 0.8231 0.8619 0.0074  -0.0493 0.1644  827 ASP B C   
3878 O O   . ASP B 236 ? 0.4533 0.8347 0.8812 0.0092  -0.0443 0.1622  827 ASP B O   
3879 C CB  . ASP B 236 ? 0.4440 0.8104 0.8787 0.0272  -0.0673 0.1787  827 ASP B CB  
3880 C CG  . ASP B 236 ? 0.4802 0.8350 0.9273 0.0421  -0.0696 0.1822  827 ASP B CG  
3881 O OD1 . ASP B 236 ? 0.4582 0.7953 0.8950 0.0483  -0.0572 0.1752  827 ASP B OD1 
3882 O OD2 . ASP B 236 ? 0.5698 0.9333 1.0389 0.0478  -0.0842 0.1916  827 ASP B OD2 
3883 N N   . MET B 237 ? 0.4105 0.7640 0.7836 -0.0049 -0.0508 0.1616  828 MET B N   
3884 C CA  . MET B 237 ? 0.3974 0.7600 0.7700 -0.0167 -0.0475 0.1558  828 MET B CA  
3885 C C   . MET B 237 ? 0.4313 0.7912 0.8100 -0.0142 -0.0303 0.1491  828 MET B C   
3886 O O   . MET B 237 ? 0.4311 0.7742 0.7979 -0.0073 -0.0203 0.1462  828 MET B O   
3887 C CB  . MET B 237 ? 0.4245 0.7742 0.7657 -0.0280 -0.0506 0.1514  828 MET B CB  
3888 C CG  . MET B 237 ? 0.4766 0.8353 0.8104 -0.0354 -0.0674 0.1564  828 MET B CG  
3889 S SD  . MET B 237 ? 0.5318 0.8758 0.8274 -0.0468 -0.0687 0.1486  828 MET B SD  
3890 C CE  . MET B 237 ? 0.4857 0.8349 0.7866 -0.0578 -0.0645 0.1380  828 MET B CE  
3891 N N   . SER B 238 ? 0.3906 0.7677 0.7877 -0.0206 -0.0270 0.1472  829 SER B N   
3892 C CA  . SER B 238 ? 0.3656 0.7420 0.7669 -0.0207 -0.0106 0.1423  829 SER B CA  
3893 C C   . SER B 238 ? 0.3894 0.7439 0.7614 -0.0293 -0.0053 0.1371  829 SER B C   
3894 O O   . SER B 238 ? 0.3421 0.6875 0.6963 -0.0364 -0.0143 0.1357  829 SER B O   
3895 C CB  . SER B 238 ? 0.3604 0.7631 0.7909 -0.0267 -0.0091 0.1431  829 SER B CB  
3896 O OG  . SER B 238 ? 0.4370 0.8419 0.8622 -0.0411 -0.0170 0.1423  829 SER B OG  
3897 N N   . ASN B 239 ? 0.3747 0.7222 0.7428 -0.0290 0.0090  0.1340  830 ASN B N   
3898 C CA  . ASN B 239 ? 0.3645 0.6918 0.7090 -0.0364 0.0141  0.1300  830 ASN B CA  
3899 C C   . ASN B 239 ? 0.4040 0.7345 0.7497 -0.0504 0.0063  0.1286  830 ASN B C   
3900 O O   . ASN B 239 ? 0.4088 0.7225 0.7341 -0.0557 0.0016  0.1243  830 ASN B O   
3901 C CB  . ASN B 239 ? 0.3376 0.6632 0.6833 -0.0350 0.0295  0.1293  830 ASN B CB  
3902 C CG  . ASN B 239 ? 0.5531 0.8653 0.8856 -0.0233 0.0372  0.1275  830 ASN B CG  
3903 O OD1 . ASN B 239 ? 0.4619 0.7602 0.7800 -0.0172 0.0316  0.1266  830 ASN B OD1 
3904 N ND2 . ASN B 239 ? 0.4614 0.7779 0.7975 -0.0212 0.0505  0.1267  830 ASN B ND2 
3905 N N   . GLN B 240 ? 0.3554 0.7089 0.7267 -0.0559 0.0040  0.1313  831 GLN B N   
3906 C CA  . GLN B 240 ? 0.3467 0.7072 0.7250 -0.0696 -0.0042 0.1299  831 GLN B CA  
3907 C C   . GLN B 240 ? 0.4019 0.7612 0.7701 -0.0721 -0.0196 0.1276  831 GLN B C   
3908 O O   . GLN B 240 ? 0.3809 0.7303 0.7368 -0.0819 -0.0253 0.1219  831 GLN B O   
3909 C CB  . GLN B 240 ? 0.3529 0.7420 0.7641 -0.0734 -0.0030 0.1342  831 GLN B CB  
3910 C CG  . GLN B 240 ? 0.4372 0.8326 0.8577 -0.0892 -0.0090 0.1329  831 GLN B CG  
3911 C CD  . GLN B 240 ? 0.7577 1.1829 1.2118 -0.0938 -0.0067 0.1374  831 GLN B CD  
3912 O OE1 . GLN B 240 ? 0.6515 1.0925 1.1222 -0.0856 0.0033  0.1408  831 GLN B OE1 
3913 N NE2 . GLN B 240 ? 0.6872 1.1218 1.1531 -0.1072 -0.0159 0.1366  831 GLN B NE2 
3914 N N   . ASP B 241 ? 0.3818 0.7516 0.7555 -0.0637 -0.0266 0.1320  832 ASP B N   
3915 C CA  . ASP B 241 ? 0.3901 0.7607 0.7520 -0.0658 -0.0411 0.1320  832 ASP B CA  
3916 C C   . ASP B 241 ? 0.4290 0.7750 0.7583 -0.0663 -0.0399 0.1260  832 ASP B C   
3917 O O   . ASP B 241 ? 0.4602 0.8040 0.7757 -0.0745 -0.0485 0.1208  832 ASP B O   
3918 C CB  . ASP B 241 ? 0.4208 0.8027 0.7934 -0.0551 -0.0476 0.1401  832 ASP B CB  
3919 C CG  . ASP B 241 ? 0.5216 0.9311 0.9286 -0.0536 -0.0529 0.1459  832 ASP B CG  
3920 O OD1 . ASP B 241 ? 0.5315 0.9555 0.9524 -0.0640 -0.0563 0.1442  832 ASP B OD1 
3921 O OD2 . ASP B 241 ? 0.5305 0.9471 0.9519 -0.0419 -0.0544 0.1520  832 ASP B OD2 
3922 N N   . VAL B 242 ? 0.3743 0.7033 0.6920 -0.0577 -0.0289 0.1258  833 VAL B N   
3923 C CA  . VAL B 242 ? 0.3631 0.6696 0.6524 -0.0571 -0.0264 0.1203  833 VAL B CA  
3924 C C   . VAL B 242 ? 0.4394 0.7355 0.7201 -0.0675 -0.0254 0.1115  833 VAL B C   
3925 O O   . VAL B 242 ? 0.4574 0.7479 0.7219 -0.0727 -0.0320 0.1048  833 VAL B O   
3926 C CB  . VAL B 242 ? 0.3923 0.6843 0.6738 -0.0459 -0.0154 0.1222  833 VAL B CB  
3927 C CG1 . VAL B 242 ? 0.3844 0.6545 0.6389 -0.0461 -0.0126 0.1161  833 VAL B CG1 
3928 C CG2 . VAL B 242 ? 0.3843 0.6835 0.6737 -0.0358 -0.0190 0.1295  833 VAL B CG2 
3929 N N   . ILE B 243 ? 0.3694 0.6645 0.6624 -0.0710 -0.0179 0.1116  834 ILE B N   
3930 C CA  . ILE B 243 ? 0.3657 0.6494 0.6550 -0.0811 -0.0180 0.1048  834 ILE B CA  
3931 C C   . ILE B 243 ? 0.4387 0.7315 0.7302 -0.0913 -0.0308 0.0986  834 ILE B C   
3932 O O   . ILE B 243 ? 0.4361 0.7162 0.7128 -0.0959 -0.0347 0.0890  834 ILE B O   
3933 C CB  . ILE B 243 ? 0.3958 0.6815 0.7014 -0.0850 -0.0092 0.1093  834 ILE B CB  
3934 C CG1 . ILE B 243 ? 0.3840 0.6583 0.6814 -0.0761 0.0036  0.1131  834 ILE B CG1 
3935 C CG2 . ILE B 243 ? 0.4124 0.6871 0.7187 -0.0971 -0.0123 0.1039  834 ILE B CG2 
3936 C CD1 . ILE B 243 ? 0.4193 0.7029 0.7330 -0.0788 0.0135  0.1194  834 ILE B CD1 
3937 N N   . ASN B 244 ? 0.4088 0.7246 0.7188 -0.0941 -0.0378 0.1035  835 ASN B N   
3938 C CA  . ASN B 244 ? 0.4245 0.7526 0.7380 -0.1041 -0.0509 0.0984  835 ASN B CA  
3939 C C   . ASN B 244 ? 0.4749 0.8015 0.7662 -0.1036 -0.0592 0.0932  835 ASN B C   
3940 O O   . ASN B 244 ? 0.4889 0.8130 0.7711 -0.1123 -0.0661 0.0826  835 ASN B O   
3941 C CB  . ASN B 244 ? 0.4587 0.8138 0.7988 -0.1063 -0.0568 0.1063  835 ASN B CB  
3942 C CG  . ASN B 244 ? 0.6224 0.9849 0.9868 -0.1116 -0.0505 0.1097  835 ASN B CG  
3943 O OD1 . ASN B 244 ? 0.5545 0.9015 0.9164 -0.1153 -0.0425 0.1072  835 ASN B OD1 
3944 N ND2 . ASN B 244 ? 0.5665 0.9543 0.9560 -0.1122 -0.0545 0.1163  835 ASN B ND2 
3945 N N   . ALA B 245 ? 0.4186 0.7476 0.7017 -0.0941 -0.0589 0.1003  836 ALA B N   
3946 C CA  . ALA B 245 ? 0.4208 0.7503 0.6820 -0.0943 -0.0663 0.0979  836 ALA B CA  
3947 C C   . ALA B 245 ? 0.4874 0.7976 0.7255 -0.0956 -0.0616 0.0862  836 ALA B C   
3948 O O   . ALA B 245 ? 0.4927 0.8065 0.7154 -0.1021 -0.0687 0.0776  836 ALA B O   
3949 C CB  . ALA B 245 ? 0.4253 0.7579 0.6850 -0.0840 -0.0662 0.1094  836 ALA B CB  
3950 N N   . ILE B 246 ? 0.4330 0.7242 0.6688 -0.0897 -0.0500 0.0852  837 ILE B N   
3951 C CA  . ILE B 246 ? 0.4262 0.6985 0.6437 -0.0897 -0.0455 0.0741  837 ILE B CA  
3952 C C   . ILE B 246 ? 0.5226 0.7926 0.7432 -0.1000 -0.0504 0.0614  837 ILE B C   
3953 O O   . ILE B 246 ? 0.5122 0.7794 0.7175 -0.1036 -0.0540 0.0492  837 ILE B O   
3954 C CB  . ILE B 246 ? 0.4325 0.6859 0.6478 -0.0812 -0.0333 0.0772  837 ILE B CB  
3955 C CG1 . ILE B 246 ? 0.4045 0.6583 0.6141 -0.0709 -0.0293 0.0870  837 ILE B CG1 
3956 C CG2 . ILE B 246 ? 0.4444 0.6784 0.6460 -0.0819 -0.0300 0.0654  837 ILE B CG2 
3957 C CD1 . ILE B 246 ? 0.4584 0.7165 0.6498 -0.0699 -0.0346 0.0868  837 ILE B CD1 
3958 N N   . GLU B 247 ? 0.5093 0.7822 0.7505 -0.1054 -0.0510 0.0639  838 GLU B N   
3959 C CA  . GLU B 247 ? 0.5348 0.8046 0.7829 -0.1161 -0.0568 0.0527  838 GLU B CA  
3960 C C   . GLU B 247 ? 0.6023 0.8880 0.8435 -0.1238 -0.0688 0.0438  838 GLU B C   
3961 O O   . GLU B 247 ? 0.6112 0.8905 0.8473 -0.1304 -0.0731 0.0288  838 GLU B O   
3962 C CB  . GLU B 247 ? 0.5602 0.8341 0.8332 -0.1218 -0.0559 0.0598  838 GLU B CB  
3963 C CG  . GLU B 247 ? 0.7363 0.9922 1.0142 -0.1184 -0.0451 0.0652  838 GLU B CG  
3964 C CD  . GLU B 247 ? 1.2016 1.4325 1.4718 -0.1208 -0.0443 0.0547  838 GLU B CD  
3965 O OE1 . GLU B 247 ? 1.2664 1.4938 1.5444 -0.1306 -0.0517 0.0456  838 GLU B OE1 
3966 O OE2 . GLU B 247 ? 1.1178 1.3326 1.3755 -0.1128 -0.0370 0.0551  838 GLU B OE2 
3967 N N   . GLN B 248 ? 0.5586 0.8646 0.7988 -0.1226 -0.0744 0.0526  839 GLN B N   
3968 C CA  . GLN B 248 ? 0.5732 0.8973 0.8046 -0.1304 -0.0866 0.0468  839 GLN B CA  
3969 C C   . GLN B 248 ? 0.6300 0.9535 0.8338 -0.1278 -0.0865 0.0414  839 GLN B C   
3970 O O   . GLN B 248 ? 0.6339 0.9747 0.8261 -0.1332 -0.0957 0.0404  839 GLN B O   
3971 C CB  . GLN B 248 ? 0.5895 0.9376 0.8364 -0.1320 -0.0951 0.0603  839 GLN B CB  
3972 C CG  . GLN B 248 ? 0.7622 1.1177 1.0384 -0.1370 -0.0966 0.0645  839 GLN B CG  
3973 C CD  . GLN B 248 ? 1.1180 1.4650 1.3998 -0.1477 -0.0990 0.0505  839 GLN B CD  
3974 O OE1 . GLN B 248 ? 1.1072 1.4576 1.3782 -0.1561 -0.1077 0.0371  839 GLN B OE1 
3975 N NE2 . GLN B 248 ? 1.0355 1.3708 1.3340 -0.1480 -0.0913 0.0532  839 GLN B NE2 
3976 N N   . ASP B 249 ? 0.5773 0.8819 0.7704 -0.1203 -0.0762 0.0383  840 ASP B N   
3977 C CA  . ASP B 249 ? 0.5714 0.8733 0.7404 -0.1174 -0.0734 0.0327  840 ASP B CA  
3978 C C   . ASP B 249 ? 0.5953 0.9096 0.7548 -0.1135 -0.0757 0.0476  840 ASP B C   
3979 O O   . ASP B 249 ? 0.5942 0.9140 0.7326 -0.1152 -0.0768 0.0443  840 ASP B O   
3980 C CB  . ASP B 249 ? 0.6147 0.9216 0.7698 -0.1261 -0.0785 0.0129  840 ASP B CB  
3981 C CG  . ASP B 249 ? 0.7678 1.0587 0.9335 -0.1289 -0.0769 -0.0030 840 ASP B CG  
3982 O OD1 . ASP B 249 ? 0.7416 1.0117 0.9124 -0.1220 -0.0683 -0.0030 840 ASP B OD1 
3983 O OD2 . ASP B 249 ? 0.9033 1.2019 1.0719 -0.1384 -0.0851 -0.0154 840 ASP B OD2 
3984 N N   . TYR B 250 ? 0.5104 0.8286 0.6862 -0.1082 -0.0761 0.0640  841 TYR B N   
3985 C CA  . TYR B 250 ? 0.4793 0.8044 0.6494 -0.1029 -0.0784 0.0789  841 TYR B CA  
3986 C C   . TYR B 250 ? 0.4857 0.7921 0.6455 -0.0937 -0.0670 0.0799  841 TYR B C   
3987 O O   . TYR B 250 ? 0.4701 0.7606 0.6373 -0.0888 -0.0578 0.0761  841 TYR B O   
3988 C CB  . TYR B 250 ? 0.4674 0.8012 0.6618 -0.0982 -0.0816 0.0939  841 TYR B CB  
3989 C CG  . TYR B 250 ? 0.4649 0.7993 0.6586 -0.0896 -0.0825 0.1092  841 TYR B CG  
3990 C CD1 . TYR B 250 ? 0.4871 0.8376 0.6768 -0.0928 -0.0950 0.1194  841 TYR B CD1 
3991 C CD2 . TYR B 250 ? 0.4549 0.7732 0.6524 -0.0787 -0.0716 0.1137  841 TYR B CD2 
3992 C CE1 . TYR B 250 ? 0.4948 0.8437 0.6865 -0.0850 -0.0972 0.1342  841 TYR B CE1 
3993 C CE2 . TYR B 250 ? 0.4545 0.7714 0.6526 -0.0708 -0.0731 0.1265  841 TYR B CE2 
3994 C CZ  . TYR B 250 ? 0.5627 0.8941 0.7590 -0.0738 -0.0861 0.1370  841 TYR B CZ  
3995 O OH  . TYR B 250 ? 0.5477 0.8758 0.7471 -0.0661 -0.0891 0.1504  841 TYR B OH  
3996 N N   . ARG B 251 ? 0.4154 0.7244 0.5583 -0.0923 -0.0686 0.0860  842 ARG B N   
3997 C CA  . ARG B 251 ? 0.4057 0.6997 0.5391 -0.0844 -0.0598 0.0891  842 ARG B CA  
3998 C C   . ARG B 251 ? 0.4387 0.7383 0.5713 -0.0809 -0.0653 0.1061  842 ARG B C   
3999 O O   . ARG B 251 ? 0.4306 0.7468 0.5589 -0.0874 -0.0763 0.1124  842 ARG B O   
4000 C CB  . ARG B 251 ? 0.3821 0.6724 0.4933 -0.0881 -0.0557 0.0761  842 ARG B CB  
4001 C CG  . ARG B 251 ? 0.3860 0.6668 0.4997 -0.0897 -0.0504 0.0585  842 ARG B CG  
