data_5MLU
# 
_entry.id   5MLU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.279 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MLU         
WWPDB D_1200002415 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MLU 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-07 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Pye, V.E.'      1 ? 
'Maskell, D.P.'  2 ? 
'Lesbats, P.'    3 ? 
'Cherepanov, P.' 4 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Proc. Natl. Acad. Sci. U.S.A.' 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            114 
_citation.language                  ? 
_citation.page_first                5509 
_citation.page_last                 5514 
_citation.title                     'Structural basis for spumavirus GAG tethering to chromatin.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1621159114 
_citation.pdbx_database_id_PubMed   28490494 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lesbats, P.'    1 
primary 'Serrao, E.'     2 
primary 'Maskell, D.P.'  3 
primary 'Pye, V.E.'      4 
primary 
;O'Reilly, N.
;
5 
primary 'Lindemann, D.'  6 
primary 'Engelman, A.N.' 7 
primary 'Cherepanov, P.' 8 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MLU 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     107.260 
_cell.length_a_esd                 ? 
_cell.length_b                     109.450 
_cell.length_b_esd                 ? 
_cell.length_c                     175.820 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MLU 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'Histone H3.2'       11405.321 2   ? ? ? ?           
2  polymer     man 'Histone H4'         9566.249  2   ? ? ? ?           
3  polymer     man 'Histone H2A type 1' 11494.393 2   ? ? ? ?           
4  polymer     man 'Histone H2B'        10348.852 1   ? ? ? ?           
5  polymer     man 'Histone H2B'        10478.032 1   ? ? ? ?           
6  polymer     man 'PFV GAG peptide'    1986.177  1   ? ? ? ?           
7  polymer     nat 'DNA (145-MER)'      44991.660 1   ? ? ? 'Widom 601' 
8  polymer     nat 'DNA (145-MER)'      44520.383 1   ? ? ? 'Widom 601' 
9  non-polymer nat 'MANGANESE (II) ION' 54.938    4   ? ? ? ?           
10 water       nat water                18.015    194 ? ? ? ?           
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVT
IMPKDIQLARRIRGERA
;
;HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVT
IMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
;
;RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPK
;
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGRVTIAQGGVLPNIQSVLLPK
;
C,G ? 
4 'polypeptide(L)'        no no 
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
D   ? 
5 'polypeptide(L)'        no no 
;KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSA
;
;KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSA
;
H   ? 
6 'polypeptide(L)'        no no GGYNLRPRTYQPQRYGG GGYNLRPRTYQPQRYGG M   ? 
7 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DT)(DG)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)
(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)
(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)
(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)
(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)
(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)
(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)
(DC)(DT)(DG)(DA)(DT)
;
;ATCGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGACAGCGCGTAC
GTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTGAT
;
I   ? 
8 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)(DG)
(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)(DA)
(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)(DA)
(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)(DC)
(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)(DG)
(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)(DA)
(DT)(DC)(DG)(DA)(DT)
;
;ATCAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCCC
CGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCGAT
;
J   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   ARG n 
1 3   TYR n 
1 4   ARG n 
1 5   PRO n 
1 6   GLY n 
1 7   THR n 
1 8   VAL n 
1 9   ALA n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  ILE n 
1 14  ARG n 
1 15  ARG n 
1 16  TYR n 
1 17  GLN n 
1 18  LYS n 
1 19  SER n 
1 20  THR n 
1 21  GLU n 
1 22  LEU n 
1 23  LEU n 
1 24  ILE n 
1 25  ARG n 
1 26  LYS n 
1 27  LEU n 
1 28  PRO n 
1 29  PHE n 
1 30  GLN n 
1 31  ARG n 
1 32  LEU n 
1 33  VAL n 
1 34  ARG n 
1 35  GLU n 
1 36  ILE n 
1 37  ALA n 
1 38  GLN n 
1 39  ASP n 
1 40  PHE n 
1 41  LYS n 
1 42  THR n 
1 43  ASP n 
1 44  LEU n 
1 45  ARG n 
1 46  PHE n 
1 47  GLN n 
1 48  SER n 
1 49  SER n 
1 50  ALA n 
1 51  VAL n 
1 52  MET n 
1 53  ALA n 
1 54  LEU n 
1 55  GLN n 
1 56  GLU n 
1 57  ALA n 
1 58  SER n 
1 59  GLU n 
1 60  ALA n 
1 61  TYR n 
1 62  LEU n 
1 63  VAL n 
1 64  ALA n 
1 65  LEU n 
1 66  PHE n 
1 67  GLU n 
1 68  ASP n 
1 69  THR n 
1 70  ASN n 
1 71  LEU n 
1 72  CYS n 
1 73  ALA n 
1 74  ILE n 
1 75  HIS n 
1 76  ALA n 
1 77  LYS n 
1 78  ARG n 
1 79  VAL n 
1 80  THR n 
1 81  ILE n 
1 82  MET n 
1 83  PRO n 
1 84  LYS n 
1 85  ASP n 
1 86  ILE n 
1 87  GLN n 
1 88  LEU n 
1 89  ALA n 
1 90  ARG n 
1 91  ARG n 
1 92  ILE n 
1 93  ARG n 
1 94  GLY n 
1 95  GLU n 
1 96  ARG n 
1 97  ALA n 
2 1   ARG n 
2 2   LYS n 
2 3   VAL n 
2 4   LEU n 
2 5   ARG n 
2 6   ASP n 
2 7   ASN n 
2 8   ILE n 
2 9   GLN n 
2 10  GLY n 
2 11  ILE n 
2 12  THR n 
2 13  LYS n 
2 14  PRO n 
2 15  ALA n 
2 16  ILE n 
2 17  ARG n 
2 18  ARG n 
2 19  LEU n 
2 20  ALA n 
2 21  ARG n 
2 22  ARG n 
2 23  GLY n 
2 24  GLY n 
2 25  VAL n 
2 26  LYS n 
2 27  ARG n 
2 28  ILE n 
2 29  SER n 
2 30  GLY n 
2 31  LEU n 
2 32  ILE n 
2 33  TYR n 
2 34  GLU n 
2 35  GLU n 
2 36  THR n 
2 37  ARG n 
2 38  GLY n 
2 39  VAL n 
2 40  LEU n 
2 41  LYS n 
2 42  VAL n 
2 43  PHE n 
2 44  LEU n 
2 45  GLU n 
2 46  ASN n 
2 47  VAL n 
2 48  ILE n 
2 49  ARG n 
2 50  ASP n 
2 51  ALA n 
2 52  VAL n 
2 53  THR n 
2 54  TYR n 
2 55  THR n 
2 56  GLU n 
2 57  HIS n 
2 58  ALA n 
2 59  LYS n 
2 60  ARG n 
2 61  LYS n 
2 62  THR n 
2 63  VAL n 
2 64  THR n 
2 65  ALA n 
2 66  MET n 
2 67  ASP n 
2 68  VAL n 
2 69  VAL n 
2 70  TYR n 
2 71  ALA n 
2 72  LEU n 
2 73  LYS n 
2 74  ARG n 
2 75  GLN n 
2 76  GLY n 
2 77  ARG n 
2 78  THR n 
2 79  LEU n 
2 80  TYR n 
2 81  GLY n 
2 82  PHE n 
2 83  GLY n 
2 84  GLY n 
3 1   ALA n 
3 2   LYS n 
3 3   THR n 
3 4   ARG n 
3 5   SER n 
3 6   SER n 
3 7   ARG n 
3 8   ALA n 
3 9   GLY n 
3 10  LEU n 
3 11  GLN n 
3 12  PHE n 
3 13  PRO n 
3 14  VAL n 
3 15  GLY n 
3 16  ARG n 
3 17  VAL n 
3 18  HIS n 
3 19  ARG n 
3 20  LEU n 
3 21  LEU n 
3 22  ARG n 
3 23  LYS n 
3 24  GLY n 
3 25  ASN n 
3 26  TYR n 
3 27  ALA n 
3 28  GLU n 
3 29  ARG n 
3 30  VAL n 
3 31  GLY n 
3 32  ALA n 
3 33  GLY n 
3 34  ALA n 
3 35  PRO n 
3 36  VAL n 
3 37  TYR n 
3 38  LEU n 
3 39  ALA n 
3 40  ALA n 
3 41  VAL n 
3 42  LEU n 
3 43  GLU n 
3 44  TYR n 
3 45  LEU n 
3 46  THR n 
3 47  ALA n 
3 48  GLU n 
3 49  ILE n 
3 50  LEU n 
3 51  GLU n 
3 52  LEU n 
3 53  ALA n 
3 54  GLY n 
3 55  ASN n 
3 56  ALA n 
3 57  ALA n 
3 58  ARG n 
3 59  ASP n 
3 60  ASN n 
3 61  LYS n 
3 62  LYS n 
3 63  THR n 
3 64  ARG n 
3 65  ILE n 
3 66  ILE n 
3 67  PRO n 
3 68  ARG n 
3 69  HIS n 
3 70  LEU n 
3 71  GLN n 
3 72  LEU n 
3 73  ALA n 
3 74  VAL n 
3 75  ARG n 
3 76  ASN n 
3 77  ASP n 
3 78  GLU n 
3 79  GLU n 
3 80  LEU n 
3 81  ASN n 
3 82  LYS n 
3 83  LEU n 
3 84  LEU n 
3 85  GLY n 
3 86  ARG n 
3 87  VAL n 
3 88  THR n 
3 89  ILE n 
3 90  ALA n 
3 91  GLN n 
3 92  GLY n 
3 93  GLY n 
3 94  VAL n 
3 95  LEU n 
3 96  PRO n 
3 97  ASN n 
3 98  ILE n 
3 99  GLN n 
3 100 SER n 
3 101 VAL n 
3 102 LEU n 
3 103 LEU n 
3 104 PRO n 
3 105 LYS n 
4 1   THR n 
4 2   ARG n 
4 3   LYS n 
4 4   GLU n 
4 5   SER n 
4 6   TYR n 
4 7   ALA n 
4 8   ILE n 
4 9   TYR n 
4 10  VAL n 
4 11  TYR n 
4 12  LYS n 
4 13  VAL n 
4 14  LEU n 
4 15  LYS n 
4 16  GLN n 
4 17  VAL n 
4 18  HIS n 
4 19  PRO n 
4 20  ASP n 
4 21  THR n 
4 22  GLY n 
4 23  ILE n 
4 24  SER n 
4 25  SER n 
4 26  LYS n 
4 27  ALA n 
4 28  MET n 
4 29  SER n 
4 30  ILE n 
4 31  MET n 
4 32  ASN n 
4 33  SER n 
4 34  PHE n 
4 35  VAL n 
4 36  ASN n 
4 37  ASP n 
4 38  VAL n 
4 39  PHE n 
4 40  GLU n 
4 41  ARG n 
4 42  ILE n 
4 43  ALA n 
4 44  GLY n 
4 45  GLU n 
4 46  ALA n 
4 47  SER n 
4 48  ARG n 
4 49  LEU n 
4 50  ALA n 
4 51  HIS n 
4 52  TYR n 
4 53  ASN n 
4 54  LYS n 
4 55  ARG n 
4 56  SER n 
4 57  THR n 
4 58  ILE n 
4 59  THR n 
4 60  SER n 
4 61  ARG n 
4 62  GLU n 
4 63  ILE n 
4 64  GLN n 
4 65  THR n 
4 66  ALA n 
4 67  VAL n 
4 68  ARG n 
4 69  LEU n 
4 70  LEU n 
4 71  LEU n 
4 72  PRO n 
4 73  GLY n 
4 74  GLU n 
4 75  LEU n 
4 76  ALA n 
4 77  LYS n 
4 78  HIS n 
4 79  ALA n 
4 80  VAL n 
4 81  SER n 
4 82  GLU n 
4 83  GLY n 
4 84  THR n 
4 85  LYS n 
4 86  ALA n 
4 87  VAL n 
4 88  THR n 
4 89  LYS n 
4 90  TYR n 
4 91  THR n 
4 92  SER n 
4 93  ALA n 
5 1   LYS n 
5 2   THR n 
5 3   ARG n 
5 4   LYS n 
5 5   GLU n 
5 6   SER n 
5 7   TYR n 
5 8   ALA n 
5 9   ILE n 
5 10  TYR n 
5 11  VAL n 
5 12  TYR n 
5 13  LYS n 
5 14  VAL n 
5 15  LEU n 
5 16  LYS n 
5 17  GLN n 
5 18  VAL n 
5 19  HIS n 
5 20  PRO n 
5 21  ASP n 
5 22  THR n 
5 23  GLY n 
5 24  ILE n 
5 25  SER n 
5 26  SER n 
5 27  LYS n 
5 28  ALA n 
5 29  MET n 
5 30  SER n 
5 31  ILE n 
5 32  MET n 
5 33  ASN n 
5 34  SER n 
5 35  PHE n 
5 36  VAL n 
5 37  ASN n 
5 38  ASP n 
5 39  VAL n 
5 40  PHE n 
5 41  GLU n 
5 42  ARG n 
5 43  ILE n 
5 44  ALA n 
5 45  GLY n 
5 46  GLU n 
5 47  ALA n 
5 48  SER n 
5 49  ARG n 
5 50  LEU n 
5 51  ALA n 
5 52  HIS n 
5 53  TYR n 
5 54  ASN n 
5 55  LYS n 
5 56  ARG n 
5 57  SER n 
5 58  THR n 
5 59  ILE n 
5 60  THR n 
5 61  SER n 
5 62  ARG n 
5 63  GLU n 
5 64  ILE n 
5 65  GLN n 
5 66  THR n 
5 67  ALA n 
5 68  VAL n 
5 69  ARG n 
5 70  LEU n 
5 71  LEU n 
5 72  LEU n 
5 73  PRO n 
5 74  GLY n 
5 75  GLU n 
5 76  LEU n 
5 77  ALA n 
5 78  LYS n 
5 79  HIS n 
5 80  ALA n 
5 81  VAL n 
5 82  SER n 
5 83  GLU n 
5 84  GLY n 
5 85  THR n 
5 86  LYS n 
5 87  ALA n 
5 88  VAL n 
5 89  THR n 
5 90  LYS n 
5 91  TYR n 
5 92  THR n 
5 93  SER n 
5 94  ALA n 
6 1   GLY n 
6 2   GLY n 
6 3   TYR n 
6 4   ASN n 
6 5   LEU n 
6 6   ARG n 
6 7   PRO n 
6 8   ARG n 
6 9   THR n 
6 10  TYR n 
6 11  GLN n 
6 12  PRO n 
6 13  GLN n 
6 14  ARG n 
6 15  TYR n 
6 16  GLY n 
6 17  GLY n 
7 1   DA  n 
7 2   DT  n 
7 3   DC  n 
7 4   DG  n 
7 5   DA  n 
7 6   DT  n 
7 7   DG  n 
7 8   DT  n 
7 9   DA  n 
7 10  DT  n 
7 11  DA  n 
7 12  DT  n 
7 13  DA  n 
7 14  DT  n 
7 15  DC  n 
7 16  DT  n 
7 17  DG  n 
7 18  DA  n 
7 19  DC  n 
7 20  DA  n 
7 21  DC  n 
7 22  DG  n 
7 23  DT  n 
7 24  DG  n 
7 25  DC  n 
7 26  DC  n 
7 27  DT  n 
7 28  DG  n 
7 29  DG  n 
7 30  DA  n 
7 31  DG  n 
7 32  DA  n 
7 33  DC  n 
7 34  DT  n 
7 35  DA  n 
7 36  DG  n 
7 37  DG  n 
7 38  DG  n 
7 39  DA  n 
7 40  DG  n 
7 41  DT  n 
7 42  DA  n 
7 43  DA  n 
7 44  DT  n 
7 45  DC  n 
7 46  DC  n 
7 47  DC  n 
7 48  DC  n 
7 49  DT  n 
7 50  DT  n 
7 51  DG  n 
7 52  DG  n 
7 53  DC  n 
7 54  DG  n 
7 55  DG  n 
7 56  DT  n 
7 57  DT  n 
7 58  DA  n 
7 59  DA  n 
7 60  DA  n 
7 61  DA  n 
7 62  DC  n 
7 63  DG  n 
7 64  DC  n 
7 65  DG  n 
7 66  DG  n 
7 67  DG  n 
7 68  DG  n 
7 69  DG  n 
7 70  DA  n 
7 71  DC  n 
7 72  DA  n 
7 73  DG  n 
7 74  DC  n 
7 75  DG  n 
7 76  DC  n 
7 77  DG  n 
7 78  DT  n 
7 79  DA  n 
7 80  DC  n 
7 81  DG  n 
7 82  DT  n 
7 83  DG  n 
7 84  DC  n 
7 85  DG  n 
7 86  DT  n 
7 87  DT  n 
7 88  DT  n 
7 89  DA  n 
7 90  DA  n 
7 91  DG  n 
7 92  DC  n 
7 93  DG  n 
7 94  DG  n 
7 95  DT  n 
7 96  DG  n 
7 97  DC  n 
7 98  DT  n 
7 99  DA  n 
7 100 DG  n 
7 101 DA  n 
7 102 DG  n 
7 103 DC  n 
7 104 DT  n 
7 105 DG  n 
7 106 DT  n 
7 107 DC  n 
7 108 DT  n 
7 109 DA  n 
7 110 DC  n 
7 111 DG  n 
7 112 DA  n 
7 113 DC  n 
7 114 DC  n 
7 115 DA  n 
7 116 DA  n 
7 117 DT  n 
7 118 DT  n 
7 119 DG  n 
7 120 DA  n 
7 121 DG  n 
7 122 DC  n 
7 123 DG  n 
7 124 DG  n 
7 125 DC  n 
7 126 DC  n 
7 127 DT  n 
7 128 DC  n 
7 129 DG  n 
7 130 DG  n 
7 131 DC  n 
7 132 DA  n 
7 133 DC  n 
7 134 DC  n 
7 135 DG  n 
7 136 DG  n 
7 137 DG  n 
7 138 DA  n 
7 139 DT  n 
7 140 DT  n 
7 141 DC  n 
7 142 DT  n 
7 143 DG  n 
7 144 DA  n 
7 145 DT  n 
8 1   DA  n 
8 2   DT  n 
8 3   DC  n 
8 4   DA  n 
8 5   DG  n 
8 6   DA  n 
8 7   DA  n 
8 8   DT  n 
8 9   DC  n 
8 10  DC  n 
8 11  DC  n 
8 12  DG  n 
8 13  DG  n 
8 14  DT  n 
8 15  DG  n 
8 16  DC  n 
8 17  DC  n 
8 18  DG  n 
8 19  DA  n 
8 20  DG  n 
8 21  DG  n 
8 22  DC  n 
8 23  DC  n 
8 24  DG  n 
8 25  DC  n 
8 26  DT  n 
8 27  DC  n 
8 28  DA  n 
8 29  DA  n 
8 30  DT  n 
8 31  DT  n 
8 32  DG  n 
8 33  DG  n 
8 34  DT  n 
8 35  DC  n 
8 36  DG  n 
8 37  DT  n 
8 38  DA  n 
8 39  DG  n 
8 40  DA  n 
8 41  DC  n 
8 42  DA  n 
8 43  DG  n 
8 44  DC  n 
8 45  DT  n 
8 46  DC  n 
8 47  DT  n 
8 48  DA  n 
8 49  DG  n 
8 50  DC  n 
8 51  DA  n 
8 52  DC  n 
8 53  DC  n 
8 54  DG  n 
8 55  DC  n 
8 56  DT  n 
8 57  DT  n 
8 58  DA  n 
8 59  DA  n 
8 60  DA  n 
8 61  DC  n 
8 62  DG  n 
8 63  DC  n 
8 64  DA  n 
8 65  DC  n 
8 66  DG  n 
8 67  DT  n 
8 68  DA  n 
8 69  DC  n 
8 70  DG  n 
8 71  DC  n 
8 72  DG  n 
8 73  DC  n 
8 74  DT  n 
8 75  DG  n 
8 76  DT  n 
8 77  DC  n 
8 78  DC  n 
8 79  DC  n 
8 80  DC  n 
8 81  DC  n 
8 82  DG  n 
8 83  DC  n 
8 84  DG  n 
8 85  DT  n 
8 86  DT  n 
8 87  DT  n 
8 88  DT  n 
8 89  DA  n 
8 90  DA  n 
8 91  DC  n 
8 92  DC  n 
8 93  DG  n 
8 94  DC  n 
8 95  DC  n 
8 96  DA  n 
8 97  DA  n 
8 98  DG  n 
8 99  DG  n 
8 100 DG  n 
8 101 DG  n 
8 102 DA  n 
8 103 DT  n 
8 104 DT  n 
8 105 DA  n 
8 106 DC  n 
8 107 DT  n 
8 108 DC  n 
8 109 DC  n 
8 110 DC  n 
8 111 DT  n 
8 112 DA  n 
8 113 DG  n 
8 114 DT  n 
8 115 DC  n 
8 116 DT  n 
8 117 DC  n 
8 118 DC  n 
8 119 DA  n 
8 120 DG  n 
8 121 DG  n 
8 122 DC  n 
8 123 DA  n 
8 124 DC  n 
8 125 DG  n 
8 126 DT  n 
8 127 DG  n 
8 128 DT  n 
8 129 DC  n 
8 130 DA  n 
8 131 DG  n 
8 132 DA  n 
8 133 DT  n 
8 134 DA  n 
8 135 DT  n 
8 136 DA  n 
8 137 DT  n 
8 138 DA  n 
8 139 DC  n 
8 140 DA  n 
8 141 DT  n 
8 142 DC  n 
8 143 DG  n 
8 144 DA  n 
8 145 DT  n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 97  'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis'     8355  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 84  'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis'     8355  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 105 'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis'     8355  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 93  'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis'     8355  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 94  'African clawed frog' ? ? ? ? ? ? ? ? 'Xenopus laevis'     8355  ? ? ? ? ? ? ? ? 
'Escherichia coli'    562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 17  ?                     ? ? ? ? ? ? ? ? 'Simian foamy virus' 11642 ? ? ? ? ? ? ? ? 
'synthetic construct' 32630 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
7 1 sample 1 145 ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'Widow 601' ? 
8 1 sample 1 145 ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'Widow 601' ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA        P84233     ? 1 
;HRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVT
IMPKDIQLARRIRGERA
;
40 
2 UNP H4_XENLA         P62799     ? 2 
;RKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLY
GFGG
;
20 
3 UNP H2A1_XENLA       P06897     ? 3 
;AKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAVRNDEEL
NKLLGGVTIAQGGVLPNIQSVLLPK
;
15 
4 UNP A0A1B8Y853_XENTR A0A1B8Y853 ? 4 
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
33 
5 UNP A0A1B8Y853_XENTR A0A1B8Y853 ? 5 
;KTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHA
VSEGTKAVTKYTSA
;
32 
6 PDB 5MLU             5MLU       ? 6 ? 1  
7 PDB 5MLU             5MLU       ? 7 ? 1  
8 PDB 5MLU             5MLU       ? 8 ? 1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 5MLU A 1 ? 97  ? P84233     40  ? 136 ? 39  135 
2  2 5MLU B 1 ? 84  ? P62799     20  ? 103 ? 19  102 
3  3 5MLU C 1 ? 105 ? P06897     15  ? 119 ? 14  118 
4  4 5MLU D 1 ? 93  ? A0A1B8Y853 33  ? 125 ? 29  121 
5  1 5MLU E 1 ? 97  ? P84233     40  ? 136 ? 39  135 
6  2 5MLU F 1 ? 84  ? P62799     20  ? 103 ? 19  102 
7  3 5MLU G 1 ? 105 ? P06897     15  ? 119 ? 14  118 
8  5 5MLU H 1 ? 94  ? A0A1B8Y853 32  ? 125 ? 28  121 
9  6 5MLU M 1 ? 17  ? 5MLU       535 ? 551 ? 535 551 
10 7 5MLU I 1 ? 145 ? 5MLU       -72 ? 72  ? -72 72  
11 8 5MLU J 1 ? 145 ? 5MLU       -72 ? 72  ? -72 72  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5MLU ALA A 64 ? UNP P84233 GLY 103 variant 102 1 
3 5MLU ARG C 86 ? UNP P06897 GLY 100 variant 99  2 
5 5MLU ALA E 64 ? UNP P84233 GLY 103 variant 102 3 
7 5MLU ARG G 86 ? UNP P06897 GLY 100 variant 99  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                 ? 'Mn 2'            54.938  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MLU 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.92 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         57.92 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.05M MnCl2, 0.04M KCl, 0.1M potassium cacodylate pH 6.0, 5% trehalose, 24% MPD' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-07-25 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97626 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I03' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97626 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I03 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5MLU 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.8 
_reflns.d_resolution_low                 76.61 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       51308 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5 
_reflns.pdbx_Rmerge_I_obs                0.067 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.8 
_reflns_shell.d_res_low                   2.87 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.6 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.86 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MLU 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.800 
_refine.ls_d_res_low                             76.607 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     45929 
_refine.ls_number_reflns_R_free                  960 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    88.87 
_refine.ls_percent_reflns_R_free                 2.09 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2094 
_refine.ls_R_factor_R_free                       0.2518 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2085 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      1KX5 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selection' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 30.61 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.34 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6096 
_refine_hist.pdbx_number_atoms_nucleic_acid   5945 
_refine_hist.pdbx_number_atoms_ligand         4 
_refine_hist.number_atoms_solvent             194 
_refine_hist.number_atoms_total               12239 
_refine_hist.d_res_high                       2.800 
_refine_hist.d_res_low                        76.607 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 12898 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.540  ? 18677 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 22.917 ? 6770  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.052  ? 2122  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 1365  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.8000 2.9476  . . 81  3450 49.00  . . . 0.3522 . 0.2917 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9476 3.1323  . . 100 5396 75.00  . . . 0.3066 . 0.2716 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1323 3.3742  . . 149 7054 99.00  . . . 0.3543 . 0.2782 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3742 3.7137  . . 141 7177 100.00 . . . 0.2636 . 0.2290 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7137 4.2511  . . 146 7183 99.00  . . . 0.2483 . 0.2125 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2511 5.3557  . . 193 7212 100.00 . . . 0.2278 . 0.1947 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3557 76.6355 . . 150 7497 99.00  . . . 0.2341 . 0.1821 . . . . . . . . . . 
# 
_struct.entry_id                     5MLU 
_struct.title                        'Crystal structure of the PFV GAG CBS bound to a mononucleosome' 
_struct.pdbx_descriptor              'Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B, PFV GAG peptide/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MLU 
_struct_keywords.text            'nucleosome, GAG, prototype foamy virus (PFV), complex, protein, DNA, DNA binding protein' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1  ? 
B N N 2  ? 
C N N 3  ? 
D N N 4  ? 
E N N 1  ? 
F N N 2  ? 
G N N 3  ? 
H N N 5  ? 
I N N 6  ? 
J N N 7  ? 
K N N 8  ? 
L N N 9  ? 
M N N 9  ? 
N N N 9  ? 
O N N 9  ? 
P N N 10 ? 
Q N N 10 ? 
R N N 10 ? 
S N N 10 ? 
T N N 10 ? 
U N N 10 ? 
V N N 10 ? 
W N N 10 ? 
X N N 10 ? 
Y N N 10 ? 
Z N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 GLY A 6  ? SER A 19  ? GLY A 44  SER A 57  1 ? 14 
HELX_P HELX_P2  AA2 ARG A 25 ? LYS A 41  ? ARG A 63  LYS A 79  1 ? 17 
HELX_P HELX_P3  AA3 GLN A 47 ? ALA A 76  ? GLN A 85  ALA A 114 1 ? 30 
HELX_P HELX_P4  AA4 MET A 82 ? ARG A 93  ? MET A 120 ARG A 131 1 ? 12 
HELX_P HELX_P5  AA5 ASN B 7  ? ILE B 11  ? ASN B 25  ILE B 29  5 ? 5  
HELX_P HELX_P6  AA6 THR B 12 ? GLY B 23  ? THR B 30  GLY B 41  1 ? 12 
HELX_P HELX_P7  AA7 LEU B 31 ? ALA B 58  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P8  AA8 THR B 64 ? GLN B 75  ? THR B 82  GLN B 93  1 ? 12 
HELX_P HELX_P9  AA9 ARG C 4  ? GLY C 9   ? ARG C 17  GLY C 22  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 13 ? LYS C 23  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P11 AB2 GLY C 33 ? ASN C 60  ? GLY C 46  ASN C 73  1 ? 28 
HELX_P HELX_P12 AB3 ILE C 66 ? ASN C 76  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P13 AB4 ASP C 77 ? LEU C 84  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P14 AB5 GLN C 99 ? LEU C 103 ? GLN C 112 LEU C 116 5 ? 5  
HELX_P HELX_P15 AB6 TYR D 6  ? HIS D 18  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P16 AB7 SER D 24 ? ASN D 53  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P17 AB8 THR D 59 ? LEU D 71  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P18 AB9 PRO D 72 ? ALA D 93  ? PRO D 100 ALA D 121 1 ? 22 
HELX_P HELX_P19 AC1 GLY E 6  ? SER E 19  ? GLY E 44  SER E 57  1 ? 14 
HELX_P HELX_P20 AC2 ARG E 25 ? ASP E 39  ? ARG E 63  ASP E 77  1 ? 15 
HELX_P HELX_P21 AC3 GLN E 47 ? ALA E 76  ? GLN E 85  ALA E 114 1 ? 30 
HELX_P HELX_P22 AC4 MET E 82 ? ARG E 93  ? MET E 120 ARG E 131 1 ? 12 
HELX_P HELX_P23 AC5 ASN F 7  ? ILE F 11  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P24 AC6 THR F 12 ? GLY F 23  ? THR F 30  GLY F 41  1 ? 12 
HELX_P HELX_P25 AC7 LEU F 31 ? ALA F 58  ? LEU F 49  ALA F 76  1 ? 28 
HELX_P HELX_P26 AC8 THR F 64 ? GLN F 75  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P27 AC9 THR G 3  ? ALA G 8   ? THR G 16  ALA G 21  1 ? 6  
HELX_P HELX_P28 AD1 PRO G 13 ? LYS G 23  ? PRO G 26  LYS G 36  1 ? 11 
HELX_P HELX_P29 AD2 ALA G 32 ? ASN G 60  ? ALA G 45  ASN G 73  1 ? 29 
HELX_P HELX_P30 AD3 ILE G 66 ? ASP G 77  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P31 AD4 ASP G 77 ? LEU G 84  ? ASP G 90  LEU G 97  1 ? 8  
HELX_P HELX_P32 AD5 GLN G 99 ? LEU G 103 ? GLN G 112 LEU G 116 5 ? 5  
HELX_P HELX_P33 AD6 TYR H 7  ? HIS H 19  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P34 AD7 SER H 25 ? ASN H 54  ? SER H 52  ASN H 81  1 ? 30 
HELX_P HELX_P35 AD8 THR H 60 ? LEU H 72  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P36 AD9 PRO H 73 ? ALA H 94  ? PRO H 100 ALA H 121 1 ? 22 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? A ASP 39  OD1 ? ? ? 1_555 L MN  .   MN ? ? A ASP 77  A MN  201 1_555 ? ? ? ? ? ? ?               2.357 ? 
metalc2   metalc ? ? J DA  1   N7  ? ? ? 1_555 N MN  .   MN ? ? I DA  -72 I MN  102 1_555 ? ? ? ? ? ? ?               2.418 ? 
metalc3   metalc ? ? J DA  39  N7  ? ? ? 1_555 M MN  .   MN ? ? I DA  -34 I MN  101 1_555 ? ? ? ? ? ? ?               2.597 ? 
metalc4   metalc ? ? L MN  .   MN  ? ? ? 1_555 P HOH .   O  ? ? A MN  201 A HOH 314 1_555 ? ? ? ? ? ? ?               2.265 ? 
metalc5   metalc ? ? L MN  .   MN  ? ? ? 1_555 Q HOH .   O  ? ? A MN  201 B HOH 226 1_555 ? ? ? ? ? ? ?               1.831 ? 
metalc6   metalc ? ? L MN  .   MN  ? ? ? 1_555 P HOH .   O  ? ? A MN  201 A HOH 326 1_555 ? ? ? ? ? ? ?               1.816 ? 
metalc7   metalc ? ? H VAL 18  O   ? ? ? 1_555 L MN  .   MN ? ? H VAL 45  A MN  201 3_555 ? ? ? ? ? ? ?               2.327 ? 
metalc8   metalc ? ? L MN  .   MN  ? ? ? 1_555 W HOH .   O  ? ? A MN  201 H HOH 201 3_545 ? ? ? ? ? ? ?               1.807 ? 
hydrog1   hydrog ? ? J DT  2   N3  ? ? ? 1_555 K DA  144 N1 ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog2   hydrog ? ? J DT  2   O4  ? ? ? 1_555 K DA  144 N6 ? ? I DT  -71 J DA  71  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog3   hydrog ? ? J DC  3   O2  ? ? ? 1_555 K DG  143 N1 ? ? I DC  -70 J DG  70  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog4   hydrog ? ? J DG  4   N1  ? ? ? 1_555 K DC  142 N3 ? ? I DG  -69 J DC  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog5   hydrog ? ? J DG  4   N2  ? ? ? 1_555 K DC  142 O2 ? ? I DG  -69 J DC  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog6   hydrog ? ? J DG  4   O6  ? ? ? 1_555 K DC  142 N4 ? ? I DG  -69 J DC  69  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog7   hydrog ? ? J DA  5   N1  ? ? ? 1_555 K DT  141 N3 ? ? I DA  -68 J DT  68  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog8   hydrog ? ? J DT  6   N3  ? ? ? 1_555 K DA  140 N1 ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog9   hydrog ? ? J DT  6   O4  ? ? ? 1_555 K DA  140 N6 ? ? I DT  -67 J DA  67  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog10  hydrog ? ? J DG  7   N1  ? ? ? 1_555 K DA  138 N1 ? ? I DG  -66 J DA  65  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog11  hydrog ? ? J DG  7   O6  ? ? ? 1_555 K DA  138 N6 ? ? I DG  -66 J DA  65  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog12  hydrog ? ? J DG  7   N2  ? ? ? 1_555 K DC  139 O2 ? ? I DG  -66 J DC  66  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog13  hydrog ? ? J DT  8   N3  ? ? ? 1_555 K DA  138 N1 ? ? I DT  -65 J DA  65  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog14  hydrog ? ? J DA  9   N1  ? ? ? 1_555 K DT  137 N3 ? ? I DA  -64 J DT  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog15  hydrog ? ? J DA  9   N6  ? ? ? 1_555 K DT  137 O4 ? ? I DA  -64 J DT  64  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog16  hydrog ? ? J DT  10  N3  ? ? ? 1_555 K DA  136 N1 ? ? I DT  -63 J DA  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog17  hydrog ? ? J DT  10  O4  ? ? ? 1_555 K DA  136 N6 ? ? I DT  -63 J DA  63  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog18  hydrog ? ? J DA  11  N1  ? ? ? 1_555 K DT  135 N3 ? ? I DA  -62 J DT  62  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog19  hydrog ? ? J DT  12  N3  ? ? ? 1_555 K DA  134 N1 ? ? I DT  -61 J DA  61  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog20  hydrog ? ? J DA  13  N1  ? ? ? 1_555 K DT  133 N3 ? ? I DA  -60 J DT  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog21  hydrog ? ? J DA  13  N6  ? ? ? 1_555 K DT  133 O4 ? ? I DA  -60 J DT  60  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog22  hydrog ? ? J DC  15  O2  ? ? ? 1_555 K DG  131 N2 ? ? I DC  -58 J DG  58  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog23  hydrog ? ? J DT  16  N3  ? ? ? 1_555 K DA  130 N1 ? ? I DT  -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog24  hydrog ? ? J DT  16  O4  ? ? ? 1_555 K DA  130 N6 ? ? I DT  -57 J DA  57  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog25  hydrog ? ? J DG  17  N2  ? ? ? 1_555 K DC  129 O2 ? ? I DG  -56 J DC  56  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog26  hydrog ? ? J DA  18  N1  ? ? ? 1_555 K DT  128 N3 ? ? I DA  -55 J DT  55  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog27  hydrog ? ? J DC  19  O2  ? ? ? 1_555 K DG  127 N2 ? ? I DC  -54 J DG  54  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog28  hydrog ? ? J DA  20  N1  ? ? ? 1_555 K DG  125 N1 ? ? I DA  -53 J DG  52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog29  hydrog ? ? J DA  20  N6  ? ? ? 1_555 K DG  125 O6 ? ? I DA  -53 J DG  52  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ?     ? 
hydrog30  hydrog ? ? J DC  21  O2  ? ? ? 1_555 K DG  125 N2 ? ? I DC  -52 J DG  52  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog31  hydrog ? ? J DG  22  N1  ? ? ? 1_555 K DC  124 O2 ? ? I DG  -51 J DC  51  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog32  hydrog ? ? J DT  23  N3  ? ? ? 1_555 K DA  123 N1 ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog33  hydrog ? ? J DT  23  O4  ? ? ? 1_555 K DA  123 N6 ? ? I DT  -50 J DA  50  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog34  hydrog ? ? J DG  24  N1  ? ? ? 1_555 K DC  122 N3 ? ? I DG  -49 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog35  hydrog ? ? J DG  24  N2  ? ? ? 1_555 K DC  122 O2 ? ? I DG  -49 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog36  hydrog ? ? J DG  24  O6  ? ? ? 1_555 K DC  122 N4 ? ? I DG  -49 J DC  49  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog37  hydrog ? ? J DC  25  N3  ? ? ? 1_555 K DG  121 N1 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog38  hydrog ? ? J DC  25  N4  ? ? ? 1_555 K DG  121 O6 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog39  hydrog ? ? J DC  25  O2  ? ? ? 1_555 K DG  121 N2 ? ? I DC  -48 J DG  48  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog40  hydrog ? ? J DC  26  N3  ? ? ? 1_555 K DG  120 N1 ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog41  hydrog ? ? J DC  26  N4  ? ? ? 1_555 K DG  120 O6 ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog42  hydrog ? ? J DC  26  O2  ? ? ? 1_555 K DG  120 N2 ? ? I DC  -47 J DG  47  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog43  hydrog ? ? J DT  27  N3  ? ? ? 1_555 K DA  119 N1 ? ? I DT  -46 J DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog44  hydrog ? ? J DT  27  O4  ? ? ? 1_555 K DA  119 N6 ? ? I DT  -46 J DA  46  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog45  hydrog ? ? J DG  28  O6  ? ? ? 1_555 K DC  117 N4 ? ? I DG  -45 J DC  44  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog46  hydrog ? ? J DG  28  N1  ? ? ? 1_555 K DC  118 O2 ? ? I DG  -45 J DC  45  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog47  hydrog ? ? J DG  29  N1  ? ? ? 1_555 K DC  117 N3 ? ? I DG  -44 J DC  44  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog48  hydrog ? ? J DA  30  N1  ? ? ? 1_555 K DT  116 N3 ? ? I DA  -43 J DT  43  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog49  hydrog ? ? J DG  31  N1  ? ? ? 1_555 K DC  115 N3 ? ? I DG  -42 J DC  42  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog50  hydrog ? ? J DA  32  N1  ? ? ? 1_555 K DT  114 N3 ? ? I DA  -41 J DT  41  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog51  hydrog ? ? J DC  33  N3  ? ? ? 1_555 K DG  113 N1 ? ? I DC  -40 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog52  hydrog ? ? J DC  33  N4  ? ? ? 1_555 K DG  113 O6 ? ? I DC  -40 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog53  hydrog ? ? J DC  33  O2  ? ? ? 1_555 K DG  113 N2 ? ? I DC  -40 J DG  40  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog54  hydrog ? ? J DT  34  N3  ? ? ? 1_555 K DA  112 N1 ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog55  hydrog ? ? J DT  34  O4  ? ? ? 1_555 K DA  112 N6 ? ? I DT  -39 J DA  39  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog56  hydrog ? ? J DA  35  N1  ? ? ? 1_555 K DT  111 N3 ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog57  hydrog ? ? J DA  35  N6  ? ? ? 1_555 K DT  111 O4 ? ? I DA  -38 J DT  38  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog58  hydrog ? ? J DG  36  N1  ? ? ? 1_555 K DC  110 N3 ? ? I DG  -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog59  hydrog ? ? J DG  36  N2  ? ? ? 1_555 K DC  110 O2 ? ? I DG  -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog60  hydrog ? ? J DG  36  O6  ? ? ? 1_555 K DC  110 N4 ? ? I DG  -37 J DC  37  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog61  hydrog ? ? J DG  37  N1  ? ? ? 1_555 K DC  109 N3 ? ? I DG  -36 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog62  hydrog ? ? J DG  37  N2  ? ? ? 1_555 K DC  109 O2 ? ? I DG  -36 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog63  hydrog ? ? J DG  37  O6  ? ? ? 1_555 K DC  109 N4 ? ? I DG  -36 J DC  36  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog64  hydrog ? ? J DG  38  N1  ? ? ? 1_555 K DC  108 N3 ? ? I DG  -35 J DC  35  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog65  hydrog ? ? J DG  40  N1  ? ? ? 1_555 K DC  106 N3 ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog66  hydrog ? ? J DG  40  N2  ? ? ? 1_555 K DC  106 O2 ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog67  hydrog ? ? J DG  40  O6  ? ? ? 1_555 K DC  106 N4 ? ? I DG  -33 J DC  33  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog68  hydrog ? ? J DT  41  N3  ? ? ? 1_555 K DA  105 N1 ? ? I DT  -32 J DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog69  hydrog ? ? J DT  41  O4  ? ? ? 1_555 K DA  105 N6 ? ? I DT  -32 J DA  32  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog70  hydrog ? ? J DA  42  N1  ? ? ? 1_555 K DT  104 N3 ? ? I DA  -31 J DT  31  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog71  hydrog ? ? J DA  43  N1  ? ? ? 1_555 K DT  103 N3 ? ? I DA  -30 J DT  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog72  hydrog ? ? J DA  43  N6  ? ? ? 1_555 K DT  103 O4 ? ? I DA  -30 J DT  30  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog73  hydrog ? ? J DT  44  N3  ? ? ? 1_555 K DA  102 N1 ? ? I DT  -29 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog74  hydrog ? ? J DT  44  O4  ? ? ? 1_555 K DA  102 N6 ? ? I DT  -29 J DA  29  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog75  hydrog ? ? J DC  45  O2  ? ? ? 1_555 K DG  101 N2 ? ? I DC  -28 J DG  28  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog76  hydrog ? ? J DC  46  O2  ? ? ? 1_555 K DG  100 N2 ? ? I DC  -27 J DG  27  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog77  hydrog ? ? J DC  47  O2  ? ? ? 1_555 K DG  99  N2 ? ? I DC  -26 J DG  26  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog78  hydrog ? ? J DC  48  O2  ? ? ? 1_555 K DG  98  N2 ? ? I DC  -25 J DG  25  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog79  hydrog ? ? J DT  49  N3  ? ? ? 1_555 K DA  97  N1 ? ? I DT  -24 J DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog80  hydrog ? ? J DT  49  O4  ? ? ? 1_555 K DA  97  N6 ? ? I DT  -24 J DA  24  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog81  hydrog ? ? J DT  50  N3  ? ? ? 1_555 K DA  96  N1 ? ? I DT  -23 J DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog82  hydrog ? ? J DT  50  O4  ? ? ? 1_555 K DA  96  N6 ? ? I DT  -23 J DA  23  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog83  hydrog ? ? J DG  51  N1  ? ? ? 1_555 K DC  95  N3 ? ? I DG  -22 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog84  hydrog ? ? J DG  51  N2  ? ? ? 1_555 K DC  95  O2 ? ? I DG  -22 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog85  hydrog ? ? J DG  51  O6  ? ? ? 1_555 K DC  95  N4 ? ? I DG  -22 J DC  22  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog86  hydrog ? ? J DG  52  N1  ? ? ? 1_555 K DC  94  N3 ? ? I DG  -21 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog87  hydrog ? ? J DG  52  N2  ? ? ? 1_555 K DC  94  O2 ? ? I DG  -21 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog88  hydrog ? ? J DG  52  O6  ? ? ? 1_555 K DC  94  N4 ? ? I DG  -21 J DC  21  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog89  hydrog ? ? J DC  53  N3  ? ? ? 1_555 K DG  93  N1 ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog90  hydrog ? ? J DC  53  N4  ? ? ? 1_555 K DG  93  O6 ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog91  hydrog ? ? J DC  53  O2  ? ? ? 1_555 K DG  93  N2 ? ? I DC  -20 J DG  20  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog92  hydrog ? ? J DG  54  N1  ? ? ? 1_555 K DC  92  N3 ? ? I DG  -19 J DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog93  hydrog ? ? J DG  54  N2  ? ? ? 1_555 K DC  92  O2 ? ? I DG  -19 J DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog94  hydrog ? ? J DG  54  O6  ? ? ? 1_555 K DC  92  N4 ? ? I DG  -19 J DC  19  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog95  hydrog ? ? J DG  55  N1  ? ? ? 1_555 K DC  91  N3 ? ? I DG  -18 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog96  hydrog ? ? J DG  55  N2  ? ? ? 1_555 K DC  91  O2 ? ? I DG  -18 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog97  hydrog ? ? J DG  55  O6  ? ? ? 1_555 K DC  91  N4 ? ? I DG  -18 J DC  18  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog98  hydrog ? ? J DT  56  N3  ? ? ? 1_555 K DA  90  N1 ? ? I DT  -17 J DA  17  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog99  hydrog ? ? J DT  57  N3  ? ? ? 1_555 K DA  89  N1 ? ? I DT  -16 J DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog100 hydrog ? ? J DT  57  O4  ? ? ? 1_555 K DA  89  N6 ? ? I DT  -16 J DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog101 hydrog ? ? J DA  58  N1  ? ? ? 1_555 K DT  88  N3 ? ? I DA  -15 J DT  15  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog102 hydrog ? ? J DA  59  N1  ? ? ? 1_555 K DT  87  N3 ? ? I DA  -14 J DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog103 hydrog ? ? J DA  59  N6  ? ? ? 1_555 K DT  87  O4 ? ? I DA  -14 J DT  14  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog104 hydrog ? ? J DA  60  N1  ? ? ? 1_555 K DT  86  N3 ? ? I DA  -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog105 hydrog ? ? J DA  60  N6  ? ? ? 1_555 K DT  86  O4 ? ? I DA  -13 J DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog106 hydrog ? ? J DA  61  N1  ? ? ? 1_555 K DT  85  N3 ? ? I DA  -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog107 hydrog ? ? J DA  61  N6  ? ? ? 1_555 K DT  85  O4 ? ? I DA  -12 J DT  12  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog108 hydrog ? ? J DC  62  N3  ? ? ? 1_555 K DG  84  N1 ? ? I DC  -11 J DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog109 hydrog ? ? J DC  62  N4  ? ? ? 1_555 K DG  84  O6 ? ? I DC  -11 J DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog110 hydrog ? ? J DC  62  O2  ? ? ? 1_555 K DG  84  N2 ? ? I DC  -11 J DG  11  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog111 hydrog ? ? J DG  63  N1  ? ? ? 1_555 K DC  83  N3 ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog112 hydrog ? ? J DG  63  N2  ? ? ? 1_555 K DC  83  O2 ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog113 hydrog ? ? J DG  63  O6  ? ? ? 1_555 K DC  83  N4 ? ? I DG  -10 J DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog114 hydrog ? ? J DC  64  O2  ? ? ? 1_555 K DG  82  N2 ? ? I DC  -9  J DG  9   1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog115 hydrog ? ? J DG  65  N1  ? ? ? 1_555 K DC  81  N3 ? ? I DG  -8  J DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog116 hydrog ? ? J DG  65  N2  ? ? ? 1_555 K DC  81  O2 ? ? I DG  -8  J DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog117 hydrog ? ? J DG  65  O6  ? ? ? 1_555 K DC  81  N4 ? ? I DG  -8  J DC  8   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog118 hydrog ? ? J DG  66  N2  ? ? ? 1_555 K DC  80  O2 ? ? I DG  -7  J DC  7   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog119 hydrog ? ? J DG  67  N1  ? ? ? 1_555 K DC  79  N3 ? ? I DG  -6  J DC  6   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog120 hydrog ? ? J DG  68  N1  ? ? ? 1_555 K DC  78  N3 ? ? I DG  -5  J DC  5   1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog121 hydrog ? ? J DG  69  N1  ? ? ? 1_555 K DC  77  N3 ? ? I DG  -4  J DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog122 hydrog ? ? J DG  69  N2  ? ? ? 1_555 K DC  77  O2 ? ? I DG  -4  J DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog123 hydrog ? ? J DG  69  O6  ? ? ? 1_555 K DC  77  N4 ? ? I DG  -4  J DC  4   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog124 hydrog ? ? J DA  70  N1  ? ? ? 1_555 K DT  76  N3 ? ? I DA  -3  J DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog125 hydrog ? ? J DA  70  N6  ? ? ? 1_555 K DT  76  O4 ? ? I DA  -3  J DT  3   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog126 hydrog ? ? J DC  71  N3  ? ? ? 1_555 K DG  75  N1 ? ? I DC  -2  J DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog127 hydrog ? ? J DC  71  N4  ? ? ? 1_555 K DG  75  O6 ? ? I DC  -2  J DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog128 hydrog ? ? J DC  71  O2  ? ? ? 1_555 K DG  75  N2 ? ? I DC  -2  J DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog129 hydrog ? ? J DA  72  N1  ? ? ? 1_555 K DT  74  N3 ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog130 hydrog ? ? J DA  72  N6  ? ? ? 1_555 K DT  74  O4 ? ? I DA  -1  J DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog131 hydrog ? ? J DG  73  N1  ? ? ? 1_555 K DC  73  N3 ? ? I DG  0   J DC  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog132 hydrog ? ? J DG  73  N2  ? ? ? 1_555 K DC  73  O2 ? ? I DG  0   J DC  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog133 hydrog ? ? J DG  73  O6  ? ? ? 1_555 K DC  73  N4 ? ? I DG  0   J DC  0   1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog134 hydrog ? ? J DC  74  O2  ? ? ? 1_555 K DG  72  N1 ? ? I DC  1   J DG  -1  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog135 hydrog ? ? J DG  75  N1  ? ? ? 1_555 K DC  71  N3 ? ? I DG  2   J DC  -2  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog136 hydrog ? ? J DC  76  N3  ? ? ? 1_555 K DG  70  N1 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog137 hydrog ? ? J DC  76  N4  ? ? ? 1_555 K DG  70  O6 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog138 hydrog ? ? J DC  76  O2  ? ? ? 1_555 K DG  70  N2 ? ? I DC  3   J DG  -3  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog139 hydrog ? ? J DG  77  N1  ? ? ? 1_555 K DC  69  N3 ? ? I DG  4   J DC  -4  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog140 hydrog ? ? J DT  78  N3  ? ? ? 1_555 K DA  68  N1 ? ? I DT  5   J DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog141 hydrog ? ? J DT  78  O4  ? ? ? 1_555 K DA  68  N6 ? ? I DT  5   J DA  -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog142 hydrog ? ? J DA  79  N1  ? ? ? 1_555 K DT  67  N3 ? ? I DA  6   J DT  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog143 hydrog ? ? J DA  79  N6  ? ? ? 1_555 K DT  67  O4 ? ? I DA  6   J DT  -6  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog144 hydrog ? ? J DC  80  O2  ? ? ? 1_555 K DG  66  N2 ? ? I DC  7   J DG  -7  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog145 hydrog ? ? J DG  81  N1  ? ? ? 1_555 K DC  65  N3 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog146 hydrog ? ? J DG  81  N2  ? ? ? 1_555 K DC  65  O2 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog147 hydrog ? ? J DG  81  O6  ? ? ? 1_555 K DC  65  N4 ? ? I DG  8   J DC  -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog148 hydrog ? ? J DT  82  N3  ? ? ? 1_555 K DA  64  N1 ? ? I DT  9   J DA  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog149 hydrog ? ? J DT  82  O4  ? ? ? 1_555 K DA  64  N6 ? ? I DT  9   J DA  -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog150 hydrog ? ? J DG  83  N1  ? ? ? 1_555 K DC  63  N3 ? ? I DG  10  J DC  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog151 hydrog ? ? J DG  83  N2  ? ? ? 1_555 K DC  63  O2 ? ? I DG  10  J DC  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog152 hydrog ? ? J DG  83  O6  ? ? ? 1_555 K DC  63  N4 ? ? I DG  10  J DC  -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog153 hydrog ? ? J DC  84  N3  ? ? ? 1_555 K DG  62  N1 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog154 hydrog ? ? J DC  84  N4  ? ? ? 1_555 K DG  62  O6 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog155 hydrog ? ? J DC  84  O2  ? ? ? 1_555 K DG  62  N2 ? ? I DC  11  J DG  -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog156 hydrog ? ? J DG  85  N1  ? ? ? 1_555 K DC  61  N3 ? ? I DG  12  J DC  -12 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog157 hydrog ? ? J DT  86  N3  ? ? ? 1_555 K DA  60  N1 ? ? I DT  13  J DA  -13 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog158 hydrog ? ? J DT  87  N3  ? ? ? 1_555 K DA  59  N1 ? ? I DT  14  J DA  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog159 hydrog ? ? J DT  87  O4  ? ? ? 1_555 K DA  59  N6 ? ? I DT  14  J DA  -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog160 hydrog ? ? J DA  89  N1  ? ? ? 1_555 K DT  57  N3 ? ? I DA  16  J DT  -16 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog161 hydrog ? ? J DG  91  N1  ? ? ? 1_555 K DC  55  N3 ? ? I DG  18  J DC  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog162 hydrog ? ? J DG  91  N2  ? ? ? 1_555 K DC  55  O2 ? ? I DG  18  J DC  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog163 hydrog ? ? J DG  91  O6  ? ? ? 1_555 K DC  55  N4 ? ? I DG  18  J DC  -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog164 hydrog ? ? J DC  92  O2  ? ? ? 1_555 K DG  54  N2 ? ? I DC  19  J DG  -19 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog165 hydrog ? ? J DG  93  N1  ? ? ? 1_555 K DC  53  N3 ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog166 hydrog ? ? J DG  93  N2  ? ? ? 1_555 K DC  53  O2 ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog167 hydrog ? ? J DG  93  O6  ? ? ? 1_555 K DC  53  N4 ? ? I DG  20  J DC  -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog168 hydrog ? ? J DG  94  N2  ? ? ? 1_555 K DC  52  O2 ? ? I DG  21  J DC  -21 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog169 hydrog ? ? J DT  95  N3  ? ? ? 1_555 K DA  51  N1 ? ? I DT  22  J DA  -22 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog170 hydrog ? ? J DG  96  N1  ? ? ? 1_555 K DC  50  N3 ? ? I DG  23  J DC  -23 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog171 hydrog ? ? J DC  97  O2  ? ? ? 1_555 K DG  49  N2 ? ? I DC  24  J DG  -24 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog172 hydrog ? ? J DT  98  N3  ? ? ? 1_555 K DA  48  N1 ? ? I DT  25  J DA  -25 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog173 hydrog ? ? J DA  99  N1  ? ? ? 1_555 K DT  47  N3 ? ? I DA  26  J DT  -26 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog174 hydrog ? ? J DG  100 N1  ? ? ? 1_555 K DC  46  N3 ? ? I DG  27  J DC  -27 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog175 hydrog ? ? J DA  101 N1  ? ? ? 1_555 K DT  45  N3 ? ? I DA  28  J DT  -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog176 hydrog ? ? J DA  101 N6  ? ? ? 1_555 K DT  45  O4 ? ? I DA  28  J DT  -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog177 hydrog ? ? J DG  102 N1  ? ? ? 1_555 K DC  44  N3 ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog178 hydrog ? ? J DG  102 N2  ? ? ? 1_555 K DC  44  O2 ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog179 hydrog ? ? J DG  102 O6  ? ? ? 1_555 K DC  44  N4 ? ? I DG  29  J DC  -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog180 hydrog ? ? J DC  103 O2  ? ? ? 1_555 K DG  43  N2 ? ? I DC  30  J DG  -30 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog181 hydrog ? ? J DT  104 N3  ? ? ? 1_555 K DA  42  N1 ? ? I DT  31  J DA  -31 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog182 hydrog ? ? J DG  105 N1  ? ? ? 1_555 K DC  41  N3 ? ? I DG  32  J DC  -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog183 hydrog ? ? J DG  105 N2  ? ? ? 1_555 K DC  41  O2 ? ? I DG  32  J DC  -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog184 hydrog ? ? J DG  105 O6  ? ? ? 1_555 K DC  41  N4 ? ? I DG  32  J DC  -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog185 hydrog ? ? J DT  106 N3  ? ? ? 1_555 K DA  40  N1 ? ? I DT  33  J DA  -33 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog186 hydrog ? ? J DC  107 N3  ? ? ? 1_555 K DG  39  N1 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog187 hydrog ? ? J DC  107 N4  ? ? ? 1_555 K DG  39  O6 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog188 hydrog ? ? J DC  107 O2  ? ? ? 1_555 K DG  39  N2 ? ? I DC  34  J DG  -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog189 hydrog ? ? J DT  108 N3  ? ? ? 1_555 K DA  38  N1 ? ? I DT  35  J DA  -35 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog190 hydrog ? ? J DA  109 N1  ? ? ? 1_555 K DT  37  N3 ? ? I DA  36  J DT  -36 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ?     ? 
hydrog191 hydrog ? ? J DC  110 N3  ? ? ? 1_555 K DG  36  N1 ? ? I DC  37  J DG  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog192 hydrog ? ? J DC  110 N4  ? ? ? 1_555 K DG  36  O6 ? ? I DC  37  J DG  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog193 hydrog ? ? J DC  110 O2  ? ? ? 1_555 K DG  36  N2 ? ? I DC  37  J DG  -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog194 hydrog ? ? J DG  111 N1  ? ? ? 1_555 K DC  35  N3 ? ? I DG  38  J DC  -38 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog195 hydrog ? ? J DA  112 N1  ? ? ? 1_555 K DT  34  N3 ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog196 hydrog ? ? J DA  112 N6  ? ? ? 1_555 K DT  34  O4 ? ? I DA  39  J DT  -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog197 hydrog ? ? J DC  113 N3  ? ? ? 1_555 K DG  33  N1 ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog198 hydrog ? ? J DC  113 N4  ? ? ? 1_555 K DG  33  O6 ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog199 hydrog ? ? J DC  113 O2  ? ? ? 1_555 K DG  33  N2 ? ? I DC  40  J DG  -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog200 hydrog ? ? J DC  114 O2  ? ? ? 1_555 K DG  32  N2 ? ? I DC  41  J DG  -41 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog201 hydrog ? ? J DA  115 N1  ? ? ? 1_555 K DT  31  N3 ? ? I DA  42  J DT  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog202 hydrog ? ? J DA  115 N6  ? ? ? 1_555 K DT  31  O4 ? ? I DA  42  J DT  -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog203 hydrog ? ? J DA  116 N1  ? ? ? 1_555 K DT  30  N3 ? ? I DA  43  J DT  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog204 hydrog ? ? J DA  116 N6  ? ? ? 1_555 K DT  30  O4 ? ? I DA  43  J DT  -43 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog205 hydrog ? ? J DT  117 N3  ? ? ? 1_555 K DA  29  N1 ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog206 hydrog ? ? J DT  117 O4  ? ? ? 1_555 K DA  29  N6 ? ? I DT  44  J DA  -44 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog207 hydrog ? ? J DT  118 N3  ? ? ? 1_555 K DA  28  N1 ? ? I DT  45  J DA  -45 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ?     ? 
hydrog208 hydrog ? ? J DG  119 N1  ? ? ? 1_555 K DC  27  N3 ? ? I DG  46  J DC  -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog209 hydrog ? ? J DG  119 N2  ? ? ? 1_555 K DC  27  O2 ? ? I DG  46  J DC  -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog210 hydrog ? ? J DG  119 O6  ? ? ? 1_555 K DC  27  N4 ? ? I DG  46  J DC  -46 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog211 hydrog ? ? J DA  120 N1  ? ? ? 1_555 K DT  26  N3 ? ? I DA  47  J DT  -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog212 hydrog ? ? J DA  120 N6  ? ? ? 1_555 K DT  26  O4 ? ? I DA  47  J DT  -47 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog213 hydrog ? ? J DG  121 N1  ? ? ? 1_555 K DC  25  N3 ? ? I DG  48  J DC  -48 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog214 hydrog ? ? J DC  122 O2  ? ? ? 1_555 K DG  24  N2 ? ? I DC  49  J DG  -49 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog215 hydrog ? ? J DG  123 N1  ? ? ? 1_555 K DC  23  N3 ? ? I DG  50  J DC  -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog216 hydrog ? ? J DG  123 N2  ? ? ? 1_555 K DC  23  O2 ? ? I DG  50  J DC  -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog217 hydrog ? ? J DG  123 O6  ? ? ? 1_555 K DC  23  N4 ? ? I DG  50  J DC  -50 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog218 hydrog ? ? J DG  124 N1  ? ? ? 1_555 K DC  22  N3 ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog219 hydrog ? ? J DG  124 N2  ? ? ? 1_555 K DC  22  O2 ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog220 hydrog ? ? J DG  124 O6  ? ? ? 1_555 K DC  22  N4 ? ? I DG  51  J DC  -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog221 hydrog ? ? J DC  125 N3  ? ? ? 1_555 K DG  21  N1 ? ? I DC  52  J DG  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog222 hydrog ? ? J DC  125 N4  ? ? ? 1_555 K DG  21  O6 ? ? I DC  52  J DG  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog223 hydrog ? ? J DC  125 O2  ? ? ? 1_555 K DG  21  N2 ? ? I DC  52  J DG  -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog224 hydrog ? ? J DC  126 O2  ? ? ? 1_555 K DG  20  N2 ? ? I DC  53  J DG  -53 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog225 hydrog ? ? J DT  127 N3  ? ? ? 1_555 K DA  19  N1 ? ? I DT  54  J DA  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog226 hydrog ? ? J DT  127 O4  ? ? ? 1_555 K DA  19  N6 ? ? I DT  54  J DA  -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog227 hydrog ? ? J DC  128 N3  ? ? ? 1_555 K DG  18  N1 ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog228 hydrog ? ? J DC  128 N4  ? ? ? 1_555 K DG  18  O6 ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog229 hydrog ? ? J DC  128 O2  ? ? ? 1_555 K DG  18  N2 ? ? I DC  55  J DG  -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog230 hydrog ? ? J DG  129 N1  ? ? ? 1_555 K DC  17  N3 ? ? I DG  56  J DC  -56 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog231 hydrog ? ? J DG  130 N1  ? ? ? 1_555 K DC  16  N3 ? ? I DG  57  J DC  -57 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog232 hydrog ? ? J DC  131 O2  ? ? ? 1_555 K DG  15  N2 ? ? I DC  58  J DG  -58 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog233 hydrog ? ? J DA  132 N1  ? ? ? 1_555 K DT  14  N3 ? ? I DA  59  J DT  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog234 hydrog ? ? J DA  132 N6  ? ? ? 1_555 K DT  14  O4 ? ? I DA  59  J DT  -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog235 hydrog ? ? J DC  133 O2  ? ? ? 1_555 K DG  13  N2 ? ? I DC  60  J DG  -60 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog236 hydrog ? ? J DC  134 N3  ? ? ? 1_555 K DG  12  N1 ? ? I DC  61  J DG  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog237 hydrog ? ? J DC  134 N4  ? ? ? 1_555 K DG  12  O6 ? ? I DC  61  J DG  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog238 hydrog ? ? J DC  134 O2  ? ? ? 1_555 K DG  12  N2 ? ? I DC  61  J DG  -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog239 hydrog ? ? J DG  135 N2  ? ? ? 1_555 K DC  11  O2 ? ? I DG  62  J DC  -62 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog240 hydrog ? ? J DG  136 N1  ? ? ? 1_555 K DC  10  O2 ? ? I DG  63  J DC  -63 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog241 hydrog ? ? J DG  137 N1  ? ? ? 1_555 K DC  9   N3 ? ? I DG  64  J DC  -64 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog242 hydrog ? ? J DA  138 N1  ? ? ? 1_555 K DT  8   N3 ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog243 hydrog ? ? J DA  138 N6  ? ? ? 1_555 K DT  8   O4 ? ? I DA  65  J DT  -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog244 hydrog ? ? J DT  139 N3  ? ? ? 1_555 K DA  7   N1 ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog245 hydrog ? ? J DT  139 O4  ? ? ? 1_555 K DA  7   N6 ? ? I DT  66  J DA  -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog246 hydrog ? ? J DT  140 N3  ? ? ? 1_555 K DA  6   N1 ? ? I DT  67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog247 hydrog ? ? J DT  140 O4  ? ? ? 1_555 K DA  6   N6 ? ? I DT  67  J DA  -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog248 hydrog ? ? J DC  141 O2  ? ? ? 1_555 K DG  5   N1 ? ? I DC  68  J DG  -68 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ?     ? 
hydrog249 hydrog ? ? J DT  142 O2  ? ? ? 1_555 K DG  5   N2 ? ? I DT  69  J DG  -68 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ?     ? 
hydrog250 hydrog ? ? J DG  143 N1  ? ? ? 1_555 K DC  3   N3 ? ? I DG  70  J DC  -70 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ?     ? 
hydrog251 hydrog ? ? J DA  144 N1  ? ? ? 1_555 K DT  2   N3 ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog252 hydrog ? ? J DA  144 N6  ? ? ? 1_555 K DT  2   O4 ? ? I DA  71  J DT  -71 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog253 hydrog ? ? J DT  145 N3  ? ? ? 1_555 K DA  1   N1 ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
hydrog254 hydrog ? ? J DT  145 O4  ? ? ? 1_555 K DA  1   N6 ? ? I DT  72  J DA  -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA8 1 2 ? parallel 
AA9 1 2 ? parallel 
AB1 1 2 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 45 ? PHE A 46 ? ARG A 83  PHE A 84  
AA1 2 THR B 62 ? VAL B 63 ? THR B 80  VAL B 81  
AA2 1 THR A 80 ? ILE A 81 ? THR A 118 ILE A 119 
AA2 2 ARG B 27 ? ILE B 28 ? ARG B 45  ILE B 46  
AA3 1 THR B 78 ? TYR B 80 ? THR B 96  TYR B 98  
AA3 2 VAL G 87 ? ILE G 89 ? VAL G 100 ILE G 102 
AA4 1 ARG C 29 ? VAL C 30 ? ARG C 42  VAL C 43  
AA4 2 THR D 57 ? ILE D 58 ? THR D 85  ILE D 86  
AA5 1 ARG C 64 ? ILE C 65 ? ARG C 77  ILE C 78  
AA5 2 GLY D 22 ? ILE D 23 ? GLY D 50  ILE D 51  
AA6 1 VAL C 87 ? ILE C 89 ? VAL C 100 ILE C 102 
AA6 2 THR F 78 ? TYR F 80 ? THR F 96  TYR F 98  
AA7 1 ARG E 45 ? PHE E 46 ? ARG E 83  PHE E 84  
AA7 2 THR F 62 ? VAL F 63 ? THR F 80  VAL F 81  
AA8 1 THR E 80 ? ILE E 81 ? THR E 118 ILE E 119 
AA8 2 ARG F 27 ? ILE F 28 ? ARG F 45  ILE F 46  
AA9 1 ARG G 29 ? VAL G 30 ? ARG G 42  VAL G 43  
AA9 2 THR H 58 ? ILE H 59 ? THR H 85  ILE H 86  
AB1 1 ARG G 64 ? ILE G 65 ? ARG G 77  ILE G 78  
AB1 2 GLY H 23 ? ILE H 24 ? GLY H 50  ILE H 51  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 45 ? N ARG A 83  O VAL B 63 ? O VAL B 81  
AA2 1 2 N ILE A 81 ? N ILE A 119 O ARG B 27 ? O ARG B 45  
AA3 1 2 N TYR B 80 ? N TYR B 98  O THR G 88 ? O THR G 101 
AA4 1 2 N ARG C 29 ? N ARG C 42  O ILE D 58 ? O ILE D 86  
AA5 1 2 N ILE C 65 ? N ILE C 78  O GLY D 22 ? O GLY D 50  
AA6 1 2 N THR C 88 ? N THR C 101 O TYR F 80 ? O TYR F 98  
AA7 1 2 N ARG E 45 ? N ARG E 83  O VAL F 63 ? O VAL F 81  
AA8 1 2 N ILE E 81 ? N ILE E 119 O ARG F 27 ? O ARG F 45  
AA9 1 2 N ARG G 29 ? N ARG G 42  O ILE H 59 ? O ILE H 86  
AB1 1 2 N ILE G 65 ? N ILE G 78  O GLY H 23 ? O GLY H 50  
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MN 201 ? 6 'binding site for residue MN A 201' 
AC2 Software I MN 101 ? 1 'binding site for residue MN I 101' 
AC3 Software I MN 102 ? 1 'binding site for residue MN I 102' 
AC4 Software J MN 101 ? 2 'binding site for residue MN J 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 ASP A 39  ? ASP A 77  . ? 1_555 ? 
2  AC1 6 HOH P .   ? HOH A 314 . ? 1_555 ? 
3  AC1 6 HOH P .   ? HOH A 326 . ? 1_555 ? 
4  AC1 6 HOH Q .   ? HOH B 226 . ? 1_555 ? 
5  AC1 6 VAL H 18  ? VAL H 45  . ? 3_545 ? 
6  AC1 6 HOH W .   ? HOH H 201 . ? 3_545 ? 
7  AC2 1 DA  J 39  ? DA  I -34 . ? 1_555 ? 
8  AC3 1 DA  J 1   ? DA  I -72 . ? 1_555 ? 
9  AC4 2 DG  K 99  ? DG  J 26  . ? 1_555 ? 
10 AC4 2 DG  K 100 ? DG  J 27  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5MLU 
_atom_sites.fract_transf_matrix[1][1]   0.009323 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009137 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005688 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MN 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . HIS A 1  1   ? 9.149   -21.183 84.577 1.00 157.20 ? 39  HIS A N     1 
ATOM   2     C  CA    . HIS A 1  1   ? 8.199   -20.323 83.881 1.00 155.51 ? 39  HIS A CA    1 
ATOM   3     C  C     . HIS A 1  1   ? 7.224   -21.148 83.048 1.00 146.68 ? 39  HIS A C     1 
ATOM   4     O  O     . HIS A 1  1   ? 7.602   -22.155 82.447 1.00 147.44 ? 39  HIS A O     1 
ATOM   5     C  CB    . HIS A 1  1   ? 8.935   -19.318 82.992 1.00 162.60 ? 39  HIS A CB    1 
ATOM   6     C  CG    . HIS A 1  1   ? 8.027   -18.376 82.264 1.00 166.74 ? 39  HIS A CG    1 
ATOM   7     N  ND1   . HIS A 1  1   ? 7.193   -17.492 82.915 1.00 169.78 ? 39  HIS A ND1   1 
ATOM   8     C  CD2   . HIS A 1  1   ? 7.823   -18.178 80.940 1.00 169.10 ? 39  HIS A CD2   1 
ATOM   9     C  CE1   . HIS A 1  1   ? 6.515   -16.791 82.024 1.00 169.49 ? 39  HIS A CE1   1 
ATOM   10    N  NE2   . HIS A 1  1   ? 6.879   -17.188 80.818 1.00 169.12 ? 39  HIS A NE2   1 
ATOM   11    N  N     . ARG A 1  2   ? 5.967   -20.711 83.016 1.00 136.50 ? 40  ARG A N     1 
ATOM   12    C  CA    . ARG A 1  2   ? 4.927   -21.415 82.279 1.00 125.17 ? 40  ARG A CA    1 
ATOM   13    C  C     . ARG A 1  2   ? 3.828   -20.435 81.897 1.00 120.09 ? 40  ARG A C     1 
ATOM   14    O  O     . ARG A 1  2   ? 3.332   -19.689 82.746 1.00 120.96 ? 40  ARG A O     1 
ATOM   15    C  CB    . ARG A 1  2   ? 4.349   -22.567 83.108 1.00 119.28 ? 40  ARG A CB    1 
ATOM   16    C  CG    . ARG A 1  2   ? 2.995   -23.064 82.630 1.00 113.92 ? 40  ARG A CG    1 
ATOM   17    C  CD    . ARG A 1  2   ? 2.583   -24.332 83.356 1.00 112.62 ? 40  ARG A CD    1 
ATOM   18    N  NE    . ARG A 1  2   ? 3.431   -25.463 82.992 1.00 112.94 ? 40  ARG A NE    1 
ATOM   19    C  CZ    . ARG A 1  2   ? 3.155   -26.317 82.012 1.00 112.49 ? 40  ARG A CZ    1 
ATOM   20    N  NH1   . ARG A 1  2   ? 2.048   -26.173 81.297 1.00 112.67 ? 40  ARG A NH1   1 
ATOM   21    N  NH2   . ARG A 1  2   ? 3.983   -27.318 81.748 1.00 112.67 ? 40  ARG A NH2   1 
ATOM   22    N  N     . TYR A 1  3   ? 3.455   -20.444 80.623 1.00 113.37 ? 41  TYR A N     1 
ATOM   23    C  CA    . TYR A 1  3   ? 2.367   -19.626 80.109 1.00 106.57 ? 41  TYR A CA    1 
ATOM   24    C  C     . TYR A 1  3   ? 1.028   -20.325 80.322 1.00 104.18 ? 41  TYR A C     1 
ATOM   25    O  O     . TYR A 1  3   ? 0.938   -21.555 80.307 1.00 106.46 ? 41  TYR A O     1 
ATOM   26    C  CB    . TYR A 1  3   ? 2.571   -19.335 78.620 1.00 102.52 ? 41  TYR A CB    1 
ATOM   27    C  CG    . TYR A 1  3   ? 3.607   -18.270 78.337 1.00 101.72 ? 41  TYR A CG    1 
ATOM   28    C  CD1   . TYR A 1  3   ? 3.311   -16.926 78.512 1.00 100.98 ? 41  TYR A CD1   1 
ATOM   29    C  CD2   . TYR A 1  3   ? 4.876   -18.607 77.884 1.00 104.59 ? 41  TYR A CD2   1 
ATOM   30    C  CE1   . TYR A 1  3   ? 4.251   -15.947 78.251 1.00 102.11 ? 41  TYR A CE1   1 
ATOM   31    C  CE2   . TYR A 1  3   ? 5.824   -17.635 77.620 1.00 105.47 ? 41  TYR A CE2   1 
ATOM   32    C  CZ    . TYR A 1  3   ? 5.505   -16.307 77.805 1.00 104.26 ? 41  TYR A CZ    1 
ATOM   33    O  OH    . TYR A 1  3   ? 6.443   -15.336 77.544 1.00 105.62 ? 41  TYR A OH    1 
ATOM   34    N  N     . ARG A 1  4   ? -0.017  -19.523 80.520 1.00 101.18 ? 42  ARG A N     1 
ATOM   35    C  CA    . ARG A 1  4   ? -1.343  -20.076 80.743 1.00 102.65 ? 42  ARG A CA    1 
ATOM   36    C  C     . ARG A 1  4   ? -1.910  -20.647 79.442 1.00 101.84 ? 42  ARG A C     1 
ATOM   37    O  O     . ARG A 1  4   ? -1.553  -20.199 78.350 1.00 101.70 ? 42  ARG A O     1 
ATOM   38    C  CB    . ARG A 1  4   ? -2.282  -19.008 81.300 1.00 103.89 ? 42  ARG A CB    1 
ATOM   39    C  CG    . ARG A 1  4   ? -1.984  -18.612 82.737 1.00 111.15 ? 42  ARG A CG    1 
ATOM   40    C  CD    . ARG A 1  4   ? -2.811  -17.410 83.169 1.00 118.08 ? 42  ARG A CD    1 
ATOM   41    N  NE    . ARG A 1  4   ? -4.245  -17.638 83.012 1.00 123.04 ? 42  ARG A NE    1 
ATOM   42    C  CZ    . ARG A 1  4   ? -5.180  -16.746 83.325 1.00 125.44 ? 42  ARG A CZ    1 
ATOM   43    N  NH1   . ARG A 1  4   ? -4.834  -15.564 83.816 1.00 124.48 ? 42  ARG A NH1   1 
ATOM   44    N  NH2   . ARG A 1  4   ? -6.462  -17.037 83.148 1.00 127.07 ? 42  ARG A NH2   1 
ATOM   45    N  N     . PRO A 1  5   ? -2.796  -21.648 79.533 1.00 99.95  ? 43  PRO A N     1 
ATOM   46    C  CA    . PRO A 1  5   ? -3.354  -22.250 78.313 1.00 94.86  ? 43  PRO A CA    1 
ATOM   47    C  C     . PRO A 1  5   ? -4.191  -21.274 77.502 1.00 88.59  ? 43  PRO A C     1 
ATOM   48    O  O     . PRO A 1  5   ? -5.287  -20.881 77.916 1.00 85.84  ? 43  PRO A O     1 
ATOM   49    C  CB    . PRO A 1  5   ? -4.205  -23.409 78.849 1.00 96.07  ? 43  PRO A CB    1 
ATOM   50    C  CG    . PRO A 1  5   ? -4.507  -23.041 80.262 1.00 98.95  ? 43  PRO A CG    1 
ATOM   51    C  CD    . PRO A 1  5   ? -3.298  -22.307 80.751 1.00 100.46 ? 43  PRO A CD    1 
ATOM   52    N  N     . GLY A 1  6   ? -3.679  -20.877 76.340 1.00 85.88  ? 44  GLY A N     1 
ATOM   53    C  CA    . GLY A 1  6   ? -4.398  -19.972 75.469 1.00 83.35  ? 44  GLY A CA    1 
ATOM   54    C  C     . GLY A 1  6   ? -3.557  -18.816 74.970 1.00 84.03  ? 44  GLY A C     1 
ATOM   55    O  O     . GLY A 1  6   ? -3.800  -18.294 73.878 1.00 84.40  ? 44  GLY A O     1 
ATOM   56    N  N     . THR A 1  7   ? -2.560  -18.404 75.758 1.00 84.10  ? 45  THR A N     1 
ATOM   57    C  CA    A THR A 1  7   ? -1.749  -17.268 75.341 0.15 86.68  ? 45  THR A CA    1 
ATOM   58    C  CA    B THR A 1  7   ? -1.712  -17.278 75.378 0.85 86.55  ? 45  THR A CA    1 
ATOM   59    C  C     . THR A 1  7   ? -0.740  -17.651 74.266 1.00 83.97  ? 45  THR A C     1 
ATOM   60    O  O     . THR A 1  7   ? -0.396  -16.808 73.430 1.00 93.89  ? 45  THR A O     1 
ATOM   61    C  CB    A THR A 1  7   ? -1.038  -16.640 76.542 0.15 83.83  ? 45  THR A CB    1 
ATOM   62    C  CB    B THR A 1  7   ? -0.942  -16.773 76.600 0.85 83.54  ? 45  THR A CB    1 
ATOM   63    O  OG1   A THR A 1  7   ? -0.268  -15.512 76.107 0.15 90.23  ? 45  THR A OG1   1 
ATOM   64    O  OG1   B THR A 1  7   ? -1.835  -16.661 77.715 0.85 86.04  ? 45  THR A OG1   1 
ATOM   65    C  CG2   A THR A 1  7   ? -0.121  -17.638 77.207 0.15 89.99  ? 45  THR A CG2   1 
ATOM   66    C  CG2   B THR A 1  7   ? -0.320  -15.412 76.319 0.85 91.30  ? 45  THR A CG2   1 
ATOM   67    N  N     . VAL A 1  8   ? -0.274  -18.900 74.249 1.00 80.59  ? 46  VAL A N     1 
ATOM   68    C  CA    . VAL A 1  8   ? 0.630   -19.322 73.185 1.00 78.19  ? 46  VAL A CA    1 
ATOM   69    C  C     . VAL A 1  8   ? -0.148  -19.592 71.903 1.00 78.52  ? 46  VAL A C     1 
ATOM   70    O  O     . VAL A 1  8   ? 0.347   -19.324 70.802 1.00 80.48  ? 46  VAL A O     1 
ATOM   71    C  CB    . VAL A 1  8   ? 1.443   -20.554 73.622 1.00 74.16  ? 46  VAL A CB    1 
ATOM   72    C  CG1   . VAL A 1  8   ? 2.456   -20.934 72.552 1.00 75.59  ? 46  VAL A CG1   1 
ATOM   73    C  CG2   . VAL A 1  8   ? 2.136   -20.290 74.952 1.00 70.55  ? 46  VAL A CG2   1 
ATOM   74    N  N     . ALA A 1  9   ? -1.373  -20.109 72.020 1.00 75.57  ? 47  ALA A N     1 
ATOM   75    C  CA    . ALA A 1  9   ? -2.205  -20.330 70.842 1.00 73.38  ? 47  ALA A CA    1 
ATOM   76    C  C     . ALA A 1  9   ? -2.525  -19.014 70.144 1.00 77.94  ? 47  ALA A C     1 
ATOM   77    O  O     . ALA A 1  9   ? -2.376  -18.893 68.922 1.00 82.23  ? 47  ALA A O     1 
ATOM   78    C  CB    . ALA A 1  9   ? -3.489  -21.059 71.239 1.00 70.28  ? 47  ALA A CB    1 
ATOM   79    N  N     . LEU A 1  10  ? -2.969  -18.012 70.909 1.00 75.40  ? 48  LEU A N     1 
ATOM   80    C  CA    . LEU A 1  10  ? -3.228  -16.698 70.331 1.00 71.06  ? 48  LEU A CA    1 
ATOM   81    C  C     . LEU A 1  10  ? -1.953  -16.068 69.788 1.00 73.15  ? 48  LEU A C     1 
ATOM   82    O  O     . LEU A 1  10  ? -1.999  -15.308 68.816 1.00 69.78  ? 48  LEU A O     1 
ATOM   83    C  CB    . LEU A 1  10  ? -3.872  -15.785 71.375 1.00 70.69  ? 48  LEU A CB    1 
ATOM   84    C  CG    . LEU A 1  10  ? -5.272  -16.194 71.834 1.00 71.59  ? 48  LEU A CG    1 
ATOM   85    C  CD1   . LEU A 1  10  ? -5.652  -15.481 73.120 1.00 69.36  ? 48  LEU A CD1   1 
ATOM   86    C  CD2   . LEU A 1  10  ? -6.291  -15.907 70.741 1.00 73.93  ? 48  LEU A CD2   1 
ATOM   87    N  N     . ARG A 1  11  ? -0.809  -16.371 70.403 1.00 81.52  ? 49  ARG A N     1 
ATOM   88    C  CA    . ARG A 1  11  ? 0.466   -15.910 69.867 1.00 87.55  ? 49  ARG A CA    1 
ATOM   89    C  C     . ARG A 1  11  ? 0.760   -16.558 68.520 1.00 86.49  ? 49  ARG A C     1 
ATOM   90    O  O     . ARG A 1  11  ? 1.231   -15.891 67.592 1.00 84.43  ? 49  ARG A O     1 
ATOM   91    C  CB    . ARG A 1  11  ? 1.582   -16.209 70.867 1.00 95.64  ? 49  ARG A CB    1 
ATOM   92    C  CG    . ARG A 1  11  ? 2.973   -15.807 70.417 1.00 103.64 ? 49  ARG A CG    1 
ATOM   93    C  CD    . ARG A 1  11  ? 4.016   -16.448 71.315 1.00 114.39 ? 49  ARG A CD    1 
ATOM   94    N  NE    . ARG A 1  11  ? 3.769   -16.162 72.725 1.00 116.09 ? 49  ARG A NE    1 
ATOM   95    C  CZ    . ARG A 1  11  ? 4.252   -16.885 73.730 1.00 119.19 ? 49  ARG A CZ    1 
ATOM   96    N  NH1   . ARG A 1  11  ? 5.004   -17.949 73.482 1.00 122.14 ? 49  ARG A NH1   1 
ATOM   97    N  NH2   . ARG A 1  11  ? 3.976   -16.551 74.983 1.00 121.69 ? 49  ARG A NH2   1 
ATOM   98    N  N     . GLU A 1  12  ? 0.482   -17.859 68.395 1.00 87.62  ? 50  GLU A N     1 
ATOM   99    C  CA    . GLU A 1  12  ? 0.714   -18.551 67.130 1.00 85.17  ? 50  GLU A CA    1 
ATOM   100   C  C     . GLU A 1  12  ? -0.255  -18.079 66.054 1.00 75.93  ? 50  GLU A C     1 
ATOM   101   O  O     . GLU A 1  12  ? 0.112   -17.998 64.876 1.00 74.01  ? 50  GLU A O     1 
ATOM   102   C  CB    . GLU A 1  12  ? 0.603   -20.062 67.331 1.00 89.98  ? 50  GLU A CB    1 
ATOM   103   C  CG    . GLU A 1  12  ? 1.675   -20.645 68.237 1.00 97.62  ? 50  GLU A CG    1 
ATOM   104   C  CD    . GLU A 1  12  ? 1.435   -22.105 68.565 1.00 104.66 ? 50  GLU A CD    1 
ATOM   105   O  OE1   . GLU A 1  12  ? 0.654   -22.762 67.844 1.00 105.67 ? 50  GLU A OE1   1 
ATOM   106   O  OE2   . GLU A 1  12  ? 2.027   -22.596 69.550 1.00 112.37 ? 50  GLU A OE2   1 
ATOM   107   N  N     . ILE A 1  13  ? -1.498  -17.772 66.435 1.00 69.28  ? 51  ILE A N     1 
ATOM   108   C  CA    . ILE A 1  13  ? -2.459  -17.235 65.474 1.00 63.90  ? 51  ILE A CA    1 
ATOM   109   C  C     . ILE A 1  13  ? -1.919  -15.953 64.855 1.00 67.55  ? 51  ILE A C     1 
ATOM   110   O  O     . ILE A 1  13  ? -1.964  -15.764 63.634 1.00 73.01  ? 51  ILE A O     1 
ATOM   111   C  CB    . ILE A 1  13  ? -3.824  -17.001 66.144 1.00 59.35  ? 51  ILE A CB    1 
ATOM   112   C  CG1   . ILE A 1  13  ? -4.474  -18.329 66.526 1.00 58.72  ? 51  ILE A CG1   1 
ATOM   113   C  CG2   . ILE A 1  13  ? -4.741  -16.212 65.224 1.00 58.27  ? 51  ILE A CG2   1 
ATOM   114   C  CD1   . ILE A 1  13  ? -5.880  -18.179 67.065 1.00 54.76  ? 51  ILE A CD1   1 
ATOM   115   N  N     . ARG A 1  14  ? -1.390  -15.057 65.689 1.00 66.79  ? 52  ARG A N     1 
ATOM   116   C  CA    . ARG A 1  14  ? -0.815  -13.823 65.169 1.00 69.21  ? 52  ARG A CA    1 
ATOM   117   C  C     . ARG A 1  14  ? 0.451   -14.089 64.365 1.00 68.17  ? 52  ARG A C     1 
ATOM   118   O  O     . ARG A 1  14  ? 0.727   -13.373 63.396 1.00 69.28  ? 52  ARG A O     1 
ATOM   119   C  CB    . ARG A 1  14  ? -0.520  -12.853 66.314 1.00 73.00  ? 52  ARG A CB    1 
ATOM   120   C  CG    . ARG A 1  14  ? -1.732  -12.512 67.164 1.00 73.59  ? 52  ARG A CG    1 
ATOM   121   C  CD    . ARG A 1  14  ? -1.370  -11.533 68.268 1.00 77.81  ? 52  ARG A CD    1 
ATOM   122   N  NE    . ARG A 1  14  ? -2.479  -11.321 69.194 1.00 85.90  ? 52  ARG A NE    1 
ATOM   123   C  CZ    . ARG A 1  14  ? -2.595  -11.925 70.373 1.00 90.10  ? 52  ARG A CZ    1 
ATOM   124   N  NH1   . ARG A 1  14  ? -1.665  -12.779 70.777 1.00 92.54  ? 52  ARG A NH1   1 
ATOM   125   N  NH2   . ARG A 1  14  ? -3.639  -11.672 71.150 1.00 90.15  ? 52  ARG A NH2   1 
ATOM   126   N  N     . ARG A 1  15  ? 1.223   -15.110 64.741 1.00 65.87  ? 53  ARG A N     1 
ATOM   127   C  CA    . ARG A 1  15  ? 2.475   -15.385 64.043 1.00 66.36  ? 53  ARG A CA    1 
ATOM   128   C  C     . ARG A 1  15  ? 2.222   -15.860 62.617 1.00 69.48  ? 53  ARG A C     1 
ATOM   129   O  O     . ARG A 1  15  ? 2.818   -15.343 61.665 1.00 75.26  ? 53  ARG A O     1 
ATOM   130   C  CB    . ARG A 1  15  ? 3.293   -16.418 64.817 1.00 68.35  ? 53  ARG A CB    1 
ATOM   131   C  CG    . ARG A 1  15  ? 4.491   -16.955 64.050 1.00 77.26  ? 53  ARG A CG    1 
ATOM   132   C  CD    . ARG A 1  15  ? 5.185   -18.063 64.826 1.00 88.73  ? 53  ARG A CD    1 
ATOM   133   N  NE    . ARG A 1  15  ? 6.208   -18.738 64.033 1.00 93.58  ? 53  ARG A NE    1 
ATOM   134   C  CZ    . ARG A 1  15  ? 6.950   -19.747 64.478 1.00 95.25  ? 53  ARG A CZ    1 
ATOM   135   N  NH1   . ARG A 1  15  ? 6.784   -20.199 65.713 1.00 93.88  ? 53  ARG A NH1   1 
ATOM   136   N  NH2   . ARG A 1  15  ? 7.858   -20.304 63.689 1.00 97.75  ? 53  ARG A NH2   1 
ATOM   137   N  N     . TYR A 1  16  ? 1.337   -16.843 62.446 1.00 64.80  ? 54  TYR A N     1 
ATOM   138   C  CA    . TYR A 1  16  ? 1.116   -17.426 61.129 1.00 62.78  ? 54  TYR A CA    1 
ATOM   139   C  C     . TYR A 1  16  ? 0.158   -16.616 60.263 1.00 62.24  ? 54  TYR A C     1 
ATOM   140   O  O     . TYR A 1  16  ? 0.104   -16.848 59.051 1.00 62.48  ? 54  TYR A O     1 
ATOM   141   C  CB    . TYR A 1  16  ? 0.612   -18.865 61.272 1.00 63.04  ? 54  TYR A CB    1 
ATOM   142   C  CG    . TYR A 1  16  ? 1.620   -19.776 61.936 1.00 62.28  ? 54  TYR A CG    1 
ATOM   143   C  CD1   . TYR A 1  16  ? 2.778   -20.161 61.272 1.00 61.07  ? 54  TYR A CD1   1 
ATOM   144   C  CD2   . TYR A 1  16  ? 1.421   -20.243 63.229 1.00 61.29  ? 54  TYR A CD2   1 
ATOM   145   C  CE1   . TYR A 1  16  ? 3.708   -20.986 61.876 1.00 63.44  ? 54  TYR A CE1   1 
ATOM   146   C  CE2   . TYR A 1  16  ? 2.345   -21.069 63.841 1.00 61.82  ? 54  TYR A CE2   1 
ATOM   147   C  CZ    . TYR A 1  16  ? 3.487   -21.438 63.160 1.00 65.54  ? 54  TYR A CZ    1 
ATOM   148   O  OH    . TYR A 1  16  ? 4.410   -22.263 63.764 1.00 71.53  ? 54  TYR A OH    1 
ATOM   149   N  N     . GLN A 1  17  ? -0.589  -15.673 60.840 1.00 65.01  ? 55  GLN A N     1 
ATOM   150   C  CA    . GLN A 1  17  ? -1.423  -14.795 60.028 1.00 64.15  ? 55  GLN A CA    1 
ATOM   151   C  C     . GLN A 1  17  ? -0.641  -13.630 59.433 1.00 60.08  ? 55  GLN A C     1 
ATOM   152   O  O     . GLN A 1  17  ? -1.098  -13.033 58.452 1.00 54.88  ? 55  GLN A O     1 
ATOM   153   C  CB    . GLN A 1  17  ? -2.599  -14.264 60.851 1.00 61.21  ? 55  GLN A CB    1 
ATOM   154   C  CG    . GLN A 1  17  ? -3.719  -15.276 61.040 1.00 57.90  ? 55  GLN A CG    1 
ATOM   155   C  CD    . GLN A 1  17  ? -4.915  -14.699 61.773 1.00 57.68  ? 55  GLN A CD    1 
ATOM   156   O  OE1   . GLN A 1  17  ? -4.845  -13.609 62.340 1.00 64.09  ? 55  GLN A OE1   1 
ATOM   157   N  NE2   . GLN A 1  17  ? -6.022  -15.429 61.763 1.00 52.83  ? 55  GLN A NE2   1 
ATOM   158   N  N     . LYS A 1  18  ? 0.520   -13.295 60.000 1.00 59.59  ? 56  LYS A N     1 
ATOM   159   C  CA    . LYS A 1  18  ? 1.381   -12.276 59.416 1.00 62.46  ? 56  LYS A CA    1 
ATOM   160   C  C     . LYS A 1  18  ? 2.277   -12.826 58.316 1.00 67.85  ? 56  LYS A C     1 
ATOM   161   O  O     . LYS A 1  18  ? 2.789   -12.047 57.505 1.00 71.36  ? 56  LYS A O     1 
ATOM   162   C  CB    . LYS A 1  18  ? 2.258   -11.634 60.494 1.00 68.95  ? 56  LYS A CB    1 
ATOM   163   C  CG    . LYS A 1  18  ? 1.505   -10.823 61.533 1.00 74.53  ? 56  LYS A CG    1 
ATOM   164   C  CD    . LYS A 1  18  ? 2.461   -10.294 62.591 1.00 84.86  ? 56  LYS A CD    1 
ATOM   165   C  CE    . LYS A 1  18  ? 1.726   -9.543  63.689 1.00 91.33  ? 56  LYS A CE    1 
ATOM   166   N  NZ    . LYS A 1  18  ? 2.657   -9.078  64.755 1.00 96.25  ? 56  LYS A NZ    1 
ATOM   167   N  N     . SER A 1  19  ? 2.477   -14.139 58.269 1.00 73.25  ? 57  SER A N     1 
ATOM   168   C  CA    . SER A 1  19  ? 3.396   -14.770 57.335 1.00 74.46  ? 57  SER A CA    1 
ATOM   169   C  C     . SER A 1  19  ? 2.628   -15.479 56.225 1.00 74.58  ? 57  SER A C     1 
ATOM   170   O  O     . SER A 1  19  ? 1.415   -15.693 56.306 1.00 68.73  ? 57  SER A O     1 
ATOM   171   C  CB    . SER A 1  19  ? 4.314   -15.756 58.066 1.00 73.67  ? 57  SER A CB    1 
ATOM   172   O  OG    . SER A 1  19  ? 3.565   -16.799 58.664 1.00 74.27  ? 57  SER A OG    1 
ATOM   173   N  N     . THR A 1  20  ? 3.364   -15.845 55.175 1.00 77.66  ? 58  THR A N     1 
ATOM   174   C  CA    . THR A 1  20  ? 2.788   -16.494 54.006 1.00 74.34  ? 58  THR A CA    1 
ATOM   175   C  C     . THR A 1  20  ? 3.442   -17.825 53.666 1.00 72.21  ? 58  THR A C     1 
ATOM   176   O  O     . THR A 1  20  ? 3.046   -18.452 52.676 1.00 72.21  ? 58  THR A O     1 
ATOM   177   C  CB    . THR A 1  20  ? 2.879   -15.574 52.781 1.00 72.97  ? 58  THR A CB    1 
ATOM   178   O  OG1   . THR A 1  20  ? 4.253   -15.268 52.513 1.00 71.13  ? 58  THR A OG1   1 
ATOM   179   C  CG2   . THR A 1  20  ? 2.117   -14.284 53.023 1.00 73.59  ? 58  THR A CG2   1 
ATOM   180   N  N     . GLU A 1  21  ? 4.429   -18.271 54.439 1.00 70.52  ? 59  GLU A N     1 
ATOM   181   C  CA    . GLU A 1  21  ? 5.122   -19.505 54.102 1.00 69.08  ? 59  GLU A CA    1 
ATOM   182   C  C     . GLU A 1  21  ? 4.193   -20.702 54.263 1.00 67.95  ? 59  GLU A C     1 
ATOM   183   O  O     . GLU A 1  21  ? 3.224   -20.671 55.027 1.00 67.56  ? 59  GLU A O     1 
ATOM   184   C  CB    . GLU A 1  21  ? 6.366   -19.688 54.974 1.00 73.69  ? 59  GLU A CB    1 
ATOM   185   C  CG    . GLU A 1  21  ? 6.090   -20.218 56.373 1.00 84.35  ? 59  GLU A CG    1 
ATOM   186   C  CD    . GLU A 1  21  ? 5.880   -19.114 57.385 1.00 97.40  ? 59  GLU A CD    1 
ATOM   187   O  OE1   . GLU A 1  21  ? 6.315   -17.975 57.118 1.00 105.28 ? 59  GLU A OE1   1 
ATOM   188   O  OE2   . GLU A 1  21  ? 5.284   -19.386 58.448 1.00 100.69 ? 59  GLU A OE2   1 
ATOM   189   N  N     . LEU A 1  22  ? 4.494   -21.762 53.520 1.00 63.64  ? 60  LEU A N     1 
ATOM   190   C  CA    . LEU A 1  22  ? 3.720   -22.988 53.630 1.00 60.40  ? 60  LEU A CA    1 
ATOM   191   C  C     . LEU A 1  22  ? 3.921   -23.613 55.005 1.00 57.57  ? 60  LEU A C     1 
ATOM   192   O  O     . LEU A 1  22  ? 5.010   -23.548 55.585 1.00 54.49  ? 60  LEU A O     1 
ATOM   193   C  CB    . LEU A 1  22  ? 4.119   -23.969 52.530 1.00 61.53  ? 60  LEU A CB    1 
ATOM   194   C  CG    . LEU A 1  22  ? 3.819   -23.485 51.109 1.00 56.11  ? 60  LEU A CG    1 
ATOM   195   C  CD1   . LEU A 1  22  ? 4.267   -24.509 50.080 1.00 56.06  ? 60  LEU A CD1   1 
ATOM   196   C  CD2   . LEU A 1  22  ? 2.338   -23.175 50.947 1.00 50.79  ? 60  LEU A CD2   1 
ATOM   197   N  N     . LEU A 1  23  ? 2.855   -24.213 55.529 1.00 59.11  ? 61  LEU A N     1 
ATOM   198   C  CA    . LEU A 1  23  ? 2.858   -24.771 56.873 1.00 65.37  ? 61  LEU A CA    1 
ATOM   199   C  C     . LEU A 1  23  ? 3.022   -26.286 56.892 1.00 63.57  ? 61  LEU A C     1 
ATOM   200   O  O     . LEU A 1  23  ? 3.332   -26.845 57.950 1.00 63.25  ? 61  LEU A O     1 
ATOM   201   C  CB    . LEU A 1  23  ? 1.564   -24.375 57.597 1.00 65.76  ? 61  LEU A CB    1 
ATOM   202   C  CG    . LEU A 1  23  ? 1.298   -22.868 57.565 1.00 56.33  ? 61  LEU A CG    1 
ATOM   203   C  CD1   . LEU A 1  23  ? -0.048  -22.520 58.180 1.00 55.43  ? 61  LEU A CD1   1 
ATOM   204   C  CD2   . LEU A 1  23  ? 2.419   -22.118 58.265 1.00 54.32  ? 61  LEU A CD2   1 
ATOM   205   N  N     . ILE A 1  24  ? 2.822   -26.956 55.762 1.00 61.13  ? 62  ILE A N     1 
ATOM   206   C  CA    . ILE A 1  24  ? 3.080   -28.385 55.636 1.00 64.54  ? 62  ILE A CA    1 
ATOM   207   C  C     . ILE A 1  24  ? 4.494   -28.573 55.106 1.00 72.05  ? 62  ILE A C     1 
ATOM   208   O  O     . ILE A 1  24  ? 4.943   -27.832 54.223 1.00 74.55  ? 62  ILE A O     1 
ATOM   209   C  CB    . ILE A 1  24  ? 2.043   -29.050 54.711 1.00 57.81  ? 62  ILE A CB    1 
ATOM   210   C  CG1   . ILE A 1  24  ? 0.628   -28.847 55.254 1.00 59.38  ? 62  ILE A CG1   1 
ATOM   211   C  CG2   . ILE A 1  24  ? 2.337   -30.533 54.545 1.00 54.63  ? 62  ILE A CG2   1 
ATOM   212   C  CD1   . ILE A 1  24  ? -0.456  -29.428 54.369 1.00 43.49  ? 62  ILE A CD1   1 
ATOM   213   N  N     . ARG A 1  25  ? 5.205   -29.557 55.649 1.00 70.86  ? 63  ARG A N     1 
ATOM   214   C  CA    . ARG A 1  25  ? 6.559   -29.833 55.190 1.00 68.34  ? 63  ARG A CA    1 
ATOM   215   C  C     . ARG A 1  25  ? 6.537   -30.339 53.752 1.00 67.43  ? 63  ARG A C     1 
ATOM   216   O  O     . ARG A 1  25  ? 5.611   -31.041 53.336 1.00 59.66  ? 63  ARG A O     1 
ATOM   217   C  CB    . ARG A 1  25  ? 7.239   -30.844 56.112 1.00 71.09  ? 63  ARG A CB    1 
ATOM   218   C  CG    . ARG A 1  25  ? 7.642   -30.255 57.453 1.00 74.58  ? 63  ARG A CG    1 
ATOM   219   C  CD    . ARG A 1  25  ? 8.523   -29.033 57.249 1.00 88.97  ? 63  ARG A CD    1 
ATOM   220   N  NE    . ARG A 1  25  ? 8.205   -27.958 58.185 1.00 99.51  ? 63  ARG A NE    1 
ATOM   221   C  CZ    . ARG A 1  25  ? 8.643   -26.708 58.063 1.00 103.42 ? 63  ARG A CZ    1 
ATOM   222   N  NH1   . ARG A 1  25  ? 8.304   -25.793 58.962 1.00 105.56 ? 63  ARG A NH1   1 
ATOM   223   N  NH2   . ARG A 1  25  ? 9.416   -26.371 57.040 1.00 102.67 ? 63  ARG A NH2   1 
ATOM   224   N  N     . LYS A 1  26  ? 7.570   -29.969 52.991 1.00 76.22  ? 64  LYS A N     1 
ATOM   225   C  CA    . LYS A 1  26  ? 7.553   -30.190 51.547 1.00 79.98  ? 64  LYS A CA    1 
ATOM   226   C  C     . LYS A 1  26  ? 7.605   -31.675 51.207 1.00 72.99  ? 64  LYS A C     1 
ATOM   227   O  O     . LYS A 1  26  ? 6.761   -32.178 50.456 1.00 70.63  ? 64  LYS A O     1 
ATOM   228   C  CB    . LYS A 1  26  ? 8.719   -29.448 50.891 1.00 88.47  ? 64  LYS A CB    1 
ATOM   229   C  CG    . LYS A 1  26  ? 8.766   -27.960 51.197 1.00 97.99  ? 64  LYS A CG    1 
ATOM   230   C  CD    . LYS A 1  26  ? 7.521   -27.246 50.700 1.00 105.15 ? 64  LYS A CD    1 
ATOM   231   C  CE    . LYS A 1  26  ? 7.640   -25.742 50.894 1.00 110.08 ? 64  LYS A CE    1 
ATOM   232   N  NZ    . LYS A 1  26  ? 7.897   -25.382 52.316 1.00 109.50 ? 64  LYS A NZ    1 
ATOM   233   N  N     . LEU A 1  27  ? 8.593   -32.391 51.744 1.00 76.52  ? 65  LEU A N     1 
ATOM   234   C  CA    . LEU A 1  27  ? 8.770   -33.799 51.391 1.00 82.44  ? 65  LEU A CA    1 
ATOM   235   C  C     . LEU A 1  27  ? 7.595   -34.677 51.805 1.00 76.34  ? 65  LEU A C     1 
ATOM   236   O  O     . LEU A 1  27  ? 7.169   -35.514 50.989 1.00 77.07  ? 65  LEU A O     1 
ATOM   237   C  CB    . LEU A 1  27  ? 10.088  -34.316 51.979 1.00 94.17  ? 65  LEU A CB    1 
ATOM   238   C  CG    . LEU A 1  27  ? 11.365  -33.817 51.302 1.00 102.27 ? 65  LEU A CG    1 
ATOM   239   C  CD1   . LEU A 1  27  ? 12.591  -34.445 51.945 1.00 108.71 ? 65  LEU A CD1   1 
ATOM   240   C  CD2   . LEU A 1  27  ? 11.325  -34.115 49.812 1.00 105.02 ? 65  LEU A CD2   1 
ATOM   241   N  N     . PRO A 1  28  ? 7.039   -34.574 53.022 1.00 69.32  ? 66  PRO A N     1 
ATOM   242   C  CA    . PRO A 1  28  ? 5.848   -35.387 53.330 1.00 69.24  ? 66  PRO A CA    1 
ATOM   243   C  C     . PRO A 1  28  ? 4.688   -35.131 52.386 1.00 68.36  ? 66  PRO A C     1 
ATOM   244   O  O     . PRO A 1  28  ? 4.016   -36.080 51.961 1.00 74.45  ? 66  PRO A O     1 
ATOM   245   C  CB    . PRO A 1  28  ? 5.509   -34.977 54.769 1.00 69.33  ? 66  PRO A CB    1 
ATOM   246   C  CG    . PRO A 1  28  ? 6.789   -34.516 55.338 1.00 71.11  ? 66  PRO A CG    1 
ATOM   247   C  CD    . PRO A 1  28  ? 7.513   -33.844 54.212 1.00 69.83  ? 66  PRO A CD    1 
ATOM   248   N  N     . PHE A 1  29  ? 4.437   -33.866 52.041 1.00 61.22  ? 67  PHE A N     1 
ATOM   249   C  CA    . PHE A 1  29  ? 3.339   -33.551 51.135 1.00 56.22  ? 67  PHE A CA    1 
ATOM   250   C  C     . PHE A 1  29  ? 3.605   -34.092 49.735 1.00 54.52  ? 67  PHE A C     1 
ATOM   251   O  O     . PHE A 1  29  ? 2.677   -34.533 49.047 1.00 53.45  ? 67  PHE A O     1 
ATOM   252   C  CB    . PHE A 1  29  ? 3.110   -32.039 51.092 1.00 54.97  ? 67  PHE A CB    1 
ATOM   253   C  CG    . PHE A 1  29  ? 1.922   -31.632 50.269 1.00 50.57  ? 67  PHE A CG    1 
ATOM   254   C  CD1   . PHE A 1  29  ? 0.662   -31.561 50.842 1.00 48.45  ? 67  PHE A CD1   1 
ATOM   255   C  CD2   . PHE A 1  29  ? 2.062   -31.326 48.925 1.00 45.96  ? 67  PHE A CD2   1 
ATOM   256   C  CE1   . PHE A 1  29  ? -0.437  -31.194 50.091 1.00 45.86  ? 67  PHE A CE1   1 
ATOM   257   C  CE2   . PHE A 1  29  ? 0.968   -30.960 48.168 1.00 42.87  ? 67  PHE A CE2   1 
ATOM   258   C  CZ    . PHE A 1  29  ? -0.285  -30.894 48.752 1.00 45.48  ? 67  PHE A CZ    1 
ATOM   259   N  N     . GLN A 1  30  ? 4.867   -34.066 49.298 1.00 49.79  ? 68  GLN A N     1 
ATOM   260   C  CA    . GLN A 1  30  ? 5.190   -34.534 47.954 1.00 54.99  ? 68  GLN A CA    1 
ATOM   261   C  C     . GLN A 1  30  ? 4.999   -36.042 47.831 1.00 67.72  ? 68  GLN A C     1 
ATOM   262   O  O     . GLN A 1  30  ? 4.520   -36.528 46.799 1.00 74.04  ? 68  GLN A O     1 
ATOM   263   C  CB    . GLN A 1  30  ? 6.621   -34.138 47.591 1.00 55.51  ? 68  GLN A CB    1 
ATOM   264   C  CG    . GLN A 1  30  ? 7.020   -34.505 46.173 1.00 68.35  ? 68  GLN A CG    1 
ATOM   265   C  CD    . GLN A 1  30  ? 8.413   -34.027 45.816 1.00 80.95  ? 68  GLN A CD    1 
ATOM   266   O  OE1   . GLN A 1  30  ? 9.149   -34.705 45.099 1.00 85.21  ? 68  GLN A OE1   1 
ATOM   267   N  NE2   . GLN A 1  30  ? 8.780   -32.849 46.310 1.00 89.53  ? 68  GLN A NE2   1 
ATOM   268   N  N     . ARG A 1  31  ? 5.365   -36.798 48.870 1.00 65.58  ? 69  ARG A N     1 
ATOM   269   C  CA    . ARG A 1  31  ? 5.136   -38.239 48.841 1.00 64.26  ? 69  ARG A CA    1 
ATOM   270   C  C     . ARG A 1  31  ? 3.646   -38.557 48.831 1.00 62.25  ? 69  ARG A C     1 
ATOM   271   O  O     . ARG A 1  31  ? 3.208   -39.493 48.151 1.00 61.97  ? 69  ARG A O     1 
ATOM   272   C  CB    . ARG A 1  31  ? 5.816   -38.913 50.035 1.00 64.79  ? 69  ARG A CB    1 
ATOM   273   C  CG    . ARG A 1  31  ? 7.333   -38.789 50.062 1.00 62.80  ? 69  ARG A CG    1 
ATOM   274   C  CD    . ARG A 1  31  ? 7.942   -39.722 51.101 1.00 58.23  ? 69  ARG A CD    1 
ATOM   275   N  NE    . ARG A 1  31  ? 7.426   -39.467 52.443 1.00 57.91  ? 69  ARG A NE    1 
ATOM   276   C  CZ    . ARG A 1  31  ? 8.082   -38.789 53.380 1.00 62.03  ? 69  ARG A CZ    1 
ATOM   277   N  NH1   . ARG A 1  31  ? 9.289   -38.300 53.127 1.00 59.48  ? 69  ARG A NH1   1 
ATOM   278   N  NH2   . ARG A 1  31  ? 7.532   -38.605 54.574 1.00 58.32  ? 69  ARG A NH2   1 
ATOM   279   N  N     . LEU A 1  32  ? 2.851   -37.789 49.579 1.00 62.74  ? 70  LEU A N     1 
ATOM   280   C  CA    . LEU A 1  32  ? 1.409   -38.009 49.585 1.00 63.61  ? 70  LEU A CA    1 
ATOM   281   C  C     . LEU A 1  32  ? 0.812   -37.781 48.203 1.00 66.92  ? 70  LEU A C     1 
ATOM   282   O  O     . LEU A 1  32  ? -0.076  -38.526 47.770 1.00 71.36  ? 70  LEU A O     1 
ATOM   283   C  CB    . LEU A 1  32  ? 0.741   -37.096 50.612 1.00 57.85  ? 70  LEU A CB    1 
ATOM   284   C  CG    . LEU A 1  32  ? -0.780  -37.212 50.688 1.00 56.70  ? 70  LEU A CG    1 
ATOM   285   C  CD1   . LEU A 1  32  ? -1.185  -38.612 51.138 1.00 66.36  ? 70  LEU A CD1   1 
ATOM   286   C  CD2   . LEU A 1  32  ? -1.345  -36.160 51.613 1.00 51.84  ? 70  LEU A CD2   1 
ATOM   287   N  N     . VAL A 1  33  ? 1.286   -36.754 47.493 1.00 64.66  ? 71  VAL A N     1 
ATOM   288   C  CA    . VAL A 1  33  ? 0.789   -36.494 46.146 1.00 61.74  ? 71  VAL A CA    1 
ATOM   289   C  C     . VAL A 1  33  ? 1.164   -37.635 45.208 1.00 61.41  ? 71  VAL A C     1 
ATOM   290   O  O     . VAL A 1  33  ? 0.333   -38.111 44.425 1.00 46.45  ? 71  VAL A O     1 
ATOM   291   C  CB    . VAL A 1  33  ? 1.316   -35.142 45.632 1.00 57.45  ? 71  VAL A CB    1 
ATOM   292   C  CG1   . VAL A 1  33  ? 1.039   -34.997 44.146 1.00 44.44  ? 71  VAL A CG1   1 
ATOM   293   C  CG2   . VAL A 1  33  ? 0.683   -34.004 46.405 1.00 53.29  ? 71  VAL A CG2   1 
ATOM   294   N  N     . ARG A 1  34  ? 2.415   -38.096 45.274 1.00 62.04  ? 72  ARG A N     1 
ATOM   295   C  CA    . ARG A 1  34  ? 2.839   -39.192 44.409 1.00 63.28  ? 72  ARG A CA    1 
ATOM   296   C  C     . ARG A 1  34  ? 2.080   -40.474 44.729 1.00 60.21  ? 72  ARG A C     1 
ATOM   297   O  O     . ARG A 1  34  ? 1.745   -41.246 43.824 1.00 59.55  ? 72  ARG A O     1 
ATOM   298   C  CB    . ARG A 1  34  ? 4.347   -39.413 44.533 1.00 69.44  ? 72  ARG A CB    1 
ATOM   299   C  CG    . ARG A 1  34  ? 5.187   -38.217 44.108 1.00 76.64  ? 72  ARG A CG    1 
ATOM   300   C  CD    . ARG A 1  34  ? 6.671   -38.546 44.127 1.00 85.00  ? 72  ARG A CD    1 
ATOM   301   N  NE    . ARG A 1  34  ? 7.497   -37.367 43.883 1.00 88.94  ? 72  ARG A NE    1 
ATOM   302   C  CZ    . ARG A 1  34  ? 7.861   -36.943 42.677 1.00 91.61  ? 72  ARG A CZ    1 
ATOM   303   N  NH1   . ARG A 1  34  ? 7.470   -37.602 41.594 1.00 94.86  ? 72  ARG A NH1   1 
ATOM   304   N  NH2   . ARG A 1  34  ? 8.615   -35.859 42.552 1.00 90.85  ? 72  ARG A NH2   1 
ATOM   305   N  N     . GLU A 1  35  ? 1.789   -40.711 46.011 1.00 59.07  ? 73  GLU A N     1 
ATOM   306   C  CA    . GLU A 1  35  ? 1.050   -41.910 46.395 1.00 67.94  ? 73  GLU A CA    1 
ATOM   307   C  C     . GLU A 1  35  ? -0.370  -41.885 45.845 1.00 70.27  ? 73  GLU A C     1 
ATOM   308   O  O     . GLU A 1  35  ? -0.839  -42.870 45.263 1.00 80.30  ? 73  GLU A O     1 
ATOM   309   C  CB    . GLU A 1  35  ? 1.029   -42.054 47.917 1.00 74.64  ? 73  GLU A CB    1 
ATOM   310   C  CG    . GLU A 1  35  ? 0.069   -43.128 48.410 1.00 78.15  ? 73  GLU A CG    1 
ATOM   311   C  CD    . GLU A 1  35  ? 0.010   -43.219 49.922 1.00 82.41  ? 73  GLU A CD    1 
ATOM   312   O  OE1   . GLU A 1  35  ? 1.067   -43.074 50.570 1.00 86.23  ? 73  GLU A OE1   1 
ATOM   313   O  OE2   . GLU A 1  35  ? -1.097  -43.431 50.461 1.00 80.57  ? 73  GLU A OE2   1 
ATOM   314   N  N     . ILE A 1  36  ? -1.076  -40.767 46.031 1.00 64.53  ? 74  ILE A N     1 
ATOM   315   C  CA    . ILE A 1  36  ? -2.444  -40.657 45.531 1.00 64.47  ? 74  ILE A CA    1 
ATOM   316   C  C     . ILE A 1  36  ? -2.463  -40.736 44.010 1.00 67.58  ? 74  ILE A C     1 
ATOM   317   O  O     . ILE A 1  36  ? -3.310  -41.418 43.418 1.00 68.43  ? 74  ILE A O     1 
ATOM   318   C  CB    . ILE A 1  36  ? -3.091  -39.353 46.037 1.00 58.02  ? 74  ILE A CB    1 
ATOM   319   C  CG1   . ILE A 1  36  ? -3.193  -39.366 47.564 1.00 57.34  ? 74  ILE A CG1   1 
ATOM   320   C  CG2   . ILE A 1  36  ? -4.464  -39.155 45.412 1.00 53.75  ? 74  ILE A CG2   1 
ATOM   321   C  CD1   . ILE A 1  36  ? -3.704  -38.064 48.151 1.00 57.16  ? 74  ILE A CD1   1 
ATOM   322   N  N     . ALA A 1  37  ? -1.526  -40.047 43.355 1.00 67.75  ? 75  ALA A N     1 
ATOM   323   C  CA    . ALA A 1  37  ? -1.478  -40.061 41.897 1.00 67.61  ? 75  ALA A CA    1 
ATOM   324   C  C     . ALA A 1  37  ? -1.087  -41.429 41.357 1.00 68.17  ? 75  ALA A C     1 
ATOM   325   O  O     . ALA A 1  37  ? -1.522  -41.808 40.264 1.00 66.44  ? 75  ALA A O     1 
ATOM   326   C  CB    . ALA A 1  37  ? -0.504  -38.996 41.393 1.00 64.95  ? 75  ALA A CB    1 
ATOM   327   N  N     . GLN A 1  38  ? -0.270  -42.179 42.102 1.00 72.16  ? 76  GLN A N     1 
ATOM   328   C  CA    . GLN A 1  38  ? 0.131   -43.509 41.655 1.00 71.73  ? 76  GLN A CA    1 
ATOM   329   C  C     . GLN A 1  38  ? -1.063  -44.450 41.567 1.00 74.23  ? 76  GLN A C     1 
ATOM   330   O  O     . GLN A 1  38  ? -1.093  -45.336 40.705 1.00 79.72  ? 76  GLN A O     1 
ATOM   331   C  CB    . GLN A 1  38  ? 1.192   -44.074 42.598 1.00 71.05  ? 76  GLN A CB    1 
ATOM   332   C  CG    . GLN A 1  38  ? 1.978   -45.248 42.050 1.00 77.10  ? 76  GLN A CG    1 
ATOM   333   C  CD    . GLN A 1  38  ? 3.126   -45.639 42.960 1.00 85.47  ? 76  GLN A CD    1 
ATOM   334   O  OE1   . GLN A 1  38  ? 3.403   -44.964 43.952 1.00 87.03  ? 76  GLN A OE1   1 
ATOM   335   N  NE2   . GLN A 1  38  ? 3.800   -46.735 42.628 1.00 91.50  ? 76  GLN A NE2   1 
ATOM   336   N  N     . ASP A 1  39  ? -2.058  -44.270 42.440 1.00 73.58  ? 77  ASP A N     1 
ATOM   337   C  CA    . ASP A 1  39  ? -3.254  -45.101 42.393 1.00 73.79  ? 77  ASP A CA    1 
ATOM   338   C  C     . ASP A 1  39  ? -4.148  -44.768 41.204 1.00 78.71  ? 77  ASP A C     1 
ATOM   339   O  O     . ASP A 1  39  ? -4.976  -45.601 40.818 1.00 87.17  ? 77  ASP A O     1 
ATOM   340   C  CB    . ASP A 1  39  ? -4.043  -44.963 43.696 1.00 72.99  ? 77  ASP A CB    1 
ATOM   341   C  CG    . ASP A 1  39  ? -3.283  -45.496 44.897 1.00 81.78  ? 77  ASP A CG    1 
ATOM   342   O  OD1   . ASP A 1  39  ? -2.485  -46.441 44.726 1.00 86.55  ? 77  ASP A OD1   1 
ATOM   343   O  OD2   . ASP A 1  39  ? -3.486  -44.973 46.013 1.00 85.61  ? 77  ASP A OD2   1 
ATOM   344   N  N     . PHE A 1  40  ? -4.005  -43.578 40.618 1.00 78.51  ? 78  PHE A N     1 
ATOM   345   C  CA    . PHE A 1  40  ? -4.775  -43.245 39.423 1.00 73.69  ? 78  PHE A CA    1 
ATOM   346   C  C     . PHE A 1  40  ? -4.093  -43.763 38.162 1.00 69.98  ? 78  PHE A C     1 
ATOM   347   O  O     . PHE A 1  40  ? -4.744  -44.351 37.292 1.00 68.68  ? 78  PHE A O     1 
ATOM   348   C  CB    . PHE A 1  40  ? -4.990  -41.732 39.332 1.00 69.33  ? 78  PHE A CB    1 
ATOM   349   C  CG    . PHE A 1  40  ? -6.048  -41.212 40.261 1.00 72.06  ? 78  PHE A CG    1 
ATOM   350   C  CD1   . PHE A 1  40  ? -7.371  -41.594 40.105 1.00 74.33  ? 78  PHE A CD1   1 
ATOM   351   C  CD2   . PHE A 1  40  ? -5.724  -40.333 41.283 1.00 72.54  ? 78  PHE A CD2   1 
ATOM   352   C  CE1   . PHE A 1  40  ? -8.351  -41.117 40.958 1.00 75.17  ? 78  PHE A CE1   1 
ATOM   353   C  CE2   . PHE A 1  40  ? -6.699  -39.850 42.137 1.00 69.25  ? 78  PHE A CE2   1 
ATOM   354   C  CZ    . PHE A 1  40  ? -8.013  -40.241 41.975 1.00 71.65  ? 78  PHE A CZ    1 
ATOM   355   N  N     . LYS A 1  41  ? -2.784  -43.549 38.045 1.00 68.00  ? 79  LYS A N     1 
ATOM   356   C  CA    . LYS A 1  41  ? -2.018  -44.065 36.919 1.00 72.25  ? 79  LYS A CA    1 
ATOM   357   C  C     . LYS A 1  41  ? -0.567  -44.222 37.342 1.00 78.01  ? 79  LYS A C     1 
ATOM   358   O  O     . LYS A 1  41  ? 0.006   -43.312 37.949 1.00 81.08  ? 79  LYS A O     1 
ATOM   359   C  CB    . LYS A 1  41  ? -2.119  -43.142 35.698 1.00 73.98  ? 79  LYS A CB    1 
ATOM   360   C  CG    . LYS A 1  41  ? -1.377  -43.673 34.477 1.00 85.38  ? 79  LYS A CG    1 
ATOM   361   C  CD    . LYS A 1  41  ? -1.571  -42.791 33.253 1.00 91.78  ? 79  LYS A CD    1 
ATOM   362   C  CE    . LYS A 1  41  ? -0.922  -43.417 32.024 1.00 96.95  ? 79  LYS A CE    1 
ATOM   363   N  NZ    . LYS A 1  41  ? -1.114  -42.595 30.797 1.00 98.10  ? 79  LYS A NZ    1 
ATOM   364   N  N     . THR A 1  42  ? 0.017   -45.375 37.026 1.00 80.13  ? 80  THR A N     1 
ATOM   365   C  CA    . THR A 1  42  ? 1.410   -45.633 37.344 1.00 81.82  ? 80  THR A CA    1 
ATOM   366   C  C     . THR A 1  42  ? 2.324   -44.916 36.351 1.00 82.79  ? 80  THR A C     1 
ATOM   367   O  O     . THR A 1  42  ? 1.888   -44.413 35.312 1.00 80.19  ? 80  THR A O     1 
ATOM   368   C  CB    . THR A 1  42  ? 1.695   -47.137 37.340 1.00 83.93  ? 80  THR A CB    1 
ATOM   369   O  OG1   . THR A 1  42  ? 1.468   -47.669 36.028 1.00 78.42  ? 80  THR A OG1   1 
ATOM   370   C  CG2   . THR A 1  42  ? 0.791   -47.856 38.335 1.00 83.23  ? 80  THR A CG2   1 
ATOM   371   N  N     . ASP A 1  43  ? 3.614   -44.871 36.694 1.00 91.71  ? 81  ASP A N     1 
ATOM   372   C  CA    . ASP A 1  43  ? 4.647   -44.277 35.842 1.00 105.05 ? 81  ASP A CA    1 
ATOM   373   C  C     . ASP A 1  43  ? 4.350   -42.806 35.550 1.00 99.34  ? 81  ASP A C     1 
ATOM   374   O  O     . ASP A 1  43  ? 4.356   -42.362 34.399 1.00 100.02 ? 81  ASP A O     1 
ATOM   375   C  CB    . ASP A 1  43  ? 4.811   -45.072 34.543 1.00 122.92 ? 81  ASP A CB    1 
ATOM   376   C  CG    . ASP A 1  43  ? 5.123   -46.535 34.789 1.00 137.14 ? 81  ASP A CG    1 
ATOM   377   O  OD1   . ASP A 1  43  ? 4.696   -47.068 35.836 1.00 144.36 ? 81  ASP A OD1   1 
ATOM   378   O  OD2   . ASP A 1  43  ? 5.793   -47.152 33.935 1.00 140.26 ? 81  ASP A OD2   1 
ATOM   379   N  N     . LEU A 1  44  ? 4.090   -42.046 36.609 1.00 93.57  ? 82  LEU A N     1 
ATOM   380   C  CA    . LEU A 1  44  ? 3.814   -40.622 36.506 1.00 80.40  ? 82  LEU A CA    1 
ATOM   381   C  C     . LEU A 1  44  ? 4.947   -39.820 37.129 1.00 79.46  ? 82  LEU A C     1 
ATOM   382   O  O     . LEU A 1  44  ? 5.483   -40.191 38.178 1.00 76.31  ? 82  LEU A O     1 
ATOM   383   C  CB    . LEU A 1  44  ? 2.492   -40.258 37.187 1.00 72.87  ? 82  LEU A CB    1 
ATOM   384   C  CG    . LEU A 1  44  ? 1.224   -40.337 36.336 1.00 68.13  ? 82  LEU A CG    1 
ATOM   385   C  CD1   . LEU A 1  44  ? 0.028   -39.825 37.121 1.00 61.80  ? 82  LEU A CD1   1 
ATOM   386   C  CD2   . LEU A 1  44  ? 1.395   -39.552 35.046 1.00 70.42  ? 82  LEU A CD2   1 
ATOM   387   N  N     . ARG A 1  45  ? 5.304   -38.719 36.475 1.00 83.16  ? 83  ARG A N     1 
ATOM   388   C  CA    . ARG A 1  45  ? 6.286   -37.777 36.985 1.00 80.31  ? 83  ARG A CA    1 
ATOM   389   C  C     . ARG A 1  45  ? 5.609   -36.435 37.228 1.00 71.23  ? 83  ARG A C     1 
ATOM   390   O  O     . ARG A 1  45  ? 4.518   -36.165 36.719 1.00 65.74  ? 83  ARG A O     1 
ATOM   391   C  CB    . ARG A 1  45  ? 7.463   -37.619 36.013 1.00 83.21  ? 83  ARG A CB    1 
ATOM   392   C  CG    . ARG A 1  45  ? 8.015   -38.944 35.514 1.00 90.44  ? 83  ARG A CG    1 
ATOM   393   C  CD    . ARG A 1  45  ? 9.303   -38.769 34.725 1.00 101.22 ? 83  ARG A CD    1 
ATOM   394   N  NE    . ARG A 1  45  ? 9.710   -40.019 34.087 1.00 113.06 ? 83  ARG A NE    1 
ATOM   395   C  CZ    . ARG A 1  45  ? 10.404  -40.978 34.691 1.00 120.67 ? 83  ARG A CZ    1 
ATOM   396   N  NH1   . ARG A 1  45  ? 10.775  -40.838 35.956 1.00 127.49 ? 83  ARG A NH1   1 
ATOM   397   N  NH2   . ARG A 1  45  ? 10.726  -42.082 34.029 1.00 124.91 ? 83  ARG A NH2   1 
ATOM   398   N  N     . PHE A 1  46  ? 6.264   -35.594 38.025 1.00 76.46  ? 84  PHE A N     1 
ATOM   399   C  CA    . PHE A 1  46  ? 5.727   -34.291 38.392 1.00 70.68  ? 84  PHE A CA    1 
ATOM   400   C  C     . PHE A 1  46  ? 6.784   -33.215 38.207 1.00 71.04  ? 84  PHE A C     1 
ATOM   401   O  O     . PHE A 1  46  ? 7.943   -33.399 38.590 1.00 79.42  ? 84  PHE A O     1 
ATOM   402   C  CB    . PHE A 1  46  ? 5.244   -34.272 39.848 1.00 66.50  ? 84  PHE A CB    1 
ATOM   403   C  CG    . PHE A 1  46  ? 3.941   -34.980 40.070 1.00 68.52  ? 84  PHE A CG    1 
ATOM   404   C  CD1   . PHE A 1  46  ? 3.906   -36.348 40.280 1.00 65.65  ? 84  PHE A CD1   1 
ATOM   405   C  CD2   . PHE A 1  46  ? 2.751   -34.272 40.084 1.00 68.64  ? 84  PHE A CD2   1 
ATOM   406   C  CE1   . PHE A 1  46  ? 2.706   -36.999 40.490 1.00 65.00  ? 84  PHE A CE1   1 
ATOM   407   C  CE2   . PHE A 1  46  ? 1.547   -34.917 40.293 1.00 66.98  ? 84  PHE A CE2   1 
ATOM   408   C  CZ    . PHE A 1  46  ? 1.526   -36.282 40.497 1.00 65.20  ? 84  PHE A CZ    1 
ATOM   409   N  N     . GLN A 1  47  ? 6.379   -32.093 37.620 1.00 68.68  ? 85  GLN A N     1 
ATOM   410   C  CA    . GLN A 1  47  ? 7.202   -30.896 37.676 1.00 66.35  ? 85  GLN A CA    1 
ATOM   411   C  C     . GLN A 1  47  ? 7.240   -30.379 39.108 1.00 60.71  ? 85  GLN A C     1 
ATOM   412   O  O     . GLN A 1  47  ? 6.250   -30.466 39.842 1.00 54.26  ? 85  GLN A O     1 
ATOM   413   C  CB    . GLN A 1  47  ? 6.655   -29.817 36.742 1.00 71.73  ? 85  GLN A CB    1 
ATOM   414   C  CG    . GLN A 1  47  ? 6.723   -30.160 35.263 1.00 74.12  ? 85  GLN A CG    1 
ATOM   415   C  CD    . GLN A 1  47  ? 6.187   -29.042 34.385 1.00 69.93  ? 85  GLN A CD    1 
ATOM   416   O  OE1   . GLN A 1  47  ? 5.494   -28.141 34.860 1.00 69.75  ? 85  GLN A OE1   1 
ATOM   417   N  NE2   . GLN A 1  47  ? 6.509   -29.095 33.097 1.00 67.77  ? 85  GLN A NE2   1 
ATOM   418   N  N     . SER A 1  48  ? 8.398   -29.848 39.511 1.00 64.63  ? 86  SER A N     1 
ATOM   419   C  CA    . SER A 1  48  ? 8.532   -29.323 40.866 1.00 68.34  ? 86  SER A CA    1 
ATOM   420   C  C     . SER A 1  48  ? 7.490   -28.251 41.155 1.00 68.36  ? 86  SER A C     1 
ATOM   421   O  O     . SER A 1  48  ? 6.991   -28.158 42.283 1.00 67.48  ? 86  SER A O     1 
ATOM   422   C  CB    . SER A 1  48  ? 9.941   -28.774 41.081 1.00 75.15  ? 86  SER A CB    1 
ATOM   423   O  OG    . SER A 1  48  ? 10.228  -27.742 40.153 1.00 85.34  ? 86  SER A OG    1 
ATOM   424   N  N     . SER A 1  49  ? 7.131   -27.450 40.149 1.00 69.56  ? 87  SER A N     1 
ATOM   425   C  CA    . SER A 1  49  ? 6.113   -26.423 40.337 1.00 69.56  ? 87  SER A CA    1 
ATOM   426   C  C     . SER A 1  49  ? 4.706   -27.003 40.411 1.00 68.60  ? 87  SER A C     1 
ATOM   427   O  O     . SER A 1  49  ? 3.817   -26.365 40.987 1.00 70.00  ? 87  SER A O     1 
ATOM   428   C  CB    . SER A 1  49  ? 6.186   -25.395 39.207 1.00 74.21  ? 87  SER A CB    1 
ATOM   429   O  OG    . SER A 1  49  ? 6.044   -26.017 37.941 1.00 79.85  ? 87  SER A OG    1 
ATOM   430   N  N     . ALA A 1  50  ? 4.482   -28.191 39.843 1.00 73.95  ? 88  ALA A N     1 
ATOM   431   C  CA    . ALA A 1  50  ? 3.154   -28.793 39.901 1.00 70.41  ? 88  ALA A CA    1 
ATOM   432   C  C     . ALA A 1  50  ? 2.802   -29.218 41.321 1.00 69.26  ? 88  ALA A C     1 
ATOM   433   O  O     . ALA A 1  50  ? 1.651   -29.076 41.751 1.00 70.73  ? 88  ALA A O     1 
ATOM   434   C  CB    . ALA A 1  50  ? 3.071   -29.982 38.945 1.00 62.38  ? 88  ALA A CB    1 
ATOM   435   N  N     . VAL A 1  51  ? 3.780   -29.742 42.064 1.00 67.69  ? 89  VAL A N     1 
ATOM   436   C  CA    . VAL A 1  51  ? 3.535   -30.116 43.453 1.00 69.52  ? 89  VAL A CA    1 
ATOM   437   C  C     . VAL A 1  51  ? 3.335   -28.873 44.312 1.00 68.72  ? 89  VAL A C     1 
ATOM   438   O  O     . VAL A 1  51  ? 2.441   -28.829 45.167 1.00 68.05  ? 89  VAL A O     1 
ATOM   439   C  CB    . VAL A 1  51  ? 4.683   -30.994 43.983 1.00 74.70  ? 89  VAL A CB    1 
ATOM   440   C  CG1   . VAL A 1  51  ? 4.475   -31.315 45.457 1.00 75.22  ? 89  VAL A CG1   1 
ATOM   441   C  CG2   . VAL A 1  51  ? 4.796   -32.274 43.166 1.00 73.10  ? 89  VAL A CG2   1 
ATOM   442   N  N     . MET A 1  52  ? 4.160   -27.844 44.098 1.00 70.88  ? 90  MET A N     1 
ATOM   443   C  CA    . MET A 1  52  ? 4.005   -26.603 44.852 1.00 67.45  ? 90  MET A CA    1 
ATOM   444   C  C     . MET A 1  52  ? 2.636   -25.979 44.611 1.00 54.31  ? 90  MET A C     1 
ATOM   445   O  O     . MET A 1  52  ? 2.015   -25.450 45.540 1.00 52.59  ? 90  MET A O     1 
ATOM   446   C  CB    . MET A 1  52  ? 5.118   -25.622 44.486 1.00 79.58  ? 90  MET A CB    1 
ATOM   447   C  CG    . MET A 1  52  ? 6.516   -26.138 44.787 1.00 90.23  ? 90  MET A CG    1 
ATOM   448   S  SD    . MET A 1  52  ? 6.739   -26.562 46.526 1.00 96.98  ? 90  MET A SD    1 
ATOM   449   C  CE    . MET A 1  52  ? 6.596   -24.946 47.283 1.00 96.70  ? 90  MET A CE    1 
ATOM   450   N  N     . ALA A 1  53  ? 2.144   -26.039 43.371 1.00 46.88  ? 91  ALA A N     1 
ATOM   451   C  CA    . ALA A 1  53  ? 0.800   -25.543 43.092 1.00 46.77  ? 91  ALA A CA    1 
ATOM   452   C  C     . ALA A 1  53  ? -0.259  -26.351 43.831 1.00 52.61  ? 91  ALA A C     1 
ATOM   453   O  O     . ALA A 1  53  ? -1.300  -25.805 44.218 1.00 55.34  ? 91  ALA A O     1 
ATOM   454   C  CB    . ALA A 1  53  ? 0.534   -25.560 41.587 1.00 45.52  ? 91  ALA A CB    1 
ATOM   455   N  N     . LEU A 1  54  ? -0.016  -27.649 44.039 1.00 51.77  ? 92  LEU A N     1 
ATOM   456   C  CA    . LEU A 1  54  ? -0.948  -28.459 44.816 1.00 49.77  ? 92  LEU A CA    1 
ATOM   457   C  C     . LEU A 1  54  ? -0.898  -28.094 46.294 1.00 48.12  ? 92  LEU A C     1 
ATOM   458   O  O     . LEU A 1  54  ? -1.939  -28.038 46.959 1.00 42.82  ? 92  LEU A O     1 
ATOM   459   C  CB    . LEU A 1  54  ? -0.645  -29.943 44.622 1.00 58.00  ? 92  LEU A CB    1 
ATOM   460   C  CG    . LEU A 1  54  ? -1.283  -30.615 43.405 1.00 55.21  ? 92  LEU A CG    1 
ATOM   461   C  CD1   . LEU A 1  54  ? -0.681  -31.985 43.170 1.00 44.67  ? 92  LEU A CD1   1 
ATOM   462   C  CD2   . LEU A 1  54  ? -2.788  -30.719 43.590 1.00 52.37  ? 92  LEU A CD2   1 
ATOM   463   N  N     . GLN A 1  55  ? 0.299   -27.837 46.826 1.00 51.77  ? 93  GLN A N     1 
ATOM   464   C  CA    . GLN A 1  55  ? 0.407   -27.475 48.236 1.00 60.97  ? 93  GLN A CA    1 
ATOM   465   C  C     . GLN A 1  55  ? -0.103  -26.058 48.486 1.00 65.47  ? 93  GLN A C     1 
ATOM   466   O  O     . GLN A 1  55  ? -0.723  -25.790 49.523 1.00 66.18  ? 93  GLN A O     1 
ATOM   467   C  CB    . GLN A 1  55  ? 1.853   -27.622 48.708 1.00 46.77  ? 93  GLN A CB    1 
ATOM   468   C  CG    . GLN A 1  55  ? 2.005   -27.583 50.220 1.00 47.30  ? 93  GLN A CG    1 
ATOM   469   C  CD    . GLN A 1  55  ? 3.435   -27.792 50.668 1.00 48.91  ? 93  GLN A CD    1 
ATOM   470   O  OE1   . GLN A 1  55  ? 4.310   -28.098 49.861 1.00 49.69  ? 93  GLN A OE1   1 
ATOM   471   N  NE2   . GLN A 1  55  ? 3.681   -27.622 51.962 1.00 56.46  ? 93  GLN A NE2   1 
ATOM   472   N  N     . GLU A 1  56  ? 0.148   -25.137 47.550 1.00 59.75  ? 94  GLU A N     1 
ATOM   473   C  CA    . GLU A 1  56  ? -0.411  -23.795 47.675 1.00 58.22  ? 94  GLU A CA    1 
ATOM   474   C  C     . GLU A 1  56  ? -1.932  -23.828 47.668 1.00 55.61  ? 94  GLU A C     1 
ATOM   475   O  O     . GLU A 1  56  ? -2.575  -23.031 48.363 1.00 58.19  ? 94  GLU A O     1 
ATOM   476   C  CB    . GLU A 1  56  ? 0.103   -22.892 46.551 1.00 61.38  ? 94  GLU A CB    1 
ATOM   477   C  CG    . GLU A 1  56  ? 1.575   -22.513 46.658 1.00 64.81  ? 94  GLU A CG    1 
ATOM   478   C  CD    . GLU A 1  56  ? 1.849   -21.479 47.736 1.00 63.44  ? 94  GLU A CD    1 
ATOM   479   O  OE1   . GLU A 1  56  ? 0.880   -20.929 48.303 1.00 59.30  ? 94  GLU A OE1   1 
ATOM   480   O  OE2   . GLU A 1  56  ? 3.039   -21.219 48.019 1.00 67.10  ? 94  GLU A OE2   1 
ATOM   481   N  N     . ALA A 1  57  ? -2.526  -24.746 46.904 1.00 53.76  ? 95  ALA A N     1 
ATOM   482   C  CA    . ALA A 1  57  ? -3.981  -24.809 46.819 1.00 54.13  ? 95  ALA A CA    1 
ATOM   483   C  C     . ALA A 1  57  ? -4.582  -25.606 47.969 1.00 56.35  ? 95  ALA A C     1 
ATOM   484   O  O     . ALA A 1  57  ? -5.670  -25.275 48.455 1.00 51.25  ? 95  ALA A O     1 
ATOM   485   C  CB    . ALA A 1  57  ? -4.400  -25.414 45.482 1.00 53.95  ? 95  ALA A CB    1 
ATOM   486   N  N     . SER A 1  58  ? -3.895  -26.662 48.411 1.00 60.75  ? 96  SER A N     1 
ATOM   487   C  CA    A SER A 1  58  ? -4.412  -27.475 49.507 0.20 58.40  ? 96  SER A CA    1 
ATOM   488   C  CA    B SER A 1  58  ? -4.413  -27.474 49.507 0.80 58.52  ? 96  SER A CA    1 
ATOM   489   C  C     . SER A 1  58  ? -4.375  -26.708 50.823 1.00 55.89  ? 96  SER A C     1 
ATOM   490   O  O     . SER A 1  58  ? -5.353  -26.707 51.580 1.00 55.45  ? 96  SER A O     1 
ATOM   491   C  CB    A SER A 1  58  ? -3.618  -28.777 49.618 0.20 58.48  ? 96  SER A CB    1 
ATOM   492   C  CB    B SER A 1  58  ? -3.622  -28.778 49.617 0.80 57.96  ? 96  SER A CB    1 
ATOM   493   O  OG    A SER A 1  58  ? -2.248  -28.518 49.868 0.20 60.29  ? 96  SER A OG    1 
ATOM   494   O  OG    B SER A 1  58  ? -3.781  -29.568 48.453 0.80 57.15  ? 96  SER A OG    1 
ATOM   495   N  N     . GLU A 1  59  ? -3.252  -26.044 51.111 1.00 54.70  ? 97  GLU A N     1 
ATOM   496   C  CA    . GLU A 1  59  ? -3.143  -25.297 52.359 1.00 54.38  ? 97  GLU A CA    1 
ATOM   497   C  C     . GLU A 1  59  ? -4.125  -24.132 52.394 1.00 53.81  ? 97  GLU A C     1 
ATOM   498   O  O     . GLU A 1  59  ? -4.728  -23.850 53.437 1.00 54.62  ? 97  GLU A O     1 
ATOM   499   C  CB    . GLU A 1  59  ? -1.709  -24.806 52.558 1.00 53.12  ? 97  GLU A CB    1 
ATOM   500   C  CG    . GLU A 1  59  ? -0.700  -25.921 52.790 1.00 58.40  ? 97  GLU A CG    1 
ATOM   501   C  CD    . GLU A 1  59  ? 0.630   -25.412 53.317 1.00 68.72  ? 97  GLU A CD    1 
ATOM   502   O  OE1   . GLU A 1  59  ? 0.665   -24.296 53.877 1.00 76.29  ? 97  GLU A OE1   1 
ATOM   503   O  OE2   . GLU A 1  59  ? 1.643   -26.130 53.170 1.00 70.84  ? 97  GLU A OE2   1 
ATOM   504   N  N     . ALA A 1  60  ? -4.308  -23.447 51.262 1.00 50.78  ? 98  ALA A N     1 
ATOM   505   C  CA    . ALA A 1  60  ? -5.283  -22.362 51.216 1.00 49.95  ? 98  ALA A CA    1 
ATOM   506   C  C     . ALA A 1  60  ? -6.702  -22.877 51.410 1.00 52.48  ? 98  ALA A C     1 
ATOM   507   O  O     . ALA A 1  60  ? -7.544  -22.174 51.981 1.00 56.14  ? 98  ALA A O     1 
ATOM   508   C  CB    . ALA A 1  60  ? -5.168  -21.604 49.896 1.00 45.29  ? 98  ALA A CB    1 
ATOM   509   N  N     . TYR A 1  61  ? -6.985  -24.097 50.947 1.00 54.34  ? 99  TYR A N     1 
ATOM   510   C  CA    . TYR A 1  61  ? -8.304  -24.683 51.156 1.00 53.16  ? 99  TYR A CA    1 
ATOM   511   C  C     . TYR A 1  61  ? -8.528  -25.027 52.623 1.00 53.32  ? 99  TYR A C     1 
ATOM   512   O  O     . TYR A 1  61  ? -9.599  -24.747 53.175 1.00 50.40  ? 99  TYR A O     1 
ATOM   513   C  CB    . TYR A 1  61  ? -8.468  -25.925 50.278 1.00 54.88  ? 99  TYR A CB    1 
ATOM   514   C  CG    . TYR A 1  61  ? -9.628  -26.811 50.674 1.00 52.27  ? 99  TYR A CG    1 
ATOM   515   C  CD1   . TYR A 1  61  ? -10.929 -26.484 50.320 1.00 46.08  ? 99  TYR A CD1   1 
ATOM   516   C  CD2   . TYR A 1  61  ? -9.418  -27.979 51.398 1.00 55.71  ? 99  TYR A CD2   1 
ATOM   517   C  CE1   . TYR A 1  61  ? -11.990 -27.290 50.681 1.00 48.55  ? 99  TYR A CE1   1 
ATOM   518   C  CE2   . TYR A 1  61  ? -10.474 -28.793 51.762 1.00 54.84  ? 99  TYR A CE2   1 
ATOM   519   C  CZ    . TYR A 1  61  ? -11.759 -28.443 51.401 1.00 52.50  ? 99  TYR A CZ    1 
ATOM   520   O  OH    . TYR A 1  61  ? -12.815 -29.249 51.762 1.00 51.01  ? 99  TYR A OH    1 
ATOM   521   N  N     . LEU A 1  62  ? -7.528  -25.629 53.272 1.00 53.65  ? 100 LEU A N     1 
ATOM   522   C  CA    . LEU A 1  62  ? -7.691  -26.049 54.661 1.00 50.69  ? 100 LEU A CA    1 
ATOM   523   C  C     . LEU A 1  62  ? -7.795  -24.853 55.600 1.00 47.68  ? 100 LEU A C     1 
ATOM   524   O  O     . LEU A 1  62  ? -8.582  -24.875 56.553 1.00 44.38  ? 100 LEU A O     1 
ATOM   525   C  CB    . LEU A 1  62  ? -6.535  -26.959 55.074 1.00 55.27  ? 100 LEU A CB    1 
ATOM   526   C  CG    . LEU A 1  62  ? -6.464  -28.334 54.401 1.00 54.07  ? 100 LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1  62  ? -5.244  -29.100 54.885 1.00 53.82  ? 100 LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1  62  ? -7.734  -29.130 54.656 1.00 47.30  ? 100 LEU A CD2   1 
ATOM   529   N  N     . VAL A 1  63  ? -7.009  -23.801 55.353 1.00 47.79  ? 101 VAL A N     1 
ATOM   530   C  CA    . VAL A 1  63  ? -7.083  -22.606 56.192 1.00 47.18  ? 101 VAL A CA    1 
ATOM   531   C  C     . VAL A 1  63  ? -8.462  -21.969 56.085 1.00 43.97  ? 101 VAL A C     1 
ATOM   532   O  O     . VAL A 1  63  ? -9.074  -21.594 57.092 1.00 43.53  ? 101 VAL A O     1 
ATOM   533   C  CB    . VAL A 1  63  ? -5.973  -21.608 55.815 1.00 49.86  ? 101 VAL A CB    1 
ATOM   534   C  CG1   . VAL A 1  63  ? -6.180  -20.294 56.545 1.00 50.41  ? 101 VAL A CG1   1 
ATOM   535   C  CG2   . VAL A 1  63  ? -4.605  -22.185 56.139 1.00 54.32  ? 101 VAL A CG2   1 
ATOM   536   N  N     . ALA A 1  64  ? -8.971  -21.837 54.856 1.00 41.92  ? 102 ALA A N     1 
ATOM   537   C  CA    . ALA A 1  64  ? -10.318 -21.311 54.664 1.00 39.91  ? 102 ALA A CA    1 
ATOM   538   C  C     . ALA A 1  64  ? -11.367 -22.229 55.276 1.00 51.53  ? 102 ALA A C     1 
ATOM   539   O  O     . ALA A 1  64  ? -12.400 -21.751 55.759 1.00 58.64  ? 102 ALA A O     1 
ATOM   540   C  CB    . ALA A 1  64  ? -10.595 -21.105 53.175 1.00 34.65  ? 102 ALA A CB    1 
ATOM   541   N  N     . LEU A 1  65  ? -11.123 -23.543 55.270 1.00 55.08  ? 103 LEU A N     1 
ATOM   542   C  CA    . LEU A 1  65  ? -12.045 -24.467 55.922 1.00 52.55  ? 103 LEU A CA    1 
ATOM   543   C  C     . LEU A 1  65  ? -11.984 -24.329 57.439 1.00 54.85  ? 103 LEU A C     1 
ATOM   544   O  O     . LEU A 1  65  ? -13.015 -24.413 58.117 1.00 53.65  ? 103 LEU A O     1 
ATOM   545   C  CB    . LEU A 1  65  ? -11.739 -25.905 55.508 1.00 50.50  ? 103 LEU A CB    1 
ATOM   546   C  CG    . LEU A 1  65  ? -12.615 -26.967 56.177 1.00 48.69  ? 103 LEU A CG    1 
ATOM   547   C  CD1   . LEU A 1  65  ? -14.065 -26.840 55.729 1.00 44.35  ? 103 LEU A CD1   1 
ATOM   548   C  CD2   . LEU A 1  65  ? -12.083 -28.369 55.911 1.00 50.16  ? 103 LEU A CD2   1 
ATOM   549   N  N     . PHE A 1  66  ? -10.786 -24.121 57.989 1.00 59.08  ? 104 PHE A N     1 
ATOM   550   C  CA    . PHE A 1  66  ? -10.653 -23.918 59.427 1.00 61.84  ? 104 PHE A CA    1 
ATOM   551   C  C     . PHE A 1  66  ? -11.304 -22.622 59.890 1.00 67.48  ? 104 PHE A C     1 
ATOM   552   O  O     . PHE A 1  66  ? -11.656 -22.509 61.069 1.00 68.31  ? 104 PHE A O     1 
ATOM   553   C  CB    . PHE A 1  66  ? -9.177  -23.940 59.826 1.00 61.85  ? 104 PHE A CB    1 
ATOM   554   C  CG    . PHE A 1  66  ? -8.604  -25.324 59.952 1.00 64.31  ? 104 PHE A CG    1 
ATOM   555   C  CD1   . PHE A 1  66  ? -9.284  -26.309 60.652 1.00 58.19  ? 104 PHE A CD1   1 
ATOM   556   C  CD2   . PHE A 1  66  ? -7.389  -25.643 59.367 1.00 65.44  ? 104 PHE A CD2   1 
ATOM   557   C  CE1   . PHE A 1  66  ? -8.761  -27.583 60.770 1.00 51.64  ? 104 PHE A CE1   1 
ATOM   558   C  CE2   . PHE A 1  66  ? -6.861  -26.917 59.481 1.00 58.92  ? 104 PHE A CE2   1 
ATOM   559   C  CZ    . PHE A 1  66  ? -7.549  -27.887 60.184 1.00 52.71  ? 104 PHE A CZ    1 
ATOM   560   N  N     . GLU A 1  67  ? -11.472 -21.647 58.993 1.00 70.56  ? 105 GLU A N     1 
ATOM   561   C  CA    . GLU A 1  67  ? -12.195 -20.429 59.347 1.00 72.36  ? 105 GLU A CA    1 
ATOM   562   C  C     . GLU A 1  67  ? -13.685 -20.707 59.506 1.00 73.15  ? 105 GLU A C     1 
ATOM   563   O  O     . GLU A 1  67  ? -14.284 -20.367 60.532 1.00 77.07  ? 105 GLU A O     1 
ATOM   564   C  CB    . GLU A 1  67  ? -11.963 -19.351 58.290 1.00 77.81  ? 105 GLU A CB    1 
ATOM   565   C  CG    . GLU A 1  67  ? -10.524 -18.888 58.165 1.00 84.84  ? 105 GLU A CG    1 
ATOM   566   C  CD    . GLU A 1  67  ? -10.327 -17.934 57.002 1.00 88.73  ? 105 GLU A CD    1 
ATOM   567   O  OE1   . GLU A 1  67  ? -11.324 -17.613 56.322 1.00 86.97  ? 105 GLU A OE1   1 
ATOM   568   O  OE2   . GLU A 1  67  ? -9.176  -17.510 56.767 1.00 96.28  ? 105 GLU A OE2   1 
ATOM   569   N  N     . ASP A 1  68  ? -14.301 -21.321 58.491 1.00 70.52  ? 106 ASP A N     1 
ATOM   570   C  CA    . ASP A 1  68  ? -15.714 -21.670 58.588 1.00 66.43  ? 106 ASP A CA    1 
ATOM   571   C  C     . ASP A 1  68  ? -15.955 -22.700 59.681 1.00 66.55  ? 106 ASP A C     1 
ATOM   572   O  O     . ASP A 1  68  ? -17.021 -22.704 60.307 1.00 68.80  ? 106 ASP A O     1 
ATOM   573   C  CB    . ASP A 1  68  ? -16.223 -22.191 57.244 1.00 67.92  ? 106 ASP A CB    1 
ATOM   574   C  CG    . ASP A 1  68  ? -16.035 -21.189 56.119 1.00 76.36  ? 106 ASP A CG    1 
ATOM   575   O  OD1   . ASP A 1  68  ? -15.786 -19.999 56.412 1.00 81.32  ? 106 ASP A OD1   1 
ATOM   576   O  OD2   . ASP A 1  68  ? -16.143 -21.588 54.941 1.00 77.90  ? 106 ASP A OD2   1 
ATOM   577   N  N     . THR A 1  69  ? -14.980 -23.579 59.922 1.00 67.09  ? 107 THR A N     1 
ATOM   578   C  CA    . THR A 1  69  ? -15.088 -24.519 61.031 1.00 62.06  ? 107 THR A CA    1 
ATOM   579   C  C     . THR A 1  69  ? -15.106 -23.786 62.366 1.00 63.14  ? 107 THR A C     1 
ATOM   580   O  O     . THR A 1  69  ? -15.913 -24.102 63.249 1.00 64.94  ? 107 THR A O     1 
ATOM   581   C  CB    . THR A 1  69  ? -13.930 -25.516 60.982 1.00 54.36  ? 107 THR A CB    1 
ATOM   582   O  OG1   . THR A 1  69  ? -14.018 -26.288 59.779 1.00 53.66  ? 107 THR A OG1   1 
ATOM   583   C  CG2   . THR A 1  69  ? -13.968 -26.446 62.181 1.00 53.05  ? 107 THR A CG2   1 
ATOM   584   N  N     . ASN A 1  70  ? -14.224 -22.797 62.527 1.00 60.04  ? 108 ASN A N     1 
ATOM   585   C  CA    . ASN A 1  70  ? -14.175 -22.038 63.772 1.00 57.16  ? 108 ASN A CA    1 
ATOM   586   C  C     . ASN A 1  70  ? -15.478 -21.289 64.015 1.00 53.84  ? 108 ASN A C     1 
ATOM   587   O  O     . ASN A 1  70  ? -15.912 -21.151 65.165 1.00 49.24  ? 108 ASN A O     1 
ATOM   588   C  CB    . ASN A 1  70  ? -12.990 -21.071 63.746 1.00 56.14  ? 108 ASN A CB    1 
ATOM   589   C  CG    . ASN A 1  70  ? -12.516 -20.699 65.134 1.00 58.36  ? 108 ASN A CG    1 
ATOM   590   O  OD1   . ASN A 1  70  ? -12.833 -21.372 66.115 1.00 61.87  ? 108 ASN A OD1   1 
ATOM   591   N  ND2   . ASN A 1  70  ? -11.744 -19.623 65.224 1.00 60.92  ? 108 ASN A ND2   1 
ATOM   592   N  N     . LEU A 1  71  ? -16.123 -20.810 62.947 1.00 57.58  ? 109 LEU A N     1 
ATOM   593   C  CA    . LEU A 1  71  ? -17.410 -20.142 63.110 1.00 58.37  ? 109 LEU A CA    1 
ATOM   594   C  C     . LEU A 1  71  ? -18.484 -21.107 63.596 1.00 64.32  ? 109 LEU A C     1 
ATOM   595   O  O     . LEU A 1  71  ? -19.358 -20.717 64.380 1.00 70.83  ? 109 LEU A O     1 
ATOM   596   C  CB    . LEU A 1  71  ? -17.838 -19.488 61.797 1.00 55.47  ? 109 LEU A CB    1 
ATOM   597   C  CG    . LEU A 1  71  ? -16.970 -18.333 61.287 1.00 55.03  ? 109 LEU A CG    1 
ATOM   598   C  CD1   . LEU A 1  71  ? -17.495 -17.801 59.959 1.00 50.20  ? 109 LEU A CD1   1 
ATOM   599   C  CD2   . LEU A 1  71  ? -16.891 -17.218 62.319 1.00 53.03  ? 109 LEU A CD2   1 
ATOM   600   N  N     . CYS A 1  72  ? -18.432 -22.365 63.151 1.00 63.89  ? 110 CYS A N     1 
ATOM   601   C  CA    . CYS A 1  72  ? -19.406 -23.350 63.611 1.00 61.72  ? 110 CYS A CA    1 
ATOM   602   C  C     . CYS A 1  72  ? -19.184 -23.702 65.076 1.00 63.58  ? 110 CYS A C     1 
ATOM   603   O  O     . CYS A 1  72  ? -20.146 -23.935 65.817 1.00 66.17  ? 110 CYS A O     1 
ATOM   604   C  CB    . CYS A 1  72  ? -19.339 -24.604 62.739 1.00 60.55  ? 110 CYS A CB    1 
ATOM   605   S  SG    . CYS A 1  72  ? -19.766 -24.327 61.005 1.00 56.85  ? 110 CYS A SG    1 
ATOM   606   N  N     . ALA A 1  73  ? -17.923 -23.750 65.513 1.00 62.36  ? 111 ALA A N     1 
ATOM   607   C  CA    . ALA A 1  73  ? -17.644 -23.996 66.923 1.00 63.91  ? 111 ALA A CA    1 
ATOM   608   C  C     . ALA A 1  73  ? -18.120 -22.836 67.787 1.00 71.99  ? 111 ALA A C     1 
ATOM   609   O  O     . ALA A 1  73  ? -18.719 -23.047 68.847 1.00 77.20  ? 111 ALA A O     1 
ATOM   610   C  CB    . ALA A 1  73  ? -16.150 -24.242 67.127 1.00 63.62  ? 111 ALA A CB    1 
ATOM   611   N  N     . ILE A 1  74  ? -17.869 -21.602 67.345 1.00 75.91  ? 112 ILE A N     1 
ATOM   612   C  CA    . ILE A 1  74  ? -18.317 -20.436 68.099 1.00 74.94  ? 112 ILE A CA    1 
ATOM   613   C  C     . ILE A 1  74  ? -19.837 -20.323 68.065 1.00 75.48  ? 112 ILE A C     1 
ATOM   614   O  O     . ILE A 1  74  ? -20.455 -19.846 69.027 1.00 76.93  ? 112 ILE A O     1 
ATOM   615   C  CB    . ILE A 1  74  ? -17.629 -19.170 67.552 1.00 70.85  ? 112 ILE A CB    1 
ATOM   616   C  CG1   . ILE A 1  74  ? -16.118 -19.267 67.768 1.00 69.02  ? 112 ILE A CG1   1 
ATOM   617   C  CG2   . ILE A 1  74  ? -18.181 -17.913 68.214 1.00 72.07  ? 112 ILE A CG2   1 
ATOM   618   C  CD1   . ILE A 1  74  ? -15.334 -18.173 67.095 1.00 67.17  ? 112 ILE A CD1   1 
ATOM   619   N  N     . HIS A 1  75  ? -20.466 -20.774 66.974 1.00 72.25  ? 113 HIS A N     1 
ATOM   620   C  CA    . HIS A 1  75  ? -21.923 -20.743 66.894 1.00 72.34  ? 113 HIS A CA    1 
ATOM   621   C  C     . HIS A 1  75  ? -22.564 -21.605 67.973 1.00 74.33  ? 113 HIS A C     1 
ATOM   622   O  O     . HIS A 1  75  ? -23.629 -21.255 68.497 1.00 75.96  ? 113 HIS A O     1 
ATOM   623   C  CB    . HIS A 1  75  ? -22.383 -21.196 65.510 1.00 74.75  ? 113 HIS A CB    1 
ATOM   624   C  CG    . HIS A 1  75  ? -23.855 -21.058 65.290 1.00 81.77  ? 113 HIS A CG    1 
ATOM   625   N  ND1   . HIS A 1  75  ? -24.468 -19.838 65.097 1.00 86.54  ? 113 HIS A ND1   1 
ATOM   626   C  CD2   . HIS A 1  75  ? -24.837 -21.988 65.226 1.00 85.08  ? 113 HIS A CD2   1 
ATOM   627   C  CE1   . HIS A 1  75  ? -25.765 -20.023 64.927 1.00 88.87  ? 113 HIS A CE1   1 
ATOM   628   N  NE2   . HIS A 1  75  ? -26.015 -21.319 65.001 1.00 88.19  ? 113 HIS A NE2   1 
ATOM   629   N  N     . ALA A 1  76  ? -21.930 -22.723 68.327 1.00 74.27  ? 114 ALA A N     1 
ATOM   630   C  CA    . ALA A 1  76  ? -22.435 -23.609 69.368 1.00 73.12  ? 114 ALA A CA    1 
ATOM   631   C  C     . ALA A 1  76  ? -21.892 -23.262 70.749 1.00 77.38  ? 114 ALA A C     1 
ATOM   632   O  O     . ALA A 1  76  ? -21.798 -24.145 71.614 1.00 81.42  ? 114 ALA A O     1 
ATOM   633   C  CB    . ALA A 1  76  ? -22.116 -25.063 69.018 1.00 70.87  ? 114 ALA A CB    1 
ATOM   634   N  N     . LYS A 1  77  ? -21.523 -21.997 70.970 1.00 76.17  ? 115 LYS A N     1 
ATOM   635   C  CA    . LYS A 1  77  ? -21.022 -21.523 72.262 1.00 77.68  ? 115 LYS A CA    1 
ATOM   636   C  C     . LYS A 1  77  ? -19.793 -22.313 72.710 1.00 76.45  ? 115 LYS A C     1 
ATOM   637   O  O     . LYS A 1  77  ? -19.644 -22.651 73.886 1.00 81.41  ? 115 LYS A O     1 
ATOM   638   C  CB    . LYS A 1  77  ? -22.118 -21.566 73.331 1.00 79.70  ? 115 LYS A CB    1 
ATOM   639   C  CG    . LYS A 1  77  ? -23.380 -20.805 72.955 1.00 86.92  ? 115 LYS A CG    1 
ATOM   640   C  CD    . LYS A 1  77  ? -23.097 -19.325 72.747 1.00 95.00  ? 115 LYS A CD    1 
ATOM   641   C  CE    . LYS A 1  77  ? -24.337 -18.590 72.261 1.00 99.49  ? 115 LYS A CE    1 
ATOM   642   N  NZ    . LYS A 1  77  ? -25.480 -18.740 73.204 1.00 102.15 ? 115 LYS A NZ    1 
ATOM   643   N  N     . ARG A 1  78  ? -18.904 -22.608 71.764 1.00 67.28  ? 116 ARG A N     1 
ATOM   644   C  CA    . ARG A 1  78  ? -17.681 -23.344 72.044 1.00 67.72  ? 116 ARG A CA    1 
ATOM   645   C  C     . ARG A 1  78  ? -16.481 -22.592 71.486 1.00 71.13  ? 116 ARG A C     1 
ATOM   646   O  O     . ARG A 1  78  ? -16.600 -21.772 70.572 1.00 76.51  ? 116 ARG A O     1 
ATOM   647   C  CB    . ARG A 1  78  ? -17.722 -24.763 71.454 1.00 66.20  ? 116 ARG A CB    1 
ATOM   648   C  CG    . ARG A 1  78  ? -18.656 -25.716 72.175 1.00 66.79  ? 116 ARG A CG    1 
ATOM   649   C  CD    . ARG A 1  78  ? -18.555 -27.129 71.618 1.00 71.19  ? 116 ARG A CD    1 
ATOM   650   N  NE    . ARG A 1  78  ? -19.164 -27.257 70.296 1.00 73.02  ? 116 ARG A NE    1 
ATOM   651   C  CZ    . ARG A 1  78  ? -18.488 -27.231 69.151 1.00 71.79  ? 116 ARG A CZ    1 
ATOM   652   N  NH1   . ARG A 1  78  ? -17.170 -27.085 69.158 1.00 74.82  ? 116 ARG A NH1   1 
ATOM   653   N  NH2   . ARG A 1  78  ? -19.130 -27.358 67.997 1.00 65.17  ? 116 ARG A NH2   1 
ATOM   654   N  N     . VAL A 1  79  ? -15.315 -22.887 72.056 1.00 71.37  ? 117 VAL A N     1 
ATOM   655   C  CA    . VAL A 1  79  ? -14.056 -22.339 71.571 1.00 72.91  ? 117 VAL A CA    1 
ATOM   656   C  C     . VAL A 1  79  ? -13.215 -23.379 70.839 1.00 73.27  ? 117 VAL A C     1 
ATOM   657   O  O     . VAL A 1  79  ? -12.295 -22.996 70.098 1.00 70.69  ? 117 VAL A O     1 
ATOM   658   C  CB    . VAL A 1  79  ? -13.242 -21.710 72.723 1.00 77.66  ? 117 VAL A CB    1 
ATOM   659   C  CG1   . VAL A 1  79  ? -12.243 -20.691 72.188 1.00 81.47  ? 117 VAL A CG1   1 
ATOM   660   C  CG2   . VAL A 1  79  ? -14.169 -21.070 73.746 1.00 78.63  ? 117 VAL A CG2   1 
ATOM   661   N  N     . THR A 1  80  ? -13.500 -24.667 71.006 1.00 76.32  ? 118 THR A N     1 
ATOM   662   C  CA    . THR A 1  80  ? -12.727 -25.733 70.384 1.00 75.72  ? 118 THR A CA    1 
ATOM   663   C  C     . THR A 1  80  ? -13.435 -26.217 69.126 1.00 70.43  ? 118 THR A C     1 
ATOM   664   O  O     . THR A 1  80  ? -14.644 -26.472 69.149 1.00 66.05  ? 118 THR A O     1 
ATOM   665   C  CB    . THR A 1  80  ? -12.536 -26.906 71.346 1.00 78.51  ? 118 THR A CB    1 
ATOM   666   O  OG1   . THR A 1  80  ? -13.685 -27.759 71.285 1.00 83.58  ? 118 THR A OG1   1 
ATOM   667   C  CG2   . THR A 1  80  ? -12.385 -26.405 72.764 1.00 76.73  ? 118 THR A CG2   1 
ATOM   668   N  N     . ILE A 1  81  ? -12.683 -26.343 68.037 1.00 71.61  ? 119 ILE A N     1 
ATOM   669   C  CA    . ILE A 1  81  ? -13.212 -26.938 66.816 1.00 67.65  ? 119 ILE A CA    1 
ATOM   670   C  C     . ILE A 1  81  ? -13.233 -28.452 66.973 1.00 65.30  ? 119 ILE A C     1 
ATOM   671   O  O     . ILE A 1  81  ? -12.281 -29.056 67.483 1.00 63.69  ? 119 ILE A O     1 
ATOM   672   C  CB    . ILE A 1  81  ? -12.384 -26.507 65.591 1.00 60.31  ? 119 ILE A CB    1 
ATOM   673   C  CG1   . ILE A 1  81  ? -10.913 -26.895 65.761 1.00 57.71  ? 119 ILE A CG1   1 
ATOM   674   C  CG2   . ILE A 1  81  ? -12.526 -25.011 65.356 1.00 57.07  ? 119 ILE A CG2   1 
ATOM   675   C  CD1   . ILE A 1  81  ? -10.120 -26.862 64.474 1.00 57.52  ? 119 ILE A CD1   1 
ATOM   676   N  N     . MET A 1  82  ? -14.324 -29.067 66.549 1.00 63.18  ? 120 MET A N     1 
ATOM   677   C  CA    . MET A 1  82  ? -14.524 -30.505 66.645 1.00 65.54  ? 120 MET A CA    1 
ATOM   678   C  C     . MET A 1  82  ? -14.879 -31.047 65.274 1.00 64.39  ? 120 MET A C     1 
ATOM   679   O  O     . MET A 1  82  ? -15.277 -30.287 64.382 1.00 64.02  ? 120 MET A O     1 
ATOM   680   C  CB    . MET A 1  82  ? -15.629 -30.834 67.661 1.00 67.76  ? 120 MET A CB    1 
ATOM   681   C  CG    . MET A 1  82  ? -15.339 -30.309 69.059 1.00 73.86  ? 120 MET A CG    1 
ATOM   682   S  SD    . MET A 1  82  ? -16.389 -31.034 70.331 1.00 83.55  ? 120 MET A SD    1 
ATOM   683   C  CE    . MET A 1  82  ? -18.013 -30.627 69.702 1.00 85.32  ? 120 MET A CE    1 
ATOM   684   N  N     . PRO A 1  83  ? -14.718 -32.357 65.052 1.00 64.57  ? 121 PRO A N     1 
ATOM   685   C  CA    . PRO A 1  83  ? -15.024 -32.922 63.727 1.00 60.47  ? 121 PRO A CA    1 
ATOM   686   C  C     . PRO A 1  83  ? -16.410 -32.579 63.209 1.00 63.42  ? 121 PRO A C     1 
ATOM   687   O  O     . PRO A 1  83  ? -16.577 -32.397 61.995 1.00 64.93  ? 121 PRO A O     1 
ATOM   688   C  CB    . PRO A 1  83  ? -14.863 -34.430 63.954 1.00 54.99  ? 121 PRO A CB    1 
ATOM   689   C  CG    . PRO A 1  83  ? -13.837 -34.522 65.019 1.00 56.70  ? 121 PRO A CG    1 
ATOM   690   C  CD    . PRO A 1  83  ? -14.087 -33.356 65.937 1.00 61.28  ? 121 PRO A CD    1 
ATOM   691   N  N     . LYS A 1  84  ? -17.412 -32.473 64.085 1.00 64.67  ? 122 LYS A N     1 
ATOM   692   C  CA    . LYS A 1  84  ? -18.744 -32.102 63.623 1.00 67.52  ? 122 LYS A CA    1 
ATOM   693   C  C     . LYS A 1  84  ? -18.797 -30.665 63.120 1.00 69.92  ? 122 LYS A C     1 
ATOM   694   O  O     . LYS A 1  84  ? -19.684 -30.333 62.326 1.00 71.21  ? 122 LYS A O     1 
ATOM   695   C  CB    . LYS A 1  84  ? -19.774 -32.314 64.734 1.00 68.28  ? 122 LYS A CB    1 
ATOM   696   C  CG    . LYS A 1  84  ? -19.766 -31.266 65.831 1.00 68.82  ? 122 LYS A CG    1 
ATOM   697   C  CD    . LYS A 1  84  ? -20.848 -31.566 66.858 1.00 76.12  ? 122 LYS A CD    1 
ATOM   698   C  CE    . LYS A 1  84  ? -21.046 -30.409 67.820 1.00 84.08  ? 122 LYS A CE    1 
ATOM   699   N  NZ    . LYS A 1  84  ? -22.025 -30.744 68.893 1.00 88.78  ? 122 LYS A NZ    1 
ATOM   700   N  N     . ASP A 1  85  ? -17.868 -29.809 63.555 1.00 66.63  ? 123 ASP A N     1 
ATOM   701   C  CA    . ASP A 1  85  ? -17.794 -28.460 63.004 1.00 60.27  ? 123 ASP A CA    1 
ATOM   702   C  C     . ASP A 1  85  ? -17.277 -28.483 61.571 1.00 60.75  ? 123 ASP A C     1 
ATOM   703   O  O     . ASP A 1  85  ? -17.769 -27.738 60.715 1.00 64.97  ? 123 ASP A O     1 
ATOM   704   C  CB    . ASP A 1  85  ? -16.904 -27.578 63.881 1.00 57.68  ? 123 ASP A CB    1 
ATOM   705   C  CG    . ASP A 1  85  ? -17.411 -27.466 65.308 1.00 58.58  ? 123 ASP A CG    1 
