data_5MMB
# 
_entry.id   5MMB 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.333 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MMB         
WWPDB D_1200002666 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MMB 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-09 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Maskell, D.P.'  1 ? 
'Pye, V.E.'      2 ? 
'Cherepanov, P.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Med. Chem.' 
_citation.journal_id_ASTM           JMCMAR 
_citation.journal_id_CSD            0151 
_citation.journal_id_ISSN           1520-4804 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            60 
_citation.language                  ? 
_citation.page_first                7315 
_citation.page_last                 7332 
_citation.title                     'Structure-Guided Optimization of HIV Integrase Strand Transfer Inhibitors.' 
_citation.year                      2017 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.jmedchem.7b00596 
_citation.pdbx_database_id_PubMed   28737946 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zhao, X.Z.'     1  ? 
primary 'Smith, S.J.'    2  ? 
primary 'Maskell, D.P.'  3  ? 
primary 'Metifiot, M.'   4  ? 
primary 'Pye, V.E.'      5  ? 
primary 'Fesen, K.'      6  ? 
primary 'Marchand, C.'   7  ? 
primary 'Pommier, Y.'    8  ? 
primary 'Cherepanov, P.' 9  ? 
primary 'Hughes, S.H.'   10 ? 
primary 'Burke, T.R.'    11 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MMB 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     160.490 
_cell.length_a_esd                 ? 
_cell.length_b                     160.490 
_cell.length_b_esd                 ? 
_cell.length_c                     123.830 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        16 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MMB 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer     man 'PFV INTEGRASE' 44456.695 2   2.7.7.49,2.7.7.7,3.1.26.4,3.4.23.-,2.7.7.-,3.1.-.- ? ? 
'G217S, S218G = natural variance' 
2  polymer     syn 
;DNA (5'-D(*AP*TP*TP*GP*TP*CP*AP*TP*GP*GP*AP*AP*TP*TP*TP*CP*GP*CP*A)-3')
;
5834.794  1   ?                                                  ? ? ?                                 
3  polymer     syn 
;DNA (5'-D(*TP*GP*CP*GP*AP*AP*AP*TP*TP*CP*CP*AP*TP*GP*AP*CP*A)-3')
;
5195.399  1   ?                                                  ? ? ?                                 
4  non-polymer syn 'ZINC ION' 65.409    1   ?                                                  ? ? ? 
5  non-polymer syn 'MAGNESIUM ION' 24.305    3   ?                                                  ? ? ? 
6  non-polymer syn 'SULFATE ION' 96.063    9   ?                                                  ? ? ? 
7  non-polymer syn GLYCEROL 92.094    7   ?                                                  ? ? ?                                 
8  non-polymer syn 
'methyl 3-[5-azanyl-6-[[2,4-bis(fluoranyl)phenyl]methylcarbamoyl]-8-oxidanyl-7-oxidanylidene-1,8-naphthyridin-3-yl]propanoate' 
432.378   1   ?                                                  ? ? ?                                 
9  non-polymer syn HEXANE-1,6-DIOL 118.174   3   ?                                                  ? ? ? 