4002 C CD  . ARG B 251 ? 0.4029 0.6640 0.5304 -0.0812 -0.0415 0.0600  842 ARG B CD  
4003 N NE  . ARG B 251 ? 0.4679 0.7178 0.5973 -0.0829 -0.0379 0.0447  842 ARG B NE  
4004 C CZ  . ARG B 251 ? 0.5571 0.8055 0.7007 -0.0872 -0.0405 0.0395  842 ARG B CZ  
4005 N NH1 . ARG B 251 ? 0.4249 0.6849 0.5822 -0.0906 -0.0462 0.0477  842 ARG B NH1 
4006 N NH2 . ARG B 251 ? 0.3697 0.6051 0.5155 -0.0883 -0.0381 0.0262  842 ARG B NH2 
4007 N N   . LEU B 252 ? 0.3853 0.6709 0.5226 -0.0709 -0.0586 0.1136  843 LEU B N   
4008 C CA  . LEU B 252 ? 0.3669 0.6534 0.5061 -0.0663 -0.0637 0.1293  843 LEU B CA  
4009 C C   . LEU B 252 ? 0.4402 0.7349 0.5568 -0.0742 -0.0706 0.1332  843 LEU B C   
4010 O O   . LEU B 252 ? 0.4375 0.7302 0.5355 -0.0789 -0.0654 0.1229  843 LEU B O   
4011 C CB  . LEU B 252 ? 0.3431 0.6106 0.4873 -0.0550 -0.0541 0.1326  843 LEU B CB  
4012 C CG  . LEU B 252 ? 0.3707 0.6337 0.5386 -0.0463 -0.0483 0.1333  843 LEU B CG  
4013 C CD1 . LEU B 252 ? 0.3290 0.5728 0.4949 -0.0377 -0.0364 0.1303  843 LEU B CD1 
4014 C CD2 . LEU B 252 ? 0.3927 0.6663 0.5811 -0.0418 -0.0568 0.1460  843 LEU B CD2 
4015 N N   . PRO B 253 ? 0.4034 0.7089 0.5218 -0.0765 -0.0825 0.1481  844 PRO B N   
4016 C CA  . PRO B 253 ? 0.4127 0.7277 0.5077 -0.0860 -0.0895 0.1538  844 PRO B CA  
4017 C C   . PRO B 253 ? 0.4708 0.7711 0.5553 -0.0822 -0.0839 0.1596  844 PRO B C   
4018 O O   . PRO B 253 ? 0.4523 0.7356 0.5500 -0.0713 -0.0772 0.1613  844 PRO B O   
4019 C CB  . PRO B 253 ? 0.4367 0.7658 0.5409 -0.0886 -0.1053 0.1702  844 PRO B CB  
4020 C CG  . PRO B 253 ? 0.4887 0.8089 0.6219 -0.0761 -0.1045 0.1766  844 PRO B CG  
4021 C CD  . PRO B 253 ? 0.4197 0.7302 0.5620 -0.0706 -0.0908 0.1610  844 PRO B CD  
4022 N N   . PRO B 254 ? 0.4444 0.7518 0.5057 -0.0915 -0.0868 0.1634  845 PRO B N   
4023 C CA  . PRO B 254 ? 0.4432 0.7369 0.4969 -0.0888 -0.0823 0.1702  845 PRO B CA  
4024 C C   . PRO B 254 ? 0.4955 0.7793 0.5639 -0.0820 -0.0907 0.1898  845 PRO B C   
4025 O O   . PRO B 254 ? 0.5065 0.8008 0.5790 -0.0857 -0.1041 0.2035  845 PRO B O   
4026 C CB  . PRO B 254 ? 0.4765 0.7855 0.5025 -0.1027 -0.0845 0.1706  845 PRO B CB  
4027 C CG  . PRO B 254 ? 0.5291 0.8596 0.5490 -0.1122 -0.0939 0.1699  845 PRO B CG  
4028 C CD  . PRO B 254 ? 0.4771 0.8066 0.5178 -0.1058 -0.0939 0.1613  845 PRO B CD  
4029 N N   . PRO B 255 ? 0.4205 0.6838 0.4977 -0.0720 -0.0837 0.1911  846 PRO B N   
4030 C CA  . PRO B 255 ? 0.4152 0.6673 0.5070 -0.0652 -0.0919 0.2082  846 PRO B CA  
4031 C C   . PRO B 255 ? 0.4966 0.7535 0.5725 -0.0758 -0.1031 0.2253  846 PRO B C   
4032 O O   . PRO B 255 ? 0.4929 0.7612 0.5446 -0.0879 -0.1014 0.2225  846 PRO B O   
4033 C CB  . PRO B 255 ? 0.4222 0.6521 0.5198 -0.0548 -0.0802 0.2017  846 PRO B CB  
4034 C CG  . PRO B 255 ? 0.4485 0.6791 0.5434 -0.0531 -0.0672 0.1824  846 PRO B CG  
4035 C CD  . PRO B 255 ? 0.4115 0.6606 0.4864 -0.0662 -0.0690 0.1769  846 PRO B CD  
4036 N N   . MET B 256 ? 0.4606 0.7096 0.5510 -0.0714 -0.1150 0.2433  847 MET B N   
4037 C CA  . MET B 256 ? 0.4812 0.7317 0.5596 -0.0812 -0.1277 0.2633  847 MET B CA  
4038 C C   . MET B 256 ? 0.5874 0.8304 0.6446 -0.0882 -0.1195 0.2617  847 MET B C   
4039 O O   . MET B 256 ? 0.5537 0.7789 0.6171 -0.0796 -0.1089 0.2529  847 MET B O   
4040 C CB  . MET B 256 ? 0.5068 0.7423 0.6100 -0.0714 -0.1400 0.2804  847 MET B CB  
4041 C CG  . MET B 256 ? 0.5598 0.7988 0.6539 -0.0824 -0.1576 0.3046  847 MET B CG  
4042 S SD  . MET B 256 ? 0.6000 0.8697 0.6837 -0.0951 -0.1723 0.3135  847 MET B SD  
4043 C CE  . MET B 256 ? 0.5410 0.8079 0.6649 -0.0789 -0.1826 0.3178  847 MET B CE  
4044 N N   . ASP B 257 ? 0.5916 0.8505 0.6237 -0.1043 -0.1241 0.2692  848 ASP B N   
4045 C CA  . ASP B 257 ? 0.6251 0.8829 0.6360 -0.1140 -0.1174 0.2697  848 ASP B CA  
4046 C C   . ASP B 257 ? 0.6344 0.8923 0.6376 -0.1116 -0.0991 0.2459  848 ASP B C   
4047 O O   . ASP B 257 ? 0.6584 0.9133 0.6495 -0.1168 -0.0922 0.2444  848 ASP B O   
4048 C CB  . ASP B 257 ? 0.6824 0.9170 0.7024 -0.1109 -0.1231 0.2863  848 ASP B CB  
4049 C CG  . ASP B 257 ? 0.9456 1.1756 0.9784 -0.1108 -0.1424 0.3100  848 ASP B CG  
4050 O OD1 . ASP B 257 ? 1.0074 1.2559 1.0250 -0.1244 -0.1537 0.3239  848 ASP B OD1 
4051 O OD2 . ASP B 257 ? 1.0251 1.2337 1.0836 -0.0969 -0.1465 0.3143  848 ASP B OD2 
4052 N N   . CYS B 258 ? 0.5290 0.7919 0.5393 -0.1050 -0.0922 0.2283  849 CYS B N   
4053 C CA  . CYS B 258 ? 0.4840 0.7472 0.4888 -0.1025 -0.0769 0.2063  849 CYS B CA  
4054 C C   . CYS B 258 ? 0.5640 0.8509 0.5439 -0.1170 -0.0734 0.1981  849 CYS B C   
4055 O O   . CYS B 258 ? 0.5756 0.8819 0.5473 -0.1248 -0.0796 0.1978  849 CYS B O   
4056 C CB  . CYS B 258 ? 0.4461 0.7052 0.4678 -0.0915 -0.0720 0.1921  849 CYS B CB  
4057 S SG  . CYS B 258 ? 0.4661 0.7223 0.4837 -0.0878 -0.0551 0.1667  849 CYS B SG  
4058 N N   . PRO B 259 ? 0.5149 0.8022 0.4833 -0.1204 -0.0630 0.1895  850 PRO B N   
4059 C CA  . PRO B 259 ? 0.5221 0.8346 0.4684 -0.1334 -0.0581 0.1789  850 PRO B CA  
4060 C C   . PRO B 259 ? 0.5527 0.8753 0.5007 -0.1308 -0.0532 0.1574  850 PRO B C   
4061 O O   . PRO B 259 ? 0.5196 0.8266 0.4846 -0.1184 -0.0483 0.1471  850 PRO B O   
4062 C CB  . PRO B 259 ? 0.5358 0.8430 0.4774 -0.1336 -0.0472 0.1725  850 PRO B CB  
4063 C CG  . PRO B 259 ? 0.5725 0.8532 0.5287 -0.1249 -0.0499 0.1859  850 PRO B CG  
4064 C CD  . PRO B 259 ? 0.5122 0.7789 0.4879 -0.1127 -0.0553 0.1878  850 PRO B CD  
4065 N N   . ALA B 260 ? 0.5184 0.8670 0.4488 -0.1430 -0.0553 0.1514  851 ALA B N   
4066 C CA  . ALA B 260 ? 0.5145 0.8740 0.4457 -0.1423 -0.0522 0.1305  851 ALA B CA  
4067 C C   . ALA B 260 ? 0.5485 0.8985 0.4880 -0.1334 -0.0389 0.1079  851 ALA B C   
4068 O O   . ALA B 260 ? 0.5382 0.8790 0.4919 -0.1251 -0.0373 0.0961  851 ALA B O   
4069 C CB  . ALA B 260 ? 0.5408 0.9311 0.4486 -0.1581 -0.0554 0.1262  851 ALA B CB  
4070 N N   . ALA B 261 ? 0.5160 0.8674 0.4481 -0.1351 -0.0300 0.1035  852 ALA B N   
4071 C CA  . ALA B 261 ? 0.4947 0.8377 0.4350 -0.1267 -0.0183 0.0839  852 ALA B CA  
4072 C C   . ALA B 261 ? 0.4993 0.8130 0.4610 -0.1117 -0.0169 0.0856  852 ALA B C   
4073 O O   . ALA B 261 ? 0.4639 0.7689 0.4362 -0.1037 -0.0113 0.0695  852 ALA B O   
4074 C CB  . ALA B 261 ? 0.5053 0.8562 0.4356 -0.1319 -0.0110 0.0835  852 ALA B CB  
4075 N N   . LEU B 262 ? 0.4574 0.7564 0.4254 -0.1082 -0.0225 0.1052  853 LEU B N   
4076 C CA  . LEU B 262 ? 0.4356 0.7093 0.4220 -0.0948 -0.0210 0.1078  853 LEU B CA  
4077 C C   . LEU B 262 ? 0.4496 0.7195 0.4491 -0.0895 -0.0248 0.1046  853 LEU B C   
4078 O O   . LEU B 262 ? 0.4385 0.6943 0.4506 -0.0803 -0.0195 0.0956  853 LEU B O   
4079 C CB  . LEU B 262 ? 0.4460 0.7070 0.4354 -0.0932 -0.0259 0.1279  853 LEU B CB  
4080 C CG  . LEU B 262 ? 0.4953 0.7310 0.5006 -0.0801 -0.0225 0.1295  853 LEU B CG  
4081 C CD1 . LEU B 262 ? 0.4670 0.6956 0.4719 -0.0756 -0.0117 0.1145  853 LEU B CD1 
4082 C CD2 . LEU B 262 ? 0.5103 0.7357 0.5170 -0.0803 -0.0281 0.1475  853 LEU B CD2 
4083 N N   . HIS B 263 ? 0.4058 0.6897 0.4021 -0.0963 -0.0341 0.1117  854 HIS B N   
4084 C CA  . HIS B 263 ? 0.3912 0.6757 0.4000 -0.0933 -0.0383 0.1081  854 HIS B CA  
4085 C C   . HIS B 263 ? 0.4242 0.7146 0.4315 -0.0947 -0.0325 0.0860  854 HIS B C   
4086 O O   . HIS B 263 ? 0.4128 0.6938 0.4348 -0.0886 -0.0312 0.0791  854 HIS B O   
4087 C CB  . HIS B 263 ? 0.4137 0.7138 0.4190 -0.1011 -0.0508 0.1211  854 HIS B CB  
4088 C CG  . HIS B 263 ? 0.4481 0.7508 0.4678 -0.0989 -0.0556 0.1174  854 HIS B CG  
4089 N ND1 . HIS B 263 ? 0.4707 0.7930 0.4824 -0.1084 -0.0615 0.1103  854 HIS B ND1 
4090 C CD2 . HIS B 263 ? 0.4529 0.7421 0.4940 -0.0889 -0.0547 0.1191  854 HIS B CD2 
4091 C CE1 . HIS B 263 ? 0.4558 0.7751 0.4855 -0.1041 -0.0647 0.1085  854 HIS B CE1 
4092 N NE2 . HIS B 263 ? 0.4530 0.7534 0.5009 -0.0926 -0.0603 0.1140  854 HIS B NE2 
4093 N N   . GLN B 264 ? 0.4044 0.7105 0.3953 -0.1028 -0.0290 0.0745  855 GLN B N   
4094 C CA  . GLN B 264 ? 0.4117 0.7225 0.4029 -0.1031 -0.0236 0.0514  855 GLN B CA  
4095 C C   . GLN B 264 ? 0.4208 0.7094 0.4262 -0.0915 -0.0155 0.0432  855 GLN B C   
4096 O O   . GLN B 264 ? 0.4179 0.6994 0.4342 -0.0878 -0.0144 0.0310  855 GLN B O   
4097 C CB  . GLN B 264 ? 0.4451 0.7787 0.4170 -0.1131 -0.0202 0.0396  855 GLN B CB  
4098 C CG  . GLN B 264 ? 0.5255 0.8656 0.4995 -0.1133 -0.0159 0.0134  855 GLN B CG  
4099 C CD  . GLN B 264 ? 0.6051 0.9469 0.5860 -0.1153 -0.0233 0.0083  855 GLN B CD  
4100 O OE1 . GLN B 264 ? 0.5926 0.9503 0.5640 -0.1242 -0.0314 0.0154  855 GLN B OE1 
4101 N NE2 . GLN B 264 ? 0.5163 0.8413 0.5146 -0.1076 -0.0213 -0.0030 855 GLN B NE2 
4102 N N   . LEU B 265 ? 0.3752 0.6522 0.3808 -0.0864 -0.0110 0.0514  856 LEU B N   
4103 C CA  . LEU B 265 ? 0.3696 0.6257 0.3873 -0.0757 -0.0044 0.0462  856 LEU B CA  
4104 C C   . LEU B 265 ? 0.4219 0.6619 0.4559 -0.0686 -0.0069 0.0525  856 LEU B C   
4105 O O   . LEU B 265 ? 0.3973 0.6252 0.4415 -0.0630 -0.0035 0.0431  856 LEU B O   
4106 C CB  . LEU B 265 ? 0.3482 0.5966 0.3621 -0.0728 -0.0002 0.0541  856 LEU B CB  
4107 C CG  . LEU B 265 ? 0.3770 0.6044 0.4014 -0.0623 0.0058  0.0498  856 LEU B CG  
4108 C CD1 . LEU B 265 ? 0.3528 0.5804 0.3817 -0.0600 0.0101  0.0304  856 LEU B CD1 
4109 C CD2 . LEU B 265 ? 0.3874 0.6098 0.4069 -0.0612 0.0087  0.0575  856 LEU B CD2 
4110 N N   . MET B 266 ? 0.3660 0.6077 0.4030 -0.0694 -0.0133 0.0681  857 MET B N   
4111 C CA  . MET B 266 ? 0.3579 0.5897 0.4113 -0.0637 -0.0153 0.0735  857 MET B CA  
4112 C C   . MET B 266 ? 0.4093 0.6472 0.4686 -0.0673 -0.0173 0.0614  857 MET B C   
4113 O O   . MET B 266 ? 0.4179 0.6436 0.4898 -0.0624 -0.0145 0.0573  857 MET B O   
4114 C CB  . MET B 266 ? 0.3849 0.6218 0.4423 -0.0644 -0.0229 0.0907  857 MET B CB  
4115 C CG  . MET B 266 ? 0.4135 0.6399 0.4702 -0.0594 -0.0219 0.1033  857 MET B CG  
4116 S SD  . MET B 266 ? 0.4562 0.6887 0.5205 -0.0600 -0.0330 0.1227  857 MET B SD  
4117 C CE  . MET B 266 ? 0.4097 0.6351 0.4636 -0.0606 -0.0338 0.1343  857 MET B CE  
4118 N N   . LEU B 267 ? 0.3611 0.6177 0.4105 -0.0767 -0.0224 0.0553  858 LEU B N   
4119 C CA  . LEU B 267 ? 0.3767 0.6400 0.4306 -0.0814 -0.0254 0.0419  858 LEU B CA  
4120 C C   . LEU B 267 ? 0.4222 0.6744 0.4803 -0.0780 -0.0191 0.0242  858 LEU B C   
4121 O O   . LEU B 267 ? 0.4306 0.6766 0.5007 -0.0778 -0.0206 0.0167  858 LEU B O   
4122 C CB  . LEU B 267 ? 0.3953 0.6822 0.4349 -0.0926 -0.0321 0.0380  858 LEU B CB  
4123 C CG  . LEU B 267 ? 0.4604 0.7596 0.4973 -0.0973 -0.0415 0.0559  858 LEU B CG  
4124 C CD1 . LEU B 267 ? 0.4635 0.7875 0.4827 -0.1099 -0.0482 0.0509  858 LEU B CD1 
4125 C CD2 . LEU B 267 ? 0.4497 0.7437 0.5067 -0.0938 -0.0465 0.0635  858 LEU B CD2 