ATOM   706   O  OD1   . ASP A 1  85  ? -18.636 -27.299 65.495 1.00 57.75  ? 123 ASP A OD1   1 
ATOM   707   O  OD2   . ASP A 1  85  ? -16.583 -27.548 66.244 1.00 56.09  ? 123 ASP A OD2   1 
ATOM   708   N  N     . ILE A 1  86  ? -16.286 -29.332 61.291 1.00 56.88  ? 124 ILE A N     1 
ATOM   709   C  CA    . ILE A 1  86  ? -15.758 -29.445 59.934 1.00 53.69  ? 124 ILE A CA    1 
ATOM   710   C  C     . ILE A 1  86  ? -16.824 -29.982 58.987 1.00 54.88  ? 124 ILE A C     1 
ATOM   711   O  O     . ILE A 1  86  ? -17.012 -29.463 57.881 1.00 56.36  ? 124 ILE A O     1 
ATOM   712   C  CB    . ILE A 1  86  ? -14.496 -30.328 59.921 1.00 54.34  ? 124 ILE A CB    1 
ATOM   713   C  CG1   . ILE A 1  86  ? -13.304 -29.574 60.513 1.00 59.39  ? 124 ILE A CG1   1 
ATOM   714   C  CG2   . ILE A 1  86  ? -14.181 -30.796 58.509 1.00 54.84  ? 124 ILE A CG2   1 
ATOM   715   C  CD1   . ILE A 1  86  ? -11.998 -30.336 60.423 1.00 64.26  ? 124 ILE A CD1   1 
ATOM   716   N  N     . GLN A 1  87  ? -17.544 -31.024 59.410 1.00 62.82  ? 125 GLN A N     1 
ATOM   717   C  CA    A GLN A 1  87  ? -18.524 -31.630 58.518 0.61 57.45  ? 125 GLN A CA    1 
ATOM   718   C  CA    B GLN A 1  87  ? -18.546 -31.646 58.546 0.39 57.42  ? 125 GLN A CA    1 
ATOM   719   C  C     . GLN A 1  87  ? -19.696 -30.691 58.254 1.00 58.39  ? 125 GLN A C     1 
ATOM   720   O  O     . GLN A 1  87  ? -20.207 -30.639 57.130 1.00 59.20  ? 125 GLN A O     1 
ATOM   721   C  CB    A GLN A 1  87  ? -18.997 -32.965 59.090 0.61 58.80  ? 125 GLN A CB    1 
ATOM   722   C  CB    B GLN A 1  87  ? -19.072 -32.927 59.196 0.39 58.84  ? 125 GLN A CB    1 
ATOM   723   C  CG    A GLN A 1  87  ? -17.876 -33.990 59.221 0.61 53.02  ? 125 GLN A CG    1 
ATOM   724   C  CG    B GLN A 1  87  ? -17.995 -33.932 59.570 0.39 52.91  ? 125 GLN A CG    1 
ATOM   725   C  CD    A GLN A 1  87  ? -17.085 -34.164 57.932 0.61 53.41  ? 125 GLN A CD    1 
ATOM   726   C  CD    B GLN A 1  87  ? -18.513 -35.028 60.485 0.39 52.46  ? 125 GLN A CD    1 
ATOM   727   O  OE1   A GLN A 1  87  ? -17.653 -34.207 56.842 0.61 44.77  ? 125 GLN A OE1   1 
ATOM   728   O  OE1   B GLN A 1  87  ? -19.633 -34.954 60.992 0.39 49.76  ? 125 GLN A OE1   1 
ATOM   729   N  NE2   A GLN A 1  87  ? -15.766 -34.260 58.056 0.61 47.75  ? 125 GLN A NE2   1 
ATOM   730   N  NE2   B GLN A 1  87  ? -17.696 -36.051 60.702 0.39 47.66  ? 125 GLN A NE2   1 
ATOM   731   N  N     . LEU A 1  88  ? -20.129 -29.934 59.264 1.00 56.36  ? 126 LEU A N     1 
ATOM   732   C  CA    . LEU A 1  88  ? -21.195 -28.963 59.038 1.00 60.53  ? 126 LEU A CA    1 
ATOM   733   C  C     . LEU A 1  88  ? -20.748 -27.880 58.064 1.00 58.74  ? 126 LEU A C     1 
ATOM   734   O  O     . LEU A 1  88  ? -21.514 -27.473 57.182 1.00 58.87  ? 126 LEU A O     1 
ATOM   735   C  CB    . LEU A 1  88  ? -21.639 -28.340 60.360 1.00 58.56  ? 126 LEU A CB    1 
ATOM   736   C  CG    . LEU A 1  88  ? -22.711 -27.258 60.219 1.00 56.76  ? 126 LEU A CG    1 
ATOM   737   C  CD1   . LEU A 1  88  ? -24.018 -27.860 59.728 1.00 54.53  ? 126 LEU A CD1   1 
ATOM   738   C  CD2   . LEU A 1  88  ? -22.913 -26.516 61.525 1.00 59.71  ? 126 LEU A CD2   1 
ATOM   739   N  N     . ALA A 1  89  ? -19.510 -27.403 58.208 1.00 53.72  ? 127 ALA A N     1 
ATOM   740   C  CA    . ALA A 1  89  ? -18.980 -26.418 57.272 1.00 57.25  ? 127 ALA A CA    1 
ATOM   741   C  C     . ALA A 1  89  ? -18.936 -26.980 55.856 1.00 66.19  ? 127 ALA A C     1 
ATOM   742   O  O     . ALA A 1  89  ? -19.373 -26.327 54.901 1.00 70.61  ? 127 ALA A O     1 
ATOM   743   C  CB    . ALA A 1  89  ? -17.590 -25.966 57.719 1.00 53.11  ? 127 ALA A CB    1 
ATOM   744   N  N     . ARG A 1  90  ? -18.419 -28.203 55.703 1.00 64.51  ? 128 ARG A N     1 
ATOM   745   C  CA    . ARG A 1  90  ? -18.336 -28.810 54.379 1.00 59.58  ? 128 ARG A CA    1 
ATOM   746   C  C     . ARG A 1  90  ? -19.716 -29.091 53.799 1.00 63.51  ? 128 ARG A C     1 
ATOM   747   O  O     . ARG A 1  90  ? -19.875 -29.126 52.574 1.00 67.33  ? 128 ARG A O     1 
ATOM   748   C  CB    . ARG A 1  90  ? -17.511 -30.097 54.438 1.00 54.65  ? 128 ARG A CB    1 
ATOM   749   C  CG    . ARG A 1  90  ? -16.057 -29.875 54.823 1.00 57.45  ? 128 ARG A CG    1 
ATOM   750   C  CD    . ARG A 1  90  ? -15.235 -31.154 54.740 1.00 60.57  ? 128 ARG A CD    1 
ATOM   751   N  NE    . ARG A 1  90  ? -15.174 -31.691 53.383 1.00 65.73  ? 128 ARG A NE    1 
ATOM   752   C  CZ    . ARG A 1  90  ? -15.766 -32.817 52.996 1.00 68.03  ? 128 ARG A CZ    1 
ATOM   753   N  NH1   . ARG A 1  90  ? -16.460 -33.536 53.867 1.00 69.64  ? 128 ARG A NH1   1 
ATOM   754   N  NH2   . ARG A 1  90  ? -15.658 -33.228 51.740 1.00 66.11  ? 128 ARG A NH2   1 
ATOM   755   N  N     . ARG A 1  91  ? -20.722 -29.287 54.653 1.00 64.59  ? 129 ARG A N     1 
ATOM   756   C  CA    . ARG A 1  91  ? -22.072 -29.525 54.156 1.00 64.87  ? 129 ARG A CA    1 
ATOM   757   C  C     . ARG A 1  91  ? -22.723 -28.234 53.674 1.00 63.88  ? 129 ARG A C     1 
ATOM   758   O  O     . ARG A 1  91  ? -23.419 -28.232 52.652 1.00 59.36  ? 129 ARG A O     1 
ATOM   759   C  CB    . ARG A 1  91  ? -22.923 -30.183 55.247 1.00 67.18  ? 129 ARG A CB    1 
ATOM   760   C  CG    . ARG A 1  91  ? -24.195 -30.866 54.745 1.00 74.80  ? 129 ARG A CG    1 
ATOM   761   C  CD    . ARG A 1  91  ? -25.352 -29.889 54.584 1.00 79.60  ? 129 ARG A CD    1 
ATOM   762   N  NE    . ARG A 1  91  ? -26.531 -30.516 53.996 1.00 84.27  ? 129 ARG A NE    1 
ATOM   763   C  CZ    . ARG A 1  91  ? -27.568 -29.842 53.511 1.00 85.91  ? 129 ARG A CZ    1 
ATOM   764   N  NH1   . ARG A 1  91  ? -27.569 -28.517 53.536 1.00 77.94  ? 129 ARG A NH1   1 
ATOM   765   N  NH2   . ARG A 1  91  ? -28.602 -30.491 52.994 1.00 93.92  ? 129 ARG A NH2   1 
ATOM   766   N  N     . ILE A 1  92  ? -22.505 -27.131 54.393 1.00 68.35  ? 130 ILE A N     1 
ATOM   767   C  CA    . ILE A 1  92  ? -23.181 -25.881 54.060 1.00 68.25  ? 130 ILE A CA    1 
ATOM   768   C  C     . ILE A 1  92  ? -22.622 -25.289 52.772 1.00 68.78  ? 130 ILE A C     1 
ATOM   769   O  O     . ILE A 1  92  ? -23.377 -24.826 51.908 1.00 71.56  ? 130 ILE A O     1 
ATOM   770   C  CB    . ILE A 1  92  ? -23.078 -24.896 55.238 1.00 69.03  ? 130 ILE A CB    1 
ATOM   771   C  CG1   . ILE A 1  92  ? -23.918 -25.396 56.414 1.00 70.87  ? 130 ILE A CG1   1 
ATOM   772   C  CG2   . ILE A 1  92  ? -23.514 -23.501 54.817 1.00 69.01  ? 130 ILE A CG2   1 
ATOM   773   C  CD1   . ILE A 1  92  ? -23.815 -24.531 57.645 1.00 71.34  ? 130 ILE A CD1   1 
ATOM   774   N  N     . ARG A 1  93  ? -21.299 -25.302 52.611 1.00 69.28  ? 131 ARG A N     1 
ATOM   775   C  CA    . ARG A 1  93  ? -20.688 -24.744 51.412 1.00 71.53  ? 131 ARG A CA    1 
ATOM   776   C  C     . ARG A 1  93  ? -20.824 -25.651 50.193 1.00 70.20  ? 131 ARG A C     1 
ATOM   777   O  O     . ARG A 1  93  ? -20.271 -25.326 49.137 1.00 73.38  ? 131 ARG A O     1 
ATOM   778   C  CB    . ARG A 1  93  ? -19.209 -24.425 51.665 1.00 72.29  ? 131 ARG A CB    1 
ATOM   779   C  CG    . ARG A 1  93  ? -18.353 -25.627 52.004 1.00 74.01  ? 131 ARG A CG    1 
ATOM   780   C  CD    . ARG A 1  93  ? -16.870 -25.305 51.878 1.00 73.92  ? 131 ARG A CD    1 
ATOM   781   N  NE    . ARG A 1  93  ? -16.389 -24.374 52.895 1.00 66.84  ? 131 ARG A NE    1 
ATOM   782   C  CZ    . ARG A 1  93  ? -15.119 -23.994 53.010 1.00 64.31  ? 131 ARG A CZ    1 
ATOM   783   N  NH1   . ARG A 1  93  ? -14.205 -24.466 52.173 1.00 63.33  ? 131 ARG A NH1   1 
ATOM   784   N  NH2   . ARG A 1  93  ? -14.758 -23.145 53.962 1.00 64.44  ? 131 ARG A NH2   1 
ATOM   785   N  N     . GLY A 1  94  ? -21.536 -26.772 50.308 1.00 66.01  ? 132 GLY A N     1 
ATOM   786   C  CA    . GLY A 1  94  ? -21.881 -27.591 49.165 1.00 65.07  ? 132 GLY A CA    1 
ATOM   787   C  C     . GLY A 1  94  ? -20.958 -28.754 48.876 1.00 66.63  ? 132 GLY A C     1 
ATOM   788   O  O     . GLY A 1  94  ? -21.189 -29.471 47.896 1.00 71.31  ? 132 GLY A O     1 
ATOM   789   N  N     . GLU A 1  95  ? -19.924 -28.969 49.690 1.00 66.68  ? 133 GLU A N     1 
ATOM   790   C  CA    . GLU A 1  95  ? -19.001 -30.070 49.444 1.00 70.55  ? 133 GLU A CA    1 
ATOM   791   C  C     . GLU A 1  95  ? -19.576 -31.422 49.843 1.00 76.72  ? 133 GLU A C     1 
ATOM   792   O  O     . GLU A 1  95  ? -19.054 -32.455 49.409 1.00 80.55  ? 133 GLU A O     1 
ATOM   793   C  CB    . GLU A 1  95  ? -17.686 -29.829 50.186 1.00 70.15  ? 133 GLU A CB    1 
ATOM   794   C  CG    . GLU A 1  95  ? -17.023 -28.509 49.835 1.00 73.04  ? 133 GLU A CG    1 
ATOM   795   C  CD    . GLU A 1  95  ? -15.668 -28.341 50.493 1.00 75.96  ? 133 GLU A CD    1 
ATOM   796   O  OE1   . GLU A 1  95  ? -15.219 -29.279 51.185 1.00 78.78  ? 133 GLU A OE1   1 
ATOM   797   O  OE2   . GLU A 1  95  ? -15.052 -27.269 50.316 1.00 75.28  ? 133 GLU A OE2   1 
ATOM   798   N  N     . ARG A 1  96  ? -20.632 -31.438 50.652 1.00 79.90  ? 134 ARG A N     1 
ATOM   799   C  CA    . ARG A 1  96  ? -21.278 -32.668 51.081 1.00 84.88  ? 134 ARG A CA    1 
ATOM   800   C  C     . ARG A 1  96  ? -22.760 -32.612 50.743 1.00 86.04  ? 134 ARG A C     1 
ATOM   801   O  O     . ARG A 1  96  ? -23.319 -31.547 50.470 1.00 84.93  ? 134 ARG A O     1 
ATOM   802   C  CB    . ARG A 1  96  ? -21.107 -32.906 52.585 1.00 91.84  ? 134 ARG A CB    1 
ATOM   803   C  CG    . ARG A 1  96  ? -19.763 -33.470 52.991 1.00 97.02  ? 134 ARG A CG    1 
ATOM   804   C  CD    . ARG A 1  96  ? -19.684 -33.598 54.500 1.00 99.85  ? 134 ARG A CD    1 
ATOM   805   N  NE    . ARG A 1  96  ? -20.895 -34.194 55.058 1.00 104.42 ? 134 ARG A NE    1 
ATOM   806   C  CZ    . ARG A 1  96  ? -21.076 -35.499 55.229 1.00 110.79 ? 134 ARG A CZ    1 
ATOM   807   N  NH1   . ARG A 1  96  ? -20.123 -36.354 54.886 1.00 115.36 ? 134 ARG A NH1   1 
ATOM   808   N  NH2   . ARG A 1  96  ? -22.212 -35.950 55.745 1.00 111.98 ? 134 ARG A NH2   1 
ATOM   809   N  N     . ALA A 1  97  ? -23.393 -33.779 50.776 1.00 89.70  ? 135 ALA A N     1 
ATOM   810   C  CA    . ALA A 1  97  ? -24.826 -33.872 50.536 1.00 94.39  ? 135 ALA A CA    1 
ATOM   811   C  C     . ALA A 1  97  ? -25.597 -33.483 51.793 1.00 98.30  ? 135 ALA A C     1 
ATOM   812   O  O     . ALA A 1  97  ? -25.106 -33.648 52.911 1.00 95.86  ? 135 ALA A O     1 
ATOM   813   C  CB    . ALA A 1  97  ? -25.201 -35.275 50.089 1.00 98.04  ? 135 ALA A CB    1 
ATOM   814   O  OXT   . ALA A 1  97  ? -26.725 -32.993 51.722 1.00 102.66 ? 135 ALA A OXT   1 
ATOM   815   N  N     . ARG B 2  1   ? 11.754  -49.186 41.883 1.00 127.19 ? 19  ARG B N     1 
ATOM   816   C  CA    . ARG B 2  1   ? 11.067  -48.122 42.606 1.00 132.47 ? 19  ARG B CA    1 
ATOM   817   C  C     . ARG B 2  1   ? 10.742  -48.545 44.034 1.00 129.16 ? 19  ARG B C     1 
ATOM   818   O  O     . ARG B 2  1   ? 10.788  -49.730 44.366 1.00 130.40 ? 19  ARG B O     1 
ATOM   819   C  CB    . ARG B 2  1   ? 9.785   -47.718 41.875 1.00 140.90 ? 19  ARG B CB    1 
ATOM   820   C  CG    . ARG B 2  1   ? 10.015  -47.173 40.476 1.00 149.03 ? 19  ARG B CG    1 
ATOM   821   C  CD    . ARG B 2  1   ? 8.707   -46.753 39.827 1.00 154.81 ? 19  ARG B CD    1 
ATOM   822   N  NE    . ARG B 2  1   ? 8.916   -46.175 38.503 1.00 158.34 ? 19  ARG B NE    1 
ATOM   823   C  CZ    . ARG B 2  1   ? 7.941   -45.715 37.726 1.00 161.19 ? 19  ARG B CZ    1 
ATOM   824   N  NH1   . ARG B 2  1   ? 6.682   -45.765 38.139 1.00 163.44 ? 19  ARG B NH1   1 
ATOM   825   N  NH2   . ARG B 2  1   ? 8.224   -45.205 36.535 1.00 163.19 ? 19  ARG B NH2   1 
ATOM   826   N  N     . LYS B 2  2   ? 10.413  -47.569 44.876 1.00 123.32 ? 20  LYS B N     1 
ATOM   827   C  CA    . LYS B 2  2   ? 10.044  -47.821 46.261 1.00 116.42 ? 20  LYS B CA    1 
ATOM   828   C  C     . LYS B 2  2   ? 8.533   -47.723 46.419 1.00 106.21 ? 20  LYS B C     1 
ATOM   829   O  O     . LYS B 2  2   ? 7.887   -46.870 45.803 1.00 107.83 ? 20  LYS B O     1 
ATOM   830   C  CB    . LYS B 2  2   ? 10.737  -46.832 47.202 1.00 119.80 ? 20  LYS B CB    1 
ATOM   831   C  CG    . LYS B 2  2   ? 10.528  -47.133 48.679 1.00 122.55 ? 20  LYS B CG    1 
ATOM   832   C  CD    . LYS B 2  2   ? 11.004  -48.537 49.025 1.00 122.33 ? 20  LYS B CD    1 
ATOM   833   C  CE    . LYS B 2  2   ? 10.772  -48.860 50.493 1.00 120.47 ? 20  LYS B CE    1 
ATOM   834   N  NZ    . LYS B 2  2   ? 9.324   -48.859 50.846 1.00 118.14 ? 20  LYS B NZ    1 
ATOM   835   N  N     . VAL B 2  3   ? 7.975   -48.602 47.243 1.00 97.20  ? 21  VAL B N     1 
ATOM   836   C  CA    . VAL B 2  3   ? 6.533   -48.640 47.457 1.00 91.66  ? 21  VAL B CA    1 
ATOM   837   C  C     . VAL B 2  3   ? 6.144   -47.554 48.453 1.00 91.24  ? 21  VAL B C     1 
ATOM   838   O  O     . VAL B 2  3   ? 6.685   -47.485 49.564 1.00 93.08  ? 21  VAL B O     1 
ATOM   839   C  CB    . VAL B 2  3   ? 6.091   -50.033 47.938 1.00 89.95  ? 21  VAL B CB    1 
ATOM   840   C  CG1   . VAL B 2  3   ? 7.036   -50.559 49.010 1.00 93.37  ? 21  VAL B CG1   1 
ATOM   841   C  CG2   . VAL B 2  3   ? 4.660   -49.991 48.451 1.00 90.00  ? 21  VAL B CG2   1 
ATOM   842   N  N     . LEU B 2  4   ? 5.209   -46.696 48.052 1.00 86.36  ? 22  LEU B N     1 
ATOM   843   C  CA    . LEU B 2  4   ? 4.715   -45.625 48.906 1.00 78.10  ? 22  LEU B CA    1 
ATOM   844   C  C     . LEU B 2  4   ? 3.560   -46.141 49.754 1.00 73.10  ? 22  LEU B C     1 
ATOM   845   O  O     . LEU B 2  4   ? 2.626   -46.757 49.231 1.00 67.84  ? 22  LEU B O     1 
ATOM   846   C  CB    . LEU B 2  4   ? 4.268   -44.430 48.065 1.00 72.27  ? 22  LEU B CB    1 
ATOM   847   C  CG    . LEU B 2  4   ? 5.362   -43.827 47.184 1.00 67.02  ? 22  LEU B CG    1 
ATOM   848   C  CD1   . LEU B 2  4   ? 4.809   -42.689 46.344 1.00 68.91  ? 22  LEU B CD1   1 
ATOM   849   C  CD2   . LEU B 2  4   ? 6.528   -43.354 48.038 1.00 55.28  ? 22  LEU B CD2   1 
ATOM   850   N  N     . ARG B 2  5   ? 3.621   -45.880 51.058 1.00 75.25  ? 23  ARG B N     1 
ATOM   851   C  CA    . ARG B 2  5   ? 2.675   -46.478 51.988 1.00 75.53  ? 23  ARG B CA    1 
ATOM   852   C  C     . ARG B 2  5   ? 2.455   -45.546 53.171 1.00 72.39  ? 23  ARG B C     1 
ATOM   853   O  O     . ARG B 2  5   ? 3.420   -45.087 53.788 1.00 71.83  ? 23  ARG B O     1 
ATOM   854   C  CB    . ARG B 2  5   ? 3.187   -47.844 52.464 1.00 77.14  ? 23  ARG B CB    1 
ATOM   855   C  CG    . ARG B 2  5   ? 2.119   -48.768 53.016 1.00 74.11  ? 23  ARG B CG    1 
ATOM   856   C  CD    . ARG B 2  5   ? 2.491   -50.237 52.817 1.00 73.62  ? 23  ARG B CD    1 
ATOM   857   N  NE    . ARG B 2  5   ? 3.238   -50.792 53.943 1.00 69.57  ? 23  ARG B NE    1 
ATOM   858   C  CZ    . ARG B 2  5   ? 4.564   -50.794 54.040 1.00 66.85  ? 23  ARG B CZ    1 
ATOM   859   N  NH1   . ARG B 2  5   ? 5.308   -50.266 53.076 1.00 67.97  ? 23  ARG B NH1   1 
ATOM   860   N  NH2   . ARG B 2  5   ? 5.150   -51.324 55.105 1.00 62.54  ? 23  ARG B NH2   1 
ATOM   861   N  N     . ASP B 2  6   ? 1.183   -45.264 53.468 1.00 76.00  ? 24  ASP B N     1 
ATOM   862   C  CA    . ASP B 2  6   ? 0.781   -44.538 54.675 1.00 82.65  ? 24  ASP B CA    1 
ATOM   863   C  C     . ASP B 2  6   ? 1.427   -43.153 54.742 1.00 83.88  ? 24  ASP B C     1 
ATOM   864   O  O     . ASP B 2  6   ? 2.002   -42.757 55.757 1.00 87.19  ? 24  ASP B O     1 
ATOM   865   C  CB    . ASP B 2  6   ? 1.099   -45.357 55.930 1.00 87.53  ? 24  ASP B CB    1 
ATOM   866   C  CG    . ASP B 2  6   ? 0.373   -44.850 57.162 1.00 94.73  ? 24  ASP B CG    1 
ATOM   867   O  OD1   . ASP B 2  6   ? -0.730  -44.283 57.015 1.00 98.78  ? 24  ASP B OD1   1 
ATOM   868   O  OD2   . ASP B 2  6   ? 0.907   -45.023 58.279 1.00 96.29  ? 24  ASP B OD2   1 
ATOM   869   N  N     . ASN B 2  7   ? 1.322   -42.405 53.644 1.00 81.16  ? 25  ASN B N     1 
ATOM   870   C  CA    . ASN B 2  7   ? 1.894   -41.064 53.591 1.00 80.53  ? 25  ASN B CA    1 
ATOM   871   C  C     . ASN B 2  7   ? 0.918   -39.977 54.023 1.00 75.00  ? 25  ASN B C     1 
ATOM   872   O  O     . ASN B 2  7   ? 1.324   -38.816 54.148 1.00 67.24  ? 25  ASN B O     1 
ATOM   873   C  CB    . ASN B 2  7   ? 2.412   -40.760 52.184 1.00 80.04  ? 25  ASN B CB    1 
ATOM   874   C  CG    . ASN B 2  7   ? 3.663   -41.550 51.844 1.00 77.31  ? 25  ASN B CG    1 
ATOM   875   O  OD1   . ASN B 2  7   ? 4.774   -41.163 52.210 1.00 75.70  ? 25  ASN B OD1   1 
ATOM   876   N  ND2   . ASN B 2  7   ? 3.487   -42.666 51.143 1.00 75.48  ? 25  ASN B ND2   1 
ATOM   877   N  N     . ILE B 2  8   ? -0.351  -40.320 54.255 1.00 77.06  ? 26  ILE B N     1 
ATOM   878   C  CA    . ILE B 2  8   ? -1.284  -39.366 54.841 1.00 75.17  ? 26  ILE B CA    1 
ATOM   879   C  C     . ILE B 2  8   ? -0.841  -38.975 56.242 1.00 82.69  ? 26  ILE B C     1 
ATOM   880   O  O     . ILE B 2  8   ? -1.186  -37.890 56.723 1.00 79.00  ? 26  ILE B O     1 
ATOM   881   C  CB    . ILE B 2  8   ? -2.715  -39.939 54.843 1.00 70.25  ? 26  ILE B CB    1 
ATOM   882   C  CG1   . ILE B 2  8   ? -3.738  -38.837 55.120 1.00 77.08  ? 26  ILE B CG1   1 
ATOM   883   C  CG2   . ILE B 2  8   ? -2.856  -41.048 55.868 1.00 69.75  ? 26  ILE B CG2   1 
ATOM   884   C  CD1   . ILE B 2  8   ? -3.805  -37.778 54.043 1.00 78.14  ? 26  ILE B CD1   1 
ATOM   885   N  N     . GLN B 2  9   ? -0.072  -39.835 56.915 1.00 70.45  ? 27  GLN B N     1 
ATOM   886   C  CA    . GLN B 2  9   ? 0.486   -39.488 58.215 1.00 72.60  ? 27  GLN B CA    1 
ATOM   887   C  C     . GLN B 2  9   ? 1.628   -38.489 58.110 1.00 65.89  ? 27  GLN B C     1 
ATOM   888   O  O     . GLN B 2  9   ? 2.094   -38.000 59.144 1.00 62.38  ? 27  GLN B O     1 
ATOM   889   C  CB    . GLN B 2  9   ? 0.975   -40.745 58.932 1.00 76.53  ? 27  GLN B CB    1 
ATOM   890   C  CG    . GLN B 2  9   ? -0.107  -41.776 59.149 1.00 78.90  ? 27  GLN B CG    1 
ATOM   891   C  CD    . GLN B 2  9   ? -1.260  -41.231 59.962 1.00 81.54  ? 27  GLN B CD    1 
ATOM   892   O  OE1   . GLN B 2  9   ? -1.059  -40.548 60.967 1.00 80.95  ? 27  GLN B OE1   1 
ATOM   893   N  NE2   . GLN B 2  9   ? -2.478  -41.520 59.524 1.00 82.83  ? 27  GLN B NE2   1 
ATOM   894   N  N     . GLY B 2  10  ? 2.098   -38.192 56.894 1.00 65.20  ? 28  GLY B N     1 
ATOM   895   C  CA    . GLY B 2  10  ? 3.110   -37.162 56.729 1.00 66.75  ? 28  GLY B CA    1 
ATOM   896   C  C     . GLY B 2  10  ? 2.632   -35.796 57.177 1.00 68.65  ? 28  GLY B C     1 
ATOM   897   O  O     . GLY B 2  10  ? 3.422   -34.980 57.655 1.00 69.92  ? 28  GLY B O     1 
ATOM   898   N  N     . ILE B 2  11  ? 1.340   -35.525 57.028 1.00 63.30  ? 29  ILE B N     1 
ATOM   899   C  CA    . ILE B 2  11  ? 0.730   -34.309 57.549 1.00 62.05  ? 29  ILE B CA    1 
ATOM   900   C  C     . ILE B 2  11  ? 0.672   -34.437 59.061 1.00 61.18  ? 29  ILE B C     1 
ATOM   901   O  O     . ILE B 2  11  ? -0.317  -34.924 59.618 1.00 62.32  ? 29  ILE B O     1 
ATOM   902   C  CB    . ILE B 2  11  ? -0.670  -34.087 56.956 1.00 66.44  ? 29  ILE B CB    1 
ATOM   903   C  CG1   . ILE B 2  11  ? -0.605  -34.180 55.436 1.00 66.92  ? 29  ILE B CG1   1 
ATOM   904   C  CG2   . ILE B 2  11  ? -1.205  -32.741 57.370 1.00 73.33  ? 29  ILE B CG2   1 
ATOM   905   C  CD1   . ILE B 2  11  ? -1.713  -34.987 54.859 1.00 73.01  ? 29  ILE B CD1   1 
ATOM   906   N  N     . THR B 2  12  ? 1.738   -34.017 59.731 1.00 58.03  ? 30  THR B N     1 
ATOM   907   C  CA    . THR B 2  12  ? 1.854   -34.225 61.162 1.00 59.28  ? 30  THR B CA    1 
ATOM   908   C  C     . THR B 2  12  ? 0.812   -33.399 61.914 1.00 63.02  ? 30  THR B C     1 
ATOM   909   O  O     . THR B 2  12  ? 0.153   -32.513 61.359 1.00 65.49  ? 30  THR B O     1 
ATOM   910   C  CB    . THR B 2  12  ? 3.266   -33.877 61.637 1.00 59.36  ? 30  THR B CB    1 
ATOM   911   O  OG1   . THR B 2  12  ? 3.543   -32.497 61.366 1.00 63.61  ? 30  THR B OG1   1 
ATOM   912   C  CG2   . THR B 2  12  ? 4.290   -34.742 60.908 1.00 53.31  ? 30  THR B CG2   1 
ATOM   913   N  N     . LYS B 2  13  ? 0.649   -33.732 63.191 1.00 65.00  ? 31  LYS B N     1 
ATOM   914   C  CA    . LYS B 2  13  ? -0.251  -32.962 64.052 1.00 65.35  ? 31  LYS B CA    1 
ATOM   915   C  C     . LYS B 2  13  ? 0.132   -31.490 64.139 1.00 68.97  ? 31  LYS B C     1 
ATOM   916   O  O     . LYS B 2  13  ? -0.770  -30.636 64.027 1.00 66.56  ? 31  LYS B O     1 
ATOM   917   C  CB    . LYS B 2  13  ? -0.299  -33.618 65.436 1.00 62.09  ? 31  LYS B CB    1 
ATOM   918   C  CG    . LYS B 2  13  ? -1.103  -32.867 66.480 1.00 65.11  ? 31  LYS B CG    1 
ATOM   919   C  CD    . LYS B 2  13  ? -1.015  -33.571 67.828 1.00 70.61  ? 31  LYS B CD    1 
ATOM   920   C  CE    . LYS B 2  13  ? -1.749  -32.802 68.918 1.00 78.20  ? 31  LYS B CE    1 
ATOM   921   N  NZ    . LYS B 2  13  ? -1.675  -33.496 70.235 1.00 78.89  ? 31  LYS B NZ    1 
ATOM   922   N  N     . PRO B 2  14  ? 1.402   -31.105 64.327 1.00 68.97  ? 32  PRO B N     1 
ATOM   923   C  CA    . PRO B 2  14  ? 1.719   -29.668 64.365 1.00 73.07  ? 32  PRO B CA    1 
ATOM   924   C  C     . PRO B 2  14  ? 1.475   -28.954 63.045 1.00 70.92  ? 32  PRO B C     1 
ATOM   925   O  O     . PRO B 2  14  ? 1.172   -27.754 63.052 1.00 74.30  ? 32  PRO B O     1 
ATOM   926   C  CB    . PRO B 2  14  ? 3.204   -29.644 64.754 1.00 78.99  ? 32  PRO B CB    1 
ATOM   927   C  CG    . PRO B 2  14  ? 3.719   -30.974 64.350 1.00 72.09  ? 32  PRO B CG    1 
ATOM   928   C  CD    . PRO B 2  14  ? 2.598   -31.923 64.609 1.00 68.91  ? 32  PRO B CD    1 
ATOM   929   N  N     . ALA B 2  15  ? 1.600   -29.648 61.911 1.00 64.53  ? 33  ALA B N     1 
ATOM   930   C  CA    . ALA B 2  15  ? 1.324   -29.009 60.629 1.00 58.52  ? 33  ALA B CA    1 
ATOM   931   C  C     . ALA B 2  15  ? -0.154  -28.665 60.494 1.00 63.94  ? 33  ALA B C     1 
ATOM   932   O  O     . ALA B 2  15  ? -0.503  -27.565 60.047 1.00 73.02  ? 33  ALA B O     1 
ATOM   933   C  CB    . ALA B 2  15  ? 1.776   -29.910 59.481 1.00 54.13  ? 33  ALA B CB    1 
ATOM   934   N  N     . ILE B 2  16  ? -1.038  -29.591 60.874 1.00 62.97  ? 34  ILE B N     1 
ATOM   935   C  CA    . ILE B 2  16  ? -2.465  -29.284 60.917 1.00 61.90  ? 34  ILE B CA    1 
ATOM   936   C  C     . ILE B 2  16  ? -2.728  -28.157 61.907 1.00 66.46  ? 34  ILE B C     1 
ATOM   937   O  O     . ILE B 2  16  ? -3.592  -27.300 61.685 1.00 70.80  ? 34  ILE B O     1 
ATOM   938   C  CB    . ILE B 2  16  ? -3.274  -30.546 61.272 1.00 61.59  ? 34  ILE B CB    1 
ATOM   939   C  CG1   . ILE B 2  16  ? -3.020  -31.655 60.250 1.00 62.82  ? 34  ILE B CG1   1 
ATOM   940   C  CG2   . ILE B 2  16  ? -4.761  -30.228 61.365 1.00 57.58  ? 34  ILE B CG2   1 
ATOM   941   C  CD1   . ILE B 2  16  ? -3.774  -32.933 60.538 1.00 62.72  ? 34  ILE B CD1   1 
ATOM   942   N  N     . ARG B 2  17  ? -1.976  -28.137 63.009 1.00 65.81  ? 35  ARG B N     1 
ATOM   943   C  CA    . ARG B 2  17  ? -2.158  -27.102 64.019 1.00 66.09  ? 35  ARG B CA    1 
ATOM   944   C  C     . ARG B 2  17  ? -1.815  -25.723 63.468 1.00 67.16  ? 35  ARG B C     1 
ATOM   945   O  O     . ARG B 2  17  ? -2.542  -24.752 63.709 1.00 65.62  ? 35  ARG B O     1 
ATOM   946   C  CB    . ARG B 2  17  ? -1.303  -27.426 65.244 1.00 71.73  ? 35  ARG B CB    1 
ATOM   947   C  CG    . ARG B 2  17  ? -1.463  -26.451 66.393 1.00 84.07  ? 35  ARG B CG    1 
ATOM   948   C  CD    . ARG B 2  17  ? -0.448  -26.730 67.489 1.00 88.69  ? 35  ARG B CD    1 
ATOM   949   N  NE    . ARG B 2  17  ? -0.596  -28.069 68.049 1.00 90.55  ? 35  ARG B NE    1 
ATOM   950   C  CZ    . ARG B 2  17  ? -1.381  -28.364 69.080 1.00 96.60  ? 35  ARG B CZ    1 
ATOM   951   N  NH1   . ARG B 2  17  ? -2.095  -27.414 69.667 1.00 99.36  ? 35  ARG B NH1   1 
ATOM   952   N  NH2   . ARG B 2  17  ? -1.452  -29.610 69.526 1.00 100.09 ? 35  ARG B NH2   1 
ATOM   953   N  N     . ARG B 2  18  ? -0.712  -25.617 62.720 1.00 63.93  ? 36  ARG B N     1 
ATOM   954   C  CA    . ARG B 2  18  ? -0.337  -24.332 62.136 1.00 54.74  ? 36  ARG B CA    1 
ATOM   955   C  C     . ARG B 2  18  ? -1.389  -23.848 61.147 1.00 57.46  ? 36  ARG B C     1 
ATOM   956   O  O     . ARG B 2  18  ? -1.714  -22.656 61.110 1.00 62.40  ? 36  ARG B O     1 
ATOM   957   C  CB    . ARG B 2  18  ? 1.028   -24.436 61.456 1.00 49.75  ? 36  ARG B CB    1 
ATOM   958   C  CG    . ARG B 2  18  ? 2.187   -24.641 62.413 1.00 53.61  ? 36  ARG B CG    1 
ATOM   959   C  CD    . ARG B 2  18  ? 3.520   -24.560 61.684 1.00 58.84  ? 36  ARG B CD    1 
ATOM   960   N  NE    . ARG B 2  18  ? 3.686   -25.630 60.705 1.00 65.19  ? 36  ARG B NE    1 
ATOM   961   C  CZ    . ARG B 2  18  ? 4.349   -26.760 60.938 1.00 60.81  ? 36  ARG B CZ    1 
ATOM   962   N  NH1   . ARG B 2  18  ? 4.912   -26.968 62.120 1.00 62.61  ? 36  ARG B NH1   1 
ATOM   963   N  NH2   . ARG B 2  18  ? 4.453   -27.679 59.987 1.00 50.97  ? 36  ARG B NH2   1 
ATOM   964   N  N     . LEU B 2  19  ? -1.933  -24.760 60.335 1.00 56.24  ? 37  LEU B N     1 
ATOM   965   C  CA    . LEU B 2  19  ? -2.985  -24.381 59.397 1.00 53.31  ? 37  LEU B CA    1 
ATOM   966   C  C     . LEU B 2  19  ? -4.217  -23.863 60.129 1.00 56.52  ? 37  LEU B C     1 
ATOM   967   O  O     . LEU B 2  19  ? -4.889  -22.940 59.655 1.00 60.69  ? 37  LEU B O     1 
ATOM   968   C  CB    . LEU B 2  19  ? -3.350  -25.572 58.511 1.00 55.99  ? 37  LEU B CB    1 
ATOM   969   C  CG    . LEU B 2  19  ? -2.258  -26.120 57.591 1.00 57.41  ? 37  LEU B CG    1 
ATOM   970   C  CD1   . LEU B 2  19  ? -2.660  -27.484 57.055 1.00 56.73  ? 37  LEU B CD1   1 
ATOM   971   C  CD2   . LEU B 2  19  ? -1.984  -25.157 56.444 1.00 54.27  ? 37  LEU B CD2   1 
ATOM   972   N  N     . ALA B 2  20  ? -4.528  -24.445 61.291 1.00 57.55  ? 38  ALA B N     1 
ATOM   973   C  CA    . ALA B 2  20  ? -5.653  -23.952 62.076 1.00 55.21  ? 38  ALA B CA    1 
ATOM   974   C  C     . ALA B 2  20  ? -5.333  -22.618 62.737 1.00 59.85  ? 38  ALA B C     1 
ATOM   975   O  O     . ALA B 2  20  ? -6.230  -21.786 62.910 1.00 59.35  ? 38  ALA B O     1 
ATOM   976   C  CB    . ALA B 2  20  ? -6.057  -24.983 63.128 1.00 50.80  ? 38  ALA B CB    1 
ATOM   977   N  N     . ARG B 2  21  ? -4.071  -22.398 63.114 1.00 61.28  ? 39  ARG B N     1 
ATOM   978   C  CA    . ARG B 2  21  ? -3.684  -21.117 63.698 1.00 57.15  ? 39  ARG B CA    1 
ATOM   979   C  C     . ARG B 2  21  ? -3.836  -19.989 62.686 1.00 58.10  ? 39  ARG B C     1 
ATOM   980   O  O     . ARG B 2  21  ? -4.370  -18.920 63.005 1.00 58.35  ? 39  ARG B O     1 
ATOM   981   C  CB    . ARG B 2  21  ? -2.246  -21.185 64.214 1.00 53.94  ? 39  ARG B CB    1 
ATOM   982   C  CG    . ARG B 2  21  ? -2.044  -22.095 65.414 1.00 60.58  ? 39  ARG B CG    1 
ATOM   983   C  CD    . ARG B 2  21  ? -2.724  -21.553 66.659 1.00 66.85  ? 39  ARG B CD    1 
ATOM   984   N  NE    . ARG B 2  21  ? -2.405  -22.354 67.839 1.00 73.81  ? 39  ARG B NE    1 
ATOM   985   C  CZ    . ARG B 2  21  ? -3.166  -23.340 68.304 1.00 73.83  ? 39  ARG B CZ    1 
ATOM   986   N  NH1   . ARG B 2  21  ? -4.301  -23.647 67.693 1.00 74.61  ? 39  ARG B NH1   1 
ATOM   987   N  NH2   . ARG B 2  21  ? -2.794  -24.019 69.382 1.00 72.75  ? 39  ARG B NH2   1 
ATOM   988   N  N     . ARG B 2  22  ? -3.369  -20.210 61.454 1.00 54.18  ? 40  ARG B N     1 
ATOM   989   C  CA    . ARG B 2  22  ? -3.598  -19.228 60.400 1.00 53.91  ? 40  ARG B CA    1 
ATOM   990   C  C     . ARG B 2  22  ? -5.088  -19.041 60.139 1.00 56.16  ? 40  ARG B C     1 
ATOM   991   O  O     . ARG B 2  22  ? -5.522  -17.941 59.778 1.00 63.12  ? 40  ARG B O     1 
ATOM   992   C  CB    . ARG B 2  22  ? -2.872  -19.646 59.120 1.00 51.57  ? 40  ARG B CB    1 
ATOM   993   C  CG    . ARG B 2  22  ? -2.932  -18.613 58.000 1.00 46.20  ? 40  ARG B CG    1 
ATOM   994   C  CD    . ARG B 2  22  ? -1.913  -18.913 56.914 1.00 42.59  ? 40  ARG B CD    1 
ATOM   995   N  NE    . ARG B 2  22  ? -0.543  -18.779 57.403 1.00 44.62  ? 40  ARG B NE    1 
ATOM   996   C  CZ    . ARG B 2  22  ? 0.536   -19.150 56.722 1.00 50.68  ? 40  ARG B CZ    1 
ATOM   997   N  NH1   . ARG B 2  22  ? 0.412   -19.691 55.517 1.00 53.21  ? 40  ARG B NH1   1 
ATOM   998   N  NH2   . ARG B 2  22  ? 1.743   -18.986 57.246 1.00 55.08  ? 40  ARG B NH2   1 
ATOM   999   N  N     . GLY B 2  23  ? -5.888  -20.091 60.331 1.00 48.50  ? 41  GLY B N     1 
ATOM   1000  C  CA    . GLY B 2  23  ? -7.329  -19.966 60.245 1.00 44.69  ? 41  GLY B CA    1 
ATOM   1001  C  C     . GLY B 2  23  ? -7.982  -19.312 61.443 1.00 46.65  ? 41  GLY B C     1 
ATOM   1002  O  O     . GLY B 2  23  ? -9.212  -19.192 61.466 1.00 45.13  ? 41  GLY B O     1 
ATOM   1003  N  N     . GLY B 2  24  ? -7.201  -18.891 62.435 1.00 48.99  ? 42  GLY B N     1 
ATOM   1004  C  CA    . GLY B 2  24  ? -7.760  -18.228 63.600 1.00 57.17  ? 42  GLY B CA    1 
ATOM   1005  C  C     . GLY B 2  24  ? -8.434  -19.149 64.591 1.00 65.89  ? 42  GLY B C     1 
ATOM   1006  O  O     . GLY B 2  24  ? -9.438  -18.765 65.202 1.00 70.23  ? 42  GLY B O     1 
ATOM   1007  N  N     . VAL B 2  25  ? -7.903  -20.356 64.779 1.00 68.47  ? 43  VAL B N     1 
ATOM   1008  C  CA    . VAL B 2  25  ? -8.475  -21.348 65.681 1.00 62.98  ? 43  VAL B CA    1 
ATOM   1009  C  C     . VAL B 2  25  ? -7.622  -21.407 66.940 1.00 61.97  ? 43  VAL B C     1 
ATOM   1010  O  O     . VAL B 2  25  ? -6.396  -21.555 66.859 1.00 57.98  ? 43  VAL B O     1 
ATOM   1011  C  CB    . VAL B 2  25  ? -8.566  -22.728 65.011 1.00 60.19  ? 43  VAL B CB    1 
ATOM   1012  C  CG1   . VAL B 2  25  ? -9.102  -23.756 65.992 1.00 64.18  ? 43  VAL B CG1   1 
ATOM   1013  C  CG2   . VAL B 2  25  ? -9.440  -22.653 63.768 1.00 53.26  ? 43  VAL B CG2   1 
ATOM   1014  N  N     . LYS B 2  26  ? -8.270  -21.299 68.101 1.00 65.29  ? 44  LYS B N     1 
ATOM   1015  C  CA    . LYS B 2  26  ? -7.567  -21.250 69.380 1.00 70.53  ? 44  LYS B CA    1 
ATOM   1016  C  C     . LYS B 2  26  ? -7.359  -22.645 69.968 1.00 80.20  ? 44  LYS B C     1 
ATOM   1017  O  O     . LYS B 2  26  ? -6.219  -23.078 70.163 1.00 83.67  ? 44  LYS B O     1 
ATOM   1018  C  CB    . LYS B 2  26  ? -8.334  -20.359 70.363 1.00 72.18  ? 44  LYS B CB    1 
ATOM   1019  C  CG    . LYS B 2  26  ? -7.639  -20.160 71.699 1.00 79.26  ? 44  LYS B CG    1 
ATOM   1020  C  CD    . LYS B 2  26  ? -8.456  -19.261 72.615 1.00 85.43  ? 44  LYS B CD    1 
ATOM   1021  C  CE    . LYS B 2  26  ? -7.789  -19.095 73.970 1.00 91.05  ? 44  LYS B CE    1 
ATOM   1022  N  NZ    . LYS B 2  26  ? -8.592  -18.230 74.878 1.00 93.93  ? 44  LYS B NZ    1 
ATOM   1023  N  N     . ARG B 2  27  ? -8.447  -23.353 70.262 1.00 82.22  ? 45  ARG B N     1 
ATOM   1024  C  CA    . ARG B 2  27  ? -8.380  -24.698 70.816 1.00 82.40  ? 45  ARG B CA    1 
ATOM   1025  C  C     . ARG B 2  27  ? -8.858  -25.706 69.777 1.00 80.14  ? 45  ARG B C     1 
ATOM   1026  O  O     . ARG B 2  27  ? -9.761  -25.417 68.986 1.00 76.82  ? 45  ARG B O     1 
ATOM   1027  C  CB    . ARG B 2  27  ? -9.215  -24.812 72.097 1.00 84.49  ? 45  ARG B CB    1 
ATOM   1028  C  CG    . ARG B 2  27  ? -8.549  -25.648 73.183 1.00 89.28  ? 45  ARG B CG    1 
ATOM   1029  C  CD    . ARG B 2  27  ? -9.389  -25.748 74.449 1.00 93.84  ? 45  ARG B CD    1 
ATOM   1030  N  NE    . ARG B 2  27  ? -9.856  -27.113 74.677 1.00 101.84 ? 45  ARG B NE    1 
ATOM   1031  C  CZ    . ARG B 2  27  ? -10.347 -27.556 75.830 1.00 108.71 ? 45  ARG B CZ    1 
ATOM   1032  N  NH1   . ARG B 2  27  ? -10.431 -26.744 76.873 1.00 108.77 ? 45  ARG B NH1   1 
ATOM   1033  N  NH2   . ARG B 2  27  ? -10.746 -28.817 75.945 1.00 116.28 ? 45  ARG B NH2   1 
ATOM   1034  N  N     . ILE B 2  28  ? -8.243  -26.889 69.782 1.00 79.31  ? 46  ILE B N     1 
ATOM   1035  C  CA    . ILE B 2  28  ? -8.468  -27.911 68.766 1.00 75.01  ? 46  ILE B CA    1 
ATOM   1036  C  C     . ILE B 2  28  ? -8.758  -29.237 69.456 1.00 76.48  ? 46  ILE B C     1 
ATOM   1037  O  O     . ILE B 2  28  ? -8.035  -29.632 70.377 1.00 79.05  ? 46  ILE B O     1 
ATOM   1038  C  CB    . ILE B 2  28  ? -7.254  -28.054 67.827 1.00 72.09  ? 46  ILE B CB    1 
ATOM   1039  C  CG1   . ILE B 2  28  ? -6.937  -26.725 67.139 1.00 68.41  ? 46  ILE B CG1   1 
ATOM   1040  C  CG2   . ILE B 2  28  ? -7.497  -29.145 66.797 1.00 73.92  ? 46  ILE B CG2   1 
ATOM   1041  C  CD1   . ILE B 2  28  ? -5.687  -26.771 66.289 1.00 65.30  ? 46  ILE B CD1   1 
ATOM   1042  N  N     . SER B 2  29  ? -9.802  -29.927 69.001 1.00 76.92  ? 47  SER B N     1 
ATOM   1043  C  CA    . SER B 2  29  ? -10.129 -31.241 69.535 1.00 78.92  ? 47  SER B CA    1 
ATOM   1044  C  C     . SER B 2  29  ? -9.132  -32.289 69.044 1.00 78.58  ? 47  SER B C     1 
ATOM   1045  O  O     . SER B 2  29  ? -8.458  -32.122 68.024 1.00 78.80  ? 47  SER B O     1 
ATOM   1046  C  CB    . SER B 2  29  ? -11.549 -31.645 69.136 1.00 83.02  ? 47  SER B CB    1 
ATOM   1047  O  OG    . SER B 2  29  ? -11.803 -33.004 69.445 1.00 87.81  ? 47  SER B OG    1 
ATOM   1048  N  N     . GLY B 2  30  ? -9.053  -33.394 69.790 1.00 79.42  ? 48  GLY B N     1 
ATOM   1049  C  CA    . GLY B 2  30  ? -8.097  -34.437 69.458 1.00 75.48  ? 48  GLY B CA    1 
ATOM   1050  C  C     . GLY B 2  30  ? -8.452  -35.215 68.207 1.00 69.53  ? 48  GLY B C     1 
ATOM   1051  O  O     . GLY B 2  30  ? -7.562  -35.716 67.513 1.00 65.80  ? 48  GLY B O     1 
ATOM   1052  N  N     . LEU B 2  31  ? -9.743  -35.333 67.902 1.00 69.12  ? 49  LEU B N     1 
ATOM   1053  C  CA    . LEU B 2  31  ? -10.192 -36.047 66.713 1.00 70.07  ? 49  LEU B CA    1 
ATOM   1054  C  C     . LEU B 2  31  ? -10.146 -35.193 65.453 1.00 72.66  ? 49  LEU B C     1 
ATOM   1055  O  O     . LEU B 2  31  ? -10.492 -35.691 64.376 1.00 76.93  ? 49  LEU B O     1 
ATOM   1056  C  CB    . LEU B 2  31  ? -11.614 -36.574 66.925 1.00 73.57  ? 49  LEU B CB    1 
ATOM   1057  C  CG    . LEU B 2  31  ? -11.847 -37.482 68.133 1.00 74.89  ? 49  LEU B CG    1 
ATOM   1058  C  CD1   . LEU B 2  31  ? -13.318 -37.854 68.246 1.00 71.08  ? 49  LEU B CD1   1 
ATOM   1059  C  CD2   . LEU B 2  31  ? -10.980 -38.728 68.041 1.00 77.75  ? 49  LEU B CD2   1 
ATOM   1060  N  N     . ILE B 2  32  ? -9.734  -33.928 65.559 1.00 69.15  ? 50  ILE B N     1 
ATOM   1061  C  CA    . ILE B 2  32  ? -9.669  -33.057 64.390 1.00 64.77  ? 50  ILE B CA    1 
ATOM   1062  C  C     . ILE B 2  32  ? -8.594  -33.533 63.421 1.00 65.57  ? 50  ILE B C     1 
ATOM   1063  O  O     . ILE B 2  32  ? -8.767  -33.466 62.197 1.00 69.67  ? 50  ILE B O     1 
ATOM   1064  C  CB    . ILE B 2  32  ? -9.432  -31.599 64.831 1.00 62.03  ? 50  ILE B CB    1 
ATOM   1065  C  CG1   . ILE B 2  32  ? -10.748 -30.935 65.239 1.00 59.63  ? 50  ILE B CG1   1 
ATOM   1066  C  CG2   . ILE B 2  32  ? -8.747  -30.795 63.731 1.00 54.56  ? 50  ILE B CG2   1 
ATOM   1067  C  CD1   . ILE B 2  32  ? -11.672 -30.654 64.073 1.00 54.30  ? 50  ILE B CD1   1 
ATOM   1068  N  N     . TYR B 2  33  ? -7.477  -34.042 63.948 1.00 62.99  ? 51  TYR B N     1 
ATOM   1069  C  CA    . TYR B 2  33  ? -6.320  -34.329 63.105 1.00 62.88  ? 51  TYR B CA    1 
ATOM   1070  C  C     . TYR B 2  33  ? -6.606  -35.454 62.118 1.00 68.23  ? 51  TYR B C     1 
ATOM   1071  O  O     . TYR B 2  33  ? -6.225  -35.365 60.945 1.00 74.90  ? 51  TYR B O     1 
ATOM   1072  C  CB    . TYR B 2  33  ? -5.113  -34.656 63.981 1.00 63.70  ? 51  TYR B CB    1 
ATOM   1073  C  CG    . TYR B 2  33  ? -4.865  -33.600 65.032 1.00 68.66  ? 51  TYR B CG    1 
ATOM   1074  C  CD1   . TYR B 2  33  ? -4.400  -32.339 64.679 1.00 69.06  ? 51  TYR B CD1   1 
ATOM   1075  C  CD2   . TYR B 2  33  ? -5.115  -33.855 66.375 1.00 70.51  ? 51  TYR B CD2   1 
ATOM   1076  C  CE1   . TYR B 2  33  ? -4.182  -31.363 65.632 1.00 67.06  ? 51  TYR B CE1   1 
ATOM   1077  C  CE2   . TYR B 2  33  ? -4.899  -32.885 67.336 1.00 73.28  ? 51  TYR B CE2   1 
ATOM   1078  C  CZ    . TYR B 2  33  ? -4.432  -31.642 66.959 1.00 69.90  ? 51  TYR B CZ    1 
ATOM   1079  O  OH    . TYR B 2  33  ? -4.215  -30.675 67.914 1.00 69.64  ? 51  TYR B OH    1 
ATOM   1080  N  N     . GLU B 2  34  ? -7.278  -36.518 62.563 1.00 68.55  ? 52  GLU B N     1 
ATOM   1081  C  CA    . GLU B 2  34  ? -7.666  -37.565 61.625 1.00 68.88  ? 52  GLU B CA    1 
ATOM   1082  C  C     . GLU B 2  34  ? -8.753  -37.086 60.672 1.00 63.65  ? 52  GLU B C     1 
ATOM   1083  O  O     . GLU B 2  34  ? -8.788  -37.511 59.512 1.00 64.09  ? 52  GLU B O     1 
ATOM   1084  C  CB    . GLU B 2  34  ? -8.126  -38.814 62.376 1.00 78.08  ? 52  GLU B CB    1 
ATOM   1085  C  CG    . GLU B 2  34  ? -6.990  -39.749 62.764 1.00 83.80  ? 52  GLU B CG    1 
ATOM   1086  C  CD    . GLU B 2  34  ? -6.215  -40.256 61.558 1.00 86.83  ? 52  GLU B CD    1 
ATOM   1087  O  OE1   . GLU B 2  34  ? -6.833  -40.466 60.491 1.00 85.88  ? 52  GLU B OE1   1 
ATOM   1088  O  OE2   . GLU B 2  34  ? -4.984  -40.437 61.675 1.00 89.96  ? 52  GLU B OE2   1 
ATOM   1089  N  N     . GLU B 2  35  ? -9.639  -36.203 61.134 1.00 60.64  ? 53  GLU B N     1 
ATOM   1090  C  CA    . GLU B 2  35  ? -10.663 -35.661 60.247 1.00 60.29  ? 53  GLU B CA    1 
ATOM   1091  C  C     . GLU B 2  35  ? -10.042 -34.786 59.164 1.00 58.89  ? 53  GLU B C     1 
ATOM   1092  O  O     . GLU B 2  35  ? -10.448 -34.852 57.998 1.00 60.54  ? 53  GLU B O     1 
ATOM   1093  C  CB    . GLU B 2  35  ? -11.695 -34.873 61.054 1.00 63.76  ? 53  GLU B CB    1 
ATOM   1094  C  CG    . GLU B 2  35  ? -13.003 -34.613 60.321 1.00 71.28  ? 53  GLU B CG    1 
ATOM   1095  C  CD    . GLU B 2  35  ? -13.951 -35.799 60.369 1.00 80.89  ? 53  GLU B CD    1 
ATOM   1096  O  OE1   . GLU B 2  35  ? -13.597 -36.826 60.987 1.00 89.12  ? 53  GLU B OE1   1 
ATOM   1097  O  OE2   . GLU B 2  35  ? -15.054 -35.703 59.791 1.00 81.39  ? 53  GLU B OE2   1 
ATOM   1098  N  N     . THR B 2  36  ? -9.048  -33.969 59.530 1.00 55.78  ? 54  THR B N     1 
ATOM   1099  C  CA    . THR B 2  36  ? -8.399  -33.100 58.552 1.00 56.52  ? 54  THR B CA    1 
ATOM   1100  C  C     . THR B 2  36  ? -7.647  -33.911 57.503 1.00 57.34  ? 54  THR B C     1 
ATOM   1101  O  O     . THR B 2  36  ? -7.650  -33.558 56.318 1.00 61.22  ? 54  THR B O     1 
ATOM   1102  C  CB    . THR B 2  36  ? -7.454  -32.125 59.257 1.00 54.88  ? 54  THR B CB    1 
ATOM   1103  O  OG1   . THR B 2  36  ? -8.181  -31.377 60.241 1.00 49.77  ? 54  THR B OG1   1 
ATOM   1104  C  CG2   . THR B 2  36  ? -6.835  -31.155 58.255 1.00 47.97  ? 54  THR B CG2   1 
ATOM   1105  N  N     . ARG B 2  37  ? -6.996  -35.002 57.918 1.00 58.87  ? 55  ARG B N     1 
ATOM   1106  C  CA    . ARG B 2  37  ? -6.316  -35.861 56.954 1.00 54.97  ? 55  ARG B CA    1 
ATOM   1107  C  C     . ARG B 2  37  ? -7.302  -36.454 55.956 1.00 55.38  ? 55  ARG B C     1 
ATOM   1108  O  O     . ARG B 2  37  ? -7.003  -36.549 54.759 1.00 57.17  ? 55  ARG B O     1 
ATOM   1109  C  CB    . ARG B 2  37  ? -5.554  -36.970 57.680 1.00 51.89  ? 55  ARG B CB    1 
ATOM   1110  C  CG    . ARG B 2  37  ? -4.395  -36.480 58.528 1.00 53.95  ? 55  ARG B CG    1 
ATOM   1111  C  CD    . ARG B 2  37  ? -3.607  -37.644 59.105 1.00 61.36  ? 55  ARG B CD    1 
ATOM   1112  N  NE    . ARG B 2  37  ? -2.559  -37.201 60.019 1.00 68.68  ? 55  ARG B NE    1 
ATOM   1113  C  CZ    . ARG B 2  37  ? -2.700  -37.129 61.339 1.00 75.53  ? 55  ARG B CZ    1 
ATOM   1114  N  NH1   . ARG B 2  37  ? -3.849  -37.475 61.903 1.00 75.66  ? 55  ARG B NH1   1 
ATOM   1115  N  NH2   . ARG B 2  37  ? -1.691  -36.713 62.095 1.00 80.20  ? 55  ARG B NH2   1 
ATOM   1116  N  N     . GLY B 2  38  ? -8.485  -36.852 56.428 1.00 58.50  ? 56  GLY B N     1 
ATOM   1117  C  CA    . GLY B 2  38  ? -9.494  -37.371 55.521 1.00 58.79  ? 56  GLY B CA    1 
ATOM   1118  C  C     . GLY B 2  38  ? -10.016 -36.313 54.568 1.00 61.93  ? 56  GLY B C     1 
ATOM   1119  O  O     . GLY B 2  38  ? -10.245 -36.588 53.387 1.00 63.13  ? 56  GLY B O     1 
ATOM   1120  N  N     . VAL B 2  39  ? -10.209 -35.089 55.066 1.00 61.17  ? 57  VAL B N     1 
ATOM   1121  C  CA    . VAL B 2  39  ? -10.650 -33.998 54.203 1.00 57.40  ? 57  VAL B CA    1 
ATOM   1122  C  C     . VAL B 2  39  ? -9.586  -33.676 53.161 1.00 53.86  ? 57  VAL B C     1 
ATOM   1123  O  O     . VAL B 2  39  ? -9.896  -33.467 51.981 1.00 50.31  ? 57  VAL B O     1 
ATOM   1124  C  CB    . VAL B 2  39  ? -11.010 -32.759 55.044 1.00 58.79  ? 57  VAL B CB    1 
ATOM   1125  C  CG1   . VAL B 2  39  ? -11.239 -31.551 54.143 1.00 60.28  ? 57  VAL B CG1   1 
ATOM   1126  C  CG2   . VAL B 2  39  ? -12.241 -33.032 55.895 1.00 56.77  ? 57  VAL B CG2   1 
ATOM   1127  N  N     . LEU B 2  40  ? -8.316  -33.636 53.572 1.00 50.75  ? 58  LEU B N     1 
ATOM   1128  C  CA    . LEU B 2  40  ? -7.257  -33.304 52.625 1.00 48.81  ? 58  LEU B CA    1 
ATOM   1129  C  C     . LEU B 2  40  ? -7.090  -34.394 51.574 1.00 56.55  ? 58  LEU B C     1 
ATOM   1130  O  O     . LEU B 2  40  ? -6.859  -34.098 50.395 1.00 58.07  ? 58  LEU B O     1 
ATOM   1131  C  CB    . LEU B 2  40  ? -5.943  -33.069 53.364 1.00 44.20  ? 58  LEU B CB    1 
ATOM   1132  C  CG    . LEU B 2  40  ? -4.812  -32.603 52.452 1.00 52.36  ? 58  LEU B CG    1 
ATOM   1133  C  CD1   . LEU B 2  40  ? -5.186  -31.272 51.791 1.00 60.54  ? 58  LEU B CD1   1 
ATOM   1134  C  CD2   . LEU B 2  40  ? -3.503  -32.511 53.226 1.00 54.74  ? 58  LEU B CD2   1 
ATOM   1135  N  N     . LYS B 2  41  ? -7.201  -35.661 51.980 1.00 59.53  ? 59  LYS B N     1 
ATOM   1136  C  CA    . LYS B 2  41  ? -7.082  -36.751 51.018 1.00 60.17  ? 59  LYS B CA    1 
ATOM   1137  C  C     . LYS B 2  41  ? -8.195  -36.688 49.980 1.00 53.83  ? 59  LYS B C     1 
ATOM   1138  O  O     . LYS B 2  41  ? -7.954  -36.909 48.789 1.00 45.41  ? 59  LYS B O     1 
ATOM   1139  C  CB    . LYS B 2  41  ? -7.090  -38.098 51.739 1.00 67.31  ? 59  LYS B CB    1 
ATOM   1140  C  CG    . LYS B 2  41  ? -6.853  -39.286 50.821 1.00 74.36  ? 59  LYS B CG    1 
ATOM   1141  C  CD    . LYS B 2  41  ? -6.746  -40.583 51.607 1.00 77.38  ? 59  LYS B CD    1 
ATOM   1142  C  CE    . LYS B 2  41  ? -6.440  -41.758 50.695 1.00 78.39  ? 59  LYS B CE    1 
ATOM   1143  N  NZ    . LYS B 2  41  ? -6.303  -43.027 51.462 1.00 81.78  ? 59  LYS B NZ    1 
ATOM   1144  N  N     . VAL B 2  42  ? -9.419  -36.375 50.413 1.00 56.64  ? 60  VAL B N     1 
ATOM   1145  C  CA    . VAL B 2  42  ? -10.524 -36.219 49.472 1.00 54.24  ? 60  VAL B CA    1 
ATOM   1146  C  C     . VAL B 2  42  ? -10.280 -35.026 48.558 1.00 58.43  ? 60  VAL B C     1 
ATOM   1147  O  O     . VAL B 2  42  ? -10.569 -35.078 47.355 1.00 59.04  ? 60  VAL B O     1 
ATOM   1148  C  CB    . VAL B 2  42  ? -11.860 -36.093 50.229 1.00 53.70  ? 60  VAL B CB    1 
ATOM   1149  C  CG1   . VAL B 2  42  ? -12.989 -35.731 49.273 1.00 52.47  ? 60  VAL B CG1   1 
ATOM   1150  C  CG2   . VAL B 2  42  ? -12.182 -37.385 50.960 1.00 60.27  ? 60  VAL B CG2   1 
ATOM   1151  N  N     . PHE B 2  43  ? -9.736  -33.936 49.109 1.00 58.72  ? 61  PHE B N     1 
ATOM   1152  C  CA    . PHE B 2  43  ? -9.422  -32.768 48.294 1.00 52.20  ? 61  PHE B CA    1 
ATOM   1153  C  C     . PHE B 2  43  ? -8.350  -33.092 47.260 1.00 47.14  ? 61  PHE B C     1 
ATOM   1154  O  O     . PHE B 2  43  ? -8.473  -32.725 46.086 1.00 49.39  ? 61  PHE B O     1 
ATOM   1155  C  CB    . PHE B 2  43  ? -8.974  -31.608 49.185 1.00 55.43  ? 61  PHE B CB    1 
ATOM   1156  C  CG    . PHE B 2  43  ? -8.548  -30.386 48.418 1.00 52.79  ? 61  PHE B CG    1 
ATOM   1157  C  CD1   . PHE B 2  43  ? -9.482  -29.446 48.021 1.00 56.34  ? 61  PHE B CD1   1 
ATOM   1158  C  CD2   . PHE B 2  43  ? -7.215  -30.177 48.092 1.00 53.15  ? 61  PHE B CD2   1 
ATOM   1159  C  CE1   . PHE B 2  43  ? -9.099  -28.321 47.314 1.00 60.24  ? 61  PHE B CE1   1 
ATOM   1160  C  CE2   . PHE B 2  43  ? -6.826  -29.057 47.383 1.00 55.51  ? 61  PHE B CE2   1 
ATOM   1161  C  CZ    . PHE B 2  43  ? -7.769  -28.126 46.994 1.00 59.43  ? 61  PHE B CZ    1 
ATOM   1162  N  N     . LEU B 2  44  ? -7.282  -33.772 47.683 1.00 47.31  ? 62  LEU B N     1 
ATOM   1163  C  CA    . LEU B 2  44  ? -6.195  -34.088 46.763 1.00 52.50  ? 62  LEU B CA    1 
ATOM   1164  C  C     . LEU B 2  44  ? -6.625  -35.082 45.692 1.00 58.43  ? 62  LEU B C     1 
ATOM   1165  O  O     . LEU B 2  44  ? -6.140  -35.012 44.558 1.00 60.50  ? 62  LEU B O     1 
ATOM   1166  C  CB    . LEU B 2  44  ? -4.994  -34.630 47.537 1.00 50.57  ? 62  LEU B CB    1 
ATOM   1167  C  CG    . LEU B 2  44  ? -4.146  -33.590 48.265 1.00 50.09  ? 62  LEU B CG    1 
ATOM   1168  C  CD1   . LEU B 2  44  ? -3.023  -34.262 49.033 1.00 45.27  ? 62  LEU B CD1   1 
ATOM   1169  C  CD2   . LEU B 2  44  ? -3.590  -32.580 47.273 1.00 54.88  ? 62  LEU B CD2   1 
ATOM   1170  N  N     . GLU B 2  45  ? -7.526  -36.009 46.027 1.00 59.05  ? 63  GLU B N     1 
ATOM   1171  C  CA    . GLU B 2  45  ? -7.966  -36.990 45.040 1.00 60.14  ? 63  GLU B CA    1 
ATOM   1172  C  C     . GLU B 2  45  ? -8.719  -36.324 43.895 1.00 56.33  ? 63  GLU B C     1 
ATOM   1173  O  O     . GLU B 2  45  ? -8.469  -36.629 42.723 1.00 55.40  ? 63  GLU B O     1 
ATOM   1174  C  CB    . GLU B 2  45  ? -8.833  -38.057 45.708 1.00 62.60  ? 63  GLU B CB    1 
ATOM   1175  C  CG    . GLU B 2  45  ? -8.038  -39.076 46.501 1.00 67.96  ? 63  GLU B CG    1 
ATOM   1176  C  CD    . GLU B 2  45  ? -8.902  -39.878 47.453 1.00 73.11  ? 63  GLU B CD    1 
ATOM   1177  O  OE1   . GLU B 2  45  ? -10.075 -39.499 47.659 1.00 76.16  ? 63  GLU B OE1   1 
ATOM   1178  O  OE2   . GLU B 2  45  ? -8.406  -40.889 47.998 1.00 75.04  ? 63  GLU B OE2   1 
ATOM   1179  N  N     . ASN B 2  46  ? -9.636  -35.406 44.212 1.00 55.46  ? 64  ASN B N     1 
ATOM   1180  C  CA    . ASN B 2  46  ? -10.428 -34.770 43.164 1.00 56.05  ? 64  ASN B CA    1 
ATOM   1181  C  C     . ASN B 2  46  ? -9.560  -33.908 42.254 1.00 54.75  ? 64  ASN B C     1 
ATOM   1182  O  O     . ASN B 2  46  ? -9.768  -33.877 41.035 1.00 55.19  ? 64  ASN B O     1 
ATOM   1183  C  CB    . ASN B 2  46  ? -11.551 -33.940 43.786 1.00 56.96  ? 64  ASN B CB    1 
ATOM   1184  C  CG    . ASN B 2  46  ? -12.487 -34.773 44.642 1.00 59.40  ? 64  ASN B CG    1 
ATOM   1185  O  OD1   . ASN B 2  46  ? -12.200 -35.928 44.952 1.00 63.97  ? 64  ASN B OD1   1 
ATOM   1186  N  ND2   . ASN B 2  46  ? -13.614 -34.186 45.033 1.00 61.41  ? 64  ASN B ND2   1 
ATOM   1187  N  N     . VAL B 2  47  ? -8.574  -33.213 42.822 1.00 51.51  ? 65  VAL B N     1 
ATOM   1188  C  CA    . VAL B 2  47  ? -7.725  -32.340 42.019 1.00 53.59  ? 65  VAL B CA    1 
ATOM   1189  C  C     . VAL B 2  47  ? -6.737  -33.153 41.191 1.00 53.05  ? 65  VAL B C     1 
ATOM   1190  O  O     . VAL B 2  47  ? -6.480  -32.834 40.025 1.00 53.56  ? 65  VAL B O     1 
ATOM   1191  C  CB    . VAL B 2  47  ? -7.009  -31.319 42.923 1.00 53.27  ? 65  VAL B CB    1 
ATOM   1192  C  CG1   . VAL B 2  47  ? -6.098  -30.420 42.099 1.00 44.65  ? 65  VAL B CG1   1 
ATOM   1193  C  CG2   . VAL B 2  47  ? -8.025  -30.485 43.693 1.00 51.27  ? 65  VAL B CG2   1 
ATOM   1194  N  N     . ILE B 2  48  ? -6.171  -34.214 41.770 1.00 59.24  ? 66  ILE B N     1 
ATOM   1195  C  CA    . ILE B 2  48  ? -5.190  -35.009 41.038 1.00 61.23  ? 66  ILE B CA    1 
ATOM   1196  C  C     . ILE B 2  48  ? -5.865  -35.868 39.973 1.00 60.34  ? 66  ILE B C     1 
ATOM   1197  O  O     . ILE B 2  48  ? -5.300  -36.082 38.893 1.00 59.11  ? 66  ILE B O     1 
ATOM   1198  C  CB    . ILE B 2  48  ? -4.357  -35.856 42.019 1.00 62.10  ? 66  ILE B CB    1 
ATOM   1199  C  CG1   . ILE B 2  48  ? -3.473  -34.949 42.876 1.00 59.41  ? 66  ILE B CG1   1 
ATOM   1200  C  CG2   . ILE B 2  48  ? -3.502  -36.870 41.275 1.00 66.93  ? 66  ILE B CG2   1 
ATOM   1201  C  CD1   . ILE B 2  48  ? -2.752  -35.671 43.990 1.00 59.51  ? 66  ILE B CD1   1 
ATOM   1202  N  N     . ARG B 2  49  ? -7.078  -36.360 40.242 1.00 59.49  ? 67  ARG B N     1 
ATOM   1203  C  CA    . ARG B 2  49  ? -7.804  -37.126 39.233 1.00 63.02  ? 67  ARG B CA    1 
ATOM   1204  C  C     . ARG B 2  49  ? -8.006  -36.312 37.960 1.00 65.97  ? 67  ARG B C     1 
ATOM   1205  O  O     . ARG B 2  49  ? -7.821  -36.824 36.849 1.00 66.52  ? 67  ARG B O     1 
ATOM   1206  C  CB    . ARG B 2  49  ? -9.150  -37.589 39.790 1.00 64.45  ? 67  ARG B CB    1 
ATOM   1207  C  CG    . ARG B 2  49  ? -10.030 -38.303 38.776 1.00 67.79  ? 67  ARG B CG    1 
ATOM   1208  C  CD    . ARG B 2  49  ? -11.450 -38.491 39.292 1.00 76.80  ? 67  ARG B CD    1 
ATOM   1209  N  NE    . ARG B 2  49  ? -11.496 -39.281 40.519 1.00 92.05  ? 67  ARG B NE    1 
ATOM   1210  C  CZ    . ARG B 2  49  ? -11.725 -38.775 41.727 1.00 100.82 ? 67  ARG B CZ    1 
ATOM   1211  N  NH1   . ARG B 2  49  ? -11.934 -37.474 41.874 1.00 103.65 ? 67  ARG B NH1   1 
ATOM   1212  N  NH2   . ARG B 2  49  ? -11.749 -39.571 42.789 1.00 104.90 ? 67  ARG B NH2   1 
ATOM   1213  N  N     . ASP B 2  50  ? -8.380  -35.037 38.101 1.00 63.23  ? 68  ASP B N     1 
ATOM   1214  C  CA    . ASP B 2  50  ? -8.551  -34.182 36.930 1.00 57.41  ? 68  ASP B CA    1 
ATOM   1215  C  C     . ASP B 2  50  ? -7.207  -33.806 36.320 1.00 53.57  ? 68  ASP B C     1 
ATOM   1216  O  O     . ASP B 2  50  ? -7.070  -33.753 35.091 1.00 53.45  ? 68  ASP B O     1 
ATOM   1217  C  CB    . ASP B 2  50  ? -9.336  -32.927 37.306 1.00 60.44  ? 68  ASP B CB    1 
ATOM   1218  C  CG    . ASP B 2  50  ? -10.774 -33.227 37.680 1.00 69.95  ? 68  ASP B CG    1 
ATOM   1219  O  OD1   . ASP B 2  50  ? -11.099 -34.411 37.909 1.00 70.79  ? 68  ASP B OD1   1 
ATOM   1220  O  OD2   . ASP B 2  50  ? -11.579 -32.275 37.752 1.00 76.95  ? 68  ASP B OD2   1 
ATOM   1221  N  N     . ALA B 2  51  ? -6.206  -33.536 37.161 1.00 50.36  ? 69  ALA B N     1 
ATOM   1222  C  CA    . ALA B 2  51  ? -4.891  -33.153 36.656 1.00 49.93  ? 69  ALA B CA    1 
ATOM   1223  C  C     . ALA B 2  51  ? -4.296  -34.251 35.783 1.00 60.00  ? 69  ALA B C     1 
ATOM   1224  O  O     . ALA B 2  51  ? -3.846  -33.993 34.662 1.00 63.15  ? 69  ALA B O     1 
ATOM   1225  C  CB    . ALA B 2  51  ? -3.957  -32.825 37.820 1.00 46.16  ? 69  ALA B CB    1 
ATOM   1226  N  N     . VAL B 2  52  ? -4.293  -35.490 36.281 1.00 65.90  ? 70  VAL B N     1 
ATOM   1227  C  CA    . VAL B 2  52  ? -3.741  -36.592 35.503 1.00 63.17  ? 70  VAL B CA    1 
ATOM   1228  C  C     . VAL B 2  52  ? -4.609  -36.915 34.295 1.00 59.42  ? 70  VAL B C     1 
ATOM   1229  O  O     . VAL B 2  52  ? -4.112  -37.488 33.319 1.00 64.93  ? 70  VAL B O     1 
ATOM   1230  C  CB    . VAL B 2  52  ? -3.546  -37.839 36.387 1.00 64.12  ? 70  VAL B CB    1 
ATOM   1231  C  CG1   . VAL B 2  52  ? -2.734  -37.487 37.626 1.00 58.43  ? 70  VAL B CG1   1 
ATOM   1232  C  CG2   . VAL B 2  52  ? -4.887  -38.443 36.766 1.00 72.77  ? 70  VAL B CG2   1 
ATOM   1233  N  N     . THR B 2  53  ? -5.897  -36.561 34.328 1.00 56.08  ? 71  THR B N     1 
ATOM   1234  C  CA    . THR B 2  53  ? -6.725  -36.707 33.135 1.00 56.68  ? 71  THR B CA    1 
ATOM   1235  C  C     . THR B 2  53  ? -6.267  -35.755 32.037 1.00 63.77  ? 71  THR B C     1 
ATOM   1236  O  O     . THR B 2  53  ? -6.186  -36.144 30.866 1.00 74.64  ? 71  THR B O     1 
ATOM   1237  C  CB    . THR B 2  53  ? -8.198  -36.472 33.473 1.00 57.10  ? 71  THR B CB    1 
ATOM   1238  O  OG1   . THR B 2  53  ? -8.649  -37.482 34.384 1.00 64.63  ? 71  THR B OG1   1 
ATOM   1239  C  CG2   . THR B 2  53  ? -9.049  -36.524 32.214 1.00 50.43  ? 71  THR B CG2   1 
ATOM   1240  N  N     . TYR B 2  54  ? -5.958  -34.504 32.393 1.00 57.29  ? 72  TYR B N     1 
ATOM   1241  C  CA    . TYR B 2  54  ? -5.329  -33.605 31.430 1.00 57.95  ? 72  TYR B CA    1 
ATOM   1242  C  C     . TYR B 2  54  ? -3.982  -34.154 30.976 1.00 57.33  ? 72  TYR B C     1 
ATOM   1243  O  O     . TYR B 2  54  ? -3.609  -34.021 29.804 1.00 59.30  ? 72  TYR B O     1 
ATOM   1244  C  CB    . TYR B 2  54  ? -5.158  -32.208 32.031 1.00 62.63  ? 72  TYR B CB    1 
ATOM   1245  C  CG    . TYR B 2  54  ? -6.437  -31.401 32.125 1.00 61.09  ? 72  TYR B CG    1 
ATOM   1246  C  CD1   . TYR B 2  54  ? -7.047  -30.895 30.984 1.00 58.99  ? 72  TYR B CD1   1 
ATOM   1247  C  CD2   . TYR B 2  54  ? -7.024  -31.130 33.356 1.00 59.29  ? 72  TYR B CD2   1 
ATOM   1248  C  CE1   . TYR B 2  54  ? -8.213  -30.155 31.065 1.00 55.52  ? 72  TYR B CE1   1 
ATOM   1249  C  CE2   . TYR B 2  54  ? -8.193  -30.393 33.447 1.00 36.10  ? 72  TYR B CE2   1 
ATOM   1250  C  CZ    . TYR B 2  54  ? -8.781  -29.907 32.298 1.00 50.18  ? 72  TYR B CZ    1 
ATOM   1251  O  OH    . TYR B 2  54  ? -9.942  -29.169 32.375 1.00 42.44  ? 72  TYR B OH    1 
ATOM   1252  N  N     . THR B 2  55  ? -3.238  -34.778 31.892 1.00 57.32  ? 73  THR B N     1 
ATOM   1253  C  CA    . THR B 2  55  ? -1.952  -35.364 31.526 1.00 64.72  ? 73  THR B CA    1 
ATOM   1254  C  C     . THR B 2  55  ? -2.134  -36.550 30.586 1.00 73.25  ? 73  THR B C     1 
ATOM   1255  O  O     . THR B 2  55  ? -1.343  -36.738 29.654 1.00 75.87  ? 73  THR B O     1 
ATOM   1256  C  CB    . THR B 2  55  ? -1.193  -35.786 32.784 1.00 65.12  ? 73  THR B CB    1 
ATOM   1257  O  OG1   . THR B 2  55  ? -1.110  -34.679 33.690 1.00 64.46  ? 73  THR B OG1   1 
ATOM   1258  C  CG2   . THR B 2  55  ? 0.211   -36.244 32.429 1.00 66.68  ? 73  THR B CG2   1 
ATOM   1259  N  N     . GLU B 2  56  ? -3.171  -37.360 30.814 1.00 77.27  ? 74  GLU B N     1 
ATOM   1260  C  CA    . GLU B 2  56  ? -3.435  -38.487 29.925 1.00 83.68  ? 74  GLU B CA    1 
ATOM   1261  C  C     . GLU B 2  56  ? -3.883  -38.013 28.548 1.00 81.95  ? 74  GLU B C     1 
ATOM   1262  O  O     . GLU B 2  56  ? -3.462  -38.571 27.528 1.00 85.84  ? 74  GLU B O     1 
ATOM   1263  C  CB    . GLU B 2  56  ? -4.484  -39.412 30.544 1.00 93.15  ? 74  GLU B CB    1 
ATOM   1264  C  CG    . GLU B 2  56  ? -3.962  -40.282 31.679 1.00 99.11  ? 74  GLU B CG    1 
ATOM   1265  C  CD    . GLU B 2  56  ? -5.051  -41.122 32.321 1.00 103.04 ? 74  GLU B CD    1 
ATOM   1266  O  OE1   . GLU B 2  56  ? -6.242  -40.790 32.146 1.00 107.89 ? 74  GLU B OE1   1 
ATOM   1267  O  OE2   . GLU B 2  56  ? -4.717  -42.117 32.999 1.00 103.98 ? 74  GLU B OE2   1 
ATOM   1268  N  N     . HIS B 2  57  ? -4.734  -36.986 28.498 1.00 80.41  ? 75  HIS B N     1 
ATOM   1269  C  CA    . HIS B 2  57  ? -5.198  -36.477 27.212 1.00 80.37  ? 75  HIS B CA    1 
ATOM   1270  C  C     . HIS B 2  57  ? -4.060  -35.875 26.399 1.00 83.85  ? 75  HIS B C     1 
ATOM   1271  O  O     . HIS B 2  57  ? -4.076  -35.948 25.165 1.00 86.75  ? 75  HIS B O     1 
ATOM   1272  C  CB    . HIS B 2  57  ? -6.299  -35.439 27.416 1.00 76.27  ? 75  HIS B CB    1 
ATOM   1273  C  CG    . HIS B 2  57  ? -6.816  -34.857 26.138 1.00 77.28  ? 75  HIS B CG    1 
ATOM   1274  N  ND1   . HIS B 2  57  ? -7.789  -35.473 25.381 1.00 78.97  ? 75  HIS B ND1   1 
ATOM   1275  C  CD2   . HIS B 2  57  ? -6.484  -33.724 25.475 1.00 80.99  ? 75  HIS B CD2   1 
ATOM   1276  C  CE1   . HIS B 2  57  ? -8.041  -34.740 24.311 1.00 81.61  ? 75  HIS B CE1   1 
ATOM   1277  N  NE2   . HIS B 2  57  ? -7.262  -33.674 24.344 1.00 82.77  ? 75  HIS B NE2   1 
ATOM   1278  N  N     . ALA B 2  58  ? -3.074  -35.277 27.062 1.00 83.27  ? 76  ALA B N     1 
ATOM   1279  C  CA    . ALA B 2  58  ? -1.922  -34.713 26.373 1.00 77.58  ? 76  ALA B CA    1 
ATOM   1280  C  C     . ALA B 2  58  ? -0.874  -35.759 26.016 1.00 74.36  ? 76  ALA B C     1 
ATOM   1281  O  O     . ALA B 2  58  ? 0.168   -35.395 25.460 1.00 69.75  ? 76  ALA B O     1 
ATOM   1282  C  CB    . ALA B 2  58  ? -1.288  -33.616 27.229 1.00 75.35  ? 76  ALA B CB    1 
ATOM   1283  N  N     . LYS B 2  59  ? -1.126  -37.034 26.324 1.00 74.59  ? 77  LYS B N     1 
ATOM   1284  C  CA    . LYS B 2  59  ? -0.214  -38.132 25.997 1.00 72.91  ? 77  LYS B CA    1 
ATOM   1285  C  C     . LYS B 2  59  ? 1.170   -37.903 26.604 1.00 70.75  ? 77  LYS B C     1 
ATOM   1286  O  O     . LYS B 2  59  ? 2.198   -38.041 25.939 1.00 67.69  ? 77  LYS B O     1 
ATOM   1287  C  CB    . LYS B 2  59  ? -0.125  -38.340 24.483 1.00 77.32  ? 77  LYS B CB    1 
ATOM   1288  C  CG    . LYS B 2  59  ? -1.367  -38.973 23.876 1.00 85.46  ? 77  LYS B CG    1 
ATOM   1289  C  CD    . LYS B 2  59  ? -1.314  -38.987 22.356 1.00 90.97  ? 77  LYS B CD    1 
ATOM   1290  C  CE    . LYS B 2  59  ? -1.447  -37.585 21.785 1.00 95.68  ? 77  LYS B CE    1 
ATOM   1291  N  NZ    . LYS B 2  59  ? -1.503  -37.596 20.296 1.00 97.87  ? 77  LYS B NZ    1 
ATOM   1292  N  N     . ARG B 2  60  ? 1.188   -37.553 27.887 1.00 73.43  ? 78  ARG B N     1 
ATOM   1293  C  CA    . ARG B 2  60  ? 2.423   -37.270 28.600 1.00 76.08  ? 78  ARG B CA    1 
ATOM   1294  C  C     . ARG B 2  60  ? 2.535   -38.143 29.842 1.00 80.20  ? 78  ARG B C     1 
ATOM   1295  O  O     . ARG B 2  60  ? 1.539   -38.628 30.386 1.00 82.66  ? 78  ARG B O     1 
ATOM   1296  C  CB    . ARG B 2  60  ? 2.511   -35.792 29.004 1.00 74.95  ? 78  ARG B CB    1 
ATOM   1297  C  CG    . ARG B 2  60  ? 2.520   -34.812 27.842 1.00 72.51  ? 78  ARG B CG    1 
ATOM   1298  C  CD    . ARG B 2  60  ? 2.967   -33.434 28.311 1.00 68.33  ? 78  ARG B CD    1 
ATOM   1299  N  NE    . ARG B 2  60  ? 2.191   -32.980 29.461 1.00 67.26  ? 78  ARG B NE    1 
ATOM   1300  C  CZ    . ARG B 2  60  ? 1.222   -32.073 29.399 1.00 69.75  ? 78  ARG B CZ    1 
ATOM   1301  N  NH1   . ARG B 2  60  ? 0.916   -31.506 28.240 1.00 76.96  ? 78  ARG B NH1   1 
ATOM   1302  N  NH2   . ARG B 2  60  ? 0.568   -31.726 30.498 1.00 66.71  ? 78  ARG B NH2   1 
ATOM   1303  N  N     . LYS B 2  61  ? 3.776   -38.335 30.287 1.00 81.31  ? 79  LYS B N     1 
ATOM   1304  C  CA    . LYS B 2  61  ? 4.075   -39.043 31.523 1.00 81.85  ? 79  LYS B CA    1 
ATOM   1305  C  C     . LYS B 2  61  ? 4.362   -38.101 32.684 1.00 79.59  ? 79  LYS B C     1 
ATOM   1306  O  O     . LYS B 2  61  ? 4.572   -38.570 33.807 1.00 80.43  ? 79  LYS B O     1 
ATOM   1307  C  CB    . LYS B 2  61  ? 5.271   -39.980 31.319 1.00 89.35  ? 79  LYS B CB    1 
ATOM   1308  C  CG    . LYS B 2  61  ? 5.034   -41.117 30.335 1.00 97.34  ? 79  LYS B CG    1 
ATOM   1309  C  CD    . LYS B 2  61  ? 4.259   -42.258 30.976 1.00 104.23 ? 79  LYS B CD    1 
ATOM   1310  C  CE    . LYS B 2  61  ? 4.219   -43.474 30.064 1.00 108.99 ? 79  LYS B CE    1 
ATOM   1311  N  NZ    . LYS B 2  61  ? 3.583   -44.648 30.724 1.00 114.54 ? 79  LYS B NZ    1 
ATOM   1312  N  N     . THR B 2  62  ? 4.378   -36.791 32.445 1.00 79.02  ? 80  THR B N     1 
ATOM   1313  C  CA    . THR B 2  62  ? 4.711   -35.803 33.463 1.00 74.67  ? 80  THR B CA    1 
ATOM   1314  C  C     . THR B 2  62  ? 3.505   -34.914 33.725 1.00 70.02  ? 80  THR B C     1 
ATOM   1315  O  O     . THR B 2  62  ? 2.872   -34.426 32.783 1.00 69.85  ? 80  THR B O     1 
ATOM   1316  C  CB    . THR B 2  62  ? 5.908   -34.947 33.036 1.00 75.40  ? 80  THR B CB    1 
ATOM   1317  O  OG1   . THR B 2  62  ? 6.990   -35.796 32.632 1.00 82.14  ? 80  THR B OG1   1 
ATOM   1318  C  CG2   . THR B 2  62  ? 6.370   -34.065 34.185 1.00 74.15  ? 80  THR B CG2   1 
ATOM   1319  N  N     . VAL B 2  63  ? 3.194   -34.704 35.000 1.00 78.36  ? 81  VAL B N     1 
ATOM   1320  C  CA    . VAL B 2  63  ? 2.124   -33.800 35.407 1.00 72.52  ? 81  VAL B CA    1 
ATOM   1321  C  C     . VAL B 2  63  ? 2.717   -32.398 35.501 1.00 65.97  ? 81  VAL B C     1 
ATOM   1322  O  O     . VAL B 2  63  ? 3.544   -32.120 36.374 1.00 62.98  ? 81  VAL B O     1 
ATOM   1323  C  CB    . VAL B 2  63  ? 1.495   -34.233 36.737 1.00 68.36  ? 81  VAL B CB    1 
ATOM   1324  C  CG1   . VAL B 2  63  ? 0.366   -33.287 37.124 1.00 61.86  ? 81  VAL B CG1   1 
ATOM   1325  C  CG2   . VAL B 2  63  ? 0.991   -35.666 36.644 1.00 67.52  ? 81  VAL B CG2   1 
ATOM   1326  N  N     . THR B 2  64  ? 2.300   -31.516 34.599 1.00 62.72  ? 82  THR B N     1 
ATOM   1327  C  CA    . THR B 2  64  ? 2.828   -30.162 34.548 1.00 58.46  ? 82  THR B CA    1 
ATOM   1328  C  C     . THR B 2  64  ? 2.062   -29.247 35.497 1.00 53.56  ? 82  THR B C     1 
ATOM   1329  O  O     . THR B 2  64  ? 0.972   -29.572 35.974 1.00 49.12  ? 82  THR B O     1 
ATOM   1330  C  CB    . THR B 2  64  ? 2.758   -29.604 33.125 1.00 56.33  ? 82  THR B CB    1 
ATOM   1331  O  OG1   . THR B 2  64  ? 1.386   -29.453 32.737 1.00 50.09  ? 82  THR B OG1   1 
ATOM   1332  C  CG2   . THR B 2  64  ? 3.453   -30.542 32.150 1.00 61.37  ? 82  THR B CG2   1 
ATOM   1333  N  N     . ALA B 2  65  ? 2.656   -28.082 35.767 1.00 57.28  ? 83  ALA B N     1 
ATOM   1334  C  CA    . ALA B 2  65  ? 1.986   -27.095 36.606 1.00 56.02  ? 83  ALA B CA    1 
ATOM   1335  C  C     . ALA B 2  65  ? 0.654   -26.676 35.998 1.00 52.23  ? 83  ALA B C     1 
ATOM   1336  O  O     . ALA B 2  65  ? -0.330  -26.472 36.721 1.00 48.29  ? 83  ALA B O     1 
ATOM   1337  C  CB    . ALA B 2  65  ? 2.889   -25.880 36.814 1.00 57.46  ? 83  ALA B CB    1 
ATOM   1338  N  N     . MET B 2  66  ? 0.600   -26.561 34.667 1.00 52.50  ? 84  MET B N     1 
ATOM   1339  C  CA    . MET B 2  66  ? -0.640  -26.174 34.002 1.00 56.19  ? 84  MET B CA    1 
ATOM   1340  C  C     . MET B 2  66  ? -1.733  -27.221 34.176 1.00 56.56  ? 84  MET B C     1 
ATOM   1341  O  O     . MET B 2  66  ? -2.917  -26.870 34.224 1.00 55.25  ? 84  MET B O     1 
ATOM   1342  C  CB    . MET B 2  66  ? -0.382  -25.919 32.518 1.00 63.17  ? 84  MET B CB    1 
ATOM   1343  C  CG    . MET B 2  66  ? 0.560   -24.761 32.247 1.00 71.10  ? 84  MET B CG    1 
ATOM   1344  S  SD    . MET B 2  66  ? 0.015   -23.232 33.033 1.00 72.59  ? 84  MET B SD    1 
ATOM   1345  C  CE    . MET B 2  66  ? -1.602  -23.032 32.289 1.00 73.19  ? 84  MET B CE    1 
ATOM   1346  N  N     . ASP B 2  67  ? -1.365  -28.504 34.267 1.00 57.07  ? 85  ASP B N     1 
ATOM   1347  C  CA    . ASP B 2  67  ? -2.368  -29.535 34.518 1.00 58.49  ? 85  ASP B CA    1 
ATOM   1348  C  C     . ASP B 2  67  ? -3.041  -29.324 35.867 1.00 53.54  ? 85  ASP B C     1 
ATOM   1349  O  O     . ASP B 2  67  ? -4.257  -29.505 35.999 1.00 46.99  ? 85  ASP B O     1 
ATOM   1350  C  CB    . ASP B 2  67  ? -1.733  -30.923 34.452 1.00 68.04  ? 85  ASP B CB    1 
ATOM   1351  C  CG    . ASP B 2  67  ? -1.219  -31.267 33.070 1.00 77.14  ? 85  ASP B CG    1 
ATOM   1352  O  OD1   . ASP B 2  67  ? -1.867  -30.873 32.076 1.00 82.82  ? 85  ASP B OD1   1 
ATOM   1353  O  OD2   . ASP B 2  67  ? -0.164  -31.930 32.978 1.00 80.41  ? 85  ASP B OD2   1 
ATOM   1354  N  N     . VAL B 2  68  ? -2.265  -28.938 36.881 1.00 58.87  ? 86  VAL B N     1 
ATOM   1355  C  CA    . VAL B 2  68  ? -2.838  -28.691 38.200 1.00 55.96  ? 86  VAL B CA    1 
ATOM   1356  C  C     . VAL B 2  68  ? -3.692  -27.429 38.184 1.00 51.45  ? 86  VAL B C     1 
ATOM   1357  O  O     . VAL B 2  68  ? -4.781  -27.393 38.769 1.00 48.25  ? 86  VAL B O     1 
ATOM   1358  C  CB    . VAL B 2  68  ? -1.721  -28.609 39.257 1.00 55.92  ? 86  VAL B CB    1 
ATOM   1359  C  CG1   . VAL B 2  68  ? -2.310  -28.356 40.634 1.00 55.08  ? 86  VAL B CG1   1 
ATOM   1360  C  CG2   . VAL B 2  68  ? -0.889  -29.882 39.248 1.00 53.96  ? 86  VAL B CG2   1 
ATOM   1361  N  N     . VAL B 2  69  ? -3.218  -26.380 37.507 1.00 50.94  ? 87  VAL B N     1 
ATOM   1362  C  CA    . VAL B 2  69  ? -3.954  -25.120 37.467 1.00 50.94  ? 87  VAL B CA    1 
ATOM   1363  C  C     . VAL B 2  69  ? -5.264  -25.285 36.705 1.00 52.67  ? 87  VAL B C     1 
ATOM   1364  O  O     . VAL B 2  69  ? -6.306  -24.756 37.113 1.00 51.86  ? 87  VAL B O     1 
ATOM   1365  C  CB    . VAL B 2  69  ? -3.072  -24.014 36.860 1.00 48.23  ? 87  VAL B CB    1 
ATOM   1366  C  CG1   . VAL B 2  69  ? -3.873  -22.739 36.653 1.00 50.85  ? 87  VAL B CG1   1 
ATOM   1367  C  CG2   . VAL B 2  69  ? -1.868  -23.754 37.755 1.00 42.01  ? 87  VAL B CG2   1 
ATOM   1368  N  N     . TYR B 2  70  ? -5.238  -26.022 35.592 1.00 55.88  ? 88  TYR B N     1 
ATOM   1369  C  CA    . TYR B 2  70  ? -6.468  -26.281 34.850 1.00 59.30  ? 88  TYR B CA    1 
ATOM   1370  C  C     . TYR B 2  70  ? -7.455  -27.100 35.671 1.00 56.07  ? 88  TYR B C     1 
ATOM   1371  O  O     . TYR B 2  70  ? -8.671  -26.912 35.549 1.00 51.11  ? 88  TYR B O     1 
ATOM   1372  C  CB    . TYR B 2  70  ? -6.152  -27.000 33.538 1.00 66.34  ? 88  TYR B CB    1 
ATOM   1373  C  CG    . TYR B 2  70  ? -5.467  -26.136 32.501 1.00 76.75  ? 88  TYR B CG    1 
ATOM   1374  C  CD1   . TYR B 2  70  ? -5.703  -24.769 32.437 1.00 80.44  ? 88  TYR B CD1   1 
ATOM   1375  C  CD2   . TYR B 2  70  ? -4.583  -26.691 31.584 1.00 83.22  ? 88  TYR B CD2   1 
ATOM   1376  C  CE1   . TYR B 2  70  ? -5.077  -23.980 31.490 1.00 88.10  ? 88  TYR B CE1   1 
ATOM   1377  C  CE2   . TYR B 2  70  ? -3.954  -25.911 30.635 1.00 90.21  ? 88  TYR B CE2   1 
ATOM   1378  C  CZ    . TYR B 2  70  ? -4.205  -24.558 30.590 1.00 92.19  ? 88  TYR B CZ    1 
ATOM   1379  O  OH    . TYR B 2  70  ? -3.577  -23.780 29.643 1.00 97.88  ? 88  TYR B OH    1 
ATOM   1380  N  N     . ALA B 2  71  ? -6.955  -28.008 36.511 1.00 58.19  ? 89  ALA B N     1 
ATOM   1381  C  CA    . ALA B 2  71  ? -7.830  -28.835 37.334 1.00 53.45  ? 89  ALA B CA    1 
ATOM   1382  C  C     . ALA B 2  71  ? -8.442  -28.038 38.478 1.00 51.31  ? 89  ALA B C     1 
ATOM   1383  O  O     . ALA B 2  71  ? -9.636  -28.177 38.763 1.00 47.54  ? 89  ALA B O     1 
ATOM   1384  C  CB    . ALA B 2  71  ? -7.058  -30.038 37.878 1.00 52.22  ? 89  ALA B CB    1 
ATOM   1385  N  N     . LEU B 2  72  ? -7.639  -27.204 39.146 1.00 53.10  ? 90  LEU B N     1 
ATOM   1386  C  CA    . LEU B 2  72  ? -8.163  -26.386 40.236 1.00 46.03  ? 90  LEU B CA    1 
ATOM   1387  C  C     . LEU B 2  72  ? -9.225  -25.415 39.737 1.00 50.17  ? 90  LEU B C     1 
ATOM   1388  O  O     . LEU B 2  72  ? -10.202 -25.134 40.443 1.00 51.90  ? 90  LEU B O     1 
ATOM   1389  C  CB    . LEU B 2  72  ? -7.020  -25.634 40.917 1.00 40.36  ? 90  LEU B CB    1 
ATOM   1390  C  CG    . LEU B 2  72  ? -6.030  -26.504 41.689 1.00 38.51  ? 90  LEU B CG    1 
ATOM   1391  C  CD1   . LEU B 2  72  ? -4.715  -25.773 41.892 1.00 40.26  ? 90  LEU B CD1   1 
ATOM   1392  C  CD2   . LEU B 2  72  ? -6.630  -26.916 43.027 1.00 33.15  ? 90  LEU B CD2   1 
ATOM   1393  N  N     . LYS B 2  73  ? -9.054  -24.896 38.520 1.00 53.95  ? 91  LYS B N     1 
ATOM   1394  C  CA    . LYS B 2  73  ? -10.056 -24.003 37.947 1.00 60.81  ? 91  LYS B CA    1 
ATOM   1395  C  C     . LYS B 2  73  ? -11.362 -24.742 37.679 1.00 64.31  ? 91  LYS B C     1 
ATOM   1396  O  O     . LYS B 2  73  ? -12.448 -24.167 37.830 1.00 62.41  ? 91  LYS B O     1 
ATOM   1397  C  CB    . LYS B 2  73  ? -9.514  -23.371 36.666 1.00 65.91  ? 91  LYS B CB    1 
ATOM   1398  C  CG    . LYS B 2  73  ? -10.428 -22.339 36.035 1.00 69.64  ? 91  LYS B CG    1 
ATOM   1399  C  CD    . LYS B 2  73  ? -9.817  -21.798 34.752 1.00 79.41  ? 91  LYS B CD    1 
ATOM   1400  C  CE    . LYS B 2  73  ? -10.726 -20.783 34.087 1.00 86.19  ? 91  LYS B CE    1 
ATOM   1401  N  NZ    . LYS B 2  73  ? -10.154 -20.300 32.800 1.00 93.82  ? 91  LYS B NZ    1 
ATOM   1402  N  N     . ARG B 2  74  ? -11.277 -26.014 37.279 1.00 65.68  ? 92  ARG B N     1 
ATOM   1403  C  CA    . ARG B 2  74  ? -12.477 -26.827 37.111 1.00 67.24  ? 92  ARG B CA    1 
ATOM   1404  C  C     . ARG B 2  74  ? -13.254 -26.936 38.416 1.00 64.24  ? 92  ARG B C     1 
ATOM   1405  O  O     . ARG B 2  74  ? -14.475 -26.743 38.445 1.00 58.66  ? 92  ARG B O     1 
ATOM   1406  C  CB    . ARG B 2  74  ? -12.103 -28.222 36.612 1.00 78.43  ? 92  ARG B CB    1 
ATOM   1407  C  CG    . ARG B 2  74  ? -12.028 -28.377 35.110 1.00 81.44  ? 92  ARG B CG    1 
ATOM   1408  C  CD    . ARG B 2  74  ? -12.280 -29.826 34.710 1.00 73.14  ? 92  ARG B CD    1 
ATOM   1409  N  NE    . ARG B 2  74  ? -13.695 -30.180 34.801 1.00 69.28  ? 92  ARG B NE    1 
ATOM   1410  C  CZ    . ARG B 2  74  ? -14.265 -30.749 35.860 1.00 72.11  ? 92  ARG B CZ    1 
ATOM   1411  N  NH1   . ARG B 2  74  ? -13.542 -31.038 36.933 1.00 75.38  ? 92  ARG B NH1   1 
ATOM   1412  N  NH2   . ARG B 2  74  ? -15.560 -31.032 35.846 1.00 72.85  ? 92  ARG B NH2   1 
ATOM   1413  N  N     . GLN B 2  75  ? -12.556 -27.250 39.509 1.00 65.98  ? 93  GLN B N     1 
ATOM   1414  C  CA    . GLN B 2  75  ? -13.187 -27.445 40.808 1.00 66.33  ? 93  GLN B CA    1 
ATOM   1415  C  C     . GLN B 2  75  ? -13.757 -26.160 41.392 1.00 65.61  ? 93  GLN B C     1 
ATOM   1416  O  O     . GLN B 2  75  ? -14.416 -26.216 42.436 1.00 70.81  ? 93  GLN B O     1 
ATOM   1417  C  CB    . GLN B 2  75  ? -12.179 -28.044 41.791 1.00 70.83  ? 93  GLN B CB    1 
ATOM   1418  C  CG    . GLN B 2  75  ? -11.454 -29.279 41.277 1.00 74.47  ? 93  GLN B CG    1 
ATOM   1419  C  CD    . GLN B 2  75  ? -12.347 -30.504 41.217 1.00 76.50  ? 93  GLN B CD    1 
ATOM   1420  O  OE1   . GLN B 2  75  ? -13.394 -30.557 41.864 1.00 78.73  ? 93  GLN B OE1   1 
ATOM   1421  N  NE2   . GLN B 2  75  ? -11.935 -31.498 40.438 1.00 77.18  ? 93  GLN B NE2   1 
ATOM   1422  N  N     . GLY B 2  76  ? -13.529 -25.015 40.753 1.00 62.28  ? 94  GLY B N     1 
ATOM   1423  C  CA    . GLY B 2  76  ? -13.926 -23.751 41.334 1.00 55.05  ? 94  GLY B CA    1 
ATOM   1424  C  C     . GLY B 2  76  ? -12.919 -23.176 42.299 1.00 54.35  ? 94  GLY B C     1 
ATOM   1425  O  O     . GLY B 2  76  ? -13.274 -22.317 43.112 1.00 60.73  ? 94  GLY B O     1 
ATOM   1426  N  N     . ARG B 2  77  ? -11.669 -23.632 42.238 1.00 48.79  ? 95  ARG B N     1 
ATOM   1427  C  CA    A ARG B 2  77  ? -10.619 -23.152 43.126 0.53 47.46  ? 95  ARG B CA    1 
ATOM   1428  C  CA    B ARG B 2  77  ? -10.630 -23.129 43.127 0.47 47.55  ? 95  ARG B CA    1 
ATOM   1429  C  C     . ARG B 2  77  ? -9.465  -22.570 42.319 1.00 49.60  ? 95  ARG B C     1 
ATOM   1430  O  O     . ARG B 2  77  ? -8.330  -23.043 42.435 1.00 48.97  ? 95  ARG B O     1 
ATOM   1431  C  CB    A ARG B 2  77  ? -10.112 -24.287 44.022 0.53 47.95  ? 95  ARG B CB    1 
ATOM   1432  C  CB    B ARG B 2  77  ? -10.171 -24.236 44.076 0.47 47.91  ? 95  ARG B CB    1 
ATOM   1433  C  CG    A ARG B 2  77  ? -11.194 -25.015 44.807 0.53 47.80  ? 95  ARG B CG    1 
ATOM   1434  C  CG    B ARG B 2  77  ? -11.335 -24.901 44.792 0.47 47.67  ? 95  ARG B CG    1 
ATOM   1435  C  CD    A ARG B 2  77  ? -11.677 -24.196 45.991 0.53 48.29  ? 95  ARG B CD    1 
ATOM   1436  C  CD    B ARG B 2  77  ? -10.914 -25.605 46.065 0.47 47.21  ? 95  ARG B CD    1 
ATOM   1437  N  NE    A ARG B 2  77  ? -10.580 -23.813 46.876 0.53 44.54  ? 95  ARG B NE    1 
ATOM   1438  N  NE    B ARG B 2  77  ? -11.985 -25.568 47.057 0.47 50.46  ? 95  ARG B NE    1 
ATOM   1439  C  CZ    A ARG B 2  77  ? -10.736 -23.152 48.018 0.53 37.36  ? 95  ARG B CZ    1 
ATOM   1440  C  CZ    B ARG B 2  77  ? -13.008 -26.415 47.088 0.47 56.48  ? 95  ARG B CZ    1 
ATOM   1441  N  NH1   A ARG B 2  77  ? -11.949 -22.801 48.424 0.53 38.12  ? 95  ARG B NH1   1 
ATOM   1442  N  NH1   B ARG B 2  77  ? -13.107 -27.377 46.180 0.47 54.91  ? 95  ARG B NH1   1 
ATOM   1443  N  NH2   A ARG B 2  77  ? -9.680  -22.843 48.757 0.53 33.43  ? 95  ARG B NH2   1 
ATOM   1444  N  NH2   B ARG B 2  77  ? -13.936 -26.299 48.029 0.47 61.60  ? 95  ARG B NH2   1 
ATOM   1445  N  N     . THR B 2  78  ? -9.751  -21.557 41.498 1.00 52.11  ? 96  THR B N     1 
ATOM   1446  C  CA    . THR B 2  78  ? -8.746  -20.951 40.632 1.00 55.78  ? 96  THR B CA    1 
ATOM   1447  C  C     . THR B 2  78  ? -7.533  -20.498 41.435 1.00 56.68  ? 96  THR B C     1 
ATOM   1448  O  O     . THR B 2  78  ? -7.661  -19.970 42.543 1.00 58.82  ? 96  THR B O     1 
ATOM   1449  C  CB    . THR B 2  78  ? -9.359  -19.764 39.879 1.00 53.66  ? 96  THR B CB    1 
ATOM   1450  O  OG1   . THR B 2  78  ? -10.496 -20.210 39.129 1.00 49.31  ? 96  THR B OG1   1 
ATOM   1451  C  CG2   . THR B 2  78  ? -8.347  -19.138 38.931 1.00 51.24  ? 96  THR B CG2   1 
ATOM   1452  N  N     . LEU B 2  79  ? -6.348  -20.720 40.871 1.00 54.01  ? 97  LEU B N     1 
ATOM   1453  C  CA    . LEU B 2  79  ? -5.085  -20.420 41.532 1.00 55.55  ? 97  LEU B CA    1 
ATOM   1454  C  C     . LEU B 2  79  ? -4.238  -19.518 40.646 1.00 60.64  ? 97  LEU B C     1 
ATOM   1455  O  O     . LEU B 2  79  ? -4.104  -19.769 39.442 1.00 68.07  ? 97  LEU B O     1 
ATOM   1456  C  CB    . LEU B 2  79  ? -4.320  -21.708 41.854 1.00 55.14  ? 97  LEU B CB    1 
ATOM   1457  C  CG    . LEU B 2  79  ? -2.951  -21.531 42.512 1.00 56.94  ? 97  LEU B CG    1 
ATOM   1458  C  CD1   . LEU B 2  79  ? -3.092  -20.865 43.873 1.00 59.23  ? 97  LEU B CD1   1 
ATOM   1459  C  CD2   . LEU B 2  79  ? -2.229  -22.863 42.635 1.00 53.74  ? 97  LEU B CD2   1 
ATOM   1460  N  N     . TYR B 2  80  ? -3.667  -18.476 41.243 1.00 53.13  ? 98  TYR B N     1 
ATOM   1461  C  CA    . TYR B 2  80  ? -2.749  -17.576 40.561 1.00 53.08  ? 98  TYR B CA    1 
ATOM   1462  C  C     . TYR B 2  80  ? -1.315  -17.864 40.988 1.00 50.45  ? 98  TYR B C     1 
ATOM   1463  O  O     . TYR B 2  80  ? -1.061  -18.316 42.108 1.00 53.31  ? 98  TYR B O     1 
ATOM   1464  C  CB    . TYR B 2  80  ? -3.074  -16.111 40.865 1.00 55.21  ? 98  TYR B CB    1 
ATOM   1465  C  CG    . TYR B 2  80  ? -4.356  -15.583 40.256 1.00 53.97  ? 98  TYR B CG    1 
ATOM   1466  C  CD1   . TYR B 2  80  ? -5.139  -16.372 39.422 1.00 48.54  ? 98  TYR B CD1   1 
ATOM   1467  C  CD2   . TYR B 2  80  ? -4.774  -14.282 40.508 1.00 54.74  ? 98  TYR B CD2   1 
ATOM   1468  C  CE1   . TYR B 2  80  ? -6.308  -15.881 38.866 1.00 50.12  ? 98  TYR B CE1   1 
ATOM   1469  C  CE2   . TYR B 2  80  ? -5.937  -13.783 39.957 1.00 53.29  ? 98  TYR B CE2   1 
ATOM   1470  C  CZ    . TYR B 2  80  ? -6.701  -14.584 39.138 1.00 53.04  ? 98  TYR B CZ    1 
ATOM   1471  O  OH    . TYR B 2  80  ? -7.860  -14.082 38.592 1.00 51.21  ? 98  TYR B OH    1 
ATOM   1472  N  N     . GLY B 2  81  ? -0.375  -17.589 40.085 1.00 46.79  ? 99  GLY B N     1 
ATOM   1473  C  CA    . GLY B 2  81  ? 1.039   -17.656 40.400 1.00 51.91  ? 99  GLY B CA    1 
ATOM   1474  C  C     . GLY B 2  81  ? 1.797   -18.821 39.800 1.00 59.81  ? 99  GLY B C     1 
ATOM   1475  O  O     . GLY B 2  81  ? 3.007   -18.930 40.038 1.00 62.01  ? 99  GLY B O     1 
ATOM   1476  N  N     . PHE B 2  82  ? 1.145   -19.696 39.032 1.00 60.17  ? 100 PHE B N     1 
ATOM   1477  C  CA    . PHE B 2  82  ? 1.828   -20.833 38.429 1.00 61.80  ? 100 PHE B CA    1 
ATOM   1478  C  C     . PHE B 2  82  ? 1.556   -20.967 36.936 1.00 65.78  ? 100 PHE B C     1 
ATOM   1479  O  O     . PHE B 2  82  ? 1.998   -21.948 36.326 1.00 74.06  ? 100 PHE B O     1 
ATOM   1480  C  CB    . PHE B 2  82  ? 1.444   -22.134 39.144 1.00 61.49  ? 100 PHE B CB    1 
ATOM   1481  C  CG    . PHE B 2  82  ? 1.936   -22.212 40.561 1.00 56.78  ? 100 PHE B CG    1 
ATOM   1482  C  CD1   . PHE B 2  82  ? 3.224   -22.644 40.838 1.00 55.93  ? 100 PHE B CD1   1 
ATOM   1483  C  CD2   . PHE B 2  82  ? 1.112   -21.853 41.614 1.00 51.78  ? 100 PHE B CD2   1 
ATOM   1484  C  CE1   . PHE B 2  82  ? 3.681   -22.716 42.140 1.00 51.22  ? 100 PHE B CE1   1 
ATOM   1485  C  CE2   . PHE B 2  82  ? 1.561   -21.924 42.919 1.00 48.82  ? 100 PHE B CE2   1 
ATOM   1486  C  CZ    . PHE B 2  82  ? 2.848   -22.357 43.183 1.00 47.99  ? 100 PHE B CZ    1 
ATOM   1487  N  N     . GLY B 2  83  ? 0.855   -20.016 36.332 1.00 65.66  ? 101 GLY B N     1 
ATOM   1488  C  CA    . GLY B 2  83  ? 0.533   -20.052 34.923 1.00 67.19  ? 101 GLY B CA    1 
ATOM   1489  C  C     . GLY B 2  83  ? -0.949  -19.872 34.688 1.00 73.72  ? 101 GLY B C     1 
ATOM   1490  O  O     . GLY B 2  83  ? -1.749  -19.758 35.615 1.00 77.75  ? 101 GLY B O     1 
ATOM   1491  N  N     . GLY B 2  84  ? -1.312  -19.845 33.410 1.00 78.09  ? 102 GLY B N     1 
ATOM   1492  C  CA    . GLY B 2  84  ? -2.699  -19.674 33.019 1.00 80.66  ? 102 GLY B CA    1 
ATOM   1493  C  C     . GLY B 2  84  ? -3.075  -18.232 32.736 1.00 81.35  ? 102 GLY B C     1 
ATOM   1494  O  O     . GLY B 2  84  ? -4.146  -17.957 32.196 1.00 81.60  ? 102 GLY B O     1 
ATOM   1495  O  OXT   . GLY B 2  84  ? -2.322  -17.305 33.040 1.00 81.69  ? 102 GLY B OXT   1 
ATOM   1496  N  N     . THR C 3  3   ? -29.192 -41.755 7.559  1.00 120.14 ? 16  THR C N     1 
ATOM   1497  C  CA    . THR C 3  3   ? -28.890 -40.891 8.695  1.00 120.30 ? 16  THR C CA    1 
ATOM   1498  C  C     . THR C 3  3   ? -27.733 -41.449 9.516  1.00 119.84 ? 16  THR C C     1 
ATOM   1499  O  O     . THR C 3  3   ? -27.591 -42.663 9.661  1.00 123.45 ? 16  THR C O     1 
ATOM   1500  C  CB    . THR C 3  3   ? -30.115 -40.709 9.610  1.00 122.31 ? 16  THR C CB    1 
ATOM   1501  O  OG1   . THR C 3  3   ? -30.482 -41.972 10.178 1.00 124.44 ? 16  THR C OG1   1 
ATOM   1502  C  CG2   . THR C 3  3   ? -31.290 -40.159 8.822  1.00 127.24 ? 16  THR C CG2   1 
ATOM   1503  N  N     . ARG C 3  4   ? -26.906 -40.552 10.057 1.00 116.02 ? 17  ARG C N     1 
ATOM   1504  C  CA    . ARG C 3  4   ? -25.767 -40.981 10.860 1.00 111.34 ? 17  ARG C CA    1 
ATOM   1505  C  C     . ARG C 3  4   ? -26.186 -41.542 12.212 1.00 109.62 ? 17  ARG C C     1 
ATOM   1506  O  O     . ARG C 3  4   ? -25.382 -42.216 12.864 1.00 109.38 ? 17  ARG C O     1 
ATOM   1507  C  CB    . ARG C 3  4   ? -24.792 -39.818 11.053 1.00 107.71 ? 17  ARG C CB    1 
ATOM   1508  C  CG    . ARG C 3  4   ? -24.037 -39.431 9.791  1.00 107.88 ? 17  ARG C CG    1 
ATOM   1509  C  CD    . ARG C 3  4   ? -23.041 -38.311 10.050 1.00 106.92 ? 17  ARG C CD    1 
ATOM   1510  N  NE    . ARG C 3  4   ? -23.697 -37.025 10.267 1.00 107.22 ? 17  ARG C NE    1 
ATOM   1511  C  CZ    . ARG C 3  4   ? -23.048 -35.884 10.481 1.00 105.77 ? 17  ARG C CZ    1 
ATOM   1512  N  NH1   . ARG C 3  4   ? -21.722 -35.870 10.510 1.00 104.94 ? 17  ARG C NH1   1 
ATOM   1513  N  NH2   . ARG C 3  4   ? -23.723 -34.758 10.667 1.00 104.75 ? 17  ARG C NH2   1 
ATOM   1514  N  N     . SER C 3  5   ? -27.422 -41.282 12.646 1.00 108.26 ? 18  SER C N     1 
ATOM   1515  C  CA    . SER C 3  5   ? -27.889 -41.837 13.913 1.00 105.00 ? 18  SER C CA    1 
ATOM   1516  C  C     . SER C 3  5   ? -28.113 -43.341 13.805 1.00 104.06 ? 18  SER C C     1 
ATOM   1517  O  O     . SER C 3  5   ? -27.806 -44.089 14.741 1.00 102.06 ? 18  SER C O     1 
ATOM   1518  C  CB    . SER C 3  5   ? -29.171 -41.132 14.355 1.00 104.85 ? 18  SER C CB    1 
ATOM   1519  O  OG    . SER C 3  5   ? -28.965 -39.735 14.486 1.00 105.02 ? 18  SER C OG    1 
ATOM   1520  N  N     . SER C 3  6   ? -28.647 -43.801 12.671 1.00 104.43 ? 19  SER C N     1 
ATOM   1521  C  CA    . SER C 3  6   ? -28.839 -45.234 12.473 1.00 101.60 ? 19  SER C CA    1 
ATOM   1522  C  C     . SER C 3  6   ? -27.508 -45.944 12.260 1.00 101.14 ? 19  SER C C     1 
ATOM   1523  O  O     . SER C 3  6   ? -27.326 -47.081 12.712 1.00 101.68 ? 19  SER C O     1 
ATOM   1524  C  CB    . SER C 3  6   ? -29.776 -45.478 11.292 1.00 100.23 ? 19  SER C CB    1 
ATOM   1525  O  OG    . SER C 3  6   ? -29.289 -44.847 10.120 1.00 100.17 ? 19  SER C OG    1 
ATOM   1526  N  N     . ARG C 3  7   ? -26.565 -45.292 11.574 1.00 100.94 ? 20  ARG C N     1 
ATOM   1527  C  CA    . ARG C 3  7   ? -25.248 -45.889 11.375 1.00 101.61 ? 20  ARG C CA    1 
ATOM   1528  C  C     . ARG C 3  7   ? -24.499 -46.042 12.692 1.00 100.40 ? 20  ARG C C     1 
ATOM   1529  O  O     . ARG C 3  7   ? -23.630 -46.913 12.815 1.00 101.00 ? 20  ARG C O     1 
ATOM   1530  C  CB    . ARG C 3  7   ? -24.433 -45.048 10.393 1.00 104.60 ? 20  ARG C CB    1 
ATOM   1531  C  CG    . ARG C 3  7   ? -25.005 -45.021 8.988  1.00 110.48 ? 20  ARG C CG    1 
ATOM   1532  C  CD    . ARG C 3  7   ? -24.141 -44.201 8.048  1.00 115.23 ? 20  ARG C CD    1 
ATOM   1533  N  NE    . ARG C 3  7   ? -24.603 -44.309 6.667  1.00 121.21 ? 20  ARG C NE    1 
ATOM   1534  C  CZ    . ARG C 3  7   ? -25.522 -43.518 6.123  1.00 123.92 ? 20  ARG C CZ    1 
ATOM   1535  N  NH1   . ARG C 3  7   ? -26.082 -42.553 6.841  1.00 123.71 ? 20  ARG C NH1   1 
ATOM   1536  N  NH2   . ARG C 3  7   ? -25.882 -43.692 4.858  1.00 125.58 ? 20  ARG C NH2   1 
ATOM   1537  N  N     . ALA C 3  8   ? -24.816 -45.209 13.682 1.00 100.06 ? 21  ALA C N     1 
ATOM   1538  C  CA    . ALA C 3  8   ? -24.231 -45.321 15.009 1.00 98.66  ? 21  ALA C CA    1 
ATOM   1539  C  C     . ALA C 3  8   ? -25.104 -46.104 15.979 1.00 97.07  ? 21  ALA C C     1 
ATOM   1540  O  O     . ALA C 3  8   ? -24.657 -46.394 17.095 1.00 95.33  ? 21  ALA C O     1 
ATOM   1541  C  CB    . ALA C 3  8   ? -23.954 -43.927 15.586 1.00 101.12 ? 21  ALA C CB    1 
ATOM   1542  N  N     . GLY C 3  9   ? -26.325 -46.457 15.584 1.00 98.52  ? 22  GLY C N     1 
ATOM   1543  C  CA    . GLY C 3  9   ? -27.228 -47.161 16.475 1.00 97.68  ? 22  GLY C CA    1 
ATOM   1544  C  C     . GLY C 3  9   ? -27.801 -46.297 17.573 1.00 96.16  ? 22  GLY C C     1 
ATOM   1545  O  O     . GLY C 3  9   ? -28.115 -46.806 18.653 1.00 95.25  ? 22  GLY C O     1 
ATOM   1546  N  N     . LEU C 3  10  ? -27.947 -44.998 17.326 1.00 97.93  ? 23  LEU C N     1 
ATOM   1547  C  CA    . LEU C 3  10  ? -28.393 -44.046 18.331 1.00 94.30  ? 23  LEU C CA    1 
ATOM   1548  C  C     . LEU C 3  10  ? -29.779 -43.515 17.988 1.00 95.79  ? 23  LEU C C     1 
ATOM   1549  O  O     . LEU C 3  10  ? -30.176 -43.472 16.819 1.00 97.09  ? 23  LEU C O     1 
ATOM   1550  C  CB    . LEU C 3  10  ? -27.413 -42.874 18.447 1.00 89.83  ? 23  LEU C CB    1 
ATOM   1551  C  CG    . LEU C 3  10  ? -25.954 -43.213 18.754 1.00 88.52  ? 23  LEU C CG    1 
ATOM   1552  C  CD1   . LEU C 3  10  ? -25.132 -41.941 18.878 1.00 87.42  ? 23  LEU C CD1   1 
ATOM   1553  C  CD2   . LEU C 3  10  ? -25.851 -44.050 20.017 1.00 89.85  ? 23  LEU C CD2   1 
ATOM   1554  N  N     . GLN C 3  11  ? -30.512 -43.108 19.024 1.00 99.00  ? 24  GLN C N     1 
ATOM   1555  C  CA    . GLN C 3  11  ? -31.804 -42.465 18.830 1.00 100.40 ? 24  GLN C CA    1 
ATOM   1556  C  C     . GLN C 3  11  ? -31.687 -40.950 18.762 1.00 96.47  ? 24  GLN C C     1 
ATOM   1557  O  O     . GLN C 3  11  ? -32.536 -40.291 18.149 1.00 99.38  ? 24  GLN C O     1 
ATOM   1558  C  CB    . GLN C 3  11  ? -32.758 -42.852 19.963 1.00 105.20 ? 24  GLN C CB    1 
ATOM   1559  C  CG    . GLN C 3  11  ? -32.948 -44.353 20.129 1.00 108.58 ? 24  GLN C CG    1 
ATOM   1560  C  CD    . GLN C 3  11  ? -33.721 -44.982 18.984 1.00 111.51 ? 24  GLN C CD    1 
ATOM   1561  O  OE1   . GLN C 3  11  ? -34.439 -44.299 18.251 1.00 113.90 ? 24  GLN C OE1   1 
ATOM   1562  N  NE2   . GLN C 3  11  ? -33.581 -46.293 18.827 1.00 114.83 ? 24  GLN C NE2   1 
ATOM   1563  N  N     . PHE C 3  12  ? -30.646 -40.383 19.376 1.00 92.92  ? 25  PHE C N     1 
ATOM   1564  C  CA    . PHE C 3  12  ? -30.412 -38.950 19.368 1.00 90.80  ? 25  PHE C CA    1 
ATOM   1565  C  C     . PHE C 3  12  ? -29.850 -38.502 18.019 1.00 93.69  ? 25  PHE C C     1 
ATOM   1566  O  O     . PHE C 3  12  ? -29.149 -39.264 17.346 1.00 95.55  ? 25  PHE C O     1 
ATOM   1567  C  CB    . PHE C 3  12  ? -29.454 -38.567 20.491 1.00 85.23  ? 25  PHE C CB    1 
ATOM   1568  C  CG    . PHE C 3  12  ? -30.140 -38.266 21.793 1.00 84.83  ? 25  PHE C CG    1 
ATOM   1569  C  CD1   . PHE C 3  12  ? -31.075 -39.142 22.321 1.00 85.50  ? 25  PHE C CD1   1 
ATOM   1570  C  CD2   . PHE C 3  12  ? -29.850 -37.105 22.489 1.00 83.99  ? 25  PHE C CD2   1 
ATOM   1571  C  CE1   . PHE C 3  12  ? -31.708 -38.862 23.520 1.00 83.80  ? 25  PHE C CE1   1 
ATOM   1572  C  CE2   . PHE C 3  12  ? -30.478 -36.821 23.685 1.00 80.13  ? 25  PHE C CE2   1 
ATOM   1573  C  CZ    . PHE C 3  12  ? -31.407 -37.699 24.202 1.00 81.16  ? 25  PHE C CZ    1 
ATOM   1574  N  N     . PRO C 3  13  ? -30.143 -37.265 17.602 1.00 92.38  ? 26  PRO C N     1 
ATOM   1575  C  CA    . PRO C 3  13  ? -29.739 -36.826 16.259 1.00 93.34  ? 26  PRO C CA    1 
ATOM   1576  C  C     . PRO C 3  13  ? -28.250 -36.542 16.145 1.00 90.53  ? 26  PRO C C     1 
ATOM   1577  O  O     . PRO C 3  13  ? -27.772 -35.494 16.589 1.00 88.14  ? 26  PRO C O     1 
ATOM   1578  C  CB    . PRO C 3  13  ? -30.570 -35.556 16.047 1.00 93.36  ? 26  PRO C CB    1 
ATOM   1579  C  CG    . PRO C 3  13  ? -30.772 -35.022 17.425 1.00 91.86  ? 26  PRO C CG    1 
ATOM   1580  C  CD    . PRO C 3  13  ? -30.881 -36.217 18.331 1.00 90.84  ? 26  PRO C CD    1 
ATOM   1581  N  N     . VAL C 3  14  ? -27.509 -37.476 15.545 1.00 91.06  ? 27  VAL C N     1 
ATOM   1582  C  CA    . VAL C 3  14  ? -26.086 -37.259 15.305 1.00 89.45  ? 27  VAL C CA    1 
ATOM   1583  C  C     . VAL C 3  14  ? -25.872 -36.065 14.385 1.00 88.88  ? 27  VAL C C     1 
ATOM   1584  O  O     . VAL C 3  14  ? -24.902 -35.313 14.543 1.00 90.59  ? 27  VAL C O     1 
ATOM   1585  C  CB    . VAL C 3  14  ? -25.445 -38.540 14.735 1.00 90.07  ? 27  VAL C CB    1 
ATOM   1586  C  CG1   . VAL C 3  14  ? -24.007 -38.283 14.320 1.00 90.99  ? 27  VAL C CG1   1 
ATOM   1587  C  CG2   . VAL C 3  14  ? -25.514 -39.664 15.758 1.00 88.22  ? 27  VAL C CG2   1 
ATOM   1588  N  N     . GLY C 3  15  ? -26.775 -35.857 13.425 1.00 89.01  ? 28  GLY C N     1 
ATOM   1589  C  CA    . GLY C 3  15  ? -26.636 -34.722 12.528 1.00 90.24  ? 28  GLY C CA    1 
ATOM   1590  C  C     . GLY C 3  15  ? -26.850 -33.391 13.224 1.00 88.26  ? 28  GLY C C     1 
ATOM   1591  O  O     . GLY C 3  15  ? -26.122 -32.426 12.974 1.00 88.04  ? 28  GLY C O     1 
ATOM   1592  N  N     . ARG C 3  16  ? -27.849 -33.318 14.108 1.00 87.99  ? 29  ARG C N     1 
ATOM   1593  C  CA    . ARG C 3  16  ? -28.115 -32.072 14.820 1.00 84.71  ? 29  ARG C CA    1 
ATOM   1594  C  C     . ARG C 3  16  ? -26.991 -31.738 15.793 1.00 83.98  ? 29  ARG C C     1 
ATOM   1595  O  O     . ARG C 3  16  ? -26.662 -30.563 15.988 1.00 82.10  ? 29  ARG C O     1 
ATOM   1596  C  CB    . ARG C 3  16  ? -29.450 -32.161 15.557 1.00 83.03  ? 29  ARG C CB    1 
ATOM   1597  C  CG    . ARG C 3  16  ? -29.883 -30.860 16.210 1.00 83.86  ? 29  ARG C CG    1 
ATOM   1598  C  CD    . ARG C 3  16  ? -31.002 -31.084 17.216 1.00 90.42  ? 29  ARG C CD    1 
ATOM   1599  N  NE    . ARG C 3  16  ? -32.158 -31.750 16.624 1.00 97.34  ? 29  ARG C NE    1 
ATOM   1600  C  CZ    . ARG C 3  16  ? -33.125 -31.122 15.963 1.00 101.62 ? 29  ARG C CZ    1 
ATOM   1601  N  NH1   . ARG C 3  16  ? -33.073 -29.808 15.801 1.00 106.42 ? 29  ARG C NH1   1 
ATOM   1602  N  NH2   . ARG C 3  16  ? -34.141 -31.809 15.460 1.00 105.57 ? 29  ARG C NH2   1 
ATOM   1603  N  N     . VAL C 3  17  ? -26.394 -32.756 16.418 1.00 85.45  ? 30  VAL C N     1 
ATOM   1604  C  CA    . VAL C 3  17  ? -25.283 -32.512 17.333 1.00 82.98  ? 30  VAL C CA    1 
ATOM   1605  C  C     . VAL C 3  17  ? -24.084 -31.951 16.580 1.00 87.71  ? 30  VAL C C     1 
ATOM   1606  O  O     . VAL C 3  17  ? -23.398 -31.043 17.064 1.00 65.90  ? 30  VAL C O     1 
ATOM   1607  C  CB    . VAL C 3  17  ? -24.924 -33.802 18.094 1.00 75.18  ? 30  VAL C CB    1 
ATOM   1608  C  CG1   . VAL C 3  17  ? -23.680 -33.592 18.941 1.00 70.75  ? 30  VAL C CG1   1 
ATOM   1609  C  CG2   . VAL C 3  17  ? -26.089 -34.246 18.963 1.00 71.05  ? 30  VAL C CG2   1 
ATOM   1610  N  N     . HIS C 3  18  ? -23.818 -32.472 15.379 1.00 94.07  ? 31  HIS C N     1 
ATOM   1611  C  CA    . HIS C 3  18  ? -22.682 -31.993 14.599 1.00 93.96  ? 31  HIS C CA    1 
ATOM   1612  C  C     . HIS C 3  18  ? -22.857 -30.530 14.211 1.00 91.46  ? 31  HIS C C     1 
ATOM   1613  O  O     . HIS C 3  18  ? -21.886 -29.763 14.198 1.00 97.55  ? 31  HIS C O     1 
ATOM   1614  C  CB    . HIS C 3  18  ? -22.495 -32.865 13.357 1.00 97.32  ? 31  HIS C CB    1 
ATOM   1615  C  CG    . HIS C 3  18  ? -21.183 -32.659 12.667 1.00 101.18 ? 31  HIS C CG    1 
ATOM   1616  N  ND1   . HIS C 3  18  ? -19.985 -32.601 13.347 1.00 102.35 ? 31  HIS C ND1   1 
ATOM   1617  C  CD2   . HIS C 3  18  ? -20.878 -32.505 11.357 1.00 105.58 ? 31  HIS C CD2   1 
ATOM   1618  C  CE1   . HIS C 3  18  ? -19.000 -32.417 12.487 1.00 102.98 ? 31  HIS C CE1   1 
ATOM   1619  N  NE2   . HIS C 3  18  ? -19.515 -32.355 11.272 1.00 106.39 ? 31  HIS C NE2   1 
ATOM   1620  N  N     . ARG C 3  19  ? -24.089 -30.122 13.895 1.00 87.53  ? 32  ARG C N     1 
ATOM   1621  C  CA    . ARG C 3  19  ? -24.339 -28.723 13.565 1.00 88.86  ? 32  ARG C CA    1 
ATOM   1622  C  C     . ARG C 3  19  ? -24.159 -27.825 14.783 1.00 86.21  ? 32  ARG C C     1 
ATOM   1623  O  O     . ARG C 3  19  ? -23.561 -26.748 14.683 1.00 85.74  ? 32  ARG C O     1 
ATOM   1624  C  CB    . ARG C 3  19  ? -25.745 -28.557 12.988 1.00 89.54  ? 32  ARG C CB    1 
ATOM   1625  C  CG    . ARG C 3  19  ? -26.213 -27.109 12.934 1.00 88.15  ? 32  ARG C CG    1 
ATOM   1626  C  CD    . ARG C 3  19  ? -27.585 -26.978 12.296 1.00 90.85  ? 32  ARG C CD    1 
ATOM   1627  N  NE    . ARG C 3  19  ? -28.613 -27.717 13.024 1.00 89.88  ? 32  ARG C NE    1 
ATOM   1628  C  CZ    . ARG C 3  19  ? -29.304 -27.226 14.047 1.00 88.88  ? 32  ARG C CZ    1 
ATOM   1629  N  NH1   . ARG C 3  19  ? -29.074 -25.992 14.474 1.00 89.43  ? 32  ARG C NH1   1 
ATOM   1630  N  NH2   . ARG C 3  19  ? -30.224 -27.969 14.646 1.00 88.90  ? 32  ARG C NH2   1 
ATOM   1631  N  N     . LEU C 3  20  ? -24.669 -28.253 15.941 1.00 83.24  ? 33  LEU C N     1 
ATOM   1632  C  CA    . LEU C 3  20  ? -24.569 -27.433 17.143 1.00 83.74  ? 33  LEU C CA    1 
ATOM   1633  C  C     . LEU C 3  20  ? -23.127 -27.284 17.609 1.00 85.07  ? 33  LEU C C     1 
ATOM   1634  O  O     . LEU C 3  20  ? -22.784 -26.280 18.244 1.00 88.47  ? 33  LEU C O     1 
ATOM   1635  C  CB    . LEU C 3  20  ? -25.433 -28.028 18.253 1.00 63.88  ? 33  LEU C CB    1 
ATOM   1636  C  CG    . LEU C 3  20  ? -26.942 -28.014 18.001 1.00 85.14  ? 33  LEU C CG    1 
ATOM   1637  C  CD1   . LEU C 3  20  ? -27.672 -28.862 19.032 1.00 64.01  ? 33  LEU C CD1   1 
ATOM   1638  C  CD2   . LEU C 3  20  ? -27.471 -26.586 18.008 1.00 63.76  ? 33  LEU C CD2   1 
ATOM   1639  N  N     . LEU C 3  21  ? -22.271 -28.263 17.310 1.00 73.41  ? 34  LEU C N     1 
ATOM   1640  C  CA    . LEU C 3  21  ? -20.854 -28.117 17.625 1.00 78.56  ? 34  LEU C CA    1 
ATOM   1641  C  C     . LEU C 3  21  ? -20.187 -27.109 16.697 1.00 89.40  ? 34  LEU C C     1 
ATOM   1642  O  O     . LEU C 3  21  ? -19.303 -26.355 17.122 1.00 89.98  ? 34  LEU C O     1 
ATOM   1643  C  CB    . LEU C 3  21  ? -20.153 -29.474 17.540 1.00 78.34  ? 34  LEU C CB    1 
ATOM   1644  C  CG    . LEU C 3  21  ? -20.568 -30.534 18.564 1.00 77.54  ? 34  LEU C CG    1 
ATOM   1645  C  CD1   . LEU C 3  21  ? -19.863 -31.858 18.289 1.00 83.93  ? 34  LEU C CD1   1 
ATOM   1646  C  CD2   . LEU C 3  21  ? -20.292 -30.059 19.983 1.00 66.53  ? 34  LEU C CD2   1 
ATOM   1647  N  N     . ARG C 3  22  ? -20.602 -27.079 15.428 1.00 100.19 ? 35  ARG C N     1 
ATOM   1648  C  CA    . ARG C 3  22  ? -20.036 -26.124 14.479 1.00 108.49 ? 35  ARG C CA    1 
ATOM   1649  C  C     . ARG C 3  22  ? -20.429 -24.695 14.834 1.00 105.76 ? 35  ARG C C     1 
ATOM   1650  O  O     . ARG C 3  22  ? -19.566 -23.823 14.990 1.00 105.96 ? 35  ARG C O     1 
ATOM   1651  C  CB    . ARG C 3  22  ? -20.494 -26.461 13.059 1.00 118.47 ? 35  ARG C CB    1 
ATOM   1652  C  CG    . ARG C 3  22  ? -19.974 -27.779 12.513 1.00 124.77 ? 35  ARG C CG    1 
ATOM   1653  C  CD    . ARG C 3  22  ? -20.675 -28.124 11.209 1.00 133.57 ? 35  ARG C CD    1 
ATOM   1654  N  NE    . ARG C 3  22  ? -20.125 -29.321 10.580 1.00 143.40 ? 35  ARG C NE    1 
ATOM   1655  C  CZ    . ARG C 3  22  ? -19.176 -29.303 9.650  1.00 152.28 ? 35  ARG C CZ    1 
ATOM   1656  N  NH1   . ARG C 3  22  ? -18.667 -28.149 9.242  1.00 158.78 ? 35  ARG C NH1   1 
ATOM   1657  N  NH2   . ARG C 3  22  ? -18.734 -30.439 9.127  1.00 156.24 ? 35  ARG C NH2   1 
ATOM   1658  N  N     . LYS C 3  23  ? -21.729 -24.436 14.964 1.00 104.05 ? 36  LYS C N     1 
ATOM   1659  C  CA    . LYS C 3  23  ? -22.232 -23.092 15.214 1.00 106.25 ? 36  LYS C CA    1 
ATOM   1660  C  C     . LYS C 3  23  ? -22.134 -22.675 16.676 1.00 101.15 ? 36  LYS C C     1 
ATOM   1661  O  O     . LYS C 3  23  ? -22.590 -21.579 17.020 1.00 100.58 ? 36  LYS C O     1 
ATOM   1662  C  CB    . LYS C 3  23  ? -23.684 -22.982 14.742 1.00 114.44 ? 36  LYS C CB    1 
ATOM   1663  C  CG    . LYS C 3  23  ? -23.861 -23.207 13.248 1.00 124.37 ? 36  LYS C CG    1 
ATOM   1664  C  CD    . LYS C 3  23  ? -25.307 -23.017 12.824 1.00 132.69 ? 36  LYS C CD    1 
ATOM   1665  C  CE    . LYS C 3  23  ? -25.470 -23.214 11.325 1.00 136.22 ? 36  LYS C CE    1 
ATOM   1666  N  NZ    . LYS C 3  23  ? -26.877 -23.003 10.887 1.00 138.19 ? 36  LYS C NZ    1 
ATOM   1667  N  N     . GLY C 3  24  ? -21.557 -23.508 17.536 1.00 97.27  ? 37  GLY C N     1 
ATOM   1668  C  CA    . GLY C 3  24  ? -21.364 -23.163 18.927 1.00 91.73  ? 37  GLY C CA    1 
ATOM   1669  C  C     . GLY C 3  24  ? -20.046 -22.502 19.249 1.00 84.72  ? 37  GLY C C     1 
ATOM   1670  O  O     . GLY C 3  24  ? -19.819 -22.137 20.407 1.00 82.34  ? 37  GLY C O     1 
ATOM   1671  N  N     . ASN C 3  25  ? -19.168 -22.342 18.255 1.00 85.19  ? 38  ASN C N     1 
ATOM   1672  C  CA    . ASN C 3  25  ? -17.869 -21.686 18.426 1.00 87.93  ? 38  ASN C CA    1 
ATOM   1673  C  C     . ASN C 3  25  ? -17.032 -22.376 19.506 1.00 83.79  ? 38  ASN C C     1 
ATOM   1674  O  O     . ASN C 3  25  ? -16.488 -21.739 20.410 1.00 82.98  ? 38  ASN C O     1 
ATOM   1675  C  CB    . ASN C 3  25  ? -18.040 -20.193 18.728 1.00 94.59  ? 38  ASN C CB    1 
ATOM   1676  C  CG    . ASN C 3  25  ? -18.537 -19.407 17.527 1.00 102.19 ? 38  ASN C CG    1 
ATOM   1677  O  OD1   . ASN C 3  25  ? -19.626 -18.833 17.552 1.00 107.61 ? 38  ASN C OD1   1 
ATOM   1678  N  ND2   . ASN C 3  25  ? -17.734 -19.373 16.469 1.00 105.21 ? 38  ASN C ND2   1 
ATOM   1679  N  N     . TYR C 3  26  ? -16.933 -23.701 19.402 1.00 80.58  ? 39  TYR C N     1 
ATOM   1680  C  CA    . TYR C 3  26  ? -16.100 -24.477 20.313 1.00 71.72  ? 39  TYR C CA    1 
ATOM   1681  C  C     . TYR C 3  26  ? -14.706 -24.735 19.759 1.00 68.69  ? 39  TYR C C     1 
ATOM   1682  O  O     . TYR C 3  26  ? -13.749 -24.839 20.537 1.00 62.94  ? 39  TYR C O     1 
ATOM   1683  C  CB    . TYR C 3  26  ? -16.770 -25.815 20.642 1.00 67.11  ? 39  TYR C CB    1 
ATOM   1684  C  CG    . TYR C 3  26  ? -18.150 -25.680 21.246 1.00 65.37  ? 39  TYR C CG    1 
ATOM   1685  C  CD1   . TYR C 3  26  ? -18.313 -25.304 22.575 1.00 63.37  ? 39  TYR C CD1   1 
ATOM   1686  C  CD2   . TYR C 3  26  ? -19.288 -25.935 20.492 1.00 68.28  ? 39  TYR C CD2   1 
ATOM   1687  C  CE1   . TYR C 3  26  ? -19.573 -25.181 23.133 1.00 62.80  ? 39  TYR C CE1   1 
ATOM   1688  C  CE2   . TYR C 3  26  ? -20.552 -25.815 21.043 1.00 67.39  ? 39  TYR C CE2   1 
ATOM   1689  C  CZ    . TYR C 3  26  ? -20.687 -25.438 22.362 1.00 64.17  ? 39  TYR C CZ    1 
ATOM   1690  O  OH    . TYR C 3  26  ? -21.942 -25.317 22.912 1.00 62.64  ? 39  TYR C OH    1 
ATOM   1691  N  N     . ALA C 3  27  ? -14.569 -24.840 18.439 1.00 68.87  ? 40  ALA C N     1 
ATOM   1692  C  CA    . ALA C 3  27  ? -13.271 -25.018 17.804 1.00 72.56  ? 40  ALA C CA    1 
ATOM   1693  C  C     . ALA C 3  27  ? -13.409 -24.676 16.329 1.00 76.37  ? 40  ALA C C     1 
ATOM   1694  O  O     . ALA C 3  27  ? -14.516 -24.567 15.797 1.00 78.86  ? 40  ALA C O     1 
ATOM   1695  C  CB    . ALA C 3  27  ? -12.739 -26.443 17.989 1.00 76.37  ? 40  ALA C CB    1 
ATOM   1696  N  N     . GLU C 3  28  ? -12.259 -24.509 15.672 1.00 79.86  ? 41  GLU C N     1 
ATOM   1697  C  CA    . GLU C 3  28  ? -12.264 -24.172 14.253 1.00 90.77  ? 41  GLU C CA    1 
ATOM   1698  C  C     . GLU C 3  28  ? -12.909 -25.275 13.423 1.00 100.20 ? 41  GLU C C     1 
ATOM   1699  O  O     . GLU C 3  28  ? -13.644 -24.996 12.468 1.00 107.33 ? 41  GLU C O     1 
ATOM   1700  C  CB    . GLU C 3  28  ? -10.837 -23.905 13.773 1.00 95.90  ? 41  GLU C CB    1 
ATOM   1701  C  CG    . GLU C 3  28  ? -10.719 -23.646 12.280 1.00 104.41 ? 41  GLU C CG    1 
ATOM   1702  C  CD    . GLU C 3  28  ? -9.280  -23.644 11.805 1.00 111.20 ? 41  GLU C CD    1 
ATOM   1703  O  OE1   . GLU C 3  28  ? -8.381  -23.395 12.637 1.00 112.20 ? 41  GLU C OE1   1 
ATOM   1704  O  OE2   . GLU C 3  28  ? -9.046  -23.901 10.605 1.00 117.19 ? 41  GLU C OE2   1 
ATOM   1705  N  N     . ARG C 3  29  ? -12.653 -26.534 13.774 1.00 101.83 ? 42  ARG C N     1 
ATOM   1706  C  CA    . ARG C 3  29  ? -13.189 -27.666 13.033 1.00 105.69 ? 42  ARG C CA    1 
ATOM   1707  C  C     . ARG C 3  29  ? -13.660 -28.741 14.002 1.00 96.43  ? 42  ARG C C     1 
ATOM   1708  O  O     . ARG C 3  29  ? -13.099 -28.911 15.088 1.00 91.36  ? 42  ARG C O     1 
ATOM   1709  C  CB    . ARG C 3  29  ? -12.149 -28.242 12.060 1.00 116.79 ? 42  ARG C CB    1 
ATOM   1710  C  CG    . ARG C 3  29  ? -10.792 -28.517 12.684 1.00 123.74 ? 42  ARG C CG    1 
ATOM   1711  C  CD    . ARG C 3  29  ? -9.793  -29.034 11.656 1.00 134.21 ? 42  ARG C CD    1 
ATOM   1712  N  NE    . ARG C 3  29  ? -9.518  -28.058 10.604 1.00 140.66 ? 42  ARG C NE    1 
ATOM   1713  C  CZ    . ARG C 3  29  ? -10.027 -28.115 9.377  1.00 144.80 ? 42  ARG C CZ    1 
ATOM   1714  N  NH1   . ARG C 3  29  ? -10.839 -29.107 9.039  1.00 147.65 ? 42  ARG C NH1   1 
ATOM   1715  N  NH2   . ARG C 3  29  ? -9.721  -27.181 8.487  1.00 146.99 ? 42  ARG C NH2   1 
ATOM   1716  N  N     . VAL C 3  30  ? -14.700 -29.465 13.594 1.00 93.37  ? 43  VAL C N     1 
ATOM   1717  C  CA    . VAL C 3  30  ? -15.302 -30.527 14.393 1.00 87.20  ? 43  VAL C CA    1 
ATOM   1718  C  C     . VAL C 3  30  ? -15.096 -31.837 13.647 1.00 89.97  ? 43  VAL C C     1 
ATOM   1719  O  O     . VAL C 3  30  ? -15.647 -32.032 12.555 1.00 94.28  ? 43  VAL C O     1 
ATOM   1720  C  CB    . VAL C 3  30  ? -16.792 -30.277 14.660 1.00 79.50  ? 43  VAL C CB    1 
ATOM   1721  C  CG1   . VAL C 3  30  ? -17.390 -31.431 15.451 1.00 74.41  ? 43  VAL C CG1   1 
ATOM   1722  C  CG2   . VAL C 3  30  ? -16.985 -28.961 15.395 1.00 75.21  ? 43  VAL C CG2   1 
ATOM   1723  N  N     . GLY C 3  31  ? -14.315 -32.738 14.235 1.00 87.87  ? 44  GLY C N     1 
ATOM   1724  C  CA    . GLY C 3  31  ? -14.054 -34.010 13.593 1.00 86.72  ? 44  GLY C CA    1 
ATOM   1725  C  C     . GLY C 3  31  ? -15.241 -34.951 13.681 1.00 86.52  ? 44  GLY C C     1 
ATOM   1726  O  O     . GLY C 3  31  ? -16.081 -34.855 14.576 1.00 84.80  ? 44  GLY C O     1 
ATOM   1727  N  N     . ALA C 3  32  ? -15.309 -35.871 12.722 1.00 94.83  ? 45  ALA C N     1 
ATOM   1728  C  CA    . ALA C 3  32  ? -16.359 -36.876 12.728 1.00 96.87  ? 45  ALA C CA    1 
ATOM   1729  C  C     . ALA C 3  32  ? -16.183 -37.820 13.914 1.00 97.80  ? 45  ALA C C     1 
ATOM   1730  O  O     . ALA C 3  32  ? -15.080 -38.010 14.440 1.00 103.99 ? 45  ALA C O     1 
ATOM   1731  C  CB    . ALA C 3  32  ? -16.356 -37.673 11.423 1.00 94.33  ? 45  ALA C CB    1 
ATOM   1732  N  N     . GLY C 3  33  ? -17.291 -38.418 14.334 1.00 94.46  ? 46  GLY C N     1 
ATOM   1733  C  CA    . GLY C 3  33  ? -17.296 -39.293 15.494 1.00 92.28  ? 46  GLY C CA    1 
ATOM   1734  C  C     . GLY C 3  33  ? -17.527 -38.547 16.786 1.00 87.55  ? 46  GLY C C     1 
ATOM   1735  O  O     . GLY C 3  33  ? -18.178 -39.062 17.699 1.00 86.66  ? 46  GLY C O     1 
ATOM   1736  N  N     . ALA C 3  34  ? -16.998 -37.328 16.879 1.00 85.02  ? 47  ALA C N     1 
ATOM   1737  C  CA    . ALA C 3  34  ? -17.284 -36.487 18.036 1.00 75.28  ? 47  ALA C CA    1 
ATOM   1738  C  C     . ALA C 3  34  ? -18.772 -36.195 18.201 1.00 72.53  ? 47  ALA C C     1 
ATOM   1739  O  O     . ALA C 3  34  ? -19.252 -36.243 19.348 1.00 67.51  ? 47  ALA C O     1 
ATOM   1740  C  CB    . ALA C 3  34  ? -16.472 -35.189 17.950 1.00 69.64  ? 47  ALA C CB    1 
ATOM   1741  N  N     . PRO C 3  35  ? -19.549 -35.896 17.151 1.00 76.09  ? 48  PRO C N     1 
ATOM   1742  C  CA    . PRO C 3  35  ? -21.001 -35.774 17.366 1.00 78.43  ? 48  PRO C CA    1 
ATOM   1743  C  C     . PRO C 3  35  ? -21.661 -37.089 17.736 1.00 78.50  ? 48  PRO C C     1 
ATOM   1744  O  O     . PRO C 3  35  ? -22.586 -37.098 18.557 1.00 75.94  ? 48  PRO C O     1 
ATOM   1745  C  CB    . PRO C 3  35  ? -21.512 -35.232 16.023 1.00 82.79  ? 48  PRO C CB    1 
ATOM   1746  C  CG    . PRO C 3  35  ? -20.480 -35.640 15.036 1.00 84.23  ? 48  PRO C CG    1 
ATOM   1747  C  CD    . PRO C 3  35  ? -19.181 -35.530 15.770 1.00 79.70  ? 48  PRO C CD    1 
ATOM   1748  N  N     . VAL C 3  36  ? -21.210 -38.207 17.159 1.00 81.26  ? 49  VAL C N     1 
ATOM   1749  C  CA    . VAL C 3  36  ? -21.815 -39.493 17.493 1.00 79.56  ? 49  VAL C CA    1 
ATOM   1750  C  C     . VAL C 3  36  ? -21.408 -39.930 18.896 1.00 73.04  ? 49  VAL C C     1 
ATOM   1751  O  O     . VAL C 3  36  ? -22.175 -40.609 19.589 1.00 71.56  ? 49  VAL C O     1 
ATOM   1752  C  CB    . VAL C 3  36  ? -21.457 -40.552 16.428 1.00 84.00  ? 49  VAL C CB    1 
ATOM   1753  C  CG1   . VAL C 3  36  ? -20.890 -39.888 15.181 1.00 87.45  ? 49  VAL C CG1   1 
ATOM   1754  C  CG2   . VAL C 3  36  ? -20.492 -41.599 16.976 1.00 84.08  ? 49  VAL C CG2   1 
ATOM   1755  N  N     . TYR C 3  37  ? -20.212 -39.543 19.346 1.00 68.82  ? 50  TYR C N     1 
ATOM   1756  C  CA    . TYR C 3  37  ? -19.811 -39.836 20.718 1.00 68.56  ? 50  TYR C CA    1 
ATOM   1757  C  C     . TYR C 3  37  ? -20.642 -39.024 21.702 1.00 74.97  ? 50  TYR C C     1 
ATOM   1758  O  O     . TYR C 3  37  ? -21.155 -39.560 22.691 1.00 73.93  ? 50  TYR C O     1 
ATOM   1759  C  CB    . TYR C 3  37  ? -18.318 -39.549 20.900 1.00 66.64  ? 50  TYR C CB    1 
ATOM   1760  C  CG    . TYR C 3  37  ? -17.685 -40.184 22.124 1.00 65.49  ? 50  TYR C CG    1 
ATOM   1761  C  CD1   . TYR C 3  37  ? -18.025 -39.771 23.408 1.00 62.53  ? 50  TYR C CD1   1 
ATOM   1762  C  CD2   . TYR C 3  37  ? -16.728 -41.183 21.992 1.00 70.04  ? 50  TYR C CD2   1 
ATOM   1763  C  CE1   . TYR C 3  37  ? -17.442 -40.345 24.523 1.00 64.09  ? 50  TYR C CE1   1 
ATOM   1764  C  CE2   . TYR C 3  37  ? -16.140 -41.762 23.102 1.00 70.51  ? 50  TYR C CE2   1 
ATOM   1765  C  CZ    . TYR C 3  37  ? -16.500 -41.340 24.364 1.00 70.49  ? 50  TYR C CZ    1 
ATOM   1766  O  OH    . TYR C 3  37  ? -15.916 -41.914 25.469 1.00 71.92  ? 50  TYR C OH    1 
ATOM   1767  N  N     . LEU C 3  38  ? -20.790 -37.723 21.439 1.00 81.03  ? 51  LEU C N     1 
ATOM   1768  C  CA    . LEU C 3  38  ? -21.550 -36.861 22.338 1.00 75.28  ? 51  LEU C CA    1 
ATOM   1769  C  C     . LEU C 3  38  ? -23.033 -37.210 22.321 1.00 81.50  ? 51  LEU C C     1 
ATOM   1770  O  O     . LEU C 3  38  ? -23.686 -37.206 23.371 1.00 83.89  ? 51  LEU C O     1 
ATOM   1771  C  CB    . LEU C 3  38  ? -21.332 -35.398 21.959 1.00 67.62  ? 51  LEU C CB    1 
ATOM   1772  C  CG    . LEU C 3  38  ? -22.113 -34.344 22.743 1.00 65.66  ? 51  LEU C CG    1 
ATOM   1773  C  CD1   . LEU C 3  38  ? -21.884 -34.500 24.236 1.00 67.15  ? 51  LEU C CD1   1 
ATOM   1774  C  CD2   . LEU C 3  38  ? -21.705 -32.961 22.280 1.00 64.07  ? 51  LEU C CD2   1 
ATOM   1775  N  N     . ALA C 3  39  ? -23.583 -37.510 21.141 1.00 83.33  ? 52  ALA C N     1 
ATOM   1776  C  CA    . ALA C 3  39  ? -24.988 -37.900 21.064 1.00 82.70  ? 52  ALA C CA    1 
ATOM   1777  C  C     . ALA C 3  39  ? -25.245 -39.178 21.849 1.00 83.74  ? 52  ALA C C     1 
ATOM   1778  O  O     . ALA C 3  39  ? -26.298 -39.328 22.478 1.00 82.43  ? 52  ALA C O     1 
ATOM   1779  C  CB    . ALA C 3  39  ? -25.413 -38.072 19.606 1.00 83.58  ? 52  ALA C CB    1 
ATOM   1780  N  N     . ALA C 3  40  ? -24.288 -40.109 21.830 1.00 86.80  ? 53  ALA C N     1 
ATOM   1781  C  CA    . ALA C 3  40  ? -24.440 -41.343 22.592 1.00 86.03  ? 53  ALA C CA    1 
ATOM   1782  C  C     . ALA C 3  40  ? -24.356 -41.082 24.090 1.00 83.86  ? 53  ALA C C     1 
ATOM   1783  O  O     . ALA C 3  40  ? -25.074 -41.710 24.877 1.00 91.49  ? 53  ALA C O     1 
ATOM   1784  C  CB    . ALA C 3  40  ? -23.383 -42.360 22.162 1.00 81.77  ? 53  ALA C CB    1 
ATOM   1785  N  N     . VAL C 3  41  ? -23.483 -40.160 24.504 1.00 78.05  ? 54  VAL C N     1 
ATOM   1786  C  CA    . VAL C 3  41  ? -23.371 -39.830 25.921 1.00 70.87  ? 54  VAL C CA    1 
ATOM   1787  C  C     . VAL C 3  41  ? -24.633 -39.125 26.405 1.00 71.24  ? 54  VAL C C     1 
ATOM   1788  O  O     . VAL C 3  41  ? -25.120 -39.384 27.512 1.00 72.22  ? 54  VAL C O     1 
ATOM   1789  C  CB    . VAL C 3  41  ? -22.109 -38.985 26.175 1.00 62.37  ? 54  VAL C CB    1 
ATOM   1790  C  CG1   . VAL C 3  41  ? -22.070 -38.498 27.615 1.00 62.87  ? 54  VAL C CG1   1 
ATOM   1791  C  CG2   . VAL C 3  41  ? -20.859 -39.791 25.853 1.00 55.11  ? 54  VAL C CG2   1 
ATOM   1792  N  N     . LEU C 3  42  ? -25.188 -38.232 25.581 1.00 72.79  ? 55  LEU C N     1 
ATOM   1793  C  CA    . LEU C 3  42  ? -26.432 -37.561 25.946 1.00 70.79  ? 55  LEU C CA    1 
ATOM   1794  C  C     . LEU C 3  42  ? -27.602 -38.536 25.953 1.00 77.16  ? 55  LEU C C     1 
ATOM   1795  O  O     . LEU C 3  42  ? -28.502 -38.428 26.795 1.00 76.39  ? 55  LEU C O     1 
ATOM   1796  C  CB    . LEU C 3  42  ? -26.703 -36.402 24.989 1.00 67.19  ? 55  LEU C CB    1 
ATOM   1797  C  CG    . LEU C 3  42  ? -25.677 -35.270 25.001 1.00 63.29  ? 55  LEU C CG    1 
ATOM   1798  C  CD1   . LEU C 3  42  ? -25.980 -34.268 23.903 1.00 65.21  ? 55  LEU C CD1   1 
ATOM   1799  C  CD2   . LEU C 3  42  ? -25.652 -34.587 26.360 1.00 60.75  ? 55  LEU C CD2   1 
ATOM   1800  N  N     . GLU C 3  43  ? -27.608 -39.494 25.022 1.00 84.63  ? 56  GLU C N     1 
ATOM   1801  C  CA    . GLU C 3  43  ? -28.666 -40.498 25.001 1.00 85.62  ? 56  GLU C CA    1 
ATOM   1802  C  C     . GLU C 3  43  ? -28.566 -41.426 26.205 1.00 83.27  ? 56  GLU C C     1 
ATOM   1803  O  O     . GLU C 3  43  ? -29.589 -41.851 26.756 1.00 85.40  ? 56  GLU C O     1 
ATOM   1804  C  CB    . GLU C 3  43  ? -28.605 -41.296 23.699 1.00 90.35  ? 56  GLU C CB    1 
ATOM   1805  C  CG    . GLU C 3  43  ? -29.673 -42.369 23.568 1.00 98.48  ? 56  GLU C CG    1 
ATOM   1806  C  CD    . GLU C 3  43  ? -29.604 -43.097 22.239 1.00 105.35 ? 56  GLU C CD    1 
ATOM   1807  O  OE1   . GLU C 3  43  ? -28.804 -42.681 21.375 1.00 109.71 ? 56  GLU C OE1   1 
ATOM   1808  O  OE2   . GLU C 3  43  ? -30.347 -44.084 22.057 1.00 109.47 ? 56  GLU C OE2   1 
ATOM   1809  N  N     . TYR C 3  44  ? -27.342 -41.750 26.630 1.00 78.42  ? 57  TYR C N     1 
ATOM   1810  C  CA    . TYR C 3  44  ? -27.168 -42.599 27.803 1.00 74.28  ? 57  TYR C CA    1 
ATOM   1811  C  C     . TYR C 3  44  ? -27.661 -41.905 29.066 1.00 76.53  ? 57  TYR C C     1 
ATOM   1812  O  O     . TYR C 3  44  ? -28.353 -42.517 29.889 1.00 77.18  ? 57  TYR C O     1 
ATOM   1813  C  CB    . TYR C 3  44  ? -25.700 -42.999 27.951 1.00 69.02  ? 57  TYR C CB    1 
ATOM   1814  C  CG    . TYR C 3  44  ? -25.345 -43.464 29.344 1.00 71.45  ? 57  TYR C CG    1 
ATOM   1815  C  CD1   . TYR C 3  44  ? -25.730 -44.719 29.796 1.00 74.92  ? 57  TYR C CD1   1 
ATOM   1816  C  CD2   . TYR C 3  44  ? -24.632 -42.645 30.211 1.00 72.97  ? 57  TYR C CD2   1 
ATOM   1817  C  CE1   . TYR C 3  44  ? -25.413 -45.146 31.072 1.00 77.13  ? 57  TYR C CE1   1 
ATOM   1818  C  CE2   . TYR C 3  44  ? -24.311 -43.063 31.489 1.00 73.94  ? 57  TYR C CE2   1 
ATOM   1819  C  CZ    . TYR C 3  44  ? -24.705 -44.314 31.914 1.00 74.77  ? 57  TYR C CZ    1 
ATOM   1820  O  OH    . TYR C 3  44  ? -24.389 -44.737 33.184 1.00 72.81  ? 57  TYR C OH    1 
ATOM   1821  N  N     . LEU C 3  45  ? -27.316 -40.626 29.236 1.00 73.84  ? 58  LEU C N     1 
ATOM   1822  C  CA    . LEU C 3  45  ? -27.698 -39.910 30.450 1.00 69.83  ? 58  LEU C CA    1 
ATOM   1823  C  C     . LEU C 3  45  ? -29.206 -39.712 30.528 1.00 72.47  ? 58  LEU C C     1 
ATOM   1824  O  O     . LEU C 3  45  ? -29.793 -39.808 31.613 1.00 72.89  ? 58  LEU C O     1 
ATOM   1825  C  CB    . LEU C 3  45  ? -26.971 -38.568 30.520 1.00 67.28  ? 58  LEU C CB    1 
ATOM   1826  C  CG    . LEU C 3  45  ? -25.458 -38.655 30.733 1.00 64.95  ? 58  LEU C CG    1 
ATOM   1827  C  CD1   . LEU C 3  45  ? -24.834 -37.271 30.777 1.00 55.90  ? 58  LEU C CD1   1 
ATOM   1828  C  CD2   . LEU C 3  45  ? -25.147 -39.426 32.007 1.00 68.14  ? 58  LEU C CD2   1 
ATOM   1829  N  N     . THR C 3  46  ? -29.852 -39.433 29.393 1.00 74.28  ? 59  THR C N     1 
ATOM   1830  C  CA    . THR C 3  46  ? -31.308 -39.346 29.385 1.00 75.68  ? 59  THR C CA    1 
ATOM   1831  C  C     . THR C 3  46  ? -31.936 -40.697 29.699 1.00 80.34  ? 59  THR C C     1 
ATOM   1832  O  O     . THR C 3  46  ? -32.970 -40.768 30.374 1.00 82.54  ? 59  THR C O     1 
ATOM   1833  C  CB    . THR C 3  46  ? -31.806 -38.828 28.036 1.00 75.81  ? 59  THR C CB    1 
ATOM   1834  O  OG1   . THR C 3  46  ? -31.288 -39.650 26.984 1.00 81.93  ? 59  THR C OG1   1 
ATOM   1835  C  CG2   . THR C 3  46  ? -31.357 -37.398 27.821 1.00 76.57  ? 59  THR C CG2   1 
ATOM   1836  N  N     . ALA C 3  47  ? -31.322 -41.781 29.221 1.00 79.98  ? 60  ALA C N     1 
ATOM   1837  C  CA    . ALA C 3  47  ? -31.821 -43.112 29.546 1.00 83.66  ? 60  ALA C CA    1 
ATOM   1838  C  C     . ALA C 3  47  ? -31.663 -43.411 31.031 1.00 83.27  ? 60  ALA C C     1 
ATOM   1839  O  O     . ALA C 3  47  ? -32.515 -44.078 31.629 1.00 84.94  ? 60  ALA C O     1 
ATOM   1840  C  CB    . ALA C 3  47  ? -31.097 -44.163 28.707 1.00 88.38  ? 60  ALA C CB    1 
ATOM   1841  N  N     . GLU C 3  48  ? -30.582 -42.921 31.643 1.00 80.49  ? 61  GLU C N     1 
ATOM   1842  C  CA    . GLU C 3  48  ? -30.357 -43.179 33.061 1.00 79.54  ? 61  GLU C CA    1 
ATOM   1843  C  C     . GLU C 3  48  ? -31.384 -42.456 33.922 1.00 82.71  ? 61  GLU C C     1 
ATOM   1844  O  O     . GLU C 3  48  ? -31.864 -43.006 34.920 1.00 86.53  ? 61  GLU C O     1 
ATOM   1845  C  CB    . GLU C 3  48  ? -28.939 -42.763 33.451 1.00 78.07  ? 61  GLU C CB    1 
ATOM   1846  C  CG    . GLU C 3  48  ? -28.491 -43.282 34.808 1.00 80.74  ? 61  GLU C CG    1 
ATOM   1847  C  CD    . GLU C 3  48  ? -27.999 -44.716 34.753 1.00 82.59  ? 61  GLU C CD    1 
ATOM   1848  O  OE1   . GLU C 3  48  ? -27.137 -45.017 33.900 1.00 80.38  ? 61  GLU C OE1   1 
ATOM   1849  O  OE2   . GLU C 3  48  ? -28.476 -45.543 35.559 1.00 86.25  ? 61  GLU C OE2   1 
ATOM   1850  N  N     . ILE C 3  49  ? -31.739 -41.224 33.551 1.00 82.92  ? 62  ILE C N     1 
ATOM   1851  C  CA    . ILE C 3  49  ? -32.719 -40.470 34.327 1.00 83.50  ? 62  ILE C CA    1 
ATOM   1852  C  C     . ILE C 3  49  ? -34.122 -41.016 34.096 1.00 85.32  ? 62  ILE C C     1 
ATOM   1853  O  O     . ILE C 3  49  ? -34.898 -41.187 35.044 1.00 89.91  ? 62  ILE C O     1 
ATOM   1854  C  CB    . ILE C 3  49  ? -32.631 -38.970 33.989 1.00 85.70  ? 62  ILE C CB    1 
ATOM   1855  C  CG1   . ILE C 3  49  ? -31.293 -38.397 34.458 1.00 85.98  ? 62  ILE C CG1   1 
ATOM   1856  C  CG2   . ILE C 3  49  ? -33.788 -38.207 34.619 1.00 83.58  ? 62  ILE C CG2   1 
ATOM   1857  C  CD1   . ILE C 3  49  ? -31.189 -36.898 34.304 1.00 84.18  ? 62  ILE C CD1   1 
ATOM   1858  N  N     . LEU C 3  50  ? -34.471 -41.301 32.839 1.00 86.51  ? 63  LEU C N     1 
ATOM   1859  C  CA    . LEU C 3  50  ? -35.798 -41.834 32.546 1.00 89.20  ? 63  LEU C CA    1 
ATOM   1860  C  C     . LEU C 3  50  ? -35.996 -43.219 33.148 1.00 94.04  ? 63  LEU C C     1 
ATOM   1861  O  O     . LEU C 3  50  ? -37.130 -43.601 33.458 1.00 101.47 ? 63  LEU C O     1 
ATOM   1862  C  CB    . LEU C 3  50  ? -36.029 -41.870 31.035 1.00 90.53  ? 63  LEU C CB    1 
ATOM   1863  C  CG    . LEU C 3  50  ? -36.154 -40.515 30.335 1.00 89.50  ? 63  LEU C CG    1 
ATOM   1864  C  CD1   . LEU C 3  50  ? -36.232 -40.694 28.827 1.00 91.38  ? 63  LEU C CD1   1 
ATOM   1865  C  CD2   . LEU C 3  50  ? -37.364 -39.752 30.851 1.00 89.89  ? 63  LEU C CD2   1 
ATOM   1866  N  N     . GLU C 3  51  ? -34.914 -43.983 33.319 1.00 92.90  ? 64  GLU C N     1 
ATOM   1867  C  CA    . GLU C 3  51  ? -35.018 -45.281 33.979 1.00 97.36  ? 64  GLU C CA    1 
ATOM   1868  C  C     . GLU C 3  51  ? -35.418 -45.121 35.440 1.00 93.98  ? 64  GLU C C     1 
ATOM   1869  O  O     . GLU C 3  51  ? -36.309 -45.823 35.932 1.00 93.11  ? 64  GLU C O     1 
ATOM   1870  C  CB    . GLU C 3  51  ? -33.692 -46.036 33.864 1.00 104.66 ? 64  GLU C CB    1 
ATOM   1871  C  CG    . GLU C 3  51  ? -33.510 -47.153 34.885 1.00 111.56 ? 64  GLU C CG    1 
ATOM   1872  C  CD    . GLU C 3  51  ? -34.419 -48.341 34.631 1.00 123.10 ? 64  GLU C CD    1 
ATOM   1873  O  OE1   . GLU C 3  51  ? -34.885 -48.505 33.484 1.00 129.30 ? 64  GLU C OE1   1 
ATOM   1874  O  OE2   . GLU C 3  51  ? -34.665 -49.115 35.581 1.00 126.54 ? 64  GLU C OE2   1 
ATOM   1875  N  N     . LEU C 3  52  ? -34.770 -44.195 36.150 1.00 91.33  ? 65  LEU C N     1 
ATOM   1876  C  CA    . LEU C 3  52  ? -35.057 -44.001 37.566 1.00 86.88  ? 65  LEU C CA    1 
ATOM   1877  C  C     . LEU C 3  52  ? -36.316 -43.173 37.788 1.00 85.04  ? 65  LEU C C     1 
ATOM   1878  O  O     . LEU C 3  52  ? -37.007 -43.364 38.795 1.00 84.16  ? 65  LEU C O     1 
ATOM   1879  C  CB    . LEU C 3  52  ? -33.862 -43.341 38.254 1.00 83.27  ? 65  LEU C CB    1 
ATOM   1880  C  CG    . LEU C 3  52  ? -32.503 -43.998 38.009 1.00 81.92  ? 65  LEU C CG    1 
ATOM   1881  C  CD1   . LEU C 3  52  ? -31.393 -43.210 38.688 1.00 75.94  ? 65  LEU C CD1   1 
ATOM   1882  C  CD2   . LEU C 3  52  ? -32.509 -45.445 38.483 1.00 87.10  ? 65  LEU C CD2   1 
ATOM   1883  N  N     . ALA C 3  53  ? -36.627 -42.251 36.873 1.00 87.20  ? 66  ALA C N     1 
ATOM   1884  C  CA    . ALA C 3  53  ? -37.853 -41.471 37.006 1.00 91.51  ? 66  ALA C CA    1 
ATOM   1885  C  C     . ALA C 3  53  ? -39.079 -42.314 36.682 1.00 97.26  ? 66  ALA C C     1 
ATOM   1886  O  O     . ALA C 3  53  ? -40.115 -42.193 37.346 1.00 97.98  ? 66  ALA C O     1 
ATOM   1887  C  CB    . ALA C 3  53  ? -37.794 -40.236 36.106 1.00 92.54  ? 66  ALA C CB    1 
ATOM   1888  N  N     . GLY C 3  54  ? -38.981 -43.169 35.661 1.00 101.95 ? 67  GLY C N     1 
ATOM   1889  C  CA    . GLY C 3  54  ? -40.079 -44.075 35.365 1.00 108.34 ? 67  GLY C CA    1 
ATOM   1890  C  C     . GLY C 3  54  ? -40.368 -45.025 36.509 1.00 111.31 ? 67  GLY C C     1 
ATOM   1891  O  O     . GLY C 3  54  ? -41.523 -45.376 36.762 1.00 117.42 ? 67  GLY C O     1 
ATOM   1892  N  N     . ASN C 3  55  ? -39.320 -45.459 37.215 1.00 108.53 ? 68  ASN C N     1 
ATOM   1893  C  CA    . ASN C 3  55  ? -39.520 -46.251 38.423 1.00 105.30 ? 68  ASN C CA    1 
ATOM   1894  C  C     . ASN C 3  55  ? -40.221 -45.434 39.501 1.00 107.95 ? 68  ASN C C     1 
ATOM   1895  O  O     . ASN C 3  55  ? -41.088 -45.952 40.215 1.00 112.89 ? 68  ASN C O     1 
ATOM   1896  C  CB    . ASN C 3  55  ? -38.180 -46.778 38.938 1.00 99.93  ? 68  ASN C CB    1 
ATOM   1897  C  CG    . ASN C 3  55  ? -37.530 -47.756 37.979 1.00 99.94  ? 68  ASN C CG    1 
ATOM   1898  O  OD1   . ASN C 3  55  ? -38.210 -48.445 37.217 1.00 104.66 ? 68  ASN C OD1   1 
ATOM   1899  N  ND2   . ASN C 3  55  ? -36.203 -47.826 38.014 1.00 95.15  ? 68  ASN C ND2   1 
ATOM   1900  N  N     . ALA C 3  56  ? -39.858 -44.154 39.631 1.00 106.93 ? 69  ALA C N     1 
ATOM   1901  C  CA    . ALA C 3  56  ? -40.520 -43.295 40.607 1.00 105.89 ? 69  ALA C CA    1 
ATOM   1902  C  C     . ALA C 3  56  ? -41.990 -43.098 40.265 1.00 109.01 ? 69  ALA C C     1 
ATOM   1903  O  O     . ALA C 3  56  ? -42.831 -43.002 41.166 1.00 109.09 ? 69  ALA C O     1 
ATOM   1904  C  CB    . ALA C 3  56  ? -39.805 -41.947 40.690 1.00 102.49 ? 69  ALA C CB    1 
ATOM   1905  N  N     . ALA C 3  57  ? -42.319 -43.041 38.973 1.00 112.66 ? 70  ALA C N     1 
ATOM   1906  C  CA    . ALA C 3  57  ? -43.717 -42.927 38.573 1.00 117.97 ? 70  ALA C CA    1 
ATOM   1907  C  C     . ALA C 3  57  ? -44.493 -44.190 38.923 1.00 126.68 ? 70  ALA C C     1 
ATOM   1908  O  O     . ALA C 3  57  ? -45.624 -44.114 39.416 1.00 126.77 ? 70  ALA C O     1 
ATOM   1909  C  CB    . ALA C 3  57  ? -43.813 -42.633 37.076 1.00 117.42 ? 70  ALA C CB    1 
ATOM   1910  N  N     . ARG C 3  58  ? -43.900 -45.362 38.679 1.00 134.31 ? 71  ARG C N     1 
ATOM   1911  C  CA    . ARG C 3  58  ? -44.565 -46.613 39.025 1.00 141.35 ? 71  ARG C CA    1 
ATOM   1912  C  C     . ARG C 3  58  ? -44.717 -46.766 40.533 1.00 141.59 ? 71  ARG C C     1 
ATOM   1913  O  O     . ARG C 3  58  ? -45.700 -47.354 40.999 1.00 143.17 ? 71  ARG C O     1 
ATOM   1914  C  CB    . ARG C 3  58  ? -43.793 -47.798 38.443 1.00 146.69 ? 71  ARG C CB    1 
ATOM   1915  C  CG    . ARG C 3  58  ? -44.523 -49.129 38.552 1.00 152.46 ? 71  ARG C CG    1 
ATOM   1916  C  CD    . ARG C 3  58  ? -43.684 -50.282 38.015 1.00 156.22 ? 71  ARG C CD    1 
ATOM   1917  N  NE    . ARG C 3  58  ? -42.507 -50.541 38.840 1.00 156.56 ? 71  ARG C NE    1 
ATOM   1918  C  CZ    . ARG C 3  58  ? -41.276 -50.140 38.537 1.00 155.20 ? 71  ARG C CZ    1 
ATOM   1919  N  NH1   . ARG C 3  58  ? -41.052 -49.460 37.421 1.00 157.30 ? 71  ARG C NH1   1 
ATOM   1920  N  NH2   . ARG C 3  58  ? -40.266 -50.422 39.350 1.00 152.86 ? 71  ARG C NH2   1 
ATOM   1921  N  N     . ASP C 3  59  ? -43.762 -46.247 41.309 1.00 142.50 ? 72  ASP C N     1 
ATOM   1922  C  CA    . ASP C 3  59  ? -43.893 -46.288 42.761 1.00 145.88 ? 72  ASP C CA    1 
ATOM   1923  C  C     . ASP C 3  59  ? -44.950 -45.309 43.256 1.00 147.84 ? 72  ASP C C     1 
ATOM   1924  O  O     . ASP C 3  59  ? -45.623 -45.580 44.257 1.00 149.80 ? 72  ASP C O     1 
ATOM   1925  C  CB    . ASP C 3  59  ? -42.546 -45.995 43.422 1.00 146.18 ? 72  ASP C CB    1 
ATOM   1926  C  CG    . ASP C 3  59  ? -41.480 -47.006 43.048 1.00 148.71 ? 72  ASP C CG    1 
ATOM   1927  O  OD1   . ASP C 3  59  ? -41.841 -48.143 42.680 1.00 152.11 ? 72  ASP C OD1   1 
ATOM   1928  O  OD2   . ASP C 3  59  ? -40.281 -46.663 43.123 1.00 150.75 ? 72  ASP C OD2   1 
ATOM   1929  N  N     . ASN C 3  60  ? -45.110 -44.176 42.575 1.00 147.92 ? 73  ASN C N     1 
ATOM   1930  C  CA    . ASN C 3  60  ? -46.124 -43.191 42.921 1.00 148.87 ? 73  ASN C CA    1 
ATOM   1931  C  C     . ASN C 3  60  ? -47.465 -43.467 42.251 1.00 150.99 ? 73  ASN C C     1 
ATOM   1932  O  O     . ASN C 3  60  ? -48.352 -42.608 42.295 1.00 151.56 ? 73  ASN C O     1 
ATOM   1933  C  CB    . ASN C 3  60  ? -45.639 -41.784 42.559 1.00 149.94 ? 73  ASN C CB    1 
ATOM   1934  C  CG    . ASN C 3  60  ? -44.426 -41.360 43.365 1.00 152.09 ? 73  ASN C CG    1 
ATOM   1935  O  OD1   . ASN C 3  60  ? -43.694 -42.197 43.894 1.00 152.77 ? 73  ASN C OD1   1 
ATOM   1936  N  ND2   . ASN C 3  60  ? -44.208 -40.054 43.464 1.00 152.37 ? 73  ASN C ND2   1 
ATOM   1937  N  N     . LYS C 3  61  ? -47.622 -44.639 41.630 1.00 150.18 ? 74  LYS C N     1 
ATOM   1938  C  CA    . LYS C 3  61  ? -48.885 -45.066 41.022 1.00 149.93 ? 74  LYS C CA    1 
ATOM   1939  C  C     . LYS C 3  61  ? -49.335 -44.102 39.924 1.00 144.25 ? 74  LYS C C     1 
ATOM   1940  O  O     . LYS C 3  61  ? -50.497 -43.694 39.857 1.00 144.24 ? 74  LYS C O     1 
ATOM   1941  C  CB    . LYS C 3  61  ? -49.975 -45.239 42.084 1.00 153.30 ? 74  LYS C CB    1 
ATOM   1942  C  CG    . LYS C 3  61  ? -49.663 -46.304 43.125 1.00 155.69 ? 74  LYS C CG    1 
ATOM   1943  C  CD    . LYS C 3  61  ? -49.465 -47.668 42.480 1.00 158.93 ? 74  LYS C CD    1 
ATOM   1944  C  CE    . LYS C 3  61  ? -49.211 -48.743 43.524 1.00 159.35 ? 74  LYS C CE    1 
ATOM   1945  N  NZ    . LYS C 3  61  ? -47.995 -48.456 44.335 1.00 156.39 ? 74  LYS C NZ    1 
ATOM   1946  N  N     . LYS C 3  62  ? -48.397 -43.739 39.052 1.00 138.72 ? 75  LYS C N     1 
ATOM   1947  C  CA    . LYS C 3  62  ? -48.684 -42.910 37.890 1.00 133.23 ? 75  LYS C CA    1 
ATOM   1948  C  C     . LYS C 3  62  ? -47.896 -43.437 36.701 1.00 130.73 ? 75  LYS C C     1 
ATOM   1949  O  O     . LYS C 3  62  ? -46.808 -43.996 36.859 1.00 129.13 ? 75  LYS C O     1 
ATOM   1950  C  CB    . LYS C 3  62  ? -48.343 -41.432 38.139 1.00 127.48 ? 75  LYS C CB    1 
ATOM   1951  C  CG    . LYS C 3  62  ? -49.229 -40.749 39.172 1.00 125.38 ? 75  LYS C CG    1 
ATOM   1952  C  CD    . LYS C 3  62  ? -48.906 -39.269 39.295 1.00 123.64 ? 75  LYS C CD    1 
ATOM   1953  C  CE    . LYS C 3  62  ? -49.826 -38.584 40.295 1.00 122.91 ? 75  LYS C CE    1 
ATOM   1954  N  NZ    . LYS C 3  62  ? -49.547 -37.126 40.408 1.00 119.66 ? 75  LYS C NZ    1 
ATOM   1955  N  N     . THR C 3  63  ? -48.456 -43.261 35.504 1.00 130.01 ? 76  THR C N     1 
ATOM   1956  C  CA    . THR C 3  63  ? -47.805 -43.740 34.293 1.00 129.90 ? 76  THR C CA    1 
ATOM   1957  C  C     . THR C 3  63  ? -47.067 -42.649 33.530 1.00 125.96 ? 76  THR C C     1 
ATOM   1958  O  O     . THR C 3  63  ? -46.189 -42.969 32.722 1.00 127.37 ? 76  THR C O     1 
ATOM   1959  C  CB    . THR C 3  63  ? -48.826 -44.402 33.358 1.00 134.44 ? 76  THR C CB    1 
ATOM   1960  O  OG1   . THR C 3  63  ? -48.139 -45.039 32.273 1.00 138.38 ? 76  THR C OG1   1 
ATOM   1961  C  CG2   . THR C 3  63  ? -49.784 -43.371 32.796 1.00 135.53 ? 76  THR C CG2   1 
ATOM   1962  N  N     . ARG C 3  64  ? -47.391 -41.380 33.763 1.00 120.47 ? 77  ARG C N     1 
ATOM   1963  C  CA    . ARG C 3  64  ? -46.704 -40.269 33.119 1.00 116.12 ? 77  ARG C CA    1 
ATOM   1964  C  C     . ARG C 3  64  ? -45.715 -39.647 34.094 1.00 106.92 ? 77  ARG C C     1 
ATOM   1965  O  O     . ARG C 3  64  ? -46.063 -39.362 35.245 1.00 103.57 ? 77  ARG C O     1 
ATOM   1966  C  CB    . ARG C 3  64  ? -47.695 -39.215 32.623 1.00 121.38 ? 77  ARG C CB    1 
ATOM   1967  C  CG    . ARG C 3  64  ? -48.447 -39.618 31.365 1.00 128.29 ? 77  ARG C CG    1 
ATOM   1968  C  CD    . ARG C 3  64  ? -48.899 -38.397 30.580 1.00 130.99 ? 77  ARG C CD    1 
ATOM   1969  N  NE    . ARG C 3  64  ? -49.906 -37.618 31.294 1.00 132.32 ? 77  ARG C NE    1 
ATOM   1970  C  CZ    . ARG C 3  64  ? -51.214 -37.719 31.082 1.00 135.15 ? 77  ARG C CZ    1 
ATOM   1971  N  NH1   . ARG C 3  64  ? -51.675 -38.566 30.172 1.00 137.46 ? 77  ARG C NH1   1 
ATOM   1972  N  NH2   . ARG C 3  64  ? -52.061 -36.971 31.776 1.00 134.65 ? 77  ARG C NH2   1 
ATOM   1973  N  N     . ILE C 3  65  ? -44.487 -39.438 33.630 1.00 102.90 ? 78  ILE C N     1 
ATOM   1974  C  CA    . ILE C 3  65  ? -43.430 -38.875 34.463 1.00 96.69  ? 78  ILE C CA    1 
ATOM   1975  C  C     . ILE C 3  65  ? -43.673 -37.379 34.623 1.00 95.29  ? 78  ILE C C     1 
ATOM   1976  O  O     . ILE C 3  65  ? -43.773 -36.646 33.634 1.00 96.35  ? 78  ILE C O     1 
ATOM   1977  C  CB    . ILE C 3  65  ? -42.046 -39.150 33.859 1.00 91.09  ? 78  ILE C CB    1 
ATOM   1978  C  CG1   . ILE C 3  65  ? -41.826 -40.656 33.696 1.00 93.93  ? 78  ILE C CG1   1 
ATOM   1979  C  CG2   . ILE C 3  65  ? -40.955 -38.538 34.726 1.00 83.18  ? 78  ILE C CG2   1 
ATOM   1980  C  CD1   . ILE C 3  65  ? -40.503 -41.014 33.055 1.00 94.96  ? 78  ILE C CD1   1 
ATOM   1981  N  N     . ILE C 3  66  ? -43.770 -36.928 35.869 1.00 92.41  ? 79  ILE C N     1 
ATOM   1982  C  CA    . ILE C 3  66  ? -43.967 -35.515 36.181 1.00 88.90  ? 79  ILE C CA    1 
ATOM   1983  C  C     . ILE C 3  66  ? -42.651 -34.969 36.727 1.00 88.65  ? 79  ILE C C     1 
ATOM   1984  O  O     . ILE C 3  66  ? -41.736 -35.755 37.011 1.00 90.16  ? 79  ILE C O     1 
ATOM   1985  C  CB    . ILE C 3  66  ? -45.123 -35.323 37.177 1.00 90.40  ? 79  ILE C CB    1 
ATOM   1986  C  CG1   . ILE C 3  66  ? -44.786 -35.967 38.522 1.00 89.53  ? 79  ILE C CG1   1 
ATOM   1987  C  CG2   . ILE C 3  66  ? -46.413 -35.896 36.610 1.00 96.67  ? 79  ILE C CG2   1 
ATOM   1988  C  CD1   . ILE C 3  66  ? -45.859 -35.777 39.572 1.00 90.28  ? 79  ILE C CD1   1 
ATOM   1989  N  N     . PRO C 3  67  ? -42.494 -33.647 36.866 1.00 89.13  ? 80  PRO C N     1 
ATOM   1990  C  CA    . PRO C 3  67  ? -41.257 -33.118 37.465 1.00 88.38  ? 80  PRO C CA    1 
ATOM   1991  C  C     . PRO C 3  67  ? -40.929 -33.699 38.830 1.00 88.95  ? 80  PRO C C     1 
ATOM   1992  O  O     . PRO C 3  67  ? -39.744 -33.831 39.165 1.00 86.63  ? 80  PRO C O     1 
ATOM   1993  C  CB    . PRO C 3  67  ? -41.539 -31.614 37.550 1.00 87.81  ? 80  PRO C CB    1 
ATOM   1994  C  CG    . PRO C 3  67  ? -42.438 -31.356 36.403 1.00 89.08  ? 80  PRO C CG    1 
ATOM   1995  C  CD    . PRO C 3  67  ? -43.321 -32.570 36.289 1.00 89.93  ? 80  PRO C CD    1 
ATOM   1996  N  N     . ARG C 3  68  ? -41.940 -34.044 39.631 1.00 91.53  ? 81  ARG C N     1 
ATOM   1997  C  CA    . ARG C 3  68  ? -41.679 -34.672 40.923 1.00 88.96  ? 81  ARG C CA    1 
ATOM   1998  C  C     . ARG C 3  68  ? -40.917 -35.979 40.754 1.00 91.23  ? 81  ARG C C     1 
ATOM   1999  O  O     . ARG C 3  68  ? -39.996 -36.275 41.524 1.00 90.51  ? 81  ARG C O     1 
ATOM   2000  C  CB    . ARG C 3  68  ? -42.993 -34.909 41.666 1.00 88.05  ? 81  ARG C CB    1 
ATOM   2001  C  CG    . ARG C 3  68  ? -42.852 -35.702 42.956 1.00 87.41  ? 81  ARG C CG    1 
ATOM   2002  C  CD    . ARG C 3  68  ? -41.953 -34.986 43.947 1.00 86.25  ? 81  ARG C CD    1 
ATOM   2003  N  NE    . ARG C 3  68  ? -41.960 -35.627 45.257 1.00 90.14  ? 81  ARG C NE    1 
ATOM   2004  C  CZ    . ARG C 3  68  ? -41.393 -35.110 46.342 1.00 92.28  ? 81  ARG C CZ    1 
ATOM   2005  N  NH1   . ARG C 3  68  ? -40.775 -33.938 46.275 1.00 92.12  ? 81  ARG C NH1   1 
ATOM   2006  N  NH2   . ARG C 3  68  ? -41.447 -35.763 47.495 1.00 92.80  ? 81  ARG C NH2   1 
ATOM   2007  N  N     . HIS C 3  69  ? -41.279 -36.769 39.740 1.00 93.31  ? 82  HIS C N     1 
ATOM   2008  C  CA    . HIS C 3  69  ? -40.606 -38.042 39.510 1.00 90.31  ? 82  HIS C CA    1 
ATOM   2009  C  C     . HIS C 3  69  ? -39.178 -37.844 39.017 1.00 86.81  ? 82  HIS C C     1 
ATOM   2010  O  O     . HIS C 3  69  ? -38.323 -38.711 39.234 1.00 87.34  ? 82  HIS C O     1 
ATOM   2011  C  CB    . HIS C 3  69  ? -41.408 -38.881 38.515 1.00 91.26  ? 82  HIS C CB    1 
ATOM   2012  C  CG    . HIS C 3  69  ? -42.835 -39.086 38.917 1.00 92.86  ? 82  HIS C CG    1 
ATOM   2013  N  ND1   . HIS C 3  69  ? -43.835 -39.349 38.005 1.00 96.70  ? 82  HIS C ND1   1 
ATOM   2014  C  CD2   . HIS C 3  69  ? -43.431 -39.067 40.133 1.00 92.09  ? 82  HIS C CD2   1 
ATOM   2015  C  CE1   . HIS C 3  69  ? -44.985 -39.483 38.642 1.00 97.96  ? 82  HIS C CE1   1 
ATOM   2016  N  NE2   . HIS C 3  69  ? -44.767 -39.316 39.935 1.00 94.70  ? 82  HIS C NE2   1 
ATOM   2017  N  N     . LEU C 3  70  ? -38.899 -36.720 38.354 1.00 84.26  ? 83  LEU C N     1 
ATOM   2018  C  CA    . LEU C 3  70  ? -37.529 -36.422 37.952 1.00 83.09  ? 83  LEU C CA    1 
ATOM   2019  C  C     . LEU C 3  70  ? -36.689 -35.977 39.142 1.00 84.27  ? 83  LEU C C     1 
ATOM   2020  O  O     . LEU C 3  70  ? -35.503 -36.315 39.229 1.00 86.26  ? 83  LEU C O     1 
ATOM   2021  C  CB    . LEU C 3  70  ? -37.521 -35.352 36.861 1.00 80.23  ? 83  LEU C CB    1 
ATOM   2022  C  CG    . LEU C 3  70  ? -38.082 -35.753 35.496 1.00 81.42  ? 83  LEU C CG    1 
ATOM   2023  C  CD1   . LEU C 3  70  ? -38.195 -34.540 34.589 1.00 80.45  ? 83  LEU C CD1   1 
ATOM   2024  C  CD2   . LEU C 3  70  ? -37.213 -36.820 34.852 1.00 84.39  ? 83  LEU C CD2   1 
ATOM   2025  N  N     . GLN C 3  71  ? -37.287 -35.224 40.068 1.00 83.56  ? 84  GLN C N     1 
ATOM   2026  C  CA    . GLN C 3  71  ? -36.554 -34.782 41.250 1.00 82.71  ? 84  GLN C CA    1 
ATOM   2027  C  C     . GLN C 3  71  ? -36.255 -35.951 42.182 1.00 83.11  ? 84  GLN C C     1 
ATOM   2028  O  O     . GLN C 3  71  ? -35.160 -36.033 42.751 1.00 82.02  ? 84  GLN C O     1 
ATOM   2029  C  CB    . GLN C 3  71  ? -37.344 -33.697 41.982 1.00 82.16  ? 84  GLN C CB    1 
ATOM   2030  C  CG    . GLN C 3  71  ? -36.695 -33.198 43.267 1.00 81.52  ? 84  GLN C CG    1 
ATOM   2031  C  CD    . GLN C 3  71  ? -35.540 -32.246 43.019 1.00 81.48  ? 84  GLN C CD    1 
ATOM   2032  O  OE1   . GLN C 3  71  ? -35.142 -32.013 41.877 1.00 85.27  ? 84  GLN C OE1   1 
ATOM   2033  N  NE2   . GLN C 3  71  ? -35.000 -31.681 44.093 1.00 78.36  ? 84  GLN C NE2   1 
ATOM   2034  N  N     . LEU C 3  72  ? -37.215 -36.865 42.348 1.00 88.39  ? 85  LEU C N     1 
ATOM   2035  C  CA    . LEU C 3  72  ? -36.975 -38.048 43.169 1.00 80.92  ? 85  LEU C CA    1 
ATOM   2036  C  C     . LEU C 3  72  ? -35.891 -38.935 42.575 1.00 74.34  ? 85  LEU C C     1 
ATOM   2037  O  O     . LEU C 3  72  ? -35.139 -39.577 43.319 1.00 74.80  ? 85  LEU C O     1 
ATOM   2038  C  CB    . LEU C 3  72  ? -38.268 -38.847 43.337 1.00 77.63  ? 85  LEU C CB    1 
ATOM   2039  C  CG    . LEU C 3  72  ? -39.401 -38.177 44.111 1.00 76.55  ? 85  LEU C CG    1 
ATOM   2040  C  CD1   . LEU C 3  72  ? -40.674 -39.002 44.014 1.00 76.69  ? 85  LEU C CD1   1 
ATOM   2041  C  CD2   . LEU C 3  72  ? -39.001 -37.970 45.562 1.00 76.41  ? 85  LEU C CD2   1 
ATOM   2042  N  N     . ALA C 3  73  ? -35.793 -38.988 41.243 1.00 70.62  ? 86  ALA C N     1 
ATOM   2043  C  CA    . ALA C 3  73  ? -34.811 -39.866 40.619 1.00 71.98  ? 86  ALA C CA    1 
ATOM   2044  C  C     . ALA C 3  73  ? -33.399 -39.307 40.729 1.00 77.18  ? 86  ALA C C     1 