10 water       nat water 18.015    103 ?                                                  ? ? ?                                 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        Pr125Pol 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
;GPGCNTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIA
NLYWWPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYP
TKAPSTSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSSGKVERKNSDIKRLLTKLLVG
RPTKWYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSP
VVGQLVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DT)(DG)(DT)(DC)(DA)(DT)(DG)(DG)(DA)(DA)(DT)(DT)(DT)(DC)(DG)(DC)(DA)' ATTGTCATGGAATTTCGCA 
C   ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DG)(DA)(DA)(DA)(DT)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DA)' TGCGAAATTCCATGACA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   GLY n 
1 4   CYS n 
1 5   ASN n 
1 6   THR n 
1 7   LYS n 
1 8   LYS n 
1 9   PRO n 
1 10  ASN n 
1 11  LEU n 
1 12  ASP n 
1 13  ALA n 
1 14  GLU n 
1 15  LEU n 
1 16  ASP n 
1 17  GLN n 
1 18  LEU n 
1 19  LEU n 
1 20  GLN n 
1 21  GLY n 
1 22  HIS n 
1 23  TYR n 
1 24  ILE n 
1 25  LYS n 
1 26  GLY n 
1 27  TYR n 
1 28  PRO n 
1 29  LYS n 
1 30  GLN n 
1 31  TYR n 
1 32  THR n 
1 33  TYR n 
1 34  PHE n 
1 35  LEU n 
1 36  GLU n 
1 37  ASP n 
1 38  GLY n 
1 39  LYS n 
1 40  VAL n 
1 41  LYS n 
1 42  VAL n 
1 43  SER n 
1 44  ARG n 
1 45  PRO n 
1 46  GLU n 
1 47  GLY n 
1 48  VAL n 
1 49  LYS n 
1 50  ILE n 
1 51  ILE n 
1 52  PRO n 
1 53  PRO n 
1 54  GLN n 
1 55  SER n 
1 56  ASP n 
1 57  ARG n 
1 58  GLN n 
1 59  LYS n 
1 60  ILE n 
1 61  VAL n 
1 62  LEU n 
1 63  GLN n 
1 64  ALA n 
1 65  HIS n 
1 66  ASN n 
1 67  LEU n 
1 68  ALA n 
1 69  HIS n 
1 70  THR n 
1 71  GLY n 
1 72  ARG n 
1 73  GLU n 
1 74  ALA n 
1 75  THR n 
1 76  LEU n 
1 77  LEU n 
1 78  LYS n 
1 79  ILE n 
1 80  ALA n 
1 81  ASN n 
1 82  LEU n 
1 83  TYR n 
1 84  TRP n 
1 85  TRP n 
1 86  PRO n 
1 87  ASN n 
1 88  MET n 
1 89  ARG n 
1 90  LYS n 
1 91  ASP n 
1 92  VAL n 
1 93  VAL n 
1 94  LYS n 
1 95  GLN n 
1 96  LEU n 
1 97  GLY n 
1 98  ARG n 
1 99  CYS n 
1 100 GLN n 
1 101 GLN n 
1 102 CYS n 
1 103 LEU n 
1 104 ILE n 
1 105 THR n 
1 106 ASN n 
1 107 ALA n 
1 108 SER n 
1 109 ASN n 
1 110 LYS n 
1 111 ALA n 
1 112 SER n 
1 113 GLY n 
1 114 PRO n 
1 115 ILE n 
1 116 LEU n 
1 117 ARG n 
1 118 PRO n 
1 119 ASP n 
1 120 ARG n 
1 121 PRO n 
1 122 GLN n 
1 123 LYS n 
1 124 PRO n 
1 125 PHE n 
1 126 ASP n 
1 127 LYS n 
1 128 PHE n 
1 129 PHE n 
1 130 ILE n 
1 131 ASP n 
1 132 TYR n 
1 133 ILE n 
1 134 GLY n 
1 135 PRO n 
1 136 LEU n 
1 137 PRO n 
1 138 PRO n 
1 139 SER n 
1 140 GLN n 
1 141 GLY n 
1 142 TYR n 
1 143 LEU n 
1 144 TYR n 
1 145 VAL n 
1 146 LEU n 
1 147 VAL n 
1 148 VAL n 
1 149 VAL n 
1 150 ASP n 
1 151 GLY n 
1 152 MET n 
1 153 THR n 
1 154 GLY n 
1 155 PHE n 
1 156 THR n 
1 157 TRP n 
1 158 LEU n 
1 159 TYR n 
1 160 PRO n 
1 161 THR n 
1 162 LYS n 
1 163 ALA n 
1 164 PRO n 
1 165 SER n 
1 166 THR n 
1 167 SER n 
1 168 ALA n 
1 169 THR n 
1 170 VAL n 
1 171 LYS n 
1 172 SER n 
1 173 LEU n 
1 174 ASN n 
1 175 VAL n 
1 176 LEU n 
1 177 THR n 
1 178 SER n 
1 179 ILE n 
1 180 ALA n 
1 181 ILE n 
1 182 PRO n 
1 183 LYS n 
1 184 VAL n 