4126 N N   . ASP B 268 ? 0.3507 0.6004 0.4004 -0.0755 -0.0128 0.0180  859 ASP B N   
4127 C CA  . ASP B 268 ? 0.3553 0.5939 0.4109 -0.0707 -0.0075 0.0020  859 ASP B CA  
4128 C C   . ASP B 268 ? 0.4074 0.6227 0.4778 -0.0622 -0.0050 0.0080  859 ASP B C   
4129 O O   . ASP B 268 ? 0.4077 0.6123 0.4882 -0.0602 -0.0048 -0.0025 859 ASP B O   
4130 C CB  . ASP B 268 ? 0.3660 0.6090 0.4114 -0.0695 -0.0015 -0.0033 859 ASP B CB  
4131 C CG  . ASP B 268 ? 0.4387 0.7068 0.4683 -0.0787 -0.0021 -0.0116 859 ASP B CG  
4132 O OD1 . ASP B 268 ? 0.4595 0.7407 0.4858 -0.0858 -0.0072 -0.0175 859 ASP B OD1 
4133 O OD2 . ASP B 268 ? 0.4602 0.7361 0.4802 -0.0797 0.0025  -0.0115 859 ASP B OD2 
4134 N N   . CYS B 269 ? 0.3538 0.5616 0.4251 -0.0577 -0.0035 0.0245  860 CYS B N   
4135 C CA  . CYS B 269 ? 0.3449 0.5338 0.4273 -0.0504 -0.0005 0.0320  860 CYS B CA  
4136 C C   . CYS B 269 ? 0.3916 0.5794 0.4869 -0.0526 -0.0041 0.0341  860 CYS B C   
4137 O O   . CYS B 269 ? 0.3580 0.5316 0.4635 -0.0490 -0.0017 0.0355  860 CYS B O   
4138 C CB  . CYS B 269 ? 0.3408 0.5257 0.4202 -0.0459 0.0017  0.0471  860 CYS B CB  
4139 S SG  . CYS B 269 ? 0.3921 0.5736 0.4594 -0.0429 0.0066  0.0458  860 CYS B SG  
4140 N N   . TRP B 270 ? 0.3648 0.5687 0.4595 -0.0593 -0.0102 0.0357  861 TRP B N   
4141 C CA  . TRP B 270 ? 0.3581 0.5648 0.4661 -0.0626 -0.0146 0.0385  861 TRP B CA  
4142 C C   . TRP B 270 ? 0.4424 0.6532 0.5538 -0.0695 -0.0191 0.0236  861 TRP B C   
4143 O O   . TRP B 270 ? 0.4415 0.6603 0.5616 -0.0748 -0.0247 0.0252  861 TRP B O   
4144 C CB  . TRP B 270 ? 0.3329 0.5536 0.4424 -0.0647 -0.0198 0.0518  861 TRP B CB  
4145 C CG  . TRP B 270 ? 0.3281 0.5444 0.4374 -0.0579 -0.0169 0.0660  861 TRP B CG  
4146 C CD1 . TRP B 270 ? 0.3517 0.5527 0.4656 -0.0499 -0.0098 0.0704  861 TRP B CD1 
4147 C CD2 . TRP B 270 ? 0.3240 0.5513 0.4299 -0.0586 -0.0220 0.0780  861 TRP B CD2 
4148 N NE1 . TRP B 270 ? 0.3343 0.5357 0.4482 -0.0452 -0.0097 0.0824  861 TRP B NE1 
4149 C CE2 . TRP B 270 ? 0.3652 0.5817 0.4752 -0.0501 -0.0176 0.0878  861 TRP B CE2 
4150 C CE3 . TRP B 270 ? 0.3304 0.5755 0.4294 -0.0659 -0.0308 0.0814  861 TRP B CE3 
4151 C CZ2 . TRP B 270 ? 0.3493 0.5702 0.4589 -0.0481 -0.0219 0.1006  861 TRP B CZ2 
4152 C CZ3 . TRP B 270 ? 0.3395 0.5894 0.4370 -0.0645 -0.0354 0.0959  861 TRP B CZ3 
4153 C CH2 . TRP B 270 ? 0.3437 0.5807 0.4480 -0.0553 -0.0312 0.1054  861 TRP B CH2 
4154 N N   . GLN B 271 ? 0.4213 0.6265 0.5283 -0.0690 -0.0170 0.0084  862 GLN B N   
4155 C CA  . GLN B 271 ? 0.4365 0.6430 0.5489 -0.0746 -0.0214 -0.0080 862 GLN B CA  
4156 C C   . GLN B 271 ? 0.4824 0.6734 0.6129 -0.0745 -0.0227 -0.0056 862 GLN B C   
4157 O O   . GLN B 271 ? 0.4721 0.6472 0.6082 -0.0685 -0.0179 0.0024  862 GLN B O   
4158 C CB  . GLN B 271 ? 0.4654 0.6693 0.5719 -0.0725 -0.0184 -0.0260 862 GLN B CB  
4159 C CG  . GLN B 271 ? 0.6530 0.8793 0.7419 -0.0774 -0.0187 -0.0328 862 GLN B CG  
4160 C CD  . GLN B 271 ? 1.0952 1.3220 1.1789 -0.0743 -0.0138 -0.0492 862 GLN B CD  
4161 O OE1 . GLN B 271 ? 1.1041 1.3383 1.1879 -0.0777 -0.0154 -0.0689 862 GLN B OE1 
4162 N NE2 . GLN B 271 ? 1.0372 1.2579 1.1171 -0.0679 -0.0079 -0.0422 862 GLN B NE2 
4163 N N   . LYS B 272 ? 0.4452 0.6424 0.5843 -0.0822 -0.0294 -0.0109 863 LYS B N   
4164 C CA  . LYS B 272 ? 0.4326 0.6173 0.5897 -0.0848 -0.0316 -0.0084 863 LYS B CA  
4165 C C   . LYS B 272 ? 0.4805 0.6421 0.6439 -0.0803 -0.0290 -0.0161 863 LYS B C   
4166 O O   . LYS B 272 ? 0.4591 0.6063 0.6306 -0.0775 -0.0259 -0.0051 863 LYS B O   
4167 C CB  . LYS B 272 ? 0.4512 0.6469 0.6153 -0.0948 -0.0403 -0.0173 863 LYS B CB  
4168 C CG  . LYS B 272 ? 0.5873 0.7741 0.7711 -0.0995 -0.0432 -0.0116 863 LYS B CG  
4169 C CD  . LYS B 272 ? 0.7295 0.9274 0.9203 -0.1101 -0.0526 -0.0216 863 LYS B CD  
4170 C CE  . LYS B 272 ? 0.8822 1.0702 1.0940 -0.1163 -0.0559 -0.0174 863 LYS B CE  
4171 N NZ  . LYS B 272 ? 0.9343 1.1335 1.1533 -0.1273 -0.0660 -0.0279 863 LYS B NZ  
4172 N N   . ASP B 273 ? 0.4726 0.6318 0.6318 -0.0794 -0.0303 -0.0345 864 ASP B N   
4173 C CA  . ASP B 273 ? 0.4787 0.6167 0.6452 -0.0741 -0.0292 -0.0430 864 ASP B CA  
4174 C C   . ASP B 273 ? 0.5027 0.6352 0.6602 -0.0650 -0.0219 -0.0343 864 ASP B C   
4175 O O   . ASP B 273 ? 0.4929 0.6374 0.6375 -0.0622 -0.0186 -0.0394 864 ASP B O   
4176 C CB  . ASP B 273 ? 0.5125 0.6528 0.6796 -0.0752 -0.0328 -0.0677 864 ASP B CB  
4177 C CG  . ASP B 273 ? 0.6640 0.7815 0.8433 -0.0692 -0.0340 -0.0787 864 ASP B CG  
4178 O OD1 . ASP B 273 ? 0.6610 0.7602 0.8461 -0.0644 -0.0321 -0.0657 864 ASP B OD1 
4179 O OD2 . ASP B 273 ? 0.7784 0.8968 0.9620 -0.0694 -0.0372 -0.1006 864 ASP B OD2 
4180 N N   . ARG B 274 ? 0.4557 0.5710 0.6199 -0.0614 -0.0196 -0.0213 865 ARG B N   
4181 C CA  . ARG B 274 ? 0.4555 0.5635 0.6122 -0.0533 -0.0134 -0.0124 865 ARG B CA  
4182 C C   . ARG B 274 ? 0.5130 0.6170 0.6665 -0.0472 -0.0126 -0.0266 865 ARG B C   
4183 O O   . ARG B 274 ? 0.4987 0.6065 0.6419 -0.0419 -0.0076 -0.0227 865 ARG B O   
4184 C CB  . ARG B 274 ? 0.4706 0.5610 0.6346 -0.0521 -0.0120 0.0024  865 ARG B CB  
4185 C CG  . ARG B 274 ? 0.6002 0.6691 0.7771 -0.0522 -0.0170 -0.0033 865 ARG B CG  
4186 C CD  . ARG B 274 ? 0.7458 0.7996 0.9282 -0.0534 -0.0160 0.0132  865 ARG B CD  
4187 N NE  . ARG B 274 ? 0.9894 1.0210 1.1786 -0.0500 -0.0200 0.0111  865 ARG B NE  
4188 C CZ  . ARG B 274 ? 1.3065 1.3228 1.5107 -0.0539 -0.0278 0.0045  865 ARG B CZ  
4189 N NH1 . ARG B 274 ? 1.1965 1.2181 1.4098 -0.0619 -0.0321 -0.0016 865 ARG B NH1 
4190 N NH2 . ARG B 274 ? 1.2021 1.1974 1.4133 -0.0499 -0.0324 0.0041  865 ARG B NH2 
4191 N N   . ASN B 275 ? 0.4884 0.5856 0.6521 -0.0479 -0.0176 -0.0438 866 ASN B N   
4192 C CA  . ASN B 275 ? 0.4916 0.5868 0.6567 -0.0416 -0.0172 -0.0603 866 ASN B CA  
4193 C C   . ASN B 275 ? 0.5209 0.6408 0.6726 -0.0426 -0.0135 -0.0714 866 ASN B C   
4194 O O   . ASN B 275 ? 0.5291 0.6530 0.6786 -0.0370 -0.0103 -0.0811 866 ASN B O   
4195 C CB  . ASN B 275 ? 0.5345 0.6150 0.7174 -0.0417 -0.0243 -0.0765 866 ASN B CB  
4196 C CG  . ASN B 275 ? 0.8140 0.8682 1.0105 -0.0414 -0.0290 -0.0650 866 ASN B CG  
4197 O OD1 . ASN B 275 ? 0.7096 0.7519 0.9049 -0.0361 -0.0270 -0.0524 866 ASN B OD1 
4198 N ND2 . ASN B 275 ? 0.7254 0.7705 0.9350 -0.0479 -0.0358 -0.0691 866 ASN B ND2 
4199 N N   . SER B 276 ? 0.4643 0.6021 0.6072 -0.0501 -0.0141 -0.0691 867 SER B N   
4200 C CA  . SER B 276 ? 0.4564 0.6193 0.5840 -0.0534 -0.0113 -0.0766 867 SER B CA  
4201 C C   . SER B 276 ? 0.4909 0.6621 0.6043 -0.0516 -0.0058 -0.0597 867 SER B C   
4202 O O   . SER B 276 ? 0.5151 0.7051 0.6155 -0.0538 -0.0028 -0.0639 867 SER B O   
4203 C CB  . SER B 276 ? 0.5151 0.6930 0.6396 -0.0630 -0.0163 -0.0812 867 SER B CB  
4204 O OG  . SER B 276 ? 0.6782 0.8478 0.8162 -0.0649 -0.0217 -0.0989 867 SER B OG  
4205 N N   . ARG B 277 ? 0.4138 0.5711 0.5297 -0.0480 -0.0044 -0.0413 868 ARG B N   
4206 C CA  . ARG B 277 ? 0.3853 0.5473 0.4900 -0.0458 0.0000  -0.0259 868 ARG B CA  
4207 C C   . ARG B 277 ? 0.4360 0.5966 0.5362 -0.0400 0.0047  -0.0306 868 ARG B C   
4208 O O   . ARG B 277 ? 0.4280 0.5757 0.5378 -0.0347 0.0045  -0.0392 868 ARG B O   
4209 C CB  . ARG B 277 ? 0.3664 0.5146 0.4762 -0.0433 0.0007  -0.0079 868 ARG B CB  
4210 C CG  . ARG B 277 ? 0.3664 0.5196 0.4818 -0.0492 -0.0033 -0.0014 868 ARG B CG  
4211 C CD  . ARG B 277 ? 0.4237 0.5656 0.5464 -0.0469 -0.0015 0.0140  868 ARG B CD  
4212 N NE  . ARG B 277 ? 0.4412 0.5871 0.5743 -0.0532 -0.0059 0.0160  868 ARG B NE  
4213 C CZ  . ARG B 277 ? 0.4752 0.6116 0.6194 -0.0540 -0.0055 0.0243  868 ARG B CZ  
4214 N NH1 . ARG B 277 ? 0.3487 0.4710 0.4932 -0.0488 -0.0007 0.0323  868 ARG B NH1 
4215 N NH2 . ARG B 277 ? 0.3379 0.4798 0.4927 -0.0609 -0.0099 0.0247  868 ARG B NH2 
4216 N N   . PRO B 278 ? 0.3722 0.5453 0.4594 -0.0408 0.0082  -0.0239 869 PRO B N   
4217 C CA  . PRO B 278 ? 0.3699 0.5418 0.4545 -0.0357 0.0126  -0.0272 869 PRO B CA  
4218 C C   . PRO B 278 ? 0.4255 0.5759 0.5156 -0.0285 0.0136  -0.0161 869 PRO B C   
4219 O O   . PRO B 278 ? 0.4052 0.5466 0.4965 -0.0284 0.0127  -0.0029 869 PRO B O   
4220 C CB  . PRO B 278 ? 0.3785 0.5679 0.4481 -0.0405 0.0150  -0.0195 869 PRO B CB  
4221 C CG  . PRO B 278 ? 0.4341 0.6248 0.5005 -0.0444 0.0117  -0.0052 869 PRO B CG  
4222 C CD  . PRO B 278 ? 0.3875 0.5748 0.4635 -0.0464 0.0074  -0.0118 869 PRO B CD  
4223 N N   . ARG B 279 ? 0.3802 0.5241 0.4743 -0.0228 0.0152  -0.0222 870 ARG B N   
4224 C CA  . ARG B 279 ? 0.3651 0.4911 0.4616 -0.0165 0.0159  -0.0125 870 ARG B CA  
4225 C C   . ARG B 279 ? 0.4032 0.5355 0.4876 -0.0170 0.0196  -0.0017 870 ARG B C   
4226 O O   . ARG B 279 ? 0.3865 0.5362 0.4633 -0.0215 0.0212  -0.0043 870 ARG B O   
4227 C CB  . ARG B 279 ? 0.3372 0.4558 0.4438 -0.0104 0.0146  -0.0242 870 ARG B CB  
4228 C CG  . ARG B 279 ? 0.5298 0.6361 0.6508 -0.0092 0.0094  -0.0328 870 ARG B CG  
4229 C CD  . ARG B 279 ? 0.7691 0.8633 0.9027 -0.0019 0.0063  -0.0408 870 ARG B CD  
4230 N NE  . ARG B 279 ? 1.1286 1.2053 1.2762 -0.0011 -0.0001 -0.0438 870 ARG B NE  
4231 C CZ  . ARG B 279 ? 1.4412 1.5069 1.6046 0.0046  -0.0052 -0.0544 870 ARG B CZ  
4232 N NH1 . ARG B 279 ? 1.3642 1.4368 1.5321 0.0107  -0.0042 -0.0641 870 ARG B NH1 
4233 N NH2 . ARG B 279 ? 1.2559 1.3038 1.4321 0.0042  -0.0120 -0.0552 870 ARG B NH2 
4234 N N   . PHE B 280 ? 0.3383 0.4568 0.4209 -0.0129 0.0206  0.0101  871 PHE B N   
4235 C CA  . PHE B 280 ? 0.3293 0.4506 0.4023 -0.0129 0.0232  0.0196  871 PHE B CA  
4236 C C   . PHE B 280 ? 0.4061 0.5386 0.4757 -0.0135 0.0251  0.0126  871 PHE B C   
4237 O O   . PHE B 280 ? 0.3965 0.5383 0.4576 -0.0174 0.0266  0.0184  871 PHE B O   
4238 C CB  . PHE B 280 ? 0.3357 0.4402 0.4076 -0.0082 0.0240  0.0305  871 PHE B CB  
4239 C CG  . PHE B 280 ? 0.3481 0.4493 0.4206 -0.0094 0.0242  0.0402  871 PHE B CG  
4240 C CD1 . PHE B 280 ? 0.3656 0.4759 0.4339 -0.0124 0.0245  0.0471  871 PHE B CD1 
4241 C CD2 . PHE B 280 ? 0.3596 0.4493 0.4380 -0.0078 0.0237  0.0431  871 PHE B CD2 
4242 C CE1 . PHE B 280 ? 0.3703 0.4795 0.4423 -0.0127 0.0245  0.0552  871 PHE B CE1 
4243 C CE2 . PHE B 280 ? 0.3867 0.4763 0.4674 -0.0091 0.0248  0.0517  871 PHE B CE2 
4244 C CZ  . PHE B 280 ? 0.3545 0.4545 0.4330 -0.0110 0.0253  0.0568  871 PHE B CZ  
4245 N N   . ALA B 281 ? 0.3483 0.4813 0.4258 -0.0102 0.0246  -0.0002 872 ALA B N   
4246 C CA  . ALA B 281 ? 0.3470 0.4938 0.4241 -0.0108 0.0271  -0.0083 872 ALA B CA  
4247 C C   . ALA B 281 ? 0.4396 0.6096 0.5101 -0.0186 0.0294  -0.0139 872 ALA B C   
4248 O O   . ALA B 281 ? 0.4435 0.6268 0.5069 -0.0229 0.0322  -0.0116 872 ALA B O   
4249 C CB  . ALA B 281 ? 0.3482 0.4915 0.4388 -0.0045 0.0254  -0.0217 872 ALA B CB  
4250 N N   . GLU B 282 ? 0.4131 0.5882 0.4851 -0.0215 0.0279  -0.0201 873 GLU B N   