ATOM   2045  O  O     . ALA C 3  73  ? -32.437 -40.073 40.850 1.00 82.76  ? 86  ALA C O     1 
ATOM   2046  C  CB    . ALA C 3  73  ? -35.175 -40.100 39.155 1.00 67.93  ? 86  ALA C CB    1 
ATOM   2047  N  N     . VAL C 3  74  ? -33.252 -37.985 40.698 1.00 76.09  ? 87  VAL C N     1 
ATOM   2048  C  CA    . VAL C 3  74  ? -31.921 -37.389 40.709 1.00 73.88  ? 87  VAL C CA    1 
ATOM   2049  C  C     . VAL C 3  74  ? -31.400 -37.244 42.134 1.00 70.72  ? 87  VAL C C     1 
ATOM   2050  O  O     . VAL C 3  74  ? -30.231 -37.535 42.411 1.00 69.01  ? 87  VAL C O     1 
ATOM   2051  C  CB    . VAL C 3  74  ? -31.942 -36.041 39.963 1.00 74.85  ? 87  VAL C CB    1 
ATOM   2052  C  CG1   . VAL C 3  74  ? -30.581 -35.367 40.036 1.00 75.22  ? 87  VAL C CG1   1 
ATOM   2053  C  CG2   . VAL C 3  74  ? -32.356 -36.253 38.515 1.00 74.91  ? 87  VAL C CG2   1 
ATOM   2054  N  N     . ARG C 3  75  ? -32.252 -36.804 43.062 1.00 69.92  ? 88  ARG C N     1 
ATOM   2055  C  CA    . ARG C 3  75  ? -31.796 -36.563 44.425 1.00 73.30  ? 88  ARG C CA    1 
ATOM   2056  C  C     . ARG C 3  75  ? -31.562 -37.852 45.201 1.00 79.89  ? 88  ARG C C     1 
ATOM   2057  O  O     . ARG C 3  75  ? -30.867 -37.826 46.222 1.00 83.46  ? 88  ARG C O     1 
ATOM   2058  C  CB    . ARG C 3  75  ? -32.798 -35.676 45.162 1.00 72.58  ? 88  ARG C CB    1 
ATOM   2059  C  CG    . ARG C 3  75  ? -33.075 -34.354 44.463 1.00 68.07  ? 88  ARG C CG    1 
ATOM   2060  C  CD    . ARG C 3  75  ? -31.785 -33.657 44.062 1.00 64.24  ? 88  ARG C CD    1 
ATOM   2061  N  NE    . ARG C 3  75  ? -32.033 -32.524 43.176 1.00 64.25  ? 88  ARG C NE    1 
ATOM   2062  C  CZ    . ARG C 3  75  ? -31.080 -31.860 42.530 1.00 67.49  ? 88  ARG C CZ    1 
ATOM   2063  N  NH1   . ARG C 3  75  ? -29.810 -32.218 42.666 1.00 68.50  ? 88  ARG C NH1   1 
ATOM   2064  N  NH2   . ARG C 3  75  ? -31.397 -30.841 41.743 1.00 68.24  ? 88  ARG C NH2   1 
ATOM   2065  N  N     . ASN C 3  76  ? -32.118 -38.974 44.745 1.00 82.84  ? 89  ASN C N     1 
ATOM   2066  C  CA    . ASN C 3  76  ? -31.881 -40.262 45.384 1.00 82.31  ? 89  ASN C CA    1 
ATOM   2067  C  C     . ASN C 3  76  ? -30.715 -41.028 44.772 1.00 78.43  ? 89  ASN C C     1 
ATOM   2068  O  O     . ASN C 3  76  ? -30.317 -42.060 45.322 1.00 84.00  ? 89  ASN C O     1 
ATOM   2069  C  CB    . ASN C 3  76  ? -33.146 -41.123 45.329 1.00 86.85  ? 89  ASN C CB    1 
ATOM   2070  C  CG    . ASN C 3  76  ? -34.207 -40.657 46.305 1.00 92.35  ? 89  ASN C CG    1 
ATOM   2071  O  OD1   . ASN C 3  76  ? -33.913 -40.357 47.462 1.00 92.47  ? 89  ASN C OD1   1 
ATOM   2072  N  ND2   . ASN C 3  76  ? -35.449 -40.586 45.841 1.00 99.65  ? 89  ASN C ND2   1 
ATOM   2073  N  N     . ASP C 3  77  ? -30.167 -40.558 43.655 1.00 72.99  ? 90  ASP C N     1 
ATOM   2074  C  CA    . ASP C 3  77  ? -28.966 -41.135 43.068 1.00 72.59  ? 90  ASP C CA    1 
ATOM   2075  C  C     . ASP C 3  77  ? -27.768 -40.270 43.434 1.00 75.44  ? 90  ASP C C     1 
ATOM   2076  O  O     . ASP C 3  77  ? -27.795 -39.051 43.239 1.00 76.86  ? 90  ASP C O     1 
ATOM   2077  C  CB    . ASP C 3  77  ? -29.094 -41.253 41.550 1.00 74.68  ? 90  ASP C CB    1 
ATOM   2078  C  CG    . ASP C 3  77  ? -27.846 -41.822 40.906 1.00 83.88  ? 90  ASP C CG    1 
ATOM   2079  O  OD1   . ASP C 3  77  ? -27.705 -43.060 40.865 1.00 91.40  ? 90  ASP C OD1   1 
ATOM   2080  O  OD2   . ASP C 3  77  ? -27.001 -41.031 40.441 1.00 91.16  ? 90  ASP C OD2   1 
ATOM   2081  N  N     . GLU C 3  78  ? -26.720 -40.908 43.959 1.00 77.74  ? 91  GLU C N     1 
ATOM   2082  C  CA    . GLU C 3  78  ? -25.567 -40.167 44.461 1.00 78.50  ? 91  GLU C CA    1 
ATOM   2083  C  C     . GLU C 3  78  ? -24.884 -39.369 43.355 1.00 76.51  ? 91  GLU C C     1 
ATOM   2084  O  O     . GLU C 3  78  ? -24.393 -38.259 43.593 1.00 79.57  ? 91  GLU C O     1 
ATOM   2085  C  CB    . GLU C 3  78  ? -24.578 -41.132 45.115 1.00 85.26  ? 91  GLU C CB    1 
ATOM   2086  C  CG    . GLU C 3  78  ? -23.242 -40.511 45.489 1.00 94.69  ? 91  GLU C CG    1 
ATOM   2087  C  CD    . GLU C 3  78  ? -22.296 -41.509 46.124 1.00 105.15 ? 91  GLU C CD    1 
ATOM   2088  O  OE1   . GLU C 3  78  ? -22.776 -42.541 46.638 1.00 108.72 ? 91  GLU C OE1   1 
ATOM   2089  O  OE2   . GLU C 3  78  ? -21.071 -41.264 46.107 1.00 111.75 ? 91  GLU C OE2   1 
ATOM   2090  N  N     . GLU C 3  79  ? -24.851 -39.909 42.139 1.00 75.53  ? 92  GLU C N     1 
ATOM   2091  C  CA    . GLU C 3  79  ? -24.058 -39.305 41.076 1.00 75.92  ? 92  GLU C CA    1 
ATOM   2092  C  C     . GLU C 3  79  ? -24.855 -38.323 40.224 1.00 73.24  ? 92  GLU C C     1 
ATOM   2093  O  O     . GLU C 3  79  ? -24.317 -37.287 39.817 1.00 76.92  ? 92  GLU C O     1 
ATOM   2094  C  CB    . GLU C 3  79  ? -23.451 -40.402 40.201 1.00 80.31  ? 92  GLU C CB    1 
ATOM   2095  C  CG    . GLU C 3  79  ? -22.685 -41.439 41.004 1.00 86.81  ? 92  GLU C CG    1 
ATOM   2096  C  CD    . GLU C 3  79  ? -21.809 -42.315 40.142 1.00 93.69  ? 92  GLU C CD    1 
ATOM   2097  O  OE1   . GLU C 3  79  ? -22.216 -42.621 39.001 1.00 96.99  ? 92  GLU C OE1   1 
ATOM   2098  O  OE2   . GLU C 3  79  ? -20.709 -42.687 40.603 1.00 98.82  ? 92  GLU C OE2   1 
ATOM   2099  N  N     . LEU C 3  80  ? -26.123 -38.626 39.935 1.00 67.80  ? 93  LEU C N     1 
ATOM   2100  C  CA    . LEU C 3  80  ? -26.971 -37.646 39.264 1.00 67.67  ? 93  LEU C CA    1 
ATOM   2101  C  C     . LEU C 3  80  ? -27.167 -36.407 40.126 1.00 75.38  ? 93  LEU C C     1 
ATOM   2102  O  O     . LEU C 3  80  ? -27.298 -35.296 39.599 1.00 79.74  ? 93  LEU C O     1 
ATOM   2103  C  CB    . LEU C 3  80  ? -28.323 -38.266 38.907 1.00 62.48  ? 93  LEU C CB    1 
ATOM   2104  C  CG    . LEU C 3  80  ? -28.334 -39.331 37.811 1.00 59.07  ? 93  LEU C CG    1 
ATOM   2105  C  CD1   . LEU C 3  80  ? -29.725 -39.925 37.660 1.00 62.36  ? 93  LEU C CD1   1 
ATOM   2106  C  CD2   . LEU C 3  80  ? -27.856 -38.748 36.492 1.00 55.51  ? 93  LEU C CD2   1 
ATOM   2107  N  N     . ASN C 3  81  ? -27.188 -36.580 41.449 1.00 76.14  ? 94  ASN C N     1 
ATOM   2108  C  CA    . ASN C 3  81  ? -27.277 -35.438 42.350 1.00 72.80  ? 94  ASN C CA    1 
ATOM   2109  C  C     . ASN C 3  81  ? -25.994 -34.617 42.329 1.00 70.62  ? 94  ASN C C     1 
ATOM   2110  O  O     . ASN C 3  81  ? -26.034 -33.390 42.469 1.00 71.57  ? 94  ASN C O     1 
ATOM   2111  C  CB    . ASN C 3  81  ? -27.588 -35.917 43.769 1.00 73.07  ? 94  ASN C CB    1 
ATOM   2112  C  CG    . ASN C 3  81  ? -27.643 -34.777 44.771 1.00 72.65  ? 94  ASN C CG    1 
ATOM   2113  O  OD1   . ASN C 3  81  ? -28.660 -34.096 44.895 1.00 75.44  ? 94  ASN C OD1   1 
ATOM   2114  N  ND2   . ASN C 3  81  ? -26.548 -34.566 45.495 1.00 71.18  ? 94  ASN C ND2   1 
ATOM   2115  N  N     . LYS C 3  82  ? -24.845 -35.275 42.164 1.00 68.94  ? 95  LYS C N     1 
ATOM   2116  C  CA    . LYS C 3  82  ? -23.585 -34.542 42.115 1.00 69.87  ? 95  LYS C CA    1 
ATOM   2117  C  C     . LYS C 3  82  ? -23.401 -33.850 40.769 1.00 75.46  ? 95  LYS C C     1 
ATOM   2118  O  O     . LYS C 3  82  ? -22.856 -32.743 40.703 1.00 83.99  ? 95  LYS C O     1 
ATOM   2119  C  CB    . LYS C 3  82  ? -22.424 -35.491 42.409 1.00 72.76  ? 95  LYS C CB    1 
ATOM   2120  C  CG    . LYS C 3  82  ? -21.054 -34.831 42.417 1.00 78.08  ? 95  LYS C CG    1 
ATOM   2121  C  CD    . LYS C 3  82  ? -20.021 -35.718 43.086 1.00 87.69  ? 95  LYS C CD    1 
ATOM   2122  C  CE    . LYS C 3  82  ? -19.978 -37.106 42.451 1.00 94.00  ? 95  LYS C CE    1 
ATOM   2123  N  NZ    . LYS C 3  82  ? -19.038 -38.016 43.173 1.00 95.15  ? 95  LYS C NZ    1 
ATOM   2124  N  N     . LEU C 3  83  ? -23.857 -34.481 39.686 1.00 73.08  ? 96  LEU C N     1 
ATOM   2125  C  CA    . LEU C 3  83  ? -23.845 -33.823 38.383 1.00 69.07  ? 96  LEU C CA    1 
ATOM   2126  C  C     . LEU C 3  83  ? -24.814 -32.648 38.341 1.00 69.79  ? 96  LEU C C     1 
ATOM   2127  O  O     . LEU C 3  83  ? -24.524 -31.630 37.703 1.00 70.89  ? 96  LEU C O     1 
ATOM   2128  C  CB    . LEU C 3  83  ? -24.177 -34.832 37.282 1.00 65.17  ? 96  LEU C CB    1 
ATOM   2129  C  CG    . LEU C 3  83  ? -24.225 -34.285 35.861 1.00 66.84  ? 96  LEU C CG    1 
ATOM   2130  C  CD1   . LEU C 3  83  ? -22.861 -33.752 35.443 1.00 70.29  ? 96  LEU C CD1   1 
ATOM   2131  C  CD2   . LEU C 3  83  ? -24.714 -35.349 34.891 1.00 66.57  ? 96  LEU C CD2   1 
ATOM   2132  N  N     . LEU C 3  84  ? -25.957 -32.765 39.010 1.00 68.41  ? 97  LEU C N     1 
ATOM   2133  C  CA    . LEU C 3  84  ? -26.960 -31.707 39.063 1.00 66.28  ? 97  LEU C CA    1 
ATOM   2134  C  C     . LEU C 3  84  ? -27.023 -31.070 40.450 1.00 62.30  ? 97  LEU C C     1 
ATOM   2135  O  O     . LEU C 3  84  ? -28.103 -30.799 40.982 1.00 55.59  ? 97  LEU C O     1 
ATOM   2136  C  CB    . LEU C 3  84  ? -28.331 -32.244 38.656 1.00 66.41  ? 97  LEU C CB    1 
ATOM   2137  C  CG    . LEU C 3  84  ? -28.711 -32.291 37.173 1.00 66.68  ? 97  LEU C CG    1 
ATOM   2138  C  CD1   . LEU C 3  84  ? -27.702 -33.070 36.352 1.00 70.31  ? 97  LEU C CD1   1 
ATOM   2139  C  CD2   . LEU C 3  84  ? -30.103 -32.890 37.009 1.00 64.86  ? 97  LEU C CD2   1 
ATOM   2140  N  N     . GLY C 3  85  ? -25.857 -30.837 41.057 1.00 63.23  ? 98  GLY C N     1 
ATOM   2141  C  CA    . GLY C 3  85  ? -25.831 -30.239 42.383 1.00 65.52  ? 98  GLY C CA    1 
ATOM   2142  C  C     . GLY C 3  85  ? -26.243 -28.779 42.380 1.00 67.50  ? 98  GLY C C     1 
ATOM   2143  O  O     . GLY C 3  85  ? -27.035 -28.347 43.224 1.00 70.04  ? 98  GLY C O     1 
ATOM   2144  N  N     . ARG C 3  86  ? -25.710 -27.997 41.436 1.00 64.53  ? 99  ARG C N     1 
ATOM   2145  C  CA    . ARG C 3  86  ? -26.065 -26.592 41.289 1.00 63.48  ? 99  ARG C CA    1 
ATOM   2146  C  C     . ARG C 3  86  ? -27.195 -26.379 40.288 1.00 64.43  ? 99  ARG C C     1 
ATOM   2147  O  O     . ARG C 3  86  ? -27.207 -25.364 39.577 1.00 66.57  ? 99  ARG C O     1 
ATOM   2148  C  CB    . ARG C 3  86  ? -24.832 -25.783 40.886 1.00 66.63  ? 99  ARG C CB    1 
ATOM   2149  C  CG    . ARG C 3  86  ? -23.657 -25.923 41.842 1.00 74.39  ? 99  ARG C CG    1 
ATOM   2150  C  CD    . ARG C 3  86  ? -24.052 -25.525 43.251 1.00 85.90  ? 99  ARG C CD    1 
ATOM   2151  N  NE    . ARG C 3  86  ? -22.972 -25.749 44.207 1.00 96.05  ? 99  ARG C NE    1 
ATOM   2152  C  CZ    . ARG C 3  86  ? -23.072 -25.518 45.511 1.00 101.68 ? 99  ARG C CZ    1 
ATOM   2153  N  NH1   . ARG C 3  86  ? -24.206 -25.054 46.020 1.00 102.80 ? 99  ARG C NH1   1 
ATOM   2154  N  NH2   . ARG C 3  86  ? -22.038 -25.751 46.308 1.00 102.98 ? 99  ARG C NH2   1 
ATOM   2155  N  N     . VAL C 3  87  ? -28.142 -27.313 40.209 1.00 62.02  ? 100 VAL C N     1 
ATOM   2156  C  CA    . VAL C 3  87  ? -29.245 -27.257 39.259 1.00 60.84  ? 100 VAL C CA    1 
ATOM   2157  C  C     . VAL C 3  87  ? -30.555 -27.339 40.028 1.00 65.60  ? 100 VAL C C     1 
ATOM   2158  O  O     . VAL C 3  87  ? -30.671 -28.101 40.994 1.00 71.53  ? 100 VAL C O     1 
ATOM   2159  C  CB    . VAL C 3  87  ? -29.144 -28.389 38.214 1.00 55.23  ? 100 VAL C CB    1 
ATOM   2160  C  CG1   . VAL C 3  87  ? -30.399 -28.450 37.365 1.00 47.32  ? 100 VAL C CG1   1 
ATOM   2161  C  CG2   . VAL C 3  87  ? -27.911 -28.195 37.338 1.00 55.69  ? 100 VAL C CG2   1 
ATOM   2162  N  N     . THR C 3  88  ? -31.536 -26.548 39.602 1.00 65.61  ? 101 THR C N     1 
ATOM   2163  C  CA    . THR C 3  88  ? -32.864 -26.537 40.204 1.00 65.63  ? 101 THR C CA    1 
ATOM   2164  C  C     . THR C 3  88  ? -33.869 -27.107 39.211 1.00 65.53  ? 101 THR C C     1 
ATOM   2165  O  O     . THR C 3  88  ? -34.010 -26.590 38.097 1.00 66.62  ? 101 THR C O     1 
ATOM   2166  C  CB    . THR C 3  88  ? -33.271 -25.124 40.622 1.00 64.51  ? 101 THR C CB    1 
ATOM   2167  O  OG1   . THR C 3  88  ? -32.361 -24.635 41.617 1.00 66.12  ? 101 THR C OG1   1 
ATOM   2168  C  CG2   . THR C 3  88  ? -34.683 -25.127 41.190 1.00 63.37  ? 101 THR C CG2   1 
ATOM   2169  N  N     . ILE C 3  89  ? -34.565 -28.163 39.616 1.00 66.67  ? 102 ILE C N     1 
ATOM   2170  C  CA    . ILE C 3  89  ? -35.610 -28.771 38.799 1.00 66.55  ? 102 ILE C CA    1 
ATOM   2171  C  C     . ILE C 3  89  ? -36.946 -28.164 39.208 1.00 65.08  ? 102 ILE C C     1 
ATOM   2172  O  O     . ILE C 3  89  ? -37.367 -28.287 40.364 1.00 67.93  ? 102 ILE C O     1 
ATOM   2173  C  CB    . ILE C 3  89  ? -35.620 -30.299 38.954 1.00 68.90  ? 102 ILE C CB    1 
ATOM   2174  C  CG1   . ILE C 3  89  ? -34.336 -30.902 38.376 1.00 66.37  ? 102 ILE C CG1   1 
ATOM   2175  C  CG2   . ILE C 3  89  ? -36.844 -30.900 38.279 1.00 68.15  ? 102 ILE C CG2   1 
ATOM   2176  C  CD1   . ILE C 3  89  ? -34.271 -32.410 38.469 1.00 64.71  ? 102 ILE C CD1   1 
ATOM   2177  N  N     . ALA C 3  90  ? -37.613 -27.507 38.262 1.00 78.25  ? 103 ALA C N     1 
ATOM   2178  C  CA    . ALA C 3  90  ? -38.846 -26.796 38.568 1.00 81.73  ? 103 ALA C CA    1 
ATOM   2179  C  C     . ALA C 3  90  ? -39.971 -27.768 38.905 1.00 86.41  ? 103 ALA C C     1 
ATOM   2180  O  O     . ALA C 3  90  ? -40.117 -28.818 38.273 1.00 91.91  ? 103 ALA C O     1 
ATOM   2181  C  CB    . ALA C 3  90  ? -39.254 -25.911 37.391 1.00 79.97  ? 103 ALA C CB    1 
ATOM   2182  N  N     . GLN C 3  91  ? -40.768 -27.404 39.914 1.00 86.33  ? 104 GLN C N     1 
ATOM   2183  C  CA    . GLN C 3  91  ? -41.912 -28.204 40.359 1.00 90.26  ? 104 GLN C CA    1 
ATOM   2184  C  C     . GLN C 3  91  ? -41.484 -29.607 40.780 1.00 94.77  ? 104 GLN C C     1 
ATOM   2185  O  O     . GLN C 3  91  ? -42.198 -30.588 40.559 1.00 100.79 ? 104 GLN C O     1 
ATOM   2186  C  CB    . GLN C 3  91  ? -42.998 -28.265 39.281 1.00 93.82  ? 104 GLN C CB    1 
ATOM   2187  C  CG    . GLN C 3  91  ? -43.783 -26.974 39.126 1.00 99.00  ? 104 GLN C CG    1 
ATOM   2188  C  CD    . GLN C 3  91  ? -44.622 -26.656 40.349 1.00 105.69 ? 104 GLN C CD    1 
ATOM   2189  O  OE1   . GLN C 3  91  ? -45.197 -27.551 40.971 1.00 109.36 ? 104 GLN C OE1   1 
ATOM   2190  N  NE2   . GLN C 3  91  ? -44.691 -25.378 40.706 1.00 108.31 ? 104 GLN C NE2   1 
ATOM   2191  N  N     . GLY C 3  92  ? -40.312 -29.704 41.402 1.00 94.65  ? 105 GLY C N     1 
ATOM   2192  C  CA    . GLY C 3  92  ? -39.788 -30.989 41.819 1.00 94.14  ? 105 GLY C CA    1 
ATOM   2193  C  C     . GLY C 3  92  ? -39.916 -31.244 43.306 1.00 96.26  ? 105 GLY C C     1 
ATOM   2194  O  O     . GLY C 3  92  ? -39.934 -32.398 43.745 1.00 99.22  ? 105 GLY C O     1 
ATOM   2195  N  N     . GLY C 3  93  ? -40.009 -30.175 44.094 1.00 96.28  ? 106 GLY C N     1 
ATOM   2196  C  CA    . GLY C 3  93  ? -40.090 -30.347 45.529 1.00 96.89  ? 106 GLY C CA    1 
ATOM   2197  C  C     . GLY C 3  93  ? -38.768 -30.819 46.117 1.00 96.02  ? 106 GLY C C     1 
ATOM   2198  O  O     . GLY C 3  93  ? -37.706 -30.757 45.490 1.00 96.59  ? 106 GLY C O     1 
ATOM   2199  N  N     . VAL C 3  94  ? -38.850 -31.304 47.356 1.00 93.45  ? 107 VAL C N     1 
ATOM   2200  C  CA    . VAL C 3  94  ? -37.690 -31.787 48.091 1.00 88.78  ? 107 VAL C CA    1 
ATOM   2201  C  C     . VAL C 3  94  ? -37.970 -33.205 48.571 1.00 85.12  ? 107 VAL C C     1 
ATOM   2202  O  O     . VAL C 3  94  ? -39.107 -33.676 48.570 1.00 84.01  ? 107 VAL C O     1 
ATOM   2203  C  CB    . VAL C 3  94  ? -37.331 -30.876 49.284 1.00 88.89  ? 107 VAL C CB    1 
ATOM   2204  C  CG1   . VAL C 3  94  ? -36.969 -29.481 48.795 1.00 90.55  ? 107 VAL C CG1   1 
ATOM   2205  C  CG2   . VAL C 3  94  ? -38.483 -30.822 50.270 1.00 86.49  ? 107 VAL C CG2   1 
ATOM   2206  N  N     . LEU C 3  95  ? -36.905 -33.887 48.979 1.00 84.90  ? 108 LEU C N     1 
ATOM   2207  C  CA    . LEU C 3  95  ? -37.051 -35.231 49.517 1.00 87.73  ? 108 LEU C CA    1 
ATOM   2208  C  C     . LEU C 3  95  ? -37.624 -35.171 50.931 1.00 96.14  ? 108 LEU C C     1 
ATOM   2209  O  O     . LEU C 3  95  ? -37.297 -34.256 51.695 1.00 101.37 ? 108 LEU C O     1 
ATOM   2210  C  CB    . LEU C 3  95  ? -35.705 -35.955 49.540 1.00 82.61  ? 108 LEU C CB    1 
ATOM   2211  C  CG    . LEU C 3  95  ? -35.016 -36.233 48.205 1.00 81.10  ? 108 LEU C CG    1 
ATOM   2212  C  CD1   . LEU C 3  95  ? -33.676 -36.915 48.436 1.00 65.59  ? 108 LEU C CD1   1 
ATOM   2213  C  CD2   . LEU C 3  95  ? -35.906 -37.083 47.316 1.00 81.41  ? 108 LEU C CD2   1 
ATOM   2214  N  N     . PRO C 3  96  ? -38.485 -36.119 51.306 1.00 97.34  ? 109 PRO C N     1 
ATOM   2215  C  CA    . PRO C 3  96  ? -38.944 -36.182 52.699 1.00 98.88  ? 109 PRO C CA    1 
ATOM   2216  C  C     . PRO C 3  96  ? -37.795 -36.467 53.653 1.00 99.19  ? 109 PRO C C     1 
ATOM   2217  O  O     . PRO C 3  96  ? -37.232 -37.567 53.647 1.00 99.50  ? 109 PRO C O     1 
ATOM   2218  C  CB    . PRO C 3  96  ? -39.967 -37.327 52.684 1.00 100.10 ? 109 PRO C CB    1 
ATOM   2219  C  CG    . PRO C 3  96  ? -40.390 -37.445 51.254 1.00 97.94  ? 109 PRO C CG    1 
ATOM   2220  C  CD    . PRO C 3  96  ? -39.172 -37.101 50.451 1.00 96.48  ? 109 PRO C CD    1 
ATOM   2221  N  N     . ASN C 3  97  ? -37.431 -35.480 54.468 1.00 102.19 ? 110 ASN C N     1 
ATOM   2222  C  CA    . ASN C 3  97  ? -36.303 -35.625 55.385 1.00 103.95 ? 110 ASN C CA    1 
ATOM   2223  C  C     . ASN C 3  97  ? -36.601 -34.822 56.642 1.00 99.67  ? 110 ASN C C     1 
ATOM   2224  O  O     . ASN C 3  97  ? -36.553 -33.588 56.617 1.00 99.49  ? 110 ASN C O     1 
ATOM   2225  C  CB    . ASN C 3  97  ? -35.003 -35.159 54.735 1.00 107.96 ? 110 ASN C CB    1 
ATOM   2226  C  CG    . ASN C 3  97  ? -33.801 -35.333 55.645 1.00 113.04 ? 110 ASN C CG    1 
ATOM   2227  O  OD1   . ASN C 3  97  ? -33.739 -36.272 56.438 1.00 115.71 ? 110 ASN C OD1   1 
ATOM   2228  N  ND2   . ASN C 3  97  ? -32.840 -34.422 55.537 1.00 113.90 ? 110 ASN C ND2   1 
ATOM   2229  N  N     . ILE C 3  98  ? -36.908 -35.517 57.733 1.00 97.68  ? 111 ILE C N     1 
ATOM   2230  C  CA    . ILE C 3  98  ? -37.120 -34.902 59.038 1.00 95.52  ? 111 ILE C CA    1 
ATOM   2231  C  C     . ILE C 3  98  ? -35.908 -35.215 59.902 1.00 98.32  ? 111 ILE C C     1 
ATOM   2232  O  O     . ILE C 3  98  ? -35.438 -36.359 59.930 1.00 102.98 ? 111 ILE C O     1 
ATOM   2233  C  CB    . ILE C 3  98  ? -38.411 -35.405 59.707 1.00 92.23  ? 111 ILE C CB    1 
ATOM   2234  C  CG1   . ILE C 3  98  ? -39.452 -35.809 58.658 1.00 95.12  ? 111 ILE C CG1   1 
ATOM   2235  C  CG2   . ILE C 3  98  ? -38.976 -34.339 60.636 1.00 85.51  ? 111 ILE C CG2   1 
ATOM   2236  C  CD1   . ILE C 3  98  ? -40.075 -34.649 57.921 1.00 95.17  ? 111 ILE C CD1   1 
ATOM   2237  N  N     . GLN C 3  99  ? -35.401 -34.204 60.599 1.00 96.31  ? 112 GLN C N     1 
ATOM   2238  C  CA    . GLN C 3  99  ? -34.258 -34.411 61.477 1.00 95.11  ? 112 GLN C CA    1 
ATOM   2239  C  C     . GLN C 3  99  ? -34.671 -35.218 62.701 1.00 98.76  ? 112 GLN C C     1 
ATOM   2240  O  O     . GLN C 3  99  ? -35.787 -35.078 63.211 1.00 99.98  ? 112 GLN C O     1 
ATOM   2241  C  CB    . GLN C 3  99  ? -33.660 -33.069 61.894 1.00 92.33  ? 112 GLN C CB    1 
ATOM   2242  C  CG    . GLN C 3  99  ? -32.995 -32.319 60.749 1.00 89.88  ? 112 GLN C CG    1 
ATOM   2243  C  CD    . GLN C 3  99  ? -31.733 -33.004 60.258 1.00 90.21  ? 112 GLN C CD    1 
ATOM   2244  O  OE1   . GLN C 3  99  ? -31.562 -33.233 59.061 1.00 93.30  ? 112 GLN C OE1   1 
ATOM   2245  N  NE2   . GLN C 3  99  ? -30.838 -33.328 61.184 1.00 87.12  ? 112 GLN C NE2   1 
ATOM   2246  N  N     . SER C 3  100 ? -33.759 -36.075 63.168 1.00 100.96 ? 113 SER C N     1 
ATOM   2247  C  CA    . SER C 3  100 ? -34.090 -36.996 64.252 1.00 100.71 ? 113 SER C CA    1 
ATOM   2248  C  C     . SER C 3  100 ? -34.371 -36.253 65.553 1.00 99.26  ? 113 SER C C     1 
ATOM   2249  O  O     . SER C 3  100 ? -35.245 -36.660 66.328 1.00 99.32  ? 113 SER C O     1 
ATOM   2250  C  CB    . SER C 3  100 ? -32.959 -38.007 64.442 1.00 100.30 ? 113 SER C CB    1 
ATOM   2251  O  OG    . SER C 3  100 ? -31.718 -37.354 64.651 1.00 100.76 ? 113 SER C OG    1 
ATOM   2252  N  N     . VAL C 3  101 ? -33.647 -35.161 65.811 1.00 98.75  ? 114 VAL C N     1 
ATOM   2253  C  CA    . VAL C 3  101 ? -33.856 -34.392 67.034 1.00 98.04  ? 114 VAL C CA    1 
ATOM   2254  C  C     . VAL C 3  101 ? -35.176 -33.640 67.041 1.00 99.04  ? 114 VAL C C     1 
ATOM   2255  O  O     . VAL C 3  101 ? -35.551 -33.075 68.075 1.00 101.35 ? 114 VAL C O     1 
ATOM   2256  C  CB    . VAL C 3  101 ? -32.699 -33.397 67.259 1.00 95.78  ? 114 VAL C CB    1 
ATOM   2257  C  CG1   . VAL C 3  101 ? -31.379 -34.140 67.395 1.00 97.97  ? 114 VAL C CG1   1 
ATOM   2258  C  CG2   . VAL C 3  101 ? -32.639 -32.391 66.123 1.00 94.78  ? 114 VAL C CG2   1 
ATOM   2259  N  N     . LEU C 3  102 ? -35.891 -33.614 65.916 1.00 95.96  ? 115 LEU C N     1 
ATOM   2260  C  CA    . LEU C 3  102 ? -37.184 -32.950 65.832 1.00 93.94  ? 115 LEU C CA    1 
ATOM   2261  C  C     . LEU C 3  102 ? -38.357 -33.900 66.033 1.00 98.05  ? 115 LEU C C     1 
ATOM   2262  O  O     . LEU C 3  102 ? -39.494 -33.434 66.162 1.00 98.55  ? 115 LEU C O     1 
ATOM   2263  C  CB    . LEU C 3  102 ? -37.326 -32.242 64.479 1.00 88.66  ? 115 LEU C CB    1 
ATOM   2264  C  CG    . LEU C 3  102 ? -36.202 -31.265 64.125 1.00 84.43  ? 115 LEU C CG    1 
ATOM   2265  C  CD1   . LEU C 3  102 ? -36.455 -30.616 62.773 1.00 84.33  ? 115 LEU C CD1   1 
ATOM   2266  C  CD2   . LEU C 3  102 ? -36.038 -30.212 65.211 1.00 82.47  ? 115 LEU C CD2   1 
ATOM   2267  N  N     . LEU C 3  103 ? -38.111 -35.210 66.064 1.00 102.85 ? 116 LEU C N     1 
ATOM   2268  C  CA    . LEU C 3  103 ? -39.166 -36.186 66.283 1.00 103.85 ? 116 LEU C CA    1 
ATOM   2269  C  C     . LEU C 3  103 ? -39.482 -36.309 67.773 1.00 108.54 ? 116 LEU C C     1 
ATOM   2270  O  O     . LEU C 3  103 ? -38.591 -36.182 68.617 1.00 112.63 ? 116 LEU C O     1 
ATOM   2271  C  CB    . LEU C 3  103 ? -38.755 -37.547 65.731 1.00 99.22  ? 116 LEU C CB    1 
ATOM   2272  C  CG    . LEU C 3  103 ? -38.506 -37.636 64.224 1.00 95.12  ? 116 LEU C CG    1 
ATOM   2273  C  CD1   . LEU C 3  103 ? -38.016 -39.024 63.842 1.00 92.70  ? 116 LEU C CD1   1 
ATOM   2274  C  CD2   . LEU C 3  103 ? -39.765 -37.277 63.451 1.00 95.78  ? 116 LEU C CD2   1 
ATOM   2275  N  N     . PRO C 3  104 ? -40.741 -36.554 68.121 1.00 112.78 ? 117 PRO C N     1 
ATOM   2276  C  CA    . PRO C 3  104 ? -41.104 -36.708 69.531 1.00 116.73 ? 117 PRO C CA    1 
ATOM   2277  C  C     . PRO C 3  104 ? -40.673 -38.060 70.081 1.00 119.66 ? 117 PRO C C     1 
ATOM   2278  O  O     . PRO C 3  104 ? -40.392 -39.007 69.344 1.00 119.67 ? 117 PRO C O     1 
ATOM   2279  C  CB    . PRO C 3  104 ? -42.630 -36.579 69.518 1.00 116.94 ? 117 PRO C CB    1 
ATOM   2280  C  CG    . PRO C 3  104 ? -43.022 -37.073 68.167 1.00 115.72 ? 117 PRO C CG    1 
ATOM   2281  C  CD    . PRO C 3  104 ? -41.914 -36.658 67.233 1.00 113.26 ? 117 PRO C CD    1 
ATOM   2282  N  N     . LYS C 3  105 ? -40.627 -38.133 71.407 1.00 120.99 ? 118 LYS C N     1 
ATOM   2283  C  CA    . LYS C 3  105 ? -40.249 -39.364 72.093 1.00 121.17 ? 118 LYS C CA    1 
ATOM   2284  C  C     . LYS C 3  105 ? -41.475 -40.119 72.596 1.00 119.99 ? 118 LYS C C     1 
ATOM   2285  O  O     . LYS C 3  105 ? -41.478 -41.349 72.649 1.00 119.58 ? 118 LYS C O     1 
ATOM   2286  C  CB    . LYS C 3  105 ? -39.304 -39.061 73.258 1.00 121.69 ? 118 LYS C CB    1 
ATOM   2287  C  CG    . LYS C 3  105 ? -37.881 -38.743 72.831 1.00 120.64 ? 118 LYS C CG    1 
ATOM   2288  C  CD    . LYS C 3  105 ? -37.250 -39.928 72.115 1.00 118.75 ? 118 LYS C CD    1 
ATOM   2289  C  CE    . LYS C 3  105 ? -35.843 -39.606 71.641 1.00 114.30 ? 118 LYS C CE    1 
ATOM   2290  N  NZ    . LYS C 3  105 ? -34.942 -39.257 72.772 1.00 111.64 ? 118 LYS C NZ    1 
ATOM   2291  N  N     . THR D 4  1   ? -43.460 -20.234 14.232 1.00 135.72 ? 29  THR D N     1 
ATOM   2292  C  CA    . THR D 4  1   ? -42.039 -20.325 13.920 1.00 137.45 ? 29  THR D CA    1 
ATOM   2293  C  C     . THR D 4  1   ? -41.483 -21.680 14.342 1.00 140.59 ? 29  THR D C     1 
ATOM   2294  O  O     . THR D 4  1   ? -41.855 -22.219 15.384 1.00 142.48 ? 29  THR D O     1 
ATOM   2295  C  CB    . THR D 4  1   ? -41.237 -19.208 14.608 1.00 137.46 ? 29  THR D CB    1 
ATOM   2296  O  OG1   . THR D 4  1   ? -41.184 -19.455 16.018 1.00 139.06 ? 29  THR D OG1   1 
ATOM   2297  C  CG2   . THR D 4  1   ? -41.897 -17.861 14.361 1.00 135.77 ? 29  THR D CG2   1 
ATOM   2298  N  N     . ARG D 4  2   ? -40.582 -22.222 13.525 1.00 141.02 ? 30  ARG D N     1 
ATOM   2299  C  CA    . ARG D 4  2   ? -40.050 -23.564 13.734 1.00 141.37 ? 30  ARG D CA    1 
ATOM   2300  C  C     . ARG D 4  2   ? -39.030 -23.540 14.867 1.00 139.12 ? 30  ARG D C     1 
ATOM   2301  O  O     . ARG D 4  2   ? -37.931 -22.997 14.713 1.00 139.81 ? 30  ARG D O     1 
ATOM   2302  C  CB    . ARG D 4  2   ? -39.429 -24.087 12.442 1.00 143.12 ? 30  ARG D CB    1 
ATOM   2303  C  CG    . ARG D 4  2   ? -38.837 -25.480 12.543 1.00 146.90 ? 30  ARG D CG    1 
ATOM   2304  C  CD    . ARG D 4  2   ? -38.348 -25.957 11.185 1.00 150.30 ? 30  ARG D CD    1 
ATOM   2305  N  NE    . ARG D 4  2   ? -37.602 -27.207 11.278 1.00 154.40 ? 30  ARG D NE    1 
ATOM   2306  C  CZ    . ARG D 4  2   ? -36.301 -27.278 11.535 1.00 156.71 ? 30  ARG D CZ    1 
ATOM   2307  N  NH1   . ARG D 4  2   ? -35.602 -26.167 11.727 1.00 157.60 ? 30  ARG D NH1   1 
ATOM   2308  N  NH2   . ARG D 4  2   ? -35.697 -28.456 11.602 1.00 159.37 ? 30  ARG D NH2   1 
ATOM   2309  N  N     . LYS D 4  3   ? -39.392 -24.127 16.005 1.00 135.49 ? 31  LYS D N     1 
ATOM   2310  C  CA    . LYS D 4  3   ? -38.500 -24.266 17.147 1.00 131.47 ? 31  LYS D CA    1 
ATOM   2311  C  C     . LYS D 4  3   ? -38.110 -25.729 17.311 1.00 131.88 ? 31  LYS D C     1 
ATOM   2312  O  O     . LYS D 4  3   ? -38.937 -26.627 17.120 1.00 138.03 ? 31  LYS D O     1 
ATOM   2313  C  CB    . LYS D 4  3   ? -39.157 -23.741 18.430 1.00 130.90 ? 31  LYS D CB    1 
ATOM   2314  C  CG    . LYS D 4  3   ? -40.445 -24.453 18.813 1.00 134.82 ? 31  LYS D CG    1 
ATOM   2315  C  CD    . LYS D 4  3   ? -41.209 -23.705 19.891 1.00 138.96 ? 31  LYS D CD    1 
ATOM   2316  C  CE    . LYS D 4  3   ? -42.552 -24.366 20.165 1.00 141.46 ? 31  LYS D CE    1 
ATOM   2317  N  NZ    . LYS D 4  3   ? -43.332 -23.645 21.207 1.00 141.06 ? 31  LYS D NZ    1 
ATOM   2318  N  N     . GLU D 4  4   ? -36.849 -25.965 17.656 1.00 126.11 ? 32  GLU D N     1 
ATOM   2319  C  CA    . GLU D 4  4   ? -36.305 -27.310 17.758 1.00 123.54 ? 32  GLU D CA    1 
ATOM   2320  C  C     . GLU D 4  4   ? -36.113 -27.704 19.217 1.00 116.72 ? 32  GLU D C     1 
ATOM   2321  O  O     . GLU D 4  4   ? -35.944 -26.851 20.093 1.00 113.05 ? 32  GLU D O     1 
ATOM   2322  C  CB    . GLU D 4  4   ? -34.972 -27.417 17.010 1.00 128.94 ? 32  GLU D CB    1 
ATOM   2323  C  CG    . GLU D 4  4   ? -33.902 -26.456 17.504 1.00 135.24 ? 32  GLU D CG    1 
ATOM   2324  C  CD    . GLU D 4  4   ? -32.612 -26.563 16.713 1.00 138.98 ? 32  GLU D CD    1 
ATOM   2325  O  OE1   . GLU D 4  4   ? -32.558 -27.381 15.770 1.00 139.96 ? 32  GLU D OE1   1 
ATOM   2326  O  OE2   . GLU D 4  4   ? -31.653 -25.830 17.034 1.00 141.18 ? 32  GLU D OE2   1 
ATOM   2327  N  N     . SER D 4  5   ? -36.138 -29.010 19.466 1.00 112.13 ? 33  SER D N     1 
ATOM   2328  C  CA    . SER D 4  5   ? -35.948 -29.552 20.806 1.00 105.49 ? 33  SER D CA    1 
ATOM   2329  C  C     . SER D 4  5   ? -35.565 -31.022 20.680 1.00 97.55  ? 33  SER D C     1 
ATOM   2330  O  O     . SER D 4  5   ? -35.429 -31.558 19.576 1.00 93.21  ? 33  SER D O     1 
ATOM   2331  C  CB    . SER D 4  5   ? -37.207 -29.374 21.661 1.00 106.54 ? 33  SER D CB    1 
ATOM   2332  O  OG    . SER D 4  5   ? -38.294 -30.112 21.130 1.00 107.08 ? 33  SER D OG    1 
ATOM   2333  N  N     . TYR D 4  6   ? -35.387 -31.671 21.831 1.00 95.34  ? 34  TYR D N     1 
ATOM   2334  C  CA    . TYR D 4  6   ? -35.094 -33.096 21.903 1.00 95.22  ? 34  TYR D CA    1 
ATOM   2335  C  C     . TYR D 4  6   ? -36.311 -33.919 22.308 1.00 98.49  ? 34  TYR D C     1 
ATOM   2336  O  O     . TYR D 4  6   ? -36.154 -35.015 22.857 1.00 103.63 ? 34  TYR D O     1 
ATOM   2337  C  CB    . TYR D 4  6   ? -33.949 -33.357 22.885 1.00 93.53  ? 34  TYR D CB    1 
ATOM   2338  C  CG    . TYR D 4  6   ? -32.621 -32.752 22.491 1.00 89.96  ? 34  TYR D CG    1 
ATOM   2339  C  CD1   . TYR D 4  6   ? -31.752 -33.428 21.646 1.00 91.96  ? 34  TYR D CD1   1 
ATOM   2340  C  CD2   . TYR D 4  6   ? -32.227 -31.515 22.982 1.00 84.96  ? 34  TYR D CD2   1 
ATOM   2341  C  CE1   . TYR D 4  6   ? -30.533 -32.883 21.289 1.00 91.47  ? 34  TYR D CE1   1 
ATOM   2342  C  CE2   . TYR D 4  6   ? -31.010 -30.962 22.631 1.00 84.92  ? 34  TYR D CE2   1 
ATOM   2343  C  CZ    . TYR D 4  6   ? -30.167 -31.650 21.785 1.00 87.91  ? 34  TYR D CZ    1 
ATOM   2344  O  OH    . TYR D 4  6   ? -28.953 -31.105 21.433 1.00 88.50  ? 34  TYR D OH    1 
ATOM   2345  N  N     . ALA D 4  7   ? -37.519 -33.413 22.050 1.00 98.53  ? 35  ALA D N     1 
ATOM   2346  C  CA    . ALA D 4  7   ? -38.725 -34.068 22.548 1.00 100.94 ? 35  ALA D CA    1 
ATOM   2347  C  C     . ALA D 4  7   ? -38.911 -35.445 21.921 1.00 105.56 ? 35  ALA D C     1 
ATOM   2348  O  O     . ALA D 4  7   ? -39.160 -36.431 22.624 1.00 108.09 ? 35  ALA D O     1 
ATOM   2349  C  CB    . ALA D 4  7   ? -39.945 -33.185 22.288 1.00 100.95 ? 35  ALA D CB    1 
ATOM   2350  N  N     . ILE D 4  8   ? -38.790 -35.534 20.594 1.00 106.79 ? 36  ILE D N     1 
ATOM   2351  C  CA    . ILE D 4  8   ? -39.018 -36.805 19.917 1.00 108.31 ? 36  ILE D CA    1 
ATOM   2352  C  C     . ILE D 4  8   ? -37.918 -37.816 20.209 1.00 105.34 ? 36  ILE D C     1 
ATOM   2353  O  O     . ILE D 4  8   ? -38.120 -39.019 20.006 1.00 106.60 ? 36  ILE D O     1 
ATOM   2354  C  CB    . ILE D 4  8   ? -39.154 -36.594 18.398 1.00 109.55 ? 36  ILE D CB    1 
ATOM   2355  C  CG1   . ILE D 4  8   ? -37.883 -35.955 17.835 1.00 107.16 ? 36  ILE D CG1   1 
ATOM   2356  C  CG2   . ILE D 4  8   ? -40.373 -35.740 18.084 1.00 110.25 ? 36  ILE D CG2   1 
ATOM   2357  C  CD1   . ILE D 4  8   ? -37.877 -35.844 16.330 1.00 108.08 ? 36  ILE D CD1   1 
ATOM   2358  N  N     . TYR D 4  9   ? -36.757 -37.366 20.684 1.00 100.13 ? 37  TYR D N     1 
ATOM   2359  C  CA    . TYR D 4  9   ? -35.641 -38.272 20.927 1.00 96.38  ? 37  TYR D CA    1 
ATOM   2360  C  C     . TYR D 4  9   ? -35.666 -38.871 22.326 1.00 97.26  ? 37  TYR D C     1 
ATOM   2361  O  O     . TYR D 4  9   ? -35.273 -40.029 22.505 1.00 100.93 ? 37  TYR D O     1 
ATOM   2362  C  CB    . TYR D 4  9   ? -34.316 -37.544 20.694 1.00 94.09  ? 37  TYR D CB    1 
ATOM   2363  C  CG    . TYR D 4  9   ? -34.261 -36.837 19.365 1.00 96.96  ? 37  TYR D CG    1 
ATOM   2364  C  CD1   . TYR D 4  9   ? -34.101 -37.551 18.185 1.00 99.44  ? 37  TYR D CD1   1 
ATOM   2365  C  CD2   . TYR D 4  9   ? -34.382 -35.457 19.285 1.00 100.65 ? 37  TYR D CD2   1 
ATOM   2366  C  CE1   . TYR D 4  9   ? -34.055 -36.908 16.964 1.00 101.73 ? 37  TYR D CE1   1 
ATOM   2367  C  CE2   . TYR D 4  9   ? -34.337 -34.805 18.068 1.00 101.46 ? 37  TYR D CE2   1 
ATOM   2368  C  CZ    . TYR D 4  9   ? -34.173 -35.536 16.911 1.00 100.58 ? 37  TYR D CZ    1 
ATOM   2369  O  OH    . TYR D 4  9   ? -34.126 -34.890 15.697 1.00 98.03  ? 37  TYR D OH    1 
ATOM   2370  N  N     . VAL D 4  10  ? -36.115 -38.109 23.326 1.00 94.87  ? 38  VAL D N     1 
ATOM   2371  C  CA    . VAL D 4  10  ? -36.264 -38.675 24.660 1.00 95.72  ? 38  VAL D CA    1 
ATOM   2372  C  C     . VAL D 4  10  ? -37.473 -39.596 24.738 1.00 97.83  ? 38  VAL D C     1 
ATOM   2373  O  O     . VAL D 4  10  ? -37.540 -40.448 25.631 1.00 99.55  ? 38  VAL D O     1 
ATOM   2374  C  CB    . VAL D 4  10  ? -36.354 -37.563 25.721 1.00 94.71  ? 38  VAL D CB    1 
ATOM   2375  C  CG1   . VAL D 4  10  ? -35.093 -36.712 25.708 1.00 93.74  ? 38  VAL D CG1   1 
ATOM   2376  C  CG2   . VAL D 4  10  ? -37.579 -36.705 25.488 1.00 93.22  ? 38  VAL D CG2   1 
ATOM   2377  N  N     . TYR D 4  11  ? -38.437 -39.448 23.824 1.00 100.52 ? 39  TYR D N     1 
ATOM   2378  C  CA    . TYR D 4  11  ? -39.538 -40.404 23.748 1.00 104.45 ? 39  TYR D CA    1 
ATOM   2379  C  C     . TYR D 4  11  ? -39.043 -41.769 23.290 1.00 98.28  ? 39  TYR D C     1 
ATOM   2380  O  O     . TYR D 4  11  ? -39.339 -42.791 23.919 1.00 97.24  ? 39  TYR D O     1 
ATOM   2381  C  CB    . TYR D 4  11  ? -40.625 -39.891 22.804 1.00 113.29 ? 39  TYR D CB    1 
ATOM   2382  C  CG    . TYR D 4  11  ? -41.749 -39.159 23.496 1.00 121.70 ? 39  TYR D CG    1 
ATOM   2383  C  CD1   . TYR D 4  11  ? -42.699 -39.849 24.238 1.00 124.73 ? 39  TYR D CD1   1 
ATOM   2384  C  CD2   . TYR D 4  11  ? -41.869 -37.780 23.397 1.00 127.43 ? 39  TYR D CD2   1 
ATOM   2385  C  CE1   . TYR D 4  11  ? -43.731 -39.185 24.869 1.00 129.15 ? 39  TYR D CE1   1 
ATOM   2386  C  CE2   . TYR D 4  11  ? -42.897 -37.107 24.023 1.00 131.76 ? 39  TYR D CE2   1 
ATOM   2387  C  CZ    . TYR D 4  11  ? -43.825 -37.813 24.757 1.00 134.60 ? 39  TYR D CZ    1 
ATOM   2388  O  OH    . TYR D 4  11  ? -44.847 -37.137 25.380 1.00 144.04 ? 39  TYR D OH    1 
ATOM   2389  N  N     . LYS D 4  12  ? -38.288 -41.802 22.188 1.00 95.95  ? 40  LYS D N     1 
ATOM   2390  C  CA    . LYS D 4  12  ? -37.729 -43.060 21.707 1.00 100.43 ? 40  LYS D CA    1 
ATOM   2391  C  C     . LYS D 4  12  ? -36.836 -43.710 22.755 1.00 103.71 ? 40  LYS D C     1 
ATOM   2392  O  O     . LYS D 4  12  ? -36.758 -44.943 22.828 1.00 110.77 ? 40  LYS D O     1 
ATOM   2393  C  CB    . LYS D 4  12  ? -36.949 -42.825 20.413 1.00 101.67 ? 40  LYS D CB    1 
ATOM   2394  C  CG    . LYS D 4  12  ? -37.774 -42.207 19.296 1.00 102.58 ? 40  LYS D CG    1 
ATOM   2395  C  CD    . LYS D 4  12  ? -36.929 -41.969 18.055 1.00 102.98 ? 40  LYS D CD    1 
ATOM   2396  C  CE    . LYS D 4  12  ? -37.743 -41.316 16.949 1.00 102.67 ? 40  LYS D CE    1 
ATOM   2397  N  NZ    . LYS D 4  12  ? -38.900 -42.159 16.539 1.00 103.74 ? 40  LYS D NZ    1 
ATOM   2398  N  N     . VAL D 4  13  ? -36.159 -42.902 23.573 1.00 92.70  ? 41  VAL D N     1 
ATOM   2399  C  CA    . VAL D 4  13  ? -35.372 -43.447 24.674 1.00 92.27  ? 41  VAL D CA    1 
ATOM   2400  C  C     . VAL D 4  13  ? -36.285 -43.909 25.802 1.00 98.80  ? 41  VAL D C     1 
ATOM   2401  O  O     . VAL D 4  13  ? -36.047 -44.952 26.425 1.00 102.44 ? 41  VAL D O     1 
ATOM   2402  C  CB    . VAL D 4  13  ? -34.349 -42.408 25.164 1.00 88.29  ? 41  VAL D CB    1 
ATOM   2403  C  CG1   . VAL D 4  13  ? -33.634 -42.911 26.401 1.00 84.81  ? 41  VAL D CG1   1 
ATOM   2404  C  CG2   . VAL D 4  13  ? -33.353 -42.087 24.066 1.00 90.67  ? 41  VAL D CG2   1 
ATOM   2405  N  N     . LEU D 4  14  ? -37.343 -43.143 26.085 1.00 100.07 ? 42  LEU D N     1 
ATOM   2406  C  CA    . LEU D 4  14  ? -38.279 -43.533 27.135 1.00 96.23  ? 42  LEU D CA    1 
ATOM   2407  C  C     . LEU D 4  14  ? -38.980 -44.844 26.796 1.00 98.95  ? 42  LEU D C     1 
ATOM   2408  O  O     . LEU D 4  14  ? -39.262 -45.652 27.687 1.00 99.67  ? 42  LEU D O     1 
ATOM   2409  C  CB    . LEU D 4  14  ? -39.304 -42.421 27.367 1.00 88.36  ? 42  LEU D CB    1 
ATOM   2410  C  CG    . LEU D 4  14  ? -40.406 -42.677 28.396 1.00 82.06  ? 42  LEU D CG    1 
ATOM   2411  C  CD1   . LEU D 4  14  ? -39.818 -42.902 29.785 1.00 76.98  ? 42  LEU D CD1   1 
ATOM   2412  C  CD2   . LEU D 4  14  ? -41.402 -41.529 28.409 1.00 80.14  ? 42  LEU D CD2   1 
ATOM   2413  N  N     . LYS D 4  15  ? -39.260 -45.079 25.512 1.00 102.38 ? 43  LYS D N     1 
ATOM   2414  C  CA    . LYS D 4  15  ? -39.966 -46.293 25.122 1.00 107.96 ? 43  LYS D CA    1 
ATOM   2415  C  C     . LYS D 4  15  ? -39.071 -47.526 25.164 1.00 112.84 ? 43  LYS D C     1 
ATOM   2416  O  O     . LYS D 4  15  ? -39.585 -48.648 25.184 1.00 115.42 ? 43  LYS D O     1 
ATOM   2417  C  CB    . LYS D 4  15  ? -40.570 -46.118 23.729 1.00 110.54 ? 43  LYS D CB    1 
ATOM   2418  C  CG    . LYS D 4  15  ? -41.597 -44.999 23.649 1.00 113.05 ? 43  LYS D CG    1 
ATOM   2419  C  CD    . LYS D 4  15  ? -42.663 -45.141 24.728 1.00 113.35 ? 43  LYS D CD    1 
ATOM   2420  C  CE    . LYS D 4  15  ? -43.633 -43.971 24.686 1.00 112.62 ? 43  LYS D CE    1 
ATOM   2421  N  NZ    . LYS D 4  15  ? -44.664 -44.047 25.756 1.00 110.35 ? 43  LYS D NZ    1 
ATOM   2422  N  N     . GLN D 4  16  ? -37.751 -47.343 25.185 1.00 114.13 ? 44  GLN D N     1 
ATOM   2423  C  CA    . GLN D 4  16  ? -36.806 -48.448 25.295 1.00 116.53 ? 44  GLN D CA    1 
ATOM   2424  C  C     . GLN D 4  16  ? -36.552 -48.879 26.732 1.00 115.28 ? 44  GLN D C     1 
ATOM   2425  O  O     . GLN D 4  16  ? -36.194 -50.042 26.959 1.00 114.95 ? 44  GLN D O     1 
ATOM   2426  C  CB    . GLN D 4  16  ? -35.472 -48.078 24.639 1.00 118.98 ? 44  GLN D CB    1 
ATOM   2427  C  CG    . GLN D 4  16  ? -35.526 -48.043 23.124 1.00 124.78 ? 44  GLN D CG    1 
ATOM   2428  C  CD    . GLN D 4  16  ? -34.154 -47.859 22.499 1.00 131.05 ? 44  GLN D CD    1 
ATOM   2429  O  OE1   . GLN D 4  16  ? -33.495 -48.829 22.122 1.00 130.76 ? 44  GLN D OE1   1 
ATOM   2430  N  NE2   . GLN D 4  16  ? -33.712 -46.611 22.397 1.00 139.55 ? 44  GLN D NE2   1 
ATOM   2431  N  N     . VAL D 4  17  ? -36.720 -47.976 27.698 1.00 112.99 ? 45  VAL D N     1 
ATOM   2432  C  CA    . VAL D 4  17  ? -36.463 -48.301 29.094 1.00 104.54 ? 45  VAL D CA    1 
ATOM   2433  C  C     . VAL D 4  17  ? -37.785 -48.573 29.800 1.00 105.66 ? 45  VAL D C     1 
ATOM   2434  O  O     . VAL D 4  17  ? -37.840 -49.365 30.747 1.00 109.42 ? 45  VAL D O     1 
ATOM   2435  C  CB    . VAL D 4  17  ? -35.678 -47.178 29.796 1.00 92.64  ? 45  VAL D CB    1 
ATOM   2436  C  CG1   . VAL D 4  17  ? -34.262 -47.099 29.249 1.00 87.28  ? 45  VAL D CG1   1 
ATOM   2437  C  CG2   . VAL D 4  17  ? -36.391 -45.843 29.633 1.00 88.93  ? 45  VAL D CG2   1 
ATOM   2438  N  N     . HIS D 4  18  ? -38.852 -47.921 29.346 1.00 105.59 ? 46  HIS D N     1 
ATOM   2439  C  CA    . HIS D 4  18  ? -40.184 -48.101 29.929 1.00 108.50 ? 46  HIS D CA    1 
ATOM   2440  C  C     . HIS D 4  18  ? -41.213 -47.897 28.837 1.00 111.35 ? 46  HIS D C     1 
ATOM   2441  O  O     . HIS D 4  18  ? -41.693 -46.773 28.606 1.00 111.65 ? 46  HIS D O     1 
ATOM   2442  C  CB    . HIS D 4  18  ? -40.432 -47.144 31.093 1.00 110.72 ? 46  HIS D CB    1 
ATOM   2443  C  CG    . HIS D 4  18  ? -39.568 -47.398 32.287 1.00 115.85 ? 46  HIS D CG    1 
ATOM   2444  N  ND1   . HIS D 4  18  ? -39.808 -48.426 33.173 1.00 119.76 ? 46  HIS D ND1   1 
ATOM   2445  C  CD2   . HIS D 4  18  ? -38.465 -46.758 32.743 1.00 116.89 ? 46  HIS D CD2   1 
ATOM   2446  C  CE1   . HIS D 4  18  ? -38.890 -48.409 34.123 1.00 119.17 ? 46  HIS D CE1   1 
ATOM   2447  N  NE2   . HIS D 4  18  ? -38.063 -47.406 33.885 1.00 117.52 ? 46  HIS D NE2   1 
ATOM   2448  N  N     . PRO D 4  19  ? -41.588 -48.960 28.119 1.00 112.22 ? 47  PRO D N     1 
ATOM   2449  C  CA    . PRO D 4  19  ? -42.533 -48.800 27.006 1.00 113.38 ? 47  PRO D CA    1 
ATOM   2450  C  C     . PRO D 4  19  ? -43.922 -48.364 27.442 1.00 116.12 ? 47  PRO D C     1 
ATOM   2451  O  O     . PRO D 4  19  ? -44.600 -47.661 26.683 1.00 116.90 ? 47  PRO D O     1 
ATOM   2452  C  CB    . PRO D 4  19  ? -42.559 -50.192 26.358 1.00 113.22 ? 47  PRO D CB    1 
ATOM   2453  C  CG    . PRO D 4  19  ? -41.304 -50.865 26.829 1.00 112.44 ? 47  PRO D CG    1 
ATOM   2454  C  CD    . PRO D 4  19  ? -41.060 -50.335 28.205 1.00 111.76 ? 47  PRO D CD    1 
ATOM   2455  N  N     . ASP D 4  20  ? -44.370 -48.757 28.633 1.00 119.55 ? 48  ASP D N     1 
ATOM   2456  C  CA    . ASP D 4  20  ? -45.714 -48.437 29.113 1.00 125.69 ? 48  ASP D CA    1 
ATOM   2457  C  C     . ASP D 4  20  ? -45.718 -47.248 30.064 1.00 122.13 ? 48  ASP D C     1 
ATOM   2458  O  O     . ASP D 4  20  ? -46.404 -47.269 31.091 1.00 122.28 ? 48  ASP D O     1 
ATOM   2459  C  CB    . ASP D 4  20  ? -46.343 -49.657 29.779 1.00 133.04 ? 48  ASP D CB    1 
ATOM   2460  C  CG    . ASP D 4  20  ? -46.728 -50.733 28.781 1.00 140.14 ? 48  ASP D CG    1 
ATOM   2461  O  OD1   . ASP D 4  20  ? -47.103 -50.383 27.641 1.00 141.06 ? 48  ASP D OD1   1 
ATOM   2462  O  OD2   . ASP D 4  20  ? -46.660 -51.928 29.137 1.00 146.83 ? 48  ASP D OD2   1 
ATOM   2463  N  N     . THR D 4  21  ? -44.962 -46.197 29.753 1.00 120.86 ? 49  THR D N     1 
ATOM   2464  C  CA    . THR D 4  21  ? -44.953 -44.978 30.547 1.00 120.68 ? 49  THR D CA    1 
ATOM   2465  C  C     . THR D 4  21  ? -45.033 -43.767 29.628 1.00 117.17 ? 49  THR D C     1 
ATOM   2466  O  O     . THR D 4  21  ? -44.736 -43.843 28.433 1.00 117.97 ? 49  THR D O     1 
ATOM   2467  C  CB    . THR D 4  21  ? -43.699 -44.863 31.430 1.00 126.77 ? 49  THR D CB    1 
ATOM   2468  O  OG1   . THR D 4  21  ? -42.529 -44.871 30.604 1.00 137.94 ? 49  THR D OG1   1 
ATOM   2469  C  CG2   . THR D 4  21  ? -43.630 -46.009 32.432 1.00 126.92 ? 49  THR D CG2   1 
ATOM   2470  N  N     . GLY D 4  22  ? -45.438 -42.641 30.209 1.00 112.33 ? 50  GLY D N     1 
ATOM   2471  C  CA    . GLY D 4  22  ? -45.518 -41.393 29.477 1.00 109.51 ? 50  GLY D CA    1 
ATOM   2472  C  C     . GLY D 4  22  ? -44.711 -40.289 30.128 1.00 102.55 ? 50  GLY D C     1 
ATOM   2473  O  O     . GLY D 4  22  ? -43.886 -40.554 31.007 1.00 104.35 ? 50  GLY D O     1 
ATOM   2474  N  N     . ILE D 4  23  ? -44.942 -39.048 29.709 1.00 96.30  ? 51  ILE D N     1 
ATOM   2475  C  CA    . ILE D 4  23  ? -44.221 -37.905 30.257 1.00 92.63  ? 51  ILE D CA    1 
ATOM   2476  C  C     . ILE D 4  23  ? -45.024 -36.648 29.950 1.00 93.95  ? 51  ILE D C     1 
ATOM   2477  O  O     . ILE D 4  23  ? -45.563 -36.491 28.851 1.00 95.08  ? 51  ILE D O     1 
ATOM   2478  C  CB    . ILE D 4  23  ? -42.779 -37.831 29.697 1.00 90.40  ? 51  ILE D CB    1 
ATOM   2479  C  CG1   . ILE D 4  23  ? -42.031 -36.626 30.272 1.00 85.96  ? 51  ILE D CG1   1 
ATOM   2480  C  CG2   . ILE D 4  23  ? -42.789 -37.802 28.175 1.00 93.02  ? 51  ILE D CG2   1 
ATOM   2481  C  CD1   . ILE D 4  23  ? -40.571 -36.576 29.880 1.00 83.07  ? 51  ILE D CD1   1 
ATOM   2482  N  N     . SER D 4  24  ? -45.111 -35.760 30.936 1.00 94.56  ? 52  SER D N     1 
ATOM   2483  C  CA    . SER D 4  24  ? -45.887 -34.538 30.804 1.00 95.59  ? 52  SER D CA    1 
ATOM   2484  C  C     . SER D 4  24  ? -45.056 -33.438 30.147 1.00 100.54 ? 52  SER D C     1 
ATOM   2485  O  O     . SER D 4  24  ? -43.837 -33.546 29.993 1.00 104.76 ? 52  SER D O     1 
ATOM   2486  C  CB    . SER D 4  24  ? -46.397 -34.075 32.169 1.00 90.67  ? 52  SER D CB    1 
ATOM   2487  O  OG    . SER D 4  24  ? -45.324 -33.693 33.013 1.00 85.55  ? 52  SER D OG    1 
ATOM   2488  N  N     . SER D 4  25  ? -45.741 -32.361 29.756 1.00 102.34 ? 53  SER D N     1 
ATOM   2489  C  CA    . SER D 4  25  ? -45.059 -31.239 29.120 1.00 103.93 ? 53  SER D CA    1 
ATOM   2490  C  C     . SER D 4  25  ? -44.120 -30.530 30.086 1.00 105.09 ? 53  SER D C     1 
ATOM   2491  O  O     . SER D 4  25  ? -43.070 -30.026 29.669 1.00 106.60 ? 53  SER D O     1 
ATOM   2492  C  CB    . SER D 4  25  ? -46.083 -30.254 28.555 1.00 106.45 ? 53  SER D CB    1 
ATOM   2493  O  OG    . SER D 4  25  ? -46.930 -29.760 29.578 1.00 108.78 ? 53  SER D OG    1 
ATOM   2494  N  N     . LYS D 4  26  ? -44.477 -30.475 31.371 1.00 106.43 ? 54  LYS D N     1 
ATOM   2495  C  CA    . LYS D 4  26  ? -43.582 -29.891 32.364 1.00 108.74 ? 54  LYS D CA    1 
ATOM   2496  C  C     . LYS D 4  26  ? -42.286 -30.686 32.463 1.00 107.79 ? 54  LYS D C     1 
ATOM   2497  O  O     . LYS D 4  26  ? -41.189 -30.118 32.425 1.00 106.82 ? 54  LYS D O     1 
ATOM   2498  C  CB    . LYS D 4  26  ? -44.279 -29.825 33.724 1.00 113.54 ? 54  LYS D CB    1 
ATOM   2499  C  CG    . LYS D 4  26  ? -45.378 -28.783 33.816 1.00 120.60 ? 54  LYS D CG    1 
ATOM   2500  C  CD    . LYS D 4  26  ? -44.815 -27.378 33.687 1.00 125.69 ? 54  LYS D CD    1 
ATOM   2501  C  CE    . LYS D 4  26  ? -45.881 -26.333 33.966 1.00 129.40 ? 54  LYS D CE    1 
ATOM   2502  N  NZ    . LYS D 4  26  ? -46.453 -26.486 35.332 1.00 129.93 ? 54  LYS D NZ    1 
ATOM   2503  N  N     . ALA D 4  27  ? -42.395 -32.011 32.586 1.00 105.58 ? 55  ALA D N     1 
ATOM   2504  C  CA    . ALA D 4  27  ? -41.210 -32.856 32.656 1.00 101.31 ? 55  ALA D CA    1 
ATOM   2505  C  C     . ALA D 4  27  ? -40.481 -32.943 31.323 1.00 97.96  ? 55  ALA D C     1 
ATOM   2506  O  O     . ALA D 4  27  ? -39.286 -33.257 31.304 1.00 95.43  ? 55  ALA D O     1 
ATOM   2507  C  CB    . ALA D 4  27  ? -41.590 -34.257 33.133 1.00 102.12 ? 55  ALA D CB    1 
ATOM   2508  N  N     . MET D 4  28  ? -41.169 -32.676 30.210 1.00 98.30  ? 56  MET D N     1 
ATOM   2509  C  CA    . MET D 4  28  ? -40.505 -32.701 28.912 1.00 98.32  ? 56  MET D CA    1 
ATOM   2510  C  C     . MET D 4  28  ? -39.534 -31.536 28.767 1.00 94.47  ? 56  MET D C     1 
ATOM   2511  O  O     . MET D 4  28  ? -38.416 -31.711 28.270 1.00 95.56  ? 56  MET D O     1 
ATOM   2512  C  CB    . MET D 4  28  ? -41.540 -32.678 27.789 1.00 102.43 ? 56  MET D CB    1 
ATOM   2513  C  CG    . MET D 4  28  ? -40.932 -32.611 26.399 1.00 110.50 ? 56  MET D CG    1 
ATOM   2514  S  SD    . MET D 4  28  ? -39.749 -33.939 26.113 1.00 107.68 ? 56  MET D SD    1 
ATOM   2515  C  CE    . MET D 4  28  ? -40.801 -35.370 26.336 1.00 109.40 ? 56  MET D CE    1 
ATOM   2516  N  N     . SER D 4  29  ? -39.946 -30.340 29.194 1.00 90.73  ? 57  SER D N     1 
ATOM   2517  C  CA    . SER D 4  29  ? -39.042 -29.197 29.157 1.00 87.51  ? 57  SER D CA    1 
ATOM   2518  C  C     . SER D 4  29  ? -37.860 -29.393 30.096 1.00 82.25  ? 57  SER D C     1 
ATOM   2519  O  O     . SER D 4  29  ? -36.753 -28.924 29.808 1.00 81.36  ? 57  SER D O     1 
ATOM   2520  C  CB    . SER D 4  29  ? -39.800 -27.917 29.512 1.00 89.00  ? 57  SER D CB    1 
ATOM   2521  O  OG    . SER D 4  29  ? -38.951 -26.784 29.442 1.00 92.71  ? 57  SER D OG    1 
ATOM   2522  N  N     . ILE D 4  30  ? -38.072 -30.086 31.218 1.00 80.07  ? 58  ILE D N     1 
ATOM   2523  C  CA    . ILE D 4  30  ? -36.976 -30.353 32.143 1.00 76.95  ? 58  ILE D CA    1 
ATOM   2524  C  C     . ILE D 4  30  ? -35.960 -31.294 31.509 1.00 76.69  ? 58  ILE D C     1 
ATOM   2525  O  O     . ILE D 4  30  ? -34.745 -31.102 31.645 1.00 75.98  ? 58  ILE D O     1 
ATOM   2526  C  CB    . ILE D 4  30  ? -37.524 -30.912 33.467 1.00 76.02  ? 58  ILE D CB    1 
ATOM   2527  C  CG1   . ILE D 4  30  ? -38.457 -29.891 34.116 1.00 78.40  ? 58  ILE D CG1   1 
ATOM   2528  C  CG2   . ILE D 4  30  ? -36.386 -31.272 34.410 1.00 74.42  ? 58  ILE D CG2   1 
ATOM   2529  C  CD1   . ILE D 4  30  ? -39.016 -30.331 35.437 1.00 78.39  ? 58  ILE D CD1   1 
ATOM   2530  N  N     . MET D 4  31  ? -36.436 -32.324 30.805 1.00 75.06  ? 59  MET D N     1 
ATOM   2531  C  CA    . MET D 4  31  ? -35.526 -33.186 30.059 1.00 72.73  ? 59  MET D CA    1 
ATOM   2532  C  C     . MET D 4  31  ? -34.852 -32.421 28.928 1.00 70.29  ? 59  MET D C     1 
ATOM   2533  O  O     . MET D 4  31  ? -33.651 -32.591 28.685 1.00 68.19  ? 59  MET D O     1 
ATOM   2534  C  CB    . MET D 4  31  ? -36.277 -34.399 29.512 1.00 77.14  ? 59  MET D CB    1 
ATOM   2535  C  CG    . MET D 4  31  ? -36.648 -35.423 30.567 1.00 78.45  ? 59  MET D CG    1 
ATOM   2536  S  SD    . MET D 4  31  ? -35.196 -36.097 31.396 1.00 78.22  ? 59  MET D SD    1 
ATOM   2537  C  CE    . MET D 4  31  ? -34.303 -36.786 30.005 1.00 82.12  ? 59  MET D CE    1 
ATOM   2538  N  N     . ASN D 4  32  ? -35.607 -31.570 28.229 1.00 72.77  ? 60  ASN D N     1 
ATOM   2539  C  CA    . ASN D 4  32  ? -35.023 -30.771 27.157 1.00 76.01  ? 60  ASN D CA    1 
ATOM   2540  C  C     . ASN D 4  32  ? -33.942 -29.841 27.693 1.00 73.28  ? 60  ASN D C     1 
ATOM   2541  O  O     . ASN D 4  32  ? -32.887 -29.677 27.069 1.00 72.69  ? 60  ASN D O     1 
ATOM   2542  C  CB    . ASN D 4  32  ? -36.113 -29.973 26.444 1.00 83.54  ? 60  ASN D CB    1 
ATOM   2543  C  CG    . ASN D 4  32  ? -35.596 -29.251 25.217 1.00 93.50  ? 60  ASN D CG    1 
ATOM   2544  O  OD1   . ASN D 4  32  ? -34.720 -29.753 24.512 1.00 99.67  ? 60  ASN D OD1   1 
ATOM   2545  N  ND2   . ASN D 4  32  ? -36.130 -28.062 24.959 1.00 94.76  ? 60  ASN D ND2   1 
ATOM   2546  N  N     . SER D 4  33  ? -34.183 -29.227 28.855 1.00 74.23  ? 61  SER D N     1 
ATOM   2547  C  CA    . SER D 4  33  ? -33.176 -28.358 29.453 1.00 76.43  ? 61  SER D CA    1 
ATOM   2548  C  C     . SER D 4  33  ? -31.982 -29.153 29.963 1.00 75.38  ? 61  SER D C     1 
ATOM   2549  O  O     . SER D 4  33  ? -30.854 -28.646 29.956 1.00 73.91  ? 61  SER D O     1 
ATOM   2550  C  CB    . SER D 4  33  ? -33.791 -27.539 30.588 1.00 74.92  ? 61  SER D CB    1 
ATOM   2551  O  OG    . SER D 4  33  ? -34.801 -26.669 30.104 1.00 75.29  ? 61  SER D OG    1 
ATOM   2552  N  N     . PHE D 4  34  ? -32.207 -30.392 30.406 1.00 77.77  ? 62  PHE D N     1 
ATOM   2553  C  CA    . PHE D 4  34  ? -31.107 -31.213 30.901 1.00 73.13  ? 62  PHE D CA    1 
ATOM   2554  C  C     . PHE D 4  34  ? -30.134 -31.571 29.785 1.00 68.34  ? 62  PHE D C     1 
ATOM   2555  O  O     . PHE D 4  34  ? -28.915 -31.564 29.993 1.00 65.66  ? 62  PHE D O     1 
ATOM   2556  C  CB    . PHE D 4  34  ? -31.655 -32.477 31.566 1.00 72.29  ? 62  PHE D CB    1 
ATOM   2557  C  CG    . PHE D 4  34  ? -30.613 -33.527 31.821 1.00 73.52  ? 62  PHE D CG    1 
ATOM   2558  C  CD1   . PHE D 4  34  ? -29.716 -33.394 32.868 1.00 75.23  ? 62  PHE D CD1   1 
ATOM   2559  C  CD2   . PHE D 4  34  ? -30.533 -34.652 31.015 1.00 75.66  ? 62  PHE D CD2   1 
ATOM   2560  C  CE1   . PHE D 4  34  ? -28.756 -34.361 33.105 1.00 76.06  ? 62  PHE D CE1   1 
ATOM   2561  C  CE2   . PHE D 4  34  ? -29.575 -35.622 31.246 1.00 75.91  ? 62  PHE D CE2   1 
ATOM   2562  C  CZ    . PHE D 4  34  ? -28.685 -35.475 32.292 1.00 76.81  ? 62  PHE D CZ    1 
ATOM   2563  N  N     . VAL D 4  35  ? -30.650 -31.881 28.595 1.00 67.35  ? 63  VAL D N     1 
ATOM   2564  C  CA    . VAL D 4  35  ? -29.778 -32.254 27.485 1.00 71.41  ? 63  VAL D CA    1 
ATOM   2565  C  C     . VAL D 4  35  ? -28.927 -31.068 27.052 1.00 74.48  ? 63  VAL D C     1 
ATOM   2566  O  O     . VAL D 4  35  ? -27.721 -31.206 26.816 1.00 75.90  ? 63  VAL D O     1 
ATOM   2567  C  CB    . VAL D 4  35  ? -30.608 -32.807 26.313 1.00 76.19  ? 63  VAL D CB    1 
ATOM   2568  C  CG1   . VAL D 4  35  ? -29.698 -33.195 25.155 1.00 77.39  ? 63  VAL D CG1   1 
ATOM   2569  C  CG2   . VAL D 4  35  ? -31.437 -33.995 26.766 1.00 75.98  ? 63  VAL D CG2   1 
ATOM   2570  N  N     . ASN D 4  36  ? -29.537 -29.884 26.945 1.00 74.10  ? 64  ASN D N     1 
ATOM   2571  C  CA    . ASN D 4  36  ? -28.803 -28.711 26.484 1.00 71.14  ? 64  ASN D CA    1 
ATOM   2572  C  C     . ASN D 4  36  ? -27.702 -28.323 27.463 1.00 68.92  ? 64  ASN D C     1 
ATOM   2573  O  O     . ASN D 4  36  ? -26.601 -27.940 27.050 1.00 69.09  ? 64  ASN D O     1 
ATOM   2574  C  CB    . ASN D 4  36  ? -29.764 -27.543 26.267 1.00 73.69  ? 64  ASN D CB    1 
ATOM   2575  C  CG    . ASN D 4  36  ? -30.634 -27.724 25.039 1.00 80.18  ? 64  ASN D CG    1 
ATOM   2576  O  OD1   . ASN D 4  36  ? -30.167 -28.180 23.993 1.00 81.47  ? 64  ASN D OD1   1 
ATOM   2577  N  ND2   . ASN D 4  36  ? -31.909 -27.368 25.159 1.00 83.39  ? 64  ASN D ND2   1 
ATOM   2578  N  N     . ASP D 4  37  ? -27.980 -28.415 28.766 1.00 69.24  ? 65  ASP D N     1 
ATOM   2579  C  CA    . ASP D 4  37  ? -26.975 -28.061 29.764 1.00 74.85  ? 65  ASP D CA    1 
ATOM   2580  C  C     . ASP D 4  37  ? -25.788 -29.015 29.711 1.00 80.17  ? 65  ASP D C     1 
ATOM   2581  O  O     . ASP D 4  37  ? -24.630 -28.582 29.721 1.00 80.76  ? 65  ASP D O     1 
ATOM   2582  C  CB    . ASP D 4  37  ? -27.597 -28.057 31.159 1.00 77.82  ? 65  ASP D CB    1 
ATOM   2583  C  CG    . ASP D 4  37  ? -26.585 -27.751 32.248 1.00 80.04  ? 65  ASP D CG    1 
ATOM   2584  O  OD1   . ASP D 4  37  ? -25.619 -27.009 31.973 1.00 88.23  ? 65  ASP D OD1   1 
ATOM   2585  O  OD2   . ASP D 4  37  ? -26.758 -28.251 33.379 1.00 73.73  ? 65  ASP D OD2   1 
ATOM   2586  N  N     . VAL D 4  38  ? -26.058 -30.321 29.657 1.00 67.63  ? 66  VAL D N     1 
ATOM   2587  C  CA    . VAL D 4  38  ? -24.975 -31.295 29.579 1.00 65.53  ? 66  VAL D CA    1 
ATOM   2588  C  C     . VAL D 4  38  ? -24.249 -31.181 28.245 1.00 65.68  ? 66  VAL D C     1 
ATOM   2589  O  O     . VAL D 4  38  ? -23.028 -31.365 28.171 1.00 66.66  ? 66  VAL D O     1 
ATOM   2590  C  CB    . VAL D 4  38  ? -25.522 -32.713 29.819 1.00 64.71  ? 66  VAL D CB    1 
ATOM   2591  C  CG1   . VAL D 4  38  ? -24.402 -33.735 29.744 1.00 65.67  ? 66  VAL D CG1   1 
ATOM   2592  C  CG2   . VAL D 4  38  ? -26.209 -32.781 31.173 1.00 65.75  ? 66  VAL D CG2   1 
ATOM   2593  N  N     . PHE D 4  39  ? -24.982 -30.867 27.175 1.00 65.76  ? 67  PHE D N     1 
ATOM   2594  C  CA    . PHE D 4  39  ? -24.345 -30.619 25.885 1.00 65.80  ? 67  PHE D CA    1 
ATOM   2595  C  C     . PHE D 4  39  ? -23.333 -29.485 25.986 1.00 72.44  ? 67  PHE D C     1 
ATOM   2596  O  O     . PHE D 4  39  ? -22.184 -29.620 25.552 1.00 74.33  ? 67  PHE D O     1 
ATOM   2597  C  CB    . PHE D 4  39  ? -25.407 -30.298 24.829 1.00 63.75  ? 67  PHE D CB    1 
ATOM   2598  C  CG    . PHE D 4  39  ? -24.843 -29.976 23.472 1.00 67.76  ? 67  PHE D CG    1 
ATOM   2599  C  CD1   . PHE D 4  39  ? -24.466 -28.681 23.148 1.00 71.47  ? 67  PHE D CD1   1 
ATOM   2600  C  CD2   . PHE D 4  39  ? -24.697 -30.970 22.518 1.00 67.38  ? 67  PHE D CD2   1 
ATOM   2601  C  CE1   . PHE D 4  39  ? -23.944 -28.388 21.906 1.00 73.67  ? 67  PHE D CE1   1 
ATOM   2602  C  CE2   . PHE D 4  39  ? -24.180 -30.681 21.272 1.00 67.60  ? 67  PHE D CE2   1 
ATOM   2603  C  CZ    . PHE D 4  39  ? -23.801 -29.390 20.967 1.00 71.69  ? 67  PHE D CZ    1 
ATOM   2604  N  N     . GLU D 4  40  ? -23.750 -28.350 26.552 1.00 73.56  ? 68  GLU D N     1 
ATOM   2605  C  CA    . GLU D 4  40  ? -22.854 -27.206 26.662 1.00 77.66  ? 68  GLU D CA    1 
ATOM   2606  C  C     . GLU D 4  40  ? -21.697 -27.497 27.609 1.00 70.50  ? 68  GLU D C     1 
ATOM   2607  O  O     . GLU D 4  40  ? -20.552 -27.121 27.331 1.00 72.45  ? 68  GLU D O     1 
ATOM   2608  C  CB    . GLU D 4  40  ? -23.633 -25.974 27.127 1.00 94.15  ? 68  GLU D CB    1 
ATOM   2609  C  CG    . GLU D 4  40  ? -22.771 -24.747 27.387 1.00 108.87 ? 68  GLU D CG    1 
ATOM   2610  C  CD    . GLU D 4  40  ? -22.171 -24.166 26.119 1.00 125.36 ? 68  GLU D CD    1 
ATOM   2611  O  OE1   . GLU D 4  40  ? -22.693 -24.455 25.021 1.00 133.14 ? 68  GLU D OE1   1 
ATOM   2612  O  OE2   . GLU D 4  40  ? -21.177 -23.416 26.222 1.00 133.41 ? 68  GLU D OE2   1 
ATOM   2613  N  N     . ARG D 4  41  ? -21.973 -28.170 28.729 1.00 64.42  ? 69  ARG D N     1 
ATOM   2614  C  CA    . ARG D 4  41  ? -20.919 -28.449 29.699 1.00 61.69  ? 69  ARG D CA    1 
ATOM   2615  C  C     . ARG D 4  41  ? -19.853 -29.370 29.116 1.00 63.73  ? 69  ARG D C     1 
ATOM   2616  O  O     . ARG D 4  41  ? -18.657 -29.182 29.365 1.00 63.04  ? 69  ARG D O     1 
ATOM   2617  C  CB    . ARG D 4  41  ? -21.517 -29.056 30.967 1.00 61.77  ? 69  ARG D CB    1 
ATOM   2618  C  CG    . ARG D 4  41  ? -22.196 -28.051 31.879 1.00 65.82  ? 69  ARG D CG    1 
ATOM   2619  C  CD    . ARG D 4  41  ? -22.275 -28.578 33.302 1.00 68.87  ? 69  ARG D CD    1 
ATOM   2620  N  NE    . ARG D 4  41  ? -23.609 -29.051 33.656 1.00 70.41  ? 69  ARG D NE    1 
ATOM   2621  C  CZ    . ARG D 4  41  ? -23.895 -29.679 34.791 1.00 71.53  ? 69  ARG D CZ    1 
ATOM   2622  N  NH1   . ARG D 4  41  ? -22.938 -29.917 35.677 1.00 72.61  ? 69  ARG D NH1   1 
ATOM   2623  N  NH2   . ARG D 4  41  ? -25.136 -30.074 35.040 1.00 74.27  ? 69  ARG D NH2   1 
ATOM   2624  N  N     . ILE D 4  42  ? -20.265 -30.371 28.334 1.00 62.10  ? 70  ILE D N     1 
ATOM   2625  C  CA    . ILE D 4  42  ? -19.298 -31.281 27.728 1.00 61.39  ? 70  ILE D CA    1 
ATOM   2626  C  C     . ILE D 4  42  ? -18.544 -30.584 26.602 1.00 63.85  ? 70  ILE D C     1 
ATOM   2627  O  O     . ILE D 4  42  ? -17.310 -30.630 26.539 1.00 69.58  ? 70  ILE D O     1 
ATOM   2628  C  CB    . ILE D 4  42  ? -19.997 -32.560 27.231 1.00 61.31  ? 70  ILE D CB    1 
ATOM   2629  C  CG1   . ILE D 4  42  ? -20.530 -33.375 28.412 1.00 54.35  ? 70  ILE D CG1   1 
ATOM   2630  C  CG2   . ILE D 4  42  ? -19.043 -33.403 26.397 1.00 59.06  ? 70  ILE D CG2   1 
ATOM   2631  C  CD1   . ILE D 4  42  ? -21.305 -34.602 27.998 1.00 51.44  ? 70  ILE D CD1   1 
ATOM   2632  N  N     . ALA D 4  43  ? -19.275 -29.926 25.698 1.00 67.13  ? 71  ALA D N     1 
ATOM   2633  C  CA    . ALA D 4  43  ? -18.630 -29.244 24.580 1.00 68.47  ? 71  ALA D CA    1 
ATOM   2634  C  C     . ALA D 4  43  ? -17.722 -28.117 25.055 1.00 70.73  ? 71  ALA D C     1 
ATOM   2635  O  O     . ALA D 4  43  ? -16.687 -27.852 24.434 1.00 76.79  ? 71  ALA D O     1 
ATOM   2636  C  CB    . ALA D 4  43  ? -19.684 -28.704 23.612 1.00 68.64  ? 71  ALA D CB    1 
ATOM   2637  N  N     . GLY D 4  44  ? -18.088 -27.446 26.149 1.00 64.36  ? 72  GLY D N     1 
ATOM   2638  C  CA    . GLY D 4  44  ? -17.234 -26.395 26.678 1.00 59.04  ? 72  GLY D CA    1 
ATOM   2639  C  C     . GLY D 4  44  ? -15.918 -26.927 27.214 1.00 55.67  ? 72  GLY D C     1 
ATOM   2640  O  O     . GLY D 4  44  ? -14.860 -26.332 26.985 1.00 45.71  ? 72  GLY D O     1 
ATOM   2641  N  N     . GLU D 4  45  ? -15.964 -28.052 27.937 1.00 61.90  ? 73  GLU D N     1 
ATOM   2642  C  CA    . GLU D 4  45  ? -14.732 -28.670 28.418 1.00 63.71  ? 73  GLU D CA    1 
ATOM   2643  C  C     . GLU D 4  45  ? -13.872 -29.153 27.259 1.00 61.38  ? 73  GLU D C     1 
ATOM   2644  O  O     . GLU D 4  45  ? -12.641 -29.038 27.299 1.00 64.99  ? 73  GLU D O     1 
ATOM   2645  C  CB    . GLU D 4  45  ? -15.052 -29.830 29.363 1.00 72.69  ? 73  GLU D CB    1 
ATOM   2646  C  CG    . GLU D 4  45  ? -15.241 -29.423 30.816 1.00 85.65  ? 73  GLU D CG    1 
ATOM   2647  C  CD    . GLU D 4  45  ? -13.956 -28.930 31.459 1.00 91.74  ? 73  GLU D CD    1 
ATOM   2648  O  OE1   . GLU D 4  45  ? -12.864 -29.271 30.953 1.00 91.30  ? 73  GLU D OE1   1 
ATOM   2649  O  OE2   . GLU D 4  45  ? -14.039 -28.201 32.470 1.00 92.91  ? 73  GLU D OE2   1 
ATOM   2650  N  N     . ALA D 4  46  ? -14.504 -29.696 26.215 1.00 58.52  ? 74  ALA D N     1 
ATOM   2651  C  CA    . ALA D 4  46  ? -13.758 -30.149 25.047 1.00 63.32  ? 74  ALA D CA    1 
ATOM   2652  C  C     . ALA D 4  46  ? -13.135 -28.983 24.294 1.00 71.82  ? 74  ALA D C     1 
ATOM   2653  O  O     . ALA D 4  46  ? -12.073 -29.140 23.679 1.00 77.38  ? 74  ALA D O     1 
ATOM   2654  C  CB    . ALA D 4  46  ? -14.670 -30.955 24.123 1.00 65.08  ? 74  ALA D CB    1 
ATOM   2655  N  N     . SER D 4  47  ? -13.779 -27.814 24.324 1.00 73.04  ? 75  SER D N     1 
ATOM   2656  C  CA    . SER D 4  47  ? -13.193 -26.630 23.706 1.00 69.17  ? 75  SER D CA    1 
ATOM   2657  C  C     . SER D 4  47  ? -11.910 -26.223 24.420 1.00 65.74  ? 75  SER D C     1 
ATOM   2658  O  O     . SER D 4  47  ? -10.876 -25.992 23.782 1.00 67.95  ? 75  SER D O     1 
ATOM   2659  C  CB    . SER D 4  47  ? -14.201 -25.481 23.710 1.00 71.50  ? 75  SER D CB    1 
ATOM   2660  O  OG    . SER D 4  47  ? -13.648 -24.324 23.106 1.00 78.51  ? 75  SER D OG    1 
ATOM   2661  N  N     . ARG D 4  48  ? -11.959 -26.138 25.752 1.00 64.11  ? 76  ARG D N     1 
ATOM   2662  C  CA    . ARG D 4  48  ? -10.764 -25.797 26.516 1.00 64.85  ? 76  ARG D CA    1 
ATOM   2663  C  C     . ARG D 4  48  ? -9.677  -26.852 26.351 1.00 71.51  ? 76  ARG D C     1 
ATOM   2664  O  O     . ARG D 4  48  ? -8.485  -26.527 26.333 1.00 78.14  ? 76  ARG D O     1 
ATOM   2665  C  CB    . ARG D 4  48  ? -11.125 -25.619 27.989 1.00 62.67  ? 76  ARG D CB    1 
ATOM   2666  C  CG    . ARG D 4  48  ? -11.676 -24.245 28.337 1.00 62.52  ? 76  ARG D CG    1 
ATOM   2667  C  CD    . ARG D 4  48  ? -12.418 -24.270 29.657 1.00 63.19  ? 76  ARG D CD    1 
ATOM   2668  N  NE    . ARG D 4  48  ? -13.749 -24.852 29.516 1.00 70.28  ? 76  ARG D NE    1 
ATOM   2669  C  CZ    . ARG D 4  48  ? -14.501 -25.260 30.533 1.00 79.48  ? 76  ARG D CZ    1 
ATOM   2670  N  NH1   . ARG D 4  48  ? -14.052 -25.161 31.778 1.00 86.10  ? 76  ARG D NH1   1 
ATOM   2671  N  NH2   . ARG D 4  48  ? -15.702 -25.777 30.307 1.00 80.27  ? 76  ARG D NH2   1 
ATOM   2672  N  N     . LEU D 4  49  ? -10.070 -28.122 26.223 1.00 70.05  ? 77  LEU D N     1 
ATOM   2673  C  CA    . LEU D 4  49  ? -9.095  -29.189 26.011 1.00 68.69  ? 77  LEU D CA    1 
ATOM   2674  C  C     . LEU D 4  49  ? -8.283  -28.950 24.744 1.00 73.15  ? 77  LEU D C     1 
ATOM   2675  O  O     . LEU D 4  49  ? -7.050  -29.050 24.756 1.00 76.75  ? 77  LEU D O     1 
ATOM   2676  C  CB    . LEU D 4  49  ? -9.805  -30.541 25.946 1.00 64.74  ? 77  LEU D CB    1 
ATOM   2677  C  CG    . LEU D 4  49  ? -10.021 -31.265 27.275 1.00 61.04  ? 77  LEU D CG    1 
ATOM   2678  C  CD1   . LEU D 4  49  ? -11.057 -32.365 27.121 1.00 58.86  ? 77  LEU D CD1   1 
ATOM   2679  C  CD2   . LEU D 4  49  ? -8.702  -31.834 27.775 1.00 59.70  ? 77  LEU D CD2   1 
ATOM   2680  N  N     . ALA D 4  50  ? -8.959  -28.638 23.636 1.00 73.74  ? 78  ALA D N     1 
ATOM   2681  C  CA    . ALA D 4  50  ? -8.247  -28.380 22.390 1.00 73.68  ? 78  ALA D CA    1 
ATOM   2682  C  C     . ALA D 4  50  ? -7.389  -27.124 22.493 1.00 77.55  ? 78  ALA D C     1 
ATOM   2683  O  O     . ALA D 4  50  ? -6.268  -27.086 21.970 1.00 83.45  ? 78  ALA D O     1 
ATOM   2684  C  CB    . ALA D 4  50  ? -9.239  -28.261 21.235 1.00 75.56  ? 78  ALA D CB    1 
ATOM   2685  N  N     . HIS D 4  51  ? -7.895  -26.089 23.167 1.00 74.02  ? 79  HIS D N     1 
ATOM   2686  C  CA    A HIS D 4  51  ? -7.124  -24.858 23.313 0.46 73.92  ? 79  HIS D CA    1 
ATOM   2687  C  CA    B HIS D 4  51  ? -7.125  -24.858 23.313 0.54 73.72  ? 79  HIS D CA    1 
ATOM   2688  C  C     . HIS D 4  51  ? -5.900  -25.071 24.195 1.00 74.46  ? 79  HIS D C     1 
ATOM   2689  O  O     . HIS D 4  51  ? -4.822  -24.538 23.907 1.00 74.18  ? 79  HIS D O     1 
ATOM   2690  C  CB    A HIS D 4  51  ? -8.006  -23.745 23.881 0.46 75.98  ? 79  HIS D CB    1 
ATOM   2691  C  CB    B HIS D 4  51  ? -8.012  -23.750 23.880 0.54 76.10  ? 79  HIS D CB    1 
ATOM   2692  C  CG    A HIS D 4  51  ? -8.893  -23.096 22.864 0.46 76.28  ? 79  HIS D CG    1 
ATOM   2693  C  CG    B HIS D 4  51  ? -7.327  -22.423 23.989 0.54 76.57  ? 79  HIS D CG    1 
ATOM   2694  N  ND1   A HIS D 4  51  ? -8.442  -22.127 21.994 0.46 76.02  ? 79  HIS D ND1   1 
ATOM   2695  N  ND1   B HIS D 4  51  ? -6.909  -21.709 22.887 0.54 75.81  ? 79  HIS D ND1   1 
ATOM   2696  C  CD2   A HIS D 4  51  ? -10.206 -23.271 22.583 0.46 76.17  ? 79  HIS D CD2   1 
ATOM   2697  C  CD2   B HIS D 4  51  ? -6.988  -21.680 25.069 0.54 77.26  ? 79  HIS D CD2   1 
ATOM   2698  C  CE1   A HIS D 4  51  ? -9.437  -21.736 21.218 0.46 75.97  ? 79  HIS D CE1   1 
ATOM   2699  C  CE1   B HIS D 4  51  ? -6.342  -20.584 23.283 0.54 77.38  ? 79  HIS D CE1   1 
ATOM   2700  N  NE2   A HIS D 4  51  ? -10.519 -22.415 21.555 0.46 75.57  ? 79  HIS D NE2   1 
ATOM   2701  N  NE2   B HIS D 4  51  ? -6.377  -20.542 24.603 0.54 78.66  ? 79  HIS D NE2   1 
ATOM   2702  N  N     . TYR D 4  52  ? -6.045  -25.848 25.274 1.00 80.31  ? 80  TYR D N     1 
ATOM   2703  C  CA    . TYR D 4  52  ? -4.918  -26.085 26.172 1.00 85.06  ? 80  TYR D CA    1 
ATOM   2704  C  C     . TYR D 4  52  ? -3.773  -26.800 25.467 1.00 87.89  ? 80  TYR D C     1 
ATOM   2705  O  O     . TYR D 4  52  ? -2.604  -26.589 25.812 1.00 93.05  ? 80  TYR D O     1 
ATOM   2706  C  CB    . TYR D 4  52  ? -5.359  -26.905 27.386 1.00 89.95  ? 80  TYR D CB    1 
ATOM   2707  C  CG    . TYR D 4  52  ? -6.355  -26.223 28.300 1.00 96.34  ? 80  TYR D CG    1 
ATOM   2708  C  CD1   . TYR D 4  52  ? -6.579  -24.855 28.230 1.00 95.02  ? 80  TYR D CD1   1 
ATOM   2709  C  CD2   . TYR D 4  52  ? -7.071  -26.957 29.238 1.00 99.96  ? 80  TYR D CD2   1 
ATOM   2710  C  CE1   . TYR D 4  52  ? -7.492  -24.238 29.068 1.00 96.04  ? 80  TYR D CE1   1 
ATOM   2711  C  CE2   . TYR D 4  52  ? -7.982  -26.349 30.079 1.00 96.58  ? 80  TYR D CE2   1 
ATOM   2712  C  CZ    . TYR D 4  52  ? -8.189  -24.991 29.991 1.00 94.87  ? 80  TYR D CZ    1 
ATOM   2713  O  OH    . TYR D 4  52  ? -9.098  -24.391 30.830 1.00 96.46  ? 80  TYR D OH    1 
ATOM   2714  N  N     . ASN D 4  53  ? -4.082  -27.649 24.486 1.00 85.55  ? 81  ASN D N     1 
ATOM   2715  C  CA    . ASN D 4  53  ? -3.078  -28.448 23.798 1.00 86.80  ? 81  ASN D CA    1 
ATOM   2716  C  C     . ASN D 4  53  ? -2.705  -27.877 22.434 1.00 93.39  ? 81  ASN D C     1 
ATOM   2717  O  O     . ASN D 4  53  ? -2.109  -28.587 21.616 1.00 98.29  ? 81  ASN D O     1 
ATOM   2718  C  CB    . ASN D 4  53  ? -3.563  -29.892 23.656 1.00 85.55  ? 81  ASN D CB    1 
ATOM   2719  C  CG    . ASN D 4  53  ? -3.786  -30.566 24.998 1.00 81.13  ? 81  ASN D CG    1 
ATOM   2720  O  OD1   . ASN D 4  53  ? -2.839  -31.008 25.649 1.00 78.94  ? 81  ASN D OD1   1 
ATOM   2721  N  ND2   . ASN D 4  53  ? -5.043  -30.648 25.418 1.00 79.96  ? 81  ASN D ND2   1 
ATOM   2722  N  N     . LYS D 4  54  ? -3.045  -26.611 22.175 1.00 94.84  ? 82  LYS D N     1 
ATOM   2723  C  CA    . LYS D 4  54  ? -2.674  -25.923 20.936 1.00 92.73  ? 82  LYS D CA    1 
ATOM   2724  C  C     . LYS D 4  54  ? -3.185  -26.666 19.703 1.00 91.58  ? 82  LYS D C     1 
ATOM   2725  O  O     . LYS D 4  54  ? -2.522  -26.714 18.665 1.00 96.41  ? 82  LYS D O     1 
ATOM   2726  C  CB    . LYS D 4  54  ? -1.160  -25.717 20.853 1.00 94.74  ? 82  LYS D CB    1 
ATOM   2727  C  CG    . LYS D 4  54  ? -0.576  -24.887 21.984 1.00 100.46 ? 82  LYS D CG    1 
ATOM   2728  C  CD    . LYS D 4  54  ? 0.944   -24.902 21.940 1.00 108.05 ? 82  LYS D CD    1 
ATOM   2729  C  CE    . LYS D 4  54  ? 1.544   -24.024 23.027 1.00 113.02 ? 82  LYS D CE    1 
ATOM   2730  N  NZ    . LYS D 4  54  ? 1.239   -22.582 22.814 1.00 114.70 ? 82  LYS D NZ    1 
ATOM   2731  N  N     . ARG D 4  55  ? -4.373  -27.252 19.815 1.00 90.45  ? 83  ARG D N     1 
ATOM   2732  C  CA    . ARG D 4  55  ? -4.978  -28.006 18.730 1.00 94.48  ? 83  ARG D CA    1 
ATOM   2733  C  C     . ARG D 4  55  ? -6.248  -27.313 18.253 1.00 92.27  ? 83  ARG D C     1 
ATOM   2734  O  O     . ARG D 4  55  ? -6.907  -26.594 19.009 1.00 92.06  ? 83  ARG D O     1 
ATOM   2735  C  CB    . ARG D 4  55  ? -5.289  -29.443 19.162 1.00 98.07  ? 83  ARG D CB    1 
ATOM   2736  C  CG    . ARG D 4  55  ? -4.052  -30.243 19.539 1.00 101.96 ? 83  ARG D CG    1 
ATOM   2737  C  CD    . ARG D 4  55  ? -4.389  -31.692 19.837 1.00 110.98 ? 83  ARG D CD    1 
ATOM   2738  N  NE    . ARG D 4  55  ? -4.865  -32.398 18.651 1.00 118.19 ? 83  ARG D NE    1 
ATOM   2739  C  CZ    . ARG D 4  55  ? -5.211  -33.680 18.636 1.00 122.79 ? 83  ARG D CZ    1 
ATOM   2740  N  NH1   . ARG D 4  55  ? -5.133  -34.403 19.746 1.00 123.10 ? 83  ARG D NH1   1 
ATOM   2741  N  NH2   . ARG D 4  55  ? -5.635  -34.240 17.512 1.00 128.59 ? 83  ARG D NH2   1 
ATOM   2742  N  N     . SER D 4  56  ? -6.584  -27.541 16.985 1.00 89.88  ? 84  SER D N     1 
ATOM   2743  C  CA    . SER D 4  56  ? -7.678  -26.844 16.323 1.00 86.57  ? 84  SER D CA    1 
ATOM   2744  C  C     . SER D 4  56  ? -8.932  -27.694 16.175 1.00 84.43  ? 84  SER D C     1 
ATOM   2745  O  O     . SER D 4  56  ? -9.953  -27.186 15.701 1.00 83.43  ? 84  SER D O     1 
ATOM   2746  C  CB    . SER D 4  56  ? -7.226  -26.363 14.939 1.00 88.30  ? 84  SER D CB    1 
ATOM   2747  O  OG    . SER D 4  56  ? -5.947  -25.756 15.000 1.00 92.21  ? 84  SER D OG    1 
ATOM   2748  N  N     . THR D 4  57  ? -8.885  -28.966 16.562 1.00 81.45  ? 85  THR D N     1 
ATOM   2749  C  CA    . THR D 4  57  ? -9.965  -29.904 16.295 1.00 79.44  ? 85  THR D CA    1 
ATOM   2750  C  C     . THR D 4  57  ? -10.517 -30.468 17.596 1.00 80.98  ? 85  THR D C     1 
ATOM   2751  O  O     . THR D 4  57  ? -9.763  -30.754 18.532 1.00 79.52  ? 85  THR D O     1 
ATOM   2752  C  CB    . THR D 4  57  ? -9.482  -31.056 15.401 1.00 76.68  ? 85  THR D CB    1 
ATOM   2753  O  OG1   . THR D 4  57  ? -8.715  -30.528 14.312 1.00 73.89  ? 85  THR D OG1   1 
ATOM   2754  C  CG2   . THR D 4  57  ? -10.664 -31.843 14.848 1.00 76.22  ? 85  THR D CG2   1 
ATOM   2755  N  N     . ILE D 4  58  ? -11.836 -30.624 17.648 1.00 80.94  ? 86  ILE D N     1 
ATOM   2756  C  CA    . ILE D 4  58  ? -12.511 -31.347 18.718 1.00 76.52  ? 86  ILE D CA    1 
ATOM   2757  C  C     . ILE D 4  58  ? -12.951 -32.679 18.125 1.00 84.21  ? 86  ILE D C     1 
ATOM   2758  O  O     . ILE D 4  58  ? -13.950 -32.757 17.401 1.00 86.16  ? 86  ILE D O     1 
ATOM   2759  C  CB    . ILE D 4  58  ? -13.695 -30.564 19.296 1.00 68.96  ? 86  ILE D CB    1 
ATOM   2760  C  CG1   . ILE D 4  58  ? -13.193 -29.355 20.086 1.00 71.64  ? 86  ILE D CG1   1 
ATOM   2761  C  CG2   . ILE D 4  58  ? -14.547 -31.456 20.188 1.00 60.36  ? 86  ILE D CG2   1 
ATOM   2762  C  CD1   . ILE D 4  58  ? -14.296 -28.550 20.735 1.00 69.16  ? 86  ILE D CD1   1 
ATOM   2763  N  N     . THR D 4  59  ? -12.188 -33.729 18.411 1.00 86.82  ? 87  THR D N     1 
ATOM   2764  C  CA    . THR D 4  59  ? -12.499 -35.071 17.954 1.00 83.33  ? 87  THR D CA    1 
ATOM   2765  C  C     . THR D 4  59  ? -13.188 -35.843 19.076 1.00 79.65  ? 87  THR D C     1 
ATOM   2766  O  O     . THR D 4  59  ? -13.491 -35.305 20.144 1.00 77.46  ? 87  THR D O     1 
ATOM   2767  C  CB    . THR D 4  59  ? -11.230 -35.785 17.481 1.00 89.24  ? 87  THR D CB    1 
ATOM   2768  O  OG1   . THR D 4  59  ? -11.574 -37.063 16.930 1.00 101.29 ? 87  THR D OG1   1 
ATOM   2769  C  CG2   . THR D 4  59  ? -10.265 -35.985 18.639 1.00 88.18  ? 87  THR D CG2   1 
ATOM   2770  N  N     . SER D 4  60  ? -13.443 -37.129 18.823 1.00 79.16  ? 88  SER D N     1 
ATOM   2771  C  CA    . SER D 4  60  ? -14.066 -37.974 19.834 1.00 76.22  ? 88  SER D CA    1 
ATOM   2772  C  C     . SER D 4  60  ? -13.191 -38.131 21.070 1.00 73.38  ? 88  SER D C     1 
ATOM   2773  O  O     . SER D 4  60  ? -13.712 -38.426 22.152 1.00 73.03  ? 88  SER D O     1 
ATOM   2774  C  CB    . SER D 4  60  ? -14.387 -39.347 19.243 1.00 79.09  ? 88  SER D CB    1 
ATOM   2775  O  OG    . SER D 4  60  ? -13.221 -39.958 18.718 1.00 85.17  ? 88  SER D OG    1 
ATOM   2776  N  N     . ARG D 4  61  ? -11.877 -37.935 20.938 1.00 73.65  ? 89  ARG D N     1 
ATOM   2777  C  CA    . ARG D 4  61  ? -10.990 -38.068 22.089 1.00 76.00  ? 89  ARG D CA    1 
ATOM   2778  C  C     . ARG D 4  61  ? -11.153 -36.896 23.052 1.00 77.27  ? 89  ARG D C     1 
ATOM   2779  O  O     . ARG D 4  61  ? -11.068 -37.073 24.273 1.00 76.09  ? 89  ARG D O     1 
ATOM   2780  C  CB    . ARG D 4  61  ? -9.541  -38.191 21.619 1.00 77.09  ? 89  ARG D CB    1 
ATOM   2781  C  CG    . ARG D 4  61  ? -8.543  -38.409 22.740 1.00 81.06  ? 89  ARG D CG    1 
ATOM   2782  C  CD    . ARG D 4  61  ? -7.228  -38.946 22.206 1.00 88.58  ? 89  ARG D CD    1 
ATOM   2783  N  NE    . ARG D 4  61  ? -6.298  -39.258 23.286 1.00 94.14  ? 89  ARG D NE    1 
ATOM   2784  C  CZ    . ARG D 4  61  ? -5.320  -38.452 23.684 1.00 92.39  ? 89  ARG D CZ    1 
ATOM   2785  N  NH1   . ARG D 4  61  ? -5.136  -37.284 23.085 1.00 90.23  ? 89  ARG D NH1   1 
ATOM   2786  N  NH2   . ARG D 4  61  ? -4.524  -38.817 24.679 1.00 93.35  ? 89  ARG D NH2   1 
ATOM   2787  N  N     . GLU D 4  62  ? -11.387 -35.691 22.526 1.00 77.72  ? 90  GLU D N     1 
ATOM   2788  C  CA    . GLU D 4  62  ? -11.662 -34.555 23.401 1.00 78.67  ? 90  GLU D CA    1 
ATOM   2789  C  C     . GLU D 4  62  ? -13.010 -34.704 24.092 1.00 74.41  ? 90  GLU D C     1 
ATOM   2790  O  O     . GLU D 4  62  ? -13.171 -34.286 25.244 1.00 74.59  ? 90  GLU D O     1 
ATOM   2791  C  CB    . GLU D 4  62  ? -11.609 -33.245 22.615 1.00 83.60  ? 90  GLU D CB    1 
ATOM   2792  C  CG    . GLU D 4  62  ? -10.219 -32.642 22.490 1.00 93.69  ? 90  GLU D CG    1 
ATOM   2793  C  CD    . GLU D 4  62  ? -9.461  -33.160 21.286 1.00 102.12 ? 90  GLU D CD    1 
ATOM   2794  O  OE1   . GLU D 4  62  ? -10.060 -33.226 20.193 1.00 104.82 ? 90  GLU D OE1   1 
ATOM   2795  O  OE2   . GLU D 4  62  ? -8.268  -33.499 21.432 1.00 107.88 ? 90  GLU D OE2   1 
ATOM   2796  N  N     . ILE D 4  63  ? -13.992 -35.293 23.405 1.00 72.68  ? 91  ILE D N     1 
ATOM   2797  C  CA    . ILE D 4  63  ? -15.288 -35.534 24.030 1.00 72.87  ? 91  ILE D CA    1 
ATOM   2798  C  C     . ILE D 4  63  ? -15.157 -36.561 25.147 1.00 76.21  ? 91  ILE D C     1 
ATOM   2799  O  O     . ILE D 4  63  ? -15.781 -36.430 26.207 1.00 74.73  ? 91  ILE D O     1 
ATOM   2800  C  CB    . ILE D 4  63  ? -16.317 -35.973 22.971 1.00 72.40  ? 91  ILE D CB    1 
ATOM   2801  C  CG1   . ILE D 4  63  ? -16.513 -34.871 21.930 1.00 75.55  ? 91  ILE D CG1   1 
ATOM   2802  C  CG2   . ILE D 4  63  ? -17.647 -36.315 23.624 1.00 66.48  ? 91  ILE D CG2   1 
ATOM   2803  C  CD1   . ILE D 4  63  ? -17.082 -33.590 22.501 1.00 70.05  ? 91  ILE D CD1   1 
ATOM   2804  N  N     . GLN D 4  64  ? -14.335 -37.592 24.934 1.00 77.45  ? 92  GLN D N     1 
ATOM   2805  C  CA    . GLN D 4  64  ? -14.162 -38.628 25.947 1.00 70.87  ? 92  GLN D CA    1 
ATOM   2806  C  C     . GLN D 4  64  ? -13.494 -38.072 27.199 1.00 64.19  ? 92  GLN D C     1 
ATOM   2807  O  O     . GLN D 4  64  ? -14.002 -38.245 28.313 1.00 62.46  ? 92  GLN D O     1 
ATOM   2808  C  CB    . GLN D 4  64  ? -13.355 -39.793 25.372 1.00 73.34  ? 92  GLN D CB    1 
ATOM   2809  C  CG    . GLN D 4  64  ? -12.908 -40.811 26.409 1.00 73.58  ? 92  GLN D CG    1 
ATOM   2810  C  CD    . GLN D 4  64  ? -12.473 -42.123 25.788 1.00 75.69  ? 92  GLN D CD    1 
ATOM   2811  O  OE1   . GLN D 4  64  ? -12.970 -42.519 24.733 1.00 74.87  ? 92  GLN D OE1   1 
ATOM   2812  N  NE2   . GLN D 4  64  ? -11.539 -42.807 26.440 1.00 80.29  ? 92  GLN D NE2   1 
ATOM   2813  N  N     . THR D 4  65  ? -12.352 -37.397 27.038 1.00 62.88  ? 93  THR D N     1 
ATOM   2814  C  CA    . THR D 4  65  ? -11.660 -36.837 28.192 1.00 66.84  ? 93  THR D CA    1 
ATOM   2815  C  C     . THR D 4  65  ? -12.456 -35.723 28.860 1.00 60.58  ? 93  THR D C     1 
ATOM   2816  O  O     . THR D 4  65  ? -12.233 -35.441 30.041 1.00 61.76  ? 93  THR D O     1 
ATOM   2817  C  CB    . THR D 4  65  ? -10.276 -36.327 27.786 1.00 74.83  ? 93  THR D CB    1 
ATOM   2818  O  OG1   . THR D 4  65  ? -10.391 -35.475 26.642 1.00 82.36  ? 93  THR D OG1   1 
ATOM   2819  C  CG2   . THR D 4  65  ? -9.361  -37.495 27.447 1.00 77.42  ? 93  THR D CG2   1 
ATOM   2820  N  N     . ALA D 4  66  ? -13.382 -35.090 28.136 1.00 56.03  ? 94  ALA D N     1 
ATOM   2821  C  CA    . ALA D 4  66  ? -14.292 -34.133 28.754 1.00 59.77  ? 94  ALA D CA    1 
ATOM   2822  C  C     . ALA D 4  66  ? -15.366 -34.828 29.578 1.00 62.11  ? 94  ALA D C     1 
ATOM   2823  O  O     . ALA D 4  66  ? -15.806 -34.288 30.600 1.00 66.47  ? 94  ALA D O     1 
ATOM   2824  C  CB    . ALA D 4  66  ? -14.941 -33.249 27.687 1.00 63.12  ? 94  ALA D CB    1 
ATOM   2825  N  N     . VAL D 4  67  ? -15.798 -36.017 29.152 1.00 65.62  ? 95  VAL D N     1 
ATOM   2826  C  CA    . VAL D 4  67  ? -16.762 -36.785 29.934 1.00 63.75  ? 95  VAL D CA    1 
ATOM   2827  C  C     . VAL D 4  67  ? -16.134 -37.258 31.239 1.00 64.99  ? 95  VAL D C     1 
ATOM   2828  O  O     . VAL D 4  67  ? -16.767 -37.212 32.301 1.00 61.43  ? 95  VAL D O     1 
ATOM   2829  C  CB    . VAL D 4  67  ? -17.303 -37.961 29.100 1.00 60.45  ? 95  VAL D CB    1 
ATOM   2830  C  CG1   . VAL D 4  67  ? -18.022 -38.968 29.988 1.00 60.00  ? 95  VAL D CG1   1 
ATOM   2831  C  CG2   . VAL D 4  67  ? -18.231 -37.455 28.003 1.00 53.67  ? 95  VAL D CG2   1 
ATOM   2832  N  N     . ARG D 4  68  ? -14.876 -37.703 31.188 1.00 69.62  ? 96  ARG D N     1 
ATOM   2833  C  CA    . ARG D 4  68  ? -14.204 -38.184 32.391 1.00 74.68  ? 96  ARG D CA    1 
ATOM   2834  C  C     . ARG D 4  68  ? -13.979 -37.075 33.411 1.00 70.27  ? 96  ARG D C     1 
ATOM   2835  O  O     . ARG D 4  68  ? -13.848 -37.363 34.605 1.00 66.36  ? 96  ARG D O     1 
ATOM   2836  C  CB    . ARG D 4  68  ? -12.868 -38.830 32.022 1.00 80.79  ? 96  ARG D CB    1 
ATOM   2837  C  CG    . ARG D 4  68  ? -12.992 -40.078 31.167 1.00 85.93  ? 96  ARG D CG    1 
ATOM   2838  C  CD    . ARG D 4  68  ? -11.624 -40.663 30.868 1.00 92.88  ? 96  ARG D CD    1 
ATOM   2839  N  NE    . ARG D 4  68  ? -11.710 -41.862 30.039 1.00 100.10 ? 96  ARG D NE    1 
ATOM   2840  C  CZ    . ARG D 4  68  ? -11.840 -43.093 30.520 1.00 107.21 ? 96  ARG D CZ    1 
ATOM   2841  N  NH1   . ARG D 4  68  ? -11.902 -43.292 31.830 1.00 109.46 ? 96  ARG D NH1   1 
ATOM   2842  N  NH2   . ARG D 4  68  ? -11.908 -44.127 29.692 1.00 112.97 ? 96  ARG D NH2   1 
ATOM   2843  N  N     . LEU D 4  69  ? -13.929 -35.820 32.966 1.00 70.70  ? 97  LEU D N     1 
ATOM   2844  C  CA    . LEU D 4  69  ? -13.793 -34.674 33.856 1.00 63.09  ? 97  LEU D CA    1 
ATOM   2845  C  C     . LEU D 4  69  ? -15.124 -34.218 34.434 1.00 64.93  ? 97  LEU D C     1 
ATOM   2846  O  O     . LEU D 4  69  ? -15.171 -33.769 35.586 1.00 67.44  ? 97  LEU D O     1 
ATOM   2847  C  CB    . LEU D 4  69  ? -13.140 -33.505 33.113 1.00 51.41  ? 97  LEU D CB    1 
ATOM   2848  C  CG    . LEU D 4  69  ? -11.670 -33.673 32.732 1.00 46.62  ? 97  LEU D CG    1 
ATOM   2849  C  CD1   . LEU D 4  69  ? -11.225 -32.556 31.800 1.00 44.03  ? 97  LEU D CD1   1 
ATOM   2850  C  CD2   . LEU D 4  69  ? -10.819 -33.698 33.985 1.00 45.35  ? 97  LEU D CD2   1 
ATOM   2851  N  N     . LEU D 4  70  ? -16.208 -34.332 33.668 1.00 64.58  ? 98  LEU D N     1 
ATOM   2852  C  CA    . LEU D 4  70  ? -17.497 -33.802 34.092 1.00 69.50  ? 98  LEU D CA    1 
ATOM   2853  C  C     . LEU D 4  70  ? -18.374 -34.845 34.774 1.00 65.15  ? 98  LEU D C     1 
ATOM   2854  O  O     . LEU D 4  70  ? -19.022 -34.541 35.781 1.00 65.69  ? 98  LEU D O     1 
ATOM   2855  C  CB    . LEU D 4  70  ? -18.241 -33.214 32.892 1.00 77.98  ? 98  LEU D CB    1 
ATOM   2856  C  CG    . LEU D 4  70  ? -19.634 -32.639 33.174 1.00 84.57  ? 98  LEU D CG    1 
ATOM   2857  C  CD1   . LEU D 4  70  ? -19.553 -31.425 34.088 1.00 85.59  ? 98  LEU D CD1   1 
ATOM   2858  C  CD2   . LEU D 4  70  ? -20.343 -32.293 31.876 1.00 87.09  ? 98  LEU D CD2   1 
ATOM   2859  N  N     . LEU D 4  71  ? -18.410 -36.069 34.252 1.00 68.24  ? 99  LEU D N     1 
ATOM   2860  C  CA    . LEU D 4  71  ? -19.365 -36.968 34.890 1.00 66.99  ? 99  LEU D CA    1 
ATOM   2861  C  C     . LEU D 4  71  ? -18.712 -37.711 36.053 1.00 68.19  ? 99  LEU D C     1 
ATOM   2862  O  O     . LEU D 4  71  ? -17.523 -38.040 35.990 1.00 65.60  ? 99  LEU D O     1 
ATOM   2863  C  CB    . LEU D 4  71  ? -19.913 -37.976 33.886 1.00 64.13  ? 99  LEU D CB    1 
ATOM   2864  C  CG    . LEU D 4  71  ? -20.618 -37.383 32.664 1.00 67.69  ? 99  LEU D CG    1 
ATOM   2865  C  CD1   . LEU D 4  71  ? -21.239 -38.478 31.812 1.00 70.09  ? 99  LEU D CD1   1 
ATOM   2866  C  CD2   . LEU D 4  71  ? -21.668 -36.367 33.084 1.00 68.92  ? 99  LEU D CD2   1 
ATOM   2867  N  N     . PRO D 4  72  ? -19.472 -37.969 37.119 1.00 72.29  ? 100 PRO D N     1 
ATOM   2868  C  CA    . PRO D 4  72  ? -18.947 -38.775 38.228 1.00 78.34  ? 100 PRO D CA    1 
ATOM   2869  C  C     . PRO D 4  72  ? -18.461 -40.139 37.758 1.00 86.67  ? 100 PRO D C     1 
ATOM   2870  O  O     . PRO D 4  72  ? -18.796 -40.607 36.667 1.00 97.08  ? 100 PRO D O     1 
ATOM   2871  C  CB    . PRO D 4  72  ? -20.149 -38.902 39.171 1.00 76.51  ? 100 PRO D CB    1 
ATOM   2872  C  CG    . PRO D 4  72  ? -20.945 -37.668 38.906 1.00 72.48  ? 100 PRO D CG    1 
ATOM   2873  C  CD    . PRO D 4  72  ? -20.794 -37.398 37.430 1.00 71.41  ? 100 PRO D CD    1 
ATOM   2874  N  N     . GLY D 4  73  ? -17.674 -40.786 38.622 1.00 83.58  ? 101 GLY D N     1 
ATOM   2875  C  CA    . GLY D 4  73  ? -16.908 -41.953 38.204 1.00 84.06  ? 101 GLY D CA    1 
ATOM   2876  C  C     . GLY D 4  73  ? -17.745 -43.042 37.562 1.00 84.40  ? 101 GLY D C     1 
ATOM   2877  O  O     . GLY D 4  73  ? -17.465 -43.480 36.444 1.00 89.63  ? 101 GLY D O     1 
ATOM   2878  N  N     . GLU D 4  74  ? -18.787 -43.500 38.261 1.00 82.26  ? 102 GLU D N     1 
ATOM   2879  C  CA    . GLU D 4  74  ? -19.574 -44.616 37.744 1.00 83.10  ? 102 GLU D CA    1 
ATOM   2880  C  C     . GLU D 4  74  ? -20.433 -44.199 36.555 1.00 78.70  ? 102 GLU D C     1 
ATOM   2881  O  O     . GLU D 4  74  ? -20.680 -45.011 35.656 1.00 78.31  ? 102 GLU D O     1 
ATOM   2882  C  CB    . GLU D 4  74  ? -20.438 -45.209 38.856 1.00 87.74  ? 102 GLU D CB    1 
ATOM   2883  C  CG    . GLU D 4  74  ? -20.888 -46.633 38.608 1.00 92.06  ? 102 GLU D CG    1 
ATOM   2884  C  CD    . GLU D 4  74  ? -19.724 -47.600 38.510 1.00 97.54  ? 102 GLU D CD    1 
ATOM   2885  O  OE1   . GLU D 4  74  ? -19.843 -48.600 37.771 1.00 101.76 ? 102 GLU D OE1   1 
ATOM   2886  O  OE2   . GLU D 4  74  ? -18.690 -47.361 39.171 1.00 98.17  ? 102 GLU D OE2   1 
ATOM   2887  N  N     . LEU D 4  75  ? -20.889 -42.945 36.527 1.00 77.08  ? 103 LEU D N     1 
ATOM   2888  C  CA    . LEU D 4  75  ? -21.624 -42.453 35.365 1.00 73.33  ? 103 LEU D CA    1 
ATOM   2889  C  C     . LEU D 4  75  ? -20.698 -42.248 34.173 1.00 72.38  ? 103 LEU D C     1 
ATOM   2890  O  O     . LEU D 4  75  ? -21.083 -42.513 33.027 1.00 72.40  ? 103 LEU D O     1 
ATOM   2891  C  CB    . LEU D 4  75  ? -22.344 -41.150 35.710 1.00 74.79  ? 103 LEU D CB    1 
ATOM   2892  C  CG    . LEU D 4  75  ? -23.829 -41.231 36.063 1.00 76.17  ? 103 LEU D CG    1 
ATOM   2893  C  CD1   . LEU D 4  75  ? -24.379 -39.841 36.342 1.00 75.54  ? 103 LEU D CD1   1 
ATOM   2894  C  CD2   . LEU D 4  75  ? -24.607 -41.904 34.942 1.00 73.17  ? 103 LEU D CD2   1 
ATOM   2895  N  N     . ALA D 4  76  ? -19.476 -41.769 34.422 1.00 71.19  ? 104 ALA D N     1 
ATOM   2896  C  CA    . ALA D 4  76  ? -18.532 -41.544 33.334 1.00 70.14  ? 104 ALA D CA    1 
ATOM   2897  C  C     . ALA D 4  76  ? -18.042 -42.855 32.738 1.00 69.55  ? 104 ALA D C     1 
ATOM   2898  O  O     . ALA D 4  76  ? -17.786 -42.927 31.530 1.00 66.45  ? 104 ALA D O     1 
ATOM   2899  C  CB    . ALA D 4  76  ? -17.348 -40.712 33.827 1.00 69.36  ? 104 ALA D CB    1 
ATOM   2900  N  N     . LYS D 4  77  ? -17.910 -43.898 33.560 1.00 72.18  ? 105 LYS D N     1 
ATOM   2901  C  CA    . LYS D 4  77  ? -17.423 -45.178 33.057 1.00 73.00  ? 105 LYS D CA    1 
ATOM   2902  C  C     . LYS D 4  77  ? -18.384 -45.765 32.031 1.00 68.05  ? 105 LYS D C     1 
ATOM   2903  O  O     . LYS D 4  77  ? -17.957 -46.262 30.982 1.00 64.58  ? 105 LYS D O     1 
ATOM   2904  C  CB    . LYS D 4  77  ? -17.206 -46.151 34.216 1.00 77.34  ? 105 LYS D CB    1 
ATOM   2905  C  CG    . LYS D 4  77  ? -16.496 -47.435 33.819 1.00 93.77  ? 105 LYS D CG    1 
ATOM   2906  C  CD    . LYS D 4  77  ? -16.177 -48.297 35.032 1.00 104.08 ? 105 LYS D CD    1 
ATOM   2907  C  CE    . LYS D 4  77  ? -17.443 -48.793 35.709 1.00 106.68 ? 105 LYS D CE    1 
ATOM   2908  N  NZ    . LYS D 4  77  ? -17.145 -49.612 36.918 1.00 106.85 ? 105 LYS D NZ    1 
ATOM   2909  N  N     . HIS D 4  78  ? -19.688 -45.699 32.307 1.00 66.46  ? 106 HIS D N     1 
ATOM   2910  C  CA    . HIS D 4  78  ? -20.668 -46.229 31.367 1.00 70.02  ? 106 HIS D CA    1 
ATOM   2911  C  C     . HIS D 4  78  ? -20.907 -45.287 30.195 1.00 71.81  ? 106 HIS D C     1 
ATOM   2912  O  O     . HIS D 4  78  ? -21.285 -45.742 29.111 1.00 75.40  ? 106 HIS D O     1 
ATOM   2913  C  CB    . HIS D 4  78  ? -21.986 -46.520 32.087 1.00 76.66  ? 106 HIS D CB    1 
ATOM   2914  C  CG    . HIS D 4  78  ? -21.910 -47.669 33.044 1.00 89.54  ? 106 HIS D CG    1 
ATOM   2915  N  ND1   . HIS D 4  78  ? -22.976 -48.509 33.285 1.00 95.19  ? 106 HIS D ND1   1 
ATOM   2916  C  CD2   . HIS D 4  78  ? -20.896 -48.118 33.821 1.00 94.47  ? 106 HIS D CD2   1 
ATOM   2917  C  CE1   . HIS D 4  78  ? -22.621 -49.427 34.166 1.00 96.42  ? 106 HIS D CE1   1 
ATOM   2918  N  NE2   . HIS D 4  78  ? -21.364 -49.211 34.508 1.00 96.46  ? 106 HIS D NE2   1 
ATOM   2919  N  N     . ALA D 4  79  ? -20.696 -43.983 30.387 1.00 94.41  ? 107 ALA D N     1 
ATOM   2920  C  CA    . ALA D 4  79  ? -20.834 -43.047 29.277 1.00 93.02  ? 107 ALA D CA    1 
ATOM   2921  C  C     . ALA D 4  79  ? -19.752 -43.274 28.229 1.00 88.79  ? 107 ALA D C     1 
ATOM   2922  O  O     . ALA D 4  79  ? -20.033 -43.263 27.025 1.00 86.06  ? 107 ALA D O     1 
ATOM   2923  C  CB    . ALA D 4  79  ? -20.794 -41.610 29.792 1.00 93.12  ? 107 ALA D CB    1 
ATOM   2924  N  N     . VAL D 4  80  ? -18.508 -43.481 28.669 1.00 87.86  ? 108 VAL D N     1 
ATOM   2925  C  CA    . VAL D 4  80  ? -17.434 -43.816 27.738 1.00 88.07  ? 108 VAL D CA    1 
ATOM   2926  C  C     . VAL D 4  80  ? -17.728 -45.143 27.051 1.00 96.25  ? 108 VAL D C     1 
ATOM   2927  O  O     . VAL D 4  80  ? -17.414 -45.333 25.869 1.00 101.65 ? 108 VAL D O     1 
ATOM   2928  C  CB    . VAL D 4  80  ? -16.080 -43.836 28.472 1.00 81.80  ? 108 VAL D CB    1 
ATOM   2929  C  CG1   . VAL D 4  80  ? -14.967 -44.305 27.547 1.00 72.98  ? 108 VAL D CG1   1 
ATOM   2930  C  CG2   . VAL D 4  80  ? -15.762 -42.459 29.033 1.00 77.79  ? 108 VAL D CG2   1 
ATOM   2931  N  N     . SER D 4  81  ? -18.347 -46.078 27.776 1.00 94.62  ? 109 SER D N     1 
ATOM   2932  C  CA    . SER D 4  81  ? -18.757 -47.337 27.164 1.00 89.51  ? 109 SER D CA    1 
ATOM   2933  C  C     . SER D 4  81  ? -19.775 -47.101 26.055 1.00 89.68  ? 109 SER D C     1 
ATOM   2934  O  O     . SER D 4  81  ? -19.678 -47.695 24.975 1.00 94.14  ? 109 SER D O     1 
ATOM   2935  C  CB    . SER D 4  81  ? -19.326 -48.275 28.229 1.00 90.74  ? 109 SER D CB    1 
ATOM   2936  O  OG    . SER D 4  81  ? -19.817 -49.471 27.648 1.00 96.91  ? 109 SER D OG    1 
ATOM   2937  N  N     . GLU D 4  82  ? -20.758 -46.232 26.300 1.00 90.34  ? 110 GLU D N     1 
ATOM   2938  C  CA    . GLU D 4  82  ? -21.736 -45.915 25.265 1.00 94.63  ? 110 GLU D CA    1 
ATOM   2939  C  C     . GLU D 4  82  ? -21.105 -45.110 24.137 1.00 96.06  ? 110 GLU D C     1 
ATOM   2940  O  O     . GLU D 4  82  ? -21.434 -45.313 22.962 1.00 98.21  ? 110 GLU D O     1 
ATOM   2941  C  CB    . GLU D 4  82  ? -22.915 -45.152 25.869 1.00 96.30  ? 110 GLU D CB    1 
ATOM   2942  C  CG    . GLU D 4  82  ? -23.686 -45.927 26.922 1.00 100.86 ? 110 GLU D CG    1 
ATOM   2943  C  CD    . GLU D 4  82  ? -24.435 -47.112 26.347 1.00 111.05 ? 110 GLU D CD    1 
ATOM   2944  O  OE1   . GLU D 4  82  ? -24.697 -47.123 25.126 1.00 118.42 ? 110 GLU D OE1   1 
ATOM   2945  O  OE2   . GLU D 4  82  ? -24.760 -48.037 27.118 1.00 114.71 ? 110 GLU D OE2   1 
ATOM   2946  N  N     . GLY D 4  83  ? -20.198 -44.191 24.475 1.00 95.32  ? 111 GLY D N     1 
ATOM   2947  C  CA    . GLY D 4  83  ? -19.565 -43.379 23.448 1.00 93.37  ? 111 GLY D CA    1 
ATOM   2948  C  C     . GLY D 4  83  ? -18.655 -44.188 22.544 1.00 96.44  ? 111 GLY D C     1 
ATOM   2949  O  O     . GLY D 4  83  ? -18.743 -44.102 21.317 1.00 98.42  ? 111 GLY D O     1 
ATOM   2950  N  N     . THR D 4  84  ? -17.769 -44.993 23.140 1.00 96.82  ? 112 THR D N     1 
ATOM   2951  C  CA    . THR D 4  84  ? -16.844 -45.791 22.342 1.00 95.32  ? 112 THR D CA    1 
ATOM   2952  C  C     . THR D 4  84  ? -17.580 -46.816 21.489 1.00 99.98  ? 112 THR D C     1 
ATOM   2953  O  O     . THR D 4  84  ? -17.136 -47.132 20.379 1.00 100.22 ? 112 THR D O     1 
ATOM   2954  C  CB    . THR D 4  84  ? -15.828 -46.489 23.249 1.00 87.88  ? 112 THR D CB    1 
ATOM   2955  O  OG1   . THR D 4  84  ? -15.294 -45.546 24.187 1.00 85.19  ? 112 THR D OG1   1 
ATOM   2956  C  CG2   . THR D 4  84  ? -14.685 -47.068 22.427 1.00 85.53  ? 112 THR D CG2   1 
ATOM   2957  N  N     . LYS D 4  85  ? -18.706 -47.338 21.981 1.00 101.82 ? 113 LYS D N     1 
ATOM   2958  C  CA    . LYS D 4  85  ? -19.470 -48.314 21.210 1.00 101.94 ? 113 LYS D CA    1 
ATOM   2959  C  C     . LYS D 4  85  ? -20.061 -47.684 19.956 1.00 104.53 ? 113 LYS D C     1 
ATOM   2960  O  O     . LYS D 4  85  ? -19.951 -48.241 18.857 1.00 105.74 ? 113 LYS D O     1 
ATOM   2961  C  CB    . LYS D 4  85  ? -20.576 -48.919 22.076 1.00 102.39 ? 113 LYS D CB    1 
ATOM   2962  C  CG    . LYS D 4  85  ? -21.484 -49.880 21.328 1.00 104.10 ? 113 LYS D CG    1 
ATOM   2963  C  CD    . LYS D 4  85  ? -22.651 -50.331 22.189 1.00 105.70 ? 113 LYS D CD    1 
ATOM   2964  C  CE    . LYS D 4  85  ? -23.550 -49.164 22.558 1.00 108.43 ? 113 LYS D CE    1 
ATOM   2965  N  NZ    . LYS D 4  85  ? -24.726 -49.604 23.357 1.00 109.60 ? 113 LYS D NZ    1 
ATOM   2966  N  N     . ALA D 4  86  ? -20.694 -46.517 20.101 1.00 107.22 ? 114 ALA D N     1 
ATOM   2967  C  CA    . ALA D 4  86  ? -21.330 -45.872 18.957 1.00 108.92 ? 114 ALA D CA    1 
ATOM   2968  C  C     . ALA D 4  86  ? -20.313 -45.450 17.904 1.00 114.64 ? 114 ALA D C     1 
ATOM   2969  O  O     . ALA D 4  86  ? -20.614 -45.496 16.706 1.00 117.85 ? 114 ALA D O     1 
ATOM   2970  C  CB    . ALA D 4  86  ? -22.146 -44.665 19.420 1.00 105.64 ? 114 ALA D CB    1 
ATOM   2971  N  N     . VAL D 4  87  ? -19.111 -45.048 18.323 1.00 115.91 ? 115 VAL D N     1 
ATOM   2972  C  CA    . VAL D 4  87  ? -18.106 -44.590 17.367 1.00 116.24 ? 115 VAL D CA    1 
ATOM   2973  C  C     . VAL D 4  87  ? -17.600 -45.754 16.522 1.00 117.00 ? 115 VAL D C     1 
ATOM   2974  O  O     . VAL D 4  87  ? -17.513 -45.656 15.292 1.00 120.24 ? 115 VAL D O     1 
ATOM   2975  C  CB    . VAL D 4  87  ? -16.953 -43.875 18.095 1.00 112.87 ? 115 VAL D CB    1 
ATOM   2976  C  CG1   . VAL D 4  87  ? -15.852 -43.510 17.113 1.00 114.79 ? 115 VAL D CG1   1 
ATOM   2977  C  CG2   . VAL D 4  87  ? -17.465 -42.632 18.798 1.00 109.15 ? 115 VAL D CG2   1 
ATOM   2978  N  N     . THR D 4  88  ? -17.260 -46.874 17.166 1.00 117.82 ? 116 THR D N     1 
ATOM   2979  C  CA    . THR D 4  88  ? -16.782 -48.032 16.417 1.00 119.60 ? 116 THR D CA    1 
ATOM   2980  C  C     . THR D 4  88  ? -17.880 -48.631 15.548 1.00 116.37 ? 116 THR D C     1 
ATOM   2981  O  O     . THR D 4  88  ? -17.593 -49.167 14.471 1.00 120.23 ? 116 THR D O     1 
ATOM   2982  C  CB    . THR D 4  88  ? -16.226 -49.093 17.368 1.00 122.63 ? 116 THR D CB    1 
ATOM   2983  O  OG1   . THR D 4  88  ? -17.269 -49.557 18.235 1.00 124.40 ? 116 THR D OG1   1 
ATOM   2984  C  CG2   . THR D 4  88  ? -15.094 -48.517 18.206 1.00 123.85 ? 116 THR D CG2   1 
ATOM   2985  N  N     . LYS D 4  89  ? -19.136 -48.550 15.992 1.00 109.69 ? 117 LYS D N     1 
ATOM   2986  C  CA    . LYS D 4  89  ? -20.241 -49.025 15.168 1.00 106.78 ? 117 LYS D CA    1 
ATOM   2987  C  C     . LYS D 4  89  ? -20.509 -48.071 14.009 1.00 112.83 ? 117 LYS D C     1 
ATOM   2988  O  O     . LYS D 4  89  ? -20.857 -48.507 12.905 1.00 118.22 ? 117 LYS D O     1 
ATOM   2989  C  CB    . LYS D 4  89  ? -21.492 -49.201 16.027 1.00 101.07 ? 117 LYS D CB    1 
ATOM   2990  C  CG    . LYS D 4  89  ? -22.678 -49.807 15.297 1.00 102.14 ? 117 LYS D CG    1 
ATOM   2991  C  CD    . LYS D 4  89  ? -23.848 -50.018 16.244 1.00 104.61 ? 117 LYS D CD    1 
ATOM   2992  C  CE    . LYS D 4  89  ? -23.441 -50.877 17.432 1.00 107.11 ? 117 LYS D CE    1 
ATOM   2993  N  NZ    . LYS D 4  89  ? -24.553 -51.049 18.408 1.00 109.14 ? 117 LYS D NZ    1 
ATOM   2994  N  N     . TYR D 4  90  ? -20.350 -46.765 14.244 1.00 112.66 ? 118 TYR D N     1 
ATOM   2995  C  CA    . TYR D 4  90  ? -20.507 -45.788 13.172 1.00 111.21 ? 118 TYR D CA    1 
ATOM   2996  C  C     . TYR D 4  90  ? -19.419 -45.934 12.115 1.00 118.24 ? 118 TYR D C     1 
ATOM   2997  O  O     . TYR D 4  90  ? -19.656 -45.638 10.938 1.00 121.55 ? 118 TYR D O     1 
ATOM   2998  C  CB    . TYR D 4  90  ? -20.502 -44.374 13.756 1.00 104.44 ? 118 TYR D CB    1 
ATOM   2999  C  CG    . TYR D 4  90  ? -20.443 -43.265 12.731 1.00 102.64 ? 118 TYR D CG    1 
ATOM   3000  C  CD1   . TYR D 4  90  ? -21.587 -42.846 12.065 1.00 104.57 ? 118 TYR D CD1   1 
ATOM   3001  C  CD2   . TYR D 4  90  ? -19.245 -42.623 12.442 1.00 99.83  ? 118 TYR D CD2   1 
ATOM   3002  C  CE1   . TYR D 4  90  ? -21.538 -41.827 11.132 1.00 104.57 ? 118 TYR D CE1   1 
ATOM   3003  C  CE2   . TYR D 4  90  ? -19.186 -41.605 11.510 1.00 99.30  ? 118 TYR D CE2   1 
ATOM   3004  C  CZ    . TYR D 4  90  ? -20.335 -41.211 10.859 1.00 102.06 ? 118 TYR D CZ    1 
ATOM   3005  O  OH    . TYR D 4  90  ? -20.281 -40.197 9.931  1.00 104.97 ? 118 TYR D OH    1 
ATOM   3006  N  N     . THR D 4  91  ? -18.229 -46.391 12.511 1.00 120.48 ? 119 THR D N     1 
ATOM   3007  C  CA    . THR D 4  91  ? -17.143 -46.575 11.557 1.00 121.75 ? 119 THR D CA    1 
ATOM   3008  C  C     . THR D 4  91  ? -17.302 -47.860 10.752 1.00 124.97 ? 119 THR D C     1 
ATOM   3009  O  O     . THR D 4  91  ? -16.924 -47.900 9.576  1.00 122.85 ? 119 THR D O     1 
ATOM   3010  C  CB    . THR D 4  91  ? -15.797 -46.574 12.288 1.00 117.07 ? 119 THR D CB    1 
ATOM   3011  O  OG1   . THR D 4  91  ? -15.721 -45.433 13.152 1.00 113.13 ? 119 THR D OG1   1 
ATOM   3012  C  CG2   . THR D 4  91  ? -14.645 -46.519 11.294 1.00 117.69 ? 119 THR D CG2   1 
ATOM   3013  N  N     . SER D 4  92  ? -17.863 -48.909 11.359 1.00 129.86 ? 120 SER D N     1 
ATOM   3014  C  CA    . SER D 4  92  ? -18.031 -50.172 10.645 1.00 135.25 ? 120 SER D CA    1 
ATOM   3015  C  C     . SER D 4  92  ? -19.080 -50.053 9.545  1.00 145.19 ? 120 SER D C     1 
ATOM   3016  O  O     . SER D 4  92  ? -18.884 -50.563 8.436  1.00 149.13 ? 120 SER D O     1 
ATOM   3017  C  CB    . SER D 4  92  ? -18.406 -51.283 11.625 1.00 130.99 ? 120 SER D CB    1 
ATOM   3018  O  OG    . SER D 4  92  ? -19.677 -51.045 12.204 1.00 126.78 ? 120 SER D OG    1 
ATOM   3019  N  N     . ALA D 4  93  ? -20.195 -49.389 9.832  1.00 149.99 ? 121 ALA D N     1 
ATOM   3020  C  CA    . ALA D 4  93  ? -21.261 -49.223 8.851  1.00 150.89 ? 121 ALA D CA    1 
ATOM   3021  C  C     . ALA D 4  93  ? -20.891 -48.166 7.815  1.00 149.59 ? 121 ALA D C     1 
ATOM   3022  O  O     . ALA D 4  93  ? -20.840 -46.975 8.120  1.00 148.91 ? 121 ALA D O     1 
ATOM   3023  C  CB    . ALA D 4  93  ? -22.566 -48.856 9.542  1.00 150.59 ? 121 ALA D CB    1 
ATOM   3024  N  N     . HIS E 1  1   ? -59.964 -32.258 69.878 1.00 203.59 ? 39  HIS E N     1 
ATOM   3025  C  CA    . HIS E 1  1   ? -59.275 -31.679 71.025 1.00 202.82 ? 39  HIS E CA    1 
ATOM   3026  C  C     . HIS E 1  1   ? -58.170 -30.723 70.584 1.00 192.94 ? 39  HIS E C     1 
ATOM   3027  O  O     . HIS E 1  1   ? -58.247 -30.120 69.514 1.00 190.63 ? 39  HIS E O     1 
ATOM   3028  C  CB    . HIS E 1  1   ? -58.697 -32.783 71.916 1.00 208.00 ? 39  HIS E CB    1 
ATOM   3029  C  CG    . HIS E 1  1   ? -57.895 -33.806 71.174 1.00 210.59 ? 39  HIS E CG    1 
ATOM   3030  N  ND1   . HIS E 1  1   ? -56.730 -33.498 70.504 1.00 208.51 ? 39  HIS E ND1   1 
ATOM   3031  C  CD2   . HIS E 1  1   ? -58.089 -35.134 70.999 1.00 213.42 ? 39  HIS E CD2   1 
ATOM   3032  C  CE1   . HIS E 1  1   ? -56.242 -34.592 69.947 1.00 207.93 ? 39  HIS E CE1   1 
ATOM   3033  N  NE2   . HIS E 1  1   ? -57.048 -35.599 70.232 1.00 210.93 ? 39  HIS E NE2   1 
ATOM   3034  N  N     . ARG E 1  2   ? -57.141 -30.592 71.417 1.00 181.93 ? 40  ARG E N     1 
ATOM   3035  C  CA    . ARG E 1  2   ? -56.043 -29.665 71.183 1.00 169.08 ? 40  ARG E CA    1 
ATOM   3036  C  C     . ARG E 1  2   ? -54.739 -30.443 71.074 1.00 158.51 ? 40  ARG E C     1 
ATOM   3037  O  O     . ARG E 1  2   ? -54.437 -31.279 71.932 1.00 156.02 ? 40  ARG E O     1 
ATOM   3038  C  CB    . ARG E 1  2   ? -55.957 -28.630 72.308 1.00 165.97 ? 40  ARG E CB    1 
ATOM   3039  C  CG    . ARG E 1  2   ? -54.878 -27.577 72.119 1.00 158.46 ? 40  ARG E CG    1 
ATOM   3040  C  CD    . ARG E 1  2   ? -54.869 -26.598 73.281 1.00 156.33 ? 40  ARG E CD    1 
ATOM   3041  N  NE    . ARG E 1  2   ? -53.856 -25.560 73.122 1.00 152.23 ? 40  ARG E NE    1 
ATOM   3042  C  CZ    . ARG E 1  2   ? -54.072 -24.388 72.532 1.00 151.04 ? 40  ARG E CZ    1 
ATOM   3043  N  NH1   . ARG E 1  2   ? -55.270 -24.102 72.041 1.00 152.12 ? 40  ARG E NH1   1 
ATOM   3044  N  NH2   . ARG E 1  2   ? -53.090 -23.503 72.432 1.00 148.96 ? 40  ARG E NH2   1 
ATOM   3045  N  N     . TYR E 1  3   ? -53.973 -30.167 70.022 1.00 151.30 ? 41  TYR E N     1 
ATOM   3046  C  CA    . TYR E 1  3   ? -52.691 -30.820 69.808 1.00 141.56 ? 41  TYR E CA    1 
ATOM   3047  C  C     . TYR E 1  3   ? -51.579 -30.070 70.530 1.00 139.68 ? 41  TYR E C     1 
ATOM   3048  O  O     . TYR E 1  3   ? -51.609 -28.844 70.661 1.00 140.01 ? 41  TYR E O     1 
ATOM   3049  C  CB    . TYR E 1  3   ? -52.368 -30.914 68.315 1.00 132.72 ? 41  TYR E CB    1 
ATOM   3050  C  CG    . TYR E 1  3   ? -53.221 -31.908 67.559 1.00 130.48 ? 41  TYR E CG    1 
ATOM   3051  C  CD1   . TYR E 1  3   ? -52.913 -33.262 67.566 1.00 128.60 ? 41  TYR E CD1   1 
ATOM   3052  C  CD2   . TYR E 1  3   ? -54.328 -31.492 66.831 1.00 131.82 ? 41  TYR E CD2   1 
ATOM   3053  C  CE1   . TYR E 1  3   ? -53.687 -34.176 66.875 1.00 129.45 ? 41  TYR E CE1   1 
ATOM   3054  C  CE2   . TYR E 1  3   ? -55.108 -32.398 66.137 1.00 132.77 ? 41  TYR E CE2   1 
ATOM   3055  C  CZ    . TYR E 1  3   ? -54.783 -33.738 66.162 1.00 131.65 ? 41  TYR E CZ    1 
ATOM   3056  O  OH    . TYR E 1  3   ? -55.556 -34.643 65.473 1.00 133.33 ? 41  TYR E OH    1 
ATOM   3057  N  N     . ARG E 1  4   ? -50.591 -30.827 70.999 1.00 138.37 ? 42  ARG E N     1 
ATOM   3058  C  CA    . ARG E 1  4   ? -49.456 -30.236 71.687 1.00 137.31 ? 42  ARG E CA    1 
ATOM   3059  C  C     . ARG E 1  4   ? -48.608 -29.425 70.707 1.00 133.73 ? 42  ARG E C     1 
ATOM   3060  O  O     . ARG E 1  4   ? -48.609 -29.697 69.503 1.00 139.71 ? 42  ARG E O     1 
ATOM   3061  C  CB    . ARG E 1  4   ? -48.609 -31.325 72.340 1.00 140.90 ? 42  ARG E CB    1 
ATOM   3062  C  CG    . ARG E 1  4   ? -49.377 -32.194 73.323 1.00 150.03 ? 42  ARG E CG    1 
ATOM   3063  C  CD    . ARG E 1  4   ? -48.518 -33.327 73.857 1.00 154.44 ? 42  ARG E CD    1 
ATOM   3064  N  NE    . ARG E 1  4   ? -47.355 -32.838 74.592 1.00 156.90 ? 42  ARG E NE    1 
ATOM   3065  C  CZ    . ARG E 1  4   ? -46.470 -33.623 75.195 1.00 157.77 ? 42  ARG E CZ    1 
ATOM   3066  N  NH1   . ARG E 1  4   ? -46.613 -34.941 75.154 1.00 159.31 ? 42  ARG E NH1   1 
ATOM   3067  N  NH2   . ARG E 1  4   ? -45.441 -33.093 75.842 1.00 157.10 ? 42  ARG E NH2   1 
ATOM   3068  N  N     . PRO E 1  5   ? -47.885 -28.417 71.194 1.00 127.62 ? 43  PRO E N     1 
ATOM   3069  C  CA    . PRO E 1  5   ? -47.055 -27.605 70.293 1.00 121.40 ? 43  PRO E CA    1 
ATOM   3070  C  C     . PRO E 1  5   ? -45.963 -28.442 69.640 1.00 115.80 ? 43  PRO E C     1 
ATOM   3071  O  O     . PRO E 1  5   ? -45.191 -29.126 70.315 1.00 112.97 ? 43  PRO E O     1 
ATOM   3072  C  CB    . PRO E 1  5   ? -46.473 -26.529 71.218 1.00 119.85 ? 43  PRO E CB    1 
ATOM   3073  C  CG    . PRO E 1  5   ? -46.571 -27.108 72.591 1.00 122.29 ? 43  PRO E CG    1 
ATOM   3074  C  CD    . PRO E 1  5   ? -47.819 -27.935 72.585 1.00 127.84 ? 43  PRO E CD    1 
ATOM   3075  N  N     . GLY E 1  6   ? -45.909 -28.381 68.310 1.00 114.40 ? 44  GLY E N     1 
ATOM   3076  C  CA    . GLY E 1  6   ? -44.968 -29.152 67.530 1.00 112.25 ? 44  GLY E CA    1 
ATOM   3077  C  C     . GLY E 1  6   ? -45.553 -30.380 66.865 1.00 116.59 ? 44  GLY E C     1 
ATOM   3078  O  O     . GLY E 1  6   ? -44.891 -30.969 66.001 1.00 114.08 ? 44  GLY E O     1 
ATOM   3079  N  N     . THR E 1  7   ? -46.771 -30.780 67.237 1.00 123.23 ? 45  THR E N     1 
ATOM   3080  C  CA    . THR E 1  7   ? -47.373 -31.973 66.650 1.00 125.33 ? 45  THR E CA    1 
ATOM   3081  C  C     . THR E 1  7   ? -47.789 -31.725 65.205 1.00 121.81 ? 45  THR E C     1 
ATOM   3082  O  O     . THR E 1  7   ? -47.398 -32.471 64.299 1.00 123.97 ? 45  THR E O     1 
ATOM   3083  C  CB    . THR E 1  7   ? -48.572 -32.423 67.484 1.00 133.63 ? 45  THR E CB    1 
ATOM   3084  O  OG1   . THR E 1  7   ? -48.141 -32.726 68.817 1.00 141.49 ? 45  THR E OG1   1 
ATOM   3085  C  CG2   . THR E 1  7   ? -49.213 -33.658 66.870 1.00 136.81 ? 45  THR E CG2   1 
ATOM   3086  N  N     . VAL E 1  8   ? -48.587 -30.681 64.968 1.00 116.32 ? 46  VAL E N     1 
ATOM   3087  C  CA    . VAL E 1  8   ? -48.982 -30.357 63.602 1.00 115.31 ? 46  VAL E CA    1 
ATOM   3088  C  C     . VAL E 1  8   ? -47.860 -29.656 62.845 1.00 113.54 ? 46  VAL E C     1 
ATOM   3089  O  O     . VAL E 1  8   ? -47.911 -29.577 61.612 1.00 113.14 ? 46  VAL E O     1 
ATOM   3090  C  CB    . VAL E 1  8   ? -50.261 -29.500 63.587 1.00 117.90 ? 46  VAL E CB    1 
ATOM   3091  C  CG1   . VAL E 1  8   ? -49.931 -28.032 63.789 1.00 116.06 ? 46  VAL E CG1   1 
ATOM   3092  C  CG2   . VAL E 1  8   ? -51.032 -29.710 62.289 1.00 120.38 ? 46  VAL E CG2   1 
ATOM   3093  N  N     . ALA E 1  9   ? -46.845 -29.150 63.550 1.00 111.60 ? 47  ALA E N     1 
ATOM   3094  C  CA    . ALA E 1  9   ? -45.685 -28.580 62.872 1.00 104.52 ? 47  ALA E CA    1 
ATOM   3095  C  C     . ALA E 1  9   ? -44.952 -29.646 62.070 1.00 101.08 ? 47  ALA E C     1 
ATOM   3096  O  O     . ALA E 1  9   ? -44.623 -29.442 60.896 1.00 99.61  ? 47  ALA E O     1 
ATOM   3097  C  CB    . ALA E 1  9   ? -44.750 -27.925 63.889 1.00 102.49 ? 47  ALA E CB    1 
ATOM   3098  N  N     . LEU E 1  10  ? -44.689 -30.799 62.692 1.00 100.61 ? 48  LEU E N     1 
ATOM   3099  C  CA    . LEU E 1  10  ? -44.124 -31.925 61.957 1.00 97.96  ? 48  LEU E CA    1 
ATOM   3100  C  C     . LEU E 1  10  ? -45.086 -32.426 60.890 1.00 100.25 ? 48  LEU E C     1 
ATOM   3101  O  O     . LEU E 1  10  ? -44.652 -32.914 59.841 1.00 102.82 ? 48  LEU E O     1 
ATOM   3102  C  CB    . LEU E 1  10  ? -43.768 -33.056 62.921 1.00 96.91  ? 48  LEU E CB    1 
ATOM   3103  C  CG    . LEU E 1  10  ? -42.796 -32.712 64.049 1.00 94.46  ? 48  LEU E CG    1 
ATOM   3104  C  CD1   . LEU E 1  10  ? -42.658 -33.882 65.005 1.00 92.38  ? 48  LEU E CD1   1 
ATOM   3105  C  CD2   . LEU E 1  10  ? -41.441 -32.313 63.486 1.00 93.72  ? 48  LEU E CD2   1 
ATOM   3106  N  N     . ARG E 1  11  ? -46.392 -32.314 61.142 1.00 101.16 ? 49  ARG E N     1 
ATOM   3107  C  CA    . ARG E 1  11  ? -47.380 -32.705 60.143 1.00 105.53 ? 49  ARG E CA    1 
ATOM   3108  C  C     . ARG E 1  11  ? -47.312 -31.800 58.919 1.00 105.42 ? 49  ARG E C     1 
ATOM   3109  O  O     . ARG E 1  11  ? -47.521 -32.256 57.789 1.00 111.21 ? 49  ARG E O     1 
ATOM   3110  C  CB    . ARG E 1  11  ? -48.776 -32.678 60.762 1.00 113.04 ? 49  ARG E CB    1 
ATOM   3111  C  CG    . ARG E 1  11  ? -49.893 -33.145 59.849 1.00 121.01 ? 49  ARG E CG    1 
ATOM   3112  C  CD    . ARG E 1  11  ? -51.236 -32.954 60.531 1.00 129.43 ? 49  ARG E CD    1 
ATOM   3113  N  NE    . ARG E 1  11  ? -51.306 -33.667 61.803 1.00 133.27 ? 49  ARG E NE    1 
ATOM   3114  C  CZ    . ARG E 1  11  ? -52.189 -33.402 62.759 1.00 136.81 ? 49  ARG E CZ    1 
ATOM   3115  N  NH1   . ARG E 1  11  ? -53.075 -32.430 62.594 1.00 139.08 ? 49  ARG E NH1   1 
ATOM   3116  N  NH2   . ARG E 1  11  ? -52.182 -34.103 63.885 1.00 141.54 ? 49  ARG E NH2   1 
ATOM   3117  N  N     . GLU E 1  12  ? -47.018 -30.513 59.125 1.00 99.68  ? 50  GLU E N     1 
ATOM   3118  C  CA    . GLU E 1  12  ? -46.864 -29.602 57.996 1.00 95.00  ? 50  GLU E CA    1 
ATOM   3119  C  C     . GLU E 1  12  ? -45.588 -29.901 57.218 1.00 90.54  ? 50  GLU E C     1 
ATOM   3120  O  O     . GLU E 1  12  ? -45.564 -29.782 55.988 1.00 90.56  ? 50  GLU E O     1 
ATOM   3121  C  CB    . GLU E 1  12  ? -46.871 -28.153 58.482 1.00 95.29  ? 50  GLU E CB    1 
ATOM   3122  C  CG    . GLU E 1  12  ? -48.213 -27.681 59.022 1.00 100.69 ? 50  GLU E CG    1 
ATOM   3123  C  CD    . GLU E 1  12  ? -48.160 -26.265 59.566 1.00 102.33 ? 50  GLU E CD    1 
ATOM   3124  O  OE1   . GLU E 1  12  ? -47.055 -25.683 59.613 1.00 100.02 ? 50  GLU E OE1   1 
ATOM   3125  O  OE2   . GLU E 1  12  ? -49.224 -25.733 59.946 1.00 104.74 ? 50  GLU E OE2   1 
ATOM   3126  N  N     . ILE E 1  13  ? -44.518 -30.287 57.917 1.00 87.97  ? 51  ILE E N     1 
ATOM   3127  C  CA    . ILE E 1  13  ? -43.273 -30.634 57.236 1.00 85.16  ? 51  ILE E CA    1 
ATOM   3128  C  C     . ILE E 1  13  ? -43.495 -31.820 56.306 1.00 92.84  ? 51  ILE E C     1 
ATOM   3129  O  O     . ILE E 1  13  ? -43.070 -31.812 55.145 1.00 96.62  ? 51  ILE E O     1 
ATOM   3130  C  CB    . ILE E 1  13  ? -42.159 -30.922 58.257 1.00 78.05  ? 51  ILE E CB    1 
ATOM   3131  C  CG1   . ILE E 1  13  ? -41.984 -29.743 59.212 1.00 74.02  ? 51  ILE E CG1   1 
ATOM   3132  C  CG2   . ILE E 1  13  ? -40.851 -31.203 57.544 1.00 75.52  ? 51  ILE E CG2   1 
ATOM   3133  C  CD1   . ILE E 1  13  ? -40.973 -29.995 60.306 1.00 69.99  ? 51  ILE E CD1   1 
ATOM   3134  N  N     . ARG E 1  14  ? -44.171 -32.858 56.806 1.00 93.87  ? 52  ARG E N     1 
ATOM   3135  C  CA    A ARG E 1  14  ? -44.478 -34.012 55.968 0.28 92.09  ? 52  ARG E CA    1 
ATOM   3136  C  CA    B ARG E 1  14  ? -44.477 -34.011 55.967 0.72 92.12  ? 52  ARG E CA    1 
ATOM   3137  C  C     . ARG E 1  14  ? -45.442 -33.651 54.845 1.00 91.08  ? 52  ARG E C     1 
ATOM   3138  O  O     . ARG E 1  14  ? -45.428 -34.294 53.789 1.00 92.86  ? 52  ARG E O     1 
ATOM   3139  C  CB    A ARG E 1  14  ? -45.062 -35.141 56.818 0.28 95.35  ? 52  ARG E CB    1 
ATOM   3140  C  CB    B ARG E 1  14  ? -45.055 -35.144 56.816 0.72 95.21  ? 52  ARG E CB    1 
ATOM   3141  C  CG    A ARG E 1  14  ? -44.200 -35.544 58.003 0.28 94.75  ? 52  ARG E CG    1 
ATOM   3142  C  CG    B ARG E 1  14  ? -44.136 -35.625 57.926 0.72 94.67  ? 52  ARG E CG    1 
ATOM   3143  C  CD    A ARG E 1  14  ? -44.861 -36.640 58.826 0.28 99.72  ? 52  ARG E CD    1 
ATOM   3144  C  CD    B ARG E 1  14  ? -44.741 -36.798 58.685 0.72 99.51  ? 52  ARG E CD    1 
ATOM   3145  N  NE    A ARG E 1  14  ? -44.122 -36.921 60.054 0.28 98.36  ? 52  ARG E NE    1 
ATOM   3146  N  NE    B ARG E 1  14  ? -43.851 -37.283 59.737 0.72 96.94  ? 52  ARG E NE    1 
ATOM   3147  C  CZ    A ARG E 1  14  ? -43.127 -37.798 60.145 0.28 98.24  ? 52  ARG E CZ    1 
ATOM   3148  C  CZ    B ARG E 1  14  ? -43.908 -36.891 61.007 0.72 100.27 ? 52  ARG E CZ    1 
ATOM   3149  N  NH1   A ARG E 1  14  ? -42.747 -38.487 59.078 0.28 95.89  ? 52  ARG E NH1   1 
ATOM   3150  N  NH1   B ARG E 1  14  ? -44.817 -36.007 61.392 0.72 99.93  ? 52  ARG E NH1   1 
ATOM   3151  N  NH2   A ARG E 1  14  ? -42.512 -37.987 61.305 0.28 96.55  ? 52  ARG E NH2   1 
ATOM   3152  N  NH2   B ARG E 1  14  ? -43.055 -37.387 61.894 0.72 98.17  ? 52  ARG E NH2   1 
ATOM   3153  N  N     . ARG E 1  15  ? -46.279 -32.632 55.052 1.00 88.17  ? 53  ARG E N     1 
ATOM   3154  C  CA    . ARG E 1  15  ? -47.253 -32.259 54.032 1.00 91.49  ? 53  ARG E CA    1 
ATOM   3155  C  C     . ARG E 1  15  ? -46.598 -31.499 52.884 1.00 92.49  ? 53  ARG E C     1 
ATOM   3156  O  O     . ARG E 1  15  ? -46.866 -31.784 51.712 1.00 95.75  ? 53  ARG E O     1 
ATOM   3157  C  CB    . ARG E 1  15  ? -48.369 -31.430 54.661 1.00 95.38  ? 53  ARG E CB    1 
ATOM   3158  C  CG    . ARG E 1  15  ? -49.222 -30.660 53.667 1.00 100.19 ? 53  ARG E CG    1 
ATOM   3159  C  CD    . ARG E 1  15  ? -50.220 -29.773 54.386 1.00 106.83 ? 53  ARG E CD    1 
ATOM   3160  N  NE    . ARG E 1  15  ? -50.879 -28.836 53.482 1.00 112.74 ? 53  ARG E NE    1 
ATOM   3161  C  CZ    . ARG E 1  15  ? -51.751 -27.912 53.874 1.00 119.98 ? 53  ARG E CZ    1 
ATOM   3162  N  NH1   . ARG E 1  15  ? -52.071 -27.800 55.157 1.00 121.89 ? 53  ARG E NH1   1 
ATOM   3163  N  NH2   . ARG E 1  15  ? -52.302 -27.099 52.985 1.00 122.40 ? 53  ARG E NH2   1 
ATOM   3164  N  N     . TYR E 1  16  ? -45.733 -30.537 53.197 1.00 88.98  ? 54  TYR E N     1 
ATOM   3165  C  CA    . TYR E 1  16  ? -45.098 -29.710 52.178 1.00 84.95  ? 54  TYR E CA    1 
ATOM   3166  C  C     . TYR E 1  16  ? -43.872 -30.357 51.547 1.00 86.45  ? 54  TYR E C     1 
ATOM   3167  O  O     . TYR E 1  16  ? -43.512 -29.992 50.423 1.00 89.54  ? 54  TYR E O     1 
ATOM   3168  C  CB    . TYR E 1  16  ? -44.718 -28.345 52.766 1.00 82.75  ? 54  TYR E CB    1 
ATOM   3169  C  CG    . TYR E 1  16  ? -45.922 -27.515 53.145 1.00 91.28  ? 54  TYR E CG    1 
ATOM   3170  C  CD1   . TYR E 1  16  ? -46.794 -27.047 52.171 1.00 96.22  ? 54  TYR E CD1   1 
ATOM   3171  C  CD2   . TYR E 1  16  ? -46.189 -27.198 54.470 1.00 96.80  ? 54  TYR E CD2   1 
ATOM   3172  C  CE1   . TYR E 1  16  ? -47.898 -26.288 52.505 1.00 101.99 ? 54  TYR E CE1   1 
ATOM   3173  C  CE2   . TYR E 1  16  ? -47.294 -26.438 54.815 1.00 102.73 ? 54  TYR E CE2   1 
ATOM   3174  C  CZ    . TYR E 1  16  ? -48.143 -25.986 53.827 1.00 104.87 ? 54  TYR E CZ    1 
ATOM   3175  O  OH    . TYR E 1  16  ? -49.244 -25.229 54.159 1.00 108.43 ? 54  TYR E OH    1 
ATOM   3176  N  N     . GLN E 1  17  ? -43.218 -31.298 52.233 1.00 86.13  ? 55  GLN E N     1 
ATOM   3177  C  CA    . GLN E 1  17  ? -42.133 -32.030 51.590 1.00 83.32  ? 55  GLN E CA    1 
ATOM   3178  C  C     . GLN E 1  17  ? -42.658 -33.088 50.628 1.00 86.05  ? 55  GLN E C     1 
ATOM   3179  O  O     . GLN E 1  17  ? -41.911 -33.546 49.758 1.00 85.28  ? 55  GLN E O     1 
ATOM   3180  C  CB    . GLN E 1  17  ? -41.228 -32.672 52.640 1.00 79.25  ? 55  GLN E CB    1 
ATOM   3181  C  CG    . GLN E 1  17  ? -40.380 -31.684 53.432 1.00 77.20  ? 55  GLN E CG    1 
ATOM   3182  C  CD    . GLN E 1  17  ? -39.486 -32.373 54.444 1.00 82.78  ? 55  GLN E CD    1 
ATOM   3183  O  OE1   . GLN E 1  17  ? -39.645 -33.561 54.720 1.00 89.90  ? 55  GLN E OE1   1 
ATOM   3184  N  NE2   . GLN E 1  17  ? -38.534 -31.629 54.999 1.00 80.62  ? 55  GLN E NE2   1 
ATOM   3185  N  N     . LYS E 1  18  ? -43.925 -33.477 50.766 1.00 90.77  ? 56  LYS E N     1 
ATOM   3186  C  CA    . LYS E 1  18  ? -44.567 -34.422 49.862 1.00 95.65  ? 56  LYS E CA    1 
ATOM   3187  C  C     . LYS E 1  18  ? -45.107 -33.764 48.599 1.00 96.10  ? 56  LYS E C     1 
ATOM   3188  O  O     . LYS E 1  18  ? -45.248 -34.441 47.574 1.00 96.98  ? 56  LYS E O     1 
ATOM   3189  C  CB    . LYS E 1  18  ? -45.709 -35.144 50.589 1.00 100.93 ? 56  LYS E CB    1 
ATOM   3190  C  CG    . LYS E 1  18  ? -46.295 -36.330 49.840 1.00 103.82 ? 56  LYS E CG    1 
ATOM   3191  C  CD    . LYS E 1  18  ? -47.427 -36.976 50.627 1.00 107.38 ? 56  LYS E CD    1 
ATOM   3192  C  CE    . LYS E 1  18  ? -48.046 -38.133 49.858 1.00 109.85 ? 56  LYS E CE    1 
ATOM   3193  N  NZ    . LYS E 1  18  ? -49.164 -38.750 50.622 1.00 113.21 ? 56  LYS E NZ    1 
ATOM   3194  N  N     . SER E 1  19  ? -45.408 -32.472 48.649 1.00 96.32  ? 57  SER E N     1 
ATOM   3195  C  CA    . SER E 1  19  ? -45.986 -31.751 47.526 1.00 96.78  ? 57  SER E CA    1 
ATOM   3196  C  C     . SER E 1  19  ? -44.929 -30.889 46.843 1.00 95.77  ? 57  SER E C     1 
ATOM   3197  O  O     . SER E 1  19  ? -43.825 -30.683 47.354 1.00 92.65  ? 57  SER E O     1 
ATOM   3198  C  CB    . SER E 1  19  ? -47.160 -30.890 47.997 1.00 99.04  ? 57  SER E CB    1 
ATOM   3199  O  OG    . SER E 1  19  ? -46.731 -29.917 48.935 1.00 100.03 ? 57  SER E OG    1 
ATOM   3200  N  N     . THR E 1  20  ? -45.288 -30.377 45.664 1.00 97.58  ? 58  THR E N     1 
ATOM   3201  C  CA    . THR E 1  20  ? -44.368 -29.594 44.852 1.00 96.57  ? 58  THR E CA    1 
ATOM   3202  C  C     . THR E 1  20  ? -44.905 -28.227 44.450 1.00 102.19 ? 58  THR E C     1 
ATOM   3203  O  O     . THR E 1  20  ? -44.206 -27.498 43.738 1.00 104.02 ? 58  THR E O     1 
ATOM   3204  C  CB    . THR E 1  20  ? -43.987 -30.362 43.576 1.00 91.36  ? 58  THR E CB    1 
ATOM   3205  O  OG1   . THR E 1  20  ? -45.163 -30.602 42.791 1.00 94.19  ? 58  THR E OG1   1 
ATOM   3206  C  CG2   . THR E 1  20  ? -43.338 -31.690 43.923 1.00 85.70  ? 58  THR E CG2   1 
ATOM   3207  N  N     . GLU E 1  21  ? -46.111 -27.858 44.874 1.00 105.76 ? 59  GLU E N     1 
ATOM   3208  C  CA    . GLU E 1  21  ? -46.679 -26.584 44.461 1.00 109.61 ? 59  GLU E CA    1 
ATOM   3209  C  C     . GLU E 1  21  ? -45.918 -25.421 45.091 1.00 104.99 ? 59  GLU E C     1 
ATOM   3210  O  O     . GLU E 1  21  ? -45.170 -25.579 46.060 1.00 105.29 ? 59  GLU E O     1 
ATOM   3211  C  CB    . GLU E 1  21  ? -48.158 -26.498 44.841 1.00 125.04 ? 59  GLU E CB    1 
ATOM   3212  C  CG    . GLU E 1  21  ? -48.415 -26.391 46.335 1.00 135.40 ? 59  GLU E CG    1 
ATOM   3213  C  CD    . GLU E 1  21  ? -48.448 -27.740 47.017 1.00 139.86 ? 59  GLU E CD    1 
ATOM   3214  O  OE1   . GLU E 1  21  ? -48.732 -28.742 46.328 1.00 142.69 ? 59  GLU E OE1   1 
ATOM   3215  O  OE2   . GLU E 1  21  ? -48.189 -27.799 48.237 1.00 141.13 ? 59  GLU E OE2   1 
ATOM   3216  N  N     . LEU E 1  22  ? -46.119 -24.237 44.521 1.00 101.35 ? 60  LEU E N     1 
ATOM   3217  C  CA    . LEU E 1  22  ? -45.498 -23.036 45.056 1.00 95.73  ? 60  LEU E CA    1 
ATOM   3218  C  C     . LEU E 1  22  ? -46.191 -22.609 46.344 1.00 95.22  ? 60  LEU E C     1 
ATOM   3219  O  O     . LEU E 1  22  ? -47.401 -22.778 46.514 1.00 98.74  ? 60  LEU E O     1 
ATOM   3220  C  CB    . LEU E 1  22  ? -45.546 -21.908 44.028 1.00 95.03  ? 60  LEU E CB    1 
ATOM   3221  C  CG    . LEU E 1  22  ? -44.789 -22.195 42.731 1.00 95.18  ? 60  LEU E CG    1 
ATOM   3222  C  CD1   . LEU E 1  22  ? -44.854 -21.002 41.795 1.00 96.90  ? 60  LEU E CD1   1 
ATOM   3223  C  CD2   . LEU E 1  22  ? -43.345 -22.571 43.027 1.00 91.76  ? 60  LEU E CD2   1 
ATOM   3224  N  N     . LEU E 1  23  ? -45.404 -22.047 47.260 1.00 90.64  ? 61  LEU E N     1 
ATOM   3225  C  CA    . LEU E 1  23  ? -45.890 -21.700 48.586 1.00 91.25  ? 61  LEU E CA    1 
ATOM   3226  C  C     . LEU E 1  23  ? -46.074 -20.204 48.801 1.00 91.22  ? 61  LEU E C     1 
ATOM   3227  O  O     . LEU E 1  23  ? -46.708 -19.813 49.787 1.00 93.06  ? 61  LEU E O     1 
ATOM   3228  C  CB    . LEU E 1  23  ? -44.939 -22.260 49.654 1.00 88.02  ? 61  LEU E CB    1 
ATOM   3229  C  CG    . LEU E 1  23  ? -44.696 -23.767 49.537 1.00 83.39  ? 61  LEU E CG    1 
ATOM   3230  C  CD1   . LEU E 1  23  ? -43.697 -24.244 50.576 1.00 83.97  ? 61  LEU E CD1   1 
ATOM   3231  C  CD2   . LEU E 1  23  ? -46.006 -24.530 49.657 1.00 81.17  ? 61  LEU E CD2   1 
ATOM   3232  N  N     . ILE E 1  24  ? -45.546 -19.363 47.916 1.00 103.34 ? 62  ILE E N     1 
ATOM   3233  C  CA    . ILE E 1  24  ? -45.739 -17.919 47.983 1.00 101.95 ? 62  ILE E CA    1 
ATOM   3234  C  C     . ILE E 1  24  ? -46.858 -17.535 47.027 1.00 104.68 ? 62  ILE E C     1 
ATOM   3235  O  O     . ILE E 1  24  ? -46.930 -18.047 45.902 1.00 105.02 ? 62  ILE E O     1 
ATOM   3236  C  CB    . ILE E 1  24  ? -44.438 -17.164 47.645 1.00 95.67  ? 62  ILE E CB    1 
ATOM   3237  C  CG1   . ILE E 1  24  ? -43.329 -17.535 48.630 1.00 91.16  ? 62  ILE E CG1   1 
ATOM   3238  C  CG2   . ILE E 1  24  ? -44.669 -15.658 47.651 1.00 94.40  ? 62  ILE E CG2   1 
ATOM   3239  C  CD1   . ILE E 1  24  ? -42.037 -16.783 48.399 1.00 87.72  ? 62  ILE E CD1   1 
ATOM   3240  N  N     . ARG E 1  25  ? -47.741 -16.645 47.475 1.00 107.99 ? 63  ARG E N     1 
ATOM   3241  C  CA    . ARG E 1  25  ? -48.809 -16.162 46.611 1.00 112.13 ? 63  ARG E CA    1 
ATOM   3242  C  C     . ARG E 1  25  ? -48.220 -15.456 45.396 1.00 111.81 ? 63  ARG E C     1 
ATOM   3243  O  O     . ARG E 1  25  ? -47.258 -14.691 45.505 1.00 114.64 ? 63  ARG E O     1 
ATOM   3244  C  CB    . ARG E 1  25  ? -49.738 -15.227 47.385 1.00 117.59 ? 63  ARG E CB    1 
ATOM   3245  C  CG    . ARG E 1  25  ? -50.489 -15.922 48.506 1.00 123.02 ? 63  ARG E CG    1 
ATOM   3246  C  CD    . ARG E 1  25  ? -51.178 -17.171 47.985 1.00 129.23 ? 63  ARG E CD    1 
ATOM   3247  N  NE    . ARG E 1  25  ? -51.310 -18.198 49.013 1.00 135.79 ? 63  ARG E NE    1 
ATOM   3248  C  CZ    . ARG E 1  25  ? -51.607 -19.469 48.761 1.00 138.56 ? 63  ARG E CZ    1 
ATOM   3249  N  NH1   . ARG E 1  25  ? -51.799 -19.872 47.512 1.00 138.54 ? 63  ARG E NH1   1 
ATOM   3250  N  NH2   . ARG E 1  25  ? -51.706 -20.340 49.756 1.00 139.22 ? 63  ARG E NH2   1 
ATOM   3251  N  N     . LYS E 1  26  ? -48.807 -15.723 44.227 1.00 110.67 ? 64  LYS E N     1 
ATOM   3252  C  CA    . LYS E 1  26  ? -48.182 -15.308 42.975 1.00 112.81 ? 64  LYS E CA    1 
ATOM   3253  C  C     . LYS E 1  26  ? -48.304 -13.806 42.750 1.00 112.69 ? 64  LYS E C     1 
ATOM   3254  O  O     . LYS E 1  26  ? -47.359 -13.169 42.269 1.00 112.41 ? 64  LYS E O     1 
ATOM   3255  C  CB    . LYS E 1  26  ? -48.792 -16.083 41.807 1.00 118.43 ? 64  LYS E CB    1 
ATOM   3256  C  CG    . LYS E 1  26  ? -48.622 -17.590 41.922 1.00 124.69 ? 64  LYS E CG    1 
ATOM   3257  C  CD    . LYS E 1  26  ? -49.094 -18.307 40.669 1.00 129.21 ? 64  LYS E CD    1 
ATOM   3258  C  CE    . LYS E 1  26  ? -48.894 -19.811 40.791 1.00 132.17 ? 64  LYS E CE    1 
ATOM   3259  N  NZ    . LYS E 1  26  ? -49.268 -20.528 39.540 1.00 133.02 ? 64  LYS E NZ    1 
ATOM   3260  N  N     . LEU E 1  27  ? -49.457 -13.217 43.088 1.00 112.13 ? 65  LEU E N     1 
ATOM   3261  C  CA    . LEU E 1  27  ? -49.637 -11.788 42.840 1.00 110.31 ? 65  LEU E CA    1 
ATOM   3262  C  C     . LEU E 1  27  ? -48.774 -10.922 43.754 1.00 107.49 ? 65  LEU E C     1 
ATOM   3263  O  O     . LEU E 1  27  ? -48.128 -9.989  43.248 1.00 109.49 ? 65  LEU E O     1 
ATOM   3264  C  CB    . LEU E 1  27  ? -51.122 -11.422 42.932 1.00 110.52 ? 65  LEU E CB    1 
ATOM   3265  C  CG    . LEU E 1  27  ? -51.865 -11.306 41.598 1.00 106.37 ? 65  LEU E CG    1 
ATOM   3266  C  CD1   . LEU E 1  27  ? -51.829 -12.621 40.831 1.00 104.28 ? 65  LEU E CD1   1 
ATOM   3267  C  CD2   . LEU E 1  27  ? -53.299 -10.847 41.817 1.00 105.95 ? 65  LEU E CD2   1 
ATOM   3268  N  N     . PRO E 1  28  ? -48.718 -11.148 45.074 1.00 103.37 ? 66  PRO E N     1 
ATOM   3269  C  CA    . PRO E 1  28  ? -47.768 -10.368 45.887 1.00 102.44 ? 66  PRO E CA    1 
ATOM   3270  C  C     . PRO E 1  28  ? -46.323 -10.574 45.476 1.00 104.07 ? 66  PRO E C     1 
ATOM   3271  O  O     . PRO E 1  28  ? -45.512 -9.648  45.606 1.00 107.22 ? 66  PRO E O     1 
ATOM   3272  C  CB    . PRO E 1  28  ? -48.026 -10.875 47.313 1.00 102.22 ? 66  PRO E CB    1 
ATOM   3273  C  CG    . PRO E 1  28  ? -49.411 -11.396 47.282 1.00 103.80 ? 66  PRO E CG    1 
ATOM   3274  C  CD    . PRO E 1  28  ? -49.580 -11.992 45.919 1.00 103.62 ? 66  PRO E CD    1 
ATOM   3275  N  N     . PHE E 1  29  ? -45.976 -11.764 44.982 1.00 102.27 ? 67  PHE E N     1 
ATOM   3276  C  CA    . PHE E 1  29  ? -44.620 -11.993 44.495 1.00 97.72  ? 67  PHE E CA    1 
ATOM   3277  C  C     . PHE E 1  29  ? -44.383 -11.271 43.175 1.00 94.24  ? 67  PHE E C     1 
ATOM   3278  O  O     . PHE E 1  29  ? -43.288 -10.750 42.933 1.00 90.34  ? 67  PHE E O     1 
ATOM   3279  C  CB    . PHE E 1  29  ? -44.363 -13.492 44.343 1.00 95.13  ? 67  PHE E CB    1 
ATOM   3280  C  CG    . PHE E 1  29  ? -42.977 -13.825 43.872 1.00 93.25  ? 67  PHE E CG    1 
ATOM   3281  C  CD1   . PHE E 1  29  ? -41.938 -13.960 44.778 1.00 95.71  ? 67  PHE E CD1   1 
ATOM   3282  C  CD2   . PHE E 1  29  ? -42.711 -14.005 42.524 1.00 90.06  ? 67  PHE E CD2   1 
ATOM   3283  C  CE1   . PHE E 1  29  ? -40.661 -14.266 44.349 1.00 95.65  ? 67  PHE E CE1   1 
ATOM   3284  C  CE2   . PHE E 1  29  ? -41.437 -14.309 42.089 1.00 89.35  ? 67  PHE E CE2   1 
ATOM   3285  C  CZ    . PHE E 1  29  ? -40.410 -14.441 43.003 1.00 92.79  ? 67  PHE E CZ    1 
ATOM   3286  N  N     . GLN E 1  30  ? -45.398 -11.231 42.308 1.00 95.27  ? 68  GLN E N     1 
ATOM   3287  C  CA    . GLN E 1  30  ? -45.245 -10.557 41.023 1.00 98.77  ? 68  GLN E CA    1 
ATOM   3288  C  C     . GLN E 1  30  ? -45.078 -9.053  41.206 1.00 100.42 ? 68  GLN E C     1 
ATOM   3289  O  O     . GLN E 1  30  ? -44.295 -8.419  40.489 1.00 101.32 ? 68  GLN E O     1 
ATOM   3290  C  CB    . GLN E 1  30  ? -46.442 -10.866 40.125 1.00 102.31 ? 68  GLN E CB    1 
ATOM   3291  C  CG    . GLN E 1  30  ? -46.345 -10.273 38.729 1.00 104.86 ? 68  GLN E CG    1 
ATOM   3292  C  CD    . GLN E 1  30  ? -47.494 -10.700 37.838 1.00 107.67 ? 68  GLN E CD    1 
ATOM   3293  O  OE1   . GLN E 1  30  ? -47.711 -10.130 36.769 1.00 110.46 ? 68  GLN E OE1   1 
ATOM   3294  N  NE2   . GLN E 1  30  ? -48.236 -11.711 38.274 1.00 109.07 ? 68  GLN E NE2   1 
ATOM   3295  N  N     . ARG E 1  31  ? -45.802 -8.465  42.162 1.00 98.74  ? 69  ARG E N     1 
ATOM   3296  C  CA    . ARG E 1  31  ? -45.629 -7.044  42.442 1.00 96.88  ? 69  ARG E CA    1 
ATOM   3297  C  C     . ARG E 1  31  ? -44.260 -6.756  43.044 1.00 93.40  ? 69  ARG E C     1 
ATOM   3298  O  O     . ARG E 1  31  ? -43.702 -5.675  42.821 1.00 94.45  ? 69  ARG E O     1 
ATOM   3299  C  CB    . ARG E 1  31  ? -46.735 -6.546  43.373 1.00 101.63 ? 69  ARG E CB    1 
ATOM   3300  C  CG    . ARG E 1  31  ? -48.129 -6.597  42.767 1.00 106.10 ? 69  ARG E CG    1 
ATOM   3301  C  CD    . ARG E 1  31  ? -49.131 -5.840  43.626 1.00 109.50 ? 69  ARG E CD    1 
ATOM   3302  N  NE    . ARG E 1  31  ? -49.203 -6.370  44.985 1.00 111.34 ? 69  ARG E NE    1 
ATOM   3303  C  CZ    . ARG E 1  31  ? -50.074 -7.291  45.383 1.00 112.80 ? 69  ARG E CZ    1 
ATOM   3304  N  NH1   . ARG E 1  31  ? -50.955 -7.789  44.525 1.00 114.06 ? 69  ARG E NH1   1 
ATOM   3305  N  NH2   . ARG E 1  31  ? -50.066 -7.714  46.640 1.00 113.18 ? 69  ARG E NH2   1 
ATOM   3306  N  N     . LEU E 1  32  ? -43.705 -7.702  43.806 1.00 91.64  ? 70  LEU E N     1 
ATOM   3307  C  CA    . LEU E 1  32  ? -42.356 -7.525  44.332 1.00 89.98  ? 70  LEU E CA    1 
ATOM   3308  C  C     . LEU E 1  32  ? -41.314 -7.586  43.222 1.00 94.66  ? 70  LEU E C     1 
ATOM   3309  O  O     . LEU E 1  32  ? -40.304 -6.876  43.283 1.00 97.23  ? 70  LEU E O     1 
ATOM   3310  C  CB    . LEU E 1  32  ? -42.065 -8.582  45.399 1.00 83.03  ? 70  LEU E CB    1 
ATOM   3311  C  CG    . LEU E 1  32  ? -40.668 -8.565  46.024 1.00 77.75  ? 70  LEU E CG    1 
ATOM   3312  C  CD1   . LEU E 1  32  ? -40.380 -7.215  46.663 1.00 78.50  ? 70  LEU E CD1   1 
ATOM   3313  C  CD2   . LEU E 1  32  ? -40.518 -9.687  47.041 1.00 75.28  ? 70  LEU E CD2   1 
ATOM   3314  N  N     . VAL E 1  33  ? -41.544 -8.417  42.203 1.00 96.39  ? 71  VAL E N     1 
ATOM   3315  C  CA    . VAL E 1  33  ? -40.601 -8.512  41.093 1.00 94.61  ? 71  VAL E CA    1 
ATOM   3316  C  C     . VAL E 1  33  ? -40.609 -7.229  40.272 1.00 95.70  ? 71  VAL E C     1 
ATOM   3317  O  O     . VAL E 1  33  ? -39.550 -6.704  39.906 1.00 94.18  ? 71  VAL E O     1 
ATOM   3318  C  CB    . VAL E 1  33  ? -40.923 -9.743  40.226 1.00 90.90  ? 71  VAL E CB    1 
ATOM   3319  C  CG1   . VAL E 1  33  ? -40.132 -9.703  38.929 1.00 87.39  ? 71  VAL E CG1   1 
ATOM   3320  C  CG2   . VAL E 1  33  ? -40.625 -11.020 40.994 1.00 90.63  ? 71  VAL E CG2   1 
ATOM   3321  N  N     . ARG E 1  34  ? -41.797 -6.699  39.975 1.00 99.02  ? 72  ARG E N     1 
ATOM   3322  C  CA    . ARG E 1  34  ? -41.884 -5.481  39.176 1.00 100.31 ? 72  ARG E CA    1 
ATOM   3323  C  C     . ARG E 1  34  ? -41.374 -4.267  39.941 1.00 101.20 ? 72  ARG E C     1 
ATOM   3324  O  O     . ARG E 1  34  ? -40.905 -3.302  39.325 1.00 103.05 ? 72  ARG E O     1 
ATOM   3325  C  CB    . ARG E 1  34  ? -43.324 -5.258  38.718 1.00 100.66 ? 72  ARG E CB    1 
ATOM   3326  C  CG    . ARG E 1  34  ? -43.886 -6.409  37.904 1.00 100.44 ? 72  ARG E CG    1 
ATOM   3327  C  CD    . ARG E 1  34  ? -45.328 -6.159  37.503 1.00 102.79 ? 72  ARG E CD    1 
ATOM   3328  N  NE    . ARG E 1  34  ? -45.859 -7.255  36.700 1.00 103.80 ? 72  ARG E NE    1 
ATOM   3329  C  CZ    . ARG E 1  34  ? -45.728 -7.344  35.381 1.00 105.98 ? 72  ARG E CZ    1 
ATOM   3330  N  NH1   . ARG E 1  34  ? -45.082 -6.398  34.712 1.00 105.71 ? 72  ARG E NH1   1 
ATOM   3331  N  NH2   . ARG E 1  34  ? -46.242 -8.378  34.730 1.00 108.56 ? 72  ARG E NH2   1 
ATOM   3332  N  N     . GLU E 1  35  ? -41.454 -4.292  41.273 1.00 99.68  ? 73  GLU E N     1 
ATOM   3333  C  CA    . GLU E 1  35  ? -40.919 -3.188  42.063 1.00 100.53 ? 73  GLU E CA    1 
ATOM   3334  C  C     . GLU E 1  35  ? -39.397 -3.159  42.004 1.00 96.14  ? 73  GLU E C     1 
ATOM   3335  O  O     . GLU E 1  35  ? -38.796 -2.091  41.839 1.00 98.33  ? 73  GLU E O     1 
ATOM   3336  C  CB    . GLU E 1  35  ? -41.395 -3.298  43.512 1.00 106.21 ? 73  GLU E CB    1 
ATOM   3337  C  CG    . GLU E 1  35  ? -40.948 -2.149  44.402 1.00 111.12 ? 73  GLU E CG    1 
ATOM   3338  C  CD    . GLU E 1  35  ? -41.244 -2.396  45.868 1.00 115.52 ? 73  GLU E CD    1 
ATOM   3339  O  OE1   . GLU E 1  35  ? -41.386 -3.576  46.255 1.00 117.33 ? 73  GLU E OE1   1 
ATOM   3340  O  OE2   . GLU E 1  35  ? -41.336 -1.413  46.633 1.00 117.16 ? 73  GLU E OE2   1 
ATOM   3341  N  N     . ILE E 1  36  ? -38.759 -4.323  42.132 1.00 92.94  ? 74  ILE E N     1 
ATOM   3342  C  CA    . ILE E 1  36  ? -37.301 -4.383  42.097 1.00 89.75  ? 74  ILE E CA    1 
ATOM   3343  C  C     . ILE E 1  36  ? -36.787 -4.098  40.691 1.00 95.46  ? 74  ILE E C     1 
ATOM   3344  O  O     . ILE E 1  36  ? -35.752 -3.444  40.514 1.00 96.54  ? 74  ILE E O     1 
ATOM   3345  C  CB    . ILE E 1  36  ? -36.819 -5.749  42.618 1.00 79.68  ? 74  ILE E CB    1 
ATOM   3346  C  CG1   . ILE E 1  36  ? -37.293 -5.959  44.057 1.00 78.34  ? 74  ILE E CG1   1 
ATOM   3347  C  CG2   . ILE E 1  36  ? -35.305 -5.856  42.532 1.00 76.14  ? 74  ILE E CG2   1 
ATOM   3348  C  CD1   . ILE E 1  36  ? -36.900 -7.292  44.646 1.00 78.21  ? 74  ILE E CD1   1 
ATOM   3349  N  N     . ALA E 1  37  ? -37.505 -4.572  39.669 1.00 98.38  ? 75  ALA E N     1 
ATOM   3350  C  CA    . ALA E 1  37  ? -37.085 -4.326  38.294 1.00 98.37  ? 75  ALA E CA    1 
ATOM   3351  C  C     . ALA E 1  37  ? -37.239 -2.860  37.912 1.00 107.73 ? 75  ALA E C     1 
ATOM   3352  O  O     . ALA E 1  37  ? -36.500 -2.365  37.053 1.00 111.87 ? 75  ALA E O     1 
ATOM   3353  C  CB    . ALA E 1  37  ? -37.881 -5.207  37.334 1.00 93.96  ? 75  ALA E CB    1 
ATOM   3354  N  N     . GLN E 1  38  ? -38.187 -2.154  38.533 1.00 113.43 ? 76  GLN E N     1 
ATOM   3355  C  CA    . GLN E 1  38  ? -38.373 -0.738  38.234 1.00 120.44 ? 76  GLN E CA    1 
ATOM   3356  C  C     . GLN E 1  38  ? -37.160 0.085   38.648 1.00 123.43 ? 76  GLN E C     1 
ATOM   3357  O  O     . GLN E 1  38  ? -36.916 1.156   38.080 1.00 127.94 ? 76  GLN E O     1 
ATOM   3358  C  CB    . GLN E 1  38  ? -39.634 -0.219  38.928 1.00 124.69 ? 76  GLN E CB    1 
ATOM   3359  C  CG    . GLN E 1  38  ? -40.104 1.145   38.448 1.00 129.92 ? 76  GLN E CG    1 
ATOM   3360  C  CD    . GLN E 1  38  ? -40.665 1.108   37.039 1.00 133.97 ? 76  GLN E CD    1 
ATOM   3361  O  OE1   . GLN E 1  38  ? -41.033 0.048   36.531 1.00 136.76 ? 76  GLN E OE1   1 
ATOM   3362  N  NE2   . GLN E 1  38  ? -40.731 2.269   36.398 1.00 135.22 ? 76  GLN E NE2   1 
ATOM   3363  N  N     . ASP E 1  39  ? -36.387 -0.399  39.620 1.00 115.51 ? 77  ASP E N     1 
ATOM   3364  C  CA    . ASP E 1  39  ? -35.202 0.311   40.084 1.00 113.22 ? 77  ASP E CA    1 
ATOM   3365  C  C     . ASP E 1  39  ? -33.997 0.125   39.170 1.00 104.16 ? 77  ASP E C     1 
ATOM   3366  O  O     . ASP E 1  39  ? -32.993 0.822   39.353 1.00 102.33 ? 77  ASP E O     1 
ATOM   3367  C  CB    . ASP E 1  39  ? -34.843 -0.138  41.503 1.00 119.38 ? 77  ASP E CB    1 
ATOM   3368  C  CG    . ASP E 1  39  ? -35.960 0.119   42.498 1.00 124.11 ? 77  ASP E CG    1 
ATOM   3369  O  OD1   . ASP E 1  39  ? -36.748 1.063   42.279 1.00 124.87 ? 77  ASP E OD1   1 
ATOM   3370  O  OD2   . ASP E 1  39  ? -36.049 -0.623  43.500 1.00 126.72 ? 77  ASP E OD2   1 
ATOM   3371  N  N     . PHE E 1  40  ? -34.064 -0.789  38.205 1.00 100.05 ? 78  PHE E N     1 
ATOM   3372  C  CA    . PHE E 1  40  ? -32.979 -1.003  37.252 1.00 97.72  ? 78  PHE E CA    1 
ATOM   3373  C  C     . PHE E 1  40  ? -33.281 -0.456  35.866 1.00 98.56  ? 78  PHE E C     1 
ATOM   3374  O  O     . PHE E 1  40  ? -32.378 0.059   35.203 1.00 97.61  ? 78  PHE E O     1 
ATOM   3375  C  CB    . PHE E 1  40  ? -32.648 -2.497  37.148 1.00 95.40  ? 78  PHE E CB    1 
ATOM   3376  C  CG    . PHE E 1  40  ? -32.097 -3.086  38.417 1.00 92.12  ? 78  PHE E CG    1 
ATOM   3377  C  CD1   . PHE E 1  40  ? -30.812 -2.782  38.836 1.00 91.69  ? 78  PHE E CD1   1 
ATOM   3378  C  CD2   . PHE E 1  40  ? -32.862 -3.947  39.188 1.00 90.58  ? 78  PHE E CD2   1 
ATOM   3379  C  CE1   . PHE E 1  40  ? -30.301 -3.321  40.002 1.00 90.07  ? 78  PHE E CE1   1 
ATOM   3380  C  CE2   . PHE E 1  40  ? -32.356 -4.491  40.355 1.00 89.78  ? 78  PHE E CE2   1 
ATOM   3381  C  CZ    . PHE E 1  40  ? -31.073 -4.177  40.762 1.00 89.22  ? 78  PHE E CZ    1 
ATOM   3382  N  N     . LYS E 1  41  ? -34.527 -0.562  35.409 1.00 102.98 ? 79  LYS E N     1 
ATOM   3383  C  CA    . LYS E 1  41  ? -34.950 0.069   34.168 1.00 108.43 ? 79  LYS E CA    1 