1 185 ILE n 
1 186 HIS n 
1 187 SER n 
1 188 ASP n 
1 189 GLN n 
1 190 GLY n 
1 191 ALA n 
1 192 ALA n 
1 193 PHE n 
1 194 THR n 
1 195 SER n 
1 196 SER n 
1 197 THR n 
1 198 PHE n 
1 199 ALA n 
1 200 GLU n 
1 201 TRP n 
1 202 ALA n 
1 203 LYS n 
1 204 GLU n 
1 205 ARG n 
1 206 GLY n 
1 207 ILE n 
1 208 HIS n 
1 209 LEU n 
1 210 GLU n 
1 211 PHE n 
1 212 SER n 
1 213 THR n 
1 214 PRO n 
1 215 TYR n 
1 216 HIS n 
1 217 PRO n 
1 218 GLN n 
1 219 SER n 
1 220 SER n 
1 221 GLY n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 ARG n 
1 226 LYS n 
1 227 ASN n 
1 228 SER n 
1 229 ASP n 
1 230 ILE n 
1 231 LYS n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 THR n 
1 236 LYS n 
1 237 LEU n 
1 238 LEU n 
1 239 VAL n 
1 240 GLY n 
1 241 ARG n 
1 242 PRO n 
1 243 THR n 
1 244 LYS n 
1 245 TRP n 
1 246 TYR n 
1 247 ASP n 
1 248 LEU n 
1 249 LEU n 
1 250 PRO n 
1 251 VAL n 
1 252 VAL n 
1 253 GLN n 
1 254 LEU n 
1 255 ALA n 
1 256 LEU n 
1 257 ASN n 
1 258 ASN n 
1 259 THR n 
1 260 TYR n 
1 261 SER n 
1 262 PRO n 
1 263 VAL n 
1 264 LEU n 
1 265 LYS n 
1 266 TYR n 
1 267 THR n 
1 268 PRO n 
1 269 HIS n 
1 270 GLN n 
1 271 LEU n 
1 272 LEU n 
1 273 PHE n 
1 274 GLY n 
1 275 ILE n 
1 276 ASP n 
1 277 SER n 
1 278 ASN n 
1 279 THR n 
1 280 PRO n 
1 281 PHE n 
1 282 ALA n 
1 283 ASN n 
1 284 GLN n 
1 285 ASP n 
1 286 THR n 
1 287 LEU n 
1 288 ASP n 
1 289 LEU n 
1 290 THR n 
1 291 ARG n 
1 292 GLU n 
1 293 GLU n 
1 294 GLU n 
1 295 LEU n 
1 296 SER n 
1 297 LEU n 
1 298 LEU n 
1 299 GLN n 
1 300 GLU n 
1 301 ILE n 
1 302 ARG n 
1 303 THR n 
1 304 SER n 
1 305 LEU n 
1 306 TYR n 
1 307 HIS n 
1 308 PRO n 
1 309 SER n 
1 310 THR n 
1 311 PRO n 
1 312 PRO n 
1 313 ALA n 
1 314 SER n 
1 315 SER n 
1 316 ARG n 
1 317 SER n 
1 318 TRP n 
1 319 SER n 
1 320 PRO n 
1 321 VAL n 
1 322 VAL n 
1 323 GLY n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 GLN n 
1 328 GLU n 
1 329 ARG n 
1 330 VAL n 
1 331 ALA n 
1 332 ARG n 
1 333 PRO n 
1 334 ALA n 
1 335 SER n 
1 336 LEU n 
1 337 ARG n 
1 338 PRO n 
1 339 ARG n 
1 340 TRP n 
1 341 HIS n 
1 342 LYS n 
1 343 PRO n 
1 344 SER n 
1 345 THR n 
1 346 VAL n 
1 347 LEU n 
1 348 LYS n 
1 349 VAL n 
1 350 LEU n 
1 351 ASN n 
1 352 PRO n 
1 353 ARG n 
1 354 THR n 
1 355 VAL n 
1 356 VAL n 
1 357 ILE n 
1 358 LEU n 
1 359 ASP n 
1 360 HIS n 
1 361 LEU n 
1 362 GLY n 
1 363 ASN n 
1 364 ASN n 
1 365 ARG n 
1 366 THR n 
1 367 VAL n 
1 368 SER n 
1 369 ILE n 
1 370 ASP n 
1 371 ASN n 
1 372 LEU n 
1 373 LYS n 
1 374 PRO n 
1 375 THR n 
1 376 SER n 
1 377 HIS n 
1 378 GLN n 
1 379 ASN n 
1 380 GLY n 
1 381 THR n 
1 382 THR n 
1 383 ASN n 
1 384 ASP n 
1 385 THR n 
1 386 ALA n 
1 387 THR n 
1 388 MET n 
1 389 ASP n 
1 390 HIS n 
1 391 LEU n 
1 392 GLU n 
1 393 LYS n 
1 394 ASN n 
1 395 GLU n 
2 1   DA  n 
2 2   DT  n 
2 3   DT  n 
2 4   DG  n 
2 5   DT  n 
2 6   DC  n 
2 7   DA  n 
2 8   DT  n 
2 9   DG  n 
2 10  DG  n 
2 11  DA  n 
2 12  DA  n 
2 13  DT  n 
2 14  DT  n 
2 15  DT  n 
2 16  DC  n 
2 17  DG  n 
2 18  DC  n 
2 19  DA  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DG  n 
3 5   DA  n 
3 6   DA  n 
3 7   DA  n 
3 8   DT  n 
3 9   DT  n 
3 10  DC  n 
3 11  DC  n 
3 12  DA  n 
3 13  DT  n 
3 14  DG  n 
3 15  DA  n 
3 16  DC  n 