4251 C CA  . GLU B 282 ? 0.4159 0.6134 0.4798 -0.0298 0.0292  -0.0254 873 GLU B CA  
4252 C C   . GLU B 282 ? 0.4315 0.6327 0.4826 -0.0360 0.0285  -0.0084 873 GLU B C   
4253 O O   . GLU B 282 ? 0.4424 0.6623 0.4833 -0.0435 0.0302  -0.0071 873 GLU B O   
4254 C CB  . GLU B 282 ? 0.4411 0.6404 0.5101 -0.0313 0.0264  -0.0360 873 GLU B CB  
4255 C CG  . GLU B 282 ? 0.6564 0.8541 0.7395 -0.0260 0.0261  -0.0555 873 GLU B CG  
4256 C CD  . GLU B 282 ? 0.8558 1.0507 0.9447 -0.0278 0.0221  -0.0643 873 GLU B CD  
4257 O OE1 . GLU B 282 ? 0.4753 0.6491 0.5755 -0.0229 0.0181  -0.0625 873 GLU B OE1 
4258 O OE2 . GLU B 282 ? 0.7327 0.9466 0.8135 -0.0353 0.0225  -0.0707 873 GLU B OE2 
4259 N N   . ILE B 283 ? 0.3587 0.5431 0.4110 -0.0331 0.0259  0.0045  874 ILE B N   
4260 C CA  . ILE B 283 ? 0.3479 0.5329 0.3921 -0.0370 0.0241  0.0208  874 ILE B CA  
4261 C C   . ILE B 283 ? 0.3855 0.5730 0.4229 -0.0386 0.0262  0.0279  874 ILE B C   
4262 O O   . ILE B 283 ? 0.3725 0.5733 0.4007 -0.0462 0.0253  0.0345  874 ILE B O   
4263 C CB  . ILE B 283 ? 0.3619 0.5290 0.4120 -0.0320 0.0220  0.0310  874 ILE B CB  
4264 C CG1 . ILE B 283 ? 0.3713 0.5402 0.4277 -0.0336 0.0191  0.0254  874 ILE B CG1 
4265 C CG2 . ILE B 283 ? 0.3352 0.5013 0.3801 -0.0337 0.0202  0.0467  874 ILE B CG2 
4266 C CD1 . ILE B 283 ? 0.3362 0.4894 0.4012 -0.0290 0.0183  0.0318  874 ILE B CD1 
4267 N N   . VAL B 284 ? 0.3525 0.5282 0.3945 -0.0325 0.0282  0.0262  875 VAL B N   
4268 C CA  . VAL B 284 ? 0.3591 0.5362 0.3965 -0.0341 0.0298  0.0315  875 VAL B CA  
4269 C C   . VAL B 284 ? 0.4109 0.6121 0.4427 -0.0425 0.0324  0.0250  875 VAL B C   
4270 O O   . VAL B 284 ? 0.4107 0.6197 0.4339 -0.0497 0.0320  0.0349  875 VAL B O   
4271 C CB  . VAL B 284 ? 0.3850 0.5473 0.4290 -0.0263 0.0309  0.0284  875 VAL B CB  
4272 C CG1 . VAL B 284 ? 0.3790 0.5450 0.4195 -0.0291 0.0322  0.0320  875 VAL B CG1 
4273 C CG2 . VAL B 284 ? 0.3753 0.5163 0.4215 -0.0199 0.0291  0.0367  875 VAL B CG2 
4274 N N   . ASN B 285 ? 0.3701 0.5835 0.4071 -0.0418 0.0348  0.0083  876 ASN B N   
4275 C CA  . ASN B 285 ? 0.3804 0.6202 0.4129 -0.0494 0.0388  -0.0012 876 ASN B CA  
4276 C C   . ASN B 285 ? 0.4199 0.6765 0.4387 -0.0603 0.0377  0.0058  876 ASN B C   
4277 O O   . ASN B 285 ? 0.4188 0.6931 0.4287 -0.0694 0.0399  0.0098  876 ASN B O   
4278 C CB  . ASN B 285 ? 0.3612 0.6098 0.4043 -0.0451 0.0413  -0.0225 876 ASN B CB  
4279 C CG  . ASN B 285 ? 0.5243 0.7618 0.5810 -0.0357 0.0419  -0.0293 876 ASN B CG  
4280 O OD1 . ASN B 285 ? 0.3627 0.5909 0.4193 -0.0340 0.0416  -0.0198 876 ASN B OD1 
4281 N ND2 . ASN B 285 ? 0.4408 0.6782 0.5104 -0.0294 0.0417  -0.0460 876 ASN B ND2 
4282 N N   . THR B 286 ? 0.3878 0.6392 0.4053 -0.0602 0.0336  0.0086  877 THR B N   
4283 C CA  . THR B 286 ? 0.3927 0.6588 0.3977 -0.0702 0.0305  0.0163  877 THR B CA  
4284 C C   . THR B 286 ? 0.4266 0.6879 0.4238 -0.0750 0.0272  0.0374  877 THR B C   
4285 O O   . THR B 286 ? 0.4262 0.7057 0.4114 -0.0859 0.0266  0.0437  877 THR B O   
4286 C CB  . THR B 286 ? 0.4098 0.6691 0.4187 -0.0677 0.0260  0.0144  877 THR B CB  
4287 O OG1 . THR B 286 ? 0.4736 0.7375 0.4902 -0.0643 0.0286  -0.0063 877 THR B OG1 
4288 C CG2 . THR B 286 ? 0.3360 0.6105 0.3327 -0.0778 0.0212  0.0229  877 THR B CG2 
4289 N N   . LEU B 287 ? 0.3794 0.6164 0.3838 -0.0672 0.0248  0.0479  878 LEU B N   
4290 C CA  . LEU B 287 ? 0.3792 0.6071 0.3798 -0.0697 0.0211  0.0665  878 LEU B CA  
4291 C C   . LEU B 287 ? 0.4120 0.6476 0.4077 -0.0757 0.0240  0.0689  878 LEU B C   
4292 O O   . LEU B 287 ? 0.4157 0.6565 0.4033 -0.0844 0.0207  0.0827  878 LEU B O   
4293 C CB  . LEU B 287 ? 0.3649 0.5665 0.3754 -0.0590 0.0191  0.0729  878 LEU B CB  
4294 C CG  . LEU B 287 ? 0.4092 0.6046 0.4253 -0.0547 0.0158  0.0744  878 LEU B CG  
4295 C CD1 . LEU B 287 ? 0.3855 0.5585 0.4111 -0.0444 0.0161  0.0778  878 LEU B CD1 
4296 C CD2 . LEU B 287 ? 0.4428 0.6475 0.4533 -0.0618 0.0092  0.0871  878 LEU B CD2 
4297 N N   . ASP B 288 ? 0.3922 0.6298 0.3936 -0.0718 0.0297  0.0557  879 ASP B N   
4298 C CA  . ASP B 288 ? 0.3795 0.6279 0.3787 -0.0777 0.0333  0.0555  879 ASP B CA  
4299 C C   . ASP B 288 ? 0.4427 0.7211 0.4304 -0.0912 0.0357  0.0545  879 ASP B C   
4300 O O   . ASP B 288 ? 0.4291 0.7155 0.4103 -0.1008 0.0357  0.0649  879 ASP B O   
4301 C CB  . ASP B 288 ? 0.3949 0.6410 0.4053 -0.0696 0.0380  0.0403  879 ASP B CB  
4302 C CG  . ASP B 288 ? 0.4554 0.6745 0.4732 -0.0601 0.0356  0.0457  879 ASP B CG  
4303 O OD1 . ASP B 288 ? 0.4533 0.6573 0.4678 -0.0605 0.0314  0.0602  879 ASP B OD1 
4304 O OD2 . ASP B 288 ? 0.4043 0.6175 0.4314 -0.0522 0.0374  0.0350  879 ASP B OD2 
4305 N N   . LYS B 289 ? 0.4277 0.7226 0.4120 -0.0930 0.0374  0.0426  880 LYS B N   
4306 C CA  . LYS B 289 ? 0.4445 0.7709 0.4155 -0.1066 0.0402  0.0399  880 LYS B CA  
4307 C C   . LYS B 289 ? 0.4999 0.8275 0.4573 -0.1168 0.0331  0.0612  880 LYS B C   
4308 O O   . LYS B 289 ? 0.5346 0.8815 0.4800 -0.1301 0.0339  0.0693  880 LYS B O   
4309 C CB  . LYS B 289 ? 0.4751 0.8181 0.4464 -0.1052 0.0435  0.0193  880 LYS B CB  
4310 C CG  . LYS B 289 ? 0.6517 0.9994 0.6371 -0.0969 0.0504  -0.0031 880 LYS B CG  
4311 C CD  . LYS B 289 ? 0.8462 1.2003 0.8359 -0.0926 0.0512  -0.0230 880 LYS B CD  
4312 C CE  . LYS B 289 ? 1.0776 1.4340 1.0842 -0.0830 0.0565  -0.0454 880 LYS B CE  
4313 N NZ  . LYS B 289 ? 1.2641 1.6158 1.2787 -0.0765 0.0547  -0.0623 880 LYS B NZ  
4314 N N   . MET B 290 ? 0.4235 0.7305 0.3841 -0.1108 0.0257  0.0710  881 MET B N   
4315 C CA  . MET B 290 ? 0.4283 0.7333 0.3799 -0.1182 0.0169  0.0917  881 MET B CA  
4316 C C   . MET B 290 ? 0.4794 0.7743 0.4297 -0.1230 0.0137  0.1103  881 MET B C   
4317 O O   . MET B 290 ? 0.4974 0.8036 0.4357 -0.1357 0.0090  0.1256  881 MET B O   
4318 C CB  . MET B 290 ? 0.4537 0.7391 0.4138 -0.1087 0.0104  0.0960  881 MET B CB  
4319 C CG  . MET B 290 ? 0.5128 0.8106 0.4712 -0.1086 0.0103  0.0834  881 MET B CG  
4320 S SD  . MET B 290 ? 0.5733 0.8469 0.5457 -0.0969 0.0037  0.0890  881 MET B SD  
4321 C CE  . MET B 290 ? 0.5422 0.8328 0.5123 -0.0991 0.0038  0.0720  881 MET B CE  
4322 N N   . ILE B 291 ? 0.4372 0.7113 0.3993 -0.1137 0.0157  0.1089  882 ILE B N   
4323 C CA  . ILE B 291 ? 0.4501 0.7110 0.4138 -0.1168 0.0129  0.1234  882 ILE B CA  
4324 C C   . ILE B 291 ? 0.5239 0.8085 0.4777 -0.1316 0.0169  0.1255  882 ILE B C   
4325 O O   . ILE B 291 ? 0.5393 0.8215 0.4882 -0.1414 0.0119  0.1433  882 ILE B O   
4326 C CB  . ILE B 291 ? 0.4694 0.7051 0.4473 -0.1030 0.0150  0.1169  882 ILE B CB  
4327 C CG1 . ILE B 291 ? 0.4625 0.6744 0.4484 -0.0920 0.0095  0.1223  882 ILE B CG1 
4328 C CG2 . ILE B 291 ? 0.4783 0.7057 0.4583 -0.1070 0.0147  0.1246  882 ILE B CG2 
4329 C CD1 . ILE B 291 ? 0.4831 0.6744 0.4809 -0.0772 0.0132  0.1110  882 ILE B CD1 
4330 N N   . ARG B 292 ? 0.4935 0.8021 0.4454 -0.1336 0.0259  0.1072  883 ARG B N   
4331 C CA  . ARG B 292 ? 0.4974 0.8339 0.4418 -0.1470 0.0322  0.1050  883 ARG B CA  
4332 C C   . ARG B 292 ? 0.5922 0.9599 0.5186 -0.1620 0.0329  0.1075  883 ARG B C   
4333 O O   . ARG B 292 ? 0.6191 1.0117 0.5366 -0.1759 0.0375  0.1099  883 ARG B O   
4334 C CB  . ARG B 292 ? 0.4627 0.8083 0.4184 -0.1395 0.0418  0.0824  883 ARG B CB  
4335 C CG  . ARG B 292 ? 0.4982 0.8191 0.4676 -0.1306 0.0408  0.0844  883 ARG B CG  
4336 C CD  . ARG B 292 ? 0.3757 0.6947 0.3593 -0.1176 0.0464  0.0633  883 ARG B CD  
4337 N NE  . ARG B 292 ? 0.4512 0.7460 0.4458 -0.1096 0.0441  0.0664  883 ARG B NE  
4338 C CZ  . ARG B 292 ? 0.5154 0.7800 0.5145 -0.0989 0.0386  0.0717  883 ARG B CZ  
4339 N NH1 . ARG B 292 ? 0.3825 0.6377 0.3777 -0.0950 0.0349  0.0754  883 ARG B NH1 
4340 N NH2 . ARG B 292 ? 0.4496 0.6947 0.4568 -0.0926 0.0368  0.0732  883 ARG B NH2 
4341 N N   . ASN B 293 ? 0.5827 0.9513 0.5032 -0.1601 0.0285  0.1067  884 ASN B N   
4342 C CA  . ASN B 293 ? 0.6092 1.0079 0.5109 -0.1745 0.0283  0.1083  884 ASN B CA  
4343 C C   . ASN B 293 ? 0.6706 1.0587 0.5637 -0.1797 0.0155  0.1315  884 ASN B C   
4344 O O   . ASN B 293 ? 0.6317 1.0113 0.5274 -0.1723 0.0105  0.1287  884 ASN B O   
4345 C CB  . ASN B 293 ? 0.6539 1.0724 0.5550 -0.1704 0.0354  0.0822  884 ASN B CB  
4346 C CG  . ASN B 293 ? 1.1214 1.5712 1.0018 -0.1846 0.0348  0.0811  884 ASN B CG  
4347 O OD1 . ASN B 293 ? 1.1993 1.6703 1.0624 -0.2016 0.0340  0.0950  884 ASN B OD1 
4348 N ND2 . ASN B 293 ? 1.0124 1.4658 0.8938 -0.1786 0.0347  0.0648  884 ASN B ND2 
4349 N N   . PRO B 294 ? 0.6891 1.0777 0.5734 -0.1927 0.0096  0.1550  885 PRO B N   
4350 C CA  . PRO B 294 ? 0.7199 1.0966 0.5984 -0.1974 -0.0044 0.1792  885 PRO B CA  
4351 C C   . PRO B 294 ? 0.7899 1.1856 0.6545 -0.2032 -0.0093 0.1788  885 PRO B C   
4352 O O   . PRO B 294 ? 0.7821 1.1615 0.6509 -0.1983 -0.0206 0.1911  885 PRO B O   
4353 C CB  . PRO B 294 ? 0.7638 1.1456 0.6329 -0.2140 -0.0081 0.2017  885 PRO B CB  
4354 C CG  . PRO B 294 ? 0.8051 1.2131 0.6694 -0.2219 0.0054  0.1874  885 PRO B CG  
4355 C CD  . PRO B 294 ? 0.7183 1.1163 0.5999 -0.2037 0.0144  0.1616  885 PRO B CD  
4356 N N   . ALA B 295 ? 0.7676 1.1980 0.6171 -0.2128 -0.0009 0.1634  886 ALA B N   
4357 C CA  . ALA B 295 ? 0.7976 1.2494 0.6319 -0.2195 -0.0048 0.1596  886 ALA B CA  
4358 C C   . ALA B 295 ? 0.8806 1.3150 0.7293 -0.2029 -0.0076 0.1462  886 ALA B C   
4359 O O   . ALA B 295 ? 0.9011 1.3365 0.7446 -0.2049 -0.0177 0.1542  886 ALA B O   
4360 C CB  . ALA B 295 ? 0.8190 1.3105 0.6370 -0.2308 0.0071  0.1401  886 ALA B CB  
4361 N N   . SER B 296 ? 0.8228 1.2410 0.6901 -0.1872 0.0005  0.1274  887 SER B N   
4362 C CA  . SER B 296 ? 0.8072 1.2084 0.6894 -0.1720 -0.0009 0.1142  887 SER B CA  
4363 C C   . SER B 296 ? 0.8688 1.2416 0.7628 -0.1636 -0.0125 0.1326  887 SER B C   
4364 O O   . SER B 296 ? 0.8652 1.2309 0.7673 -0.1557 -0.0160 0.1262  887 SER B O   
4365 C CB  . SER B 296 ? 0.8091 1.2001 0.7075 -0.1587 0.0098  0.0922  887 SER B CB  
4366 O OG  . SER B 296 ? 0.8531 1.2165 0.7656 -0.1495 0.0093  0.1016  887 SER B OG  
4367 N N   . LEU B 297 ? 0.8176 1.1748 0.7142 -0.1654 -0.0184 0.1546  888 LEU B N   
4368 C CA  . LEU B 297 ? 0.8106 1.1418 0.7202 -0.1571 -0.0293 0.1718  888 LEU B CA  
4369 C C   . LEU B 297 ? 0.9563 1.2942 0.8553 -0.1689 -0.0432 0.1965  888 LEU B C   
4370 O O   . LEU B 297 ? 0.9585 1.2747 0.8689 -0.1639 -0.0528 0.2145  888 LEU B O   
4371 C CB  . LEU B 297 ? 0.7911 1.0941 0.7161 -0.1472 -0.0274 0.1766  888 LEU B CB  
4372 C CG  . LEU B 297 ? 0.8184 1.1086 0.7572 -0.1329 -0.0168 0.1556  888 LEU B CG  
4373 C CD1 . LEU B 297 ? 0.8042 1.0703 0.7542 -0.1259 -0.0159 0.1615  888 LEU B CD1 
4374 C CD2 . LEU B 297 ? 0.8074 1.0883 0.7583 -0.1207 -0.0179 0.1457  888 LEU B CD2 
4375 N N   . LYS B 298 ? 0.9703 1.3377 0.8493 -0.1829 -0.0453 0.1961  889 LYS B N   