ATOM   3384  C  C     . LYS E 1  41  ? -36.455 0.282   34.226 1.00 113.12 ? 79  LYS E C     1 
ATOM   3385  O  O     . LYS E 1  41  ? -37.192 -0.589  34.695 1.00 110.83 ? 79  LYS E O     1 
ATOM   3386  C  CB    . LYS E 1  41  ? -34.580 -0.769  32.938 1.00 107.39 ? 79  LYS E CB    1 
ATOM   3387  C  CG    . LYS E 1  41  ? -34.872 -0.064  31.619 1.00 108.95 ? 79  LYS E CG    1 
ATOM   3388  C  CD    . LYS E 1  41  ? -34.578 -0.950  30.421 1.00 109.47 ? 79  LYS E CD    1 
ATOM   3389  C  CE    . LYS E 1  41  ? -34.780 -0.190  29.118 1.00 110.81 ? 79  LYS E CE    1 
ATOM   3390  N  NZ    . LYS E 1  41  ? -34.447 -1.019  27.926 1.00 109.78 ? 79  LYS E NZ    1 
ATOM   3391  N  N     . THR E 1  42  ? -36.899 1.440   33.750 1.00 121.30 ? 80  THR E N     1 
ATOM   3392  C  CA    . THR E 1  42  ? -38.308 1.795   33.779 1.00 126.91 ? 80  THR E CA    1 
ATOM   3393  C  C     . THR E 1  42  ? -39.014 1.314   32.514 1.00 125.66 ? 80  THR E C     1 
ATOM   3394  O  O     . THR E 1  42  ? -38.388 1.040   31.487 1.00 125.14 ? 80  THR E O     1 
ATOM   3395  C  CB    . THR E 1  42  ? -38.478 3.308   33.930 1.00 136.33 ? 80  THR E CB    1 
ATOM   3396  O  OG1   . THR E 1  42  ? -39.872 3.633   33.956 1.00 147.80 ? 80  THR E OG1   1 
ATOM   3397  C  CG2   . THR E 1  42  ? -37.810 4.037   32.773 1.00 139.29 ? 80  THR E CG2   1 
ATOM   3398  N  N     . ASP E 1  43  ? -40.342 1.212   32.610 1.00 124.45 ? 81  ASP E N     1 
ATOM   3399  C  CA    . ASP E 1  43  ? -41.201 0.781   31.507 1.00 125.40 ? 81  ASP E CA    1 
ATOM   3400  C  C     . ASP E 1  43  ? -40.783 -0.601  30.999 1.00 120.59 ? 81  ASP E C     1 
ATOM   3401  O  O     . ASP E 1  43  ? -40.437 -0.792  29.831 1.00 119.38 ? 81  ASP E O     1 
ATOM   3402  C  CB    . ASP E 1  43  ? -41.199 1.817   30.375 1.00 131.33 ? 81  ASP E CB    1 
ATOM   3403  C  CG    . ASP E 1  43  ? -42.412 1.696   29.466 1.00 134.10 ? 81  ASP E CG    1 
ATOM   3404  O  OD1   . ASP E 1  43  ? -42.965 0.583   29.341 1.00 139.55 ? 81  ASP E OD1   1 
ATOM   3405  O  OD2   . ASP E 1  43  ? -42.814 2.721   28.874 1.00 132.16 ? 81  ASP E OD2   1 
ATOM   3406  N  N     . LEU E 1  44  ? -40.824 -1.570  31.909 1.00 118.77 ? 82  LEU E N     1 
ATOM   3407  C  CA    . LEU E 1  44  ? -40.469 -2.948  31.609 1.00 114.88 ? 82  LEU E CA    1 
ATOM   3408  C  C     . LEU E 1  44  ? -41.698 -3.843  31.682 1.00 115.89 ? 82  LEU E C     1 
ATOM   3409  O  O     . LEU E 1  44  ? -42.593 -3.637  32.508 1.00 117.78 ? 82  LEU E O     1 
ATOM   3410  C  CB    . LEU E 1  44  ? -39.399 -3.471  32.573 1.00 109.22 ? 82  LEU E CB    1 
ATOM   3411  C  CG    . LEU E 1  44  ? -37.950 -3.078  32.287 1.00 105.77 ? 82  LEU E CG    1 
ATOM   3412  C  CD1   . LEU E 1  44  ? -37.027 -3.675  33.337 1.00 103.81 ? 82  LEU E CD1   1 
ATOM   3413  C  CD2   . LEU E 1  44  ? -37.539 -3.525  30.893 1.00 102.43 ? 82  LEU E CD2   1 
ATOM   3414  N  N     . ARG E 1  45  ? -41.729 -4.841  30.807 1.00 117.07 ? 83  ARG E N     1 
ATOM   3415  C  CA    . ARG E 1  45  ? -42.774 -5.850  30.796 1.00 120.27 ? 83  ARG E CA    1 
ATOM   3416  C  C     . ARG E 1  45  ? -42.171 -7.211  31.117 1.00 114.87 ? 83  ARG E C     1 
ATOM   3417  O  O     . ARG E 1  45  ? -40.973 -7.444  30.933 1.00 119.31 ? 83  ARG E O     1 
ATOM   3418  C  CB    . ARG E 1  45  ? -43.500 -5.889  29.444 1.00 129.10 ? 83  ARG E CB    1 
ATOM   3419  C  CG    . ARG E 1  45  ? -44.389 -4.680  29.198 1.00 140.96 ? 83  ARG E CG    1 
ATOM   3420  C  CD    . ARG E 1  45  ? -44.939 -4.660  27.781 1.00 149.66 ? 83  ARG E CD    1 
ATOM   3421  N  NE    . ARG E 1  45  ? -45.853 -3.540  27.573 1.00 159.00 ? 83  ARG E NE    1 
ATOM   3422  C  CZ    . ARG E 1  45  ? -45.466 -2.299  27.295 1.00 166.78 ? 83  ARG E CZ    1 
ATOM   3423  N  NH1   . ARG E 1  45  ? -44.175 -2.012  27.192 1.00 167.11 ? 83  ARG E NH1   1 
ATOM   3424  N  NH2   . ARG E 1  45  ? -46.368 -1.343  27.122 1.00 173.61 ? 83  ARG E NH2   1 
ATOM   3425  N  N     . PHE E 1  46  ? -43.018 -8.111  31.608 1.00 107.88 ? 84  PHE E N     1 
ATOM   3426  C  CA    . PHE E 1  46  ? -42.588 -9.434  32.038 1.00 98.81  ? 84  PHE E CA    1 
ATOM   3427  C  C     . PHE E 1  46  ? -43.464 -10.495 31.394 1.00 93.55  ? 84  PHE E C     1 
ATOM   3428  O  O     . PHE E 1  46  ? -44.695 -10.388 31.418 1.00 91.45  ? 84  PHE E O     1 
ATOM   3429  C  CB    . PHE E 1  46  ? -42.646 -9.567  33.562 1.00 96.40  ? 84  PHE E CB    1 
ATOM   3430  C  CG    . PHE E 1  46  ? -41.456 -8.988  34.266 1.00 93.61  ? 84  PHE E CG    1 
ATOM   3431  C  CD1   . PHE E 1  46  ? -41.377 -7.630  34.520 1.00 94.57  ? 84  PHE E CD1   1 
ATOM   3432  C  CD2   . PHE E 1  46  ? -40.417 -9.805  34.678 1.00 88.24  ? 84  PHE E CD2   1 
ATOM   3433  C  CE1   . PHE E 1  46  ? -40.281 -7.097  35.169 1.00 94.03  ? 84  PHE E CE1   1 
ATOM   3434  C  CE2   . PHE E 1  46  ? -39.319 -9.279  35.328 1.00 85.80  ? 84  PHE E CE2   1 
ATOM   3435  C  CZ    . PHE E 1  46  ? -39.251 -7.925  35.573 1.00 89.73  ? 84  PHE E CZ    1 
ATOM   3436  N  N     . GLN E 1  47  ? -42.829 -11.514 30.824 1.00 92.72  ? 85  GLN E N     1 
ATOM   3437  C  CA    . GLN E 1  47  ? -43.566 -12.670 30.341 1.00 94.41  ? 85  GLN E CA    1 
ATOM   3438  C  C     . GLN E 1  47  ? -44.127 -13.461 31.516 1.00 100.81 ? 85  GLN E C     1 
ATOM   3439  O  O     . GLN E 1  47  ? -43.595 -13.424 32.629 1.00 101.85 ? 85  GLN E O     1 
ATOM   3440  C  CB    . GLN E 1  47  ? -42.664 -13.564 29.490 1.00 90.40  ? 85  GLN E CB    1 
ATOM   3441  C  CG    . GLN E 1  47  ? -42.153 -12.906 28.220 1.00 89.76  ? 85  GLN E CG    1 
ATOM   3442  C  CD    . GLN E 1  47  ? -41.339 -13.853 27.363 1.00 88.43  ? 85  GLN E CD    1 
ATOM   3443  O  OE1   . GLN E 1  47  ? -40.983 -14.950 27.796 1.00 89.82  ? 85  GLN E OE1   1 
ATOM   3444  N  NE2   . GLN E 1  47  ? -41.041 -13.435 26.137 1.00 86.78  ? 85  GLN E NE2   1 
ATOM   3445  N  N     . SER E 1  48  ? -45.225 -14.176 31.260 1.00 107.54 ? 86  SER E N     1 
ATOM   3446  C  CA    . SER E 1  48  ? -45.807 -15.021 32.298 1.00 111.57 ? 86  SER E CA    1 
ATOM   3447  C  C     . SER E 1  48  ? -44.815 -16.082 32.757 1.00 107.84 ? 86  SER E C     1 
ATOM   3448  O  O     . SER E 1  48  ? -44.683 -16.341 33.959 1.00 105.83 ? 86  SER E O     1 
ATOM   3449  C  CB    . SER E 1  48  ? -47.093 -15.670 31.787 1.00 120.93 ? 86  SER E CB    1 
ATOM   3450  O  OG    . SER E 1  48  ? -46.843 -16.468 30.643 1.00 126.98 ? 86  SER E OG    1 
ATOM   3451  N  N     . SER E 1  49  ? -44.097 -16.695 31.814 1.00 106.84 ? 87  SER E N     1 
ATOM   3452  C  CA    . SER E 1  49  ? -43.080 -17.678 32.168 1.00 103.00 ? 87  SER E CA    1 
ATOM   3453  C  C     . SER E 1  49  ? -41.872 -17.043 32.843 1.00 97.79  ? 87  SER E C     1 
ATOM   3454  O  O     . SER E 1  49  ? -41.157 -17.732 33.578 1.00 100.80 ? 87  SER E O     1 
ATOM   3455  C  CB    . SER E 1  49  ? -42.638 -18.445 30.920 1.00 104.24 ? 87  SER E CB    1 
ATOM   3456  O  OG    . SER E 1  49  ? -42.168 -17.560 29.918 1.00 106.68 ? 87  SER E OG    1 
ATOM   3457  N  N     . ALA E 1  50  ? -41.629 -15.750 32.615 1.00 94.27  ? 88  ALA E N     1 
ATOM   3458  C  CA    . ALA E 1  50  ? -40.482 -15.096 33.236 1.00 93.39  ? 88  ALA E CA    1 
ATOM   3459  C  C     . ALA E 1  50  ? -40.702 -14.893 34.730 1.00 96.77  ? 88  ALA E C     1 
ATOM   3460  O  O     . ALA E 1  50  ? -39.776 -15.077 35.529 1.00 101.37 ? 88  ALA E O     1 
ATOM   3461  C  CB    . ALA E 1  50  ? -40.201 -13.761 32.549 1.00 93.52  ? 88  ALA E CB    1 
ATOM   3462  N  N     . VAL E 1  51  ? -41.918 -14.513 35.126 1.00 94.95  ? 89  VAL E N     1 
ATOM   3463  C  CA    . VAL E 1  51  ? -42.210 -14.332 36.545 1.00 91.35  ? 89  VAL E CA    1 
ATOM   3464  C  C     . VAL E 1  51  ? -42.247 -15.678 37.258 1.00 91.99  ? 89  VAL E C     1 
ATOM   3465  O  O     . VAL E 1  51  ? -41.770 -15.809 38.392 1.00 93.15  ? 89  VAL E O     1 
ATOM   3466  C  CB    . VAL E 1  51  ? -43.529 -13.558 36.724 1.00 88.64  ? 89  VAL E CB    1 
ATOM   3467  C  CG1   . VAL E 1  51  ? -43.774 -13.254 38.195 1.00 87.10  ? 89  VAL E CG1   1 
ATOM   3468  C  CG2   . VAL E 1  51  ? -43.508 -12.277 35.906 1.00 89.32  ? 89  VAL E CG2   1 
ATOM   3469  N  N     . MET E 1  52  ? -42.807 -16.700 36.606 1.00 91.58  ? 90  MET E N     1 
ATOM   3470  C  CA    . MET E 1  52  ? -42.845 -18.027 37.212 1.00 92.36  ? 90  MET E CA    1 
ATOM   3471  C  C     . MET E 1  52  ? -41.453 -18.633 37.323 1.00 88.45  ? 90  MET E C     1 
ATOM   3472  O  O     . MET E 1  52  ? -41.197 -19.432 38.231 1.00 87.73  ? 90  MET E O     1 
ATOM   3473  C  CB    . MET E 1  52  ? -43.764 -18.947 36.410 1.00 97.30  ? 90  MET E CB    1 
ATOM   3474  C  CG    . MET E 1  52  ? -45.182 -18.422 36.263 1.00 105.78 ? 90  MET E CG    1 
ATOM   3475  S  SD    . MET E 1  52  ? -45.927 -17.997 37.848 1.00 112.41 ? 90  MET E SD    1 
ATOM   3476  C  CE    . MET E 1  52  ? -45.934 -19.601 38.643 1.00 112.71 ? 90  MET E CE    1 
ATOM   3477  N  N     . ALA E 1  53  ? -40.544 -18.271 36.414 1.00 86.34  ? 91  ALA E N     1 
ATOM   3478  C  CA    . ALA E 1  53  ? -39.169 -18.747 36.518 1.00 84.57  ? 91  ALA E CA    1 
ATOM   3479  C  C     . ALA E 1  53  ? -38.476 -18.159 37.740 1.00 88.50  ? 91  ALA E C     1 
ATOM   3480  O  O     . ALA E 1  53  ? -37.705 -18.850 38.417 1.00 91.40  ? 91  ALA E O     1 
ATOM   3481  C  CB    . ALA E 1  53  ? -38.395 -18.405 35.245 1.00 82.06  ? 91  ALA E CB    1 
ATOM   3482  N  N     . LEU E 1  54  ? -38.740 -16.886 38.040 1.00 86.25  ? 92  LEU E N     1 
ATOM   3483  C  CA    . LEU E 1  54  ? -38.157 -16.271 39.227 1.00 83.26  ? 92  LEU E CA    1 
ATOM   3484  C  C     . LEU E 1  54  ? -38.724 -16.881 40.502 1.00 86.80  ? 92  LEU E C     1 
ATOM   3485  O  O     . LEU E 1  54  ? -37.999 -17.049 41.490 1.00 89.99  ? 92  LEU E O     1 
ATOM   3486  C  CB    . LEU E 1  54  ? -38.394 -14.761 39.205 1.00 80.12  ? 92  LEU E CB    1 
ATOM   3487  C  CG    . LEU E 1  54  ? -37.476 -13.956 38.287 1.00 77.66  ? 92  LEU E CG    1 
ATOM   3488  C  CD1   . LEU E 1  54  ? -37.956 -12.522 38.172 1.00 78.99  ? 92  LEU E CD1   1 
ATOM   3489  C  CD2   . LEU E 1  54  ? -36.052 -14.001 38.809 1.00 76.92  ? 92  LEU E CD2   1 
ATOM   3490  N  N     . GLN E 1  55  ? -40.014 -17.223 40.500 1.00 87.32  ? 93  GLN E N     1 
ATOM   3491  C  CA    . GLN E 1  55  ? -40.628 -17.780 41.701 1.00 86.78  ? 93  GLN E CA    1 
ATOM   3492  C  C     . GLN E 1  55  ? -40.143 -19.201 41.962 1.00 86.43  ? 93  GLN E C     1 
ATOM   3493  O  O     . GLN E 1  55  ? -39.972 -19.600 43.119 1.00 89.52  ? 93  GLN E O     1 
ATOM   3494  C  CB    . GLN E 1  55  ? -42.151 -17.739 41.581 1.00 86.03  ? 93  GLN E CB    1 
ATOM   3495  C  CG    . GLN E 1  55  ? -42.881 -18.029 42.882 1.00 87.57  ? 93  GLN E CG    1 
ATOM   3496  C  CD    . GLN E 1  55  ? -44.362 -17.715 42.803 1.00 93.95  ? 93  GLN E CD    1 
ATOM   3497  O  OE1   . GLN E 1  55  ? -44.832 -17.124 41.830 1.00 97.53  ? 93  GLN E OE1   1 
ATOM   3498  N  NE2   . GLN E 1  55  ? -45.106 -18.111 43.829 1.00 96.31  ? 93  GLN E NE2   1 
ATOM   3499  N  N     . GLU E 1  56  ? -39.916 -19.978 40.900 1.00 83.07  ? 94  GLU E N     1 
ATOM   3500  C  CA    . GLU E 1  56  ? -39.378 -21.323 41.075 1.00 84.05  ? 94  GLU E CA    1 
ATOM   3501  C  C     . GLU E 1  56  ? -37.960 -21.280 41.629 1.00 82.94  ? 94  GLU E C     1 
ATOM   3502  O  O     . GLU E 1  56  ? -37.576 -22.136 42.435 1.00 85.40  ? 94  GLU E O     1 
ATOM   3503  C  CB    . GLU E 1  56  ? -39.411 -22.081 39.747 1.00 89.53  ? 94  GLU E CB    1 
ATOM   3504  C  CG    . GLU E 1  56  ? -40.802 -22.500 39.297 1.00 95.24  ? 94  GLU E CG    1 
ATOM   3505  C  CD    . GLU E 1  56  ? -41.360 -23.656 40.107 1.00 96.60  ? 94  GLU E CD    1 
ATOM   3506  O  OE1   . GLU E 1  56  ? -40.573 -24.337 40.798 1.00 97.26  ? 94  GLU E OE1   1 
ATOM   3507  O  OE2   . GLU E 1  56  ? -42.587 -23.883 40.050 1.00 98.53  ? 94  GLU E OE2   1 
ATOM   3508  N  N     . ALA E 1  57  ? -37.169 -20.289 41.214 1.00 78.53  ? 95  ALA E N     1 
ATOM   3509  C  CA    . ALA E 1  57  ? -35.799 -20.182 41.700 1.00 75.80  ? 95  ALA E CA    1 
ATOM   3510  C  C     . ALA E 1  57  ? -35.742 -19.566 43.093 1.00 79.01  ? 95  ALA E C     1 
ATOM   3511  O  O     . ALA E 1  57  ? -34.888 -19.942 43.904 1.00 81.54  ? 95  ALA E O     1 
ATOM   3512  C  CB    . ALA E 1  57  ? -34.959 -19.361 40.724 1.00 72.89  ? 95  ALA E CB    1 
ATOM   3513  N  N     . SER E 1  58  ? -36.639 -18.622 43.387 1.00 78.86  ? 96  SER E N     1 
ATOM   3514  C  CA    . SER E 1  58  ? -36.613 -17.959 44.686 1.00 76.57  ? 96  SER E CA    1 
ATOM   3515  C  C     . SER E 1  58  ? -37.042 -18.904 45.801 1.00 79.14  ? 96  SER E C     1 
ATOM   3516  O  O     . SER E 1  58  ? -36.423 -18.930 46.871 1.00 79.39  ? 96  SER E O     1 
ATOM   3517  C  CB    . SER E 1  58  ? -37.502 -16.717 44.660 1.00 76.59  ? 96  SER E CB    1 
ATOM   3518  O  OG    . SER E 1  58  ? -37.050 -15.789 43.689 1.00 75.01  ? 96  SER E OG    1 
ATOM   3519  N  N     . GLU E 1  59  ? -38.099 -19.688 45.573 1.00 85.10  ? 97  GLU E N     1 
ATOM   3520  C  CA    . GLU E 1  59  ? -38.546 -20.629 46.596 1.00 89.20  ? 97  GLU E CA    1 
ATOM   3521  C  C     . GLU E 1  59  ? -37.539 -21.755 46.791 1.00 82.92  ? 97  GLU E C     1 
ATOM   3522  O  O     . GLU E 1  59  ? -37.247 -22.142 47.928 1.00 83.26  ? 97  GLU E O     1 
ATOM   3523  C  CB    . GLU E 1  59  ? -39.921 -21.192 46.234 1.00 99.46  ? 97  GLU E CB    1 
ATOM   3524  C  CG    . GLU E 1  59  ? -41.048 -20.172 46.293 1.00 106.92 ? 97  GLU E CG    1 
ATOM   3525  C  CD    . GLU E 1  59  ? -42.419 -20.812 46.189 1.00 109.90 ? 97  GLU E CD    1 
ATOM   3526  O  OE1   . GLU E 1  59  ? -42.495 -22.058 46.154 1.00 113.27 ? 97  GLU E OE1   1 
ATOM   3527  O  OE2   . GLU E 1  59  ? -43.422 -20.069 46.144 1.00 111.38 ? 97  GLU E OE2   1 
ATOM   3528  N  N     . ALA E 1  60  ? -36.995 -22.291 45.695 1.00 79.49  ? 98  ALA E N     1 
ATOM   3529  C  CA    . ALA E 1  60  ? -36.000 -23.352 45.811 1.00 79.27  ? 98  ALA E CA    1 
ATOM   3530  C  C     . ALA E 1  60  ? -34.728 -22.856 46.486 1.00 80.15  ? 98  ALA E C     1 
ATOM   3531  O  O     . ALA E 1  60  ? -34.028 -23.639 47.138 1.00 82.14  ? 98  ALA E O     1 
ATOM   3532  C  CB    . ALA E 1  60  ? -35.679 -23.928 44.434 1.00 80.31  ? 98  ALA E CB    1 
ATOM   3533  N  N     . TYR E 1  61  ? -34.412 -21.568 46.338 1.00 78.86  ? 99  TYR E N     1 
ATOM   3534  C  CA    . TYR E 1  61  ? -33.274 -21.003 47.054 1.00 75.05  ? 99  TYR E CA    1 
ATOM   3535  C  C     . TYR E 1  61  ? -33.559 -20.904 48.547 1.00 73.25  ? 99  TYR E C     1 
ATOM   3536  O  O     . TYR E 1  61  ? -32.708 -21.260 49.372 1.00 69.51  ? 99  TYR E O     1 
ATOM   3537  C  CB    . TYR E 1  61  ? -32.922 -19.629 46.477 1.00 71.28  ? 99  TYR E CB    1 
ATOM   3538  C  CG    . TYR E 1  61  ? -31.970 -18.821 47.333 1.00 65.44  ? 99  TYR E CG    1 
ATOM   3539  C  CD1   . TYR E 1  61  ? -30.597 -19.009 47.248 1.00 63.72  ? 99  TYR E CD1   1 
ATOM   3540  C  CD2   . TYR E 1  61  ? -32.447 -17.865 48.221 1.00 65.54  ? 99  TYR E CD2   1 
ATOM   3541  C  CE1   . TYR E 1  61  ? -29.726 -18.272 48.029 1.00 66.66  ? 99  TYR E CE1   1 
ATOM   3542  C  CE2   . TYR E 1  61  ? -31.586 -17.126 49.006 1.00 68.51  ? 99  TYR E CE2   1 
ATOM   3543  C  CZ    . TYR E 1  61  ? -30.227 -17.331 48.907 1.00 71.35  ? 99  TYR E CZ    1 
ATOM   3544  O  OH    . TYR E 1  61  ? -29.367 -16.592 49.689 1.00 77.13  ? 99  TYR E OH    1 
ATOM   3545  N  N     . LEU E 1  62  ? -34.752 -20.428 48.913 1.00 74.70  ? 100 LEU E N     1 
ATOM   3546  C  CA    . LEU E 1  62  ? -35.076 -20.245 50.325 1.00 74.26  ? 100 LEU E CA    1 
ATOM   3547  C  C     . LEU E 1  62  ? -35.254 -21.582 51.033 1.00 76.72  ? 100 LEU E C     1 
ATOM   3548  O  O     . LEU E 1  62  ? -34.821 -21.741 52.181 1.00 77.09  ? 100 LEU E O     1 
ATOM   3549  C  CB    . LEU E 1  62  ? -36.335 -19.390 50.471 1.00 74.86  ? 100 LEU E CB    1 
ATOM   3550  C  CG    . LEU E 1  62  ? -36.244 -17.937 49.998 1.00 78.87  ? 100 LEU E CG    1 
ATOM   3551  C  CD1   . LEU E 1  62  ? -37.542 -17.198 50.284 1.00 80.15  ? 100 LEU E CD1   1 
ATOM   3552  C  CD2   . LEU E 1  62  ? -35.063 -17.227 50.643 1.00 80.49  ? 100 LEU E CD2   1 
ATOM   3553  N  N     . VAL E 1  63  ? -35.890 -22.551 50.371 1.00 77.57  ? 101 VAL E N     1 
ATOM   3554  C  CA    . VAL E 1  63  ? -36.075 -23.870 50.975 1.00 71.56  ? 101 VAL E CA    1 
ATOM   3555  C  C     . VAL E 1  63  ? -34.724 -24.510 51.266 1.00 66.49  ? 101 VAL E C     1 
ATOM   3556  O  O     . VAL E 1  63  ? -34.496 -25.057 52.352 1.00 65.65  ? 101 VAL E O     1 
ATOM   3557  C  CB    . VAL E 1  63  ? -36.944 -24.761 50.069 1.00 67.52  ? 101 VAL E CB    1 
ATOM   3558  C  CG1   . VAL E 1  63  ? -36.887 -26.206 50.532 1.00 69.32  ? 101 VAL E CG1   1 
ATOM   3559  C  CG2   . VAL E 1  63  ? -38.381 -24.265 50.065 1.00 64.04  ? 101 VAL E CG2   1 
ATOM   3560  N  N     . ALA E 1  64  ? -33.801 -24.441 50.303 1.00 62.12  ? 102 ALA E N     1 
ATOM   3561  C  CA    . ALA E 1  64  ? -32.450 -24.932 50.547 1.00 61.97  ? 102 ALA E CA    1 
ATOM   3562  C  C     . ALA E 1  64  ? -31.749 -24.117 51.627 1.00 66.77  ? 102 ALA E C     1 
ATOM   3563  O  O     . ALA E 1  64  ? -30.892 -24.645 52.346 1.00 70.92  ? 102 ALA E O     1 
ATOM   3564  C  CB    . ALA E 1  64  ? -31.638 -24.912 49.252 1.00 61.44  ? 102 ALA E CB    1 
ATOM   3565  N  N     . LEU E 1  65  ? -32.102 -22.836 51.761 1.00 69.33  ? 103 LEU E N     1 
ATOM   3566  C  CA    . LEU E 1  65  ? -31.495 -22.008 52.798 1.00 68.20  ? 103 LEU E CA    1 
ATOM   3567  C  C     . LEU E 1  65  ? -32.015 -22.384 54.180 1.00 73.66  ? 103 LEU E C     1 
ATOM   3568  O  O     . LEU E 1  65  ? -31.255 -22.379 55.155 1.00 80.26  ? 103 LEU E O     1 
ATOM   3569  C  CB    . LEU E 1  65  ? -31.754 -20.530 52.513 1.00 64.63  ? 103 LEU E CB    1 
ATOM   3570  C  CG    . LEU E 1  65  ? -31.146 -19.544 53.512 1.00 60.65  ? 103 LEU E CG    1 
ATOM   3571  C  CD1   . LEU E 1  65  ? -29.629 -19.661 53.533 1.00 45.36  ? 103 LEU E CD1   1 
ATOM   3572  C  CD2   . LEU E 1  65  ? -31.576 -18.123 53.189 1.00 61.68  ? 103 LEU E CD2   1 
ATOM   3573  N  N     . PHE E 1  66  ? -33.307 -22.708 54.287 1.00 74.00  ? 104 PHE E N     1 
ATOM   3574  C  CA    . PHE E 1  66  ? -33.846 -23.144 55.570 1.00 74.57  ? 104 PHE E CA    1 
ATOM   3575  C  C     . PHE E 1  66  ? -33.282 -24.496 55.986 1.00 76.08  ? 104 PHE E C     1 
ATOM   3576  O  O     . PHE E 1  66  ? -33.127 -24.757 57.184 1.00 74.52  ? 104 PHE E O     1 
ATOM   3577  C  CB    . PHE E 1  66  ? -35.373 -23.196 55.517 1.00 72.98  ? 104 PHE E CB    1 
ATOM   3578  C  CG    . PHE E 1  66  ? -36.028 -21.849 55.630 1.00 72.73  ? 104 PHE E CG    1 
ATOM   3579  C  CD1   . PHE E 1  66  ? -35.964 -21.133 56.814 1.00 69.68  ? 104 PHE E CD1   1 
ATOM   3580  C  CD2   . PHE E 1  66  ? -36.714 -21.303 54.558 1.00 73.55  ? 104 PHE E CD2   1 
ATOM   3581  C  CE1   . PHE E 1  66  ? -36.565 -19.894 56.926 1.00 67.95  ? 104 PHE E CE1   1 
ATOM   3582  C  CE2   . PHE E 1  66  ? -37.318 -20.063 54.664 1.00 73.42  ? 104 PHE E CE2   1 
ATOM   3583  C  CZ    . PHE E 1  66  ? -37.243 -19.359 55.850 1.00 69.96  ? 104 PHE E CZ    1 
ATOM   3584  N  N     . GLU E 1  67  ? -32.970 -25.363 55.019 1.00 77.78  ? 105 GLU E N     1 
ATOM   3585  C  CA    . GLU E 1  67  ? -32.320 -26.628 55.344 1.00 80.23  ? 105 GLU E CA    1 
ATOM   3586  C  C     . GLU E 1  67  ? -30.955 -26.391 55.978 1.00 82.94  ? 105 GLU E C     1 
ATOM   3587  O  O     . GLU E 1  67  ? -30.601 -27.039 56.970 1.00 87.95  ? 105 GLU E O     1 
ATOM   3588  C  CB    . GLU E 1  67  ? -32.188 -27.491 54.089 1.00 86.90  ? 105 GLU E CB    1 
ATOM   3589  C  CG    . GLU E 1  67  ? -33.514 -27.931 53.490 1.00 94.02  ? 105 GLU E CG    1 
ATOM   3590  C  CD    . GLU E 1  67  ? -33.345 -28.643 52.161 1.00 97.00  ? 105 GLU E CD    1 
ATOM   3591  O  OE1   . GLU E 1  67  ? -32.190 -28.795 51.708 1.00 99.05  ? 105 GLU E OE1   1 
ATOM   3592  O  OE2   . GLU E 1  67  ? -34.367 -29.049 51.567 1.00 98.03  ? 105 GLU E OE2   1 
ATOM   3593  N  N     . ASP E 1  68  ? -30.174 -25.463 55.418 1.00 81.22  ? 106 ASP E N     1 
ATOM   3594  C  CA    . ASP E 1  68  ? -28.900 -25.104 56.032 1.00 80.03  ? 106 ASP E CA    1 
ATOM   3595  C  C     . ASP E 1  68  ? -29.117 -24.328 57.325 1.00 75.48  ? 106 ASP E C     1 
ATOM   3596  O  O     . ASP E 1  68  ? -28.353 -24.484 58.285 1.00 76.13  ? 106 ASP E O     1 
ATOM   3597  C  CB    . ASP E 1  68  ? -28.053 -24.288 55.056 1.00 85.04  ? 106 ASP E CB    1 
ATOM   3598  C  CG    . ASP E 1  68  ? -27.773 -25.030 53.766 1.00 88.91  ? 106 ASP E CG    1 
ATOM   3599  O  OD1   . ASP E 1  68  ? -27.864 -26.275 53.764 1.00 93.40  ? 106 ASP E OD1   1 
ATOM   3600  O  OD2   . ASP E 1  68  ? -27.458 -24.367 52.754 1.00 87.31  ? 106 ASP E OD2   1 
ATOM   3601  N  N     . THR E 1  69  ? -30.150 -23.484 57.364 1.00 71.64  ? 107 THR E N     1 
ATOM   3602  C  CA    . THR E 1  69  ? -30.468 -22.757 58.588 1.00 72.62  ? 107 THR E CA    1 
ATOM   3603  C  C     . THR E 1  69  ? -30.868 -23.713 59.703 1.00 78.75  ? 107 THR E C     1 
ATOM   3604  O  O     . THR E 1  69  ? -30.456 -23.543 60.858 1.00 86.37  ? 107 THR E O     1 
ATOM   3605  C  CB    . THR E 1  69  ? -31.588 -21.750 58.322 1.00 70.05  ? 107 THR E CB    1 
ATOM   3606  O  OG1   . THR E 1  69  ? -31.167 -20.814 57.321 1.00 70.83  ? 107 THR E OG1   1 
ATOM   3607  C  CG2   . THR E 1  69  ? -31.946 -20.999 59.594 1.00 68.52  ? 107 THR E CG2   1 
ATOM   3608  N  N     . ASN E 1  70  ? -31.666 -24.731 59.374 1.00 76.23  ? 108 ASN E N     1 
ATOM   3609  C  CA    . ASN E 1  70  ? -32.100 -25.694 60.381 1.00 74.04  ? 108 ASN E CA    1 
ATOM   3610  C  C     . ASN E 1  70  ? -30.915 -26.464 60.951 1.00 68.88  ? 108 ASN E C     1 
ATOM   3611  O  O     . ASN E 1  70  ? -30.870 -26.745 62.154 1.00 70.54  ? 108 ASN E O     1 
ATOM   3612  C  CB    . ASN E 1  70  ? -33.125 -26.652 59.775 1.00 78.30  ? 108 ASN E CB    1 
ATOM   3613  C  CG    . ASN E 1  70  ? -33.967 -27.347 60.823 1.00 83.80  ? 108 ASN E CG    1 
ATOM   3614  O  OD1   . ASN E 1  70  ? -34.154 -26.835 61.927 1.00 85.69  ? 108 ASN E OD1   1 
ATOM   3615  N  ND2   . ASN E 1  70  ? -34.485 -28.520 60.479 1.00 86.12  ? 108 ASN E ND2   1 
ATOM   3616  N  N     . LEU E 1  71  ? -29.941 -26.806 60.103 1.00 64.54  ? 109 LEU E N     1 
ATOM   3617  C  CA    . LEU E 1  71  ? -28.770 -27.537 60.575 1.00 66.41  ? 109 LEU E CA    1 
ATOM   3618  C  C     . LEU E 1  71  ? -27.915 -26.692 61.510 1.00 74.05  ? 109 LEU E C     1 
ATOM   3619  O  O     . LEU E 1  71  ? -27.312 -27.228 62.447 1.00 83.59  ? 109 LEU E O     1 
ATOM   3620  C  CB    . LEU E 1  71  ? -27.939 -28.021 59.387 1.00 63.93  ? 109 LEU E CB    1 
ATOM   3621  C  CG    . LEU E 1  71  ? -28.578 -29.106 58.518 1.00 64.16  ? 109 LEU E CG    1 
ATOM   3622  C  CD1   . LEU E 1  71  ? -27.717 -29.388 57.299 1.00 62.27  ? 109 LEU E CD1   1 
ATOM   3623  C  CD2   . LEU E 1  71  ? -28.800 -30.378 59.325 1.00 65.99  ? 109 LEU E CD2   1 
ATOM   3624  N  N     . CYS E 1  72  ? -27.847 -25.379 61.275 1.00 71.90  ? 110 CYS E N     1 
ATOM   3625  C  CA    . CYS E 1  72  ? -27.087 -24.512 62.170 1.00 71.71  ? 110 CYS E CA    1 
ATOM   3626  C  C     . CYS E 1  72  ? -27.741 -24.430 63.543 1.00 75.99  ? 110 CYS E C     1 
ATOM   3627  O  O     . CYS E 1  72  ? -27.046 -24.378 64.565 1.00 79.24  ? 110 CYS E O     1 
ATOM   3628  C  CB    . CYS E 1  72  ? -26.944 -23.118 61.558 1.00 68.94  ? 110 CYS E CB    1 
ATOM   3629  S  SG    . CYS E 1  72  ? -25.990 -23.064 60.019 1.00 61.31  ? 110 CYS E SG    1 
ATOM   3630  N  N     . ALA E 1  73  ? -29.076 -24.413 63.588 1.00 74.81  ? 111 ALA E N     1 
ATOM   3631  C  CA    . ALA E 1  73  ? -29.771 -24.382 64.869 1.00 72.97  ? 111 ALA E CA    1 
ATOM   3632  C  C     . ALA E 1  73  ? -29.544 -25.670 65.650 1.00 76.54  ? 111 ALA E C     1 
ATOM   3633  O  O     . ALA E 1  73  ? -29.284 -25.634 66.858 1.00 81.50  ? 111 ALA E O     1 
ATOM   3634  C  CB    . ALA E 1  73  ? -31.264 -24.139 64.650 1.00 69.86  ? 111 ALA E CB    1 
ATOM   3635  N  N     . ILE E 1  74  ? -29.637 -26.819 64.975 1.00 76.45  ? 112 ILE E N     1 
ATOM   3636  C  CA    . ILE E 1  74  ? -29.385 -28.097 65.635 1.00 74.89  ? 112 ILE E CA    1 
ATOM   3637  C  C     . ILE E 1  74  ? -27.939 -28.181 66.102 1.00 76.35  ? 112 ILE E C     1 
ATOM   3638  O  O     . ILE E 1  74  ? -27.646 -28.770 67.151 1.00 80.54  ? 112 ILE E O     1 
ATOM   3639  C  CB    . ILE E 1  74  ? -29.746 -29.258 64.688 1.00 72.91  ? 112 ILE E CB    1 
ATOM   3640  C  CG1   . ILE E 1  74  ? -31.216 -29.165 64.280 1.00 72.38  ? 112 ILE E CG1   1 
ATOM   3641  C  CG2   . ILE E 1  74  ? -29.460 -30.602 65.341 1.00 75.33  ? 112 ILE E CG2   1 
ATOM   3642  C  CD1   . ILE E 1  74  ? -31.632 -30.209 63.279 1.00 71.94  ? 112 ILE E CD1   1 
ATOM   3643  N  N     . HIS E 1  75  ? -27.014 -27.586 65.344 1.00 73.26  ? 113 HIS E N     1 
ATOM   3644  C  CA    . HIS E 1  75  ? -25.612 -27.588 65.746 1.00 75.06  ? 113 HIS E CA    1 
ATOM   3645  C  C     . HIS E 1  75  ? -25.405 -26.850 67.061 1.00 80.92  ? 113 HIS E C     1 
ATOM   3646  O  O     . HIS E 1  75  ? -24.488 -27.181 67.821 1.00 85.08  ? 113 HIS E O     1 
ATOM   3647  C  CB    . HIS E 1  75  ? -24.754 -26.963 64.648 1.00 74.85  ? 113 HIS E CB    1 
ATOM   3648  C  CG    . HIS E 1  75  ? -23.285 -27.169 64.841 1.00 79.40  ? 113 HIS E CG    1 
ATOM   3649  N  ND1   . HIS E 1  75  ? -22.672 -28.384 64.627 1.00 83.84  ? 113 HIS E ND1   1 
ATOM   3650  C  CD2   . HIS E 1  75  ? -22.307 -26.315 65.226 1.00 80.84  ? 113 HIS E CD2   1 
ATOM   3651  C  CE1   . HIS E 1  75  ? -21.379 -28.270 64.872 1.00 84.96  ? 113 HIS E CE1   1 
ATOM   3652  N  NE2   . HIS E 1  75  ? -21.132 -27.025 65.237 1.00 81.83  ? 113 HIS E NE2   1 
ATOM   3653  N  N     . ALA E 1  76  ? -26.243 -25.850 67.346 1.00 81.14  ? 114 ALA E N     1 
ATOM   3654  C  CA    . ALA E 1  76  ? -26.184 -25.100 68.595 1.00 80.92  ? 114 ALA E CA    1 
ATOM   3655  C  C     . ALA E 1  76  ? -27.129 -25.653 69.654 1.00 82.76  ? 114 ALA E C     1 
ATOM   3656  O  O     . ALA E 1  76  ? -27.556 -24.907 70.547 1.00 84.50  ? 114 ALA E O     1 
ATOM   3657  C  CB    . ALA E 1  76  ? -26.480 -23.622 68.336 1.00 80.30  ? 114 ALA E CB    1 
ATOM   3658  N  N     . LYS E 1  77  ? -27.474 -26.940 69.569 1.00 84.17  ? 115 LYS E N     1 
ATOM   3659  C  CA    . LYS E 1  77  ? -28.338 -27.610 70.544 1.00 88.01  ? 115 LYS E CA    1 
ATOM   3660  C  C     . LYS E 1  77  ? -29.711 -26.949 70.644 1.00 85.44  ? 115 LYS E C     1 
ATOM   3661  O  O     . LYS E 1  77  ? -30.331 -26.940 71.711 1.00 86.32  ? 115 LYS E O     1 
ATOM   3662  C  CB    . LYS E 1  77  ? -27.673 -27.675 71.924 1.00 95.12  ? 115 LYS E CB    1 
ATOM   3663  C  CG    . LYS E 1  77  ? -26.303 -28.336 71.922 1.00 98.36  ? 115 LYS E CG    1 
ATOM   3664  C  CD    . LYS E 1  77  ? -26.374 -29.760 71.395 1.00 100.69 ? 115 LYS E CD    1 
ATOM   3665  C  CE    . LYS E 1  77  ? -24.999 -30.406 71.363 1.00 104.23 ? 115 LYS E CE    1 
ATOM   3666  N  NZ    . LYS E 1  77  ? -24.381 -30.461 72.717 1.00 109.38 ? 115 LYS E NZ    1 
ATOM   3667  N  N     . ARG E 1  78  ? -30.198 -26.395 69.537 1.00 82.70  ? 116 ARG E N     1 
ATOM   3668  C  CA    . ARG E 1  78  ? -31.504 -25.759 69.481 1.00 83.14  ? 116 ARG E CA    1 
ATOM   3669  C  C     . ARG E 1  78  ? -32.359 -26.409 68.401 1.00 83.03  ? 116 ARG E C     1 
ATOM   3670  O  O     . ARG E 1  78  ? -31.861 -27.127 67.529 1.00 86.36  ? 116 ARG E O     1 
ATOM   3671  C  CB    . ARG E 1  78  ? -31.386 -24.252 69.208 1.00 82.34  ? 116 ARG E CB    1 
ATOM   3672  C  CG    . ARG E 1  78  ? -30.837 -23.441 70.371 1.00 81.70  ? 116 ARG E CG    1 
ATOM   3673  C  CD    . ARG E 1  78  ? -30.802 -21.951 70.053 1.00 79.68  ? 116 ARG E CD    1 
ATOM   3674  N  NE    . ARG E 1  78  ? -29.790 -21.618 69.054 1.00 81.40  ? 116 ARG E NE    1 
ATOM   3675  C  CZ    . ARG E 1  78  ? -30.044 -21.422 67.763 1.00 84.43  ? 116 ARG E CZ    1 
ATOM   3676  N  NH1   . ARG E 1  78  ? -31.284 -21.524 67.304 1.00 88.26  ? 116 ARG E NH1   1 
ATOM   3677  N  NH2   . ARG E 1  78  ? -29.057 -21.122 66.929 1.00 82.15  ? 116 ARG E NH2   1 
ATOM   3678  N  N     . VAL E 1  79  ? -33.664 -26.150 68.473 1.00 80.50  ? 117 VAL E N     1 
ATOM   3679  C  CA    . VAL E 1  79  ? -34.610 -26.583 67.453 1.00 80.96  ? 117 VAL E CA    1 
ATOM   3680  C  C     . VAL E 1  79  ? -35.322 -25.415 66.791 1.00 84.59  ? 117 VAL E C     1 
ATOM   3681  O  O     . VAL E 1  79  ? -36.115 -25.631 65.869 1.00 88.45  ? 117 VAL E O     1 
ATOM   3682  C  CB    . VAL E 1  79  ? -35.641 -27.579 68.024 1.00 80.51  ? 117 VAL E CB    1 
ATOM   3683  C  CG1   . VAL E 1  79  ? -34.940 -28.803 68.594 1.00 79.47  ? 117 VAL E CG1   1 
ATOM   3684  C  CG2   . VAL E 1  79  ? -36.504 -26.905 69.081 1.00 82.05  ? 117 VAL E CG2   1 
ATOM   3685  N  N     . THR E 1  80  ? -35.064 -24.188 67.232 1.00 83.65  ? 118 THR E N     1 
ATOM   3686  C  CA    . THR E 1  80  ? -35.654 -22.994 66.644 1.00 83.73  ? 118 THR E CA    1 
ATOM   3687  C  C     . THR E 1  80  ? -34.616 -22.302 65.771 1.00 80.31  ? 118 THR E C     1 
ATOM   3688  O  O     . THR E 1  80  ? -33.477 -22.095 66.202 1.00 78.91  ? 118 THR E O     1 
ATOM   3689  C  CB    . THR E 1  80  ? -36.147 -22.035 67.730 1.00 88.39  ? 118 THR E CB    1 
ATOM   3690  O  OG1   . THR E 1  80  ? -36.925 -22.756 68.693 1.00 94.10  ? 118 THR E OG1   1 
ATOM   3691  C  CG2   . THR E 1  80  ? -36.998 -20.930 67.121 1.00 86.39  ? 118 THR E CG2   1 
ATOM   3692  N  N     . ILE E 1  81  ? -35.006 -21.951 64.550 1.00 79.60  ? 119 ILE E N     1 
ATOM   3693  C  CA    . ILE E 1  81  ? -34.119 -21.202 63.669 1.00 81.84  ? 119 ILE E CA    1 
ATOM   3694  C  C     . ILE E 1  81  ? -34.176 -19.728 64.044 1.00 84.92  ? 119 ILE E C     1 
ATOM   3695  O  O     . ILE E 1  81  ? -35.243 -19.189 64.361 1.00 88.67  ? 119 ILE E O     1 
ATOM   3696  C  CB    . ILE E 1  81  ? -34.488 -21.429 62.191 1.00 82.51  ? 119 ILE E CB    1 
ATOM   3697  C  CG1   . ILE E 1  81  ? -35.920 -20.973 61.902 1.00 83.78  ? 119 ILE E CG1   1 
ATOM   3698  C  CG2   . ILE E 1  81  ? -34.307 -22.893 61.815 1.00 82.33  ? 119 ILE E CG2   1 
ATOM   3699  C  CD1   . ILE E 1  81  ? -36.247 -20.912 60.425 1.00 81.19  ? 119 ILE E CD1   1 
ATOM   3700  N  N     . MET E 1  82  ? -33.024 -19.077 64.025 1.00 84.23  ? 120 MET E N     1 
ATOM   3701  C  CA    . MET E 1  82  ? -32.870 -17.693 64.444 1.00 86.71  ? 120 MET E CA    1 
ATOM   3702  C  C     . MET E 1  82  ? -32.055 -16.940 63.413 1.00 87.24  ? 120 MET E C     1 
ATOM   3703  O  O     . MET E 1  82  ? -31.362 -17.552 62.588 1.00 88.93  ? 120 MET E O     1 
ATOM   3704  C  CB    . MET E 1  82  ? -32.194 -17.616 65.821 1.00 90.45  ? 120 MET E CB    1 
ATOM   3705  C  CG    . MET E 1  82  ? -33.080 -18.090 66.957 1.00 94.82  ? 120 MET E CG    1 
ATOM   3706  S  SD    . MET E 1  82  ? -32.286 -17.977 68.568 1.00 98.62  ? 120 MET E SD    1 
ATOM   3707  C  CE    . MET E 1  82  ? -33.692 -18.255 69.641 1.00 101.34 ? 120 MET E CE    1 
ATOM   3708  N  N     . PRO E 1  83  ? -32.128 -15.603 63.405 1.00 85.59  ? 121 PRO E N     1 
ATOM   3709  C  CA    . PRO E 1  83  ? -31.344 -14.830 62.429 1.00 83.26  ? 121 PRO E CA    1 
ATOM   3710  C  C     . PRO E 1  83  ? -29.857 -15.139 62.452 1.00 80.61  ? 121 PRO E C     1 
ATOM   3711  O  O     . PRO E 1  83  ? -29.214 -15.101 61.395 1.00 79.49  ? 121 PRO E O     1 
ATOM   3712  C  CB    . PRO E 1  83  ? -31.627 -13.378 62.834 1.00 84.29  ? 121 PRO E CB    1 
ATOM   3713  C  CG    . PRO E 1  83  ? -32.983 -13.429 63.440 1.00 85.53  ? 121 PRO E CG    1 
ATOM   3714  C  CD    . PRO E 1  83  ? -33.056 -14.744 64.166 1.00 85.89  ? 121 PRO E CD    1 
ATOM   3715  N  N     . LYS E 1  84  ? -29.289 -15.456 63.618 1.00 79.27  ? 122 LYS E N     1 
ATOM   3716  C  CA    . LYS E 1  84  ? -27.877 -15.815 63.673 1.00 79.27  ? 122 LYS E CA    1 
ATOM   3717  C  C     . LYS E 1  84  ? -27.584 -17.123 62.947 1.00 78.74  ? 122 LYS E C     1 
ATOM   3718  O  O     . LYS E 1  84  ? -26.430 -17.367 62.579 1.00 78.12  ? 122 LYS E O     1 
ATOM   3719  C  CB    . LYS E 1  84  ? -27.407 -15.903 65.126 1.00 81.03  ? 122 LYS E CB    1 
ATOM   3720  C  CG    . LYS E 1  84  ? -28.197 -16.870 65.990 1.00 83.53  ? 122 LYS E CG    1 
ATOM   3721  C  CD    . LYS E 1  84  ? -27.646 -16.907 67.407 1.00 88.14  ? 122 LYS E CD    1 
ATOM   3722  C  CE    . LYS E 1  84  ? -28.457 -17.836 68.297 1.00 93.90  ? 122 LYS E CE    1 
ATOM   3723  N  NZ    . LYS E 1  84  ? -27.901 -17.912 69.678 1.00 96.63  ? 122 LYS E NZ    1 
ATOM   3724  N  N     . ASP E 1  85  ? -28.598 -17.964 62.731 1.00 78.01  ? 123 ASP E N     1 
ATOM   3725  C  CA    . ASP E 1  85  ? -28.399 -19.183 61.955 1.00 76.35  ? 123 ASP E CA    1 
ATOM   3726  C  C     . ASP E 1  85  ? -28.395 -18.895 60.458 1.00 76.22  ? 123 ASP E C     1 
ATOM   3727  O  O     . ASP E 1  85  ? -27.591 -19.470 59.716 1.00 75.95  ? 123 ASP E O     1 
ATOM   3728  C  CB    . ASP E 1  85  ? -29.478 -20.212 62.297 1.00 77.75  ? 123 ASP E CB    1 
ATOM   3729  C  CG    . ASP E 1  85  ? -29.460 -20.613 63.760 1.00 81.30  ? 123 ASP E CG    1 
ATOM   3730  O  OD1   . ASP E 1  85  ? -28.525 -21.334 64.168 1.00 83.07  ? 123 ASP E OD1   1 
ATOM   3731  O  OD2   . ASP E 1  85  ? -30.384 -20.214 64.501 1.00 82.33  ? 123 ASP E OD2   1 
ATOM   3732  N  N     . ILE E 1  86  ? -29.286 -18.013 59.999 1.00 77.98  ? 124 ILE E N     1 
ATOM   3733  C  CA    . ILE E 1  86  ? -29.294 -17.626 58.590 1.00 76.60  ? 124 ILE E CA    1 
ATOM   3734  C  C     . ILE E 1  86  ? -28.003 -16.901 58.232 1.00 74.91  ? 124 ILE E C     1 
ATOM   3735  O  O     . ILE E 1  86  ? -27.417 -17.132 57.167 1.00 73.66  ? 124 ILE E O     1 
ATOM   3736  C  CB    . ILE E 1  86  ? -30.532 -16.763 58.278 1.00 77.43  ? 124 ILE E CB    1 
ATOM   3737  C  CG1   . ILE E 1  86  ? -31.812 -17.589 58.421 1.00 79.91  ? 124 ILE E CG1   1 
ATOM   3738  C  CG2   . ILE E 1  86  ? -30.436 -16.163 56.883 1.00 75.91  ? 124 ILE E CG2   1 
ATOM   3739  C  CD1   . ILE E 1  86  ? -33.068 -16.837 58.039 1.00 79.19  ? 124 ILE E CD1   1 
ATOM   3740  N  N     . GLN E 1  87  ? -27.538 -16.018 59.118 1.00 74.92  ? 125 GLN E N     1 
ATOM   3741  C  CA    . GLN E 1  87  ? -26.313 -15.273 58.852 1.00 77.43  ? 125 GLN E CA    1 
ATOM   3742  C  C     . GLN E 1  87  ? -25.096 -16.186 58.795 1.00 72.11  ? 125 GLN E C     1 
ATOM   3743  O  O     . GLN E 1  87  ? -24.158 -15.916 58.038 1.00 73.27  ? 125 GLN E O     1 
ATOM   3744  C  CB    . GLN E 1  87  ? -26.122 -14.191 59.914 1.00 82.90  ? 125 GLN E CB    1 
ATOM   3745  C  CG    . GLN E 1  87  ? -27.236 -13.159 59.943 1.00 83.95  ? 125 GLN E CG    1 
ATOM   3746  C  CD    . GLN E 1  87  ? -27.367 -12.479 61.290 1.00 86.40  ? 125 GLN E CD    1 
ATOM   3747  O  OE1   . GLN E 1  87  ? -26.635 -12.793 62.230 1.00 86.25  ? 125 GLN E OE1   1 
ATOM   3748  N  NE2   . GLN E 1  87  ? -28.306 -11.544 61.392 1.00 88.59  ? 125 GLN E NE2   1 
ATOM   3749  N  N     . LEU E 1  88  ? -25.089 -17.267 59.578 1.00 70.08  ? 126 LEU E N     1 
ATOM   3750  C  CA    . LEU E 1  88  ? -23.969 -18.200 59.523 1.00 70.30  ? 126 LEU E CA    1 
ATOM   3751  C  C     . LEU E 1  88  ? -24.004 -19.031 58.246 1.00 70.72  ? 126 LEU E C     1 
ATOM   3752  O  O     . LEU E 1  88  ? -22.960 -19.279 57.632 1.00 70.31  ? 126 LEU E O     1 
ATOM   3753  C  CB    . LEU E 1  88  ? -23.974 -19.110 60.750 1.00 69.59  ? 126 LEU E CB    1 
ATOM   3754  C  CG    . LEU E 1  88  ? -22.851 -20.149 60.777 1.00 68.08  ? 126 LEU E CG    1 
ATOM   3755  C  CD1   . LEU E 1  88  ? -21.491 -19.467 60.837 1.00 69.75  ? 126 LEU E CD1   1 
ATOM   3756  C  CD2   . LEU E 1  88  ? -23.029 -21.110 61.938 1.00 65.97  ? 126 LEU E CD2   1 
ATOM   3757  N  N     . ALA E 1  89  ? -25.195 -19.472 57.835 1.00 68.74  ? 127 ALA E N     1 
ATOM   3758  C  CA    . ALA E 1  89  ? -25.316 -20.243 56.602 1.00 64.38  ? 127 ALA E CA    1 
ATOM   3759  C  C     . ALA E 1  89  ? -24.865 -19.424 55.399 1.00 68.49  ? 127 ALA E C     1 
ATOM   3760  O  O     . ALA E 1  89  ? -24.075 -19.895 54.573 1.00 72.11  ? 127 ALA E O     1 
ATOM   3761  C  CB    . ALA E 1  89  ? -26.757 -20.721 56.422 1.00 61.02  ? 127 ALA E CB    1 
ATOM   3762  N  N     . ARG E 1  90  ? -25.350 -18.184 55.290 1.00 67.94  ? 128 ARG E N     1 
ATOM   3763  C  CA    . ARG E 1  90  ? -24.968 -17.341 54.163 1.00 64.37  ? 128 ARG E CA    1 
ATOM   3764  C  C     . ARG E 1  90  ? -23.498 -16.945 54.226 1.00 64.90  ? 128 ARG E C     1 
ATOM   3765  O  O     . ARG E 1  90  ? -22.866 -16.753 53.181 1.00 74.33  ? 128 ARG E O     1 
ATOM   3766  C  CB    . ARG E 1  90  ? -25.860 -16.099 54.110 1.00 66.23  ? 128 ARG E CB    1 
ATOM   3767  C  CG    . ARG E 1  90  ? -27.336 -16.421 53.923 1.00 71.77  ? 128 ARG E CG    1 
ATOM   3768  C  CD    . ARG E 1  90  ? -28.188 -15.169 53.771 1.00 79.05  ? 128 ARG E CD    1 
ATOM   3769  N  NE    . ARG E 1  90  ? -27.888 -14.437 52.543 1.00 83.04  ? 128 ARG E NE    1 
ATOM   3770  C  CZ    . ARG E 1  90  ? -27.276 -13.258 52.503 1.00 82.18  ? 128 ARG E CZ    1 
ATOM   3771  N  NH1   . ARG E 1  90  ? -26.901 -12.665 53.628 1.00 82.97  ? 128 ARG E NH1   1 
ATOM   3772  N  NH2   . ARG E 1  90  ? -27.045 -12.668 51.338 1.00 79.47  ? 128 ARG E NH2   1 
ATOM   3773  N  N     . ARG E 1  91  ? -22.935 -16.823 55.431 1.00 65.08  ? 129 ARG E N     1 
ATOM   3774  C  CA    . ARG E 1  91  ? -21.512 -16.522 55.551 1.00 71.14  ? 129 ARG E CA    1 
ATOM   3775  C  C     . ARG E 1  91  ? -20.659 -17.690 55.072 1.00 73.80  ? 129 ARG E C     1 
ATOM   3776  O  O     . ARG E 1  91  ? -19.684 -17.495 54.337 1.00 79.74  ? 129 ARG E O     1 
ATOM   3777  C  CB    . ARG E 1  91  ? -21.174 -16.157 56.998 1.00 75.57  ? 129 ARG E CB    1 
ATOM   3778  C  CG    . ARG E 1  91  ? -19.713 -16.345 57.393 1.00 79.76  ? 129 ARG E CG    1 
ATOM   3779  C  CD    . ARG E 1  91  ? -18.778 -15.403 56.649 1.00 86.39  ? 129 ARG E CD    1 
ATOM   3780  N  NE    . ARG E 1  91  ? -17.390 -15.581 57.066 1.00 94.92  ? 129 ARG E NE    1 
ATOM   3781  C  CZ    . ARG E 1  91  ? -16.583 -16.530 56.600 1.00 102.31 ? 129 ARG E CZ    1 
ATOM   3782  N  NH1   . ARG E 1  91  ? -17.023 -17.397 55.698 1.00 105.31 ? 129 ARG E NH1   1 
ATOM   3783  N  NH2   . ARG E 1  91  ? -15.334 -16.615 57.039 1.00 103.61 ? 129 ARG E NH2   1 
ATOM   3784  N  N     . ILE E 1  92  ? -21.011 -18.913 55.474 1.00 71.43  ? 130 ILE E N     1 
ATOM   3785  C  CA    . ILE E 1  92  ? -20.245 -20.078 55.042 1.00 74.63  ? 130 ILE E CA    1 
ATOM   3786  C  C     . ILE E 1  92  ? -20.477 -20.357 53.562 1.00 74.07  ? 130 ILE E C     1 
ATOM   3787  O  O     . ILE E 1  92  ? -19.568 -20.813 52.858 1.00 70.66  ? 130 ILE E O     1 
ATOM   3788  C  CB    . ILE E 1  92  ? -20.594 -21.292 55.922 1.00 76.01  ? 130 ILE E CB    1 
ATOM   3789  C  CG1   . ILE E 1  92  ? -20.216 -21.007 57.377 1.00 75.52  ? 130 ILE E CG1   1 
ATOM   3790  C  CG2   . ILE E 1  92  ? -19.886 -22.543 55.430 1.00 76.92  ? 130 ILE E CG2   1 
ATOM   3791  C  CD1   . ILE E 1  92  ? -20.594 -22.110 58.332 1.00 78.95  ? 130 ILE E CD1   1 
ATOM   3792  N  N     . ARG E 1  93  ? -21.683 -20.076 53.060 1.00 73.56  ? 131 ARG E N     1 
ATOM   3793  C  CA    . ARG E 1  93  ? -21.949 -20.216 51.631 1.00 67.94  ? 131 ARG E CA    1 
ATOM   3794  C  C     . ARG E 1  93  ? -21.093 -19.273 50.798 1.00 68.97  ? 131 ARG E C     1 
ATOM   3795  O  O     . ARG E 1  93  ? -20.824 -19.555 49.625 1.00 72.82  ? 131 ARG E O     1 
ATOM   3796  C  CB    . ARG E 1  93  ? -23.425 -19.950 51.336 1.00 61.46  ? 131 ARG E CB    1 
ATOM   3797  C  CG    . ARG E 1  93  ? -24.367 -21.094 51.636 1.00 56.40  ? 131 ARG E CG    1 
ATOM   3798  C  CD    . ARG E 1  93  ? -25.759 -20.750 51.135 1.00 58.71  ? 131 ARG E CD    1 
ATOM   3799  N  NE    . ARG E 1  93  ? -26.710 -21.839 51.318 1.00 68.05  ? 131 ARG E NE    1 
ATOM   3800  C  CZ    . ARG E 1  93  ? -27.947 -21.834 50.832 1.00 74.97  ? 131 ARG E CZ    1 
ATOM   3801  N  NH1   . ARG E 1  93  ? -28.381 -20.796 50.130 1.00 75.45  ? 131 ARG E NH1   1 
ATOM   3802  N  NH2   . ARG E 1  93  ? -28.750 -22.868 51.045 1.00 78.55  ? 131 ARG E NH2   1 
ATOM   3803  N  N     . GLY E 1  94  ? -20.666 -18.152 51.376 1.00 69.95  ? 132 GLY E N     1 
ATOM   3804  C  CA    . GLY E 1  94  ? -19.944 -17.135 50.645 1.00 73.61  ? 132 GLY E CA    1 
ATOM   3805  C  C     . GLY E 1  94  ? -20.803 -16.004 50.125 1.00 79.02  ? 132 GLY E C     1 
ATOM   3806  O  O     . GLY E 1  94  ? -20.289 -15.141 49.401 1.00 77.61  ? 132 GLY E O     1 
ATOM   3807  N  N     . GLU E 1  95  ? -22.093 -15.984 50.465 1.00 86.14  ? 133 GLU E N     1 
ATOM   3808  C  CA    . GLU E 1  95  ? -22.976 -14.914 50.016 1.00 95.72  ? 133 GLU E CA    1 
ATOM   3809  C  C     . GLU E 1  95  ? -22.777 -13.651 50.846 1.00 111.47 ? 133 GLU E C     1 
ATOM   3810  O  O     . GLU E 1  95  ? -22.677 -12.549 50.297 1.00 114.36 ? 133 GLU E O     1 
ATOM   3811  C  CB    . GLU E 1  95  ? -24.430 -15.382 50.079 1.00 90.09  ? 133 GLU E CB    1 
ATOM   3812  C  CG    . GLU E 1  95  ? -24.695 -16.671 49.317 1.00 85.90  ? 133 GLU E CG    1 
ATOM   3813  C  CD    . GLU E 1  95  ? -26.117 -17.168 49.479 1.00 86.18  ? 133 GLU E CD    1 
ATOM   3814  O  OE1   . GLU E 1  95  ? -26.907 -16.503 50.182 1.00 86.16  ? 133 GLU E OE1   1 
ATOM   3815  O  OE2   . GLU E 1  95  ? -26.445 -18.227 48.903 1.00 87.48  ? 133 GLU E OE2   1 
ATOM   3816  N  N     . ARG E 1  96  ? -22.718 -13.794 52.167 1.00 126.31 ? 134 ARG E N     1 
ATOM   3817  C  CA    . ARG E 1  96  ? -22.474 -12.669 53.057 1.00 144.63 ? 134 ARG E CA    1 
ATOM   3818  C  C     . ARG E 1  96  ? -20.991 -12.574 53.391 1.00 156.42 ? 134 ARG E C     1 
ATOM   3819  O  O     . ARG E 1  96  ? -20.335 -13.584 53.661 1.00 156.58 ? 134 ARG E O     1 
ATOM   3820  C  CB    . ARG E 1  96  ? -23.294 -12.804 54.343 1.00 153.85 ? 134 ARG E CB    1 
ATOM   3821  C  CG    . ARG E 1  96  ? -22.878 -11.836 55.441 1.00 163.69 ? 134 ARG E CG    1 
ATOM   3822  C  CD    . ARG E 1  96  ? -23.892 -11.771 56.568 1.00 171.31 ? 134 ARG E CD    1 
ATOM   3823  N  NE    . ARG E 1  96  ? -23.442 -10.885 57.639 1.00 177.45 ? 134 ARG E NE    1 
ATOM   3824  C  CZ    . ARG E 1  96  ? -24.229 -10.402 58.594 1.00 182.49 ? 134 ARG E CZ    1 
ATOM   3825  N  NH1   . ARG E 1  96  ? -25.518 -10.711 58.613 1.00 187.17 ? 134 ARG E NH1   1 
ATOM   3826  N  NH2   . ARG E 1  96  ? -23.729 -9.604  59.527 1.00 184.38 ? 134 ARG E NH2   1 
ATOM   3827  N  N     . ALA E 1  97  ? -20.467 -11.352 53.366 1.00 171.31 ? 135 ALA E N     1 
ATOM   3828  C  CA    . ALA E 1  97  ? -19.066 -11.110 53.686 1.00 176.75 ? 135 ALA E CA    1 
ATOM   3829  C  C     . ALA E 1  97  ? -18.785 -11.386 55.160 1.00 180.77 ? 135 ALA E C     1 
ATOM   3830  O  O     . ALA E 1  97  ? -17.675 -11.765 55.534 1.00 182.38 ? 135 ALA E O     1 
ATOM   3831  C  CB    . ALA E 1  97  ? -18.680 -9.681  53.331 1.00 178.36 ? 135 ALA E CB    1 
ATOM   3832  O  OXT   . ALA E 1  97  ? -19.661 -11.239 56.012 1.00 183.23 ? 135 ALA E OXT   1 
ATOM   3833  N  N     . ASN F 2  7   ? -44.646 -3.157  50.154 1.00 120.71 ? 25  ASN F N     1 
ATOM   3834  C  CA    . ASN F 2  7   ? -44.704 -4.040  48.995 1.00 120.95 ? 25  ASN F CA    1 
ATOM   3835  C  C     . ASN F 2  7   ? -43.870 -5.295  49.242 1.00 119.24 ? 25  ASN F C     1 
ATOM   3836  O  O     . ASN F 2  7   ? -44.254 -6.396  48.845 1.00 118.10 ? 25  ASN F O     1 
ATOM   3837  C  CB    . ASN F 2  7   ? -44.218 -3.312  47.741 1.00 119.97 ? 25  ASN F CB    1 
ATOM   3838  C  CG    . ASN F 2  7   ? -44.724 -3.951  46.462 1.00 118.59 ? 25  ASN F CG    1 
ATOM   3839  O  OD1   . ASN F 2  7   ? -45.165 -5.100  46.458 1.00 115.64 ? 25  ASN F OD1   1 
ATOM   3840  N  ND2   . ASN F 2  7   ? -44.660 -3.205  45.365 1.00 119.87 ? 25  ASN F ND2   1 
ATOM   3841  N  N     . ILE F 2  8   ? -42.722 -5.118  49.901 1.00 118.39 ? 26  ILE F N     1 
ATOM   3842  C  CA    . ILE F 2  8   ? -41.910 -6.265  50.296 1.00 116.01 ? 26  ILE F CA    1 
ATOM   3843  C  C     . ILE F 2  8   ? -42.650 -7.110  51.325 1.00 117.10 ? 26  ILE F C     1 
ATOM   3844  O  O     . ILE F 2  8   ? -42.456 -8.330  51.397 1.00 114.35 ? 26  ILE F O     1 
ATOM   3845  C  CB    . ILE F 2  8   ? -40.539 -5.790  50.818 1.00 114.97 ? 26  ILE F CB    1 
ATOM   3846  C  CG1   . ILE F 2  8   ? -39.689 -6.973  51.292 1.00 110.49 ? 26  ILE F CG1   1 
ATOM   3847  C  CG2   . ILE F 2  8   ? -40.713 -4.764  51.931 1.00 118.77 ? 26  ILE F CG2   1 
ATOM   3848  C  CD1   . ILE F 2  8   ? -39.381 -7.985  50.209 1.00 106.20 ? 26  ILE F CD1   1 
ATOM   3849  N  N     . GLN F 2  9   ? -43.526 -6.490  52.118 1.00 121.02 ? 27  GLN F N     1 
ATOM   3850  C  CA    . GLN F 2  9   ? -44.332 -7.210  53.096 1.00 120.46 ? 27  GLN F CA    1 
ATOM   3851  C  C     . GLN F 2  9   ? -45.373 -8.120  52.455 1.00 117.99 ? 27  GLN F C     1 
ATOM   3852  O  O     . GLN F 2  9   ? -46.092 -8.811  53.186 1.00 118.88 ? 27  GLN F O     1 
ATOM   3853  C  CB    . GLN F 2  9   ? -45.021 -6.219  54.037 1.00 122.05 ? 27  GLN F CB    1 
ATOM   3854  C  CG    . GLN F 2  9   ? -44.068 -5.255  54.726 1.00 121.26 ? 27  GLN F CG    1 
ATOM   3855  C  CD    . GLN F 2  9   ? -43.070 -5.959  55.625 1.00 121.29 ? 27  GLN F CD    1 
ATOM   3856  O  OE1   . GLN F 2  9   ? -43.367 -7.004  56.205 1.00 121.65 ? 27  GLN F OE1   1 
ATOM   3857  N  NE2   . GLN F 2  9   ? -41.875 -5.390  55.742 1.00 121.13 ? 27  GLN F NE2   1 
ATOM   3858  N  N     . GLY F 2  10  ? -45.480 -8.131  51.124 1.00 116.04 ? 28  GLY F N     1 
ATOM   3859  C  CA    . GLY F 2  10  ? -46.376 -9.068  50.469 1.00 118.45 ? 28  GLY F CA    1 
ATOM   3860  C  C     . GLY F 2  10  ? -46.007 -10.513 50.733 1.00 120.06 ? 28  GLY F C     1 
ATOM   3861  O  O     . GLY F 2  10  ? -46.877 -11.388 50.750 1.00 122.98 ? 28  GLY F O     1 
ATOM   3862  N  N     . ILE F 2  11  ? -44.719 -10.785 50.938 1.00 112.78 ? 29  ILE F N     1 
ATOM   3863  C  CA    . ILE F 2  11  ? -44.265 -12.104 51.361 1.00 102.58 ? 29  ILE F CA    1 
ATOM   3864  C  C     . ILE F 2  11  ? -44.708 -12.302 52.804 1.00 101.53 ? 29  ILE F C     1 
ATOM   3865  O  O     . ILE F 2  11  ? -43.965 -11.995 53.743 1.00 98.73  ? 29  ILE F O     1 
ATOM   3866  C  CB    . ILE F 2  11  ? -42.740 -12.248 51.214 1.00 93.64  ? 29  ILE F CB    1 
ATOM   3867  C  CG1   . ILE F 2  11  ? -42.279 -11.688 49.866 1.00 86.66  ? 29  ILE F CG1   1 
ATOM   3868  C  CG2   . ILE F 2  11  ? -42.328 -13.705 51.357 1.00 92.48  ? 29  ILE F CG2   1 
ATOM   3869  C  CD1   . ILE F 2  11  ? -42.889 -12.385 48.669 1.00 83.99  ? 29  ILE F CD1   1 
ATOM   3870  N  N     . THR F 2  12  ? -45.924 -12.812 52.984 1.00 101.85 ? 30  THR F N     1 
ATOM   3871  C  CA    . THR F 2  12  ? -46.553 -12.853 54.294 1.00 100.40 ? 30  THR F CA    1 
ATOM   3872  C  C     . THR F 2  12  ? -45.826 -13.821 55.226 1.00 97.06  ? 30  THR F C     1 
ATOM   3873  O  O     . THR F 2  12  ? -44.980 -14.621 54.815 1.00 94.26  ? 30  THR F O     1 
ATOM   3874  C  CB    . THR F 2  12  ? -48.023 -13.252 54.166 1.00 100.67 ? 30  THR F CB    1 
ATOM   3875  O  OG1   . THR F 2  12  ? -48.120 -14.521 53.506 1.00 98.40  ? 30  THR F OG1   1 
ATOM   3876  C  CG2   . THR F 2  12  ? -48.789 -12.210 53.364 1.00 101.38 ? 30  THR F CG2   1 
ATOM   3877  N  N     . LYS F 2  13  ? -46.172 -13.731 56.511 1.00 98.34  ? 31  LYS F N     1 
ATOM   3878  C  CA    . LYS F 2  13  ? -45.604 -14.640 57.504 1.00 98.73  ? 31  LYS F CA    1 
ATOM   3879  C  C     . LYS F 2  13  ? -45.969 -16.098 57.250 1.00 101.22 ? 31  LYS F C     1 
ATOM   3880  O  O     . LYS F 2  13  ? -45.060 -16.946 57.268 1.00 101.33 ? 31  LYS F O     1 
ATOM   3881  C  CB    . LYS F 2  13  ? -46.024 -14.192 58.909 1.00 99.53  ? 31  LYS F CB    1 
ATOM   3882  C  CG    . LYS F 2  13  ? -45.756 -15.221 59.995 1.00 101.73 ? 31  LYS F CG    1 
ATOM   3883  C  CD    . LYS F 2  13  ? -46.162 -14.701 61.365 1.00 106.12 ? 31  LYS F CD    1 
ATOM   3884  C  CE    . LYS F 2  13  ? -45.945 -15.753 62.441 1.00 106.69 ? 31  LYS F CE    1 
ATOM   3885  N  NZ    . LYS F 2  13  ? -46.249 -15.233 63.803 1.00 107.66 ? 31  LYS F NZ    1 
ATOM   3886  N  N     . PRO F 2  14  ? -47.236 -16.470 57.016 1.00 101.59 ? 32  PRO F N     1 
ATOM   3887  C  CA    . PRO F 2  14  ? -47.523 -17.889 56.748 1.00 99.98  ? 32  PRO F CA    1 
ATOM   3888  C  C     . PRO F 2  14  ? -46.871 -18.405 55.478 1.00 97.83  ? 32  PRO F C     1 
ATOM   3889  O  O     . PRO F 2  14  ? -46.616 -19.611 55.371 1.00 96.99  ? 32  PRO F O     1 
ATOM   3890  C  CB    . PRO F 2  14  ? -49.055 -17.928 56.656 1.00 102.66 ? 32  PRO F CB    1 
ATOM   3891  C  CG    . PRO F 2  14  ? -49.445 -16.543 56.292 1.00 104.07 ? 32  PRO F CG    1 
ATOM   3892  C  CD    . PRO F 2  14  ? -48.471 -15.664 57.010 1.00 103.48 ? 32  PRO F CD    1 
ATOM   3893  N  N     . ALA F 2  15  ? -46.593 -17.530 54.510 1.00 96.46  ? 33  ALA F N     1 
ATOM   3894  C  CA    . ALA F 2  15  ? -45.876 -17.960 53.314 1.00 92.83  ? 33  ALA F CA    1 
ATOM   3895  C  C     . ALA F 2  15  ? -44.435 -18.328 53.642 1.00 91.74  ? 33  ALA F C     1 
ATOM   3896  O  O     . ALA F 2  15  ? -43.894 -19.296 53.094 1.00 93.86  ? 33  ALA F O     1 
ATOM   3897  C  CB    . ALA F 2  15  ? -45.925 -16.865 52.250 1.00 90.87  ? 33  ALA F CB    1 
ATOM   3898  N  N     . ILE F 2  16  ? -43.797 -17.569 54.535 1.00 90.09  ? 34  ILE F N     1 
ATOM   3899  C  CA    . ILE F 2  16  ? -42.438 -17.895 54.953 1.00 88.15  ? 34  ILE F CA    1 
ATOM   3900  C  C     . ILE F 2  16  ? -42.433 -19.165 55.796 1.00 87.95  ? 34  ILE F C     1 
ATOM   3901  O  O     . ILE F 2  16  ? -41.502 -19.976 55.715 1.00 88.93  ? 34  ILE F O     1 
ATOM   3902  C  CB    . ILE F 2  16  ? -41.814 -16.704 55.704 1.00 91.39  ? 34  ILE F CB    1 
ATOM   3903  C  CG1   . ILE F 2  16  ? -41.692 -15.496 54.773 1.00 94.36  ? 34  ILE F CG1   1 
ATOM   3904  C  CG2   . ILE F 2  16  ? -40.453 -17.075 56.277 1.00 89.89  ? 34  ILE F CG2   1 
ATOM   3905  C  CD1   . ILE F 2  16  ? -41.020 -14.297 55.407 1.00 96.05  ? 34  ILE F CD1   1 
ATOM   3906  N  N     . ARG F 2  17  ? -43.474 -19.365 56.607 1.00 90.59  ? 35  ARG F N     1 
ATOM   3907  C  CA    . ARG F 2  17  ? -43.557 -20.579 57.413 1.00 93.08  ? 35  ARG F CA    1 
ATOM   3908  C  C     . ARG F 2  17  ? -43.684 -21.817 56.535 1.00 92.95  ? 35  ARG F C     1 
ATOM   3909  O  O     . ARG F 2  17  ? -43.068 -22.852 56.816 1.00 94.31  ? 35  ARG F O     1 
ATOM   3910  C  CB    . ARG F 2  17  ? -44.734 -20.487 58.386 1.00 97.06  ? 35  ARG F CB    1 
ATOM   3911  C  CG    . ARG F 2  17  ? -44.592 -19.391 59.430 1.00 102.78 ? 35  ARG F CG    1 
ATOM   3912  C  CD    . ARG F 2  17  ? -45.794 -19.348 60.361 1.00 109.46 ? 35  ARG F CD    1 
ATOM   3913  N  NE    . ARG F 2  17  ? -45.935 -20.575 61.139 1.00 112.84 ? 35  ARG F NE    1 
ATOM   3914  C  CZ    . ARG F 2  17  ? -45.361 -20.781 62.321 1.00 114.77 ? 35  ARG F CZ    1 
ATOM   3915  N  NH1   . ARG F 2  17  ? -44.603 -19.838 62.865 1.00 115.09 ? 35  ARG F NH1   1 
ATOM   3916  N  NH2   . ARG F 2  17  ? -45.545 -21.928 62.959 1.00 117.69 ? 35  ARG F NH2   1 
ATOM   3917  N  N     . ARG F 2  18  ? -44.476 -21.730 55.462 1.00 90.49  ? 36  ARG F N     1 
ATOM   3918  C  CA    . ARG F 2  18  ? -44.626 -22.870 54.562 1.00 89.53  ? 36  ARG F CA    1 
ATOM   3919  C  C     . ARG F 2  18  ? -43.303 -23.225 53.894 1.00 90.36  ? 36  ARG F C     1 
ATOM   3920  O  O     . ARG F 2  18  ? -42.975 -24.408 53.740 1.00 94.16  ? 36  ARG F O     1 
ATOM   3921  C  CB    . ARG F 2  18  ? -45.696 -22.577 53.511 1.00 91.03  ? 36  ARG F CB    1 
ATOM   3922  C  CG    . ARG F 2  18  ? -47.110 -22.524 54.064 1.00 98.75  ? 36  ARG F CG    1 
ATOM   3923  C  CD    . ARG F 2  18  ? -48.141 -22.448 52.949 1.00 104.78 ? 36  ARG F CD    1 
ATOM   3924  N  NE    . ARG F 2  18  ? -48.064 -21.198 52.200 1.00 107.62 ? 36  ARG F NE    1 
ATOM   3925  C  CZ    . ARG F 2  18  ? -48.759 -20.106 52.501 1.00 111.57 ? 36  ARG F CZ    1 
ATOM   3926  N  NH1   . ARG F 2  18  ? -49.583 -20.107 53.540 1.00 112.44 ? 36  ARG F NH1   1 
ATOM   3927  N  NH2   . ARG F 2  18  ? -48.631 -19.011 51.763 1.00 112.94 ? 36  ARG F NH2   1 
ATOM   3928  N  N     . LEU F 2  19  ? -42.530 -22.214 53.490 1.00 86.19  ? 37  LEU F N     1 
ATOM   3929  C  CA    . LEU F 2  19  ? -41.222 -22.478 52.900 1.00 80.93  ? 37  LEU F CA    1 
ATOM   3930  C  C     . LEU F 2  19  ? -40.290 -23.144 53.904 1.00 80.82  ? 37  LEU F C     1 
ATOM   3931  O  O     . LEU F 2  19  ? -39.513 -24.037 53.546 1.00 83.46  ? 37  LEU F O     1 
ATOM   3932  C  CB    . LEU F 2  19  ? -40.608 -21.179 52.380 1.00 78.48  ? 37  LEU F CB    1 
ATOM   3933  C  CG    . LEU F 2  19  ? -41.335 -20.497 51.221 1.00 79.74  ? 37  LEU F CG    1 
ATOM   3934  C  CD1   . LEU F 2  19  ? -40.685 -19.161 50.898 1.00 80.30  ? 37  LEU F CD1   1 
ATOM   3935  C  CD2   . LEU F 2  19  ? -41.348 -21.398 49.996 1.00 79.53  ? 37  LEU F CD2   1 
ATOM   3936  N  N     . ALA F 2  20  ? -40.357 -22.725 55.169 1.00 80.12  ? 38  ALA F N     1 
ATOM   3937  C  CA    . ALA F 2  20  ? -39.531 -23.350 56.195 1.00 81.22  ? 38  ALA F CA    1 
ATOM   3938  C  C     . ALA F 2  20  ? -40.020 -24.758 56.513 1.00 82.57  ? 38  ALA F C     1 
ATOM   3939  O  O     . ALA F 2  20  ? -39.213 -25.649 56.802 1.00 81.15  ? 38  ALA F O     1 
ATOM   3940  C  CB    . ALA F 2  20  ? -39.516 -22.487 57.456 1.00 84.08  ? 38  ALA F CB    1 
ATOM   3941  N  N     . ARG F 2  21  ? -41.338 -24.975 56.471 1.00 85.42  ? 39  ARG F N     1 
ATOM   3942  C  CA    . ARG F 2  21  ? -41.872 -26.315 56.693 1.00 86.55  ? 39  ARG F CA    1 
ATOM   3943  C  C     . ARG F 2  21  ? -41.384 -27.283 55.623 1.00 86.78  ? 39  ARG F C     1 
ATOM   3944  O  O     . ARG F 2  21  ? -41.054 -28.436 55.922 1.00 89.67  ? 39  ARG F O     1 
ATOM   3945  C  CB    . ARG F 2  21  ? -43.400 -26.277 56.731 1.00 88.90  ? 39  ARG F CB    1 
ATOM   3946  C  CG    . ARG F 2  21  ? -43.981 -25.656 57.993 1.00 92.07  ? 39  ARG F CG    1 
ATOM   3947  C  CD    . ARG F 2  21  ? -43.640 -26.478 59.226 1.00 92.53  ? 39  ARG F CD    1 
ATOM   3948  N  NE    . ARG F 2  21  ? -44.281 -25.957 60.430 1.00 94.91  ? 39  ARG F NE    1 
ATOM   3949  C  CZ    . ARG F 2  21  ? -43.699 -25.124 61.287 1.00 94.19  ? 39  ARG F CZ    1 
ATOM   3950  N  NH1   . ARG F 2  21  ? -42.456 -24.714 61.077 1.00 91.30  ? 39  ARG F NH1   1 
ATOM   3951  N  NH2   . ARG F 2  21  ? -44.359 -24.701 62.357 1.00 95.63  ? 39  ARG F NH2   1 
ATOM   3952  N  N     . ARG F 2  22  ? -41.330 -26.831 54.368 1.00 82.16  ? 40  ARG F N     1 
ATOM   3953  C  CA    . ARG F 2  22  ? -40.739 -27.652 53.318 1.00 78.25  ? 40  ARG F CA    1 
ATOM   3954  C  C     . ARG F 2  22  ? -39.245 -27.845 53.543 1.00 79.66  ? 40  ARG F C     1 
ATOM   3955  O  O     . ARG F 2  22  ? -38.681 -28.863 53.126 1.00 84.90  ? 40  ARG F O     1 
ATOM   3956  C  CB    . ARG F 2  22  ? -41.003 -27.023 51.949 1.00 75.85  ? 40  ARG F CB    1 
ATOM   3957  C  CG    . ARG F 2  22  ? -40.416 -27.795 50.778 1.00 72.47  ? 40  ARG F CG    1 
ATOM   3958  C  CD    . ARG F 2  22  ? -40.923 -27.259 49.453 1.00 73.56  ? 40  ARG F CD    1 
ATOM   3959  N  NE    . ARG F 2  22  ? -42.366 -27.430 49.320 1.00 77.41  ? 40  ARG F NE    1 
ATOM   3960  C  CZ    . ARG F 2  22  ? -43.070 -27.043 48.262 1.00 79.28  ? 40  ARG F CZ    1 
ATOM   3961  N  NH1   . ARG F 2  22  ? -42.463 -26.459 47.237 1.00 80.39  ? 40  ARG F NH1   1 
ATOM   3962  N  NH2   . ARG F 2  22  ? -44.381 -27.240 48.227 1.00 79.55  ? 40  ARG F NH2   1 
ATOM   3963  N  N     . GLY F 2  23  ? -38.594 -26.891 54.203 1.00 77.28  ? 41  GLY F N     1 
ATOM   3964  C  CA    . GLY F 2  23  ? -37.193 -27.009 54.544 1.00 73.18  ? 41  GLY F CA    1 
ATOM   3965  C  C     . GLY F 2  23  ? -36.895 -27.818 55.782 1.00 74.87  ? 41  GLY F C     1 
ATOM   3966  O  O     . GLY F 2  23  ? -35.732 -27.916 56.183 1.00 75.11  ? 41  GLY F O     1 
ATOM   3967  N  N     . GLY F 2  24  ? -37.913 -28.401 56.407 1.00 79.35  ? 42  GLY F N     1 
ATOM   3968  C  CA    . GLY F 2  24  ? -37.720 -29.221 57.584 1.00 85.30  ? 42  GLY F CA    1 
ATOM   3969  C  C     . GLY F 2  24  ? -37.656 -28.475 58.896 1.00 88.60  ? 42  GLY F C     1 
ATOM   3970  O  O     . GLY F 2  24  ? -37.256 -29.070 59.905 1.00 91.21  ? 42  GLY F O     1 
ATOM   3971  N  N     . VAL F 2  25  ? -38.038 -27.202 58.923 1.00 89.89  ? 43  VAL F N     1 
ATOM   3972  C  CA    . VAL F 2  25  ? -37.977 -26.411 60.148 1.00 87.69  ? 43  VAL F CA    1 
ATOM   3973  C  C     . VAL F 2  25  ? -39.228 -26.671 60.976 1.00 89.68  ? 43  VAL F C     1 
ATOM   3974  O  O     . VAL F 2  25  ? -40.351 -26.630 60.458 1.00 91.85  ? 43  VAL F O     1 
ATOM   3975  C  CB    . VAL F 2  25  ? -37.829 -24.917 59.825 1.00 85.30  ? 43  VAL F CB    1 
ATOM   3976  C  CG1   . VAL F 2  25  ? -37.797 -24.103 61.106 1.00 87.03  ? 43  VAL F CG1   1 
ATOM   3977  C  CG2   . VAL F 2  25  ? -36.573 -24.673 58.999 1.00 81.28  ? 43  VAL F CG2   1 
ATOM   3978  N  N     . LYS F 2  26  ? -39.037 -26.934 62.268 1.00 92.25  ? 44  LYS F N     1 
ATOM   3979  C  CA    . LYS F 2  26  ? -40.135 -27.199 63.190 1.00 97.60  ? 44  LYS F CA    1 
ATOM   3980  C  C     . LYS F 2  26  ? -40.553 -25.971 63.987 1.00 102.70 ? 44  LYS F C     1 
ATOM   3981  O  O     . LYS F 2  26  ? -41.752 -25.717 64.139 1.00 104.79 ? 44  LYS F O     1 
ATOM   3982  C  CB    . LYS F 2  26  ? -39.752 -28.325 64.155 1.00 96.62  ? 44  LYS F CB    1 
ATOM   3983  C  CG    . LYS F 2  26  ? -40.800 -28.623 65.215 1.00 99.61  ? 44  LYS F CG    1 
ATOM   3984  C  CD    . LYS F 2  26  ? -40.343 -29.739 66.141 1.00 101.48 ? 44  LYS F CD    1 
ATOM   3985  C  CE    . LYS F 2  26  ? -41.392 -30.047 67.197 1.00 104.69 ? 44  LYS F CE    1 
ATOM   3986  N  NZ    . LYS F 2  26  ? -40.983 -31.184 68.067 1.00 104.87 ? 44  LYS F NZ    1 
ATOM   3987  N  N     . ARG F 2  27  ? -39.594 -25.203 64.501 1.00 101.97 ? 45  ARG F N     1 
ATOM   3988  C  CA    . ARG F 2  27  ? -39.876 -24.023 65.307 1.00 101.26 ? 45  ARG F CA    1 
ATOM   3989  C  C     . ARG F 2  27  ? -39.158 -22.830 64.694 1.00 99.10  ? 45  ARG F C     1 
ATOM   3990  O  O     . ARG F 2  27  ? -37.980 -22.929 64.337 1.00 96.08  ? 45  ARG F O     1 
ATOM   3991  C  CB    . ARG F 2  27  ? -39.436 -24.236 66.760 1.00 100.89 ? 45  ARG F CB    1 
ATOM   3992  C  CG    . ARG F 2  27  ? -40.225 -23.433 67.780 1.00 101.29 ? 45  ARG F CG    1 
ATOM   3993  C  CD    . ARG F 2  27  ? -39.897 -23.878 69.197 1.00 100.42 ? 45  ARG F CD    1 
ATOM   3994  N  NE    . ARG F 2  27  ? -40.647 -23.127 70.200 1.00 103.93 ? 45  ARG F NE    1 
ATOM   3995  C  CZ    . ARG F 2  27  ? -40.234 -21.985 70.742 1.00 105.47 ? 45  ARG F CZ    1 
ATOM   3996  N  NH1   . ARG F 2  27  ? -40.982 -21.370 71.648 1.00 108.90 ? 45  ARG F NH1   1 
ATOM   3997  N  NH2   . ARG F 2  27  ? -39.073 -21.457 70.378 1.00 102.17 ? 45  ARG F NH2   1 
ATOM   3998  N  N     . ILE F 2  28  ? -39.867 -21.710 64.570 1.00 102.30 ? 46  ILE F N     1 
ATOM   3999  C  CA    . ILE F 2  28  ? -39.371 -20.527 63.875 1.00 101.83 ? 46  ILE F CA    1 
ATOM   4000  C  C     . ILE F 2  28  ? -39.402 -19.345 64.833 1.00 103.60 ? 46  ILE F C     1 
ATOM   4001  O  O     . ILE F 2  28  ? -40.399 -19.132 65.533 1.00 107.08 ? 46  ILE F O     1 
ATOM   4002  C  CB    . ILE F 2  28  ? -40.201 -20.224 62.614 1.00 101.29 ? 46  ILE F CB    1 
ATOM   4003  C  CG1   . ILE F 2  28  ? -40.260 -21.450 61.702 1.00 100.19 ? 46  ILE F CG1   1 
ATOM   4004  C  CG2   . ILE F 2  28  ? -39.625 -19.031 61.867 1.00 100.32 ? 46  ILE F CG2   1 
ATOM   4005  C  CD1   . ILE F 2  28  ? -41.154 -21.267 60.497 1.00 101.15 ? 46  ILE F CD1   1 
ATOM   4006  N  N     . SER F 2  29  ? -38.317 -18.573 64.855 1.00 87.89  ? 47  SER F N     1 
ATOM   4007  C  CA    . SER F 2  29  ? -38.276 -17.368 65.665 1.00 90.06  ? 47  SER F CA    1 
ATOM   4008  C  C     . SER F 2  29  ? -39.108 -16.262 65.017 1.00 95.11  ? 47  SER F C     1 
ATOM   4009  O  O     . SER F 2  29  ? -39.554 -16.366 63.871 1.00 96.22  ? 47  SER F O     1 
ATOM   4010  C  CB    . SER F 2  29  ? -36.835 -16.900 65.865 1.00 89.15  ? 47  SER F CB    1 
ATOM   4011  O  OG    . SER F 2  29  ? -36.794 -15.650 66.530 1.00 92.08  ? 47  SER F OG    1 
ATOM   4012  N  N     . GLY F 2  30  ? -39.311 -15.185 65.772 1.00 99.98  ? 48  GLY F N     1 
ATOM   4013  C  CA    . GLY F 2  30  ? -40.102 -14.066 65.298 1.00 103.04 ? 48  GLY F CA    1 
ATOM   4014  C  C     . GLY F 2  30  ? -39.347 -13.160 64.349 1.00 104.35 ? 48  GLY F C     1 
ATOM   4015  O  O     . GLY F 2  30  ? -39.915 -12.660 63.374 1.00 107.26 ? 48  GLY F O     1 
ATOM   4016  N  N     . LEU F 2  31  ? -38.061 -12.943 64.621 1.00 106.03 ? 49  LEU F N     1 
ATOM   4017  C  CA    . LEU F 2  31  ? -37.231 -12.084 63.787 1.00 109.02 ? 49  LEU F CA    1 
ATOM   4018  C  C     . LEU F 2  31  ? -36.799 -12.754 62.489 1.00 105.86 ? 49  LEU F C     1 
ATOM   4019  O  O     . LEU F 2  31  ? -36.103 -12.122 61.687 1.00 111.58 ? 49  LEU F O     1 
ATOM   4020  C  CB    . LEU F 2  31  ? -35.991 -11.625 64.564 1.00 110.21 ? 49  LEU F CB    1 
ATOM   4021  C  CG    . LEU F 2  31  ? -36.164 -10.564 65.656 1.00 112.65 ? 49  LEU F CG    1 
ATOM   4022  C  CD1   . LEU F 2  31  ? -36.800 -11.137 66.917 1.00 115.41 ? 49  LEU F CD1   1 
ATOM   4023  C  CD2   . LEU F 2  31  ? -34.827 -9.914  65.978 1.00 113.26 ? 49  LEU F CD2   1 
ATOM   4024  N  N     . ILE F 2  32  ? -37.194 -14.009 62.265 1.00 98.87  ? 50  ILE F N     1 
ATOM   4025  C  CA    . ILE F 2  32  ? -36.826 -14.703 61.035 1.00 94.50  ? 50  ILE F CA    1 
ATOM   4026  C  C     . ILE F 2  32  ? -37.506 -14.065 59.831 1.00 96.63  ? 50  ILE F C     1 
ATOM   4027  O  O     . ILE F 2  32  ? -36.903 -13.930 58.759 1.00 99.72  ? 50  ILE F O     1 
ATOM   4028  C  CB    . ILE F 2  32  ? -37.169 -16.200 61.154 1.00 90.15  ? 50  ILE F CB    1 
ATOM   4029  C  CG1   . ILE F 2  32  ? -36.116 -16.927 61.992 1.00 88.82  ? 50  ILE F CG1   1 
ATOM   4030  C  CG2   . ILE F 2  32  ? -37.293 -16.843 59.780 1.00 84.88  ? 50  ILE F CG2   1 
ATOM   4031  C  CD1   . ILE F 2  32  ? -34.774 -17.034 61.308 1.00 86.88  ? 50  ILE F CD1   1 
ATOM   4032  N  N     . TYR F 2  33  ? -38.764 -13.646 59.992 1.00 95.08  ? 51  TYR F N     1 
ATOM   4033  C  CA    . TYR F 2  33  ? -39.547 -13.182 58.850 1.00 93.42  ? 51  TYR F CA    1 
ATOM   4034  C  C     . TYR F 2  33  ? -38.955 -11.916 58.241 1.00 92.99  ? 51  TYR F C     1 
ATOM   4035  O  O     . TYR F 2  33  ? -38.848 -11.805 57.014 1.00 94.41  ? 51  TYR F O     1 
ATOM   4036  C  CB    . TYR F 2  33  ? -40.997 -12.959 59.275 1.00 95.53  ? 51  TYR F CB    1 
ATOM   4037  C  CG    . TYR F 2  33  ? -41.598 -14.165 59.960 1.00 96.88  ? 51  TYR F CG    1 
ATOM   4038  C  CD1   . TYR F 2  33  ? -41.908 -15.312 59.241 1.00 98.04  ? 51  TYR F CD1   1 
ATOM   4039  C  CD2   . TYR F 2  33  ? -41.845 -14.162 61.327 1.00 97.93  ? 51  TYR F CD2   1 
ATOM   4040  C  CE1   . TYR F 2  33  ? -42.450 -16.421 59.862 1.00 98.32  ? 51  TYR F CE1   1 
ATOM   4041  C  CE2   . TYR F 2  33  ? -42.389 -15.267 61.957 1.00 99.17  ? 51  TYR F CE2   1 
ATOM   4042  C  CZ    . TYR F 2  33  ? -42.690 -16.393 61.219 1.00 98.47  ? 51  TYR F CZ    1 
ATOM   4043  O  OH    . TYR F 2  33  ? -43.231 -17.495 61.839 1.00 97.63  ? 51  TYR F OH    1 
ATOM   4044  N  N     . GLU F 2  34  ? -38.562 -10.953 59.077 1.00 94.43  ? 52  GLU F N     1 
ATOM   4045  C  CA    . GLU F 2  34  ? -37.919 -9.754  58.548 1.00 96.35  ? 52  GLU F CA    1 
ATOM   4046  C  C     . GLU F 2  34  ? -36.535 -10.058 57.992 1.00 93.31  ? 52  GLU F C     1 
ATOM   4047  O  O     . GLU F 2  34  ? -36.104 -9.420  57.025 1.00 94.09  ? 52  GLU F O     1 
ATOM   4048  C  CB    . GLU F 2  34  ? -37.838 -8.674  59.627 1.00 101.07 ? 52  GLU F CB    1 
ATOM   4049  C  CG    . GLU F 2  34  ? -39.078 -7.800  59.705 1.00 108.19 ? 52  GLU F CG    1 
ATOM   4050  C  CD    . GLU F 2  34  ? -39.334 -7.043  58.415 1.00 112.02 ? 52  GLU F CD    1 
ATOM   4051  O  OE1   . GLU F 2  34  ? -38.353 -6.651  57.747 1.00 111.53 ? 52  GLU F OE1   1 
ATOM   4052  O  OE2   . GLU F 2  34  ? -40.517 -6.846  58.064 1.00 117.21 ? 52  GLU F OE2   1 
ATOM   4053  N  N     . GLU F 2  35  ? -35.827 -11.023 58.583 1.00 91.79  ? 53  GLU F N     1 
ATOM   4054  C  CA    . GLU F 2  35  ? -34.548 -11.441 58.021 1.00 91.42  ? 53  GLU F CA    1 
ATOM   4055  C  C     . GLU F 2  35  ? -34.739 -12.179 56.702 1.00 87.02  ? 53  GLU F C     1 
ATOM   4056  O  O     . GLU F 2  35  ? -33.902 -12.061 55.800 1.00 84.38  ? 53  GLU F O     1 
ATOM   4057  C  CB    . GLU F 2  35  ? -33.796 -12.322 59.020 1.00 94.93  ? 53  GLU F CB    1 
ATOM   4058  C  CG    . GLU F 2  35  ? -32.350 -12.611 58.640 1.00 97.38  ? 53  GLU F CG    1 
ATOM   4059  C  CD    . GLU F 2  35  ? -31.415 -11.467 58.983 1.00 101.83 ? 53  GLU F CD    1 
ATOM   4060  O  OE1   . GLU F 2  35  ? -31.765 -10.655 59.865 1.00 104.97 ? 53  GLU F OE1   1 
ATOM   4061  O  OE2   . GLU F 2  35  ? -30.329 -11.381 58.371 1.00 102.05 ? 53  GLU F OE2   1 
ATOM   4062  N  N     . THR F 2  36  ? -35.832 -12.935 56.570 1.00 85.30  ? 54  THR F N     1 
ATOM   4063  C  CA    . THR F 2  36  ? -36.087 -13.668 55.333 1.00 83.69  ? 54  THR F CA    1 
ATOM   4064  C  C     . THR F 2  36  ? -36.465 -12.724 54.198 1.00 81.97  ? 54  THR F C     1 
ATOM   4065  O  O     . THR F 2  36  ? -36.034 -12.917 53.055 1.00 77.98  ? 54  THR F O     1 
ATOM   4066  C  CB    . THR F 2  36  ? -37.186 -14.707 55.555 1.00 86.92  ? 54  THR F CB    1 
ATOM   4067  O  OG1   . THR F 2  36  ? -36.808 -15.584 56.624 1.00 91.59  ? 54  THR F OG1   1 
ATOM   4068  C  CG2   . THR F 2  36  ? -37.413 -15.528 54.292 1.00 82.96  ? 54  THR F CG2   1 
ATOM   4069  N  N     . ARG F 2  37  ? -37.273 -11.701 54.492 1.00 82.93  ? 55  ARG F N     1 
ATOM   4070  C  CA    . ARG F 2  37  ? -37.642 -10.734 53.462 1.00 77.78  ? 55  ARG F CA    1 
ATOM   4071  C  C     . ARG F 2  37  ? -36.419 -9.988  52.945 1.00 74.89  ? 55  ARG F C     1 
ATOM   4072  O  O     . ARG F 2  37  ? -36.313 -9.711  51.745 1.00 78.72  ? 55  ARG F O     1 
ATOM   4073  C  CB    . ARG F 2  37  ? -38.680 -9.753  54.007 1.00 77.28  ? 55  ARG F CB    1 
ATOM   4074  C  CG    . ARG F 2  37  ? -40.012 -10.391 54.365 1.00 78.00  ? 55  ARG F CG    1 
ATOM   4075  C  CD    . ARG F 2  37  ? -41.028 -9.347  54.795 1.00 82.62  ? 55  ARG F CD    1 
ATOM   4076  N  NE    . ARG F 2  37  ? -42.298 -9.953  55.186 1.00 89.71  ? 55  ARG F NE    1 
ATOM   4077  C  CZ    . ARG F 2  37  ? -42.625 -10.262 56.436 1.00 96.00  ? 55  ARG F CZ    1 
ATOM   4078  N  NH1   . ARG F 2  37  ? -41.776 -10.018 57.425 1.00 99.18  ? 55  ARG F NH1   1 
ATOM   4079  N  NH2   . ARG F 2  37  ? -43.802 -10.813 56.700 1.00 98.67  ? 55  ARG F NH2   1 
ATOM   4080  N  N     . GLY F 2  38  ? -35.482 -9.658  53.836 1.00 71.06  ? 56  GLY F N     1 
ATOM   4081  C  CA    . GLY F 2  38  ? -34.259 -9.009  53.396 1.00 71.40  ? 56  GLY F CA    1 
ATOM   4082  C  C     . GLY F 2  38  ? -33.388 -9.920  52.552 1.00 75.13  ? 56  GLY F C     1 
ATOM   4083  O  O     . GLY F 2  38  ? -32.769 -9.475  51.581 1.00 77.38  ? 56  GLY F O     1 
ATOM   4084  N  N     . VAL F 2  39  ? -33.329 -11.206 52.907 1.00 75.52  ? 57  VAL F N     1 
ATOM   4085  C  CA    . VAL F 2  39  ? -32.548 -12.162 52.127 1.00 72.81  ? 57  VAL F CA    1 
ATOM   4086  C  C     . VAL F 2  39  ? -33.191 -12.392 50.764 1.00 69.42  ? 57  VAL F C     1 
ATOM   4087  O  O     . VAL F 2  39  ? -32.501 -12.446 49.738 1.00 64.86  ? 57  VAL F O     1 
ATOM   4088  C  CB    . VAL F 2  39  ? -32.384 -13.477 52.910 1.00 74.94  ? 57  VAL F CB    1 
ATOM   4089  C  CG1   . VAL F 2  39  ? -31.885 -14.588 51.998 1.00 77.03  ? 57  VAL F CG1   1 
ATOM   4090  C  CG2   . VAL F 2  39  ? -31.431 -13.282 54.079 1.00 72.73  ? 57  VAL F CG2   1 
ATOM   4091  N  N     . LEU F 2  40  ? -34.519 -12.532 50.730 1.00 72.40  ? 58  LEU F N     1 
ATOM   4092  C  CA    . LEU F 2  40  ? -35.216 -12.705 49.460 1.00 74.52  ? 58  LEU F CA    1 
ATOM   4093  C  C     . LEU F 2  40  ? -35.031 -11.490 48.560 1.00 82.45  ? 58  LEU F C     1 
ATOM   4094  O  O     . LEU F 2  40  ? -34.914 -11.626 47.336 1.00 86.70  ? 58  LEU F O     1 
ATOM   4095  C  CB    . LEU F 2  40  ? -36.701 -12.965 49.710 1.00 72.44  ? 58  LEU F CB    1 
ATOM   4096  C  CG    . LEU F 2  40  ? -37.620 -12.971 48.487 1.00 69.10  ? 58  LEU F CG    1 
ATOM   4097  C  CD1   . LEU F 2  40  ? -37.194 -14.039 47.493 1.00 65.20  ? 58  LEU F CD1   1 
ATOM   4098  C  CD2   . LEU F 2  40  ? -39.067 -13.170 48.906 1.00 70.60  ? 58  LEU F CD2   1 
ATOM   4099  N  N     . LYS F 2  41  ? -35.000 -10.293 49.151 1.00 84.13  ? 59  LYS F N     1 
ATOM   4100  C  CA    . LYS F 2  41  ? -34.808 -9.082  48.361 1.00 82.41  ? 59  LYS F CA    1 
ATOM   4101  C  C     . LYS F 2  41  ? -33.428 -9.059  47.716 1.00 75.84  ? 59  LYS F C     1 
ATOM   4102  O  O     . LYS F 2  41  ? -33.295 -8.744  46.528 1.00 73.94  ? 59  LYS F O     1 
ATOM   4103  C  CB    . LYS F 2  41  ? -35.018 -7.850  49.243 1.00 88.81  ? 59  LYS F CB    1 
ATOM   4104  C  CG    . LYS F 2  41  ? -35.035 -6.528  48.490 1.00 97.18  ? 59  LYS F CG    1 
ATOM   4105  C  CD    . LYS F 2  41  ? -35.509 -5.396  49.389 1.00 105.16 ? 59  LYS F CD    1 
ATOM   4106  C  CE    . LYS F 2  41  ? -35.542 -4.069  48.650 1.00 110.52 ? 59  LYS F CE    1 
ATOM   4107  N  NZ    . LYS F 2  41  ? -34.182 -3.625  48.239 1.00 114.00 ? 59  LYS F NZ    1 
ATOM   4108  N  N     . VAL F 2  42  ? -32.389 -9.404  48.482 1.00 70.74  ? 60  VAL F N     1 
ATOM   4109  C  CA    . VAL F 2  42  ? -31.033 -9.431  47.940 1.00 67.28  ? 60  VAL F CA    1 
ATOM   4110  C  C     . VAL F 2  42  ? -30.915 -10.463 46.827 1.00 66.31  ? 60  VAL F C     1 
ATOM   4111  O  O     . VAL F 2  42  ? -30.180 -10.258 45.853 1.00 65.68  ? 60  VAL F O     1 
ATOM   4112  C  CB    . VAL F 2  42  ? -30.016 -9.692  49.071 1.00 65.86  ? 60  VAL F CB    1 
ATOM   4113  C  CG1   . VAL F 2  42  ? -28.607 -9.828  48.513 1.00 63.87  ? 60  VAL F CG1   1 
ATOM   4114  C  CG2   . VAL F 2  42  ? -30.073 -8.574  50.097 1.00 68.76  ? 60  VAL F CG2   1 
ATOM   4115  N  N     . PHE F 2  43  ? -31.641 -11.579 46.940 1.00 67.77  ? 61  PHE F N     1 
ATOM   4116  C  CA    . PHE F 2  43  ? -31.610 -12.590 45.887 1.00 65.82  ? 61  PHE F CA    1 
ATOM   4117  C  C     . PHE F 2  43  ? -32.258 -12.073 44.610 1.00 65.19  ? 61  PHE F C     1 
ATOM   4118  O  O     . PHE F 2  43  ? -31.682 -12.181 43.521 1.00 65.85  ? 61  PHE F O     1 
ATOM   4119  C  CB    . PHE F 2  43  ? -32.301 -13.869 46.364 1.00 64.96  ? 61  PHE F CB    1 
ATOM   4120  C  CG    . PHE F 2  43  ? -32.407 -14.933 45.306 1.00 61.14  ? 61  PHE F CG    1 
ATOM   4121  C  CD1   . PHE F 2  43  ? -31.322 -15.740 45.003 1.00 63.38  ? 61  PHE F CD1   1 
ATOM   4122  C  CD2   . PHE F 2  43  ? -33.593 -15.129 44.616 1.00 57.22  ? 61  PHE F CD2   1 
ATOM   4123  C  CE1   . PHE F 2  43  ? -31.417 -16.720 44.030 1.00 62.38  ? 61  PHE F CE1   1 
ATOM   4124  C  CE2   . PHE F 2  43  ? -33.694 -16.106 43.642 1.00 57.44  ? 61  PHE F CE2   1 
ATOM   4125  C  CZ    . PHE F 2  43  ? -32.604 -16.903 43.350 1.00 59.31  ? 61  PHE F CZ    1 
ATOM   4126  N  N     . LEU F 2  44  ? -33.462 -11.503 44.722 1.00 66.09  ? 62  LEU F N     1 
ATOM   4127  C  CA    . LEU F 2  44  ? -34.142 -10.981 43.542 1.00 67.88  ? 62  LEU F CA    1 
ATOM   4128  C  C     . LEU F 2  44  ? -33.399 -9.797  42.937 1.00 70.88  ? 62  LEU F C     1 
ATOM   4129  O  O     . LEU F 2  44  ? -33.413 -9.621  41.714 1.00 74.17  ? 62  LEU F O     1 
ATOM   4130  C  CB    . LEU F 2  44  ? -35.576 -10.587 43.894 1.00 65.76  ? 62  LEU F CB    1 
ATOM   4131  C  CG    . LEU F 2  44  ? -36.539 -11.746 44.149 1.00 63.89  ? 62  LEU F CG    1 
ATOM   4132  C  CD1   . LEU F 2  44  ? -37.892 -11.234 44.614 1.00 63.59  ? 62  LEU F CD1   1 
ATOM   4133  C  CD2   . LEU F 2  44  ? -36.685 -12.590 42.893 1.00 65.09  ? 62  LEU F CD2   1 
ATOM   4134  N  N     . GLU F 2  45  ? -32.747 -8.979  43.767 1.00 69.31  ? 63  GLU F N     1 
ATOM   4135  C  CA    . GLU F 2  45  ? -31.985 -7.853  43.237 1.00 74.74  ? 63  GLU F CA    1 
ATOM   4136  C  C     . GLU F 2  45  ? -30.857 -8.329  42.332 1.00 74.35  ? 63  GLU F C     1 
ATOM   4137  O  O     . GLU F 2  45  ? -30.636 -7.765  41.254 1.00 79.65  ? 63  GLU F O     1 
ATOM   4138  C  CB    . GLU F 2  45  ? -31.428 -7.004  44.379 1.00 84.00  ? 63  GLU F CB    1 
ATOM   4139  C  CG    . GLU F 2  45  ? -32.442 -6.075  45.025 1.00 92.52  ? 63  GLU F CG    1 
ATOM   4140  C  CD    . GLU F 2  45  ? -31.873 -5.342  46.225 1.00 99.19  ? 63  GLU F CD    1 
ATOM   4141  O  OE1   . GLU F 2  45  ? -30.739 -5.664  46.638 1.00 100.63 ? 63  GLU F OE1   1 
ATOM   4142  O  OE2   . GLU F 2  45  ? -32.560 -4.443  46.753 1.00 102.63 ? 63  GLU F OE2   1 
ATOM   4143  N  N     . ASN F 2  46  ? -30.137 -9.373  42.748 1.00 71.27  ? 64  ASN F N     1 
ATOM   4144  C  CA    . ASN F 2  46  ? -28.996 -9.839  41.965 1.00 70.90  ? 64  ASN F CA    1 
ATOM   4145  C  C     . ASN F 2  46  ? -29.442 -10.524 40.679 1.00 70.09  ? 64  ASN F C     1 
ATOM   4146  O  O     . ASN F 2  46  ? -28.773 -10.410 39.646 1.00 69.52  ? 64  ASN F O     1 
ATOM   4147  C  CB    . ASN F 2  46  ? -28.134 -10.780 42.805 1.00 75.18  ? 64  ASN F CB    1 
ATOM   4148  C  CG    . ASN F 2  46  ? -27.510 -10.086 44.000 1.00 83.43  ? 64  ASN F CG    1 
ATOM   4149  O  OD1   . ASN F 2  46  ? -27.224 -8.890  43.957 1.00 89.73  ? 64  ASN F OD1   1 
ATOM   4150  N  ND2   . ASN F 2  46  ? -27.295 -10.835 45.075 1.00 85.47  ? 64  ASN F ND2   1 
ATOM   4151  N  N     . VAL F 2  47  ? -30.570 -11.235 40.718 1.00 71.12  ? 65  VAL F N     1 
ATOM   4152  C  CA    . VAL F 2  47  ? -31.016 -11.974 39.542 1.00 70.81  ? 65  VAL F CA    1 
ATOM   4153  C  C     . VAL F 2  47  ? -31.697 -11.049 38.541 1.00 72.77  ? 65  VAL F C     1 
ATOM   4154  O  O     . VAL F 2  47  ? -31.451 -11.138 37.333 1.00 75.43  ? 65  VAL F O     1 
ATOM   4155  C  CB    . VAL F 2  47  ? -31.936 -13.135 39.960 1.00 71.98  ? 65  VAL F CB    1 
ATOM   4156  C  CG1   . VAL F 2  47  ? -32.435 -13.879 38.735 1.00 73.06  ? 65  VAL F CG1   1 
ATOM   4157  C  CG2   . VAL F 2  47  ? -31.198 -14.084 40.893 1.00 70.25  ? 65  VAL F CG2   1 
ATOM   4158  N  N     . ILE F 2  48  ? -32.561 -10.150 39.019 1.00 73.90  ? 66  ILE F N     1 
ATOM   4159  C  CA    . ILE F 2  48  ? -33.262 -9.250  38.108 1.00 69.65  ? 66  ILE F CA    1 
ATOM   4160  C  C     . ILE F 2  48  ? -32.299 -8.239  37.494 1.00 67.38  ? 66  ILE F C     1 
ATOM   4161  O  O     . ILE F 2  48  ? -32.468 -7.838  36.336 1.00 67.22  ? 66  ILE F O     1 
ATOM   4162  C  CB    . ILE F 2  48  ? -34.432 -8.563  38.836 1.00 67.92  ? 66  ILE F CB    1 
ATOM   4163  C  CG1   . ILE F 2  48  ? -35.445 -9.609  39.305 1.00 69.07  ? 66  ILE F CG1   1 
ATOM   4164  C  CG2   . ILE F 2  48  ? -35.115 -7.551  37.934 1.00 67.71  ? 66  ILE F CG2   1 
ATOM   4165  C  CD1   . ILE F 2  48  ? -36.621 -9.028  40.058 1.00 72.63  ? 66  ILE F CD1   1 
ATOM   4166  N  N     . ARG F 2  49  ? -31.273 -7.820  38.241 1.00 65.65  ? 67  ARG F N     1 
ATOM   4167  C  CA    . ARG F 2  49  ? -30.268 -6.926  37.674 1.00 67.12  ? 67  ARG F CA    1 
ATOM   4168  C  C     . ARG F 2  49  ? -29.598 -7.551  36.457 1.00 72.59  ? 67  ARG F C     1 
ATOM   4169  O  O     . ARG F 2  49  ? -29.396 -6.882  35.437 1.00 76.32  ? 67  ARG F O     1 
ATOM   4170  C  CB    . ARG F 2  49  ? -29.220 -6.567  38.728 1.00 64.70  ? 67  ARG F CB    1 
ATOM   4171  C  CG    . ARG F 2  49  ? -28.090 -5.697  38.201 1.00 70.01  ? 67  ARG F CG    1 
ATOM   4172  C  CD    . ARG F 2  49  ? -26.979 -5.526  39.228 1.00 81.00  ? 67  ARG F CD    1 
ATOM   4173  N  NE    . ARG F 2  49  ? -27.437 -4.853  40.442 1.00 92.15  ? 67  ARG F NE    1 
ATOM   4174  C  CZ    . ARG F 2  49  ? -27.701 -5.471  41.589 1.00 94.84  ? 67  ARG F CZ    1 
ATOM   4175  N  NH1   . ARG F 2  49  ? -27.550 -6.785  41.686 1.00 92.50  ? 67  ARG F NH1   1 
ATOM   4176  N  NH2   . ARG F 2  49  ? -28.113 -4.776  42.641 1.00 96.64  ? 67  ARG F NH2   1 
ATOM   4177  N  N     . ASP F 2  50  ? -29.251 -8.838  36.543 1.00 72.07  ? 68  ASP F N     1 
ATOM   4178  C  CA    . ASP F 2  50  ? -28.623 -9.511  35.410 1.00 67.07  ? 68  ASP F CA    1 
ATOM   4179  C  C     . ASP F 2  50  ? -29.636 -9.797  34.308 1.00 62.15  ? 68  ASP F C     1 
ATOM   4180  O  O     . ASP F 2  50  ? -29.310 -9.703  33.118 1.00 60.12  ? 68  ASP F O     1 
ATOM   4181  C  CB    . ASP F 2  50  ? -27.952 -10.804 35.870 1.00 70.91  ? 68  ASP F CB    1 
ATOM   4182  C  CG    . ASP F 2  50  ? -26.778 -10.556 36.797 1.00 79.72  ? 68  ASP F CG    1 
ATOM   4183  O  OD1   . ASP F 2  50  ? -26.745 -9.492  37.449 1.00 86.61  ? 68  ASP F OD1   1 
ATOM   4184  O  OD2   . ASP F 2  50  ? -25.889 -11.430 36.876 1.00 80.35  ? 68  ASP F OD2   1 
ATOM   4185  N  N     . ALA F 2  51  ? -30.869 -10.147 34.683 1.00 60.41  ? 69  ALA F N     1 
ATOM   4186  C  CA    . ALA F 2  51  ? -31.897 -10.416 33.682 1.00 61.18  ? 69  ALA F CA    1 
ATOM   4187  C  C     . ALA F 2  51  ? -32.223 -9.164  32.876 1.00 65.68  ? 69  ALA F C     1 
ATOM   4188  O  O     . ALA F 2  51  ? -32.345 -9.223  31.647 1.00 67.32  ? 69  ALA F O     1 
ATOM   4189  C  CB    . ALA F 2  51  ? -33.155 -10.966 34.355 1.00 58.84  ? 69  ALA F CB    1 
ATOM   4190  N  N     . VAL F 2  52  ? -32.366 -8.021  33.553 1.00 64.45  ? 70  VAL F N     1 
ATOM   4191  C  CA    . VAL F 2  52  ? -32.629 -6.766  32.852 1.00 61.38  ? 70  VAL F CA    1 
ATOM   4192  C  C     . VAL F 2  52  ? -31.438 -6.385  31.982 1.00 58.97  ? 70  VAL F C     1 
ATOM   4193  O  O     . VAL F 2  52  ? -31.601 -5.843  30.881 1.00 59.27  ? 70  VAL F O     1 
ATOM   4194  C  CB    . VAL F 2  52  ? -32.980 -5.657  33.862 1.00 63.62  ? 70  VAL F CB    1 
ATOM   4195  C  CG1   . VAL F 2  52  ? -33.001 -4.297  33.184 1.00 71.13  ? 70  VAL F CG1   1 
ATOM   4196  C  CG2   . VAL F 2  52  ? -34.324 -5.944  34.512 1.00 59.63  ? 70  VAL F CG2   1 
ATOM   4197  N  N     . THR F 2  53  ? -30.222 -6.674  32.455 1.00 54.32  ? 71  THR F N     1 
ATOM   4198  C  CA    . THR F 2  53  ? -29.037 -6.438  31.637 1.00 58.89  ? 71  THR F CA    1 
ATOM   4199  C  C     . THR F 2  53  ? -29.103 -7.225  30.334 1.00 69.59  ? 71  THR F C     1 
ATOM   4200  O  O     . THR F 2  53  ? -28.738 -6.712  29.270 1.00 79.38  ? 71  THR F O     1 
ATOM   4201  C  CB    . THR F 2  53  ? -27.776 -6.805  32.421 1.00 56.23  ? 71  THR F CB    1 
ATOM   4202  O  OG1   . THR F 2  53  ? -27.716 -6.032  33.625 1.00 58.21  ? 71  THR F OG1   1 
ATOM   4203  C  CG2   . THR F 2  53  ? -26.533 -6.533  31.590 1.00 51.26  ? 71  THR F CG2   1 
ATOM   4204  N  N     . TYR F 2  54  ? -29.569 -8.475  30.396 1.00 67.50  ? 72  TYR F N     1 
ATOM   4205  C  CA    . TYR F 2  54  ? -29.767 -9.245  29.172 1.00 70.59  ? 72  TYR F CA    1 
ATOM   4206  C  C     . TYR F 2  54  ? -30.880 -8.647  28.322 1.00 73.31  ? 72  TYR F C     1 
ATOM   4207  O  O     . TYR F 2  54  ? -30.803 -8.663  27.088 1.00 77.81  ? 72  TYR F O     1 
ATOM   4208  C  CB    . TYR F 2  54  ? -30.074 -10.706 29.505 1.00 68.23  ? 72  TYR F CB    1 
ATOM   4209  C  CG    . TYR F 2  54  ? -28.858 -11.523 29.878 1.00 65.56  ? 72  TYR F CG    1 
ATOM   4210  C  CD1   . TYR F 2  54  ? -27.869 -11.795 28.941 1.00 64.83  ? 72  TYR F CD1   1 
ATOM   4211  C  CD2   . TYR F 2  54  ? -28.704 -12.034 31.161 1.00 64.13  ? 72  TYR F CD2   1 
ATOM   4212  C  CE1   . TYR F 2  54  ? -26.755 -12.543 29.274 1.00 64.03  ? 72  TYR F CE1   1 
ATOM   4213  C  CE2   . TYR F 2  54  ? -27.592 -12.784 31.504 1.00 62.41  ? 72  TYR F CE2   1 
ATOM   4214  C  CZ    . TYR F 2  54  ? -26.621 -13.035 30.555 1.00 64.06  ? 72  TYR F CZ    1 
ATOM   4215  O  OH    . TYR F 2  54  ? -25.512 -13.780 30.883 1.00 64.70  ? 72  TYR F OH    1 
ATOM   4216  N  N     . THR F 2  55  ? -31.922 -8.113  28.964 1.00 72.09  ? 73  THR F N     1 
ATOM   4217  C  CA    . THR F 2  55  ? -33.013 -7.499  28.216 1.00 75.99  ? 73  THR F CA    1 
ATOM   4218  C  C     . THR F 2  55  ? -32.561 -6.211  27.538 1.00 80.86  ? 73  THR F C     1 
ATOM   4219  O  O     . THR F 2  55  ? -32.907 -5.959  26.378 1.00 86.01  ? 73  THR F O     1 
ATOM   4220  C  CB    . THR F 2  55  ? -34.199 -7.229  29.141 1.00 76.25  ? 73  THR F CB    1 
ATOM   4221  O  OG1   . THR F 2  55  ? -34.554 -8.435  29.830 1.00 77.89  ? 73  THR F OG1   1 
ATOM   4222  C  CG2   . THR F 2  55  ? -35.398 -6.742  28.342 1.00 75.24  ? 73  THR F CG2   1 
ATOM   4223  N  N     . GLU F 2  56  ? -31.784 -5.385  28.244 1.00 81.29  ? 74  GLU F N     1 
ATOM   4224  C  CA    . GLU F 2  56  ? -31.302 -4.140  27.657 1.00 87.93  ? 74  GLU F CA    1 
ATOM   4225  C  C     . GLU F 2  56  ? -30.341 -4.395  26.504 1.00 87.17  ? 74  GLU F C     1 
ATOM   4226  O  O     . GLU F 2  56  ? -30.305 -3.613  25.546 1.00 91.44  ? 74  GLU F O     1 
ATOM   4227  C  CB    . GLU F 2  56  ? -30.624 -3.280  28.722 1.00 98.71  ? 74  GLU F CB    1 
ATOM   4228  C  CG    . GLU F 2  56  ? -31.561 -2.764  29.796 1.00 108.99 ? 74  GLU F CG    1 
ATOM   4229  C  CD    . GLU F 2  56  ? -30.833 -1.989  30.874 1.00 118.85 ? 74  GLU F CD    1 
ATOM   4230  O  OE1   . GLU F 2  56  ? -29.599 -2.149  30.990 1.00 125.38 ? 74  GLU F OE1   1 
ATOM   4231  O  OE2   . GLU F 2  56  ? -31.492 -1.219  31.605 1.00 126.74 ? 74  GLU F OE2   1 
ATOM   4232  N  N     . HIS F 2  57  ? -29.556 -5.472  26.574 1.00 81.84  ? 75  HIS F N     1 
ATOM   4233  C  CA    . HIS F 2  57  ? -28.636 -5.775  25.484 1.00 77.10  ? 75  HIS F CA    1 
ATOM   4234  C  C     . HIS F 2  57  ? -29.377 -6.239  24.238 1.00 80.51  ? 75  HIS F C     1 
ATOM   4235  O  O     . HIS F 2  57  ? -28.913 -5.999  23.117 1.00 85.23  ? 75  HIS F O     1 
ATOM   4236  C  CB    . HIS F 2  57  ? -27.624 -6.832  25.919 1.00 68.25  ? 75  HIS F CB    1 
ATOM   4237  C  CG    . HIS F 2  57  ? -26.607 -7.153  24.871 1.00 64.79  ? 75  HIS F CG    1 
ATOM   4238  N  ND1   . HIS F 2  57  ? -25.394 -6.504  24.788 1.00 65.34  ? 75  HIS F ND1   1 
ATOM   4239  C  CD2   . HIS F 2  57  ? -26.627 -8.044  23.851 1.00 66.62  ? 75  HIS F CD2   1 
ATOM   4240  C  CE1   . HIS F 2  57  ? -24.707 -6.986  23.768 1.00 69.19  ? 75  HIS F CE1   1 
ATOM   4241  N  NE2   . HIS F 2  57  ? -25.434 -7.921  23.181 1.00 69.52  ? 75  HIS F NE2   1 
ATOM   4242  N  N     . ALA F 2  58  ? -30.518 -6.902  24.408 1.00 78.17  ? 76  ALA F N     1 
ATOM   4243  C  CA    . ALA F 2  58  ? -31.333 -7.328  23.279 1.00 81.99  ? 76  ALA F CA    1 
ATOM   4244  C  C     . ALA F 2  58  ? -32.195 -6.206  22.717 1.00 85.36  ? 76  ALA F C     1 
ATOM   4245  O  O     . ALA F 2  58  ? -32.928 -6.440  21.748 1.00 88.59  ? 76  ALA F O     1 
ATOM   4246  C  CB    . ALA F 2  58  ? -32.220 -8.507  23.685 1.00 87.85  ? 76  ALA F CB    1 
ATOM   4247  N  N     . LYS F 2  59  ? -32.120 -5.005  23.296 1.00 103.56 ? 77  LYS F N     1 
ATOM   4248  C  CA    . LYS F 2  59  ? -32.922 -3.857  22.870 1.00 99.86  ? 77  LYS F CA    1 
ATOM   4249  C  C     . LYS F 2  59  ? -34.413 -4.189  22.896 1.00 96.91  ? 77  LYS F C     1 
ATOM   4250  O  O     . LYS F 2  59  ? -35.151 -3.940  21.939 1.00 98.62  ? 77  LYS F O     1 
ATOM   4251  C  CB    . LYS F 2  59  ? -32.486 -3.362  21.488 1.00 101.99 ? 77  LYS F CB    1 
ATOM   4252  C  CG    . LYS F 2  59  ? -31.073 -2.802  21.459 1.00 103.79 ? 77  LYS F CG    1 
ATOM   4253  C  CD    . LYS F 2  59  ? -30.685 -2.313  20.075 1.00 106.89 ? 77  LYS F CD    1 
ATOM   4254  C  CE    . LYS F 2  59  ? -29.288 -1.711  20.083 1.00 108.04 ? 77  LYS F CE    1 
ATOM   4255  N  NZ    . LYS F 2  59  ? -28.877 -1.222  18.737 1.00 109.77 ? 77  LYS F NZ    1 
ATOM   4256  N  N     . ARG F 2  60  ? -34.855 -4.762  24.011 1.00 94.72  ? 78  ARG F N     1 
ATOM   4257  C  CA    . ARG F 2  60  ? -36.249 -5.114  24.220 1.00 97.63  ? 78  ARG F CA    1 
ATOM   4258  C  C     . ARG F 2  60  ? -36.768 -4.443  25.485 1.00 101.22 ? 78  ARG F C     1 
ATOM   4259  O  O     . ARG F 2  60  ? -35.999 -4.030  26.358 1.00 101.13 ? 78  ARG F O     1 
ATOM   4260  C  CB    . ARG F 2  60  ? -36.434 -6.636  24.317 1.00 97.21  ? 78  ARG F CB    1 
ATOM   4261  C  CG    . ARG F 2  60  ? -36.240 -7.372  22.998 1.00 100.18 ? 78  ARG F CG    1 
ATOM   4262  C  CD    . ARG F 2  60  ? -36.498 -8.870  23.134 1.00 100.25 ? 78  ARG F CD    1 
ATOM   4263  N  NE    . ARG F 2  60  ? -35.411 -9.566  23.819 1.00 100.06 ? 78  ARG F NE    1 
ATOM   4264  C  CZ    . ARG F 2  60  ? -35.438 -9.932  25.097 1.00 95.43  ? 78  ARG F CZ    1 
ATOM   4265  N  NH1   . ARG F 2  60  ? -36.504 -9.673  25.842 1.00 96.68  ? 78  ARG F NH1   1 
ATOM   4266  N  NH2   . ARG F 2  60  ? -34.400 -10.561 25.630 1.00 88.98  ? 78  ARG F NH2   1 
ATOM   4267  N  N     . LYS F 2  61  ? -38.092 -4.331  25.570 1.00 105.83 ? 79  LYS F N     1 
ATOM   4268  C  CA    . LYS F 2  61  ? -38.758 -3.780  26.744 1.00 108.42 ? 79  LYS F CA    1 
ATOM   4269  C  C     . LYS F 2  61  ? -39.564 -4.828  27.500 1.00 106.70 ? 79  LYS F C     1 
ATOM   4270  O  O     . LYS F 2  61  ? -40.312 -4.477  28.418 1.00 106.50 ? 79  LYS F O     1 
ATOM   4271  C  CB    . LYS F 2  61  ? -39.661 -2.610  26.347 1.00 114.73 ? 79  LYS F CB    1 
ATOM   4272  C  CG    . LYS F 2  61  ? -38.915 -1.319  26.055 1.00 120.77 ? 79  LYS F CG    1 
ATOM   4273  C  CD    . LYS F 2  61  ? -39.870 -0.138  26.000 1.00 126.98 ? 79  LYS F CD    1 
ATOM   4274  C  CE    . LYS F 2  61  ? -39.123 1.180   25.878 1.00 134.67 ? 79  LYS F CE    1 
ATOM   4275  N  NZ    . LYS F 2  61  ? -40.052 2.345   25.898 1.00 139.01 ? 79  LYS F NZ    1 
ATOM   4276  N  N     . THR F 2  62  ? -39.431 -6.101  27.138 1.00 106.57 ? 80  THR F N     1 
ATOM   4277  C  CA    . THR F 2  62  ? -40.129 -7.194  27.806 1.00 105.24 ? 80  THR F CA    1 
ATOM   4278  C  C     . THR F 2  62  ? -39.101 -8.217  28.265 1.00 101.33 ? 80  THR F C     1 
ATOM   4279  O  O     . THR F 2  62  ? -38.419 -8.831  27.438 1.00 103.69 ? 80  THR F O     1 
ATOM   4280  C  CB    . THR F 2  62  ? -41.158 -7.844  26.878 1.00 109.47 ? 80  THR F CB    1 
ATOM   4281  O  OG1   . THR F 2  62  ? -42.099 -6.857  26.437 1.00 112.18 ? 80  THR F OG1   1 
ATOM   4282  C  CG2   . THR F 2  62  ? -41.901 -8.955  27.606 1.00 110.28 ? 80  THR F CG2   1 
ATOM   4283  N  N     . VAL F 2  63  ? -38.990 -8.396  29.580 1.00 97.01  ? 81  VAL F N     1 
ATOM   4284  C  CA    . VAL F 2  63  ? -38.049 -9.361  30.143 1.00 91.40  ? 81  VAL F CA    1 
ATOM   4285  C  C     . VAL F 2  63  ? -38.576 -10.763 29.854 1.00 93.98  ? 81  VAL F C     1 
ATOM   4286  O  O     . VAL F 2  63  ? -39.636 -11.153 30.350 1.00 95.28  ? 81  VAL F O     1 
ATOM   4287  C  CB    . VAL F 2  63  ? -37.848 -9.140  31.646 1.00 80.89  ? 81  VAL F CB    1 
ATOM   4288  C  CG1   . VAL F 2  63  ? -36.928 -10.207 32.217 1.00 76.15  ? 81  VAL F CG1   1 
ATOM   4289  C  CG2   . VAL F 2  63  ? -37.285 -7.753  31.904 1.00 80.97  ? 81  VAL F CG2   1 
ATOM   4290  N  N     . THR F 2  64  ? -37.838 -11.522 29.051 1.00 92.47  ? 82  THR F N     1 
ATOM   4291  C  CA    . THR F 2  64  ? -38.243 -12.867 28.681 1.00 87.45  ? 82  THR F CA    1 
ATOM   4292  C  C     . THR F 2  64  ? -37.704 -13.887 29.682 1.00 81.98  ? 82  THR F C     1 
ATOM   4293  O  O     . THR F 2  64  ? -36.827 -13.599 30.499 1.00 81.91  ? 82  THR F O     1 
ATOM   4294  C  CB    . THR F 2  64  ? -37.765 -13.203 27.267 1.00 91.00  ? 82  THR F CB    1 
ATOM   4295  O  OG1   . THR F 2  64  ? -38.194 -14.524 26.918 1.00 98.75  ? 82  THR F OG1   1 
ATOM   4296  C  CG2   . THR F 2  64  ? -36.250 -13.133 27.186 1.00 88.54  ? 82  THR F CG2   1 
ATOM   4297  N  N     . ALA F 2  65  ? -38.249 -15.104 29.605 1.00 79.75  ? 83  ALA F N     1 
ATOM   4298  C  CA    . ALA F 2  65  ? -37.830 -16.161 30.519 1.00 80.90  ? 83  ALA F CA    1 
ATOM   4299  C  C     . ALA F 2  65  ? -36.380 -16.566 30.291 1.00 83.54  ? 83  ALA F C     1 
ATOM   4300  O  O     . ALA F 2  65  ? -35.722 -17.051 31.218 1.00 86.17  ? 83  ALA F O     1 
ATOM   4301  C  CB    . ALA F 2  65  ? -38.748 -17.375 30.374 1.00 80.21  ? 83  ALA F CB    1 
ATOM   4302  N  N     . MET F 2  66  ? -35.864 -16.378 29.074 1.00 82.94  ? 84  MET F N     1 
ATOM   4303  C  CA    . MET F 2  66  ? -34.475 -16.732 28.804 1.00 81.46  ? 84  MET F CA    1 
ATOM   4304  C  C     . MET F 2  66  ? -33.515 -15.800 29.533 1.00 80.03  ? 84  MET F C     1 
ATOM   4305  O  O     . MET F 2  66  ? -32.460 -16.237 30.006 1.00 79.13  ? 84  MET F O     1 
ATOM   4306  C  CB    . MET F 2  66  ? -34.208 -16.715 27.300 1.00 84.39  ? 84  MET F CB    1 
ATOM   4307  C  CG    . MET F 2  66  ? -34.997 -17.755 26.527 1.00 87.81  ? 84  MET F CG    1 
ATOM   4308  S  SD    . MET F 2  66  ? -34.790 -19.413 27.208 1.00 90.97  ? 84  MET F SD    1 
ATOM   4309  C  CE    . MET F 2  66  ? -33.014 -19.609 27.086 1.00 91.77  ? 84  MET F CE    1 
ATOM   4310  N  N     . ASP F 2  67  ? -33.862 -14.514 29.634 1.00 78.46  ? 85  ASP F N     1 
ATOM   4311  C  CA    . ASP F 2  67  ? -33.044 -13.592 30.416 1.00 76.89  ? 85  ASP F CA    1 
ATOM   4312  C  C     . ASP F 2  67  ? -32.975 -14.028 31.873 1.00 73.59  ? 85  ASP F C     1 
ATOM   4313  O  O     . ASP F 2  67  ? -31.936 -13.878 32.528 1.00 77.85  ? 85  ASP F O     1 
ATOM   4314  C  CB    . ASP F 2  67  ? -33.597 -12.171 30.309 1.00 80.32  ? 85  ASP F CB    1 
ATOM   4315  C  CG    . ASP F 2  67  ? -33.625 -11.660 28.882 1.00 83.93  ? 85  ASP F CG    1 
ATOM   4316  O  OD1   . ASP F 2  67  ? -32.806 -12.127 28.063 1.00 87.95  ? 85  ASP F OD1   1 
ATOM   4317  O  OD2   . ASP F 2  67  ? -34.469 -10.789 28.582 1.00 83.36  ? 85  ASP F OD2   1 
ATOM   4318  N  N     . VAL F 2  68  ? -34.072 -14.576 32.397 1.00 67.11  ? 86  VAL F N     1 
ATOM   4319  C  CA    . VAL F 2  68  ? -34.065 -15.087 33.763 1.00 65.99  ? 86  VAL F CA    1 
ATOM   4320  C  C     . VAL F 2  68  ? -33.222 -16.352 33.855 1.00 69.80  ? 86  VAL F C     1 
ATOM   4321  O  O     . VAL F 2  68  ? -32.416 -16.510 34.781 1.00 74.23  ? 86  VAL F O     1 
ATOM   4322  C  CB    . VAL F 2  68  ? -35.506 -15.327 34.247 1.00 67.17  ? 86  VAL F CB    1 
ATOM   4323  C  CG1   . VAL F 2  68  ? -35.505 -15.875 35.665 1.00 70.08  ? 86  VAL F CG1   1 
ATOM   4324  C  CG2   . VAL F 2  68  ? -36.315 -14.042 34.162 1.00 66.99  ? 86  VAL F CG2   1 
ATOM   4325  N  N     . VAL F 2  69  ? -33.389 -17.270 32.899 1.00 65.87  ? 87  VAL F N     1 
ATOM   4326  C  CA    . VAL F 2  69  ? -32.617 -18.510 32.908 1.00 65.67  ? 87  VAL F CA    1 
ATOM   4327  C  C     . VAL F 2  69  ? -31.131 -18.216 32.739 1.00 69.89  ? 87  VAL F C     1 
ATOM   4328  O  O     . VAL F 2  69  ? -30.281 -18.850 33.378 1.00 76.16  ? 87  VAL F O     1 
ATOM   4329  C  CB    . VAL F 2  69  ? -33.137 -19.469 31.819 1.00 65.90  ? 87  VAL F CB    1 
ATOM   4330  C  CG1   . VAL F 2  69  ? -32.211 -20.666 31.668 1.00 61.21  ? 87  VAL F CG1   1 
ATOM   4331  C  CG2   . VAL F 2  69  ? -34.549 -19.928 32.151 1.00 65.69  ? 87  VAL F CG2   1 
ATOM   4332  N  N     . TYR F 2  70  ? -30.794 -17.246 31.886 1.00 68.67  ? 88  TYR F N     1 
ATOM   4333  C  CA    . TYR F 2  70  ? -29.393 -16.879 31.704 1.00 69.98  ? 88  TYR F CA    1 
ATOM   4334  C  C     . TYR F 2  70  ? -28.817 -16.250 32.966 1.00 68.15  ? 88  TYR F C     1 
ATOM   4335  O  O     . TYR F 2  70  ? -27.666 -16.518 33.330 1.00 67.21  ? 88  TYR F O     1 
ATOM   4336  C  CB    . TYR F 2  70  ? -29.247 -15.924 30.519 1.00 74.25  ? 88  TYR F CB    1 
ATOM   4337  C  CG    . TYR F 2  70  ? -29.550 -16.553 29.179 1.00 79.90  ? 88  TYR F CG    1 
ATOM   4338  C  CD1   . TYR F 2  70  ? -29.360 -17.912 28.968 1.00 84.31  ? 88  TYR F CD1   1 
ATOM   4339  C  CD2   . TYR F 2  70  ? -30.028 -15.787 28.124 1.00 82.11  ? 88  TYR F CD2   1 
ATOM   4340  C  CE1   . TYR F 2  70  ? -29.636 -18.490 27.744 1.00 87.77  ? 88  TYR F CE1   1 
ATOM   4341  C  CE2   . TYR F 2  70  ? -30.308 -16.356 26.898 1.00 87.27  ? 88  TYR F CE2   1 
ATOM   4342  C  CZ    . TYR F 2  70  ? -30.109 -17.707 26.713 1.00 90.31  ? 88  TYR F CZ    1 
ATOM   4343  O  OH    . TYR F 2  70  ? -30.385 -18.278 25.491 1.00 96.53  ? 88  TYR F OH    1 
ATOM   4344  N  N     . ALA F 2  71  ? -29.602 -15.408 33.644 1.00 69.05  ? 89  ALA F N     1 
ATOM   4345  C  CA    . ALA F 2  71  ? -29.120 -14.760 34.860 1.00 69.05  ? 89  ALA F CA    1 
ATOM   4346  C  C     . ALA F 2  71  ? -28.903 -15.777 35.973 1.00 66.13  ? 89  ALA F C     1 
ATOM   4347  O  O     . ALA F 2  71  ? -27.868 -15.760 36.650 1.00 63.26  ? 89  ALA F O     1 
ATOM   4348  C  CB    . ALA F 2  71  ? -30.104 -13.676 35.301 1.00 68.41  ? 89  ALA F CB    1 
ATOM   4349  N  N     . LEU F 2  72  ? -29.872 -16.671 36.177 1.00 66.84  ? 90  LEU F N     1 
ATOM   4350  C  CA    . LEU F 2  72  ? -29.718 -17.714 37.186 1.00 63.33  ? 90  LEU F CA    1 
ATOM   4351  C  C     . LEU F 2  72  ? -28.510 -18.592 36.891 1.00 64.89  ? 90  LEU F C     1 
ATOM   4352  O  O     . LEU F 2  72  ? -27.818 -19.041 37.812 1.00 69.71  ? 90  LEU F O     1 
ATOM   4353  C  CB    . LEU F 2  72  ? -30.989 -18.560 37.258 1.00 63.08  ? 90  LEU F CB    1 
ATOM   4354  C  CG    . LEU F 2  72  ? -32.248 -17.860 37.765 1.00 64.13  ? 90  LEU F CG    1 
ATOM   4355  C  CD1   . LEU F 2  72  ? -33.470 -18.724 37.502 1.00 63.68  ? 90  LEU F CD1   1 
ATOM   4356  C  CD2   . LEU F 2  72  ? -32.119 -17.547 39.246 1.00 64.30  ? 90  LEU F CD2   1 
ATOM   4357  N  N     . LYS F 2  73  ? -28.235 -18.841 35.608 1.00 65.34  ? 91  LYS F N     1 
ATOM   4358  C  CA    . LYS F 2  73  ? -27.112 -19.696 35.240 1.00 68.54  ? 91  LYS F CA    1 
ATOM   4359  C  C     . LYS F 2  73  ? -25.787 -19.092 35.690 1.00 71.09  ? 91  LYS F C     1 
ATOM   4360  O  O     . LYS F 2  73  ? -24.964 -19.771 36.317 1.00 74.24  ? 91  LYS F O     1 
ATOM   4361  C  CB    . LYS F 2  73  ? -27.111 -19.939 33.730 1.00 70.44  ? 91  LYS F CB    1 
ATOM   4362  C  CG    . LYS F 2  73  ? -26.050 -20.921 33.265 1.00 74.68  ? 91  LYS F CG    1 
ATOM   4363  C  CD    . LYS F 2  73  ? -26.146 -21.174 31.768 1.00 81.74  ? 91  LYS F CD    1 
ATOM   4364  C  CE    . LYS F 2  73  ? -27.475 -21.815 31.394 1.00 87.17  ? 91  LYS F CE    1 
ATOM   4365  N  NZ    . LYS F 2  73  ? -27.635 -23.176 31.982 1.00 89.40  ? 91  LYS F NZ    1 
ATOM   4366  N  N     . ARG F 2  74  ? -25.562 -17.811 35.384 1.00 72.24  ? 92  ARG F N     1 
ATOM   4367  C  CA    . ARG F 2  74  ? -24.301 -17.188 35.767 1.00 73.17  ? 92  ARG F CA    1 
ATOM   4368  C  C     . ARG F 2  74  ? -24.238 -16.876 37.257 1.00 72.13  ? 92  ARG F C     1 
ATOM   4369  O  O     . ARG F 2  74  ? -23.138 -16.705 37.795 1.00 74.43  ? 92  ARG F O     1 
ATOM   4370  C  CB    . ARG F 2  74  ? -24.063 -15.919 34.952 1.00 76.17  ? 92  ARG F CB    1 
ATOM   4371  C  CG    . ARG F 2  74  ? -25.007 -14.779 35.269 1.00 76.39  ? 92  ARG F CG    1 
ATOM   4372  C  CD    . ARG F 2  74  ? -24.501 -13.492 34.646 1.00 75.45  ? 92  ARG F CD    1 
ATOM   4373  N  NE    . ARG F 2  74  ? -23.068 -13.319 34.868 1.00 75.06  ? 92  ARG F NE    1 
ATOM   4374  C  CZ    . ARG F 2  74  ? -22.535 -12.835 35.986 1.00 76.89  ? 92  ARG F CZ    1 
ATOM   4375  N  NH1   . ARG F 2  74  ? -23.317 -12.475 36.994 1.00 78.78  ? 92  ARG F NH1   1 
ATOM   4376  N  NH2   . ARG F 2  74  ? -21.219 -12.713 36.099 1.00 78.05  ? 92  ARG F NH2   1 
ATOM   4377  N  N     . GLN F 2  75  ? -25.382 -16.798 37.936 1.00 68.25  ? 93  GLN F N     1 
ATOM   4378  C  CA    . GLN F 2  75  ? -25.397 -16.683 39.390 1.00 65.90  ? 93  GLN F CA    1 
ATOM   4379  C  C     . GLN F 2  75  ? -25.153 -18.015 40.088 1.00 72.89  ? 93  GLN F C     1 
ATOM   4380  O  O     . GLN F 2  75  ? -25.116 -18.051 41.323 1.00 77.90  ? 93  GLN F O     1 
ATOM   4381  C  CB    . GLN F 2  75  ? -26.730 -16.094 39.862 1.00 64.80  ? 93  GLN F CB    1 
ATOM   4382  C  CG    . GLN F 2  75  ? -26.931 -14.624 39.513 1.00 75.55  ? 93  GLN F CG    1 
ATOM   4383  C  CD    . GLN F 2  75  ? -26.097 -13.695 40.374 1.00 82.82  ? 93  GLN F CD    1 
ATOM   4384  O  OE1   . GLN F 2  75  ? -25.620 -14.078 41.442 1.00 88.38  ? 93  GLN F OE1   1 
ATOM   4385  N  NE2   . GLN F 2  75  ? -25.916 -12.464 39.911 1.00 84.61  ? 93  GLN F NE2   1 
ATOM   4386  N  N     . GLY F 2  76  ? -24.985 -19.101 39.337 1.00 70.68  ? 94  GLY F N     1 
ATOM   4387  C  CA    . GLY F 2  76  ? -24.829 -20.415 39.924 1.00 69.96  ? 94  GLY F CA    1 
ATOM   4388  C  C     . GLY F 2  76  ? -26.118 -21.087 40.332 1.00 66.98  ? 94  GLY F C     1 
ATOM   4389  O  O     . GLY F 2  76  ? -26.073 -22.103 41.037 1.00 67.31  ? 94  GLY F O     1 
ATOM   4390  N  N     . ARG F 2  77  ? -27.267 -20.557 39.914 1.00 59.57  ? 95  ARG F N     1 
ATOM   4391  C  CA    A ARG F 2  77  ? -28.556 -21.136 40.270 0.43 59.02  ? 95  ARG F CA    1 
ATOM   4392  C  CA    B ARG F 2  77  ? -28.553 -21.143 40.271 0.57 58.77  ? 95  ARG F CA    1 
ATOM   4393  C  C     . ARG F 2  77  ? -29.267 -21.665 39.030 1.00 62.74  ? 95  ARG F C     1 
ATOM   4394  O  O     . ARG F 2  77  ? -30.406 -21.274 38.753 1.00 63.99  ? 95  ARG F O     1 
ATOM   4395  C  CB    A ARG F 2  77  ? -29.433 -20.101 40.978 0.43 60.52  ? 95  ARG F CB    1 
ATOM   4396  C  CB    B ARG F 2  77  ? -29.423 -20.117 41.000 0.57 60.37  ? 95  ARG F CB    1 
ATOM   4397  C  CG    A ARG F 2  77  ? -28.807 -19.483 42.221 0.43 60.88  ? 95  ARG F CG    1 
ATOM   4398  C  CG    B ARG F 2  77  ? -28.735 -19.437 42.179 0.57 60.87  ? 95  ARG F CG    1 
ATOM   4399  C  CD    A ARG F 2  77  ? -28.650 -20.506 43.333 0.43 62.80  ? 95  ARG F CD    1 
ATOM   4400  C  CD    B ARG F 2  77  ? -28.301 -20.446 43.232 0.57 63.13  ? 95  ARG F CD    1 
ATOM   4401  N  NE    A ARG F 2  77  ? -29.914 -21.164 43.651 0.43 61.99  ? 95  ARG F NE    1 
ATOM   4402  N  NE    B ARG F 2  77  ? -27.662 -19.804 44.379 0.57 60.06  ? 95  ARG F NE    1 
ATOM   4403  C  CZ    A ARG F 2  77  ? -30.083 -22.008 44.664 0.43 56.90  ? 95  ARG F CZ    1 
ATOM   4404  C  CZ    B ARG F 2  77  ? -27.132 -20.465 45.404 0.57 55.82  ? 95  ARG F CZ    1 
ATOM   4405  N  NH1   A ARG F 2  77  ? -29.069 -22.295 45.468 0.43 45.09  ? 95  ARG F NH1   1 
ATOM   4406  N  NH1   B ARG F 2  77  ? -27.161 -21.791 45.429 0.57 51.58  ? 95  ARG F NH1   1 
ATOM   4407  N  NH2   A ARG F 2  77  ? -31.269 -22.562 44.875 0.43 54.15  ? 95  ARG F NH2   1 
ATOM   4408  N  NH2   B ARG F 2  77  ? -26.571 -19.800 46.405 0.57 53.65  ? 95  ARG F NH2   1 
ATOM   4409  N  N     . THR F 2  78  ? -28.602 -22.548 38.284 1.00 66.08  ? 96  THR F N     1 
ATOM   4410  C  CA    . THR F 2  78  ? -29.158 -23.088 37.046 1.00 70.05  ? 96  THR F CA    1 
ATOM   4411  C  C     . THR F 2  78  ? -30.544 -23.678 37.276 1.00 71.94  ? 96  THR F C     1 
ATOM   4412  O  O     . THR F 2  78  ? -30.773 -24.405 38.246 1.00 73.49  ? 96  THR F O     1 
ATOM   4413  C  CB    . THR F 2  78  ? -28.221 -24.155 36.473 1.00 74.43  ? 96  THR F CB    1 
ATOM   4414  O  OG1   . THR F 2  78  ? -26.930 -23.581 36.234 1.00 84.24  ? 96  THR F OG1   1 
ATOM   4415  C  CG2   . THR F 2  78  ? -28.770 -24.708 35.165 1.00 68.33  ? 96  THR F CG2   1 
ATOM   4416  N  N     . LEU F 2  79  ? -31.468 -23.353 36.375 1.00 73.51  ? 97  LEU F N     1 
ATOM   4417  C  CA    . LEU F 2  79  ? -32.863 -23.757 36.478 1.00 74.14  ? 97  LEU F CA    1 
ATOM   4418  C  C     . LEU F 2  79  ? -33.265 -24.529 35.229 1.00 78.33  ? 97  LEU F C     1 
ATOM   4419  O  O     . LEU F 2  79  ? -33.006 -24.080 34.108 1.00 82.82  ? 97  LEU F O     1 
ATOM   4420  C  CB    . LEU F 2  79  ? -33.767 -22.533 36.662 1.00 74.30  ? 97  LEU F CB    1 
ATOM   4421  C  CG    . LEU F 2  79  ? -35.277 -22.767 36.699 1.00 72.65  ? 97  LEU F CG    1 
ATOM   4422  C  CD1   . LEU F 2  79  ? -35.655 -23.668 37.863 1.00 71.48  ? 97  LEU F CD1   1 
ATOM   4423  C  CD2   . LEU F 2  79  ? -36.022 -21.441 36.778 1.00 71.16  ? 97  LEU F CD2   1 
ATOM   4424  N  N     . TYR F 2  80  ? -33.898 -25.682 35.424 1.00 78.01  ? 98  TYR F N     1 
ATOM   4425  C  CA    . TYR F 2  80  ? -34.403 -26.502 34.332 1.00 78.87  ? 98  TYR F CA    1 
ATOM   4426  C  C     . TYR F 2  80  ? -35.913 -26.338 34.201 1.00 80.64  ? 98  TYR F C     1 
ATOM   4427  O  O     . TYR F 2  80  ? -36.609 -26.041 35.175 1.00 79.97  ? 98  TYR F O     1 
ATOM   4428  C  CB    . TYR F 2  80  ? -34.073 -27.984 34.548 1.00 79.89  ? 98  TYR F CB    1 
ATOM   4429  C  CG    . TYR F 2  80  ? -32.619 -28.365 34.347 1.00 78.83  ? 98  TYR F CG    1 
ATOM   4430  C  CD1   . TYR F 2  80  ? -31.667 -27.416 33.995 1.00 80.27  ? 98  TYR F CD1   1 
ATOM   4431  C  CD2   . TYR F 2  80  ? -32.205 -29.684 34.496 1.00 78.24  ? 98  TYR F CD2   1 
ATOM   4432  C  CE1   . TYR F 2  80  ? -30.340 -27.769 33.809 1.00 82.84  ? 98  TYR F CE1   1 
ATOM   4433  C  CE2   . TYR F 2  80  ? -30.882 -30.047 34.309 1.00 79.33  ? 98  TYR F CE2   1 
ATOM   4434  C  CZ    . TYR F 2  80  ? -29.954 -29.086 33.967 1.00 83.18  ? 98  TYR F CZ    1 
ATOM   4435  O  OH    . TYR F 2  80  ? -28.638 -29.443 33.783 1.00 85.84  ? 98  TYR F OH    1 
ATOM   4436  N  N     . GLY F 2  81  ? -36.415 -26.538 32.981 1.00 87.36  ? 99  GLY F N     1 
ATOM   4437  C  CA    . GLY F 2  81  ? -37.839 -26.596 32.729 1.00 93.53  ? 99  GLY F CA    1 
ATOM   4438  C  C     . GLY F 2  81  ? -38.459 -25.319 32.202 1.00 92.44  ? 99  GLY F C     1 
ATOM   4439  O  O     . GLY F 2  81  ? -39.652 -25.322 31.873 1.00 91.52  ? 99  GLY F O     1 
ATOM   4440  N  N     . PHE F 2  82  ? -37.694 -24.231 32.113 1.00 94.88  ? 100 PHE F N     1 
ATOM   4441  C  CA    . PHE F 2  82  ? -38.200 -22.952 31.630 1.00 97.66  ? 100 PHE F CA    1 
ATOM   4442  C  C     . PHE F 2  82  ? -37.478 -22.510 30.362 1.00 97.47  ? 100 PHE F C     1 
ATOM   4443  O  O     . PHE F 2  82  ? -37.393 -21.317 30.067 1.00 97.39  ? 100 PHE F O     1 
ATOM   4444  C  CB    . PHE F 2  82  ? -38.086 -21.886 32.720 1.00 96.50  ? 100 PHE F CB    1 
ATOM   4445  C  CG    . PHE F 2  82  ? -39.280 -21.822 33.630 1.00 96.45  ? 100 PHE F CG    1 
ATOM   4446  C  CD1   . PHE F 2  82  ? -39.377 -22.647 34.740 1.00 95.89  ? 100 PHE F CD1   1 
ATOM   4447  C  CD2   . PHE F 2  82  ? -40.309 -20.934 33.371 1.00 98.18  ? 100 PHE F CD2   1 
ATOM   4448  C  CE1   . PHE F 2  82  ? -40.482 -22.584 35.573 1.00 97.49  ? 100 PHE F CE1   1 
ATOM   4449  C  CE2   . PHE F 2  82  ? -41.411 -20.865 34.196 1.00 99.35  ? 100 PHE F CE2   1 
ATOM   4450  C  CZ    . PHE F 2  82  ? -41.500 -21.690 35.299 1.00 98.80  ? 100 PHE F CZ    1 
ATOM   4451  N  N     . GLY F 2  83  ? -36.959 -23.468 29.604 1.00 97.15  ? 101 GLY F N     1 
ATOM   4452  C  CA    . GLY F 2  83  ? -36.215 -23.184 28.396 1.00 94.66  ? 101 GLY F CA    1 
ATOM   4453  C  C     . GLY F 2  83  ? -34.714 -23.228 28.623 1.00 94.27  ? 101 GLY F C     1 
ATOM   4454  O  O     . GLY F 2  83  ? -34.216 -23.375 29.743 1.00 95.43  ? 101 GLY F O     1 
ATOM   4455  N  N     . GLY F 2  84  ? -33.983 -23.097 27.522 1.00 94.95  ? 102 GLY F N     1 
ATOM   4456  C  CA    . GLY F 2  84  ? -32.533 -23.113 27.569 1.00 97.05  ? 102 GLY F CA    1 
ATOM   4457  C  C     . GLY F 2  84  ? -31.936 -24.501 27.451 1.00 103.14 ? 102 GLY F C     1 
ATOM   4458  O  O     . GLY F 2  84  ? -32.655 -25.495 27.337 1.00 106.27 ? 102 GLY F O     1 
ATOM   4459  O  OXT   . GLY F 2  84  ? -30.715 -24.665 27.464 1.00 103.81 ? 102 GLY F OXT   1 
ATOM   4460  N  N     . ALA G 3  1   ? 0.181   8.127   14.463 1.00 160.09 ? 14  ALA G N     1 
ATOM   4461  C  CA    . ALA G 3  1   ? 0.126   6.956   15.330 1.00 156.47 ? 14  ALA G CA    1 
ATOM   4462  C  C     . ALA G 3  1   ? 0.240   5.670   14.517 1.00 155.92 ? 14  ALA G C     1 
ATOM   4463  O  O     . ALA G 3  1   ? -0.313  5.566   13.422 1.00 159.78 ? 14  ALA G O     1 
ATOM   4464  C  CB    . ALA G 3  1   ? -1.158  6.960   16.145 1.00 154.25 ? 14  ALA G CB    1 
ATOM   4465  N  N     . LYS G 3  2   ? 0.963   4.691   15.061 1.00 152.42 ? 15  LYS G N     1 
ATOM   4466  C  CA    . LYS G 3  2   ? 1.177   3.409   14.394 1.00 146.71 ? 15  LYS G CA    1 
ATOM   4467  C  C     . LYS G 3  2   ? 0.393   2.303   15.078 1.00 139.02 ? 15  LYS G C     1 
ATOM   4468  O  O     . LYS G 3  2   ? -0.555  1.765   14.496 1.00 139.47 ? 15  LYS G O     1 
ATOM   4469  C  CB    . LYS G 3  2   ? 2.672   3.082   14.347 1.00 145.18 ? 15  LYS G CB    1 
ATOM   4470  C  CG    . LYS G 3  2   ? 3.468   3.944   13.384 1.00 145.48 ? 15  LYS G CG    1 
ATOM   4471  C  CD    . LYS G 3  2   ? 3.094   3.643   11.943 1.00 148.10 ? 15  LYS G CD    1 
ATOM   4472  C  CE    . LYS G 3  2   ? 3.407   2.199   11.586 1.00 148.66 ? 15  LYS G CE    1 
ATOM   4473  N  NZ    . LYS G 3  2   ? 3.110   1.902   10.158 1.00 151.56 ? 15  LYS G NZ    1 
ATOM   4474  N  N     . THR G 3  3   ? 0.756   1.933   16.305 1.00 129.74 ? 16  THR G N     1 
ATOM   4475  C  CA    . THR G 3  3   ? 0.055   0.872   17.011 1.00 120.78 ? 16  THR G CA    1 
ATOM   4476  C  C     . THR G 3  3   ? -1.362  1.307   17.367 1.00 115.40 ? 16  THR G C     1 
ATOM   4477  O  O     . THR G 3  3   ? -1.640  2.490   17.581 1.00 117.09 ? 16  THR G O     1 
ATOM   4478  C  CB    . THR G 3  3   ? 0.810   0.480   18.282 1.00 118.35 ? 16  THR G CB    1 
ATOM   4479  O  OG1   . THR G 3  3   ? 0.825   1.587   19.192 1.00 115.94 ? 16  THR G OG1   1 
ATOM   4480  C  CG2   . THR G 3  3   ? 2.240   0.085   17.950 1.00 120.54 ? 16  THR G CG2   1 
ATOM   4481  N  N     . ARG G 3  4   ? -2.268  0.328   17.427 1.00 110.04 ? 17  ARG G N     1 
ATOM   4482  C  CA    . ARG G 3  4   ? -3.654  0.621   17.768 1.00 105.31 ? 17  ARG G CA    1 
ATOM   4483  C  C     . ARG G 3  4   ? -3.818  1.035   19.223 1.00 100.47 ? 17  ARG G C     1 
ATOM   4484  O  O     . ARG G 3  4   ? -4.829  1.656   19.567 1.00 100.61 ? 17  ARG G O     1 
ATOM   4485  C  CB    . ARG G 3  4   ? -4.541  -0.586  17.462 1.00 105.60 ? 17  ARG G CB    1 
ATOM   4486  C  CG    . ARG G 3  4   ? -4.777  -0.808  15.978 1.00 106.46 ? 17  ARG G CG    1 
ATOM   4487  C  CD    . ARG G 3  4   ? -5.856  -1.847  15.731 1.00 105.22 ? 17  ARG G CD    1 
ATOM   4488  N  NE    . ARG G 3  4   ? -5.376  -3.208  15.946 1.00 104.39 ? 17  ARG G NE    1 
ATOM   4489  C  CZ    . ARG G 3  4   ? -6.129  -4.293  15.801 1.00 105.43 ? 17  ARG G CZ    1 
ATOM   4490  N  NH1   . ARG G 3  4   ? -7.401  -4.175  15.445 1.00 107.76 ? 17  ARG G NH1   1 
ATOM   4491  N  NH2   . ARG G 3  4   ? -5.612  -5.495  16.013 1.00 105.87 ? 17  ARG G NH2   1 
ATOM   4492  N  N     . SER G 3  5   ? -2.851  0.708   20.084 1.00 97.48  ? 18  SER G N     1 
ATOM   4493  C  CA    . SER G 3  5   ? -2.925  1.148   21.472 1.00 91.84  ? 18  SER G CA    1 
ATOM   4494  C  C     . SER G 3  5   ? -2.695  2.649   21.595 1.00 94.27  ? 18  SER G C     1 
ATOM   4495  O  O     . SER G 3  5   ? -3.257  3.288   22.492 1.00 94.56  ? 18  SER G O     1 
ATOM   4496  C  CB    . SER G 3  5   ? -1.911  0.383   22.322 1.00 84.85  ? 18  SER G CB    1 
ATOM   4497  O  OG    . SER G 3  5   ? -2.161  -1.011  22.277 1.00 85.41  ? 18  SER G OG    1 
ATOM   4498  N  N     . SER G 3  6   ? -1.880  3.227   20.710 1.00 89.60  ? 19  SER G N     1 
ATOM   4499  C  CA    . SER G 3  6   ? -1.662  4.669   20.746 1.00 89.81  ? 19  SER G CA    1 
ATOM   4500  C  C     . SER G 3  6   ? -2.896  5.424   20.268 1.00 88.55  ? 19  SER G C     1 
ATOM   4501  O  O     . SER G 3  6   ? -3.234  6.480   20.816 1.00 87.06  ? 19  SER G O     1 
ATOM   4502  C  CB    . SER G 3  6   ? -0.442  5.038   19.901 1.00 91.28  ? 19  SER G CB    1 
ATOM   4503  O  OG    . SER G 3  6   ? -0.623  4.657   18.549 1.00 92.01  ? 19  SER G OG    1 
ATOM   4504  N  N     . ARG G 3  7   ? -3.585  4.897   19.250 1.00 87.60  ? 20  ARG G N     1 
ATOM   4505  C  CA    . ARG G 3  7   ? -4.811  5.531   18.776 1.00 87.45  ? 20  ARG G CA    1 
ATOM   4506  C  C     . ARG G 3  7   ? -5.890  5.538   19.850 1.00 88.78  ? 20  ARG G C     1 
ATOM   4507  O  O     . ARG G 3  7   ? -6.777  6.400   19.834 1.00 91.80  ? 20  ARG G O     1 
ATOM   4508  C  CB    . ARG G 3  7   ? -5.328  4.819   17.525 1.00 89.26  ? 20  ARG G CB    1 
ATOM   4509  C  CG    . ARG G 3  7   ? -4.359  4.795   16.356 1.00 95.51  ? 20  ARG G CG    1 
ATOM   4510  C  CD    . ARG G 3  7   ? -4.959  4.044   15.175 1.00 102.56 ? 20  ARG G CD    1 
ATOM   4511  N  NE    . ARG G 3  7   ? -4.042  3.967   14.042 1.00 112.35 ? 20  ARG G NE    1 
ATOM   4512  C  CZ    . ARG G 3  7   ? -4.020  4.835   13.036 1.00 121.16 ? 20  ARG G CZ    1 
ATOM   4513  N  NH1   . ARG G 3  7   ? -4.869  5.853   13.017 1.00 124.05 ? 20  ARG G NH1   1 
ATOM   4514  N  NH2   . ARG G 3  7   ? -3.150  4.685   12.047 1.00 124.45 ? 20  ARG G NH2   1 
ATOM   4515  N  N     . ALA G 3  8   ? -5.838  4.590   20.782 1.00 90.02  ? 21  ALA G N     1 
ATOM   4516  C  CA    . ALA G 3  8   ? -6.812  4.493   21.860 1.00 87.67  ? 21  ALA G CA    1 
ATOM   4517  C  C     . ALA G 3  8   ? -6.300  5.064   23.174 1.00 89.45  ? 21  ALA G C     1 
ATOM   4518  O  O     . ALA G 3  8   ? -7.042  5.069   24.161 1.00 90.48  ? 21  ALA G O     1 
ATOM   4519  C  CB    . ALA G 3  8   ? -7.230  3.034   22.060 1.00 85.76  ? 21  ALA G CB    1 
ATOM   4520  N  N     . GLY G 3  9   ? -5.061  5.544   23.210 1.00 90.02  ? 22  GLY G N     1 
ATOM   4521  C  CA    . GLY G 3  9   ? -4.501  6.076   24.443 1.00 86.84  ? 22  GLY G CA    1 
ATOM   4522  C  C     . GLY G 3  9   ? -4.377  5.045   25.543 1.00 84.51  ? 22  GLY G C     1 
ATOM   4523  O  O     . GLY G 3  9   ? -4.654  5.347   26.710 1.00 83.49  ? 22  GLY G O     1 
ATOM   4524  N  N     . LEU G 3  10  ? -3.967  3.828   25.196 1.00 84.45  ? 23  LEU G N     1 
ATOM   4525  C  CA    . LEU G 3  10  ? -3.869  2.730   26.144 1.00 77.74  ? 23  LEU G CA    1 
ATOM   4526  C  C     . LEU G 3  10  ? -2.435  2.223   26.216 1.00 74.50  ? 23  LEU G C     1 
ATOM   4527  O  O     . LEU G 3  10  ? -1.634  2.418   25.296 1.00 72.27  ? 23  LEU G O     1 
ATOM   4528  C  CB    . LEU G 3  10  ? -4.806  1.577   25.760 1.00 73.04  ? 23  LEU G CB    1 
ATOM   4529  C  CG    . LEU G 3  10  ? -6.297  1.899   25.642 1.00 73.59  ? 23  LEU G CG    1 
ATOM   4530  C  CD1   . LEU G 3  10  ? -7.063  0.681   25.150 1.00 75.40  ? 23  LEU G CD1   1 
ATOM   4531  C  CD2   . LEU G 3  10  ? -6.851  2.382   26.973 1.00 70.79  ? 23  LEU G CD2   1 
ATOM   4532  N  N     . GLN G 3  11  ? -2.119  1.566   27.332 1.00 74.70  ? 24  GLN G N     1 
ATOM   4533  C  CA    . GLN G 3  11  ? -0.825  0.922   27.503 1.00 76.30  ? 24  GLN G CA    1 
ATOM   4534  C  C     . GLN G 3  11  ? -0.852  -0.554  27.135 1.00 79.93  ? 24  GLN G C     1 
ATOM   4535  O  O     . GLN G 3  11  ? 0.175   -1.097  26.715 1.00 83.56  ? 24  GLN G O     1 
ATOM   4536  C  CB    . GLN G 3  11  ? -0.340  1.074   28.949 1.00 70.88  ? 24  GLN G CB    1 
ATOM   4537  C  CG    . GLN G 3  11  ? -0.368  2.504   29.467 1.00 76.14  ? 24  GLN G CG    1 
ATOM   4538  C  CD    . GLN G 3  11  ? 0.481   3.447   28.633 1.00 86.38  ? 24  GLN G CD    1 
ATOM   4539  O  OE1   . GLN G 3  11  ? 1.545   3.073   28.140 1.00 92.18  ? 24  GLN G OE1   1 
ATOM   4540  N  NE2   . GLN G 3  11  ? 0.007   4.678   28.466 1.00 85.90  ? 24  GLN G NE2   1 
ATOM   4541  N  N     . PHE G 3  12  ? -2.004  -1.209  27.277 1.00 79.40  ? 25  PHE G N     1 
ATOM   4542  C  CA    . PHE G 3  12  ? -2.147  -2.613  26.933 1.00 81.25  ? 25  PHE G CA    1 
ATOM   4543  C  C     . PHE G 3  12  ? -2.240  -2.793  25.415 1.00 82.74  ? 25  PHE G C     1 
ATOM   4544  O  O     . PHE G 3  12  ? -2.730  -1.903  24.711 1.00 81.25  ? 25  PHE G O     1 
ATOM   4545  C  CB    . PHE G 3  12  ? -3.384  -3.197  27.609 1.00 81.03  ? 25  PHE G CB    1 
ATOM   4546  C  CG    . PHE G 3  12  ? -3.133  -3.689  29.008 1.00 80.76  ? 25  PHE G CG    1 
ATOM   4547  C  CD1   . PHE G 3  12  ? -2.785  -2.806  30.018 1.00 78.78  ? 25  PHE G CD1   1 
ATOM   4548  C  CD2   . PHE G 3  12  ? -3.248  -5.037  29.313 1.00 79.35  ? 25  PHE G CD2   1 
ATOM   4549  C  CE1   . PHE G 3  12  ? -2.555  -3.259  31.305 1.00 78.13  ? 25  PHE G CE1   1 
ATOM   4550  C  CE2   . PHE G 3  12  ? -3.020  -5.496  30.597 1.00 75.18  ? 25  PHE G CE2   1 
ATOM   4551  C  CZ    . PHE G 3  12  ? -2.674  -4.606  31.594 1.00 77.12  ? 25  PHE G CZ    1 
ATOM   4552  N  N     . PRO G 3  13  ? -1.776  -3.922  24.893 1.00 84.85  ? 26  PRO G N     1 
ATOM   4553  C  CA    . PRO G 3  13  ? -1.725  -4.119  23.435 1.00 86.80  ? 26  PRO G CA    1 
ATOM   4554  C  C     . PRO G 3  13  ? -3.096  -4.441  22.867 1.00 85.00  ? 26  PRO G C     1 
ATOM   4555  O  O     . PRO G 3  13  ? -3.681  -5.490  23.162 1.00 81.72  ? 26  PRO G O     1 
ATOM   4556  C  CB    . PRO G 3  13  ? -0.748  -5.292  23.279 1.00 85.41  ? 26  PRO G CB    1 
ATOM   4557  C  CG    . PRO G 3  13  ? -0.935  -6.081  24.528 1.00 82.61  ? 26  PRO G CG    1 
ATOM   4558  C  CD    . PRO G 3  13  ? -1.221  -5.082  25.620 1.00 81.80  ? 26  PRO G CD    1 
ATOM   4559  N  N     . VAL G 3  14  ? -3.620  -3.536  22.038 1.00 84.83  ? 27  VAL G N     1 
ATOM   4560  C  CA    . VAL G 3  14  ? -4.890  -3.799  21.372 1.00 80.90  ? 27  VAL G CA    1 
ATOM   4561  C  C     . VAL G 3  14  ? -4.719  -4.863  20.296 1.00 78.45  ? 27  VAL G C     1 
ATOM   4562  O  O     . VAL G 3  14  ? -5.623  -5.676  20.065 1.00 74.37  ? 27  VAL G O     1 
ATOM   4563  C  CB    . VAL G 3  14  ? -5.468  -2.493  20.796 1.00 79.65  ? 27  VAL G CB    1 
ATOM   4564  C  CG1   . VAL G 3  14  ? -6.758  -2.763  20.039 1.00 78.93  ? 27  VAL G CG1   1 
ATOM   4565  C  CG2   . VAL G 3  14  ? -5.699  -1.481  21.909 1.00 76.29  ? 27  VAL G CG2   1 
ATOM   4566  N  N     . GLY G 3  15  ? -3.560  -4.891  19.634 1.00 80.74  ? 28  GLY G N     1 
ATOM   4567  C  CA    . GLY G 3  15  ? -3.341  -5.876  18.588 1.00 81.13  ? 28  GLY G CA    1 
ATOM   4568  C  C     . GLY G 3  15  ? -3.269  -7.294  19.120 1.00 83.39  ? 28  GLY G C     1 
ATOM   4569  O  O     . GLY G 3  15  ? -3.732  -8.234  18.469 1.00 86.97  ? 28  GLY G O     1 
ATOM   4570  N  N     . ARG G 3  16  ? -2.687  -7.470  20.308 1.00 83.80  ? 29  ARG G N     1 
ATOM   4571  C  CA    . ARG G 3  16  ? -2.619  -8.800  20.903 1.00 79.40  ? 29  ARG G CA    1 
ATOM   4572  C  C     . ARG G 3  16  ? -3.990  -9.257  21.389 1.00 79.86  ? 29  ARG G C     1 
ATOM   4573  O  O     . ARG G 3  16  ? -4.365  -10.420 21.198 1.00 80.33  ? 29  ARG G O     1 
ATOM   4574  C  CB    . ARG G 3  16  ? -1.607  -8.813  22.048 1.00 76.77  ? 29  ARG G CB    1 
ATOM   4575  C  CG    . ARG G 3  16  ? -1.481  -10.156 22.749 1.00 74.72  ? 29  ARG G CG    1 
ATOM   4576  C  CD    . ARG G 3  16  ? -0.402  -10.130 23.819 1.00 70.37  ? 29  ARG G CD    1 
ATOM   4577  N  NE    . ARG G 3  16  ? 0.932   -9.956  23.251 1.00 69.77  ? 29  ARG G NE    1 
ATOM   4578  C  CZ    . ARG G 3  16  ? 2.055   -9.987  23.961 1.00 71.51  ? 29  ARG G CZ    1 
ATOM   4579  N  NH1   . ARG G 3  16  ? 2.008   -10.188 25.272 1.00 70.43  ? 29  ARG G NH1   1 
ATOM   4580  N  NH2   . ARG G 3  16  ? 3.226   -9.819  23.360 1.00 75.20  ? 29  ARG G NH2   1 
ATOM   4581  N  N     . VAL G 3  17  ? -4.750  -8.356  22.017 1.00 80.09  ? 30  VAL G N     1 
ATOM   4582  C  CA    . VAL G 3  17  ? -6.096  -8.698  22.475 1.00 79.43  ? 30  VAL G CA    1 
ATOM   4583  C  C     . VAL G 3  17  ? -6.985  -9.059  21.291 1.00 83.86  ? 30  VAL G C     1 
ATOM   4584  O  O     . VAL G 3  17  ? -7.835  -9.954  21.382 1.00 82.24  ? 30  VAL G O     1 
ATOM   4585  C  CB    . VAL G 3  17  ? -6.689  -7.539  23.300 1.00 73.58  ? 30  VAL G CB    1 
ATOM   4586  C  CG1   . VAL G 3  17  ? -8.138  -7.826  23.669 1.00 73.34  ? 30  VAL G CG1   1 
ATOM   4587  C  CG2   . VAL G 3  17  ? -5.861  -7.300  24.553 1.00 65.44  ? 30  VAL G CG2   1 
ATOM   4588  N  N     . HIS G 3  18  ? -6.799  -8.375  20.160 1.00 89.71  ? 31  HIS G N     1 
ATOM   4589  C  CA    . HIS G 3  18  ? -7.591  -8.679  18.973 1.00 92.12  ? 31  HIS G CA    1 
ATOM   4590  C  C     . HIS G 3  18  ? -7.277  -10.073 18.442 1.00 87.34  ? 31  HIS G C     1 
ATOM   4591  O  O     . HIS G 3  18  ? -8.184  -10.806 18.029 1.00 87.34  ? 31  HIS G O     1 
ATOM   4592  C  CB    . HIS G 3  18  ? -7.340  -7.621  17.898 1.00 98.00  ? 31  HIS G CB    1 
ATOM   4593  C  CG    . HIS G 3  18  ? -8.239  -7.740  16.707 1.00 104.40 ? 31  HIS G CG    1 
ATOM   4594  N  ND1   . HIS G 3  18  ? -9.612  -7.659  16.800 1.00 106.79 ? 31  HIS G ND1   1 
ATOM   4595  C  CD2   . HIS G 3  18  ? -7.961  -7.928  15.396 1.00 110.57 ? 31  HIS G CD2   1 
ATOM   4596  C  CE1   . HIS G 3  18  ? -10.141 -7.795  15.597 1.00 111.92 ? 31  HIS G CE1   1 
ATOM   4597  N  NE2   . HIS G 3  18  ? -9.161  -7.960  14.727 1.00 114.44 ? 31  HIS G NE2   1 
ATOM   4598  N  N     . ARG G 3  19  ? -5.998  -10.457 18.450 1.00 85.73  ? 32  ARG G N     1 
ATOM   4599  C  CA    . ARG G 3  19  ? -5.618  -11.788 17.988 1.00 85.55  ? 32  ARG G CA    1 
ATOM   4600  C  C     . ARG G 3  19  ? -6.123  -12.868 18.937 1.00 86.09  ? 32  ARG G C     1 
ATOM   4601  O  O     . ARG G 3  19  ? -6.573  -13.931 18.494 1.00 86.95  ? 32  ARG G O     1 
ATOM   4602  C  CB    . ARG G 3  19  ? -4.100  -11.874 17.840 1.00 83.09  ? 32  ARG G CB    1 
ATOM   4603  C  CG    . ARG G 3  19  ? -3.582  -13.257 17.488 1.00 81.89  ? 32  ARG G CG    1 
ATOM   4604  C  CD    . ARG G 3  19  ? -2.159  -13.439 17.985 1.00 83.17  ? 32  ARG G CD    1 
ATOM   4605  N  NE    . ARG G 3  19  ? -2.095  -13.468 19.444 1.00 78.41  ? 32  ARG G NE    1 
ATOM   4606  C  CZ    . ARG G 3  19  ? -0.977  -13.324 20.148 1.00 75.94  ? 32  ARG G CZ    1 
ATOM   4607  N  NH1   . ARG G 3  19  ? 0.179   -13.129 19.528 1.00 78.55  ? 32  ARG G NH1   1 
ATOM   4608  N  NH2   . ARG G 3  19  ? -1.015  -13.368 21.472 1.00 76.92  ? 32  ARG G NH2   1 
ATOM   4609  N  N     . LEU G 3  20  ? -6.054  -12.611 20.246 1.00 82.86  ? 33  LEU G N     1 
ATOM   4610  C  CA    . LEU G 3  20  ? -6.513  -13.596 21.220 1.00 76.90  ? 33  LEU G CA    1 
ATOM   4611  C  C     . LEU G 3  20  ? -8.015  -13.828 21.107 1.00 79.51  ? 33  LEU G C     1 
ATOM   4612  O  O     . LEU G 3  20  ? -8.488  -14.961 21.256 1.00 87.26  ? 33  LEU G O     1 
ATOM   4613  C  CB    . LEU G 3  20  ? -6.141  -13.146 22.632 1.00 63.72  ? 33  LEU G CB    1 
ATOM   4614  C  CG    . LEU G 3  20  ? -4.654  -13.167 22.987 1.00 63.59  ? 33  LEU G CG    1 
ATOM   4615  C  CD1   . LEU G 3  20  ? -4.422  -12.568 24.363 1.00 67.34  ? 33  LEU G CD1   1 
ATOM   4616  C  CD2   . LEU G 3  20  ? -4.112  -14.586 22.922 1.00 63.16  ? 33  LEU G CD2   1 
ATOM   4617  N  N     . LEU G 3  21  ? -8.781  -12.767 20.842 1.00 78.79  ? 34  LEU G N     1 
ATOM   4618  C  CA    . LEU G 3  21  ? -10.222 -12.921 20.668 1.00 81.71  ? 34  LEU G CA    1 
ATOM   4619  C  C     . LEU G 3  21  ? -10.544 -13.758 19.436 1.00 88.47  ? 34  LEU G C     1 
ATOM   4620  O  O     . LEU G 3  21  ? -11.416 -14.635 19.482 1.00 88.86  ? 34  LEU G O     1 
ATOM   4621  C  CB    . LEU G 3  21  ? -10.888 -11.548 20.569 1.00 81.82  ? 34  LEU G CB    1 
ATOM   4622  C  CG    . LEU G 3  21  ? -10.970 -10.714 21.847 1.00 77.57  ? 34  LEU G CG    1 
ATOM   4623  C  CD1   . LEU G 3  21  ? -11.394 -9.292  21.519 1.00 79.18  ? 34  LEU G CD1   1 
ATOM   4624  C  CD2   . LEU G 3  21  ? -11.936 -11.345 22.833 1.00 63.10  ? 34  LEU G CD2   1 
ATOM   4625  N  N     . ARG G 3  22  ? -9.850  -13.503 18.325 1.00 95.43  ? 35  ARG G N     1 
ATOM   4626  C  CA    . ARG G 3  22  ? -10.109 -14.251 17.099 1.00 101.11 ? 35  ARG G CA    1 
ATOM   4627  C  C     . ARG G 3  22  ? -9.667  -15.703 17.235 1.00 98.81  ? 35  ARG G C     1 
ATOM   4628  O  O     . ARG G 3  22  ? -10.396 -16.623 16.848 1.00 101.62 ? 35  ARG G O     1 
ATOM   4629  C  CB    . ARG G 3  22  ? -9.411  -13.579 15.915 1.00 110.39 ? 35  ARG G CB    1 
ATOM   4630  C  CG    . ARG G 3  22  ? -10.078 -12.293 15.459 1.00 120.80 ? 35  ARG G CG    1 
ATOM   4631  C  CD    . ARG G 3  22  ? -9.438  -11.739 14.193 1.00 131.12 ? 35  ARG G CD    1 
ATOM   4632  N  NE    . ARG G 3  22  ? -8.241  -10.950 14.471 1.00 138.58 ? 35  ARG G NE    1 
ATOM   4633  C  CZ    . ARG G 3  22  ? -6.998  -11.415 14.385 1.00 145.49 ? 35  ARG G CZ    1 
ATOM   4634  N  NH1   . ARG G 3  22  ? -6.780  -12.672 14.025 1.00 149.97 ? 35  ARG G NH1   1 
ATOM   4635  N  NH2   . ARG G 3  22  ? -5.972  -10.620 14.656 1.00 145.74 ? 35  ARG G NH2   1 
ATOM   4636  N  N     . LYS G 3  23  ? -8.475  -15.928 17.787 1.00 96.46  ? 36  LYS G N     1 
ATOM   4637  C  CA    . LYS G 3  23  ? -7.940  -17.269 17.972 1.00 92.26  ? 36  LYS G CA    1 
ATOM   4638  C  C     . LYS G 3  23  ? -8.411  -17.916 19.271 1.00 90.02  ? 36  LYS G C     1 
ATOM   4639  O  O     . LYS G 3  23  ? -7.800  -18.890 19.726 1.00 92.33  ? 36  LYS G O     1 
ATOM   4640  C  CB    . LYS G 3  23  ? -6.411  -17.236 17.925 1.00 90.06  ? 36  LYS G CB    1 
ATOM   4641  C  CG    . LYS G 3  23  ? -5.846  -16.876 16.561 1.00 93.01  ? 36  LYS G CG    1 
ATOM   4642  C  CD    . LYS G 3  23  ? -4.325  -16.869 16.572 1.00 95.71  ? 36  LYS G CD    1 
ATOM   4643  C  CE    . LYS G 3  23  ? -3.764  -16.644 15.173 1.00 100.75 ? 36  LYS G CE    1 
ATOM   4644  N  NZ    . LYS G 3  23  ? -4.270  -15.383 14.562 1.00 105.00 ? 36  LYS G NZ    1 
ATOM   4645  N  N     . GLY G 3  24  ? -9.479  -17.402 19.874 1.00 84.78  ? 37  GLY G N     1 
ATOM   4646  C  CA    . GLY G 3  24  ? -9.967  -17.939 21.129 1.00 79.63  ? 37  GLY G CA    1 
ATOM   4647  C  C     . GLY G 3  24  ? -11.315 -18.616 21.003 1.00 78.83  ? 37  GLY G C     1 
ATOM   4648  O  O     . GLY G 3  24  ? -11.878 -19.086 21.997 1.00 78.26  ? 37  GLY G O     1 
ATOM   4649  N  N     . ASN G 3  25  ? -11.837 -18.669 19.778 1.00 81.10  ? 38  ASN G N     1 
ATOM   4650  C  CA    . ASN G 3  25  ? -13.129 -19.287 19.484 1.00 85.61  ? 38  ASN G CA    1 
ATOM   4651  C  C     . ASN G 3  25  ? -14.236 -18.695 20.354 1.00 82.37  ? 38  ASN G C     1 
ATOM   4652  O  O     . ASN G 3  25  ? -14.962 -19.403 21.055 1.00 81.49  ? 38  ASN G O     1 
ATOM   4653  C  CB    . ASN G 3  25  ? -13.060 -20.809 19.641 1.00 89.64  ? 38  ASN G CB    1 
ATOM   4654  C  CG    . ASN G 3  25  ? -12.283 -21.477 18.524 1.00 95.31  ? 38  ASN G CG    1 
ATOM   4655  O  OD1   . ASN G 3  25  ? -11.264 -22.126 18.764 1.00 102.64 ? 38  ASN G OD1   1 
ATOM   4656  N  ND2   . ASN G 3  25  ? -12.762 -21.324 17.294 1.00 95.17  ? 38  ASN G ND2   1 
ATOM   4657  N  N     . TYR G 3  26  ? -14.352 -17.370 20.310 1.00 80.18  ? 39  TYR G N     1 
ATOM   4658  C  CA    . TYR G 3  26  ? -15.434 -16.675 20.993 1.00 74.64  ? 39  TYR G CA    1 
ATOM   4659  C  C     . TYR G 3  26  ? -16.571 -16.291 20.060 1.00 73.43  ? 39  TYR G C     1 
ATOM   4660  O  O     . TYR G 3  26  ? -17.727 -16.243 20.494 1.00 68.22  ? 39  TYR G O     1 
ATOM   4661  C  CB    . TYR G 3  26  ? -14.905 -15.418 21.692 1.00 72.64  ? 39  TYR G CB    1 
ATOM   4662  C  CG    . TYR G 3  26  ? -13.824 -15.693 22.713 1.00 68.73  ? 39  TYR G CG    1 
ATOM   4663  C  CD1   . TYR G 3  26  ? -14.139 -16.203 23.966 1.00 65.38  ? 39  TYR G CD1   1 
ATOM   4664  C  CD2   . TYR G 3  26  ? -12.490 -15.439 22.424 1.00 70.86  ? 39  TYR G CD2   1 
ATOM   4665  C  CE1   . TYR G 3  26  ? -13.153 -16.459 24.901 1.00 65.65  ? 39  TYR G CE1   1 
ATOM   4666  C  CE2   . TYR G 3  26  ? -11.497 -15.689 23.353 1.00 70.33  ? 39  TYR G CE2   1 
ATOM   4667  C  CZ    . TYR G 3  26  ? -11.834 -16.199 24.589 1.00 66.92  ? 39  TYR G CZ    1 
ATOM   4668  O  OH    . TYR G 3  26  ? -10.850 -16.450 25.517 1.00 64.38  ? 39  TYR G OH    1 
ATOM   4669  N  N     . ALA G 3  27  ? -16.267 -16.021 18.793 1.00 76.38  ? 40  ALA G N     1 
ATOM   4670  C  CA    . ALA G 3  27  ? -17.273 -15.722 17.784 1.00 80.86  ? 40  ALA G CA    1 
ATOM   4671  C  C     . ALA G 3  27  ? -16.624 -15.850 16.416 1.00 90.89  ? 40  ALA G C     1 
ATOM   4672  O  O     . ALA G 3  27  ? -15.396 -15.856 16.290 1.00 92.96  ? 40  ALA G O     1 
ATOM   4673  C  CB    . ALA G 3  27  ? -17.872 -14.323 17.968 1.00 78.45  ? 40  ALA G CB    1 
ATOM   4674  N  N     . GLU G 3  28  ? -17.468 -15.954 15.389 1.00 100.02 ? 41  GLU G N     1 
ATOM   4675  C  CA    . GLU G 3  28  ? -16.955 -16.072 14.028 1.00 111.73 ? 41  GLU G CA    1 
ATOM   4676  C  C     . GLU G 3  28  ? -16.224 -14.804 13.603 1.00 117.14 ? 41  GLU G C     1 
ATOM   4677  O  O     . GLU G 3  28  ? -15.185 -14.873 12.936 1.00 118.10 ? 41  GLU G O     1 
ATOM   4678  C  CB    . GLU G 3  28  ? -18.098 -16.388 13.064 1.00 120.04 ? 41  GLU G CB    1 
ATOM   4679  C  CG    . GLU G 3  28  ? -17.645 -16.727 11.653 1.00 132.20 ? 41  GLU G CG    1 
ATOM   4680  C  CD    . GLU G 3  28  ? -18.805 -17.062 10.736 1.00 143.86 ? 41  GLU G CD    1 
ATOM   4681  O  OE1   . GLU G 3  28  ? -19.954 -16.710 11.077 1.00 147.55 ? 41  GLU G OE1   1 
ATOM   4682  O  OE2   . GLU G 3  28  ? -18.568 -17.681 9.677  1.00 150.87 ? 41  GLU G OE2   1 
ATOM   4683  N  N     . ARG G 3  29  ? -16.745 -13.640 13.986 1.00 89.93  ? 42  ARG G N     1 
ATOM   4684  C  CA    . ARG G 3  29  ? -16.137 -12.361 13.653 1.00 93.41  ? 42  ARG G CA    1 
ATOM   4685  C  C     . ARG G 3  29  ? -15.960 -11.534 14.920 1.00 88.95  ? 42  ARG G C     1 
ATOM   4686  O  O     . ARG G 3  29  ? -16.701 -11.694 15.894 1.00 85.19  ? 42  ARG G O     1 
ATOM   4687  C  CB    . ARG G 3  29  ? -16.980 -11.588 12.623 1.00 99.70  ? 42  ARG G CB    1 
ATOM   4688  C  CG    . ARG G 3  29  ? -17.187 -12.344 11.317 1.00 106.50 ? 42  ARG G CG    1 
ATOM   4689  C  CD    . ARG G 3  29  ? -17.907 -11.514 10.263 1.00 115.53 ? 42  ARG G CD    1 
ATOM   4690  N  NE    . ARG G 3  29  ? -19.247 -11.115 10.682 1.00 124.13 ? 42  ARG G NE    1 
ATOM   4691  C  CZ    . ARG G 3  29  ? -19.642 -9.854  10.825 1.00 134.27 ? 42  ARG G CZ    1 
ATOM   4692  N  NH1   . ARG G 3  29  ? -18.801 -8.861  10.570 1.00 139.56 ? 42  ARG G NH1   1 
ATOM   4693  N  NH2   . ARG G 3  29  ? -20.880 -9.583  11.213 1.00 137.86 ? 42  ARG G NH2   1 
ATOM   4694  N  N     . VAL G 3  30  ? -14.963 -10.654 14.900 1.00 87.70  ? 43  VAL G N     1 
ATOM   4695  C  CA    . VAL G 3  30  ? -14.637 -9.796  16.033 1.00 83.31  ? 43  VAL G CA    1 
ATOM   4696  C  C     . VAL G 3  30  ? -14.643 -8.350  15.559 1.00 83.88  ? 43  VAL G C     1 
ATOM   4697  O  O     . VAL G 3  30  ? -13.958 -8.004  14.589 1.00 83.43  ? 43  VAL G O     1 
ATOM   4698  C  CB    . VAL G 3  30  ? -13.275 -10.161 16.653 1.00 77.97  ? 43  VAL G CB    1 
ATOM   4699  C  CG1   . VAL G 3  30  ? -12.885 -9.142  17.716 1.00 73.54  ? 43  VAL G CG1   1 
ATOM   4700  C  CG2   . VAL G 3  30  ? -13.318 -11.565 17.242 1.00 73.35  ? 43  VAL G CG2   1 
ATOM   4701  N  N     . GLY G 3  31  ? -15.418 -7.510  16.241 1.00 83.81  ? 44  GLY G N     1 
ATOM   4702  C  CA    . GLY G 3  31  ? -15.471 -6.108  15.886 1.00 83.27  ? 44  GLY G CA    1 
ATOM   4703  C  C     . GLY G 3  31  ? -14.163 -5.393  16.163 1.00 83.31  ? 44  GLY G C     1 
ATOM   4704  O  O     . GLY G 3  31  ? -13.301 -5.867  16.905 1.00 82.54  ? 44  GLY G O     1 
ATOM   4705  N  N     . ALA G 3  32  ? -14.013 -4.218  15.548 1.00 83.94  ? 45  ALA G N     1 
ATOM   4706  C  CA    . ALA G 3  32  ? -12.778 -3.464  15.725 1.00 82.02  ? 45  ALA G CA    1 
ATOM   4707  C  C     . ALA G 3  32  ? -12.721 -2.796  17.093 1.00 80.39  ? 45  ALA G C     1 
ATOM   4708  O  O     . ALA G 3  32  ? -11.628 -2.543  17.614 1.00 82.05  ? 45  ALA G O     1 
ATOM   4709  C  CB    . ALA G 3  32  ? -12.632 -2.420  14.619 1.00 84.92  ? 45  ALA G CB    1 
ATOM   4710  N  N     . GLY G 3  33  ? -13.878 -2.506  17.692 1.00 77.60  ? 46  GLY G N     1 
ATOM   4711  C  CA    . GLY G 3  33  ? -13.934 -1.885  19.002 1.00 78.71  ? 46  GLY G CA    1 
ATOM   4712  C  C     . GLY G 3  33  ? -13.862 -2.831  20.179 1.00 78.17  ? 46  GLY G C     1 
ATOM   4713  O  O     . GLY G 3  33  ? -13.686 -2.380  21.316 1.00 76.06  ? 46  GLY G O     1 
ATOM   4714  N  N     . ALA G 3  34  ? -13.996 -4.140  19.938 1.00 74.93  ? 47  ALA G N     1 
ATOM   4715  C  CA    . ALA G 3  34  ? -13.929 -5.097  21.041 1.00 67.99  ? 47  ALA G CA    1 
ATOM   4716  C  C     . ALA G 3  34  ? -12.547 -5.148  21.685 1.00 65.86  ? 47  ALA G C     1 
ATOM   4717  O  O     . ALA G 3  34  ? -12.467 -5.052  22.922 1.00 65.67  ? 47  ALA G O     1 
ATOM   4718  C  CB    . ALA G 3  34  ? -14.386 -6.479  20.564 1.00 67.61  ? 47  ALA G CB    1 
ATOM   4719  N  N     . PRO G 3  35  ? -11.438 -5.295  20.945 1.00 67.83  ? 48  PRO G N     1 
ATOM   4720  C  CA    . PRO G 3  35  ? -10.135 -5.333  21.629 1.00 69.40  ? 48  PRO G CA    1 
ATOM   4721  C  C     . PRO G 3  35  ? -9.764  -4.015  22.284 1.00 70.61  ? 48  PRO G C     1 
ATOM   4722  O  O     . PRO G 3  35  ? -9.077  -4.023  23.313 1.00 68.98  ? 48  PRO G O     1 