3 17  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   395 
_entity_src_gen.gene_src_common_name               'SFVcpz(hu)' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 pol 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Human spumaretrovirus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     11963 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 19 'synthetic construct' ? 32630 ? 
3 1 sample 1 17 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POL_FOAMV P14350 ? 1 
;NTKKPNLDAELDQLLQGHYIKGYPKQYTYFLEDGKVKVSRPEGVKIIPPQSDRQKIVLQAHNLAHTGREATLLKIANLYW
WPNMRKDVVKQLGRCQQCLITNASNKASGPILRPDRPQKPFDKFFIDYIGPLPPSQGYLYVLVVVDGMTGFTWLYPTKAP
STSATVKSLNVLTSIAIPKVIHSDQGAAFTSSTFAEWAKERGIHLEFSTPYHPQSGSKVERKNSDIKRLLTKLLVGRPTK
WYDLLPVVQLALNNTYSPVLKYTPHQLLFGIDSNTPFANQDTLDLTREEELSLLQEIRTSLYHPSTPPASSRSWSPVVGQ
LVQERVARPASLRPRWHKPSTVLKVLNPRTVVILDHLGNNRTVSIDNLKPTSHQNGTTNDTATMDHLEKNE
;
753 
2 PDB 5MMB      5MMB   ? 2 ? 1   
3 PDB 5MMB      5MMB   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MMB A 5 ? 395 ? P14350 753 ? 1143 ? 2 392 
2 1 5MMB B 5 ? 395 ? P14350 753 ? 1143 ? 2 392 
3 2 5MMB C 1 ? 19  ? 5MMB   1   ? 19   ? 1 19  
4 3 5MMB D 1 ? 17  ? 5MMB   1   ? 17   ? 1 17  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 5MMB GLY A 1   ? UNP P14350 ?   ?   'expression tag' -2  1  
1 5MMB PRO A 2   ? UNP P14350 ?   ?   'expression tag' -1  2  
1 5MMB GLY A 3   ? UNP P14350 ?   ?   'expression tag' 0   3  
1 5MMB CYS A 4   ? UNP P14350 ?   ?   'expression tag' 1   4  
1 5MMB SER A 220 ? UNP P14350 GLY 968 variant          217 5  
1 5MMB GLY A 221 ? UNP P14350 SER 969 variant          218 6  
2 5MMB GLY B 1   ? UNP P14350 ?   ?   'expression tag' -2  7  
2 5MMB PRO B 2   ? UNP P14350 ?   ?   'expression tag' -1  8  
2 5MMB GLY B 3   ? UNP P14350 ?   ?   'expression tag' 0   9  
2 5MMB CYS B 4   ? UNP P14350 ?   ?   'expression tag' 1   10 
2 5MMB SER B 220 ? UNP P14350 GLY 968 variant          217 11 
2 5MMB GLY B 221 ? UNP P14350 SER 969 variant          218 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE ?                               'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE ?                               'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE ?                               'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE ?                               'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE" ?                               'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                               'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE" ?                               'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE ?                               'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE ?                               'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HEZ non-polymer         . HEXANE-1,6-DIOL ?                               'C6 H14 O2'        118.174 