4376 C CA  . LYS B 298 ? 1.0054 1.3820 0.8723 -0.1951 -0.0597 0.2196  889 LYS B CA  
4377 C C   . LYS B 298 ? 1.0734 1.4372 0.9546 -0.1853 -0.0715 0.2258  889 LYS B C   
4378 O O   . LYS B 298 ? 1.0498 1.4109 0.9417 -0.1746 -0.0673 0.2076  889 LYS B O   
4379 C CB  . LYS B 298 ? 1.0555 1.4701 0.8946 -0.2137 -0.0576 0.2157  889 LYS B CB  
4380 N N   . THR B 299 ? 1.0629 1.4195 0.9453 -0.1897 -0.0869 0.2522  890 THR B N   
4381 C CA  . THR B 299 ? 1.4519 1.7978 1.3497 -0.1818 -0.1007 0.2632  890 THR B CA  
4382 C C   . THR B 299 ? 1.7636 2.1303 1.6556 -0.1837 -0.1028 0.2509  890 THR B C   
4383 O O   . THR B 299 ? 1.2464 1.6033 1.1573 -0.1722 -0.1077 0.2483  890 THR B O   
4384 C CB  . THR B 299 ? 1.5677 1.9081 1.4635 -0.1900 -0.1179 0.2947  890 THR B CB  
4385 O OG1 . THR B 299 ? 1.5765 1.9444 1.4430 -0.2111 -0.1211 0.3046  890 THR B OG1 
4386 C CG2 . THR B 299 ? 1.5414 1.8526 1.4523 -0.1835 -0.1189 0.3070  890 THR B CG2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   592 ?   ?   ?   A . n 
A 1 2   GLY 2   593 ?   ?   ?   A . n 
A 1 3   HIS 3   594 ?   ?   ?   A . n 
A 1 4   HIS 4   595 ?   ?   ?   A . n 
A 1 5   HIS 5   596 ?   ?   ?   A . n 
A 1 6   HIS 6   597 ?   ?   ?   A . n 
A 1 7   HIS 7   598 ?   ?   ?   A . n 
A 1 8   HIS 8   599 ?   ?   ?   A . n 
A 1 9   GLY 9   600 ?   ?   ?   A . n 
A 1 10  SER 10  601 ?   ?   ?   A . n 
A 1 11  ASP 11  602 ?   ?   ?   A . n 
A 1 12  PRO 12  603 ?   ?   ?   A . n 
A 1 13  ASN 13  604 ?   ?   ?   A . n 
A 1 14  GLU 14  605 ?   ?   ?   A . n 
A 1 15  ALA 15  606 ?   ?   ?   A . n 
A 1 16  VAL 16  607 ?   ?   ?   A . n 
A 1 17  ARG 17  608 ?   ?   ?   A . n 
A 1 18  GLU 18  609 609 GLU GLU A . n 
A 1 19  PHE 19  610 610 PHE PHE A . n 
A 1 20  ALA 20  611 611 ALA ALA A . n 
A 1 21  LYS 21  612 612 LYS LYS A . n 
A 1 22  GLU 22  613 613 GLU GLU A . n 
A 1 23  ILE 23  614 614 ILE ILE A . n 
A 1 24  ASP 24  615 615 ASP ASP A . n 
A 1 25  VAL 25  616 616 VAL VAL A . n 
A 1 26  SER 26  617 617 SER SER A . n 
A 1 27  PHE 27  618 618 PHE PHE A . n 
A 1 28  VAL 28  619 619 VAL VAL A . n 
A 1 29  LYS 29  620 620 LYS LYS A . n 
A 1 30  ILE 30  621 621 ILE ILE A . n 
A 1 31  GLU 31  622 622 GLU GLU A . n 
A 1 32  GLU 32  623 623 GLU GLU A . n 
A 1 33  VAL 33  624 624 VAL VAL A . n 
A 1 34  ILE 34  625 625 ILE ILE A . n 
A 1 35  GLY 35  626 626 GLY GLY A . n 
A 1 36  ALA 36  627 627 ALA ALA A . n 
A 1 37  GLY 37  628 628 GLY GLY A . n 
A 1 38  GLU 38  629 629 GLU GLU A . n 
A 1 39  PHE 39  630 630 PHE PHE A . n 
A 1 40  GLY 40  631 631 GLY GLY A . n 
A 1 41  GLU 41  632 632 GLU GLU A . n 
A 1 42  VAL 42  633 633 VAL VAL A . n 
A 1 43  TYR 43  634 634 TYR TYR A . n 
A 1 44  LYS 44  635 635 LYS LYS A . n 
A 1 45  GLY 45  636 636 GLY GLY A . n 
A 1 46  ARG 46  637 637 ARG ARG A . n 
A 1 47  LEU 47  638 638 LEU LEU A . n 
A 1 48  LYS 48  639 639 LYS LYS A . n 
A 1 49  LEU 49  640 640 LEU LEU A . n 
A 1 50  PRO 50  641 641 PRO PRO A . n 
A 1 51  GLY 51  642 642 GLY GLY A . n 
A 1 52  LYS 52  643 643 LYS LYS A . n 
A 1 53  ARG 53  644 644 ARG ARG A . n 
A 1 54  GLU 54  645 645 GLU GLU A . n 
A 1 55  ILE 55  646 646 ILE ILE A . n 
A 1 56  PTR 56  647 647 PTR PTR A . n 
A 1 57  VAL 57  648 648 VAL VAL A . n 
A 1 58  ALA 58  649 649 ALA ALA A . n 
A 1 59  ILE 59  650 650 ILE ILE A . n 
A 1 60  LYS 60  651 651 LYS LYS A . n 
A 1 61  THR 61  652 652 THR THR A . n 
A 1 62  LEU 62  653 653 LEU LEU A . n 
A 1 63  LYS 63  654 654 LYS LYS A . n 
A 1 64  ALA 64  655 655 ALA ALA A . n 
A 1 65  GLY 65  656 656 GLY GLY A . n 
A 1 66  TYR 66  657 657 TYR TYR A . n 
A 1 67  SER 67  658 658 SER SER A . n 
A 1 68  GLU 68  659 659 GLU GLU A . n 
A 1 69  LYS 69  660 660 LYS LYS A . n 
A 1 70  GLN 70  661 661 GLN GLN A . n 
A 1 71  ARG 71  662 662 ARG ARG A . n 
A 1 72  ARG 72  663 663 ARG ARG A . n 
A 1 73  ASP 73  664 664 ASP ASP A . n 
A 1 74  PHE 74  665 665 PHE PHE A . n 
A 1 75  LEU 75  666 666 LEU LEU A . n 
A 1 76  SER 76  667 667 SER SER A . n 
A 1 77  GLU 77  668 668 GLU GLU A . n 
A 1 78  ALA 78  669 669 ALA ALA A . n 
A 1 79  SER 79  670 670 SER SER A . n 
A 1 80  ILE 80  671 671 ILE ILE A . n 
A 1 81  MET 81  672 672 MET MET A . n 
A 1 82  GLY 82  673 673 GLY GLY A . n 
A 1 83  GLN 83  674 674 GLN GLN A . n 
A 1 84  PHE 84  675 675 PHE PHE A . n 
A 1 85  ASP 85  676 676 ASP ASP A . n 
A 1 86  HIS 86  677 677 HIS HIS A . n 
A 1 87  ARG 87  678 678 ARG ARG A . n 
A 1 88  ASN 88  679 679 ASN ASN A . n 
A 1 89  ILE 89  680 680 ILE ILE A . n 
A 1 90  ILE 90  681 681 ILE ILE A . n 
A 1 91  ARG 91  682 682 ARG ARG A . n 
A 1 92  LEU 92  683 683 LEU LEU A . n 
A 1 93  GLU 93  684 684 GLU GLU A . n 
A 1 94  GLY 94  685 685 GLY GLY A . n 
A 1 95  VAL 95  686 686 VAL VAL A . n 
A 1 96  VAL 96  687 687 VAL VAL A . n 
A 1 97  THR 97  688 688 THR THR A . n 
A 1 98  LYS 98  689 689 LYS LYS A . n 
A 1 99  SER 99  690 690 SER SER A . n 
A 1 100 ARG 100 691 691 ARG ARG A . n 
A 1 101 PRO 101 692 692 PRO PRO A . n 
A 1 102 VAL 102 693 693 VAL VAL A . n 
A 1 103 MET 103 694 694 MET MET A . n 
A 1 104 ILE 104 695 695 ILE ILE A . n 
A 1 105 ILE 105 696 696 ILE ILE A . n 
A 1 106 THR 106 697 697 THR THR A . n 
A 1 107 GLU 107 698 698 GLU GLU A . n 
A 1 108 PHE 108 699 699 PHE PHE A . n 
A 1 109 MET 109 700 700 MET MET A . n 
A 1 110 GLU 110 701 701 GLU GLU A . n 
A 1 111 ASN 111 702 702 ASN ASN A . n 
A 1 112 GLY 112 703 703 GLY GLY A . n 
A 1 113 ALA 113 704 704 ALA ALA A . n 
A 1 114 LEU 114 705 705 LEU LEU A . n 
A 1 115 ASP 115 706 706 ASP ASP A . n 
A 1 116 SER 116 707 707 SER SER A . n 
A 1 117 PHE 117 708 708 PHE PHE A . n 
A 1 118 LEU 118 709 709 LEU LEU A . n 
A 1 119 ARG 119 710 710 ARG ARG A . n 
A 1 120 GLN 120 711 711 GLN GLN A . n 
A 1 121 ASN 121 712 712 ASN ASN A . n 
A 1 122 ASP 122 713 713 ASP ASP A . n 
A 1 123 GLY 123 714 714 GLY GLY A . n 
A 1 124 GLN 124 715 715 GLN GLN A . n 
A 1 125 PHE 125 716 716 PHE PHE A . n 
A 1 126 THR 126 717 717 THR THR A . n 
A 1 127 VAL 127 718 718 VAL VAL A . n 
A 1 128 ILE 128 719 719 ILE ILE A . n 
A 1 129 GLN 129 720 720 GLN GLN A . n 
A 1 130 LEU 130 721 721 LEU LEU A . n 
A 1 131 VAL 131 722 722 VAL VAL A . n 
A 1 132 GLY 132 723 723 GLY GLY A . n 
A 1 133 MET 133 724 724 MET MET A . n 
A 1 134 LEU 134 725 725 LEU LEU A . n 
A 1 135 ARG 135 726 726 ARG ARG A . n 
A 1 136 GLY 136 727 727 GLY GLY A . n 
A 1 137 ILE 137 728 728 ILE ILE A . n 
A 1 138 ALA 138 729 729 ALA ALA A . n 
A 1 139 ALA 139 730 730 ALA ALA A . n 
A 1 140 GLY 140 731 731 GLY GLY A . n 
A 1 141 MET 141 732 732 MET MET A . n 
A 1 142 LYS 142 733 733 LYS LYS A . n 
A 1 143 TYR 143 734 734 TYR TYR A . n 
A 1 144 LEU 144 735 735 LEU LEU A . n 
A 1 145 SER 145 736 736 SER SER A . n 
A 1 146 GLU 146 737 737 GLU GLU A . n 
A 1 147 MET 147 738 738 MET MET A . n 
A 1 148 ASN 148 739 739 ASN ASN A . n 
A 1 149 TYR 149 740 740 TYR TYR A . n 
A 1 150 VAL 150 741 741 VAL VAL A . n 
A 1 151 HIS 151 742 742 HIS HIS A . n 
A 1 152 ARG 152 743 743 ARG ARG A . n 
A 1 153 ASP 153 744 744 ASP ASP A . n 
A 1 154 LEU 154 745 745 LEU LEU A . n 
A 1 155 ALA 155 746 746 ALA ALA A . n 
A 1 156 ALA 156 747 747 ALA ALA A . n 
A 1 157 ARG 157 748 748 ARG ARG A . n 
A 1 158 ASN 158 749 749 ASN ASN A . n 
A 1 159 ILE 159 750 750 ILE ILE A . n 
A 1 160 LEU 160 751 751 LEU LEU A . n 
A 1 161 VAL 161 752 752 VAL VAL A . n 
A 1 162 ASN 162 753 753 ASN ASN A . n 
A 1 163 SER 163 754 754 SER SER A . n 
A 1 164 ASN 164 755 755 ASN ASN A . n 
A 1 165 LEU 165 756 756 LEU LEU A . n 
A 1 166 VAL 166 757 757 VAL VAL A . n 
A 1 167 CYS 167 758 758 CYS CYS A . n 
A 1 168 LYS 168 759 759 LYS LYS A . n 
A 1 169 VAL 169 760 760 VAL VAL A . n 
A 1 170 SER 170 761 761 SER SER A . n 
A 1 171 ASP 171 762 762 ASP ASP A . n 
A 1 172 PHE 172 763 763 PHE PHE A . n 
A 1 173 GLY 173 764 764 GLY GLY A . n 
A 1 174 LEU 174 765 765 LEU LEU A . n 
A 1 175 SER 175 766 766 SER SER A . n 
A 1 176 ARG 176 767 767 ARG ARG A . n 
A 1 177 TYR 177 768 768 TYR TYR A . n 
A 1 178 LEU 178 769 769 LEU LEU A . n 
A 1 179 GLN 179 770 ?   ?   ?   A . n 
A 1 180 ASP 180 771 ?   ?   ?   A . n 
A 1 181 ASP 181 772 ?   ?   ?   A . n 
A 1 182 THR 182 773 ?   ?   ?   A . n 
A 1 183 SER 183 774 ?   ?   ?   A . n 
A 1 184 ASP 184 775 ?   ?   ?   A . n 
A 1 185 PRO 185 776 776 PRO PRO A . n 
A 1 186 THR 186 777 777 THR THR A . n 
A 1 187 PTR 187 778 778 PTR PTR A . n 
A 1 188 THR 188 779 779 THR THR A . n 
A 1 189 SER 189 780 780 SER SER A . n 
A 1 190 SER 190 781 781 SER SER A . n 
A 1 191 LEU 191 782 ?   ?   ?   A . n 
A 1 192 GLY 192 783 ?   ?   ?   A . n 
A 1 193 GLY 193 784 ?   ?   ?   A . n 
A 1 194 LYS 194 785 ?   ?   ?   A . n 
A 1 195 ILE 195 786 ?   ?   ?   A . n 
A 1 196 PRO 196 787 787 PRO PRO A . n 
A 1 197 VAL 197 788 788 VAL VAL A . n 
A 1 198 ARG 198 789 789 ARG ARG A . n 
A 1 199 TRP 199 790 790 TRP TRP A . n 
A 1 200 THR 200 791 791 THR THR A . n 
A 1 201 ALA 201 792 792 ALA ALA A . n 
A 1 202 PRO 202 793 793 PRO PRO A . n 
A 1 203 GLU 203 794 794 GLU GLU A . n 
A 1 204 ALA 204 795 795 ALA ALA A . n 
A 1 205 ILE 205 796 796 ILE ILE A . n 
A 1 206 ALA 206 797 797 ALA ALA A . n 
A 1 207 TYR 207 798 798 TYR TYR A . n 
A 1 208 ARG 208 799 799 ARG ARG A . n 
A 1 209 LYS 209 800 800 LYS LYS A . n 
A 1 210 PHE 210 801 801 PHE PHE A . n 
A 1 211 THR 211 802 802 THR THR A . n 
A 1 212 SER 212 803 803 SER SER A . n 
A 1 213 ALA 213 804 804 ALA ALA A . n 
A 1 214 SER 214 805 805 SER SER A . n 
A 1 215 ASP 215 806 806 ASP ASP A . n 
A 1 216 VAL 216 807 807 VAL VAL A . n 
A 1 217 TRP 217 808 808 TRP TRP A . n 
A 1 218 SER 218 809 809 SER SER A . n 
A 1 219 TYR 219 810 810 TYR TYR A . n 
A 1 220 GLY 220 811 811 GLY GLY A . n 
A 1 221 ILE 221 812 812 ILE ILE A . n 
A 1 222 VAL 222 813 813 VAL VAL A . n 
A 1 223 MET 223 814 814 MET MET A . n 
A 1 224 TRP 224 815 815 TRP TRP A . n 
A 1 225 GLU 225 816 816 GLU GLU A . n 
A 1 226 VAL 226 817 817 VAL VAL A . n 
A 1 227 MET 227 818 818 MET MET A . n 
A 1 228 SER 228 819 819 SER SER A . n 
A 1 229 PHE 229 820 820 PHE PHE A . n 
A 1 230 GLY 230 821 821 GLY GLY A . n 
A 1 231 GLU 231 822 822 GLU GLU A . n 
A 1 232 ARG 232 823 823 ARG ARG A . n 
A 1 233 PRO 233 824 824 PRO PRO A . n 
A 1 234 TYR 234 825 825 TYR TYR A . n 
A 1 235 TRP 235 826 826 TRP TRP A . n 
A 1 236 ASP 236 827 827 ASP ASP A . n 
A 1 237 MET 237 828 828 MET MET A . n 
A 1 238 SER 238 829 829 SER SER A . n 
A 1 239 ASN 239 830 830 ASN ASN A . n 
A 1 240 GLN 240 831 831 GLN GLN A . n 
A 1 241 ASP 241 832 832 ASP ASP A . n 
A 1 242 VAL 242 833 833 VAL VAL A . n 
A 1 243 ILE 243 834 834 ILE ILE A . n 
A 1 244 ASN 244 835 835 ASN ASN A . n 
A 1 245 ALA 245 836 836 ALA ALA A . n 
A 1 246 ILE 246 837 837 ILE ILE A . n 