ATOM   4723  C  CB    . PRO G 3  35  ? -9.157  -5.702  20.504 1.00 68.59  ? 48  PRO G CB    1 
ATOM   4724  C  CG    . PRO G 3  35  ? -9.813  -5.208  19.273 1.00 70.41  ? 48  PRO G CG    1 
ATOM   4725  C  CD    . PRO G 3  35  ? -11.281 -5.439  19.485 1.00 68.29  ? 48  PRO G CD    1 
ATOM   4726  N  N     . VAL G 3  36  ? -10.200 -2.885  21.722 1.00 67.58  ? 49  VAL G N     1 
ATOM   4727  C  CA    . VAL G 3  36  ? -9.944  -1.591  22.351 1.00 65.30  ? 49  VAL G CA    1 
ATOM   4728  C  C     . VAL G 3  36  ? -10.652 -1.509  23.698 1.00 62.37  ? 49  VAL G C     1 
ATOM   4729  O  O     . VAL G 3  36  ? -10.051 -1.150  24.717 1.00 60.14  ? 49  VAL G O     1 
ATOM   4730  C  CB    . VAL G 3  36  ? -10.378 -0.445  21.420 1.00 67.20  ? 49  VAL G CB    1 
ATOM   4731  C  CG1   . VAL G 3  36  ? -10.227 0.895   22.122 1.00 64.67  ? 49  VAL G CG1   1 
ATOM   4732  C  CG2   . VAL G 3  36  ? -9.576  -0.476  20.129 1.00 66.36  ? 49  VAL G CG2   1 
ATOM   4733  N  N     . TYR G 3  37  ? -11.943 -1.847  23.719 1.00 60.53  ? 50  TYR G N     1 
ATOM   4734  C  CA    . TYR G 3  37  ? -12.709 -1.796  24.961 1.00 59.65  ? 50  TYR G CA    1 
ATOM   4735  C  C     . TYR G 3  37  ? -12.137 -2.759  25.994 1.00 61.89  ? 50  TYR G C     1 
ATOM   4736  O  O     . TYR G 3  37  ? -11.947 -2.396  27.161 1.00 65.08  ? 50  TYR G O     1 
ATOM   4737  C  CB    . TYR G 3  37  ? -14.177 -2.119  24.673 1.00 60.60  ? 50  TYR G CB    1 
ATOM   4738  C  CG    . TYR G 3  37  ? -15.156 -1.659  25.734 1.00 63.57  ? 50  TYR G CG    1 
ATOM   4739  C  CD1   . TYR G 3  37  ? -15.142 -2.205  27.010 1.00 67.23  ? 50  TYR G CD1   1 
ATOM   4740  C  CD2   . TYR G 3  37  ? -16.111 -0.694  25.449 1.00 67.48  ? 50  TYR G CD2   1 
ATOM   4741  C  CE1   . TYR G 3  37  ? -16.038 -1.791  27.976 1.00 66.13  ? 50  TYR G CE1   1 
ATOM   4742  C  CE2   . TYR G 3  37  ? -17.012 -0.276  26.409 1.00 69.97  ? 50  TYR G CE2   1 
ATOM   4743  C  CZ    . TYR G 3  37  ? -16.970 -0.827  27.669 1.00 66.65  ? 50  TYR G CZ    1 
ATOM   4744  O  OH    . TYR G 3  37  ? -17.864 -0.414  28.625 1.00 65.96  ? 50  TYR G OH    1 
ATOM   4745  N  N     . LEU G 3  38  ? -11.850 -3.994  25.577 1.00 61.56  ? 51  LEU G N     1 
ATOM   4746  C  CA    . LEU G 3  38  ? -11.391 -5.012  26.517 1.00 58.18  ? 51  LEU G CA    1 
ATOM   4747  C  C     . LEU G 3  38  ? -10.016 -4.674  27.081 1.00 57.20  ? 51  LEU G C     1 
ATOM   4748  O  O     . LEU G 3  38  ? -9.790  -4.798  28.291 1.00 54.56  ? 51  LEU G O     1 
ATOM   4749  C  CB    . LEU G 3  38  ? -11.379 -6.378  25.834 1.00 60.73  ? 51  LEU G CB    1 
ATOM   4750  C  CG    . LEU G 3  38  ? -10.868 -7.584  26.624 1.00 59.75  ? 51  LEU G CG    1 
ATOM   4751  C  CD1   . LEU G 3  38  ? -11.577 -7.717  27.962 1.00 56.90  ? 51  LEU G CD1   1 
ATOM   4752  C  CD2   . LEU G 3  38  ? -11.060 -8.837  25.793 1.00 61.25  ? 51  LEU G CD2   1 
ATOM   4753  N  N     . ALA G 3  39  ? -9.083  -4.246  26.226 1.00 61.35  ? 52  ALA G N     1 
ATOM   4754  C  CA    . ALA G 3  39  ? -7.755  -3.884  26.714 1.00 60.85  ? 52  ALA G CA    1 
ATOM   4755  C  C     . ALA G 3  39  ? -7.810  -2.680  27.644 1.00 63.63  ? 52  ALA G C     1 
ATOM   4756  O  O     . ALA G 3  39  ? -6.964  -2.544  28.536 1.00 63.92  ? 52  ALA G O     1 
ATOM   4757  C  CB    . ALA G 3  39  ? -6.816  -3.605  25.541 1.00 60.03  ? 52  ALA G CB    1 
ATOM   4758  N  N     . ALA G 3  40  ? -8.795  -1.798  27.453 1.00 66.28  ? 53  ALA G N     1 
ATOM   4759  C  CA    . ALA G 3  40  ? -8.953  -0.661  28.353 1.00 64.10  ? 53  ALA G CA    1 
ATOM   4760  C  C     . ALA G 3  40  ? -9.483  -1.104  29.711 1.00 63.08  ? 53  ALA G C     1 
ATOM   4761  O  O     . ALA G 3  40  ? -9.052  -0.588  30.749 1.00 67.71  ? 53  ALA G O     1 
ATOM   4762  C  CB    . ALA G 3  40  ? -9.880  0.381   27.727 1.00 62.71  ? 53  ALA G CB    1 
ATOM   4763  N  N     . VAL G 3  41  ? -10.419 -2.056  29.723 1.00 57.90  ? 54  VAL G N     1 
ATOM   4764  C  CA    . VAL G 3  41  ? -10.942 -2.569  30.986 1.00 57.02  ? 54  VAL G CA    1 
ATOM   4765  C  C     . VAL G 3  41  ? -9.866  -3.349  31.730 1.00 57.69  ? 54  VAL G C     1 
ATOM   4766  O  O     . VAL G 3  41  ? -9.748  -3.257  32.958 1.00 62.60  ? 54  VAL G O     1 
ATOM   4767  C  CB    . VAL G 3  41  ? -12.195 -3.426  30.735 1.00 54.00  ? 54  VAL G CB    1 
ATOM   4768  C  CG1   . VAL G 3  41  ? -12.657 -4.091  32.021 1.00 51.07  ? 54  VAL G CG1   1 
ATOM   4769  C  CG2   . VAL G 3  41  ? -13.307 -2.574  30.144 1.00 51.14  ? 54  VAL G CG2   1 
ATOM   4770  N  N     . LEU G 3  42  ? -9.061  -4.124  31.001 1.00 56.53  ? 55  LEU G N     1 
ATOM   4771  C  CA    . LEU G 3  42  ? -7.964  -4.847  31.632 1.00 59.09  ? 55  LEU G CA    1 
ATOM   4772  C  C     . LEU G 3  42  ? -6.909  -3.895  32.182 1.00 58.87  ? 55  LEU G C     1 
ATOM   4773  O  O     . LEU G 3  42  ? -6.268  -4.201  33.192 1.00 54.70  ? 55  LEU G O     1 
ATOM   4774  C  CB    . LEU G 3  42  ? -7.337  -5.823  30.636 1.00 62.63  ? 55  LEU G CB    1 
ATOM   4775  C  CG    . LEU G 3  42  ? -8.256  -6.934  30.122 1.00 60.91  ? 55  LEU G CG    1 
ATOM   4776  C  CD1   . LEU G 3  42  ? -7.596  -7.695  28.985 1.00 63.58  ? 55  LEU G CD1   1 
ATOM   4777  C  CD2   . LEU G 3  42  ? -8.637  -7.877  31.252 1.00 55.35  ? 55  LEU G CD2   1 
ATOM   4778  N  N     . GLU G 3  43  ? -6.719  -2.740  31.538 1.00 63.77  ? 56  GLU G N     1 
ATOM   4779  C  CA    . GLU G 3  43  ? -5.757  -1.766  32.044 1.00 64.80  ? 56  GLU G CA    1 
ATOM   4780  C  C     . GLU G 3  43  ? -6.273  -1.085  33.306 1.00 60.97  ? 56  GLU G C     1 
ATOM   4781  O  O     . GLU G 3  43  ? -5.499  -0.817  34.233 1.00 58.29  ? 56  GLU G O     1 
ATOM   4782  C  CB    . GLU G 3  43  ? -5.436  -0.730  30.967 1.00 71.35  ? 56  GLU G CB    1 
ATOM   4783  C  CG    . GLU G 3  43  ? -4.444  0.336   31.414 1.00 82.68  ? 56  GLU G CG    1 
ATOM   4784  C  CD    . GLU G 3  43  ? -4.022  1.258   30.287 1.00 86.05  ? 56  GLU G CD    1 
ATOM   4785  O  OE1   . GLU G 3  43  ? -4.210  0.883   29.110 1.00 90.97  ? 56  GLU G OE1   1 
ATOM   4786  O  OE2   . GLU G 3  43  ? -3.503  2.357   30.579 1.00 83.67  ? 56  GLU G OE2   1 
ATOM   4787  N  N     . TYR G 3  44  ? -7.575  -0.796  33.360 1.00 60.15  ? 57  TYR G N     1 
ATOM   4788  C  CA    . TYR G 3  44  ? -8.144  -0.159  34.544 1.00 62.79  ? 57  TYR G CA    1 
ATOM   4789  C  C     . TYR G 3  44  ? -8.068  -1.082  35.755 1.00 67.64  ? 57  TYR G C     1 
ATOM   4790  O  O     . TYR G 3  44  ? -7.658  -0.664  36.844 1.00 71.90  ? 57  TYR G O     1 
ATOM   4791  C  CB    . TYR G 3  44  ? -9.590  0.258   34.278 1.00 64.26  ? 57  TYR G CB    1 
ATOM   4792  C  CG    . TYR G 3  44  ? -10.366 0.553   35.542 1.00 71.98  ? 57  TYR G CG    1 
ATOM   4793  C  CD1   . TYR G 3  44  ? -10.125 1.709   36.274 1.00 75.20  ? 57  TYR G CD1   1 
ATOM   4794  C  CD2   . TYR G 3  44  ? -11.332 -0.330  36.008 1.00 76.56  ? 57  TYR G CD2   1 
ATOM   4795  C  CE1   . TYR G 3  44  ? -10.827 1.979   37.434 1.00 79.48  ? 57  TYR G CE1   1 
ATOM   4796  C  CE2   . TYR G 3  44  ? -12.039 -0.069  37.166 1.00 81.20  ? 57  TYR G CE2   1 
ATOM   4797  C  CZ    . TYR G 3  44  ? -11.783 1.086   37.876 1.00 83.98  ? 57  TYR G CZ    1 
ATOM   4798  O  OH    . TYR G 3  44  ? -12.485 1.351   39.031 1.00 87.68  ? 57  TYR G OH    1 
ATOM   4799  N  N     . LEU G 3  45  ? -8.470  -2.344  35.583 1.00 63.53  ? 58  LEU G N     1 
ATOM   4800  C  CA    . LEU G 3  45  ? -8.422  -3.292  36.692 1.00 52.87  ? 58  LEU G CA    1 
ATOM   4801  C  C     . LEU G 3  45  ? -6.988  -3.560  37.130 1.00 45.40  ? 58  LEU G C     1 
ATOM   4802  O  O     . LEU G 3  45  ? -6.718  -3.706  38.328 1.00 42.14  ? 58  LEU G O     1 
ATOM   4803  C  CB    . LEU G 3  45  ? -9.123  -4.589  36.298 1.00 53.60  ? 58  LEU G CB    1 
ATOM   4804  C  CG    . LEU G 3  45  ? -10.639 -4.472  36.132 1.00 51.94  ? 58  LEU G CG    1 
ATOM   4805  C  CD1   . LEU G 3  45  ? -11.226 -5.771  35.599 1.00 45.97  ? 58  LEU G CD1   1 
ATOM   4806  C  CD2   . LEU G 3  45  ? -11.284 -4.091  37.456 1.00 47.70  ? 58  LEU G CD2   1 
ATOM   4807  N  N     . THR G 3  46  ? -6.054  -3.627  36.176 1.00 44.33  ? 59  THR G N     1 
ATOM   4808  C  CA    . THR G 3  46  ? -4.645  -3.766  36.531 1.00 45.11  ? 59  THR G CA    1 
ATOM   4809  C  C     . THR G 3  46  ? -4.158  -2.554  37.317 1.00 51.68  ? 59  THR G C     1 
ATOM   4810  O  O     . THR G 3  46  ? -3.437  -2.696  38.311 1.00 48.92  ? 59  THR G O     1 
ATOM   4811  C  CB    . THR G 3  46  ? -3.797  -3.962  35.273 1.00 50.59  ? 59  THR G CB    1 
ATOM   4812  O  OG1   . THR G 3  46  ? -4.227  -5.140  34.581 1.00 58.69  ? 59  THR G OG1   1 
ATOM   4813  C  CG2   . THR G 3  46  ? -2.326  -4.101  35.634 1.00 53.91  ? 59  THR G CG2   1 
ATOM   4814  N  N     . ALA G 3  47  ? -4.550  -1.350  36.888 1.00 55.00  ? 60  ALA G N     1 
ATOM   4815  C  CA    . ALA G 3  47  ? -4.159  -0.141  37.605 1.00 55.87  ? 60  ALA G CA    1 
ATOM   4816  C  C     . ALA G 3  47  ? -4.763  -0.107  39.002 1.00 53.77  ? 60  ALA G C     1 
ATOM   4817  O  O     . ALA G 3  47  ? -4.104  0.310   39.962 1.00 50.93  ? 60  ALA G O     1 
ATOM   4818  C  CB    . ALA G 3  47  ? -4.577  1.097   36.814 1.00 58.54  ? 60  ALA G CB    1 
ATOM   4819  N  N     . GLU G 3  48  ? -6.019  -0.542  39.134 1.00 56.07  ? 61  GLU G N     1 
ATOM   4820  C  CA    . GLU G 3  48  ? -6.688  -0.501  40.431 1.00 60.21  ? 61  GLU G CA    1 
ATOM   4821  C  C     . GLU G 3  48  ? -5.977  -1.382  41.451 1.00 63.43  ? 61  GLU G C     1 
ATOM   4822  O  O     . GLU G 3  48  ? -5.892  -1.032  42.634 1.00 66.94  ? 61  GLU G O     1 
ATOM   4823  C  CB    . GLU G 3  48  ? -8.148  -0.925  40.277 1.00 62.33  ? 61  GLU G CB    1 
ATOM   4824  C  CG    . GLU G 3  48  ? -8.972  -0.801  41.548 1.00 75.09  ? 61  GLU G CG    1 
ATOM   4825  C  CD    . GLU G 3  48  ? -9.325  0.637   41.878 1.00 86.27  ? 61  GLU G CD    1 
ATOM   4826  O  OE1   . GLU G 3  48  ? -9.295  1.485   40.961 1.00 86.83  ? 61  GLU G OE1   1 
ATOM   4827  O  OE2   . GLU G 3  48  ? -9.636  0.917   43.055 1.00 94.60  ? 61  GLU G OE2   1 
ATOM   4828  N  N     . ILE G 3  49  ? -5.454  -2.528  41.012 1.00 62.91  ? 62  ILE G N     1 
ATOM   4829  C  CA    . ILE G 3  49  ? -4.770  -3.426  41.936 1.00 59.67  ? 62  ILE G CA    1 
ATOM   4830  C  C     . ILE G 3  49  ? -3.362  -2.928  42.234 1.00 54.07  ? 62  ILE G C     1 
ATOM   4831  O  O     . ILE G 3  49  ? -2.933  -2.910  43.394 1.00 55.48  ? 62  ILE G O     1 
ATOM   4832  C  CB    . ILE G 3  49  ? -4.762  -4.858  41.375 1.00 65.00  ? 62  ILE G CB    1 
ATOM   4833  C  CG1   . ILE G 3  49  ? -6.195  -5.360  41.197 1.00 70.88  ? 62  ILE G CG1   1 
ATOM   4834  C  CG2   . ILE G 3  49  ? -3.980  -5.793  42.292 1.00 60.46  ? 62  ILE G CG2   1 
ATOM   4835  C  CD1   . ILE G 3  49  ? -6.280  -6.803  40.761 1.00 73.04  ? 62  ILE G CD1   1 
ATOM   4836  N  N     . LEU G 3  50  ? -2.621  -2.511  41.204 1.00 51.89  ? 63  LEU G N     1 
ATOM   4837  C  CA    . LEU G 3  50  ? -1.266  -2.016  41.421 1.00 57.10  ? 63  LEU G CA    1 
ATOM   4838  C  C     . LEU G 3  50  ? -1.241  -0.754  42.275 1.00 62.35  ? 63  LEU G C     1 
ATOM   4839  O  O     . LEU G 3  50  ? -0.219  -0.470  42.909 1.00 64.14  ? 63  LEU G O     1 
ATOM   4840  C  CB    . LEU G 3  50  ? -0.578  -1.756  40.080 1.00 57.34  ? 63  LEU G CB    1 
ATOM   4841  C  CG    . LEU G 3  50  ? -0.368  -2.979  39.186 1.00 54.08  ? 63  LEU G CG    1 
ATOM   4842  C  CD1   . LEU G 3  50  ? 0.248   -2.569  37.858 1.00 54.95  ? 63  LEU G CD1   1 
ATOM   4843  C  CD2   . LEU G 3  50  ? 0.489   -4.026  39.885 1.00 50.67  ? 63  LEU G CD2   1 
ATOM   4844  N  N     . GLU G 3  51  ? -2.339  0.005   42.307 1.00 63.81  ? 64  GLU G N     1 
ATOM   4845  C  CA    . GLU G 3  51  ? -2.411  1.168   43.187 1.00 70.82  ? 64  GLU G CA    1 
ATOM   4846  C  C     . GLU G 3  51  ? -2.474  0.745   44.650 1.00 69.04  ? 64  GLU G C     1 
ATOM   4847  O  O     . GLU G 3  51  ? -1.750  1.283   45.496 1.00 69.82  ? 64  GLU G O     1 
ATOM   4848  C  CB    . GLU G 3  51  ? -3.624  2.027   42.823 1.00 79.68  ? 64  GLU G CB    1 
ATOM   4849  C  CG    . GLU G 3  51  ? -3.985  3.074   43.867 1.00 84.15  ? 64  GLU G CG    1 
ATOM   4850  C  CD    . GLU G 3  51  ? -3.075  4.288   43.828 1.00 92.66  ? 64  GLU G CD    1 
ATOM   4851  O  OE1   . GLU G 3  51  ? -2.818  4.802   42.720 1.00 94.98  ? 64  GLU G OE1   1 
ATOM   4852  O  OE2   . GLU G 3  51  ? -2.619  4.731   44.904 1.00 99.49  ? 64  GLU G OE2   1 
ATOM   4853  N  N     . LEU G 3  52  ? -3.335  -0.225  44.965 1.00 65.90  ? 65  LEU G N     1 
ATOM   4854  C  CA    . LEU G 3  52  ? -3.504  -0.652  46.349 1.00 61.74  ? 65  LEU G CA    1 
ATOM   4855  C  C     . LEU G 3  52  ? -2.357  -1.537  46.820 1.00 62.97  ? 65  LEU G C     1 
ATOM   4856  O  O     . LEU G 3  52  ? -1.993  -1.493  48.001 1.00 65.67  ? 65  LEU G O     1 
ATOM   4857  C  CB    . LEU G 3  52  ? -4.838  -1.379  46.509 1.00 58.40  ? 65  LEU G CB    1 
ATOM   4858  C  CG    . LEU G 3  52  ? -6.086  -0.576  46.138 1.00 61.76  ? 65  LEU G CG    1 
ATOM   4859  C  CD1   . LEU G 3  52  ? -7.321  -1.461  46.157 1.00 64.43  ? 65  LEU G CD1   1 
ATOM   4860  C  CD2   . LEU G 3  52  ? -6.254  0.602   47.084 1.00 66.62  ? 65  LEU G CD2   1 
ATOM   4861  N  N     . ALA G 3  53  ? -1.780  -2.339  45.922 1.00 60.46  ? 66  ALA G N     1 
ATOM   4862  C  CA    . ALA G 3  53  ? -0.645  -3.175  46.300 1.00 57.61  ? 66  ALA G CA    1 
ATOM   4863  C  C     . ALA G 3  53  ? 0.599   -2.334  46.556 1.00 58.24  ? 66  ALA G C     1 
ATOM   4864  O  O     . ALA G 3  53  ? 1.385   -2.637  47.462 1.00 56.58  ? 66  ALA G O     1 
ATOM   4865  C  CB    . ALA G 3  53  ? -0.375  -4.218  45.215 1.00 54.86  ? 66  ALA G CB    1 
ATOM   4866  N  N     . GLY G 3  54  ? 0.796   -1.275  45.768 1.00 59.09  ? 67  GLY G N     1 
ATOM   4867  C  CA    . GLY G 3  54  ? 1.921   -0.387  46.011 1.00 54.67  ? 67  GLY G CA    1 
ATOM   4868  C  C     . GLY G 3  54  ? 1.836   0.303   47.358 1.00 50.70  ? 67  GLY G C     1 
ATOM   4869  O  O     . GLY G 3  54  ? 2.851   0.497   48.034 1.00 45.39  ? 67  GLY G O     1 
ATOM   4870  N  N     . ASN G 3  55  ? 0.622   0.681   47.770 1.00 51.03  ? 68  ASN G N     1 
ATOM   4871  C  CA    . ASN G 3  55  ? 0.441   1.250   49.101 1.00 57.89  ? 68  ASN G CA    1 
ATOM   4872  C  C     . ASN G 3  55  ? 0.754   0.223   50.179 1.00 60.65  ? 68  ASN G C     1 
ATOM   4873  O  O     . ASN G 3  55  ? 1.425   0.536   51.169 1.00 61.92  ? 68  ASN G O     1 
ATOM   4874  C  CB    . ASN G 3  55  ? -0.985  1.774   49.262 1.00 62.52  ? 68  ASN G CB    1 
ATOM   4875  C  CG    . ASN G 3  55  ? -1.351  2.798   48.211 1.00 66.15  ? 68  ASN G CG    1 
ATOM   4876  O  OD1   . ASN G 3  55  ? -0.483  3.473   47.655 1.00 68.81  ? 68  ASN G OD1   1 
ATOM   4877  N  ND2   . ASN G 3  55  ? -2.644  2.920   47.932 1.00 66.95  ? 68  ASN G ND2   1 
ATOM   4878  N  N     . ALA G 3  56  ? 0.277   -1.011  50.003 1.00 59.89  ? 69  ALA G N     1 
ATOM   4879  C  CA    . ALA G 3  56  ? 0.597   -2.069  50.954 1.00 51.91  ? 69  ALA G CA    1 
ATOM   4880  C  C     . ALA G 3  56  ? 2.100   -2.314  51.015 1.00 51.85  ? 69  ALA G C     1 
ATOM   4881  O  O     . ALA G 3  56  ? 2.656   -2.549  52.094 1.00 53.74  ? 69  ALA G O     1 
ATOM   4882  C  CB    . ALA G 3  56  ? -0.148  -3.350  50.581 1.00 46.95  ? 69  ALA G CB    1 
ATOM   4883  N  N     . ALA G 3  57  ? 2.776   -2.254  49.865 1.00 53.32  ? 70  ALA G N     1 
ATOM   4884  C  CA    . ALA G 3  57  ? 4.227   -2.405  49.850 1.00 61.26  ? 70  ALA G CA    1 
ATOM   4885  C  C     . ALA G 3  57  ? 4.911   -1.265  50.593 1.00 75.02  ? 70  ALA G C     1 
ATOM   4886  O  O     . ALA G 3  57  ? 5.944   -1.473  51.240 1.00 73.84  ? 70  ALA G O     1 
ATOM   4887  C  CB    . ALA G 3  57  ? 4.733   -2.485  48.410 1.00 42.85  ? 70  ALA G CB    1 
ATOM   4888  N  N     . ARG G 3  58  ? 4.346   -0.057  50.518 1.00 82.69  ? 71  ARG G N     1 
ATOM   4889  C  CA    . ARG G 3  58  ? 4.889   1.078   51.256 1.00 86.09  ? 71  ARG G CA    1 
ATOM   4890  C  C     . ARG G 3  58  ? 4.578   0.981   52.745 1.00 85.82  ? 71  ARG G C     1 
ATOM   4891  O  O     . ARG G 3  58  ? 5.400   1.379   53.581 1.00 85.75  ? 71  ARG G O     1 
ATOM   4892  C  CB    . ARG G 3  58  ? 4.343   2.386   50.687 1.00 96.53  ? 71  ARG G CB    1 
ATOM   4893  C  CG    . ARG G 3  58  ? 4.875   3.633   51.368 1.00 105.68 ? 71  ARG G CG    1 
ATOM   4894  C  CD    . ARG G 3  58  ? 4.266   4.884   50.764 1.00 113.79 ? 71  ARG G CD    1 
ATOM   4895  N  NE    . ARG G 3  58  ? 4.494   4.953   49.323 1.00 120.95 ? 71  ARG G NE    1 
ATOM   4896  C  CZ    . ARG G 3  58  ? 4.070   5.945   48.548 1.00 124.94 ? 71  ARG G CZ    1 
ATOM   4897  N  NH1   . ARG G 3  58  ? 3.393   6.956   49.076 1.00 126.29 ? 71  ARG G NH1   1 
ATOM   4898  N  NH2   . ARG G 3  58  ? 4.321   5.927   47.245 1.00 125.99 ? 71  ARG G NH2   1 
ATOM   4899  N  N     . ASP G 3  59  ? 3.396   0.463   53.095 1.00 89.14  ? 72  ASP G N     1 
ATOM   4900  C  CA    . ASP G 3  59  ? 3.062   0.289   54.504 1.00 93.23  ? 72  ASP G CA    1 
ATOM   4901  C  C     . ASP G 3  59  ? 3.952   -0.757  55.163 1.00 93.89  ? 72  ASP G C     1 
ATOM   4902  O  O     . ASP G 3  59  ? 4.206   -0.682  56.371 1.00 91.53  ? 72  ASP G O     1 
ATOM   4903  C  CB    . ASP G 3  59  ? 1.590   -0.093  54.656 1.00 95.42  ? 72  ASP G CB    1 
ATOM   4904  C  CG    . ASP G 3  59  ? 0.653   0.950   54.081 1.00 101.19 ? 72  ASP G CG    1 
ATOM   4905  O  OD1   . ASP G 3  59  ? 1.012   2.146   54.087 1.00 102.34 ? 72  ASP G OD1   1 
ATOM   4906  O  OD2   . ASP G 3  59  ? -0.446  0.573   53.620 1.00 103.95 ? 72  ASP G OD2   1 
ATOM   4907  N  N     . ASN G 3  60  ? 4.431   -1.732  54.393 1.00 97.71  ? 73  ASN G N     1 
ATOM   4908  C  CA    . ASN G 3  60  ? 5.367   -2.732  54.885 1.00 100.96 ? 73  ASN G CA    1 
ATOM   4909  C  C     . ASN G 3  60  ? 6.820   -2.313  54.702 1.00 96.13  ? 73  ASN G C     1 
ATOM   4910  O  O     . ASN G 3  60  ? 7.717   -3.142  54.882 1.00 94.88  ? 73  ASN G O     1 
ATOM   4911  C  CB    . ASN G 3  60  ? 5.119   -4.075  54.193 1.00 104.94 ? 73  ASN G CB    1 
ATOM   4912  C  CG    . ASN G 3  60  ? 3.769   -4.673  54.544 1.00 107.35 ? 73  ASN G CG    1 
ATOM   4913  O  OD1   . ASN G 3  60  ? 2.807   -3.953  54.811 1.00 110.54 ? 73  ASN G OD1   1 
ATOM   4914  N  ND2   . ASN G 3  60  ? 3.694   -5.998  54.551 1.00 109.83 ? 73  ASN G ND2   1 
ATOM   4915  N  N     . LYS G 3  61  ? 7.063   -1.050  54.341 1.00 94.28  ? 74  LYS G N     1 
ATOM   4916  C  CA    . LYS G 3  61  ? 8.413   -0.495  54.219 1.00 94.02  ? 74  LYS G CA    1 
ATOM   4917  C  C     . LYS G 3  61  ? 9.246   -1.263  53.194 1.00 84.84  ? 74  LYS G C     1 
ATOM   4918  O  O     . LYS G 3  61  ? 10.426  -1.543  53.410 1.00 84.03  ? 74  LYS G O     1 
ATOM   4919  C  CB    . LYS G 3  61  ? 9.121   -0.460  55.577 1.00 101.49 ? 74  LYS G CB    1 
ATOM   4920  C  CG    . LYS G 3  61  ? 8.294   0.158   56.700 1.00 110.03 ? 74  LYS G CG    1 
ATOM   4921  C  CD    . LYS G 3  61  ? 9.028   0.106   58.035 1.00 114.21 ? 74  LYS G CD    1 
ATOM   4922  C  CE    . LYS G 3  61  ? 8.136   0.566   59.181 1.00 115.19 ? 74  LYS G CE    1 
ATOM   4923  N  NZ    . LYS G 3  61  ? 6.951   -0.321  59.355 1.00 114.16 ? 74  LYS G NZ    1 
ATOM   4924  N  N     . LYS G 3  62  ? 8.631   -1.605  52.064 1.00 78.73  ? 75  LYS G N     1 
ATOM   4925  C  CA    . LYS G 3  62  ? 9.308   -2.359  51.020 1.00 79.04  ? 75  LYS G CA    1 
ATOM   4926  C  C     . LYS G 3  62  ? 9.148   -1.662  49.678 1.00 75.44  ? 75  LYS G C     1 
ATOM   4927  O  O     . LYS G 3  62  ? 8.174   -0.940  49.441 1.00 73.10  ? 75  LYS G O     1 
ATOM   4928  C  CB    . LYS G 3  62  ? 8.784   -3.800  50.930 1.00 80.52  ? 75  LYS G CB    1 
ATOM   4929  C  CG    . LYS G 3  62  ? 9.160   -4.655  52.126 1.00 86.63  ? 75  LYS G CG    1 
ATOM   4930  C  CD    . LYS G 3  62  ? 8.908   -6.126  51.865 1.00 95.13  ? 75  LYS G CD    1 
ATOM   4931  C  CE    . LYS G 3  62  ? 9.393   -6.970  53.031 1.00 98.88  ? 75  LYS G CE    1 
ATOM   4932  N  NZ    . LYS G 3  62  ? 10.817  -6.682  53.355 1.00 99.94  ? 75  LYS G NZ    1 
ATOM   4933  N  N     . THR G 3  63  ? 10.123  -1.893  48.802 1.00 78.04  ? 76  THR G N     1 
ATOM   4934  C  CA    . THR G 3  63  ? 10.169  -1.270  47.487 1.00 69.66  ? 76  THR G CA    1 
ATOM   4935  C  C     . THR G 3  63  ? 9.380   -2.067  46.454 1.00 74.88  ? 76  THR G C     1 
ATOM   4936  O  O     . THR G 3  63  ? 8.590   -1.499  45.694 1.00 75.21  ? 76  THR G O     1 
ATOM   4937  C  CB    . THR G 3  63  ? 11.627  -1.127  47.037 1.00 62.65  ? 76  THR G CB    1 
ATOM   4938  O  OG1   . THR G 3  63  ? 12.321  -0.254  47.938 1.00 64.24  ? 76  THR G OG1   1 
ATOM   4939  C  CG2   . THR G 3  63  ? 11.704  -0.572  45.621 1.00 60.24  ? 76  THR G CG2   1 
ATOM   4940  N  N     . ARG G 3  64  ? 9.577   -3.383  46.425 1.00 75.42  ? 77  ARG G N     1 
ATOM   4941  C  CA    . ARG G 3  64  ? 8.990   -4.255  45.419 1.00 70.56  ? 77  ARG G CA    1 
ATOM   4942  C  C     . ARG G 3  64  ? 7.701   -4.878  45.938 1.00 67.72  ? 77  ARG G C     1 
ATOM   4943  O  O     . ARG G 3  64  ? 7.597   -5.233  47.116 1.00 68.75  ? 77  ARG G O     1 
ATOM   4944  C  CB    . ARG G 3  64  ? 9.975   -5.357  45.023 1.00 78.96  ? 77  ARG G CB    1 
ATOM   4945  C  CG    . ARG G 3  64  ? 11.254  -4.846  44.386 1.00 81.70  ? 77  ARG G CG    1 
ATOM   4946  C  CD    . ARG G 3  64  ? 12.293  -5.947  44.269 1.00 87.25  ? 77  ARG G CD    1 
ATOM   4947  N  NE    . ARG G 3  64  ? 13.578  -5.432  43.806 1.00 93.65  ? 77  ARG G NE    1 
ATOM   4948  C  CZ    . ARG G 3  64  ? 14.706  -6.134  43.801 1.00 99.05  ? 77  ARG G CZ    1 
ATOM   4949  N  NH1   . ARG G 3  64  ? 14.712  -7.387  44.237 1.00 99.58  ? 77  ARG G NH1   1 
ATOM   4950  N  NH2   . ARG G 3  64  ? 15.829  -5.584  43.360 1.00 102.64 ? 77  ARG G NH2   1 
ATOM   4951  N  N     . ILE G 3  65  ? 6.725   -5.013  45.046 1.00 66.31  ? 78  ILE G N     1 
ATOM   4952  C  CA    . ILE G 3  65  ? 5.455   -5.646  45.381 1.00 64.72  ? 78  ILE G CA    1 
ATOM   4953  C  C     . ILE G 3  65  ? 5.635   -7.159  45.340 1.00 60.98  ? 78  ILE G C     1 
ATOM   4954  O  O     . ILE G 3  65  ? 6.082   -7.715  44.332 1.00 52.58  ? 78  ILE G O     1 
ATOM   4955  C  CB    . ILE G 3  65  ? 4.344   -5.196  44.421 1.00 64.24  ? 78  ILE G CB    1 
ATOM   4956  C  CG1   . ILE G 3  65  ? 4.075   -3.697  44.585 1.00 60.61  ? 78  ILE G CG1   1 
ATOM   4957  C  CG2   . ILE G 3  65  ? 3.076   -6.017  44.643 1.00 59.90  ? 78  ILE G CG2   1 
ATOM   4958  C  CD1   . ILE G 3  65  ? 3.044   -3.151  43.627 1.00 57.37  ? 78  ILE G CD1   1 
ATOM   4959  N  N     . ILE G 3  66  ? 5.294   -7.826  46.439 1.00 61.37  ? 79  ILE G N     1 
ATOM   4960  C  CA    . ILE G 3  66  ? 5.359   -9.283  46.524 1.00 55.01  ? 79  ILE G CA    1 
ATOM   4961  C  C     . ILE G 3  66  ? 3.929   -9.814  46.532 1.00 56.49  ? 79  ILE G C     1 
ATOM   4962  O  O     . ILE G 3  66  ? 2.983   -9.018  46.628 1.00 57.52  ? 79  ILE G O     1 
ATOM   4963  C  CB    . ILE G 3  66  ? 6.149   -9.734  47.766 1.00 53.03  ? 79  ILE G CB    1 
ATOM   4964  C  CG1   . ILE G 3  66  ? 5.419   -9.332  49.049 1.00 49.30  ? 79  ILE G CG1   1 
ATOM   4965  C  CG2   . ILE G 3  66  ? 7.561   -9.165  47.737 1.00 59.90  ? 79  ILE G CG2   1 
ATOM   4966  C  CD1   . ILE G 3  66  ? 6.199   -9.645  50.309 1.00 43.64  ? 79  ILE G CD1   1 
ATOM   4967  N  N     . PRO G 3  67  ? 3.713   -11.129 46.400 1.00 59.30  ? 80  PRO G N     1 
ATOM   4968  C  CA    . PRO G 3  67  ? 2.338   -11.656 46.479 1.00 56.86  ? 80  PRO G CA    1 
ATOM   4969  C  C     . PRO G 3  67  ? 1.570   -11.227 47.720 1.00 54.35  ? 80  PRO G C     1 
ATOM   4970  O  O     . PRO G 3  67  ? 0.353   -11.011 47.643 1.00 47.33  ? 80  PRO G O     1 
ATOM   4971  C  CB    . PRO G 3  67  ? 2.561   -13.170 46.451 1.00 53.73  ? 80  PRO G CB    1 
ATOM   4972  C  CG    . PRO G 3  67  ? 3.779   -13.332 45.617 1.00 55.18  ? 80  PRO G CG    1 
ATOM   4973  C  CD    . PRO G 3  67  ? 4.663   -12.158 45.936 1.00 55.84  ? 80  PRO G CD    1 
ATOM   4974  N  N     . ARG G 3  68  ? 2.245   -11.105 48.866 1.00 54.97  ? 81  ARG G N     1 
ATOM   4975  C  CA    . ARG G 3  68  ? 1.565   -10.676 50.084 1.00 54.99  ? 81  ARG G CA    1 
ATOM   4976  C  C     . ARG G 3  68  ? 0.908   -9.315  49.896 1.00 65.20  ? 81  ARG G C     1 
ATOM   4977  O  O     . ARG G 3  68  ? -0.213  -9.087  50.367 1.00 69.21  ? 81  ARG G O     1 
ATOM   4978  C  CB    . ARG G 3  68  ? 2.553   -10.637 51.250 1.00 52.65  ? 81  ARG G CB    1 
ATOM   4979  C  CG    . ARG G 3  68  ? 1.965   -10.118 52.549 1.00 52.88  ? 81  ARG G CG    1 
ATOM   4980  C  CD    . ARG G 3  68  ? 0.755   -10.933 52.965 1.00 54.99  ? 81  ARG G CD    1 
ATOM   4981  N  NE    . ARG G 3  68  ? 0.317   -10.617 54.320 1.00 58.66  ? 81  ARG G NE    1 
ATOM   4982  C  CZ    . ARG G 3  68  ? -0.693  -11.222 54.935 1.00 62.54  ? 81  ARG G CZ    1 
ATOM   4983  N  NH1   . ARG G 3  68  ? -1.373  -12.177 54.316 1.00 65.30  ? 81  ARG G NH1   1 
ATOM   4984  N  NH2   . ARG G 3  68  ? -1.025  -10.872 56.169 1.00 65.15  ? 81  ARG G NH2   1 
ATOM   4985  N  N     . HIS G 3  69  ? 1.589   -8.401  49.201 1.00 64.72  ? 82  HIS G N     1 
ATOM   4986  C  CA    . HIS G 3  69  ? 1.024   -7.079  48.957 1.00 56.36  ? 82  HIS G CA    1 
ATOM   4987  C  C     . HIS G 3  69  ? -0.189  -7.156  48.038 1.00 55.43  ? 82  HIS G C     1 
ATOM   4988  O  O     . HIS G 3  69  ? -1.149  -6.393  48.202 1.00 58.51  ? 82  HIS G O     1 
ATOM   4989  C  CB    . HIS G 3  69  ? 2.097   -6.162  48.373 1.00 52.82  ? 82  HIS G CB    1 
ATOM   4990  C  CG    . HIS G 3  69  ? 3.304   -6.022  49.247 1.00 51.39  ? 82  HIS G CG    1 
ATOM   4991  N  ND1   . HIS G 3  69  ? 4.591   -6.094  48.759 1.00 50.91  ? 82  HIS G ND1   1 
ATOM   4992  C  CD2   . HIS G 3  69  ? 3.420   -5.819  50.581 1.00 53.04  ? 82  HIS G CD2   1 
ATOM   4993  C  CE1   . HIS G 3  69  ? 5.447   -5.939  49.753 1.00 58.97  ? 82  HIS G CE1   1 
ATOM   4994  N  NE2   . HIS G 3  69  ? 4.762   -5.771  50.870 1.00 59.68  ? 82  HIS G NE2   1 
ATOM   4995  N  N     . LEU G 3  70  ? -0.169  -8.076  47.069 1.00 53.13  ? 83  LEU G N     1 
ATOM   4996  C  CA    . LEU G 3  70  ? -1.336  -8.267  46.215 1.00 51.03  ? 83  LEU G CA    1 
ATOM   4997  C  C     . LEU G 3  70  ? -2.516  -8.828  46.999 1.00 53.07  ? 83  LEU G C     1 
ATOM   4998  O  O     . LEU G 3  70  ? -3.670  -8.501  46.699 1.00 52.34  ? 83  LEU G O     1 
ATOM   4999  C  CB    . LEU G 3  70  ? -0.990  -9.187  45.045 1.00 47.60  ? 83  LEU G CB    1 
ATOM   5000  C  CG    . LEU G 3  70  ? -0.021  -8.632  43.998 1.00 55.08  ? 83  LEU G CG    1 
ATOM   5001  C  CD1   . LEU G 3  70  ? 0.350   -9.711  42.993 1.00 62.22  ? 83  LEU G CD1   1 
ATOM   5002  C  CD2   . LEU G 3  70  ? -0.620  -7.425  43.290 1.00 53.27  ? 83  LEU G CD2   1 
ATOM   5003  N  N     . GLN G 3  71  ? -2.249  -9.662  48.006 1.00 50.16  ? 84  GLN G N     1 
ATOM   5004  C  CA    . GLN G 3  71  ? -3.334  -10.221 48.805 1.00 49.45  ? 84  GLN G CA    1 
ATOM   5005  C  C     . GLN G 3  71  ? -3.965  -9.160  49.697 1.00 48.48  ? 84  GLN G C     1 
ATOM   5006  O  O     . GLN G 3  71  ? -5.194  -9.028  49.744 1.00 47.17  ? 84  GLN G O     1 
ATOM   5007  C  CB    . GLN G 3  71  ? -2.822  -11.395 49.639 1.00 54.08  ? 84  GLN G CB    1 
ATOM   5008  C  CG    . GLN G 3  71  ? -3.855  -11.985 50.593 1.00 58.28  ? 84  GLN G CG    1 
ATOM   5009  C  CD    . GLN G 3  71  ? -4.891  -12.853 49.897 1.00 63.52  ? 84  GLN G CD    1 
ATOM   5010  O  OE1   . GLN G 3  71  ? -5.145  -12.709 48.699 1.00 65.56  ? 84  GLN G OE1   1 
ATOM   5011  N  NE2   . GLN G 3  71  ? -5.497  -13.764 50.652 1.00 64.59  ? 84  GLN G NE2   1 
ATOM   5012  N  N     . LEU G 3  72  ? -3.138  -8.393  50.415 1.00 51.61  ? 85  LEU G N     1 
ATOM   5013  C  CA    . LEU G 3  72  ? -3.666  -7.342  51.280 1.00 52.61  ? 85  LEU G CA    1 
ATOM   5014  C  C     . LEU G 3  72  ? -4.492  -6.332  50.492 1.00 50.54  ? 85  LEU G C     1 
ATOM   5015  O  O     . LEU G 3  72  ? -5.471  -5.787  51.014 1.00 54.35  ? 85  LEU G O     1 
ATOM   5016  C  CB    . LEU G 3  72  ? -2.522  -6.637  52.009 1.00 55.32  ? 85  LEU G CB    1 
ATOM   5017  C  CG    . LEU G 3  72  ? -1.636  -7.498  52.911 1.00 51.89  ? 85  LEU G CG    1 
ATOM   5018  C  CD1   . LEU G 3  72  ? -0.501  -6.671  53.495 1.00 46.13  ? 85  LEU G CD1   1 
ATOM   5019  C  CD2   . LEU G 3  72  ? -2.455  -8.136  54.017 1.00 53.75  ? 85  LEU G CD2   1 
ATOM   5020  N  N     . ALA G 3  73  ? -4.123  -6.083  49.235 1.00 46.54  ? 86  ALA G N     1 
ATOM   5021  C  CA    . ALA G 3  73  ? -4.884  -5.155  48.407 1.00 50.05  ? 86  ALA G CA    1 
ATOM   5022  C  C     . ALA G 3  73  ? -6.246  -5.731  48.034 1.00 60.03  ? 86  ALA G C     1 
ATOM   5023  O  O     . ALA G 3  73  ? -7.278  -5.072  48.204 1.00 67.01  ? 86  ALA G O     1 
ATOM   5024  C  CB    . ALA G 3  73  ? -4.084  -4.807  47.152 1.00 49.53  ? 86  ALA G CB    1 
ATOM   5025  N  N     . VAL G 3  74  ? -6.267  -6.967  47.528 1.00 63.68  ? 87  VAL G N     1 
ATOM   5026  C  CA    . VAL G 3  74  ? -7.510  -7.562  47.043 1.00 63.04  ? 87  VAL G CA    1 
ATOM   5027  C  C     . VAL G 3  74  ? -8.485  -7.792  48.192 1.00 57.50  ? 87  VAL G C     1 
ATOM   5028  O  O     . VAL G 3  74  ? -9.672  -7.453  48.098 1.00 57.48  ? 87  VAL G O     1 
ATOM   5029  C  CB    . VAL G 3  74  ? -7.218  -8.872  46.287 1.00 64.20  ? 87  VAL G CB    1 
ATOM   5030  C  CG1   . VAL G 3  74  ? -8.516  -9.606  45.967 1.00 43.34  ? 87  VAL G CG1   1 
ATOM   5031  C  CG2   . VAL G 3  74  ? -6.433  -8.589  45.016 1.00 61.72  ? 87  VAL G CG2   1 
ATOM   5032  N  N     . ARG G 3  75  ? -8.000  -8.371  49.293 1.00 51.05  ? 88  ARG G N     1 
ATOM   5033  C  CA    . ARG G 3  75  ? -8.899  -8.784  50.363 1.00 54.89  ? 88  ARG G CA    1 
ATOM   5034  C  C     . ARG G 3  75  ? -9.428  -7.608  51.175 1.00 61.27  ? 88  ARG G C     1 
ATOM   5035  O  O     . ARG G 3  75  ? -10.490 -7.730  51.795 1.00 65.81  ? 88  ARG G O     1 
ATOM   5036  C  CB    . ARG G 3  75  ? -8.190  -9.779  51.277 1.00 58.22  ? 88  ARG G CB    1 
ATOM   5037  C  CG    . ARG G 3  75  ? -7.613  -10.992 50.550 1.00 54.75  ? 88  ARG G CG    1 
ATOM   5038  C  CD    . ARG G 3  75  ? -8.626  -12.118 50.404 1.00 53.39  ? 88  ARG G CD    1 
ATOM   5039  N  NE    . ARG G 3  75  ? -9.391  -12.057 49.159 1.00 51.82  ? 88  ARG G NE    1 
ATOM   5040  C  CZ    . ARG G 3  75  ? -9.088  -12.745 48.060 1.00 58.72  ? 88  ARG G CZ    1 
ATOM   5041  N  NH1   . ARG G 3  75  ? -8.030  -13.544 48.044 1.00 66.20  ? 88  ARG G NH1   1 
ATOM   5042  N  NH2   . ARG G 3  75  ? -9.844  -12.637 46.976 1.00 59.53  ? 88  ARG G NH2   1 
ATOM   5043  N  N     . ASN G 3  76  ? -8.723  -6.476  51.189 1.00 64.23  ? 89  ASN G N     1 
ATOM   5044  C  CA    . ASN G 3  76  ? -9.192  -5.301  51.913 1.00 60.71  ? 89  ASN G CA    1 
ATOM   5045  C  C     . ASN G 3  76  ? -10.151 -4.441  51.102 1.00 63.78  ? 89  ASN G C     1 
ATOM   5046  O  O     . ASN G 3  76  ? -10.878 -3.631  51.688 1.00 70.17  ? 89  ASN G O     1 
ATOM   5047  C  CB    . ASN G 3  76  ? -8.004  -4.448  52.368 1.00 55.28  ? 89  ASN G CB    1 
ATOM   5048  C  CG    . ASN G 3  76  ? -7.316  -5.018  53.593 1.00 52.76  ? 89  ASN G CG    1 
ATOM   5049  O  OD1   . ASN G 3  76  ? -7.966  -5.342  54.587 1.00 51.83  ? 89  ASN G OD1   1 
ATOM   5050  N  ND2   . ASN G 3  76  ? -5.995  -5.153  53.524 1.00 53.51  ? 89  ASN G ND2   1 
ATOM   5051  N  N     . ASP G 3  77  ? -10.170 -4.590  49.781 1.00 61.26  ? 90  ASP G N     1 
ATOM   5052  C  CA    . ASP G 3  77  ? -11.122 -3.892  48.928 1.00 69.58  ? 90  ASP G CA    1 
ATOM   5053  C  C     . ASP G 3  77  ? -12.304 -4.815  48.660 1.00 78.16  ? 90  ASP G C     1 
ATOM   5054  O  O     . ASP G 3  77  ? -12.123 -5.933  48.165 1.00 87.59  ? 90  ASP G O     1 
ATOM   5055  C  CB    . ASP G 3  77  ? -10.469 -3.454  47.618 1.00 76.93  ? 90  ASP G CB    1 
ATOM   5056  C  CG    . ASP G 3  77  ? -11.410 -2.653  46.738 1.00 88.88  ? 90  ASP G CG    1 
ATOM   5057  O  OD1   . ASP G 3  77  ? -12.382 -2.077  47.273 1.00 93.61  ? 90  ASP G OD1   1 
ATOM   5058  O  OD2   . ASP G 3  77  ? -11.179 -2.595  45.512 1.00 96.91  ? 90  ASP G OD2   1 
ATOM   5059  N  N     . GLU G 3  78  ? -13.510 -4.345  48.989 1.00 77.93  ? 91  GLU G N     1 
ATOM   5060  C  CA    . GLU G 3  78  ? -14.698 -5.180  48.842 1.00 81.56  ? 91  GLU G CA    1 
ATOM   5061  C  C     . GLU G 3  78  ? -14.949 -5.548  47.384 1.00 81.50  ? 91  GLU G C     1 
ATOM   5062  O  O     . GLU G 3  78  ? -15.304 -6.692  47.077 1.00 81.47  ? 91  GLU G O     1 
ATOM   5063  C  CB    . GLU G 3  78  ? -15.916 -4.466  49.428 1.00 87.25  ? 91  GLU G CB    1 
ATOM   5064  C  CG    . GLU G 3  78  ? -17.246 -5.080  49.017 1.00 96.75  ? 91  GLU G CG    1 
ATOM   5065  C  CD    . GLU G 3  78  ? -18.436 -4.375  49.638 1.00 104.25 ? 91  GLU G CD    1 
ATOM   5066  O  OE1   . GLU G 3  78  ? -18.330 -3.943  50.805 1.00 104.42 ? 91  GLU G OE1   1 
ATOM   5067  O  OE2   . GLU G 3  78  ? -19.475 -4.248  48.955 1.00 106.93 ? 91  GLU G OE2   1 
ATOM   5068  N  N     . GLU G 3  79  ? -14.767 -4.592  46.470 1.00 80.42  ? 92  GLU G N     1 
ATOM   5069  C  CA    . GLU G 3  79  ? -15.072 -4.846  45.066 1.00 78.72  ? 92  GLU G CA    1 
ATOM   5070  C  C     . GLU G 3  79  ? -14.102 -5.854  44.459 1.00 70.06  ? 92  GLU G C     1 
ATOM   5071  O  O     . GLU G 3  79  ? -14.522 -6.775  43.749 1.00 70.46  ? 92  GLU G O     1 
ATOM   5072  C  CB    . GLU G 3  79  ? -15.053 -3.533  44.285 1.00 86.74  ? 92  GLU G CB    1 
ATOM   5073  C  CG    . GLU G 3  79  ? -15.903 -2.438  44.912 1.00 92.43  ? 92  GLU G CG    1 
ATOM   5074  C  CD    . GLU G 3  79  ? -17.022 -1.967  44.003 1.00 97.22  ? 92  GLU G CD    1 
ATOM   5075  O  OE1   . GLU G 3  79  ? -17.028 -2.353  42.815 1.00 102.53 ? 92  GLU G OE1   1 
ATOM   5076  O  OE2   . GLU G 3  79  ? -17.897 -1.211  44.477 1.00 98.39  ? 92  GLU G OE2   1 
ATOM   5077  N  N     . LEU G 3  80  ? -12.802 -5.696  44.724 1.00 65.04  ? 93  LEU G N     1 
ATOM   5078  C  CA    . LEU G 3  80  ? -11.829 -6.664  44.229 1.00 64.11  ? 93  LEU G CA    1 
ATOM   5079  C  C     . LEU G 3  80  ? -12.009 -8.026  44.888 1.00 68.09  ? 93  LEU G C     1 
ATOM   5080  O  O     . LEU G 3  80  ? -11.768 -9.058  44.250 1.00 71.13  ? 93  LEU G O     1 
ATOM   5081  C  CB    . LEU G 3  80  ? -10.407 -6.150  44.459 1.00 61.58  ? 93  LEU G CB    1 
ATOM   5082  C  CG    . LEU G 3  80  ? -9.955  -4.946  43.628 1.00 60.38  ? 93  LEU G CG    1 
ATOM   5083  C  CD1   . LEU G 3  80  ? -8.581  -4.478  44.082 1.00 60.78  ? 93  LEU G CD1   1 
ATOM   5084  C  CD2   . LEU G 3  80  ? -9.943  -5.282  42.145 1.00 47.86  ? 93  LEU G CD2   1 
ATOM   5085  N  N     . ASN G 3  81  ? -12.428 -8.051  46.156 1.00 66.72  ? 94  ASN G N     1 
ATOM   5086  C  CA    . ASN G 3  81  ? -12.645 -9.324  46.832 1.00 62.38  ? 94  ASN G CA    1 
ATOM   5087  C  C     . ASN G 3  81  ? -13.813 -10.083 46.215 1.00 65.51  ? 94  ASN G C     1 
ATOM   5088  O  O     . ASN G 3  81  ? -13.762 -11.311 46.086 1.00 73.30  ? 94  ASN G O     1 
ATOM   5089  C  CB    . ASN G 3  81  ? -12.882 -9.095  48.324 1.00 60.28  ? 94  ASN G CB    1 
ATOM   5090  C  CG    . ASN G 3  81  ? -12.811 -10.378 49.129 1.00 60.40  ? 94  ASN G CG    1 
ATOM   5091  O  OD1   . ASN G 3  81  ? -12.214 -11.363 48.696 1.00 61.92  ? 94  ASN G OD1   1 
ATOM   5092  N  ND2   . ASN G 3  81  ? -13.421 -10.371 50.309 1.00 60.26  ? 94  ASN G ND2   1 
ATOM   5093  N  N     . LYS G 3  82  ? -14.874 -9.371  45.827 1.00 57.34  ? 95  LYS G N     1 
ATOM   5094  C  CA    . LYS G 3  82  ? -15.998 -10.024 45.165 1.00 58.44  ? 95  LYS G CA    1 
ATOM   5095  C  C     . LYS G 3  82  ? -15.600 -10.534 43.786 1.00 65.12  ? 95  LYS G C     1 
ATOM   5096  O  O     . LYS G 3  82  ? -16.050 -11.604 43.357 1.00 71.90  ? 95  LYS G O     1 
ATOM   5097  C  CB    . LYS G 3  82  ? -17.182 -9.060  45.067 1.00 63.12  ? 95  LYS G CB    1 
ATOM   5098  C  CG    . LYS G 3  82  ? -18.398 -9.617  44.340 1.00 76.23  ? 95  LYS G CG    1 
ATOM   5099  C  CD    . LYS G 3  82  ? -18.998 -10.808 45.074 1.00 91.09  ? 95  LYS G CD    1 
ATOM   5100  C  CE    . LYS G 3  82  ? -20.206 -11.364 44.330 1.00 101.11 ? 95  LYS G CE    1 
ATOM   5101  N  NZ    . LYS G 3  82  ? -20.772 -12.571 44.998 1.00 104.85 ? 95  LYS G NZ    1 
ATOM   5102  N  N     . LEU G 3  83  ? -14.746 -9.788  43.082 1.00 63.46  ? 96  LEU G N     1 
ATOM   5103  C  CA    . LEU G 3  83  ? -14.298 -10.221 41.763 1.00 60.46  ? 96  LEU G CA    1 
ATOM   5104  C  C     . LEU G 3  83  ? -13.397 -11.447 41.850 1.00 60.85  ? 96  LEU G C     1 
ATOM   5105  O  O     . LEU G 3  83  ? -13.409 -12.290 40.945 1.00 63.64  ? 96  LEU G O     1 
ATOM   5106  C  CB    . LEU G 3  83  ? -13.571 -9.075  41.056 1.00 55.76  ? 96  LEU G CB    1 
ATOM   5107  C  CG    . LEU G 3  83  ? -13.172 -9.303  39.596 1.00 53.67  ? 96  LEU G CG    1 
ATOM   5108  C  CD1   . LEU G 3  83  ? -14.405 -9.370  38.708 1.00 57.30  ? 96  LEU G CD1   1 
ATOM   5109  C  CD2   . LEU G 3  83  ? -12.215 -8.220  39.116 1.00 54.31  ? 96  LEU G CD2   1 
ATOM   5110  N  N     . LEU G 3  84  ? -12.618 -11.567 42.923 1.00 58.14  ? 97  LEU G N     1 
ATOM   5111  C  CA    . LEU G 3  84  ? -11.709 -12.688 43.124 1.00 57.73  ? 97  LEU G CA    1 
ATOM   5112  C  C     . LEU G 3  84  ? -12.099 -13.481 44.368 1.00 57.57  ? 97  LEU G C     1 
ATOM   5113  O  O     . LEU G 3  84  ? -11.251 -13.888 45.166 1.00 53.98  ? 97  LEU G O     1 
ATOM   5114  C  CB    . LEU G 3  84  ? -10.264 -12.204 43.218 1.00 42.32  ? 97  LEU G CB    1 
ATOM   5115  C  CG    . LEU G 3  84  ? -9.826  -11.150 42.195 1.00 53.45  ? 97  LEU G CG    1 
ATOM   5116  C  CD1   . LEU G 3  84  ? -8.359  -10.793 42.385 1.00 56.22  ? 97  LEU G CD1   1 
ATOM   5117  C  CD2   . LEU G 3  84  ? -10.086 -11.609 40.765 1.00 52.55  ? 97  LEU G CD2   1 
ATOM   5118  N  N     . GLY G 3  85  ? -13.403 -13.707 44.544 1.00 55.27  ? 98  GLY G N     1 
ATOM   5119  C  CA    . GLY G 3  85  ? -13.870 -14.440 45.708 1.00 57.05  ? 98  GLY G CA    1 
ATOM   5120  C  C     . GLY G 3  85  ? -13.572 -15.922 45.644 1.00 55.73  ? 98  GLY G C     1 
ATOM   5121  O  O     . GLY G 3  85  ? -13.441 -16.577 46.682 1.00 56.73  ? 98  GLY G O     1 
ATOM   5122  N  N     . ARG G 3  86  ? -13.465 -16.472 44.437 1.00 56.85  ? 99  ARG G N     1 
ATOM   5123  C  CA    . ARG G 3  86  ? -13.149 -17.879 44.231 1.00 58.48  ? 99  ARG G CA    1 
ATOM   5124  C  C     . ARG G 3  86  ? -11.740 -18.062 43.672 1.00 57.04  ? 99  ARG G C     1 
ATOM   5125  O  O     . ARG G 3  86  ? -11.487 -18.980 42.887 1.00 57.42  ? 99  ARG G O     1 
ATOM   5126  C  CB    . ARG G 3  86  ? -14.184 -18.521 43.308 1.00 65.02  ? 99  ARG G CB    1 
ATOM   5127  C  CG    . ARG G 3  86  ? -15.616 -18.403 43.811 1.00 75.35  ? 99  ARG G CG    1 
ATOM   5128  C  CD    . ARG G 3  86  ? -15.795 -19.110 45.146 1.00 87.67  ? 99  ARG G CD    1 
ATOM   5129  N  NE    . ARG G 3  86  ? -17.188 -19.108 45.586 1.00 99.51  ? 99  ARG G NE    1 
ATOM   5130  C  CZ    . ARG G 3  86  ? -17.620 -19.682 46.705 1.00 110.06 ? 99  ARG G CZ    1 
ATOM   5131  N  NH1   . ARG G 3  86  ? -16.767 -20.308 47.506 1.00 112.99 ? 99  ARG G NH1   1 
ATOM   5132  N  NH2   . ARG G 3  86  ? -18.907 -19.630 47.024 1.00 116.70 ? 99  ARG G NH2   1 
ATOM   5133  N  N     . VAL G 3  87  ? -10.815 -17.192 44.073 1.00 52.84  ? 100 VAL G N     1 
ATOM   5134  C  CA    . VAL G 3  87  ? -9.455  -17.167 43.551 1.00 51.40  ? 100 VAL G CA    1 
ATOM   5135  C  C     . VAL G 3  87  ? -8.483  -17.275 44.718 1.00 56.33  ? 100 VAL G C     1 
ATOM   5136  O  O     . VAL G 3  87  ? -8.739  -16.746 45.807 1.00 60.30  ? 100 VAL G O     1 
ATOM   5137  C  CB    . VAL G 3  87  ? -9.188  -15.885 42.731 1.00 46.76  ? 100 VAL G CB    1 
ATOM   5138  C  CG1   . VAL G 3  87  ? -7.765  -15.863 42.196 1.00 39.80  ? 100 VAL G CG1   1 
ATOM   5139  C  CG2   . VAL G 3  87  ? -10.191 -15.765 41.590 1.00 45.10  ? 100 VAL G CG2   1 
ATOM   5140  N  N     . THR G 3  88  ? -7.369  -17.968 44.490 1.00 56.63  ? 101 THR G N     1 
ATOM   5141  C  CA    . THR G 3  88  ? -6.310  -18.114 45.478 1.00 55.38  ? 101 THR G CA    1 
ATOM   5142  C  C     . THR G 3  88  ? -5.027  -17.502 44.935 1.00 53.85  ? 101 THR G C     1 
ATOM   5143  O  O     . THR G 3  88  ? -4.610  -17.817 43.815 1.00 57.24  ? 101 THR G O     1 
ATOM   5144  C  CB    . THR G 3  88  ? -6.081  -19.584 45.839 1.00 57.43  ? 101 THR G CB    1 
ATOM   5145  O  OG1   . THR G 3  88  ? -7.280  -20.131 46.403 1.00 63.07  ? 101 THR G OG1   1 
ATOM   5146  C  CG2   . THR G 3  88  ? -4.949  -19.712 46.848 1.00 49.85  ? 101 THR G CG2   1 
ATOM   5147  N  N     . ILE G 3  89  ? -4.408  -16.635 45.727 1.00 52.23  ? 102 ILE G N     1 
ATOM   5148  C  CA    . ILE G 3  89  ? -3.148  -15.993 45.373 1.00 52.10  ? 102 ILE G CA    1 
ATOM   5149  C  C     . ILE G 3  89  ? -2.028  -16.724 46.100 1.00 48.51  ? 102 ILE G C     1 
ATOM   5150  O  O     . ILE G 3  89  ? -1.987  -16.741 47.337 1.00 49.95  ? 102 ILE G O     1 
ATOM   5151  C  CB    . ILE G 3  89  ? -3.166  -14.497 45.729 1.00 53.05  ? 102 ILE G CB    1 
ATOM   5152  C  CG1   . ILE G 3  89  ? -4.125  -13.742 44.805 1.00 44.52  ? 102 ILE G CG1   1 
ATOM   5153  C  CG2   . ILE G 3  89  ? -1.770  -13.905 45.652 1.00 53.62  ? 102 ILE G CG2   1 
ATOM   5154  C  CD1   . ILE G 3  89  ? -4.386  -12.321 45.231 1.00 46.17  ? 102 ILE G CD1   1 
ATOM   5155  N  N     . ALA G 3  90  ? -1.128  -17.337 45.334 1.00 47.75  ? 103 ALA G N     1 
ATOM   5156  C  CA    . ALA G 3  90  ? -0.041  -18.110 45.920 1.00 46.23  ? 103 ALA G CA    1 
ATOM   5157  C  C     . ALA G 3  90  ? 0.873   -17.215 46.747 1.00 54.77  ? 103 ALA G C     1 
ATOM   5158  O  O     . ALA G 3  90  ? 1.219   -16.104 46.335 1.00 63.87  ? 103 ALA G O     1 
ATOM   5159  C  CB    . ALA G 3  90  ? 0.758   -18.813 44.823 1.00 39.38  ? 103 ALA G CB    1 
ATOM   5160  N  N     . GLN G 3  91  ? 1.261   -17.710 47.925 1.00 53.79  ? 104 GLN G N     1 
ATOM   5161  C  CA    . GLN G 3  91  ? 2.082   -16.962 48.882 1.00 55.29  ? 104 GLN G CA    1 
ATOM   5162  C  C     . GLN G 3  91  ? 1.425   -15.647 49.290 1.00 56.88  ? 104 GLN G C     1 
ATOM   5163  O  O     . GLN G 3  91  ? 2.108   -14.647 49.517 1.00 61.06  ? 104 GLN G O     1 
ATOM   5164  C  CB    . GLN G 3  91  ? 3.490   -16.706 48.334 1.00 60.05  ? 104 GLN G CB    1 
ATOM   5165  C  CG    . GLN G 3  91  ? 4.354   -17.952 48.231 1.00 68.69  ? 104 GLN G CG    1 
ATOM   5166  C  CD    . GLN G 3  91  ? 4.679   -18.547 49.587 1.00 80.62  ? 104 GLN G CD    1 
ATOM   5167  O  OE1   . GLN G 3  91  ? 5.127   -17.847 50.495 1.00 89.12  ? 104 GLN G OE1   1 
ATOM   5168  N  NE2   . GLN G 3  91  ? 4.445   -19.845 49.735 1.00 83.67  ? 104 GLN G NE2   1 
ATOM   5169  N  N     . GLY G 3  92  ? 0.099   -15.635 49.393 1.00 52.74  ? 105 GLY G N     1 
ATOM   5170  C  CA    . GLY G 3  92  ? -0.611  -14.425 49.752 1.00 50.08  ? 105 GLY G CA    1 
ATOM   5171  C  C     . GLY G 3  92  ? -0.962  -14.341 51.223 1.00 56.35  ? 105 GLY G C     1 
ATOM   5172  O  O     . GLY G 3  92  ? -1.136  -13.244 51.760 1.00 64.03  ? 105 GLY G O     1 
ATOM   5173  N  N     . GLY G 3  93  ? -1.075  -15.488 51.886 1.00 54.31  ? 106 GLY G N     1 
ATOM   5174  C  CA    . GLY G 3  93  ? -1.454  -15.494 53.282 1.00 53.11  ? 106 GLY G CA    1 
ATOM   5175  C  C     . GLY G 3  93  ? -2.920  -15.133 53.472 1.00 56.41  ? 106 GLY G C     1 
ATOM   5176  O  O     . GLY G 3  93  ? -3.729  -15.146 52.542 1.00 60.00  ? 106 GLY G O     1 
ATOM   5177  N  N     . VAL G 3  94  ? -3.255  -14.806 54.721 1.00 60.11  ? 107 VAL G N     1 
ATOM   5178  C  CA    . VAL G 3  94  ? -4.609  -14.416 55.086 1.00 64.70  ? 107 VAL G CA    1 
ATOM   5179  C  C     . VAL G 3  94  ? -4.564  -13.074 55.806 1.00 64.92  ? 107 VAL G C     1 
ATOM   5180  O  O     . VAL G 3  94  ? -3.515  -12.624 56.273 1.00 64.46  ? 107 VAL G O     1 
ATOM   5181  C  CB    . VAL G 3  94  ? -5.308  -15.467 55.973 1.00 65.58  ? 107 VAL G CB    1 
ATOM   5182  C  CG1   . VAL G 3  94  ? -5.252  -16.844 55.325 1.00 63.86  ? 107 VAL G CG1   1 
ATOM   5183  C  CG2   . VAL G 3  94  ? -4.691  -15.488 57.363 1.00 70.73  ? 107 VAL G CG2   1 
ATOM   5184  N  N     . LEU G 3  95  ? -5.727  -12.435 55.890 1.00 62.64  ? 108 LEU G N     1 
ATOM   5185  C  CA    . LEU G 3  95  ? -5.833  -11.188 56.632 1.00 64.94  ? 108 LEU G CA    1 
ATOM   5186  C  C     . LEU G 3  95  ? -5.831  -11.472 58.132 1.00 66.98  ? 108 LEU G C     1 
ATOM   5187  O  O     . LEU G 3  95  ? -6.468  -12.432 58.584 1.00 67.03  ? 108 LEU G O     1 
ATOM   5188  C  CB    . LEU G 3  95  ? -7.108  -10.428 56.252 1.00 60.81  ? 108 LEU G CB    1 
ATOM   5189  C  CG    . LEU G 3  95  ? -7.133  -9.690  54.916 1.00 51.21  ? 108 LEU G CG    1 
ATOM   5190  C  CD1   . LEU G 3  95  ? -8.411  -8.881  54.793 1.00 51.31  ? 108 LEU G CD1   1 
ATOM   5191  C  CD2   . LEU G 3  95  ? -5.915  -8.797  54.772 1.00 44.20  ? 108 LEU G CD2   1 
ATOM   5192  N  N     . PRO G 3  96  ? -5.121  -10.671 58.925 1.00 68.84  ? 109 PRO G N     1 
ATOM   5193  C  CA    . PRO G 3  96  ? -5.161  -10.851 60.383 1.00 68.00  ? 109 PRO G CA    1 
ATOM   5194  C  C     . PRO G 3  96  ? -6.567  -10.623 60.915 1.00 68.43  ? 109 PRO G C     1 
ATOM   5195  O  O     . PRO G 3  96  ? -7.116  -9.523  60.819 1.00 69.24  ? 109 PRO G O     1 
ATOM   5196  C  CB    . PRO G 3  96  ? -4.176  -9.795  60.899 1.00 68.38  ? 109 PRO G CB    1 
ATOM   5197  C  CG    . PRO G 3  96  ? -3.279  -9.513  59.735 1.00 66.63  ? 109 PRO G CG    1 
ATOM   5198  C  CD    . PRO G 3  96  ? -4.151  -9.639  58.523 1.00 67.62  ? 109 PRO G CD    1 
ATOM   5199  N  N     . ASN G 3  97  ? -7.158  -11.683 61.463 1.00 71.66  ? 110 ASN G N     1 
ATOM   5200  C  CA    . ASN G 3  97  ? -8.515  -11.615 61.993 1.00 75.90  ? 110 ASN G CA    1 
ATOM   5201  C  C     . ASN G 3  97  ? -8.658  -12.654 63.094 1.00 74.86  ? 110 ASN G C     1 
ATOM   5202  O  O     . ASN G 3  97  ? -8.504  -13.853 62.840 1.00 76.35  ? 110 ASN G O     1 
ATOM   5203  C  CB    . ASN G 3  97  ? -9.551  -11.849 60.890 1.00 80.34  ? 110 ASN G CB    1 
ATOM   5204  C  CG    . ASN G 3  97  ? -10.972 -11.608 61.363 1.00 83.79  ? 110 ASN G CG    1 
ATOM   5205  O  OD1   . ASN G 3  97  ? -11.202 -10.907 62.350 1.00 87.75  ? 110 ASN G OD1   1 
ATOM   5206  N  ND2   . ASN G 3  97  ? -11.937 -12.190 60.658 1.00 82.37  ? 110 ASN G ND2   1 
ATOM   5207  N  N     . ILE G 3  98  ? -8.948  -12.194 64.308 1.00 72.35  ? 111 ILE G N     1 
ATOM   5208  C  CA    . ILE G 3  98  ? -9.147  -13.057 65.465 1.00 67.65  ? 111 ILE G CA    1 
ATOM   5209  C  C     . ILE G 3  98  ? -10.528 -12.771 66.036 1.00 73.71  ? 111 ILE G C     1 
ATOM   5210  O  O     . ILE G 3  98  ? -10.877 -11.608 66.274 1.00 79.65  ? 111 ILE G O     1 
ATOM   5211  C  CB    . ILE G 3  98  ? -8.058  -12.841 66.532 1.00 62.10  ? 111 ILE G CB    1 
ATOM   5212  C  CG1   . ILE G 3  98  ? -6.680  -13.191 65.967 1.00 61.66  ? 111 ILE G CG1   1 
ATOM   5213  C  CG2   . ILE G 3  98  ? -8.355  -13.662 67.778 1.00 59.67  ? 111 ILE G CG2   1 
ATOM   5214  C  CD1   . ILE G 3  98  ? -5.552  -13.032 66.962 1.00 62.22  ? 111 ILE G CD1   1 
ATOM   5215  N  N     . GLN G 3  99  ? -11.309 -13.826 66.249 1.00 77.57  ? 112 GLN G N     1 
ATOM   5216  C  CA    . GLN G 3  99  ? -12.661 -13.664 66.764 1.00 81.91  ? 112 GLN G CA    1 
ATOM   5217  C  C     . GLN G 3  99  ? -12.634 -13.084 68.174 1.00 92.30  ? 112 GLN G C     1 
ATOM   5218  O  O     . GLN G 3  99  ? -11.681 -13.276 68.934 1.00 92.02  ? 112 GLN G O     1 
ATOM   5219  C  CB    . GLN G 3  99  ? -13.394 -15.005 66.751 1.00 77.20  ? 112 GLN G CB    1 
ATOM   5220  C  CG    . GLN G 3  99  ? -13.613 -15.561 65.353 1.00 73.26  ? 112 GLN G CG    1 
ATOM   5221  C  CD    . GLN G 3  99  ? -14.674 -14.799 64.586 1.00 71.97  ? 112 GLN G CD    1 
ATOM   5222  O  OE1   . GLN G 3  99  ? -15.716 -14.439 65.137 1.00 72.68  ? 112 GLN G OE1   1 
ATOM   5223  N  NE2   . GLN G 3  99  ? -14.414 -14.544 63.308 1.00 69.36  ? 112 GLN G NE2   1 
ATOM   5224  N  N     . SER G 3  100 ? -13.704 -12.365 68.521 1.00 101.98 ? 113 SER G N     1 
ATOM   5225  C  CA    . SER G 3  100 ? -13.736 -11.647 69.791 1.00 101.60 ? 113 SER G CA    1 
ATOM   5226  C  C     . SER G 3  100 ? -13.843 -12.599 70.976 1.00 98.50  ? 113 SER G C     1 
ATOM   5227  O  O     . SER G 3  100 ? -13.220 -12.368 72.019 1.00 102.19 ? 113 SER G O     1 
ATOM   5228  C  CB    . SER G 3  100 ? -14.891 -10.646 69.798 1.00 104.90 ? 113 SER G CB    1 
ATOM   5229  O  OG    . SER G 3  100 ? -16.138 -11.304 69.647 1.00 112.68 ? 113 SER G OG    1 
ATOM   5230  N  N     . VAL G 3  101 ? -14.626 -13.673 70.839 1.00 93.63  ? 114 VAL G N     1 
ATOM   5231  C  CA    . VAL G 3  101 ? -14.795 -14.612 71.943 1.00 87.65  ? 114 VAL G CA    1 
ATOM   5232  C  C     . VAL G 3  101 ? -13.494 -15.330 72.280 1.00 89.87  ? 114 VAL G C     1 
ATOM   5233  O  O     . VAL G 3  101 ? -13.338 -15.830 73.400 1.00 92.13  ? 114 VAL G O     1 
ATOM   5234  C  CB    . VAL G 3  101 ? -15.905 -15.633 71.627 1.00 79.85  ? 114 VAL G CB    1 
ATOM   5235  C  CG1   . VAL G 3  101 ? -17.256 -14.938 71.528 1.00 75.73  ? 114 VAL G CG1   1 
ATOM   5236  C  CG2   . VAL G 3  101 ? -15.589 -16.377 70.343 1.00 79.96  ? 114 VAL G CG2   1 
ATOM   5237  N  N     . LEU G 3  102 ? -12.552 -15.390 71.341 1.00 92.00  ? 115 LEU G N     1 
ATOM   5238  C  CA    . LEU G 3  102 ? -11.263 -16.021 71.590 1.00 92.63  ? 115 LEU G CA    1 
ATOM   5239  C  C     . LEU G 3  102 ? -10.314 -15.135 72.384 1.00 95.67  ? 115 LEU G C     1 
ATOM   5240  O  O     . LEU G 3  102 ? -9.300  -15.634 72.882 1.00 93.57  ? 115 LEU G O     1 
ATOM   5241  C  CB    . LEU G 3  102 ? -10.606 -16.415 70.263 1.00 90.56  ? 115 LEU G CB    1 
ATOM   5242  C  CG    . LEU G 3  102 ? -10.920 -17.784 69.650 1.00 87.98  ? 115 LEU G CG    1 
ATOM   5243  C  CD1   . LEU G 3  102 ? -12.416 -18.021 69.517 1.00 86.12  ? 115 LEU G CD1   1 
ATOM   5244  C  CD2   . LEU G 3  102 ? -10.239 -17.918 68.296 1.00 89.55  ? 115 LEU G CD2   1 
ATOM   5245  N  N     . LEU G 3  103 ? -10.618 -13.843 72.516 1.00 104.44 ? 116 LEU G N     1 
ATOM   5246  C  CA    . LEU G 3  103 ? -9.739  -12.918 73.220 1.00 106.42 ? 116 LEU G CA    1 
ATOM   5247  C  C     . LEU G 3  103 ? -9.963  -13.015 74.728 1.00 107.72 ? 116 LEU G C     1 
ATOM   5248  O  O     . LEU G 3  103 ? -11.102 -13.160 75.180 1.00 112.14 ? 116 LEU G O     1 
ATOM   5249  C  CB    . LEU G 3  103 ? -9.983  -11.486 72.751 1.00 103.96 ? 116 LEU G CB    1 
ATOM   5250  C  CG    . LEU G 3  103 ? -9.717  -11.209 71.271 1.00 106.64 ? 116 LEU G CG    1 
ATOM   5251  C  CD1   . LEU G 3  103 ? -10.054 -9.768  70.925 1.00 107.00 ? 116 LEU G CD1   1 
ATOM   5252  C  CD2   . LEU G 3  103 ? -8.272  -11.523 70.921 1.00 109.59 ? 116 LEU G CD2   1 
ATOM   5253  N  N     . PRO G 3  104 ? -8.902  -12.938 75.522 1.00 114.58 ? 117 PRO G N     1 
ATOM   5254  C  CA    . PRO G 3  104 ? -9.039  -13.015 76.979 1.00 123.28 ? 117 PRO G CA    1 
ATOM   5255  C  C     . PRO G 3  104 ? -9.462  -11.669 77.560 1.00 136.07 ? 117 PRO G C     1 
ATOM   5256  O  O     . PRO G 3  104 ? -9.726  -10.705 76.844 1.00 136.74 ? 117 PRO G O     1 
ATOM   5257  C  CB    . PRO G 3  104 ? -7.633  -13.408 77.434 1.00 118.17 ? 117 PRO G CB    1 
ATOM   5258  C  CG    . PRO G 3  104 ? -6.741  -12.790 76.409 1.00 112.94 ? 117 PRO G CG    1 
ATOM   5259  C  CD    . PRO G 3  104 ? -7.491  -12.862 75.102 1.00 112.22 ? 117 PRO G CD    1 
ATOM   5260  N  N     . LYS G 3  105 ? -9.522  -11.621 78.887 1.00 144.00 ? 118 LYS G N     1 
ATOM   5261  C  CA    . LYS G 3  105 ? -9.876  -10.397 79.598 1.00 158.74 ? 118 LYS G CA    1 
ATOM   5262  C  C     . LYS G 3  105 ? -8.748  -9.956  80.524 1.00 162.80 ? 118 LYS G C     1 
ATOM   5263  O  O     . LYS G 3  105 ? -8.932  -9.078  81.367 1.00 165.89 ? 118 LYS G O     1 
ATOM   5264  C  CB    . LYS G 3  105 ? -11.166 -10.592 80.397 1.00 164.18 ? 118 LYS G CB    1 
ATOM   5265  C  CG    . LYS G 3  105 ? -12.427 -10.583 79.551 1.00 168.33 ? 118 LYS G CG    1 
ATOM   5266  C  CD    . LYS G 3  105 ? -12.641 -9.224  78.906 1.00 170.96 ? 118 LYS G CD    1 
ATOM   5267  C  CE    . LYS G 3  105 ? -13.898 -9.208  78.053 1.00 173.33 ? 118 LYS G CE    1 
ATOM   5268  N  NZ    . LYS G 3  105 ? -13.829 -10.207 76.953 1.00 174.68 ? 118 LYS G NZ    1 
ATOM   5269  N  N     . LYS H 5  1   ? 15.380  -20.280 22.342 1.00 147.20 ? 28  LYS H N     1 
ATOM   5270  C  CA    . LYS H 5  1   ? 14.412  -21.181 22.957 1.00 149.81 ? 28  LYS H CA    1 
ATOM   5271  C  C     . LYS H 5  1   ? 12.981  -20.822 22.570 1.00 155.22 ? 28  LYS H C     1 
ATOM   5272  O  O     . LYS H 5  1   ? 12.746  -20.149 21.566 1.00 157.57 ? 28  LYS H O     1 
ATOM   5273  C  CB    . LYS H 5  1   ? 14.553  -21.166 24.481 1.00 148.23 ? 28  LYS H CB    1 
ATOM   5274  C  CG    . LYS H 5  1   ? 15.786  -21.881 25.006 1.00 145.89 ? 28  LYS H CG    1 
ATOM   5275  C  CD    . LYS H 5  1   ? 15.934  -21.676 26.506 1.00 145.23 ? 28  LYS H CD    1 
ATOM   5276  C  CE    . LYS H 5  1   ? 17.241  -22.256 27.019 1.00 145.81 ? 28  LYS H CE    1 
ATOM   5277  N  NZ    . LYS H 5  1   ? 17.441  -21.970 28.467 1.00 146.75 ? 28  LYS H NZ    1 
ATOM   5278  N  N     . THR H 5  2   ? 12.032  -21.279 23.382 1.00 159.78 ? 29  THR H N     1 
ATOM   5279  C  CA    . THR H 5  2   ? 10.623  -21.024 23.118 1.00 164.12 ? 29  THR H CA    1 
ATOM   5280  C  C     . THR H 5  2   ? 10.262  -19.585 23.466 1.00 163.56 ? 29  THR H C     1 
ATOM   5281  O  O     . THR H 5  2   ? 10.652  -19.065 24.515 1.00 173.53 ? 29  THR H O     1 
ATOM   5282  C  CB    . THR H 5  2   ? 9.753   -21.991 23.922 1.00 172.44 ? 29  THR H CB    1 
ATOM   5283  O  OG1   . THR H 5  2   ? 10.001  -23.334 23.486 1.00 180.43 ? 29  THR H OG1   1 
ATOM   5284  C  CG2   . THR H 5  2   ? 8.275   -21.665 23.746 1.00 172.95 ? 29  THR H CG2   1 
ATOM   5285  N  N     . ARG H 5  3   ? 9.513   -18.942 22.575 1.00 155.07 ? 30  ARG H N     1 
ATOM   5286  C  CA    . ARG H 5  3   ? 9.052   -17.573 22.782 1.00 147.21 ? 30  ARG H CA    1 
ATOM   5287  C  C     . ARG H 5  3   ? 7.686   -17.616 23.459 1.00 135.78 ? 30  ARG H C     1 
ATOM   5288  O  O     . ARG H 5  3   ? 6.683   -17.972 22.832 1.00 135.62 ? 30  ARG H O     1 
ATOM   5289  C  CB    . ARG H 5  3   ? 8.988   -16.822 21.455 1.00 148.05 ? 30  ARG H CB    1 
ATOM   5290  C  CG    . ARG H 5  3   ? 8.678   -15.344 21.594 1.00 150.30 ? 30  ARG H CG    1 
ATOM   5291  C  CD    . ARG H 5  3   ? 8.468   -14.698 20.237 1.00 150.07 ? 30  ARG H CD    1 
ATOM   5292  N  NE    . ARG H 5  3   ? 7.398   -15.358 19.496 1.00 150.36 ? 30  ARG H NE    1 
ATOM   5293  C  CZ    . ARG H 5  3   ? 6.110   -15.051 19.611 1.00 151.41 ? 30  ARG H CZ    1 
ATOM   5294  N  NH1   . ARG H 5  3   ? 5.727   -14.087 20.438 1.00 152.65 ? 30  ARG H NH1   1 
ATOM   5295  N  NH2   . ARG H 5  3   ? 5.205   -15.708 18.900 1.00 150.43 ? 30  ARG H NH2   1 
ATOM   5296  N  N     . LYS H 5  4   ? 7.648   -17.254 24.739 1.00 123.86 ? 31  LYS H N     1 
ATOM   5297  C  CA    . LYS H 5  4   ? 6.430   -17.267 25.538 1.00 115.30 ? 31  LYS H CA    1 
ATOM   5298  C  C     . LYS H 5  4   ? 5.980   -15.836 25.798 1.00 110.44 ? 31  LYS H C     1 
ATOM   5299  O  O     . LYS H 5  4   ? 6.758   -15.020 26.306 1.00 116.88 ? 31  LYS H O     1 
ATOM   5300  C  CB    . LYS H 5  4   ? 6.658   -18.004 26.861 1.00 115.99 ? 31  LYS H CB    1 
ATOM   5301  C  CG    . LYS H 5  4   ? 5.462   -18.004 27.803 1.00 118.97 ? 31  LYS H CG    1 
ATOM   5302  C  CD    . LYS H 5  4   ? 4.352   -18.915 27.306 1.00 118.99 ? 31  LYS H CD    1 
ATOM   5303  C  CE    . LYS H 5  4   ? 3.220   -19.001 28.318 1.00 119.03 ? 31  LYS H CE    1 
ATOM   5304  N  NZ    . LYS H 5  4   ? 2.151   -19.942 27.882 1.00 118.08 ? 31  LYS H NZ    1 
ATOM   5305  N  N     . GLU H 5  5   ? 4.730   -15.536 25.454 1.00 97.39  ? 32  GLU H N     1 
ATOM   5306  C  CA    . GLU H 5  5   ? 4.199   -14.196 25.636 1.00 89.28  ? 32  GLU H CA    1 
ATOM   5307  C  C     . GLU H 5  5   ? 3.747   -13.982 27.079 1.00 87.04  ? 32  GLU H C     1 
ATOM   5308  O  O     . GLU H 5  5   ? 3.593   -14.924 27.861 1.00 88.58  ? 32  GLU H O     1 
ATOM   5309  C  CB    . GLU H 5  5   ? 3.037   -13.942 24.678 1.00 85.13  ? 32  GLU H CB    1 
ATOM   5310  C  CG    . GLU H 5  5   ? 3.451   -13.771 23.229 1.00 87.92  ? 32  GLU H CG    1 
ATOM   5311  C  CD    . GLU H 5  5   ? 2.273   -13.474 22.324 1.00 90.95  ? 32  GLU H CD    1 
ATOM   5312  O  OE1   . GLU H 5  5   ? 1.120   -13.616 22.787 1.00 90.91  ? 32  GLU H OE1   1 
ATOM   5313  O  OE2   . GLU H 5  5   ? 2.501   -13.096 21.153 1.00 91.53  ? 32  GLU H OE2   1 
ATOM   5314  N  N     . SER H 5  6   ? 3.527   -12.715 27.423 1.00 80.76  ? 33  SER H N     1 
ATOM   5315  C  CA    . SER H 5  6   ? 3.122   -12.329 28.767 1.00 76.31  ? 33  SER H CA    1 
ATOM   5316  C  C     . SER H 5  6   ? 2.668   -10.877 28.742 1.00 84.58  ? 33  SER H C     1 
ATOM   5317  O  O     . SER H 5  6   ? 2.953   -10.135 27.797 1.00 85.26  ? 33  SER H O     1 
ATOM   5318  C  CB    . SER H 5  6   ? 4.263   -12.514 29.774 1.00 71.34  ? 33  SER H CB    1 
ATOM   5319  O  OG    . SER H 5  6   ? 3.848   -12.163 31.081 1.00 74.82  ? 33  SER H OG    1 
ATOM   5320  N  N     . TYR H 5  7   ? 1.952   -10.485 29.795 1.00 87.97  ? 34  TYR H N     1 
ATOM   5321  C  CA    . TYR H 5  7   ? 1.559   -9.099  30.006 1.00 84.99  ? 34  TYR H CA    1 
ATOM   5322  C  C     . TYR H 5  7   ? 2.541   -8.348  30.895 1.00 87.35  ? 34  TYR H C     1 
ATOM   5323  O  O     . TYR H 5  7   ? 2.173   -7.328  31.488 1.00 89.80  ? 34  TYR H O     1 
ATOM   5324  C  CB    . TYR H 5  7   ? 0.155   -9.031  30.612 1.00 80.22  ? 34  TYR H CB    1 
ATOM   5325  C  CG    . TYR H 5  7   ? -0.948  -9.477  29.680 1.00 78.63  ? 34  TYR H CG    1 
ATOM   5326  C  CD1   . TYR H 5  7   ? -1.456  -8.617  28.715 1.00 79.67  ? 34  TYR H CD1   1 
ATOM   5327  C  CD2   . TYR H 5  7   ? -1.489  -10.752 29.772 1.00 78.28  ? 34  TYR H CD2   1 
ATOM   5328  C  CE1   . TYR H 5  7   ? -2.467  -9.018  27.862 1.00 80.19  ? 34  TYR H CE1   1 
ATOM   5329  C  CE2   . TYR H 5  7   ? -2.501  -11.161 28.923 1.00 78.98  ? 34  TYR H CE2   1 
ATOM   5330  C  CZ    . TYR H 5  7   ? -2.986  -10.290 27.970 1.00 79.66  ? 34  TYR H CZ    1 
ATOM   5331  O  OH    . TYR H 5  7   ? -3.993  -10.691 27.122 1.00 79.19  ? 34  TYR H OH    1 
ATOM   5332  N  N     . ALA H 5  8   ? 3.784   -8.827  30.992 1.00 87.42  ? 35  ALA H N     1 
ATOM   5333  C  CA    . ALA H 5  8   ? 4.726   -8.268  31.956 1.00 84.45  ? 35  ALA H CA    1 
ATOM   5334  C  C     . ALA H 5  8   ? 5.093   -6.827  31.619 1.00 82.94  ? 35  ALA H C     1 
ATOM   5335  O  O     . ALA H 5  8   ? 5.155   -5.974  32.512 1.00 83.88  ? 35  ALA H O     1 
ATOM   5336  C  CB    . ALA H 5  8   ? 5.980   -9.140  32.026 1.00 82.01  ? 35  ALA H CB    1 
ATOM   5337  N  N     . ILE H 5  9   ? 5.338   -6.531  30.340 1.00 78.21  ? 36  ILE H N     1 
ATOM   5338  C  CA    . ILE H 5  9   ? 5.769   -5.182  29.986 1.00 83.02  ? 36  ILE H CA    1 
ATOM   5339  C  C     . ILE H 5  9   ? 4.627   -4.186  30.148 1.00 86.83  ? 36  ILE H C     1 
ATOM   5340  O  O     . ILE H 5  9   ? 4.859   -3.022  30.495 1.00 90.26  ? 36  ILE H O     1 
ATOM   5341  C  CB    . ILE H 5  9   ? 6.351   -5.145  28.559 1.00 77.02  ? 36  ILE H CB    1 
ATOM   5342  C  CG1   . ILE H 5  9   ? 5.282   -5.484  27.517 1.00 67.23  ? 36  ILE H CG1   1 
ATOM   5343  C  CG2   . ILE H 5  9   ? 7.534   -6.093  28.440 1.00 80.13  ? 36  ILE H CG2   1 
ATOM   5344  C  CD1   . ILE H 5  9   ? 5.767   -5.353  26.090 1.00 61.48  ? 36  ILE H CD1   1 
ATOM   5345  N  N     . TYR H 5  10  ? 3.385   -4.616  29.917 1.00 81.93  ? 37  TYR H N     1 
ATOM   5346  C  CA    . TYR H 5  10  ? 2.257   -3.697  30.009 1.00 73.26  ? 37  TYR H CA    1 
ATOM   5347  C  C     . TYR H 5  10  ? 1.816   -3.482  31.448 1.00 72.59  ? 37  TYR H C     1 
ATOM   5348  O  O     . TYR H 5  10  ? 1.354   -2.388  31.792 1.00 78.98  ? 37  TYR H O     1 
ATOM   5349  C  CB    . TYR H 5  10  ? 1.092   -4.215  29.167 1.00 70.46  ? 37  TYR H CB    1 
ATOM   5350  C  CG    . TYR H 5  10  ? 1.532   -4.755  27.828 1.00 69.03  ? 37  TYR H CG    1 
ATOM   5351  C  CD1   . TYR H 5  10  ? 1.881   -3.897  26.792 1.00 69.51  ? 37  TYR H CD1   1 
ATOM   5352  C  CD2   . TYR H 5  10  ? 1.610   -6.122  27.602 1.00 63.50  ? 37  TYR H CD2   1 
ATOM   5353  C  CE1   . TYR H 5  10  ? 2.289   -4.388  25.567 1.00 70.28  ? 37  TYR H CE1   1 
ATOM   5354  C  CE2   . TYR H 5  10  ? 2.016   -6.621  26.382 1.00 63.07  ? 37  TYR H CE2   1 
ATOM   5355  C  CZ    . TYR H 5  10  ? 2.354   -5.751  25.369 1.00 71.99  ? 37  TYR H CZ    1 
ATOM   5356  O  OH    . TYR H 5  10  ? 2.758   -6.249  24.153 1.00 79.99  ? 37  TYR H OH    1 
ATOM   5357  N  N     . VAL H 5  11  ? 1.941   -4.503  32.297 1.00 70.65  ? 38  VAL H N     1 
ATOM   5358  C  CA    . VAL H 5  11  ? 1.702   -4.303  33.722 1.00 70.66  ? 38  VAL H CA    1 
ATOM   5359  C  C     . VAL H 5  11  ? 2.792   -3.422  34.319 1.00 68.67  ? 38  VAL H C     1 
ATOM   5360  O  O     . VAL H 5  11  ? 2.530   -2.602  35.207 1.00 66.84  ? 38  VAL H O     1 
ATOM   5361  C  CB    . VAL H 5  11  ? 1.600   -5.660  34.443 1.00 68.71  ? 38  VAL H CB    1 
ATOM   5362  C  CG1   . VAL H 5  11  ? 1.554   -5.467  35.950 1.00 67.43  ? 38  VAL H CG1   1 
ATOM   5363  C  CG2   . VAL H 5  11  ? 0.371   -6.416  33.972 1.00 55.49  ? 38  VAL H CG2   1 
ATOM   5364  N  N     . TYR H 5  12  ? 4.025   -3.557  33.823 1.00 71.21  ? 39  TYR H N     1 
ATOM   5365  C  CA    . TYR H 5  12  ? 5.122   -2.745  34.339 1.00 81.17  ? 39  TYR H CA    1 
ATOM   5366  C  C     . TYR H 5  12  ? 4.980   -1.282  33.932 1.00 80.00  ? 39  TYR H C     1 
ATOM   5367  O  O     . TYR H 5  12  ? 5.385   -0.388  34.686 1.00 77.56  ? 39  TYR H O     1 
ATOM   5368  C  CB    . TYR H 5  12  ? 6.460   -3.309  33.860 1.00 90.77  ? 39  TYR H CB    1 
ATOM   5369  C  CG    . TYR H 5  12  ? 7.635   -2.911  34.723 1.00 105.26 ? 39  TYR H CG    1 
ATOM   5370  C  CD1   . TYR H 5  12  ? 7.975   -3.652  35.847 1.00 110.44 ? 39  TYR H CD1   1 
ATOM   5371  C  CD2   . TYR H 5  12  ? 8.402   -1.794  34.417 1.00 115.35 ? 39  TYR H CD2   1 
ATOM   5372  C  CE1   . TYR H 5  12  ? 9.045   -3.293  36.642 1.00 118.43 ? 39  TYR H CE1   1 
ATOM   5373  C  CE2   . TYR H 5  12  ? 9.476   -1.426  35.207 1.00 121.21 ? 39  TYR H CE2   1 
ATOM   5374  C  CZ    . TYR H 5  12  ? 9.792   -2.180  36.319 1.00 124.40 ? 39  TYR H CZ    1 
ATOM   5375  O  OH    . TYR H 5  12  ? 10.860  -1.820  37.109 1.00 135.44 ? 39  TYR H OH    1 
ATOM   5376  N  N     . LYS H 5  13  ? 4.413   -1.016  32.753 1.00 73.32  ? 40  LYS H N     1 
ATOM   5377  C  CA    . LYS H 5  13  ? 4.152   0.363   32.351 1.00 67.55  ? 40  LYS H CA    1 
ATOM   5378  C  C     . LYS H 5  13  ? 3.110   1.007   33.256 1.00 75.44  ? 40  LYS H C     1 
ATOM   5379  O  O     . LYS H 5  13  ? 3.284   2.143   33.713 1.00 83.16  ? 40  LYS H O     1 
ATOM   5380  C  CB    . LYS H 5  13  ? 3.693   0.412   30.893 1.00 60.71  ? 40  LYS H CB    1 
ATOM   5381  C  CG    . LYS H 5  13  ? 4.762   0.058   29.877 1.00 62.95  ? 40  LYS H CG    1 
ATOM   5382  C  CD    . LYS H 5  13  ? 4.203   0.118   28.463 1.00 69.94  ? 40  LYS H CD    1 
ATOM   5383  C  CE    . LYS H 5  13  ? 5.191   -0.443  27.450 1.00 80.72  ? 40  LYS H CE    1 
ATOM   5384  N  NZ    . LYS H 5  13  ? 6.471   0.320   27.428 1.00 89.07  ? 40  LYS H NZ    1 
ATOM   5385  N  N     . VAL H 5  14  ? 2.014   0.293   33.523 1.00 58.43  ? 41  VAL H N     1 
ATOM   5386  C  CA    . VAL H 5  14  ? 0.957   0.843   34.365 1.00 57.72  ? 41  VAL H CA    1 
ATOM   5387  C  C     . VAL H 5  14  ? 1.455   1.040   35.791 1.00 65.75  ? 41  VAL H C     1 
ATOM   5388  O  O     . VAL H 5  14  ? 1.100   2.021   36.457 1.00 66.12  ? 41  VAL H O     1 
ATOM   5389  C  CB    . VAL H 5  14  ? -0.286  -0.065  34.312 1.00 52.02  ? 41  VAL H CB    1 
ATOM   5390  C  CG1   . VAL H 5  14  ? -1.365  0.449   35.245 1.00 42.03  ? 41  VAL H CG1   1 
ATOM   5391  C  CG2   . VAL H 5  14  ? -0.811  -0.156  32.889 1.00 50.04  ? 41  VAL H CG2   1 
ATOM   5392  N  N     . LEU H 5  15  ? 2.291   0.119   36.279 1.00 72.42  ? 42  LEU H N     1 
ATOM   5393  C  CA    . LEU H 5  15  ? 2.845   0.261   37.622 1.00 68.73  ? 42  LEU H CA    1 
ATOM   5394  C  C     . LEU H 5  15  ? 3.652   1.547   37.758 1.00 64.17  ? 42  LEU H C     1 
ATOM   5395  O  O     . LEU H 5  15  ? 3.512   2.273   38.749 1.00 61.24  ? 42  LEU H O     1 
ATOM   5396  C  CB    . LEU H 5  15  ? 3.712   -0.952  37.966 1.00 62.16  ? 42  LEU H CB    1 
ATOM   5397  C  CG    . LEU H 5  15  ? 4.559   -0.834  39.237 1.00 57.92  ? 42  LEU H CG    1 
ATOM   5398  C  CD1   . LEU H 5  15  ? 3.680   -0.762  40.476 1.00 52.03  ? 42  LEU H CD1   1 
ATOM   5399  C  CD2   . LEU H 5  15  ? 5.549   -1.988  39.339 1.00 65.11  ? 42  LEU H CD2   1 
ATOM   5400  N  N     . LYS H 5  16  ? 4.496   1.850   36.768 1.00 64.85  ? 43  LYS H N     1 
ATOM   5401  C  CA    . LYS H 5  16  ? 5.316   3.054   36.845 1.00 63.93  ? 43  LYS H CA    1 
ATOM   5402  C  C     . LYS H 5  16  ? 4.476   4.319   36.724 1.00 66.02  ? 43  LYS H C     1 
ATOM   5403  O  O     . LYS H 5  16  ? 4.851   5.364   37.268 1.00 67.50  ? 43  LYS H O     1 
ATOM   5404  C  CB    . LYS H 5  16  ? 6.400   3.024   35.769 1.00 65.75  ? 43  LYS H CB    1 
ATOM   5405  C  CG    . LYS H 5  16  ? 7.485   1.995   36.034 1.00 75.48  ? 43  LYS H CG    1 
ATOM   5406  C  CD    . LYS H 5  16  ? 8.040   2.150   37.443 1.00 80.72  ? 43  LYS H CD    1 
ATOM   5407  C  CE    . LYS H 5  16  ? 9.156   1.157   37.719 1.00 85.31  ? 43  LYS H CE    1 
ATOM   5408  N  NZ    . LYS H 5  16  ? 9.700   1.313   39.097 1.00 84.90  ? 43  LYS H NZ    1 
ATOM   5409  N  N     . GLN H 5  17  ? 3.346   4.250   36.016 1.00 63.17  ? 44  GLN H N     1 
ATOM   5410  C  CA    . GLN H 5  17  ? 2.430   5.385   35.989 1.00 56.28  ? 44  GLN H CA    1 
ATOM   5411  C  C     . GLN H 5  17  ? 1.854   5.656   37.372 1.00 60.71  ? 44  GLN H C     1 
ATOM   5412  O  O     . GLN H 5  17  ? 1.639   6.814   37.751 1.00 69.88  ? 44  GLN H O     1 
ATOM   5413  C  CB    . GLN H 5  17  ? 1.300   5.127   34.993 1.00 54.32  ? 44  GLN H CB    1 
ATOM   5414  C  CG    . GLN H 5  17  ? 1.691   5.194   33.528 1.00 57.76  ? 44  GLN H CG    1 
ATOM   5415  C  CD    . GLN H 5  17  ? 0.496   4.994   32.612 1.00 59.83  ? 44  GLN H CD    1 
ATOM   5416  O  OE1   . GLN H 5  17  ? -0.229  4.006   32.730 1.00 65.37  ? 44  GLN H OE1   1 
ATOM   5417  N  NE2   . GLN H 5  17  ? 0.275   5.940   31.707 1.00 55.97  ? 44  GLN H NE2   1 
ATOM   5418  N  N     . VAL H 5  18  ? 1.605   4.599   38.141 1.00 59.76  ? 45  VAL H N     1 
ATOM   5419  C  CA    . VAL H 5  18  ? 0.928   4.719   39.428 1.00 56.53  ? 45  VAL H CA    1 
ATOM   5420  C  C     . VAL H 5  18  ? 1.922   4.823   40.579 1.00 60.41  ? 45  VAL H C     1 
ATOM   5421  O  O     . VAL H 5  18  ? 1.719   5.604   41.513 1.00 73.38  ? 45  VAL H O     1 
ATOM   5422  C  CB    . VAL H 5  18  ? -0.032  3.527   39.607 1.00 54.97  ? 45  VAL H CB    1 
ATOM   5423  C  CG1   . VAL H 5  18  ? -0.539  3.457   41.029 1.00 60.85  ? 45  VAL H CG1   1 
ATOM   5424  C  CG2   . VAL H 5  18  ? -1.195  3.637   38.629 1.00 49.02  ? 45  VAL H CG2   1 
ATOM   5425  N  N     . HIS H 5  19  ? 3.008   4.052   40.534 1.00 54.40  ? 46  HIS H N     1 
ATOM   5426  C  CA    . HIS H 5  19  ? 4.055   4.098   41.553 1.00 55.30  ? 46  HIS H CA    1 
ATOM   5427  C  C     . HIS H 5  19  ? 5.406   4.104   40.852 1.00 59.01  ? 46  HIS H C     1 
ATOM   5428  O  O     . HIS H 5  19  ? 5.968   3.043   40.549 1.00 59.14  ? 46  HIS H O     1 
ATOM   5429  C  CB    . HIS H 5  19  ? 3.937   2.929   42.527 1.00 54.24  ? 46  HIS H CB    1 
ATOM   5430  C  CG    . HIS H 5  19  ? 2.724   2.987   43.401 1.00 54.40  ? 46  HIS H CG    1 
ATOM   5431  N  ND1   . HIS H 5  19  ? 1.628   2.174   43.208 1.00 57.48  ? 46  HIS H ND1   1 
ATOM   5432  C  CD2   . HIS H 5  19  ? 2.433   3.761   44.473 1.00 52.71  ? 46  HIS H CD2   1 
ATOM   5433  C  CE1   . HIS H 5  19  ? 0.716   2.444   44.125 1.00 55.90  ? 46  HIS H CE1   1 
ATOM   5434  N  NE2   . HIS H 5  19  ? 1.179   3.405   44.904 1.00 51.43  ? 46  HIS H NE2   1 
ATOM   5435  N  N     . PRO H 5  20  ? 5.961   5.289   40.579 1.00 64.16  ? 47  PRO H N     1 
ATOM   5436  C  CA    . PRO H 5  20  ? 7.211   5.356   39.803 1.00 65.69  ? 47  PRO H CA    1 
ATOM   5437  C  C     . PRO H 5  20  ? 8.419   4.769   40.513 1.00 73.56  ? 47  PRO H C     1 
ATOM   5438  O  O     . PRO H 5  20  ? 9.376   4.376   39.835 1.00 79.08  ? 47  PRO H O     1 
ATOM   5439  C  CB    . PRO H 5  20  ? 7.392   6.861   39.559 1.00 65.51  ? 47  PRO H CB    1 
ATOM   5440  C  CG    . PRO H 5  20  ? 6.032   7.457   39.778 1.00 62.90  ? 47  PRO H CG    1 
ATOM   5441  C  CD    . PRO H 5  20  ? 5.396   6.623   40.839 1.00 60.31  ? 47  PRO H CD    1 
ATOM   5442  N  N     . ASP H 5  21  ? 8.416   4.700   41.844 1.00 79.92  ? 48  ASP H N     1 
ATOM   5443  C  CA    . ASP H 5  21  ? 9.545   4.180   42.605 1.00 89.05  ? 48  ASP H CA    1 
ATOM   5444  C  C     . ASP H 5  21  ? 9.235   2.826   43.237 1.00 92.54  ? 48  ASP H C     1 
ATOM   5445  O  O     . ASP H 5  21  ? 9.752   2.503   44.309 1.00 96.22  ? 48  ASP H O     1 
ATOM   5446  C  CB    . ASP H 5  21  ? 9.973   5.179   43.678 1.00 96.61  ? 48  ASP H CB    1 
ATOM   5447  C  CG    . ASP H 5  21  ? 10.335  6.534   43.103 1.00 101.12 ? 48  ASP H CG    1 
ATOM   5448  O  OD1   . ASP H 5  21  ? 10.683  6.602   41.906 1.00 106.92 ? 48  ASP H OD1   1 
ATOM   5449  O  OD2   . ASP H 5  21  ? 10.272  7.532   43.851 1.00 101.49 ? 48  ASP H OD2   1 
ATOM   5450  N  N     . THR H 5  22  ? 8.401   2.022   42.581 1.00 91.64  ? 49  THR H N     1 
ATOM   5451  C  CA    . THR H 5  22  ? 7.977   0.733   43.108 1.00 88.78  ? 49  THR H CA    1 
ATOM   5452  C  C     . THR H 5  22  ? 8.161   -0.339  42.044 1.00 89.92  ? 49  THR H C     1 
ATOM   5453  O  O     . THR H 5  22  ? 7.839   -0.125  40.871 1.00 91.62  ? 49  THR H O     1 
ATOM   5454  C  CB    . THR H 5  22  ? 6.510   0.778   43.563 1.00 86.80  ? 49  THR H CB    1 
ATOM   5455  O  OG1   . THR H 5  22  ? 6.356   1.761   44.595 1.00 87.58  ? 49  THR H OG1   1 
ATOM   5456  C  CG2   . THR H 5  22  ? 6.057   -0.576  44.084 1.00 86.03  ? 49  THR H CG2   1 
ATOM   5457  N  N     . GLY H 5  23  ? 8.690   -1.491  42.458 1.00 86.22  ? 50  GLY H N     1 
ATOM   5458  C  CA    . GLY H 5  23  ? 8.886   -2.621  41.582 1.00 82.74  ? 50  GLY H CA    1 
ATOM   5459  C  C     . GLY H 5  23  ? 7.936   -3.766  41.898 1.00 74.94  ? 50  GLY H C     1 
ATOM   5460  O  O     . GLY H 5  23  ? 7.050   -3.667  42.745 1.00 72.79  ? 50  GLY H O     1 
ATOM   5461  N  N     . ILE H 5  24  ? 8.148   -4.874  41.187 1.00 70.67  ? 51  ILE H N     1 
ATOM   5462  C  CA    . ILE H 5  24  ? 7.319   -6.065  41.336 1.00 65.37  ? 51  ILE H CA    1 
ATOM   5463  C  C     . ILE H 5  24  ? 8.205   -7.301  41.219 1.00 66.82  ? 51  ILE H C     1 
ATOM   5464  O  O     . ILE H 5  24  ? 9.137   -7.341  40.408 1.00 70.29  ? 51  ILE H O     1 
ATOM   5465  C  CB    . ILE H 5  24  ? 6.171   -6.087  40.301 1.00 53.84  ? 51  ILE H CB    1 
ATOM   5466  C  CG1   . ILE H 5  24  ? 5.112   -7.116  40.696 1.00 46.89  ? 51  ILE H CG1   1 
ATOM   5467  C  CG2   . ILE H 5  24  ? 6.693   -6.360  38.896 1.00 48.77  ? 51  ILE H CG2   1 
ATOM   5468  C  CD1   . ILE H 5  24  ? 3.855   -7.053  39.856 1.00 45.94  ? 51  ILE H CD1   1 
ATOM   5469  N  N     . SER H 5  25  ? 7.928   -8.301  42.051 1.00 67.15  ? 52  SER H N     1 
ATOM   5470  C  CA    . SER H 5  25  ? 8.708   -9.528  42.043 1.00 61.61  ? 52  SER H CA    1 
ATOM   5471  C  C     . SER H 5  25  ? 8.223   -10.461 40.938 1.00 62.05  ? 52  SER H C     1 
ATOM   5472  O  O     . SER H 5  25  ? 7.132   -10.298 40.384 1.00 57.04  ? 52  SER H O     1 
ATOM   5473  C  CB    . SER H 5  25  ? 8.619   -10.235 43.395 1.00 52.32  ? 52  SER H CB    1 
ATOM   5474  O  OG    . SER H 5  25  ? 7.312   -10.734 43.617 1.00 48.99  ? 52  SER H OG    1 
ATOM   5475  N  N     . SER H 5  26  ? 9.060   -11.453 40.623 1.00 68.34  ? 53  SER H N     1 
ATOM   5476  C  CA    . SER H 5  26  ? 8.701   -12.422 39.593 1.00 64.61  ? 53  SER H CA    1 
ATOM   5477  C  C     . SER H 5  26  ? 7.398   -13.131 39.935 1.00 57.43  ? 53  SER H C     1 
ATOM   5478  O  O     . SER H 5  26  ? 6.525   -13.293 39.073 1.00 56.07  ? 53  SER H O     1 
ATOM   5479  C  CB    . SER H 5  26  ? 9.831   -13.434 39.410 1.00 73.94  ? 53  SER H CB    1 
ATOM   5480  O  OG    . SER H 5  26  ? 9.508   -14.372 38.400 1.00 87.72  ? 53  SER H OG    1 
ATOM   5481  N  N     . LYS H 5  27  ? 7.242   -13.547 41.194 1.00 56.20  ? 54  LYS H N     1 
ATOM   5482  C  CA    . LYS H 5  27  ? 6.015   -14.219 41.613 1.00 61.35  ? 54  LYS H CA    1 
ATOM   5483  C  C     . LYS H 5  27  ? 4.814   -13.288 41.505 1.00 58.28  ? 54  LYS H C     1 
ATOM   5484  O  O     . LYS H 5  27  ? 3.758   -13.676 40.992 1.00 54.40  ? 54  LYS H O     1 
ATOM   5485  C  CB    . LYS H 5  27  ? 6.163   -14.740 43.043 1.00 70.30  ? 54  LYS H CB    1 
ATOM   5486  C  CG    . LYS H 5  27  ? 7.132   -15.901 43.199 1.00 72.89  ? 54  LYS H CG    1 
ATOM   5487  C  CD    . LYS H 5  27  ? 7.187   -16.378 44.643 1.00 73.49  ? 54  LYS H CD    1 
ATOM   5488  C  CE    . LYS H 5  27  ? 8.236   -17.464 44.830 1.00 77.97  ? 54  LYS H CE    1 
ATOM   5489  N  NZ    . LYS H 5  27  ? 8.254   -17.987 46.225 1.00 80.63  ? 54  LYS H NZ    1 
ATOM   5490  N  N     . ALA H 5  28  ? 4.956   -12.051 41.987 1.00 65.15  ? 55  ALA H N     1 
ATOM   5491  C  CA    . ALA H 5  28  ? 3.842   -11.111 41.935 1.00 58.96  ? 55  ALA H CA    1 
ATOM   5492  C  C     . ALA H 5  28  ? 3.470   -10.757 40.501 1.00 56.32  ? 55  ALA H C     1 
ATOM   5493  O  O     . ALA H 5  28  ? 2.287   -10.562 40.201 1.00 49.65  ? 55  ALA H O     1 
ATOM   5494  C  CB    . ALA H 5  28  ? 4.180   -9.851  42.728 1.00 53.37  ? 55  ALA H CB    1 
ATOM   5495  N  N     . MET H 5  29  ? 4.455   -10.677 39.603 1.00 60.56  ? 56  MET H N     1 
ATOM   5496  C  CA    . MET H 5  29  ? 4.144   -10.428 38.199 1.00 65.38  ? 56  MET H CA    1 
ATOM   5497  C  C     . MET H 5  29  ? 3.411   -11.612 37.580 1.00 70.95  ? 56  MET H C     1 
ATOM   5498  O  O     . MET H 5  29  ? 2.483   -11.427 36.783 1.00 69.38  ? 56  MET H O     1 
ATOM   5499  C  CB    . MET H 5  29  ? 5.421   -10.113 37.421 1.00 69.85  ? 56  MET H CB    1 
ATOM   5500  C  CG    . MET H 5  29  ? 5.198   -9.910  35.929 1.00 74.06  ? 56  MET H CG    1 
ATOM   5501  S  SD    . MET H 5  29  ? 4.006   -8.604  35.564 1.00 78.33  ? 56  MET H SD    1 
ATOM   5502  C  CE    . MET H 5  29  ? 5.005   -7.141  35.820 1.00 74.22  ? 56  MET H CE    1 
ATOM   5503  N  N     . SER H 5  30  ? 3.808   -12.837 37.938 1.00 75.29  ? 57  SER H N     1 
ATOM   5504  C  CA    . SER H 5  30  ? 3.077   -14.013 37.478 1.00 78.31  ? 57  SER H CA    1 
ATOM   5505  C  C     . SER H 5  30  ? 1.639   -13.993 37.978 1.00 67.04  ? 57  SER H C     1 
ATOM   5506  O  O     . SER H 5  30  ? 0.719   -14.413 37.268 1.00 67.02  ? 57  SER H O     1 
ATOM   5507  C  CB    . SER H 5  30  ? 3.786   -15.288 37.936 1.00 96.69  ? 57  SER H CB    1 
ATOM   5508  O  OG    . SER H 5  30  ? 3.079   -16.442 37.517 1.00 117.22 ? 57  SER H OG    1 
ATOM   5509  N  N     . ILE H 5  31  ? 1.425   -13.503 39.200 1.00 61.55  ? 58  ILE H N     1 
ATOM   5510  C  CA    . ILE H 5  31  ? 0.069   -13.392 39.726 1.00 57.08  ? 58  ILE H CA    1 
ATOM   5511  C  C     . ILE H 5  31  ? -0.720  -12.343 38.955 1.00 55.67  ? 58  ILE H C     1 
ATOM   5512  O  O     . ILE H 5  31  ? -1.911  -12.524 38.675 1.00 55.12  ? 58  ILE H O     1 
ATOM   5513  C  CB    . ILE H 5  31  ? 0.114   -13.086 41.233 1.00 57.54  ? 58  ILE H CB    1 
ATOM   5514  C  CG1   . ILE H 5  31  ? 0.757   -14.256 41.974 1.00 60.65  ? 58  ILE H CG1   1 
ATOM   5515  C  CG2   . ILE H 5  31  ? -1.284  -12.807 41.769 1.00 56.70  ? 58  ILE H CG2   1 
ATOM   5516  C  CD1   . ILE H 5  31  ? 1.027   -13.977 43.416 1.00 61.43  ? 58  ILE H CD1   1 
ATOM   5517  N  N     . MET H 5  32  ? -0.073  -11.232 38.595 1.00 50.57  ? 59  MET H N     1 
ATOM   5518  C  CA    . MET H 5  32  ? -0.733  -10.232 37.763 1.00 51.98  ? 59  MET H CA    1 
ATOM   5519  C  C     . MET H 5  32  ? -1.046  -10.792 36.382 1.00 53.32  ? 59  MET H C     1 
ATOM   5520  O  O     . MET H 5  32  ? -2.151  -10.605 35.860 1.00 55.02  ? 59  MET H O     1 
ATOM   5521  C  CB    . MET H 5  32  ? 0.138   -8.981  37.648 1.00 58.56  ? 59  MET H CB    1 
ATOM   5522  C  CG    . MET H 5  32  ? 0.269   -8.189  38.936 1.00 55.39  ? 59  MET H CG    1 
ATOM   5523  S  SD    . MET H 5  32  ? -1.330  -7.708  39.612 1.00 61.36  ? 59  MET H SD    1 
ATOM   5524  C  CE    . MET H 5  32  ? -1.980  -6.707  38.277 1.00 67.85  ? 59  MET H CE    1 
ATOM   5525  N  N     . ASN H 5  33  ? -0.079  -11.483 35.773 1.00 55.42  ? 60  ASN H N     1 
ATOM   5526  C  CA    . ASN H 5  33  ? -0.319  -12.095 34.470 1.00 58.46  ? 60  ASN H CA    1 
ATOM   5527  C  C     . ASN H 5  33  ? -1.435  -13.127 34.540 1.00 53.92  ? 60  ASN H C     1 
ATOM   5528  O  O     . ASN H 5  33  ? -2.191  -13.291 33.576 1.00 57.32  ? 60  ASN H O     1 
ATOM   5529  C  CB    . ASN H 5  33  ? 0.969   -12.730 33.944 1.00 63.36  ? 60  ASN H CB    1 
ATOM   5530  C  CG    . ASN H 5  33  ? 0.875   -13.113 32.481 1.00 72.54  ? 60  ASN H CG    1 
ATOM   5531  O  OD1   . ASN H 5  33  ? 1.010   -12.266 31.599 1.00 72.32  ? 60  ASN H OD1   1 
ATOM   5532  N  ND2   . ASN H 5  33  ? 0.644   -14.394 32.215 1.00 82.66  ? 60  ASN H ND2   1 
ATOM   5533  N  N     . SER H 5  34  ? -1.562  -13.824 35.671 1.00 45.07  ? 61  SER H N     1 
ATOM   5534  C  CA    . SER H 5  34  ? -2.688  -14.732 35.845 1.00 50.20  ? 61  SER H CA    1 
ATOM   5535  C  C     . SER H 5  34  ? -3.994  -13.972 36.034 1.00 50.22  ? 61  SER H C     1 
ATOM   5536  O  O     . SER H 5  34  ? -5.057  -14.459 35.633 1.00 48.91  ? 61  SER H O     1 
ATOM   5537  C  CB    . SER H 5  34  ? -2.435  -15.666 37.031 1.00 53.53  ? 61  SER H CB    1 
ATOM   5538  O  OG    . SER H 5  34  ? -1.451  -16.640 36.716 1.00 52.23  ? 61  SER H OG    1 
ATOM   5539  N  N     . PHE H 5  35  ? -3.939  -12.781 36.633 1.00 59.86  ? 62  PHE H N     1 
ATOM   5540  C  CA    . PHE H 5  35  ? -5.157  -12.005 36.842 1.00 58.03  ? 62  PHE H CA    1 
ATOM   5541  C  C     . PHE H 5  35  ? -5.726  -11.503 35.521 1.00 57.58  ? 62  PHE H C     1 
ATOM   5542  O  O     . PHE H 5  35  ? -6.940  -11.571 35.295 1.00 64.55  ? 62  PHE H O     1 
ATOM   5543  C  CB    . PHE H 5  35  ? -4.880  -10.838 37.791 1.00 55.90  ? 62  PHE H CB    1 
ATOM   5544  C  CG    . PHE H 5  35  ? -5.991  -9.827  37.850 1.00 58.65  ? 62  PHE H CG    1 
ATOM   5545  C  CD1   . PHE H 5  35  ? -7.190  -10.131 38.476 1.00 58.01  ? 62  PHE H CD1   1 
ATOM   5546  C  CD2   . PHE H 5  35  ? -5.834  -8.571  37.283 1.00 65.28  ? 62  PHE H CD2   1 
ATOM   5547  C  CE1   . PHE H 5  35  ? -8.214  -9.203  38.532 1.00 62.34  ? 62  PHE H CE1   1 
ATOM   5548  C  CE2   . PHE H 5  35  ? -6.854  -7.638  37.334 1.00 64.96  ? 62  PHE H CE2   1 
ATOM   5549  C  CZ    . PHE H 5  35  ? -8.045  -7.954  37.959 1.00 66.02  ? 62  PHE H CZ    1 
ATOM   5550  N  N     . VAL H 5  36  ? -4.863  -11.003 34.634 1.00 49.05  ? 63  VAL H N     1 
ATOM   5551  C  CA    . VAL H 5  36  ? -5.332  -10.447 33.368 1.00 49.78  ? 63  VAL H CA    1 
ATOM   5552  C  C     . VAL H 5  36  ? -5.974  -11.533 32.512 1.00 56.72  ? 63  VAL H C     1 
ATOM   5553  O  O     . VAL H 5  36  ? -7.071  -11.348 31.970 1.00 59.59  ? 63  VAL H O     1 
ATOM   5554  C  CB    . VAL H 5  36  ? -4.176  -9.754  32.625 1.00 53.28  ? 63  VAL H CB    1 
ATOM   5555  C  CG1   . VAL H 5  36  ? -4.656  -9.215  31.286 1.00 50.34  ? 63  VAL H CG1   1 
ATOM   5556  C  CG2   . VAL H 5  36  ? -3.593  -8.634  33.479 1.00 57.70  ? 63  VAL H CG2   1 
ATOM   5557  N  N     . ASN H 5  37  ? -5.306  -12.684 32.385 1.00 55.09  ? 64  ASN H N     1 
ATOM   5558  C  CA    . ASN H 5  37  ? -5.833  -13.758 31.549 1.00 48.21  ? 64  ASN H CA    1 
ATOM   5559  C  C     . ASN H 5  37  ? -7.172  -14.265 32.072 1.00 50.54  ? 64  ASN H C     1 
ATOM   5560  O  O     . ASN H 5  37  ? -8.062  -14.612 31.287 1.00 54.39  ? 64  ASN H O     1 
ATOM   5561  C  CB    . ASN H 5  37  ? -4.825  -14.904 31.464 1.00 45.20  ? 64  ASN H CB    1 
ATOM   5562  C  CG    . ASN H 5  37  ? -3.654  -14.589 30.555 1.00 52.48  ? 64  ASN H CG    1 
ATOM   5563  O  OD1   . ASN H 5  37  ? -3.825  -14.044 29.464 1.00 62.88  ? 64  ASN H OD1   1 
ATOM   5564  N  ND2   . ASN H 5  37  ? -2.453  -14.936 31.000 1.00 51.22  ? 64  ASN H ND2   1 
ATOM   5565  N  N     . ASP H 5  38  ? -7.336  -14.310 33.396 1.00 52.13  ? 65  ASP H N     1 
ATOM   5566  C  CA    . ASP H 5  38  ? -8.602  -14.756 33.969 1.00 56.80  ? 65  ASP H CA    1 
ATOM   5567  C  C     . ASP H 5  38  ? -9.732  -13.798 33.612 1.00 59.17  ? 65  ASP H C     1 
ATOM   5568  O  O     . ASP H 5  38  ? -10.776 -14.215 33.096 1.00 57.11  ? 65  ASP H O     1 
ATOM   5569  C  CB    . ASP H 5  38  ? -8.467  -14.897 35.485 1.00 60.00  ? 65  ASP H CB    1 
ATOM   5570  C  CG    . ASP H 5  38  ? -9.764  -15.313 36.151 1.00 58.01  ? 65  ASP H CG    1 
ATOM   5571  O  OD1   . ASP H 5  38  ? -10.599 -15.959 35.483 1.00 62.40  ? 65  ASP H OD1   1 
ATOM   5572  O  OD2   . ASP H 5  38  ? -9.949  -14.994 37.345 1.00 55.21  ? 65  ASP H OD2   1 
ATOM   5573  N  N     . VAL H 5  39  ? -9.538  -12.504 33.882 1.00 60.23  ? 66  VAL H N     1 
ATOM   5574  C  CA    . VAL H 5  39  ? -10.558 -11.510 33.558 1.00 57.18  ? 66  VAL H CA    1 
ATOM   5575  C  C     . VAL H 5  39  ? -10.799 -11.464 32.054 1.00 52.47  ? 66  VAL H C     1 
ATOM   5576  O  O     . VAL H 5  39  ? -11.938 -11.299 31.596 1.00 47.38  ? 66  VAL H O     1 
ATOM   5577  C  CB    . VAL H 5  39  ? -10.152 -10.132 34.113 1.00 58.65  ? 66  VAL H CB    1 
ATOM   5578  C  CG1   . VAL H 5  39  ? -11.177 -9.078  33.734 1.00 61.28  ? 66  VAL H CG1   1 
ATOM   5579  C  CG2   . VAL H 5  39  ? -9.988  -10.198 35.623 1.00 58.87  ? 66  VAL H CG2   1 
ATOM   5580  N  N     . PHE H 5  40  ? -9.733  -11.614 31.263 1.00 52.43  ? 67  PHE H N     1 
ATOM   5581  C  CA    . PHE H 5  40  ? -9.878  -11.700 29.813 1.00 57.14  ? 67  PHE H CA    1 
ATOM   5582  C  C     . PHE H 5  40  ? -10.842 -12.816 29.427 1.00 68.47  ? 67  PHE H C     1 
ATOM   5583  O  O     . PHE H 5  40  ? -11.771 -12.608 28.640 1.00 73.42  ? 67  PHE H O     1 
ATOM   5584  C  CB    . PHE H 5  40  ? -8.507  -11.922 29.166 1.00 58.29  ? 67  PHE H CB    1 
ATOM   5585  C  CG    . PHE H 5  40  ? -8.555  -12.074 27.671 1.00 58.45  ? 67  PHE H CG    1 
ATOM   5586  C  CD1   . PHE H 5  40  ? -8.732  -13.322 27.091 1.00 63.74  ? 67  PHE H CD1   1 
ATOM   5587  C  CD2   . PHE H 5  40  ? -8.411  -10.972 26.844 1.00 51.32  ? 67  PHE H CD2   1 
ATOM   5588  C  CE1   . PHE H 5  40  ? -8.776  -13.464 25.717 1.00 66.73  ? 67  PHE H CE1   1 
ATOM   5589  C  CE2   . PHE H 5  40  ? -8.450  -11.108 25.470 1.00 54.81  ? 67  PHE H CE2   1 
ATOM   5590  C  CZ    . PHE H 5  40  ? -8.635  -12.355 24.906 1.00 64.10  ? 67  PHE H CZ    1 
ATOM   5591  N  N     . GLU H 5  41  ? -10.634 -14.012 29.982 1.00 69.09  ? 68  GLU H N     1 
ATOM   5592  C  CA    . GLU H 5  41  ? -11.489 -15.143 29.641 1.00 71.76  ? 68  GLU H CA    1 
ATOM   5593  C  C     . GLU H 5  41  ? -12.915 -14.929 30.131 1.00 63.85  ? 68  GLU H C     1 
ATOM   5594  O  O     . GLU H 5  41  ? -13.874 -15.237 29.414 1.00 68.11  ? 68  GLU H O     1 
ATOM   5595  C  CB    . GLU H 5  41  ? -10.912 -16.434 30.222 1.00 85.11  ? 68  GLU H CB    1 
ATOM   5596  C  CG    . GLU H 5  41  ? -11.715 -17.679 29.882 1.00 101.01 ? 68  GLU H CG    1 
ATOM   5597  C  CD    . GLU H 5  41  ? -11.658 -18.026 28.406 1.00 117.77 ? 68  GLU H CD    1 
ATOM   5598  O  OE1   . GLU H 5  41  ? -10.699 -17.599 27.729 1.00 121.74 ? 68  GLU H OE1   1 
ATOM   5599  O  OE2   . GLU H 5  41  ? -12.574 -18.725 27.922 1.00 122.67 ? 68  GLU H OE2   1 
ATOM   5600  N  N     . ARG H 5  42  ? -13.075 -14.406 31.348 1.00 55.79  ? 69  ARG H N     1 
ATOM   5601  C  CA    . ARG H 5  42  ? -14.414 -14.163 31.877 1.00 54.60  ? 69  ARG H CA    1 
ATOM   5602  C  C     . ARG H 5  42  ? -15.192 -13.199 30.988 1.00 63.02  ? 69  ARG H C     1 
ATOM   5603  O  O     . ARG H 5  42  ? -16.327 -13.484 30.587 1.00 67.65  ? 69  ARG H O     1 
ATOM   5604  C  CB    . ARG H 5  42  ? -14.331 -13.619 33.304 1.00 48.39  ? 69  ARG H CB    1 
ATOM   5605  C  CG    . ARG H 5  42  ? -13.764 -14.570 34.344 1.00 43.57  ? 69  ARG H CG    1 
ATOM   5606  C  CD    . ARG H 5  42  ? -14.160 -14.093 35.733 1.00 48.00  ? 69  ARG H CD    1 
ATOM   5607  N  NE    . ARG H 5  42  ? -13.155 -14.393 36.745 1.00 52.01  ? 69  ARG H NE    1 
ATOM   5608  C  CZ    . ARG H 5  42  ? -13.243 -14.010 38.016 1.00 56.01  ? 69  ARG H CZ    1 
ATOM   5609  N  NH1   . ARG H 5  42  ? -14.294 -13.314 38.428 1.00 54.55  ? 69  ARG H NH1   1 
ATOM   5610  N  NH2   . ARG H 5  42  ? -12.283 -14.323 38.875 1.00 60.03  ? 69  ARG H NH2   1 
ATOM   5611  N  N     . ILE H 5  43  ? -14.598 -12.044 30.675 1.00 59.47  ? 70  ILE H N     1 
ATOM   5612  C  CA    . ILE H 5  43  ? -15.293 -11.042 29.868 1.00 58.13  ? 70  ILE H CA    1 
ATOM   5613  C  C     . ILE H 5  43  ? -15.573 -11.585 28.473 1.00 60.86  ? 70  ILE H C     1 
ATOM   5614  O  O     . ILE H 5  43  ? -16.707 -11.531 27.982 1.00 65.60  ? 70  ILE H O     1 
ATOM   5615  C  CB    . ILE H 5  43  ? -14.481 -9.736  29.808 1.00 58.00  ? 70  ILE H CB    1 
ATOM   5616  C  CG1   . ILE H 5  43  ? -14.342 -9.121  31.201 1.00 56.94  ? 70  ILE H CG1   1 
ATOM   5617  C  CG2   . ILE H 5  43  ? -15.134 -8.746  28.851 1.00 50.00  ? 70  ILE H CG2   1 
ATOM   5618  C  CD1   . ILE H 5  43  ? -13.517 -7.856  31.218 1.00 55.34  ? 70  ILE H CD1   1 
ATOM   5619  N  N     . ALA H 5  44  ? -14.540 -12.116 27.811 1.00 64.27  ? 71  ALA H N     1 
ATOM   5620  C  CA    . ALA H 5  44  ? -14.723 -12.659 26.469 1.00 66.96  ? 71  ALA H CA    1 
ATOM   5621  C  C     . ALA H 5  44  ? -15.690 -13.835 26.467 1.00 64.14  ? 71  ALA H C     1 
ATOM   5622  O  O     . ALA H 5  44  ? -16.442 -14.016 25.503 1.00 64.49  ? 71  ALA H O     1 
ATOM   5623  C  CB    . ALA H 5  44  ? -13.375 -13.076 25.881 1.00 71.10  ? 71  ALA H CB    1 
ATOM   5624  N  N     . GLY H 5  45  ? -15.689 -14.637 27.532 1.00 60.73  ? 72  GLY H N     1 
ATOM   5625  C  CA    . GLY H 5  45  ? -16.630 -15.743 27.610 1.00 62.80  ? 72  GLY H CA    1 
ATOM   5626  C  C     . GLY H 5  45  ? -18.068 -15.276 27.718 1.00 65.13  ? 72  GLY H C     1 
ATOM   5627  O  O     . GLY H 5  45  ? -18.956 -15.808 27.045 1.00 60.94  ? 72  GLY H O     1 
ATOM   5628  N  N     . GLU H 5  46  ? -18.320 -14.275 28.565 1.00 74.47  ? 73  GLU H N     1 
ATOM   5629  C  CA    . GLU H 5  46  ? -19.671 -13.736 28.685 1.00 79.03  ? 73  GLU H CA    1 
ATOM   5630  C  C     . GLU H 5  46  ? -20.098 -13.039 27.400 1.00 77.65  ? 73  GLU H C     1 
ATOM   5631  O  O     . GLU H 5  46  ? -21.255 -13.153 26.979 1.00 75.39  ? 73  GLU H O     1 
ATOM   5632  C  CB    . GLU H 5  46  ? -19.751 -12.776 29.872 1.00 81.03  ? 73  GLU H CB    1 
ATOM   5633  C  CG    . GLU H 5  46  ? -21.159 -12.289 30.172 1.00 85.91  ? 73  GLU H CG    1 
ATOM   5634  C  CD    . GLU H 5  46  ? -22.088 -13.418 30.581 1.00 90.39  ? 73  GLU H CD    1 
ATOM   5635  O  OE1   . GLU H 5  46  ? -21.688 -14.236 31.438 1.00 96.75  ? 73  GLU H OE1   1 
ATOM   5636  O  OE2   . GLU H 5  46  ? -23.212 -13.492 30.038 1.00 88.65  ? 73  GLU H OE2   1 
ATOM   5637  N  N     . ALA H 5  47  ? -19.176 -12.314 26.762 1.00 76.64  ? 74  ALA H N     1 
ATOM   5638  C  CA    . ALA H 5  47  ? -19.485 -11.689 25.480 1.00 73.10  ? 74  ALA H CA    1 
ATOM   5639  C  C     . ALA H 5  47  ? -19.715 -12.730 24.393 1.00 71.93  ? 74  ALA H C     1 
ATOM   5640  O  O     . ALA H 5  47  ? -20.489 -12.489 23.459 1.00 70.95  ? 74  ALA H O     1 
ATOM   5641  C  CB    . ALA H 5  47  ? -18.361 -10.736 25.076 1.00 70.45  ? 74  ALA H CB    1 
ATOM   5642  N  N     . SER H 5  48  ? -19.053 -13.885 24.494 1.00 71.09  ? 75  SER H N     1 
ATOM   5643  C  CA    . SER H 5  48  ? -19.290 -14.960 23.536 1.00 69.23  ? 75  SER H CA    1 
ATOM   5644  C  C     . SER H 5  48  ? -20.714 -15.488 23.655 1.00 64.08  ? 75  SER H C     1 
ATOM   5645  O  O     . SER H 5  48  ? -21.400 -15.688 22.646 1.00 63.49  ? 75  SER H O     1 
ATOM   5646  C  CB    . SER H 5  48  ? -18.276 -16.084 23.747 1.00 73.56  ? 75  SER H CB    1 
ATOM   5647  O  OG    . SER H 5  48  ? -18.494 -17.146 22.834 1.00 81.06  ? 75  SER H OG    1 
ATOM   5648  N  N     . ARG H 5  49  ? -21.177 -15.715 24.887 1.00 61.35  ? 76  ARG H N     1 
ATOM   5649  C  CA    . ARG H 5  49  ? -22.542 -16.188 25.081 1.00 65.16  ? 76  ARG H CA    1 
ATOM   5650  C  C     . ARG H 5  49  ? -23.564 -15.111 24.738 1.00 71.29  ? 76  ARG H C     1 
ATOM   5651  O  O     . ARG H 5  49  ? -24.670 -15.434 24.291 1.00 77.55  ? 76  ARG H O     1 
ATOM   5652  C  CB    . ARG H 5  49  ? -22.733 -16.672 26.518 1.00 66.86  ? 76  ARG H CB    1 
ATOM   5653  C  CG    . ARG H 5  49  ? -21.875 -17.876 26.878 1.00 69.39  ? 76  ARG H CG    1 
ATOM   5654  C  CD    . ARG H 5  49  ? -22.171 -18.375 28.283 1.00 74.83  ? 76  ARG H CD    1 
ATOM   5655  N  NE    . ARG H 5  49  ? -21.798 -17.402 29.306 1.00 76.74  ? 76  ARG H NE    1 
ATOM   5656  C  CZ    . ARG H 5  49  ? -20.595 -17.334 29.867 1.00 76.90  ? 76  ARG H CZ    1 
ATOM   5657  N  NH1   . ARG H 5  49  ? -19.642 -18.181 29.502 1.00 74.17  ? 76  ARG H NH1   1 
ATOM   5658  N  NH2   . ARG H 5  49  ? -20.344 -16.417 30.793 1.00 77.58  ? 76  ARG H NH2   1 
ATOM   5659  N  N     . LEU H 5  50  ? -23.215 -13.836 24.933 1.00 67.94  ? 77  LEU H N     1 
ATOM   5660  C  CA    . LEU H 5  50  ? -24.130 -12.754 24.579 1.00 70.46  ? 77  LEU H CA    1 
ATOM   5661  C  C     . LEU H 5  50  ? -24.435 -12.752 23.087 1.00 77.76  ? 77  LEU H C     1 
ATOM   5662  O  O     . LEU H 5  50  ? -25.575 -12.501 22.679 1.00 81.53  ? 77  LEU H O     1 
ATOM   5663  C  CB    . LEU H 5  50  ? -23.544 -11.409 25.007 1.00 71.24  ? 77  LEU H CB    1 
ATOM   5664  C  CG    . LEU H 5  50  ? -23.802 -10.985 26.454 1.00 72.66  ? 77  LEU H CG    1 
ATOM   5665  C  CD1   . LEU H 5  50  ? -22.923 -9.804  26.834 1.00 70.93  ? 77  LEU H CD1   1 
ATOM   5666  C  CD2   . LEU H 5  50  ? -25.269 -10.641 26.642 1.00 73.84  ? 77  LEU H CD2   1 
ATOM   5667  N  N     . ALA H 5  51  ? -23.429 -13.028 22.255 1.00 79.70  ? 78  ALA H N     1 
ATOM   5668  C  CA    . ALA H 5  51  ? -23.669 -13.108 20.819 1.00 86.11  ? 78  ALA H CA    1 
ATOM   5669  C  C     . ALA H 5  51  ? -24.508 -14.332 20.467 1.00 92.46  ? 78  ALA H C     1 
ATOM   5670  O  O     . ALA H 5  51  ? -25.404 -14.252 19.619 1.00 97.27  ? 78  ALA H O     1 
ATOM   5671  C  CB    . ALA H 5  51  ? -22.339 -13.124 20.067 1.00 90.02  ? 78  ALA H CB    1 
ATOM   5672  N  N     . HIS H 5  52  ? -24.237 -15.470 21.113 1.00 92.92  ? 79  HIS H N     1 
ATOM   5673  C  CA    . HIS H 5  52  ? -25.006 -16.681 20.843 1.00 94.95  ? 79  HIS H CA    1 
ATOM   5674  C  C     . HIS H 5  52  ? -26.453 -16.542 21.300 1.00 90.86  ? 79  HIS H C     1 
ATOM   5675  O  O     . HIS H 5  52  ? -27.359 -17.096 20.665 1.00 93.11  ? 79  HIS H O     1 
ATOM   5676  C  CB    . HIS H 5  52  ? -24.357 -17.888 21.518 1.00 103.21 ? 79  HIS H CB    1 
ATOM   5677  C  CG    . HIS H 5  52  ? -23.105 -18.357 20.845 1.00 110.70 ? 79  HIS H CG    1 
ATOM   5678  N  ND1   . HIS H 5  52  ? -21.902 -17.696 20.963 1.00 114.63 ? 79  HIS H ND1   1 
ATOM   5679  C  CD2   . HIS H 5  52  ? -22.869 -19.429 20.052 1.00 113.71 ? 79  HIS H CD2   1 
ATOM   5680  C  CE1   . HIS H 5  52  ? -20.980 -18.338 20.269 1.00 113.22 ? 79  HIS H CE1   1 
ATOM   5681  N  NE2   . HIS H 5  52  ? -21.541 -19.393 19.705 1.00 114.44 ? 79  HIS H NE2   1 
ATOM   5682  N  N     . TYR H 5  53  ? -26.692 -15.810 22.394 1.00 87.01  ? 80  TYR H N     1 
ATOM   5683  C  CA    . TYR H 5  53  ? -28.059 -15.643 22.877 1.00 85.73  ? 80  TYR H CA    1 
ATOM   5684  C  C     . TYR H 5  53  ? -28.896 -14.813 21.915 1.00 82.91  ? 80  TYR H C     1 
ATOM   5685  O  O     . TYR H 5  53  ? -30.109 -15.025 21.810 1.00 82.49  ? 80  TYR H O     1 
ATOM   5686  C  CB    . TYR H 5  53  ? -28.066 -14.992 24.260 1.00 88.00  ? 80  TYR H CB    1 
ATOM   5687  C  CG    . TYR H 5  53  ? -27.401 -15.805 25.350 1.00 90.49  ? 80  TYR H CG    1 
ATOM   5688  C  CD1   . TYR H 5  53  ? -27.193 -17.172 25.204 1.00 90.92  ? 80  TYR H CD1   1 
ATOM   5689  C  CD2   . TYR H 5  53  ? -26.985 -15.202 26.531 1.00 87.76  ? 80  TYR H CD2   1 
ATOM   5690  C  CE1   . TYR H 5  53  ? -26.587 -17.912 26.203 1.00 91.02  ? 80  TYR H CE1   1 
ATOM   5691  C  CE2   . TYR H 5  53  ? -26.380 -15.934 27.535 1.00 85.97  ? 80  TYR H CE2   1 
ATOM   5692  C  CZ    . TYR H 5  53  ? -26.183 -17.287 27.367 1.00 91.50  ? 80  TYR H CZ    1 
ATOM   5693  O  OH    . TYR H 5  53  ? -25.580 -18.018 28.365 1.00 94.71  ? 80  TYR H OH    1 
ATOM   5694  N  N     . ASN H 5  54  ? -28.271 -13.872 21.207 1.00 83.83  ? 81  ASN H N     1 
ATOM   5695  C  CA    . ASN H 5  54  ? -28.975 -12.979 20.297 1.00 89.27  ? 81  ASN H CA    1 
ATOM   5696  C  C     . ASN H 5  54  ? -28.776 -13.358 18.833 1.00 92.01  ? 81  ASN H C     1 
ATOM   5697  O  O     . ASN H 5  54  ? -29.056 -12.544 17.947 1.00 90.52  ? 81  ASN H O     1 
ATOM   5698  C  CB    . ASN H 5  54  ? -28.536 -11.533 20.533 1.00 92.42  ? 81  ASN H CB    1 
ATOM   5699  C  CG    . ASN H 5  54  ? -28.894 -11.035 21.919 1.00 93.01  ? 81  ASN H CG    1 
ATOM   5700  O  OD1   . ASN H 5  54  ? -30.000 -10.546 22.147 1.00 96.55  ? 81  ASN H OD1   1 
ATOM   5701  N  ND2   . ASN H 5  54  ? -27.959 -11.159 22.854 1.00 91.83  ? 81  ASN H ND2   1 
ATOM   5702  N  N     . LYS H 5  55  ? -28.298 -14.577 18.569 1.00 95.26  ? 82  LYS H N     1 
ATOM   5703  C  CA    . LYS H 5  55  ? -28.112 -15.082 17.208 1.00 95.98  ? 82  LYS H CA    1 
ATOM   5704  C  C     . LYS H 5  55  ? -27.201 -14.168 16.391 1.00 91.66  ? 82  LYS H C     1 
ATOM   5705  O  O     . LYS H 5  55  ? -27.442 -13.911 15.210 1.00 91.00  ? 82  LYS H O     1 
ATOM   5706  C  CB    . LYS H 5  55  ? -29.458 -15.284 16.507 1.00 100.77 ? 82  LYS H CB    1 
ATOM   5707  C  CG    . LYS H 5  55  ? -30.405 -16.208 17.254 1.00 104.27 ? 82  LYS H CG    1 
ATOM   5708  C  CD    . LYS H 5  55  ? -31.730 -16.353 16.525 1.00 113.11 ? 82  LYS H CD    1 
ATOM   5709  C  CE    . LYS H 5  55  ? -32.684 -17.252 17.295 1.00 117.30 ? 82  LYS H CE    1 
ATOM   5710  N  NZ    . LYS H 5  55  ? -32.969 -16.716 18.655 1.00 117.43 ? 82  LYS H NZ    1 
ATOM   5711  N  N     . ARG H 5  56  ? -26.147 -13.670 17.029 1.00 88.78  ? 83  ARG H N     1 
ATOM   5712  C  CA    . ARG H 5  56  ? -25.149 -12.837 16.378 1.00 89.31  ? 83  ARG H CA    1 
ATOM   5713  C  C     . ARG H 5  56  ? -23.842 -13.607 16.246 1.00 91.16  ? 83  ARG H C     1 
ATOM   5714  O  O     . ARG H 5  56  ? -23.560 -14.526 17.021 1.00 95.05  ? 83  ARG H O     1 
ATOM   5715  C  CB    . ARG H 5  56  ? -24.913 -11.542 17.159 1.00 91.41  ? 83  ARG H CB    1 
ATOM   5716  C  CG    . ARG H 5  56  ? -26.141 -10.660 17.282 1.00 96.54  ? 83  ARG H CG    1 
ATOM   5717  C  CD    . ARG H 5  56  ? -26.652 -10.236 15.916 1.00 103.34 ? 83  ARG H CD    1 
ATOM   5718  N  NE    . ARG H 5  56  ? -27.802 -9.344  16.020 1.00 107.93 ? 83  ARG H NE    1 
ATOM   5719  C  CZ    . ARG H 5  56  ? -27.713 -8.025  16.156 1.00 108.98 ? 83  ARG H CZ    1 
ATOM   5720  N  NH1   . ARG H 5  56  ? -26.523 -7.441  16.206 1.00 106.49 ? 83  ARG H NH1   1 
ATOM   5721  N  NH2   . ARG H 5  56  ? -28.812 -7.288  16.243 1.00 111.15 ? 83  ARG H NH2   1 
ATOM   5722  N  N     . SER H 5  57  ? -23.044 -13.222 15.249 1.00 87.97  ? 84  SER H N     1 
ATOM   5723  C  CA    . SER H 5  57  ? -21.764 -13.869 14.981 1.00 86.61  ? 84  SER H CA    1 
ATOM   5724  C  C     . SER H 5  57  ? -20.594 -12.908 15.153 1.00 82.31  ? 84  SER H C     1 
ATOM   5725  O  O     . SER H 5  57  ? -19.495 -13.180 14.659 1.00 81.16  ? 84  SER H O     1 
ATOM   5726  C  CB    . SER H 5  57  ? -21.755 -14.472 13.575 1.00 88.72  ? 84  SER H CB    1 
ATOM   5727  O  OG    . SER H 5  57  ? -21.994 -13.480 12.593 1.00 88.19  ? 84  SER H OG    1 
ATOM   5728  N  N     . THR H 5  58  ? -20.806 -11.792 15.847 1.00 81.61  ? 85  THR H N     1 
ATOM   5729  C  CA    . THR H 5  58  ? -19.784 -10.770 16.022 1.00 79.41  ? 85  THR H CA    1 
ATOM   5730  C  C     . THR H 5  58  ? -19.753 -10.325 17.475 1.00 78.16  ? 85  THR H C     1 
ATOM   5731  O  O     . THR H 5  58  ? -20.804 -10.063 18.070 1.00 80.62  ? 85  THR H O     1 
ATOM   5732  C  CB    . THR H 5  58  ? -20.043 -9.561  15.115 1.00 78.65  ? 85  THR H CB    1 
ATOM   5733  O  OG1   . THR H 5  58  ? -20.398 -10.011 13.802 1.00 84.52  ? 85  THR H OG1   1 
ATOM   5734  C  CG2   . THR H 5  58  ? -18.799 -8.688  15.024 1.00 75.73  ? 85  THR H CG2   1 
ATOM   5735  N  N     . ILE H 5  59  ? -18.553 -10.239 18.040 1.00 75.75  ? 86  ILE H N     1 
ATOM   5736  C  CA    . ILE H 5  59  ? -18.344 -9.688  19.373 1.00 77.70  ? 86  ILE H CA    1 
ATOM   5737  C  C     . ILE H 5  59  ? -17.807 -8.274  19.182 1.00 84.37  ? 86  ILE H C     1 
ATOM   5738  O  O     . ILE H 5  59  ? -16.640 -8.078  18.830 1.00 87.31  ? 86  ILE H O     1 
ATOM   5739  C  CB    . ILE H 5  59  ? -17.398 -10.552 20.210 1.00 74.98  ? 86  ILE H CB    1 
ATOM   5740  C  CG1   . ILE H 5  59  ? -18.076 -11.867 20.587 1.00 76.25  ? 86  ILE H CG1   1 
ATOM   5741  C  CG2   . ILE H 5  59  ? -16.963 -9.814  21.467 1.00 71.65  ? 86  ILE H CG2   1 
ATOM   5742  C  CD1   . ILE H 5  59  ? -17.253 -12.725 21.512 1.00 74.99  ? 86  ILE H CD1   1 
ATOM   5743  N  N     . THR H 5  60  ? -18.667 -7.286  19.398 1.00 86.32  ? 87  THR H N     1 
ATOM   5744  C  CA    . THR H 5  60  ? -18.306 -5.886  19.269 1.00 85.49  ? 87  THR H CA    1 
ATOM   5745  C  C     . THR H 5  60  ? -18.083 -5.281  20.653 1.00 83.12  ? 87  THR H C     1 
ATOM   5746  O  O     . THR H 5  60  ? -18.143 -5.964  21.678 1.00 81.83  ? 87  THR H O     1 
ATOM   5747  C  CB    . THR H 5  60  ? -19.388 -5.124  18.502 1.00 86.06  ? 87  THR H CB    1 
ATOM   5748  O  OG1   . THR H 5  60  ? -20.645 -5.271  19.174 1.00 86.06  ? 87  THR H OG1   1 
ATOM   5749  C  CG2   . THR H 5  60  ? -19.512 -5.662  17.084 1.00 85.44  ? 87  THR H CG2   1 
ATOM   5750  N  N     . SER H 5  61  ? -17.819 -3.973  20.677 1.00 86.24  ? 88  SER H N     1 
ATOM   5751  C  CA    . SER H 5  61  ? -17.645 -3.276  21.945 1.00 86.59  ? 88  SER H CA    1 
ATOM   5752  C  C     . SER H 5  61  ? -18.921 -3.266  22.775 1.00 88.59  ? 88  SER H C     1 
ATOM   5753  O  O     . SER H 5  61  ? -18.850 -3.103  23.998 1.00 92.14  ? 88  SER H O     1 
ATOM   5754  C  CB    . SER H 5  61  ? -17.175 -1.843  21.695 1.00 85.50  ? 88  SER H CB    1 
ATOM   5755  O  OG    . SER H 5  61  ? -18.069 -1.162  20.831 1.00 90.51  ? 88  SER H OG    1 
ATOM   5756  N  N     . ARG H 5  62  ? -20.083 -3.438  22.142 1.00 87.59  ? 89  ARG H N     1 
ATOM   5757  C  CA    . ARG H 5  62  ? -21.335 -3.445  22.889 1.00 85.18  ? 89  ARG H CA    1 
ATOM   5758  C  C     . ARG H 5  62  ? -21.501 -4.740  23.677 1.00 84.47  ? 89  ARG H C     1 
ATOM   5759  O  O     . ARG H 5  62  ? -21.991 -4.723  24.812 1.00 83.86  ? 89  ARG H O     1 
ATOM   5760  C  CB    . ARG H 5  62  ? -22.513 -3.233  21.939 1.00 88.75  ? 89  ARG H CB    1 
ATOM   5761  C  CG    . ARG H 5  62  ? -23.844 -3.026  22.639 1.00 89.20  ? 89  ARG H CG    1 
ATOM   5762  C  CD    . ARG H 5  62  ? -24.935 -2.645  21.653 1.00 94.97  ? 89  ARG H CD    1 
ATOM   5763  N  NE    . ARG H 5  62  ? -26.183 -2.306  22.330 1.00 99.01  ? 89  ARG H NE    1 
ATOM   5764  C  CZ    . ARG H 5  62  ? -27.156 -3.175  22.583 1.00 101.61 ? 89  ARG H CZ    1 
ATOM   5765  N  NH1   . ARG H 5  62  ? -27.029 -4.442  22.211 1.00 101.21 ? 89  ARG H NH1   1 
ATOM   5766  N  NH2   . ARG H 5  62  ? -28.256 -2.776  23.206 1.00 102.96 ? 89  ARG H NH2   1 
ATOM   5767  N  N     . GLU H 5  63  ? -21.101 -5.873  23.091 1.00 85.48  ? 90  GLU H N     1 
ATOM   5768  C  CA    . GLU H 5  63  ? -21.155 -7.138  23.818 1.00 80.03  ? 90  GLU H CA    1 
ATOM   5769  C  C     . GLU H 5  63  ? -20.162 -7.154  24.974 1.00 70.23  ? 90  GLU H C     1 
ATOM   5770  O  O     . GLU H 5  63  ? -20.488 -7.618  26.073 1.00 68.90  ? 90  GLU H O     1 
ATOM   5771  C  CB    . GLU H 5  63  ? -20.888 -8.310  22.872 1.00 84.88  ? 90  GLU H CB    1 
ATOM   5772  C  CG    . GLU H 5  63  ? -22.096 -8.763  22.065 1.00 92.87  ? 90  GLU H CG    1 
ATOM   5773  C  CD    . GLU H 5  63  ? -22.431 -7.824  20.924 1.00 103.40 ? 90  GLU H CD    1 
ATOM   5774  O  OE1   . GLU H 5  63  ? -21.560 -7.016  20.539 1.00 108.26 ? 90  GLU H OE1   1 
ATOM   5775  O  OE2   . GLU H 5  63  ? -23.568 -7.896  20.411 1.00 107.46 ? 90  GLU H OE2   1 
ATOM   5776  N  N     . ILE H 5  64  ? -18.947 -6.653  24.745 1.00 67.41  ? 91  ILE H N     1 
ATOM   5777  C  CA    . ILE H 5  64  ? -17.943 -6.621  25.803 1.00 68.46  ? 91  ILE H CA    1 
ATOM   5778  C  C     . ILE H 5  64  ? -18.364 -5.668  26.916 1.00 69.98  ? 91  ILE H C     1 
ATOM   5779  O  O     . ILE H 5  64  ? -18.142 -5.940  28.102 1.00 73.56  ? 91  ILE H O     1 
ATOM   5780  C  CB    . ILE H 5  64  ? -16.567 -6.257  25.216 1.00 67.31  ? 91  ILE H CB    1 
ATOM   5781  C  CG1   . ILE H 5  64  ? -15.903 -7.506  24.629 1.00 67.57  ? 91  ILE H CG1   1 
ATOM   5782  C  CG2   . ILE H 5  64  ? -15.673 -5.600  26.262 1.00 61.57  ? 91  ILE H CG2   1 
ATOM   5783  C  CD1   . ILE H 5  64  ? -14.486 -7.285  24.161 1.00 69.18  ? 91  ILE H CD1   1 
ATOM   5784  N  N     . GLN H 5  65  ? -18.992 -4.545  26.558 1.00 66.64  ? 92  GLN H N     1 
ATOM   5785  C  CA    . GLN H 5  65  ? -19.486 -3.625  27.579 1.00 66.85  ? 92  GLN H CA    1 
ATOM   5786  C  C     . GLN H 5  65  ? -20.557 -4.281  28.440 1.00 67.84  ? 92  GLN H C     1 
ATOM   5787  O  O     . GLN H 5  65  ? -20.536 -4.157  29.671 1.00 71.38  ? 92  GLN H O     1 
ATOM   5788  C  CB    . GLN H 5  65  ? -20.027 -2.353  26.926 1.00 72.18  ? 92  GLN H CB    1 
ATOM   5789  C  CG    . GLN H 5  65  ? -20.772 -1.437  27.885 1.00 76.02  ? 92  GLN H CG    1 
ATOM   5790  C  CD    . GLN H 5  65  ? -21.055 -0.075  27.287 1.00 81.28  ? 92  GLN H CD    1 
ATOM   5791  O  OE1   . GLN H 5  65  ? -22.181 0.219   26.886 1.00 87.77  ? 92  GLN H OE1   1 
ATOM   5792  N  NE2   . GLN H 5  65  ? -20.030 0.768   27.224 1.00 80.56  ? 92  GLN H NE2   1 
ATOM   5793  N  N     . THR H 5  66  ? -21.501 -4.986  27.812 1.00 69.04  ? 93  THR H N     1 
ATOM   5794  C  CA    . THR H 5  66  ? -22.539 -5.675  28.572 1.00 70.81  ? 93  THR H CA    1 
ATOM   5795  C  C     . THR H 5  66  ? -21.941 -6.761  29.458 1.00 71.38  ? 93  THR H C     1 
ATOM   5796  O  O     . THR H 5  66  ? -22.404 -6.979  30.584 1.00 74.06  ? 93  THR H O     1 
ATOM   5797  C  CB    . THR H 5  66  ? -23.579 -6.269  27.621 1.00 76.32  ? 93  THR H CB    1 
ATOM   5798  O  OG1   . THR H 5  66  ? -24.101 -5.240  26.770 1.00 81.94  ? 93  THR H OG1   1 
ATOM   5799  C  CG2   . THR H 5  66  ? -24.726 -6.896  28.402 1.00 75.44  ? 93  THR H CG2   1 
ATOM   5800  N  N     . ALA H 5  67  ? -20.903 -7.447  28.969 1.00 68.76  ? 94  ALA H N     1 
ATOM   5801  C  CA    . ALA H 5  67  ? -20.242 -8.468  29.775 1.00 63.93  ? 94  ALA H CA    1 
ATOM   5802  C  C     . ALA H 5  67  ? -19.558 -7.864  30.994 1.00 65.79  ? 94  ALA H C     1 
ATOM   5803  O  O     . ALA H 5  67  ? -19.493 -8.508  32.048 1.00 69.52  ? 94  ALA H O     1 
ATOM   5804  C  CB    . ALA H 5  67  ? -19.231 -9.237  28.924 1.00 60.90  ? 94  ALA H CB    1 
ATOM   5805  N  N     . VAL H 5  68  ? -19.047 -6.636  30.871 1.00 67.21  ? 95  VAL H N     1 
ATOM   5806  C  CA    . VAL H 5  68  ? -18.426 -5.970  32.011 1.00 64.89  ? 95  VAL H CA    1 
ATOM   5807  C  C     . VAL H 5  68  ? -19.463 -5.678  33.089 1.00 65.01  ? 95  VAL H C     1 
ATOM   5808  O  O     . VAL H 5  68  ? -19.214 -5.888  34.282 1.00 65.57  ? 95  VAL H O     1 
ATOM   5809  C  CB    . VAL H 5  68  ? -17.706 -4.688  31.551 1.00 62.92  ? 95  VAL H CB    1 
ATOM   5810  C  CG1   . VAL H 5  68  ? -17.301 -3.841  32.747 1.00 60.01  ? 95  VAL H CG1   1 
ATOM   5811  C  CG2   . VAL H 5  68  ? -16.487 -5.039  30.711 1.00 63.91  ? 95  VAL H CG2   1 
ATOM   5812  N  N     . ARG H 5  69  ? -20.647 -5.205  32.686 1.00 63.88  ? 96  ARG H N     1 
ATOM   5813  C  CA    . ARG H 5  69  ? -21.685 -4.875  33.657 1.00 71.11  ? 96  ARG H CA    1 
ATOM   5814  C  C     . ARG H 5  69  ? -22.153 -6.102  34.428 1.00 71.06  ? 96  ARG H C     1 
ATOM   5815  O  O     . ARG H 5  69  ? -22.517 -5.992  35.604 1.00 71.60  ? 96  ARG H O     1 
ATOM   5816  C  CB    . ARG H 5  69  ? -22.871 -4.209  32.957 1.00 81.32  ? 96  ARG H CB    1 
ATOM   5817  C  CG    . ARG H 5  69  ? -22.636 -2.758  32.562 1.00 88.66  ? 96  ARG H CG    1 
ATOM   5818  C  CD    . ARG H 5  69  ? -23.943 -2.087  32.176 1.00 98.64  ? 96  ARG H CD    1 
ATOM   5819  N  NE    . ARG H 5  69  ? -23.783 -0.654  31.939 1.00 109.43 ? 96  ARG H NE    1 
ATOM   5820  C  CZ    . ARG H 5  69  ? -23.635 -0.106  30.737 1.00 116.55 ? 96  ARG H CZ    1 
ATOM   5821  N  NH1   . ARG H 5  69  ? -23.628 -0.871  29.654 1.00 118.30 ? 96  ARG H NH1   1 
ATOM   5822  N  NH2   . ARG H 5  69  ? -23.496 1.207   30.617 1.00 120.15 ? 96  ARG H NH2   1 
ATOM   5823  N  N     . LEU H 5  70  ? -22.149 -7.274  33.789 1.00 69.57  ? 97  LEU H N     1 
ATOM   5824  C  CA    . LEU H 5  70  ? -22.590 -8.496  34.453 1.00 61.71  ? 97  LEU H CA    1 
ATOM   5825  C  C     . LEU H 5  70  ? -21.545 -9.021  35.430 1.00 62.77  ? 97  LEU H C     1 
ATOM   5826  O  O     . LEU H 5  70  ? -21.893 -9.507  36.512 1.00 65.97  ? 97  LEU H O     1 
ATOM   5827  C  CB    . LEU H 5  70  ? -22.914 -9.567  33.410 1.00 57.86  ? 97  LEU H CB    1 
ATOM   5828  C  CG    . LEU H 5  70  ? -24.147 -9.353  32.531 1.00 56.89  ? 97  LEU H CG    1 
ATOM   5829  C  CD1   . LEU H 5  70  ? -24.128 -10.312 31.350 1.00 51.56  ? 97  LEU H CD1   1 
ATOM   5830  C  CD2   . LEU H 5  70  ? -25.414 -9.541  33.349 1.00 59.37  ? 97  LEU H CD2   1 
ATOM   5831  N  N     . LEU H 5  71  ? -20.266 -8.922  35.071 1.00 61.99  ? 98  LEU H N     1 
ATOM   5832  C  CA    . LEU H 5  71  ? -19.195 -9.577  35.812 1.00 66.29  ? 98  LEU H CA    1 
ATOM   5833  C  C     . LEU H 5  71  ? -18.635 -8.707  36.933 1.00 66.99  ? 98  LEU H C     1 
ATOM   5834  O  O     . LEU H 5  71  ? -18.554 -9.152  38.083 1.00 68.74  ? 98  LEU H O     1 
ATOM   5835  C  CB    . LEU H 5  71  ? -18.071 -9.977  34.852 1.00 72.88  ? 98  LEU H CB    1 
ATOM   5836  C  CG    . LEU H 5  71  ? -18.162 -11.319 34.120 1.00 85.38  ? 98  LEU H CG    1 
ATOM   5837  C  CD1   . LEU H 5  71  ? -19.519 -11.545 33.472 1.00 93.71  ? 98  LEU H CD1   1 
ATOM   5838  C  CD2   . LEU H 5  71  ? -17.075 -11.374 33.074 1.00 86.74  ? 98  LEU H CD2   1 
ATOM   5839  N  N     . LEU H 5  72  ? -18.239 -7.478  36.616 1.00 68.36  ? 99  LEU H N     1 
ATOM   5840  C  CA    . LEU H 5  72  ? -17.598 -6.624  37.602 1.00 66.87  ? 99  LEU H CA    1 
ATOM   5841  C  C     . LEU H 5  72  ? -18.619 -6.098  38.611 1.00 61.51  ? 99  LEU H C     1 
ATOM   5842  O  O     . LEU H 5  72  ? -19.793 -5.910  38.280 1.00 61.04  ? 99  LEU H O     1 
ATOM   5843  C  CB    . LEU H 5  72  ? -16.895 -5.452  36.921 1.00 70.86  ? 99  LEU H CB    1 
ATOM   5844  C  CG    . LEU H 5  72  ? -15.449 -5.651  36.452 1.00 70.15  ? 99  LEU H CG    1 
ATOM   5845  C  CD1   . LEU H 5  72  ? -15.349 -6.708  35.366 1.00 69.91  ? 99  LEU H CD1   1 
ATOM   5846  C  CD2   . LEU H 5  72  ? -14.858 -4.332  35.972 1.00 65.63  ? 99  LEU H CD2   1 
ATOM   5847  N  N     . PRO H 5  73  ? -18.193 -5.856  39.857 1.00 59.99  ? 100 PRO H N     1 
ATOM   5848  C  CA    . PRO H 5  73  ? -19.102 -5.265  40.851 1.00 61.73  ? 100 PRO H CA    1 
ATOM   5849  C  C     . PRO H 5  73  ? -19.499 -3.837  40.509 1.00 67.67  ? 100 PRO H C     1 
ATOM   5850  O  O     . PRO H 5  73  ? -19.144 -3.322  39.444 1.00 73.45  ? 100 PRO H O     1 
ATOM   5851  C  CB    . PRO H 5  73  ? -18.288 -5.323  42.152 1.00 59.21  ? 100 PRO H CB    1 
ATOM   5852  C  CG    . PRO H 5  73  ? -17.245 -6.369  41.912 1.00 59.46  ? 100 PRO H CG    1 
ATOM   5853  C  CD    . PRO H 5  73  ? -16.914 -6.273  40.455 1.00 59.65  ? 100 PRO H CD    1 
ATOM   5854  N  N     . GLY H 5  74  ? -20.223 -3.186  41.418 1.00 68.80  ? 101 GLY H N     1 
ATOM   5855  C  CA    . GLY H 5  74  ? -20.800 -1.877  41.171 1.00 70.41  ? 101 GLY H CA    1 
ATOM   5856  C  C     . GLY H 5  74  ? -19.846 -0.805  40.683 1.00 71.31  ? 101 GLY H C     1 
ATOM   5857  O  O     . GLY H 5  74  ? -19.911 -0.396  39.520 1.00 68.71  ? 101 GLY H O     1 
ATOM   5858  N  N     . GLU H 5  75  ? -18.956 -0.340  41.563 1.00 73.01  ? 102 GLU H N     1 
ATOM   5859  C  CA    . GLU H 5  75  ? -18.079 0.773   41.211 1.00 75.22  ? 102 GLU H CA    1 
ATOM   5860  C  C     . GLU H 5  75  ? -17.043 0.381   40.165 1.00 74.52  ? 102 GLU H C     1 
ATOM   5861  O  O     . GLU H 5  75  ? -16.661 1.214   39.336 1.00 75.18  ? 102 GLU H O     1 
ATOM   5862  C  CB    . GLU H 5  75  ? -17.391 1.315   42.463 1.00 84.54  ? 102 GLU H CB    1 
ATOM   5863  C  CG    . GLU H 5  75  ? -18.323 2.073   43.392 1.00 92.99  ? 102 GLU H CG    1 
ATOM   5864  C  CD    . GLU H 5  75  ? -18.874 3.335   42.756 1.00 98.14  ? 102 GLU H CD    1 
ATOM   5865  O  OE1   . GLU H 5  75  ? -18.117 4.018   42.033 1.00 96.58  ? 102 GLU H OE1   1 
ATOM   5866  O  OE2   . GLU H 5  75  ? -20.066 3.640   42.973 1.00 103.88 ? 102 GLU H OE2   1 
ATOM   5867  N  N     . LEU H 5  76  ? -16.573 -0.869  40.187 1.00 75.15  ? 103 LEU H N     1 
ATOM   5868  C  CA    . LEU H 5  76  ? -15.597 -1.301  39.192 1.00 69.49  ? 103 LEU H CA    1 
ATOM   5869  C  C     . LEU H 5  76  ? -16.189 -1.268  37.789 1.00 70.43  ? 103 LEU H C     1 
ATOM   5870  O  O     . LEU H 5  76  ? -15.526 -0.839  36.837 1.00 68.11  ? 103 LEU H O     1 
ATOM   5871  C  CB    . LEU H 5  76  ? -15.088 -2.704  39.523 1.00 66.46  ? 103 LEU H CB    1 
ATOM   5872  C  CG    . LEU H 5  76  ? -14.148 -2.850  40.722 1.00 64.00  ? 103 LEU H CG    1 
ATOM   5873  C  CD1   . LEU H 5  76  ? -13.758 -4.309  40.914 1.00 70.10  ? 103 LEU H CD1   1 
ATOM   5874  C  CD2   . LEU H 5  76  ? -12.911 -1.986  40.544 1.00 56.17  ? 103 LEU H CD2   1 
ATOM   5875  N  N     . ALA H 5  77  ? -17.440 -1.712  37.640 1.00 71.61  ? 104 ALA H N     1 
ATOM   5876  C  CA    . ALA H 5  77  ? -18.063 -1.724  36.322 1.00 71.48  ? 104 ALA H CA    1 
ATOM   5877  C  C     . ALA H 5  77  ? -18.331 -0.311  35.823 1.00 77.79  ? 104 ALA H C     1 
ATOM   5878  O  O     . ALA H 5  77  ? -18.147 -0.023  34.635 1.00 78.89  ? 104 ALA H O     1 
ATOM   5879  C  CB    . ALA H 5  77  ? -19.358 -2.535  36.355 1.00 68.74  ? 104 ALA H CB    1 
ATOM   5880  N  N     . LYS H 5  78  ? -18.761 0.585   36.715 1.00 80.30  ? 105 LYS H N     1 
ATOM   5881  C  CA    . LYS H 5  78  ? -19.066 1.952   36.303 1.00 74.27  ? 105 LYS H CA    1 
ATOM   5882  C  C     . LYS H 5  78  ? -17.823 2.659   35.776 1.00 66.41  ? 105 LYS H C     1 
ATOM   5883  O  O     . LYS H 5  78  ? -17.899 3.419   34.803 1.00 70.58  ? 105 LYS H O     1 
ATOM   5884  C  CB    . LYS H 5  78  ? -19.676 2.730   37.470 1.00 82.44  ? 105 LYS H CB    1 
ATOM   5885  C  CG    . LYS H 5  78  ? -20.181 4.114   37.091 1.00 96.94  ? 105 LYS H CG    1 
ATOM   5886  C  CD    . LYS H 5  78  ? -20.881 4.800   38.255 1.00 110.62 ? 105 LYS H CD    1 
ATOM   5887  C  CE    . LYS H 5  78  ? -19.918 5.092   39.395 1.00 118.59 ? 105 LYS H CE    1 
ATOM   5888  N  NZ    . LYS H 5  78  ? -20.583 5.826   40.510 1.00 119.70 ? 105 LYS H NZ    1 
ATOM   5889  N  N     . HIS H 5  79  ? -16.667 2.408   36.392 1.00 59.59  ? 106 HIS H N     1 
ATOM   5890  C  CA    . HIS H 5  79  ? -15.436 3.048   35.941 1.00 65.36  ? 106 HIS H CA    1 
ATOM   5891  C  C     . HIS H 5  79  ? -14.837 2.337   34.732 1.00 72.72  ? 106 HIS H C     1 
ATOM   5892  O  O     . HIS H 5  79  ? -14.319 2.990   33.821 1.00 77.11  ? 106 HIS H O     1 
ATOM   5893  C  CB    . HIS H 5  79  ? -14.426 3.104   37.088 1.00 69.21  ? 106 HIS H CB    1 
ATOM   5894  C  CG    . HIS H 5  79  ? -14.810 4.051   38.183 1.00 76.47  ? 106 HIS H CG    1 
ATOM   5895  N  ND1   . HIS H 5  79  ? -14.211 4.038   39.425 1.00 78.58  ? 106 HIS H ND1   1 
ATOM   5896  C  CD2   . HIS H 5  79  ? -15.732 5.042   38.221 1.00 74.75  ? 106 HIS H CD2   1 
ATOM   5897  C  CE1   . HIS H 5  79  ? -14.750 4.978   40.181 1.00 80.17  ? 106 HIS H CE1   1 
ATOM   5898  N  NE2   . HIS H 5  79  ? -15.675 5.602   39.474 1.00 78.20  ? 106 HIS H NE2   1 
ATOM   5899  N  N     . ALA H 5  80  ? -14.891 1.002   34.707 1.00 76.08  ? 107 ALA H N     1 
ATOM   5900  C  CA    . ALA H 5  80  ? -14.368 0.264   33.563 1.00 69.48  ? 107 ALA H CA    1 
ATOM   5901  C  C     . ALA H 5  80  ? -15.147 0.580   32.294 1.00 68.45  ? 107 ALA H C     1 
ATOM   5902  O  O     . ALA H 5  80  ? -14.564 0.626   31.205 1.00 71.30  ? 107 ALA H O     1 
ATOM   5903  C  CB    . ALA H 5  80  ? -14.391 -1.237  33.844 1.00 69.01  ? 107 ALA H CB    1 
ATOM   5904  N  N     . VAL H 5  81  ? -16.459 0.800   32.411 1.00 86.58  ? 108 VAL H N     1 
ATOM   5905  C  CA    . VAL H 5  81  ? -17.244 1.212   31.251 1.00 84.02  ? 108 VAL H CA    1 
ATOM   5906  C  C     . VAL H 5  81  ? -16.828 2.606   30.797 1.00 88.43  ? 108 VAL H C     1 
ATOM   5907  O  O     . VAL H 5  81  ? -16.778 2.894   29.594 1.00 93.99  ? 108 VAL H O     1 
ATOM   5908  C  CB    . VAL H 5  81  ? -18.749 1.135   31.567 1.00 76.94  ? 108 VAL H CB    1 
ATOM   5909  C  CG1   . VAL H 5  81  ? -19.562 1.840   30.494 1.00 68.15  ? 108 VAL H CG1   1 
ATOM   5910  C  CG2   . VAL H 5  81  ? -19.186 -0.318  31.690 1.00 79.38  ? 108 VAL H CG2   1 
ATOM   5911  N  N     . SER H 5  82  ? -16.497 3.483   31.747 1.00 87.09  ? 109 SER H N     1 
ATOM   5912  C  CA    . SER H 5  82  ? -16.033 4.819   31.391 1.00 86.55  ? 109 SER H CA    1 
ATOM   5913  C  C     . SER H 5  82  ? -14.696 4.766   30.662 1.00 88.28  ? 109 SER H C     1 
ATOM   5914  O  O     . SER H 5  82  ? -14.452 5.557   29.743 1.00 91.13  ? 109 SER H O     1 
ATOM   5915  C  CB    . SER H 5  82  ? -15.927 5.688   32.644 1.00 89.04  ? 109 SER H CB    1 
ATOM   5916  O  OG    . SER H 5  82  ? -15.387 6.964   32.334 1.00 95.33  ? 109 SER H OG    1 
ATOM   5917  N  N     . GLU H 5  83  ? -13.816 3.842   31.058 1.00 85.66  ? 110 GLU H N     1 
ATOM   5918  C  CA    . GLU H 5  83  ? -12.517 3.731   30.402 1.00 87.47  ? 110 GLU H CA    1 
ATOM   5919  C  C     . GLU H 5  83  ? -12.652 3.162   28.995 1.00 88.34  ? 110 GLU H C     1 
ATOM   5920  O  O     . GLU H 5  83  ? -12.002 3.643   28.060 1.00 88.56  ? 110 GLU H O     1 
ATOM   5921  C  CB    . GLU H 5  83  ? -11.578 2.864   31.239 1.00 91.68  ? 110 GLU H CB    1 
ATOM   5922  C  CG    . GLU H 5  83  ? -11.306 3.390   32.641 1.00 100.03 ? 110 GLU H CG    1 
ATOM   5923  C  CD    . GLU H 5  83  ? -10.266 4.495   32.666 1.00 114.09 ? 110 GLU H CD    1 
ATOM   5924  O  OE1   . GLU H 5  83  ? -9.767  4.875   31.586 1.00 122.28 ? 110 GLU H OE1   1 
ATOM   5925  O  OE2   . GLU H 5  83  ? -9.946  4.981   33.772 1.00 118.27 ? 110 GLU H OE2   1 
ATOM   5926  N  N     . GLY H 5  84  ? -13.487 2.135   28.827 1.00 89.07  ? 111 GLY H N     1 
ATOM   5927  C  CA    . GLY H 5  84  ? -13.644 1.530   27.514 1.00 87.63  ? 111 GLY H CA    1 
ATOM   5928  C  C     . GLY H 5  84  ? -14.318 2.460   26.522 1.00 88.20  ? 111 GLY H C     1 
ATOM   5929  O  O     . GLY H 5  84  ? -13.870 2.597   25.380 1.00 89.94  ? 111 GLY H O     1 
ATOM   5930  N  N     . THR H 5  85  ? -15.406 3.109   26.945 1.00 89.11  ? 112 THR H N     1 
ATOM   5931  C  CA    . THR H 5  85  ? -16.095 4.054   26.070 1.00 89.76  ? 112 THR H CA    1 
ATOM   5932  C  C     . THR H 5  85  ? -15.173 5.197   25.663 1.00 90.07  ? 112 THR H C     1 
ATOM   5933  O  O     . THR H 5  85  ? -15.189 5.637   24.507 1.00 93.38  ? 112 THR H O     1 
ATOM   5934  C  CB    . THR H 5  85  ? -17.348 4.593   26.761 1.00 89.96  ? 112 THR H CB    1 
ATOM   5935  O  OG1   . THR H 5  85  ? -18.235 3.508   27.063 1.00 89.25  ? 112 THR H OG1   1 
ATOM   5936  C  CG2   . THR H 5  85  ? -18.068 5.592   25.865 1.00 92.82  ? 112 THR H CG2   1 
ATOM   5937  N  N     . LYS H 5  86  ? -14.353 5.683   26.598 1.00 86.29  ? 113 LYS H N     1 
ATOM   5938  C  CA    . LYS H 5  86  ? -13.379 6.717   26.268 1.00 85.69  ? 113 LYS H CA    1 
ATOM   5939  C  C     . LYS H 5  86  ? -12.378 6.225   25.230 1.00 88.35  ? 113 LYS H C     1 
ATOM   5940  O  O     . LYS H 5  86  ? -12.012 6.964   24.309 1.00 96.08  ? 113 LYS H O     1 
ATOM   5941  C  CB    . LYS H 5  86  ? -12.655 7.173   27.536 1.00 89.10  ? 113 LYS H CB    1 
ATOM   5942  C  CG    . LYS H 5  86  ? -11.412 8.014   27.286 1.00 94.65  ? 113 LYS H CG    1 
ATOM   5943  C  CD    . LYS H 5  86  ? -10.668 8.289   28.583 1.00 99.34  ? 113 LYS H CD    1 
ATOM   5944  C  CE    . LYS H 5  86  ? -9.361  9.022   28.331 1.00 107.04 ? 113 LYS H CE    1 
ATOM   5945  N  NZ    . LYS H 5  86  ? -8.636  9.314   29.601 1.00 110.44 ? 113 LYS H NZ    1 
ATOM   5946  N  N     . ALA H 5  87  ? -11.932 4.974   25.354 1.00 88.05  ? 114 ALA H N     1 
ATOM   5947  C  CA    . ALA H 5  87  ? -10.916 4.462   24.441 1.00 88.61  ? 114 ALA H CA    1 
ATOM   5948  C  C     . ALA H 5  87  ? -11.493 4.185   23.058 1.00 91.94  ? 114 ALA H C     1 
ATOM   5949  O  O     . ALA H 5  87  ? -10.855 4.490   22.044 1.00 92.57  ? 114 ALA H O     1 
ATOM   5950  C  CB    . ALA H 5  87  ? -10.279 3.200   25.022 1.00 87.49  ? 114 ALA H CB    1 
ATOM   5951  N  N     . VAL H 5  88  ? -12.697 3.611   22.995 1.00 96.31  ? 115 VAL H N     1 
ATOM   5952  C  CA    . VAL H 5  88  ? -13.253 3.215   21.703 1.00 96.39  ? 115 VAL H CA    1 
ATOM   5953  C  C     . VAL H 5  88  ? -13.632 4.436   20.871 1.00 100.31 ? 115 VAL H C     1 
ATOM   5954  O  O     . VAL H 5  88  ? -13.548 4.402   19.637 1.00 106.26 ? 115 VAL H O     1 
ATOM   5955  C  CB    . VAL H 5  88  ? -14.448 2.261   21.899 1.00 94.68  ? 115 VAL H CB    1 
ATOM   5956  C  CG1   . VAL H 5  88  ? -15.597 2.958   22.608 1.00 99.89  ? 115 VAL H CG1   1 
ATOM   5957  C  CG2   . VAL H 5  88  ? -14.904 1.692   20.563 1.00 98.10  ? 115 VAL H CG2   1 
ATOM   5958  N  N     . THR H 5  89  ? -14.042 5.532   21.515 1.00 94.52  ? 116 THR H N     1 
ATOM   5959  C  CA    . THR H 5  89  ? -14.319 6.753   20.765 1.00 95.09  ? 116 THR H CA    1 
ATOM   5960  C  C     . THR H 5  89  ? -13.025 7.439   20.344 1.00 96.34  ? 116 THR H C     1 
ATOM   5961  O  O     . THR H 5  89  ? -12.942 7.997   19.243 1.00 102.43 ? 116 THR H O     1 
ATOM   5962  C  CB    . THR H 5  89  ? -15.187 7.704   21.589 1.00 96.85  ? 116 THR H CB    1 
ATOM   5963  O  OG1   . THR H 5  89  ? -14.505 8.054   22.799 1.00 100.25 ? 116 THR H OG1   1 
ATOM   5964  C  CG2   . THR H 5  89  ? -16.519 7.050   21.930 1.00 95.03  ? 116 THR H CG2   1 
ATOM   5965  N  N     . LYS H 5  90  ? -12.006 7.406   21.206 1.00 95.43  ? 117 LYS H N     1 
ATOM   5966  C  CA    . LYS H 5  90  ? -10.702 7.944   20.833 1.00 96.95  ? 117 LYS H CA    1 
ATOM   5967  C  C     . LYS H 5  90  ? -10.074 7.138   19.703 1.00 98.12  ? 117 LYS H C     1 
ATOM   5968  O  O     . LYS H 5  90  ? -9.372  7.698   18.854 1.00 102.30 ? 117 LYS H O     1 
ATOM   5969  C  CB    . LYS H 5  90  ? -9.782  7.969   22.055 1.00 73.16  ? 117 LYS H CB    1 
ATOM   5970  C  CG    . LYS H 5  90  ? -8.399  8.548   21.800 1.00 74.76  ? 117 LYS H CG    1 
ATOM   5971  C  CD    . LYS H 5  90  ? -7.595  8.632   23.089 1.00 81.25  ? 117 LYS H CD    1 
ATOM   5972  C  CE    . LYS H 5  90  ? -6.194  9.170   22.842 1.00 85.15  ? 117 LYS H CE    1 
ATOM   5973  N  NZ    . LYS H 5  90  ? -6.215  10.528  22.228 1.00 88.18  ? 117 LYS H NZ    1 
ATOM   5974  N  N     . TYR H 5  91  ? -10.322 5.826   19.672 1.00 94.21  ? 118 TYR H N     1 
ATOM   5975  C  CA    . TYR H 5  91  ? -9.819  4.993   18.586 1.00 92.07  ? 118 TYR H CA    1 
ATOM   5976  C  C     . TYR H 5  91  ? -10.551 5.273   17.279 1.00 98.81  ? 118 TYR H C     1 
ATOM   5977  O  O     . TYR H 5  91  ? -9.954  5.166   16.202 1.00 105.80 ? 118 TYR H O     1 
ATOM   5978  C  CB    . TYR H 5  91  ? -9.944  3.516   18.970 1.00 85.21  ? 118 TYR H CB    1 
ATOM   5979  C  CG    . TYR H 5  91  ? -9.568  2.541   17.876 1.00 79.32  ? 118 TYR H CG    1 
ATOM   5980  C  CD1   . TYR H 5  91  ? -8.247  2.153   17.688 1.00 73.20  ? 118 TYR H CD1   1 
ATOM   5981  C  CD2   . TYR H 5  91  ? -10.536 1.996   17.043 1.00 77.61  ? 118 TYR H CD2   1 
ATOM   5982  C  CE1   . TYR H 5  91  ? -7.901  1.259   16.694 1.00 84.67  ? 118 TYR H CE1   1 
ATOM   5983  C  CE2   . TYR H 5  91  ? -10.200 1.102   16.048 1.00 82.50  ? 118 TYR H CE2   1 
ATOM   5984  C  CZ    . TYR H 5  91  ? -8.882  0.736   15.877 1.00 85.61  ? 118 TYR H CZ    1 
ATOM   5985  O  OH    . TYR H 5  91  ? -8.547  -0.157  14.883 1.00 87.48  ? 118 TYR H OH    1 
ATOM   5986  N  N     . THR H 5  92  ? -11.836 5.630   17.351 1.00 104.41 ? 119 THR H N     1 
ATOM   5987  C  CA    . THR H 5  92  ? -12.604 5.892   16.137 1.00 112.95 ? 119 THR H CA    1 
ATOM   5988  C  C     . THR H 5  92  ? -12.161 7.190   15.470 1.00 124.95 ? 119 THR H C     1 
ATOM   5989  O  O     . THR H 5  92  ? -12.089 7.269   14.238 1.00 127.50 ? 119 THR H O     1 
ATOM   5990  C  CB    . THR H 5  92  ? -14.098 5.938   16.462 1.00 109.60 ? 119 THR H CB    1 
ATOM   5991  O  OG1   . THR H 5  92  ? -14.501 4.691   17.043 1.00 102.94 ? 119 THR H OG1   1 
ATOM   5992  C  CG2   . THR H 5  92  ? -14.916 6.190   15.203 1.00 114.20 ? 119 THR H CG2   1 
ATOM   5993  N  N     . SER H 5  93  ? -11.855 8.216   16.266 1.00 134.91 ? 120 SER H N     1 
ATOM   5994  C  CA    . SER H 5  93  ? -11.429 9.494   15.708 1.00 139.36 ? 120 SER H CA    1 
ATOM   5995  C  C     . SER H 5  93  ? -10.058 9.415   15.049 1.00 141.89 ? 120 SER H C     1 
ATOM   5996  O  O     . SER H 5  93  ? -9.754  10.239  14.180 1.00 151.26 ? 120 SER H O     1 
ATOM   5997  C  CB    . SER H 5  93  ? -11.421 10.565  16.799 1.00 142.63 ? 120 SER H CB    1 
ATOM   5998  O  OG    . SER H 5  93  ? -10.572 10.193  17.871 1.00 148.21 ? 120 SER H OG    1 
ATOM   5999  N  N     . ALA H 5  94  ? -9.229  8.450   15.437 1.00 135.21 ? 121 ALA H N     1 
ATOM   6000  C  CA    . ALA H 5  94  ? -7.898  8.306   14.860 1.00 132.86 ? 121 ALA H CA    1 
ATOM   6001  C  C     . ALA H 5  94  ? -7.805  7.043   14.011 1.00 134.63 ? 121 ALA H C     1 
ATOM   6002  O  O     . ALA H 5  94  ? -8.520  6.895   13.019 1.00 135.31 ? 121 ALA H O     1 
ATOM   6003  C  CB    . ALA H 5  94  ? -6.843  8.288   15.956 1.00 128.84 ? 121 ALA H CB    1 
ATOM   6004  N  N     . GLY I 6  1   ? -32.866 -50.954 26.382 1.00 154.88 ? 535 GLY M N     1 
ATOM   6005  C  CA    . GLY I 6  1   ? -32.248 -51.355 25.132 1.00 159.06 ? 535 GLY M CA    1 
ATOM   6006  C  C     . GLY I 6  1   ? -30.769 -51.617 25.284 1.00 163.69 ? 535 GLY M C     1 
ATOM   6007  O  O     . GLY I 6  1   ? -30.337 -52.165 26.298 1.00 165.25 ? 535 GLY M O     1 
ATOM   6008  N  N     . GLY I 6  2   ? -29.997 -51.235 24.271 1.00 165.09 ? 536 GLY M N     1 
ATOM   6009  C  CA    . GLY I 6  2   ? -28.553 -51.306 24.306 1.00 162.89 ? 536 GLY M CA    1 
ATOM   6010  C  C     . GLY I 6  2   ? -27.872 -50.432 25.332 1.00 160.21 ? 536 GLY M C     1 
ATOM   6011  O  O     . GLY I 6  2   ? -26.643 -50.416 25.379 1.00 159.27 ? 536 GLY M O     1 
ATOM   6012  N  N     . TYR I 6  3   ? -28.614 -49.698 26.157 1.00 151.10 ? 537 TYR M N     1 
ATOM   6013  C  CA    . TYR I 6  3   ? -27.996 -48.833 27.159 1.00 140.28 ? 537 TYR M CA    1 
ATOM   6014  C  C     . TYR I 6  3   ? -27.365 -49.675 28.260 1.00 137.67 ? 537 TYR M C     1 
ATOM   6015  O  O     . TYR I 6  3   ? -28.041 -50.498 28.886 1.00 134.82 ? 537 TYR M O     1 
ATOM   6016  C  CB    . TYR I 6  3   ? -29.028 -47.870 27.753 1.00 127.91 ? 537 TYR M CB    1 
ATOM   6017  C  CG    . TYR I 6  3   ? -29.824 -47.129 26.702 1.00 113.29 ? 537 TYR M CG    1 
ATOM   6018  C  CD1   . TYR I 6  3   ? -29.184 -46.493 25.645 1.00 102.60 ? 537 TYR M CD1   1 
ATOM   6019  C  CD2   . TYR I 6  3   ? -31.211 -47.081 26.751 1.00 109.08 ? 537 TYR M CD2   1 
ATOM   6020  C  CE1   . TYR I 6  3   ? -29.900 -45.827 24.677 1.00 97.84  ? 537 TYR M CE1   1 
ATOM   6021  C  CE2   . TYR I 6  3   ? -31.938 -46.413 25.782 1.00 103.39 ? 537 TYR M CE2   1 
ATOM   6022  C  CZ    . TYR I 6  3   ? -31.276 -45.789 24.748 1.00 100.38 ? 537 TYR M CZ    1 
ATOM   6023  O  OH    . TYR I 6  3   ? -31.981 -45.121 23.775 1.00 104.17 ? 537 TYR M OH    1 
ATOM   6024  N  N     . ASN I 6  4   ? -26.074 -49.448 28.519 1.00 137.92 ? 538 ASN M N     1 
ATOM   6025  C  CA    . ASN I 6  4   ? -25.366 -50.123 29.611 1.00 139.96 ? 538 ASN M CA    1 
ATOM   6026  C  C     . ASN I 6  4   ? -25.598 -49.332 30.897 1.00 136.44 ? 538 ASN M C     1 
ATOM   6027  O  O     . ASN I 6  4   ? -24.735 -48.602 31.391 1.00 140.23 ? 538 ASN M O     1 
ATOM   6028  C  CB    . ASN I 6  4   ? -23.880 -50.268 29.295 1.00 145.43 ? 538 ASN M CB    1 
ATOM   6029  C  CG    . ASN I 6  4   ? -23.113 -51.051 30.372 1.00 150.91 ? 538 ASN M CG    1 
ATOM   6030  O  OD1   . ASN I 6  4   ? -23.692 -51.849 31.113 1.00 153.38 ? 538 ASN M OD1   1 
ATOM   6031  N  ND2   . ASN I 6  4   ? -21.804 -50.820 30.454 1.00 154.93 ? 538 ASN M ND2   1 
ATOM   6032  N  N     . LEU I 6  5   ? -26.795 -49.499 31.452 1.00 129.19 ? 539 LEU M N     1 
ATOM   6033  C  CA    . LEU I 6  5   ? -27.177 -48.786 32.662 1.00 121.76 ? 539 LEU M CA    1 
ATOM   6034  C  C     . LEU I 6  5   ? -26.531 -49.424 33.883 1.00 118.94 ? 539 LEU M C     1 
ATOM   6035  O  O     . LEU I 6  5   ? -26.436 -50.651 33.987 1.00 123.64 ? 539 LEU M O     1 
ATOM   6036  C  CB    . LEU I 6  5   ? -28.699 -48.775 32.821 1.00 116.10 ? 539 LEU M CB    1 
ATOM   6037  C  CG    . LEU I 6  5   ? -29.514 -48.097 31.717 1.00 111.57 ? 539 LEU M CG    1 
ATOM   6038  C  CD1   . LEU I 6  5   ? -30.999 -48.117 32.054 1.00 108.61 ? 539 LEU M CD1   1 
ATOM   6039  C  CD2   . LEU I 6  5   ? -29.032 -46.673 31.482 1.00 110.44 ? 539 LEU M CD2   1 
ATOM   6040  N  N     . ARG I 6  6   ? -26.081 -48.584 34.803 1.00 111.67 ? 540 ARG M N     1 
ATOM   6041  C  CA    . ARG I 6  6   ? -25.489 -49.080 36.038 1.00 108.74 ? 540 ARG M CA    1 
ATOM   6042  C  C     . ARG I 6  6   ? -26.562 -49.749 36.889 1.00 108.81 ? 540 ARG M C     1 
ATOM   6043  O  O     . ARG I 6  6   ? -27.654 -49.192 37.052 1.00 109.85 ? 540 ARG M O     1 
ATOM   6044  C  CB    . ARG I 6  6   ? -24.827 -47.935 36.800 1.00 107.86 ? 540 ARG M CB    1 
ATOM   6045  C  CG    . ARG I 6  6   ? -25.596 -46.630 36.722 1.00 105.12 ? 540 ARG M CG    1 
ATOM   6046  C  CD    . ARG I 6  6   ? -24.817 -45.482 37.339 1.00 102.17 ? 540 ARG M CD    1 
ATOM   6047  N  NE    . ARG I 6  6   ? -25.562 -44.230 37.259 1.00 96.64  ? 540 ARG M NE    1 
ATOM   6048  C  CZ    . ARG I 6  6   ? -26.463 -43.840 38.154 1.00 91.48  ? 540 ARG M CZ    1 
ATOM   6049  N  NH1   . ARG I 6  6   ? -27.096 -42.687 38.002 1.00 85.48  ? 540 ARG M NH1   1 
ATOM   6050  N  NH2   . ARG I 6  6   ? -26.731 -44.607 39.203 1.00 94.88  ? 540 ARG M NH2   1 
ATOM   6051  N  N     . PRO I 6  7   ? -26.300 -50.939 37.441 1.00 107.57 ? 541 PRO M N     1 
ATOM   6052  C  CA    . PRO I 6  7   ? -27.361 -51.665 38.153 1.00 108.37 ? 541 PRO M CA    1 
ATOM   6053  C  C     . PRO I 6  7   ? -27.643 -51.157 39.556 1.00 111.48 ? 541 PRO M C     1 
ATOM   6054  O  O     . PRO I 6  7   ? -28.693 -51.505 40.113 1.00 114.30 ? 541 PRO M O     1 
ATOM   6055  C  CB    . PRO I 6  7   ? -26.832 -53.105 38.190 1.00 107.64 ? 541 PRO M CB    1 
ATOM   6056  C  CG    . PRO I 6  7   ? -25.349 -52.943 38.186 1.00 105.33 ? 541 PRO M CG    1 
ATOM   6057  C  CD    . PRO I 6  7   ? -25.058 -51.726 37.342 1.00 105.68 ? 541 PRO M CD    1 
ATOM   6058  N  N     . ARG I 6  8   ? -26.761 -50.354 40.147 1.00 113.68 ? 542 ARG M N     1 
ATOM   6059  C  CA    . ARG I 6  8   ? -26.923 -49.894 41.520 1.00 119.58 ? 542 ARG M CA    1 
ATOM   6060  C  C     . ARG I 6  8   ? -27.093 -48.383 41.554 1.00 122.65 ? 542 ARG M C     1 
ATOM   6061  O  O     . ARG I 6  8   ? -26.337 -47.651 40.907 1.00 122.97 ? 542 ARG M O     1 