HIS 'L-peptide linking' y HISTIDINE ?                               'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER ?                               'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE ?                               'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE ?                               'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE ?                               'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE ?                               'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION' ?                               'Mg 2'             24.305  
OUY non-polymer         . 
'methyl 3-[5-azanyl-6-[[2,4-bis(fluoranyl)phenyl]methylcarbamoyl]-8-oxidanyl-7-oxidanylidene-1,8-naphthyridin-3-yl]propanoate' ? 
'C20 H18 F2 N4 O5' 432.378 
PHE 'L-peptide linking' y PHENYLALANINE ?                               'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE ?                               'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE ?                               'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION' ?                               'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE ?                               'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN ?                               'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE ?                               'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE ?                               'C5 H11 N O2'      117.146 
ZN  non-polymer         . 'ZINC ION' ?                               'Zn 2'             65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MMB 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.99 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         69.17 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'1.35 M AMMONIUM SULFATE, 25% (V/V) GLYCEROL, 4.8% (V/V) 1,6-HEXANEDIOL, 50 MM MES-NAOH, 1MM EDTA, PH 6.5' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS 6M-F' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-19 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'DIAMOND BEAMLINE I04' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   I04 
_diffrn_source.pdbx_synchrotron_site       Diamond 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5MMB 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.77 
_reflns.d_resolution_low                 71.77 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       40992 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  7.2 
_reflns.pdbx_Rmerge_I_obs                0.072 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            18.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.77 
_reflns_shell.d_res_low                   2.84 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        97.4 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.075 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             7.3 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               76 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MMB 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.770 
_refine.ls_d_res_low                             57.765 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     40989 
_refine.ls_number_reflns_R_free                  2057 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.44 
_refine.ls_percent_reflns_R_free                 5.02 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1848 