A 1 247 GLU 247 838 838 GLU GLU A . n 
A 1 248 GLN 248 839 839 GLN GLN A . n 
A 1 249 ASP 249 840 840 ASP ASP A . n 
A 1 250 TYR 250 841 841 TYR TYR A . n 
A 1 251 ARG 251 842 842 ARG ARG A . n 
A 1 252 LEU 252 843 843 LEU LEU A . n 
A 1 253 PRO 253 844 844 PRO PRO A . n 
A 1 254 PRO 254 845 845 PRO PRO A . n 
A 1 255 PRO 255 846 846 PRO PRO A . n 
A 1 256 MET 256 847 847 MET MET A . n 
A 1 257 ASP 257 848 848 ASP ASP A . n 
A 1 258 CYS 258 849 849 CYS CYS A . n 
A 1 259 PRO 259 850 850 PRO PRO A . n 
A 1 260 ALA 260 851 851 ALA ALA A . n 
A 1 261 ALA 261 852 852 ALA ALA A . n 
A 1 262 LEU 262 853 853 LEU LEU A . n 
A 1 263 HIS 263 854 854 HIS HIS A . n 
A 1 264 GLN 264 855 855 GLN GLN A . n 
A 1 265 LEU 265 856 856 LEU LEU A . n 
A 1 266 MET 266 857 857 MET MET A . n 
A 1 267 LEU 267 858 858 LEU LEU A . n 
A 1 268 ASP 268 859 859 ASP ASP A . n 
A 1 269 CYS 269 860 860 CYS CYS A . n 
A 1 270 TRP 270 861 861 TRP TRP A . n 
A 1 271 GLN 271 862 862 GLN GLN A . n 
A 1 272 LYS 272 863 863 LYS LYS A . n 
A 1 273 ASP 273 864 864 ASP ASP A . n 
A 1 274 ARG 274 865 865 ARG ARG A . n 
A 1 275 ASN 275 866 866 ASN ASN A . n 
A 1 276 SER 276 867 867 SER SER A . n 
A 1 277 ARG 277 868 868 ARG ARG A . n 
A 1 278 PRO 278 869 869 PRO PRO A . n 
A 1 279 ARG 279 870 870 ARG ARG A . n 
A 1 280 PHE 280 871 871 PHE PHE A . n 
A 1 281 ALA 281 872 872 ALA ALA A . n 
A 1 282 GLU 282 873 873 GLU GLU A . n 
A 1 283 ILE 283 874 874 ILE ILE A . n 
A 1 284 VAL 284 875 875 VAL VAL A . n 
A 1 285 ASN 285 876 876 ASN ASN A . n 
A 1 286 THR 286 877 877 THR THR A . n 
A 1 287 LEU 287 878 878 LEU LEU A . n 
A 1 288 ASP 288 879 879 ASP ASP A . n 
A 1 289 LYS 289 880 880 LYS LYS A . n 
A 1 290 MET 290 881 881 MET MET A . n 
A 1 291 ILE 291 882 882 ILE ILE A . n 
A 1 292 ARG 292 883 883 ARG ARG A . n 
A 1 293 ASN 293 884 884 ASN ASN A . n 
A 1 294 PRO 294 885 885 PRO PRO A . n 
A 1 295 ALA 295 886 886 ALA ALA A . n 
A 1 296 SER 296 887 887 SER SER A . n 
A 1 297 LEU 297 888 888 LEU LEU A . n 
A 1 298 LYS 298 889 889 LYS LYS A . n 
A 1 299 THR 299 890 890 THR THR A . n 
A 1 300 VAL 300 891 891 VAL VAL A . n 
A 1 301 ALA 301 892 892 ALA ALA A . n 
A 1 302 THR 302 893 ?   ?   ?   A . n 
A 1 303 ILE 303 894 ?   ?   ?   A . n 
A 1 304 THR 304 895 ?   ?   ?   A . n 
A 1 305 ALA 305 896 ?   ?   ?   A . n 
B 1 1   MET 1   592 ?   ?   ?   B . n 
B 1 2   GLY 2   593 ?   ?   ?   B . n 
B 1 3   HIS 3   594 ?   ?   ?   B . n 
B 1 4   HIS 4   595 ?   ?   ?   B . n 
B 1 5   HIS 5   596 ?   ?   ?   B . n 
B 1 6   HIS 6   597 ?   ?   ?   B . n 
B 1 7   HIS 7   598 ?   ?   ?   B . n 
B 1 8   HIS 8   599 ?   ?   ?   B . n 
B 1 9   GLY 9   600 ?   ?   ?   B . n 
B 1 10  SER 10  601 ?   ?   ?   B . n 
B 1 11  ASP 11  602 ?   ?   ?   B . n 
B 1 12  PRO 12  603 ?   ?   ?   B . n 
B 1 13  ASN 13  604 ?   ?   ?   B . n 
B 1 14  GLU 14  605 ?   ?   ?   B . n 
B 1 15  ALA 15  606 ?   ?   ?   B . n 
B 1 16  VAL 16  607 ?   ?   ?   B . n 
B 1 17  ARG 17  608 ?   ?   ?   B . n 
B 1 18  GLU 18  609 609 GLU GLU B . n 
B 1 19  PHE 19  610 610 PHE PHE B . n 
B 1 20  ALA 20  611 611 ALA ALA B . n 
B 1 21  LYS 21  612 612 LYS LYS B . n 
B 1 22  GLU 22  613 613 GLU GLU B . n 
B 1 23  ILE 23  614 614 ILE ILE B . n 
B 1 24  ASP 24  615 615 ASP ASP B . n 
B 1 25  VAL 25  616 616 VAL VAL B . n 
B 1 26  SER 26  617 617 SER SER B . n 
B 1 27  PHE 27  618 618 PHE PHE B . n 
B 1 28  VAL 28  619 619 VAL VAL B . n 
B 1 29  LYS 29  620 620 LYS LYS B . n 
B 1 30  ILE 30  621 621 ILE ILE B . n 
B 1 31  GLU 31  622 622 GLU GLU B . n 
B 1 32  GLU 32  623 623 GLU GLU B . n 
B 1 33  VAL 33  624 624 VAL VAL B . n 
B 1 34  ILE 34  625 625 ILE ILE B . n 
B 1 35  GLY 35  626 626 GLY GLY B . n 
B 1 36  ALA 36  627 627 ALA ALA B . n 
B 1 37  GLY 37  628 628 GLY GLY B . n 
B 1 38  GLU 38  629 629 GLU GLU B . n 
B 1 39  PHE 39  630 630 PHE PHE B . n 
B 1 40  GLY 40  631 631 GLY GLY B . n 
B 1 41  GLU 41  632 632 GLU GLU B . n 
B 1 42  VAL 42  633 633 VAL VAL B . n 
B 1 43  TYR 43  634 634 TYR TYR B . n 
B 1 44  LYS 44  635 635 LYS LYS B . n 
B 1 45  GLY 45  636 636 GLY GLY B . n 
B 1 46  ARG 46  637 637 ARG ARG B . n 
B 1 47  LEU 47  638 638 LEU LEU B . n 
B 1 48  LYS 48  639 639 LYS LYS B . n 
B 1 49  LEU 49  640 640 LEU LEU B . n 
B 1 50  PRO 50  641 641 PRO PRO B . n 
B 1 51  GLY 51  642 642 GLY GLY B . n 
B 1 52  LYS 52  643 643 LYS LYS B . n 
B 1 53  ARG 53  644 644 ARG ARG B . n 
B 1 54  GLU 54  645 645 GLU GLU B . n 
B 1 55  ILE 55  646 646 ILE ILE B . n 
B 1 56  PTR 56  647 647 PTR PTR B . n 
B 1 57  VAL 57  648 648 VAL VAL B . n 
B 1 58  ALA 58  649 649 ALA ALA B . n 
B 1 59  ILE 59  650 650 ILE ILE B . n 
B 1 60  LYS 60  651 651 LYS LYS B . n 
B 1 61  THR 61  652 652 THR THR B . n 
B 1 62  LEU 62  653 653 LEU LEU B . n 
B 1 63  LYS 63  654 654 LYS LYS B . n 
B 1 64  ALA 64  655 655 ALA ALA B . n 
B 1 65  GLY 65  656 656 GLY GLY B . n 
B 1 66  TYR 66  657 657 TYR TYR B . n 
B 1 67  SER 67  658 658 SER SER B . n 
B 1 68  GLU 68  659 659 GLU GLU B . n 
B 1 69  LYS 69  660 660 LYS LYS B . n 
B 1 70  GLN 70  661 661 GLN GLN B . n 
B 1 71  ARG 71  662 662 ARG ARG B . n 
B 1 72  ARG 72  663 663 ARG ARG B . n 
B 1 73  ASP 73  664 664 ASP ASP B . n 
B 1 74  PHE 74  665 665 PHE PHE B . n 
B 1 75  LEU 75  666 666 LEU LEU B . n 
B 1 76  SER 76  667 667 SER SER B . n 
B 1 77  GLU 77  668 668 GLU GLU B . n 
B 1 78  ALA 78  669 669 ALA ALA B . n 
B 1 79  SER 79  670 670 SER SER B . n 
B 1 80  ILE 80  671 671 ILE ILE B . n 
B 1 81  MET 81  672 672 MET MET B . n 
B 1 82  GLY 82  673 673 GLY GLY B . n 
B 1 83  GLN 83  674 674 GLN GLN B . n 
B 1 84  PHE 84  675 675 PHE PHE B . n 
B 1 85  ASP 85  676 676 ASP ASP B . n 
B 1 86  HIS 86  677 677 HIS HIS B . n 
B 1 87  ARG 87  678 678 ARG ARG B . n 
B 1 88  ASN 88  679 679 ASN ASN B . n 
B 1 89  ILE 89  680 680 ILE ILE B . n 
B 1 90  ILE 90  681 681 ILE ILE B . n 
B 1 91  ARG 91  682 682 ARG ARG B . n 
B 1 92  LEU 92  683 683 LEU LEU B . n 
B 1 93  GLU 93  684 684 GLU GLU B . n 
B 1 94  GLY 94  685 685 GLY GLY B . n 
B 1 95  VAL 95  686 686 VAL VAL B . n 
B 1 96  VAL 96  687 687 VAL VAL B . n 
B 1 97  THR 97  688 688 THR THR B . n 
B 1 98  LYS 98  689 689 LYS LYS B . n 
B 1 99  SER 99  690 690 SER SER B . n 
B 1 100 ARG 100 691 691 ARG ARG B . n 
B 1 101 PRO 101 692 692 PRO PRO B . n 
B 1 102 VAL 102 693 693 VAL VAL B . n 
B 1 103 MET 103 694 694 MET MET B . n 
B 1 104 ILE 104 695 695 ILE ILE B . n 
B 1 105 ILE 105 696 696 ILE ILE B . n 
B 1 106 THR 106 697 697 THR THR B . n 
B 1 107 GLU 107 698 698 GLU GLU B . n 
B 1 108 PHE 108 699 699 PHE PHE B . n 
B 1 109 MET 109 700 700 MET MET B . n 
B 1 110 GLU 110 701 701 GLU GLU B . n 
B 1 111 ASN 111 702 702 ASN ASN B . n 
B 1 112 GLY 112 703 703 GLY GLY B . n 
B 1 113 ALA 113 704 704 ALA ALA B . n 
B 1 114 LEU 114 705 705 LEU LEU B . n 
B 1 115 ASP 115 706 706 ASP ASP B . n 
B 1 116 SER 116 707 707 SER SER B . n 
B 1 117 PHE 117 708 708 PHE PHE B . n 
B 1 118 LEU 118 709 709 LEU LEU B . n 
B 1 119 ARG 119 710 710 ARG ARG B . n 
B 1 120 GLN 120 711 711 GLN GLN B . n 
B 1 121 ASN 121 712 712 ASN ASN B . n 
B 1 122 ASP 122 713 713 ASP ASP B . n 
B 1 123 GLY 123 714 714 GLY GLY B . n 
B 1 124 GLN 124 715 715 GLN GLN B . n 
B 1 125 PHE 125 716 716 PHE PHE B . n 
B 1 126 THR 126 717 717 THR THR B . n 
B 1 127 VAL 127 718 718 VAL VAL B . n 
B 1 128 ILE 128 719 719 ILE ILE B . n 
B 1 129 GLN 129 720 720 GLN GLN B . n 
B 1 130 LEU 130 721 721 LEU LEU B . n 
B 1 131 VAL 131 722 722 VAL VAL B . n 
B 1 132 GLY 132 723 723 GLY GLY B . n 
B 1 133 MET 133 724 724 MET MET B . n 
B 1 134 LEU 134 725 725 LEU LEU B . n 
B 1 135 ARG 135 726 726 ARG ARG B . n 
B 1 136 GLY 136 727 727 GLY GLY B . n 
B 1 137 ILE 137 728 728 ILE ILE B . n 
B 1 138 ALA 138 729 729 ALA ALA B . n 
B 1 139 ALA 139 730 730 ALA ALA B . n 
B 1 140 GLY 140 731 731 GLY GLY B . n 
B 1 141 MET 141 732 732 MET MET B . n 
B 1 142 LYS 142 733 733 LYS LYS B . n 
B 1 143 TYR 143 734 734 TYR TYR B . n 
B 1 144 LEU 144 735 735 LEU LEU B . n 
B 1 145 SER 145 736 736 SER SER B . n 
B 1 146 GLU 146 737 737 GLU GLU B . n 
B 1 147 MET 147 738 738 MET MET B . n 
B 1 148 ASN 148 739 739 ASN ASN B . n 
B 1 149 TYR 149 740 740 TYR TYR B . n 
B 1 150 VAL 150 741 741 VAL VAL B . n 
B 1 151 HIS 151 742 742 HIS HIS B . n 
B 1 152 ARG 152 743 743 ARG ARG B . n 
B 1 153 ASP 153 744 744 ASP ASP B . n 
B 1 154 LEU 154 745 745 LEU LEU B . n 
B 1 155 ALA 155 746 746 ALA ALA B . n 
B 1 156 ALA 156 747 747 ALA ALA B . n 
B 1 157 ARG 157 748 748 ARG ARG B . n 
B 1 158 ASN 158 749 749 ASN ASN B . n 
B 1 159 ILE 159 750 750 ILE ILE B . n 
B 1 160 LEU 160 751 751 LEU LEU B . n 
B 1 161 VAL 161 752 752 VAL VAL B . n 
B 1 162 ASN 162 753 753 ASN ASN B . n 
B 1 163 SER 163 754 754 SER SER B . n 
B 1 164 ASN 164 755 755 ASN ASN B . n 
B 1 165 LEU 165 756 756 LEU LEU B . n 
B 1 166 VAL 166 757 757 VAL VAL B . n 
B 1 167 CYS 167 758 758 CYS CYS B . n 
B 1 168 LYS 168 759 759 LYS LYS B . n 
B 1 169 VAL 169 760 760 VAL VAL B . n 
B 1 170 SER 170 761 761 SER SER B . n 
B 1 171 ASP 171 762 762 ASP ASP B . n 
B 1 172 PHE 172 763 763 PHE PHE B . n 
B 1 173 GLY 173 764 764 GLY GLY B . n 
B 1 174 LEU 174 765 765 LEU LEU B . n 
B 1 175 SER 175 766 766 SER SER B . n 
B 1 176 ARG 176 767 767 ARG ARG B . n 
B 1 177 TYR 177 768 768 TYR TYR B . n 
B 1 178 LEU 178 769 769 LEU LEU B . n 
B 1 179 GLN 179 770 ?   ?   ?   B . n 
B 1 180 ASP 180 771 ?   ?   ?   B . n 
B 1 181 ASP 181 772 ?   ?   ?   B . n 
B 1 182 THR 182 773 ?   ?   ?   B . n 
B 1 183 SER 183 774 ?   ?   ?   B . n 
B 1 184 ASP 184 775 ?   ?   ?   B . n 
B 1 185 PRO 185 776 776 PRO PRO B . n 
B 1 186 THR 186 777 777 THR THR B . n 
B 1 187 PTR 187 778 778 PTR PTR B . n 
B 1 188 THR 188 779 779 THR THR B . n 
B 1 189 SER 189 780 780 SER SER B . n 
B 1 190 SER 190 781 781 SER SER B . n 
B 1 191 LEU 191 782 782 LEU LEU B . n 
B 1 192 GLY 192 783 783 GLY GLY B . n 
B 1 193 GLY 193 784 784 GLY GLY B . n 
B 1 194 LYS 194 785 785 LYS LYS B . n 
B 1 195 ILE 195 786 786 ILE ILE B . n 
B 1 196 PRO 196 787 787 PRO PRO B . n 
B 1 197 VAL 197 788 788 VAL VAL B . n 
B 1 198 ARG 198 789 789 ARG ARG B . n 
B 1 199 TRP 199 790 790 TRP TRP B . n 
B 1 200 THR 200 791 791 THR THR B . n 
B 1 201 ALA 201 792 792 ALA ALA B . n 
B 1 202 PRO 202 793 793 PRO PRO B . n 
B 1 203 GLU 203 794 794 GLU GLU B . n 
B 1 204 ALA 204 795 795 ALA ALA B . n 
B 1 205 ILE 205 796 796 ILE ILE B . n 
B 1 206 ALA 206 797 797 ALA ALA B . n 
B 1 207 TYR 207 798 798 TYR TYR B . n 
B 1 208 ARG 208 799 799 ARG ARG B . n 
B 1 209 LYS 209 800 800 LYS LYS B . n 
B 1 210 PHE 210 801 801 PHE PHE B . n 
B 1 211 THR 211 802 802 THR THR B . n 
B 1 212 SER 212 803 803 SER SER B . n 