ATOM   6062  C  CB    . ARG I 6  8   ? -25.731 -50.308 42.388 1.00 124.44 ? 542 ARG M CB    1 
ATOM   6063  C  CG    . ARG I 6  8   ? -25.817 -51.733 42.903 1.00 128.53 ? 542 ARG M CG    1 
ATOM   6064  C  CD    . ARG I 6  8   ? -27.071 -51.939 43.741 1.00 131.72 ? 542 ARG M CD    1 
ATOM   6065  N  NE    . ARG I 6  8   ? -27.043 -51.167 44.980 1.00 134.63 ? 542 ARG M NE    1 
ATOM   6066  C  CZ    . ARG I 6  8   ? -26.723 -51.670 46.169 1.00 136.19 ? 542 ARG M CZ    1 
ATOM   6067  N  NH1   . ARG I 6  8   ? -26.723 -50.893 47.243 1.00 137.89 ? 542 ARG M NH1   1 
ATOM   6068  N  NH2   . ARG I 6  8   ? -26.409 -52.953 46.285 1.00 135.22 ? 542 ARG M NH2   1 
ATOM   6069  N  N     . THR I 6  9   ? -28.086 -47.926 42.313 1.00 126.06 ? 543 THR M N     1 
ATOM   6070  C  CA    . THR I 6  9   ? -28.340 -46.507 42.548 1.00 127.73 ? 543 THR M CA    1 
ATOM   6071  C  C     . THR I 6  9   ? -28.117 -46.251 44.035 1.00 129.66 ? 543 THR M C     1 
ATOM   6072  O  O     . THR I 6  9   ? -29.004 -46.505 44.857 1.00 130.66 ? 543 THR M O     1 
ATOM   6073  C  CB    . THR I 6  9   ? -29.751 -46.117 42.113 1.00 125.51 ? 543 THR M CB    1 
ATOM   6074  O  OG1   . THR I 6  9   ? -29.881 -46.287 40.696 1.00 124.84 ? 543 THR M OG1   1 
ATOM   6075  C  CG2   . THR I 6  9   ? -30.045 -44.668 42.473 1.00 122.86 ? 543 THR M CG2   1 
ATOM   6076  N  N     . TYR I 6  10  ? -26.930 -45.764 44.382 1.00 130.76 ? 544 TYR M N     1 
ATOM   6077  C  CA    . TYR I 6  10  ? -26.594 -45.516 45.776 1.00 132.68 ? 544 TYR M CA    1 
ATOM   6078  C  C     . TYR I 6  10  ? -27.158 -44.178 46.234 1.00 130.96 ? 544 TYR M C     1 
ATOM   6079  O  O     . TYR I 6  10  ? -27.139 -43.191 45.493 1.00 131.52 ? 544 TYR M O     1 
ATOM   6080  C  CB    . TYR I 6  10  ? -25.078 -45.545 45.975 1.00 137.47 ? 544 TYR M CB    1 
ATOM   6081  C  CG    . TYR I 6  10  ? -24.449 -46.889 45.684 1.00 143.25 ? 544 TYR M CG    1 
ATOM   6082  C  CD1   . TYR I 6  10  ? -24.548 -47.935 46.593 1.00 145.87 ? 544 TYR M CD1   1 
ATOM   6083  C  CD2   . TYR I 6  10  ? -23.752 -47.111 44.503 1.00 145.29 ? 544 TYR M CD2   1 
ATOM   6084  C  CE1   . TYR I 6  10  ? -23.975 -49.166 46.332 1.00 147.58 ? 544 TYR M CE1   1 
ATOM   6085  C  CE2   . TYR I 6  10  ? -23.175 -48.338 44.234 1.00 147.14 ? 544 TYR M CE2   1 
ATOM   6086  C  CZ    . TYR I 6  10  ? -23.290 -49.362 45.152 1.00 148.19 ? 544 TYR M CZ    1 
ATOM   6087  O  OH    . TYR I 6  10  ? -22.717 -50.585 44.888 1.00 149.14 ? 544 TYR M OH    1 
ATOM   6088  N  N     . GLN I 6  11  ? -27.664 -44.154 47.463 1.00 129.13 ? 545 GLN M N     1 
ATOM   6089  C  CA    . GLN I 6  11  ? -28.232 -42.945 48.051 1.00 125.61 ? 545 GLN M CA    1 
ATOM   6090  C  C     . GLN I 6  11  ? -27.128 -42.103 48.678 1.00 121.89 ? 545 GLN M C     1 
ATOM   6091  O  O     . GLN I 6  11  ? -26.280 -42.645 49.397 1.00 120.92 ? 545 GLN M O     1 
ATOM   6092  C  CB    . GLN I 6  11  ? -29.273 -43.297 49.104 1.00 127.65 ? 545 GLN M CB    1 
ATOM   6093  C  CG    . GLN I 6  11  ? -29.852 -42.099 49.840 1.00 130.57 ? 545 GLN M CG    1 
ATOM   6094  C  CD    . GLN I 6  11  ? -30.800 -42.502 50.953 1.00 132.89 ? 545 GLN M CD    1 
ATOM   6095  O  OE1   . GLN I 6  11  ? -31.166 -43.671 51.080 1.00 134.15 ? 545 GLN M OE1   1 
ATOM   6096  N  NE2   . GLN I 6  11  ? -31.200 -41.534 51.770 1.00 132.87 ? 545 GLN M NE2   1 
ATOM   6097  N  N     . PRO I 6  12  ? -27.098 -40.793 48.430 1.00 120.66 ? 546 PRO M N     1 
ATOM   6098  C  CA    . PRO I 6  12  ? -26.063 -39.944 49.041 1.00 122.33 ? 546 PRO M CA    1 
ATOM   6099  C  C     . PRO I 6  12  ? -26.331 -39.748 50.527 1.00 127.71 ? 546 PRO M C     1 
ATOM   6100  O  O     . PRO I 6  12  ? -27.406 -39.293 50.922 1.00 127.66 ? 546 PRO M O     1 
ATOM   6101  C  CB    . PRO I 6  12  ? -26.182 -38.628 48.264 1.00 118.47 ? 546 PRO M CB    1 
ATOM   6102  C  CG    . PRO I 6  12  ? -27.601 -38.602 47.796 1.00 116.63 ? 546 PRO M CG    1 
ATOM   6103  C  CD    . PRO I 6  12  ? -27.974 -40.034 47.520 1.00 117.58 ? 546 PRO M CD    1 
ATOM   6104  N  N     . GLN I 6  13  ? -25.346 -40.101 51.350 1.00 134.08 ? 547 GLN M N     1 
ATOM   6105  C  CA    . GLN I 6  13  ? -25.468 -39.896 52.787 1.00 138.83 ? 547 GLN M CA    1 
ATOM   6106  C  C     . GLN I 6  13  ? -25.305 -38.417 53.115 1.00 141.25 ? 547 GLN M C     1 
ATOM   6107  O  O     . GLN I 6  13  ? -24.314 -37.787 52.731 1.00 142.53 ? 547 GLN M O     1 
ATOM   6108  C  CB    . GLN I 6  13  ? -24.435 -40.736 53.542 1.00 140.91 ? 547 GLN M CB    1 
ATOM   6109  C  CG    . GLN I 6  13  ? -23.001 -40.609 53.043 1.00 143.26 ? 547 GLN M CG    1 
ATOM   6110  C  CD    . GLN I 6  13  ? -22.684 -41.568 51.911 1.00 146.99 ? 547 GLN M CD    1 
ATOM   6111  O  OE1   . GLN I 6  13  ? -23.560 -42.285 51.424 1.00 149.03 ? 547 GLN M OE1   1 
ATOM   6112  N  NE2   . GLN I 6  13  ? -21.425 -41.590 51.489 1.00 148.48 ? 547 GLN M NE2   1 
ATOM   6113  N  N     . ARG I 6  14  ? -26.285 -37.859 53.815 1.00 145.94 ? 548 ARG M N     1 
ATOM   6114  C  CA    . ARG I 6  14  ? -26.316 -36.441 54.138 1.00 153.08 ? 548 ARG M CA    1 
ATOM   6115  C  C     . ARG I 6  14  ? -26.010 -36.219 55.613 1.00 148.44 ? 548 ARG M C     1 
ATOM   6116  O  O     . ARG I 6  14  ? -25.969 -37.155 56.415 1.00 151.54 ? 548 ARG M O     1 
ATOM   6117  C  CB    . ARG I 6  14  ? -27.678 -35.836 53.774 1.00 157.95 ? 548 ARG M CB    1 
ATOM   6118  C  CG    . ARG I 6  14  ? -28.027 -35.956 52.298 1.00 166.13 ? 548 ARG M CG    1 
ATOM   6119  C  CD    . ARG I 6  14  ? -29.295 -35.191 51.953 1.00 173.31 ? 548 ARG M CD    1 
ATOM   6120  N  NE    . ARG I 6  14  ? -29.529 -35.146 50.512 1.00 177.34 ? 548 ARG M NE    1 
ATOM   6121  C  CZ    . ARG I 6  14  ? -30.595 -34.593 49.942 1.00 179.57 ? 548 ARG M CZ    1 
ATOM   6122  N  NH1   . ARG I 6  14  ? -31.538 -34.035 50.690 1.00 181.42 ? 548 ARG M NH1   1 
ATOM   6123  N  NH2   . ARG I 6  14  ? -30.720 -34.599 48.622 1.00 180.22 ? 548 ARG M NH2   1 
ATOM   6124  N  N     . TYR I 6  15  ? -25.800 -34.952 55.962 1.00 132.81 ? 549 TYR M N     1 
ATOM   6125  C  CA    . TYR I 6  15  ? -25.524 -34.584 57.344 1.00 123.73 ? 549 TYR M CA    1 
ATOM   6126  C  C     . TYR I 6  15  ? -26.758 -34.821 58.210 1.00 125.41 ? 549 TYR M C     1 
ATOM   6127  O  O     . TYR I 6  15  ? -27.867 -34.396 57.863 1.00 125.72 ? 549 TYR M O     1 
ATOM   6128  C  CB    . TYR I 6  15  ? -25.094 -33.119 57.414 1.00 114.78 ? 549 TYR M CB    1 
ATOM   6129  C  CG    . TYR I 6  15  ? -24.468 -32.710 58.728 1.00 108.86 ? 549 TYR M CG    1 
ATOM   6130  C  CD1   . TYR I 6  15  ? -23.148 -33.037 59.027 1.00 108.55 ? 549 TYR M CD1   1 
ATOM   6131  C  CD2   . TYR I 6  15  ? -25.192 -31.988 59.666 1.00 102.83 ? 549 TYR M CD2   1 
ATOM   6132  C  CE1   . TYR I 6  15  ? -22.575 -32.662 60.231 1.00 105.80 ? 549 TYR M CE1   1 
ATOM   6133  C  CE2   . TYR I 6  15  ? -24.628 -31.610 60.867 1.00 99.97  ? 549 TYR M CE2   1 
ATOM   6134  C  CZ    . TYR I 6  15  ? -23.319 -31.949 61.144 1.00 100.15 ? 549 TYR M CZ    1 
ATOM   6135  O  OH    . TYR I 6  15  ? -22.746 -31.578 62.337 1.00 96.46  ? 549 TYR M OH    1 
ATOM   6136  N  N     . GLY I 6  16  ? -26.567 -35.504 59.335 1.00 129.28 ? 550 GLY M N     1 
ATOM   6137  C  CA    . GLY I 6  16  ? -27.663 -35.805 60.229 1.00 131.66 ? 550 GLY M CA    1 
ATOM   6138  C  C     . GLY I 6  16  ? -28.733 -36.676 59.613 1.00 130.88 ? 550 GLY M C     1 
ATOM   6139  O  O     . GLY I 6  16  ? -29.919 -36.487 59.892 1.00 133.68 ? 550 GLY M O     1 
ATOM   6140  N  N     . GLY I 6  17  ? -28.320 -37.637 58.792 1.00 128.53 ? 551 GLY M N     1 
ATOM   6141  P  P     . DA  J 7  1   ? -46.504 -51.166 76.474 1.00 208.81 ? -72 DA  I P     1 
ATOM   6142  O  OP1   . DA  J 7  1   ? -45.846 -52.479 76.652 1.00 210.37 ? -72 DA  I OP1   1 
ATOM   6143  O  OP2   . DA  J 7  1   ? -46.305 -50.401 75.222 1.00 204.21 ? -72 DA  I OP2   1 
ATOM   6144  O  "O5'" . DA  J 7  1   ? -48.078 -51.336 76.708 1.00 213.15 ? -72 DA  I "O5'" 1 
ATOM   6145  C  "C5'" . DA  J 7  1   ? -48.558 -52.275 77.664 1.00 219.56 ? -72 DA  I "C5'" 1 
ATOM   6146  C  "C4'" . DA  J 7  1   ? -49.977 -51.940 78.090 1.00 225.39 ? -72 DA  I "C4'" 1 
ATOM   6147  O  "O4'" . DA  J 7  1   ? -50.022 -50.580 78.599 1.00 227.03 ? -72 DA  I "O4'" 1 
ATOM   6148  C  "C3'" . DA  J 7  1   ? -51.023 -52.012 76.976 1.00 226.04 ? -72 DA  I "C3'" 1 
ATOM   6149  O  "O3'" . DA  J 7  1   ? -52.225 -52.590 77.473 1.00 230.80 ? -72 DA  I "O3'" 1 
ATOM   6150  C  "C2'" . DA  J 7  1   ? -51.224 -50.548 76.595 1.00 224.91 ? -72 DA  I "C2'" 1 
ATOM   6151  C  "C1'" . DA  J 7  1   ? -51.034 -49.858 77.935 1.00 228.24 ? -72 DA  I "C1'" 1 
ATOM   6152  N  N9    . DA  J 7  1   ? -50.611 -48.466 77.815 1.00 228.49 ? -72 DA  I N9    1 
ATOM   6153  C  C8    . DA  J 7  1   ? -49.458 -48.001 77.247 1.00 225.39 ? -72 DA  I C8    1 
ATOM   6154  N  N7    . DA  J 7  1   ? -49.342 -46.694 77.279 1.00 224.28 ? -72 DA  I N7    1 
ATOM   6155  C  C5    . DA  J 7  1   ? -50.499 -46.273 77.912 1.00 227.85 ? -72 DA  I C5    1 
ATOM   6156  C  C6    . DA  J 7  1   ? -50.982 -44.994 78.256 1.00 228.48 ? -72 DA  I C6    1 
ATOM   6157  N  N6    . DA  J 7  1   ? -50.321 -43.863 77.992 1.00 225.52 ? -72 DA  I N6    1 
ATOM   6158  N  N1    . DA  J 7  1   ? -52.175 -44.924 78.883 1.00 232.45 ? -72 DA  I N1    1 
ATOM   6159  C  C2    . DA  J 7  1   ? -52.833 -46.060 79.146 1.00 235.90 ? -72 DA  I C2    1 
ATOM   6160  N  N3    . DA  J 7  1   ? -52.481 -47.315 78.872 1.00 235.87 ? -72 DA  I N3    1 
ATOM   6161  C  C4    . DA  J 7  1   ? -51.293 -47.352 78.250 1.00 231.23 ? -72 DA  I C4    1 
ATOM   6162  P  P     . DT  J 7  2   ? -53.410 -52.988 76.463 1.00 233.05 ? -71 DT  I P     1 
ATOM   6163  O  OP1   . DT  J 7  2   ? -53.961 -54.284 76.914 1.00 239.30 ? -71 DT  I OP1   1 
ATOM   6164  O  OP2   . DT  J 7  2   ? -52.899 -52.849 75.081 1.00 226.86 ? -71 DT  I OP2   1 
ATOM   6165  O  "O5'" . DT  J 7  2   ? -54.514 -51.853 76.697 1.00 235.73 ? -71 DT  I "O5'" 1 
ATOM   6166  C  "C5'" . DT  J 7  2   ? -55.183 -51.764 77.951 1.00 240.75 ? -71 DT  I "C5'" 1 
ATOM   6167  C  "C4'" . DT  J 7  2   ? -56.115 -50.564 77.989 1.00 241.82 ? -71 DT  I "C4'" 1 
ATOM   6168  O  "O4'" . DT  J 7  2   ? -55.342 -49.340 77.879 1.00 239.48 ? -71 DT  I "O4'" 1 
ATOM   6169  C  "C3'" . DT  J 7  2   ? -57.162 -50.512 76.870 1.00 241.75 ? -71 DT  I "C3'" 1 
ATOM   6170  O  "O3'" . DT  J 7  2   ? -58.444 -50.225 77.417 1.00 245.83 ? -71 DT  I "O3'" 1 
ATOM   6171  C  "C2'" . DT  J 7  2   ? -56.669 -49.378 75.971 1.00 238.54 ? -71 DT  I "C2'" 1 
ATOM   6172  C  "C1'" . DT  J 7  2   ? -55.984 -48.472 76.978 1.00 239.08 ? -71 DT  I "C1'" 1 
ATOM   6173  N  N1    . DT  J 7  2   ? -54.964 -47.568 76.376 1.00 235.89 ? -71 DT  I N1    1 
ATOM   6174  C  C2    . DT  J 7  2   ? -55.035 -46.217 76.622 1.00 235.56 ? -71 DT  I C2    1 
ATOM   6175  O  O2    . DT  J 7  2   ? -55.896 -45.711 77.319 1.00 238.76 ? -71 DT  I O2    1 
ATOM   6176  N  N3    . DT  J 7  2   ? -54.054 -45.474 76.023 1.00 231.18 ? -71 DT  I N3    1 
ATOM   6177  C  C4    . DT  J 7  2   ? -53.030 -45.935 75.217 1.00 227.46 ? -71 DT  I C4    1 
ATOM   6178  O  O4    . DT  J 7  2   ? -52.194 -45.185 74.723 1.00 223.42 ? -71 DT  I O4    1 
ATOM   6179  C  C5    . DT  J 7  2   ? -53.014 -47.362 74.996 1.00 228.88 ? -71 DT  I C5    1 
ATOM   6180  C  C7    . DT  J 7  2   ? -51.950 -47.979 74.137 1.00 225.73 ? -71 DT  I C7    1 
ATOM   6181  C  C6    . DT  J 7  2   ? -53.970 -48.101 75.579 1.00 233.01 ? -71 DT  I C6    1 
ATOM   6182  P  P     . DC  J 7  3   ? -59.768 -50.420 76.527 1.00 245.58 ? -70 DC  I P     1 
ATOM   6183  O  OP1   . DC  J 7  3   ? -60.818 -50.979 77.407 1.00 251.16 ? -70 DC  I OP1   1 
ATOM   6184  O  OP2   . DC  J 7  3   ? -59.381 -51.142 75.295 1.00 243.69 ? -70 DC  I OP2   1 
ATOM   6185  O  "O5'" . DC  J 7  3   ? -60.181 -48.930 76.116 1.00 242.14 ? -70 DC  I "O5'" 1 
ATOM   6186  C  "C5'" . DC  J 7  3   ? -60.611 -48.009 77.114 1.00 241.69 ? -70 DC  I "C5'" 1 
ATOM   6187  C  "C4'" . DC  J 7  3   ? -60.849 -46.632 76.518 1.00 236.25 ? -70 DC  I "C4'" 1 
ATOM   6188  O  "O4'" . DC  J 7  3   ? -59.583 -46.059 76.095 1.00 227.67 ? -70 DC  I "O4'" 1 
ATOM   6189  C  "C3'" . DC  J 7  3   ? -61.763 -46.604 75.291 1.00 236.57 ? -70 DC  I "C3'" 1 
ATOM   6190  O  "O3'" . DC  J 7  3   ? -62.660 -45.505 75.376 1.00 241.32 ? -70 DC  I "O3'" 1 
ATOM   6191  C  "C2'" . DC  J 7  3   ? -60.785 -46.439 74.130 1.00 227.68 ? -70 DC  I "C2'" 1 
ATOM   6192  C  "C1'" . DC  J 7  3   ? -59.696 -45.594 74.770 1.00 221.56 ? -70 DC  I "C1'" 1 
ATOM   6193  N  N1    . DC  J 7  3   ? -58.371 -45.733 74.106 1.00 210.64 ? -70 DC  I N1    1 
ATOM   6194  C  C2    . DC  J 7  3   ? -57.549 -44.611 73.958 1.00 203.65 ? -70 DC  I C2    1 
ATOM   6195  O  O2    . DC  J 7  3   ? -57.938 -43.518 74.387 1.00 202.07 ? -70 DC  I O2    1 
ATOM   6196  N  N3    . DC  J 7  3   ? -56.345 -44.756 73.350 1.00 199.19 ? -70 DC  I N3    1 
ATOM   6197  C  C4    . DC  J 7  3   ? -55.962 -45.953 72.902 1.00 197.73 ? -70 DC  I C4    1 
ATOM   6198  N  N4    . DC  J 7  3   ? -54.768 -46.047 72.309 1.00 192.80 ? -70 DC  I N4    1 
ATOM   6199  C  C5    . DC  J 7  3   ? -56.788 -47.107 73.043 1.00 201.96 ? -70 DC  I C5    1 
ATOM   6200  C  C6    . DC  J 7  3   ? -57.972 -46.953 73.644 1.00 207.49 ? -70 DC  I C6    1 
ATOM   6201  P  P     . DG  J 7  4   ? -64.094 -45.573 74.653 1.00 246.55 ? -69 DG  I P     1 
ATOM   6202  O  OP1   . DG  J 7  4   ? -65.125 -45.616 75.714 1.00 257.46 ? -69 DG  I OP1   1 
ATOM   6203  O  OP2   . DG  J 7  4   ? -64.038 -46.647 73.636 1.00 246.51 ? -69 DG  I OP2   1 
ATOM   6204  O  "O5'" . DG  J 7  4   ? -64.205 -44.174 73.887 1.00 240.53 ? -69 DG  I "O5'" 1 
ATOM   6205  C  "C5'" . DG  J 7  4   ? -64.310 -42.968 74.631 1.00 238.17 ? -69 DG  I "C5'" 1 
ATOM   6206  C  "C4'" . DG  J 7  4   ? -63.659 -41.813 73.891 1.00 228.74 ? -69 DG  I "C4'" 1 
ATOM   6207  O  "O4'" . DG  J 7  4   ? -62.300 -42.173 73.526 1.00 220.69 ? -69 DG  I "O4'" 1 
ATOM   6208  C  "C3'" . DG  J 7  4   ? -64.354 -41.395 72.594 1.00 226.93 ? -69 DG  I "C3'" 1 
ATOM   6209  O  "O3'" . DG  J 7  4   ? -64.411 -39.977 72.517 1.00 227.08 ? -69 DG  I "O3'" 1 
ATOM   6210  C  "C2'" . DG  J 7  4   ? -63.454 -41.982 71.508 1.00 219.46 ? -69 DG  I "C2'" 1 
ATOM   6211  C  "C1'" . DG  J 7  4   ? -62.088 -41.883 72.164 1.00 213.30 ? -69 DG  I "C1'" 1 
ATOM   6212  N  N9    . DG  J 7  4   ? -61.112 -42.832 71.635 1.00 203.44 ? -69 DG  I N9    1 
ATOM   6213  C  C8    . DG  J 7  4   ? -61.264 -44.191 71.506 1.00 202.63 ? -69 DG  I C8    1 
ATOM   6214  N  N7    . DG  J 7  4   ? -60.218 -44.786 71.003 1.00 197.38 ? -69 DG  I N7    1 
ATOM   6215  C  C5    . DG  J 7  4   ? -59.313 -43.756 70.786 1.00 192.30 ? -69 DG  I C5    1 
ATOM   6216  C  C6    . DG  J 7  4   ? -58.001 -43.791 70.256 1.00 186.11 ? -69 DG  I C6    1 
ATOM   6217  O  O6    . DG  J 7  4   ? -57.360 -44.774 69.859 1.00 183.62 ? -69 DG  I O6    1 
ATOM   6218  N  N1    . DG  J 7  4   ? -57.431 -42.521 70.206 1.00 183.05 ? -69 DG  I N1    1 
ATOM   6219  C  C2    . DG  J 7  4   ? -58.050 -41.364 70.617 1.00 183.90 ? -69 DG  I C2    1 
ATOM   6220  N  N2    . DG  J 7  4   ? -57.341 -40.233 70.492 1.00 180.32 ? -69 DG  I N2    1 
ATOM   6221  N  N3    . DG  J 7  4   ? -59.279 -41.317 71.116 1.00 189.15 ? -69 DG  I N3    1 
ATOM   6222  C  C4    . DG  J 7  4   ? -59.848 -42.546 71.171 1.00 194.51 ? -69 DG  I C4    1 
ATOM   6223  P  P     . DA  J 7  5   ? -65.367 -39.255 71.447 1.00 226.26 ? -68 DA  I P     1 
ATOM   6224  O  OP1   . DA  J 7  5   ? -66.093 -38.175 72.150 1.00 232.66 ? -68 DA  I OP1   1 
ATOM   6225  O  OP2   . DA  J 7  5   ? -66.123 -40.304 70.727 1.00 229.74 ? -68 DA  I OP2   1 
ATOM   6226  O  "O5'" . DA  J 7  5   ? -64.343 -38.598 70.412 1.00 217.21 ? -68 DA  I "O5'" 1 
ATOM   6227  C  "C5'" . DA  J 7  5   ? -63.249 -37.826 70.890 1.00 211.96 ? -68 DA  I "C5'" 1 
ATOM   6228  C  "C4'" . DA  J 7  5   ? -62.226 -37.601 69.792 1.00 204.86 ? -68 DA  I "C4'" 1 
ATOM   6229  O  "O4'" . DA  J 7  5   ? -61.436 -38.806 69.601 1.00 202.13 ? -68 DA  I "O4'" 1 
ATOM   6230  C  "C3'" . DA  J 7  5   ? -62.814 -37.264 68.419 1.00 202.19 ? -68 DA  I "C3'" 1 
ATOM   6231  O  "O3'" . DA  J 7  5   ? -61.994 -36.314 67.771 1.00 195.87 ? -68 DA  I "O3'" 1 
ATOM   6232  C  "C2'" . DA  J 7  5   ? -62.750 -38.605 67.699 1.00 201.60 ? -68 DA  I "C2'" 1 
ATOM   6233  C  "C1'" . DA  J 7  5   ? -61.432 -39.133 68.231 1.00 198.74 ? -68 DA  I "C1'" 1 
ATOM   6234  N  N9    . DA  J 7  5   ? -61.269 -40.575 68.084 1.00 197.02 ? -68 DA  I N9    1 
ATOM   6235  C  C8    . DA  J 7  5   ? -62.218 -41.538 68.283 1.00 200.61 ? -68 DA  I C8    1 
ATOM   6236  N  N7    . DA  J 7  5   ? -61.785 -42.759 68.072 1.00 199.80 ? -68 DA  I N7    1 
ATOM   6237  C  C5    . DA  J 7  5   ? -60.460 -42.582 67.707 1.00 194.84 ? -68 DA  I C5    1 
ATOM   6238  C  C6    . DA  J 7  5   ? -59.443 -43.491 67.352 1.00 192.37 ? -68 DA  I C6    1 
ATOM   6239  N  N6    . DA  J 7  5   ? -59.621 -44.815 67.308 1.00 193.79 ? -68 DA  I N6    1 
ATOM   6240  N  N1    . DA  J 7  5   ? -58.230 -42.983 67.044 1.00 187.81 ? -68 DA  I N1    1 
ATOM   6241  C  C2    . DA  J 7  5   ? -58.055 -41.657 67.090 1.00 185.03 ? -68 DA  I C2    1 
ATOM   6242  N  N3    . DA  J 7  5   ? -58.933 -40.707 67.408 1.00 186.43 ? -68 DA  I N3    1 
ATOM   6243  C  C4    . DA  J 7  5   ? -60.127 -41.242 67.709 1.00 192.00 ? -68 DA  I C4    1 
ATOM   6244  P  P     . DT  J 7  6   ? -62.292 -34.742 67.901 1.00 193.09 ? -67 DT  I P     1 
ATOM   6245  O  OP1   . DT  J 7  6   ? -62.436 -34.414 69.338 1.00 194.94 ? -67 DT  I OP1   1 
ATOM   6246  O  OP2   . DT  J 7  6   ? -63.383 -34.409 66.959 1.00 193.41 ? -67 DT  I OP2   1 
ATOM   6247  O  "O5'" . DT  J 7  6   ? -60.948 -34.077 67.352 1.00 187.45 ? -67 DT  I "O5'" 1 
ATOM   6248  C  "C5'" . DT  J 7  6   ? -59.691 -34.665 67.675 1.00 182.62 ? -67 DT  I "C5'" 1 
ATOM   6249  C  "C4'" . DT  J 7  6   ? -58.878 -34.934 66.422 1.00 174.34 ? -67 DT  I "C4'" 1 
ATOM   6250  O  "O4'" . DT  J 7  6   ? -58.761 -36.366 66.203 1.00 171.71 ? -67 DT  I "O4'" 1 
ATOM   6251  C  "C3'" . DT  J 7  6   ? -59.464 -34.353 65.128 1.00 170.89 ? -67 DT  I "C3'" 1 
ATOM   6252  O  "O3'" . DT  J 7  6   ? -58.457 -33.641 64.424 1.00 166.93 ? -67 DT  I "O3'" 1 
ATOM   6253  C  "C2'" . DT  J 7  6   ? -59.914 -35.594 64.353 1.00 169.24 ? -67 DT  I "C2'" 1 
ATOM   6254  C  "C1'" . DT  J 7  6   ? -58.896 -36.614 64.828 1.00 167.10 ? -67 DT  I "C1'" 1 
ATOM   6255  N  N1    . DT  J 7  6   ? -59.312 -38.035 64.622 1.00 165.75 ? -67 DT  I N1    1 
ATOM   6256  C  C2    . DT  J 7  6   ? -58.344 -38.999 64.460 1.00 163.12 ? -67 DT  I C2    1 
ATOM   6257  O  O2    . DT  J 7  6   ? -57.150 -38.757 64.485 1.00 161.49 ? -67 DT  I O2    1 
ATOM   6258  N  N3    . DT  J 7  6   ? -58.823 -40.267 64.270 1.00 163.79 ? -67 DT  I N3    1 
ATOM   6259  C  C4    . DT  J 7  6   ? -60.147 -40.661 64.223 1.00 168.02 ? -67 DT  I C4    1 
ATOM   6260  O  O4    . DT  J 7  6   ? -60.478 -41.830 64.048 1.00 170.68 ? -67 DT  I O4    1 
ATOM   6261  C  C5    . DT  J 7  6   ? -61.113 -39.602 64.395 1.00 170.03 ? -67 DT  I C5    1 
ATOM   6262  C  C7    . DT  J 7  6   ? -62.581 -39.910 64.361 1.00 174.13 ? -67 DT  I C7    1 
ATOM   6263  C  C6    . DT  J 7  6   ? -60.655 -38.353 64.582 1.00 168.35 ? -67 DT  I C6    1 
ATOM   6264  P  P     . DG  J 7  7   ? -58.843 -32.388 63.495 1.00 165.17 ? -66 DG  I P     1 
ATOM   6265  O  OP1   . DG  J 7  7   ? -58.502 -31.156 64.240 1.00 164.12 ? -66 DG  I OP1   1 
ATOM   6266  O  OP2   . DG  J 7  7   ? -60.225 -32.595 63.009 1.00 168.64 ? -66 DG  I OP2   1 
ATOM   6267  O  "O5'" . DG  J 7  7   ? -57.857 -32.526 62.244 1.00 160.08 ? -66 DG  I "O5'" 1 
ATOM   6268  C  "C5'" . DG  J 7  7   ? -56.460 -32.682 62.458 1.00 157.41 ? -66 DG  I "C5'" 1 
ATOM   6269  C  "C4'" . DG  J 7  7   ? -55.924 -33.879 61.692 1.00 157.85 ? -66 DG  I "C4'" 1 
ATOM   6270  O  "O4'" . DG  J 7  7   ? -56.737 -35.038 61.976 1.00 161.11 ? -66 DG  I "O4'" 1 
ATOM   6271  C  "C3'" . DG  J 7  7   ? -55.918 -33.725 60.166 1.00 158.33 ? -66 DG  I "C3'" 1 
ATOM   6272  O  "O3'" . DG  J 7  7   ? -54.576 -33.724 59.680 1.00 155.26 ? -66 DG  I "O3'" 1 
ATOM   6273  C  "C2'" . DG  J 7  7   ? -56.713 -34.936 59.649 1.00 160.92 ? -66 DG  I "C2'" 1 
ATOM   6274  C  "C1'" . DG  J 7  7   ? -56.742 -35.870 60.849 1.00 162.03 ? -66 DG  I "C1'" 1 
ATOM   6275  N  N9    . DG  J 7  7   ? -57.936 -36.708 60.898 1.00 166.12 ? -66 DG  I N9    1 
ATOM   6276  C  C8    . DG  J 7  7   ? -59.228 -36.295 61.118 1.00 168.64 ? -66 DG  I C8    1 
ATOM   6277  N  N7    . DG  J 7  7   ? -60.095 -37.269 61.106 1.00 171.42 ? -66 DG  I N7    1 
ATOM   6278  C  C5    . DG  J 7  7   ? -59.330 -38.401 60.860 1.00 171.51 ? -66 DG  I C5    1 
ATOM   6279  C  C6    . DG  J 7  7   ? -59.721 -39.755 60.736 1.00 175.35 ? -66 DG  I C6    1 
ATOM   6280  O  O6    . DG  J 7  7   ? -60.859 -40.237 60.822 1.00 179.51 ? -66 DG  I O6    1 
ATOM   6281  N  N1    . DG  J 7  7   ? -58.631 -40.585 60.486 1.00 173.99 ? -66 DG  I N1    1 
ATOM   6282  C  C2    . DG  J 7  7   ? -57.328 -40.159 60.372 1.00 171.08 ? -66 DG  I C2    1 
ATOM   6283  N  N2    . DG  J 7  7   ? -56.412 -41.108 60.127 1.00 173.60 ? -66 DG  I N2    1 
ATOM   6284  N  N3    . DG  J 7  7   ? -56.949 -38.893 60.485 1.00 168.02 ? -66 DG  I N3    1 
ATOM   6285  C  C4    . DG  J 7  7   ? -57.999 -38.073 60.728 1.00 168.39 ? -66 DG  I C4    1 
ATOM   6286  P  P     . DT  J 7  8   ? -54.280 -33.697 58.099 1.00 152.63 ? -65 DT  I P     1 
ATOM   6287  O  OP1   . DT  J 7  8   ? -52.975 -33.032 57.896 1.00 149.41 ? -65 DT  I OP1   1 
ATOM   6288  O  OP2   . DT  J 7  8   ? -55.476 -33.166 57.408 1.00 153.53 ? -65 DT  I OP2   1 
ATOM   6289  O  "O5'" . DT  J 7  8   ? -54.127 -35.241 57.716 1.00 153.92 ? -65 DT  I "O5'" 1 
ATOM   6290  C  "C5'" . DT  J 7  8   ? -53.237 -36.069 58.457 1.00 153.86 ? -65 DT  I "C5'" 1 
ATOM   6291  C  "C4'" . DT  J 7  8   ? -53.266 -37.494 57.937 1.00 154.66 ? -65 DT  I "C4'" 1 
ATOM   6292  O  "O4'" . DT  J 7  8   ? -54.554 -38.096 58.233 1.00 158.27 ? -65 DT  I "O4'" 1 
ATOM   6293  C  "C3'" . DT  J 7  8   ? -53.063 -37.634 56.426 1.00 152.80 ? -65 DT  I "C3'" 1 
ATOM   6294  O  "O3'" . DT  J 7  8   ? -52.158 -38.697 56.154 1.00 152.13 ? -65 DT  I "O3'" 1 
ATOM   6295  C  "C2'" . DT  J 7  8   ? -54.468 -37.944 55.909 1.00 155.37 ? -65 DT  I "C2'" 1 
ATOM   6296  C  "C1'" . DT  J 7  8   ? -55.052 -38.722 57.074 1.00 158.38 ? -65 DT  I "C1'" 1 
ATOM   6297  N  N1    . DT  J 7  8   ? -56.544 -38.698 57.121 1.00 160.53 ? -65 DT  I N1    1 
ATOM   6298  C  C2    . DT  J 7  8   ? -57.235 -39.886 57.116 1.00 161.90 ? -65 DT  I C2    1 
ATOM   6299  O  O2    . DT  J 7  8   ? -56.691 -40.975 57.081 1.00 161.18 ? -65 DT  I O2    1 
ATOM   6300  N  N3    . DT  J 7  8   ? -58.598 -39.755 57.160 1.00 164.31 ? -65 DT  I N3    1 
ATOM   6301  C  C4    . DT  J 7  8   ? -59.324 -38.579 57.204 1.00 165.06 ? -65 DT  I C4    1 
ATOM   6302  O  O4    . DT  J 7  8   ? -60.550 -38.566 57.240 1.00 168.90 ? -65 DT  I O4    1 
ATOM   6303  C  C5    . DT  J 7  8   ? -58.538 -37.369 57.204 1.00 161.55 ? -65 DT  I C5    1 
ATOM   6304  C  C7    . DT  J 7  8   ? -59.215 -36.031 57.248 1.00 160.34 ? -65 DT  I C7    1 
ATOM   6305  C  C6    . DT  J 7  8   ? -57.201 -37.485 57.162 1.00 160.30 ? -65 DT  I C6    1 
ATOM   6306  P  P     . DA  J 7  9   ? -51.577 -38.908 54.670 1.00 151.93 ? -64 DA  I P     1 
ATOM   6307  O  OP1   . DA  J 7  9   ? -50.125 -39.163 54.796 1.00 150.58 ? -64 DA  I OP1   1 
ATOM   6308  O  OP2   . DA  J 7  9   ? -52.054 -37.790 53.826 1.00 148.04 ? -64 DA  I OP2   1 
ATOM   6309  O  "O5'" . DA  J 7  9   ? -52.293 -40.247 54.166 1.00 158.51 ? -64 DA  I "O5'" 1 
ATOM   6310  C  "C5'" . DA  J 7  9   ? -52.089 -41.469 54.870 1.00 162.62 ? -64 DA  I "C5'" 1 
ATOM   6311  C  "C4'" . DA  J 7  9   ? -53.038 -42.548 54.377 1.00 167.14 ? -64 DA  I "C4'" 1 
ATOM   6312  O  "O4'" . DA  J 7  9   ? -54.405 -42.178 54.695 1.00 168.06 ? -64 DA  I "O4'" 1 
ATOM   6313  C  "C3'" . DA  J 7  9   ? -53.004 -42.804 52.870 1.00 171.16 ? -64 DA  I "C3'" 1 
ATOM   6314  O  "O3'" . DA  J 7  9   ? -53.064 -44.202 52.615 1.00 178.77 ? -64 DA  I "O3'" 1 
ATOM   6315  C  "C2'" . DA  J 7  9   ? -54.252 -42.086 52.364 1.00 170.15 ? -64 DA  I "C2'" 1 
ATOM   6316  C  "C1'" . DA  J 7  9   ? -55.203 -42.261 53.536 1.00 170.69 ? -64 DA  I "C1'" 1 
ATOM   6317  N  N9    . DA  J 7  9   ? -56.228 -41.226 53.610 1.00 173.45 ? -64 DA  I N9    1 
ATOM   6318  C  C8    . DA  J 7  9   ? -56.032 -39.874 53.606 1.00 172.70 ? -64 DA  I C8    1 
ATOM   6319  N  N7    . DA  J 7  9   ? -57.141 -39.177 53.687 1.00 175.65 ? -64 DA  I N7    1 
ATOM   6320  C  C5    . DA  J 7  9   ? -58.134 -40.140 53.749 1.00 179.26 ? -64 DA  I C5    1 
ATOM   6321  C  C6    . DA  J 7  9   ? -59.536 -40.051 53.845 1.00 183.36 ? -64 DA  I C6    1 
ATOM   6322  N  N6    . DA  J 7  9   ? -60.196 -38.889 53.899 1.00 183.91 ? -64 DA  I N6    1 
ATOM   6323  N  N1    . DA  J 7  9   ? -60.234 -41.205 53.886 1.00 186.32 ? -64 DA  I N1    1 
ATOM   6324  C  C2    . DA  J 7  9   ? -59.568 -42.364 53.832 1.00 185.03 ? -64 DA  I C2    1 
ATOM   6325  N  N3    . DA  J 7  9   ? -58.255 -42.573 53.741 1.00 181.32 ? -64 DA  I N3    1 
ATOM   6326  C  C4    . DA  J 7  9   ? -57.589 -41.409 53.703 1.00 178.21 ? -64 DA  I C4    1 
ATOM   6327  P  P     . DT  J 7  10  ? -52.680 -44.780 51.165 1.00 182.62 ? -63 DT  I P     1 
ATOM   6328  O  OP1   . DT  J 7  10  ? -51.664 -45.837 51.363 1.00 178.68 ? -63 DT  I OP1   1 
ATOM   6329  O  OP2   . DT  J 7  10  ? -52.382 -43.632 50.279 1.00 181.90 ? -63 DT  I OP2   1 
ATOM   6330  O  "O5'" . DT  J 7  10  ? -54.036 -45.457 50.654 1.00 192.63 ? -63 DT  I "O5'" 1 
ATOM   6331  C  "C5'" . DT  J 7  10  ? -54.612 -46.527 51.392 1.00 201.53 ? -63 DT  I "C5'" 1 
ATOM   6332  C  "C4'" . DT  J 7  10  ? -56.080 -46.705 51.042 1.00 210.12 ? -63 DT  I "C4'" 1 
ATOM   6333  O  "O4'" . DT  J 7  10  ? -56.808 -45.494 51.353 1.00 213.06 ? -63 DT  I "O4'" 1 
ATOM   6334  C  "C3'" . DT  J 7  10  ? -56.369 -47.012 49.567 1.00 214.42 ? -63 DT  I "C3'" 1 
ATOM   6335  O  "O3'" . DT  J 7  10  ? -57.032 -48.266 49.454 1.00 222.15 ? -63 DT  I "O3'" 1 
ATOM   6336  C  "C2'" . DT  J 7  10  ? -57.265 -45.853 49.105 1.00 215.42 ? -63 DT  I "C2'" 1 
ATOM   6337  C  "C1'" . DT  J 7  10  ? -57.841 -45.347 50.417 1.00 216.69 ? -63 DT  I "C1'" 1 
ATOM   6338  N  N1    . DT  J 7  10  ? -58.251 -43.912 50.379 1.00 218.61 ? -63 DT  I N1    1 
ATOM   6339  C  C2    . DT  J 7  10  ? -59.573 -43.587 50.570 1.00 222.14 ? -63 DT  I C2    1 
ATOM   6340  O  O2    . DT  J 7  10  ? -60.442 -44.415 50.775 1.00 225.19 ? -63 DT  I O2    1 
ATOM   6341  N  N3    . DT  J 7  10  ? -59.847 -42.246 50.515 1.00 221.54 ? -63 DT  I N3    1 
ATOM   6342  C  C4    . DT  J 7  10  ? -58.949 -41.218 50.291 1.00 217.65 ? -63 DT  I C4    1 
ATOM   6343  O  O4    . DT  J 7  10  ? -59.293 -40.041 50.259 1.00 216.17 ? -63 DT  I O4    1 
ATOM   6344  C  C5    . DT  J 7  10  ? -57.578 -41.628 50.096 1.00 215.36 ? -63 DT  I C5    1 
ATOM   6345  C  C7    . DT  J 7  10  ? -56.513 -40.602 49.844 1.00 211.88 ? -63 DT  I C7    1 
ATOM   6346  C  C6    . DT  J 7  10  ? -57.298 -42.940 50.148 1.00 216.40 ? -63 DT  I C6    1 
ATOM   6347  P  P     . DA  J 7  11  ? -57.341 -48.894 48.008 1.00 221.81 ? -62 DA  I P     1 
ATOM   6348  O  OP1   . DA  J 7  11  ? -57.337 -50.367 48.151 1.00 225.23 ? -62 DA  I OP1   1 
ATOM   6349  O  OP2   . DA  J 7  11  ? -56.441 -48.247 47.028 1.00 219.37 ? -62 DA  I OP2   1 
ATOM   6350  O  "O5'" . DA  J 7  11  ? -58.834 -48.414 47.694 1.00 221.93 ? -62 DA  I "O5'" 1 
ATOM   6351  C  "C5'" . DA  J 7  11  ? -59.897 -48.789 48.561 1.00 220.99 ? -62 DA  I "C5'" 1 
ATOM   6352  C  "C4'" . DA  J 7  11  ? -61.226 -48.274 48.040 1.00 217.70 ? -62 DA  I "C4'" 1 
ATOM   6353  O  "O4'" . DA  J 7  11  ? -61.343 -46.856 48.322 1.00 215.71 ? -62 DA  I "O4'" 1 
ATOM   6354  C  "C3'" . DA  J 7  11  ? -61.432 -48.435 46.533 1.00 214.65 ? -62 DA  I "C3'" 1 
ATOM   6355  O  "O3'" . DA  J 7  11  ? -62.724 -48.966 46.273 1.00 216.96 ? -62 DA  I "O3'" 1 
ATOM   6356  C  "C2'" . DA  J 7  11  ? -61.283 -47.012 45.992 1.00 212.68 ? -62 DA  I "C2'" 1 
ATOM   6357  C  "C1'" . DA  J 7  11  ? -61.767 -46.175 47.165 1.00 213.52 ? -62 DA  I "C1'" 1 
ATOM   6358  N  N9    . DA  J 7  11  ? -61.200 -44.829 47.193 1.00 208.00 ? -62 DA  I N9    1 
ATOM   6359  C  C8    . DA  J 7  11  ? -59.875 -44.493 47.152 1.00 202.93 ? -62 DA  I C8    1 
ATOM   6360  N  N7    . DA  J 7  11  ? -59.655 -43.200 47.195 1.00 199.97 ? -62 DA  I N7    1 
ATOM   6361  C  C5    . DA  J 7  11  ? -60.923 -42.649 47.272 1.00 202.09 ? -62 DA  I C5    1 
ATOM   6362  C  C6    . DA  J 7  11  ? -61.377 -41.317 47.346 1.00 200.55 ? -62 DA  I C6    1 
ATOM   6363  N  N6    . DA  J 7  11  ? -60.558 -40.260 47.355 1.00 196.15 ? -62 DA  I N6    1 
ATOM   6364  N  N1    . DA  J 7  11  ? -62.709 -41.113 47.412 1.00 204.70 ? -62 DA  I N1    1 
ATOM   6365  C  C2    . DA  J 7  11  ? -63.526 -42.174 47.404 1.00 208.79 ? -62 DA  I C2    1 
ATOM   6366  N  N3    . DA  J 7  11  ? -63.218 -43.468 47.337 1.00 210.01 ? -62 DA  I N3    1 
ATOM   6367  C  C4    . DA  J 7  11  ? -61.888 -43.639 47.273 1.00 207.03 ? -62 DA  I C4    1 
ATOM   6368  P  P     . DT  J 7  12  ? -62.971 -49.900 44.989 1.00 216.78 ? -61 DT  I P     1 
ATOM   6369  O  OP1   . DT  J 7  12  ? -63.708 -51.102 45.440 1.00 220.71 ? -61 DT  I OP1   1 
ATOM   6370  O  OP2   . DT  J 7  12  ? -61.678 -50.051 44.285 1.00 216.37 ? -61 DT  I OP2   1 
ATOM   6371  O  "O5'" . DT  J 7  12  ? -63.930 -49.020 44.062 1.00 213.69 ? -61 DT  I "O5'" 1 
ATOM   6372  C  "C5'" . DT  J 7  12  ? -65.107 -48.446 44.612 1.00 212.56 ? -61 DT  I "C5'" 1 
ATOM   6373  C  "C4'" . DT  J 7  12  ? -65.447 -47.141 43.917 1.00 208.27 ? -61 DT  I "C4'" 1 
ATOM   6374  O  "O4'" . DT  J 7  12  ? -64.415 -46.155 44.192 1.00 201.33 ? -61 DT  I "O4'" 1 
ATOM   6375  C  "C3'" . DT  J 7  12  ? -65.558 -47.227 42.391 1.00 209.02 ? -61 DT  I "C3'" 1 
ATOM   6376  O  "O3'" . DT  J 7  12  ? -66.708 -46.521 41.954 1.00 214.71 ? -61 DT  I "O3'" 1 
ATOM   6377  C  "C2'" . DT  J 7  12  ? -64.277 -46.546 41.910 1.00 202.06 ? -61 DT  I "C2'" 1 
ATOM   6378  C  "C1'" . DT  J 7  12  ? -64.088 -45.500 42.992 1.00 197.95 ? -61 DT  I "C1'" 1 
ATOM   6379  N  N1    . DT  J 7  12  ? -62.696 -44.971 43.088 1.00 190.07 ? -61 DT  I N1    1 
ATOM   6380  C  C2    . DT  J 7  12  ? -62.498 -43.684 43.531 1.00 184.95 ? -61 DT  I C2    1 
ATOM   6381  O  O2    . DT  J 7  12  ? -63.407 -42.944 43.862 1.00 185.30 ? -61 DT  I O2    1 
ATOM   6382  N  N3    . DT  J 7  12  ? -61.187 -43.291 43.579 1.00 179.49 ? -61 DT  I N3    1 
ATOM   6383  C  C4    . DT  J 7  12  ? -60.077 -44.039 43.231 1.00 175.84 ? -61 DT  I C4    1 
ATOM   6384  O  O4    . DT  J 7  12  ? -58.936 -43.595 43.309 1.00 169.24 ? -61 DT  I O4    1 
ATOM   6385  C  C5    . DT  J 7  12  ? -60.356 -45.379 42.770 1.00 180.49 ? -61 DT  I C5    1 
ATOM   6386  C  C7    . DT  J 7  12  ? -59.232 -46.286 42.365 1.00 177.46 ? -61 DT  I C7    1 
ATOM   6387  C  C6    . DT  J 7  12  ? -61.637 -45.775 42.719 1.00 187.15 ? -61 DT  I C6    1 
ATOM   6388  P  P     . DA  J 7  13  ? -68.042 -47.315 41.543 1.00 220.71 ? -60 DA  I P     1 
ATOM   6389  O  OP1   . DA  J 7  13  ? -68.562 -47.980 42.758 1.00 224.22 ? -60 DA  I OP1   1 
ATOM   6390  O  OP2   . DA  J 7  13  ? -67.739 -48.117 40.338 1.00 220.71 ? -60 DA  I OP2   1 
ATOM   6391  O  "O5'" . DA  J 7  13  ? -69.054 -46.151 41.118 1.00 222.29 ? -60 DA  I "O5'" 1 
ATOM   6392  C  "C5'" . DA  J 7  13  ? -69.397 -45.133 42.052 1.00 221.54 ? -60 DA  I "C5'" 1 
ATOM   6393  C  "C4'" . DA  J 7  13  ? -69.304 -43.759 41.412 1.00 218.32 ? -60 DA  I "C4'" 1 
ATOM   6394  O  "O4'" . DA  J 7  13  ? -68.011 -43.173 41.699 1.00 215.79 ? -60 DA  I "O4'" 1 
ATOM   6395  C  "C3'" . DA  J 7  13  ? -69.456 -43.744 39.886 1.00 217.10 ? -60 DA  I "C3'" 1 
ATOM   6396  O  "O3'" . DA  J 7  13  ? -70.527 -42.887 39.512 1.00 217.60 ? -60 DA  I "O3'" 1 
ATOM   6397  C  "C2'" . DA  J 7  13  ? -68.106 -43.222 39.376 1.00 213.86 ? -60 DA  I "C2'" 1 
ATOM   6398  C  "C1'" . DA  J 7  13  ? -67.579 -42.452 40.575 1.00 212.67 ? -60 DA  I "C1'" 1 
ATOM   6399  N  N9    . DA  J 7  13  ? -66.121 -42.364 40.612 1.00 209.04 ? -60 DA  I N9    1 
ATOM   6400  C  C8    . DA  J 7  13  ? -65.232 -43.398 40.524 1.00 208.15 ? -60 DA  I C8    1 
ATOM   6401  N  N7    . DA  J 7  13  ? -63.975 -43.023 40.586 1.00 204.64 ? -60 DA  I N7    1 
ATOM   6402  C  C5    . DA  J 7  13  ? -64.045 -41.647 40.722 1.00 202.80 ? -60 DA  I C5    1 
ATOM   6403  C  C6    . DA  J 7  13  ? -63.052 -40.653 40.840 1.00 198.08 ? -60 DA  I C6    1 
ATOM   6404  N  N6    . DA  J 7  13  ? -61.742 -40.918 40.838 1.00 194.27 ? -60 DA  I N6    1 
ATOM   6405  N  N1    . DA  J 7  13  ? -63.461 -39.373 40.960 1.00 197.82 ? -60 DA  I N1    1 
ATOM   6406  C  C2    . DA  J 7  13  ? -64.774 -39.112 40.962 1.00 201.12 ? -60 DA  I C2    1 
ATOM   6407  N  N3    . DA  J 7  13  ? -65.797 -39.959 40.858 1.00 205.12 ? -60 DA  I N3    1 
ATOM   6408  C  C4    . DA  J 7  13  ? -65.360 -41.223 40.740 1.00 205.79 ? -60 DA  I C4    1 
ATOM   6409  P  P     . DT  J 7  14  ? -70.978 -42.777 37.973 1.00 217.93 ? -59 DT  I P     1 
ATOM   6410  O  OP1   . DT  J 7  14  ? -72.448 -42.610 37.953 1.00 223.95 ? -59 DT  I OP1   1 
ATOM   6411  O  OP2   . DT  J 7  14  ? -70.358 -43.898 37.231 1.00 215.84 ? -59 DT  I OP2   1 
ATOM   6412  O  "O5'" . DT  J 7  14  ? -70.299 -41.418 37.475 1.00 214.38 ? -59 DT  I "O5'" 1 
ATOM   6413  C  "C5'" . DT  J 7  14  ? -70.578 -40.201 38.154 1.00 213.74 ? -59 DT  I "C5'" 1 
ATOM   6414  C  "C4'" . DT  J 7  14  ? -69.598 -39.114 37.750 1.00 210.18 ? -59 DT  I "C4'" 1 
ATOM   6415  O  "O4'" . DT  J 7  14  ? -68.251 -39.503 38.124 1.00 205.32 ? -59 DT  I "O4'" 1 
ATOM   6416  C  "C3'" . DT  J 7  14  ? -69.554 -38.800 36.250 1.00 211.57 ? -59 DT  I "C3'" 1 
ATOM   6417  O  "O3'" . DT  J 7  14  ? -69.633 -37.396 36.052 1.00 214.76 ? -59 DT  I "O3'" 1 
ATOM   6418  C  "C2'" . DT  J 7  14  ? -68.198 -39.354 35.807 1.00 206.08 ? -59 DT  I "C2'" 1 
ATOM   6419  C  "C1'" . DT  J 7  14  ? -67.376 -39.184 37.071 1.00 201.86 ? -59 DT  I "C1'" 1 
ATOM   6420  N  N1    . DT  J 7  14  ? -66.191 -40.088 37.141 1.00 196.84 ? -59 DT  I N1    1 
ATOM   6421  C  C2    . DT  J 7  14  ? -64.962 -39.560 37.459 1.00 190.59 ? -59 DT  I C2    1 
ATOM   6422  O  O2    . DT  J 7  14  ? -64.783 -38.378 37.694 1.00 188.06 ? -59 DT  I O2    1 
ATOM   6423  N  N3    . DT  J 7  14  ? -63.940 -40.470 37.495 1.00 187.93 ? -59 DT  I N3    1 
ATOM   6424  C  C4    . DT  J 7  14  ? -64.022 -41.829 37.249 1.00 189.26 ? -59 DT  I C4    1 
ATOM   6425  O  O4    . DT  J 7  14  ? -63.043 -42.567 37.307 1.00 186.18 ? -59 DT  I O4    1 
ATOM   6426  C  C5    . DT  J 7  14  ? -65.340 -42.318 36.919 1.00 194.60 ? -59 DT  I C5    1 
ATOM   6427  C  C7    . DT  J 7  14  ? -65.554 -43.774 36.632 1.00 195.95 ? -59 DT  I C7    1 
ATOM   6428  C  C6    . DT  J 7  14  ? -66.349 -41.433 36.881 1.00 198.04 ? -59 DT  I C6    1 
ATOM   6429  P  P     . DC  J 7  15  ? -70.163 -36.798 34.658 1.00 221.73 ? -58 DC  I P     1 
ATOM   6430  O  OP1   . DC  J 7  15  ? -71.488 -36.188 34.909 1.00 232.23 ? -58 DC  I OP1   1 
ATOM   6431  O  OP2   . DC  J 7  15  ? -70.021 -37.847 33.624 1.00 224.07 ? -58 DC  I OP2   1 
ATOM   6432  O  "O5'" . DC  J 7  15  ? -69.117 -35.637 34.325 1.00 214.04 ? -58 DC  I "O5'" 1 
ATOM   6433  C  "C5'" . DC  J 7  15  ? -68.817 -34.652 35.307 1.00 209.12 ? -58 DC  I "C5'" 1 
ATOM   6434  C  "C4'" . DC  J 7  15  ? -67.413 -34.108 35.116 1.00 201.61 ? -58 DC  I "C4'" 1 
ATOM   6435  O  "O4'" . DC  J 7  15  ? -66.446 -35.170 35.326 1.00 198.03 ? -58 DC  I "O4'" 1 
ATOM   6436  C  "C3'" . DC  J 7  15  ? -67.125 -33.533 33.726 1.00 198.37 ? -58 DC  I "C3'" 1 
ATOM   6437  O  "O3'" . DC  J 7  15  ? -66.477 -32.275 33.848 1.00 194.33 ? -58 DC  I "O3'" 1 
ATOM   6438  C  "C2'" . DC  J 7  15  ? -66.212 -34.578 33.085 1.00 196.32 ? -58 DC  I "C2'" 1 
ATOM   6439  C  "C1'" . DC  J 7  15  ? -65.487 -35.137 34.297 1.00 195.16 ? -58 DC  I "C1'" 1 
ATOM   6440  N  N1    . DC  J 7  15  ? -64.962 -36.518 34.093 1.00 195.81 ? -58 DC  I N1    1 
ATOM   6441  C  C2    . DC  J 7  15  ? -63.632 -36.807 34.419 1.00 192.78 ? -58 DC  I C2    1 
ATOM   6442  O  O2    . DC  J 7  15  ? -62.915 -35.909 34.877 1.00 190.50 ? -58 DC  I O2    1 
ATOM   6443  N  N3    . DC  J 7  15  ? -63.168 -38.067 34.227 1.00 192.28 ? -58 DC  I N3    1 
ATOM   6444  C  C4    . DC  J 7  15  ? -63.974 -39.007 33.731 1.00 194.76 ? -58 DC  I C4    1 
ATOM   6445  N  N4    . DC  J 7  15  ? -63.471 -40.234 33.559 1.00 193.01 ? -58 DC  I N4    1 
ATOM   6446  C  C5    . DC  J 7  15  ? -65.331 -38.731 33.390 1.00 199.08 ? -58 DC  I C5    1 
ATOM   6447  C  C6    . DC  J 7  15  ? -65.778 -37.485 33.585 1.00 199.36 ? -58 DC  I C6    1 
ATOM   6448  P  P     . DT  J 7  16  ? -66.606 -31.184 32.676 1.00 194.37 ? -57 DT  I P     1 
ATOM   6449  O  OP1   . DT  J 7  16  ? -67.067 -29.920 33.291 1.00 193.68 ? -57 DT  I OP1   1 
ATOM   6450  O  OP2   . DT  J 7  16  ? -67.383 -31.795 31.575 1.00 196.78 ? -57 DT  I OP2   1 
ATOM   6451  O  "O5'" . DT  J 7  16  ? -65.102 -30.992 32.166 1.00 193.32 ? -57 DT  I "O5'" 1 
ATOM   6452  C  "C5'" . DT  J 7  16  ? -64.111 -30.487 33.053 1.00 192.71 ? -57 DT  I "C5'" 1 
ATOM   6453  C  "C4'" . DT  J 7  16  ? -62.719 -30.675 32.477 1.00 192.04 ? -57 DT  I "C4'" 1 
ATOM   6454  O  "O4'" . DT  J 7  16  ? -62.350 -32.079 32.533 1.00 190.73 ? -57 DT  I "O4'" 1 
ATOM   6455  C  "C3'" . DT  J 7  16  ? -62.557 -30.253 31.014 1.00 195.19 ? -57 DT  I "C3'" 1 
ATOM   6456  O  "O3'" . DT  J 7  16  ? -61.312 -29.599 30.839 1.00 195.18 ? -57 DT  I "O3'" 1 
ATOM   6457  C  "C2'" . DT  J 7  16  ? -62.588 -31.586 30.272 1.00 194.82 ? -57 DT  I "C2'" 1 
ATOM   6458  C  "C1'" . DT  J 7  16  ? -61.878 -32.483 31.269 1.00 191.28 ? -57 DT  I "C1'" 1 
ATOM   6459  N  N1    . DT  J 7  16  ? -62.171 -33.931 31.090 1.00 193.43 ? -57 DT  I N1    1 
ATOM   6460  C  C2    . DT  J 7  16  ? -61.211 -34.857 31.425 1.00 193.26 ? -57 DT  I C2    1 
ATOM   6461  O  O2    . DT  J 7  16  ? -60.119 -34.554 31.871 1.00 189.95 ? -57 DT  I O2    1 
ATOM   6462  N  N3    . DT  J 7  16  ? -61.577 -36.160 31.221 1.00 196.37 ? -57 DT  I N3    1 
ATOM   6463  C  C4    . DT  J 7  16  ? -62.782 -36.621 30.723 1.00 198.29 ? -57 DT  I C4    1 
ATOM   6464  O  O4    . DT  J 7  16  ? -63.016 -37.817 30.576 1.00 198.46 ? -57 DT  I O4    1 
ATOM   6465  C  C5    . DT  J 7  16  ? -63.745 -35.598 30.389 1.00 199.92 ? -57 DT  I C5    1 
ATOM   6466  C  C7    . DT  J 7  16  ? -65.088 -35.977 29.840 1.00 203.69 ? -57 DT  I C7    1 
ATOM   6467  C  C6    . DT  J 7  16  ? -63.396 -34.317 30.586 1.00 197.38 ? -57 DT  I C6    1 
ATOM   6468  P  P     . DG  J 7  17  ? -61.257 -28.035 30.476 1.00 197.63 ? -56 DG  I P     1 
ATOM   6469  O  OP1   . DG  J 7  17  ? -61.841 -27.290 31.613 1.00 197.74 ? -56 DG  I OP1   1 
ATOM   6470  O  OP2   . DG  J 7  17  ? -61.820 -27.868 29.117 1.00 206.98 ? -56 DG  I OP2   1 
ATOM   6471  O  "O5'" . DG  J 7  17  ? -59.692 -27.720 30.401 1.00 190.33 ? -56 DG  I "O5'" 1 
ATOM   6472  C  "C5'" . DG  J 7  17  ? -58.833 -28.151 31.449 1.00 185.26 ? -56 DG  I "C5'" 1 
ATOM   6473  C  "C4'" . DG  J 7  17  ? -57.846 -29.192 30.947 1.00 181.44 ? -56 DG  I "C4'" 1 
ATOM   6474  O  "O4'" . DG  J 7  17  ? -58.565 -30.376 30.506 1.00 182.93 ? -56 DG  I "O4'" 1 
ATOM   6475  C  "C3'" . DG  J 7  17  ? -56.986 -28.749 29.762 1.00 178.58 ? -56 DG  I "C3'" 1 
ATOM   6476  O  "O3'" . DG  J 7  17  ? -55.647 -29.176 29.952 1.00 170.91 ? -56 DG  I "O3'" 1 
ATOM   6477  C  "C2'" . DG  J 7  17  ? -57.633 -29.461 28.576 1.00 182.60 ? -56 DG  I "C2'" 1 
ATOM   6478  C  "C1'" . DG  J 7  17  ? -58.110 -30.748 29.226 1.00 184.45 ? -56 DG  I "C1'" 1 
ATOM   6479  N  N9    . DG  J 7  17  ? -59.208 -31.390 28.508 1.00 190.81 ? -56 DG  I N9    1 
ATOM   6480  C  C8    . DG  J 7  17  ? -60.230 -30.768 27.833 1.00 194.41 ? -56 DG  I C8    1 
ATOM   6481  N  N7    . DG  J 7  17  ? -61.071 -31.600 27.283 1.00 197.90 ? -56 DG  I N7    1 
ATOM   6482  C  C5    . DG  J 7  17  ? -60.574 -32.854 27.613 1.00 197.18 ? -56 DG  I C5    1 
ATOM   6483  C  C6    . DG  J 7  17  ? -61.067 -34.142 27.294 1.00 199.20 ? -56 DG  I C6    1 
ATOM   6484  O  O6    . DG  J 7  17  ? -62.073 -34.438 26.634 1.00 201.39 ? -56 DG  I O6    1 
ATOM   6485  N  N1    . DG  J 7  17  ? -60.262 -35.147 27.825 1.00 198.60 ? -56 DG  I N1    1 
ATOM   6486  C  C2    . DG  J 7  17  ? -59.127 -34.935 28.570 1.00 195.01 ? -56 DG  I C2    1 
ATOM   6487  N  N2    . DG  J 7  17  ? -58.483 -36.030 28.996 1.00 193.38 ? -56 DG  I N2    1 
ATOM   6488  N  N3    . DG  J 7  17  ? -58.655 -33.733 28.877 1.00 192.57 ? -56 DG  I N3    1 
ATOM   6489  C  C4    . DG  J 7  17  ? -59.427 -32.743 28.367 1.00 193.63 ? -56 DG  I C4    1 
ATOM   6490  P  P     . DA  J 7  18  ? -54.435 -28.137 29.770 1.00 161.26 ? -55 DA  I P     1 
ATOM   6491  O  OP1   . DA  J 7  18  ? -54.301 -27.382 31.036 1.00 157.76 ? -55 DA  I OP1   1 
ATOM   6492  O  OP2   . DA  J 7  18  ? -54.650 -27.413 28.498 1.00 161.14 ? -55 DA  I OP2   1 
ATOM   6493  O  "O5'" . DA  J 7  18  ? -53.153 -29.077 29.592 1.00 155.37 ? -55 DA  I "O5'" 1 
ATOM   6494  C  "C5'" . DA  J 7  18  ? -52.825 -30.026 30.598 1.00 150.94 ? -55 DA  I "C5'" 1 
ATOM   6495  C  "C4'" . DA  J 7  18  ? -52.576 -31.396 29.992 1.00 148.51 ? -55 DA  I "C4'" 1 
ATOM   6496  O  "O4'" . DA  J 7  18  ? -53.770 -31.848 29.298 1.00 150.99 ? -55 DA  I "O4'" 1 
ATOM   6497  C  "C3'" . DA  J 7  18  ? -51.447 -31.458 28.964 1.00 145.12 ? -55 DA  I "C3'" 1 
ATOM   6498  O  "O3'" . DA  J 7  18  ? -50.755 -32.689 29.089 1.00 138.83 ? -55 DA  I "O3'" 1 
ATOM   6499  C  "C2'" . DA  J 7  18  ? -52.195 -31.378 27.638 1.00 149.10 ? -55 DA  I "C2'" 1 
ATOM   6500  C  "C1'" . DA  J 7  18  ? -53.446 -32.177 27.965 1.00 152.83 ? -55 DA  I "C1'" 1 
ATOM   6501  N  N9    . DA  J 7  18  ? -54.587 -31.852 27.116 1.00 159.66 ? -55 DA  I N9    1 
ATOM   6502  C  C8    . DA  J 7  18  ? -54.926 -30.622 26.626 1.00 162.18 ? -55 DA  I C8    1 
ATOM   6503  N  N7    . DA  J 7  18  ? -56.011 -30.627 25.888 1.00 166.80 ? -55 DA  I N7    1 
ATOM   6504  C  C5    . DA  J 7  18  ? -56.412 -31.953 25.897 1.00 169.11 ? -55 DA  I C5    1 
ATOM   6505  C  C6    . DA  J 7  18  ? -57.499 -32.621 25.298 1.00 173.69 ? -55 DA  I C6    1 
ATOM   6506  N  N6    . DA  J 7  18  ? -58.416 -32.005 24.545 1.00 176.58 ? -55 DA  I N6    1 
ATOM   6507  N  N1    . DA  J 7  18  ? -57.608 -33.950 25.506 1.00 174.25 ? -55 DA  I N1    1 
ATOM   6508  C  C2    . DA  J 7  18  ? -56.688 -34.563 26.261 1.00 170.98 ? -55 DA  I C2    1 
ATOM   6509  N  N3    . DA  J 7  18  ? -55.626 -34.043 26.875 1.00 166.80 ? -55 DA  I N3    1 
ATOM   6510  C  C4    . DA  J 7  18  ? -55.545 -32.721 26.650 1.00 165.23 ? -55 DA  I C4    1 
ATOM   6511  P  P     . DC  J 7  19  ? -49.198 -32.790 28.709 1.00 130.56 ? -54 DC  I P     1 
ATOM   6512  O  OP1   . DC  J 7  19  ? -48.429 -32.701 29.969 1.00 128.38 ? -54 DC  I OP1   1 
ATOM   6513  O  OP2   . DC  J 7  19  ? -48.933 -31.831 27.612 1.00 130.09 ? -54 DC  I OP2   1 
ATOM   6514  O  "O5'" . DC  J 7  19  ? -49.053 -34.265 28.110 1.00 128.67 ? -54 DC  I "O5'" 1 
ATOM   6515  C  "C5'" . DC  J 7  19  ? -49.719 -35.353 28.736 1.00 128.75 ? -54 DC  I "C5'" 1 
ATOM   6516  C  "C4'" . DC  J 7  19  ? -50.231 -36.337 27.701 1.00 133.14 ? -54 DC  I "C4'" 1 
ATOM   6517  O  "O4'" . DC  J 7  19  ? -51.404 -35.788 27.042 1.00 135.48 ? -54 DC  I "O4'" 1 
ATOM   6518  C  "C3'" . DC  J 7  19  ? -49.235 -36.678 26.590 1.00 136.72 ? -54 DC  I "C3'" 1 
ATOM   6519  O  "O3'" . DC  J 7  19  ? -49.201 -38.083 26.377 1.00 143.37 ? -54 DC  I "O3'" 1 
ATOM   6520  C  "C2'" . DC  J 7  19  ? -49.787 -35.937 25.373 1.00 137.16 ? -54 DC  I "C2'" 1 
ATOM   6521  C  "C1'" . DC  J 7  19  ? -51.279 -35.960 25.651 1.00 138.93 ? -54 DC  I "C1'" 1 
ATOM   6522  N  N1    . DC  J 7  19  ? -52.029 -34.868 24.965 1.00 143.22 ? -54 DC  I N1    1 
ATOM   6523  C  C2    . DC  J 7  19  ? -53.274 -35.140 24.386 1.00 148.21 ? -54 DC  I C2    1 
ATOM   6524  O  O2    . DC  J 7  19  ? -53.736 -36.286 24.459 1.00 150.17 ? -54 DC  I O2    1 
ATOM   6525  N  N3    . DC  J 7  19  ? -53.941 -34.137 23.763 1.00 149.54 ? -54 DC  I N3    1 
ATOM   6526  C  C4    . DC  J 7  19  ? -53.409 -32.915 23.705 1.00 147.66 ? -54 DC  I C4    1 
ATOM   6527  N  N4    . DC  J 7  19  ? -54.104 -31.959 23.080 1.00 149.02 ? -54 DC  I N4    1 
ATOM   6528  C  C5    . DC  J 7  19  ? -52.140 -32.620 24.286 1.00 144.16 ? -54 DC  I C5    1 
ATOM   6529  C  C6    . DC  J 7  19  ? -51.491 -33.616 24.898 1.00 142.10 ? -54 DC  I C6    1 
ATOM   6530  P  P     . DA  J 7  20  ? -47.791 -38.850 26.310 1.00 144.95 ? -53 DA  I P     1 
ATOM   6531  O  OP1   . DA  J 7  20  ? -47.520 -39.432 27.643 1.00 140.96 ? -53 DA  I OP1   1 
ATOM   6532  O  OP2   . DA  J 7  20  ? -46.821 -37.914 25.702 1.00 145.26 ? -53 DA  I OP2   1 
ATOM   6533  O  "O5'" . DA  J 7  20  ? -48.040 -40.030 25.260 1.00 149.17 ? -53 DA  I "O5'" 1 
ATOM   6534  C  "C5'" . DA  J 7  20  ? -49.346 -40.556 25.078 1.00 152.38 ? -53 DA  I "C5'" 1 
ATOM   6535  C  "C4'" . DA  J 7  20  ? -49.808 -40.362 23.645 1.00 154.01 ? -53 DA  I "C4'" 1 
ATOM   6536  O  "O4'" . DA  J 7  20  ? -50.200 -38.994 23.446 1.00 153.02 ? -53 DA  I "O4'" 1 
ATOM   6537  C  "C3'" . DA  J 7  20  ? -48.743 -40.629 22.584 1.00 154.93 ? -53 DA  I "C3'" 1 
ATOM   6538  O  "O3'" . DA  J 7  20  ? -48.908 -41.943 22.054 1.00 158.83 ? -53 DA  I "O3'" 1 
ATOM   6539  C  "C2'" . DA  J 7  20  ? -48.983 -39.544 21.514 1.00 155.38 ? -53 DA  I "C2'" 1 
ATOM   6540  C  "C1'" . DA  J 7  20  ? -50.145 -38.721 22.072 1.00 155.27 ? -53 DA  I "C1'" 1 
ATOM   6541  N  N9    . DA  J 7  20  ? -49.979 -37.283 21.889 1.00 156.25 ? -53 DA  I N9    1 
ATOM   6542  C  C8    . DA  J 7  20  ? -48.866 -36.539 22.169 1.00 155.09 ? -53 DA  I C8    1 
ATOM   6543  N  N7    . DA  J 7  20  ? -49.003 -35.261 21.903 1.00 157.18 ? -53 DA  I N7    1 
ATOM   6544  C  C5    . DA  J 7  20  ? -50.295 -35.161 21.411 1.00 160.50 ? -53 DA  I C5    1 
ATOM   6545  C  C6    . DA  J 7  20  ? -51.052 -34.067 20.947 1.00 163.23 ? -53 DA  I C6    1 
ATOM   6546  N  N6    . DA  J 7  20  ? -50.587 -32.814 20.904 1.00 164.37 ? -53 DA  I N6    1 
ATOM   6547  N  N1    . DA  J 7  20  ? -52.311 -34.312 20.526 1.00 165.54 ? -53 DA  I N1    1 
ATOM   6548  C  C2    . DA  J 7  20  ? -52.774 -35.568 20.569 1.00 165.34 ? -53 DA  I C2    1 
ATOM   6549  N  N3    . DA  J 7  20  ? -52.157 -36.674 20.984 1.00 162.79 ? -53 DA  I N3    1 
ATOM   6550  C  C4    . DA  J 7  20  ? -50.910 -36.398 21.396 1.00 160.04 ? -53 DA  I C4    1 
ATOM   6551  P  P     . DC  J 7  21  ? -48.079 -42.418 20.759 1.00 161.34 ? -52 DC  I P     1 
ATOM   6552  O  OP1   . DC  J 7  21  ? -48.016 -43.896 20.798 1.00 163.07 ? -52 DC  I OP1   1 
ATOM   6553  O  OP2   . DC  J 7  21  ? -46.822 -41.639 20.693 1.00 157.55 ? -52 DC  I OP2   1 
ATOM   6554  O  "O5'" . DC  J 7  21  ? -49.010 -41.983 19.532 1.00 164.37 ? -52 DC  I "O5'" 1 
ATOM   6555  C  "C5'" . DC  J 7  21  ? -50.395 -42.314 19.546 1.00 165.32 ? -52 DC  I "C5'" 1 
ATOM   6556  C  "C4'" . DC  J 7  21  ? -51.143 -41.578 18.448 1.00 164.50 ? -52 DC  I "C4'" 1 
ATOM   6557  O  "O4'" . DC  J 7  21  ? -51.142 -40.155 18.722 1.00 161.45 ? -52 DC  I "O4'" 1 
ATOM   6558  C  "C3'" . DC  J 7  21  ? -50.559 -41.745 17.039 1.00 165.35 ? -52 DC  I "C3'" 1 
ATOM   6559  O  "O3'" . DC  J 7  21  ? -51.555 -42.245 16.157 1.00 170.74 ? -52 DC  I "O3'" 1 
ATOM   6560  C  "C2'" . DC  J 7  21  ? -50.115 -40.331 16.647 1.00 163.16 ? -52 DC  I "C2'" 1 
ATOM   6561  C  "C1'" . DC  J 7  21  ? -51.017 -39.464 17.507 1.00 161.58 ? -52 DC  I "C1'" 1 
ATOM   6562  N  N1    . DC  J 7  21  ? -50.455 -38.113 17.783 1.00 157.75 ? -52 DC  I N1    1 
ATOM   6563  C  C2    . DC  J 7  21  ? -51.212 -36.975 17.485 1.00 158.16 ? -52 DC  I C2    1 
ATOM   6564  O  O2    . DC  J 7  21  ? -52.342 -37.112 17.002 1.00 161.16 ? -52 DC  I O2    1 
ATOM   6565  N  N3    . DC  J 7  21  ? -50.685 -35.752 17.739 1.00 156.02 ? -52 DC  I N3    1 
ATOM   6566  C  C4    . DC  J 7  21  ? -49.461 -35.647 18.260 1.00 153.56 ? -52 DC  I C4    1 
ATOM   6567  N  N4    . DC  J 7  21  ? -48.984 -34.419 18.493 1.00 151.35 ? -52 DC  I N4    1 
ATOM   6568  C  C5    . DC  J 7  21  ? -48.674 -36.795 18.568 1.00 153.43 ? -52 DC  I C5    1 
ATOM   6569  C  C6    . DC  J 7  21  ? -49.205 -37.996 18.314 1.00 155.23 ? -52 DC  I C6    1 
ATOM   6570  P  P     . DG  J 7  22  ? -51.145 -42.809 14.710 1.00 175.08 ? -51 DG  I P     1 
ATOM   6571  O  OP1   . DG  J 7  22  ? -51.917 -44.050 14.482 1.00 179.83 ? -51 DG  I OP1   1 
ATOM   6572  O  OP2   . DG  J 7  22  ? -49.667 -42.836 14.633 1.00 170.94 ? -51 DG  I OP2   1 
ATOM   6573  O  "O5'" . DG  J 7  22  ? -51.671 -41.687 13.699 1.00 178.79 ? -51 DG  I "O5'" 1 
ATOM   6574  C  "C5'" . DG  J 7  22  ? -53.061 -41.390 13.634 1.00 182.13 ? -51 DG  I "C5'" 1 
ATOM   6575  C  "C4'" . DG  J 7  22  ? -53.309 -40.133 12.821 1.00 183.25 ? -51 DG  I "C4'" 1 
ATOM   6576  O  "O4'" . DG  J 7  22  ? -52.707 -38.993 13.489 1.00 182.14 ? -51 DG  I "O4'" 1 
ATOM   6577  C  "C3'" . DG  J 7  22  ? -52.733 -40.151 11.403 1.00 183.85 ? -51 DG  I "C3'" 1 
ATOM   6578  O  "O3'" . DG  J 7  22  ? -53.676 -39.598 10.495 1.00 184.19 ? -51 DG  I "O3'" 1 
ATOM   6579  C  "C2'" . DG  J 7  22  ? -51.485 -39.277 11.522 1.00 183.46 ? -51 DG  I "C2'" 1 
ATOM   6580  C  "C1'" . DG  J 7  22  ? -51.920 -38.270 12.572 1.00 183.57 ? -51 DG  I "C1'" 1 
ATOM   6581  N  N9    . DG  J 7  22  ? -50.805 -37.664 13.294 1.00 182.79 ? -51 DG  I N9    1 
ATOM   6582  C  C8    . DG  J 7  22  ? -49.745 -38.315 13.876 1.00 180.54 ? -51 DG  I C8    1 
ATOM   6583  N  N7    . DG  J 7  22  ? -48.897 -37.512 14.456 1.00 177.83 ? -51 DG  I N7    1 
ATOM   6584  C  C5    . DG  J 7  22  ? -49.429 -36.247 14.246 1.00 179.83 ? -51 DG  I C5    1 
ATOM   6585  C  C6    . DG  J 7  22  ? -48.948 -34.978 14.646 1.00 179.97 ? -51 DG  I C6    1 
ATOM   6586  O  O6    . DG  J 7  22  ? -47.921 -34.713 15.287 1.00 177.35 ? -51 DG  I O6    1 
ATOM   6587  N  N1    . DG  J 7  22  ? -49.791 -33.952 14.227 1.00 182.92 ? -51 DG  I N1    1 
ATOM   6588  C  C2    . DG  J 7  22  ? -50.952 -34.130 13.512 1.00 184.68 ? -51 DG  I C2    1 
ATOM   6589  N  N2    . DG  J 7  22  ? -51.635 -33.019 13.198 1.00 184.17 ? -51 DG  I N2    1 
ATOM   6590  N  N3    . DG  J 7  22  ? -51.414 -35.314 13.132 1.00 185.79 ? -51 DG  I N3    1 
ATOM   6591  C  C4    . DG  J 7  22  ? -50.604 -36.324 13.532 1.00 182.83 ? -51 DG  I C4    1 
ATOM   6592  P  P     . DT  J 7  23  ? -53.539 -39.854 8.915  1.00 186.36 ? -50 DT  I P     1 
ATOM   6593  O  OP1   . DT  J 7  23  ? -54.636 -40.761 8.514  1.00 191.26 ? -50 DT  I OP1   1 
ATOM   6594  O  OP2   . DT  J 7  23  ? -52.138 -40.221 8.612  1.00 183.42 ? -50 DT  I OP2   1 
ATOM   6595  O  "O5'" . DT  J 7  23  ? -53.810 -38.412 8.284  1.00 188.04 ? -50 DT  I "O5'" 1 
ATOM   6596  C  "C5'" . DT  J 7  23  ? -53.290 -37.257 8.926  1.00 186.45 ? -50 DT  I "C5'" 1 
ATOM   6597  C  "C4'" . DT  J 7  23  ? -53.200 -36.096 7.958  1.00 189.98 ? -50 DT  I "C4'" 1 
ATOM   6598  O  "O4'" . DT  J 7  23  ? -52.425 -35.032 8.562  1.00 186.87 ? -50 DT  I "O4'" 1 
ATOM   6599  C  "C3'" . DT  J 7  23  ? -52.494 -36.411 6.650  1.00 195.06 ? -50 DT  I "C3'" 1 
ATOM   6600  O  "O3'" . DT  J 7  23  ? -52.962 -35.543 5.626  1.00 200.62 ? -50 DT  I "O3'" 1 
ATOM   6601  C  "C2'" . DT  J 7  23  ? -51.033 -36.144 6.996  1.00 191.04 ? -50 DT  I "C2'" 1 
ATOM   6602  C  "C1'" . DT  J 7  23  ? -51.137 -34.973 7.973  1.00 186.82 ? -50 DT  I "C1'" 1 
ATOM   6603  N  N1    . DT  J 7  23  ? -50.118 -35.024 9.062  1.00 181.23 ? -50 DT  I N1    1 
ATOM   6604  C  C2    . DT  J 7  23  ? -49.740 -33.858 9.687  1.00 176.49 ? -50 DT  I C2    1 
ATOM   6605  O  O2    . DT  J 7  23  ? -50.200 -32.767 9.402  1.00 174.48 ? -50 DT  I O2    1 
ATOM   6606  N  N3    . DT  J 7  23  ? -48.797 -34.016 10.669 1.00 174.18 ? -50 DT  I N3    1 
ATOM   6607  C  C4    . DT  J 7  23  ? -48.206 -35.198 11.078 1.00 173.89 ? -50 DT  I C4    1 
ATOM   6608  O  O4    . DT  J 7  23  ? -47.367 -35.237 11.972 1.00 173.02 ? -50 DT  I O4    1 
ATOM   6609  C  C5    . DT  J 7  23  ? -48.647 -36.382 10.380 1.00 175.39 ? -50 DT  I C5    1 
ATOM   6610  C  C7    . DT  J 7  23  ? -48.077 -37.724 10.735 1.00 173.41 ? -50 DT  I C7    1 
ATOM   6611  C  C6    . DT  J 7  23  ? -49.569 -36.239 9.417  1.00 179.48 ? -50 DT  I C6    1 
ATOM   6612  P  P     . DG  J 7  24  ? -52.451 -35.720 4.112  1.00 206.26 ? -49 DG  I P     1 
ATOM   6613  O  OP1   . DG  J 7  24  ? -53.617 -35.515 3.224  1.00 216.54 ? -49 DG  I OP1   1 
ATOM   6614  O  OP2   . DG  J 7  24  ? -51.680 -36.981 4.024  1.00 205.90 ? -49 DG  I OP2   1 
ATOM   6615  O  "O5'" . DG  J 7  24  ? -51.437 -34.500 3.914  1.00 201.79 ? -49 DG  I "O5'" 1 
ATOM   6616  C  "C5'" . DG  J 7  24  ? -51.881 -33.171 4.160  1.00 198.37 ? -49 DG  I "C5'" 1 
ATOM   6617  C  "C4'" . DG  J 7  24  ? -50.708 -32.231 4.377  1.00 192.87 ? -49 DG  I "C4'" 1 
ATOM   6618  O  "O4'" . DG  J 7  24  ? -49.943 -32.654 5.538  1.00 190.02 ? -49 DG  I "O4'" 1 
ATOM   6619  C  "C3'" . DG  J 7  24  ? -49.709 -32.154 3.217  1.00 190.50 ? -49 DG  I "C3'" 1 
ATOM   6620  O  "O3'" . DG  J 7  24  ? -49.335 -30.804 3.006  1.00 184.46 ? -49 DG  I "O3'" 1 
ATOM   6621  C  "C2'" . DG  J 7  24  ? -48.530 -32.978 3.728  1.00 190.53 ? -49 DG  I "C2'" 1 
ATOM   6622  C  "C1'" . DG  J 7  24  ? -48.575 -32.643 5.206  1.00 189.17 ? -49 DG  I "C1'" 1 
ATOM   6623  N  N9    . DG  J 7  24  ? -47.873 -33.602 6.055  1.00 188.62 ? -49 DG  I N9    1 
ATOM   6624  C  C8    . DG  J 7  24  ? -47.841 -34.968 5.914  1.00 189.72 ? -49 DG  I C8    1 
ATOM   6625  N  N7    . DG  J 7  24  ? -47.127 -35.567 6.827  1.00 187.92 ? -49 DG  I N7    1 
ATOM   6626  C  C5    . DG  J 7  24  ? -46.655 -34.532 7.624  1.00 185.60 ? -49 DG  I C5    1 
ATOM   6627  C  C6    . DG  J 7  24  ? -45.827 -34.568 8.771  1.00 181.92 ? -49 DG  I C6    1 
ATOM   6628  O  O6    . DG  J 7  24  ? -45.331 -35.556 9.329  1.00 180.69 ? -49 DG  I O6    1 
ATOM   6629  N  N1    . DG  J 7  24  ? -45.589 -33.291 9.276  1.00 179.32 ? -49 DG  I N1    1 
ATOM   6630  C  C2    . DG  J 7  24  ? -46.088 -32.127 8.739  1.00 179.52 ? -49 DG  I C2    1 
ATOM   6631  N  N2    . DG  J 7  24  ? -45.749 -30.991 9.364  1.00 175.51 ? -49 DG  I N2    1 
ATOM   6632  N  N3    . DG  J 7  24  ? -46.864 -32.080 7.664  1.00 184.03 ? -49 DG  I N3    1 
ATOM   6633  C  C4    . DG  J 7  24  ? -47.105 -33.316 7.161  1.00 186.35 ? -49 DG  I C4    1 
ATOM   6634  P  P     . DC  J 7  25  ? -49.120 -30.240 1.518  1.00 183.45 ? -48 DC  I P     1 
ATOM   6635  O  OP1   . DC  J 7  25  ? -50.430 -29.754 1.032  1.00 187.66 ? -48 DC  I OP1   1 
ATOM   6636  O  OP2   . DC  J 7  25  ? -48.378 -31.262 0.747  1.00 184.58 ? -48 DC  I OP2   1 
ATOM   6637  O  "O5'" . DC  J 7  25  ? -48.153 -28.986 1.732  1.00 177.77 ? -48 DC  I "O5'" 1 
ATOM   6638  C  "C5'" . DC  J 7  25  ? -48.455 -28.023 2.734  1.00 173.76 ? -48 DC  I "C5'" 1 
ATOM   6639  C  "C4'" . DC  J 7  25  ? -47.219 -27.680 3.546  1.00 168.80 ? -48 DC  I "C4'" 1 
ATOM   6640  O  "O4'" . DC  J 7  25  ? -46.818 -28.828 4.337  1.00 162.57 ? -48 DC  I "O4'" 1 
ATOM   6641  C  "C3'" . DC  J 7  25  ? -45.993 -27.276 2.720  1.00 170.96 ? -48 DC  I "C3'" 1 
ATOM   6642  O  "O3'" . DC  J 7  25  ? -45.465 -26.046 3.200  1.00 173.15 ? -48 DC  I "O3'" 1 
ATOM   6643  C  "C2'" . DC  J 7  25  ? -45.011 -28.433 2.929  1.00 164.65 ? -48 DC  I "C2'" 1 
ATOM   6644  C  "C1'" . DC  J 7  25  ? -45.419 -28.944 4.300  1.00 157.34 ? -48 DC  I "C1'" 1 
ATOM   6645  N  N1    . DC  J 7  25  ? -45.050 -30.370 4.538  1.00 150.29 ? -48 DC  I N1    1 
ATOM   6646  C  C2    . DC  J 7  25  ? -44.389 -30.726 5.719  1.00 147.44 ? -48 DC  I C2    1 
ATOM   6647  O  O2    . DC  J 7  25  ? -44.125 -29.850 6.551  1.00 146.38 ? -48 DC  I O2    1 
ATOM   6648  N  N3    . DC  J 7  25  ? -44.059 -32.027 5.919  1.00 146.21 ? -48 DC  I N3    1 
ATOM   6649  C  C4    . DC  J 7  25  ? -44.362 -32.943 4.997  1.00 146.82 ? -48 DC  I C4    1 
ATOM   6650  N  N4    . DC  J 7  25  ? -44.016 -34.212 5.239  1.00 144.88 ? -48 DC  I N4    1 
ATOM   6651  C  C5    . DC  J 7  25  ? -45.032 -32.597 3.787  1.00 149.34 ? -48 DC  I C5    1 
ATOM   6652  C  C6    . DC  J 7  25  ? -45.354 -31.313 3.601  1.00 149.88 ? -48 DC  I C6    1 
ATOM   6653  P  P     . DC  J 7  26  ? -44.367 -25.248 2.340  1.00 176.40 ? -47 DC  I P     1 
ATOM   6654  O  OP1   . DC  J 7  26  ? -44.629 -23.801 2.504  1.00 175.63 ? -47 DC  I OP1   1 
ATOM   6655  O  OP2   . DC  J 7  26  ? -44.340 -25.842 0.985  1.00 185.12 ? -47 DC  I OP2   1 
ATOM   6656  O  "O5'" . DC  J 7  26  ? -42.984 -25.609 3.058  1.00 172.74 ? -47 DC  I "O5'" 1 
ATOM   6657  C  "C5'" . DC  J 7  26  ? -42.793 -25.293 4.432  1.00 166.48 ? -47 DC  I "C5'" 1 
ATOM   6658  C  "C4'" . DC  J 7  26  ? -41.456 -25.814 4.929  1.00 163.51 ? -47 DC  I "C4'" 1 
ATOM   6659  O  "O4'" . DC  J 7  26  ? -41.511 -27.261 5.058  1.00 165.19 ? -47 DC  I "O4'" 1 
ATOM   6660  C  "C3'" . DC  J 7  26  ? -40.263 -25.514 4.018  1.00 162.82 ? -47 DC  I "C3'" 1 
ATOM   6661  O  "O3'" . DC  J 7  26  ? -39.138 -25.153 4.804  1.00 156.00 ? -47 DC  I "O3'" 1 
ATOM   6662  C  "C2'" . DC  J 7  26  ? -40.034 -26.845 3.308  1.00 166.91 ? -47 DC  I "C2'" 1 
ATOM   6663  C  "C1'" . DC  J 7  26  ? -40.394 -27.825 4.411  1.00 166.78 ? -47 DC  I "C1'" 1 
ATOM   6664  N  N1    . DC  J 7  26  ? -40.765 -29.180 3.914  1.00 170.59 ? -47 DC  I N1    1 
ATOM   6665  C  C2    . DC  J 7  26  ? -40.238 -30.314 4.540  1.00 170.34 ? -47 DC  I C2    1 
ATOM   6666  O  O2    . DC  J 7  26  ? -39.473 -30.172 5.502  1.00 168.85 ? -47 DC  I O2    1 
ATOM   6667  N  N3    . DC  J 7  26  ? -40.584 -31.540 4.076  1.00 172.73 ? -47 DC  I N3    1 
ATOM   6668  C  C4    . DC  J 7  26  ? -41.412 -31.651 3.036  1.00 176.24 ? -47 DC  I C4    1 
ATOM   6669  N  N4    . DC  J 7  26  ? -41.724 -32.881 2.614  1.00 179.65 ? -47 DC  I N4    1 
ATOM   6670  C  C5    . DC  J 7  26  ? -41.958 -30.507 2.384  1.00 176.21 ? -47 DC  I C5    1 
ATOM   6671  C  C6    . DC  J 7  26  ? -41.610 -29.303 2.850  1.00 173.91 ? -47 DC  I C6    1 
ATOM   6672  P  P     . DT  J 7  27  ? -38.752 -23.609 5.019  1.00 149.85 ? -46 DT  I P     1 
ATOM   6673  O  OP1   . DT  J 7  27  ? -39.871 -22.963 5.742  1.00 148.86 ? -46 DT  I OP1   1 
ATOM   6674  O  OP2   . DT  J 7  27  ? -38.303 -23.064 3.719  1.00 149.71 ? -46 DT  I OP2   1 
ATOM   6675  O  "O5'" . DT  J 7  27  ? -37.486 -23.675 5.992  1.00 145.25 ? -46 DT  I "O5'" 1 
ATOM   6676  C  "C5'" . DT  J 7  27  ? -37.599 -24.319 7.255  1.00 140.12 ? -46 DT  I "C5'" 1 
ATOM   6677  C  "C4'" . DT  J 7  27  ? -36.571 -25.429 7.398  1.00 136.09 ? -46 DT  I "C4'" 1 
ATOM   6678  O  "O4'" . DT  J 7  27  ? -36.925 -26.549 6.541  1.00 135.03 ? -46 DT  I "O4'" 1 
ATOM   6679  C  "C3'" . DT  J 7  27  ? -35.136 -25.046 7.019  1.00 136.11 ? -46 DT  I "C3'" 1 
ATOM   6680  O  "O3'" . DT  J 7  27  ? -34.234 -25.595 7.965  1.00 135.25 ? -46 DT  I "O3'" 1 
ATOM   6681  C  "C2'" . DT  J 7  27  ? -34.961 -25.702 5.651  1.00 136.23 ? -46 DT  I "C2'" 1 
ATOM   6682  C  "C1'" . DT  J 7  27  ? -35.774 -26.967 5.848  1.00 135.32 ? -46 DT  I "C1'" 1 
ATOM   6683  N  N1    . DT  J 7  27  ? -36.182 -27.631 4.578  1.00 138.74 ? -46 DT  I N1    1 
ATOM   6684  C  C2    . DT  J 7  27  ? -36.327 -28.999 4.553  1.00 139.95 ? -46 DT  I C2    1 
ATOM   6685  O  O2    . DT  J 7  27  ? -36.145 -29.708 5.527  1.00 140.22 ? -46 DT  I O2    1 
ATOM   6686  N  N3    . DT  J 7  27  ? -36.699 -29.513 3.340  1.00 143.40 ? -46 DT  I N3    1 
ATOM   6687  C  C4    . DT  J 7  27  ? -36.934 -28.812 2.172  1.00 145.57 ? -46 DT  I C4    1 
ATOM   6688  O  O4    . DT  J 7  27  ? -37.266 -29.367 1.129  1.00 147.27 ? -46 DT  I O4    1 
ATOM   6689  C  C5    . DT  J 7  27  ? -36.760 -27.381 2.265  1.00 145.13 ? -46 DT  I C5    1 
ATOM   6690  C  C7    . DT  J 7  27  ? -36.987 -26.514 1.063  1.00 148.73 ? -46 DT  I C7    1 
ATOM   6691  C  C6    . DT  J 7  27  ? -36.395 -26.866 3.450  1.00 141.98 ? -46 DT  I C6    1 
ATOM   6692  P  P     . DG  J 7  28  ? -33.101 -24.680 8.643  1.00 131.25 ? -45 DG  I P     1 
ATOM   6693  O  OP1   . DG  J 7  28  ? -33.755 -23.851 9.681  1.00 126.57 ? -45 DG  I OP1   1 
ATOM   6694  O  OP2   . DG  J 7  28  ? -32.331 -24.034 7.556  1.00 133.58 ? -45 DG  I OP2   1 
ATOM   6695  O  "O5'" . DG  J 7  28  ? -32.146 -25.742 9.360  1.00 128.46 ? -45 DG  I "O5'" 1 
ATOM   6696  C  "C5'" . DG  J 7  28  ? -32.701 -26.702 10.250 1.00 122.76 ? -45 DG  I "C5'" 1 
ATOM   6697  C  "C4'" . DG  J 7  28  ? -32.374 -28.116 9.802  1.00 117.99 ? -45 DG  I "C4'" 1 
ATOM   6698  O  "O4'" . DG  J 7  28  ? -32.906 -28.348 8.469  1.00 119.59 ? -45 DG  I "O4'" 1 
ATOM   6699  C  "C3'" . DG  J 7  28  ? -30.880 -28.444 9.725  1.00 114.05 ? -45 DG  I "C3'" 1 
ATOM   6700  O  "O3'" . DG  J 7  28  ? -30.640 -29.719 10.298 1.00 113.02 ? -45 DG  I "O3'" 1 
ATOM   6701  C  "C2'" . DG  J 7  28  ? -30.601 -28.449 8.224  1.00 116.10 ? -45 DG  I "C2'" 1 
ATOM   6702  C  "C1'" . DG  J 7  28  ? -31.918 -28.975 7.688  1.00 120.75 ? -45 DG  I "C1'" 1 
ATOM   6703  N  N9    . DG  J 7  28  ? -32.147 -28.653 6.283  1.00 129.39 ? -45 DG  I N9    1 
ATOM   6704  C  C8    . DG  J 7  28  ? -32.011 -27.426 5.679  1.00 131.47 ? -45 DG  I C8    1 
ATOM   6705  N  N7    . DG  J 7  28  ? -32.281 -27.442 4.403  1.00 134.80 ? -45 DG  I N7    1 
ATOM   6706  C  C5    . DG  J 7  28  ? -32.613 -28.766 4.142  1.00 137.83 ? -45 DG  I C5    1 
ATOM   6707  C  C6    . DG  J 7  28  ? -32.996 -29.389 2.930  1.00 142.05 ? -45 DG  I C6    1 
ATOM   6708  O  O6    . DG  J 7  28  ? -33.122 -28.876 1.809  1.00 145.54 ? -45 DG  I O6    1 
ATOM   6709  N  N1    . DG  J 7  28  ? -33.245 -30.748 3.106  1.00 141.56 ? -45 DG  I N1    1 
ATOM   6710  C  C2    . DG  J 7  28  ? -33.138 -31.419 4.302  1.00 137.22 ? -45 DG  I C2    1 
ATOM   6711  N  N2    . DG  J 7  28  ? -33.418 -32.731 4.275  1.00 136.03 ? -45 DG  I N2    1 
ATOM   6712  N  N3    . DG  J 7  28  ? -32.780 -30.848 5.443  1.00 135.59 ? -45 DG  I N3    1 
ATOM   6713  C  C4    . DG  J 7  28  ? -32.533 -29.524 5.289  1.00 135.14 ? -45 DG  I C4    1 
ATOM   6714  P  P     . DG  J 7  29  ? -29.165 -30.123 10.790 1.00 113.84 ? -44 DG  I P     1 
ATOM   6715  O  OP1   . DG  J 7  29  ? -29.199 -30.195 12.268 1.00 114.86 ? -44 DG  I OP1   1 
ATOM   6716  O  OP2   . DG  J 7  29  ? -28.195 -29.233 10.115 1.00 112.74 ? -44 DG  I OP2   1 
ATOM   6717  O  "O5'" . DG  J 7  29  ? -28.954 -31.594 10.197 1.00 115.54 ? -44 DG  I "O5'" 1 
ATOM   6718  C  "C5'" . DG  J 7  29  ? -29.957 -32.586 10.378 1.00 113.68 ? -44 DG  I "C5'" 1 
ATOM   6719  C  "C4'" . DG  J 7  29  ? -29.897 -33.621 9.270  1.00 112.69 ? -44 DG  I "C4'" 1 
ATOM   6720  O  "O4'" . DG  J 7  29  ? -30.326 -33.019 8.020  1.00 113.94 ? -44 DG  I "O4'" 1 
ATOM   6721  C  "C3'" . DG  J 7  29  ? -28.509 -34.207 9.011  1.00 113.55 ? -44 DG  I "C3'" 1 
ATOM   6722  O  "O3'" . DG  J 7  29  ? -28.599 -35.613 8.833  1.00 117.01 ? -44 DG  I "O3'" 1 
ATOM   6723  C  "C2'" . DG  J 7  29  ? -28.056 -33.504 7.732  1.00 115.88 ? -44 DG  I "C2'" 1 
ATOM   6724  C  "C1'" . DG  J 7  29  ? -29.377 -33.283 7.013  1.00 119.86 ? -44 DG  I "C1'" 1 
ATOM   6725  N  N9    . DG  J 7  29  ? -29.349 -32.148 6.096  1.00 127.37 ? -44 DG  I N9    1 
ATOM   6726  C  C8    . DG  J 7  29  ? -28.967 -30.861 6.386  1.00 126.87 ? -44 DG  I C8    1 
ATOM   6727  N  N7    . DG  J 7  29  ? -29.043 -30.053 5.365  1.00 129.95 ? -44 DG  I N7    1 
ATOM   6728  C  C5    . DG  J 7  29  ? -29.503 -30.856 4.330  1.00 136.23 ? -44 DG  I C5    1 
ATOM   6729  C  C6    . DG  J 7  29  ? -29.780 -30.532 2.981  1.00 143.85 ? -44 DG  I C6    1 
ATOM   6730  O  O6    . DG  J 7  29  ? -29.668 -29.436 2.415  1.00 147.06 ? -44 DG  I O6    1 
ATOM   6731  N  N1    . DG  J 7  29  ? -30.228 -31.641 2.267  1.00 147.63 ? -44 DG  I N1    1 
ATOM   6732  C  C2    . DG  J 7  29  ? -30.390 -32.902 2.792  1.00 146.82 ? -44 DG  I C2    1 
ATOM   6733  N  N2    . DG  J 7  29  ? -30.834 -33.845 1.948  1.00 154.24 ? -44 DG  I N2    1 
ATOM   6734  N  N3    . DG  J 7  29  ? -30.134 -33.219 4.055  1.00 140.57 ? -44 DG  I N3    1 
ATOM   6735  C  C4    . DG  J 7  29  ? -29.696 -32.149 4.763  1.00 135.58 ? -44 DG  I C4    1 
ATOM   6736  P  P     . DA  J 7  30  ? -27.266 -36.509 8.773  1.00 122.07 ? -43 DA  I P     1 
ATOM   6737  O  OP1   . DA  J 7  30  ? -27.489 -37.700 9.624  1.00 124.72 ? -43 DA  I OP1   1 
ATOM   6738  O  OP2   . DA  J 7  30  ? -26.104 -35.630 9.037  1.00 119.23 ? -43 DA  I OP2   1 
ATOM   6739  O  "O5'" . DA  J 7  30  ? -27.191 -36.972 7.246  1.00 127.06 ? -43 DA  I "O5'" 1 
ATOM   6740  C  "C5'" . DA  J 7  30  ? -28.296 -37.647 6.657  1.00 131.14 ? -43 DA  I "C5'" 1 
ATOM   6741  C  "C4'" . DA  J 7  30  ? -28.102 -37.801 5.161  1.00 137.69 ? -43 DA  I "C4'" 1 
ATOM   6742  O  "O4'" . DA  J 7  30  ? -28.233 -36.506 4.516  1.00 140.73 ? -43 DA  I "O4'" 1 
ATOM   6743  C  "C3'" . DA  J 7  30  ? -26.739 -38.352 4.740  1.00 141.32 ? -43 DA  I "C3'" 1 
ATOM   6744  O  "O3'" . DA  J 7  30  ? -26.904 -39.304 3.701  1.00 145.71 ? -43 DA  I "O3'" 1 
ATOM   6745  C  "C2'" . DA  J 7  30  ? -25.995 -37.111 4.250  1.00 142.67 ? -43 DA  I "C2'" 1 
ATOM   6746  C  "C1'" . DA  J 7  30  ? -27.131 -36.289 3.667  1.00 146.86 ? -43 DA  I "C1'" 1 
ATOM   6747  N  N9    . DA  J 7  30  ? -26.855 -34.857 3.627  1.00 155.95 ? -43 DA  I N9    1 
ATOM   6748  C  C8    . DA  J 7  30  ? -26.302 -34.096 4.619  1.00 156.91 ? -43 DA  I C8    1 
ATOM   6749  N  N7    . DA  J 7  30  ? -26.171 -32.830 4.303  1.00 160.50 ? -43 DA  I N7    1 
ATOM   6750  C  C5    . DA  J 7  30  ? -26.676 -32.754 3.015  1.00 165.83 ? -43 DA  I C5    1 
ATOM   6751  C  C6    . DA  J 7  30  ? -26.821 -31.682 2.114  1.00 171.13 ? -43 DA  I C6    1 
ATOM   6752  N  N6    . DA  J 7  30  ? -26.453 -30.428 2.397  1.00 174.81 ? -43 DA  I N6    1 
ATOM   6753  N  N1    . DA  J 7  30  ? -27.363 -31.948 0.907  1.00 177.79 ? -43 DA  I N1    1 
ATOM   6754  C  C2    . DA  J 7  30  ? -27.730 -33.205 0.628  1.00 176.12 ? -43 DA  I C2    1 
ATOM   6755  N  N3    . DA  J 7  30  ? -27.643 -34.293 1.392  1.00 171.98 ? -43 DA  I N3    1 
ATOM   6756  C  C4    . DA  J 7  30  ? -27.102 -33.996 2.584  1.00 165.26 ? -43 DA  I C4    1 
ATOM   6757  P  P     . DG  J 7  31  ? -25.838 -40.491 3.514  1.00 145.06 ? -42 DG  I P     1 
ATOM   6758  O  OP1   . DG  J 7  31  ? -26.549 -41.768 3.745  1.00 146.78 ? -42 DG  I OP1   1 
ATOM   6759  O  OP2   . DG  J 7  31  ? -24.640 -40.155 4.316  1.00 140.34 ? -42 DG  I OP2   1 
ATOM   6760  O  "O5'" . DG  J 7  31  ? -25.438 -40.398 1.969  1.00 149.12 ? -42 DG  I "O5'" 1 
ATOM   6761  C  "C5'" . DG  J 7  31  ? -26.449 -40.456 0.972  1.00 151.49 ? -42 DG  I "C5'" 1 
ATOM   6762  C  "C4'" . DG  J 7  31  ? -25.985 -39.783 -0.307 1.00 153.69 ? -42 DG  I "C4'" 1 
ATOM   6763  O  "O4'" . DG  J 7  31  ? -25.926 -38.347 -0.107 1.00 154.14 ? -42 DG  I "O4'" 1 
ATOM   6764  C  "C3'" . DG  J 7  31  ? -24.600 -40.209 -0.794 1.00 154.43 ? -42 DG  I "C3'" 1 
ATOM   6765  O  "O3'" . DG  J 7  31  ? -24.634 -40.461 -2.191 1.00 155.78 ? -42 DG  I "O3'" 1 
ATOM   6766  C  "C2'" . DG  J 7  31  ? -23.712 -39.010 -0.457 1.00 155.00 ? -42 DG  I "C2'" 1 
ATOM   6767  C  "C1'" . DG  J 7  31  ? -24.691 -37.852 -0.568 1.00 158.63 ? -42 DG  I "C1'" 1 
ATOM   6768  N  N9    . DG  J 7  31  ? -24.322 -36.703 0.254  1.00 164.19 ? -42 DG  I N9    1 
ATOM   6769  C  C8    . DG  J 7  31  ? -23.896 -36.725 1.560  1.00 163.39 ? -42 DG  I C8    1 
ATOM   6770  N  N7    . DG  J 7  31  ? -23.638 -35.542 2.043  1.00 163.28 ? -42 DG  I N7    1 
ATOM   6771  C  C5    . DG  J 7  31  ? -23.913 -34.677 0.991  1.00 167.61 ? -42 DG  I C5    1 
ATOM   6772  C  C6    . DG  J 7  31  ? -23.819 -33.267 0.923  1.00 169.53 ? -42 DG  I C6    1 
ATOM   6773  O  O6    . DG  J 7  31  ? -23.461 -32.478 1.809  1.00 168.55 ? -42 DG  I O6    1 
ATOM   6774  N  N1    . DG  J 7  31  ? -24.190 -32.786 -0.330 1.00 172.56 ? -42 DG  I N1    1 
ATOM   6775  C  C2    . DG  J 7  31  ? -24.602 -33.569 -1.383 1.00 175.85 ? -42 DG  I C2    1 
ATOM   6776  N  N2    . DG  J 7  31  ? -24.920 -32.923 -2.514 1.00 179.83 ? -42 DG  I N2    1 
ATOM   6777  N  N3    . DG  J 7  31  ? -24.695 -34.892 -1.332 1.00 174.88 ? -42 DG  I N3    1 
ATOM   6778  C  C4    . DG  J 7  31  ? -24.336 -35.376 -0.118 1.00 169.50 ? -42 DG  I C4    1 
ATOM   6779  P  P     . DA  J 7  32  ? -23.406 -41.207 -2.906 1.00 159.42 ? -41 DA  I P     1 
ATOM   6780  O  OP1   . DA  J 7  32  ? -23.972 -42.151 -3.895 1.00 169.51 ? -41 DA  I OP1   1 
ATOM   6781  O  OP2   . DA  J 7  32  ? -22.501 -41.708 -1.849 1.00 151.93 ? -41 DA  I OP2   1 
ATOM   6782  O  "O5'" . DA  J 7  32  ? -22.648 -40.033 -3.682 1.00 163.62 ? -41 DA  I "O5'" 1 
ATOM   6783  C  "C5'" . DA  J 7  32  ? -23.341 -39.268 -4.662 1.00 169.56 ? -41 DA  I "C5'" 1 
ATOM   6784  C  "C4'" . DA  J 7  32  ? -22.477 -38.126 -5.164 1.00 175.12 ? -41 DA  I "C4'" 1 
ATOM   6785  O  "O4'" . DA  J 7  32  ? -22.518 -37.030 -4.215 1.00 171.27 ? -41 DA  I "O4'" 1 
ATOM   6786  C  "C3'" . DA  J 7  32  ? -20.997 -38.475 -5.358 1.00 182.95 ? -41 DA  I "C3'" 1 
ATOM   6787  O  "O3'" . DA  J 7  32  ? -20.559 -38.056 -6.644 1.00 194.27 ? -41 DA  I "O3'" 1 
ATOM   6788  C  "C2'" . DA  J 7  32  ? -20.289 -37.703 -4.243 1.00 177.38 ? -41 DA  I "C2'" 1 
ATOM   6789  C  "C1'" . DA  J 7  32  ? -21.220 -36.519 -4.042 1.00 172.69 ? -41 DA  I "C1'" 1 
ATOM   6790  N  N9    . DA  J 7  32  ? -21.125 -35.928 -2.711 1.00 167.16 ? -41 DA  I N9    1 
ATOM   6791  C  C8    . DA  J 7  32  ? -21.166 -36.585 -1.513 1.00 162.89 ? -41 DA  I C8    1 
ATOM   6792  N  N7    . DA  J 7  32  ? -21.053 -35.795 -0.471 1.00 159.70 ? -41 DA  I N7    1 
ATOM   6793  C  C5    . DA  J 7  32  ? -20.928 -34.531 -1.025 1.00 160.16 ? -41 DA  I C5    1 
ATOM   6794  C  C6    . DA  J 7  32  ? -20.774 -33.254 -0.450 1.00 155.04 ? -41 DA  I C6    1 
ATOM   6795  N  N6    . DA  J 7  32  ? -20.717 -33.043 0.869  1.00 150.25 ? -41 DA  I N6    1 
ATOM   6796  N  N1    . DA  J 7  32  ? -20.679 -32.199 -1.286 1.00 156.64 ? -41 DA  I N1    1 
ATOM   6797  C  C2    . DA  J 7  32  ? -20.736 -32.415 -2.606 1.00 162.15 ? -41 DA  I C2    1 
ATOM   6798  N  N3    . DA  J 7  32  ? -20.878 -33.566 -3.261 1.00 166.79 ? -41 DA  I N3    1 
ATOM   6799  C  C4    . DA  J 7  32  ? -20.969 -34.595 -2.404 1.00 165.33 ? -41 DA  I C4    1 
ATOM   6800  P  P     . DC  J 7  33  ? -19.064 -38.382 -7.133 1.00 202.69 ? -40 DC  I P     1 
ATOM   6801  O  OP1   . DC  J 7  33  ? -19.078 -38.438 -8.612 1.00 209.82 ? -40 DC  I OP1   1 
ATOM   6802  O  OP2   . DC  J 7  33  ? -18.579 -39.545 -6.358 1.00 202.21 ? -40 DC  I OP2   1 
ATOM   6803  O  "O5'" . DC  J 7  33  ? -18.223 -37.101 -6.674 1.00 203.96 ? -40 DC  I "O5'" 1 
ATOM   6804  C  "C5'" . DC  J 7  33  ? -18.608 -35.807 -7.118 1.00 205.38 ? -40 DC  I "C5'" 1 
ATOM   6805  C  "C4'" . DC  J 7  33  ? -17.657 -34.745 -6.594 1.00 201.87 ? -40 DC  I "C4'" 1 
ATOM   6806  O  "O4'" . DC  J 7  33  ? -18.019 -34.384 -5.237 1.00 200.70 ? -40 DC  I "O4'" 1 
ATOM   6807  C  "C3'" . DC  J 7  33  ? -16.178 -35.157 -6.550 1.00 201.58 ? -40 DC  I "C3'" 1 
ATOM   6808  O  "O3'" . DC  J 7  33  ? -15.387 -34.181 -7.214 1.00 200.66 ? -40 DC  I "O3'" 1 
ATOM   6809  C  "C2'" . DC  J 7  33  ? -15.862 -35.210 -5.052 1.00 197.67 ? -40 DC  I "C2'" 1 
ATOM   6810  C  "C1'" . DC  J 7  33  ? -16.842 -34.192 -4.498 1.00 196.82 ? -40 DC  I "C1'" 1 
ATOM   6811  N  N1    . DC  J 7  33  ? -17.144 -34.379 -3.050 1.00 193.14 ? -40 DC  I N1    1 
ATOM   6812  C  C2    . DC  J 7  33  ? -17.264 -33.259 -2.218 1.00 190.96 ? -40 DC  I C2    1 
ATOM   6813  O  O2    . DC  J 7  33  ? -17.123 -32.130 -2.704 1.00 192.70 ? -40 DC  I O2    1 
ATOM   6814  N  N3    . DC  J 7  33  ? -17.535 -33.445 -0.903 1.00 186.65 ? -40 DC  I N3    1 
ATOM   6815  C  C4    . DC  J 7  33  ? -17.679 -34.679 -0.418 1.00 185.07 ? -40 DC  I C4    1 
ATOM   6816  N  N4    . DC  J 7  33  ? -17.946 -34.812 0.885  1.00 181.76 ? -40 DC  I N4    1 
ATOM   6817  C  C5    . DC  J 7  33  ? -17.558 -35.832 -1.249 1.00 187.14 ? -40 DC  I C5    1 
ATOM   6818  C  C6    . DC  J 7  33  ? -17.291 -35.637 -2.544 1.00 191.59 ? -40 DC  I C6    1 
ATOM   6819  P  P     . DT  J 7  34  ? -13.908 -34.539 -7.732 1.00 200.46 ? -39 DT  I P     1 
ATOM   6820  O  OP1   . DT  J 7  34  ? -13.968 -34.646 -9.206 1.00 207.93 ? -39 DT  I OP1   1 
ATOM   6821  O  OP2   . DT  J 7  34  ? -13.392 -35.674 -6.935 1.00 197.02 ? -39 DT  I OP2   1 
ATOM   6822  O  "O5'" . DT  J 7  34  ? -13.053 -33.244 -7.347 1.00 195.30 ? -39 DT  I "O5'" 1 
ATOM   6823  C  "C5'" . DT  J 7  34  ? -13.485 -31.960 -7.778 1.00 192.92 ? -39 DT  I "C5'" 1 
ATOM   6824  C  "C4'" . DT  J 7  34  ? -13.045 -30.884 -6.802 1.00 187.15 ? -39 DT  I "C4'" 1 
ATOM   6825  O  "O4'" . DT  J 7  34  ? -13.666 -31.113 -5.510 1.00 178.83 ? -39 DT  I "O4'" 1 
ATOM   6826  C  "C3'" . DT  J 7  34  ? -11.535 -30.817 -6.548 1.00 190.27 ? -39 DT  I "C3'" 1 
ATOM   6827  O  "O3'" . DT  J 7  34  ? -11.086 -29.471 -6.646 1.00 198.13 ? -39 DT  I "O3'" 1 
ATOM   6828  C  "C2'" . DT  J 7  34  ? -11.383 -31.362 -5.127 1.00 181.88 ? -39 DT  I "C2'" 1 
ATOM   6829  C  "C1'" . DT  J 7  34  ? -12.703 -30.953 -4.498 1.00 174.63 ? -39 DT  I "C1'" 1 
ATOM   6830  N  N1    . DT  J 7  34  ? -13.096 -31.795 -3.326 1.00 164.81 ? -39 DT  I N1    1 
ATOM   6831  C  C2    . DT  J 7  34  ? -13.552 -31.183 -2.182 1.00 156.05 ? -39 DT  I C2    1 
ATOM   6832  O  O2    . DT  J 7  34  ? -13.659 -29.975 -2.068 1.00 153.44 ? -39 DT  I O2    1 
ATOM   6833  N  N3    . DT  J 7  34  ? -13.884 -32.042 -1.167 1.00 150.54 ? -39 DT  I N3    1 
ATOM   6834  C  C4    . DT  J 7  34  ? -13.806 -33.422 -1.181 1.00 148.68 ? -39 DT  I C4    1 
ATOM   6835  O  O4    . DT  J 7  34  ? -14.128 -34.108 -0.215 1.00 142.88 ? -39 DT  I O4    1 
ATOM   6836  C  C5    . DT  J 7  34  ? -13.317 -34.000 -2.410 1.00 155.12 ? -39 DT  I C5    1 
ATOM   6837  C  C7    . DT  J 7  34  ? -13.188 -35.489 -2.544 1.00 154.79 ? -39 DT  I C7    1 
ATOM   6838  C  C6    . DT  J 7  34  ? -12.990 -33.168 -3.412 1.00 162.92 ? -39 DT  I C6    1 
ATOM   6839  P  P     . DA  J 7  35  ? -9.537  -29.154 -6.929 1.00 211.10 ? -38 DA  I P     1 
ATOM   6840  O  OP1   . DA  J 7  35  ? -9.474  -28.125 -7.991 1.00 221.65 ? -38 DA  I OP1   1 
ATOM   6841  O  OP2   . DA  J 7  35  ? -8.838  -30.445 -7.111 1.00 213.31 ? -38 DA  I OP2   1 
ATOM   6842  O  "O5'" . DA  J 7  35  ? -9.022  -28.511 -5.559 1.00 206.97 ? -38 DA  I "O5'" 1 
ATOM   6843  C  "C5'" . DA  J 7  35  ? -9.629  -27.325 -5.059 1.00 202.42 ? -38 DA  I "C5'" 1 
ATOM   6844  C  "C4'" . DA  J 7  35  ? -9.146  -27.025 -3.652 1.00 197.24 ? -38 DA  I "C4'" 1 
ATOM   6845  O  "O4'" . DA  J 7  35  ? -9.789  -27.926 -2.712 1.00 195.28 ? -38 DA  I "O4'" 1 
ATOM   6846  C  "C3'" . DA  J 7  35  ? -7.640  -27.186 -3.439 1.00 194.67 ? -38 DA  I "C3'" 1 
ATOM   6847  O  "O3'" . DA  J 7  35  ? -7.151  -26.126 -2.636 1.00 185.82 ? -38 DA  I "O3'" 1 
ATOM   6848  C  "C2'" . DA  J 7  35  ? -7.529  -28.530 -2.722 1.00 196.03 ? -38 DA  I "C2'" 1 
ATOM   6849  C  "C1'" . DA  J 7  35  ? -8.814  -28.551 -1.909 1.00 195.45 ? -38 DA  I "C1'" 1 
ATOM   6850  N  N9    . DA  J 7  35  ? -9.276  -29.899 -1.591 1.00 198.23 ? -38 DA  I N9    1 
ATOM   6851  C  C8    . DA  J 7  35  ? -9.226  -30.999 -2.400 1.00 201.64 ? -38 DA  I C8    1 
ATOM   6852  N  N7    . DA  J 7  35  ? -9.716  -32.084 -1.850 1.00 200.23 ? -38 DA  I N7    1 
ATOM   6853  C  C5    . DA  J 7  35  ? -10.117 -31.667 -0.592 1.00 197.58 ? -38 DA  I C5    1 
ATOM   6854  C  C6    . DA  J 7  35  ? -10.719 -32.346 0.486  1.00 196.30 ? -38 DA  I C6    1 
ATOM   6855  N  N6    . DA  J 7  35  ? -11.030 -33.646 0.455  1.00 198.10 ? -38 DA  I N6    1 
ATOM   6856  N  N1    . DA  J 7  35  ? -10.988 -31.634 1.600  1.00 192.06 ? -38 DA  I N1    1 
ATOM   6857  C  C2    . DA  J 7  35  ? -10.675 -30.333 1.627  1.00 190.92 ? -38 DA  I C2    1 
ATOM   6858  N  N3    . DA  J 7  35  ? -10.109 -29.588 0.679  1.00 193.46 ? -38 DA  I N3    1 
ATOM   6859  C  C4    . DA  J 7  35  ? -9.853  -30.322 -0.415 1.00 196.40 ? -38 DA  I C4    1 
ATOM   6860  P  P     . DG  J 7  36  ? -5.622  -25.652 -2.764 1.00 183.76 ? -37 DG  I P     1 
ATOM   6861  O  OP1   . DG  J 7  36  ? -5.609  -24.359 -3.483 1.00 187.15 ? -37 DG  I OP1   1 
ATOM   6862  O  OP2   . DG  J 7  36  ? -4.833  -26.793 -3.280 1.00 187.40 ? -37 DG  I OP2   1 
ATOM   6863  O  "O5'" . DG  J 7  36  ? -5.182  -25.402 -1.250 1.00 174.96 ? -37 DG  I "O5'" 1 
ATOM   6864  C  "C5'" . DG  J 7  36  ? -6.073  -24.751 -0.355 1.00 166.99 ? -37 DG  I "C5'" 1 
ATOM   6865  C  "C4'" . DG  J 7  36  ? -5.944  -25.323 1.045  1.00 158.77 ? -37 DG  I "C4'" 1 
ATOM   6866  O  "O4'" . DG  J 7  36  ? -6.549  -26.645 1.095  1.00 156.38 ? -37 DG  I "O4'" 1 
ATOM   6867  C  "C3'" . DG  J 7  36  ? -4.508  -25.500 1.543  1.00 156.47 ? -37 DG  I "C3'" 1 
ATOM   6868  O  "O3'" . DG  J 7  36  ? -4.440  -25.164 2.912  1.00 149.79 ? -37 DG  I "O3'" 1 
ATOM   6869  C  "C2'" . DG  J 7  36  ? -4.266  -26.991 1.337  1.00 157.43 ? -37 DG  I "C2'" 1 
ATOM   6870  C  "C1'" . DG  J 7  36  ? -5.636  -27.542 1.684  1.00 154.56 ? -37 DG  I "C1'" 1 
ATOM   6871  N  N9    . DG  J 7  36  ? -5.884  -28.883 1.164  1.00 155.88 ? -37 DG  I N9    1 
ATOM   6872  C  C8    . DG  J 7  36  ? -5.457  -29.400 -0.034 1.00 162.13 ? -37 DG  I C8    1 
ATOM   6873  N  N7    . DG  J 7  36  ? -5.830  -30.635 -0.229 1.00 163.11 ? -37 DG  I N7    1 
ATOM   6874  C  C5    . DG  J 7  36  ? -6.549  -30.957 0.916  1.00 157.62 ? -37 DG  I C5    1 
ATOM   6875  C  C6    . DG  J 7  36  ? -7.199  -32.162 1.276  1.00 156.03 ? -37 DG  I C6    1 
ATOM   6876  O  O6    . DG  J 7  36  ? -7.270  -33.218 0.632  1.00 158.65 ? -37 DG  I O6    1 
ATOM   6877  N  N1    . DG  J 7  36  ? -7.811  -32.064 2.524  1.00 151.78 ? -37 DG  I N1    1 
ATOM   6878  C  C2    . DG  J 7  36  ? -7.796  -30.944 3.322  1.00 148.18 ? -37 DG  I C2    1 
ATOM   6879  N  N2    . DG  J 7  36  ? -8.442  -31.040 4.493  1.00 142.61 ? -37 DG  I N2    1 
ATOM   6880  N  N3    . DG  J 7  36  ? -7.190  -29.810 2.996  1.00 149.47 ? -37 DG  I N3    1 
ATOM   6881  C  C4    . DG  J 7  36  ? -6.590  -29.889 1.783  1.00 153.67 ? -37 DG  I C4    1 
ATOM   6882  P  P     . DG  J 7  37  ? -3.637  -23.861 3.396  1.00 145.25 ? -36 DG  I P     1 
ATOM   6883  O  OP1   . DG  J 7  37  ? -4.417  -22.673 2.981  1.00 145.40 ? -36 DG  I OP1   1 
ATOM   6884  O  OP2   . DG  J 7  37  ? -2.230  -24.008 2.963  1.00 147.15 ? -36 DG  I OP2   1 
ATOM   6885  O  "O5'" . DG  J 7  37  ? -3.684  -23.975 4.989  1.00 137.75 ? -36 DG  I "O5'" 1 
ATOM   6886  C  "C5'" . DG  J 7  37  ? -4.923  -24.235 5.639  1.00 131.94 ? -36 DG  I "C5'" 1 
ATOM   6887  C  "C4'" . DG  J 7  37  ? -4.869  -25.537 6.421  1.00 127.91 ? -36 DG  I "C4'" 1 
ATOM   6888  O  "O4'" . DG  J 7  37  ? -4.825  -26.667 5.509  1.00 130.55 ? -36 DG  I "O4'" 1 
ATOM   6889  C  "C3'" . DG  J 7  37  ? -3.658  -25.694 7.350  1.00 124.94 ? -36 DG  I "C3'" 1 
ATOM   6890  O  "O3'" . DG  J 7  37  ? -4.092  -26.087 8.639  1.00 118.70 ? -36 DG  I "O3'" 1 
ATOM   6891  C  "C2'" . DG  J 7  37  ? -2.836  -26.798 6.683  1.00 128.53 ? -36 DG  I "C2'" 1 
ATOM   6892  C  "C1'" . DG  J 7  37  ? -3.931  -27.617 6.030  1.00 132.35 ? -36 DG  I "C1'" 1 
ATOM   6893  N  N9    . DG  J 7  37  ? -3.460  -28.477 4.948  1.00 143.34 ? -36 DG  I N9    1 
ATOM   6894  C  C8    . DG  J 7  37  ? -2.515  -28.175 3.998  1.00 150.36 ? -36 DG  I C8    1 
ATOM   6895  N  N7    . DG  J 7  37  ? -2.294  -29.148 3.156  1.00 154.51 ? -36 DG  I N7    1 
ATOM   6896  C  C5    . DG  J 7  37  ? -3.145  -30.162 3.578  1.00 153.46 ? -36 DG  I C5    1 
ATOM   6897  C  C6    . DG  J 7  37  ? -3.347  -31.461 3.052  1.00 156.02 ? -36 DG  I C6    1 
ATOM   6898  O  O6    . DG  J 7  37  ? -2.795  -31.989 2.077  1.00 159.33 ? -36 DG  I O6    1 
ATOM   6899  N  N1    . DG  J 7  37  ? -4.301  -32.168 3.780  1.00 154.94 ? -36 DG  I N1    1 
ATOM   6900  C  C2    . DG  J 7  37  ? -4.974  -31.681 4.876  1.00 152.80 ? -36 DG  I C2    1 
ATOM   6901  N  N2    . DG  J 7  37  ? -5.860  -32.511 5.447  1.00 156.55 ? -36 DG  I N2    1 
ATOM   6902  N  N3    . DG  J 7  37  ? -4.795  -30.466 5.378  1.00 148.00 ? -36 DG  I N3    1 
ATOM   6903  C  C4    . DG  J 7  37  ? -3.868  -29.765 4.681  1.00 148.45 ? -36 DG  I C4    1 
ATOM   6904  P  P     . DG  J 7  38  ? -3.693  -25.216 9.927  1.00 117.33 ? -35 DG  I P     1 
ATOM   6905  O  OP1   . DG  J 7  38  ? -4.372  -23.906 9.811  1.00 116.41 ? -35 DG  I OP1   1 
ATOM   6906  O  OP2   . DG  J 7  38  ? -2.221  -25.276 10.068 1.00 115.49 ? -35 DG  I OP2   1 
ATOM   6907  O  "O5'" . DG  J 7  38  ? -4.333  -26.029 11.145 1.00 121.96 ? -35 DG  I "O5'" 1 
ATOM   6908  C  "C5'" . DG  J 7  38  ? -5.644  -26.570 11.028 1.00 124.83 ? -35 DG  I "C5'" 1 
ATOM   6909  C  "C4'" . DG  J 7  38  ? -5.645  -28.056 11.344 1.00 125.69 ? -35 DG  I "C4'" 1 
ATOM   6910  O  "O4'" . DG  J 7  38  ? -4.988  -28.779 10.269 1.00 132.87 ? -35 DG  I "O4'" 1 
ATOM   6911  C  "C3'" . DG  J 7  38  ? -4.912  -28.441 12.628 1.00 122.15 ? -35 DG  I "C3'" 1 
ATOM   6912  O  "O3'" . DG  J 7  38  ? -5.618  -29.472 13.306 1.00 113.88 ? -35 DG  I "O3'" 1 
ATOM   6913  C  "C2'" . DG  J 7  38  ? -3.556  -28.926 12.125 1.00 130.85 ? -35 DG  I "C2'" 1 
ATOM   6914  C  "C1'" . DG  J 7  38  ? -3.922  -29.548 10.786 1.00 138.96 ? -35 DG  I "C1'" 1 
ATOM   6915  N  N9    . DG  J 7  38  ? -2.828  -29.524 9.821  1.00 154.02 ? -35 DG  I N9    1 
ATOM   6916  C  C8    . DG  J 7  38  ? -1.890  -28.532 9.661  1.00 160.13 ? -35 DG  I C8    1 
ATOM   6917  N  N7    . DG  J 7  38  ? -1.026  -28.781 8.717  1.00 168.10 ? -35 DG  I N7    1 
ATOM   6918  C  C5    . DG  J 7  38  ? -1.415  -30.018 8.219  1.00 171.07 ? -35 DG  I C5    1 
ATOM   6919  C  C6    . DG  J 7  38  ? -0.853  -30.800 7.182  1.00 179.39 ? -35 DG  I C6    1 
ATOM   6920  O  O6    . DG  J 7  38  ? 0.132   -30.544 6.475  1.00 186.89 ? -35 DG  I O6    1 
ATOM   6921  N  N1    . DG  J 7  38  ? -1.553  -31.989 6.996  1.00 183.11 ? -35 DG  I N1    1 
ATOM   6922  C  C2    . DG  J 7  38  ? -2.657  -32.373 7.721  1.00 180.53 ? -35 DG  I C2    1 
ATOM   6923  N  N2    . DG  J 7  38  ? -3.198  -33.556 7.396  1.00 189.43 ? -35 DG  I N2    1 
ATOM   6924  N  N3    . DG  J 7  38  ? -3.193  -31.650 8.695  1.00 170.23 ? -35 DG  I N3    1 
ATOM   6925  C  C4    . DG  J 7  38  ? -2.522  -30.489 8.888  1.00 165.01 ? -35 DG  I C4    1 
ATOM   6926  P  P     . DA  J 7  39  ? -5.118  -29.976 14.747 1.00 109.50 ? -34 DA  I P     1 
ATOM   6927  O  OP1   . DA  J 7  39  ? -6.309  -30.388 15.520 1.00 104.52 ? -34 DA  I OP1   1 
ATOM   6928  O  OP2   . DA  J 7  39  ? -4.204  -28.948 15.294 1.00 111.74 ? -34 DA  I OP2   1 
ATOM   6929  O  "O5'" . DA  J 7  39  ? -4.249  -31.276 14.417 1.00 116.07 ? -34 DA  I "O5'" 1 
ATOM   6930  C  "C5'" . DA  J 7  39  ? -4.857  -32.390 13.776 1.00 121.38 ? -34 DA  I "C5'" 1 
ATOM   6931  C  "C4'" . DA  J 7  39  ? -3.831  -33.463 13.460 1.00 126.94 ? -34 DA  I "C4'" 1 
ATOM   6932  O  "O4'" . DA  J 7  39  ? -2.942  -32.996 12.409 1.00 131.49 ? -34 DA  I "O4'" 1 
ATOM   6933  C  "C3'" . DA  J 7  39  ? -2.927  -33.864 14.631 1.00 130.35 ? -34 DA  I "C3'" 1 
ATOM   6934  O  "O3'" . DA  J 7  39  ? -2.718  -35.267 14.615 1.00 135.02 ? -34 DA  I "O3'" 1 
ATOM   6935  C  "C2'" . DA  J 7  39  ? -1.633  -33.114 14.327 1.00 132.53 ? -34 DA  I "C2'" 1 
ATOM   6936  C  "C1'" . DA  J 7  39  ? -1.609  -33.204 12.812 1.00 137.16 ? -34 DA  I "C1'" 1 
ATOM   6937  N  N9    . DA  J 7  39  ? -0.758  -32.204 12.173 1.00 147.92 ? -34 DA  I N9    1 
ATOM   6938  C  C8    . DA  J 7  39  ? -0.519  -30.927 12.599 1.00 153.10 ? -34 DA  I C8    1 
ATOM   6939  N  N7    . DA  J 7  39  ? 0.297   -30.254 11.822 1.00 155.97 ? -34 DA  I N7    1 
ATOM   6940  C  C5    . DA  J 7  39  ? 0.616   -31.153 10.816 1.00 160.11 ? -34 DA  I C5    1 
ATOM   6941  C  C6    . DA  J 7  39  ? 1.441   -31.053 9.678  1.00 166.93 ? -34 DA  I C6    1 
ATOM   6942  N  N6    . DA  J 7  39  ? 2.122   -29.948 9.357  1.00 169.55 ? -34 DA  I N6    1 
ATOM   6943  N  N1    . DA  J 7  39  ? 1.540   -32.137 8.880  1.00 169.33 ? -34 DA  I N1    1 
ATOM   6944  C  C2    . DA  J 7  39  ? 0.857   -33.241 9.204  1.00 166.22 ? -34 DA  I C2    1 
ATOM   6945  N  N3    . DA  J 7  39  ? 0.053   -33.454 10.245 1.00 160.79 ? -34 DA  I N3    1 
ATOM   6946  C  C4    . DA  J 7  39  ? -0.026  -32.360 11.019 1.00 156.59 ? -34 DA  I C4    1 
ATOM   6947  P  P     . DG  J 7  40  ? -3.356  -36.204 15.753 1.00 130.50 ? -33 DG  I P     1 
ATOM   6948  O  OP1   . DG  J 7  40  ? -4.817  -35.968 15.770 1.00 128.40 ? -33 DG  I OP1   1 
ATOM   6949  O  OP2   . DG  J 7  40  ? -2.565  -36.016 16.991 1.00 124.96 ? -33 DG  I OP2   1 
ATOM   6950  O  "O5'" . DG  J 7  40  ? -3.076  -37.683 15.215 1.00 133.67 ? -33 DG  I "O5'" 1 
ATOM   6951  C  "C5'" . DG  J 7  40  ? -3.364  -38.010 13.860 1.00 138.08 ? -33 DG  I "C5'" 1 
ATOM   6952  C  "C4'" . DG  J 7  40  ? -2.129  -38.553 13.162 1.00 145.50 ? -33 DG  I "C4'" 1 
ATOM   6953  O  "O4'" . DG  J 7  40  ? -1.351  -37.461 12.617 1.00 148.00 ? -33 DG  I "O4'" 1 
ATOM   6954  C  "C3'" . DG  J 7  40  ? -1.176  -39.352 14.060 1.00 149.11 ? -33 DG  I "C3'" 1 
ATOM   6955  O  "O3'" . DG  J 7  40  ? -1.021  -40.671 13.557 1.00 152.81 ? -33 DG  I "O3'" 1 
ATOM   6956  C  "C2'" . DG  J 7  40  ? 0.143   -38.569 14.008 1.00 151.03 ? -33 DG  I "C2'" 1 
ATOM   6957  C  "C1'" . DG  J 7  40  ? 0.010   -37.792 12.710 1.00 154.37 ? -33 DG  I "C1'" 1 
ATOM   6958  N  N9    . DG  J 7  40  ? 0.794   -36.560 12.689 1.00 162.62 ? -33 DG  I N9    1 
ATOM   6959  C  C8    . DG  J 7  40  ? 0.767   -35.548 13.617 1.00 162.54 ? -33 DG  I C8    1 
ATOM   6960  N  N7    . DG  J 7  40  ? 1.581   -34.567 13.341 1.00 166.17 ? -33 DG  I N7    1 
ATOM   6961  C  C5    . DG  J 7  40  ? 2.190   -34.954 12.155 1.00 171.85 ? -33 DG  I C5    1 
ATOM   6962  C  C6    . DG  J 7  40  ? 3.168   -34.291 11.376 1.00 176.99 ? -33 DG  I C6    1 
ATOM   6963  O  O6    . DG  J 7  40  ? 3.704   -33.194 11.587 1.00 176.58 ? -33 DG  I O6    1 
ATOM   6964  N  N1    . DG  J 7  40  ? 3.514   -35.029 10.247 1.00 182.67 ? -33 DG  I N1    1 
ATOM   6965  C  C2    . DG  J 7  40  ? 2.983   -36.254 9.915  1.00 186.59 ? -33 DG  I C2    1 
ATOM   6966  N  N2    . DG  J 7  40  ? 3.442   -36.814 8.786  1.00 197.55 ? -33 DG  I N2    1 
ATOM   6967  N  N3    . DG  J 7  40  ? 2.066   -36.886 10.637 1.00 179.16 ? -33 DG  I N3    1 
ATOM   6968  C  C4    . DG  J 7  40  ? 1.718   -36.179 11.740 1.00 171.65 ? -33 DG  I C4    1 
ATOM   6969  P  P     . DT  J 7  41  ? -0.164  -41.753 14.380 1.00 150.49 ? -32 DT  I P     1 
ATOM   6970  O  OP1   . DT  J 7  41  ? -0.650  -43.095 13.990 1.00 154.12 ? -32 DT  I OP1   1 
ATOM   6971  O  OP2   . DT  J 7  41  ? -0.178  -41.350 15.804 1.00 144.97 ? -32 DT  I OP2   1 
ATOM   6972  O  "O5'" . DT  J 7  41  ? 1.325   -41.560 13.828 1.00 151.06 ? -32 DT  I "O5'" 1 
ATOM   6973  C  "C5'" . DT  J 7  41  ? 1.577   -41.634 12.431 1.00 154.82 ? -32 DT  I "C5'" 1 
ATOM   6974  C  "C4'" . DT  J 7  41  ? 3.026   -41.300 12.124 1.00 160.17 ? -32 DT  I "C4'" 1 
ATOM   6975  O  "O4'" . DT  J 7  41  ? 3.224   -39.865 12.189 1.00 162.85 ? -32 DT  I "O4'" 1 
ATOM   6976  C  "C3'" . DT  J 7  41  ? 4.052   -41.920 13.082 1.00 160.83 ? -32 DT  I "C3'" 1 
ATOM   6977  O  "O3'" . DT  J 7  41  ? 5.042   -42.627 12.343 1.00 164.24 ? -32 DT  I "O3'" 1 
ATOM   6978  C  "C2'" . DT  J 7  41  ? 4.649   -40.712 13.811 1.00 162.18 ? -32 DT  I "C2'" 1 
ATOM   6979  C  "C1'" . DT  J 7  41  ? 4.470   -39.611 12.782 1.00 166.17 ? -32 DT  I "C1'" 1 
ATOM   6980  N  N1    . DT  J 7  41  ? 4.452   -38.240 13.371 1.00 167.57 ? -32 DT  I N1    1 
ATOM   6981  C  C2    . DT  J 7  41  ? 5.214   -37.251 12.794 1.00 170.97 ? -32 DT  I C2    1 
ATOM   6982  O  O2    . DT  J 7  41  ? 5.908   -37.431 11.810 1.00 174.60 ? -32 DT  I O2    1 
ATOM   6983  N  N3    . DT  J 7  41  ? 5.131   -36.031 13.412 1.00 169.86 ? -32 DT  I N3    1 
ATOM   6984  C  C4    . DT  J 7  41  ? 4.380   -35.709 14.528 1.00 165.97 ? -32 DT  I C4    1 
ATOM   6985  O  O4    . DT  J 7  41  ? 4.373   -34.581 15.009 1.00 163.91 ? -32 DT  I O4    1 
ATOM   6986  C  C5    . DT  J 7  41  ? 3.607   -36.794 15.086 1.00 164.85 ? -32 DT  I C5    1 
ATOM   6987  C  C7    . DT  J 7  41  ? 2.753   -36.566 16.298 1.00 161.78 ? -32 DT  I C7    1 
ATOM   6988  C  C6    . DT  J 7  41  ? 3.680   -37.993 14.488 1.00 165.73 ? -32 DT  I C6    1 
ATOM   6989  P  P     . DA  J 7  42  ? 5.967   -43.723 13.069 1.00 165.46 ? -31 DA  I P     1 
ATOM   6990  O  OP1   . DA  J 7  42  ? 5.794   -45.000 12.343 1.00 172.68 ? -31 DA  I OP1   1 
ATOM   6991  O  OP2   . DA  J 7  42  ? 5.699   -43.661 14.523 1.00 158.59 ? -31 DA  I OP2   1 
ATOM   6992  O  "O5'" . DA  J 7  42  ? 7.454   -43.191 12.820 1.00 166.43 ? -31 DA  I "O5'" 1 
ATOM   6993  C  "C5'" . DA  J 7  42  ? 7.956   -43.088 11.494 1.00 169.50 ? -31 DA  I "C5'" 1 
ATOM   6994  C  "C4'" . DA  J 7  42  ? 9.141   -42.141 11.433 1.00 170.44 ? -31 DA  I "C4'" 1 
ATOM   6995  O  "O4'" . DA  J 7  42  ? 8.727   -40.817 11.865 1.00 164.76 ? -31 DA  I "O4'" 1 
ATOM   6996  C  "C3'" . DA  J 7  42  ? 10.328  -42.528 12.316 1.00 174.71 ? -31 DA  I "C3'" 1 
ATOM   6997  O  "O3'" . DA  J 7  42  ? 11.544  -42.313 11.611 1.00 185.20 ? -31 DA  I "O3'" 1 
ATOM   6998  C  "C2'" . DA  J 7  42  ? 10.196  -41.589 13.513 1.00 167.83 ? -31 DA  I "C2'" 1 
ATOM   6999  C  "C1'" . DA  J 7  42  ? 9.600   -40.349 12.868 1.00 165.11 ? -31 DA  I "C1'" 1 
ATOM   7000  N  N9    . DA  J 7  42  ? 8.834   -39.528 13.799 1.00 161.11 ? -31 DA  I N9    1 
ATOM   7001  C  C8    . DA  J 7  42  ? 7.879   -39.955 14.679 1.00 157.15 ? -31 DA  I C8    1 
ATOM   7002  N  N7    . DA  J 7  42  ? 7.352   -38.992 15.397 1.00 154.03 ? -31 DA  I N7    1 
ATOM   7003  C  C5    . DA  J 7  42  ? 8.007   -37.854 14.958 1.00 155.07 ? -31 DA  I C5    1 
ATOM   7004  C  C6    . DA  J 7  42  ? 7.904   -36.497 15.326 1.00 152.30 ? -31 DA  I C6    1 
ATOM   7005  N  N6    . DA  J 7  42  ? 7.060   -36.051 16.264 1.00 147.31 ? -31 DA  I N6    1 
ATOM   7006  N  N1    . DA  J 7  42  ? 8.704   -35.615 14.692 1.00 153.90 ? -31 DA  I N1    1 
ATOM   7007  C  C2    . DA  J 7  42  ? 9.546   -36.066 13.755 1.00 156.94 ? -31 DA  I C2    1 
ATOM   7008  N  N3    . DA  J 7  42  ? 9.733   -37.313 13.325 1.00 159.92 ? -31 DA  I N3    1 
ATOM   7009  C  C4    . DA  J 7  42  ? 8.924   -38.166 13.973 1.00 159.08 ? -31 DA  I C4    1 
ATOM   7010  P  P     . DA  J 7  43  ? 12.955  -42.696 12.280 1.00 191.07 ? -30 DA  I P     1 
ATOM   7011  O  OP1   . DA  J 7  43  ? 13.797  -43.290 11.218 1.00 200.82 ? -30 DA  I OP1   1 
ATOM   7012  O  OP2   . DA  J 7  43  ? 12.697  -43.460 13.521 1.00 186.84 ? -30 DA  I OP2   1 
ATOM   7013  O  "O5'" . DA  J 7  43  ? 13.576  -41.280 12.687 1.00 191.81 ? -30 DA  I "O5'" 1 
ATOM   7014  C  "C5'" . DA  J 7  43  ? 13.792  -40.292 11.687 1.00 195.53 ? -30 DA  I "C5'" 1 
ATOM   7015  C  "C4'" . DA  J 7  43  ? 14.353  -39.020 12.296 1.00 194.44 ? -30 DA  I "C4'" 1 
ATOM   7016  O  "O4'" . DA  J 7  43  ? 13.306  -38.317 13.008 1.00 188.60 ? -30 DA  I "O4'" 1 
ATOM   7017  C  "C3'" . DA  J 7  43  ? 15.494  -39.231 13.298 1.00 197.09 ? -30 DA  I "C3'" 1 
ATOM   7018  O  "O3'" . DA  J 7  43  ? 16.617  -38.442 12.930 1.00 206.87 ? -30 DA  I "O3'" 1 
ATOM   7019  C  "C2'" . DA  J 7  43  ? 14.901  -38.783 14.638 1.00 189.86 ? -30 DA  I "C2'" 1 
ATOM   7020  C  "C1'" . DA  J 7  43  ? 13.833  -37.795 14.200 1.00 185.22 ? -30 DA  I "C1'" 1 
ATOM   7021  N  N9    . DA  J 7  43  ? 12.745  -37.651 15.162 1.00 175.69 ? -30 DA  I N9    1 
ATOM   7022  C  C8    . DA  J 7  43  ? 11.896  -38.629 15.598 1.00 172.48 ? -30 DA  I C8    1 
ATOM   7023  N  N7    . DA  J 7  43  ? 11.009  -38.210 16.470 1.00 167.17 ? -30 DA  I N7    1 
ATOM   7024  C  C5    . DA  J 7  43  ? 11.297  -36.863 16.615 1.00 164.92 ? -30 DA  I C5    1 
ATOM   7025  C  C6    . DA  J 7  43  ? 10.716  -35.848 17.400 1.00 159.36 ? -30 DA  I C6    1 
ATOM   7026  N  N6    . DA  J 7  43  ? 9.678   -36.053 18.218 1.00 155.04 ? -30 DA  I N6    1 
ATOM   7027  N  N1    . DA  J 7  43  ? 11.243  -34.609 17.311 1.00 159.36 ? -30 DA  I N1    1 
ATOM   7028  C  C2    . DA  J 7  43  ? 12.282  -34.408 16.490 1.00 163.21 ? -30 DA  I C2    1 
ATOM   7029  N  N3    . DA  J 7  43  ? 12.911  -35.281 15.706 1.00 167.53 ? -30 DA  I N3    1 
ATOM   7030  C  C4    . DA  J 7  43  ? 12.364  -36.502 15.816 1.00 169.11 ? -30 DA  I C4    1 
ATOM   7031  P  P     . DT  J 7  44  ? 18.014  -38.615 13.705 1.00 208.02 ? -29 DT  I P     1 
ATOM   7032  O  OP1   . DT  J 7  44  ? 19.100  -38.345 12.737 1.00 216.53 ? -29 DT  I OP1   1 
ATOM   7033  O  OP2   . DT  J 7  44  ? 17.974  -39.907 14.424 1.00 207.47 ? -29 DT  I OP2   1 
ATOM   7034  O  "O5'" . DT  J 7  44  ? 17.993  -37.445 14.794 1.00 203.26 ? -29 DT  I "O5'" 1 
ATOM   7035  C  "C5'" . DT  J 7  44  ? 17.866  -36.092 14.376 1.00 201.57 ? -29 DT  I "C5'" 1 
ATOM   7036  C  "C4'" . DT  J 7  44  ? 17.792  -35.159 15.572 1.00 195.18 ? -29 DT  I "C4'" 1 
ATOM   7037  O  "O4'" . DT  J 7  44  ? 16.475  -35.240 16.176 1.00 187.89 ? -29 DT  I "O4'" 1 
ATOM   7038  C  "C3'" . DT  J 7  44  ? 18.798  -35.455 16.690 1.00 195.09 ? -29 DT  I "C3'" 1 
ATOM   7039  O  "O3'" . DT  J 7  44  ? 19.498  -34.268 17.038 1.00 194.76 ? -29 DT  I "O3'" 1 
ATOM   7040  C  "C2'" . DT  J 7  44  ? 17.924  -35.951 17.846 1.00 189.34 ? -29 DT  I "C2'" 1 
ATOM   7041  C  "C1'" . DT  J 7  44  ? 16.615  -35.232 17.573 1.00 184.58 ? -29 DT  I "C1'" 1 
ATOM   7042  N  N1    . DT  J 7  44  ? 15.429  -35.904 18.176 1.00 179.05 ? -29 DT  I N1    1 
ATOM   7043  C  C2    . DT  J 7  44  ? 14.540  -35.161 18.918 1.00 173.66 ? -29 DT  I C2    1 
ATOM   7044  O  O2    . DT  J 7  44  ? 14.665  -33.964 19.110 1.00 172.10 ? -29 DT  I O2    1 
ATOM   7045  N  N3    . DT  J 7  44  ? 13.487  -35.872 19.430 1.00 169.90 ? -29 DT  I N3    1 
ATOM   7046  C  C4    . DT  J 7  44  ? 13.241  -37.225 19.280 1.00 169.63 ? -29 DT  I C4    1 
ATOM   7047  O  O4    . DT  J 7  44  ? 12.264  -37.774 19.781 1.00 165.08 ? -29 DT  I O4    1 
ATOM   7048  C  C5    . DT  J 7  44  ? 14.213  -37.946 18.493 1.00 175.12 ? -29 DT  I C5    1 
ATOM   7049  C  C7    . DT  J 7  44  ? 14.053  -39.419 18.261 1.00 175.52 ? -29 DT  I C7    1 
ATOM   7050  C  C6    . DT  J 7  44  ? 15.248  -37.259 17.986 1.00 179.46 ? -29 DT  I C6    1 
ATOM   7051  P  P     . DC  J 7  45  ? 20.946  -34.351 17.730 1.00 194.84 ? -28 DC  I P     1 
ATOM   7052  O  OP1   . DC  J 7  45  ? 21.946  -33.914 16.731 1.00 201.27 ? -28 DC  I OP1   1 
ATOM   7053  O  OP2   . DC  J 7  45  ? 21.075  -35.679 18.369 1.00 195.45 ? -28 DC  I OP2   1 
ATOM   7054  O  "O5'" . DC  J 7  45  ? 20.869  -33.257 18.892 1.00 187.70 ? -28 DC  I "O5'" 1 
ATOM   7055  C  "C5'" . DC  J 7  45  ? 20.445  -31.933 18.591 1.00 182.58 ? -28 DC  I "C5'" 1 
ATOM   7056  C  "C4'" . DC  J 7  45  ? 19.849  -31.265 19.816 1.00 175.11 ? -28 DC  I "C4'" 1 
ATOM   7057  O  "O4'" . DC  J 7  45  ? 18.623  -31.945 20.194 1.00 169.29 ? -28 DC  I "O4'" 1 
ATOM   7058  C  "C3'" . DC  J 7  45  ? 20.743  -31.273 21.055 1.00 174.80 ? -28 DC  I "C3'" 1 
ATOM   7059  O  "O3'" . DC  J 7  45  ? 20.659  -30.023 21.719 1.00 173.72 ? -28 DC  I "O3'" 1 
ATOM   7060  C  "C2'" . DC  J 7  45  ? 20.159  -32.401 21.903 1.00 170.86 ? -28 DC  I "C2'" 1 
ATOM   7061  C  "C1'" . DC  J 7  45  ? 18.681  -32.322 21.551 1.00 165.41 ? -28 DC  I "C1'" 1 
ATOM   7062  N  N1    . DC  J 7  45  ? 17.965  -33.620 21.711 1.00 160.13 ? -28 DC  I N1    1 
ATOM   7063  C  C2    . DC  J 7  45  ? 16.680  -33.640 22.266 1.00 153.25 ? -28 DC  I C2    1 
ATOM   7064  O  O2    . DC  J 7  45  ? 16.156  -32.575 22.614 1.00 148.74 ? -28 DC  I O2    1 
ATOM   7065  N  N3    . DC  J 7  45  ? 16.044  -34.831 22.405 1.00 151.17 ? -28 DC  I N3    1 
ATOM   7066  C  C4    . DC  J 7  45  ? 16.644  -35.958 22.017 1.00 152.59 ? -28 DC  I C4    1 
ATOM   7067  N  N4    . DC  J 7  45  ? 15.978  -37.107 22.174 1.00 150.90 ? -28 DC  I N4    1 
ATOM   7068  C  C5    . DC  J 7  45  ? 17.953  -35.957 21.451 1.00 157.23 ? -28 DC  I C5    1 
ATOM   7069  C  C6    . DC  J 7  45  ? 18.570  -34.778 21.319 1.00 160.82 ? -28 DC  I C6    1 
ATOM   7070  P  P     . DC  J 7  46  ? 21.864  -29.516 22.652 1.00 175.97 ? -27 DC  I P     1 
ATOM   7071  O  OP1   . DC  J 7  46  ? 22.450  -28.311 22.024 1.00 177.72 ? -27 DC  I OP1   1 
ATOM   7072  O  OP2   . DC  J 7  46  ? 22.725  -30.681 22.956 1.00 177.83 ? -27 DC  I OP2   1 
ATOM   7073  O  "O5'" . DC  J 7  46  ? 21.133  -29.089 24.006 1.00 172.13 ? -27 DC  I "O5'" 1 
ATOM   7074  C  "C5'" . DC  J 7  46  ? 19.866  -28.449 23.953 1.00 166.46 ? -27 DC  I "C5'" 1 
ATOM   7075  C  "C4'" . DC  J 7  46  ? 19.010  -28.854 25.139 1.00 159.18 ? -27 DC  I "C4'" 1 
ATOM   7076  O  "O4'" . DC  J 7  46  ? 18.506  -30.202 24.942 1.00 157.65 ? -27 DC  I "O4'" 1 
ATOM   7077  C  "C3'" . DC  J 7  46  ? 19.740  -28.865 26.484 1.00 157.43 ? -27 DC  I "C3'" 1 
ATOM   7078  O  "O3'" . DC  J 7  46  ? 18.912  -28.300 27.482 1.00 154.28 ? -27 DC  I "O3'" 1 
ATOM   7079  C  "C2'" . DC  J 7  46  ? 19.974  -30.352 26.738 1.00 157.61 ? -27 DC  I "C2'" 1 
ATOM   7080  C  "C1'" . DC  J 7  46  ? 18.727  -30.950 26.114 1.00 155.92 ? -27 DC  I "C1'" 1 
ATOM   7081  N  N1    . DC  J 7  46  ? 18.871  -32.388 25.749 1.00 156.54 ? -27 DC  I N1    1 
ATOM   7082  C  C2    . DC  J 7  46  ? 17.746  -33.220 25.760 1.00 152.36 ? -27 DC  I C2    1 
ATOM   7083  O  O2    . DC  J 7  46  ? 16.646  -32.743 26.067 1.00 147.43 ? -27 DC  I O2    1 
ATOM   7084  N  N3    . DC  J 7  46  ? 17.893  -34.527 25.430 1.00 154.84 ? -27 DC  I N3    1 
ATOM   7085  C  C4    . DC  J 7  46  ? 19.097  -35.001 25.104 1.00 157.47 ? -27 DC  I C4    1 
ATOM   7086  N  N4    . DC  J 7  46  ? 19.193  -36.296 24.785 1.00 157.71 ? -27 DC  I N4    1 
ATOM   7087  C  C5    . DC  J 7  46  ? 20.255  -34.169 25.090 1.00 159.98 ? -27 DC  I C5    1 
ATOM   7088  C  C6    . DC  J 7  46  ? 20.098  -32.883 25.418 1.00 159.53 ? -27 DC  I C6    1 
ATOM   7089  P  P     . DC  J 7  47  ? 19.317  -26.911 28.178 1.00 157.30 ? -26 DC  I P     1 
ATOM   7090  O  OP1   . DC  J 7  47  ? 19.537  -25.916 27.103 1.00 160.32 ? -26 DC  I OP1   1 
ATOM   7091  O  OP2   . DC  J 7  47  ? 20.392  -27.194 29.154 1.00 159.06 ? -26 DC  I OP2   1 
ATOM   7092  O  "O5'" . DC  J 7  47  ? 18.005  -26.505 28.994 1.00 148.97 ? -26 DC  I "O5'" 1 
ATOM   7093  C  "C5'" . DC  J 7  47  ? 16.738  -26.522 28.348 1.00 141.15 ? -26 DC  I "C5'" 1 
ATOM   7094  C  "C4'" . DC  J 7  47  ? 15.793  -27.489 29.039 1.00 133.87 ? -26 DC  I "C4'" 1 
ATOM   7095  O  "O4'" . DC  J 7  47  ? 16.218  -28.851 28.791 1.00 135.35 ? -26 DC  I "O4'" 1 
ATOM   7096  C  "C3'" . DC  J 7  47  ? 15.712  -27.336 30.563 1.00 126.73 ? -26 DC  I "C3'" 1 
ATOM   7097  O  "O3'" . DC  J 7  47  ? 14.368  -27.097 30.957 1.00 119.68 ? -26 DC  I "O3'" 1 
ATOM   7098  C  "C2'" . DC  J 7  47  ? 16.230  -28.674 31.107 1.00 128.07 ? -26 DC  I "C2'" 1 
ATOM   7099  C  "C1'" . DC  J 7  47  ? 15.974  -29.615 29.942 1.00 131.96 ? -26 DC  I "C1'" 1 
ATOM   7100  N  N1    . DC  J 7  47  ? 16.874  -30.804 29.928 1.00 135.62 ? -26 DC  I N1    1 
ATOM   7101  C  C2    . DC  J 7  47  ? 16.323  -32.089 29.991 1.00 134.42 ? -26 DC  I C2    1 
ATOM   7102  O  O2    . DC  J 7  47  ? 15.094  -32.217 30.054 1.00 131.09 ? -26 DC  I O2    1 
ATOM   7103  N  N3    . DC  J 7  47  ? 17.155  -33.161 29.979 1.00 136.22 ? -26 DC  I N3    1 
ATOM   7104  C  C4    . DC  J 7  47  ? 18.475  -32.982 29.910 1.00 137.85 ? -26 DC  I C4    1 
ATOM   7105  N  N4    . DC  J 7  47  ? 19.254  -34.068 29.902 1.00 138.61 ? -26 DC  I N4    1 
ATOM   7106  C  C5    . DC  J 7  47  ? 19.054  -31.680 29.848 1.00 140.01 ? -26 DC  I C5    1 
ATOM   7107  C  C6    . DC  J 7  47  ? 18.225  -30.631 29.860 1.00 139.19 ? -26 DC  I C6    1 
ATOM   7108  P  P     . DC  J 7  48  ? 14.045  -26.588 32.446 1.00 117.00 ? -25 DC  I P     1 
ATOM   7109  O  OP1   . DC  J 7  48  ? 12.737  -25.895 32.414 1.00 110.42 ? -25 DC  I OP1   1 
ATOM   7110  O  OP2   . DC  J 7  48  ? 15.246  -25.882 32.944 1.00 118.14 ? -25 DC  I OP2   1 
ATOM   7111  O  "O5'" . DC  J 7  48  ? 13.894  -27.940 33.290 1.00 119.78 ? -25 DC  I "O5'" 1 
ATOM   7112  C  "C5'" . DC  J 7  48  ? 12.890  -28.888 32.941 1.00 115.92 ? -25 DC  I "C5'" 1 
ATOM   7113  C  "C4'" . DC  J 7  48  ? 13.016  -30.149 33.779 1.00 112.71 ? -25 DC  I "C4'" 1 
ATOM   7114  O  "O4'" . DC  J 7  48  ? 14.177  -30.915 33.348 1.00 117.24 ? -25 DC  I "O4'" 1 
ATOM   7115  C  "C3'" . DC  J 7  48  ? 13.201  -29.920 35.284 1.00 107.87 ? -25 DC  I "C3'" 1 
ATOM   7116  O  "O3'" . DC  J 7  48  ? 12.470  -30.895 36.006 1.00 103.10 ? -25 DC  I "O3'" 1 
ATOM   7117  C  "C2'" . DC  J 7  48  ? 14.700  -30.135 35.464 1.00 113.07 ? -25 DC  I "C2'" 1 
ATOM   7118  C  "C1'" . DC  J 7  48  ? 14.922  -31.274 34.487 1.00 118.83 ? -25 DC  I "C1'" 1 
ATOM   7119  N  N1    . DC  J 7  48  ? 16.347  -31.483 34.100 1.00 127.69 ? -25 DC  I N1    1 
ATOM   7120  C  C2    . DC  J 7  48  ? 16.770  -32.754 33.691 1.00 133.71 ? -25 DC  I C2    1 
ATOM   7121  O  O2    . DC  J 7  48  ? 15.949  -33.677 33.647 1.00 135.43 ? -25 DC  I O2    1 
ATOM   7122  N  N3    . DC  J 7  48  ? 18.069  -32.935 33.349 1.00 137.36 ? -25 DC  I N3    1 
ATOM   7123  C  C4    . DC  J 7  48  ? 18.924  -31.914 33.409 1.00 139.45 ? -25 DC  I C4    1 
ATOM   7124  N  N4    . DC  J 7  48  ? 20.195  -32.141 33.061 1.00 144.13 ? -25 DC  I N4    1 
ATOM   7125  C  C5    . DC  J 7  48  ? 18.514  -30.613 33.828 1.00 136.69 ? -25 DC  I C5    1 
ATOM   7126  C  C6    . DC  J 7  48  ? 17.229  -30.445 34.163 1.00 131.15 ? -25 DC  I C6    1 
ATOM   7127  P  P     . DT  J 7  49  ? 11.055  -30.541 36.678 1.00 98.25  ? -24 DT  I P     1 
ATOM   7128  O  OP1   . DT  J 7  49  ? 10.232  -29.839 35.667 1.00 97.92  ? -24 DT  I OP1   1 
ATOM   7129  O  OP2   . DT  J 7  49  ? 11.319  -29.906 37.988 1.00 95.48  ? -24 DT  I OP2   1 
ATOM   7130  O  "O5'" . DT  J 7  49  ? 10.416  -31.981 36.956 1.00 99.37  ? -24 DT  I "O5'" 1 
ATOM   7131  C  "C5'" . DT  J 7  49  ? 10.324  -32.931 35.895 1.00 97.08  ? -24 DT  I "C5'" 1 
ATOM   7132  C  "C4'" . DT  J 7  49  ? 11.050  -34.224 36.242 1.00 92.42  ? -24 DT  I "C4'" 1 
ATOM   7133  O  "O4'" . DT  J 7  49  ? 12.454  -34.113 35.920 1.00 94.19  ? -24 DT  I "O4'" 1 
ATOM   7134  C  "C3'" . DT  J 7  49  ? 10.991  -34.641 37.719 1.00 89.11  ? -24 DT  I "C3'" 1 
ATOM   7135  O  "O3'" . DT  J 7  49  ? 10.214  -35.829 37.858 1.00 85.87  ? -24 DT  I "O3'" 1 
ATOM   7136  C  "C2'" . DT  J 7  49  ? 12.464  -34.876 38.109 1.00 92.55  ? -24 DT  I "C2'" 1 
ATOM   7137  C  "C1'" . DT  J 7  49  ? 13.147  -35.000 36.754 1.00 97.16  ? -24 DT  I "C1'" 1 
ATOM   7138  N  N1    . DT  J 7  49  ? 14.602  -34.636 36.766 1.00 104.30 ? -24 DT  I N1    1 
ATOM   7139  C  C2    . DT  J 7  49  ? 15.513  -35.500 36.202 1.00 112.74 ? -24 DT  I C2    1 
ATOM   7140  O  O2    . DT  J 7  49  ? 15.199  -36.555 35.682 1.00 118.35 ? -24 DT  I O2    1 
ATOM   7141  N  N3    . DT  J 7  49  ? 16.816  -35.081 36.265 1.00 115.37 ? -24 DT  I N3    1 
ATOM   7142  C  C4    . DT  J 7  49  ? 17.292  -33.911 36.826 1.00 116.56 ? -24 DT  I C4    1 
ATOM   7143  O  O4    . DT  J 7  49  ? 18.485  -33.624 36.832 1.00 121.49 ? -24 DT  I O4    1 
ATOM   7144  C  C5    . DT  J 7  49  ? 16.286  -33.050 37.403 1.00 111.38 ? -24 DT  I C5    1 
ATOM   7145  C  C7    . DT  J 7  49  ? 16.684  -31.752 38.042 1.00 112.30 ? -24 DT  I C7    1 
ATOM   7146  C  C6    . DT  J 7  49  ? 15.004  -33.450 37.348 1.00 105.87 ? -24 DT  I C6    1 
ATOM   7147  P  P     . DT  J 7  50  ? 9.912   -36.443 39.313 1.00 80.86  ? -23 DT  I P     1 
ATOM   7148  O  OP1   . DT  J 7  50  ? 8.574   -37.073 39.274 1.00 73.08  ? -23 DT  I OP1   1 
ATOM   7149  O  OP2   . DT  J 7  50  ? 10.196  -35.392 40.317 1.00 89.55  ? -23 DT  I OP2   1 
ATOM   7150  O  "O5'" . DT  J 7  50  ? 11.012  -37.588 39.479 1.00 86.51  ? -23 DT  I "O5'" 1 
ATOM   7151  C  "C5'" . DT  J 7  50  ? 11.137  -38.595 38.486 1.00 96.23  ? -23 DT  I "C5'" 1 
ATOM   7152  C  "C4'" . DT  J 7  50  ? 12.336  -39.480 38.770 1.00 107.93 ? -23 DT  I "C4'" 1 
ATOM   7153  O  "O4'" . DT  J 7  50  ? 13.558  -38.734 38.539 1.00 112.19 ? -23 DT  I "O4'" 1 
ATOM   7154  C  "C3'" . DT  J 7  50  ? 12.417  -40.012 40.203 1.00 112.53 ? -23 DT  I "C3'" 1 
ATOM   7155  O  "O3'" . DT  J 7  50  ? 12.641  -41.416 40.190 1.00 118.69 ? -23 DT  I "O3'" 1 
ATOM   7156  C  "C2'" . DT  J 7  50  ? 13.598  -39.254 40.813 1.00 112.62 ? -23 DT  I "C2'" 1 
ATOM   7157  C  "C1'" . DT  J 7  50  ? 14.459  -38.971 39.592 1.00 113.52 ? -23 DT  I "C1'" 1 
ATOM   7158  N  N1    . DT  J 7  50  ? 15.332  -37.771 39.746 1.00 112.43 ? -23 DT  I N1    1 
ATOM   7159  C  C2    . DT  J 7  50  ? 16.657  -37.851 39.384 1.00 115.48 ? -23 DT  I C2    1 
ATOM   7160  O  O2    . DT  J 7  50  ? 17.167  -38.862 38.936 1.00 119.42 ? -23 DT  I O2    1 
ATOM   7161  N  N3    . DT  J 7  50  ? 17.371  -36.696 39.565 1.00 115.02 ? -23 DT  I N3    1 
ATOM   7162  C  C4    . DT  J 7  50  ? 16.902  -35.493 40.062 1.00 114.22 ? -23 DT  I C4    1 
ATOM   7163  O  O4    . DT  J 7  50  ? 17.623  -34.509 40.188 1.00 117.06 ? -23 DT  I O4    1 
ATOM   7164  C  C5    . DT  J 7  50  ? 15.504  -35.477 40.423 1.00 111.96 ? -23 DT  I C5    1 
ATOM   7165  C  C7    . DT  J 7  50  ? 14.880  -34.229 40.974 1.00 112.11 ? -23 DT  I C7    1 
ATOM   7166  C  C6    . DT  J 7  50  ? 14.795  -36.604 40.250 1.00 109.74 ? -23 DT  I C6    1 
ATOM   7167  P  P     . DG  J 7  51  ? 12.586  -42.255 41.558 1.00 118.10 ? -22 DG  I P     1 
ATOM   7168  O  OP1   . DG  J 7  51  ? 12.143  -43.628 41.225 1.00 120.83 ? -22 DG  I OP1   1 
ATOM   7169  O  OP2   . DG  J 7  51  ? 11.829  -41.457 42.550 1.00 113.42 ? -22 DG  I OP2   1 
ATOM   7170  O  "O5'" . DG  J 7  51  ? 14.112  -42.309 42.026 1.00 120.26 ? -22 DG  I "O5'" 1 
ATOM   7171  C  "C5'" . DG  J 7  51  ? 15.096  -42.848 41.155 1.00 126.00 ? -22 DG  I "C5'" 1 
ATOM   7172  C  "C4'" . DG  J 7  51  ? 16.479  -42.725 41.763 1.00 131.03 ? -22 DG  I "C4'" 1 
ATOM   7173  O  "O4'" . DG  J 7  51  ? 16.988  -41.391 41.546 1.00 130.89 ? -22 DG  I "O4'" 1 
ATOM   7174  C  "C3'" . DG  J 7  51  ? 16.544  -42.968 43.274 1.00 133.21 ? -22 DG  I "C3'" 1 
ATOM   7175  O  "O3'" . DG  J 7  51  ? 17.357  -44.102 43.546 1.00 139.52 ? -22 DG  I "O3'" 1 
ATOM   7176  C  "C2'" . DG  J 7  51  ? 17.153  -41.679 43.849 1.00 131.30 ? -22 DG  I "C2'" 1 
ATOM   7177  C  "C1'" . DG  J 7  51  ? 17.804  -41.043 42.630 1.00 133.71 ? -22 DG  I "C1'" 1 
ATOM   7178  N  N9    . DG  J 7  51  ? 17.877  -39.587 42.702 1.00 136.65 ? -22 DG  I N9    1 
ATOM   7179  C  C8    . DG  J 7  51  ? 16.827  -38.713 42.856 1.00 134.91 ? -22 DG  I C8    1 
ATOM   7180  N  N7    . DG  J 7  51  ? 17.193  -37.462 42.885 1.00 135.18 ? -22 DG  I N7    1 
ATOM   7181  C  C5    . DG  J 7  51  ? 18.574  -37.508 42.740 1.00 138.85 ? -22 DG  I C5    1 
ATOM   7182  C  C6    . DG  J 7  51  ? 19.521  -36.458 42.697 1.00 142.14 ? -22 DG  I C6    1 
ATOM   7183  O  O6    . DG  J 7  51  ? 19.320  -35.238 42.783 1.00 143.08 ? -22 DG  I O6    1 
ATOM   7184  N  N1    . DG  J 7  51  ? 20.818  -36.940 42.538 1.00 146.79 ? -22 DG  I N1    1 
ATOM   7185  C  C2    . DG  J 7  51  ? 21.156  -38.269 42.433 1.00 148.20 ? -22 DG  I C2    1 
ATOM   7186  N  N2    . DG  J 7  51  ? 22.460  -38.541 42.283 1.00 153.75 ? -22 DG  I N2    1 
ATOM   7187  N  N3    . DG  J 7  51  ? 20.278  -39.263 42.470 1.00 144.30 ? -22 DG  I N3    1 
ATOM   7188  C  C4    . DG  J 7  51  ? 19.010  -38.809 42.625 1.00 140.09 ? -22 DG  I C4    1 
ATOM   7189  P  P     . DG  J 7  52  ? 17.568  -44.605 45.056 1.00 139.47 ? -21 DG  I P     1 
ATOM   7190  O  OP1   . DG  J 7  52  ? 17.827  -46.062 45.008 1.00 142.33 ? -21 DG  I OP1   1 
ATOM   7191  O  OP2   . DG  J 7  52  ? 16.449  -44.085 45.874 1.00 133.55 ? -21 DG  I OP2   1 
ATOM   7192  O  "O5'" . DG  J 7  52  ? 18.905  -43.861 45.517 1.00 142.80 ? -21 DG  I "O5'" 1 
ATOM   7193  C  "C5'" . DG  J 7  52  ? 20.075  -43.949 44.713 1.00 148.02 ? -21 DG  I "C5'" 1 
ATOM   7194  C  "C4'" . DG  J 7  52  ? 21.248  -43.274 45.398 1.00 152.75 ? -21 DG  I "C4'" 1 
ATOM   7195  O  "O4'" . DG  J 7  52  ? 21.244  -41.857 45.089 1.00 153.94 ? -21 DG  I "O4'" 1 
ATOM   7196  C  "C3'" . DG  J 7  52  ? 21.249  -43.384 46.925 1.00 154.46 ? -21 DG  I "C3'" 1 
ATOM   7197  O  "O3'" . DG  J 7  52  ? 22.526  -43.798 47.381 1.00 159.85 ? -21 DG  I "O3'" 1 
ATOM   7198  C  "C2'" . DG  J 7  52  ? 20.916  -41.966 47.391 1.00 153.85 ? -21 DG  I "C2'" 1 
ATOM   7199  C  "C1'" . DG  J 7  52  ? 21.492  -41.127 46.264 1.00 156.49 ? -21 DG  I "C1'" 1 
ATOM   7200  N  N9    . DG  J 7  52  ? 20.867  -39.814 46.136 1.00 157.42 ? -21 DG  I N9    1 
ATOM   7201  C  C8    . DG  J 7  52  ? 19.522  -39.542 46.057 1.00 154.01 ? -21 DG  I C8    1 
ATOM   7202  N  N7    . DG  J 7  52  ? 19.254  -38.271 45.947 1.00 152.97 ? -21 DG  I N7    1 
ATOM   7203  C  C5    . DG  J 7  52  ? 20.502  -37.659 45.953 1.00 156.73 ? -21 DG  I C5    1 
ATOM   7204  C  C6    . DG  J 7  52  ? 20.846  -36.289 45.861 1.00 157.09 ? -21 DG  I C6    1 
ATOM   7205  O  O6    . DG  J 7  52  ? 20.090  -35.313 45.753 1.00 153.94 ? -21 DG  I O6    1 
ATOM   7206  N  N1    . DG  J 7  52  ? 22.225  -36.101 45.904 1.00 161.90 ? -21 DG  I N1    1 
ATOM   7207  C  C2    . DG  J 7  52  ? 23.154  -37.108 46.022 1.00 165.41 ? -21 DG  I C2    1 
ATOM   7208  N  N2    . DG  J 7  52  ? 24.440  -36.731 46.047 1.00 167.37 ? -21 DG  I N2    1 
ATOM   7209  N  N3    . DG  J 7  52  ? 22.845  -38.396 46.109 1.00 165.93 ? -21 DG  I N3    1 
ATOM   7210  C  C4    . DG  J 7  52  ? 21.505  -38.596 46.068 1.00 160.82 ? -21 DG  I C4    1 
ATOM   7211  P  P     . DC  J 7  53  ? 22.680  -44.510 48.812 1.00 161.83 ? -20 DC  I P     1 
ATOM   7212  O  OP1   . DC  J 7  53  ? 23.355  -45.810 48.596 1.00 167.02 ? -20 DC  I OP1   1 
ATOM   7213  O  OP2   . DC  J 7  53  ? 21.362  -44.469 49.483 1.00 155.44 ? -20 DC  I OP2   1 
ATOM   7214  O  "O5'" . DC  J 7  53  ? 23.667  -43.540 49.611 1.00 162.15 ? -20 DC  I "O5'" 1 
ATOM   7215  C  "C5'" . DC  J 7  53  ? 24.946  -43.235 49.072 1.00 162.82 ? -20 DC  I "C5'" 1 
ATOM   7216  C  "C4'" . DC  J 7  53  ? 25.425  -41.879 49.556 1.00 158.79 ? -20 DC  I "C4'" 1 
ATOM   7217  O  "O4'" . DC  J 7  53  ? 24.676  -40.841 48.901 1.00 154.42 ? -20 DC  I "O4'" 1 
ATOM   7218  C  "C3'" . DC  J 7  53  ? 25.213  -41.616 51.033 1.00 155.89 ? -20 DC  I "C3'" 1 
ATOM   7219  O  "O3'" . DC  J 7  53  ? 26.313  -42.129 51.775 1.00 162.79 ? -20 DC  I "O3'" 1 
ATOM   7220  C  "C2'" . DC  J 7  53  ? 25.148  -40.085 51.106 1.00 152.43 ? -20 DC  I "C2'" 1 
ATOM   7221  C  "C1'" . DC  J 7  53  ? 24.745  -39.668 49.683 1.00 149.93 ? -20 DC  I "C1'" 1 
ATOM   7222  N  N1    . DC  J 7  53  ? 23.431  -38.969 49.614 1.00 140.61 ? -20 DC  I N1    1 
ATOM   7223  C  C2    . DC  J 7  53  ? 23.395  -37.583 49.425 1.00 137.95 ? -20 DC  I C2    1 
ATOM   7224  O  O2    . DC  J 7  53  ? 24.459  -36.961 49.317 1.00 139.32 ? -20 DC  I O2    1 
ATOM   7225  N  N3    . DC  J 7  53  ? 22.192  -36.960 49.364 1.00 132.12 ? -20 DC  I N3    1 
ATOM   7226  C  C4    . DC  J 7  53  ? 21.067  -37.667 49.485 1.00 126.88 ? -20 DC  I C4    1 
ATOM   7227  N  N4    . DC  J 7  53  ? 19.905  -37.009 49.419 1.00 120.67 ? -20 DC  I N4    1 
ATOM   7228  C  C5    . DC  J 7  53  ? 21.084  -39.080 49.680 1.00 128.66 ? -20 DC  I C5    1 
ATOM   7229  C  C6    . DC  J 7  53  ? 22.276  -39.683 49.739 1.00 134.42 ? -20 DC  I C6    1 
ATOM   7230  P  P     . DG  J 7  54  ? 26.223  -42.264 53.374 1.00 164.60 ? -19 DG  I P     1 
ATOM   7231  O  OP1   . DG  J 7  54  ? 27.245  -43.245 53.801 1.00 168.97 ? -19 DG  I OP1   1 
ATOM   7232  O  OP2   . DG  J 7  54  ? 24.803  -42.473 53.731 1.00 161.11 ? -19 DG  I OP2   1 
ATOM   7233  O  "O5'" . DG  J 7  54  ? 26.650  -40.818 53.902 1.00 166.47 ? -19 DG  I "O5'" 1 
ATOM   7234  C  "C5'" . DG  J 7  54  ? 27.834  -40.204 53.412 1.00 168.95 ? -19 DG  I "C5'" 1 
ATOM   7235  C  "C4'" . DG  J 7  54  ? 27.856  -38.729 53.762 1.00 165.27 ? -19 DG  I "C4'" 1 
ATOM   7236  O  "O4'" . DG  J 7  54  ? 26.720  -38.065 53.143 1.00 158.19 ? -19 DG  I "O4'" 1 
ATOM   7237  C  "C3'" . DG  J 7  54  ? 27.762  -38.426 55.257 1.00 166.24 ? -19 DG  I "C3'" 1 
ATOM   7238  O  "O3'" . DG  J 7  54  ? 28.646  -37.371 55.594 1.00 171.36 ? -19 DG  I "O3'" 1 
ATOM   7239  C  "C2'" . DG  J 7  54  ? 26.304  -38.014 55.437 1.00 159.19 ? -19 DG  I "C2'" 1 
ATOM   7240  C  "C1'" . DG  J 7  54  ? 26.027  -37.318 54.116 1.00 155.75 ? -19 DG  I "C1'" 1 
ATOM   7241  N  N9    . DG  J 7  54  ? 24.611  -37.282 53.761 1.00 150.86 ? -19 DG  I N9    1 
ATOM   7242  C  C8    . DG  J 7  54  ? 23.719  -38.327 53.802 1.00 149.51 ? -19 DG  I C8    1 
ATOM   7243  N  N7    . DG  J 7  54  ? 22.514  -37.998 53.429 1.00 144.91 ? -19 DG  I N7    1 
ATOM   7244  C  C5    . DG  J 7  54  ? 22.610  -36.646 53.122 1.00 142.32 ? -19 DG  I C5    1 
ATOM   7245  C  C6    . DG  J 7  54  ? 21.623  -35.743 52.661 1.00 137.93 ? -19 DG  I C6    1 
ATOM   7246  O  O6    . DG  J 7  54  ? 20.427  -35.966 52.425 1.00 135.18 ? -19 DG  I O6    1 
ATOM   7247  N  N1    . DG  J 7  54  ? 22.142  -34.464 52.473 1.00 139.45 ? -19 DG  I N1    1 
ATOM   7248  C  C2    . DG  J 7  54  ? 23.449  -34.105 52.702 1.00 144.64 ? -19 DG  I C2    1 
ATOM   7249  N  N2    . DG  J 7  54  ? 23.763  -32.823 52.463 1.00 147.09 ? -19 DG  I N2    1 
ATOM   7250  N  N3    . DG  J 7  54  ? 24.384  -34.941 53.134 1.00 146.29 ? -19 DG  I N3    1 
ATOM   7251  C  C4    . DG  J 7  54  ? 23.895  -36.191 53.321 1.00 145.82 ? -19 DG  I C4    1 
ATOM   7252  P  P     . DG  J 7  55  ? 29.410  -37.379 57.007 1.00 175.41 ? -18 DG  I P     1 
ATOM   7253  O  OP1   . DG  J 7  55  ? 30.846  -37.613 56.738 1.00 179.90 ? -18 DG  I OP1   1 
ATOM   7254  O  OP2   . DG  J 7  55  ? 28.672  -38.290 57.910 1.00 173.32 ? -18 DG  I OP2   1 
ATOM   7255  O  "O5'" . DG  J 7  55  ? 29.216  -35.889 57.551 1.00 176.67 ? -18 DG  I "O5'" 1 
ATOM   7256  C  "C5'" . DG  J 7  55  ? 29.618  -34.784 56.753 1.00 178.85 ? -18 DG  I "C5'" 1 
ATOM   7257  C  "C4'" . DG  J 7  55  ? 28.755  -33.569 57.041 1.00 177.55 ? -18 DG  I "C4'" 1 
ATOM   7258  O  "O4'" . DG  J 7  55  ? 27.432  -33.767 56.478 1.00 173.80 ? -18 DG  I "O4'" 1 
ATOM   7259  C  "C3'" . DG  J 7  55  ? 28.550  -33.258 58.526 1.00 178.80 ? -18 DG  I "C3'" 1 
ATOM   7260  O  "O3'" . DG  J 7  55  ? 28.748  -31.870 58.764 1.00 178.95 ? -18 DG  I "O3'" 1 
ATOM   7261  C  "C2'" . DG  J 7  55  ? 27.102  -33.675 58.785 1.00 174.92 ? -18 DG  I "C2'" 1 
ATOM   7262  C  "C1'" . DG  J 7  55  ? 26.459  -33.418 57.434 1.00 173.00 ? -18 DG  I "C1'" 1 
ATOM   7263  N  N9    . DG  J 7  55  ? 25.267  -34.227 57.198 1.00 173.31 ? -18 DG  I N9    1 
ATOM   7264  C  C8    . DG  J 7  55  ? 25.120  -35.571 57.442 1.00 175.39 ? -18 DG  I C8    1 
ATOM   7265  N  N7    . DG  J 7  55  ? 23.939  -36.030 57.134 1.00 172.98 ? -18 DG  I N7    1 
ATOM   7266  C  C5    . DG  J 7  55  ? 23.256  -34.919 56.658 1.00 170.38 ? -18 DG  I C5    1 
ATOM   7267  C  C6    . DG  J 7  55  ? 21.931  -34.802 56.176 1.00 167.45 ? -18 DG  I C6    1 
ATOM   7268  O  O6    . DG  J 7  55  ? 21.071  -35.687 56.073 1.00 162.62 ? -18 DG  I O6    1 
ATOM   7269  N  N1    . DG  J 7  55  ? 21.636  -33.496 55.791 1.00 168.61 ? -18 DG  I N1    1 
ATOM   7270  C  C2    . DG  J 7  55  ? 22.512  -32.438 55.863 1.00 169.39 ? -18 DG  I C2    1 
ATOM   7271  N  N2    . DG  J 7  55  ? 22.046  -31.252 55.445 1.00 167.13 ? -18 DG  I N2    1 
ATOM   7272  N  N3    . DG  J 7  55  ? 23.757  -32.535 56.312 1.00 171.87 ? -18 DG  I N3    1 
ATOM   7273  C  C4    . DG  J 7  55  ? 24.060  -33.800 56.691 1.00 171.60 ? -18 DG  I C4    1 
ATOM   7274  P  P     . DT  J 7  56  ? 28.592  -31.269 60.247 1.00 175.65 ? -17 DT  I P     1 
ATOM   7275  O  OP1   . DT  J 7  56  ? 29.529  -30.129 60.360 1.00 179.16 ? -17 DT  I OP1   1 
ATOM   7276  O  OP2   . DT  J 7  56  ? 28.682  -32.387 61.212 1.00 175.16 ? -17 DT  I OP2   1 
ATOM   7277  O  "O5'" . DT  J 7  56  ? 27.095  -30.705 60.273 1.00 166.54 ? -17 DT  I "O5'" 1 
ATOM   7278  C  "C5'" . DT  J 7  56  ? 26.685  -29.744 59.306 1.00 161.11 ? -17 DT  I "C5'" 1 
ATOM   7279  C  "C4'" . DT  J 7  56  ? 25.257  -29.291 59.556 1.00 154.94 ? -17 DT  I "C4'" 1 
ATOM   7280  O  "O4'" . DT  J 7  56  ? 24.334  -30.343 59.181 1.00 150.69 ? -17 DT  I "O4'" 1 
ATOM   7281  C  "C3'" . DT  J 7  56  ? 24.932  -28.929 61.010 1.00 154.59 ? -17 DT  I "C3'" 1 
ATOM   7282  O  "O3'" . DT  J 7  56  ? 24.366  -27.623 61.070 1.00 153.78 ? -17 DT  I "O3'" 1 
ATOM   7283  C  "C2'" . DT  J 7  56  ? 23.926  -30.002 61.443 1.00 149.99 ? -17 DT  I "C2'" 1 
ATOM   7284  C  "C1'" . DT  J 7  56  ? 23.289  -30.385 60.119 1.00 145.25 ? -17 DT  I "C1'" 1 
ATOM   7285  N  N1    . DT  J 7  56  ? 22.697  -31.755 60.111 1.00 138.25 ? -17 DT  I N1    1 
ATOM   7286  C  C2    . DT  J 7  56  ? 21.386  -31.918 59.728 1.00 131.60 ? -17 DT  I C2    1 
ATOM   7287  O  O2    . DT  J 7  56  ? 20.669  -30.994 59.387 1.00 127.37 ? -17 DT  I O2    1 
ATOM   7288  N  N3    . DT  J 7  56  ? 20.940  -33.212 59.755 1.00 130.30 ? -17 DT  I N3    1 
ATOM   7289  C  C4    . DT  J 7  56  ? 21.657  -34.336 60.121 1.00 133.10 ? -17 DT  I C4    1 
ATOM   7290  O  O4    . DT  J 7  56  ? 21.165  -35.460 60.112 1.00 134.33 ? -17 DT  I O4    1 
ATOM   7291  C  C5    . DT  J 7  56  ? 23.026  -34.095 60.513 1.00 135.89 ? -17 DT  I C5    1 
ATOM   7292  C  C7    . DT  J 7  56  ? 23.904  -35.237 60.931 1.00 138.45 ? -17 DT  I C7    1 
ATOM   7293  C  C6    . DT  J 7  56  ? 23.474  -32.830 60.489 1.00 138.04 ? -17 DT  I C6    1 
ATOM   7294  P  P     . DT  J 7  57  ? 24.126  -26.906 62.488 1.00 153.21 ? -16 DT  I P     1 
ATOM   7295  O  OP1   . DT  J 7  57  ? 24.322  -25.452 62.292 1.00 154.98 ? -16 DT  I OP1   1 
ATOM   7296  O  OP2   . DT  J 7  57  ? 24.929  -27.626 63.501 1.00 157.43 ? -16 DT  I OP2   1 
ATOM   7297  O  "O5'" . DT  J 7  57  ? 22.581  -27.183 62.799 1.00 150.45 ? -16 DT  I "O5'" 1 
ATOM   7298  C  "C5'" . DT  J 7  57  ? 21.588  -26.792 61.857 1.00 145.20 ? -16 DT  I "C5'" 1 
ATOM   7299  C  "C4'" . DT  J 7  57  ? 20.219  -27.316 62.256 1.00 139.36 ? -16 DT  I "C4'" 1 
ATOM   7300  O  "O4'" . DT  J 7  57  ? 20.168  -28.754 62.071 1.00 135.85 ? -16 DT  I "O4'" 1 
ATOM   7301  C  "C3'" . DT  J 7  57  ? 19.821  -27.056 63.715 1.00 140.46 ? -16 DT  I "C3'" 1 
ATOM   7302  O  "O3'" . DT  J 7  57  ? 18.528  -26.470 63.765 1.00 139.60 ? -16 DT  I "O3'" 1 
ATOM   7303  C  "C2'" . DT  J 7  57  ? 19.827  -28.452 64.345 1.00 136.92 ? -16 DT  I "C2'" 1 
ATOM   7304  C  "C1'" . DT  J 7  57  ? 19.477  -29.323 63.152 1.00 131.68 ? -16 DT  I "C1'" 1 
ATOM   7305  N  N1    . DT  J 7  57  ? 19.903  -30.743 63.299 1.00 127.66 ? -16 DT  I N1    1 
ATOM   7306  C  C2    . DT  J 7  57  ? 19.080  -31.741 62.834 1.00 123.29 ? -16 DT  I C2    1 
ATOM   7307  O  O2    . DT  J 7  57  ? 18.009  -31.526 62.294 1.00 117.06 ? -16 DT  I O2    1 
ATOM   7308  N  N3    . DT  J 7  57  ? 19.559  -33.011 63.019 1.00 126.82 ? -16 DT  I N3    1 
ATOM   7309  C  C4    . DT  J 7  57  ? 20.753  -33.375 63.614 1.00 130.68 ? -16 DT  I C4    1 
ATOM   7310  O  O4    . DT  J 7  57  ? 21.096  -34.547 63.735 1.00 131.94 ? -16 DT  I O4    1 
ATOM   7311  C  C5    . DT  J 7  57  ? 21.568  -32.279 64.084 1.00 131.98 ? -16 DT  I C5    1 
ATOM   7312  C  C7    . DT  J 7  57  ? 22.887  -32.549 64.747 1.00 135.27 ? -16 DT  I C7    1 
ATOM   7313  C  C6    . DT  J 7  57  ? 21.108  -31.030 63.906 1.00 129.85 ? -16 DT  I C6    1 
ATOM   7314  P  P     . DA  J 7  58  ? 18.327  -24.998 64.377 1.00 134.08 ? -15 DA  I P     1 
ATOM   7315  O  OP1   . DA  J 7  58  ? 19.322  -24.107 63.739 1.00 135.45 ? -15 DA  I OP1   1 
ATOM   7316  O  OP2   . DA  J 7  58  ? 18.282  -25.124 65.850 1.00 133.32 ? -15 DA  I OP2   1 
ATOM   7317  O  "O5'" . DA  J 7  58  ? 16.868  -24.576 63.877 1.00 129.47 ? -15 DA  I "O5'" 1 
ATOM   7318  C  "C5'" . DA  J 7  58  ? 16.579  -24.541 62.485 1.00 121.94 ? -15 DA  I "C5'" 1 
ATOM   7319  C  "C4'" . DA  J 7  58  ? 15.410  -25.451 62.154 1.00 117.39 ? -15 DA  I "C4'" 1 
ATOM   7320  O  "O4'" . DA  J 7  58  ? 15.787  -26.832 62.394 1.00 118.70 ? -15 DA  I "O4'" 1 
ATOM   7321  C  "C3'" . DA  J 7  58  ? 14.142  -25.199 62.973 1.00 113.23 ? -15 DA  I "C3'" 1 
ATOM   7322  O  "O3'" . DA  J 7  58  ? 13.010  -25.171 62.114 1.00 110.62 ? -15 DA  I "O3'" 1 
ATOM   7323  C  "C2'" . DA  J 7  58  ? 14.095  -26.383 63.941 1.00 112.25 ? -15 DA  I "C2'" 1 
ATOM   7324  C  "C1'" . DA  J 7  58  ? 14.780  -27.476 63.138 1.00 112.16 ? -15 DA  I "C1'" 1 
ATOM   7325  N  N9    . DA  J 7  58  ? 15.406  -28.499 63.971 1.00 106.98 ? -15 DA  I N9    1 
ATOM   7326  C  C8    . DA  J 7  58  ? 16.198  -28.299 65.068 1.00 107.10 ? -15 DA  I C8    1 
ATOM   7327  N  N7    . DA  J 7  58  ? 16.625  -29.409 65.623 1.00 105.57 ? -15 DA  I N7    1 
ATOM   7328  C  C5    . DA  J 7  58  ? 16.077  -30.406 64.834 1.00 103.53 ? -15 DA  I C5    1 
ATOM   7329  C  C6    . DA  J 7  58  ? 16.153  -31.812 64.893 1.00 101.12 ? -15 DA  I C6    1 
ATOM   7330  N  N6    . DA  J 7  58  ? 16.844  -32.474 65.827 1.00 100.51 ? -15 DA  I N6    1 
ATOM   7331  N  N1    . DA  J 7  58  ? 15.488  -32.513 63.951 1.00 100.63 ? -15 DA  I N1    1 
ATOM   7332  C  C2    . DA  J 7  58  ? 14.796  -31.848 63.019 1.00 100.19 ? -15 DA  I C2    1 
ATOM   7333  N  N3    . DA  J 7  58  ? 14.650  -30.533 62.862 1.00 101.19 ? -15 DA  I N3    1 
ATOM   7334  C  C4    . DA  J 7  58  ? 15.323  -29.863 63.811 1.00 103.96 ? -15 DA  I C4    1 
ATOM   7335  P  P     . DA  J 7  59  ? 11.538  -24.926 62.712 1.00 110.42 ? -14 DA  I P     1 
ATOM   7336  O  OP1   . DA  J 7  59  ? 10.774  -24.151 61.709 1.00 110.81 ? -14 DA  I OP1   1 
ATOM   7337  O  OP2   . DA  J 7  59  ? 11.671  -24.409 64.093 1.00 111.11 ? -14 DA  I OP2   1 
ATOM   7338  O  "O5'" . DA  J 7  59  ? 10.921  -26.396 62.793 1.00 105.57 ? -14 DA  I "O5'" 1 
ATOM   7339  C  "C5'" . DA  J 7  59  ? 10.966  -27.239 61.651 1.00 97.21  ? -14 DA  I "C5'" 1 
ATOM   7340  C  "C4'" . DA  J 7  59  ? 10.604  -28.663 62.020 1.00 87.75  ? -14 DA  I "C4'" 1 
ATOM   7341  O  "O4'" . DA  J 7  59  ? 11.619  -29.211 62.892 1.00 89.60  ? -14 DA  I "O4'" 1 
ATOM   7342  C  "C3'" . DA  J 7  59  ? 9.269   -28.817 62.756 1.00 78.71  ? -14 DA  I "C3'" 1 
ATOM   7343  O  "O3'" . DA  J 7  59  ? 8.410   -29.672 62.017 1.00 75.71  ? -14 DA  I "O3'" 1 
ATOM   7344  C  "C2'" . DA  J 7  59  ? 9.649   -29.423 64.115 1.00 80.02  ? -14 DA  I "C2'" 1 
ATOM   7345  C  "C1'" . DA  J 7  59  ? 11.006  -30.049 63.835 1.00 85.14  ? -14 DA  I "C1'" 1 
ATOM   7346  N  N9    . DA  J 7  59  ? 11.866  -30.122 65.014 1.00 85.31  ? -14 DA  I N9    1 
ATOM   7347  C  C8    . DA  J 7  59  ? 12.261  -29.083 65.811 1.00 86.37  ? -14 DA  I C8    1 
ATOM   7348  N  N7    . DA  J 7  59  ? 13.039  -29.445 66.805 1.00 87.61  ? -14 DA  I N7    1 
ATOM   7349  C  C5    . DA  J 7  59  ? 13.165  -30.814 66.646 1.00 89.10  ? -14 DA  I C5    1 
ATOM   7350  C  C6    . DA  J 7  59  ? 13.864  -31.795 67.379 1.00 90.68  ? -14 DA  I C6    1 
ATOM   7351  N  N6    . DA  J 7  59  ? 14.597  -31.521 68.463 1.00 93.45  ? -14 DA  I N6    1 
ATOM   7352  N  N1    . DA  J 7  59  ? 13.780  -33.073 66.952 1.00 90.31  ? -14 DA  I N1    1 
ATOM   7353  C  C2    . DA  J 7  59  ? 13.044  -33.344 65.867 1.00 88.95  ? -14 DA  I C2    1 
ATOM   7354  N  N3    . DA  J 7  59  ? 12.345  -32.509 65.099 1.00 88.75  ? -14 DA  I N3    1 
ATOM   7355  C  C4    . DA  J 7  59  ? 12.449  -31.248 65.547 1.00 88.63  ? -14 DA  I C4    1 
ATOM   7356  P  P     . DA  J 7  60  ? 6.888   -29.901 62.479 1.00 77.50  ? -13 DA  I P     1 
ATOM   7357  O  OP1   . DA  J 7  60  ? 6.044   -29.852 61.264 1.00 76.79  ? -13 DA  I OP1   1 
ATOM   7358  O  OP2   . DA  J 7  60  ? 6.602   -28.991 63.612 1.00 76.85  ? -13 DA  I OP2   1 
ATOM   7359  O  "O5'" . DA  J 7  60  ? 6.890   -31.401 63.032 1.00 84.55  ? -13 DA  I "O5'" 1 
ATOM   7360  C  "C5'" . DA  J 7  60  ? 7.416   -32.446 62.224 1.00 88.36  ? -13 DA  I "C5'" 1 
ATOM   7361  C  "C4'" . DA  J 7  60  ? 7.641   -33.704 63.044 1.00 89.36  ? -13 DA  I "C4'" 1 
ATOM   7362  O  "O4'" . DA  J 7  60  ? 8.717   -33.485 63.991 1.00 88.53  ? -13 DA  I "O4'" 1 
ATOM   7363  C  "C3'" . DA  J 7  60  ? 6.430   -34.168 63.858 1.00 90.19  ? -13 DA  I "C3'" 1 
ATOM   7364  O  "O3'" . DA  J 7  60  ? 6.165   -35.542 63.595 1.00 92.86  ? -13 DA  I "O3'" 1 
ATOM   7365  C  "C2'" . DA  J 7  60  ? 6.848   -33.935 65.313 1.00 89.42  ? -13 DA  I "C2'" 1 
ATOM   7366  C  "C1'" . DA  J 7  60  ? 8.363   -34.039 65.233 1.00 89.72  ? -13 DA  I "C1'" 1 
ATOM   7367  N  N9    . DA  J 7  60  ? 9.055   -33.295 66.285 1.00 89.45  ? -13 DA  I N9    1 
ATOM   7368  C  C8    . DA  J 7  60  ? 9.068   -31.939 66.463 1.00 89.65  ? -13 DA  I C8    1 
ATOM   7369  N  N7    . DA  J 7  60  ? 9.776   -31.548 67.497 1.00 89.47  ? -13 DA  I N7    1 
ATOM   7370  C  C5    . DA  J 7  60  ? 10.262  -32.728 68.034 1.00 89.96  ? -13 DA  I C5    1 
ATOM   7371  C  C6    . DA  J 7  60  ? 11.083  -32.999 69.147 1.00 93.02  ? -13 DA  I C6    1 
ATOM   7372  N  N6    . DA  J 7  60  ? 11.576  -32.046 69.946 1.00 90.98  ? -13 DA  I N6    1 
ATOM   7373  N  N1    . DA  J 7  60  ? 11.379  -34.291 69.407 1.00 97.23  ? -13 DA  I N1    1 
ATOM   7374  C  C2    . DA  J 7  60  ? 10.883  -35.241 68.605 1.00 97.07  ? -13 DA  I C2    1 
ATOM   7375  N  N3    . DA  J 7  60  ? 10.103  -35.109 67.532 1.00 94.83  ? -13 DA  I N3    1 
ATOM   7376  C  C4    . DA  J 7  60  ? 9.827   -33.815 67.299 1.00 91.05  ? -13 DA  I C4    1 
ATOM   7377  P  P     . DA  J 7  61  ? 4.890   -36.265 64.256 1.00 88.52  ? -12 DA  I P     1 
ATOM   7378  O  OP1   . DA  J 7  61  ? 4.483   -37.373 63.364 1.00 87.67  ? -12 DA  I OP1   1 
ATOM   7379  O  OP2   . DA  J 7  61  ? 3.909   -35.218 64.619 1.00 86.56  ? -12 DA  I OP2   1 
ATOM   7380  O  "O5'" . DA  J 7  61  ? 5.475   -36.885 65.606 1.00 90.86  ? -12 DA  I "O5'" 1 
ATOM   7381  C  "C5'" . DA  J 7  61  ? 6.645   -37.687 65.561 1.00 94.51  ? -12 DA  I "C5'" 1 
ATOM   7382  C  "C4'" . DA  J 7  61  ? 6.961   -38.252 66.931 1.00 101.68 ? -12 DA  I "C4'" 1 
ATOM   7383  O  "O4'" . DA  J 7  61  ? 7.715   -37.279 67.698 1.00 102.21 ? -12 DA  I "O4'" 1 
ATOM   7384  C  "C3'" . DA  J 7  61  ? 5.735   -38.615 67.771 1.00 106.78 ? -12 DA  I "C3'" 1 
ATOM   7385  O  "O3'" . DA  J 7  61  ? 5.897   -39.911 68.328 1.00 115.13 ? -12 DA  I "O3'" 1 
ATOM   7386  C  "C2'" . DA  J 7  61  ? 5.696   -37.532 68.851 1.00 104.43 ? -12 DA  I "C2'" 1 
ATOM   7387  C  "C1'" . DA  J 7  61  ? 7.164   -37.160 68.988 1.00 104.22 ? -12 DA  I "C1'" 1 
ATOM   7388  N  N9    . DA  J 7  61  ? 7.372   -35.789 69.448 1.00 104.80 ? -12 DA  I N9    1 
ATOM   7389  C  C8    . DA  J 7  61  ? 6.883   -34.648 68.877 1.00 103.39 ? -12 DA  I C8    1 
ATOM   7390  N  N7    . DA  J 7  61  ? 7.232   -33.550 69.504 1.00 104.32 ? -12 DA  I N7    1 
ATOM   7391  C  C5    . DA  J 7  61  ? 8.005   -34.002 70.560 1.00 107.14 ? -12 DA  I C5    1 
ATOM   7392  C  C6    . DA  J 7  61  ? 8.676   -33.329 71.600 1.00 111.61 ? -12 DA  I C6    1 
ATOM   7393  N  N6    . DA  J 7  61  ? 8.668   -31.999 71.742 1.00 109.81 ? -12 DA  I N6    1 
ATOM   7394  N  N1    . DA  J 7  61  ? 9.359   -34.079 72.491 1.00 116.64 ? -12 DA  I N1    1 
ATOM   7395  C  C2    . DA  J 7  61  ? 9.364   -35.410 72.345 1.00 116.05 ? -12 DA  I C2    1 
ATOM   7396  N  N3    . DA  J 7  61  ? 8.772   -36.153 71.411 1.00 112.76 ? -12 DA  I N3    1 
ATOM   7397  C  C4    . DA  J 7  61  ? 8.102   -35.381 70.541 1.00 107.82 ? -12 DA  I C4    1 
ATOM   7398  P  P     . DC  J 7  62  ? 4.662   -40.642 69.050 1.00 114.12 ? -11 DC  I P     1 
ATOM   7399  O  OP1   . DC  J 7  62  ? 4.682   -42.061 68.632 1.00 116.98 ? -11 DC  I OP1   1 