_refine.ls_R_factor_R_free                       0.2032 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1838 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4BE2 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            'Random selectino' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 24.06 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.34 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        4380 
_refine_hist.pdbx_number_atoms_nucleic_acid   732 
_refine_hist.pdbx_number_atoms_ligand         146 
_refine_hist.number_atoms_solvent             103 
_refine_hist.number_atoms_total               5361 
_refine_hist.d_res_high                       2.770 
_refine_hist.d_res_low                        57.765 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.004  ? 5481 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.587  ? 7584 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 15.028 ? 3132 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.041  ? 840  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 827  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7701 2.8346  . . 136 2500 97.00 . . . 0.3592 . 0.3069 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8346 2.9054  . . 153 2531 98.00 . . . 0.3522 . 0.2857 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9054 2.9840  . . 129 2563 98.00 . . . 0.2819 . 0.2549 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9840 3.0718  . . 122 2604 99.00 . . . 0.3154 . 0.2484 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0718 3.1709  . . 127 2569 99.00 . . . 0.2665 . 0.2380 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1709 3.2843  . . 129 2585 99.00 . . . 0.2464 . 0.2418 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2843 3.4157  . . 142 2574 99.00 . . . 0.2533 . 0.2221 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4157 3.5712  . . 141 2582 99.00 . . . 0.2301 . 0.1966 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5712 3.7594  . . 123 2598 98.00 . . . 0.2451 . 0.1877 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7594 3.9949  . . 140 2591 99.00 . . . 0.2066 . 0.1840 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9949 4.3033  . . 157 2587 99.00 . . . 0.1733 . 0.1580 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.3033 4.7361  . . 149 2615 99.00 . . . 0.1739 . 0.1415 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7361 5.4210  . . 150 2591 98.00 . . . 0.1685 . 0.1522 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4210 6.8282  . . 124 2670 98.00 . . . 0.1592 . 0.1690 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8282 57.7779 . . 135 2772 97.00 . . . 0.1715 . 0.1705 . . . . . . . . . . 
# 
_struct.entry_id                     5MMB 
_struct.title                        
'Crystal structure of the Prototype Foamy Virus (PFV) intasome in complex with magnesium and the INSTI XZ434 (compound 6p)' 
_struct.pdbx_descriptor              'PFV INTEGRASE/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MMB 
_struct_keywords.text            
'HIV, PFV, prototype foamy virus, integrase, strand transfer, INSTI, tetramer, intasome, integration, inhibitor, drug, viral protein' 
_struct_keywords.pdbx_keywords   'VIRAL PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 1  ? 