B 1 213 ALA 213 804 804 ALA ALA B . n 
B 1 214 SER 214 805 805 SER SER B . n 
B 1 215 ASP 215 806 806 ASP ASP B . n 
B 1 216 VAL 216 807 807 VAL VAL B . n 
B 1 217 TRP 217 808 808 TRP TRP B . n 
B 1 218 SER 218 809 809 SER SER B . n 
B 1 219 TYR 219 810 810 TYR TYR B . n 
B 1 220 GLY 220 811 811 GLY GLY B . n 
B 1 221 ILE 221 812 812 ILE ILE B . n 
B 1 222 VAL 222 813 813 VAL VAL B . n 
B 1 223 MET 223 814 814 MET MET B . n 
B 1 224 TRP 224 815 815 TRP TRP B . n 
B 1 225 GLU 225 816 816 GLU GLU B . n 
B 1 226 VAL 226 817 817 VAL VAL B . n 
B 1 227 MET 227 818 818 MET MET B . n 
B 1 228 SER 228 819 819 SER SER B . n 
B 1 229 PHE 229 820 820 PHE PHE B . n 
B 1 230 GLY 230 821 821 GLY GLY B . n 
B 1 231 GLU 231 822 822 GLU GLU B . n 
B 1 232 ARG 232 823 823 ARG ARG B . n 
B 1 233 PRO 233 824 824 PRO PRO B . n 
B 1 234 TYR 234 825 825 TYR TYR B . n 
B 1 235 TRP 235 826 826 TRP TRP B . n 
B 1 236 ASP 236 827 827 ASP ASP B . n 
B 1 237 MET 237 828 828 MET MET B . n 
B 1 238 SER 238 829 829 SER SER B . n 
B 1 239 ASN 239 830 830 ASN ASN B . n 
B 1 240 GLN 240 831 831 GLN GLN B . n 
B 1 241 ASP 241 832 832 ASP ASP B . n 
B 1 242 VAL 242 833 833 VAL VAL B . n 
B 1 243 ILE 243 834 834 ILE ILE B . n 
B 1 244 ASN 244 835 835 ASN ASN B . n 
B 1 245 ALA 245 836 836 ALA ALA B . n 
B 1 246 ILE 246 837 837 ILE ILE B . n 
B 1 247 GLU 247 838 838 GLU GLU B . n 
B 1 248 GLN 248 839 839 GLN GLN B . n 
B 1 249 ASP 249 840 840 ASP ASP B . n 
B 1 250 TYR 250 841 841 TYR TYR B . n 
B 1 251 ARG 251 842 842 ARG ARG B . n 
B 1 252 LEU 252 843 843 LEU LEU B . n 
B 1 253 PRO 253 844 844 PRO PRO B . n 
B 1 254 PRO 254 845 845 PRO PRO B . n 
B 1 255 PRO 255 846 846 PRO PRO B . n 
B 1 256 MET 256 847 847 MET MET B . n 
B 1 257 ASP 257 848 848 ASP ASP B . n 
B 1 258 CYS 258 849 849 CYS CYS B . n 
B 1 259 PRO 259 850 850 PRO PRO B . n 
B 1 260 ALA 260 851 851 ALA ALA B . n 
B 1 261 ALA 261 852 852 ALA ALA B . n 
B 1 262 LEU 262 853 853 LEU LEU B . n 
B 1 263 HIS 263 854 854 HIS HIS B . n 
B 1 264 GLN 264 855 855 GLN GLN B . n 
B 1 265 LEU 265 856 856 LEU LEU B . n 
B 1 266 MET 266 857 857 MET MET B . n 
B 1 267 LEU 267 858 858 LEU LEU B . n 
B 1 268 ASP 268 859 859 ASP ASP B . n 
B 1 269 CYS 269 860 860 CYS CYS B . n 
B 1 270 TRP 270 861 861 TRP TRP B . n 
B 1 271 GLN 271 862 862 GLN GLN B . n 
B 1 272 LYS 272 863 863 LYS LYS B . n 
B 1 273 ASP 273 864 864 ASP ASP B . n 
B 1 274 ARG 274 865 865 ARG ARG B . n 
B 1 275 ASN 275 866 866 ASN ASN B . n 
B 1 276 SER 276 867 867 SER SER B . n 
B 1 277 ARG 277 868 868 ARG ARG B . n 
B 1 278 PRO 278 869 869 PRO PRO B . n 
B 1 279 ARG 279 870 870 ARG ARG B . n 
B 1 280 PHE 280 871 871 PHE PHE B . n 
B 1 281 ALA 281 872 872 ALA ALA B . n 
B 1 282 GLU 282 873 873 GLU GLU B . n 
B 1 283 ILE 283 874 874 ILE ILE B . n 
B 1 284 VAL 284 875 875 VAL VAL B . n 
B 1 285 ASN 285 876 876 ASN ASN B . n 
B 1 286 THR 286 877 877 THR THR B . n 
B 1 287 LEU 287 878 878 LEU LEU B . n 
B 1 288 ASP 288 879 879 ASP ASP B . n 
B 1 289 LYS 289 880 880 LYS LYS B . n 
B 1 290 MET 290 881 881 MET MET B . n 
B 1 291 ILE 291 882 882 ILE ILE B . n 
B 1 292 ARG 292 883 883 ARG ARG B . n 
B 1 293 ASN 293 884 884 ASN ASN B . n 
B 1 294 PRO 294 885 885 PRO PRO B . n 
B 1 295 ALA 295 886 886 ALA ALA B . n 
B 1 296 SER 296 887 887 SER SER B . n 
B 1 297 LEU 297 888 888 LEU LEU B . n 
B 1 298 LYS 298 889 889 LYS LYS B . n 
B 1 299 THR 299 890 890 THR THR B . n 
B 1 300 VAL 300 891 ?   ?   ?   B . n 
B 1 301 ALA 301 892 ?   ?   ?   B . n 
B 1 302 THR 302 893 ?   ?   ?   B . n 
B 1 303 ILE 303 894 ?   ?   ?   B . n 
B 1 304 THR 304 895 ?   ?   ?   B . n 
B 1 305 ALA 305 896 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 7O3 1   901  1   7O3 INH A . 
D 3 SO4 1   902  1   SO4 SO4 A . 
E 2 7O3 1   901  2   7O3 INH B . 
F 3 SO4 1   902  2   SO4 SO4 B . 
G 4 HOH 1   1001 341 HOH HOH A . 
G 4 HOH 2   1002 60  HOH HOH A . 
G 4 HOH 3   1003 357 HOH HOH A . 
G 4 HOH 4   1004 356 HOH HOH A . 
G 4 HOH 5   1005 352 HOH HOH A . 
G 4 HOH 6   1006 47  HOH HOH A . 
G 4 HOH 7   1007 330 HOH HOH A . 
G 4 HOH 8   1008 199 HOH HOH A . 
G 4 HOH 9   1009 252 HOH HOH A . 
G 4 HOH 10  1010 256 HOH HOH A . 
G 4 HOH 11  1011 177 HOH HOH A . 
G 4 HOH 12  1012 69  HOH HOH A . 
G 4 HOH 13  1013 185 HOH HOH A . 
G 4 HOH 14  1014 61  HOH HOH A . 
G 4 HOH 15  1015 30  HOH HOH A . 
G 4 HOH 16  1016 215 HOH HOH A . 
G 4 HOH 17  1017 152 HOH HOH A . 
G 4 HOH 18  1018 265 HOH HOH A . 
G 4 HOH 19  1019 26  HOH HOH A . 
G 4 HOH 20  1020 74  HOH HOH A . 
G 4 HOH 21  1021 171 HOH HOH A . 
G 4 HOH 22  1022 131 HOH HOH A . 
G 4 HOH 23  1023 359 HOH HOH A . 
G 4 HOH 24  1024 148 HOH HOH A . 
G 4 HOH 25  1025 144 HOH HOH A . 
G 4 HOH 26  1026 20  HOH HOH A . 
G 4 HOH 27  1027 178 HOH HOH A . 
G 4 HOH 28  1028 382 HOH HOH A . 
G 4 HOH 29  1029 111 HOH HOH A . 
G 4 HOH 30  1030 367 HOH HOH A . 
G 4 HOH 31  1031 246 HOH HOH A . 
G 4 HOH 32  1032 251 HOH HOH A . 
G 4 HOH 33  1033 334 HOH HOH A . 
G 4 HOH 34  1034 27  HOH HOH A . 
G 4 HOH 35  1035 306 HOH HOH A . 
G 4 HOH 36  1036 377 HOH HOH A . 
G 4 HOH 37  1037 232 HOH HOH A . 
G 4 HOH 38  1038 167 HOH HOH A . 
G 4 HOH 39  1039 331 HOH HOH A . 
G 4 HOH 40  1040 282 HOH HOH A . 
G 4 HOH 41  1041 153 HOH HOH A . 
G 4 HOH 42  1042 105 HOH HOH A . 
G 4 HOH 43  1043 281 HOH HOH A . 
G 4 HOH 44  1044 375 HOH HOH A . 
G 4 HOH 45  1045 258 HOH HOH A . 
G 4 HOH 46  1046 255 HOH HOH A . 
G 4 HOH 47  1047 76  HOH HOH A . 
G 4 HOH 48  1048 25  HOH HOH A . 
G 4 HOH 49  1049 129 HOH HOH A . 
G 4 HOH 50  1050 87  HOH HOH A . 
G 4 HOH 51  1051 191 HOH HOH A . 
G 4 HOH 52  1052 19  HOH HOH A . 
G 4 HOH 53  1053 59  HOH HOH A . 
G 4 HOH 54  1054 5   HOH HOH A . 
G 4 HOH 55  1055 240 HOH HOH A . 
G 4 HOH 56  1056 72  HOH HOH A . 
G 4 HOH 57  1057 96  HOH HOH A . 
G 4 HOH 58  1058 262 HOH HOH A . 
G 4 HOH 59  1059 53  HOH HOH A . 
G 4 HOH 60  1060 39  HOH HOH A . 
G 4 HOH 61  1061 75  HOH HOH A . 
G 4 HOH 62  1062 230 HOH HOH A . 
G 4 HOH 63  1063 170 HOH HOH A . 
G 4 HOH 64  1064 287 HOH HOH A . 
G 4 HOH 65  1065 79  HOH HOH A . 
G 4 HOH 66  1066 158 HOH HOH A . 
G 4 HOH 67  1067 358 HOH HOH A . 
G 4 HOH 68  1068 100 HOH HOH A . 
G 4 HOH 69  1069 200 HOH HOH A . 
G 4 HOH 70  1070 85  HOH HOH A . 
G 4 HOH 71  1071 22  HOH HOH A . 
G 4 HOH 72  1072 81  HOH HOH A . 
G 4 HOH 73  1073 161 HOH HOH A . 
G 4 HOH 74  1074 288 HOH HOH A . 
G 4 HOH 75  1075 181 HOH HOH A . 
G 4 HOH 76  1076 21  HOH HOH A . 
G 4 HOH 77  1077 290 HOH HOH A . 
G 4 HOH 78  1078 183 HOH HOH A . 
G 4 HOH 79  1079 42  HOH HOH A . 
G 4 HOH 80  1080 91  HOH HOH A . 
G 4 HOH 81  1081 219 HOH HOH A . 
G 4 HOH 82  1082 132 HOH HOH A . 
G 4 HOH 83  1083 184 HOH HOH A . 
G 4 HOH 84  1084 195 HOH HOH A . 
G 4 HOH 85  1085 36  HOH HOH A . 
G 4 HOH 86  1086 138 HOH HOH A . 
G 4 HOH 87  1087 43  HOH HOH A . 
G 4 HOH 88  1088 233 HOH HOH A . 
G 4 HOH 89  1089 102 HOH HOH A . 
G 4 HOH 90  1090 90  HOH HOH A . 
G 4 HOH 91  1091 135 HOH HOH A . 
G 4 HOH 92  1092 89  HOH HOH A . 
G 4 HOH 93  1093 224 HOH HOH A . 
G 4 HOH 94  1094 278 HOH HOH A . 
G 4 HOH 95  1095 50  HOH HOH A . 
G 4 HOH 96  1096 196 HOH HOH A . 
G 4 HOH 97  1097 80  HOH HOH A . 
G 4 HOH 98  1098 285 HOH HOH A . 
G 4 HOH 99  1099 18  HOH HOH A . 
G 4 HOH 100 1100 147 HOH HOH A . 
G 4 HOH 101 1101 24  HOH HOH A . 
G 4 HOH 102 1102 128 HOH HOH A . 
G 4 HOH 103 1103 241 HOH HOH A . 
G 4 HOH 104 1104 204 HOH HOH A . 
G 4 HOH 105 1105 40  HOH HOH A . 
G 4 HOH 106 1106 136 HOH HOH A . 
G 4 HOH 107 1107 150 HOH HOH A . 
G 4 HOH 108 1108 125 HOH HOH A . 
G 4 HOH 109 1109 245 HOH HOH A . 
G 4 HOH 110 1110 95  HOH HOH A . 
G 4 HOH 111 1111 109 HOH HOH A . 
G 4 HOH 112 1112 302 HOH HOH A . 
G 4 HOH 113 1113 239 HOH HOH A . 
G 4 HOH 114 1114 141 HOH HOH A . 
G 4 HOH 115 1115 247 HOH HOH A . 
G 4 HOH 116 1116 220 HOH HOH A . 
G 4 HOH 117 1117 160 HOH HOH A . 
G 4 HOH 118 1118 231 HOH HOH A . 
G 4 HOH 119 1119 368 HOH HOH A . 
G 4 HOH 120 1120 243 HOH HOH A . 
G 4 HOH 121 1121 137 HOH HOH A . 
G 4 HOH 122 1122 297 HOH HOH A . 
G 4 HOH 123 1123 376 HOH HOH A . 
G 4 HOH 124 1124 93  HOH HOH A . 
G 4 HOH 125 1125 293 HOH HOH A . 
G 4 HOH 126 1126 259 HOH HOH A . 
G 4 HOH 127 1127 49  HOH HOH A . 
G 4 HOH 128 1128 179 HOH HOH A . 
G 4 HOH 129 1129 283 HOH HOH A . 
G 4 HOH 130 1130 355 HOH HOH A . 
G 4 HOH 131 1131 180 HOH HOH A . 
G 4 HOH 132 1132 130 HOH HOH A . 
G 4 HOH 133 1133 108 HOH HOH A . 
G 4 HOH 134 1134 121 HOH HOH A . 
G 4 HOH 135 1135 372 HOH HOH A . 
G 4 HOH 136 1136 267 HOH HOH A . 
G 4 HOH 137 1137 116 HOH HOH A . 
G 4 HOH 138 1138 238 HOH HOH A . 
G 4 HOH 139 1139 173 HOH HOH A . 
G 4 HOH 140 1140 305 HOH HOH A . 
G 4 HOH 141 1141 3   HOH HOH A . 
G 4 HOH 142 1142 360 HOH HOH A . 
G 4 HOH 143 1143 203 HOH HOH A . 
G 4 HOH 144 1144 310 HOH HOH A . 
G 4 HOH 145 1145 286 HOH HOH A . 
G 4 HOH 146 1146 242 HOH HOH A . 
G 4 HOH 147 1147 172 HOH HOH A . 
G 4 HOH 148 1148 249 HOH HOH A . 
G 4 HOH 149 1149 202 HOH HOH A . 
G 4 HOH 150 1150 292 HOH HOH A . 
G 4 HOH 151 1151 1   HOH HOH A . 
G 4 HOH 152 1152 332 HOH HOH A . 
H 4 HOH 1   1001 348 HOH HOH B . 
H 4 HOH 2   1002 165 HOH HOH B . 
H 4 HOH 3   1003 192 HOH HOH B . 
H 4 HOH 4   1004 253 HOH HOH B . 
H 4 HOH 5   1005 349 HOH HOH B . 
H 4 HOH 6   1006 41  HOH HOH B . 
H 4 HOH 7   1007 169 HOH HOH B . 
H 4 HOH 8   1008 321 HOH HOH B . 
H 4 HOH 9   1009 166 HOH HOH B . 
H 4 HOH 10  1010 340 HOH HOH B . 
H 4 HOH 11  1011 35  HOH HOH B . 
H 4 HOH 12  1012 113 HOH HOH B . 
H 4 HOH 13  1013 45  HOH HOH B . 
H 4 HOH 14  1014 345 HOH HOH B . 
H 4 HOH 15  1015 254 HOH HOH B . 
H 4 HOH 16  1016 234 HOH HOH B . 
H 4 HOH 17  1017 190 HOH HOH B . 
H 4 HOH 18  1018 12  HOH HOH B . 
H 4 HOH 19  1019 182 HOH HOH B . 
H 4 HOH 20  1020 168 HOH HOH B . 
H 4 HOH 21  1021 54  HOH HOH B . 
H 4 HOH 22  1022 280 HOH HOH B . 
H 4 HOH 23  1023 9   HOH HOH B . 
H 4 HOH 24  1024 14  HOH HOH B . 
H 4 HOH 25  1025 342 HOH HOH B . 
H 4 HOH 26  1026 62  HOH HOH B . 
H 4 HOH 27  1027 176 HOH HOH B . 
H 4 HOH 28  1028 31  HOH HOH B . 
H 4 HOH 29  1029 338 HOH HOH B . 
H 4 HOH 30  1030 112 HOH HOH B . 
H 4 HOH 31  1031 284 HOH HOH B . 
H 4 HOH 32  1032 336 HOH HOH B . 
H 4 HOH 33  1033 369 HOH HOH B . 
H 4 HOH 34  1034 4   HOH HOH B . 
H 4 HOH 35  1035 123 HOH HOH B . 
H 4 HOH 36  1036 13  HOH HOH B . 
H 4 HOH 37  1037 319 HOH HOH B . 
H 4 HOH 38  1038 346 HOH HOH B . 
H 4 HOH 39  1039 70  HOH HOH B . 
H 4 HOH 40  1040 16  HOH HOH B . 
H 4 HOH 41  1041 221 HOH HOH B . 
H 4 HOH 42  1042 175 HOH HOH B . 
H 4 HOH 43  1043 32  HOH HOH B . 
H 4 HOH 44  1044 106 HOH HOH B . 
H 4 HOH 45  1045 104 HOH HOH B . 
H 4 HOH 46  1046 120 HOH HOH B . 
H 4 HOH 47  1047 2   HOH HOH B . 
H 4 HOH 48  1048 186 HOH HOH B . 