ATOM   7400  O  OP2   . DC  J 7  62  ? 3.448   -39.827 68.819 1.00 109.56 ? -11 DC  I OP2   1 
ATOM   7401  O  "O5'" . DC  J 7  62  ? 5.034   -40.553 70.603 1.00 112.27 ? -11 DC  I "O5'" 1 
ATOM   7402  C  "C5'" . DC  J 7  62  ? 6.303   -41.008 71.049 1.00 114.61 ? -11 DC  I "C5'" 1 
ATOM   7403  C  "C4'" . DC  J 7  62  ? 6.526   -40.647 72.505 1.00 121.13 ? -11 DC  I "C4'" 1 
ATOM   7404  O  "O4'" . DC  J 7  62  ? 6.877   -39.244 72.614 1.00 120.63 ? -11 DC  I "O4'" 1 
ATOM   7405  C  "C3'" . DC  J 7  62  ? 5.317   -40.864 73.420 1.00 126.52 ? -11 DC  I "C3'" 1 
ATOM   7406  O  "O3'" . DC  J 7  62  ? 5.709   -41.604 74.570 1.00 136.58 ? -11 DC  I "O3'" 1 
ATOM   7407  C  "C2'" . DC  J 7  62  ? 4.876   -39.444 73.783 1.00 123.00 ? -11 DC  I "C2'" 1 
ATOM   7408  C  "C1'" . DC  J 7  62  ? 6.183   -38.677 73.696 1.00 122.34 ? -11 DC  I "C1'" 1 
ATOM   7409  N  N1    . DC  J 7  62  ? 6.001   -37.222 73.430 1.00 120.14 ? -11 DC  I N1    1 
ATOM   7410  C  C2    . DC  J 7  62  ? 6.664   -36.282 74.228 1.00 121.97 ? -11 DC  I C2    1 
ATOM   7411  O  O2    . DC  J 7  62  ? 7.397   -36.677 75.143 1.00 123.19 ? -11 DC  I O2    1 
ATOM   7412  N  N3    . DC  J 7  62  ? 6.485   -34.962 73.972 1.00 121.30 ? -11 DC  I N3    1 
ATOM   7413  C  C4    . DC  J 7  62  ? 5.686   -34.577 72.975 1.00 116.69 ? -11 DC  I C4    1 
ATOM   7414  N  N4    . DC  J 7  62  ? 5.541   -33.264 72.761 1.00 113.64 ? -11 DC  I N4    1 
ATOM   7415  C  C5    . DC  J 7  62  ? 5.001   -35.520 72.153 1.00 114.42 ? -11 DC  I C5    1 
ATOM   7416  C  C6    . DC  J 7  62  ? 5.185   -36.818 72.414 1.00 115.38 ? -11 DC  I C6    1 
ATOM   7417  P  P     . DG  J 7  63  ? 4.613   -42.094 75.638 1.00 138.64 ? -10 DG  I P     1 
ATOM   7418  O  OP1   . DG  J 7  63  ? 4.953   -43.485 76.012 1.00 143.05 ? -10 DG  I OP1   1 
ATOM   7419  O  OP2   . DG  J 7  63  ? 3.267   -41.792 75.100 1.00 130.79 ? -10 DG  I OP2   1 
ATOM   7420  O  "O5'" . DG  J 7  63  ? 4.870   -41.148 76.902 1.00 141.10 ? -10 DG  I "O5'" 1 
ATOM   7421  C  "C5'" . DG  J 7  63  ? 6.162   -41.100 77.498 1.00 145.20 ? -10 DG  I "C5'" 1 
ATOM   7422  C  "C4'" . DG  J 7  63  ? 6.271   -39.938 78.468 1.00 147.24 ? -10 DG  I "C4'" 1 
ATOM   7423  O  "O4'" . DG  J 7  63  ? 6.146   -38.686 77.744 1.00 145.75 ? -10 DG  I "O4'" 1 
ATOM   7424  C  "C3'" . DG  J 7  63  ? 5.204   -39.910 79.566 1.00 148.07 ? -10 DG  I "C3'" 1 
ATOM   7425  O  "O3'" . DG  J 7  63  ? 5.807   -39.644 80.827 1.00 150.40 ? -10 DG  I "O3'" 1 
ATOM   7426  C  "C2'" . DG  J 7  63  ? 4.274   -38.776 79.137 1.00 146.67 ? -10 DG  I "C2'" 1 
ATOM   7427  C  "C1'" . DG  J 7  63  ? 5.231   -37.847 78.407 1.00 145.85 ? -10 DG  I "C1'" 1 
ATOM   7428  N  N9    . DG  J 7  63  ? 4.572   -37.004 77.413 1.00 144.02 ? -10 DG  I N9    1 
ATOM   7429  C  C8    . DG  J 7  63  ? 3.774   -37.421 76.376 1.00 142.35 ? -10 DG  I C8    1 
ATOM   7430  N  N7    . DG  J 7  63  ? 3.318   -36.443 75.645 1.00 141.70 ? -10 DG  I N7    1 
ATOM   7431  C  C5    . DG  J 7  63  ? 3.848   -35.302 76.234 1.00 143.76 ? -10 DG  I C5    1 
ATOM   7432  C  C6    . DG  J 7  63  ? 3.700   -33.940 75.879 1.00 142.84 ? -10 DG  I C6    1 
ATOM   7433  O  O6    . DG  J 7  63  ? 3.051   -33.458 74.940 1.00 141.25 ? -10 DG  I O6    1 
ATOM   7434  N  N1    . DG  J 7  63  ? 4.405   -33.103 76.741 1.00 145.21 ? -10 DG  I N1    1 
ATOM   7435  C  C2    . DG  J 7  63  ? 5.156   -33.529 77.811 1.00 146.99 ? -10 DG  I C2    1 
ATOM   7436  N  N2    . DG  J 7  63  ? 5.764   -32.573 78.528 1.00 146.76 ? -10 DG  I N2    1 
ATOM   7437  N  N3    . DG  J 7  63  ? 5.302   -34.803 78.155 1.00 148.37 ? -10 DG  I N3    1 
ATOM   7438  C  C4    . DG  J 7  63  ? 4.622   -35.631 77.325 1.00 145.68 ? -10 DG  I C4    1 
ATOM   7439  P  P     . DC  J 7  64  ? 5.040   -40.027 82.186 1.00 152.20 ? -9  DC  I P     1 
ATOM   7440  O  OP1   . DC  J 7  64  ? 5.963   -40.839 83.010 1.00 160.04 ? -9  DC  I OP1   1 
ATOM   7441  O  OP2   . DC  J 7  64  ? 3.711   -40.564 81.816 1.00 144.52 ? -9  DC  I OP2   1 
ATOM   7442  O  "O5'" . DC  J 7  64  ? 4.812   -38.619 82.908 1.00 155.64 ? -9  DC  I "O5'" 1 
ATOM   7443  C  "C5'" . DC  J 7  64  ? 5.930   -37.843 83.324 1.00 158.94 ? -9  DC  I "C5'" 1 
ATOM   7444  C  "C4'" . DC  J 7  64  ? 5.548   -36.380 83.442 1.00 156.20 ? -9  DC  I "C4'" 1 
ATOM   7445  O  "O4'" . DC  J 7  64  ? 5.078   -35.914 82.167 1.00 153.59 ? -9  DC  I "O4'" 1 
ATOM   7446  C  "C3'" . DC  J 7  64  ? 4.416   -36.093 84.423 1.00 154.46 ? -9  DC  I "C3'" 1 
ATOM   7447  O  "O3'" . DC  J 7  64  ? 4.951   -35.629 85.660 1.00 156.05 ? -9  DC  I "O3'" 1 
ATOM   7448  C  "C2'" . DC  J 7  64  ? 3.564   -35.010 83.734 1.00 153.70 ? -9  DC  I "C2'" 1 
ATOM   7449  C  "C1'" . DC  J 7  64  ? 4.229   -34.816 82.368 1.00 152.32 ? -9  DC  I "C1'" 1 
ATOM   7450  N  N1    . DC  J 7  64  ? 3.260   -34.765 81.235 1.00 148.96 ? -9  DC  I N1    1 
ATOM   7451  C  C2    . DC  J 7  64  ? 2.967   -33.539 80.628 1.00 147.56 ? -9  DC  I C2    1 
ATOM   7452  O  O2    . DC  J 7  64  ? 3.515   -32.512 81.046 1.00 147.76 ? -9  DC  I O2    1 
ATOM   7453  N  N3    . DC  J 7  64  ? 2.086   -33.512 79.597 1.00 145.60 ? -9  DC  I N3    1 
ATOM   7454  C  C4    . DC  J 7  64  ? 1.515   -34.642 79.175 1.00 145.67 ? -9  DC  I C4    1 
ATOM   7455  N  N4    . DC  J 7  64  ? 0.654   -34.565 78.155 1.00 145.21 ? -9  DC  I N4    1 
ATOM   7456  C  C5    . DC  J 7  64  ? 1.804   -35.902 79.781 1.00 144.53 ? -9  DC  I C5    1 
ATOM   7457  C  C6    . DC  J 7  64  ? 2.673   -35.916 80.796 1.00 146.74 ? -9  DC  I C6    1 
ATOM   7458  P  P     . DG  J 7  65  ? 4.075   -35.709 87.005 1.00 158.93 ? -8  DG  I P     1 
ATOM   7459  O  OP1   . DG  J 7  65  ? 5.006   -35.637 88.153 1.00 161.48 ? -8  DG  I OP1   1 
ATOM   7460  O  OP2   . DG  J 7  65  ? 3.154   -36.860 86.875 1.00 159.84 ? -8  DG  I OP2   1 
ATOM   7461  O  "O5'" . DG  J 7  65  ? 3.196   -34.373 86.971 1.00 156.73 ? -8  DG  I "O5'" 1 
ATOM   7462  C  "C5'" . DG  J 7  65  ? 3.837   -33.103 86.954 1.00 152.50 ? -8  DG  I "C5'" 1 
ATOM   7463  C  "C4'" . DG  J 7  65  ? 2.850   -32.002 86.610 1.00 144.30 ? -8  DG  I "C4'" 1 
ATOM   7464  O  "O4'" . DG  J 7  65  ? 2.377   -32.178 85.250 1.00 142.05 ? -8  DG  I "O4'" 1 
ATOM   7465  C  "C3'" . DG  J 7  65  ? 1.600   -31.949 87.497 1.00 141.62 ? -8  DG  I "C3'" 1 
ATOM   7466  O  "O3'" . DG  J 7  65  ? 1.407   -30.627 87.985 1.00 139.94 ? -8  DG  I "O3'" 1 
ATOM   7467  C  "C2'" . DG  J 7  65  ? 0.467   -32.377 86.560 1.00 141.86 ? -8  DG  I "C2'" 1 
ATOM   7468  C  "C1'" . DG  J 7  65  ? 0.995   -31.927 85.209 1.00 144.19 ? -8  DG  I "C1'" 1 
ATOM   7469  N  N9    . DG  J 7  65  ? 0.418   -32.660 84.085 1.00 148.79 ? -8  DG  I N9    1 
ATOM   7470  C  C8    . DG  J 7  65  ? 0.222   -34.017 83.995 1.00 152.01 ? -8  DG  I C8    1 
ATOM   7471  N  N7    . DG  J 7  65  ? -0.318  -34.391 82.868 1.00 149.81 ? -8  DG  I N7    1 
ATOM   7472  C  C5    . DG  J 7  65  ? -0.492  -33.206 82.165 1.00 148.12 ? -8  DG  I C5    1 
ATOM   7473  C  C6    . DG  J 7  65  ? -1.034  -32.981 80.877 1.00 148.77 ? -8  DG  I C6    1 
ATOM   7474  O  O6    . DG  J 7  65  ? -1.483  -33.814 80.077 1.00 148.41 ? -8  DG  I O6    1 
ATOM   7475  N  N1    . DG  J 7  65  ? -1.026  -31.629 80.543 1.00 150.03 ? -8  DG  I N1    1 
ATOM   7476  C  C2    . DG  J 7  65  ? -0.555  -30.622 81.352 1.00 150.32 ? -8  DG  I C2    1 
ATOM   7477  N  N2    . DG  J 7  65  ? -0.631  -29.377 80.856 1.00 148.24 ? -8  DG  I N2    1 
ATOM   7478  N  N3    . DG  J 7  65  ? -0.044  -30.819 82.561 1.00 149.41 ? -8  DG  I N3    1 
ATOM   7479  C  C4    . DG  J 7  65  ? -0.045  -32.131 82.901 1.00 147.88 ? -8  DG  I C4    1 
ATOM   7480  P  P     . DG  J 7  66  ? 0.373   -30.344 89.183 1.00 143.55 ? -7  DG  I P     1 
ATOM   7481  O  OP1   . DG  J 7  66  ? 1.090   -29.558 90.211 1.00 146.96 ? -7  DG  I OP1   1 
ATOM   7482  O  OP2   . DG  J 7  66  ? -0.267  -31.626 89.554 1.00 144.03 ? -7  DG  I OP2   1 
ATOM   7483  O  "O5'" . DG  J 7  66  ? -0.743  -29.413 88.512 1.00 143.13 ? -7  DG  I "O5'" 1 
ATOM   7484  C  "C5'" . DG  J 7  66  ? -0.375  -28.156 87.954 1.00 142.93 ? -7  DG  I "C5'" 1 
ATOM   7485  C  "C4'" . DG  J 7  66  ? -1.463  -27.625 87.033 1.00 139.64 ? -7  DG  I "C4'" 1 
ATOM   7486  O  "O4'" . DG  J 7  66  ? -1.681  -28.560 85.942 1.00 137.08 ? -7  DG  I "O4'" 1 
ATOM   7487  C  "C3'" . DG  J 7  66  ? -2.829  -27.415 87.689 1.00 141.02 ? -7  DG  I "C3'" 1 
ATOM   7488  O  "O3'" . DG  J 7  66  ? -3.426  -26.229 87.185 1.00 140.13 ? -7  DG  I "O3'" 1 
ATOM   7489  C  "C2'" . DG  J 7  66  ? -3.607  -28.653 87.251 1.00 139.87 ? -7  DG  I "C2'" 1 
ATOM   7490  C  "C1'" . DG  J 7  66  ? -3.056  -28.856 85.850 1.00 137.12 ? -7  DG  I "C1'" 1 
ATOM   7491  N  N9    . DG  J 7  66  ? -3.209  -30.218 85.347 1.00 139.05 ? -7  DG  I N9    1 
ATOM   7492  C  C8    . DG  J 7  66  ? -3.123  -31.383 86.070 1.00 143.15 ? -7  DG  I C8    1 
ATOM   7493  N  N7    . DG  J 7  66  ? -3.305  -32.456 85.350 1.00 140.80 ? -7  DG  I N7    1 
ATOM   7494  C  C5    . DG  J 7  66  ? -3.523  -31.971 84.066 1.00 138.25 ? -7  DG  I C5    1 
ATOM   7495  C  C6    . DG  J 7  66  ? -3.778  -32.666 82.860 1.00 136.29 ? -7  DG  I C6    1 
ATOM   7496  O  O6    . DG  J 7  66  ? -3.864  -33.889 82.681 1.00 138.55 ? -7  DG  I O6    1 
ATOM   7497  N  N1    . DG  J 7  66  ? -3.941  -31.792 81.787 1.00 131.97 ? -7  DG  I N1    1 
ATOM   7498  C  C2    . DG  J 7  66  ? -3.867  -30.422 81.870 1.00 131.61 ? -7  DG  I C2    1 
ATOM   7499  N  N2    . DG  J 7  66  ? -4.050  -29.746 80.726 1.00 125.78 ? -7  DG  I N2    1 
ATOM   7500  N  N3    . DG  J 7  66  ? -3.628  -29.759 82.994 1.00 136.35 ? -7  DG  I N3    1 
ATOM   7501  C  C4    . DG  J 7  66  ? -3.467  -30.595 84.048 1.00 138.09 ? -7  DG  I C4    1 
ATOM   7502  P  P     . DG  J 7  67  ? -3.535  -24.917 88.105 1.00 141.59 ? -6  DG  I P     1 
ATOM   7503  O  OP1   . DG  J 7  67  ? -2.164  -24.532 88.508 1.00 144.83 ? -6  DG  I OP1   1 
ATOM   7504  O  OP2   . DG  J 7  67  ? -4.564  -25.174 89.138 1.00 143.34 ? -6  DG  I OP2   1 
ATOM   7505  O  "O5'" . DG  J 7  67  ? -4.108  -23.804 87.109 1.00 136.17 ? -6  DG  I "O5'" 1 
ATOM   7506  C  "C5'" . DG  J 7  67  ? -3.388  -23.472 85.926 1.00 133.30 ? -6  DG  I "C5'" 1 
ATOM   7507  C  "C4'" . DG  J 7  67  ? -4.293  -23.520 84.706 1.00 128.63 ? -6  DG  I "C4'" 1 
ATOM   7508  O  "O4'" . DG  J 7  67  ? -4.634  -24.900 84.404 1.00 130.40 ? -6  DG  I "O4'" 1 
ATOM   7509  C  "C3'" . DG  J 7  67  ? -5.617  -22.775 84.849 1.00 126.69 ? -6  DG  I "C3'" 1 
ATOM   7510  O  "O3'" . DG  J 7  67  ? -5.933  -22.117 83.633 1.00 122.13 ? -6  DG  I "O3'" 1 
ATOM   7511  C  "C2'" . DG  J 7  67  ? -6.614  -23.890 85.159 1.00 129.20 ? -6  DG  I "C2'" 1 
ATOM   7512  C  "C1'" . DG  J 7  67  ? -6.036  -25.054 84.366 1.00 131.01 ? -6  DG  I "C1'" 1 
ATOM   7513  N  N9    . DG  J 7  67  ? -6.367  -26.359 84.931 1.00 137.42 ? -6  DG  I N9    1 
ATOM   7514  C  C8    . DG  J 7  67  ? -6.462  -26.683 86.263 1.00 143.21 ? -6  DG  I C8    1 
ATOM   7515  N  N7    . DG  J 7  67  ? -6.772  -27.931 86.474 1.00 144.36 ? -6  DG  I N7    1 
ATOM   7516  C  C5    . DG  J 7  67  ? -6.888  -28.473 85.201 1.00 141.07 ? -6  DG  I C5    1 
ATOM   7517  C  C6    . DG  J 7  67  ? -7.207  -29.792 84.797 1.00 140.86 ? -6  DG  I C6    1 
ATOM   7518  O  O6    . DG  J 7  67  ? -7.457  -30.774 85.510 1.00 143.80 ? -6  DG  I O6    1 
ATOM   7519  N  N1    . DG  J 7  67  ? -7.219  -29.917 83.410 1.00 136.67 ? -6  DG  I N1    1 
ATOM   7520  C  C2    . DG  J 7  67  ? -6.957  -28.897 82.526 1.00 134.59 ? -6  DG  I C2    1 
ATOM   7521  N  N2    . DG  J 7  67  ? -7.017  -29.211 81.223 1.00 132.31 ? -6  DG  I N2    1 
ATOM   7522  N  N3    . DG  J 7  67  ? -6.657  -27.656 82.891 1.00 134.43 ? -6  DG  I N3    1 
ATOM   7523  C  C4    . DG  J 7  67  ? -6.641  -27.518 84.239 1.00 137.17 ? -6  DG  I C4    1 
ATOM   7524  P  P     . DG  J 7  68  ? -6.810  -20.772 83.645 1.00 122.81 ? -5  DG  I P     1 
ATOM   7525  O  OP1   . DG  J 7  68  ? -5.968  -19.685 83.101 1.00 119.91 ? -5  DG  I OP1   1 
ATOM   7526  O  OP2   . DG  J 7  68  ? -7.419  -20.638 84.987 1.00 128.67 ? -5  DG  I OP2   1 
ATOM   7527  O  "O5'" . DG  J 7  68  ? -7.984  -21.080 82.607 1.00 123.07 ? -5  DG  I "O5'" 1 
ATOM   7528  C  "C5'" . DG  J 7  68  ? -7.669  -21.576 81.314 1.00 120.50 ? -5  DG  I "C5'" 1 
ATOM   7529  C  "C4'" . DG  J 7  68  ? -8.791  -22.448 80.784 1.00 116.15 ? -5  DG  I "C4'" 1 
ATOM   7530  O  "O4'" . DG  J 7  68  ? -8.826  -23.702 81.519 1.00 115.16 ? -5  DG  I "O4'" 1 
ATOM   7531  C  "C3'" . DG  J 7  68  ? -10.192 -21.846 80.912 1.00 115.21 ? -5  DG  I "C3'" 1 
ATOM   7532  O  "O3'" . DG  J 7  68  ? -10.941 -22.133 79.748 1.00 111.70 ? -5  DG  I "O3'" 1 
ATOM   7533  C  "C2'" . DG  J 7  68  ? -10.762 -22.572 82.126 1.00 117.38 ? -5  DG  I "C2'" 1 
ATOM   7534  C  "C1'" . DG  J 7  68  ? -10.146 -23.946 81.943 1.00 118.44 ? -5  DG  I "C1'" 1 
ATOM   7535  N  N9    . DG  J 7  68  ? -10.112 -24.746 83.163 1.00 128.24 ? -5  DG  I N9    1 
ATOM   7536  C  C8    . DG  J 7  68  ? -10.041 -24.288 84.456 1.00 132.19 ? -5  DG  I C8    1 
ATOM   7537  N  N7    . DG  J 7  68  ? -10.031 -25.243 85.345 1.00 134.56 ? -5  DG  I N7    1 
ATOM   7538  C  C5    . DG  J 7  68  ? -10.100 -26.409 84.592 1.00 134.46 ? -5  DG  I C5    1 
ATOM   7539  C  C6    . DG  J 7  68  ? -10.123 -27.762 85.005 1.00 137.34 ? -5  DG  I C6    1 
ATOM   7540  O  O6    . DG  J 7  68  ? -10.084 -28.214 86.158 1.00 144.34 ? -5  DG  I O6    1 
ATOM   7541  N  N1    . DG  J 7  68  ? -10.197 -28.631 83.919 1.00 135.23 ? -5  DG  I N1    1 
ATOM   7542  C  C2    . DG  J 7  68  ? -10.245 -28.241 82.601 1.00 133.37 ? -5  DG  I C2    1 
ATOM   7543  N  N2    . DG  J 7  68  ? -10.315 -29.224 81.692 1.00 133.55 ? -5  DG  I N2    1 
ATOM   7544  N  N3    . DG  J 7  68  ? -10.225 -26.977 82.201 1.00 131.44 ? -5  DG  I N3    1 
ATOM   7545  C  C4    . DG  J 7  68  ? -10.152 -26.119 83.247 1.00 131.89 ? -5  DG  I C4    1 
ATOM   7546  P  P     . DG  J 7  69  ? -11.281 -20.969 78.698 1.00 113.61 ? -4  DG  I P     1 
ATOM   7547  O  OP1   . DG  J 7  69  ? -10.002 -20.526 78.097 1.00 111.59 ? -4  DG  I OP1   1 
ATOM   7548  O  OP2   . DG  J 7  69  ? -12.159 -19.990 79.378 1.00 117.25 ? -4  DG  I OP2   1 
ATOM   7549  O  "O5'" . DG  J 7  69  ? -12.141 -21.715 77.576 1.00 115.20 ? -4  DG  I "O5'" 1 
ATOM   7550  C  "C5'" . DG  J 7  69  ? -11.525 -22.693 76.751 1.00 113.11 ? -4  DG  I "C5'" 1 
ATOM   7551  C  "C4'" . DG  J 7  69  ? -12.208 -24.042 76.895 1.00 110.63 ? -4  DG  I "C4'" 1 
ATOM   7552  O  "O4'" . DG  J 7  69  ? -12.090 -24.514 78.261 1.00 114.82 ? -4  DG  I "O4'" 1 
ATOM   7553  C  "C3'" . DG  J 7  69  ? -13.705 -24.059 76.563 1.00 105.28 ? -4  DG  I "C3'" 1 
ATOM   7554  O  "O3'" . DG  J 7  69  ? -13.967 -25.048 75.577 1.00 98.73  ? -4  DG  I "O3'" 1 
ATOM   7555  C  "C2'" . DG  J 7  69  ? -14.376 -24.402 77.898 1.00 110.11 ? -4  DG  I "C2'" 1 
ATOM   7556  C  "C1'" . DG  J 7  69  ? -13.281 -25.170 78.611 1.00 116.90 ? -4  DG  I "C1'" 1 
ATOM   7557  N  N9    . DG  J 7  69  ? -13.416 -25.159 80.064 1.00 128.43 ? -4  DG  I N9    1 
ATOM   7558  C  C8    . DG  J 7  69  ? -13.546 -24.057 80.875 1.00 133.23 ? -4  DG  I C8    1 
ATOM   7559  N  N7    . DG  J 7  69  ? -13.652 -24.352 82.141 1.00 137.00 ? -4  DG  I N7    1 
ATOM   7560  C  C5    . DG  J 7  69  ? -13.593 -25.739 82.172 1.00 138.11 ? -4  DG  I C5    1 
ATOM   7561  C  C6    . DG  J 7  69  ? -13.658 -26.629 83.271 1.00 143.53 ? -4  DG  I C6    1 
ATOM   7562  O  O6    . DG  J 7  69  ? -13.784 -26.357 84.473 1.00 145.71 ? -4  DG  I O6    1 
ATOM   7563  N  N1    . DG  J 7  69  ? -13.560 -27.958 82.864 1.00 145.70 ? -4  DG  I N1    1 
ATOM   7564  C  C2    . DG  J 7  69  ? -13.418 -28.373 81.560 1.00 142.42 ? -4  DG  I C2    1 
ATOM   7565  N  N2    . DG  J 7  69  ? -13.340 -29.697 81.364 1.00 143.56 ? -4  DG  I N2    1 
ATOM   7566  N  N3    . DG  J 7  69  ? -13.355 -27.549 80.522 1.00 136.47 ? -4  DG  I N3    1 
ATOM   7567  C  C4    . DG  J 7  69  ? -13.450 -26.251 80.902 1.00 134.23 ? -4  DG  I C4    1 
ATOM   7568  P  P     . DA  J 7  70  ? -15.399 -25.119 74.852 1.00 95.32  ? -3  DA  I P     1 
ATOM   7569  O  OP1   . DA  J 7  70  ? -15.168 -25.022 73.395 1.00 97.07  ? -3  DA  I OP1   1 
ATOM   7570  O  OP2   . DA  J 7  70  ? -16.313 -24.159 75.510 1.00 97.05  ? -3  DA  I OP2   1 
ATOM   7571  O  "O5'" . DA  J 7  70  ? -15.915 -26.593 75.183 1.00 93.38  ? -3  DA  I "O5'" 1 
ATOM   7572  C  "C5'" . DA  J 7  70  ? -15.149 -27.722 74.776 1.00 92.50  ? -3  DA  I "C5'" 1 
ATOM   7573  C  "C4'" . DA  J 7  70  ? -15.774 -29.010 75.283 1.00 93.69  ? -3  DA  I "C4'" 1 
ATOM   7574  O  "O4'" . DA  J 7  70  ? -15.654 -29.072 76.727 1.00 95.97  ? -3  DA  I "O4'" 1 
ATOM   7575  C  "C3'" . DA  J 7  70  ? -17.259 -29.171 74.975 1.00 94.08  ? -3  DA  I "C3'" 1 
ATOM   7576  O  "O3'" . DA  J 7  70  ? -17.560 -30.533 74.717 1.00 95.19  ? -3  DA  I "O3'" 1 
ATOM   7577  C  "C2'" . DA  J 7  70  ? -17.933 -28.680 76.252 1.00 96.50  ? -3  DA  I "C2'" 1 
ATOM   7578  C  "C1'" . DA  J 7  70  ? -16.935 -29.102 77.325 1.00 98.98  ? -3  DA  I "C1'" 1 
ATOM   7579  N  N9    . DA  J 7  70  ? -16.922 -28.209 78.479 1.00 102.04 ? -3  DA  I N9    1 
ATOM   7580  C  C8    . DA  J 7  70  ? -16.827 -26.846 78.463 1.00 101.77 ? -3  DA  I C8    1 
ATOM   7581  N  N7    . DA  J 7  70  ? -16.840 -26.300 79.656 1.00 102.94 ? -3  DA  I N7    1 
ATOM   7582  C  C5    . DA  J 7  70  ? -16.950 -27.381 80.515 1.00 104.99 ? -3  DA  I C5    1 
ATOM   7583  C  C6    . DA  J 7  70  ? -17.016 -27.474 81.918 1.00 110.65 ? -3  DA  I C6    1 
ATOM   7584  N  N6    . DA  J 7  70  ? -16.976 -26.411 82.729 1.00 112.56 ? -3  DA  I N6    1 
ATOM   7585  N  N1    . DA  J 7  70  ? -17.123 -28.706 82.459 1.00 114.04 ? -3  DA  I N1    1 
ATOM   7586  C  C2    . DA  J 7  70  ? -17.162 -29.768 81.644 1.00 110.55 ? -3  DA  I C2    1 
ATOM   7587  N  N3    . DA  J 7  70  ? -17.108 -29.805 80.313 1.00 106.32 ? -3  DA  I N3    1 
ATOM   7588  C  C4    . DA  J 7  70  ? -17.002 -28.566 79.806 1.00 104.22 ? -3  DA  I C4    1 
ATOM   7589  P  P     . DC  J 7  71  ? -19.003 -30.941 74.142 1.00 96.36  ? -2  DC  I P     1 
ATOM   7590  O  OP1   . DC  J 7  71  ? -18.857 -32.243 73.452 1.00 96.56  ? -2  DC  I OP1   1 
ATOM   7591  O  OP2   . DC  J 7  71  ? -19.537 -29.774 73.405 1.00 91.92  ? -2  DC  I OP2   1 
ATOM   7592  O  "O5'" . DC  J 7  71  ? -19.896 -31.142 75.456 1.00 105.21 ? -2  DC  I "O5'" 1 
ATOM   7593  C  "C5'" . DC  J 7  71  ? -19.474 -32.050 76.470 1.00 111.35 ? -2  DC  I "C5'" 1 
ATOM   7594  C  "C4'" . DC  J 7  71  ? -20.433 -32.039 77.650 1.00 116.43 ? -2  DC  I "C4'" 1 
ATOM   7595  O  "O4'" . DC  J 7  71  ? -20.062 -30.987 78.583 1.00 118.14 ? -2  DC  I "O4'" 1 
ATOM   7596  C  "C3'" . DC  J 7  71  ? -21.904 -31.790 77.295 1.00 117.82 ? -2  DC  I "C3'" 1 
ATOM   7597  O  "O3'" . DC  J 7  71  ? -22.732 -32.635 78.077 1.00 121.81 ? -2  DC  I "O3'" 1 
ATOM   7598  C  "C2'" . DC  J 7  71  ? -22.097 -30.326 77.684 1.00 117.87 ? -2  DC  I "C2'" 1 
ATOM   7599  C  "C1'" . DC  J 7  71  ? -21.216 -30.253 78.919 1.00 120.05 ? -2  DC  I "C1'" 1 
ATOM   7600  N  N1    . DC  J 7  71  ? -20.820 -28.867 79.302 1.00 120.91 ? -2  DC  I N1    1 
ATOM   7601  C  C2    . DC  J 7  71  ? -20.575 -28.567 80.647 1.00 123.09 ? -2  DC  I C2    1 
ATOM   7602  O  O2    . DC  J 7  71  ? -20.684 -29.462 81.495 1.00 123.48 ? -2  DC  I O2    1 
ATOM   7603  N  N3    . DC  J 7  71  ? -20.219 -27.302 80.983 1.00 124.57 ? -2  DC  I N3    1 
ATOM   7604  C  C4    . DC  J 7  71  ? -20.112 -26.366 80.039 1.00 124.14 ? -2  DC  I C4    1 
ATOM   7605  N  N4    . DC  J 7  71  ? -19.760 -25.133 80.418 1.00 127.42 ? -2  DC  I N4    1 
ATOM   7606  C  C5    . DC  J 7  71  ? -20.362 -26.652 78.664 1.00 120.38 ? -2  DC  I C5    1 
ATOM   7607  C  C6    . DC  J 7  71  ? -20.711 -27.902 78.344 1.00 119.38 ? -2  DC  I C6    1 
ATOM   7608  P  P     . DA  J 7  72  ? -23.598 -33.801 77.389 1.00 121.68 ? -1  DA  I P     1 
ATOM   7609  O  OP1   . DA  J 7  72  ? -22.652 -34.795 76.834 1.00 119.12 ? -1  DA  I OP1   1 
ATOM   7610  O  OP2   . DA  J 7  72  ? -24.603 -33.164 76.509 1.00 116.98 ? -1  DA  I OP2   1 
ATOM   7611  O  "O5'" . DA  J 7  72  ? -24.371 -34.464 78.622 1.00 129.82 ? -1  DA  I "O5'" 1 
ATOM   7612  C  "C5'" . DA  J 7  72  ? -23.637 -34.923 79.752 1.00 138.17 ? -1  DA  I "C5'" 1 
ATOM   7613  C  "C4'" . DA  J 7  72  ? -24.103 -34.231 81.023 1.00 144.88 ? -1  DA  I "C4'" 1 
ATOM   7614  O  "O4'" . DA  J 7  72  ? -23.663 -32.854 81.024 1.00 144.94 ? -1  DA  I "O4'" 1 
ATOM   7615  C  "C3'" . DA  J 7  72  ? -25.622 -34.195 81.226 1.00 148.40 ? -1  DA  I "C3'" 1 
ATOM   7616  O  "O3'" . DA  J 7  72  ? -25.969 -34.901 82.409 1.00 156.41 ? -1  DA  I "O3'" 1 
ATOM   7617  C  "C2'" . DA  J 7  72  ? -25.960 -32.699 81.339 1.00 145.54 ? -1  DA  I "C2'" 1 
ATOM   7618  C  "C1'" . DA  J 7  72  ? -24.619 -32.084 81.704 1.00 145.72 ? -1  DA  I "C1'" 1 
ATOM   7619  N  N9    . DA  J 7  72  ? -24.481 -30.692 81.284 1.00 144.92 ? -1  DA  I N9    1 
ATOM   7620  C  C8    . DA  J 7  72  ? -24.600 -30.200 80.014 1.00 142.61 ? -1  DA  I C8    1 
ATOM   7621  N  N7    . DA  J 7  72  ? -24.426 -28.902 79.931 1.00 142.25 ? -1  DA  I N7    1 
ATOM   7622  C  C5    . DA  J 7  72  ? -24.176 -28.515 81.238 1.00 144.68 ? -1  DA  I C5    1 
ATOM   7623  C  C6    . DA  J 7  72  ? -23.910 -27.261 81.823 1.00 144.91 ? -1  DA  I C6    1 
ATOM   7624  N  N6    . DA  J 7  72  ? -23.849 -26.121 81.126 1.00 143.40 ? -1  DA  I N6    1 
ATOM   7625  N  N1    . DA  J 7  72  ? -23.707 -27.224 83.157 1.00 146.55 ? -1  DA  I N1    1 
ATOM   7626  C  C2    . DA  J 7  72  ? -23.769 -28.366 83.851 1.00 148.21 ? -1  DA  I C2    1 
ATOM   7627  N  N3    . DA  J 7  72  ? -24.010 -29.602 83.413 1.00 148.64 ? -1  DA  I N3    1 
ATOM   7628  C  C4    . DA  J 7  72  ? -24.207 -29.607 82.085 1.00 146.51 ? -1  DA  I C4    1 
ATOM   7629  P  P     . DG  J 7  73  ? -27.510 -35.074 82.828 1.00 162.14 ? 0   DG  I P     1 
ATOM   7630  O  OP1   . DG  J 7  73  ? -27.625 -36.341 83.583 1.00 167.84 ? 0   DG  I OP1   1 
ATOM   7631  O  OP2   . DG  J 7  73  ? -28.337 -34.859 81.620 1.00 155.80 ? 0   DG  I OP2   1 
ATOM   7632  O  "O5'" . DG  J 7  73  ? -27.771 -33.853 83.828 1.00 168.44 ? 0   DG  I "O5'" 1 
ATOM   7633  C  "C5'" . DG  J 7  73  ? -26.954 -33.695 84.982 1.00 173.83 ? 0   DG  I "C5'" 1 
ATOM   7634  C  "C4'" . DG  J 7  73  ? -27.384 -32.481 85.786 1.00 179.14 ? 0   DG  I "C4'" 1 
ATOM   7635  O  "O4'" . DG  J 7  73  ? -26.902 -31.274 85.144 1.00 178.84 ? 0   DG  I "O4'" 1 
ATOM   7636  C  "C3'" . DG  J 7  73  ? -28.899 -32.314 85.941 1.00 182.84 ? 0   DG  I "C3'" 1 
ATOM   7637  O  "O3'" . DG  J 7  73  ? -29.232 -32.143 87.311 1.00 189.71 ? 0   DG  I "O3'" 1 
ATOM   7638  C  "C2'" . DG  J 7  73  ? -29.220 -31.062 85.119 1.00 180.85 ? 0   DG  I "C2'" 1 
ATOM   7639  C  "C1'" . DG  J 7  73  ? -27.910 -30.296 85.182 1.00 180.70 ? 0   DG  I "C1'" 1 
ATOM   7640  N  N9    . DG  J 7  73  ? -27.714 -29.386 84.057 1.00 180.06 ? 0   DG  I N9    1 
ATOM   7641  C  C8    . DG  J 7  73  ? -27.783 -29.697 82.720 1.00 177.81 ? 0   DG  I C8    1 
ATOM   7642  N  N7    . DG  J 7  73  ? -27.564 -28.678 81.937 1.00 176.22 ? 0   DG  I N7    1 
ATOM   7643  C  C5    . DG  J 7  73  ? -27.333 -27.622 82.809 1.00 178.50 ? 0   DG  I C5    1 
ATOM   7644  C  C6    . DG  J 7  73  ? -27.039 -26.264 82.538 1.00 178.16 ? 0   DG  I C6    1 
ATOM   7645  O  O6    . DG  J 7  73  ? -26.921 -25.708 81.437 1.00 175.07 ? 0   DG  I O6    1 
ATOM   7646  N  N1    . DG  J 7  73  ? -26.877 -25.528 83.710 1.00 181.17 ? 0   DG  I N1    1 
ATOM   7647  C  C2    . DG  J 7  73  ? -26.986 -26.040 84.981 1.00 183.70 ? 0   DG  I C2    1 
ATOM   7648  N  N2    . DG  J 7  73  ? -26.797 -25.175 85.988 1.00 185.55 ? 0   DG  I N2    1 
ATOM   7649  N  N3    . DG  J 7  73  ? -27.262 -27.311 85.249 1.00 184.24 ? 0   DG  I N3    1 
ATOM   7650  C  C4    . DG  J 7  73  ? -27.422 -28.041 84.118 1.00 181.22 ? 0   DG  I C4    1 
ATOM   7651  P  P     . DC  J 7  74  ? -30.771 -32.054 87.763 1.00 195.87 ? 1   DC  I P     1 
ATOM   7652  O  OP1   . DC  J 7  74  ? -30.853 -32.507 89.169 1.00 201.25 ? 1   DC  I OP1   1 
ATOM   7653  O  OP2   . DC  J 7  74  ? -31.585 -32.725 86.725 1.00 192.93 ? 1   DC  I OP2   1 
ATOM   7654  O  "O5'" . DC  J 7  74  ? -31.095 -30.489 87.705 1.00 198.65 ? 1   DC  I "O5'" 1 
ATOM   7655  C  "C5'" . DC  J 7  74  ? -30.267 -29.569 88.406 1.00 201.74 ? 1   DC  I "C5'" 1 
ATOM   7656  C  "C4'" . DC  J 7  74  ? -30.735 -28.143 88.184 1.00 202.00 ? 1   DC  I "C4'" 1 
ATOM   7657  O  "O4'" . DC  J 7  74  ? -30.223 -27.649 86.923 1.00 197.51 ? 1   DC  I "O4'" 1 
ATOM   7658  C  "C3'" . DC  J 7  74  ? -32.257 -27.962 88.132 1.00 205.67 ? 1   DC  I "C3'" 1 
ATOM   7659  O  "O3'" . DC  J 7  74  ? -32.663 -26.995 89.088 1.00 213.76 ? 1   DC  I "O3'" 1 
ATOM   7660  C  "C2'" . DC  J 7  74  ? -32.528 -27.487 86.699 1.00 199.60 ? 1   DC  I "C2'" 1 
ATOM   7661  C  "C1'" . DC  J 7  74  ? -31.204 -26.843 86.326 1.00 195.34 ? 1   DC  I "C1'" 1 
ATOM   7662  N  N1    . DC  J 7  74  ? -30.955 -26.795 84.857 1.00 188.29 ? 1   DC  I N1    1 
ATOM   7663  C  C2    . DC  J 7  74  ? -30.712 -25.565 84.236 1.00 186.70 ? 1   DC  I C2    1 
ATOM   7664  O  O2    . DC  J 7  74  ? -30.705 -24.535 84.920 1.00 190.24 ? 1   DC  I O2    1 
ATOM   7665  N  N3    . DC  J 7  74  ? -30.488 -25.538 82.899 1.00 182.04 ? 1   DC  I N3    1 
ATOM   7666  C  C4    . DC  J 7  74  ? -30.504 -26.671 82.196 1.00 180.39 ? 1   DC  I C4    1 
ATOM   7667  N  N4    . DC  J 7  74  ? -30.279 -26.594 80.880 1.00 178.78 ? 1   DC  I N4    1 
ATOM   7668  C  C5    . DC  J 7  74  ? -30.752 -27.934 82.811 1.00 180.95 ? 1   DC  I C5    1 
ATOM   7669  C  C6    . DC  J 7  74  ? -30.970 -27.949 84.130 1.00 184.69 ? 1   DC  I C6    1 
ATOM   7670  P  P     . DG  J 7  75  ? -34.048 -27.175 89.883 1.00 213.48 ? 2   DG  I P     1 
ATOM   7671  O  OP1   . DG  J 7  75  ? -33.731 -27.674 91.239 1.00 216.83 ? 2   DG  I OP1   1 
ATOM   7672  O  OP2   . DG  J 7  75  ? -34.969 -27.939 89.013 1.00 211.48 ? 2   DG  I OP2   1 
ATOM   7673  O  "O5'" . DG  J 7  75  ? -34.612 -25.684 90.000 1.00 209.31 ? 2   DG  I "O5'" 1 
ATOM   7674  C  "C5'" . DG  J 7  75  ? -33.751 -24.632 90.414 1.00 204.33 ? 2   DG  I "C5'" 1 
ATOM   7675  C  "C4'" . DG  J 7  75  ? -33.897 -23.430 89.501 1.00 195.78 ? 2   DG  I "C4'" 1 
ATOM   7676  O  "O4'" . DG  J 7  75  ? -33.480 -23.787 88.170 1.00 189.83 ? 2   DG  I "O4'" 1 
ATOM   7677  C  "C3'" . DG  J 7  75  ? -35.325 -22.900 89.365 1.00 192.72 ? 2   DG  I "C3'" 1 
ATOM   7678  O  "O3'" . DG  J 7  75  ? -35.447 -21.659 90.048 1.00 193.05 ? 2   DG  I "O3'" 1 
ATOM   7679  C  "C2'" . DG  J 7  75  ? -35.548 -22.740 87.849 1.00 187.71 ? 2   DG  I "C2'" 1 
ATOM   7680  C  "C1'" . DG  J 7  75  ? -34.165 -22.978 87.253 1.00 184.25 ? 2   DG  I "C1'" 1 
ATOM   7681  N  N9    . DG  J 7  75  ? -34.197 -23.671 85.967 1.00 175.92 ? 2   DG  I N9    1 
ATOM   7682  C  C8    . DG  J 7  75  ? -34.674 -24.936 85.721 1.00 173.89 ? 2   DG  I C8    1 
ATOM   7683  N  N7    . DG  J 7  75  ? -34.572 -25.297 84.472 1.00 168.56 ? 2   DG  I N7    1 
ATOM   7684  C  C5    . DG  J 7  75  ? -33.987 -24.203 83.849 1.00 166.04 ? 2   DG  I C5    1 
ATOM   7685  C  C6    . DG  J 7  75  ? -33.631 -24.010 82.493 1.00 162.10 ? 2   DG  I C6    1 
ATOM   7686  O  O6    . DG  J 7  75  ? -33.766 -24.796 81.545 1.00 159.26 ? 2   DG  I O6    1 
ATOM   7687  N  N1    . DG  J 7  75  ? -33.063 -22.756 82.283 1.00 161.63 ? 2   DG  I N1    1 
ATOM   7688  C  C2    . DG  J 7  75  ? -32.865 -21.809 83.260 1.00 163.16 ? 2   DG  I C2    1 
ATOM   7689  N  N2    . DG  J 7  75  ? -32.303 -20.657 82.866 1.00 162.04 ? 2   DG  I N2    1 
ATOM   7690  N  N3    . DG  J 7  75  ? -33.194 -21.977 84.535 1.00 166.26 ? 2   DG  I N3    1 
ATOM   7691  C  C4    . DG  J 7  75  ? -33.749 -23.193 84.755 1.00 168.91 ? 2   DG  I C4    1 
ATOM   7692  P  P     . DC  J 7  76  ? -36.886 -20.966 90.217 1.00 194.69 ? 3   DC  I P     1 
ATOM   7693  O  OP1   . DC  J 7  76  ? -36.880 -20.231 91.501 1.00 198.51 ? 3   DC  I OP1   1 
ATOM   7694  O  OP2   . DC  J 7  76  ? -37.919 -21.995 89.962 1.00 197.49 ? 3   DC  I OP2   1 
ATOM   7695  O  "O5'" . DC  J 7  76  ? -36.939 -19.909 89.019 1.00 187.41 ? 3   DC  I "O5'" 1 
ATOM   7696  C  "C5'" . DC  J 7  76  ? -35.900 -18.950 88.879 1.00 181.06 ? 3   DC  I "C5'" 1 
ATOM   7697  C  "C4'" . DC  J 7  76  ? -36.039 -18.187 87.575 1.00 173.87 ? 3   DC  I "C4'" 1 
ATOM   7698  O  "O4'" . DC  J 7  76  ? -35.727 -19.064 86.461 1.00 169.60 ? 3   DC  I "O4'" 1 
ATOM   7699  C  "C3'" . DC  J 7  76  ? -37.436 -17.623 87.302 1.00 174.47 ? 3   DC  I "C3'" 1 
ATOM   7700  O  "O3'" . DC  J 7  76  ? -37.336 -16.269 86.888 1.00 173.86 ? 3   DC  I "O3'" 1 
ATOM   7701  C  "C2'" . DC  J 7  76  ? -37.971 -18.516 86.181 1.00 171.06 ? 3   DC  I "C2'" 1 
ATOM   7702  C  "C1'" . DC  J 7  76  ? -36.692 -18.892 85.453 1.00 165.66 ? 3   DC  I "C1'" 1 
ATOM   7703  N  N1    . DC  J 7  76  ? -36.796 -20.160 84.675 1.00 160.24 ? 3   DC  I N1    1 
ATOM   7704  C  C2    . DC  J 7  76  ? -36.297 -20.214 83.368 1.00 153.40 ? 3   DC  I C2    1 
ATOM   7705  O  O2    . DC  J 7  76  ? -35.773 -19.204 82.880 1.00 150.27 ? 3   DC  I O2    1 
ATOM   7706  N  N3    . DC  J 7  76  ? -36.400 -21.374 82.674 1.00 149.87 ? 3   DC  I N3    1 
ATOM   7707  C  C4    . DC  J 7  76  ? -36.972 -22.441 83.236 1.00 151.27 ? 3   DC  I C4    1 
ATOM   7708  N  N4    . DC  J 7  76  ? -37.051 -23.562 82.513 1.00 148.55 ? 3   DC  I N4    1 
ATOM   7709  C  C5    . DC  J 7  76  ? -37.488 -22.404 84.565 1.00 156.88 ? 3   DC  I C5    1 
ATOM   7710  C  C6    . DC  J 7  76  ? -37.381 -21.255 85.240 1.00 160.75 ? 3   DC  I C6    1 
ATOM   7711  P  P     . DG  J 7  77  ? -38.562 -15.257 87.116 1.00 176.15 ? 4   DG  I P     1 
ATOM   7712  O  OP1   . DG  J 7  77  ? -38.110 -14.205 88.054 1.00 179.07 ? 4   DG  I OP1   1 
ATOM   7713  O  OP2   . DG  J 7  77  ? -39.762 -16.062 87.435 1.00 177.60 ? 4   DG  I OP2   1 
ATOM   7714  O  "O5'" . DG  J 7  77  ? -38.781 -14.603 85.675 1.00 173.32 ? 4   DG  I "O5'" 1 
ATOM   7715  C  "C5'" . DG  J 7  77  ? -37.659 -14.177 84.915 1.00 169.78 ? 4   DG  I "C5'" 1 
ATOM   7716  C  "C4'" . DG  J 7  77  ? -37.855 -14.494 83.445 1.00 164.70 ? 4   DG  I "C4'" 1 
ATOM   7717  O  "O4'" . DG  J 7  77  ? -38.006 -15.920 83.276 1.00 166.00 ? 4   DG  I "O4'" 1 
ATOM   7718  C  "C3'" . DG  J 7  77  ? -39.090 -13.852 82.809 1.00 160.85 ? 4   DG  I "C3'" 1 
ATOM   7719  O  "O3'" . DG  J 7  77  ? -38.692 -12.945 81.793 1.00 157.27 ? 4   DG  I "O3'" 1 
ATOM   7720  C  "C2'" . DG  J 7  77  ? -39.900 -15.029 82.241 1.00 161.27 ? 4   DG  I "C2'" 1 
ATOM   7721  C  "C1'" . DG  J 7  77  ? -38.888 -16.167 82.214 1.00 163.53 ? 4   DG  I "C1'" 1 
ATOM   7722  N  N9    . DG  J 7  77  ? -39.491 -17.482 82.419 1.00 166.33 ? 4   DG  I N9    1 
ATOM   7723  C  C8    . DG  J 7  77  ? -40.178 -17.910 83.529 1.00 170.37 ? 4   DG  I C8    1 
ATOM   7724  N  N7    . DG  J 7  77  ? -40.605 -19.139 83.436 1.00 170.52 ? 4   DG  I N7    1 
ATOM   7725  C  C5    . DG  J 7  77  ? -40.172 -19.555 82.184 1.00 166.99 ? 4   DG  I C5    1 
ATOM   7726  C  C6    . DG  J 7  77  ? -40.339 -20.798 81.529 1.00 165.97 ? 4   DG  I C6    1 
ATOM   7727  O  O6    . DG  J 7  77  ? -40.922 -21.811 81.942 1.00 167.62 ? 4   DG  I O6    1 
ATOM   7728  N  N1    . DG  J 7  77  ? -39.745 -20.802 80.270 1.00 162.65 ? 4   DG  I N1    1 
ATOM   7729  C  C2    . DG  J 7  77  ? -39.075 -19.738 79.714 1.00 161.60 ? 4   DG  I C2    1 
ATOM   7730  N  N2    . DG  J 7  77  ? -38.569 -19.931 78.487 1.00 160.03 ? 4   DG  I N2    1 
ATOM   7731  N  N3    . DG  J 7  77  ? -38.911 -18.566 80.316 1.00 162.12 ? 4   DG  I N3    1 
ATOM   7732  C  C4    . DG  J 7  77  ? -39.484 -18.547 81.544 1.00 164.72 ? 4   DG  I C4    1 
ATOM   7733  P  P     . DT  J 7  78  ? -39.783 -12.019 81.063 1.00 161.88 ? 5   DT  I P     1 
ATOM   7734  O  OP1   . DT  J 7  78  ? -39.120 -10.748 80.695 1.00 162.04 ? 5   DT  I OP1   1 
ATOM   7735  O  OP2   . DT  J 7  78  ? -40.999 -11.998 81.907 1.00 164.92 ? 5   DT  I OP2   1 
ATOM   7736  O  "O5'" . DT  J 7  78  ? -40.125 -12.825 79.727 1.00 163.74 ? 5   DT  I "O5'" 1 
ATOM   7737  C  "C5'" . DT  J 7  78  ? -39.070 -13.294 78.896 1.00 163.67 ? 5   DT  I "C5'" 1 
ATOM   7738  C  "C4'" . DT  J 7  78  ? -39.621 -14.052 77.703 1.00 163.84 ? 5   DT  I "C4'" 1 
ATOM   7739  O  "O4'" . DT  J 7  78  ? -40.056 -15.373 78.120 1.00 165.69 ? 5   DT  I "O4'" 1 
ATOM   7740  C  "C3'" . DT  J 7  78  ? -40.828 -13.398 77.027 1.00 165.77 ? 5   DT  I "C3'" 1 
ATOM   7741  O  "O3'" . DT  J 7  78  ? -40.710 -13.511 75.618 1.00 162.33 ? 5   DT  I "O3'" 1 
ATOM   7742  C  "C2'" . DT  J 7  78  ? -42.003 -14.218 77.556 1.00 169.05 ? 5   DT  I "C2'" 1 
ATOM   7743  C  "C1'" . DT  J 7  78  ? -41.373 -15.596 77.672 1.00 169.61 ? 5   DT  I "C1'" 1 
ATOM   7744  N  N1    . DT  J 7  78  ? -42.060 -16.485 78.647 1.00 179.12 ? 5   DT  I N1    1 
ATOM   7745  C  C2    . DT  J 7  78  ? -42.151 -17.831 78.381 1.00 182.45 ? 5   DT  I C2    1 
ATOM   7746  O  O2    . DT  J 7  78  ? -41.693 -18.346 77.377 1.00 180.55 ? 5   DT  I O2    1 
ATOM   7747  N  N3    . DT  J 7  78  ? -42.802 -18.560 79.340 1.00 187.42 ? 5   DT  I N3    1 
ATOM   7748  C  C4    . DT  J 7  78  ? -43.360 -18.087 80.514 1.00 191.89 ? 5   DT  I C4    1 
ATOM   7749  O  O4    . DT  J 7  78  ? -43.927 -18.824 81.315 1.00 197.38 ? 5   DT  I O4    1 
ATOM   7750  C  C5    . DT  J 7  78  ? -43.229 -16.665 80.730 1.00 191.33 ? 5   DT  I C5    1 
ATOM   7751  C  C7    . DT  J 7  78  ? -43.795 -16.035 81.968 1.00 196.39 ? 5   DT  I C7    1 
ATOM   7752  C  C6    . DT  J 7  78  ? -42.593 -15.942 79.797 1.00 185.66 ? 5   DT  I C6    1 
ATOM   7753  P  P     . DA  J 7  79  ? -40.115 -12.294 74.754 1.00 157.12 ? 6   DA  I P     1 
ATOM   7754  O  OP1   . DA  J 7  79  ? -38.882 -11.820 75.422 1.00 155.31 ? 6   DA  I OP1   1 
ATOM   7755  O  OP2   . DA  J 7  79  ? -41.221 -11.347 74.489 1.00 158.55 ? 6   DA  I OP2   1 
ATOM   7756  O  "O5'" . DA  J 7  79  ? -39.712 -12.980 73.368 1.00 150.68 ? 6   DA  I "O5'" 1 
ATOM   7757  C  "C5'" . DA  J 7  79  ? -38.832 -14.096 73.363 1.00 145.90 ? 6   DA  I "C5'" 1 
ATOM   7758  C  "C4'" . DA  J 7  79  ? -39.498 -15.306 72.731 1.00 143.18 ? 6   DA  I "C4'" 1 
ATOM   7759  O  "O4'" . DA  J 7  79  ? -40.401 -15.926 73.683 1.00 144.37 ? 6   DA  I "O4'" 1 
ATOM   7760  C  "C3'" . DA  J 7  79  ? -40.330 -15.009 71.480 1.00 142.07 ? 6   DA  I "C3'" 1 
ATOM   7761  O  "O3'" . DA  J 7  79  ? -39.999 -15.930 70.458 1.00 139.44 ? 6   DA  I "O3'" 1 
ATOM   7762  C  "C2'" . DA  J 7  79  ? -41.772 -15.193 71.956 1.00 143.98 ? 6   DA  I "C2'" 1 
ATOM   7763  C  "C1'" . DA  J 7  79  ? -41.606 -16.249 73.032 1.00 144.73 ? 6   DA  I "C1'" 1 
ATOM   7764  N  N9    . DA  J 7  79  ? -42.681 -16.246 74.018 1.00 148.69 ? 6   DA  I N9    1 
ATOM   7765  C  C8    . DA  J 7  79  ? -43.313 -15.154 74.543 1.00 150.79 ? 6   DA  I C8    1 
ATOM   7766  N  N7    . DA  J 7  79  ? -44.247 -15.451 75.415 1.00 153.17 ? 6   DA  I N7    1 
ATOM   7767  C  C5    . DA  J 7  79  ? -44.227 -16.834 75.464 1.00 153.08 ? 6   DA  I C5    1 
ATOM   7768  C  C6    . DA  J 7  79  ? -44.981 -17.768 76.200 1.00 155.37 ? 6   DA  I C6    1 
ATOM   7769  N  N6    . DA  J 7  79  ? -45.939 -17.421 77.065 1.00 157.76 ? 6   DA  I N6    1 
ATOM   7770  N  N1    . DA  J 7  79  ? -44.709 -19.077 76.015 1.00 155.37 ? 6   DA  I N1    1 
ATOM   7771  C  C2    . DA  J 7  79  ? -43.748 -19.420 75.149 1.00 152.26 ? 6   DA  I C2    1 
ATOM   7772  N  N3    . DA  J 7  79  ? -42.974 -18.634 74.401 1.00 150.00 ? 6   DA  I N3    1 
ATOM   7773  C  C4    . DA  J 7  79  ? -43.268 -17.341 74.608 1.00 150.63 ? 6   DA  I C4    1 
ATOM   7774  P  P     . DC  J 7  80  ? -40.452 -15.660 68.940 1.00 137.94 ? 7   DC  I P     1 
ATOM   7775  O  OP1   . DC  J 7  80  ? -39.216 -15.576 68.132 1.00 137.87 ? 7   DC  I OP1   1 
ATOM   7776  O  OP2   . DC  J 7  80  ? -41.412 -14.533 68.922 1.00 141.85 ? 7   DC  I OP2   1 
ATOM   7777  O  "O5'" . DC  J 7  80  ? -41.250 -16.989 68.549 1.00 133.40 ? 7   DC  I "O5'" 1 
ATOM   7778  C  "C5'" . DC  J 7  80  ? -40.693 -18.261 68.853 1.00 127.85 ? 7   DC  I "C5'" 1 
ATOM   7779  C  "C4'" . DC  J 7  80  ? -41.782 -19.309 69.000 1.00 124.68 ? 7   DC  I "C4'" 1 
ATOM   7780  O  "O4'" . DC  J 7  80  ? -42.588 -19.016 70.172 1.00 126.91 ? 7   DC  I "O4'" 1 
ATOM   7781  C  "C3'" . DC  J 7  80  ? -42.755 -19.403 67.823 1.00 122.80 ? 7   DC  I "C3'" 1 
ATOM   7782  O  "O3'" . DC  J 7  80  ? -43.000 -20.764 67.509 1.00 119.55 ? 7   DC  I "O3'" 1 
ATOM   7783  C  "C2'" . DC  J 7  80  ? -44.013 -18.718 68.352 1.00 127.44 ? 7   DC  I "C2'" 1 
ATOM   7784  C  "C1'" . DC  J 7  80  ? -43.951 -19.077 69.826 1.00 129.66 ? 7   DC  I "C1'" 1 
ATOM   7785  N  N1    . DC  J 7  80  ? -44.705 -18.136 70.699 1.00 133.05 ? 7   DC  I N1    1 
ATOM   7786  C  C2    . DC  J 7  80  ? -45.408 -18.628 71.803 1.00 136.23 ? 7   DC  I C2    1 
ATOM   7787  O  O2    . DC  J 7  80  ? -45.386 -19.843 72.040 1.00 136.24 ? 7   DC  I O2    1 
ATOM   7788  N  N3    . DC  J 7  80  ? -46.092 -17.758 72.587 1.00 139.54 ? 7   DC  I N3    1 
ATOM   7789  C  C4    . DC  J 7  80  ? -46.090 -16.456 72.298 1.00 138.85 ? 7   DC  I C4    1 
ATOM   7790  N  N4    . DC  J 7  80  ? -46.779 -15.636 73.099 1.00 142.54 ? 7   DC  I N4    1 
ATOM   7791  C  C5    . DC  J 7  80  ? -45.381 -15.936 71.175 1.00 134.85 ? 7   DC  I C5    1 
ATOM   7792  C  C6    . DC  J 7  80  ? -44.711 -16.803 70.410 1.00 132.70 ? 7   DC  I C6    1 
ATOM   7793  P  P     . DG  J 7  81  ? -43.437 -21.188 66.023 1.00 118.67 ? 8   DG  I P     1 
ATOM   7794  O  OP1   . DG  J 7  81  ? -42.245 -21.738 65.342 1.00 117.89 ? 8   DG  I OP1   1 
ATOM   7795  O  OP2   . DG  J 7  81  ? -44.173 -20.055 65.418 1.00 117.36 ? 8   DG  I OP2   1 
ATOM   7796  O  "O5'" . DG  J 7  81  ? -44.479 -22.373 66.264 1.00 123.71 ? 8   DG  I "O5'" 1 
ATOM   7797  C  "C5'" . DG  J 7  81  ? -44.166 -23.412 67.181 1.00 126.63 ? 8   DG  I "C5'" 1 
ATOM   7798  C  "C4'" . DG  J 7  81  ? -45.422 -23.922 67.859 1.00 130.76 ? 8   DG  I "C4'" 1 
ATOM   7799  O  "O4'" . DG  J 7  81  ? -45.911 -22.924 68.792 1.00 139.53 ? 8   DG  I "O4'" 1 
ATOM   7800  C  "C3'" . DG  J 7  81  ? -46.582 -24.228 66.910 1.00 128.07 ? 8   DG  I "C3'" 1 
ATOM   7801  O  "O3'" . DG  J 7  81  ? -47.157 -25.479 67.236 1.00 125.49 ? 8   DG  I "O3'" 1 
ATOM   7802  C  "C2'" . DG  J 7  81  ? -47.560 -23.078 67.151 1.00 136.53 ? 8   DG  I "C2'" 1 
ATOM   7803  C  "C1'" . DG  J 7  81  ? -47.295 -22.749 68.610 1.00 146.12 ? 8   DG  I "C1'" 1 
ATOM   7804  N  N9    . DG  J 7  81  ? -47.640 -21.377 68.969 1.00 158.31 ? 8   DG  I N9    1 
ATOM   7805  C  C8    . DG  J 7  81  ? -47.202 -20.227 68.358 1.00 159.34 ? 8   DG  I C8    1 
ATOM   7806  N  N7    . DG  J 7  81  ? -47.677 -19.139 68.897 1.00 164.74 ? 8   DG  I N7    1 
ATOM   7807  C  C5    . DG  J 7  81  ? -48.481 -19.595 69.933 1.00 171.53 ? 8   DG  I C5    1 
ATOM   7808  C  C6    . DG  J 7  81  ? -49.257 -18.873 70.871 1.00 180.82 ? 8   DG  I C6    1 
ATOM   7809  O  O6    . DG  J 7  81  ? -49.390 -17.646 70.975 1.00 187.15 ? 8   DG  I O6    1 
ATOM   7810  N  N1    . DG  J 7  81  ? -49.922 -19.723 71.753 1.00 187.60 ? 8   DG  I N1    1 
ATOM   7811  C  C2    . DG  J 7  81  ? -49.846 -21.096 71.730 1.00 184.50 ? 8   DG  I C2    1 
ATOM   7812  N  N2    . DG  J 7  81  ? -50.559 -21.746 72.662 1.00 187.72 ? 8   DG  I N2    1 
ATOM   7813  N  N3    . DG  J 7  81  ? -49.123 -21.785 70.856 1.00 176.92 ? 8   DG  I N3    1 
ATOM   7814  C  C4    . DG  J 7  81  ? -48.469 -20.971 69.991 1.00 169.60 ? 8   DG  I C4    1 
ATOM   7815  P  P     . DT  J 7  82  ? -48.041 -26.260 66.148 1.00 128.53 ? 9   DT  I P     1 
ATOM   7816  O  OP1   . DT  J 7  82  ? -47.617 -27.678 66.157 1.00 130.92 ? 9   DT  I OP1   1 
ATOM   7817  O  OP2   . DT  J 7  82  ? -47.989 -25.483 64.889 1.00 126.79 ? 9   DT  I OP2   1 
ATOM   7818  O  "O5'" . DT  J 7  82  ? -49.530 -26.162 66.723 1.00 133.30 ? 9   DT  I "O5'" 1 
ATOM   7819  C  "C5'" . DT  J 7  82  ? -49.837 -26.731 67.989 1.00 138.12 ? 9   DT  I "C5'" 1 
ATOM   7820  C  "C4'" . DT  J 7  82  ? -51.155 -26.197 68.519 1.00 143.82 ? 9   DT  I "C4'" 1 
ATOM   7821  O  "O4'" . DT  J 7  82  ? -51.021 -24.787 68.822 1.00 146.03 ? 9   DT  I "O4'" 1 
ATOM   7822  C  "C3'" . DT  J 7  82  ? -52.339 -26.322 67.553 1.00 146.54 ? 9   DT  I "C3'" 1 
ATOM   7823  O  "O3'" . DT  J 7  82  ? -53.413 -27.004 68.188 1.00 150.09 ? 9   DT  I "O3'" 1 
ATOM   7824  C  "C2'" . DT  J 7  82  ? -52.706 -24.871 67.219 1.00 148.08 ? 9   DT  I "C2'" 1 
ATOM   7825  C  "C1'" . DT  J 7  82  ? -52.196 -24.122 68.439 1.00 150.75 ? 9   DT  I "C1'" 1 
ATOM   7826  N  N1    . DT  J 7  82  ? -51.862 -22.694 68.165 1.00 155.06 ? 9   DT  I N1    1 
ATOM   7827  C  C2    . DT  J 7  82  ? -52.299 -21.722 69.035 1.00 160.91 ? 9   DT  I C2    1 
ATOM   7828  O  O2    . DT  J 7  82  ? -52.953 -21.964 70.034 1.00 165.92 ? 9   DT  I O2    1 
ATOM   7829  N  N3    . DT  J 7  82  ? -51.940 -20.445 68.693 1.00 160.45 ? 9   DT  I N3    1 
ATOM   7830  C  C4    . DT  J 7  82  ? -51.204 -20.050 67.592 1.00 157.66 ? 9   DT  I C4    1 
ATOM   7831  O  O4    . DT  J 7  82  ? -50.932 -18.874 67.371 1.00 157.04 ? 9   DT  I O4    1 
ATOM   7832  C  C5    . DT  J 7  82  ? -50.776 -21.119 66.719 1.00 155.16 ? 9   DT  I C5    1 
ATOM   7833  C  C7    . DT  J 7  82  ? -49.971 -20.814 65.491 1.00 151.86 ? 9   DT  I C7    1 
ATOM   7834  C  C6    . DT  J 7  82  ? -51.123 -22.375 67.045 1.00 154.43 ? 9   DT  I C6    1 
ATOM   7835  P  P     . DG  J 7  83  ? -54.710 -27.436 67.344 1.00 150.23 ? 10  DG  I P     1 
ATOM   7836  O  OP1   . DG  J 7  83  ? -55.318 -28.603 68.020 1.00 152.55 ? 10  DG  I OP1   1 
ATOM   7837  O  OP2   . DG  J 7  83  ? -54.312 -27.536 65.922 1.00 145.78 ? 10  DG  I OP2   1 
ATOM   7838  O  "O5'" . DG  J 7  83  ? -55.694 -26.184 67.495 1.00 154.02 ? 10  DG  I "O5'" 1 
ATOM   7839  C  "C5'" . DG  J 7  83  ? -56.036 -25.709 68.790 1.00 157.53 ? 10  DG  I "C5'" 1 
ATOM   7840  C  "C4'" . DG  J 7  83  ? -56.928 -24.485 68.700 1.00 159.00 ? 10  DG  I "C4'" 1 
ATOM   7841  O  "O4'" . DG  J 7  83  ? -56.118 -23.294 68.514 1.00 156.48 ? 10  DG  I "O4'" 1 
ATOM   7842  C  "C3'" . DG  J 7  83  ? -57.936 -24.498 67.545 1.00 160.09 ? 10  DG  I "C3'" 1 
ATOM   7843  O  "O3'" . DG  J 7  83  ? -59.202 -24.068 68.013 1.00 167.71 ? 10  DG  I "O3'" 1 
ATOM   7844  C  "C2'" . DG  J 7  83  ? -57.342 -23.495 66.557 1.00 156.02 ? 10  DG  I "C2'" 1 
ATOM   7845  C  "C1'" . DG  J 7  83  ? -56.706 -22.503 67.511 1.00 156.24 ? 10  DG  I "C1'" 1 
ATOM   7846  N  N9    . DG  J 7  83  ? -55.676 -21.667 66.901 1.00 153.18 ? 10  DG  I N9    1 
ATOM   7847  C  C8    . DG  J 7  83  ? -54.611 -22.083 66.140 1.00 148.45 ? 10  DG  I C8    1 
ATOM   7848  N  N7    . DG  J 7  83  ? -53.854 -21.103 65.728 1.00 146.47 ? 10  DG  I N7    1 
ATOM   7849  C  C5    . DG  J 7  83  ? -54.457 -19.965 66.250 1.00 150.13 ? 10  DG  I C5    1 
ATOM   7850  C  C6    . DG  J 7  83  ? -54.087 -18.602 66.138 1.00 149.86 ? 10  DG  I C6    1 
ATOM   7851  O  O6    . DG  J 7  83  ? -53.120 -18.116 65.535 1.00 147.94 ? 10  DG  I O6    1 
ATOM   7852  N  N1    . DG  J 7  83  ? -54.972 -17.770 66.820 1.00 152.73 ? 10  DG  I N1    1 
ATOM   7853  C  C2    . DG  J 7  83  ? -56.074 -18.201 67.521 1.00 156.05 ? 10  DG  I C2    1 
ATOM   7854  N  N2    . DG  J 7  83  ? -56.810 -17.250 68.114 1.00 157.25 ? 10  DG  I N2    1 
ATOM   7855  N  N3    . DG  J 7  83  ? -56.431 -19.473 67.633 1.00 158.21 ? 10  DG  I N3    1 
ATOM   7856  C  C4    . DG  J 7  83  ? -55.579 -20.296 66.974 1.00 154.61 ? 10  DG  I C4    1 
ATOM   7857  P  P     . DC  J 7  84  ? -60.540 -24.833 67.562 1.00 176.62 ? 11  DC  I P     1 
ATOM   7858  O  OP1   . DC  J 7  84  ? -60.783 -25.917 68.539 1.00 179.14 ? 11  DC  I OP1   1 
ATOM   7859  O  OP2   . DC  J 7  84  ? -60.416 -25.154 66.123 1.00 172.73 ? 11  DC  I OP2   1 
ATOM   7860  O  "O5'" . DC  J 7  84  ? -61.679 -23.721 67.723 1.00 187.93 ? 11  DC  I "O5'" 1 
ATOM   7861  C  "C5'" . DC  J 7  84  ? -61.846 -23.053 68.969 1.00 196.52 ? 11  DC  I "C5'" 1 
ATOM   7862  C  "C4'" . DC  J 7  84  ? -62.087 -21.567 68.763 1.00 201.82 ? 11  DC  I "C4'" 1 
ATOM   7863  O  "O4'" . DC  J 7  84  ? -60.879 -20.941 68.258 1.00 197.54 ? 11  DC  I "O4'" 1 
ATOM   7864  C  "C3'" . DC  J 7  84  ? -63.202 -21.219 67.768 1.00 209.87 ? 11  DC  I "C3'" 1 
ATOM   7865  O  "O3'" . DC  J 7  84  ? -64.125 -20.311 68.363 1.00 220.85 ? 11  DC  I "O3'" 1 
ATOM   7866  C  "C2'" . DC  J 7  84  ? -62.459 -20.577 66.593 1.00 201.57 ? 11  DC  I "C2'" 1 
ATOM   7867  C  "C1'" . DC  J 7  84  ? -61.232 -20.000 67.277 1.00 196.99 ? 11  DC  I "C1'" 1 
ATOM   7868  N  N1    . DC  J 7  84  ? -60.074 -19.808 66.357 1.00 190.68 ? 11  DC  I N1    1 
ATOM   7869  C  C2    . DC  J 7  84  ? -59.461 -18.553 66.266 1.00 187.73 ? 11  DC  I C2    1 
ATOM   7870  O  O2    . DC  J 7  84  ? -59.887 -17.622 66.961 1.00 189.03 ? 11  DC  I O2    1 
ATOM   7871  N  N3    . DC  J 7  84  ? -58.413 -18.395 65.421 1.00 183.41 ? 11  DC  I N3    1 
ATOM   7872  C  C4    . DC  J 7  84  ? -57.983 -19.425 64.689 1.00 180.67 ? 11  DC  I C4    1 
ATOM   7873  N  N4    . DC  J 7  84  ? -56.946 -19.220 63.870 1.00 176.17 ? 11  DC  I N4    1 
ATOM   7874  C  C5    . DC  J 7  84  ? -58.598 -20.709 64.765 1.00 182.74 ? 11  DC  I C5    1 
ATOM   7875  C  C6    . DC  J 7  84  ? -59.630 -20.854 65.603 1.00 187.28 ? 11  DC  I C6    1 
ATOM   7876  P  P     . DG  J 7  85  ? -65.507 -19.959 67.622 1.00 228.31 ? 12  DG  I P     1 
ATOM   7877  O  OP1   . DG  J 7  85  ? -66.559 -19.872 68.659 1.00 237.48 ? 12  DG  I OP1   1 
ATOM   7878  O  OP2   . DG  J 7  85  ? -65.670 -20.900 66.492 1.00 228.00 ? 12  DG  I OP2   1 
ATOM   7879  O  "O5'" . DG  J 7  85  ? -65.260 -18.498 67.016 1.00 225.42 ? 12  DG  I "O5'" 1 
ATOM   7880  C  "C5'" . DG  J 7  85  ? -65.133 -17.381 67.891 1.00 226.25 ? 12  DG  I "C5'" 1 
ATOM   7881  C  "C4'" . DG  J 7  85  ? -64.542 -16.182 67.167 1.00 218.76 ? 12  DG  I "C4'" 1 
ATOM   7882  O  "O4'" . DG  J 7  85  ? -63.339 -16.582 66.458 1.00 213.05 ? 12  DG  I "O4'" 1 
ATOM   7883  C  "C3'" . DG  J 7  85  ? -65.456 -15.528 66.126 1.00 217.17 ? 12  DG  I "C3'" 1 
ATOM   7884  O  "O3'" . DG  J 7  85  ? -65.404 -14.110 66.265 1.00 215.33 ? 12  DG  I "O3'" 1 
ATOM   7885  C  "C2'" . DG  J 7  85  ? -64.856 -15.984 64.797 1.00 213.54 ? 12  DG  I "C2'" 1 
ATOM   7886  C  "C1'" . DG  J 7  85  ? -63.382 -16.070 65.148 1.00 209.75 ? 12  DG  I "C1'" 1 
ATOM   7887  N  N9    . DG  J 7  85  ? -62.628 -16.961 64.272 1.00 204.18 ? 12  DG  I N9    1 
ATOM   7888  C  C8    . DG  J 7  85  ? -62.875 -18.292 64.035 1.00 203.37 ? 12  DG  I C8    1 
ATOM   7889  N  N7    . DG  J 7  85  ? -62.033 -18.836 63.202 1.00 199.58 ? 12  DG  I N7    1 
ATOM   7890  C  C5    . DG  J 7  85  ? -61.172 -17.801 62.863 1.00 196.47 ? 12  DG  I C5    1 
ATOM   7891  C  C6    . DG  J 7  85  ? -60.056 -17.792 61.993 1.00 190.07 ? 12  DG  I C6    1 
ATOM   7892  O  O6    . DG  J 7  85  ? -59.592 -18.730 61.328 1.00 185.80 ? 12  DG  I O6    1 
ATOM   7893  N  N1    . DG  J 7  85  ? -59.460 -16.535 61.933 1.00 188.77 ? 12  DG  I N1    1 
ATOM   7894  C  C2    . DG  J 7  85  ? -59.888 -15.427 62.625 1.00 191.58 ? 12  DG  I C2    1 
ATOM   7895  N  N2    . DG  J 7  85  ? -59.185 -14.301 62.439 1.00 189.92 ? 12  DG  I N2    1 
ATOM   7896  N  N3    . DG  J 7  85  ? -60.933 -15.422 63.444 1.00 196.60 ? 12  DG  I N3    1 
ATOM   7897  C  C4    . DG  J 7  85  ? -61.525 -16.639 63.513 1.00 199.21 ? 12  DG  I C4    1 
ATOM   7898  P  P     . DT  J 7  86  ? -66.395 -13.162 65.425 1.00 213.25 ? 13  DT  I P     1 
ATOM   7899  O  OP1   . DT  J 7  86  ? -67.071 -12.272 66.395 1.00 218.93 ? 13  DT  I OP1   1 
ATOM   7900  O  OP2   . DT  J 7  86  ? -67.212 -13.998 64.518 1.00 214.28 ? 13  DT  I OP2   1 
ATOM   7901  O  "O5'" . DT  J 7  86  ? -65.405 -12.277 64.534 1.00 203.40 ? 13  DT  I "O5'" 1 
ATOM   7902  C  "C5'" . DT  J 7  86  ? -64.413 -11.474 65.166 1.00 195.20 ? 13  DT  I "C5'" 1 
ATOM   7903  C  "C4'" . DT  J 7  86  ? -63.439 -10.905 64.148 1.00 184.50 ? 13  DT  I "C4'" 1 
ATOM   7904  O  "O4'" . DT  J 7  86  ? -62.716 -11.983 63.506 1.00 179.40 ? 13  DT  I "O4'" 1 
ATOM   7905  C  "C3'" . DT  J 7  86  ? -64.079 -10.083 63.022 1.00 180.13 ? 13  DT  I "C3'" 1 
ATOM   7906  O  "O3'" . DT  J 7  86  ? -63.478 -8.794  62.960 1.00 174.88 ? 13  DT  I "O3'" 1 
ATOM   7907  C  "C2'" . DT  J 7  86  ? -63.797 -10.900 61.757 1.00 177.81 ? 13  DT  I "C2'" 1 
ATOM   7908  C  "C1'" . DT  J 7  86  ? -62.548 -11.671 62.148 1.00 175.01 ? 13  DT  I "C1'" 1 
ATOM   7909  N  N1    . DT  J 7  86  ? -62.371 -12.939 61.387 1.00 169.76 ? 13  DT  I N1    1 
ATOM   7910  C  C2    . DT  J 7  86  ? -61.315 -13.057 60.514 1.00 162.77 ? 13  DT  I C2    1 
ATOM   7911  O  O2    . DT  J 7  86  ? -60.500 -12.171 60.328 1.00 158.81 ? 13  DT  I O2    1 
ATOM   7912  N  N3    . DT  J 7  86  ? -61.242 -14.260 59.863 1.00 161.12 ? 13  DT  I N3    1 
ATOM   7913  C  C4    . DT  J 7  86  ? -62.103 -15.334 59.993 1.00 163.60 ? 13  DT  I C4    1 
ATOM   7914  O  O4    . DT  J 7  86  ? -61.954 -16.375 59.363 1.00 163.02 ? 13  DT  I O4    1 
ATOM   7915  C  C5    . DT  J 7  86  ? -63.191 -15.143 60.924 1.00 167.51 ? 13  DT  I C5    1 
ATOM   7916  C  C7    . DT  J 7  86  ? -64.191 -16.238 61.150 1.00 168.64 ? 13  DT  I C7    1 
ATOM   7917  C  C6    . DT  J 7  86  ? -63.272 -13.968 61.567 1.00 170.88 ? 13  DT  I C6    1 
ATOM   7918  P  P     . DT  J 7  87  ? -64.050 -7.676  61.956 1.00 174.39 ? 14  DT  I P     1 
ATOM   7919  O  OP1   . DT  J 7  87  ? -63.978 -6.374  62.655 1.00 176.10 ? 14  DT  I OP1   1 
ATOM   7920  O  OP2   . DT  J 7  87  ? -65.346 -8.152  61.423 1.00 176.61 ? 14  DT  I OP2   1 
ATOM   7921  O  "O5'" . DT  J 7  87  ? -62.996 -7.669  60.753 1.00 169.85 ? 14  DT  I "O5'" 1 
ATOM   7922  C  "C5'" . DT  J 7  87  ? -61.628 -7.381  61.015 1.00 165.82 ? 14  DT  I "C5'" 1 
ATOM   7923  C  "C4'" . DT  J 7  87  ? -60.759 -7.736  59.822 1.00 160.68 ? 14  DT  I "C4'" 1 
ATOM   7924  O  "O4'" . DT  J 7  87  ? -60.919 -9.135  59.505 1.00 159.93 ? 14  DT  I "O4'" 1 
ATOM   7925  C  "C3'" . DT  J 7  87  ? -61.077 -6.967  58.533 1.00 160.17 ? 14  DT  I "C3'" 1 
ATOM   7926  O  "O3'" . DT  J 7  87  ? -59.964 -6.156  58.167 1.00 159.13 ? 14  DT  I "O3'" 1 
ATOM   7927  C  "C2'" . DT  J 7  87  ? -61.358 -8.060  57.488 1.00 158.54 ? 14  DT  I "C2'" 1 
ATOM   7928  C  "C1'" . DT  J 7  87  ? -60.749 -9.301  58.124 1.00 158.22 ? 14  DT  I "C1'" 1 
ATOM   7929  N  N1    . DT  J 7  87  ? -61.416 -10.571 57.713 1.00 159.69 ? 14  DT  I N1    1 
ATOM   7930  C  C2    . DT  J 7  87  ? -60.774 -11.415 56.837 1.00 155.61 ? 14  DT  I C2    1 
ATOM   7931  O  O2    . DT  J 7  87  ? -59.673 -11.181 56.370 1.00 151.70 ? 14  DT  I O2    1 
ATOM   7932  N  N3    . DT  J 7  87  ? -61.469 -12.553 56.523 1.00 155.26 ? 14  DT  I N3    1 
ATOM   7933  C  C4    . DT  J 7  87  ? -62.718 -12.924 56.987 1.00 157.78 ? 14  DT  I C4    1 
ATOM   7934  O  O4    . DT  J 7  87  ? -63.261 -13.969 56.646 1.00 156.78 ? 14  DT  I O4    1 
ATOM   7935  C  C5    . DT  J 7  87  ? -63.337 -11.994 57.903 1.00 162.09 ? 14  DT  I C5    1 
ATOM   7936  C  C7    . DT  J 7  87  ? -64.693 -12.288 58.473 1.00 165.27 ? 14  DT  I C7    1 
ATOM   7937  C  C6    . DT  J 7  87  ? -62.665 -10.876 58.217 1.00 163.21 ? 14  DT  I C6    1 
ATOM   7938  P  P     . DT  J 7  88  ? -60.043 -5.184  56.890 1.00 161.84 ? 15  DT  I P     1 
ATOM   7939  O  OP1   . DT  J 7  88  ? -59.261 -3.969  57.210 1.00 160.56 ? 15  DT  I OP1   1 
ATOM   7940  O  OP2   . DT  J 7  88  ? -61.462 -5.055  56.489 1.00 164.17 ? 15  DT  I OP2   1 
ATOM   7941  O  "O5'" . DT  J 7  88  ? -59.275 -5.998  55.748 1.00 163.60 ? 15  DT  I "O5'" 1 
ATOM   7942  C  "C5'" . DT  J 7  88  ? -57.953 -6.467  55.986 1.00 164.95 ? 15  DT  I "C5'" 1 
ATOM   7943  C  "C4'" . DT  J 7  88  ? -57.543 -7.496  54.949 1.00 167.05 ? 15  DT  I "C4'" 1 
ATOM   7944  O  "O4'" . DT  J 7  88  ? -58.457 -8.618  54.985 1.00 169.36 ? 15  DT  I "O4'" 1 
ATOM   7945  C  "C3'" . DT  J 7  88  ? -57.533 -6.993  53.501 1.00 169.71 ? 15  DT  I "C3'" 1 
ATOM   7946  O  "O3'" . DT  J 7  88  ? -56.240 -7.175  52.939 1.00 171.28 ? 15  DT  I "O3'" 1 
ATOM   7947  C  "C2'" . DT  J 7  88  ? -58.586 -7.857  52.792 1.00 169.28 ? 15  DT  I "C2'" 1 
ATOM   7948  C  "C1'" . DT  J 7  88  ? -58.643 -9.091  53.677 1.00 168.33 ? 15  DT  I "C1'" 1 
ATOM   7949  N  N1    . DT  J 7  88  ? -59.947 -9.812  53.617 1.00 170.12 ? 15  DT  I N1    1 
ATOM   7950  C  C2    . DT  J 7  88  ? -59.982 -11.102 53.140 1.00 168.14 ? 15  DT  I C2    1 
ATOM   7951  O  O2    . DT  J 7  88  ? -58.992 -11.700 52.759 1.00 165.79 ? 15  DT  I O2    1 
ATOM   7952  N  N3    . DT  J 7  88  ? -61.226 -11.673 53.127 1.00 170.39 ? 15  DT  I N3    1 
ATOM   7953  C  C4    . DT  J 7  88  ? -62.415 -11.096 53.533 1.00 175.34 ? 15  DT  I C4    1 
ATOM   7954  O  O4    . DT  J 7  88  ? -63.486 -11.693 53.482 1.00 178.80 ? 15  DT  I O4    1 
ATOM   7955  C  C5    . DT  J 7  88  ? -62.308 -9.741  54.022 1.00 176.53 ? 15  DT  I C5    1 
ATOM   7956  C  C7    . DT  J 7  88  ? -63.531 -9.010  54.492 1.00 180.55 ? 15  DT  I C7    1 
ATOM   7957  C  C6    . DT  J 7  88  ? -61.094 -9.172  54.040 1.00 174.05 ? 15  DT  I C6    1 
ATOM   7958  P  P     . DA  J 7  89  ? -55.754 -6.266  51.707 1.00 174.14 ? 16  DA  I P     1 
ATOM   7959  O  OP1   . DA  J 7  89  ? -54.468 -5.640  52.089 1.00 171.12 ? 16  DA  I OP1   1 
ATOM   7960  O  OP2   . DA  J 7  89  ? -56.893 -5.416  51.294 1.00 181.82 ? 16  DA  I OP2   1 
ATOM   7961  O  "O5'" . DA  J 7  89  ? -55.489 -7.326  50.541 1.00 172.56 ? 16  DA  I "O5'" 1 
ATOM   7962  C  "C5'" . DA  J 7  89  ? -54.773 -8.521  50.824 1.00 170.18 ? 16  DA  I "C5'" 1 
ATOM   7963  C  "C4'" . DA  J 7  89  ? -55.208 -9.643  49.900 1.00 169.19 ? 16  DA  I "C4'" 1 
ATOM   7964  O  "O4'" . DA  J 7  89  ? -56.585 -10.011 50.189 1.00 172.77 ? 16  DA  I "O4'" 1 
ATOM   7965  C  "C3'" . DA  J 7  89  ? -55.164 -9.305  48.406 1.00 166.71 ? 16  DA  I "C3'" 1 
ATOM   7966  O  "O3'" . DA  J 7  89  ? -54.624 -10.399 47.681 1.00 161.18 ? 16  DA  I "O3'" 1 
ATOM   7967  C  "C2'" . DA  J 7  89  ? -56.635 -9.086  48.061 1.00 171.55 ? 16  DA  I "C2'" 1 
ATOM   7968  C  "C1'" . DA  J 7  89  ? -57.294 -10.101 48.977 1.00 174.40 ? 16  DA  I "C1'" 1 
ATOM   7969  N  N9    . DA  J 7  89  ? -58.708 -9.836  49.231 1.00 180.20 ? 16  DA  I N9    1 
ATOM   7970  C  C8    . DA  J 7  89  ? -59.310 -8.616  49.354 1.00 183.39 ? 16  DA  I C8    1 
ATOM   7971  N  N7    . DA  J 7  89  ? -60.602 -8.684  49.576 1.00 187.56 ? 16  DA  I N7    1 
ATOM   7972  C  C5    . DA  J 7  89  ? -60.865 -10.044 49.597 1.00 187.76 ? 16  DA  I C5    1 
ATOM   7973  C  C6    . DA  J 7  89  ? -62.052 -10.779 49.789 1.00 191.31 ? 16  DA  I C6    1 
ATOM   7974  N  N6    . DA  J 7  89  ? -63.243 -10.212 50.005 1.00 193.93 ? 16  DA  I N6    1 
ATOM   7975  N  N1    . DA  J 7  89  ? -61.966 -12.126 49.751 1.00 191.23 ? 16  DA  I N1    1 
ATOM   7976  C  C2    . DA  J 7  89  ? -60.772 -12.690 49.536 1.00 186.69 ? 16  DA  I C2    1 
ATOM   7977  N  N3    . DA  J 7  89  ? -59.591 -12.105 49.341 1.00 182.55 ? 16  DA  I N3    1 
ATOM   7978  C  C4    . DA  J 7  89  ? -59.708 -10.768 49.385 1.00 183.25 ? 16  DA  I C4    1 
ATOM   7979  P  P     . DA  J 7  90  ? -53.076 -10.403 47.253 1.00 155.96 ? 17  DA  I P     1 
ATOM   7980  O  OP1   . DA  J 7  90  ? -52.275 -10.500 48.494 1.00 159.28 ? 17  DA  I OP1   1 
ATOM   7981  O  OP2   . DA  J 7  90  ? -52.861 -9.270  46.327 1.00 149.42 ? 17  DA  I OP2   1 
ATOM   7982  O  "O5'" . DA  J 7  90  ? -52.914 -11.762 46.420 1.00 156.42 ? 17  DA  I "O5'" 1 
ATOM   7983  C  "C5'" . DA  J 7  90  ? -53.082 -13.022 47.068 1.00 157.52 ? 17  DA  I "C5'" 1 
ATOM   7984  C  "C4'" . DA  J 7  90  ? -53.944 -13.962 46.237 1.00 158.61 ? 17  DA  I "C4'" 1 
ATOM   7985  O  "O4'" . DA  J 7  90  ? -55.350 -13.768 46.567 1.00 161.47 ? 17  DA  I "O4'" 1 
ATOM   7986  C  "C3'" . DA  J 7  90  ? -53.858 -13.772 44.717 1.00 158.98 ? 17  DA  I "C3'" 1 
ATOM   7987  O  "O3'" . DA  J 7  90  ? -54.079 -15.014 44.078 1.00 158.44 ? 17  DA  I "O3'" 1 
ATOM   7988  C  "C2'" . DA  J 7  90  ? -55.047 -12.860 44.465 1.00 163.01 ? 17  DA  I "C2'" 1 
ATOM   7989  C  "C1'" . DA  J 7  90  ? -56.052 -13.549 45.365 1.00 163.06 ? 17  DA  I "C1'" 1 
ATOM   7990  N  N9    . DA  J 7  90  ? -57.261 -12.779 45.632 1.00 165.98 ? 17  DA  I N9    1 
ATOM   7991  C  C8    . DA  J 7  90  ? -57.372 -11.424 45.751 1.00 166.63 ? 17  DA  I C8    1 
ATOM   7992  N  N7    . DA  J 7  90  ? -58.597 -11.013 45.986 1.00 169.24 ? 17  DA  I N7    1 
ATOM   7993  C  C5    . DA  J 7  90  ? -59.339 -12.182 46.016 1.00 170.82 ? 17  DA  I C5    1 
ATOM   7994  C  C6    . DA  J 7  90  ? -60.711 -12.433 46.221 1.00 174.89 ? 17  DA  I C6    1 
ATOM   7995  N  N6    . DA  J 7  90  ? -61.610 -11.469 46.446 1.00 177.82 ? 17  DA  I N6    1 
ATOM   7996  N  N1    . DA  J 7  90  ? -61.124 -13.718 46.189 1.00 176.37 ? 17  DA  I N1    1 
ATOM   7997  C  C2    . DA  J 7  90  ? -60.221 -14.680 45.965 1.00 173.98 ? 17  DA  I C2    1 
ATOM   7998  N  N3    . DA  J 7  90  ? -58.911 -14.566 45.758 1.00 170.56 ? 17  DA  I N3    1 
ATOM   7999  C  C4    . DA  J 7  90  ? -58.531 -13.279 45.797 1.00 169.11 ? 17  DA  I C4    1 
ATOM   8000  P  P     . DG  J 7  91  ? -52.869 -15.990 43.681 1.00 152.10 ? 18  DG  I P     1 
ATOM   8001  O  OP1   . DG  J 7  91  ? -52.138 -16.343 44.919 1.00 148.62 ? 18  DG  I OP1   1 
ATOM   8002  O  OP2   . DG  J 7  91  ? -52.141 -15.386 42.545 1.00 148.87 ? 18  DG  I OP2   1 
ATOM   8003  O  "O5'" . DG  J 7  91  ? -53.632 -17.290 43.143 1.00 156.17 ? 18  DG  I "O5'" 1 
ATOM   8004  C  "C5'" . DG  J 7  91  ? -54.655 -17.890 43.942 1.00 159.27 ? 18  DG  I "C5'" 1 
ATOM   8005  C  "C4'" . DG  J 7  91  ? -55.997 -17.912 43.217 1.00 160.69 ? 18  DG  I "C4'" 1 
ATOM   8006  O  "O4'" . DG  J 7  91  ? -56.712 -16.679 43.440 1.00 162.58 ? 18  DG  I "O4'" 1 
ATOM   8007  C  "C3'" . DG  J 7  91  ? -55.926 -18.078 41.694 1.00 159.45 ? 18  DG  I "C3'" 1 
ATOM   8008  O  "O3'" . DG  J 7  91  ? -56.356 -19.383 41.330 1.00 161.08 ? 18  DG  I "O3'" 1 
ATOM   8009  C  "C2'" . DG  J 7  91  ? -56.877 -16.995 41.143 1.00 160.96 ? 18  DG  I "C2'" 1 
ATOM   8010  C  "C1'" . DG  J 7  91  ? -57.623 -16.526 42.386 1.00 163.35 ? 18  DG  I "C1'" 1 
ATOM   8011  N  N9    . DG  J 7  91  ? -58.053 -15.130 42.321 1.00 164.62 ? 18  DG  I N9    1 
ATOM   8012  C  C8    . DG  J 7  91  ? -57.254 -14.025 42.155 1.00 163.02 ? 18  DG  I C8    1 
ATOM   8013  N  N7    . DG  J 7  91  ? -57.916 -12.902 42.133 1.00 165.39 ? 18  DG  I N7    1 
ATOM   8014  C  C5    . DG  J 7  91  ? -59.242 -13.285 42.289 1.00 169.32 ? 18  DG  I C5    1 
ATOM   8015  C  C6    . DG  J 7  91  ? -60.418 -12.498 42.340 1.00 173.56 ? 18  DG  I C6    1 
ATOM   8016  O  O6    . DG  J 7  91  ? -60.523 -11.266 42.254 1.00 174.84 ? 18  DG  I O6    1 
ATOM   8017  N  N1    . DG  J 7  91  ? -61.556 -13.283 42.509 1.00 176.40 ? 18  DG  I N1    1 
ATOM   8018  C  C2    . DG  J 7  91  ? -61.557 -14.654 42.616 1.00 175.31 ? 18  DG  I C2    1 
ATOM   8019  N  N2    . DG  J 7  91  ? -62.755 -15.236 42.775 1.00 177.71 ? 18  DG  I N2    1 
ATOM   8020  N  N3    . DG  J 7  91  ? -60.462 -15.403 42.570 1.00 171.70 ? 18  DG  I N3    1 
ATOM   8021  C  C4    . DG  J 7  91  ? -59.344 -14.654 42.405 1.00 168.78 ? 18  DG  I C4    1 
ATOM   8022  P  P     . DC  J 7  92  ? -56.317 -19.850 39.793 1.00 162.54 ? 19  DC  I P     1 
ATOM   8023  O  OP1   . DC  J 7  92  ? -56.194 -21.325 39.776 1.00 161.90 ? 19  DC  I OP1   1 
ATOM   8024  O  OP2   . DC  J 7  92  ? -55.312 -19.019 39.094 1.00 160.47 ? 19  DC  I OP2   1 
ATOM   8025  O  "O5'" . DC  J 7  92  ? -57.759 -19.447 39.231 1.00 167.91 ? 19  DC  I "O5'" 1 
ATOM   8026  C  "C5'" . DC  J 7  92  ? -58.932 -19.955 39.855 1.00 172.45 ? 19  DC  I "C5'" 1 
ATOM   8027  C  "C4'" . DC  J 7  92  ? -60.179 -19.429 39.169 1.00 177.37 ? 19  DC  I "C4'" 1 
ATOM   8028  O  "O4'" . DC  J 7  92  ? -60.366 -18.032 39.503 1.00 175.37 ? 19  DC  I "O4'" 1 
ATOM   8029  C  "C3'" . DC  J 7  92  ? -60.155 -19.508 37.638 1.00 182.72 ? 19  DC  I "C3'" 1 
ATOM   8030  O  "O3'" . DC  J 7  92  ? -61.314 -20.182 37.169 1.00 195.10 ? 19  DC  I "O3'" 1 
ATOM   8031  C  "C2'" . DC  J 7  92  ? -60.130 -18.044 37.187 1.00 178.19 ? 19  DC  I "C2'" 1 
ATOM   8032  C  "C1'" . DC  J 7  92  ? -60.789 -17.336 38.359 1.00 176.14 ? 19  DC  I "C1'" 1 
ATOM   8033  N  N1    . DC  J 7  92  ? -60.379 -15.910 38.496 1.00 173.13 ? 19  DC  I N1    1 
ATOM   8034  C  C2    . DC  J 7  92  ? -61.336 -14.942 38.819 1.00 173.95 ? 19  DC  I C2    1 
ATOM   8035  O  O2    . DC  J 7  92  ? -62.511 -15.288 38.989 1.00 176.08 ? 19  DC  I O2    1 
ATOM   8036  N  N3    . DC  J 7  92  ? -60.945 -13.649 38.939 1.00 173.36 ? 19  DC  I N3    1 
ATOM   8037  C  C4    . DC  J 7  92  ? -59.667 -13.316 38.748 1.00 170.87 ? 19  DC  I C4    1 
ATOM   8038  N  N4    . DC  J 7  92  ? -59.329 -12.029 38.877 1.00 169.75 ? 19  DC  I N4    1 
ATOM   8039  C  C5    . DC  J 7  92  ? -58.678 -14.289 38.416 1.00 169.72 ? 19  DC  I C5    1 
ATOM   8040  C  C6    . DC  J 7  92  ? -59.075 -15.561 38.301 1.00 170.44 ? 19  DC  I C6    1 
ATOM   8041  P  P     . DG  J 7  93  ? -61.368 -20.748 35.667 1.00 203.49 ? 20  DG  I P     1 
ATOM   8042  O  OP1   . DG  J 7  93  ? -61.908 -22.125 35.724 1.00 204.51 ? 20  DG  I OP1   1 
ATOM   8043  O  OP2   . DG  J 7  93  ? -60.049 -20.502 35.043 1.00 200.17 ? 20  DG  I OP2   1 
ATOM   8044  O  "O5'" . DG  J 7  93  ? -62.435 -19.803 34.944 1.00 214.41 ? 20  DG  I "O5'" 1 
ATOM   8045  C  "C5'" . DG  J 7  93  ? -63.743 -19.667 35.486 1.00 224.14 ? 20  DG  I "C5'" 1 
ATOM   8046  C  "C4'" . DG  J 7  93  ? -64.464 -18.487 34.861 1.00 232.20 ? 20  DG  I "C4'" 1 
ATOM   8047  O  "O4'" . DG  J 7  93  ? -63.897 -17.250 35.364 1.00 232.99 ? 20  DG  I "O4'" 1 
ATOM   8048  C  "C3'" . DG  J 7  93  ? -64.376 -18.416 33.334 1.00 236.71 ? 20  DG  I "C3'" 1 
ATOM   8049  O  "O3'" . DG  J 7  93  ? -65.664 -18.192 32.780 1.00 245.55 ? 20  DG  I "O3'" 1 
ATOM   8050  C  "C2'" . DG  J 7  93  ? -63.435 -17.237 33.076 1.00 235.29 ? 20  DG  I "C2'" 1 
ATOM   8051  C  "C1'" . DG  J 7  93  ? -63.681 -16.362 34.294 1.00 235.44 ? 20  DG  I "C1'" 1 
ATOM   8052  N  N9    . DG  J 7  93  ? -62.547 -15.505 34.629 1.00 234.52 ? 20  DG  I N9    1 
ATOM   8053  C  C8    . DG  J 7  93  ? -61.217 -15.848 34.608 1.00 231.37 ? 20  DG  I C8    1 
ATOM   8054  N  N7    . DG  J 7  93  ? -60.424 -14.874 34.957 1.00 230.24 ? 20  DG  I N7    1 
ATOM   8055  C  C5    . DG  J 7  93  ? -61.282 -13.816 35.229 1.00 233.37 ? 20  DG  I C5    1 
ATOM   8056  C  C6    . DG  J 7  93  ? -60.997 -12.497 35.653 1.00 233.80 ? 20  DG  I C6    1 
ATOM   8057  O  O6    . DG  J 7  93  ? -59.891 -11.985 35.879 1.00 230.51 ? 20  DG  I O6    1 
ATOM   8058  N  N1    . DG  J 7  93  ? -62.158 -11.744 35.811 1.00 237.87 ? 20  DG  I N1    1 
ATOM   8059  C  C2    . DG  J 7  93  ? -63.433 -12.209 35.588 1.00 240.00 ? 20  DG  I C2    1 
ATOM   8060  N  N2    . DG  J 7  93  ? -64.428 -11.334 35.794 1.00 242.00 ? 20  DG  I N2    1 
ATOM   8061  N  N3    . DG  J 7  93  ? -63.714 -13.443 35.190 1.00 240.49 ? 20  DG  I N3    1 
ATOM   8062  C  C4    . DG  J 7  93  ? -62.593 -14.189 35.032 1.00 236.51 ? 20  DG  I C4    1 
ATOM   8063  P  P     . DG  J 7  94  ? -65.905 -18.378 31.203 1.00 247.89 ? 21  DG  I P     1 
ATOM   8064  O  OP1   . DG  J 7  94  ? -67.301 -18.830 31.010 1.00 253.28 ? 21  DG  I OP1   1 
ATOM   8065  O  OP2   . DG  J 7  94  ? -64.788 -19.190 30.672 1.00 245.90 ? 21  DG  I OP2   1 
ATOM   8066  O  "O5'" . DG  J 7  94  ? -65.754 -16.898 30.618 1.00 248.16 ? 21  DG  I "O5'" 1 
ATOM   8067  C  "C5'" . DG  J 7  94  ? -66.642 -15.875 31.047 1.00 249.53 ? 21  DG  I "C5'" 1 
ATOM   8068  C  "C4'" . DG  J 7  94  ? -66.122 -14.505 30.652 1.00 246.57 ? 21  DG  I "C4'" 1 
ATOM   8069  O  "O4'" . DG  J 7  94  ? -64.981 -14.171 31.457 1.00 242.61 ? 21  DG  I "O4'" 1 
ATOM   8070  C  "C3'" . DG  J 7  94  ? -65.636 -14.389 29.210 1.00 245.75 ? 21  DG  I "C3'" 1 
ATOM   8071  O  "O3'" . DG  J 7  94  ? -66.663 -13.828 28.398 1.00 249.05 ? 21  DG  I "O3'" 1 
ATOM   8072  C  "C2'" . DG  J 7  94  ? -64.404 -13.465 29.291 1.00 242.16 ? 21  DG  I "C2'" 1 
ATOM   8073  C  "C1'" . DG  J 7  94  ? -64.257 -13.174 30.787 1.00 240.63 ? 21  DG  I "C1'" 1 
ATOM   8074  N  N9    . DG  J 7  94  ? -62.875 -13.205 31.258 1.00 234.86 ? 21  DG  I N9    1 
ATOM   8075  C  C8    . DG  J 7  94  ? -62.045 -14.298 31.322 1.00 231.18 ? 21  DG  I C8    1 
ATOM   8076  N  N7    . DG  J 7  94  ? -60.858 -14.023 31.787 1.00 227.50 ? 21  DG  I N7    1 
ATOM   8077  C  C5    . DG  J 7  94  ? -60.903 -12.660 32.050 1.00 227.91 ? 21  DG  I C5    1 
ATOM   8078  C  C6    . DG  J 7  94  ? -59.908 -11.798 32.569 1.00 224.86 ? 21  DG  I C6    1 
ATOM   8079  O  O6    . DG  J 7  94  ? -58.751 -12.079 32.911 1.00 221.03 ? 21  DG  I O6    1 
ATOM   8080  N  N1    . DG  J 7  94  ? -60.367 -10.487 32.678 1.00 226.88 ? 21  DG  I N1    1 
ATOM   8081  C  C2    . DG  J 7  94  ? -61.628 -10.064 32.329 1.00 230.32 ? 21  DG  I C2    1 
ATOM   8082  N  N2    . DG  J 7  94  ? -61.887 -8.760  32.505 1.00 230.72 ? 21  DG  I N2    1 
ATOM   8083  N  N3    . DG  J 7  94  ? -62.570 -10.862 31.841 1.00 233.40 ? 21  DG  I N3    1 
ATOM   8084  C  C4    . DG  J 7  94  ? -62.138 -12.141 31.729 1.00 232.19 ? 21  DG  I C4    1 
ATOM   8085  P  P     . DT  J 7  95  ? -66.429 -13.612 26.823 1.00 242.44 ? 22  DT  I P     1 
ATOM   8086  O  OP1   . DT  J 7  95  ? -67.757 -13.609 26.170 1.00 245.83 ? 22  DT  I OP1   1 
ATOM   8087  O  OP2   . DT  J 7  95  ? -65.394 -14.573 26.381 1.00 239.51 ? 22  DT  I OP2   1 
ATOM   8088  O  "O5'" . DT  J 7  95  ? -65.807 -12.142 26.729 1.00 233.26 ? 22  DT  I "O5'" 1 
ATOM   8089  C  "C5'" . DT  J 7  95  ? -66.437 -11.063 27.408 1.00 225.94 ? 22  DT  I "C5'" 1 
ATOM   8090  C  "C4'" . DT  J 7  95  ? -65.536 -9.843  27.438 1.00 215.03 ? 22  DT  I "C4'" 1 
ATOM   8091  O  "O4'" . DT  J 7  95  ? -64.355 -10.130 28.218 1.00 204.61 ? 22  DT  I "O4'" 1 
ATOM   8092  C  "C3'" . DT  J 7  95  ? -65.037 -9.374  26.067 1.00 213.75 ? 22  DT  I "C3'" 1 
ATOM   8093  O  "O3'" . DT  J 7  95  ? -65.561 -8.086  25.775 1.00 220.83 ? 22  DT  I "O3'" 1 
ATOM   8094  C  "C2'" . DT  J 7  95  ? -63.505 -9.350  26.196 1.00 204.44 ? 22  DT  I "C2'" 1 
ATOM   8095  C  "C1'" . DT  J 7  95  ? -63.289 -9.381  27.702 1.00 197.80 ? 22  DT  I "C1'" 1 
ATOM   8096  N  N1    . DT  J 7  95  ? -62.009 -10.034 28.108 1.00 184.69 ? 22  DT  I N1    1 
ATOM   8097  C  C2    . DT  J 7  95  ? -61.106 -9.328  28.868 1.00 176.96 ? 22  DT  I C2    1 
ATOM   8098  O  O2    . DT  J 7  95  ? -61.294 -8.183  29.239 1.00 176.38 ? 22  DT  I O2    1 
ATOM   8099  N  N3    . DT  J 7  95  ? -59.964 -10.016 29.186 1.00 170.24 ? 22  DT  I N3    1 
ATOM   8100  C  C4    . DT  J 7  95  ? -59.641 -11.312 28.825 1.00 166.55 ? 22  DT  I C4    1 
ATOM   8101  O  O4    . DT  J 7  95  ? -58.587 -11.843 29.160 1.00 160.84 ? 22  DT  I O4    1 
ATOM   8102  C  C5    . DT  J 7  95  ? -60.632 -11.995 28.027 1.00 170.94 ? 22  DT  I C5    1 
ATOM   8103  C  C7    . DT  J 7  95  ? -60.394 -13.405 27.574 1.00 167.57 ? 22  DT  I C7    1 
ATOM   8104  C  C6    . DT  J 7  95  ? -61.754 -11.330 27.710 1.00 179.13 ? 22  DT  I C6    1 
ATOM   8105  P  P     . DG  J 7  96  ? -65.489 -7.501  24.280 1.00 227.16 ? 23  DG  I P     1 
ATOM   8106  O  OP1   . DG  J 7  96  ? -66.784 -6.845  23.992 1.00 234.77 ? 23  DG  I OP1   1 
ATOM   8107  O  OP2   . DG  J 7  96  ? -64.998 -8.580  23.393 1.00 226.31 ? 23  DG  I OP2   1 
ATOM   8108  O  "O5'" . DG  J 7  96  ? -64.353 -6.381  24.366 1.00 227.08 ? 23  DG  I "O5'" 1 
ATOM   8109  C  "C5'" . DG  J 7  96  ? -64.466 -5.332  25.320 1.00 230.31 ? 23  DG  I "C5'" 1 
ATOM   8110  C  "C4'" . DG  J 7  96  ? -63.157 -4.577  25.449 1.00 227.10 ? 23  DG  I "C4'" 1 
ATOM   8111  O  "O4'" . DG  J 7  96  ? -62.172 -5.417  26.104 1.00 226.13 ? 23  DG  I "O4'" 1 
ATOM   8112  C  "C3'" . DG  J 7  96  ? -62.534 -4.133  24.122 1.00 223.74 ? 23  DG  I "C3'" 1 
ATOM   8113  O  "O3'" . DG  J 7  96  ? -62.163 -2.765  24.194 1.00 217.93 ? 23  DG  I "O3'" 1 
ATOM   8114  C  "C2'" . DG  J 7  96  ? -61.314 -5.043  23.968 1.00 223.05 ? 23  DG  I "C2'" 1 
ATOM   8115  C  "C1'" . DG  J 7  96  ? -60.949 -5.331  25.415 1.00 222.91 ? 23  DG  I "C1'" 1 
ATOM   8116  N  N9    . DG  J 7  96  ? -60.231 -6.590  25.594 1.00 222.02 ? 23  DG  I N9    1 
ATOM   8117  C  C8    . DG  J 7  96  ? -60.596 -7.825  25.116 1.00 223.83 ? 23  DG  I C8    1 
ATOM   8118  N  N7    . DG  J 7  96  ? -59.759 -8.773  25.434 1.00 220.93 ? 23  DG  I N7    1 
ATOM   8119  C  C5    . DG  J 7  96  ? -58.775 -8.127  26.170 1.00 217.83 ? 23  DG  I C5    1 
ATOM   8120  C  C6    . DG  J 7  96  ? -57.607 -8.643  26.780 1.00 214.85 ? 23  DG  I C6    1 
ATOM   8121  O  O6    . DG  J 7  96  ? -57.198 -9.812  26.789 1.00 214.15 ? 23  DG  I O6    1 
ATOM   8122  N  N1    . DG  J 7  96  ? -56.883 -7.646  27.429 1.00 212.90 ? 23  DG  I N1    1 
ATOM   8123  C  C2    . DG  J 7  96  ? -57.242 -6.320  27.482 1.00 214.56 ? 23  DG  I C2    1 
ATOM   8124  N  N2    . DG  J 7  96  ? -56.416 -5.508  28.157 1.00 214.33 ? 23  DG  I N2    1 
ATOM   8125  N  N3    . DG  J 7  96  ? -58.334 -5.824  26.916 1.00 216.87 ? 23  DG  I N3    1 
ATOM   8126  C  C4    . DG  J 7  96  ? -59.051 -6.782  26.279 1.00 218.57 ? 23  DG  I C4    1 
ATOM   8127  P  P     . DC  J 7  97  ? -61.874 -1.935  22.850 1.00 213.38 ? 24  DC  I P     1 
ATOM   8128  O  OP1   . DC  J 7  97  ? -62.575 -0.637  22.963 1.00 217.12 ? 24  DC  I OP1   1 
ATOM   8129  O  OP2   . DC  J 7  97  ? -62.150 -2.824  21.699 1.00 215.10 ? 24  DC  I OP2   1 
ATOM   8130  O  "O5'" . DC  J 7  97  ? -60.299 -1.673  22.898 1.00 201.38 ? 24  DC  I "O5'" 1 
ATOM   8131  C  "C5'" . DC  J 7  97  ? -59.728 -1.006  24.014 1.00 191.69 ? 24  DC  I "C5'" 1 
ATOM   8132  C  "C4'" . DC  J 7  97  ? -58.215 -1.027  23.932 1.00 182.54 ? 24  DC  I "C4'" 1 
ATOM   8133  O  "O4'" . DC  J 7  97  ? -57.719 -2.309  24.398 1.00 177.78 ? 24  DC  I "O4'" 1 
ATOM   8134  C  "C3'" . DC  J 7  97  ? -57.646 -0.829  22.525 1.00 180.03 ? 24  DC  I "C3'" 1 
ATOM   8135  O  "O3'" . DC  J 7  97  ? -56.607 0.135   22.557 1.00 177.18 ? 24  DC  I "O3'" 1 
ATOM   8136  C  "C2'" . DC  J 7  97  ? -57.119 -2.215  22.149 1.00 177.39 ? 24  DC  I "C2'" 1 
ATOM   8137  C  "C1'" . DC  J 7  97  ? -56.740 -2.782  23.506 1.00 173.87 ? 24  DC  I "C1'" 1 
ATOM   8138  N  N1    . DC  J 7  97  ? -56.743 -4.270  23.548 1.00 168.80 ? 24  DC  I N1    1 
ATOM   8139  C  C2    . DC  J 7  97  ? -55.638 -4.950  24.072 1.00 163.11 ? 24  DC  I C2    1 
ATOM   8140  O  O2    . DC  J 7  97  ? -54.676 -4.301  24.498 1.00 160.41 ? 24  DC  I O2    1 
ATOM   8141  N  N3    . DC  J 7  97  ? -55.657 -6.306  24.100 1.00 160.76 ? 24  DC  I N3    1 
ATOM   8142  C  C4    . DC  J 7  97  ? -56.715 -6.970  23.631 1.00 162.45 ? 24  DC  I C4    1 
ATOM   8143  N  N4    . DC  J 7  97  ? -56.687 -8.306  23.679 1.00 160.30 ? 24  DC  I N4    1 
ATOM   8144  C  C5    . DC  J 7  97  ? -57.848 -6.293  23.091 1.00 167.10 ? 24  DC  I C5    1 
ATOM   8145  C  C6    . DC  J 7  97  ? -57.819 -4.957  23.069 1.00 169.53 ? 24  DC  I C6    1 
ATOM   8146  P  P     . DT  J 7  98  ? -56.130 0.861   21.205 1.00 177.25 ? 25  DT  I P     1 
ATOM   8147  O  OP1   . DT  J 7  98  ? -56.386 2.310   21.364 1.00 180.72 ? 25  DT  I OP1   1 
ATOM   8148  O  OP2   . DT  J 7  98  ? -56.713 0.134   20.056 1.00 179.21 ? 25  DT  I OP2   1 
ATOM   8149  O  "O5'" . DT  J 7  98  ? -54.551 0.618   21.190 1.00 170.72 ? 25  DT  I "O5'" 1 
ATOM   8150  C  "C5'" . DT  J 7  98  ? -53.791 0.853   22.369 1.00 162.27 ? 25  DT  I "C5'" 1 
ATOM   8151  C  "C4'" . DT  J 7  98  ? -52.555 -0.026  22.396 1.00 152.39 ? 25  DT  I "C4'" 1 
ATOM   8152  O  "O4'" . DT  J 7  98  ? -52.950 -1.418  22.514 1.00 147.89 ? 25  DT  I "O4'" 1 
ATOM   8153  C  "C3'" . DT  J 7  98  ? -51.673 0.068   21.150 1.00 150.46 ? 25  DT  I "C3'" 1 
ATOM   8154  O  "O3'" . DT  J 7  98  ? -50.310 0.190   21.531 1.00 147.46 ? 25  DT  I "O3'" 1 
ATOM   8155  C  "C2'" . DT  J 7  98  ? -51.940 -1.251  20.422 1.00 149.05 ? 25  DT  I "C2'" 1 
ATOM   8156  C  "C1'" . DT  J 7  98  ? -52.229 -2.187  21.583 1.00 146.61 ? 25  DT  I "C1'" 1 
ATOM   8157  N  N1    . DT  J 7  98  ? -53.055 -3.371  21.204 1.00 148.43 ? 25  DT  I N1    1 
ATOM   8158  C  C2    . DT  J 7  98  ? -52.760 -4.601  21.747 1.00 148.62 ? 25  DT  I C2    1 
ATOM   8159  O  O2    . DT  J 7  98  ? -51.849 -4.782  22.536 1.00 147.48 ? 25  DT  I O2    1 
ATOM   8160  N  N3    . DT  J 7  98  ? -53.576 -5.620  21.334 1.00 148.98 ? 25  DT  I N3    1 
ATOM   8161  C  C4    . DT  J 7  98  ? -54.636 -5.535  20.449 1.00 151.09 ? 25  DT  I C4    1 
ATOM   8162  O  O4    . DT  J 7  98  ? -55.312 -6.511  20.139 1.00 152.03 ? 25  DT  I O4    1 
ATOM   8163  C  C5    . DT  J 7  98  ? -54.891 -4.217  19.916 1.00 152.21 ? 25  DT  I C5    1 
ATOM   8164  C  C7    . DT  J 7  98  ? -56.014 -4.000  18.946 1.00 155.53 ? 25  DT  I C7    1 
ATOM   8165  C  C6    . DT  J 7  98  ? -54.097 -3.211  20.314 1.00 150.92 ? 25  DT  I C6    1 
ATOM   8166  P  P     . DA  J 7  99  ? -49.578 1.619   21.462 1.00 149.23 ? 26  DA  I P     1 
ATOM   8167  O  OP1   . DA  J 7  99  ? -50.461 2.606   22.123 1.00 151.53 ? 26  DA  I OP1   1 
ATOM   8168  O  OP2   . DA  J 7  99  ? -49.140 1.835   20.065 1.00 152.38 ? 26  DA  I OP2   1 
ATOM   8169  O  "O5'" . DA  J 7  99  ? -48.270 1.423   22.358 1.00 146.55 ? 26  DA  I "O5'" 1 
ATOM   8170  C  "C5'" . DA  J 7  99  ? -48.395 1.060   23.726 1.00 149.60 ? 26  DA  I "C5'" 1 
ATOM   8171  C  "C4'" . DA  J 7  99  ? -47.583 -0.187  24.030 1.00 153.72 ? 26  DA  I "C4'" 1 
ATOM   8172  O  "O4'" . DA  J 7  99  ? -48.251 -1.351  23.475 1.00 156.44 ? 26  DA  I "O4'" 1 
ATOM   8173  C  "C3'" . DA  J 7  99  ? -46.166 -0.192  23.456 1.00 156.13 ? 26  DA  I "C3'" 1 
ATOM   8174  O  "O3'" . DA  J 7  99  ? -45.260 -0.728  24.408 1.00 153.17 ? 26  DA  I "O3'" 1 
ATOM   8175  C  "C2'" . DA  J 7  99  ? -46.288 -1.092  22.227 1.00 157.60 ? 26  DA  I "C2'" 1 
ATOM   8176  C  "C1'" . DA  J 7  99  ? -47.346 -2.085  22.680 1.00 157.24 ? 26  DA  I "C1'" 1 
ATOM   8177  N  N9    . DA  J 7  99  ? -48.089 -2.688  21.578 1.00 160.87 ? 26  DA  I N9    1 
ATOM   8178  C  C8    . DA  J 7  99  ? -48.549 -2.062  20.453 1.00 164.55 ? 26  DA  I C8    1 
ATOM   8179  N  N7    . DA  J 7  99  ? -49.191 -2.857  19.630 1.00 166.22 ? 26  DA  I N7    1 
ATOM   8180  C  C5    . DA  J 7  99  ? -49.151 -4.090  20.259 1.00 164.61 ? 26  DA  I C5    1 
ATOM   8181  C  C6    . DA  J 7  99  ? -49.656 -5.355  19.901 1.00 165.14 ? 26  DA  I C6    1 
ATOM   8182  N  N6    . DA  J 7  99  ? -50.327 -5.587  18.768 1.00 167.48 ? 26  DA  I N6    1 
ATOM   8183  N  N1    . DA  J 7  99  ? -49.440 -6.378  20.754 1.00 162.51 ? 26  DA  I N1    1 
ATOM   8184  C  C2    . DA  J 7  99  ? -48.766 -6.142  21.886 1.00 159.36 ? 26  DA  I C2    1 
ATOM   8185  N  N3    . DA  J 7  99  ? -48.247 -5.000  22.330 1.00 158.55 ? 26  DA  I N3    1 
ATOM   8186  C  C4    . DA  J 7  99  ? -48.476 -4.003  21.462 1.00 161.15 ? 26  DA  I C4    1 
ATOM   8187  P  P     . DG  J 7  100 ? -43.676 -0.616  24.168 1.00 148.17 ? 27  DG  I P     1 
ATOM   8188  O  OP1   . DG  J 7  100 ? -43.031 -0.560  25.498 1.00 145.47 ? 27  DG  I OP1   1 
ATOM   8189  O  OP2   . DG  J 7  100 ? -43.445 0.471   23.190 1.00 150.63 ? 27  DG  I OP2   1 
ATOM   8190  O  "O5'" . DG  J 7  100 ? -43.297 -2.001  23.461 1.00 143.17 ? 27  DG  I "O5'" 1 
ATOM   8191  C  "C5'" . DG  J 7  100 ? -43.592 -3.233  24.112 1.00 134.07 ? 27  DG  I "C5'" 1 
ATOM   8192  C  "C4'" . DG  J 7  100 ? -43.418 -4.408  23.165 1.00 127.99 ? 27  DG  I "C4'" 1 
ATOM   8193  O  "O4'" . DG  J 7  100 ? -44.466 -4.391  22.158 1.00 130.58 ? 27  DG  I "O4'" 1 
ATOM   8194  C  "C3'" . DG  J 7  100 ? -42.093 -4.435  22.396 1.00 123.58 ? 27  DG  I "C3'" 1 
ATOM   8195  O  "O3'" . DG  J 7  100 ? -41.594 -5.762  22.353 1.00 116.14 ? 27  DG  I "O3'" 1 
ATOM   8196  C  "C2'" . DG  J 7  100 ? -42.500 -3.958  21.004 1.00 129.18 ? 27  DG  I "C2'" 1 
ATOM   8197  C  "C1'" . DG  J 7  100 ? -43.880 -4.576  20.891 1.00 133.57 ? 27  DG  I "C1'" 1 
ATOM   8198  N  N9    . DG  J 7  100 ? -44.728 -3.953  19.879 1.00 142.46 ? 27  DG  I N9    1 
ATOM   8199  C  C8    . DG  J 7  100 ? -44.729 -2.634  19.494 1.00 146.46 ? 27  DG  I C8    1 
ATOM   8200  N  N7    . DG  J 7  100 ? -45.599 -2.366  18.559 1.00 150.41 ? 27  DG  I N7    1 
ATOM   8201  C  C5    . DG  J 7  100 ? -46.213 -3.586  18.307 1.00 150.66 ? 27  DG  I C5    1 
ATOM   8202  C  C6    . DG  J 7  100 ? -47.240 -3.918  17.391 1.00 153.84 ? 27  DG  I C6    1 
ATOM   8203  O  O6    . DG  J 7  100 ? -47.830 -3.173  16.595 1.00 155.58 ? 27  DG  I O6    1 
ATOM   8204  N  N1    . DG  J 7  100 ? -47.572 -5.270  17.457 1.00 152.78 ? 27  DG  I N1    1 
ATOM   8205  C  C2    . DG  J 7  100 ? -46.984 -6.184  18.300 1.00 147.31 ? 27  DG  I C2    1 
ATOM   8206  N  N2    . DG  J 7  100 ? -47.438 -7.444  18.220 1.00 144.76 ? 27  DG  I N2    1 
ATOM   8207  N  N3    . DG  J 7  100 ? -46.022 -5.886  19.163 1.00 145.50 ? 27  DG  I N3    1 
ATOM   8208  C  C4    . DG  J 7  100 ? -45.688 -4.573  19.111 1.00 146.48 ? 27  DG  I C4    1 
ATOM   8209  P  P     . DA  J 7  101 ? -40.158 -6.114  22.979 1.00 106.44 ? 28  DA  I P     1 
ATOM   8210  O  OP1   . DA  J 7  101 ? -40.208 -5.799  24.424 1.00 105.04 ? 28  DA  I OP1   1 
ATOM   8211  O  OP2   . DA  J 7  101 ? -39.126 -5.495  22.119 1.00 102.44 ? 28  DA  I OP2   1 
ATOM   8212  O  "O5'" . DA  J 7  101 ? -40.050 -7.698  22.801 1.00 109.51 ? 28  DA  I "O5'" 1 
ATOM   8213  C  "C5'" . DA  J 7  101 ? -41.170 -8.521  23.096 1.00 113.34 ? 28  DA  I "C5'" 1 
ATOM   8214  C  "C4'" . DA  J 7  101 ? -41.598 -9.303  21.867 1.00 119.54 ? 28  DA  I "C4'" 1 
ATOM   8215  O  "O4'" . DA  J 7  101 ? -42.319 -8.433  20.962 1.00 123.85 ? 28  DA  I "O4'" 1 
ATOM   8216  C  "C3'" . DA  J 7  101 ? -40.447 -9.908  21.057 1.00 122.64 ? 28  DA  I "C3'" 1 
ATOM   8217  O  "O3'" . DA  J 7  101 ? -40.613 -11.314 20.954 1.00 129.71 ? 28  DA  I "O3'" 1 
ATOM   8218  C  "C2'" . DA  J 7  101 ? -40.541 -9.223  19.687 1.00 122.26 ? 28  DA  I "C2'" 1 
ATOM   8219  C  "C1'" . DA  J 7  101 ? -41.992 -8.777  19.641 1.00 124.63 ? 28  DA  I "C1'" 1 
ATOM   8220  N  N9    . DA  J 7  101 ? -42.216 -7.611  18.791 1.00 127.31 ? 28  DA  I N9    1 
ATOM   8221  C  C8    . DA  J 7  101 ? -41.544 -6.421  18.831 1.00 128.16 ? 28  DA  I C8    1 
ATOM   8222  N  N7    . DA  J 7  101 ? -41.960 -5.547  17.946 1.00 131.59 ? 28  DA  I N7    1 
ATOM   8223  C  C5    . DA  J 7  101 ? -42.977 -6.209  17.278 1.00 133.18 ? 28  DA  I C5    1 
ATOM   8224  C  C6    . DA  J 7  101 ? -43.827 -5.825  16.222 1.00 137.28 ? 28  DA  I C6    1 
ATOM   8225  N  N6    . DA  J 7  101 ? -43.773 -4.625  15.633 1.00 138.86 ? 28  DA  I N6    1 
ATOM   8226  N  N1    . DA  J 7  101 ? -44.734 -6.726  15.790 1.00 139.62 ? 28  DA  I N1    1 
ATOM   8227  C  C2    . DA  J 7  101 ? -44.783 -7.927  16.380 1.00 135.58 ? 28  DA  I C2    1 
ATOM   8228  N  N3    . DA  J 7  101 ? -44.041 -8.400  17.380 1.00 131.24 ? 28  DA  I N3    1 
ATOM   8229  C  C4    . DA  J 7  101 ? -43.148 -7.483  17.787 1.00 130.30 ? 28  DA  I C4    1 
ATOM   8230  P  P     . DG  J 7  102 ? -39.478 -12.212 20.258 1.00 135.32 ? 29  DG  I P     1 
ATOM   8231  O  OP1   . DG  J 7  102 ? -39.532 -13.559 20.869 1.00 129.85 ? 29  DG  I OP1   1 
ATOM   8232  O  OP2   . DG  J 7  102 ? -38.215 -11.441 20.283 1.00 137.86 ? 29  DG  I OP2   1 
ATOM   8233  O  "O5'" . DG  J 7  102 ? -39.957 -12.313 18.736 1.00 142.61 ? 29  DG  I "O5'" 1 
ATOM   8234  C  "C5'" . DG  J 7  102 ? -41.282 -12.735 18.436 1.00 149.98 ? 29  DG  I "C5'" 1 
ATOM   8235  C  "C4'" . DG  J 7  102 ? -41.528 -12.720 16.939 1.00 159.16 ? 29  DG  I "C4'" 1 
ATOM   8236  O  "O4'" . DG  J 7  102 ? -41.911 -11.381 16.516 1.00 164.82 ? 29  DG  I "O4'" 1 
ATOM   8237  C  "C3'" . DG  J 7  102 ? -40.316 -13.102 16.083 1.00 163.45 ? 29  DG  I "C3'" 1 
ATOM   8238  O  "O3'" . DG  J 7  102 ? -40.729 -13.924 14.996 1.00 169.27 ? 29  DG  I "O3'" 1 
ATOM   8239  C  "C2'" . DG  J 7  102 ? -39.817 -11.747 15.593 1.00 166.05 ? 29  DG  I "C2'" 1 
ATOM   8240  C  "C1'" . DG  J 7  102 ? -41.134 -11.023 15.398 1.00 168.75 ? 29  DG  I "C1'" 1 
ATOM   8241  N  N9    . DG  J 7  102 ? -41.004 -9.571  15.345 1.00 172.96 ? 29  DG  I N9    1 
ATOM   8242  C  C8    . DG  J 7  102 ? -40.306 -8.767  16.213 1.00 172.93 ? 29  DG  I C8    1 
ATOM   8243  N  N7    . DG  J 7  102 ? -40.363 -7.500  15.908 1.00 177.16 ? 29  DG  I N7    1 
ATOM   8244  C  C5    . DG  J 7  102 ? -41.147 -7.461  14.762 1.00 181.44 ? 29  DG  I C5    1 
ATOM   8245  C  C6    . DG  J 7  102 ? -41.556 -6.359  13.973 1.00 185.69 ? 29  DG  I C6    1 
ATOM   8246  O  O6    . DG  J 7  102 ? -41.299 -5.159  14.139 1.00 186.18 ? 29  DG  I O6    1 
ATOM   8247  N  N1    . DG  J 7  102 ? -42.346 -6.760  12.898 1.00 189.11 ? 29  DG  I N1    1 
ATOM   8248  C  C2    . DG  J 7  102 ? -42.695 -8.060  12.620 1.00 187.97 ? 29  DG  I C2    1 
ATOM   8249  N  N2    . DG  J 7  102 ? -43.463 -8.251  11.537 1.00 192.24 ? 29  DG  I N2    1 
ATOM   8250  N  N3    . DG  J 7  102 ? -42.317 -9.101  13.350 1.00 183.92 ? 29  DG  I N3    1 
ATOM   8251  C  C4    . DG  J 7  102 ? -41.548 -8.728  14.402 1.00 179.74 ? 29  DG  I C4    1 
ATOM   8252  P  P     . DC  J 7  103 ? -39.653 -14.781 14.164 1.00 171.74 ? 30  DC  I P     1 
ATOM   8253  O  OP1   . DC  J 7  103 ? -39.361 -16.003 14.945 1.00 168.46 ? 30  DC  I OP1   1 
ATOM   8254  O  OP2   . DC  J 7  103 ? -38.539 -13.892 13.766 1.00 173.43 ? 30  DC  I OP2   1 
ATOM   8255  O  "O5'" . DC  J 7  103 ? -40.440 -15.185 12.830 1.00 176.22 ? 30  DC  I "O5'" 1 
ATOM   8256  C  "C5'" . DC  J 7  103 ? -41.708 -14.595 12.542 1.00 177.96 ? 30  DC  I "C5'" 1 
ATOM   8257  C  "C4'" . DC  J 7  103 ? -41.662 -13.792 11.251 1.00 178.47 ? 30  DC  I "C4'" 1 
ATOM   8258  O  "O4'" . DC  J 7  103 ? -41.503 -12.375 11.556 1.00 175.09 ? 30  DC  I "O4'" 1 
ATOM   8259  C  "C3'" . DC  J 7  103 ? -40.508 -14.142 10.302 1.00 180.18 ? 30  DC  I "C3'" 1 
ATOM   8260  O  "O3'" . DC  J 7  103 ? -40.959 -14.073 8.930  1.00 188.15 ? 30  DC  I "O3'" 1 
ATOM   8261  C  "C2'" . DC  J 7  103 ? -39.500 -13.044 10.618 1.00 175.97 ? 30  DC  I "C2'" 1 
ATOM   8262  C  "C1'" . DC  J 7  103 ? -40.451 -11.872 10.767 1.00 174.09 ? 30  DC  I "C1'" 1 
ATOM   8263  N  N1    . DC  J 7  103 ? -39.853 -10.672 11.418 1.00 169.17 ? 30  DC  I N1    1 
ATOM   8264  C  C2    . DC  J 7  103 ? -40.204 -9.397  10.962 1.00 167.77 ? 30  DC  I C2    1 
ATOM   8265  O  O2    . DC  J 7  103 ? -41.020 -9.291  10.039 1.00 170.71 ? 30  DC  I O2    1 
ATOM   8266  N  N3    . DC  J 7  103 ? -39.649 -8.311  11.554 1.00 164.83 ? 30  DC  I N3    1 
ATOM   8267  C  C4    . DC  J 7  103 ? -38.774 -8.468  12.548 1.00 163.91 ? 30  DC  I C4    1 
ATOM   8268  N  N4    . DC  J 7  103 ? -38.251 -7.368  13.100 1.00 163.70 ? 30  DC  I N4    1 
ATOM   8269  C  C5    . DC  J 7  103 ? -38.396 -9.760  13.019 1.00 164.38 ? 30  DC  I C5    1 
ATOM   8270  C  C6    . DC  J 7  103 ? -38.950 -10.823 12.427 1.00 166.56 ? 30  DC  I C6    1 
ATOM   8271  P  P     . DT  J 7  104 ? -39.927 -13.732 7.739  1.00 194.70 ? 31  DT  I P     1 
ATOM   8272  O  OP1   . DT  J 7  104 ? -38.836 -14.729 7.777  1.00 190.63 ? 31  DT  I OP1   1 
ATOM   8273  O  OP2   . DT  J 7  104 ? -39.626 -12.291 7.801  1.00 199.32 ? 31  DT  I OP2   1 
ATOM   8274  O  "O5'" . DT  J 7  104 ? -40.769 -13.946 6.394  1.00 199.80 ? 31  DT  I "O5'" 1 
ATOM   8275  C  "C5'" . DT  J 7  104 ? -41.736 -12.969 5.987  1.00 202.52 ? 31  DT  I "C5'" 1 
ATOM   8276  C  "C4'" . DT  J 7  104 ? -41.141 -11.943 5.022  1.00 207.78 ? 31  DT  I "C4'" 1 
ATOM   8277  O  "O4'" . DT  J 7  104 ? -40.571 -10.827 5.760  1.00 205.24 ? 31  DT  I "O4'" 1 
ATOM   8278  C  "C3'" . DT  J 7  104 ? -40.038 -12.456 4.088  1.00 209.55 ? 31  DT  I "C3'" 1 
ATOM   8279  O  "O3'" . DT  J 7  104 ? -40.332 -12.060 2.743  1.00 209.60 ? 31  DT  I "O3'" 1 
ATOM   8280  C  "C2'" . DT  J 7  104 ? -38.771 -11.778 4.622  1.00 207.98 ? 31  DT  I "C2'" 1 
ATOM   8281  C  "C1'" . DT  J 7  104 ? -39.322 -10.486 5.201  1.00 202.10 ? 31  DT  I "C1'" 1 
ATOM   8282  N  N1    . DT  J 7  104 ? -38.461 -9.896  6.280  1.00 193.81 ? 31  DT  I N1    1 
ATOM   8283  C  C2    . DT  J 7  104 ? -38.681 -8.601  6.685  1.00 191.07 ? 31  DT  I C2    1 
ATOM   8284  O  O2    . DT  J 7  104 ? -39.551 -7.892  6.212  1.00 194.23 ? 31  DT  I O2    1 
ATOM   8285  N  N3    . DT  J 7  104 ? -37.842 -8.159  7.675  1.00 184.93 ? 31  DT  I N3    1 
ATOM   8286  C  C4    . DT  J 7  104 ? -36.823 -8.868  8.286  1.00 180.02 ? 31  DT  I C4    1 
ATOM   8287  O  O4    . DT  J 7  104 ? -36.122 -8.382  9.168  1.00 173.81 ? 31  DT  I O4    1 
ATOM   8288  C  C5    . DT  J 7  104 ? -36.644 -10.220 7.813  1.00 184.11 ? 31  DT  I C5    1 
ATOM   8289  C  C7    . DT  J 7  104 ? -35.570 -11.089 8.400  1.00 181.90 ? 31  DT  I C7    1 
ATOM   8290  C  C6    . DT  J 7  104 ? -37.456 -10.661 6.841  1.00 189.92 ? 31  DT  I C6    1 
ATOM   8291  P  P     . DG  J 7  105 ? -39.266 -12.262 1.554  1.00 207.78 ? 32  DG  I P     1 
ATOM   8292  O  OP1   . DG  J 7  105 ? -40.042 -12.614 0.345  1.00 213.57 ? 32  DG  I OP1   1 
ATOM   8293  O  OP2   . DG  J 7  105 ? -38.181 -13.166 1.998  1.00 204.95 ? 32  DG  I OP2   1 
ATOM   8294  O  "O5'" . DG  J 7  105 ? -38.659 -10.797 1.340  1.00 203.66 ? 32  DG  I "O5'" 1 
ATOM   8295  C  "C5'" . DG  J 7  105 ? -39.528 -9.717  1.010  1.00 202.02 ? 32  DG  I "C5'" 1 
ATOM   8296  C  "C4'" . DG  J 7  105 ? -38.790 -8.390  1.036  1.00 199.06 ? 32  DG  I "C4'" 1 
ATOM   8297  O  "O4'" . DG  J 7  105 ? -38.261 -8.150  2.363  1.00 195.09 ? 32  DG  I "O4'" 1 
ATOM   8298  C  "C3'" . DG  J 7  105 ? -37.604 -8.286  0.071  1.00 199.50 ? 32  DG  I "C3'" 1 
ATOM   8299  O  "O3'" . DG  J 7  105 ? -37.740 -7.128  -0.741 1.00 200.90 ? 32  DG  I "O3'" 1 
ATOM   8300  C  "C2'" . DG  J 7  105 ? -36.381 -8.193  0.989  1.00 196.98 ? 32  DG  I "C2'" 1 
ATOM   8301  C  "C1'" . DG  J 7  105 ? -36.975 -7.596  2.254  1.00 196.06 ? 32  DG  I "C1'" 1 
ATOM   8302  N  N9    . DG  J 7  105 ? -36.225 -7.931  3.461  1.00 195.51 ? 32  DG  I N9    1 
ATOM   8303  C  C8    . DG  J 7  105 ? -36.008 -9.186  3.976  1.00 194.33 ? 32  DG  I C8    1 
ATOM   8304  N  N7    . DG  J 7  105 ? -35.298 -9.183  5.070  1.00 192.18 ? 32  DG  I N7    1 
ATOM   8305  C  C5    . DG  J 7  105 ? -35.029 -7.840  5.298  1.00 193.18 ? 32  DG  I C5    1 
ATOM   8306  C  C6    . DG  J 7  105 ? -34.299 -7.221  6.340  1.00 192.61 ? 32  DG  I C6    1 
ATOM   8307  O  O6    . DG  J 7  105 ? -33.728 -7.757  7.300  1.00 189.66 ? 32  DG  I O6    1 
ATOM   8308  N  N1    . DG  J 7  105 ? -34.266 -5.837  6.194  1.00 195.20 ? 32  DG  I N1    1 
ATOM   8309  C  C2    . DG  J 7  105 ? -34.864 -5.139  5.171  1.00 198.30 ? 32  DG  I C2    1 
ATOM   8310  N  N2    . DG  J 7  105 ? -34.723 -3.806  5.200  1.00 201.22 ? 32  DG  I N2    1 
ATOM   8311  N  N3    . DG  J 7  105 ? -35.551 -5.707  4.188  1.00 199.28 ? 32  DG  I N3    1 
ATOM   8312  C  C4    . DG  J 7  105 ? -35.592 -7.056  4.315  1.00 195.83 ? 32  DG  I C4    1 
ATOM   8313  P  P     . DT  J 7  106 ? -36.747 -6.888  -1.981 1.00 201.06 ? 33  DT  I P     1 
ATOM   8314  O  OP1   . DT  J 7  106 ? -37.515 -6.204  -3.044 1.00 204.60 ? 33  DT  I OP1   1 
ATOM   8315  O  OP2   . DT  J 7  106 ? -36.069 -8.171  -2.272 1.00 199.30 ? 33  DT  I OP2   1 
ATOM   8316  O  "O5'" . DT  J 7  106 ? -35.654 -5.874  -1.403 1.00 198.71 ? 33  DT  I "O5'" 1 
ATOM   8317  C  "C5'" . DT  J 7  106 ? -36.059 -4.606  -0.904 1.00 196.77 ? 33  DT  I "C5'" 1 
ATOM   8318  C  "C4'" . DT  J 7  106 ? -34.875 -3.845  -0.337 1.00 192.84 ? 33  DT  I "C4'" 1 
ATOM   8319  O  "O4'" . DT  J 7  106 ? -34.481 -4.428  0.930  1.00 188.68 ? 33  DT  I "O4'" 1 
ATOM   8320  C  "C3'" . DT  J 7  106 ? -33.622 -3.845  -1.221 1.00 192.23 ? 33  DT  I "C3'" 1 
ATOM   8321  O  "O3'" . DT  J 7  106 ? -33.158 -2.514  -1.406 1.00 192.09 ? 33  DT  I "O3'" 1 
ATOM   8322  C  "C2'" . DT  J 7  106 ? -32.616 -4.691  -0.435 1.00 189.96 ? 33  DT  I "C2'" 1 
ATOM   8323  C  "C1'" . DT  J 7  106 ? -33.079 -4.480  0.996  1.00 187.11 ? 33  DT  I "C1'" 1 
ATOM   8324  N  N1    . DT  J 7  106 ? -32.688 -5.587  1.913  1.00 182.52 ? 33  DT  I N1    1 
ATOM   8325  C  C2    . DT  J 7  106 ? -32.052 -5.288  3.096  1.00 179.24 ? 33  DT  I C2    1 
ATOM   8326  O  O2    . DT  J 7  106 ? -31.790 -4.151  3.444  1.00 180.35 ? 33  DT  I O2    1 
ATOM   8327  N  N3    . DT  J 7  106 ? -31.734 -6.375  3.865  1.00 174.96 ? 33  DT  I N3    1 
ATOM   8328  C  C4    . DT  J 7  106 ? -31.980 -7.705  3.574  1.00 174.29 ? 33  DT  I C4    1 
ATOM   8329  O  O4    . DT  J 7  106 ? -31.654 -8.613  4.332  1.00 170.67 ? 33  DT  I O4    1 
ATOM   8330  C  C5    . DT  J 7  106 ? -32.648 -7.949  2.318  1.00 179.15 ? 33  DT  I C5    1 
ATOM   8331  C  C7    . DT  J 7  106 ? -32.968 -9.351  1.893  1.00 180.89 ? 33  DT  I C7    1 
ATOM   8332  C  C6    . DT  J 7  106 ? -32.965 -6.890  1.556  1.00 181.91 ? 33  DT  I C6    1 
ATOM   8333  P  P     . DC  J 7  107 ? -32.091 -2.180  -2.560 1.00 194.91 ? 34  DC  I P     1 
ATOM   8334  O  OP1   . DC  J 7  107 ? -32.636 -1.059  -3.358 1.00 200.03 ? 34  DC  I OP1   1 
ATOM   8335  O  OP2   . DC  J 7  107 ? -31.724 -3.447  -3.230 1.00 196.32 ? 34  DC  I OP2   1 
ATOM   8336  O  "O5'" . DC  J 7  107 ? -30.812 -1.660  -1.755 1.00 189.90 ? 34  DC  I "O5'" 1 
ATOM   8337  C  "C5'" . DC  J 7  107 ? -30.923 -0.520  -0.913 1.00 184.00 ? 34  DC  I "C5'" 1 
ATOM   8338  C  "C4'" . DC  J 7  107 ? -29.724 -0.405  0.009  1.00 175.33 ? 34  DC  I "C4'" 1 
ATOM   8339  O  "O4'" . DC  J 7  107 ? -29.704 -1.529  0.931  1.00 169.26 ? 34  DC  I "O4'" 1 
ATOM   8340  C  "C3'" . DC  J 7  107 ? -28.361 -0.403  -0.691 1.00 174.54 ? 34  DC  I "C3'" 1 
ATOM   8341  O  "O3'" . DC  J 7  107 ? -27.536 0.603   -0.125 1.00 173.65 ? 34  DC  I "O3'" 1 
ATOM   8342  C  "C2'" . DC  J 7  107 ? -27.816 -1.800  -0.396 1.00 171.50 ? 34  DC  I "C2'" 1 
ATOM   8343  C  "C1'" . DC  J 7  107 ? -28.402 -2.059  0.980  1.00 166.90 ? 34  DC  I "C1'" 1 
ATOM   8344  N  N1    . DC  J 7  107 ? -28.484 -3.504  1.333  1.00 161.64 ? 34  DC  I N1    1 
ATOM   8345  C  C2    . DC  J 7  107 ? -27.991 -3.943  2.567  1.00 154.53 ? 34  DC  I C2    1 
ATOM   8346  O  O2    . DC  J 7  107 ? -27.500 -3.118  3.348  1.00 152.03 ? 34  DC  I O2    1 
ATOM   8347  N  N3    . DC  J 7  107 ? -28.069 -5.261  2.873  1.00 150.14 ? 34  DC  I N3    1 
ATOM   8348  C  C4    . DC  J 7  107 ? -28.607 -6.118  2.003  1.00 151.66 ? 34  DC  I C4    1 
ATOM   8349  N  N4    . DC  J 7  107 ? -28.663 -7.408  2.350  1.00 149.73 ? 34  DC  I N4    1 
ATOM   8350  C  C5    . DC  J 7  107 ? -29.112 -5.690  0.740  1.00 157.14 ? 34  DC  I C5    1 
ATOM   8351  C  C6    . DC  J 7  107 ? -29.029 -4.387  0.449  1.00 161.89 ? 34  DC  I C6    1 
ATOM   8352  P  P     . DT  J 7  108 ? -26.262 1.168   -0.925 1.00 177.86 ? 35  DT  I P     1 
ATOM   8353  O  OP1   . DT  J 7  108 ? -26.642 2.474   -1.508 1.00 182.30 ? 35  DT  I OP1   1 
ATOM   8354  O  OP2   . DT  J 7  108 ? -25.741 0.095   -1.800 1.00 179.26 ? 35  DT  I OP2   1 
ATOM   8355  O  "O5'" . DT  J 7  108 ? -25.185 1.417   0.228  1.00 174.58 ? 35  DT  I "O5'" 1 
ATOM   8356  C  "C5'" . DT  J 7  108 ? -25.607 1.927   1.487  1.00 170.62 ? 35  DT  I "C5'" 1 
ATOM   8357  C  "C4'" . DT  J 7  108 ? -24.845 1.266   2.620  1.00 165.56 ? 35  DT  I "C4'" 1 
ATOM   8358  O  "O4'" . DT  J 7  108 ? -25.190 -0.145  2.689  1.00 162.50 ? 35  DT  I "O4'" 1 
ATOM   8359  C  "C3'" . DT  J 7  108 ? -23.319 1.323   2.493  1.00 166.64 ? 35  DT  I "C3'" 1 
ATOM   8360  O  "O3'" . DT  J 7  108 ? -22.743 1.616   3.756  1.00 166.96 ? 35  DT  I "O3'" 1 
ATOM   8361  C  "C2'" . DT  J 7  108 ? -22.964 -0.091  2.038  1.00 164.31 ? 35  DT  I "C2'" 1 
ATOM   8362  C  "C1'" . DT  J 7  108 ? -24.005 -0.897  2.791  1.00 160.09 ? 35  DT  I "C1'" 1 
ATOM   8363  N  N1    . DT  J 7  108 ? -24.240 -2.259  2.230  1.00 157.71 ? 35  DT  I N1    1 
ATOM   8364  C  C2    . DT  J 7  108 ? -24.306 -3.333  3.086  1.00 152.20 ? 35  DT  I C2    1 
ATOM   8365  O  O2    . DT  J 7  108 ? -24.187 -3.231  4.294  1.00 150.95 ? 35  DT  I O2    1 
ATOM   8366  N  N3    . DT  J 7  108 ? -24.520 -4.540  2.477  1.00 149.36 ? 35  DT  I N3    1 
ATOM   8367  C  C4    . DT  J 7  108 ? -24.670 -4.777  1.123  1.00 152.64 ? 35  DT  I C4    1 
ATOM   8368  O  O4    . DT  J 7  108 ? -24.860 -5.902  0.672  1.00 151.08 ? 35  DT  I O4    1 
ATOM   8369  C  C5    . DT  J 7  108 ? -24.588 -3.608  0.279  1.00 159.51 ? 35  DT  I C5    1 
ATOM   8370  C  C7    . DT  J 7  108 ? -24.736 -3.741  -1.208 1.00 164.00 ? 35  DT  I C7    1 
ATOM   8371  C  C6    . DT  J 7  108 ? -24.378 -2.419  0.866  1.00 161.46 ? 35  DT  I C6    1 
ATOM   8372  P  P     . DA  J 7  109 ? -22.395 3.132   4.158  1.00 172.33 ? 36  DA  I P     1 
ATOM   8373  O  OP1   . DA  J 7  109 ? -23.672 3.870   4.275  1.00 177.01 ? 36  DA  I OP1   1 
ATOM   8374  O  OP2   . DA  J 7  109 ? -21.345 3.615   3.235  1.00 176.98 ? 36  DA  I OP2   1 
ATOM   8375  O  "O5'" . DA  J 7  109 ? -21.748 2.999   5.615  1.00 165.57 ? 36  DA  I "O5'" 1 
ATOM   8376  C  "C5'" . DA  J 7  109 ? -22.528 2.493   6.693  1.00 156.00 ? 36  DA  I "C5'" 1 
ATOM   8377  C  "C4'" . DA  J 7  109 ? -21.905 1.233   7.267  1.00 150.34 ? 36  DA  I "C4'" 1 
ATOM   8378  O  "O4'" . DA  J 7  109 ? -21.981 0.165   6.294  1.00 149.36 ? 36  DA  I "O4'" 1 
ATOM   8379  C  "C3'" . DA  J 7  109 ? -20.429 1.360   7.659  1.00 148.27 ? 36  DA  I "C3'" 1 
ATOM   8380  O  "O3'" . DA  J 7  109 ? -20.270 1.070   9.043  1.00 139.69 ? 36  DA  I "O3'" 1 
ATOM   8381  C  "C2'" . DA  J 7  109 ? -19.704 0.336   6.772  1.00 148.82 ? 36  DA  I "C2'" 1 
ATOM   8382  C  "C1'" . DA  J 7  109 ? -20.819 -0.618  6.374  1.00 148.77 ? 36  DA  I "C1'" 1 
ATOM   8383  N  N9    . DA  J 7  109 ? -20.604 -1.246  5.074  1.00 155.33 ? 36  DA  I N9    1 
ATOM   8384  C  C8    . DA  J 7  109 ? -20.174 -0.637  3.928  1.00 162.26 ? 36  DA  I C8    1 
ATOM   8385  N  N7    . DA  J 7  109 ? -20.074 -1.448  2.903  1.00 165.01 ? 36  DA  I N7    1 
ATOM   8386  C  C5    . DA  J 7  109 ? -20.465 -2.675  3.410  1.00 162.21 ? 36  DA  I C5    1 
ATOM   8387  C  C6    . DA  J 7  109 ? -20.578 -3.951  2.825  1.00 163.86 ? 36  DA  I C6    1 
ATOM   8388  N  N6    . DA  J 7  109 ? -20.293 -4.199  1.543  1.00 166.59 ? 36  DA  I N6    1 
ATOM   8389  N  N1    . DA  J 7  109 ? -20.998 -4.964  3.611  1.00 162.00 ? 36  DA  I N1    1 
ATOM   8390  C  C2    . DA  J 7  109 ? -21.283 -4.710  4.894  1.00 158.69 ? 36  DA  I C2    1 
ATOM   8391  N  N3    . DA  J 7  109 ? -21.216 -3.555  5.555  1.00 157.03 ? 36  DA  I N3    1 
ATOM   8392  C  C4    . DA  J 7  109 ? -20.797 -2.569  4.748  1.00 157.58 ? 36  DA  I C4    1 
ATOM   8393  P  P     . DC  J 7  110 ? -18.815 1.099   9.726  1.00 131.06 ? 37  DC  I P     1 
ATOM   8394  O  OP1   . DC  J 7  110 ? -18.991 1.576   11.116 1.00 129.06 ? 37  DC  I OP1   1 
ATOM   8395  O  OP2   . DC  J 7  110 ? -17.880 1.811   8.826  1.00 129.15 ? 37  DC  I OP2   1 
ATOM   8396  O  "O5'" . DC  J 7  110 ? -18.394 -0.441  9.766  1.00 128.44 ? 37  DC  I "O5'" 1 
ATOM   8397  C  "C5'" . DC  J 7  110 ? -19.311 -1.408  10.262 1.00 121.91 ? 37  DC  I "C5'" 1 
ATOM   8398  C  "C4'" . DC  J 7  110 ? -18.781 -2.813  10.054 1.00 115.22 ? 37  DC  I "C4'" 1 
ATOM   8399  O  "O4'" . DC  J 7  110 ? -18.859 -3.164  8.646  1.00 114.52 ? 37  DC  I "O4'" 1 
ATOM   8400  C  "C3'" . DC  J 7  110 ? -17.321 -3.019  10.463 1.00 112.36 ? 37  DC  I "C3'" 1 
ATOM   8401  O  "O3'" . DC  J 7  110 ? -17.189 -4.244  11.160 1.00 109.53 ? 37  DC  I "O3'" 1 
ATOM   8402  C  "C2'" . DC  J 7  110 ? -16.589 -3.062  9.125  1.00 113.73 ? 37  DC  I "C2'" 1 
ATOM   8403  C  "C1'" . DC  J 7  110 ? -17.633 -3.728  8.248  1.00 114.62 ? 37  DC  I "C1'" 1 
ATOM   8404  N  N1    . DC  J 7  110 ? -17.440 -3.481  6.795  1.00 118.89 ? 37  DC  I N1    1 
ATOM   8405  C  C2    . DC  J 7  110 ? -17.487 -4.555  5.900  1.00 119.78 ? 37  DC  I C2    1 
ATOM   8406  O  O2    . DC  J 7  110 ? -17.696 -5.694  6.337  1.00 114.86 ? 37  DC  I O2    1 
ATOM   8407  N  N3    . DC  J 7  110 ? -17.307 -4.315  4.578  1.00 125.25 ? 37  DC  I N3    1 
ATOM   8408  C  C4    . DC  J 7  110 ? -17.085 -3.072  4.148  1.00 125.00 ? 37  DC  I C4    1 
ATOM   8409  N  N4    . DC  J 7  110 ? -16.913 -2.886  2.835  1.00 127.07 ? 37  DC  I N4    1 
ATOM   8410  C  C5    . DC  J 7  110 ? -17.031 -1.964  5.045  1.00 124.17 ? 37  DC  I C5    1 
ATOM   8411  C  C6    . DC  J 7  110 ? -17.210 -2.213  6.347  1.00 122.24 ? 37  DC  I C6    1 
ATOM   8412  P  P     . DG  J 7  111 ? -16.143 -4.374  12.371 1.00 105.57 ? 38  DG  I P     1 
ATOM   8413  O  OP1   . DG  J 7  111 ? -16.923 -4.366  13.629 1.00 97.21  ? 38  DG  I OP1   1 
ATOM   8414  O  OP2   . DG  J 7  111 ? -15.075 -3.374  12.151 1.00 102.89 ? 38  DG  I OP2   1 
ATOM   8415  O  "O5'" . DG  J 7  111 ? -15.496 -5.821  12.158 1.00 113.84 ? 38  DG  I "O5'" 1 
ATOM   8416  C  "C5'" . DG  J 7  111 ? -16.336 -6.948  11.943 1.00 113.38 ? 38  DG  I "C5'" 1 
ATOM   8417  C  "C4'" . DG  J 7  111 ? -15.701 -7.916  10.960 1.00 112.42 ? 38  DG  I "C4'" 1 
ATOM   8418  O  "O4'" . DG  J 7  111 ? -15.722 -7.343  9.624  1.00 117.69 ? 38  DG  I "O4'" 1 
ATOM   8419  C  "C3'" . DG  J 7  111 ? -14.241 -8.271  11.247 1.00 110.82 ? 38  DG  I "C3'" 1 
ATOM   8420  O  "O3'" . DG  J 7  111 ? -14.032 -9.656  11.031 1.00 104.24 ? 38  DG  I "O3'" 1 
ATOM   8421  C  "C2'" . DG  J 7  111 ? -13.476 -7.431  10.228 1.00 118.99 ? 38  DG  I "C2'" 1 
ATOM   8422  C  "C1'" . DG  J 7  111 ? -14.438 -7.449  9.054  1.00 124.47 ? 38  DG  I "C1'" 1 
ATOM   8423  N  N9    . DG  J 7  111 ? -14.241 -6.342  8.124  1.00 135.11 ? 38  DG  I N9    1 
ATOM   8424  C  C8    . DG  J 7  111 ? -13.909 -5.046  8.438  1.00 137.57 ? 38  DG  I C8    1 
ATOM   8425  N  N7    . DG  J 7  111 ? -13.796 -4.271  7.395  1.00 140.22 ? 38  DG  I N7    1 
ATOM   8426  C  C5    . DG  J 7  111 ? -14.067 -5.107  6.320  1.00 143.58 ? 38  DG  I C5    1 
ATOM   8427  C  C6    . DG  J 7  111 ? -14.094 -4.827  4.933  1.00 151.90 ? 38  DG  I C6    1 
ATOM   8428  O  O6    . DG  J 7  111 ? -13.876 -3.749  4.363  1.00 156.47 ? 38  DG  I O6    1 
ATOM   8429  N  N1    . DG  J 7  111 ? -14.413 -5.959  4.186  1.00 154.83 ? 38  DG  I N1    1 
ATOM   8430  C  C2    . DG  J 7  111 ? -14.674 -7.202  4.713  1.00 151.13 ? 38  DG  I C2    1 
ATOM   8431  N  N2    . DG  J 7  111 ? -14.964 -8.172  3.833  1.00 156.13 ? 38  DG  I N2    1 
ATOM   8432  N  N3    . DG  J 7  111 ? -14.652 -7.477  6.011  1.00 142.38 ? 38  DG  I N3    1 
ATOM   8433  C  C4    . DG  J 7  111 ? -14.342 -6.386  6.752  1.00 140.06 ? 38  DG  I C4    1 
ATOM   8434  P  P     . DA  J 7  112 ? -12.810 -10.413 11.746 1.00 102.05 ? 39  DA  I P     1 
ATOM   8435  O  OP1   . DA  J 7  112 ? -13.284 -10.887 13.065 1.00 97.17  ? 39  DA  I OP1   1 
ATOM   8436  O  OP2   . DA  J 7  112 ? -11.615 -9.545  11.665 1.00 96.91  ? 39  DA  I OP2   1 
ATOM   8437  O  "O5'" . DA  J 7  112 ? -12.555 -11.681 10.807 1.00 115.27 ? 39  DA  I "O5'" 1 
ATOM   8438  C  "C5'" . DA  J 7  112 ? -13.645 -12.508 10.420 1.00 119.58 ? 39  DA  I "C5'" 1 
ATOM   8439  C  "C4'" . DA  J 7  112 ? -13.424 -13.073 9.029  1.00 123.67 ? 39  DA  I "C4'" 1 
ATOM   8440  O  "O4'" . DA  J 7  112 ? -13.517 -12.002 8.052  1.00 127.77 ? 39  DA  I "O4'" 1 
ATOM   8441  C  "C3'" . DA  J 7  112 ? -12.065 -13.733 8.815  1.00 125.20 ? 39  DA  I "C3'" 1 
ATOM   8442  O  "O3'" . DA  J 7  112 ? -12.210 -14.910 8.036  1.00 127.44 ? 39  DA  I "O3'" 1 
ATOM   8443  C  "C2'" . DA  J 7  112 ? -11.263 -12.662 8.078  1.00 128.16 ? 39  DA  I "C2'" 1 
ATOM   8444  C  "C1'" . DA  J 7  112 ? -12.343 -11.957 7.270  1.00 130.62 ? 39  DA  I "C1'" 1 
ATOM   8445  N  N9    . DA  J 7  112 ? -12.032 -10.558 6.990  1.00 132.69 ? 39  DA  I N9    1 
ATOM   8446  C  C8    . DA  J 7  112 ? -11.859 -9.557  7.904  1.00 131.24 ? 39  DA  I C8    1 
ATOM   8447  N  N7    . DA  J 7  112 ? -11.588 -8.391  7.367  1.00 132.51 ? 39  DA  I N7    1 
ATOM   8448  C  C5    . DA  J 7  112 ? -11.582 -8.645  6.006  1.00 136.98 ? 39  DA  I C5    1 
ATOM   8449  C  C6    . DA  J 7  112 ? -11.356 -7.818  4.888  1.00 141.79 ? 39  DA  I C6    1 
ATOM   8450  N  N6    . DA  J 7  112 ? -11.083 -6.513  4.982  1.00 142.32 ? 39  DA  I N6    1 
ATOM   8451  N  N1    . DA  J 7  112 ? -11.424 -8.388  3.666  1.00 145.47 ? 39  DA  I N1    1 
ATOM   8452  C  C2    . DA  J 7  112 ? -11.698 -9.695  3.577  1.00 145.00 ? 39  DA  I C2    1 
ATOM   8453  N  N3    . DA  J 7  112 ? -11.928 -10.571 4.554  1.00 142.18 ? 39  DA  I N3    1 
ATOM   8454  C  C4    . DA  J 7  112 ? -11.855 -9.976  5.756  1.00 137.44 ? 39  DA  I C4    1 
ATOM   8455  P  P     . DC  J 7  113 ? -10.969 -15.913 7.860  1.00 131.03 ? 40  DC  I P     1 
ATOM   8456  O  OP1   . DC  J 7  113 ? -11.510 -17.249 7.524  1.00 137.73 ? 40  DC  I OP1   1 
ATOM   8457  O  OP2   . DC  J 7  113 ? -10.090 -15.750 9.040  1.00 126.62 ? 40  DC  I OP2   1 
ATOM   8458  O  "O5'" . DC  J 7  113 ? -10.195 -15.338 6.585  1.00 132.46 ? 40  DC  I "O5'" 1 
ATOM   8459  C  "C5'" . DC  J 7  113 ? -10.871 -15.231 5.340  1.00 135.93 ? 40  DC  I "C5'" 1 
ATOM   8460  C  "C4'" . DC  J 7  113 ? -9.909  -14.819 4.242  1.00 143.30 ? 40  DC  I "C4'" 1 
ATOM   8461  O  "O4'" . DC  J 7  113 ? -9.875  -13.373 4.140  1.00 146.16 ? 40  DC  I "O4'" 1 
ATOM   8462  C  "C3'" . DC  J 7  113 ? -8.462  -15.274 4.449  1.00 146.75 ? 40  DC  I "C3'" 1 
ATOM   8463  O  "O3'" . DC  J 7  113 ? -7.977  -15.897 3.269  1.00 154.79 ? 40  DC  I "O3'" 1 
ATOM   8464  C  "C2'" . DC  J 7  113 ? -7.711  -13.976 4.757  1.00 147.53 ? 40  DC  I "C2'" 1 
ATOM   8465  C  "C1'" . DC  J 7  113 ? -8.542  -12.947 4.008  1.00 148.83 ? 40  DC  I "C1'" 1 
ATOM   8466  N  N1    . DC  J 7  113 ? -8.431  -11.570 4.568  1.00 148.14 ? 40  DC  I N1    1 
ATOM   8467  C  C2    . DC  J 7  113 ? -8.145  -10.497 3.718  1.00 151.56 ? 40  DC  I C2    1 
ATOM   8468  O  O2    . DC  J 7  113 ? -7.989  -10.710 2.509  1.00 156.15 ? 40  DC  I O2    1 
ATOM   8469  N  N3    . DC  J 7  113 ? -8.049  -9.251  4.243  1.00 150.70 ? 40  DC  I N3    1 
ATOM   8470  C  C4    . DC  J 7  113 ? -8.227  -9.062  5.552  1.00 147.78 ? 40  DC  I C4    1 
ATOM   8471  N  N4    . DC  J 7  113 ? -8.121  -7.816  6.025  1.00 146.96 ? 40  DC  I N4    1 
ATOM   8472  C  C5    . DC  J 7  113 ? -8.517  -10.144 6.435  1.00 145.00 ? 40  DC  I C5    1 
ATOM   8473  C  C6    . DC  J 7  113 ? -8.610  -11.368 5.905  1.00 145.62 ? 40  DC  I C6    1 
ATOM   8474  P  P     . DC  J 7  114 ? -6.547  -16.629 3.266  1.00 162.12 ? 41  DC  I P     1 
ATOM   8475  O  OP1   . DC  J 7  114 ? -6.668  -17.841 2.426  1.00 165.77 ? 41  DC  I OP1   1 
ATOM   8476  O  OP2   . DC  J 7  114 ? -6.093  -16.752 4.670  1.00 158.39 ? 41  DC  I OP2   1 
ATOM   8477  O  "O5'" . DC  J 7  114 ? -5.591  -15.583 2.527  1.00 168.73 ? 41  DC  I "O5'" 1 
ATOM   8478  C  "C5'" . DC  J 7  114 ? -5.942  -15.094 1.238  1.00 174.36 ? 41  DC  I "C5'" 1 
ATOM   8479  C  "C4'" . DC  J 7  114 ? -5.012  -13.972 0.816  1.00 178.50 ? 41  DC  I "C4'" 1 
ATOM   8480  O  "O4'" . DC  J 7  114 ? -5.347  -12.763 1.543  1.00 175.22 ? 41  DC  I "O4'" 1 
ATOM   8481  C  "C3'" . DC  J 7  114 ? -3.526  -14.236 1.076  1.00 183.34 ? 41  DC  I "C3'" 1 
ATOM   8482  O  "O3'" . DC  J 7  114 ? -2.768  -13.966 -0.095 1.00 196.85 ? 41  DC  I "O3'" 1 
ATOM   8483  C  "C2'" . DC  J 7  114 ? -3.175  -13.270 2.210  1.00 178.04 ? 41  DC  I "C2'" 1 
ATOM   8484  C  "C1'" . DC  J 7  114 ? -4.164  -12.141 1.977  1.00 175.60 ? 41  DC  I "C1'" 1 
ATOM   8485  N  N1    . DC  J 7  114 ? -4.465  -11.353 3.206  1.00 169.51 ? 41  DC  I N1    1 
ATOM   8486  C  C2    . DC  J 7  114 ? -4.410  -9.956  3.164  1.00 166.49 ? 41  DC  I C2    1 
ATOM   8487  O  O2    . DC  J 7  114 ? -4.119  -9.396  2.101  1.00 170.48 ? 41  DC  I O2    1 
ATOM   8488  N  N3    . DC  J 7  114 ? -4.683  -9.254  4.292  1.00 162.05 ? 41  DC  I N3    1 
ATOM   8489  C  C4    . DC  J 7  114 ? -4.995  -9.896  5.419  1.00 161.05 ? 41  DC  I C4    1 
ATOM   8490  N  N4    . DC  J 7  114 ? -5.255  -9.162  6.505  1.00 159.56 ? 41  DC  I N4    1 
ATOM   8491  C  C5    . DC  J 7  114 ? -5.053  -11.320 5.482  1.00 162.03 ? 41  DC  I C5    1 
ATOM   8492  C  C6    . DC  J 7  114 ? -4.782  -12.001 4.364  1.00 166.43 ? 41  DC  I C6    1 
ATOM   8493  P  P     . DA  J 7  115 ? -1.360  -14.703 -0.330 1.00 206.26 ? 42  DA  I P     1 
ATOM   8494  O  OP1   . DA  J 7  115 ? -1.432  -15.403 -1.632 1.00 212.35 ? 42  DA  I OP1   1 
ATOM   8495  O  OP2   . DA  J 7  115 ? -1.042  -15.465 0.898  1.00 204.51 ? 42  DA  I OP2   1 
ATOM   8496  O  "O5'" . DA  J 7  115 ? -0.313  -13.500 -0.447 1.00 213.65 ? 42  DA  I "O5'" 1 
ATOM   8497  C  "C5'" . DA  J 7  115 ? -0.400  -12.585 -1.532 1.00 222.50 ? 42  DA  I "C5'" 1 
ATOM   8498  C  "C4'" . DA  J 7  115 ? 0.388   -11.320 -1.241 1.00 226.07 ? 42  DA  I "C4'" 1 
ATOM   8499  O  "O4'" . DA  J 7  115 ? -0.252  -10.585 -0.163 1.00 223.56 ? 42  DA  I "O4'" 1 
ATOM   8500  C  "C3'" . DA  J 7  115 ? 1.837   -11.543 -0.806 1.00 230.03 ? 42  DA  I "C3'" 1 
ATOM   8501  O  "O3'" . DA  J 7  115 ? 2.684   -10.592 -1.438 1.00 237.11 ? 42  DA  I "O3'" 1 
ATOM   8502  C  "C2'" . DA  J 7  115 ? 1.786   -11.329 0.705  1.00 224.60 ? 42  DA  I "C2'" 1 
ATOM   8503  C  "C1'" . DA  J 7  115 ? 0.701   -10.271 0.826  1.00 223.25 ? 42  DA  I "C1'" 1 
ATOM   8504  N  N9    . DA  J 7  115 ? 0.035   -10.268 2.125  1.00 219.79 ? 42  DA  I N9    1 
ATOM   8505  C  C8    . DA  J 7  115 ? -0.355  -11.357 2.853  1.00 216.86 ? 42  DA  I C8    1 
ATOM   8506  N  N7    . DA  J 7  115 ? -0.934  -11.055 3.991  1.00 212.90 ? 42  DA  I N7    1 
ATOM   8507  C  C5    . DA  J 7  115 ? -0.923  -9.670  4.011  1.00 213.37 ? 42  DA  I C5    1 
ATOM   8508  C  C6    . DA  J 7  115 ? -1.392  -8.731  4.951  1.00 209.62 ? 42  DA  I C6    1 
ATOM   8509  N  N6    . DA  J 7  115 ? -1.985  -9.073  6.099  1.00 204.56 ? 42  DA  I N6    1 
ATOM   8510  N  N1    . DA  J 7  115 ? -1.225  -7.423  4.665  1.00 211.35 ? 42  DA  I N1    1 
ATOM   8511  C  C2    . DA  J 7  115 ? -0.629  -7.085  3.515  1.00 215.69 ? 42  DA  I C2    1 
ATOM   8512  N  N3    . DA  J 7  115 ? -0.149  -7.876  2.555  1.00 219.27 ? 42  DA  I N3    1 
ATOM   8513  C  C4    . DA  J 7  115 ? -0.330  -9.169  2.868  1.00 217.88 ? 42  DA  I C4    1 
ATOM   8514  P  P     . DA  J 7  116 ? 4.256   -10.883 -1.597 1.00 234.39 ? 43  DA  I P     1 
ATOM   8515  O  OP1   . DA  J 7  116 ? 4.541   -11.021 -3.042 1.00 240.54 ? 43  DA  I OP1   1 
ATOM   8516  O  OP2   . DA  J 7  116 ? 4.617   -11.978 -0.670 1.00 229.81 ? 43  DA  I OP2   1 
ATOM   8517  O  "O5'" . DA  J 7  116 ? 4.946   -9.544  -1.062 1.00 228.29 ? 43  DA  I "O5'" 1 
ATOM   8518  C  "C5'" . DA  J 7  116 ? 4.611   -8.294  -1.649 1.00 223.91 ? 43  DA  I "C5'" 1 
ATOM   8519  C  "C4'" . DA  J 7  116 ? 4.810   -7.161  -0.658 1.00 214.28 ? 43  DA  I "C4'" 1 
ATOM   8520  O  "O4'" . DA  J 7  116 ? 3.898   -7.328  0.459  1.00 206.31 ? 43  DA  I "O4'" 1 
ATOM   8521  C  "C3'" . DA  J 7  116 ? 6.215   -7.063  -0.058 1.00 210.09 ? 43  DA  I "C3'" 1 
ATOM   8522  O  "O3'" . DA  J 7  116 ? 6.663   -5.714  -0.091 1.00 207.11 ? 43  DA  I "O3'" 1 
ATOM   8523  C  "C2'" . DA  J 7  116 ? 6.032   -7.565  1.374  1.00 204.78 ? 43  DA  I "C2'" 1 
ATOM   8524  C  "C1'" . DA  J 7  116 ? 4.598   -7.158  1.668  1.00 202.68 ? 43  DA  I "C1'" 1 
ATOM   8525  N  N9    . DA  J 7  116 ? 3.962   -7.984  2.691  1.00 198.67 ? 43  DA  I N9    1 
ATOM   8526  C  C8    . DA  J 7  116 ? 3.926   -9.349  2.741  1.00 198.68 ? 43  DA  I C8    1 
ATOM   8527  N  N7    . DA  J 7  116 ? 3.281   -9.824  3.781  1.00 194.41 ? 43  DA  I N7    1 
ATOM   8528  C  C5    . DA  J 7  116 ? 2.865   -8.691  4.460  1.00 191.83 ? 43  DA  I C5    1 
ATOM   8529  C  C6    . DA  J 7  116 ? 2.129   -8.513  5.648  1.00 187.24 ? 43  DA  I C6    1 
ATOM   8530  N  N6    . DA  J 7  116 ? 1.668   -9.527  6.388  1.00 183.34 ? 43  DA  I N6    1 
ATOM   8531  N  N1    . DA  J 7  116 ? 1.885   -7.248  6.049  1.00 186.26 ? 43  DA  I N1    1 
ATOM   8532  C  C2    . DA  J 7  116 ? 2.349   -6.235  5.306  1.00 188.60 ? 43  DA  I C2    1 
ATOM   8533  N  N3    . DA  J 7  116 ? 3.050   -6.278  4.174  1.00 192.59 ? 43  DA  I N3    1 
ATOM   8534  C  C4    . DA  J 7  116 ? 3.276   -7.547  3.801  1.00 194.06 ? 43  DA  I C4    1 
ATOM   8535  P  P     . DT  J 7  117 ? 8.137   -5.331  0.423  1.00 202.77 ? 44  DT  I P     1 
ATOM   8536  O  OP1   . DT  J 7  117 ? 8.638   -4.242  -0.443 1.00 206.56 ? 44  DT  I OP1   1 
ATOM   8537  O  OP2   . DT  J 7  117 ? 8.922   -6.579  0.559  1.00 202.25 ? 44  DT  I OP2   1 
ATOM   8538  O  "O5'" . DT  J 7  117 ? 7.885   -4.741  1.887  1.00 193.90 ? 44  DT  I "O5'" 1 
ATOM   8539  C  "C5'" . DT  J 7  117 ? 6.989   -3.651  2.063  1.00 187.75 ? 44  DT  I "C5'" 1 
ATOM   8540  C  "C4'" . DT  J 7  117 ? 6.820   -3.318  3.534  1.00 178.23 ? 44  DT  I "C4'" 1 
ATOM   8541  O  "O4'" . DT  J 7  117 ? 6.090   -4.381  4.194  1.00 171.80 ? 44  DT  I "O4'" 1 
ATOM   8542  C  "C3'" . DT  J 7  117 ? 8.129   -3.146  4.313  1.00 175.69 ? 44  DT  I "C3'" 1 
ATOM   8543  O  "O3'" . DT  J 7  117 ? 8.160   -1.868  4.935  1.00 172.13 ? 44  DT  I "O3'" 1 
ATOM   8544  C  "C2'" . DT  J 7  117 ? 8.106   -4.278  5.347  1.00 171.04 ? 44  DT  I "C2'" 1 
ATOM   8545  C  "C1'" . DT  J 7  117 ? 6.619   -4.563  5.480  1.00 167.49 ? 44  DT  I "C1'" 1 
ATOM   8546  N  N1    . DT  J 7  117 ? 6.316   -5.953  5.926  1.00 163.10 ? 44  DT  I N1    1 
ATOM   8547  C  C2    . DT  J 7  117 ? 5.559   -6.146  7.058  1.00 156.77 ? 44  DT  I C2    1 
ATOM   8548  O  O2    . DT  J 7  117 ? 5.111   -5.231  7.726  1.00 153.79 ? 44  DT  I O2    1 
ATOM   8549  N  N3    . DT  J 7  117 ? 5.340   -7.458  7.382  1.00 154.60 ? 44  DT  I N3    1 
ATOM   8550  C  C4    . DT  J 7  117 ? 5.794   -8.574  6.703  1.00 157.37 ? 44  DT  I C4    1 
ATOM   8551  O  O4    . DT  J 7  117 ? 5.543   -9.716  7.075  1.00 155.22 ? 44  DT  I O4    1 
ATOM   8552  C  C5    . DT  J 7  117 ? 6.583   -8.301  5.526  1.00 163.15 ? 44  DT  I C5    1 
ATOM   8553  C  C7    . DT  J 7  117 ? 7.131   -9.432  4.706  1.00 165.75 ? 44  DT  I C7    1 
ATOM   8554  C  C6    . DT  J 7  117 ? 6.804   -7.019  5.198  1.00 165.42 ? 44  DT  I C6    1 
ATOM   8555  P  P     . DT  J 7  118 ? 9.554   -1.251  5.443  1.00 169.78 ? 45  DT  I P     1 
ATOM   8556  O  OP1   . DT  J 7  118 ? 9.526   0.203   5.173  1.00 169.60 ? 45  DT  I OP1   1 
ATOM   8557  O  OP2   . DT  J 7  118 ? 10.643  -2.085  4.888  1.00 174.08 ? 45  DT  I OP2   1 
ATOM   8558  O  "O5'" . DT  J 7  118 ? 9.520   -1.482  7.024  1.00 165.13 ? 45  DT  I "O5'" 1 
ATOM   8559  C  "C5'" . DT  J 7  118 ? 8.503   -0.873  7.808  1.00 159.88 ? 45  DT  I "C5'" 1 
ATOM   8560  C  "C4'" . DT  J 7  118 ? 8.515   -1.413  9.226  1.00 154.04 ? 45  DT  I "C4'" 1 
ATOM   8561  O  "O4'" . DT  J 7  118 ? 8.031   -2.782  9.233  1.00 152.50 ? 45  DT  I "O4'" 1 
ATOM   8562  C  "C3'" . DT  J 7  118 ? 9.892   -1.444  9.896  1.00 153.32 ? 45  DT  I "C3'" 1 
ATOM   8563  O  "O3'" . DT  J 7  118 ? 9.786   -0.984  11.234 1.00 147.42 ? 45  DT  I "O3'" 1 
ATOM   8564  C  "C2'" . DT  J 7  118 ? 10.270  -2.924  9.846  1.00 153.64 ? 45  DT  I "C2'" 1 
ATOM   8565  C  "C1'" . DT  J 7  118 ? 8.907   -3.576  9.996  1.00 151.64 ? 45  DT  I "C1'" 1 
ATOM   8566  N  N1    . DT  J 7  118 ? 8.850   -4.976  9.487  1.00 153.22 ? 45  DT  I N1    1 
ATOM   8567  C  C2    . DT  J 7  118 ? 8.048   -5.890  10.129 1.00 150.78 ? 45  DT  I C2    1 
ATOM   8568  O  O2    . DT  J 7  118 ? 7.368   -5.615  11.102 1.00 146.86 ? 45  DT  I O2    1 
ATOM   8569  N  N3    . DT  J 7  118 ? 8.066   -7.147  9.586  1.00 152.04 ? 45  DT  I N3    1 
ATOM   8570  C  C4    . DT  J 7  118 ? 8.792   -7.574  8.490  1.00 154.68 ? 45  DT  I C4    1 
ATOM   8571  O  O4    . DT  J 7  118 ? 8.742   -8.729  8.078  1.00 154.43 ? 45  DT  I O4    1 
ATOM   8572  C  C5    . DT  J 7  118 ? 9.616   -6.565  7.865  1.00 158.04 ? 45  DT  I C5    1 
ATOM   8573  C  C7    . DT  J 7  118 ? 10.450  -6.909  6.667  1.00 163.43 ? 45  DT  I C7    1 
ATOM   8574  C  C6    . DT  J 7  118 ? 9.605   -5.330  8.388  1.00 157.08 ? 45  DT  I C6    1 
ATOM   8575  P  P     . DG  J 7  119 ? 10.389  0.445   11.652 1.00 144.79 ? 46  DG  I P     1 
ATOM   8576  O  OP1   . DG  J 7  119 ? 9.605   1.484   10.948 1.00 144.96 ? 46  DG  I OP1   1 
ATOM   8577  O  OP2   . DG  J 7  119 ? 11.858  0.384   11.482 1.00 146.57 ? 46  DG  I OP2   1 
ATOM   8578  O  "O5'" . DG  J 7  119 ? 10.075  0.545   13.217 1.00 140.04 ? 46  DG  I "O5'" 1 
ATOM   8579  C  "C5'" . DG  J 7  119 ? 8.726   0.588   13.666 1.00 134.66 ? 46  DG  I "C5'" 1 
ATOM   8580  C  "C4'" . DG  J 7  119 ? 8.436   -0.546  14.634 1.00 128.95 ? 46  DG  I "C4'" 1 
ATOM   8581  O  "O4'" . DG  J 7  119 ? 8.671   -1.823  13.979 1.00 130.75 ? 46  DG  I "O4'" 1 
ATOM   8582  C  "C3'" . DG  J 7  119 ? 9.297   -0.559  15.900 1.00 127.74 ? 46  DG  I "C3'" 1 
ATOM   8583  O  "O3'" . DG  J 7  119 ? 8.502   -0.938  17.013 1.00 122.51 ? 46  DG  I "O3'" 1 
ATOM   8584  C  "C2'" . DG  J 7  119 ? 10.341  -1.625  15.585 1.00 131.85 ? 46  DG  I "C2'" 1 
ATOM   8585  C  "C1'" . DG  J 7  119 ? 9.500   -2.614  14.798 1.00 131.35 ? 46  DG  I "C1'" 1 
ATOM   8586  N  N9    . DG  J 7  119 ? 10.278  -3.512  13.952 1.00 133.82 ? 46  DG  I N9    1 
ATOM   8587  C  C8    . DG  J 7  119 ? 11.399  -3.202  13.219 1.00 139.63 ? 46  DG  I C8    1 
ATOM   8588  N  N7    . DG  J 7  119 ? 11.882  -4.216  12.557 1.00 142.39 ? 46  DG  I N7    1 
ATOM   8589  C  C5    . DG  J 7  119 ? 11.027  -5.266  12.870 1.00 137.95 ? 46  DG  I C5    1 
ATOM   8590  C  C6    . DG  J 7  119 ? 11.046  -6.617  12.447 1.00 138.28 ? 46  DG  I C6    1 
ATOM   8591  O  O6    . DG  J 7  119 ? 11.850  -7.172  11.686 1.00 142.17 ? 46  DG  I O6    1 
ATOM   8592  N  N1    . DG  J 7  119 ? 9.996   -7.345  13.002 1.00 133.46 ? 46  DG  I N1    1 
ATOM   8593  C  C2    . DG  J 7  119 ? 9.048   -6.832  13.855 1.00 129.21 ? 46  DG  I C2    1 
ATOM   8594  N  N2    . DG  J 7  119 ? 8.112   -7.688  14.288 1.00 129.59 ? 46  DG  I N2    1 
ATOM   8595  N  N3    . DG  J 7  119 ? 9.019   -5.569  14.259 1.00 125.81 ? 46  DG  I N3    1 
ATOM   8596  C  C4    . DG  J 7  119 ? 10.035  -4.847  13.728 1.00 131.51 ? 46  DG  I C4    1 
ATOM   8597  P  P     . DA  J 7  120 ? 7.992   0.165   18.063 1.00 119.15 ? 47  DA  I P     1 
ATOM   8598  O  OP1   . DA  J 7  120 ? 7.161   1.135   17.318 1.00 120.83 ? 47  DA  I OP1   1 
ATOM   8599  O  OP2   . DA  J 7  120 ? 9.166   0.631   18.835 1.00 124.39 ? 47  DA  I OP2   1 
ATOM   8600  O  "O5'" . DA  J 7  120 ? 7.044   -0.661  19.052 1.00 112.74 ? 47  DA  I "O5'" 1 
ATOM   8601  C  "C5'" . DA  J 7  120 ? 5.770   -1.109  18.602 1.00 112.77 ? 47  DA  I "C5'" 1 
ATOM   8602  C  "C4'" . DA  J 7  120 ? 5.554   -2.575  18.940 1.00 114.30 ? 47  DA  I "C4'" 1 
ATOM   8603  O  "O4'" . DA  J 7  120 ? 6.533   -3.386  18.238 1.00 118.60 ? 47  DA  I "O4'" 1 
ATOM   8604  C  "C3'" . DA  J 7  120 ? 5.689   -2.930  20.418 1.00 112.48 ? 47  DA  I "C3'" 1 
ATOM   8605  O  "O3'" . DA  J 7  120 ? 4.715   -3.902  20.771 1.00 108.80 ? 47  DA  I "O3'" 1 
ATOM   8606  C  "C2'" . DA  J 7  120 ? 7.105   -3.491  20.514 1.00 114.74 ? 47  DA  I "C2'" 1 
ATOM   8607  C  "C1'" . DA  J 7  120 ? 7.264   -4.167  19.160 1.00 119.00 ? 47  DA  I "C1'" 1 
ATOM   8608  N  N9    . DA  J 7  120 ? 8.648   -4.233  18.700 1.00 127.93 ? 47  DA  I N9    1 
ATOM   8609  C  C8    . DA  J 7  120 ? 9.594   -3.249  18.788 1.00 133.62 ? 47  DA  I C8    1 
ATOM   8610  N  N7    . DA  J 7  120 ? 10.757  -3.586  18.285 1.00 140.83 ? 47  DA  I N7    1 
ATOM   8611  C  C5    . DA  J 7  120 ? 10.561  -4.880  17.832 1.00 141.60 ? 47  DA  I C5    1 
ATOM   8612  C  C6    . DA  J 7  120 ? 11.414  -5.803  17.194 1.00 145.81 ? 47  DA  I C6    1 
ATOM   8613  N  N6    . DA  J 7  120 ? 12.690  -5.539  16.894 1.00 151.08 ? 47  DA  I N6    1 
ATOM   8614  N  N1    . DA  J 7  120 ? 10.903  -7.011  16.877 1.00 145.10 ? 47  DA  I N1    1 
ATOM   8615  C  C2    . DA  J 7  120 ? 9.625   -7.271  17.180 1.00 140.40 ? 47  DA  I C2    1 
ATOM   8616  N  N3    . DA  J 7  120 ? 8.729   -6.486  17.776 1.00 135.93 ? 47  DA  I N3    1 
ATOM   8617  C  C4    . DA  J 7  120 ? 9.266   -5.294  18.079 1.00 135.12 ? 47  DA  I C4    1 
ATOM   8618  P  P     . DG  J 7  121 ? 4.423   -4.232  22.315 1.00 105.50 ? 48  DG  I P     1 
ATOM   8619  O  OP1   . DG  J 7  121 ? 2.979   -4.532  22.445 1.00 101.12 ? 48  DG  I OP1   1 
ATOM   8620  O  OP2   . DG  J 7  121 ? 5.029   -3.153  23.128 1.00 109.06 ? 48  DG  I OP2   1 
ATOM   8621  O  "O5'" . DG  J 7  121 ? 5.251   -5.573  22.580 1.00 102.21 ? 48  DG  I "O5'" 1 
ATOM   8622  C  "C5'" . DG  J 7  121 ? 4.990   -6.726  21.796 1.00 100.45 ? 48  DG  I "C5'" 1 
ATOM   8623  C  "C4'" . DG  J 7  121 ? 6.093   -7.754  21.960 1.00 103.31 ? 48  DG  I "C4'" 1 
ATOM   8624  O  "O4'" . DG  J 7  121 ? 7.294   -7.302  21.280 1.00 107.96 ? 48  DG  I "O4'" 1 
ATOM   8625  C  "C3'" . DG  J 7  121 ? 6.506   -8.045  23.409 1.00 101.82 ? 48  DG  I "C3'" 1 
ATOM   8626  O  "O3'" . DG  J 7  121 ? 6.563   -9.451  23.615 1.00 102.84 ? 48  DG  I "O3'" 1 
ATOM   8627  C  "C2'" . DG  J 7  121 ? 7.893   -7.408  23.514 1.00 103.49 ? 48  DG  I "C2'" 1 
ATOM   8628  C  "C1'" . DG  J 7  121 ? 8.401   -7.584  22.096 1.00 109.78 ? 48  DG  I "C1'" 1 
ATOM   8629  N  N9    . DG  J 7  121 ? 9.494   -6.683  21.742 1.00 120.93 ? 48  DG  I N9    1 
ATOM   8630  C  C8    . DG  J 7  121 ? 9.601   -5.347  22.044 1.00 124.70 ? 48  DG  I C8    1 
ATOM   8631  N  N7    . DG  J 7  121 ? 10.697  -4.800  21.595 1.00 129.06 ? 48  DG  I N7    1 
ATOM   8632  C  C5    . DG  J 7  121 ? 11.359  -5.840  20.955 1.00 131.06 ? 48  DG  I C5    1 
ATOM   8633  C  C6    . DG  J 7  121 ? 12.601  -5.852  20.278 1.00 136.31 ? 48  DG  I C6    1 
ATOM   8634  O  O6    . DG  J 7  121 ? 13.388  -4.911  20.102 1.00 143.76 ? 48  DG  I O6    1 
ATOM   8635  N  N1    . DG  J 7  121 ? 12.902  -7.115  19.774 1.00 135.27 ? 48  DG  I N1    1 
ATOM   8636  C  C2    . DG  J 7  121 ? 12.103  -8.226  19.909 1.00 131.36 ? 48  DG  I C2    1 
ATOM   8637  N  N2    . DG  J 7  121 ? 12.561  -9.359  19.355 1.00 132.86 ? 48  DG  I N2    1 
ATOM   8638  N  N3    . DG  J 7  121 ? 10.938  -8.229  20.541 1.00 127.89 ? 48  DG  I N3    1 
ATOM   8639  C  C4    . DG  J 7  121 ? 10.631  -7.006  21.037 1.00 127.52 ? 48  DG  I C4    1 
ATOM   8640  P  P     . DC  J 7  122 ? 6.437   -10.069 25.093 1.00 99.40  ? 49  DC  I P     1 
ATOM   8641  O  OP1   . DC  J 7  122 ? 5.107   -10.709 25.201 1.00 94.18  ? 49  DC  I OP1   1 
ATOM   8642  O  OP2   . DC  J 7  122 ? 6.834   -9.026  26.066 1.00 99.23  ? 49  DC  I OP2   1 
ATOM   8643  O  "O5'" . DC  J 7  122 ? 7.555   -11.212 25.115 1.00 102.04 ? 49  DC  I "O5'" 1 
ATOM   8644  C  "C5'" . DC  J 7  122 ? 7.639   -12.138 24.039 1.00 104.15 ? 49  DC  I "C5'" 1 
ATOM   8645  C  "C4'" . DC  J 7  122 ? 9.087   -12.448 23.707 1.00 106.91 ? 49  DC  I "C4'" 1 
ATOM   8646  O  "O4'" . DC  J 7  122 ? 9.735   -11.257 23.227 1.00 108.72 ? 49  DC  I "O4'" 1 
ATOM   8647  C  "C3'" . DC  J 7  122 ? 9.927   -12.930 24.887 1.00 107.78 ? 49  DC  I "C3'" 1 
ATOM   8648  O  "O3'" . DC  J 7  122 ? 10.115  -14.335 24.802 1.00 110.37 ? 49  DC  I "O3'" 1 
ATOM   8649  C  "C2'" . DC  J 7  122 ? 11.261  -12.170 24.760 1.00 110.66 ? 49  DC  I "C2'" 1 
ATOM   8650  C  "C1'" . DC  J 7  122 ? 11.112  -11.372 23.466 1.00 112.64 ? 49  DC  I "C1'" 1 
ATOM   8651  N  N1    . DC  J 7  122 ? 11.688  -9.999  23.547 1.00 116.90 ? 49  DC  I N1    1 
ATOM   8652  C  C2    . DC  J 7  122 ? 12.955  -9.745  23.011 1.00 122.29 ? 49  DC  I C2    1 
ATOM   8653  O  O2    . DC  J 7  122 ? 13.580  -10.668 22.475 1.00 125.70 ? 49  DC  I O2    1 
ATOM   8654  N  N3    . DC  J 7  122 ? 13.461  -8.489  23.094 1.00 125.69 ? 49  DC  I N3    1 
ATOM   8655  C  C4    . DC  J 7  122 ? 12.755  -7.520  23.680 1.00 121.98 ? 49  DC  I C4    1 
ATOM   8656  N  N4    . DC  J 7  122 ? 13.295  -6.298  23.738 1.00 122.38 ? 49  DC  I N4    1 
ATOM   8657  C  C5    . DC  J 7  122 ? 11.463  -7.762  24.232 1.00 117.52 ? 49  DC  I C5    1 
ATOM   8658  C  C6    . DC  J 7  122 ? 10.974  -9.003  24.144 1.00 116.24 ? 49  DC  I C6    1 
ATOM   8659  P  P     . DG  J 7  123 ? 10.620  -15.164 26.082 1.00 112.19 ? 50  DG  I P     1 
ATOM   8660  O  OP1   . DG  J 7  123 ? 9.898   -16.457 26.093 1.00 111.41 ? 50  DG  I OP1   1 
ATOM   8661  O  OP2   . DG  J 7  123 ? 10.551  -14.270 27.260 1.00 107.47 ? 50  DG  I OP2   1 
ATOM   8662  O  "O5'" . DG  J 7  123 ? 12.161  -15.445 25.766 1.00 119.40 ? 50  DG  I "O5'" 1 
ATOM   8663  C  "C5'" . DG  J 7  123 ? 12.523  -16.134 24.577 1.00 126.32 ? 50  DG  I "C5'" 1 
ATOM   8664  C  "C4'" . DG  J 7  123 ? 14.003  -15.968 24.286 1.00 134.34 ? 50  DG  I "C4'" 1 
ATOM   8665  O  "O4'" . DG  J 7  123 ? 14.312  -14.558 24.134 1.00 139.10 ? 50  DG  I "O4'" 1 
ATOM   8666  C  "C3'" . DG  J 7  123 ? 14.938  -16.497 25.373 1.00 137.36 ? 50  DG  I "C3'" 1 
ATOM   8667  O  "O3'" . DG  J 7  123 ? 16.051  -17.146 24.777 1.00 142.20 ? 50  DG  I "O3'" 1 
ATOM   8668  C  "C2'" . DG  J 7  123 ? 15.357  -15.232 26.120 1.00 140.43 ? 50  DG  I "C2'" 1 
ATOM   8669  C  "C1'" . DG  J 7  123 ? 15.364  -14.201 25.003 1.00 145.54 ? 50  DG  I "C1'" 1 
ATOM   8670  N  N9    . DG  J 7  123 ? 15.131  -12.837 25.469 1.00 153.67 ? 50  DG  I N9    1 
ATOM   8671  C  C8    . DG  J 7  123 ? 14.242  -12.434 26.436 1.00 153.42 ? 50  DG  I C8    1 
ATOM   8672  N  N7    . DG  J 7  123 ? 14.246  -11.146 26.642 1.00 157.09 ? 50  DG  I N7    1 
ATOM   8673  C  C5    . DG  J 7  123 ? 15.197  -10.662 25.753 1.00 163.22 ? 50  DG  I C5    1 
ATOM   8674  C  C6    . DG  J 7  123 ? 15.638  -9.337  25.521 1.00 167.19 ? 50  DG  I C6    1 
ATOM   8675  O  O6    . DG  J 7  123 ? 15.262  -8.295  26.075 1.00 165.63 ? 50  DG  I O6    1 
ATOM   8676  N  N1    . DG  J 7  123 ? 16.618  -9.286  24.533 1.00 173.23 ? 50  DG  I N1    1 
ATOM   8677  C  C2    . DG  J 7  123 ? 17.110  -10.377 23.855 1.00 177.51 ? 50  DG  I C2    1 
ATOM   8678  N  N2    . DG  J 7  123 ? 18.054  -10.130 22.935 1.00 183.81 ? 50  DG  I N2    1 
ATOM   8679  N  N3    . DG  J 7  123 ? 16.705  -11.624 24.063 1.00 173.51 ? 50  DG  I N3    1 
ATOM   8680  C  C4    . DG  J 7  123 ? 15.751  -11.691 25.023 1.00 163.43 ? 50  DG  I C4    1 
ATOM   8681  P  P     . DG  J 7  124 ? 17.065  -18.007 25.677 1.00 145.25 ? 51  DG  I P     1 
ATOM   8682  O  OP1   . DG  J 7  124 ? 17.419  -19.219 24.906 1.00 151.78 ? 51  DG  I OP1   1 
ATOM   8683  O  OP2   . DG  J 7  124 ? 16.488  -18.131 27.034 1.00 138.92 ? 51  DG  I OP2   1 
ATOM   8684  O  "O5'" . DG  J 7  124 ? 18.364  -17.083 25.773 1.00 149.77 ? 51  DG  I "O5'" 1 
ATOM   8685  C  "C5'" . DG  J 7  124 ? 19.087  -16.760 24.594 1.00 157.21 ? 51  DG  I "C5'" 1 
ATOM   8686  C  "C4'" . DG  J 7  124 ? 20.178  -15.751 24.893 1.00 164.13 ? 51  DG  I "C4'" 1 
ATOM   8687  O  "O4'" . DG  J 7  124 ? 19.579  -14.460 25.168 1.00 163.49 ? 51  DG  I "O4'" 1 
ATOM   8688  C  "C3'" . DG  J 7  124 ? 21.053  -16.091 26.100 1.00 168.00 ? 51  DG  I "C3'" 1 
ATOM   8689  O  "O3'" . DG  J 7  124 ? 22.423  -15.920 25.770 1.00 175.19 ? 51  DG  I "O3'" 1 
ATOM   8690  C  "C2'" . DG  J 7  124 ? 20.598  -15.100 27.172 1.00 165.34 ? 51  DG  I "C2'" 1 
ATOM   8691  C  "C1'" . DG  J 7  124 ? 20.141  -13.915 26.337 1.00 165.64 ? 51  DG  I "C1'" 1 
ATOM   8692  N  N9    . DG  J 7  124 ? 19.125  -13.101 26.996 1.00 164.87 ? 51  DG  I N9    1 
ATOM   8693  C  C8    . DG  J 7  124 ? 18.028  -13.551 27.691 1.00 161.59 ? 51  DG  I C8    1 
ATOM   8694  N  N7    . DG  J 7  124 ? 17.289  -12.592 28.173 1.00 160.60 ? 51  DG  I N7    1 
ATOM   8695  C  C5    . DG  J 7  124 ? 17.934  -11.430 27.771 1.00 163.95 ? 51  DG  I C5    1 
ATOM   8696  C  C6    . DG  J 7  124 ? 17.597  -10.075 28.000 1.00 162.94 ? 51  DG  I C6    1 
ATOM   8697  O  O6    . DG  J 7  124 ? 16.627  -9.620  28.622 1.00 159.53 ? 51  DG  I O6    1 
ATOM   8698  N  N1    . DG  J 7  124 ? 18.519  -9.209  27.416 1.00 166.12 ? 51  DG  I N1    1 
ATOM   8699  C  C2    . DG  J 7  124 ? 19.627  -9.604  26.704 1.00 170.24 ? 51  DG  I C2    1 
ATOM   8700  N  N2    . DG  J 7  124 ? 20.401  -8.623  26.218 1.00 173.65 ? 51  DG  I N2    1 
ATOM   8701  N  N3    . DG  J 7  124 ? 19.955  -10.871 26.484 1.00 171.20 ? 51  DG  I N3    1 
ATOM   8702  C  C4    . DG  J 7  124 ? 19.066  -11.726 27.044 1.00 167.24 ? 51  DG  I C4    1 
ATOM   8703  P  P     . DC  J 7  125 ? 23.565  -16.537 26.716 1.00 178.14 ? 52  DC  I P     1 
ATOM   8704  O  OP1   . DC  J 7  125 ? 24.558  -17.202 25.843 1.00 182.67 ? 52  DC  I OP1   1 
ATOM   8705  O  OP2   . DC  J 7  125 ? 22.899  -17.304 27.792 1.00 172.41 ? 52  DC  I OP2   1 
ATOM   8706  O  "O5'" . DC  J 7  125 ? 24.242  -15.249 27.376 1.00 181.50 ? 52  DC  I "O5'" 1 
ATOM   8707  C  "C5'" . DC  J 7  125 ? 24.730  -14.207 26.543 1.00 185.26 ? 52  DC  I "C5'" 1 
ATOM   8708  C  "C4'" . DC  J 7  125 ? 24.809  -12.898 27.306 1.00 183.66 ? 52  DC  I "C4'" 1 
ATOM   8709  O  "O4'" . DC  J 7  125 ? 23.478  -12.444 27.628 1.00 180.35 ? 52  DC  I "O4'" 1 
ATOM   8710  C  "C3'" . DC  J 7  125 ? 25.563  -12.971 28.636 1.00 182.25 ? 52  DC  I "C3'" 1 
ATOM   8711  O  "O3'" . DC  J 7  125 ? 26.775  -12.233 28.546 1.00 185.74 ? 52  DC  I "O3'" 1 
ATOM   8712  C  "C2'" . DC  J 7  125 ? 24.598  -12.360 29.669 1.00 179.08 ? 52  DC  I "C2'" 1 
ATOM   8713  C  "C1'" . DC  J 7  125 ? 23.544  -11.685 28.802 1.00 179.60 ? 52  DC  I "C1'" 1 
ATOM   8714  N  N1    . DC  J 7  125 ? 22.189  -11.658 29.426 1.00 176.92 ? 52  DC  I N1    1 
ATOM   8715  C  C2    . DC  J 7  125 ? 21.539  -10.434 29.621 1.00 175.70 ? 52  DC  I C2    1 
ATOM   8716  O  O2    . DC  J 7  125 ? 22.101  -9.390  29.267 1.00 178.75 ? 52  DC  I O2    1 
ATOM   8717  N  N3    . DC  J 7  125 ? 20.308  -10.428 30.191 1.00 171.20 ? 52  DC  I N3    1 
ATOM   8718  C  C4    . DC  J 7  125 ? 19.736  -11.576 30.559 1.00 168.88 ? 52  DC  I C4    1 
ATOM   8719  N  N4    . DC  J 7  125 ? 18.522  -11.519 31.116 1.00 164.54 ? 52  DC  I N4    1 
ATOM   8720  C  C5    . DC  J 7  125 ? 20.383  -12.833 30.370 1.00 171.18 ? 52  DC  I C5    1 
ATOM   8721  C  C6    . DC  J 7  125 ? 21.596  -12.827 29.806 1.00 175.27 ? 52  DC  I C6    1 
ATOM   8722  P  P     . DC  J 7  126 ? 27.786  -12.176 29.794 1.00 186.84 ? 53  DC  I P     1 
ATOM   8723  O  OP1   . DC  J 7  126 ? 29.147  -11.955 29.256 1.00 191.31 ? 53  DC  I OP1   1 
ATOM   8724  O  OP2   . DC  J 7  126 ? 27.516  -13.350 30.654 1.00 185.38 ? 53  DC  I OP2   1 
ATOM   8725  O  "O5'" . DC  J 7  126 ? 27.329  -10.868 30.590 1.00 184.65 ? 53  DC  I "O5'" 1 
ATOM   8726  C  "C5'" . DC  J 7  126 ? 27.173  -9.637  29.896 1.00 184.66 ? 53  DC  I "C5'" 1 
ATOM   8727  C  "C4'" . DC  J 7  126 ? 26.627  -8.565  30.819 1.00 180.03 ? 53  DC  I "C4'" 1 
ATOM   8728  O  "O4'" . DC  J 7  126 ? 25.213  -8.789  31.045 1.00 172.61 ? 53  DC  I "O4'" 1 
ATOM   8729  C  "C3'" . DC  J 7  126 ? 27.284  -8.511  32.201 1.00 181.50 ? 53  DC  I "C3'" 1 
ATOM   8730  O  "O3'" . DC  J 7  126 ? 27.685  -7.182  32.496 1.00 188.16 ? 53  DC  I "O3'" 1 
ATOM   8731  C  "C2'" . DC  J 7  126 ? 26.183  -8.993  33.151 1.00 173.16 ? 53  DC  I "C2'" 1 
ATOM   8732  C  "C1'" . DC  J 7  126 ? 24.924  -8.586  32.405 1.00 168.99 ? 53  DC  I "C1'" 1 
ATOM   8733  N  N1    . DC  J 7  126 ? 23.730  -9.405  32.762 1.00 162.83 ? 53  DC  I N1    1 
ATOM   8734  C  C2    . DC  J 7  126 ? 22.524  -8.770  33.080 1.00 157.95 ? 53  DC  I C2    1 
ATOM   8735  O  O2    . DC  J 7  126 ? 22.469  -7.534  33.055 1.00 157.57 ? 53  DC  I O2    1 
ATOM   8736  N  N3    . DC  J 7  126 ? 21.448  -9.529  33.404 1.00 153.34 ? 53  DC  I N3    1 
ATOM   8737  C  C4    . DC  J 7  126 ? 21.549  -10.859 33.418 1.00 151.67 ? 53  DC  I C4    1 
ATOM   8738  N  N4    . DC  J 7  126 ? 20.461  -11.565 33.744 1.00 147.75 ? 53  DC  I N4    1 