H 4 HOH 49  1049 380 HOH HOH B . 
H 4 HOH 50  1050 257 HOH HOH B . 
H 4 HOH 51  1051 115 HOH HOH B . 
H 4 HOH 52  1052 122 HOH HOH B . 
H 4 HOH 53  1053 10  HOH HOH B . 
H 4 HOH 54  1054 11  HOH HOH B . 
H 4 HOH 55  1055 48  HOH HOH B . 
H 4 HOH 56  1056 307 HOH HOH B . 
H 4 HOH 57  1057 67  HOH HOH B . 
H 4 HOH 58  1058 8   HOH HOH B . 
H 4 HOH 59  1059 101 HOH HOH B . 
H 4 HOH 60  1060 187 HOH HOH B . 
H 4 HOH 61  1061 110 HOH HOH B . 
H 4 HOH 62  1062 63  HOH HOH B . 
H 4 HOH 63  1063 78  HOH HOH B . 
H 4 HOH 64  1064 55  HOH HOH B . 
H 4 HOH 65  1065 197 HOH HOH B . 
H 4 HOH 66  1066 97  HOH HOH B . 
H 4 HOH 67  1067 7   HOH HOH B . 
H 4 HOH 68  1068 210 HOH HOH B . 
H 4 HOH 69  1069 339 HOH HOH B . 
H 4 HOH 70  1070 237 HOH HOH B . 
H 4 HOH 71  1071 29  HOH HOH B . 
H 4 HOH 72  1072 270 HOH HOH B . 
H 4 HOH 73  1073 126 HOH HOH B . 
H 4 HOH 74  1074 23  HOH HOH B . 
H 4 HOH 75  1075 99  HOH HOH B . 
H 4 HOH 76  1076 37  HOH HOH B . 
H 4 HOH 77  1077 333 HOH HOH B . 
H 4 HOH 78  1078 188 HOH HOH B . 
H 4 HOH 79  1079 86  HOH HOH B . 
H 4 HOH 80  1080 34  HOH HOH B . 
H 4 HOH 81  1081 139 HOH HOH B . 
H 4 HOH 82  1082 162 HOH HOH B . 
H 4 HOH 83  1083 216 HOH HOH B . 
H 4 HOH 84  1084 213 HOH HOH B . 
H 4 HOH 85  1085 56  HOH HOH B . 
H 4 HOH 86  1086 226 HOH HOH B . 
H 4 HOH 87  1087 327 HOH HOH B . 
H 4 HOH 88  1088 218 HOH HOH B . 
H 4 HOH 89  1089 225 HOH HOH B . 
H 4 HOH 90  1090 261 HOH HOH B . 
H 4 HOH 91  1091 209 HOH HOH B . 
H 4 HOH 92  1092 38  HOH HOH B . 
H 4 HOH 93  1093 250 HOH HOH B . 
H 4 HOH 94  1094 163 HOH HOH B . 
H 4 HOH 95  1095 371 HOH HOH B . 
H 4 HOH 96  1096 273 HOH HOH B . 
H 4 HOH 97  1097 201 HOH HOH B . 
H 4 HOH 98  1098 174 HOH HOH B . 
H 4 HOH 99  1099 65  HOH HOH B . 
H 4 HOH 100 1100 58  HOH HOH B . 
H 4 HOH 101 1101 146 HOH HOH B . 
H 4 HOH 102 1102 77  HOH HOH B . 
H 4 HOH 103 1103 71  HOH HOH B . 
H 4 HOH 104 1104 98  HOH HOH B . 
H 4 HOH 105 1105 222 HOH HOH B . 
H 4 HOH 106 1106 28  HOH HOH B . 
H 4 HOH 107 1107 229 HOH HOH B . 
H 4 HOH 108 1108 103 HOH HOH B . 
H 4 HOH 109 1109 46  HOH HOH B . 
H 4 HOH 110 1110 155 HOH HOH B . 
H 4 HOH 111 1111 44  HOH HOH B . 
H 4 HOH 112 1112 83  HOH HOH B . 
H 4 HOH 113 1113 84  HOH HOH B . 
H 4 HOH 114 1114 143 HOH HOH B . 
H 4 HOH 115 1115 347 HOH HOH B . 
H 4 HOH 116 1116 57  HOH HOH B . 
H 4 HOH 117 1117 271 HOH HOH B . 
H 4 HOH 118 1118 207 HOH HOH B . 
H 4 HOH 119 1119 194 HOH HOH B . 
H 4 HOH 120 1120 114 HOH HOH B . 
H 4 HOH 121 1121 309 HOH HOH B . 
H 4 HOH 122 1122 208 HOH HOH B . 
H 4 HOH 123 1123 17  HOH HOH B . 
H 4 HOH 124 1124 381 HOH HOH B . 
H 4 HOH 125 1125 117 HOH HOH B . 
H 4 HOH 126 1126 92  HOH HOH B . 
H 4 HOH 127 1127 312 HOH HOH B . 
H 4 HOH 128 1128 51  HOH HOH B . 
H 4 HOH 129 1129 142 HOH HOH B . 
H 4 HOH 130 1130 15  HOH HOH B . 
H 4 HOH 131 1131 149 HOH HOH B . 
H 4 HOH 132 1132 64  HOH HOH B . 
H 4 HOH 133 1133 88  HOH HOH B . 
H 4 HOH 134 1134 294 HOH HOH B . 
H 4 HOH 135 1135 328 HOH HOH B . 
H 4 HOH 136 1136 370 HOH HOH B . 
H 4 HOH 137 1137 119 HOH HOH B . 
H 4 HOH 138 1138 33  HOH HOH B . 
H 4 HOH 139 1139 164 HOH HOH B . 
H 4 HOH 140 1140 263 HOH HOH B . 
H 4 HOH 141 1141 236 HOH HOH B . 
H 4 HOH 142 1142 140 HOH HOH B . 
H 4 HOH 143 1143 248 HOH HOH B . 
H 4 HOH 144 1144 73  HOH HOH B . 
H 4 HOH 145 1145 124 HOH HOH B . 
H 4 HOH 146 1146 320 HOH HOH B . 
H 4 HOH 147 1147 68  HOH HOH B . 
H 4 HOH 148 1148 276 HOH HOH B . 
H 4 HOH 149 1149 223 HOH HOH B . 
H 4 HOH 150 1150 264 HOH HOH B . 
H 4 HOH 151 1151 157 HOH HOH B . 
H 4 HOH 152 1152 301 HOH HOH B . 
H 4 HOH 153 1153 156 HOH HOH B . 
H 4 HOH 154 1154 205 HOH HOH B . 
H 4 HOH 155 1155 94  HOH HOH B . 
H 4 HOH 156 1156 217 HOH HOH B . 
H 4 HOH 157 1157 66  HOH HOH B . 
H 4 HOH 158 1158 82  HOH HOH B . 
H 4 HOH 159 1159 134 HOH HOH B . 
H 4 HOH 160 1160 326 HOH HOH B . 
H 4 HOH 161 1161 212 HOH HOH B . 
H 4 HOH 162 1162 329 HOH HOH B . 
H 4 HOH 163 1163 266 HOH HOH B . 
H 4 HOH 164 1164 6   HOH HOH B . 
H 4 HOH 165 1165 374 HOH HOH B . 
H 4 HOH 166 1166 159 HOH HOH B . 
H 4 HOH 167 1167 279 HOH HOH B . 
H 4 HOH 168 1168 189 HOH HOH B . 
H 4 HOH 169 1169 311 HOH HOH B . 
H 4 HOH 170 1170 379 HOH HOH B . 
H 4 HOH 171 1171 52  HOH HOH B . 
H 4 HOH 172 1172 296 HOH HOH B . 
H 4 HOH 173 1173 373 HOH HOH B . 
H 4 HOH 174 1174 214 HOH HOH B . 
H 4 HOH 175 1175 298 HOH HOH B . 
H 4 HOH 176 1176 235 HOH HOH B . 
H 4 HOH 177 1177 304 HOH HOH B . 
H 4 HOH 178 1178 299 HOH HOH B . 
H 4 HOH 179 1179 275 HOH HOH B . 
H 4 HOH 180 1180 272 HOH HOH B . 
H 4 HOH 181 1181 211 HOH HOH B . 
H 4 HOH 182 1182 133 HOH HOH B . 
H 4 HOH 183 1183 378 HOH HOH B . 
H 4 HOH 184 1184 300 HOH HOH B . 
H 4 HOH 185 1185 145 HOH HOH B . 
H 4 HOH 186 1186 154 HOH HOH B . 
H 4 HOH 187 1187 193 HOH HOH B . 
H 4 HOH 188 1188 303 HOH HOH B . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A PTR 56  A PTR 647 ? TYR 'modified residue' 
2 A PTR 187 A PTR 778 ? TYR 'modified residue' 
3 B PTR 56  B PTR 647 ? TYR 'modified residue' 
4 B PTR 187 B PTR 778 ? TYR 'modified residue' 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? monomeric 1 
2 author_defined_assembly ? monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,G 
2 1 B,E,F,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2017-05-17 
2 'Structure model' 1 1 2017-06-28 
3 'Structure model' 1 2 2018-01-24 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Source and taxonomy' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation       
2 3 'Structure model' entity_src_gen 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.country'                              
2 2 'Structure model' '_citation.journal_volume'                       
3 2 'Structure model' '_citation.page_first'                           
4 2 'Structure model' '_citation.page_last'                            
5 3 'Structure model' '_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id' 
6 3 'Structure model' '_entity_src_gen.pdbx_host_org_scientific_name'  
7 3 'Structure model' '_entity_src_gen.pdbx_host_org_strain'           
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1 ? refined -2.1256  39.7153 -2.9347 -0.1978 -0.2018 -0.0578 0.0236 0.0024 0.0006 1.8498 1.7837 1.9192 0.2216 
0.2139 -0.0687 -0.0983 -0.0787 -0.1039 0.1237 0.1327 -0.4200 0.0677  0.1690  -0.0344 
'X-RAY DIFFRACTION' 2 ? refined -33.4040 40.1416 -6.1210 -0.1707 -0.0930 -0.0900 0.0202 0.0487 0.0895 2.1980 1.2336 1.2283 0.5447 
0.6060 0.1665  -0.0575 0.0182  0.1069  0.1013 0.0818 0.2543  -0.0640 -0.1944 -0.0243 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1 1 ? ? ? ? ? ? ? ? ? '{ A|* }' 
'X-RAY DIFFRACTION' 2 2 ? ? ? ? ? ? ? ? ? '{ B|* }' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.11.6 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DIALS   ? ? ? .      2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .      3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? BUSTER  ? ? ? 2.11.6 4 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 622 ? ? -112.20 -136.07 
2  1 ASN A 739 ? ? 70.51   39.16   
3  1 ARG A 743 ? ? 72.70   -6.85   
4  1 ASP A 762 ? ? 56.55   73.99   
5  1 TRP A 826 ? ? 51.68   -117.08 
6  1 GLU B 622 ? ? -112.93 -137.04 
7  1 ASN B 739 ? ? 70.53   39.00   
8  1 ARG B 743 ? ? 73.12   -6.86   
9  1 ASP B 762 ? ? 58.22   72.67   
10 1 TRP B 826 ? ? 52.33   -118.70 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 609 ? CG  ? A GLU 18  CG  
2  1 Y 1 A GLU 609 ? CD  ? A GLU 18  CD  
3  1 Y 1 A GLU 609 ? OE1 ? A GLU 18  OE1 
4  1 Y 1 A GLU 609 ? OE2 ? A GLU 18  OE2 
5  1 Y 1 A LYS 620 ? CD  ? A LYS 29  CD  
6  1 Y 1 A LYS 620 ? CE  ? A LYS 29  CE  
7  1 Y 1 A LYS 620 ? NZ  ? A LYS 29  NZ  
8  1 Y 1 A LYS 800 ? CD  ? A LYS 209 CD  
9  1 Y 1 A LYS 800 ? CE  ? A LYS 209 CE  
10 1 Y 1 A LYS 800 ? NZ  ? A LYS 209 NZ  
11 1 Y 1 A GLN 839 ? CG  ? A GLN 248 CG  
12 1 Y 1 A GLN 839 ? CD  ? A GLN 248 CD  
13 1 Y 1 A GLN 839 ? OE1 ? A GLN 248 OE1 
14 1 Y 1 A GLN 839 ? NE2 ? A GLN 248 NE2 
15 1 Y 1 A LYS 889 ? CG  ? A LYS 298 CG  
16 1 Y 1 A LYS 889 ? CD  ? A LYS 298 CD  
17 1 Y 1 A LYS 889 ? CE  ? A LYS 298 CE  
18 1 Y 1 A LYS 889 ? NZ  ? A LYS 298 NZ  
19 1 Y 1 B GLU 609 ? CG  ? B GLU 18  CG  
20 1 Y 1 B GLU 609 ? CD  ? B GLU 18  CD  
21 1 Y 1 B GLU 609 ? OE1 ? B GLU 18  OE1 
22 1 Y 1 B GLU 609 ? OE2 ? B GLU 18  OE2 
23 1 Y 1 B LYS 620 ? CD  ? B LYS 29  CD  
24 1 Y 1 B LYS 620 ? CE  ? B LYS 29  CE  
25 1 Y 1 B LYS 620 ? NZ  ? B LYS 29  NZ  
26 1 Y 1 B ARG 663 ? NE  ? B ARG 72  NE  
27 1 Y 1 B ARG 663 ? CZ  ? B ARG 72  CZ  
28 1 Y 1 B ARG 663 ? NH1 ? B ARG 72  NH1 
29 1 Y 1 B ARG 663 ? NH2 ? B ARG 72  NH2 
30 1 Y 1 B LYS 889 ? CG  ? B LYS 298 CG  
31 1 Y 1 B LYS 889 ? CD  ? B LYS 298 CD  
32 1 Y 1 B LYS 889 ? CE  ? B LYS 298 CE  
33 1 Y 1 B LYS 889 ? NZ  ? B LYS 298 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 592 ? A MET 1   
2  1 Y 1 A GLY 593 ? A GLY 2   
3  1 Y 1 A HIS 594 ? A HIS 3   
4  1 Y 1 A HIS 595 ? A HIS 4   
5  1 Y 1 A HIS 596 ? A HIS 5   
6  1 Y 1 A HIS 597 ? A HIS 6   
7  1 Y 1 A HIS 598 ? A HIS 7   
8  1 Y 1 A HIS 599 ? A HIS 8   
9  1 Y 1 A GLY 600 ? A GLY 9   
10 1 Y 1 A SER 601 ? A SER 10  
11 1 Y 1 A ASP 602 ? A ASP 11  
12 1 Y 1 A PRO 603 ? A PRO 12  
13 1 Y 1 A ASN 604 ? A ASN 13  
14 1 Y 1 A GLU 605 ? A GLU 14  
15 1 Y 1 A ALA 606 ? A ALA 15  
16 1 Y 1 A VAL 607 ? A VAL 16  
17 1 Y 1 A ARG 608 ? A ARG 17  
18 1 Y 1 A GLN 770 ? A GLN 179 
19 1 Y 1 A ASP 771 ? A ASP 180 
20 1 Y 1 A ASP 772 ? A ASP 181 
21 1 Y 1 A THR 773 ? A THR 182 
22 1 Y 1 A SER 774 ? A SER 183 
23 1 Y 1 A ASP 775 ? A ASP 184 
24 1 Y 1 A LEU 782 ? A LEU 191 
25 1 Y 1 A GLY 783 ? A GLY 192 
26 1 Y 1 A GLY 784 ? A GLY 193 
27 1 Y 1 A LYS 785 ? A LYS 194 
28 1 Y 1 A ILE 786 ? A ILE 195 
29 1 Y 1 A THR 893 ? A THR 302 
30 1 Y 1 A ILE 894 ? A ILE 303 
31 1 Y 1 A THR 895 ? A THR 304 
32 1 Y 1 A ALA 896 ? A ALA 305 
33 1 Y 1 B MET 592 ? B MET 1   
34 1 Y 1 B GLY 593 ? B GLY 2   
35 1 Y 1 B HIS 594 ? B HIS 3   
36 1 Y 1 B HIS 595 ? B HIS 4   
37 1 Y 1 B HIS 596 ? B HIS 5   
38 1 Y 1 B HIS 597 ? B HIS 6   
39 1 Y 1 B HIS 598 ? B HIS 7   
40 1 Y 1 B HIS 599 ? B HIS 8   
41 1 Y 1 B GLY 600 ? B GLY 9   
42 1 Y 1 B SER 601 ? B SER 10  
43 1 Y 1 B ASP 602 ? B ASP 11  
44 1 Y 1 B PRO 603 ? B PRO 12  
45 1 Y 1 B ASN 604 ? B ASN 13  
46 1 Y 1 B GLU 605 ? B GLU 14  
47 1 Y 1 B ALA 606 ? B ALA 15  
48 1 Y 1 B VAL 607 ? B VAL 16  
49 1 Y 1 B ARG 608 ? B ARG 17  
50 1 Y 1 B GLN 770 ? B GLN 179 
51 1 Y 1 B ASP 771 ? B ASP 180 
52 1 Y 1 B ASP 772 ? B ASP 181 
53 1 Y 1 B THR 773 ? B THR 182 
54 1 Y 1 B SER 774 ? B SER 183 
55 1 Y 1 B ASP 775 ? B ASP 184 
56 1 Y 1 B VAL 891 ? B VAL 300 
57 1 Y 1 B ALA 892 ? B ALA 301 
58 1 Y 1 B THR 893 ? B THR 302 
59 1 Y 1 B ILE 894 ? B ILE 303 
60 1 Y 1 B THR 895 ? B THR 304 
61 1 Y 1 B ALA 896 ? B ALA 305 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '2-chloranyl-~{N}-[4-[(2-chloranyl-5-oxidanyl-phenyl)amino]quinazolin-7-yl]ethanamide' 7O3 
3 'SULFATE ION'                                                                          SO4 
4 water                                                                                  HOH 
#