ATOM   8739  C  C5    . DC  J 7  126 ? 22.770  -11.524 33.099 1.00 155.31 ? 53  DC  I C5    1 
ATOM   8740  C  C6    . DC  J 7  126 ? 23.824  -10.766 32.781 1.00 160.77 ? 53  DC  I C6    1 
ATOM   8741  P  P     . DT  J 7  127 ? 28.828  -6.909  33.591 1.00 194.12 ? 54  DT  I P     1 
ATOM   8742  O  OP1   . DT  J 7  127 ? 29.816  -5.987  32.990 1.00 203.58 ? 54  DT  I OP1   1 
ATOM   8743  O  OP2   . DT  J 7  127 ? 29.269  -8.220  34.119 1.00 192.06 ? 54  DT  I OP2   1 
ATOM   8744  O  "O5'" . DT  J 7  127 ? 28.055  -6.145  34.763 1.00 192.14 ? 54  DT  I "O5'" 1 
ATOM   8745  C  "C5'" . DT  J 7  127 ? 27.340  -4.950  34.476 1.00 192.04 ? 54  DT  I "C5'" 1 
ATOM   8746  C  "C4'" . DT  J 7  127 ? 26.505  -4.521  35.668 1.00 187.90 ? 54  DT  I "C4'" 1 
ATOM   8747  O  "O4'" . DT  J 7  127 ? 25.347  -5.390  35.792 1.00 184.31 ? 54  DT  I "O4'" 1 
ATOM   8748  C  "C3'" . DT  J 7  127 ? 27.226  -4.576  37.017 1.00 186.30 ? 54  DT  I "C3'" 1 
ATOM   8749  O  "O3'" . DT  J 7  127 ? 26.905  -3.426  37.780 1.00 182.05 ? 54  DT  I "O3'" 1 
ATOM   8750  C  "C2'" . DT  J 7  127 ? 26.668  -5.845  37.658 1.00 184.11 ? 54  DT  I "C2'" 1 
ATOM   8751  C  "C1'" . DT  J 7  127 ? 25.248  -5.853  37.118 1.00 182.63 ? 54  DT  I "C1'" 1 
ATOM   8752  N  N1    . DT  J 7  127 ? 24.626  -7.206  37.104 1.00 182.98 ? 54  DT  I N1    1 
ATOM   8753  C  C2    . DT  J 7  127 ? 23.292  -7.336  37.413 1.00 179.97 ? 54  DT  I C2    1 
ATOM   8754  O  O2    . DT  J 7  127 ? 22.577  -6.391  37.699 1.00 177.71 ? 54  DT  I O2    1 
ATOM   8755  N  N3    . DT  J 7  127 ? 22.818  -8.620  37.373 1.00 178.19 ? 54  DT  I N3    1 
ATOM   8756  C  C4    . DT  J 7  127 ? 23.531  -9.765  37.063 1.00 178.28 ? 54  DT  I C4    1 
ATOM   8757  O  O4    . DT  J 7  127 ? 23.015  -10.878 37.054 1.00 174.29 ? 54  DT  I O4    1 
ATOM   8758  C  C5    . DT  J 7  127 ? 24.926  -9.557  36.751 1.00 182.84 ? 54  DT  I C5    1 
ATOM   8759  C  C7    . DT  J 7  127 ? 25.801  -10.724 36.399 1.00 184.58 ? 54  DT  I C7    1 
ATOM   8760  C  C6    . DT  J 7  127 ? 25.400  -8.303  36.787 1.00 185.42 ? 54  DT  I C6    1 
ATOM   8761  P  P     . DC  J 7  128 ? 27.912  -2.894  38.913 1.00 180.99 ? 55  DC  I P     1 
ATOM   8762  O  OP1   . DC  J 7  128 ? 28.692  -1.779  38.332 1.00 184.42 ? 55  DC  I OP1   1 
ATOM   8763  O  OP2   . DC  J 7  128 ? 28.614  -4.062  39.490 1.00 181.38 ? 55  DC  I OP2   1 
ATOM   8764  O  "O5'" . DC  J 7  128 ? 26.935  -2.309  40.033 1.00 175.41 ? 55  DC  I "O5'" 1 
ATOM   8765  C  "C5'" . DC  J 7  128 ? 25.805  -1.537  39.648 1.00 169.12 ? 55  DC  I "C5'" 1 
ATOM   8766  C  "C4'" . DC  J 7  128 ? 24.576  -1.947  40.439 1.00 158.72 ? 55  DC  I "C4'" 1 
ATOM   8767  O  "O4'" . DC  J 7  128 ? 24.281  -3.349  40.191 1.00 153.62 ? 55  DC  I "O4'" 1 
ATOM   8768  C  "C3'" . DC  J 7  128 ? 24.706  -1.802  41.956 1.00 154.78 ? 55  DC  I "C3'" 1 
ATOM   8769  O  "O3'" . DC  J 7  128 ? 23.507  -1.271  42.493 1.00 147.95 ? 55  DC  I "O3'" 1 
ATOM   8770  C  "C2'" . DC  J 7  128 ? 24.939  -3.237  42.423 1.00 152.92 ? 55  DC  I "C2'" 1 
ATOM   8771  C  "C1'" . DC  J 7  128 ? 24.103  -4.012  41.421 1.00 150.32 ? 55  DC  I "C1'" 1 
ATOM   8772  N  N1    . DC  J 7  128 ? 24.528  -5.430  41.264 1.00 150.49 ? 55  DC  I N1    1 
ATOM   8773  C  C2    . DC  J 7  128 ? 23.563  -6.442  41.237 1.00 147.50 ? 55  DC  I C2    1 
ATOM   8774  O  O2    . DC  J 7  128 ? 22.368  -6.139  41.339 1.00 142.95 ? 55  DC  I O2    1 
ATOM   8775  N  N3    . DC  J 7  128 ? 23.966  -7.729  41.096 1.00 149.08 ? 55  DC  I N3    1 
ATOM   8776  C  C4    . DC  J 7  128 ? 25.265  -8.014  40.989 1.00 152.51 ? 55  DC  I C4    1 
ATOM   8777  N  N4    . DC  J 7  128 ? 25.614  -9.297  40.852 1.00 153.57 ? 55  DC  I N4    1 
ATOM   8778  C  C5    . DC  J 7  128 ? 26.263  -6.996  41.017 1.00 155.11 ? 55  DC  I C5    1 
ATOM   8779  C  C6    . DC  J 7  128 ? 25.854  -5.731  41.156 1.00 154.18 ? 55  DC  I C6    1 
ATOM   8780  P  P     . DG  J 7  129 ? 23.483  0.219   43.091 1.00 141.45 ? 56  DG  I P     1 
ATOM   8781  O  OP1   . DG  J 7  129 ? 23.632  1.164   41.962 1.00 142.56 ? 56  DG  I OP1   1 
ATOM   8782  O  OP2   . DG  J 7  129 ? 24.437  0.253   44.221 1.00 144.14 ? 56  DG  I OP2   1 
ATOM   8783  O  "O5'" . DG  J 7  129 ? 22.010  0.366   43.693 1.00 134.70 ? 56  DG  I "O5'" 1 
ATOM   8784  C  "C5'" . DG  J 7  129 ? 20.897  -0.152  42.979 1.00 129.25 ? 56  DG  I "C5'" 1 
ATOM   8785  C  "C4'" . DG  J 7  129 ? 20.158  -1.183  43.812 1.00 123.27 ? 56  DG  I "C4'" 1 
ATOM   8786  O  "O4'" . DG  J 7  129 ? 20.925  -2.417  43.854 1.00 124.78 ? 56  DG  I "O4'" 1 
ATOM   8787  C  "C3'" . DG  J 7  129 ? 19.919  -0.783  45.269 1.00 119.49 ? 56  DG  I "C3'" 1 
ATOM   8788  O  "O3'" . DG  J 7  129 ? 18.612  -1.159  45.664 1.00 111.58 ? 56  DG  I "O3'" 1 
ATOM   8789  C  "C2'" . DG  J 7  129 ? 20.978  -1.580  46.026 1.00 122.69 ? 56  DG  I "C2'" 1 
ATOM   8790  C  "C1'" . DG  J 7  129 ? 21.041  -2.845  45.191 1.00 124.76 ? 56  DG  I "C1'" 1 
ATOM   8791  N  N9    . DG  J 7  129 ? 22.291  -3.584  45.340 1.00 130.22 ? 56  DG  I N9    1 
ATOM   8792  C  C8    . DG  J 7  129 ? 23.544  -3.061  45.550 1.00 134.43 ? 56  DG  I C8    1 
ATOM   8793  N  N7    . DG  J 7  129 ? 24.477  -3.969  45.646 1.00 136.95 ? 56  DG  I N7    1 
ATOM   8794  C  C5    . DG  J 7  129 ? 23.798  -5.170  45.490 1.00 135.75 ? 56  DG  I C5    1 
ATOM   8795  C  C6    . DG  J 7  129 ? 24.283  -6.500  45.499 1.00 139.59 ? 56  DG  I C6    1 
ATOM   8796  O  O6    . DG  J 7  129 ? 25.449  -6.892  45.654 1.00 142.66 ? 56  DG  I O6    1 
ATOM   8797  N  N1    . DG  J 7  129 ? 23.258  -7.423  45.305 1.00 138.15 ? 56  DG  I N1    1 
ATOM   8798  C  C2    . DG  J 7  129 ? 21.933  -7.101  45.124 1.00 133.14 ? 56  DG  I C2    1 
ATOM   8799  N  N2    . DG  J 7  129 ? 21.089  -8.128  44.953 1.00 130.72 ? 56  DG  I N2    1 
ATOM   8800  N  N3    . DG  J 7  129 ? 21.467  -5.860  45.113 1.00 129.67 ? 56  DG  I N3    1 
ATOM   8801  C  C4    . DG  J 7  129 ? 22.452  -4.950  45.301 1.00 131.31 ? 56  DG  I C4    1 
ATOM   8802  P  P     . DG  J 7  130 ? 17.639  -0.090  46.363 1.00 106.25 ? 57  DG  I P     1 
ATOM   8803  O  OP1   . DG  J 7  130 ? 17.284  0.922   45.343 1.00 106.27 ? 57  DG  I OP1   1 
ATOM   8804  O  OP2   . DG  J 7  130 ? 18.271  0.331   47.634 1.00 107.46 ? 57  DG  I OP2   1 
ATOM   8805  O  "O5'" . DG  J 7  130 ? 16.334  -0.943  46.719 1.00 101.41 ? 57  DG  I "O5'" 1 
ATOM   8806  C  "C5'" . DG  J 7  130 ? 15.645  -1.648  45.690 1.00 100.59 ? 57  DG  I "C5'" 1 
ATOM   8807  C  "C4'" . DG  J 7  130 ? 15.396  -3.091  46.095 1.00 98.51  ? 57  DG  I "C4'" 1 
ATOM   8808  O  "O4'" . DG  J 7  130 ? 16.661  -3.800  46.169 1.00 101.11 ? 57  DG  I "O4'" 1 
ATOM   8809  C  "C3'" . DG  J 7  130 ? 14.720  -3.271  47.455 1.00 92.55  ? 57  DG  I "C3'" 1 
ATOM   8810  O  "O3'" . DG  J 7  130 ? 13.702  -4.255  47.371 1.00 82.27  ? 57  DG  I "O3'" 1 
ATOM   8811  C  "C2'" . DG  J 7  130 ? 15.860  -3.719  48.367 1.00 95.74  ? 57  DG  I "C2'" 1 
ATOM   8812  C  "C1'" . DG  J 7  130 ? 16.759  -4.474  47.403 1.00 102.23 ? 57  DG  I "C1'" 1 
ATOM   8813  N  N9    . DG  J 7  130 ? 18.160  -4.482  47.812 1.00 114.06 ? 57  DG  I N9    1 
ATOM   8814  C  C8    . DG  J 7  130 ? 18.921  -3.395  48.170 1.00 119.10 ? 57  DG  I C8    1 
ATOM   8815  N  N7    . DG  J 7  130 ? 20.147  -3.702  48.492 1.00 124.78 ? 57  DG  I N7    1 
ATOM   8816  C  C5    . DG  J 7  130 ? 20.203  -5.081  48.338 1.00 126.00 ? 57  DG  I C5    1 
ATOM   8817  C  C6    . DG  J 7  130 ? 21.278  -5.976  48.544 1.00 130.68 ? 57  DG  I C6    1 
ATOM   8818  O  O6    . DG  J 7  130 ? 22.432  -5.718  48.915 1.00 135.74 ? 57  DG  I O6    1 
ATOM   8819  N  N1    . DG  J 7  130 ? 20.912  -7.293  48.274 1.00 130.32 ? 57  DG  I N1    1 
ATOM   8820  C  C2    . DG  J 7  130 ? 19.663  -7.692  47.857 1.00 127.40 ? 57  DG  I C2    1 
ATOM   8821  N  N2    . DG  J 7  130 ? 19.499  -9.006  47.647 1.00 128.33 ? 57  DG  I N2    1 
ATOM   8822  N  N3    . DG  J 7  130 ? 18.646  -6.862  47.661 1.00 123.39 ? 57  DG  I N3    1 
ATOM   8823  C  C4    . DG  J 7  130 ? 18.988  -5.577  47.920 1.00 121.28 ? 57  DG  I C4    1 
ATOM   8824  P  P     . DC  J 7  131 ? 12.724  -4.508  48.620 1.00 81.93  ? 58  DC  I P     1 
ATOM   8825  O  OP1   . DC  J 7  131 ? 11.407  -4.929  48.088 1.00 81.38  ? 58  DC  I OP1   1 
ATOM   8826  O  OP2   . DC  J 7  131 ? 12.809  -3.321  49.497 1.00 85.78  ? 58  DC  I OP2   1 
ATOM   8827  O  "O5'" . DC  J 7  131 ? 13.405  -5.735  49.393 1.00 94.66  ? 58  DC  I "O5'" 1 
ATOM   8828  C  "C5'" . DC  J 7  131 ? 13.744  -6.924  48.680 1.00 96.78  ? 58  DC  I "C5'" 1 
ATOM   8829  C  "C4'" . DC  J 7  131 ? 14.592  -7.852  49.535 1.00 99.36  ? 58  DC  I "C4'" 1 
ATOM   8830  O  "O4'" . DC  J 7  131 ? 15.944  -7.326  49.650 1.00 103.95 ? 58  DC  I "O4'" 1 
ATOM   8831  C  "C3'" . DC  J 7  131 ? 14.095  -8.056  50.971 1.00 102.04 ? 58  DC  I "C3'" 1 
ATOM   8832  O  "O3'" . DC  J 7  131 ? 14.232  -9.420  51.330 1.00 108.46 ? 58  DC  I "O3'" 1 
ATOM   8833  C  "C2'" . DC  J 7  131 ? 15.046  -7.180  51.782 1.00 105.11 ? 58  DC  I "C2'" 1 
ATOM   8834  C  "C1'" . DC  J 7  131 ? 16.333  -7.373  51.002 1.00 108.44 ? 58  DC  I "C1'" 1 
ATOM   8835  N  N1    . DC  J 7  131 ? 17.363  -6.320  51.255 1.00 116.41 ? 58  DC  I N1    1 
ATOM   8836  C  C2    . DC  J 7  131 ? 18.713  -6.682  51.345 1.00 122.15 ? 58  DC  I C2    1 
ATOM   8837  O  O2    . DC  J 7  131 ? 19.029  -7.870  51.203 1.00 122.66 ? 58  DC  I O2    1 
ATOM   8838  N  N3    . DC  J 7  131 ? 19.637  -5.718  51.580 1.00 124.87 ? 58  DC  I N3    1 
ATOM   8839  C  C4    . DC  J 7  131 ? 19.256  -4.448  51.727 1.00 124.52 ? 58  DC  I C4    1 
ATOM   8840  N  N4    . DC  J 7  131 ? 20.204  -3.533  51.958 1.00 126.91 ? 58  DC  I N4    1 
ATOM   8841  C  C5    . DC  J 7  131 ? 17.885  -4.060  51.643 1.00 121.46 ? 58  DC  I C5    1 
ATOM   8842  C  C6    . DC  J 7  131 ? 16.982  -5.020  51.411 1.00 117.67 ? 58  DC  I C6    1 
ATOM   8843  P  P     . DA  J 7  132 ? 12.951  -10.292 51.752 1.00 109.13 ? 59  DA  I P     1 
ATOM   8844  O  OP1   . DA  J 7  132 ? 12.064  -10.387 50.572 1.00 109.30 ? 59  DA  I OP1   1 
ATOM   8845  O  OP2   . DA  J 7  132 ? 12.426  -9.750  53.025 1.00 107.88 ? 59  DA  I OP2   1 
ATOM   8846  O  "O5'" . DA  J 7  132 ? 13.570  -11.735 52.051 1.00 111.58 ? 59  DA  I "O5'" 1 
ATOM   8847  C  "C5'" . DA  J 7  132 ? 14.365  -12.381 51.062 1.00 118.87 ? 59  DA  I "C5'" 1 
ATOM   8848  C  "C4'" . DA  J 7  132 ? 15.692  -12.839 51.642 1.00 127.66 ? 59  DA  I "C4'" 1 
ATOM   8849  O  "O4'" . DA  J 7  132 ? 16.555  -11.693 51.859 1.00 130.37 ? 59  DA  I "O4'" 1 
ATOM   8850  C  "C3'" . DA  J 7  132 ? 15.598  -13.571 52.984 1.00 133.95 ? 59  DA  I "C3'" 1 
ATOM   8851  O  "O3'" . DA  J 7  132 ? 16.344  -14.780 52.930 1.00 136.84 ? 59  DA  I "O3'" 1 
ATOM   8852  C  "C2'" . DA  J 7  132 ? 16.200  -12.579 53.984 1.00 136.19 ? 59  DA  I "C2'" 1 
ATOM   8853  C  "C1'" . DA  J 7  132 ? 17.182  -11.815 53.113 1.00 133.47 ? 59  DA  I "C1'" 1 
ATOM   8854  N  N9    . DA  J 7  132 ? 17.483  -10.475 53.611 1.00 134.53 ? 59  DA  I N9    1 
ATOM   8855  C  C8    . DA  J 7  132 ? 16.596  -9.457  53.817 1.00 132.40 ? 59  DA  I C8    1 
ATOM   8856  N  N7    . DA  J 7  132 ? 17.147  -8.356  54.270 1.00 132.87 ? 59  DA  I N7    1 
ATOM   8857  C  C5    . DA  J 7  132 ? 18.491  -8.674  54.368 1.00 135.67 ? 59  DA  I C5    1 
ATOM   8858  C  C6    . DA  J 7  132 ? 19.613  -7.932  54.788 1.00 138.98 ? 59  DA  I C6    1 
ATOM   8859  N  N6    . DA  J 7  132 ? 19.543  -6.662  55.203 1.00 139.35 ? 59  DA  I N6    1 
ATOM   8860  N  N1    . DA  J 7  132 ? 20.814  -8.547  54.765 1.00 141.74 ? 59  DA  I N1    1 
ATOM   8861  C  C2    . DA  J 7  132 ? 20.879  -9.818  54.349 1.00 142.05 ? 59  DA  I C2    1 
ATOM   8862  N  N3    . DA  J 7  132 ? 19.897  -10.615 53.931 1.00 140.07 ? 59  DA  I N3    1 
ATOM   8863  C  C4    . DA  J 7  132 ? 18.717  -9.976  53.965 1.00 136.80 ? 59  DA  I C4    1 
ATOM   8864  P  P     . DC  J 7  133 ? 16.274  -15.830 54.145 1.00 135.84 ? 60  DC  I P     1 
ATOM   8865  O  OP1   . DC  J 7  133 ? 16.496  -17.178 53.578 1.00 140.83 ? 60  DC  I OP1   1 
ATOM   8866  O  OP2   . DC  J 7  133 ? 15.042  -15.550 54.916 1.00 129.51 ? 60  DC  I OP2   1 
ATOM   8867  O  "O5'" . DC  J 7  133 ? 17.531  -15.443 55.057 1.00 138.13 ? 60  DC  I "O5'" 1 
ATOM   8868  C  "C5'" . DC  J 7  133 ? 18.845  -15.513 54.516 1.00 142.65 ? 60  DC  I "C5'" 1 
ATOM   8869  C  "C4'" . DC  J 7  133 ? 19.873  -15.015 55.516 1.00 149.07 ? 60  DC  I "C4'" 1 
ATOM   8870  O  "O4'" . DC  J 7  133 ? 19.784  -13.575 55.634 1.00 151.69 ? 60  DC  I "O4'" 1 
ATOM   8871  C  "C3'" . DC  J 7  133 ? 19.724  -15.574 56.937 1.00 151.33 ? 60  DC  I "C3'" 1 
ATOM   8872  O  "O3'" . DC  J 7  133 ? 20.918  -16.245 57.322 1.00 155.45 ? 60  DC  I "O3'" 1 
ATOM   8873  C  "C2'" . DC  J 7  133 ? 19.463  -14.336 57.807 1.00 151.69 ? 60  DC  I "C2'" 1 
ATOM   8874  C  "C1'" . DC  J 7  133 ? 20.044  -13.214 56.964 1.00 152.94 ? 60  DC  I "C1'" 1 
ATOM   8875  N  N1    . DC  J 7  133 ? 19.413  -11.891 57.225 1.00 151.13 ? 60  DC  I N1    1 
ATOM   8876  C  C2    . DC  J 7  133 ? 20.213  -10.801 57.587 1.00 154.52 ? 60  DC  I C2    1 
ATOM   8877  O  O2    . DC  J 7  133 ? 21.437  -10.955 57.679 1.00 157.89 ? 60  DC  I O2    1 
ATOM   8878  N  N3    . DC  J 7  133 ? 19.621  -9.604  57.823 1.00 154.17 ? 60  DC  I N3    1 
ATOM   8879  C  C4    . DC  J 7  133 ? 18.297  -9.479  57.712 1.00 151.27 ? 60  DC  I C4    1 
ATOM   8880  N  N4    . DC  J 7  133 ? 17.759  -8.280  57.955 1.00 152.30 ? 60  DC  I N4    1 
ATOM   8881  C  C5    . DC  J 7  133 ? 17.467  -10.580 57.347 1.00 146.90 ? 60  DC  I C5    1 
ATOM   8882  C  C6    . DC  J 7  133 ? 18.061  -11.754 57.116 1.00 146.90 ? 60  DC  I C6    1 
ATOM   8883  P  P     . DC  J 7  134 ? 20.999  -17.030 58.723 1.00 154.88 ? 61  DC  I P     1 
ATOM   8884  O  OP1   . DC  J 7  134 ? 21.746  -18.284 58.479 1.00 158.87 ? 61  DC  I OP1   1 
ATOM   8885  O  OP2   . DC  J 7  134 ? 19.640  -17.091 59.308 1.00 145.79 ? 61  DC  I OP2   1 
ATOM   8886  O  "O5'" . DC  J 7  134 ? 21.894  -16.076 59.641 1.00 160.62 ? 61  DC  I "O5'" 1 
ATOM   8887  C  "C5'" . DC  J 7  134 ? 23.208  -15.724 59.223 1.00 166.79 ? 61  DC  I "C5'" 1 
ATOM   8888  C  "C4'" . DC  J 7  134 ? 23.850  -14.762 60.206 1.00 171.34 ? 61  DC  I "C4'" 1 
ATOM   8889  O  "O4'" . DC  J 7  134 ? 23.218  -13.461 60.097 1.00 168.96 ? 61  DC  I "O4'" 1 
ATOM   8890  C  "C3'" . DC  J 7  134 ? 23.743  -15.173 61.676 1.00 175.58 ? 61  DC  I "C3'" 1 
ATOM   8891  O  "O3'" . DC  J 7  134 ? 25.003  -15.018 62.316 1.00 185.47 ? 61  DC  I "O3'" 1 
ATOM   8892  C  "C2'" . DC  J 7  134 ? 22.698  -14.212 62.244 1.00 171.13 ? 61  DC  I "C2'" 1 
ATOM   8893  C  "C1'" . DC  J 7  134 ? 22.911  -12.979 61.383 1.00 169.70 ? 61  DC  I "C1'" 1 
ATOM   8894  N  N1    . DC  J 7  134 ? 21.706  -12.111 61.281 1.00 165.82 ? 61  DC  I N1    1 
ATOM   8895  C  C2    . DC  J 7  134 ? 21.801  -10.753 61.606 1.00 167.48 ? 61  DC  I C2    1 
ATOM   8896  O  O2    . DC  J 7  134 ? 22.890  -10.294 61.972 1.00 169.09 ? 61  DC  I O2    1 
ATOM   8897  N  N3    . DC  J 7  134 ? 20.693  -9.976  61.507 1.00 166.45 ? 61  DC  I N3    1 
ATOM   8898  C  C4    . DC  J 7  134 ? 19.537  -10.509 61.108 1.00 161.50 ? 61  DC  I C4    1 
ATOM   8899  N  N4    . DC  J 7  134 ? 18.473  -9.703  61.027 1.00 158.70 ? 61  DC  I N4    1 
ATOM   8900  C  C5    . DC  J 7  134 ? 19.421  -11.891 60.774 1.00 158.22 ? 61  DC  I C5    1 
ATOM   8901  C  C6    . DC  J 7  134 ? 20.519  -12.646 60.874 1.00 160.36 ? 61  DC  I C6    1 
ATOM   8902  P  P     . DG  J 7  135 ? 25.240  -15.612 63.790 1.00 192.69 ? 62  DG  I P     1 
ATOM   8903  O  OP1   . DG  J 7  135 ? 26.627  -16.126 63.849 1.00 197.00 ? 62  DG  I OP1   1 
ATOM   8904  O  OP2   . DG  J 7  135 ? 24.108  -16.512 64.103 1.00 190.32 ? 62  DG  I OP2   1 
ATOM   8905  O  "O5'" . DG  J 7  135 ? 25.124  -14.331 64.738 1.00 198.81 ? 62  DG  I "O5'" 1 
ATOM   8906  C  "C5'" . DG  J 7  135 ? 25.945  -13.196 64.495 1.00 205.48 ? 62  DG  I "C5'" 1 
ATOM   8907  C  "C4'" . DG  J 7  135 ? 25.479  -12.007 65.315 1.00 207.46 ? 62  DG  I "C4'" 1 
ATOM   8908  O  "O4'" . DG  J 7  135 ? 24.189  -11.552 64.825 1.00 203.63 ? 62  DG  I "O4'" 1 
ATOM   8909  C  "C3'" . DG  J 7  135 ? 25.298  -12.283 66.809 1.00 210.93 ? 62  DG  I "C3'" 1 
ATOM   8910  O  "O3'" . DG  J 7  135 ? 25.835  -11.212 67.565 1.00 216.64 ? 62  DG  I "O3'" 1 
ATOM   8911  C  "C2'" . DG  J 7  135 ? 23.781  -12.374 66.969 1.00 206.55 ? 62  DG  I "C2'" 1 
ATOM   8912  C  "C1'" . DG  J 7  135 ? 23.307  -11.392 65.911 1.00 203.93 ? 62  DG  I "C1'" 1 
ATOM   8913  N  N9    . DG  J 7  135 ? 21.947  -11.650 65.446 1.00 202.08 ? 62  DG  I N9    1 
ATOM   8914  C  C8    . DG  J 7  135 ? 21.364  -12.876 65.233 1.00 201.57 ? 62  DG  I C8    1 
ATOM   8915  N  N7    . DG  J 7  135 ? 20.131  -12.799 64.817 1.00 199.46 ? 62  DG  I N7    1 
ATOM   8916  C  C5    . DG  J 7  135 ? 19.879  -11.435 64.749 1.00 199.25 ? 62  DG  I C5    1 
ATOM   8917  C  C6    . DG  J 7  135 ? 18.707  -10.743 64.361 1.00 196.72 ? 62  DG  I C6    1 
ATOM   8918  O  O6    . DG  J 7  135 ? 17.624  -11.215 63.988 1.00 194.04 ? 62  DG  I O6    1 
ATOM   8919  N  N1    . DG  J 7  135 ? 18.875  -9.362  64.435 1.00 196.98 ? 62  DG  I N1    1 
ATOM   8920  C  C2    . DG  J 7  135 ? 20.030  -8.731  64.834 1.00 199.30 ? 62  DG  I C2    1 
ATOM   8921  N  N2    . DG  J 7  135 ? 20.002  -7.390  64.842 1.00 199.43 ? 62  DG  I N2    1 
ATOM   8922  N  N3    . DG  J 7  135 ? 21.135  -9.368  65.201 1.00 201.79 ? 62  DG  I N3    1 
ATOM   8923  C  C4    . DG  J 7  135 ? 20.987  -10.713 65.133 1.00 201.04 ? 62  DG  I C4    1 
ATOM   8924  P  P     . DG  J 7  136 ? 26.400  -11.467 69.047 1.00 222.45 ? 63  DG  I P     1 
ATOM   8925  O  OP1   . DG  J 7  136 ? 27.870  -11.609 68.948 1.00 228.05 ? 63  DG  I OP1   1 
ATOM   8926  O  OP2   . DG  J 7  136 ? 25.596  -12.545 69.663 1.00 219.41 ? 63  DG  I OP2   1 
ATOM   8927  O  "O5'" . DG  J 7  136 ? 26.064  -10.105 69.813 1.00 225.51 ? 63  DG  I "O5'" 1 
ATOM   8928  C  "C5'" . DG  J 7  136 ? 26.417  -8.861  69.225 1.00 228.54 ? 63  DG  I "C5'" 1 
ATOM   8929  C  "C4'" . DG  J 7  136 ? 25.300  -7.847  69.396 1.00 226.91 ? 63  DG  I "C4'" 1 
ATOM   8930  O  "O4'" . DG  J 7  136 ? 24.144  -8.265  68.644 1.00 225.45 ? 63  DG  I "O4'" 1 
ATOM   8931  C  "C3'" . DG  J 7  136 ? 24.813  -7.659  70.835 1.00 227.59 ? 63  DG  I "C3'" 1 
ATOM   8932  O  "O3'" . DG  J 7  136 ? 25.249  -6.400  71.332 1.00 229.92 ? 63  DG  I "O3'" 1 
ATOM   8933  C  "C2'" . DG  J 7  136 ? 23.276  -7.734  70.743 1.00 224.02 ? 63  DG  I "C2'" 1 
ATOM   8934  C  "C1'" . DG  J 7  136 ? 23.010  -7.701  69.242 1.00 222.76 ? 63  DG  I "C1'" 1 
ATOM   8935  N  N9    . DG  J 7  136 ? 21.836  -8.472  68.839 1.00 214.56 ? 63  DG  I N9    1 
ATOM   8936  C  C8    . DG  J 7  136 ? 21.727  -9.841  68.776 1.00 211.89 ? 63  DG  I C8    1 
ATOM   8937  N  N7    . DG  J 7  136 ? 20.553  -10.250 68.381 1.00 208.47 ? 63  DG  I N7    1 
ATOM   8938  C  C5    . DG  J 7  136 ? 19.836  -9.079  68.169 1.00 206.47 ? 63  DG  I C5    1 
ATOM   8939  C  C6    . DG  J 7  136 ? 18.503  -8.892  67.734 1.00 200.81 ? 63  DG  I C6    1 
ATOM   8940  O  O6    . DG  J 7  136 ? 17.663  -9.754  67.440 1.00 197.23 ? 63  DG  I O6    1 
ATOM   8941  N  N1    . DG  J 7  136 ? 18.172  -7.541  67.652 1.00 200.18 ? 63  DG  I N1    1 
ATOM   8942  C  C2    . DG  J 7  136 ? 19.022  -6.504  67.953 1.00 203.85 ? 63  DG  I C2    1 
ATOM   8943  N  N2    . DG  J 7  136 ? 18.523  -5.267  67.813 1.00 202.17 ? 63  DG  I N2    1 
ATOM   8944  N  N3    . DG  J 7  136 ? 20.275  -6.665  68.362 1.00 209.34 ? 63  DG  I N3    1 
ATOM   8945  C  C4    . DG  J 7  136 ? 20.612  -7.975  68.447 1.00 210.24 ? 63  DG  I C4    1 
ATOM   8946  P  P     . DG  J 7  137 ? 25.025  -6.019  72.877 1.00 228.72 ? 64  DG  I P     1 
ATOM   8947  O  OP1   . DG  J 7  137 ? 26.055  -5.022  73.246 1.00 232.64 ? 64  DG  I OP1   1 
ATOM   8948  O  OP2   . DG  J 7  137 ? 24.915  -7.282  73.640 1.00 229.64 ? 64  DG  I OP2   1 
ATOM   8949  O  "O5'" . DG  J 7  137 ? 23.592  -5.311  72.890 1.00 220.31 ? 64  DG  I "O5'" 1 
ATOM   8950  C  "C5'" . DG  J 7  137 ? 23.317  -4.254  71.979 1.00 214.63 ? 64  DG  I "C5'" 1 
ATOM   8951  C  "C4'" . DG  J 7  137 ? 21.855  -3.853  72.040 1.00 208.49 ? 64  DG  I "C4'" 1 
ATOM   8952  O  "O4'" . DG  J 7  137 ? 21.037  -4.872  71.404 1.00 204.10 ? 64  DG  I "O4'" 1 
ATOM   8953  C  "C3'" . DG  J 7  137 ? 21.290  -3.674  73.454 1.00 207.31 ? 64  DG  I "C3'" 1 
ATOM   8954  O  "O3'" . DG  J 7  137 ? 20.533  -2.477  73.521 1.00 206.76 ? 64  DG  I "O3'" 1 
ATOM   8955  C  "C2'" . DG  J 7  137 ? 20.402  -4.904  73.636 1.00 203.54 ? 64  DG  I "C2'" 1 
ATOM   8956  C  "C1'" . DG  J 7  137 ? 19.917  -5.124  72.215 1.00 198.93 ? 64  DG  I "C1'" 1 
ATOM   8957  N  N9    . DG  J 7  137 ? 19.442  -6.481  71.959 1.00 189.77 ? 64  DG  I N9    1 
ATOM   8958  C  C8    . DG  J 7  137 ? 20.066  -7.657  72.300 1.00 188.73 ? 64  DG  I C8    1 
ATOM   8959  N  N7    . DG  J 7  137 ? 19.400  -8.721  71.943 1.00 184.20 ? 64  DG  I N7    1 
ATOM   8960  C  C5    . DG  J 7  137 ? 18.261  -8.218  71.326 1.00 179.73 ? 64  DG  I C5    1 
ATOM   8961  C  C6    . DG  J 7  137 ? 17.168  -8.897  70.736 1.00 174.21 ? 64  DG  I C6    1 
ATOM   8962  O  O6    . DG  J 7  137 ? 16.984  -10.118 70.639 1.00 171.58 ? 64  DG  I O6    1 
ATOM   8963  N  N1    . DG  J 7  137 ? 16.225  -8.008  70.224 1.00 172.07 ? 64  DG  I N1    1 
ATOM   8964  C  C2    . DG  J 7  137 ? 16.327  -6.638  70.276 1.00 173.44 ? 64  DG  I C2    1 
ATOM   8965  N  N2    . DG  J 7  137 ? 15.317  -5.946  69.728 1.00 171.52 ? 64  DG  I N2    1 
ATOM   8966  N  N3    . DG  J 7  137 ? 17.346  -5.990  70.825 1.00 177.07 ? 64  DG  I N3    1 
ATOM   8967  C  C4    . DG  J 7  137 ? 18.272  -6.841  71.328 1.00 181.56 ? 64  DG  I C4    1 
ATOM   8968  P  P     . DA  J 7  138 ? 20.604  -1.545  74.826 1.00 211.51 ? 65  DA  I P     1 
ATOM   8969  O  OP1   . DA  J 7  138 ? 21.651  -0.526  74.592 1.00 219.62 ? 65  DA  I OP1   1 
ATOM   8970  O  OP2   . DA  J 7  138 ? 20.685  -2.428  76.011 1.00 213.40 ? 65  DA  I OP2   1 
ATOM   8971  O  "O5'" . DA  J 7  138 ? 19.180  -0.821  74.850 1.00 206.56 ? 65  DA  I "O5'" 1 
ATOM   8972  C  "C5'" . DA  J 7  138 ? 18.717  -0.136  73.696 1.00 202.28 ? 65  DA  I "C5'" 1 
ATOM   8973  C  "C4'" . DA  J 7  138 ? 17.241  -0.401  73.471 1.00 195.83 ? 65  DA  I "C4'" 1 
ATOM   8974  O  "O4'" . DA  J 7  138 ? 17.054  -1.771  73.039 1.00 191.29 ? 65  DA  I "O4'" 1 
ATOM   8975  C  "C3'" . DA  J 7  138 ? 16.356  -0.214  74.708 1.00 195.20 ? 65  DA  I "C3'" 1 
ATOM   8976  O  "O3'" . DA  J 7  138 ? 15.334  0.736   74.434 1.00 194.90 ? 65  DA  I "O3'" 1 
ATOM   8977  C  "C2'" . DA  J 7  138 ? 15.778  -1.610  74.978 1.00 191.07 ? 65  DA  I "C2'" 1 
ATOM   8978  C  "C1'" . DA  J 7  138 ? 15.877  -2.273  73.615 1.00 187.26 ? 65  DA  I "C1'" 1 
ATOM   8979  N  N9    . DA  J 7  138 ? 15.978  -3.728  73.684 1.00 183.08 ? 65  DA  I N9    1 
ATOM   8980  C  C8    . DA  J 7  138 ? 17.036  -4.458  74.148 1.00 184.27 ? 65  DA  I C8    1 
ATOM   8981  N  N7    . DA  J 7  138 ? 16.849  -5.755  74.094 1.00 182.31 ? 65  DA  I N7    1 
ATOM   8982  C  C5    . DA  J 7  138 ? 15.578  -5.885  73.558 1.00 178.73 ? 65  DA  I C5    1 
ATOM   8983  C  C6    . DA  J 7  138 ? 14.789  -7.011  73.247 1.00 175.51 ? 65  DA  I C6    1 
ATOM   8984  N  N6    . DA  J 7  138 ? 15.193  -8.270  73.442 1.00 176.23 ? 65  DA  I N6    1 
ATOM   8985  N  N1    . DA  J 7  138 ? 13.565  -6.790  72.724 1.00 171.33 ? 65  DA  I N1    1 
ATOM   8986  C  C2    . DA  J 7  138 ? 13.164  -5.528  72.529 1.00 170.98 ? 65  DA  I C2    1 
ATOM   8987  N  N3    . DA  J 7  138 ? 13.815  -4.393  72.782 1.00 174.05 ? 65  DA  I N3    1 
ATOM   8988  C  C4    . DA  J 7  138 ? 15.027  -4.645  73.300 1.00 178.23 ? 65  DA  I C4    1 
ATOM   8989  P  P     . DT  J 7  139 ? 14.247  1.107   75.557 1.00 194.49 ? 66  DT  I P     1 
ATOM   8990  O  OP1   . DT  J 7  139 ? 13.804  2.495   75.305 1.00 196.21 ? 66  DT  I OP1   1 
ATOM   8991  O  OP2   . DT  J 7  139 ? 14.805  0.744   76.879 1.00 196.21 ? 66  DT  I OP2   1 
ATOM   8992  O  "O5'" . DT  J 7  139 ? 13.030  0.120   75.243 1.00 190.00 ? 66  DT  I "O5'" 1 
ATOM   8993  C  "C5'" . DT  J 7  139 ? 12.513  0.039   73.922 1.00 188.80 ? 66  DT  I "C5'" 1 
ATOM   8994  C  "C4'" . DT  J 7  139 ? 11.322  -0.899  73.867 1.00 188.31 ? 66  DT  I "C4'" 1 
ATOM   8995  O  "O4'" . DT  J 7  139 ? 11.775  -2.270  73.981 1.00 189.31 ? 66  DT  I "O4'" 1 
ATOM   8996  C  "C3'" . DT  J 7  139 ? 10.286  -0.691  74.976 1.00 188.79 ? 66  DT  I "C3'" 1 
ATOM   8997  O  "O3'" . DT  J 7  139 ? 8.998   -0.504  74.406 1.00 185.47 ? 66  DT  I "O3'" 1 
ATOM   8998  C  "C2'" . DT  J 7  139 ? 10.359  -1.978  75.805 1.00 189.34 ? 66  DT  I "C2'" 1 
ATOM   8999  C  "C1'" . DT  J 7  139 ? 10.880  -2.984  74.793 1.00 188.29 ? 66  DT  I "C1'" 1 
ATOM   9000  N  N1    . DT  J 7  139 ? 11.611  -4.121  75.414 1.00 189.19 ? 66  DT  I N1    1 
ATOM   9001  C  C2    . DT  J 7  139 ? 11.137  -5.400  75.244 1.00 186.29 ? 66  DT  I C2    1 
ATOM   9002  O  O2    . DT  J 7  139 ? 10.138  -5.662  74.599 1.00 181.83 ? 66  DT  I O2    1 
ATOM   9003  N  N3    . DT  J 7  139 ? 11.882  -6.372  75.857 1.00 188.14 ? 66  DT  I N3    1 
ATOM   9004  C  C4    . DT  J 7  139 ? 13.029  -6.196  76.610 1.00 190.49 ? 66  DT  I C4    1 
ATOM   9005  O  O4    . DT  J 7  139 ? 13.629  -7.135  77.122 1.00 190.24 ? 66  DT  I O4    1 
ATOM   9006  C  C5    . DT  J 7  139 ? 13.470  -4.828  76.751 1.00 193.31 ? 66  DT  I C5    1 
ATOM   9007  C  C7    . DT  J 7  139 ? 14.702  -4.511  77.545 1.00 195.93 ? 66  DT  I C7    1 
ATOM   9008  C  C6    . DT  J 7  139 ? 12.748  -3.869  76.154 1.00 192.81 ? 66  DT  I C6    1 
ATOM   9009  P  P     . DT  J 7  140 ? 7.744   -0.134  75.340 1.00 184.55 ? 67  DT  I P     1 
ATOM   9010  O  OP1   . DT  J 7  140 ? 6.904   0.828   74.592 1.00 190.39 ? 67  DT  I OP1   1 
ATOM   9011  O  OP2   . DT  J 7  140 ? 8.255   0.227   76.681 1.00 186.80 ? 67  DT  I OP2   1 
ATOM   9012  O  "O5'" . DT  J 7  140 ? 6.949   -1.515  75.467 1.00 176.12 ? 67  DT  I "O5'" 1 
ATOM   9013  C  "C5'" . DT  J 7  140 ? 6.540   -2.204  74.292 1.00 167.34 ? 67  DT  I "C5'" 1 
ATOM   9014  C  "C4'" . DT  J 7  140 ? 5.959   -3.563  74.634 1.00 158.83 ? 67  DT  I "C4'" 1 
ATOM   9015  O  "O4'" . DT  J 7  140 ? 7.010   -4.434  75.115 1.00 156.26 ? 67  DT  I "O4'" 1 
ATOM   9016  C  "C3'" . DT  J 7  140 ? 4.877   -3.549  75.721 1.00 155.46 ? 67  DT  I "C3'" 1 
ATOM   9017  O  "O3'" . DT  J 7  140 ? 3.682   -4.140  75.226 1.00 149.70 ? 67  DT  I "O3'" 1 
ATOM   9018  C  "C2'" . DT  J 7  140 ? 5.483   -4.365  76.870 1.00 156.24 ? 67  DT  I "C2'" 1 
ATOM   9019  C  "C1'" . DT  J 7  140 ? 6.503   -5.233  76.151 1.00 154.62 ? 67  DT  I "C1'" 1 
ATOM   9020  N  N1    . DT  J 7  140 ? 7.639   -5.659  77.018 1.00 154.42 ? 67  DT  I N1    1 
ATOM   9021  C  C2    . DT  J 7  140 ? 7.891   -7.000  77.189 1.00 151.84 ? 67  DT  I C2    1 
ATOM   9022  O  O2    . DT  J 7  140 ? 7.229   -7.876  76.662 1.00 149.58 ? 67  DT  I O2    1 
ATOM   9023  N  N3    . DT  J 7  140 ? 8.954   -7.283  78.003 1.00 153.42 ? 67  DT  I N3    1 
ATOM   9024  C  C4    . DT  J 7  140 ? 9.774   -6.378  78.653 1.00 157.36 ? 67  DT  I C4    1 
ATOM   9025  O  O4    . DT  J 7  140 ? 10.708  -6.732  79.366 1.00 160.89 ? 67  DT  I O4    1 
ATOM   9026  C  C5    . DT  J 7  140 ? 9.455   -4.988  78.432 1.00 158.32 ? 67  DT  I C5    1 
ATOM   9027  C  C7    . DT  J 7  140 ? 10.274  -3.913  79.083 1.00 161.02 ? 67  DT  I C7    1 
ATOM   9028  C  C6    . DT  J 7  140 ? 8.415   -4.699  77.635 1.00 156.74 ? 67  DT  I C6    1 
ATOM   9029  P  P     . DC  J 7  141 ? 2.331   -4.082  76.093 1.00 144.41 ? 68  DC  I P     1 
ATOM   9030  O  OP1   . DC  J 7  141 ? 1.188   -4.114  75.153 1.00 138.66 ? 68  DC  I OP1   1 
ATOM   9031  O  OP2   . DC  J 7  141 ? 2.462   -2.966  77.056 1.00 146.09 ? 68  DC  I OP2   1 
ATOM   9032  O  "O5'" . DC  J 7  141 ? 2.356   -5.448  76.924 1.00 143.05 ? 68  DC  I "O5'" 1 
ATOM   9033  C  "C5'" . DC  J 7  141 ? 2.549   -6.684  76.247 1.00 136.58 ? 68  DC  I "C5'" 1 
ATOM   9034  C  "C4'" . DC  J 7  141 ? 2.693   -7.826  77.237 1.00 132.94 ? 68  DC  I "C4'" 1 
ATOM   9035  O  "O4'" . DC  J 7  141 ? 4.027   -7.815  77.812 1.00 132.61 ? 68  DC  I "O4'" 1 
ATOM   9036  C  "C3'" . DC  J 7  141 ? 1.719   -7.785  78.419 1.00 133.98 ? 68  DC  I "C3'" 1 
ATOM   9037  O  "O3'" . DC  J 7  141 ? 1.202   -9.082  78.656 1.00 132.69 ? 68  DC  I "O3'" 1 
ATOM   9038  C  "C2'" . DC  J 7  141 ? 2.603   -7.325  79.577 1.00 136.11 ? 68  DC  I "C2'" 1 
ATOM   9039  C  "C1'" . DC  J 7  141 ? 3.921   -7.978  79.205 1.00 135.65 ? 68  DC  I "C1'" 1 
ATOM   9040  N  N1    . DC  J 7  141 ? 5.107   -7.357  79.857 1.00 141.95 ? 68  DC  I N1    1 
ATOM   9041  C  C2    . DC  J 7  141 ? 6.159   -8.169  80.294 1.00 144.91 ? 68  DC  I C2    1 
ATOM   9042  O  O2    . DC  J 7  141 ? 6.087   -9.392  80.123 1.00 144.10 ? 68  DC  I O2    1 
ATOM   9043  N  N3    . DC  J 7  141 ? 7.231   -7.592  80.889 1.00 148.62 ? 68  DC  I N3    1 
ATOM   9044  C  C4    . DC  J 7  141 ? 7.271   -6.269  81.054 1.00 150.56 ? 68  DC  I C4    1 
ATOM   9045  N  N4    . DC  J 7  141 ? 8.349   -5.745  81.647 1.00 154.46 ? 68  DC  I N4    1 
ATOM   9046  C  C5    . DC  J 7  141 ? 6.207   -5.424  80.619 1.00 149.59 ? 68  DC  I C5    1 
ATOM   9047  C  C6    . DC  J 7  141 ? 5.155   -6.005  80.033 1.00 146.17 ? 68  DC  I C6    1 
ATOM   9048  P  P     . DT  J 7  142 ? -0.318  -9.438  78.278 1.00 126.27 ? 69  DT  I P     1 
ATOM   9049  O  OP1   . DT  J 7  142 ? -0.492  -9.208  76.826 1.00 118.86 ? 69  DT  I OP1   1 
ATOM   9050  O  OP2   . DT  J 7  142 ? -1.199  -8.748  79.247 1.00 129.30 ? 69  DT  I OP2   1 
ATOM   9051  O  "O5'" . DT  J 7  142 ? -0.410  -11.008 78.564 1.00 123.76 ? 69  DT  I "O5'" 1 
ATOM   9052  C  "C5'" . DT  J 7  142 ? 0.610   -11.871 78.079 1.00 120.36 ? 69  DT  I "C5'" 1 
ATOM   9053  C  "C4'" . DT  J 7  142 ? 1.348   -12.539 79.226 1.00 120.85 ? 69  DT  I "C4'" 1 
ATOM   9054  O  "O4'" . DT  J 7  142 ? 2.234   -11.589 79.871 1.00 125.54 ? 69  DT  I "O4'" 1 
ATOM   9055  C  "C3'" . DT  J 7  142 ? 0.452   -13.106 80.334 1.00 121.83 ? 69  DT  I "C3'" 1 
ATOM   9056  O  "O3'" . DT  J 7  142 ? 0.751   -14.476 80.533 1.00 118.85 ? 69  DT  I "O3'" 1 
ATOM   9057  C  "C2'" . DT  J 7  142 ? 0.813   -12.268 81.567 1.00 127.68 ? 69  DT  I "C2'" 1 
ATOM   9058  C  "C1'" . DT  J 7  142 ? 2.238   -11.856 81.249 1.00 130.90 ? 69  DT  I "C1'" 1 
ATOM   9059  N  N1    . DT  J 7  142 ? 2.693   -10.636 81.982 1.00 138.74 ? 69  DT  I N1    1 
ATOM   9060  C  C2    . DT  J 7  142 ? 3.995   -10.564 82.420 1.00 143.69 ? 69  DT  I C2    1 
ATOM   9061  O  O2    . DT  J 7  142 ? 4.812   -11.448 82.234 1.00 143.69 ? 69  DT  I O2    1 
ATOM   9062  N  N3    . DT  J 7  142 ? 4.313   -9.409  83.084 1.00 148.23 ? 69  DT  I N3    1 
ATOM   9063  C  C4    . DT  J 7  142 ? 3.477   -8.342  83.352 1.00 148.22 ? 69  DT  I C4    1 
ATOM   9064  O  O4    . DT  J 7  142 ? 3.858   -7.346  83.959 1.00 149.87 ? 69  DT  I O4    1 
ATOM   9065  C  C5    . DT  J 7  142 ? 2.122   -8.483  82.870 1.00 145.55 ? 69  DT  I C5    1 
ATOM   9066  C  C7    . DT  J 7  142 ? 1.122   -7.389  83.102 1.00 145.39 ? 69  DT  I C7    1 
ATOM   9067  C  C6    . DT  J 7  142 ? 1.799   -9.611  82.217 1.00 141.91 ? 69  DT  I C6    1 
ATOM   9068  P  P     . DG  J 7  143 ? -0.324  -15.450 81.219 1.00 115.91 ? 70  DG  I P     1 
ATOM   9069  O  OP1   . DG  J 7  143 ? -0.494  -16.603 80.310 1.00 116.96 ? 70  DG  I OP1   1 
ATOM   9070  O  OP2   . DG  J 7  143 ? -1.499  -14.641 81.615 1.00 117.69 ? 70  DG  I OP2   1 
ATOM   9071  O  "O5'" . DG  J 7  143 ? 0.409   -15.939 82.554 1.00 114.79 ? 70  DG  I "O5'" 1 
ATOM   9072  C  "C5'" . DG  J 7  143 ? 1.679   -16.566 82.467 1.00 110.92 ? 70  DG  I "C5'" 1 
ATOM   9073  C  "C4'" . DG  J 7  143 ? 2.491   -16.331 83.728 1.00 110.26 ? 70  DG  I "C4'" 1 
ATOM   9074  O  "O4'" . DG  J 7  143 ? 2.761   -14.915 83.883 1.00 109.43 ? 70  DG  I "O4'" 1 
ATOM   9075  C  "C3'" . DG  J 7  143 ? 1.822   -16.785 85.033 1.00 112.83 ? 70  DG  I "C3'" 1 
ATOM   9076  O  "O3'" . DG  J 7  143 ? 2.706   -17.635 85.751 1.00 118.97 ? 70  DG  I "O3'" 1 
ATOM   9077  C  "C2'" . DG  J 7  143 ? 1.567   -15.475 85.786 1.00 112.71 ? 70  DG  I "C2'" 1 
ATOM   9078  C  "C1'" . DG  J 7  143 ? 2.677   -14.594 85.247 1.00 113.72 ? 70  DG  I "C1'" 1 
ATOM   9079  N  N9    . DG  J 7  143 ? 2.412   -13.164 85.383 1.00 115.79 ? 70  DG  I N9    1 
ATOM   9080  C  C8    . DG  J 7  143 ? 1.286   -12.487 84.981 1.00 113.23 ? 70  DG  I C8    1 
ATOM   9081  N  N7    . DG  J 7  143 ? 1.330   -11.208 85.237 1.00 114.14 ? 70  DG  I N7    1 
ATOM   9082  C  C5    . DG  J 7  143 ? 2.564   -11.026 85.849 1.00 119.64 ? 70  DG  I C5    1 
ATOM   9083  C  C6    . DG  J 7  143 ? 3.170   -9.849  86.349 1.00 125.93 ? 70  DG  I C6    1 
ATOM   9084  O  O6    . DG  J 7  143 ? 2.720   -8.695  86.350 1.00 128.24 ? 70  DG  I O6    1 
ATOM   9085  N  N1    . DG  J 7  143 ? 4.427   -10.106 86.891 1.00 128.75 ? 70  DG  I N1    1 
ATOM   9086  C  C2    . DG  J 7  143 ? 5.023   -11.344 86.943 1.00 127.44 ? 70  DG  I C2    1 
ATOM   9087  N  N2    . DG  J 7  143 ? 6.240   -11.396 87.504 1.00 131.20 ? 70  DG  I N2    1 
ATOM   9088  N  N3    . DG  J 7  143 ? 4.466   -12.455 86.478 1.00 123.18 ? 70  DG  I N3    1 
ATOM   9089  C  C4    . DG  J 7  143 ? 3.241   -12.221 85.946 1.00 119.31 ? 70  DG  I C4    1 
ATOM   9090  P  P     . DA  J 7  144 ? 2.171   -18.543 86.964 1.00 122.68 ? 71  DA  I P     1 
ATOM   9091  O  OP1   . DA  J 7  144 ? 2.364   -19.956 86.571 1.00 125.78 ? 71  DA  I OP1   1 
ATOM   9092  O  OP2   . DA  J 7  144 ? 0.825   -18.072 87.358 1.00 125.12 ? 71  DA  I OP2   1 
ATOM   9093  O  "O5'" . DA  J 7  144 ? 3.180   -18.205 88.156 1.00 122.12 ? 71  DA  I "O5'" 1 
ATOM   9094  C  "C5'" . DA  J 7  144 ? 4.582   -18.334 87.951 1.00 122.21 ? 71  DA  I "C5'" 1 
ATOM   9095  C  "C4'" . DA  J 7  144 ? 5.357   -17.514 88.966 1.00 124.11 ? 71  DA  I "C4'" 1 
ATOM   9096  O  "O4'" . DA  J 7  144 ? 5.109   -16.101 88.741 1.00 122.05 ? 71  DA  I "O4'" 1 
ATOM   9097  C  "C3'" . DA  J 7  144 ? 4.997   -17.787 90.427 1.00 127.43 ? 71  DA  I "C3'" 1 
ATOM   9098  O  "O3'" . DA  J 7  144 ? 6.177   -17.854 91.215 1.00 136.05 ? 71  DA  I "O3'" 1 
ATOM   9099  C  "C2'" . DA  J 7  144 ? 4.133   -16.588 90.809 1.00 125.53 ? 71  DA  I "C2'" 1 
ATOM   9100  C  "C1'" . DA  J 7  144 ? 4.737   -15.486 89.953 1.00 123.17 ? 71  DA  I "C1'" 1 
ATOM   9101  N  N9    . DA  J 7  144 ? 3.803   -14.405 89.654 1.00 120.37 ? 71  DA  I N9    1 
ATOM   9102  C  C8    . DA  J 7  144 ? 2.586   -14.514 89.040 1.00 117.56 ? 71  DA  I C8    1 
ATOM   9103  N  N7    . DA  J 7  144 ? 1.959   -13.369 88.901 1.00 117.78 ? 71  DA  I N7    1 
ATOM   9104  C  C5    . DA  J 7  144 ? 2.825   -12.445 89.461 1.00 120.42 ? 71  DA  I C5    1 
ATOM   9105  C  C6    . DA  J 7  144 ? 2.746   -11.048 89.627 1.00 118.03 ? 71  DA  I C6    1 
ATOM   9106  N  N6    . DA  J 7  144 ? 1.702   -10.317 89.222 1.00 112.17 ? 71  DA  I N6    1 
ATOM   9107  N  N1    . DA  J 7  144 ? 3.784   -10.430 90.227 1.00 122.69 ? 71  DA  I N1    1 
ATOM   9108  C  C2    . DA  J 7  144 ? 4.827   -11.165 90.631 1.00 126.08 ? 71  DA  I C2    1 
ATOM   9109  N  N3    . DA  J 7  144 ? 5.015   -12.480 90.530 1.00 125.96 ? 71  DA  I N3    1 
ATOM   9110  C  C4    . DA  J 7  144 ? 3.967   -13.067 89.930 1.00 122.89 ? 71  DA  I C4    1 
ATOM   9111  P  P     . DT  J 7  145 ? 6.121   -18.463 92.701 1.00 145.75 ? 72  DT  I P     1 
ATOM   9112  O  OP1   . DT  J 7  145 ? 7.351   -19.260 92.906 1.00 150.00 ? 72  DT  I OP1   1 
ATOM   9113  O  OP2   . DT  J 7  145 ? 4.796   -19.095 92.877 1.00 145.95 ? 72  DT  I OP2   1 
ATOM   9114  O  "O5'" . DT  J 7  145 ? 6.179   -17.174 93.646 1.00 147.82 ? 72  DT  I "O5'" 1 
ATOM   9115  C  "C5'" . DT  J 7  145 ? 7.319   -16.325 93.618 1.00 149.19 ? 72  DT  I "C5'" 1 
ATOM   9116  C  "C4'" . DT  J 7  145 ? 7.103   -15.101 94.488 1.00 152.45 ? 72  DT  I "C4'" 1 
ATOM   9117  O  "O4'" . DT  J 7  145 ? 6.154   -14.209 93.849 1.00 150.00 ? 72  DT  I "O4'" 1 
ATOM   9118  C  "C3'" . DT  J 7  145 ? 6.547   -15.391 95.888 1.00 156.82 ? 72  DT  I "C3'" 1 
ATOM   9119  O  "O3'" . DT  J 7  145 ? 7.327   -14.720 96.871 1.00 159.42 ? 72  DT  I "O3'" 1 
ATOM   9120  C  "C2'" . DT  J 7  145 ? 5.119   -14.843 95.832 1.00 156.86 ? 72  DT  I "C2'" 1 
ATOM   9121  C  "C1'" . DT  J 7  145 ? 5.260   -13.722 94.816 1.00 153.70 ? 72  DT  I "C1'" 1 
ATOM   9122  N  N1    . DT  J 7  145 ? 3.980   -13.357 94.143 1.00 151.02 ? 72  DT  I N1    1 
ATOM   9123  C  C2    . DT  J 7  145 ? 3.603   -12.035 94.092 1.00 152.69 ? 72  DT  I C2    1 
ATOM   9124  O  O2    . DT  J 7  145 ? 4.267   -11.133 94.570 1.00 155.71 ? 72  DT  I O2    1 
ATOM   9125  N  N3    . DT  J 7  145 ? 2.413   -11.804 93.455 1.00 150.73 ? 72  DT  I N3    1 
ATOM   9126  C  C4    . DT  J 7  145 ? 1.578   -12.742 92.878 1.00 147.02 ? 72  DT  I C4    1 
ATOM   9127  O  O4    . DT  J 7  145 ? 0.526   -12.434 92.327 1.00 142.99 ? 72  DT  I O4    1 
ATOM   9128  C  C5    . DT  J 7  145 ? 2.031   -14.110 92.967 1.00 147.89 ? 72  DT  I C5    1 
ATOM   9129  C  C7    . DT  J 7  145 ? 1.206   -15.215 92.376 1.00 146.86 ? 72  DT  I C7    1 
ATOM   9130  C  C6    . DT  J 7  145 ? 3.196   -14.349 93.589 1.00 149.13 ? 72  DT  I C6    1 
ATOM   9131  P  P     . DA  K 8  1   ? -3.063  -1.804  91.894 1.00 179.37 ? -72 DA  J P     1 
ATOM   9132  O  OP1   . DA  K 8  1   ? -3.967  -0.901  92.640 1.00 184.74 ? -72 DA  J OP1   1 
ATOM   9133  O  OP2   . DA  K 8  1   ? -2.926  -1.671  90.426 1.00 172.73 ? -72 DA  J OP2   1 
ATOM   9134  O  "O5'" . DA  K 8  1   ? -1.602  -1.718  92.536 1.00 181.04 ? -72 DA  J "O5'" 1 
ATOM   9135  C  "C5'" . DA  K 8  1   ? -1.416  -1.089  93.798 1.00 185.86 ? -72 DA  J "C5'" 1 
ATOM   9136  C  "C4'" . DA  K 8  1   ? -0.110  -1.529  94.435 1.00 190.99 ? -72 DA  J "C4'" 1 
ATOM   9137  O  "O4'" . DA  K 8  1   ? -0.124  -2.969  94.621 1.00 190.67 ? -72 DA  J "O4'" 1 
ATOM   9138  C  "C3'" . DA  K 8  1   ? 1.144   -1.217  93.621 1.00 192.64 ? -72 DA  J "C3'" 1 
ATOM   9139  O  "O3'" . DA  K 8  1   ? 2.204   -0.830  94.486 1.00 201.00 ? -72 DA  J "O3'" 1 
ATOM   9140  C  "C2'" . DA  K 8  1   ? 1.442   -2.541  92.923 1.00 188.30 ? -72 DA  J "C2'" 1 
ATOM   9141  C  "C1'" . DA  K 8  1   ? 0.981   -3.552  93.963 1.00 188.30 ? -72 DA  J "C1'" 1 
ATOM   9142  N  N9    . DA  K 8  1   ? 0.552   -4.823  93.385 1.00 182.57 ? -72 DA  J N9    1 
ATOM   9143  C  C8    . DA  K 8  1   ? -0.575  -5.054  92.645 1.00 178.13 ? -72 DA  J C8    1 
ATOM   9144  N  N7    . DA  K 8  1   ? -0.706  -6.300  92.254 1.00 174.83 ? -72 DA  J N7    1 
ATOM   9145  C  C5    . DA  K 8  1   ? 0.412   -6.931  92.774 1.00 176.09 ? -72 DA  J C5    1 
ATOM   9146  C  C6    . DA  K 8  1   ? 0.864   -8.264  92.714 1.00 174.07 ? -72 DA  J C6    1 
ATOM   9147  N  N6    . DA  K 8  1   ? 0.206   -9.236  92.073 1.00 170.23 ? -72 DA  J N6    1 
ATOM   9148  N  N1    . DA  K 8  1   ? 2.021   -8.561  93.342 1.00 177.01 ? -72 DA  J N1    1 
ATOM   9149  C  C2    . DA  K 8  1   ? 2.677   -7.585  93.982 1.00 180.29 ? -72 DA  J C2    1 
ATOM   9150  N  N3    . DA  K 8  1   ? 2.352   -6.299  94.107 1.00 181.74 ? -72 DA  J N3    1 
ATOM   9151  C  C4    . DA  K 8  1   ? 1.199   -6.035  93.474 1.00 180.39 ? -72 DA  J C4    1 
ATOM   9152  P  P     . DT  K 8  2   ? 3.598   -0.317  93.875 1.00 205.84 ? -71 DT  J P     1 
ATOM   9153  O  OP1   . DT  K 8  2   ? 4.193   0.631   94.842 1.00 214.09 ? -71 DT  J OP1   1 
ATOM   9154  O  OP2   . DT  K 8  2   ? 3.345   0.113   92.482 1.00 203.02 ? -71 DT  J OP2   1 
ATOM   9155  O  "O5'" . DT  K 8  2   ? 4.501   -1.637  93.823 1.00 203.99 ? -71 DT  J "O5'" 1 
ATOM   9156  C  "C5'" . DT  K 8  2   ? 5.792   -1.593  93.230 1.00 199.58 ? -71 DT  J "C5'" 1 
ATOM   9157  C  "C4'" . DT  K 8  2   ? 6.508   -2.921  93.400 1.00 194.86 ? -71 DT  J "C4'" 1 
ATOM   9158  O  "O4'" . DT  K 8  2   ? 5.567   -4.008  93.191 1.00 192.35 ? -71 DT  J "O4'" 1 
ATOM   9159  C  "C3'" . DT  K 8  2   ? 7.659   -3.161  92.422 1.00 189.12 ? -71 DT  J "C3'" 1 
ATOM   9160  O  "O3'" . DT  K 8  2   ? 8.754   -3.780  93.089 1.00 187.26 ? -71 DT  J "O3'" 1 
ATOM   9161  C  "C2'" . DT  K 8  2   ? 7.041   -4.087  91.380 1.00 186.71 ? -71 DT  J "C2'" 1 
ATOM   9162  C  "C1'" . DT  K 8  2   ? 6.082   -4.903  92.231 1.00 188.65 ? -71 DT  J "C1'" 1 
ATOM   9163  N  N1    . DT  K 8  2   ? 4.944   -5.480  91.458 1.00 184.38 ? -71 DT  J N1    1 
ATOM   9164  C  C2    . DT  K 8  2   ? 4.881   -6.841  91.269 1.00 181.92 ? -71 DT  J C2    1 
ATOM   9165  O  O2    . DT  K 8  2   ? 5.712   -7.615  91.709 1.00 183.94 ? -71 DT  J O2    1 
ATOM   9166  N  N3    . DT  K 8  2   ? 3.801   -7.269  90.544 1.00 177.12 ? -71 DT  J N3    1 
ATOM   9167  C  C4    . DT  K 8  2   ? 2.799   -6.488  89.998 1.00 174.46 ? -71 DT  J C4    1 
ATOM   9168  O  O4    . DT  K 8  2   ? 1.866   -6.968  89.360 1.00 170.48 ? -71 DT  J O4    1 
ATOM   9169  C  C5    . DT  K 8  2   ? 2.926   -5.069  90.230 1.00 177.59 ? -71 DT  J C5    1 
ATOM   9170  C  C7    . DT  K 8  2   ? 1.898   -4.121  89.685 1.00 175.99 ? -71 DT  J C7    1 
ATOM   9171  C  C6    . DT  K 8  2   ? 3.980   -4.638  90.940 1.00 181.97 ? -71 DT  J C6    1 
ATOM   9172  P  P     . DC  K 8  3   ? 10.241  -3.641  92.494 1.00 184.08 ? -70 DC  J P     1 
ATOM   9173  O  OP1   . DC  K 8  3   ? 11.175  -3.530  93.636 1.00 190.52 ? -70 DC  J OP1   1 
ATOM   9174  O  OP2   . DC  K 8  3   ? 10.209  -2.579  91.464 1.00 181.63 ? -70 DC  J OP2   1 
ATOM   9175  O  "O5'" . DC  K 8  3   ? 10.495  -5.036  91.751 1.00 176.51 ? -70 DC  J "O5'" 1 
ATOM   9176  C  "C5'" . DC  K 8  3   ? 10.710  -6.219  92.513 1.00 172.35 ? -70 DC  J "C5'" 1 
ATOM   9177  C  "C4'" . DC  K 8  3   ? 10.728  -7.448  91.619 1.00 164.25 ? -70 DC  J "C4'" 1 
ATOM   9178  O  "O4'" . DC  K 8  3   ? 9.429   -7.613  90.990 1.00 155.38 ? -70 DC  J "O4'" 1 
ATOM   9179  C  "C3'" . DC  K 8  3   ? 11.755  -7.414  90.481 1.00 163.14 ? -70 DC  J "C3'" 1 
ATOM   9180  O  "O3'" . DC  K 8  3   ? 12.441  -8.661  90.408 1.00 166.47 ? -70 DC  J "O3'" 1 
ATOM   9181  C  "C2'" . DC  K 8  3   ? 10.899  -7.172  89.238 1.00 154.68 ? -70 DC  J "C2'" 1 
ATOM   9182  C  "C1'" . DC  K 8  3   ? 9.608   -7.875  89.619 1.00 149.81 ? -70 DC  J "C1'" 1 
ATOM   9183  N  N1    . DC  K 8  3   ? 8.414   -7.373  88.880 1.00 142.59 ? -70 DC  J N1    1 
ATOM   9184  C  C2    . DC  K 8  3   ? 7.497   -8.284  88.346 1.00 136.91 ? -70 DC  J C2    1 
ATOM   9185  O  O2    . DC  K 8  3   ? 7.690   -9.496  88.501 1.00 136.69 ? -70 DC  J O2    1 
ATOM   9186  N  N3    . DC  K 8  3   ? 6.417   -7.811  87.674 1.00 131.96 ? -70 DC  J N3    1 
ATOM   9187  C  C4    . DC  K 8  3   ? 6.244   -6.496  87.528 1.00 129.77 ? -70 DC  J C4    1 
ATOM   9188  N  N4    . DC  K 8  3   ? 5.166   -6.077  86.858 1.00 122.50 ? -70 DC  J N4    1 
ATOM   9189  C  C5    . DC  K 8  3   ? 7.170   -5.553  88.064 1.00 136.12 ? -70 DC  J C5    1 
ATOM   9190  C  C6    . DC  K 8  3   ? 8.230   -6.031  88.724 1.00 141.25 ? -70 DC  J C6    1 
ATOM   9191  P  P     . DA  K 8  4   ? 13.891  -8.751  89.721 1.00 165.52 ? -69 DA  J P     1 
ATOM   9192  O  OP1   . DA  K 8  4   ? 14.864  -9.114  90.775 1.00 167.61 ? -69 DA  J OP1   1 
ATOM   9193  O  OP2   . DA  K 8  4   ? 14.096  -7.522  88.923 1.00 162.45 ? -69 DA  J OP2   1 
ATOM   9194  O  "O5'" . DA  K 8  4   ? 13.757  -9.977  88.701 1.00 163.83 ? -69 DA  J "O5'" 1 
ATOM   9195  C  "C5'" . DA  K 8  4   ? 13.507  -11.289 89.194 1.00 164.87 ? -69 DA  J "C5'" 1 
ATOM   9196  C  "C4'" . DA  K 8  4   ? 12.892  -12.168 88.117 1.00 161.90 ? -69 DA  J "C4'" 1 
ATOM   9197  O  "O4'" . DA  K 8  4   ? 11.669  -11.556 87.631 1.00 157.89 ? -69 DA  J "O4'" 1 
ATOM   9198  C  "C3'" . DA  K 8  4   ? 13.764  -12.397 86.887 1.00 162.12 ? -69 DA  J "C3'" 1 
ATOM   9199  O  "O3'" . DA  K 8  4   ? 13.557  -13.710 86.383 1.00 166.85 ? -69 DA  J "O3'" 1 
ATOM   9200  C  "C2'" . DA  K 8  4   ? 13.258  -11.340 85.911 1.00 156.06 ? -69 DA  J "C2'" 1 
ATOM   9201  C  "C1'" . DA  K 8  4   ? 11.773  -11.301 86.245 1.00 153.06 ? -69 DA  J "C1'" 1 
ATOM   9202  N  N9    . DA  K 8  4   ? 11.152  -10.009 85.971 1.00 149.57 ? -69 DA  J N9    1 
ATOM   9203  C  C8    . DA  K 8  4   ? 11.724  -8.775  86.112 1.00 152.30 ? -69 DA  J C8    1 
ATOM   9204  N  N7    . DA  K 8  4   ? 10.926  -7.784  85.795 1.00 151.61 ? -69 DA  J N7    1 
ATOM   9205  C  C5    . DA  K 8  4   ? 9.748   -8.411  85.423 1.00 148.06 ? -69 DA  J C5    1 
ATOM   9206  C  C6    . DA  K 8  4   ? 8.507   -7.913  84.978 1.00 145.54 ? -69 DA  J C6    1 
ATOM   9207  N  N6    . DA  K 8  4   ? 8.247   -6.610  84.830 1.00 143.53 ? -69 DA  J N6    1 
ATOM   9208  N  N1    . DA  K 8  4   ? 7.541   -8.811  84.690 1.00 143.70 ? -69 DA  J N1    1 
ATOM   9209  C  C2    . DA  K 8  4   ? 7.805   -10.115 84.839 1.00 142.29 ? -69 DA  J C2    1 
ATOM   9210  N  N3    . DA  K 8  4   ? 8.930   -10.700 85.249 1.00 143.23 ? -69 DA  J N3    1 
ATOM   9211  C  C4    . DA  K 8  4   ? 9.871   -9.783  85.527 1.00 146.07 ? -69 DA  J C4    1 
ATOM   9212  P  P     . DG  K 8  5   ? 14.799  -14.572 85.842 1.00 175.03 ? -68 DG  J P     1 
ATOM   9213  O  OP1   . DG  K 8  5   ? 15.115  -15.592 86.867 1.00 179.33 ? -68 DG  J OP1   1 
ATOM   9214  O  OP2   . DG  K 8  5   ? 15.844  -13.624 85.396 1.00 177.46 ? -68 DG  J OP2   1 
ATOM   9215  O  "O5'" . DG  K 8  5   ? 14.219  -15.313 84.548 1.00 176.29 ? -68 DG  J "O5'" 1 
ATOM   9216  C  "C5'" . DG  K 8  5   ? 13.298  -16.386 84.698 1.00 175.76 ? -68 DG  J "C5'" 1 
ATOM   9217  C  "C4'" . DG  K 8  5   ? 12.410  -16.515 83.473 1.00 172.50 ? -68 DG  J "C4'" 1 
ATOM   9218  O  "O4'" . DG  K 8  5   ? 11.577  -15.333 83.350 1.00 169.91 ? -68 DG  J "O4'" 1 
ATOM   9219  C  "C3'" . DG  K 8  5   ? 13.151  -16.657 82.144 1.00 171.56 ? -68 DG  J "C3'" 1 
ATOM   9220  O  "O3'" . DG  K 8  5   ? 12.481  -17.600 81.320 1.00 171.38 ? -68 DG  J "O3'" 1 
ATOM   9221  C  "C2'" . DG  K 8  5   ? 13.085  -15.249 81.558 1.00 168.25 ? -68 DG  J "C2'" 1 
ATOM   9222  C  "C1'" . DG  K 8  5   ? 11.739  -14.761 82.071 1.00 166.72 ? -68 DG  J "C1'" 1 
ATOM   9223  N  N9    . DG  K 8  5   ? 11.663  -13.310 82.204 1.00 166.42 ? -68 DG  J N9    1 
ATOM   9224  C  C8    . DG  K 8  5   ? 12.676  -12.460 82.577 1.00 167.87 ? -68 DG  J C8    1 
ATOM   9225  N  N7    . DG  K 8  5   ? 12.317  -11.207 82.611 1.00 166.97 ? -68 DG  J N7    1 
ATOM   9226  C  C5    . DG  K 8  5   ? 10.979  -11.227 82.239 1.00 164.38 ? -68 DG  J C5    1 
ATOM   9227  C  C6    . DG  K 8  5   ? 10.057  -10.163 82.097 1.00 161.18 ? -68 DG  J C6    1 
ATOM   9228  O  O6    . DG  K 8  5   ? 10.248  -8.953  82.280 1.00 160.32 ? -68 DG  J O6    1 
ATOM   9229  N  N1    . DG  K 8  5   ? 8.802   -10.618 81.701 1.00 159.80 ? -68 DG  J N1    1 
ATOM   9230  C  C2    . DG  K 8  5   ? 8.480   -11.935 81.471 1.00 160.97 ? -68 DG  J C2    1 
ATOM   9231  N  N2    . DG  K 8  5   ? 7.216   -12.181 81.095 1.00 160.17 ? -68 DG  J N2    1 
ATOM   9232  N  N3    . DG  K 8  5   ? 9.335   -12.942 81.600 1.00 163.56 ? -68 DG  J N3    1 
ATOM   9233  C  C4    . DG  K 8  5   ? 10.561  -12.514 81.985 1.00 165.00 ? -68 DG  J C4    1 
ATOM   9234  P  P     . DA  K 8  6   ? 13.198  -18.200 80.013 1.00 175.08 ? -67 DA  J P     1 
ATOM   9235  O  OP1   . DA  K 8  6   ? 13.246  -19.671 80.166 1.00 176.75 ? -67 DA  J OP1   1 
ATOM   9236  O  OP2   . DA  K 8  6   ? 14.448  -17.446 79.770 1.00 177.98 ? -67 DA  J OP2   1 
ATOM   9237  O  "O5'" . DA  K 8  6   ? 12.179  -17.845 78.837 1.00 166.25 ? -67 DA  J "O5'" 1 
ATOM   9238  C  "C5'" . DA  K 8  6   ? 10.792  -18.103 79.006 1.00 155.89 ? -67 DA  J "C5'" 1 
ATOM   9239  C  "C4'" . DA  K 8  6   ? 9.962   -17.082 78.255 1.00 144.97 ? -67 DA  J "C4'" 1 
ATOM   9240  O  "O4'" . DA  K 8  6   ? 10.105  -15.797 78.876 1.00 143.09 ? -67 DA  J "O4'" 1 
ATOM   9241  C  "C3'" . DA  K 8  6   ? 10.383  -16.860 76.815 1.00 136.57 ? -67 DA  J "C3'" 1 
ATOM   9242  O  "O3'" . DA  K 8  6   ? 9.677   -17.756 75.970 1.00 132.21 ? -67 DA  J "O3'" 1 
ATOM   9243  C  "C2'" . DA  K 8  6   ? 9.994   -15.398 76.541 1.00 132.43 ? -67 DA  J "C2'" 1 
ATOM   9244  C  "C1'" . DA  K 8  6   ? 9.765   -14.805 77.938 1.00 135.27 ? -67 DA  J "C1'" 1 
ATOM   9245  N  N9    . DA  K 8  6   ? 10.566  -13.615 78.211 1.00 134.22 ? -67 DA  J N9    1 
ATOM   9246  C  C8    . DA  K 8  6   ? 11.898  -13.568 78.512 1.00 136.33 ? -67 DA  J C8    1 
ATOM   9247  N  N7    . DA  K 8  6   ? 12.352  -12.353 78.714 1.00 136.49 ? -67 DA  J N7    1 
ATOM   9248  C  C5    . DA  K 8  6   ? 11.239  -11.549 78.535 1.00 133.80 ? -67 DA  J C5    1 
ATOM   9249  C  C6    . DA  K 8  6   ? 11.052  -10.155 78.611 1.00 132.63 ? -67 DA  J C6    1 
ATOM   9250  N  N6    . DA  K 8  6   ? 12.035  -9.296  78.901 1.00 135.08 ? -67 DA  J N6    1 
ATOM   9251  N  N1    . DA  K 8  6   ? 9.813   -9.676  78.377 1.00 131.23 ? -67 DA  J N1    1 
ATOM   9252  C  C2    . DA  K 8  6   ? 8.832   -10.540 78.087 1.00 129.43 ? -67 DA  J C2    1 
ATOM   9253  N  N3    . DA  K 8  6   ? 8.886   -11.867 77.987 1.00 130.03 ? -67 DA  J N3    1 
ATOM   9254  C  C4    . DA  K 8  6   ? 10.129  -12.312 78.225 1.00 132.67 ? -67 DA  J C4    1 
ATOM   9255  P  P     . DA  K 8  7   ? 10.201  -18.049 74.481 1.00 128.92 ? -66 DA  J P     1 
ATOM   9256  O  OP1   . DA  K 8  7   ? 9.763   -19.412 74.106 1.00 131.99 ? -66 DA  J OP1   1 
ATOM   9257  O  OP2   . DA  K 8  7   ? 11.637  -17.694 74.431 1.00 127.17 ? -66 DA  J OP2   1 
ATOM   9258  O  "O5'" . DA  K 8  7   ? 9.410   -16.986 73.591 1.00 122.33 ? -66 DA  J "O5'" 1 
ATOM   9259  C  "C5'" . DA  K 8  7   ? 8.038   -16.731 73.847 1.00 118.40 ? -66 DA  J "C5'" 1 
ATOM   9260  C  "C4'" . DA  K 8  7   ? 7.636   -15.388 73.278 1.00 116.04 ? -66 DA  J "C4'" 1 
ATOM   9261  O  "O4'" . DA  K 8  7   ? 8.279   -14.337 74.034 1.00 115.97 ? -66 DA  J "O4'" 1 
ATOM   9262  C  "C3'" . DA  K 8  7   ? 8.031   -15.179 71.815 1.00 116.65 ? -66 DA  J "C3'" 1 
ATOM   9263  O  "O3'" . DA  K 8  7   ? 6.877   -14.930 71.027 1.00 118.79 ? -66 DA  J "O3'" 1 
ATOM   9264  C  "C2'" . DA  K 8  7   ? 8.985   -13.978 71.834 1.00 115.95 ? -66 DA  J "C2'" 1 
ATOM   9265  C  "C1'" . DA  K 8  7   ? 8.684   -13.311 73.167 1.00 115.58 ? -66 DA  J "C1'" 1 
ATOM   9266  N  N9    . DA  K 8  7   ? 9.850   -12.653 73.752 1.00 117.57 ? -66 DA  J N9    1 
ATOM   9267  C  C8    . DA  K 8  7   ? 11.055  -13.226 74.048 1.00 120.12 ? -66 DA  J C8    1 
ATOM   9268  N  N7    . DA  K 8  7   ? 11.926  -12.393 74.566 1.00 122.78 ? -66 DA  J N7    1 
ATOM   9269  C  C5    . DA  K 8  7   ? 11.246  -11.188 74.612 1.00 121.54 ? -66 DA  J C5    1 
ATOM   9270  C  C6    . DA  K 8  7   ? 11.620  -9.905  75.058 1.00 123.30 ? -66 DA  J C6    1 
ATOM   9271  N  N6    . DA  K 8  7   ? 12.826  -9.623  75.563 1.00 127.22 ? -66 DA  J N6    1 
ATOM   9272  N  N1    . DA  K 8  7   ? 10.703  -8.919  74.965 1.00 122.40 ? -66 DA  J N1    1 
ATOM   9273  C  C2    . DA  K 8  7   ? 9.497   -9.205  74.459 1.00 120.56 ? -66 DA  J C2    1 
ATOM   9274  N  N3    . DA  K 8  7   ? 9.032   -10.370 74.008 1.00 118.95 ? -66 DA  J N3    1 
ATOM   9275  C  C4    . DA  K 8  7   ? 9.965   -11.329 74.113 1.00 118.86 ? -66 DA  J C4    1 
ATOM   9276  P  P     . DT  K 8  8   ? 7.003   -14.782 69.432 1.00 121.09 ? -65 DT  J P     1 
ATOM   9277  O  OP1   . DT  K 8  8   ? 5.784   -15.359 68.823 1.00 117.64 ? -65 DT  J OP1   1 
ATOM   9278  O  OP2   . DT  K 8  8   ? 8.332   -15.295 69.027 1.00 122.63 ? -65 DT  J OP2   1 
ATOM   9279  O  "O5'" . DT  K 8  8   ? 6.991   -13.201 69.205 1.00 125.33 ? -65 DT  J "O5'" 1 
ATOM   9280  C  "C5'" . DT  K 8  8   ? 5.994   -12.409 69.839 1.00 128.29 ? -65 DT  J "C5'" 1 
ATOM   9281  C  "C4'" . DT  K 8  8   ? 6.357   -10.937 69.789 1.00 127.03 ? -65 DT  J "C4'" 1 
ATOM   9282  O  "O4'" . DT  K 8  8   ? 7.497   -10.684 70.649 1.00 128.25 ? -65 DT  J "O4'" 1 
ATOM   9283  C  "C3'" . DT  K 8  8   ? 6.738   -10.413 68.401 1.00 126.53 ? -65 DT  J "C3'" 1 
ATOM   9284  O  "O3'" . DT  K 8  8   ? 5.989   -9.241  68.107 1.00 127.80 ? -65 DT  J "O3'" 1 
ATOM   9285  C  "C2'" . DT  K 8  8   ? 8.236   -10.114 68.520 1.00 127.64 ? -65 DT  J "C2'" 1 
ATOM   9286  C  "C1'" . DT  K 8  8   ? 8.373   -9.798  69.999 1.00 127.07 ? -65 DT  J "C1'" 1 
ATOM   9287  N  N1    . DT  K 8  8   ? 9.751   -10.016 70.532 1.00 122.80 ? -65 DT  J N1    1 
ATOM   9288  C  C2    . DT  K 8  8   ? 10.375  -9.001  71.220 1.00 119.76 ? -65 DT  J C2    1 
ATOM   9289  O  O2    . DT  K 8  8   ? 9.857   -7.919  71.427 1.00 116.24 ? -65 DT  J O2    1 
ATOM   9290  N  N3    . DT  K 8  8   ? 11.635  -9.303  71.666 1.00 121.76 ? -65 DT  J N3    1 
ATOM   9291  C  C4    . DT  K 8  8   ? 12.321  -10.492 71.492 1.00 122.48 ? -65 DT  J C4    1 
ATOM   9292  O  O4    . DT  K 8  8   ? 13.453  -10.667 71.931 1.00 124.31 ? -65 DT  J O4    1 
ATOM   9293  C  C5    . DT  K 8  8   ? 11.610  -11.513 70.759 1.00 120.28 ? -65 DT  J C5    1 
ATOM   9294  C  C7    . DT  K 8  8   ? 12.252  -12.846 70.508 1.00 117.55 ? -65 DT  J C7    1 
ATOM   9295  C  C6    . DT  K 8  8   ? 10.375  -11.227 70.318 1.00 120.57 ? -65 DT  J C6    1 
ATOM   9296  P  P     . DC  K 8  9   ? 6.054   -8.579  66.644 1.00 127.69 ? -64 DC  J P     1 
ATOM   9297  O  OP1   . DC  K 8  9   ? 4.683   -8.153  66.289 1.00 126.24 ? -64 DC  J OP1   1 
ATOM   9298  O  OP2   . DC  K 8  9   ? 6.789   -9.503  65.752 1.00 123.02 ? -64 DC  J OP2   1 
ATOM   9299  O  "O5'" . DC  K 8  9   ? 6.955   -7.275  66.861 1.00 132.72 ? -64 DC  J "O5'" 1 
ATOM   9300  C  "C5'" . DC  K 8  9   ? 6.590   -6.319  67.853 1.00 132.79 ? -64 DC  J "C5'" 1 
ATOM   9301  C  "C4'" . DC  K 8  9   ? 7.698   -5.302  68.060 1.00 133.07 ? -64 DC  J "C4'" 1 
ATOM   9302  O  "O4'" . DC  K 8  9   ? 8.825   -5.935  68.723 1.00 132.13 ? -64 DC  J "O4'" 1 
ATOM   9303  C  "C3'" . DC  K 8  9   ? 8.251   -4.678  66.775 1.00 135.01 ? -64 DC  J "C3'" 1 
ATOM   9304  O  "O3'" . DC  K 8  9   ? 8.373   -3.270  66.929 1.00 138.67 ? -64 DC  J "O3'" 1 
ATOM   9305  C  "C2'" . DC  K 8  9   ? 9.616   -5.346  66.615 1.00 135.00 ? -64 DC  J "C2'" 1 
ATOM   9306  C  "C1'" . DC  K 8  9   ? 10.013  -5.575  68.062 1.00 135.51 ? -64 DC  J "C1'" 1 
ATOM   9307  N  N1    . DC  K 8  9   ? 11.009  -6.670  68.238 1.00 140.10 ? -64 DC  J N1    1 
ATOM   9308  C  C2    . DC  K 8  9   ? 12.177  -6.433  68.970 1.00 144.00 ? -64 DC  J C2    1 
ATOM   9309  O  O2    . DC  K 8  9   ? 12.362  -5.315  69.466 1.00 145.00 ? -64 DC  J O2    1 
ATOM   9310  N  N3    . DC  K 8  9   ? 13.075  -7.439  69.118 1.00 146.34 ? -64 DC  J N3    1 
ATOM   9311  C  C4    . DC  K 8  9   ? 12.838  -8.631  68.567 1.00 144.70 ? -64 DC  J C4    1 
ATOM   9312  N  N4    . DC  K 8  9   ? 13.752  -9.592  68.740 1.00 144.17 ? -64 DC  J N4    1 
ATOM   9313  C  C5    . DC  K 8  9   ? 11.654  -8.890  67.815 1.00 143.15 ? -64 DC  J C5    1 
ATOM   9314  C  C6    . DC  K 8  9   ? 10.778  -7.890  67.676 1.00 141.15 ? -64 DC  J C6    1 
ATOM   9315  P  P     . DC  K 8  10  ? 8.838   -2.359  65.689 1.00 138.30 ? -63 DC  J P     1 
ATOM   9316  O  OP1   . DC  K 8  10  ? 8.317   -0.993  65.918 1.00 141.55 ? -63 DC  J OP1   1 
ATOM   9317  O  OP2   . DC  K 8  10  ? 8.489   -3.083  64.447 1.00 132.43 ? -63 DC  J OP2   1 
ATOM   9318  O  "O5'" . DC  K 8  10  ? 10.434  -2.330  65.811 1.00 140.32 ? -63 DC  J "O5'" 1 
ATOM   9319  C  "C5'" . DC  K 8  10  ? 11.044  -1.883  67.016 1.00 144.51 ? -63 DC  J "C5'" 1 
ATOM   9320  C  "C4'" . DC  K 8  10  ? 12.557  -1.984  66.933 1.00 151.70 ? -63 DC  J "C4'" 1 
ATOM   9321  O  "O4'" . DC  K 8  10  ? 12.972  -3.370  67.077 1.00 152.80 ? -63 DC  J "O4'" 1 
ATOM   9322  C  "C3'" . DC  K 8  10  ? 13.175  -1.494  65.619 1.00 157.27 ? -63 DC  J "C3'" 1 
ATOM   9323  O  "O3'" . DC  K 8  10  ? 14.348  -0.752  65.896 1.00 165.28 ? -63 DC  J "O3'" 1 
ATOM   9324  C  "C2'" . DC  K 8  10  ? 13.514  -2.797  64.901 1.00 155.23 ? -63 DC  J "C2'" 1 
ATOM   9325  C  "C1'" . DC  K 8  10  ? 13.923  -3.657  66.081 1.00 155.07 ? -63 DC  J "C1'" 1 
ATOM   9326  N  N1    . DC  K 8  10  ? 13.910  -5.120  65.802 1.00 155.41 ? -63 DC  J N1    1 
ATOM   9327  C  C2    . DC  K 8  10  ? 15.034  -5.892  66.117 1.00 157.27 ? -63 DC  J C2    1 
ATOM   9328  O  O2    . DC  K 8  10  ? 16.019  -5.342  66.627 1.00 158.21 ? -63 DC  J O2    1 
ATOM   9329  N  N3    . DC  K 8  10  ? 15.011  -7.222  65.858 1.00 157.52 ? -63 DC  J N3    1 
ATOM   9330  C  C4    . DC  K 8  10  ? 13.930  -7.776  65.308 1.00 155.24 ? -63 DC  J C4    1 
ATOM   9331  N  N4    . DC  K 8  10  ? 13.954  -9.091  65.071 1.00 155.50 ? -63 DC  J N4    1 
ATOM   9332  C  C5    . DC  K 8  10  ? 12.776  -7.006  64.977 1.00 152.95 ? -63 DC  J C5    1 
ATOM   9333  C  C6    . DC  K 8  10  ? 12.810  -5.695  65.238 1.00 153.85 ? -63 DC  J C6    1 
ATOM   9334  P  P     . DC  K 8  11  ? 14.411  0.823   65.592 1.00 168.97 ? -62 DC  J P     1 
ATOM   9335  O  OP1   . DC  K 8  11  ? 13.901  1.526   66.791 1.00 171.09 ? -62 DC  J OP1   1 
ATOM   9336  O  OP2   . DC  K 8  11  ? 13.784  1.062   64.273 1.00 162.82 ? -62 DC  J OP2   1 
ATOM   9337  O  "O5'" . DC  K 8  11  ? 15.977  1.111   65.452 1.00 176.78 ? -62 DC  J "O5'" 1 
ATOM   9338  C  "C5'" . DC  K 8  11  ? 16.872  0.666   66.465 1.00 184.15 ? -62 DC  J "C5'" 1 
ATOM   9339  C  "C4'" . DC  K 8  11  ? 18.056  -0.065  65.858 1.00 190.65 ? -62 DC  J "C4'" 1 
ATOM   9340  O  "O4'" . DC  K 8  11  ? 17.753  -1.464  65.736 1.00 188.94 ? -62 DC  J "O4'" 1 
ATOM   9341  C  "C3'" . DC  K 8  11  ? 18.435  0.381   64.449 1.00 196.33 ? -62 DC  J "C3'" 1 
ATOM   9342  O  "O3'" . DC  K 8  11  ? 19.514  1.306   64.507 1.00 205.67 ? -62 DC  J "O3'" 1 
ATOM   9343  C  "C2'" . DC  K 8  11  ? 18.842  -0.922  63.729 1.00 193.39 ? -62 DC  J "C2'" 1 
ATOM   9344  C  "C1'" . DC  K 8  11  ? 18.623  -2.010  64.782 1.00 189.37 ? -62 DC  J "C1'" 1 
ATOM   9345  N  N1    . DC  K 8  11  ? 18.014  -3.258  64.234 1.00 183.98 ? -62 DC  J N1    1 
ATOM   9346  C  C2    . DC  K 8  11  ? 18.692  -4.474  64.365 1.00 183.44 ? -62 DC  J C2    1 
ATOM   9347  O  O2    . DC  K 8  11  ? 19.787  -4.495  64.939 1.00 186.23 ? -62 DC  J O2    1 
ATOM   9348  N  N3    . DC  K 8  11  ? 18.127  -5.599  63.860 1.00 180.93 ? -62 DC  J N3    1 
ATOM   9349  C  C4    . DC  K 8  11  ? 16.944  -5.535  63.248 1.00 179.21 ? -62 DC  J C4    1 
ATOM   9350  N  N4    . DC  K 8  11  ? 16.427  -6.670  62.766 1.00 178.98 ? -62 DC  J N4    1 
ATOM   9351  C  C5    . DC  K 8  11  ? 16.239  -4.304  63.102 1.00 178.03 ? -62 DC  J C5    1 
ATOM   9352  C  C6    . DC  K 8  11  ? 16.806  -3.201  63.604 1.00 180.46 ? -62 DC  J C6    1 
ATOM   9353  P  P     . DG  K 8  12  ? 20.050  2.016   63.169 1.00 209.82 ? -61 DG  J P     1 
ATOM   9354  O  OP1   . DG  K 8  12  ? 20.422  3.403   63.523 1.00 212.43 ? -61 DG  J OP1   1 
ATOM   9355  O  OP2   . DG  K 8  12  ? 19.065  1.777   62.091 1.00 208.85 ? -61 DG  J OP2   1 
ATOM   9356  O  "O5'" . DG  K 8  12  ? 21.380  1.203   62.813 1.00 213.27 ? -61 DG  J "O5'" 1 
ATOM   9357  C  "C5'" . DG  K 8  12  ? 22.451  1.157   63.748 1.00 217.27 ? -61 DG  J "C5'" 1 
ATOM   9358  C  "C4'" . DG  K 8  12  ? 23.419  0.037   63.412 1.00 218.40 ? -61 DG  J "C4'" 1 
ATOM   9359  O  "O4'" . DG  K 8  12  ? 22.723  -1.235  63.447 1.00 219.06 ? -61 DG  J "O4'" 1 
ATOM   9360  C  "C3'" . DG  K 8  12  ? 24.073  0.136   62.030 1.00 218.35 ? -61 DG  J "C3'" 1 
ATOM   9361  O  "O3'" . DG  K 8  12  ? 25.486  0.016   62.154 1.00 215.57 ? -61 DG  J "O3'" 1 
ATOM   9362  C  "C2'" . DG  K 8  12  ? 23.468  -1.036  61.249 1.00 218.70 ? -61 DG  J "C2'" 1 
ATOM   9363  C  "C1'" . DG  K 8  12  ? 23.136  -2.020  62.357 1.00 219.24 ? -61 DG  J "C1'" 1 
ATOM   9364  N  N9    . DG  K 8  12  ? 22.053  -2.938  62.013 1.00 218.16 ? -61 DG  J N9    1 
ATOM   9365  C  C8    . DG  K 8  12  ? 20.807  -2.605  61.541 1.00 215.97 ? -61 DG  J C8    1 
ATOM   9366  N  N7    . DG  K 8  12  ? 20.042  -3.638  61.321 1.00 213.62 ? -61 DG  J N7    1 
ATOM   9367  C  C5    . DG  K 8  12  ? 20.831  -4.726  61.668 1.00 215.47 ? -61 DG  J C5    1 
ATOM   9368  C  C6    . DG  K 8  12  ? 20.539  -6.109  61.637 1.00 215.75 ? -61 DG  J C6    1 
ATOM   9369  O  O6    . DG  K 8  12  ? 19.489  -6.665  61.286 1.00 212.89 ? -61 DG  J O6    1 
ATOM   9370  N  N1    . DG  K 8  12  ? 21.620  -6.874  62.072 1.00 219.27 ? -61 DG  J N1    1 
ATOM   9371  C  C2    . DG  K 8  12  ? 22.829  -6.364  62.483 1.00 220.92 ? -61 DG  J C2    1 
ATOM   9372  N  N2    . DG  K 8  12  ? 23.751  -7.259  62.867 1.00 222.01 ? -61 DG  J N2    1 
ATOM   9373  N  N3    . DG  K 8  12  ? 23.115  -5.069  62.516 1.00 221.03 ? -61 DG  J N3    1 
ATOM   9374  C  C4    . DG  K 8  12  ? 22.073  -4.312  62.096 1.00 218.34 ? -61 DG  J C4    1 
ATOM   9375  P  P     . DG  K 8  13  ? 26.429  0.093   60.855 1.00 208.08 ? -60 DG  J P     1 
ATOM   9376  O  OP1   . DG  K 8  13  ? 27.709  0.708   61.271 1.00 210.43 ? -60 DG  J OP1   1 
ATOM   9377  O  OP2   . DG  K 8  13  ? 25.651  0.698   59.750 1.00 206.23 ? -60 DG  J OP2   1 
ATOM   9378  O  "O5'" . DG  K 8  13  ? 26.697  -1.440  60.491 1.00 200.13 ? -60 DG  J "O5'" 1 
ATOM   9379  C  "C5'" . DG  K 8  13  ? 27.239  -2.314  61.473 1.00 193.03 ? -60 DG  J "C5'" 1 
ATOM   9380  C  "C4'" . DG  K 8  13  ? 27.432  -3.709  60.909 1.00 182.34 ? -60 DG  J "C4'" 1 
ATOM   9381  O  "O4'" . DG  K 8  13  ? 26.142  -4.356  60.759 1.00 173.77 ? -60 DG  J "O4'" 1 
ATOM   9382  C  "C3'" . DG  K 8  13  ? 28.110  -3.761  59.541 1.00 178.64 ? -60 DG  J "C3'" 1 
ATOM   9383  O  "O3'" . DG  K 8  13  ? 29.113  -4.765  59.536 1.00 180.55 ? -60 DG  J "O3'" 1 
ATOM   9384  C  "C2'" . DG  K 8  13  ? 26.967  -4.089  58.577 1.00 172.02 ? -60 DG  J "C2'" 1 
ATOM   9385  C  "C1'" . DG  K 8  13  ? 26.008  -4.878  59.457 1.00 168.24 ? -60 DG  J "C1'" 1 
ATOM   9386  N  N9    . DG  K 8  13  ? 24.611  -4.736  59.056 1.00 159.99 ? -60 DG  J N9    1 
ATOM   9387  C  C8    . DG  K 8  13  ? 23.927  -3.562  58.854 1.00 157.10 ? -60 DG  J C8    1 
ATOM   9388  N  N7    . DG  K 8  13  ? 22.684  -3.737  58.502 1.00 153.13 ? -60 DG  J N7    1 
ATOM   9389  C  C5    . DG  K 8  13  ? 22.531  -5.116  58.468 1.00 151.31 ? -60 DG  J C5    1 
ATOM   9390  C  C6    . DG  K 8  13  ? 21.396  -5.899  58.151 1.00 147.02 ? -60 DG  J C6    1 
ATOM   9391  O  O6    . DG  K 8  13  ? 20.264  -5.513  57.827 1.00 142.09 ? -60 DG  J O6    1 
ATOM   9392  N  N1    . DG  K 8  13  ? 21.669  -7.262  58.239 1.00 148.86 ? -60 DG  J N1    1 
ATOM   9393  C  C2    . DG  K 8  13  ? 22.886  -7.799  58.589 1.00 151.29 ? -60 DG  J C2    1 
ATOM   9394  N  N2    . DG  K 8  13  ? 22.956  -9.138  58.620 1.00 149.25 ? -60 DG  J N2    1 
ATOM   9395  N  N3    . DG  K 8  13  ? 23.958  -7.077  58.889 1.00 155.68 ? -60 DG  J N3    1 
ATOM   9396  C  C4    . DG  K 8  13  ? 23.708  -5.747  58.808 1.00 155.59 ? -60 DG  J C4    1 
ATOM   9397  P  P     . DT  K 8  14  ? 30.116  -4.908  58.289 1.00 181.81 ? -59 DT  J P     1 
ATOM   9398  O  OP1   . DT  K 8  14  ? 31.467  -5.176  58.828 1.00 185.30 ? -59 DT  J OP1   1 
ATOM   9399  O  OP2   . DT  K 8  14  ? 29.901  -3.756  57.385 1.00 179.12 ? -59 DT  J OP2   1 
ATOM   9400  O  "O5'" . DT  K 8  14  ? 29.594  -6.219  57.545 1.00 181.58 ? -59 DT  J "O5'" 1 
ATOM   9401  C  "C5'" . DT  K 8  14  ? 29.283  -7.380  58.303 1.00 181.38 ? -59 DT  J "C5'" 1 
ATOM   9402  C  "C4'" . DT  K 8  14  ? 28.556  -8.396  57.448 1.00 178.32 ? -59 DT  J "C4'" 1 
ATOM   9403  O  "O4'" . DT  K 8  14  ? 27.157  -8.034  57.341 1.00 175.44 ? -59 DT  J "O4'" 1 
ATOM   9404  C  "C3'" . DT  K 8  14  ? 29.081  -8.518  56.014 1.00 179.00 ? -59 DT  J "C3'" 1 
ATOM   9405  O  "O3'" . DT  K 8  14  ? 29.418  -9.866  55.737 1.00 180.29 ? -59 DT  J "O3'" 1 
ATOM   9406  C  "C2'" . DT  K 8  14  ? 27.915  -8.033  55.146 1.00 175.59 ? -59 DT  J "C2'" 1 
ATOM   9407  C  "C1'" . DT  K 8  14  ? 26.717  -8.307  56.038 1.00 172.97 ? -59 DT  J "C1'" 1 
ATOM   9408  N  N1    . DT  K 8  14  ? 25.538  -7.441  55.740 1.00 170.60 ? -59 DT  J N1    1 
ATOM   9409  C  C2    . DT  K 8  14  ? 24.321  -8.027  55.483 1.00 168.69 ? -59 DT  J C2    1 
ATOM   9410  O  O2    . DT  K 8  14  ? 24.145  -9.233  55.489 1.00 169.42 ? -59 DT  J O2    1 
ATOM   9411  N  N3    . DT  K 8  14  ? 23.305  -7.147  55.220 1.00 165.68 ? -59 DT  J N3    1 
ATOM   9412  C  C4    . DT  K 8  14  ? 23.384  -5.766  55.186 1.00 164.56 ? -59 DT  J C4    1 
ATOM   9413  O  O4    . DT  K 8  14  ? 22.412  -5.059  54.938 1.00 160.43 ? -59 DT  J O4    1 
ATOM   9414  C  C5    . DT  K 8  14  ? 24.690  -5.216  55.462 1.00 168.92 ? -59 DT  J C5    1 
ATOM   9415  C  C7    . DT  K 8  14  ? 24.899  -3.731  55.453 1.00 171.16 ? -59 DT  J C7    1 
ATOM   9416  C  C6    . DT  K 8  14  ? 25.693  -6.070  55.722 1.00 171.02 ? -59 DT  J C6    1 
ATOM   9417  P  P     . DG  K 8  15  ? 30.488  -10.214 54.590 1.00 182.79 ? -58 DG  J P     1 
ATOM   9418  O  OP1   . DG  K 8  15  ? 31.584  -10.987 55.217 1.00 185.87 ? -58 DG  J OP1   1 
ATOM   9419  O  OP2   . DG  K 8  15  ? 30.790  -8.965  53.856 1.00 182.16 ? -58 DG  J OP2   1 
ATOM   9420  O  "O5'" . DG  K 8  15  ? 29.678  -11.174 53.605 1.00 181.41 ? -58 DG  J "O5'" 1 
ATOM   9421  C  "C5'" . DG  K 8  15  ? 28.829  -12.176 54.143 1.00 179.55 ? -58 DG  J "C5'" 1 
ATOM   9422  C  "C4'" . DG  K 8  15  ? 27.651  -12.432 53.224 1.00 176.34 ? -58 DG  J "C4'" 1 
ATOM   9423  O  "O4'" . DG  K 8  15  ? 26.758  -11.286 53.240 1.00 173.38 ? -58 DG  J "O4'" 1 
ATOM   9424  C  "C3'" . DG  K 8  15  ? 28.017  -12.668 51.757 1.00 178.38 ? -58 DG  J "C3'" 1 
ATOM   9425  O  "O3'" . DG  K 8  15  ? 27.300  -13.782 51.260 1.00 179.12 ? -58 DG  J "O3'" 1 
ATOM   9426  C  "C2'" . DG  K 8  15  ? 27.584  -11.373 51.069 1.00 176.00 ? -58 DG  J "C2'" 1 
ATOM   9427  C  "C1'" . DG  K 8  15  ? 26.394  -10.967 51.919 1.00 171.76 ? -58 DG  J "C1'" 1 
ATOM   9428  N  N9    . DG  K 8  15  ? 26.083  -9.541  51.849 1.00 169.06 ? -58 DG  J N9    1 
ATOM   9429  C  C8    . DG  K 8  15  ? 26.970  -8.495  51.938 1.00 169.89 ? -58 DG  J C8    1 
ATOM   9430  N  N7    . DG  K 8  15  ? 26.404  -7.324  51.841 1.00 167.06 ? -58 DG  J N7    1 
ATOM   9431  C  C5    . DG  K 8  15  ? 25.055  -7.610  51.674 1.00 163.18 ? -58 DG  J C5    1 
ATOM   9432  C  C6    . DG  K 8  15  ? 23.951  -6.739  51.514 1.00 158.62 ? -58 DG  J C6    1 
ATOM   9433  O  O6    . DG  K 8  15  ? 23.948  -5.500  51.487 1.00 157.17 ? -58 DG  J O6    1 
ATOM   9434  N  N1    . DG  K 8  15  ? 22.756  -7.442  51.376 1.00 156.06 ? -58 DG  J N1    1 
ATOM   9435  C  C2    . DG  K 8  15  ? 22.643  -8.812  51.391 1.00 155.21 ? -58 DG  J C2    1 
ATOM   9436  N  N2    . DG  K 8  15  ? 21.406  -9.307  51.243 1.00 150.36 ? -58 DG  J N2    1 
ATOM   9437  N  N3    . DG  K 8  15  ? 23.670  -9.640  51.541 1.00 159.62 ? -58 DG  J N3    1 
ATOM   9438  C  C4    . DG  K 8  15  ? 24.841  -8.971  51.677 1.00 164.19 ? -58 DG  J C4    1 
ATOM   9439  P  P     . DC  K 8  16  ? 27.892  -14.657 50.051 1.00 182.53 ? -57 DC  J P     1 
ATOM   9440  O  OP1   . DC  K 8  16  ? 28.462  -15.893 50.629 1.00 187.47 ? -57 DC  J OP1   1 
ATOM   9441  O  OP2   . DC  K 8  16  ? 28.739  -13.775 49.218 1.00 184.72 ? -57 DC  J OP2   1 
ATOM   9442  O  "O5'" . DC  K 8  16  ? 26.595  -15.037 49.202 1.00 179.80 ? -57 DC  J "O5'" 1 
ATOM   9443  C  "C5'" . DC  K 8  16  ? 25.414  -15.458 49.871 1.00 176.33 ? -57 DC  J "C5'" 1 
ATOM   9444  C  "C4'" . DC  K 8  16  ? 24.182  -15.072 49.078 1.00 171.54 ? -57 DC  J "C4'" 1 
ATOM   9445  O  "O4'" . DC  K 8  16  ? 23.909  -13.656 49.254 1.00 170.86 ? -57 DC  J "O4'" 1 
ATOM   9446  C  "C3'" . DC  K 8  16  ? 24.292  -15.302 47.571 1.00 169.18 ? -57 DC  J "C3'" 1 
ATOM   9447  O  "O3'" . DC  K 8  16  ? 23.101  -15.889 47.088 1.00 162.46 ? -57 DC  J "O3'" 1 
ATOM   9448  C  "C2'" . DC  K 8  16  ? 24.491  -13.895 47.009 1.00 170.20 ? -57 DC  J "C2'" 1 
ATOM   9449  C  "C1'" . DC  K 8  16  ? 23.697  -13.059 47.997 1.00 170.11 ? -57 DC  J "C1'" 1 
ATOM   9450  N  N1    . DC  K 8  16  ? 24.143  -11.640 48.067 1.00 174.21 ? -57 DC  J N1    1 
ATOM   9451  C  C2    . DC  K 8  16  ? 23.192  -10.615 48.060 1.00 173.46 ? -57 DC  J C2    1 
ATOM   9452  O  O2    . DC  K 8  16  ? 21.991  -10.906 48.000 1.00 172.28 ? -57 DC  J O2    1 
ATOM   9453  N  N3    . DC  K 8  16  ? 23.615  -9.327  48.123 1.00 174.22 ? -57 DC  J N3    1 
ATOM   9454  C  C4    . DC  K 8  16  ? 24.920  -9.056  48.188 1.00 177.41 ? -57 DC  J C4    1 
ATOM   9455  N  N4    . DC  K 8  16  ? 25.289  -7.772  48.248 1.00 177.48 ? -57 DC  J N4    1 
ATOM   9456  C  C5    . DC  K 8  16  ? 25.903  -10.088 48.193 1.00 180.91 ? -57 DC  J C5    1 
ATOM   9457  C  C6    . DC  K 8  16  ? 25.474  -11.353 48.131 1.00 179.55 ? -57 DC  J C6    1 
ATOM   9458  P  P     . DC  K 8  17  ? 23.146  -16.894 45.837 1.00 157.25 ? -56 DC  J P     1 
ATOM   9459  O  OP1   . DC  K 8  17  ? 22.949  -18.267 46.352 1.00 157.92 ? -56 DC  J OP1   1 
ATOM   9460  O  OP2   . DC  K 8  17  ? 24.351  -16.568 45.041 1.00 158.37 ? -56 DC  J OP2   1 
ATOM   9461  O  "O5'" . DC  K 8  17  ? 21.867  -16.476 44.978 1.00 148.85 ? -56 DC  J "O5'" 1 
ATOM   9462  C  "C5'" . DC  K 8  17  ? 20.662  -16.115 45.638 1.00 138.37 ? -56 DC  J "C5'" 1 
ATOM   9463  C  "C4'" . DC  K 8  17  ? 19.990  -14.957 44.927 1.00 130.10 ? -56 DC  J "C4'" 1 
ATOM   9464  O  "O4'" . DC  K 8  17  ? 20.739  -13.735 45.170 1.00 131.99 ? -56 DC  J "O4'" 1 
ATOM   9465  C  "C3'" . DC  K 8  17  ? 19.895  -15.105 43.407 1.00 125.97 ? -56 DC  J "C3'" 1 
ATOM   9466  O  "O3'" . DC  K 8  17  ? 18.613  -14.693 42.962 1.00 118.57 ? -56 DC  J "O3'" 1 
ATOM   9467  C  "C2'" . DC  K 8  17  ? 20.993  -14.174 42.895 1.00 130.86 ? -56 DC  J "C2'" 1 
ATOM   9468  C  "C1'" . DC  K 8  17  ? 20.967  -13.077 43.946 1.00 133.16 ? -56 DC  J "C1'" 1 
ATOM   9469  N  N1    . DC  K 8  17  ? 22.243  -12.311 44.047 1.00 138.74 ? -56 DC  J N1    1 
ATOM   9470  C  C2    . DC  K 8  17  ? 22.216  -10.976 44.464 1.00 140.64 ? -56 DC  J C2    1 
ATOM   9471  O  O2    . DC  K 8  17  ? 21.130  -10.454 44.745 1.00 139.90 ? -56 DC  J O2    1 
ATOM   9472  N  N3    . DC  K 8  17  ? 23.384  -10.291 44.550 1.00 144.19 ? -56 DC  J N3    1 
ATOM   9473  C  C4    . DC  K 8  17  ? 24.534  -10.891 44.238 1.00 148.15 ? -56 DC  J C4    1 
ATOM   9474  N  N4    . DC  K 8  17  ? 25.659  -10.175 44.338 1.00 152.34 ? -56 DC  J N4    1 
ATOM   9475  C  C5    . DC  K 8  17  ? 24.581  -12.250 43.810 1.00 147.20 ? -56 DC  J C5    1 
ATOM   9476  C  C6    . DC  K 8  17  ? 23.424  -12.915 43.729 1.00 143.32 ? -56 DC  J C6    1 
ATOM   9477  P  P     . DG  K 8  18  ? 17.457  -15.777 42.702 1.00 109.63 ? -55 DG  J P     1 
ATOM   9478  O  OP1   . DG  K 8  18  ? 17.369  -16.641 43.900 1.00 109.82 ? -55 DG  J OP1   1 
ATOM   9479  O  OP2   . DG  K 8  18  ? 17.696  -16.376 41.371 1.00 103.38 ? -55 DG  J OP2   1 
ATOM   9480  O  "O5'" . DG  K 8  18  ? 16.124  -14.898 42.607 1.00 108.87 ? -55 DG  J "O5'" 1 
ATOM   9481  C  "C5'" . DG  K 8  18  ? 15.780  -14.014 43.670 1.00 106.72 ? -55 DG  J "C5'" 1 
ATOM   9482  C  "C4'" . DG  K 8  18  ? 15.635  -12.587 43.167 1.00 102.29 ? -55 DG  J "C4'" 1 
ATOM   9483  O  "O4'" . DG  K 8  18  ? 16.949  -12.010 42.938 1.00 101.83 ? -55 DG  J "O4'" 1 
ATOM   9484  C  "C3'" . DG  K 8  18  ? 14.867  -12.435 41.853 1.00 99.44  ? -55 DG  J "C3'" 1 
ATOM   9485  O  "O3'" . DG  K 8  18  ? 13.998  -11.317 41.930 1.00 98.99  ? -55 DG  J "O3'" 1 
ATOM   9486  C  "C2'" . DG  K 8  18  ? 15.974  -12.212 40.825 1.00 98.53  ? -55 DG  J "C2'" 1 
ATOM   9487  C  "C1'" . DG  K 8  18  ? 16.997  -11.444 41.648 1.00 102.57 ? -55 DG  J "C1'" 1 
ATOM   9488  N  N9    . DG  K 8  18  ? 18.360  -11.564 41.141 1.00 110.74 ? -55 DG  J N9    1 
ATOM   9489  C  C8    . DG  K 8  18  ? 18.916  -12.652 40.513 1.00 114.22 ? -55 DG  J C8    1 
ATOM   9490  N  N7    . DG  K 8  18  ? 20.160  -12.473 40.167 1.00 119.57 ? -55 DG  J N7    1 
ATOM   9491  C  C5    . DG  K 8  18  ? 20.450  -11.184 40.594 1.00 121.81 ? -55 DG  J C5    1 
ATOM   9492  C  C6    . DG  K 8  18  ? 21.648  -10.438 40.494 1.00 126.91 ? -55 DG  J C6    1 
ATOM   9493  O  O6    . DG  K 8  18  ? 22.728  -10.783 39.992 1.00 130.69 ? -55 DG  J O6    1 
ATOM   9494  N  N1    . DG  K 8  18  ? 21.514  -9.170  41.054 1.00 127.62 ? -55 DG  J N1    1 
ATOM   9495  C  C2    . DG  K 8  18  ? 20.367  -8.684  41.636 1.00 126.71 ? -55 DG  J C2    1 
ATOM   9496  N  N2    . DG  K 8  18  ? 20.429  -7.435  42.121 1.00 132.77 ? -55 DG  J N2    1 
ATOM   9497  N  N3    . DG  K 8  18  ? 19.237  -9.373  41.736 1.00 120.64 ? -55 DG  J N3    1 
ATOM   9498  C  C4    . DG  K 8  18  ? 19.351  -10.610 41.196 1.00 117.70 ? -55 DG  J C4    1 
ATOM   9499  P  P     . DA  K 8  19  ? 12.654  -11.269 41.052 1.00 96.37  ? -54 DA  J P     1 
ATOM   9500  O  OP1   . DA  K 8  19  ? 11.518  -11.545 41.960 1.00 84.10  ? -54 DA  J OP1   1 
ATOM   9501  O  OP2   . DA  K 8  19  ? 12.868  -12.108 39.851 1.00 99.14  ? -54 DA  J OP2   1 
ATOM   9502  O  "O5'" . DA  K 8  19  ? 12.576  -9.747  40.569 1.00 103.60 ? -54 DA  J "O5'" 1 
ATOM   9503  C  "C5'" . DA  K 8  19  ? 12.788  -8.701  41.504 1.00 101.41 ? -54 DA  J "C5'" 1 
ATOM   9504  C  "C4'" . DA  K 8  19  ? 13.655  -7.607  40.907 1.00 97.44  ? -54 DA  J "C4'" 1 
ATOM   9505  O  "O4'" . DA  K 8  19  ? 14.938  -8.155  40.504 1.00 98.52  ? -54 DA  J "O4'" 1 
ATOM   9506  C  "C3'" . DA  K 8  19  ? 13.077  -6.918  39.669 1.00 93.71  ? -54 DA  J "C3'" 1 
ATOM   9507  O  "O3'" . DA  K 8  19  ? 13.217  -5.521  39.803 1.00 96.96  ? -54 DA  J "O3'" 1 
ATOM   9508  C  "C2'" . DA  K 8  19  ? 13.941  -7.454  38.529 1.00 95.20  ? -54 DA  J "C2'" 1 
ATOM   9509  C  "C1'" . DA  K 8  19  ? 15.270  -7.652  39.233 1.00 100.66 ? -54 DA  J "C1'" 1 
ATOM   9510  N  N9    . DA  K 8  19  ? 16.149  -8.606  38.566 1.00 108.89 ? -54 DA  J N9    1 
ATOM   9511  C  C8    . DA  K 8  19  ? 15.813  -9.838  38.079 1.00 110.21 ? -54 DA  J C8    1 
ATOM   9512  N  N7    . DA  K 8  19  ? 16.814  -10.480 37.524 1.00 113.82 ? -54 DA  J N7    1 
ATOM   9513  C  C5    . DA  K 8  19  ? 17.881  -9.607  37.655 1.00 117.26 ? -54 DA  J C5    1 
ATOM   9514  C  C6    . DA  K 8  19  ? 19.233  -9.696  37.268 1.00 122.73 ? -54 DA  J C6    1 
ATOM   9515  N  N6    . DA  K 8  19  ? 19.751  -10.758 36.642 1.00 122.82 ? -54 DA  J N6    1 
ATOM   9516  N  N1    . DA  K 8  19  ? 20.034  -8.646  37.550 1.00 126.15 ? -54 DA  J N1    1 
ATOM   9517  C  C2    . DA  K 8  19  ? 19.511  -7.585  38.177 1.00 122.81 ? -54 DA  J C2    1 
ATOM   9518  N  N3    . DA  K 8  19  ? 18.259  -7.388  38.589 1.00 117.84 ? -54 DA  J N3    1 
ATOM   9519  C  C4    . DA  K 8  19  ? 17.489  -8.447  38.295 1.00 114.85 ? -54 DA  J C4    1 
ATOM   9520  P  P     . DG  K 8  20  ? 12.039  -4.538  39.332 1.00 102.03 ? -53 DG  J P     1 
ATOM   9521  O  OP1   . DG  K 8  20  ? 11.559  -3.831  40.538 1.00 99.91  ? -53 DG  J OP1   1 
ATOM   9522  O  OP2   . DG  K 8  20  ? 11.092  -5.318  38.502 1.00 105.29 ? -53 DG  J OP2   1 
ATOM   9523  O  "O5'" . DG  K 8  20  ? 12.786  -3.493  38.383 1.00 105.96 ? -53 DG  J "O5'" 1 
ATOM   9524  C  "C5'" . DG  K 8  20  ? 13.999  -2.898  38.815 1.00 108.79 ? -53 DG  J "C5'" 1 
ATOM   9525  C  "C4'" . DG  K 8  20  ? 15.003  -2.839  37.681 1.00 113.06 ? -53 DG  J "C4'" 1 
ATOM   9526  O  "O4'" . DG  K 8  20  ? 15.466  -4.166  37.371 1.00 113.77 ? -53 DG  J "O4'" 1 
ATOM   9527  C  "C3'" . DG  K 8  20  ? 14.459  -2.278  36.367 1.00 116.49 ? -53 DG  J "C3'" 1 
ATOM   9528  O  "O3'" . DG  K 8  20  ? 14.940  -0.953  36.175 1.00 118.55 ? -53 DG  J "O3'" 1 
ATOM   9529  C  "C2'" . DG  K 8  20  ? 14.982  -3.243  35.284 1.00 118.68 ? -53 DG  J "C2'" 1 
ATOM   9530  C  "C1'" . DG  K 8  20  ? 15.928  -4.161  36.050 1.00 120.46 ? -53 DG  J "C1'" 1 
ATOM   9531  N  N9    . DG  K 8  20  ? 15.936  -5.533  35.553 1.00 128.45 ? -53 DG  J N9    1 
ATOM   9532  C  C8    . DG  K 8  20  ? 14.847  -6.341  35.332 1.00 129.51 ? -53 DG  J C8    1 
ATOM   9533  N  N7    . DG  K 8  20  ? 15.161  -7.524  34.881 1.00 131.60 ? -53 DG  J N7    1 
ATOM   9534  C  C5    . DG  K 8  20  ? 16.547  -7.498  34.795 1.00 135.77 ? -53 DG  J C5    1 
ATOM   9535  C  C6    . DG  K 8  20  ? 17.452  -8.499  34.369 1.00 140.29 ? -53 DG  J C6    1 
ATOM   9536  O  O6    . DG  K 8  20  ? 17.199  -9.645  33.970 1.00 139.67 ? -53 DG  J O6    1 
ATOM   9537  N  N1    . DG  K 8  20  ? 18.773  -8.061  34.438 1.00 144.26 ? -53 DG  J N1    1 
ATOM   9538  C  C2    . DG  K 8  20  ? 19.167  -6.814  34.863 1.00 144.87 ? -53 DG  J C2    1 
ATOM   9539  N  N2    . DG  K 8  20  ? 20.487  -6.575  34.860 1.00 152.87 ? -53 DG  J N2    1 
ATOM   9540  N  N3    . DG  K 8  20  ? 18.329  -5.868  35.265 1.00 139.83 ? -53 DG  J N3    1 
ATOM   9541  C  C4    . DG  K 8  20  ? 17.039  -6.279  35.204 1.00 135.10 ? -53 DG  J C4    1 
ATOM   9542  P  P     . DG  K 8  21  ? 14.645  -0.168  34.804 1.00 117.77 ? -52 DG  J P     1 
ATOM   9543  O  OP1   . DG  K 8  21  ? 14.715  1.278   35.106 1.00 127.71 ? -52 DG  J OP1   1 
ATOM   9544  O  OP2   . DG  K 8  21  ? 13.416  -0.729  34.199 1.00 108.83 ? -52 DG  J OP2   1 
ATOM   9545  O  "O5'" . DG  K 8  21  ? 15.890  -0.553  33.875 1.00 117.19 ? -52 DG  J "O5'" 1 
ATOM   9546  C  "C5'" . DG  K 8  21  ? 17.214  -0.401  34.374 1.00 120.62 ? -52 DG  J "C5'" 1 
ATOM   9547  C  "C4'" . DG  K 8  21  ? 18.235  -0.870  33.354 1.00 125.95 ? -52 DG  J "C4'" 1 
ATOM   9548  O  "O4'" . DG  K 8  21  ? 18.285  -2.317  33.343 1.00 126.82 ? -52 DG  J "O4'" 1 
ATOM   9549  C  "C3'" . DG  K 8  21  ? 17.954  -0.435  31.912 1.00 128.54 ? -52 DG  J "C3'" 1 
ATOM   9550  O  "O3'" . DG  K 8  21  ? 19.070  0.280   31.395 1.00 130.69 ? -52 DG  J "O3'" 1 
ATOM   9551  C  "C2'" . DG  K 8  21  ? 17.723  -1.751  31.158 1.00 129.99 ? -52 DG  J "C2'" 1 
ATOM   9552  C  "C1'" . DG  K 8  21  ? 18.469  -2.754  32.022 1.00 130.85 ? -52 DG  J "C1'" 1 
ATOM   9553  N  N9    . DG  K 8  21  ? 17.953  -4.114  31.909 1.00 133.64 ? -52 DG  J N9    1 
ATOM   9554  C  C8    . DG  K 8  21  ? 16.697  -4.554  32.250 1.00 131.12 ? -52 DG  J C8    1 
ATOM   9555  N  N7    . DG  K 8  21  ? 16.517  -5.828  32.040 1.00 132.00 ? -52 DG  J N7    1 
ATOM   9556  C  C5    . DG  K 8  21  ? 17.732  -6.262  31.527 1.00 136.78 ? -52 DG  J C5    1 
ATOM   9557  C  C6    . DG  K 8  21  ? 18.137  -7.553  31.111 1.00 140.47 ? -52 DG  J C6    1 
ATOM   9558  O  O6    . DG  K 8  21  ? 17.478  -8.603  31.116 1.00 142.76 ? -52 DG  J O6    1 
ATOM   9559  N  N1    . DG  K 8  21  ? 19.453  -7.559  30.655 1.00 143.55 ? -52 DG  J N1    1 
ATOM   9560  C  C2    . DG  K 8  21  ? 20.273  -6.457  30.606 1.00 145.03 ? -52 DG  J C2    1 
ATOM   9561  N  N2    . DG  K 8  21  ? 21.512  -6.659  30.134 1.00 147.81 ? -52 DG  J N2    1 
ATOM   9562  N  N3    . DG  K 8  21  ? 19.907  -5.242  30.993 1.00 144.16 ? -52 DG  J N3    1 
ATOM   9563  C  C4    . DG  K 8  21  ? 18.627  -5.219  31.440 1.00 138.92 ? -52 DG  J C4    1 
ATOM   9564  P  P     . DC  K 8  22  ? 18.973  1.021   29.972 1.00 132.49 ? -51 DC  J P     1 
ATOM   9565  O  OP1   . DC  K 8  22  ? 19.621  2.343   30.116 1.00 138.14 ? -51 DC  J OP1   1 
ATOM   9566  O  OP2   . DC  K 8  22  ? 17.574  0.940   29.497 1.00 124.72 ? -51 DC  J OP2   1 
ATOM   9567  O  "O5'" . DC  K 8  22  ? 19.875  0.114   29.014 1.00 137.36 ? -51 DC  J "O5'" 1 
ATOM   9568  C  "C5'" . DC  K 8  22  ? 21.216  -0.183  29.382 1.00 141.85 ? -51 DC  J "C5'" 1 
ATOM   9569  C  "C4'" . DC  K 8  22  ? 21.814  -1.224  28.455 1.00 144.61 ? -51 DC  J "C4'" 1 
ATOM   9570  O  "O4'" . DC  K 8  22  ? 21.182  -2.508  28.693 1.00 140.80 ? -51 DC  J "O4'" 1 
ATOM   9571  C  "C3'" . DC  K 8  22  ? 21.646  -0.929  26.963 1.00 148.88 ? -51 DC  J "C3'" 1 
ATOM   9572  O  "O3'" . DC  K 8  22  ? 22.885  -1.103  26.292 1.00 157.71 ? -51 DC  J "O3'" 1 
ATOM   9573  C  "C2'" . DC  K 8  22  ? 20.606  -1.953  26.503 1.00 143.46 ? -51 DC  J "C2'" 1 
ATOM   9574  C  "C1'" . DC  K 8  22  ? 20.857  -3.105  27.461 1.00 140.81 ? -51 DC  J "C1'" 1 
ATOM   9575  N  N1    . DC  K 8  22  ? 19.668  -3.981  27.662 1.00 135.43 ? -51 DC  J N1    1 
ATOM   9576  C  C2    . DC  K 8  22  ? 19.749  -5.343  27.349 1.00 131.50 ? -51 DC  J C2    1 
ATOM   9577  O  O2    . DC  K 8  22  ? 20.812  -5.800  26.912 1.00 133.54 ? -51 DC  J O2    1 
ATOM   9578  N  N3    . DC  K 8  22  ? 18.657  -6.125  27.538 1.00 125.89 ? -51 DC  J N3    1 
ATOM   9579  C  C4    . DC  K 8  22  ? 17.529  -5.594  28.012 1.00 123.89 ? -51 DC  J C4    1 
ATOM   9580  N  N4    . DC  K 8  22  ? 16.479  -6.404  28.181 1.00 121.86 ? -51 DC  J N4    1 
ATOM   9581  C  C5    . DC  K 8  22  ? 17.427  -4.209  28.334 1.00 125.77 ? -51 DC  J C5    1 
ATOM   9582  C  C6    . DC  K 8  22  ? 18.509  -3.448  28.145 1.00 131.05 ? -51 DC  J C6    1 
ATOM   9583  P  P     . DC  K 8  23  ? 23.042  -0.662  24.756 1.00 163.31 ? -50 DC  J P     1 
ATOM   9584  O  OP1   . DC  K 8  23  ? 24.424  -0.170  24.569 1.00 167.19 ? -50 DC  J OP1   1 
ATOM   9585  O  OP2   . DC  K 8  23  ? 21.896  0.210   24.415 1.00 161.30 ? -50 DC  J OP2   1 
ATOM   9586  O  "O5'" . DC  K 8  23  ? 22.869  -2.031  23.950 1.00 165.23 ? -50 DC  J "O5'" 1 
ATOM   9587  C  "C5'" . DC  K 8  23  ? 23.714  -3.136  24.244 1.00 168.40 ? -50 DC  J "C5'" 1 
ATOM   9588  C  "C4'" . DC  K 8  23  ? 23.372  -4.322  23.363 1.00 170.09 ? -50 DC  J "C4'" 1 
ATOM   9589  O  "O4'" . DC  K 8  23  ? 22.216  -5.014  23.904 1.00 167.14 ? -50 DC  J "O4'" 1 
ATOM   9590  C  "C3'" . DC  K 8  23  ? 23.023  -3.966  21.916 1.00 172.20 ? -50 DC  J "C3'" 1 
ATOM   9591  O  "O3'" . DC  K 8  23  ? 23.684  -4.852  21.025 1.00 173.47 ? -50 DC  J "O3'" 1 
ATOM   9592  C  "C2'" . DC  K 8  23  ? 21.506  -4.140  21.863 1.00 169.62 ? -50 DC  J "C2'" 1 
ATOM   9593  C  "C1'" . DC  K 8  23  ? 21.288  -5.253  22.873 1.00 168.06 ? -50 DC  J "C1'" 1 
ATOM   9594  N  N1    . DC  K 8  23  ? 19.917  -5.263  23.462 1.00 166.23 ? -50 DC  J N1    1 
ATOM   9595  C  C2    . DC  K 8  23  ? 19.204  -6.465  23.538 1.00 163.05 ? -50 DC  J C2    1 
ATOM   9596  O  O2    . DC  K 8  23  ? 19.727  -7.504  23.116 1.00 164.37 ? -50 DC  J O2    1 
ATOM   9597  N  N3    . DC  K 8  23  ? 17.959  -6.456  24.075 1.00 160.37 ? -50 DC  J N3    1 
ATOM   9598  C  C4    . DC  K 8  23  ? 17.431  -5.315  24.519 1.00 158.78 ? -50 DC  J C4    1 
ATOM   9599  N  N4    . DC  K 8  23  ? 16.200  -5.355  25.040 1.00 152.99 ? -50 DC  J N4    1 
ATOM   9600  C  C5    . DC  K 8  23  ? 18.141  -4.080  24.448 1.00 162.83 ? -50 DC  J C5    1 
ATOM   9601  C  C6    . DC  K 8  23  ? 19.368  -4.101  23.917 1.00 166.26 ? -50 DC  J C6    1 
ATOM   9602  P  P     . DG  K 8  24  ? 23.875  -4.456  19.480 1.00 175.12 ? -49 DG  J P     1 
ATOM   9603  O  OP1   . DG  K 8  24  ? 25.324  -4.494  19.184 1.00 180.19 ? -49 DG  J OP1   1 
ATOM   9604  O  OP2   . DG  K 8  24  ? 23.105  -3.217  19.226 1.00 172.69 ? -49 DG  J OP2   1 
ATOM   9605  O  "O5'" . DG  K 8  24  ? 23.155  -5.647  18.696 1.00 174.39 ? -49 DG  J "O5'" 1 
ATOM   9606  C  "C5'" . DG  K 8  24  ? 23.493  -6.994  18.995 1.00 175.04 ? -49 DG  J "C5'" 1 
ATOM   9607  C  "C4'" . DG  K 8  24  ? 22.330  -7.924  18.702 1.00 175.06 ? -49 DG  J "C4'" 1 
ATOM   9608  O  "O4'" . DG  K 8  24  ? 21.205  -7.588  19.559 1.00 171.53 ? -49 DG  J "O4'" 1 
ATOM   9609  C  "C3'" . DG  K 8  24  ? 21.799  -7.866  17.269 1.00 179.28 ? -49 DG  J "C3'" 1 
ATOM   9610  O  "O3'" . DG  K 8  24  ? 21.468  -9.172  16.831 1.00 180.77 ? -49 DG  J "O3'" 1 
ATOM   9611  C  "C2'" . DG  K 8  24  ? 20.552  -6.999  17.404 1.00 176.38 ? -49 DG  J "C2'" 1 
ATOM   9612  C  "C1'" . DG  K 8  24  ? 20.049  -7.435  18.768 1.00 172.48 ? -49 DG  J "C1'" 1 
ATOM   9613  N  N9    . DG  K 8  24  ? 19.166  -6.465  19.408 1.00 172.21 ? -49 DG  J N9    1 
ATOM   9614  C  C8    . DG  K 8  24  ? 19.325  -5.101  19.449 1.00 173.49 ? -49 DG  J C8    1 
ATOM   9615  N  N7    . DG  K 8  24  ? 18.373  -4.487  20.097 1.00 171.47 ? -49 DG  J N7    1 
ATOM   9616  C  C5    . DG  K 8  24  ? 17.528  -5.509  20.510 1.00 169.22 ? -49 DG  J C5    1 
ATOM   9617  C  C6    . DG  K 8  24  ? 16.325  -5.454  21.254 1.00 166.30 ? -49 DG  J C6    1 
ATOM   9618  O  O6    . DG  K 8  24  ? 15.749  -4.456  21.710 1.00 164.83 ? -49 DG  J O6    1 
ATOM   9619  N  N1    . DG  K 8  24  ? 15.785  -6.722  21.456 1.00 164.28 ? -49 DG  J N1    1 
ATOM   9620  C  C2    . DG  K 8  24  ? 16.339  -7.895  20.996 1.00 165.15 ? -49 DG  J C2    1 
ATOM   9621  N  N2    . DG  K 8  24  ? 15.673  -9.021  21.289 1.00 162.67 ? -49 DG  J N2    1 
ATOM   9622  N  N3    . DG  K 8  24  ? 17.465  -7.960  20.299 1.00 168.49 ? -49 DG  J N3    1 
ATOM   9623  C  C4    . DG  K 8  24  ? 18.003  -6.733  20.094 1.00 170.08 ? -49 DG  J C4    1 
ATOM   9624  P  P     . DC  K 8  25  ? 21.925  -9.683  15.380 1.00 183.05 ? -48 DC  J P     1 
ATOM   9625  O  OP1   . DC  K 8  25  ? 23.323  -10.158 15.491 1.00 185.36 ? -48 DC  J OP1   1 
ATOM   9626  O  OP2   . DC  K 8  25  ? 21.578  -8.628  14.401 1.00 183.59 ? -48 DC  J OP2   1 
ATOM   9627  O  "O5'" . DC  K 8  25  ? 20.975  -10.938 15.108 1.00 182.56 ? -48 DC  J "O5'" 1 
ATOM   9628  C  "C5'" . DC  K 8  25  ? 20.859  -11.962 16.087 1.00 182.10 ? -48 DC  J "C5'" 1 
ATOM   9629  C  "C4'" . DC  K 8  25  ? 19.403  -12.323 16.319 1.00 180.69 ? -48 DC  J "C4'" 1 
ATOM   9630  O  "O4'" . DC  K 8  25  ? 18.740  -11.243 17.023 1.00 178.45 ? -48 DC  J "O4'" 1 
ATOM   9631  C  "C3'" . DC  K 8  25  ? 18.587  -12.573 15.045 1.00 182.44 ? -48 DC  J "C3'" 1 
ATOM   9632  O  "O3'" . DC  K 8  25  ? 17.977  -13.856 15.102 1.00 180.31 ? -48 DC  J "O3'" 1 
ATOM   9633  C  "C2'" . DC  K 8  25  ? 17.545  -11.449 15.039 1.00 180.58 ? -48 DC  J "C2'" 1 
ATOM   9634  C  "C1'" . DC  K 8  25  ? 17.440  -11.099 16.514 1.00 176.50 ? -48 DC  J "C1'" 1 
ATOM   9635  N  N1    . DC  K 8  25  ? 16.982  -9.701  16.764 1.00 173.62 ? -48 DC  J N1    1 
ATOM   9636  C  C2    . DC  K 8  25  ? 15.917  -9.466  17.641 1.00 170.19 ? -48 DC  J C2    1 
ATOM   9637  O  O2    . DC  K 8  25  ? 15.374  -10.426 18.201 1.00 168.64 ? -48 DC  J O2    1 
ATOM   9638  N  N3    . DC  K 8  25  ? 15.512  -8.190  17.854 1.00 167.66 ? -48 DC  J N3    1 
ATOM   9639  C  C4    . DC  K 8  25  ? 16.124  -7.181  17.231 1.00 168.01 ? -48 DC  J C4    1 
ATOM   9640  N  N4    . DC  K 8  25  ? 15.689  -5.940  17.474 1.00 166.47 ? -48 DC  J N4    1 
ATOM   9641  C  C5    . DC  K 8  25  ? 17.208  -7.401  16.332 1.00 171.57 ? -48 DC  J C5    1 
ATOM   9642  C  C6    . DC  K 8  25  ? 17.600  -8.663  16.130 1.00 173.95 ? -48 DC  J C6    1 
ATOM   9643  P  P     . DT  K 8  26  ? 17.389  -14.532 13.768 1.00 179.36 ? -47 DT  J P     1 
ATOM   9644  O  OP1   . DT  K 8  26  ? 17.826  -15.946 13.752 1.00 181.83 ? -47 DT  J OP1   1 
ATOM   9645  O  OP2   . DT  K 8  26  ? 17.719  -13.648 12.628 1.00 185.18 ? -47 DT  J OP2   1 
ATOM   9646  O  "O5'" . DT  K 8  26  ? 15.806  -14.486 13.985 1.00 170.55 ? -47 DT  J "O5'" 1 
ATOM   9647  C  "C5'" . DT  K 8  26  ? 15.234  -15.096 15.133 1.00 162.14 ? -47 DT  J "C5'" 1 
ATOM   9648  C  "C4'" . DT  K 8  26  ? 13.800  -14.640 15.335 1.00 154.26 ? -47 DT  J "C4'" 1 
ATOM   9649  O  "O4'" . DT  K 8  26  ? 13.774  -13.227 15.679 1.00 152.20 ? -47 DT  J "O4'" 1 
ATOM   9650  C  "C3'" . DT  K 8  26  ? 12.888  -14.791 14.114 1.00 151.73 ? -47 DT  J "C3'" 1 
ATOM   9651  O  "O3'" . DT  K 8  26  ? 11.613  -15.243 14.531 1.00 145.80 ? -47 DT  J "O3'" 1 
ATOM   9652  C  "C2'" . DT  K 8  26  ? 12.810  -13.365 13.577 1.00 152.62 ? -47 DT  J "C2'" 1 
ATOM   9653  C  "C1'" . DT  K 8  26  ? 12.810  -12.587 14.878 1.00 150.79 ? -47 DT  J "C1'" 1 
ATOM   9654  N  N1    . DT  K 8  26  ? 13.176  -11.150 14.729 1.00 150.97 ? -47 DT  J N1    1 
ATOM   9655  C  C2    . DT  K 8  26  ? 12.459  -10.204 15.424 1.00 147.55 ? -47 DT  J C2    1 
ATOM   9656  O  O2    . DT  K 8  26  ? 11.535  -10.480 16.167 1.00 145.20 ? -47 DT  J O2    1 
ATOM   9657  N  N3    . DT  K 8  26  ? 12.867  -8.913  15.221 1.00 147.87 ? -47 DT  J N3    1 
ATOM   9658  C  C4    . DT  K 8  26  ? 13.897  -8.482  14.407 1.00 151.54 ? -47 DT  J C4    1 
ATOM   9659  O  O4    . DT  K 8  26  ? 14.188  -7.295  14.290 1.00 153.11 ? -47 DT  J O4    1 
ATOM   9660  C  C5    . DT  K 8  26  ? 14.607  -9.524  13.703 1.00 153.96 ? -47 DT  J C5    1 
ATOM   9661  C  C7    . DT  K 8  26  ? 15.745  -9.177  12.789 1.00 157.26 ? -47 DT  J C7    1 
ATOM   9662  C  C6    . DT  K 8  26  ? 14.215  -10.794 13.895 1.00 153.94 ? -47 DT  J C6    1 
ATOM   9663  P  P     . DC  K 8  27  ? 10.928  -16.518 13.837 1.00 142.00 ? -46 DC  J P     1 
ATOM   9664  O  OP1   . DC  K 8  27  ? 11.513  -17.730 14.452 1.00 141.48 ? -46 DC  J OP1   1 
ATOM   9665  O  OP2   . DC  K 8  27  ? 10.989  -16.327 12.371 1.00 144.93 ? -46 DC  J OP2   1 
ATOM   9666  O  "O5'" . DC  K 8  27  ? 9.398   -16.403 14.285 1.00 134.15 ? -46 DC  J "O5'" 1 
ATOM   9667  C  "C5'" . DC  K 8  27  ? 9.081   -16.128 15.644 1.00 126.22 ? -46 DC  J "C5'" 1 
ATOM   9668  C  "C4'" . DC  K 8  27  ? 8.181   -14.909 15.759 1.00 118.90 ? -46 DC  J "C4'" 1 
ATOM   9669  O  "O4'" . DC  K 8  27  ? 8.864   -13.740 15.231 1.00 118.24 ? -46 DC  J "O4'" 1 
ATOM   9670  C  "C3'" . DC  K 8  27  ? 6.853   -15.007 15.000 1.00 114.69 ? -46 DC  J "C3'" 1 
ATOM   9671  O  "O3'" . DC  K 8  27  ? 5.786   -14.605 15.845 1.00 111.22 ? -46 DC  J "O3'" 1 
ATOM   9672  C  "C2'" . DC  K 8  27  ? 7.035   -14.036 13.832 1.00 114.37 ? -46 DC  J "C2'" 1 
ATOM   9673  C  "C1'" . DC  K 8  27  ? 7.959   -13.002 14.448 1.00 115.62 ? -46 DC  J "C1'" 1 
ATOM   9674  N  N1    . DC  K 8  27  ? 8.726   -12.211 13.444 1.00 119.00 ? -46 DC  J N1    1 
ATOM   9675  C  C2    . DC  K 8  27  ? 8.683   -10.812 13.489 1.00 119.04 ? -46 DC  J C2    1 
ATOM   9676  O  O2    . DC  K 8  27  ? 8.011   -10.257 14.367 1.00 118.45 ? -46 DC  J O2    1 
ATOM   9677  N  N3    . DC  K 8  27  ? 9.384   -10.105 12.568 1.00 119.38 ? -46 DC  J N3    1 
ATOM   9678  C  C4    . DC  K 8  27  ? 10.097  -10.743 11.639 1.00 123.15 ? -46 DC  J C4    1 
ATOM   9679  N  N4    . DC  K 8  27  ? 10.771  -10.004 10.752 1.00 128.57 ? -46 DC  J N4    1 
ATOM   9680  C  C5    . DC  K 8  27  ? 10.150  -12.167 11.575 1.00 123.40 ? -46 DC  J C5    1 
ATOM   9681  C  C6    . DC  K 8  27  ? 9.455   -12.854 12.488 1.00 121.01 ? -46 DC  J C6    1 
ATOM   9682  P  P     . DA  K 8  28  ? 4.336   -15.280 15.698 1.00 109.53 ? -45 DA  J P     1 
ATOM   9683  O  OP1   . DA  K 8  28  ? 4.252   -16.392 16.672 1.00 109.18 ? -45 DA  J OP1   1 
ATOM   9684  O  OP2   . DA  K 8  28  ? 4.106   -15.539 14.259 1.00 111.22 ? -45 DA  J OP2   1 
ATOM   9685  O  "O5'" . DA  K 8  28  ? 3.332   -14.122 16.150 1.00 106.47 ? -45 DA  J "O5'" 1 
ATOM   9686  C  "C5'" . DA  K 8  28  ? 3.621   -13.345 17.304 1.00 101.95 ? -45 DA  J "C5'" 1 
ATOM   9687  C  "C4'" . DA  K 8  28  ? 3.316   -11.880 17.057 1.00 95.14  ? -45 DA  J "C4'" 1 
ATOM   9688  O  "O4'" . DA  K 8  28  ? 4.182   -11.373 16.006 1.00 94.36  ? -45 DA  J "O4'" 1 
ATOM   9689  C  "C3'" . DA  K 8  28  ? 1.887   -11.587 16.607 1.00 92.53  ? -45 DA  J "C3'" 1 
ATOM   9690  O  "O3'" . DA  K 8  28  ? 1.429   -10.390 17.208 1.00 93.74  ? -45 DA  J "O3'" 1 
ATOM   9691  C  "C2'" . DA  K 8  28  ? 2.023   -11.437 15.095 1.00 93.99  ? -45 DA  J "C2'" 1 
ATOM   9692  C  "C1'" . DA  K 8  28  ? 3.405   -10.813 14.970 1.00 93.95  ? -45 DA  J "C1'" 1 
ATOM   9693  N  N9    . DA  K 8  28  ? 4.057   -11.101 13.696 1.00 95.55  ? -45 DA  J N9    1 
ATOM   9694  C  C8    . DA  K 8  28  ? 4.061   -12.292 13.025 1.00 95.89  ? -45 DA  J C8    1 
ATOM   9695  N  N7    . DA  K 8  28  ? 4.731   -12.262 11.897 1.00 100.61 ? -45 DA  J N7    1 
ATOM   9696  C  C5    . DA  K 8  28  ? 5.198   -10.960 11.822 1.00 102.90 ? -45 DA  J C5    1 
ATOM   9697  C  C6    . DA  K 8  28  ? 5.979   -10.285 10.863 1.00 104.19 ? -45 DA  J C6    1 
ATOM   9698  N  N6    . DA  K 8  28  ? 6.441   -10.865 9.751  1.00 105.47 ? -45 DA  J N6    1 
ATOM   9699  N  N1    . DA  K 8  28  ? 6.267   -8.987  11.093 1.00 105.30 ? -45 DA  J N1    1 
ATOM   9700  C  C2    . DA  K 8  28  ? 5.802   -8.410  12.208 1.00 104.01 ? -45 DA  J C2    1 
ATOM   9701  N  N3    . DA  K 8  28  ? 5.061   -8.940  13.180 1.00 103.31 ? -45 DA  J N3    1 
ATOM   9702  C  C4    . DA  K 8  28  ? 4.791   -10.230 12.924 1.00 101.86 ? -45 DA  J C4    1 
ATOM   9703  P  P     . DA  K 8  29  ? -0.145  -10.112 17.364 1.00 97.61  ? -44 DA  J P     1 
ATOM   9704  O  OP1   . DA  K 8  29  ? -0.475  -10.203 18.804 1.00 95.02  ? -44 DA  J OP1   1 
ATOM   9705  O  OP2   . DA  K 8  29  ? -0.862  -10.962 16.387 1.00 96.89  ? -44 DA  J OP2   1 
ATOM   9706  O  "O5'" . DA  K 8  29  ? -0.303  -8.592  16.896 1.00 104.40 ? -44 DA  J "O5'" 1 
ATOM   9707  C  "C5'" . DA  K 8  29  ? 0.523   -7.590  17.471 1.00 105.16 ? -44 DA  J "C5'" 1 
ATOM   9708  C  "C4'" . DA  K 8  29  ? 0.860   -6.521  16.451 1.00 106.67 ? -44 DA  J "C4'" 1 
ATOM   9709  O  "O4'" . DA  K 8  29  ? 1.644   -7.103  15.379 1.00 110.55 ? -44 DA  J "O4'" 1 
ATOM   9710  C  "C3'" . DA  K 8  29  ? -0.351  -5.856  15.791 1.00 106.62 ? -44 DA  J "C3'" 1 
ATOM   9711  O  "O3'" . DA  K 8  29  ? -0.244  -4.444  15.897 1.00 104.84 ? -44 DA  J "O3'" 1 
ATOM   9712  C  "C2'" . DA  K 8  29  ? -0.286  -6.323  14.333 1.00 111.13 ? -44 DA  J "C2'" 1 
ATOM   9713  C  "C1'" . DA  K 8  29  ? 1.197   -6.595  14.148 1.00 115.03 ? -44 DA  J "C1'" 1 
ATOM   9714  N  N9    . DA  K 8  29  ? 1.477   -7.585  13.112 1.00 121.73 ? -44 DA  J N9    1 
ATOM   9715  C  C8    . DA  K 8  29  ? 1.016   -8.870  13.055 1.00 122.88 ? -44 DA  J C8    1 
ATOM   9716  N  N7    . DA  K 8  29  ? 1.429   -9.536  12.003 1.00 125.18 ? -44 DA  J N7    1 
ATOM   9717  C  C5    . DA  K 8  29  ? 2.217   -8.624  11.321 1.00 128.84 ? -44 DA  J C5    1 
ATOM   9718  C  C6    . DA  K 8  29  ? 2.948   -8.713  10.121 1.00 134.35 ? -44 DA  J C6    1 
ATOM   9719  N  N6    . DA  K 8  29  ? 3.000   -9.819  9.371  1.00 137.45 ? -44 DA  J N6    1 
ATOM   9720  N  N1    . DA  K 8  29  ? 3.626   -7.618  9.719  1.00 136.58 ? -44 DA  J N1    1 
ATOM   9721  C  C2    . DA  K 8  29  ? 3.571   -6.512  10.472 1.00 134.91 ? -44 DA  J C2    1 
ATOM   9722  N  N3    . DA  K 8  29  ? 2.921   -6.310  11.617 1.00 131.57 ? -44 DA  J N3    1 
ATOM   9723  C  C4    . DA  K 8  29  ? 2.257   -7.415  11.990 1.00 127.81 ? -44 DA  J C4    1 
ATOM   9724  P  P     . DT  K 8  30  ? -1.502  -3.505  15.554 1.00 102.16 ? -43 DT  J P     1 
ATOM   9725  O  OP1   . DT  K 8  30  ? -1.639  -2.530  16.658 1.00 98.63  ? -43 DT  J OP1   1 
ATOM   9726  O  OP2   . DT  K 8  30  ? -2.648  -4.370  15.200 1.00 102.38 ? -43 DT  J OP2   1 
ATOM   9727  O  "O5'" . DT  K 8  30  ? -1.041  -2.738  14.230 1.00 108.53 ? -43 DT  J "O5'" 1 
ATOM   9728  C  "C5'" . DT  K 8  30  ? 0.232   -2.105  14.190 1.00 110.88 ? -43 DT  J "C5'" 1 
ATOM   9729  C  "C4'" . DT  K 8  30  ? 0.633   -1.780  12.762 1.00 112.45 ? -43 DT  J "C4'" 1 
ATOM   9730  O  "O4'" . DT  K 8  30  ? 0.980   -2.997  12.060 1.00 109.91 ? -43 DT  J "O4'" 1 
ATOM   9731  C  "C3'" . DT  K 8  30  ? -0.453  -1.094  11.924 1.00 115.36 ? -43 DT  J "C3'" 1 
ATOM   9732  O  "O3'" . DT  K 8  30  ? 0.019   0.161   11.452 1.00 122.58 ? -43 DT  J "O3'" 1 
ATOM   9733  C  "C2'" . DT  K 8  30  ? -0.715  -2.072  10.770 1.00 114.21 ? -43 DT  J "C2'" 1 
ATOM   9734  C  "C1'" . DT  K 8  30  ? 0.578   -2.870  10.723 1.00 112.33 ? -43 DT  J "C1'" 1 
ATOM   9735  N  N1    . DT  K 8  30  ? 0.420   -4.234  10.139 1.00 111.82 ? -43 DT  J N1    1 
ATOM   9736  C  C2    . DT  K 8  30  ? 1.151   -4.577  9.024  1.00 116.33 ? -43 DT  J C2    1 
ATOM   9737  O  O2    . DT  K 8  30  ? 1.935   -3.820  8.481  1.00 120.42 ? -43 DT  J O2    1 
ATOM   9738  N  N3    . DT  K 8  30  ? 0.932   -5.848  8.565  1.00 116.46 ? -43 DT  J N3    1 
ATOM   9739  C  C4    . DT  K 8  30  ? 0.071   -6.792  9.095  1.00 115.55 ? -43 DT  J C4    1 
ATOM   9740  O  O4    . DT  K 8  30  ? -0.057  -7.911  8.608  1.00 120.57 ? -43 DT  J O4    1 
ATOM   9741  C  C5    . DT  K 8  30  ? -0.668  -6.368  10.261 1.00 109.73 ? -43 DT  J C5    1 
ATOM   9742  C  C7    . DT  K 8  30  ? -1.633  -7.306  10.925 1.00 105.44 ? -43 DT  J C7    1 
ATOM   9743  C  C6    . DT  K 8  30  ? -0.460  -5.123  10.721 1.00 108.90 ? -43 DT  J C6    1 
ATOM   9744  P  P     . DT  K 8  31  ? -1.011  1.246   10.867 1.00 124.93 ? -42 DT  J P     1 
ATOM   9745  O  OP1   . DT  K 8  31  ? -0.464  2.588   11.167 1.00 121.24 ? -42 DT  J OP1   1 
ATOM   9746  O  OP2   . DT  K 8  31  ? -2.366  0.882   11.336 1.00 123.90 ? -42 DT  J OP2   1 
ATOM   9747  O  "O5'" . DT  K 8  31  ? -0.959  1.007   9.287  1.00 132.58 ? -42 DT  J "O5'" 1 
ATOM   9748  C  "C5'" . DT  K 8  31  ? 0.255   1.223   8.578  1.00 140.40 ? -42 DT  J "C5'" 1 
ATOM   9749  C  "C4'" . DT  K 8  31  ? 0.174   0.643   7.178  1.00 147.23 ? -42 DT  J "C4'" 1 
ATOM   9750  O  "O4'" . DT  K 8  31  ? 0.102   -0.795  7.256  1.00 146.59 ? -42 DT  J "O4'" 1 
ATOM   9751  C  "C3'" . DT  K 8  31  ? -1.047  1.085   6.365  1.00 151.47 ? -42 DT  J "C3'" 1 
ATOM   9752  O  "O3'" . DT  K 8  31  ? -0.635  1.904   5.275  1.00 158.07 ? -42 DT  J "O3'" 1 
ATOM   9753  C  "C2'" . DT  K 8  31  ? -1.693  -0.225  5.880  1.00 150.89 ? -42 DT  J "C2'" 1 
ATOM   9754  C  "C1'" . DT  K 8  31  ? -0.612  -1.266  6.147  1.00 151.31 ? -42 DT  J "C1'" 1 
ATOM   9755  N  N1    . DT  K 8  31  ? -1.154  -2.615  6.475  1.00 153.81 ? -42 DT  J N1    1 
ATOM   9756  C  C2    . DT  K 8  31  ? -0.770  -3.698  5.720  1.00 156.73 ? -42 DT  J C2    1 
ATOM   9757  O  O2    . DT  K 8  31  ? 0.003   -3.618  4.782  1.00 160.09 ? -42 DT  J O2    1 
ATOM   9758  N  N3    . DT  K 8  31  ? -1.324  -4.890  6.104  1.00 156.20 ? -42 DT  J N3    1 
ATOM   9759  C  C4    . DT  K 8  31  ? -2.207  -5.103  7.147  1.00 155.39 ? -42 DT  J C4    1 
ATOM   9760  O  O4    . DT  K 8  31  ? -2.652  -6.215  7.414  1.00 157.45 ? -42 DT  J O4    1 
ATOM   9761  C  C5    . DT  K 8  31  ? -2.571  -3.925  7.899  1.00 152.61 ? -42 DT  J C5    1 
ATOM   9762  C  C7    . DT  K 8  31  ? -3.523  -4.030  9.053  1.00 148.91 ? -42 DT  J C7    1 
ATOM   9763  C  C6    . DT  K 8  31  ? -2.033  -2.752  7.530  1.00 153.28 ? -42 DT  J C6    1 
ATOM   9764  P  P     . DG  K 8  32  ? -1.694  2.864   4.540  1.00 161.30 ? -41 DG  J P     1 
ATOM   9765  O  OP1   . DG  K 8  32  ? -0.942  3.996   3.955  1.00 164.39 ? -41 DG  J OP1   1 
ATOM   9766  O  OP2   . DG  K 8  32  ? -2.798  3.127   5.490  1.00 156.86 ? -41 DG  J OP2   1 
ATOM   9767  O  "O5'" . DG  K 8  32  ? -2.273  1.957   3.356  1.00 166.92 ? -41 DG  J "O5'" 1 
ATOM   9768  C  "C5'" . DG  K 8  32  ? -1.392  1.430   2.371  1.00 174.54 ? -41 DG  J "C5'" 1 
ATOM   9769  C  "C4'" . DG  K 8  32  ? -2.087  0.375   1.529  1.00 180.43 ? -41 DG  J "C4'" 1 
ATOM   9770  O  "O4'" . DG  K 8  32  ? -2.297  -0.821  2.320  1.00 179.29 ? -41 DG  J "O4'" 1 
ATOM   9771  C  "C3'" . DG  K 8  32  ? -3.463  0.780   0.985  1.00 184.71 ? -41 DG  J "C3'" 1 
ATOM   9772  O  "O3'" . DG  K 8  32  ? -3.509  0.582   -0.422 1.00 191.41 ? -41 DG  J "O3'" 1 
ATOM   9773  C  "C2'" . DG  K 8  32  ? -4.440  -0.145  1.717  1.00 182.10 ? -41 DG  J "C2'" 1 
ATOM   9774  C  "C1'" . DG  K 8  32  ? -3.566  -1.348  2.027  1.00 180.59 ? -41 DG  J "C1'" 1 
ATOM   9775  N  N9    . DG  K 8  32  ? -4.028  -2.118  3.179  1.00 177.43 ? -41 DG  J N9    1 
ATOM   9776  C  C8    . DG  K 8  32  ? -4.523  -1.622  4.360  1.00 174.41 ? -41 DG  J C8    1 
ATOM   9777  N  N7    . DG  K 8  32  ? -4.862  -2.549  5.212  1.00 172.30 ? -41 DG  J N7    1 
ATOM   9778  C  C5    . DG  K 8  32  ? -4.574  -3.738  4.554  1.00 173.96 ? -41 DG  J C5    1 
ATOM   9779  C  C6    . DG  K 8  32  ? -4.731  -5.078  4.981  1.00 172.90 ? -41 DG  J C6    1 
ATOM   9780  O  O6    . DG  K 8  32  ? -5.172  -5.492  6.062  1.00 169.59 ? -41 DG  J O6    1 
ATOM   9781  N  N1    . DG  K 8  32  ? -4.316  -5.981  4.006  1.00 176.62 ? -41 DG  J N1    1 
ATOM   9782  C  C2    . DG  K 8  32  ? -3.813  -5.634  2.774  1.00 179.27 ? -41 DG  J C2    1 
ATOM   9783  N  N2    . DG  K 8  32  ? -3.466  -6.647  1.967  1.00 180.65 ? -41 DG  J N2    1 
ATOM   9784  N  N3    . DG  K 8  32  ? -3.660  -4.382  2.362  1.00 180.04 ? -41 DG  J N3    1 
ATOM   9785  C  C4    . DG  K 8  32  ? -4.060  -3.490  3.300  1.00 177.10 ? -41 DG  J C4    1 
ATOM   9786  P  P     . DG  K 8  33  ? -4.730  1.174   -1.283 1.00 197.51 ? -40 DG  J P     1 
ATOM   9787  O  OP1   . DG  K 8  33  ? -4.160  1.763   -2.515 1.00 204.56 ? -40 DG  J OP1   1 
ATOM   9788  O  OP2   . DG  K 8  33  ? -5.560  2.009   -0.386 1.00 194.70 ? -40 DG  J OP2   1 
ATOM   9789  O  "O5'" . DG  K 8  33  ? -5.582  -0.122  -1.680 1.00 200.28 ? -40 DG  J "O5'" 1 
ATOM   9790  C  "C5'" . DG  K 8  33  ? -5.020  -1.097  -2.548 1.00 204.68 ? -40 DG  J "C5'" 1 
ATOM   9791  C  "C4'" . DG  K 8  33  ? -5.909  -2.325  -2.639 1.00 203.67 ? -40 DG  J "C4'" 1 
ATOM   9792  O  "O4'" . DG  K 8  33  ? -5.916  -3.019  -1.369 1.00 199.42 ? -40 DG  J "O4'" 1 
ATOM   9793  C  "C3'" . DG  K 8  33  ? -7.377  -2.045  -2.988 1.00 204.82 ? -40 DG  J "C3'" 1 
ATOM   9794  O  "O3'" . DG  K 8  33  ? -7.746  -2.790  -4.143 1.00 209.12 ? -40 DG  J "O3'" 1 
ATOM   9795  C  "C2'" . DG  K 8  33  ? -8.149  -2.506  -1.744 1.00 200.02 ? -40 DG  J "C2'" 1 
ATOM   9796  C  "C1'" . DG  K 8  33  ? -7.203  -3.527  -1.140 1.00 199.09 ? -40 DG  J "C1'" 1 
ATOM   9797  N  N9    . DG  K 8  33  ? -7.383  -3.710  0.297  1.00 197.71 ? -40 DG  J N9    1 
ATOM   9798  C  C8    . DG  K 8  33  ? -7.460  -2.726  1.253  1.00 196.05 ? -40 DG  J C8    1 
ATOM   9799  N  N7    . DG  K 8  33  ? -7.625  -3.188  2.461  1.00 192.96 ? -40 DG  J N7    1 
ATOM   9800  C  C5    . DG  K 8  33  ? -7.659  -4.566  2.297  1.00 193.36 ? -40 DG  J C5    1 
ATOM   9801  C  C6    . DG  K 8  33  ? -7.816  -5.595  3.256  1.00 190.68 ? -40 DG  J C6    1 
ATOM   9802  O  O6    . DG  K 8  33  ? -7.960  -5.487  4.482  1.00 187.25 ? -40 DG  J O6    1 
ATOM   9803  N  N1    . DG  K 8  33  ? -7.794  -6.857  2.666  1.00 192.10 ? -40 DG  J N1    1 
ATOM   9804  C  C2    . DG  K 8  33  ? -7.641  -7.094  1.320  1.00 195.43 ? -40 DG  J C2    1 
ATOM   9805  N  N2    . DG  K 8  33  ? -7.645  -8.380  0.939  1.00 195.17 ? -40 DG  J N2    1 
ATOM   9806  N  N3    . DG  K 8  33  ? -7.493  -6.139  0.411  1.00 198.62 ? -40 DG  J N3    1 
ATOM   9807  C  C4    . DG  K 8  33  ? -7.512  -4.904  0.970  1.00 196.85 ? -40 DG  J C4    1 
ATOM   9808  P  P     . DT  K 8  34  ? -9.182  -2.580  -4.836 1.00 210.48 ? -39 DT  J P     1 
ATOM   9809  O  OP1   . DT  K 8  34  ? -8.947  -2.397  -6.285 1.00 214.68 ? -39 DT  J OP1   1 
ATOM   9810  O  OP2   . DT  K 8  34  ? -9.936  -1.551  -4.085 1.00 207.62 ? -39 DT  J OP2   1 
ATOM   9811  O  "O5'" . DT  K 8  34  ? -9.910  -3.985  -4.618 1.00 209.17 ? -39 DT  J "O5'" 1 
ATOM   9812  C  "C5'" . DT  K 8  34  ? -9.265  -5.182  -5.034 1.00 209.23 ? -39 DT  J "C5'" 1 
ATOM   9813  C  "C4'" . DT  K 8  34  ? -9.986  -6.402  -4.493 1.00 204.53 ? -39 DT  J "C4'" 1 
ATOM   9814  O  "O4'" . DT  K 8  34  ? -9.845  -6.452  -3.049 1.00 198.71 ? -39 DT  J "O4'" 1 
ATOM   9815  C  "C3'" . DT  K 8  34  ? -11.488 -6.444  -4.781 1.00 204.50 ? -39 DT  J "C3'" 1 
ATOM   9816  O  "O3'" . DT  K 8  34  ? -11.858 -7.744  -5.205 1.00 206.84 ? -39 DT  J "O3'" 1 
ATOM   9817  C  "C2'" . DT  K 8  34  ? -12.116 -6.093  -3.432 1.00 198.84 ? -39 DT  J "C2'" 1 
ATOM   9818  C  "C1'" . DT  K 8  34  ? -11.105 -6.683  -2.465 1.00 195.76 ? -39 DT  J "C1'" 1 
ATOM   9819  N  N1    . DT  K 8  34  ? -11.127 -6.045  -1.118 1.00 190.82 ? -39 DT  J N1    1 
ATOM   9820  C  C2    . DT  K 8  34  ? -11.048 -6.839  0.003  1.00 184.98 ? -39 DT  J C2    1 
ATOM   9821  O  O2    . DT  K 8  34  ? -10.958 -8.053  -0.042 1.00 183.17 ? -39 DT  J O2    1 
ATOM   9822  N  N3    . DT  K 8  34  ? -11.078 -6.156  1.190  1.00 180.35 ? -39 DT  J N3    1 
ATOM   9823  C  C4    . DT  K 8  34  ? -11.177 -4.788  1.365  1.00 177.98 ? -39 DT  J C4    1 
ATOM   9824  O  O4    . DT  K 8  34  ? -11.196 -4.267  2.476  1.00 171.48 ? -39 DT  J O4    1 
ATOM   9825  C  C5    . DT  K 8  34  ? -11.257 -4.014  0.148  1.00 184.45 ? -39 DT  J C5    1 
ATOM   9826  C  C7    . DT  K 8  34  ? -11.368 -2.520  0.211  1.00 184.99 ? -39 DT  J C7    1 
ATOM   9827  C  C6    . DT  K 8  34  ? -11.229 -4.673  -1.020 1.00 190.08 ? -39 DT  J C6    1 
ATOM   9828  P  P     . DC  K 8  35  ? -13.189 -7.966  -6.077 1.00 211.30 ? -38 DC  J P     1 
ATOM   9829  O  OP1   . DC  K 8  35  ? -12.779 -8.480  -7.403 1.00 220.02 ? -38 DC  J OP1   1 
ATOM   9830  O  OP2   . DC  K 8  35  ? -14.008 -6.737  -5.984 1.00 213.62 ? -38 DC  J OP2   1 
ATOM   9831  O  "O5'" . DC  K 8  35  ? -13.959 -9.122  -5.292 1.00 204.98 ? -38 DC  J "O5'" 1 
ATOM   9832  C  "C5'" . DC  K 8  35  ? -13.227 -10.206 -4.738 1.00 199.31 ? -38 DC  J "C5'" 1 
ATOM   9833  C  "C4'" . DC  K 8  35  ? -13.896 -10.707 -3.475 1.00 189.74 ? -38 DC  J "C4'" 1 
ATOM   9834  O  "O4'" . DC  K 8  35  ? -13.658 -9.771  -2.396 1.00 187.19 ? -38 DC  J "O4'" 1 
ATOM   9835  C  "C3'" . DC  K 8  35  ? -15.415 -10.869 -3.581 1.00 184.26 ? -38 DC  J "C3'" 1 
ATOM   9836  O  "O3'" . DC  K 8  35  ? -15.785 -12.196 -3.250 1.00 178.35 ? -38 DC  J "O3'" 1 
ATOM   9837  C  "C2'" . DC  K 8  35  ? -15.979 -9.854  -2.580 1.00 183.19 ? -38 DC  J "C2'" 1 
ATOM   9838  C  "C1'" . DC  K 8  35  ? -14.819 -9.660  -1.616 1.00 184.12 ? -38 DC  J "C1'" 1 
ATOM   9839  N  N1    . DC  K 8  35  ? -14.817 -8.323  -0.954 1.00 185.33 ? -38 DC  J N1    1 
ATOM   9840  C  C2    . DC  K 8  35  ? -14.636 -8.233  0.432  1.00 182.31 ? -38 DC  J C2    1 
ATOM   9841  O  O2    . DC  K 8  35  ? -14.478 -9.270  1.088  1.00 180.57 ? -38 DC  J O2    1 
ATOM   9842  N  N3    . DC  K 8  35  ? -14.637 -7.009  1.016  1.00 181.20 ? -38 DC  J N3    1 
ATOM   9843  C  C4    . DC  K 8  35  ? -14.810 -5.914  0.273  1.00 183.19 ? -38 DC  J C4    1 
ATOM   9844  N  N4    . DC  K 8  35  ? -14.804 -4.730  0.894  1.00 180.78 ? -38 DC  J N4    1 
ATOM   9845  C  C5    . DC  K 8  35  ? -14.998 -5.985  -1.139 1.00 187.81 ? -38 DC  J C5    1 
ATOM   9846  C  C6    . DC  K 8  35  ? -14.995 -7.197  -1.704 1.00 189.06 ? -38 DC  J C6    1 
ATOM   9847  P  P     . DG  K 8  36  ? -17.209 -12.775 -3.718 1.00 175.62 ? -37 DG  J P     1 
ATOM   9848  O  OP1   . DG  K 8  36  ? -16.993 -14.149 -4.224 1.00 177.91 ? -37 DG  J OP1   1 
ATOM   9849  O  OP2   . DG  K 8  36  ? -17.845 -11.758 -4.585 1.00 175.28 ? -37 DG  J OP2   1 
ATOM   9850  O  "O5'" . DG  K 8  36  ? -18.047 -12.850 -2.361 1.00 169.77 ? -37 DG  J "O5'" 1 
ATOM   9851  C  "C5'" . DG  K 8  36  ? -17.502 -13.519 -1.232 1.00 161.12 ? -37 DG  J "C5'" 1 
ATOM   9852  C  "C4'" . DG  K 8  36  ? -18.227 -13.114 0.038  1.00 150.44 ? -37 DG  J "C4'" 1 
ATOM   9853  O  "O4'" . DG  K 8  36  ? -17.868 -11.751 0.395  1.00 147.43 ? -37 DG  J "O4'" 1 
ATOM   9854  C  "C3'" . DG  K 8  36  ? -19.754 -13.137 -0.052 1.00 147.75 ? -37 DG  J "C3'" 1 
ATOM   9855  O  "O3'" . DG  K 8  36  ? -20.288 -13.639 1.154  1.00 143.48 ? -37 DG  J "O3'" 1 
ATOM   9856  C  "C2'" . DG  K 8  36  ? -20.104 -11.663 -0.234 1.00 148.46 ? -37 DG  J "C2'" 1 
ATOM   9857  C  "C1'" . DG  K 8  36  ? -19.044 -11.015 0.637  1.00 145.78 ? -37 DG  J "C1'" 1 
ATOM   9858  N  N9    . DG  K 8  36  ? -18.795 -9.613  0.320  1.00 145.32 ? -37 DG  J N9    1 
ATOM   9859  C  C8    . DG  K 8  36  ? -18.812 -9.027  -0.923 1.00 148.29 ? -37 DG  J C8    1 
ATOM   9860  N  N7    . DG  K 8  36  ? -18.550 -7.749  -0.897 1.00 149.12 ? -37 DG  J N7    1 
ATOM   9861  C  C5    . DG  K 8  36  ? -18.348 -7.471  0.450  1.00 145.69 ? -37 DG  J C5    1 
ATOM   9862  C  C6    . DG  K 8  36  ? -18.031 -6.250  1.091  1.00 143.92 ? -37 DG  J C6    1 
ATOM   9863  O  O6    . DG  K 8  36  ? -17.862 -5.135  0.580  1.00 147.44 ? -37 DG  J O6    1 
ATOM   9864  N  N1    . DG  K 8  36  ? -17.915 -6.409  2.471  1.00 137.75 ? -37 DG  J N1    1 
ATOM   9865  C  C2    . DG  K 8  36  ? -18.083 -7.596  3.143  1.00 133.68 ? -37 DG  J C2    1 
ATOM   9866  N  N2    . DG  K 8  36  ? -17.930 -7.552  4.474  1.00 129.51 ? -37 DG  J N2    1 
ATOM   9867  N  N3    . DG  K 8  36  ? -18.379 -8.746  2.553  1.00 136.03 ? -37 DG  J N3    1 
ATOM   9868  C  C4    . DG  K 8  36  ? -18.496 -8.608  1.210  1.00 142.34 ? -37 DG  J C4    1 
ATOM   9869  P  P     . DT  K 8  37  ? -21.359 -14.834 1.139  1.00 141.56 ? -36 DT  J P     1 
ATOM   9870  O  OP1   . DT  K 8  37  ? -20.612 -16.103 0.994  1.00 140.77 ? -36 DT  J OP1   1 
ATOM   9871  O  OP2   . DT  K 8  37  ? -22.419 -14.483 0.168  1.00 144.39 ? -36 DT  J OP2   1 
ATOM   9872  O  "O5'" . DT  K 8  37  ? -21.992 -14.775 2.606  1.00 135.24 ? -36 DT  J "O5'" 1 
ATOM   9873  C  "C5'" . DT  K 8  37  ? -21.137 -14.623 3.733  1.00 126.91 ? -36 DT  J "C5'" 1 
ATOM   9874  C  "C4'" . DT  K 8  37  ? -21.603 -13.483 4.623  1.00 120.81 ? -36 DT  J "C4'" 1 
ATOM   9875  O  "O4'" . DT  K 8  37  ? -21.250 -12.204 4.027  1.00 120.58 ? -36 DT  J "O4'" 1 
ATOM   9876  C  "C3'" . DT  K 8  37  ? -23.115 -13.428 4.877  1.00 118.85 ? -36 DT  J "C3'" 1 
ATOM   9877  O  "O3'" . DT  K 8  37  ? -23.356 -13.221 6.258  1.00 117.87 ? -36 DT  J "O3'" 1 
ATOM   9878  C  "C2'" . DT  K 8  37  ? -23.558 -12.217 4.057  1.00 119.38 ? -36 DT  J "C2'" 1 
ATOM   9879  C  "C1'" . DT  K 8  37  ? -22.337 -11.331 4.198  1.00 121.02 ? -36 DT  J "C1'" 1 
ATOM   9880  N  N1    . DT  K 8  37  ? -22.258 -10.231 3.191  1.00 127.69 ? -36 DT  J N1    1 
ATOM   9881  C  C2    . DT  K 8  37  ? -21.701 -9.026  3.557  1.00 129.68 ? -36 DT  J C2    1 
ATOM   9882  O  O2    . DT  K 8  37  ? -21.251 -8.809  4.668  1.00 130.51 ? -36 DT  J O2    1 
ATOM   9883  N  N3    . DT  K 8  37  ? -21.681 -8.080  2.568  1.00 131.70 ? -36 DT  J N3    1 
ATOM   9884  C  C4    . DT  K 8  37  ? -22.157 -8.211  1.278  1.00 136.36 ? -36 DT  J C4    1 
ATOM   9885  O  O4    . DT  K 8  37  ? -22.094 -7.298  0.459  1.00 140.28 ? -36 DT  J O4    1 
ATOM   9886  C  C5    . DT  K 8  37  ? -22.735 -9.496  0.960  1.00 136.49 ? -36 DT  J C5    1 
ATOM   9887  C  C7    . DT  K 8  37  ? -23.286 -9.756  -0.411 1.00 140.73 ? -36 DT  J C7    1 
ATOM   9888  C  C6    . DT  K 8  37  ? -22.760 -10.432 1.922  1.00 132.17 ? -36 DT  J C6    1 
ATOM   9889  P  P     . DA  K 8  38  ? -24.003 -14.384 7.156  1.00 115.03 ? -35 DA  J P     1 
ATOM   9890  O  OP1   . DA  K 8  38  ? -23.110 -15.562 7.075  1.00 113.39 ? -35 DA  J OP1   1 
ATOM   9891  O  OP2   . DA  K 8  38  ? -25.427 -14.509 6.772  1.00 115.60 ? -35 DA  J OP2   1 
ATOM   9892  O  "O5'" . DA  K 8  38  ? -23.944 -13.790 8.640  1.00 115.37 ? -35 DA  J "O5'" 1 
ATOM   9893  C  "C5'" . DA  K 8  38  ? -22.690 -13.417 9.205  1.00 112.71 ? -35 DA  J "C5'" 1 
ATOM   9894  C  "C4'" . DA  K 8  38  ? -22.694 -11.957 9.631  1.00 105.96 ? -35 DA  J "C4'" 1 
ATOM   9895  O  "O4'" . DA  K 8  38  ? -22.821 -11.106 8.461  1.00 105.77 ? -35 DA  J "O4'" 1 
ATOM   9896  C  "C3'" . DA  K 8  38  ? -23.827 -11.556 10.576 1.00 100.97 ? -35 DA  J "C3'" 1 
ATOM   9897  O  "O3'" . DA  K 8  38  ? -23.332 -10.674 11.575 1.00 99.19  ? -35 DA  J "O3'" 1 
ATOM   9898  C  "C2'" . DA  K 8  38  ? -24.820 -10.856 9.652  1.00 101.26 ? -35 DA  J "C2'" 1 
ATOM   9899  C  "C1'" . DA  K 8  38  ? -23.887 -10.201 8.646  1.00 105.07 ? -35 DA  J "C1'" 1 
ATOM   9900  N  N9    . DA  K 8  38  ? -24.508 -9.956  7.348  1.00 110.83 ? -35 DA  J N9    1 
ATOM   9901  C  C8    . DA  K 8  38  ? -25.355 -10.788 6.670  1.00 113.01 ? -35 DA  J C8    1 
ATOM   9902  N  N7    . DA  K 8  38  ? -25.757 -10.309 5.516  1.00 118.47 ? -35 DA  J N7    1 
ATOM   9903  C  C5    . DA  K 8  38  ? -25.125 -9.079  5.429  1.00 120.22 ? -35 DA  J C5    1 
ATOM   9904  C  C6    . DA  K 8  38  ? -25.139 -8.073  4.442  1.00 120.34 ? -35 DA  J C6    1 
ATOM   9905  N  N6    . DA  K 8  38  ? -25.843 -8.164  3.309  1.00 120.95 ? -35 DA  J N6    1 
ATOM   9906  N  N1    . DA  K 8  38  ? -24.400 -6.967  4.668  1.00 119.39 ? -35 DA  J N1    1 
ATOM   9907  C  C2    . DA  K 8  38  ? -23.698 -6.881  5.804  1.00 118.07 ? -35 DA  J C2    1 
ATOM   9908  N  N3    . DA  K 8  38  ? -23.607 -7.758  6.803  1.00 117.86 ? -35 DA  J N3    1 
ATOM   9909  C  C4    . DA  K 8  38  ? -24.352 -8.846  6.550  1.00 117.10 ? -35 DA  J C4    1 
ATOM   9910  P  P     . DG  K 8  39  ? -24.197 -10.375 12.896 1.00 100.16 ? -34 DG  J P     1 
ATOM   9911  O  OP1   . DG  K 8  39  ? -23.280 -10.422 14.057 1.00 99.26  ? -34 DG  J OP1   1 
ATOM   9912  O  OP2   . DG  K 8  39  ? -25.392 -11.247 12.863 1.00 105.52 ? -34 DG  J OP2   1 
ATOM   9913  O  "O5'" . DG  K 8  39  ? -24.690 -8.871  12.694 1.00 103.05 ? -34 DG  J "O5'" 1 
ATOM   9914  C  "C5'" . DG  K 8  39  ? -23.741 -7.836  12.480 1.00 104.53 ? -34 DG  J "C5'" 1 
ATOM   9915  C  "C4'" . DG  K 8  39  ? -24.429 -6.566  12.016 1.00 105.67 ? -34 DG  J "C4'" 1 
ATOM   9916  O  "O4'" . DG  K 8  39  ? -24.881 -6.732  10.646 1.00 106.12 ? -34 DG  J "O4'" 1 
ATOM   9917  C  "C3'" . DG  K 8  39  ? -25.667 -6.173  12.826 1.00 109.21 ? -34 DG  J "C3'" 1 
ATOM   9918  O  "O3'" . DG  K 8  39  ? -25.696 -4.767  13.011 1.00 119.59 ? -34 DG  J "O3'" 1 
ATOM   9919  C  "C2'" . DG  K 8  39  ? -26.819 -6.640  11.942 1.00 104.30 ? -34 DG  J "C2'" 1 
ATOM   9920  C  "C1'" . DG  K 8  39  ? -26.244 -6.387  10.559 1.00 106.40 ? -34 DG  J "C1'" 1 
ATOM   9921  N  N9    . DG  K 8  39  ? -26.865 -7.192  9.512  1.00 107.57 ? -34 DG  J N9    1 
ATOM   9922  C  C8    . DG  K 8  39  ? -27.385 -8.457  9.637  1.00 107.37 ? -34 DG  J C8    1 
ATOM   9923  N  N7    . DG  K 8  39  ? -27.880 -8.926  8.525  1.00 110.95 ? -34 DG  J N7    1 
ATOM   9924  C  C5    . DG  K 8  39  ? -27.675 -7.906  7.604  1.00 113.05 ? -34 DG  J C5    1 
ATOM   9925  C  C6    . DG  K 8  39  ? -28.005 -7.837  6.230  1.00 117.09 ? -34 DG  J C6    1 
ATOM   9926  O  O6    . DG  K 8  39  ? -28.560 -8.695  5.530  1.00 119.90 ? -34 DG  J O6    1 
ATOM   9927  N  N1    . DG  K 8  39  ? -27.620 -6.621  5.669  1.00 117.13 ? -34 DG  J N1    1 
ATOM   9928  C  C2    . DG  K 8  39  ? -26.997 -5.602  6.349  1.00 113.77 ? -34 DG  J C2    1 
ATOM   9929  N  N2    . DG  K 8  39  ? -26.704 -4.505  5.638  1.00 116.17 ? -34 DG  J N2    1 
ATOM   9930  N  N3    . DG  K 8  39  ? -26.684 -5.654  7.637  1.00 110.91 ? -34 DG  J N3    1 
ATOM   9931  C  C4    . DG  K 8  39  ? -27.051 -6.832  8.198  1.00 110.58 ? -34 DG  J C4    1 
ATOM   9932  P  P     . DA  K 8  40  ? -26.300 -4.142  14.362 1.00 124.17 ? -33 DA  J P     1 
ATOM   9933  O  OP1   . DA  K 8  40  ? -25.203 -4.048  15.351 1.00 123.33 ? -33 DA  J OP1   1 
ATOM   9934  O  OP2   . DA  K 8  40  ? -27.531 -4.894  14.693 1.00 124.88 ? -33 DA  J OP2   1 
ATOM   9935  O  "O5'" . DA  K 8  40  ? -26.737 -2.669  13.930 1.00 129.51 ? -33 DA  J "O5'" 1 
ATOM   9936  C  "C5'" . DA  K 8  40  ? -26.009 -1.983  12.922 1.00 136.39 ? -33 DA  J "C5'" 1 
ATOM   9937  C  "C4'" . DA  K 8  40  ? -26.950 -1.439  11.863 1.00 143.68 ? -33 DA  J "C4'" 1 
ATOM   9938  O  "O4'" . DA  K 8  40  ? -27.292 -2.488  10.931 1.00 147.83 ? -33 DA  J "O4'" 1 
ATOM   9939  C  "C3'" . DA  K 8  40  ? -28.278 -0.898  12.403 1.00 144.38 ? -33 DA  J "C3'" 1 
ATOM   9940  O  "O3'" . DA  K 8  40  ? -28.380 0.493   12.139 1.00 145.45 ? -33 DA  J "O3'" 1 
ATOM   9941  C  "C2'" . DA  K 8  40  ? -29.358 -1.701  11.658 1.00 147.75 ? -33 DA  J "C2'" 1 
ATOM   9942  C  "C1'" . DA  K 8  40  ? -28.596 -2.265  10.468 1.00 150.96 ? -33 DA  J "C1'" 1 
ATOM   9943  N  N9    . DA  K 8  40  ? -29.139 -3.529  9.976  1.00 152.67 ? -33 DA  J N9    1 
ATOM   9944  C  C8    . DA  K 8  40  ? -29.393 -4.656  10.707 1.00 150.09 ? -33 DA  J C8    1 
ATOM   9945  N  N7    . DA  K 8  40  ? -29.883 -5.647  9.999  1.00 151.31 ? -33 DA  J N7    1 
ATOM   9946  C  C5    . DA  K 8  40  ? -29.955 -5.134  8.714  1.00 155.94 ? -33 DA  J C5    1 
ATOM   9947  C  C6    . DA  K 8  40  ? -30.391 -5.687  7.494  1.00 160.27 ? -33 DA  J C6    1 
ATOM   9948  N  N6    . DA  K 8  40  ? -30.855 -6.935  7.376  1.00 160.64 ? -33 DA  J N6    1 
ATOM   9949  N  N1    . DA  K 8  40  ? -30.332 -4.904  6.396  1.00 164.26 ? -33 DA  J N1    1 
ATOM   9950  C  C2    . DA  K 8  40  ? -29.867 -3.655  6.519  1.00 165.32 ? -33 DA  J C2    1 
ATOM   9951  N  N3    . DA  K 8  40  ? -29.430 -3.027  7.609  1.00 162.37 ? -33 DA  J N3    1 
ATOM   9952  C  C4    . DA  K 8  40  ? -29.501 -3.829  8.683  1.00 157.22 ? -33 DA  J C4    1 
ATOM   9953  P  P     . DC  K 8  41  ? -29.604 1.340   12.744 1.00 147.25 ? -32 DC  J P     1 
ATOM   9954  O  OP1   . DC  K 8  41  ? -29.148 2.738   12.901 1.00 150.34 ? -32 DC  J OP1   1 
ATOM   9955  O  OP2   . DC  K 8  41  ? -30.129 0.600   13.914 1.00 142.62 ? -32 DC  J OP2   1 
ATOM   9956  O  "O5'" . DC  K 8  41  ? -30.710 1.281   11.592 1.00 150.47 ? -32 DC  J "O5'" 1 
ATOM   9957  C  "C5'" . DC  K 8  41  ? -30.371 1.668   10.267 1.00 153.38 ? -32 DC  J "C5'" 1 
ATOM   9958  C  "C4'" . DC  K 8  41  ? -31.476 1.294   9.297  1.00 156.19 ? -32 DC  J "C4'" 1 
ATOM   9959  O  "O4'" . DC  K 8  41  ? -31.468 -0.133  9.080  1.00 155.01 ? -32 DC  J "O4'" 1 
ATOM   9960  C  "C3'" . DC  K 8  41  ? -32.891 1.644   9.769  1.00 158.32 ? -32 DC  J "C3'" 1 
ATOM   9961  O  "O3'" . DC  K 8  41  ? -33.449 2.647   8.932  1.00 164.98 ? -32 DC  J "O3'" 1 
ATOM   9962  C  "C2'" . DC  K 8  41  ? -33.675 0.324   9.673  1.00 156.15 ? -32 DC  J "C2'" 1 
ATOM   9963  C  "C1'" . DC  K 8  41  ? -32.778 -0.547  8.804  1.00 155.81 ? -32 DC  J "C1'" 1 
ATOM   9964  N  N1    . DC  K 8  41  ? -32.888 -2.002  9.110  1.00 154.40 ? -32 DC  J N1    1 
ATOM   9965  C  C2    . DC  K 8  41  ? -33.275 -2.895  8.105  1.00 155.26 ? -32 DC  J C2    1 
ATOM   9966  O  O2    . DC  K 8  41  ? -33.517 -2.459  6.973  1.00 157.00 ? -32 DC  J O2    1 
ATOM   9967  N  N3    . DC  K 8  41  ? -33.371 -4.215  8.401  1.00 154.59 ? -32 DC  J N3    1 
ATOM   9968  C  C4    . DC  K 8  41  ? -33.102 -4.644  9.635  1.00 151.22 ? -32 DC  J C4    1 
ATOM   9969  N  N4    . DC  K 8  41  ? -33.211 -5.954  9.879  1.00 148.55 ? -32 DC  J N4    1 
ATOM   9970  C  C5    . DC  K 8  41  ? -32.707 -3.750  10.673 1.00 150.53 ? -32 DC  J C5    1 
ATOM   9971  C  C6    . DC  K 8  41  ? -32.615 -2.451  10.370 1.00 152.70 ? -32 DC  J C6    1 
ATOM   9972  P  P     . DA  K 8  42  ? -34.772 3.436   9.389  1.00 165.83 ? -31 DA  J P     1 
ATOM   9973  O  OP1   . DA  K 8  42  ? -34.635 4.841   8.947  1.00 169.46 ? -31 DA  J OP1   1 
ATOM   9974  O  OP2   . DA  K 8  42  ? -35.005 3.133   10.819 1.00 159.50 ? -31 DA  J OP2   1 
ATOM   9975  O  "O5'" . DA  K 8  42  ? -35.939 2.741   8.546  1.00 167.58 ? -31 DA  J "O5'" 1 
ATOM   9976  C  "C5'" . DA  K 8  42  ? -35.861 2.702   7.126  1.00 170.99 ? -31 DA  J "C5'" 1 
ATOM   9977  C  "C4'" . DA  K 8  42  ? -36.964 1.835   6.548  1.00 173.52 ? -31 DA  J "C4'" 1 
ATOM   9978  O  "O4'" . DA  K 8  42  ? -36.704 0.442   6.862  1.00 170.28 ? -31 DA  J "O4'" 1 
ATOM   9979  C  "C3'" . DA  K 8  42  ? -38.367 2.138   7.074  1.00 176.38 ? -31 DA  J "C3'" 1 
ATOM   9980  O  "O3'" . DA  K 8  42  ? -39.305 2.088   6.009  1.00 183.71 ? -31 DA  J "O3'" 1 
ATOM   9981  C  "C2'" . DA  K 8  42  ? -38.608 1.023   8.089  1.00 171.41 ? -31 DA  J "C2'" 1 
ATOM   9982  C  "C1'" . DA  K 8  42  ? -37.842 -0.132  7.464  1.00 169.51 ? -31 DA  J "C1'" 1 
ATOM   9983  N  N9    . DA  K 8  42  ? -37.396 -1.127  8.435  1.00 165.79 ? -31 DA  J N9    1 
ATOM   9984  C  C8    . DA  K 8  42  ? -36.900 -0.891  9.687  1.00 162.37 ? -31 DA  J C8    1 
ATOM   9985  N  N7    . DA  K 8  42  ? -36.574 -1.981  10.341 1.00 160.15 ? -31 DA  J N7    1 
ATOM   9986  C  C5    . DA  K 8  42  ? -36.876 -3.003  9.457  1.00 161.82 ? -31 DA  J C5    1 
ATOM   9987  C  C6    . DA  K 8  42  ? -36.761 -4.405  9.550  1.00 159.41 ? -31 DA  J C6    1 
ATOM   9988  N  N6    . DA  K 8  42  ? -36.288 -5.034  10.631 1.00 155.80 ? -31 DA  J N6    1 
ATOM   9989  N  N1    . DA  K 8  42  ? -37.153 -5.136  8.486  1.00 160.77 ? -31 DA  J N1    1 
ATOM   9990  C  C2    . DA  K 8  42  ? -37.626 -4.502  7.406  1.00 164.68 ? -31 DA  J C2    1 
ATOM   9991  N  N3    . DA  K 8  42  ? -37.781 -3.195  7.202  1.00 167.82 ? -31 DA  J N3    1 
ATOM   9992  C  C4    . DA  K 8  42  ? -37.384 -2.494  8.276  1.00 165.66 ? -31 DA  J C4    1 
ATOM   9993  P  P     . DG  K 8  43  ? -40.690 2.896   6.111  1.00 188.54 ? -30 DG  J P     1 
ATOM   9994  O  OP1   . DG  K 8  43  ? -40.725 3.869   4.996  1.00 196.24 ? -30 DG  J OP1   1 
ATOM   9995  O  OP2   . DG  K 8  43  ? -40.838 3.370   7.505  1.00 186.54 ? -30 DG  J OP2   1 
ATOM   9996  O  "O5'" . DG  K 8  43  ? -41.801 1.777   5.853  1.00 189.68 ? -30 DG  J "O5'" 1 
ATOM   9997  C  "C5'" . DG  K 8  43  ? -41.760 1.003   4.662  1.00 191.39 ? -30 DG  J "C5'" 1 
ATOM   9998  C  "C4'" . DG  K 8  43  ? -42.386 -0.362  4.885  1.00 188.85 ? -30 DG  J "C4'" 1 
ATOM   9999  O  "O4'" . DG  K 8  43  ? -41.546 -1.141  5.770  1.00 183.02 ? -30 DG  J "O4'" 1 
ATOM   10000 C  "C3'" . DG  K 8  43  ? -43.780 -0.336  5.520  1.00 189.47 ? -30 DG  J "C3'" 1 
ATOM   10001 O  "O3'" . DG  K 8  43  ? -44.708 -1.011  4.682  1.00 194.14 ? -30 DG  J "O3'" 1 
ATOM   10002 C  "C2'" . DG  K 8  43  ? -43.600 -1.054  6.864  1.00 183.55 ? -30 DG  J "C2'" 1 
ATOM   10003 C  "C1'" . DG  K 8  43  ? -42.360 -1.900  6.624  1.00 180.60 ? -30 DG  J "C1'" 1 
ATOM   10004 N  N9    . DG  K 8  43  ? -41.608 -2.186  7.843  1.00 175.57 ? -30 DG  J N9    1 
ATOM   10005 C  C8    . DG  K 8  43  ? -41.088 -1.271  8.725  1.00 173.20 ? -30 DG  J C8    1 
ATOM   10006 N  N7    . DG  K 8  43  ? -40.461 -1.817  9.731  1.00 169.75 ? -30 DG  J N7    1 
ATOM   10007 C  C5    . DG  K 8  43  ? -40.573 -3.182  9.501  1.00 169.03 ? -30 DG  J C5    1 
ATOM   10008 C  C6    . DG  K 8  43  ? -40.087 -4.275  10.257 1.00 165.12 ? -30 DG  J C6    1 
ATOM   10009 O  O6    . DG  K 8  43  ? -39.441 -4.251  11.314 1.00 162.80 ? -30 DG  J O6    1 
ATOM   10010 N  N1    . DG  K 8  43  ? -40.419 -5.494  9.672  1.00 164.19 ? -30 DG  J N1    1 
ATOM   10011 C  C2    . DG  K 8  43  ? -41.131 -5.638  8.504  1.00 166.58 ? -30 DG  J C2    1 
ATOM   10012 N  N2    . DG  K 8  43  ? -41.354 -6.895  8.096  1.00 165.30 ? -30 DG  J N2    1 
ATOM   10013 N  N3    . DG  K 8  43  ? -41.592 -4.621  7.786  1.00 171.27 ? -30 DG  J N3    1 
ATOM   10014 C  C4    . DG  K 8  43  ? -41.276 -3.427  8.343  1.00 172.22 ? -30 DG  J C4    1 
ATOM   10015 P  P     . DC  K 8  44  ? -46.287 -0.867  4.942  1.00 196.45 ? -29 DC  J P     1 
ATOM   10016 O  OP1   . DC  K 8  44  ? -46.942 -0.688  3.628  1.00 200.54 ? -29 DC  J OP1   1 
ATOM   10017 O  OP2   . DC  K 8  44  ? -46.483 0.143   6.006  1.00 193.30 ? -29 DC  J OP2   1 
ATOM   10018 O  "O5'" . DC  K 8  44  ? -46.703 -2.292  5.535  1.00 196.62 ? -29 DC  J "O5'" 1 
ATOM   10019 C  "C5'" . DC  K 8  44  ? -46.432 -3.472  4.790  1.00 197.73 ? -29 DC  J "C5'" 1 
ATOM   10020 C  "C4'" . DC  K 8  44  ? -46.514 -4.702  5.675  1.00 194.72 ? -29 DC  J "C4'" 1 
ATOM   10021 O  "O4'" . DC  K 8  44  ? -45.453 -4.665  6.656  1.00 187.47 ? -29 DC  J "O4'" 1 
ATOM   10022 C  "C3'" . DC  K 8  44  ? -47.822 -4.848  6.460  1.00 197.61 ? -29 DC  J "C3'" 1 
ATOM   10023 O  "O3'" . DC  K 8  44  ? -48.478 -6.054  6.087  1.00 205.11 ? -29 DC  J "O3'" 1 
ATOM   10024 C  "C2'" . DC  K 8  44  ? -47.388 -4.868  7.934  1.00 189.16 ? -29 DC  J "C2'" 1 
ATOM   10025 C  "C1'" . DC  K 8  44  ? -45.917 -5.245  7.844  1.00 183.49 ? -29 DC  J "C1'" 1 
ATOM   10026 N  N1    . DC  K 8  44  ? -45.098 -4.722  8.976  1.00 176.42 ? -29 DC  J N1    1 
ATOM   10027 C  C2    . DC  K 8  44  ? -44.436 -5.616  9.824  1.00 170.28 ? -29 DC  J C2    1 
ATOM   10028 O  O2    . DC  K 8  44  ? -44.539 -6.832  9.619  1.00 168.38 ? -29 DC  J O2    1 
ATOM   10029 N  N3    . DC  K 8  44  ? -43.696 -5.123  10.849 1.00 167.00 ? -29 DC  J N3    1 
ATOM   10030 C  C4    . DC  K 8  44  ? -43.609 -3.805  11.036 1.00 166.04 ? -29 DC  J C4    1 
ATOM   10031 N  N4    . DC  K 8  44  ? -42.868 -3.366  12.059 1.00 160.81 ? -29 DC  J N4    1 
ATOM   10032 C  C5    . DC  K 8  44  ? -44.277 -2.878  10.183 1.00 171.31 ? -29 DC  J C5    1 
ATOM   10033 C  C6    . DC  K 8  44  ? -45.004 -3.376  9.176  1.00 175.76 ? -29 DC  J C6    1 
ATOM   10034 P  P     . DT  K 8  45  ? -49.941 -6.394  6.659  1.00 210.75 ? -28 DT  J P     1 
ATOM   10035 O  OP1   . DT  K 8  45  ? -50.665 -7.151  5.614  1.00 217.70 ? -28 DT  J OP1   1 
ATOM   10036 O  OP2   . DT  K 8  45  ? -50.524 -5.145  7.199  1.00 215.19 ? -28 DT  J OP2   1 
ATOM   10037 O  "O5'" . DT  K 8  45  ? -49.647 -7.370  7.889  1.00 203.48 ? -28 DT  J "O5'" 1 
ATOM   10038 C  "C5'" . DT  K 8  45  ? -48.800 -8.496  7.707  1.00 200.38 ? -28 DT  J "C5'" 1 
ATOM   10039 C  "C4'" . DT  K 8  45  ? -48.570 -9.218  9.020  1.00 194.51 ? -28 DT  J "C4'" 1 
ATOM   10040 O  "O4'" . DT  K 8  45  ? -47.675 -8.440  9.857  1.00 192.33 ? -28 DT  J "O4'" 1 
ATOM   10041 C  "C3'" . DT  K 8  45  ? -49.832 -9.464  9.851  1.00 191.21 ? -28 DT  J "C3'" 1 
ATOM   10042 O  "O3'" . DT  K 8  45  ? -49.858 -10.809 10.297 1.00 185.70 ? -28 DT  J "O3'" 1 
ATOM   10043 C  "C2'" . DT  K 8  45  ? -49.690 -8.486  11.019 1.00 190.95 ? -28 DT  J "C2'" 1 
ATOM   10044 C  "C1'" . DT  K 8  45  ? -48.180 -8.409  11.168 1.00 190.53 ? -28 DT  J "C1'" 1 
ATOM   10045 N  N1    . DT  K 8  45  ? -47.705 -7.160  11.832 1.00 190.90 ? -28 DT  J N1    1 
ATOM   10046 C  C2    . DT  K 8  45  ? -46.874 -7.254  12.923 1.00 187.37 ? -28 DT  J C2    1 
ATOM   10047 O  O2    . DT  K 8  45  ? -46.496 -8.315  13.386 1.00 185.59 ? -28 DT  J O2    1 
ATOM   10048 N  N3    . DT  K 8  45  ? -46.494 -6.052  13.459 1.00 185.96 ? -28 DT  J N3    1 
ATOM   10049 C  C4    . DT  K 8  45  ? -46.857 -4.790  13.023 1.00 187.33 ? -28 DT  J C4    1 
ATOM   10050 O  O4    . DT  K 8  45  ? -46.463 -3.767  13.573 1.00 184.06 ? -28 DT  J O4    1 
ATOM   10051 C  C5    . DT  K 8  45  ? -47.732 -4.763  11.874 1.00 192.73 ? -28 DT  J C5    1 
ATOM   10052 C  C7    . DT  K 8  45  ? -48.193 -3.452  11.309 1.00 195.26 ? -28 DT  J C7    1 
ATOM   10053 C  C6    . DT  K 8  45  ? -48.109 -5.935  11.341 1.00 194.36 ? -28 DT  J C6    1 
ATOM   10054 P  P     . DC  K 8  46  ? -51.239 -11.627 10.325 1.00 184.27 ? -27 DC  J P     1 
ATOM   10055 O  OP1   . DC  K 8  46  ? -51.116 -12.748 9.366  1.00 183.55 ? -27 DC  J OP1   1 
ATOM   10056 O  OP2   . DC  K 8  46  ? -52.344 -10.653 10.184 1.00 186.95 ? -27 DC  J OP2   1 
ATOM   10057 O  "O5'" . DC  K 8  46  ? -51.293 -12.217 11.809 1.00 180.41 ? -27 DC  J "O5'" 1 
ATOM   10058 C  "C5'" . DC  K 8  46  ? -50.141 -12.836 12.364 1.00 175.27 ? -27 DC  J "C5'" 1 
ATOM   10059 C  "C4'" . DC  K 8  46  ? -50.023 -12.528 13.845 1.00 170.14 ? -27 DC  J "C4'" 1 
ATOM   10060 O  "O4'" . DC  K 8  46  ? -49.553 -11.166 14.030 1.00 169.07 ? -27 DC  J "O4'" 1 
ATOM   10061 C  "C3'" . DC  K 8  46  ? -51.331 -12.640 14.637 1.00 169.53 ? -27 DC  J "C3'" 1 
ATOM   10062 O  "O3'" . DC  K 8  46  ? -51.109 -13.376 15.828 1.00 166.57 ? -27 DC  J "O3'" 1 
ATOM   10063 C  "C2'" . DC  K 8  46  ? -51.683 -11.184 14.943 1.00 170.17 ? -27 DC  J "C2'" 1 
ATOM   10064 C  "C1'" . DC  K 8  46  ? -50.301 -10.569 15.058 1.00 167.93 ? -27 DC  J "C1'" 1 
ATOM   10065 N  N1    . DC  K 8  46  ? -50.282 -9.089  14.876 1.00 167.70 ? -27 DC  J N1    1 
ATOM   10066 C  C2    . DC  K 8  46  ? -49.225 -8.342  15.407 1.00 166.27 ? -27 DC  J C2    1 
ATOM   10067 O  O2    . DC  K 8  46  ? -48.318 -8.926  16.012 1.00 163.90 ? -27 DC  J O2    1 
ATOM   10068 N  N3    . DC  K 8  46  ? -49.223 -6.996  15.239 1.00 167.20 ? -27 DC  J N3    1 
ATOM   10069 C  C4    . DC  K 8  46  ? -50.220 -6.404  14.580 1.00 169.47 ? -27 DC  J C4    1 
ATOM   10070 N  N4    . DC  K 8  46  ? -50.174 -5.075  14.440 1.00 170.36 ? -27 DC  J N4    1 
ATOM   10071 C  C5    . DC  K 8  46  ? -51.308 -7.148  14.035 1.00 171.52 ? -27 DC  J C5    1 
ATOM   10072 C  C6    . DC  K 8  46  ? -51.299 -8.474  14.207 1.00 170.11 ? -27 DC  J C6    1 
ATOM   10073 P  P     . DT  K 8  47  ? -51.450 -14.944 15.890 1.00 166.35 ? -26 DT  J P     1 
ATOM   10074 O  OP1   . DT  K 8  47  ? -51.037 -15.551 14.605 1.00 169.71 ? -26 DT  J OP1   1 
ATOM   10075 O  OP2   . DT  K 8  47  ? -52.848 -15.083 16.356 1.00 167.98 ? -26 DT  J OP2   1 
ATOM   10076 O  "O5'" . DT  K 8  47  ? -50.492 -15.489 17.046 1.00 160.29 ? -26 DT  J "O5'" 1 
ATOM   10077 C  "C5'" . DT  K 8  47  ? -49.093 -15.249 16.975 1.00 157.80 ? -26 DT  J "C5'" 1 
ATOM   10078 C