C  N N 2  ? 
D  N N 3  ? 
E  N N 4  ? 
F  N N 5  ? 
G  N N 5  ? 
H  N N 6  ? 
I  N N 6  ? 
J  N N 6  ? 
K  N N 6  ? 
L  N N 6  ? 
M  N N 6  ? 
N  N N 6  ? 
O  N N 6  ? 
P  N N 7  ? 
Q  N N 7  ? 
R  N N 7  ? 
S  N N 7  ? 
T  N N 7  ? 
U  N N 8  ? 
V  N N 9  ? 
W  N N 9  ? 
X  N N 5  ? 
Y  N N 6  ? 
Z  N N 7  ? 
AA N N 9  ? 
BA N N 7  ? 
CA N N 10 ? 
DA N N 10 ? 
EA N N 10 ? 
FA N N 10 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 12  ? GLY A 21  ? ASP A 9   GLY A 18  1 ? 10 
HELX_P HELX_P2  AA2 PRO A 53  ? LEU A 67  ? PRO A 50  LEU A 64  1 ? 15 
HELX_P HELX_P3  AA3 GLY A 71  ? ASN A 81  ? GLY A 68  ASN A 78  1 ? 11 
HELX_P HELX_P4  AA4 ASN A 87  ? GLY A 97  ? ASN A 84  GLY A 94  1 ? 11 
HELX_P HELX_P5  AA5 CYS A 99  ? ASN A 106 ? CYS A 96  ASN A 103 1 ? 8  
HELX_P HELX_P6  AA6 SER A 165 ? THR A 177 ? SER A 162 THR A 174 1 ? 13 
HELX_P HELX_P7  AA7 GLY A 190 ? SER A 195 ? GLY A 187 SER A 192 1 ? 6  
HELX_P HELX_P8  AA8 SER A 195 ? GLU A 204 ? SER A 192 GLU A 201 1 ? 10 
HELX_P HELX_P9  AA9 HIS A 216 ? SER A 219 ? HIS A 213 SER A 216 5 ? 4  
HELX_P HELX_P10 AB1 SER A 220 ? LEU A 238 ? SER A 217 LEU A 235 1 ? 19 
HELX_P HELX_P11 AB2 TRP A 245 ? ASP A 247 ? TRP A 242 ASP A 244 5 ? 3  
HELX_P HELX_P12 AB3 LEU A 248 ? ASN A 258 ? LEU A 245 ASN A 255 1 ? 11 
HELX_P HELX_P13 AB4 THR A 267 ? GLY A 274 ? THR A 264 GLY A 271 1 ? 8  
HELX_P HELX_P14 AB5 THR A 290 ? SER A 304 ? THR A 287 SER A 301 1 ? 15 
HELX_P HELX_P15 AB6 SER B 165 ? THR B 177 ? SER B 162 THR B 174 1 ? 13 
HELX_P HELX_P16 AB7 GLY B 190 ? SER B 195 ? GLY B 187 SER B 192 1 ? 6  
HELX_P HELX_P17 AB8 SER B 195 ? ARG B 205 ? SER B 192 ARG B 202 1 ? 11 
HELX_P HELX_P18 AB9 SER B 220 ? VAL B 239 ? SER B 217 VAL B 236 1 ? 20 
HELX_P HELX_P19 AC1 LYS B 244 ? ASN B 258 ? LYS B 241 ASN B 255 1 ? 15 
HELX_P HELX_P20 AC2 THR B 267 ? GLY B 274 ? THR B 264 GLY B 271 1 ? 8  
HELX_P HELX_P21 AC3 THR B 290 ? GLU B 300 ? THR B 287 GLU B 297 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A HIS 65  NE2 ? ? ? 1_555 E  ZN  .  ZN    ? ? A HIS 62  A ZN  401 1_555 ? ? ? ? ? ? ?            2.022 ? ? 
metalc2  metalc ? ? A HIS 69  ND1 ? ? ? 1_555 E  ZN  .  ZN    ? ? A HIS 66  A ZN  401 1_555 ? ? ? ? ? ? ?            2.023 ? ? 
metalc3  metalc ? ? A CYS 99  SG  ? ? ? 1_555 E  ZN  .  ZN    ? ? A CYS 96  A ZN  401 1_555 ? ? ? ? ? ? ?            2.248 ? ? 
metalc4  metalc ? ? A CYS 102 SG  ? ? ? 1_555 E  ZN  .  ZN    ? ? A CYS 99  A ZN  401 1_555 ? ? ? ? ? ? ?            2.288 ? ? 
metalc5  metalc ? ? A ASP 131 OD1 ? ? ? 1_555 F  MG  .  MG    ? ? A ASP 128 A MG  402 1_555 ? ? ? ? ? ? ?            2.080 ? ? 
metalc6  metalc ? ? A ASP 131 OD2 ? ? ? 1_555 G  MG  .  MG    ? ? A ASP 128 A MG  403 1_555 ? ? ? ? ? ? ?            2.080 ? ? 
metalc7  metalc ? ? A ASP 188 OD2 ? ? ? 1_555 F  MG  .  MG    ? ? A ASP 185 A MG  402 1_555 ? ? ? ? ? ? ?            2.119 ? ? 
metalc8  metalc ? ? A GLU 224 OE1 ? ? ? 1_555 G  MG  .  MG    ? ? A GLU 221 A MG  403 1_555 ? ? ? ? ? ? ?            2.087 ? ? 
metalc9  metalc ? ? A GLU 224 OE2 ? ? ? 1_555 G  MG  .  MG    ? ? A GLU 221 A MG  403 1_555 ? ? ? ? ? ? ?            2.076 ? ? 
metalc10 metalc ? ? F MG  .   MG  ? ? ? 1_555 U  OUY .  OAF   ? ? A MG  402 A OUY 417 1_555 ? ? ? ? ? ? ?            2.123 ? ? 
metalc11 metalc ? ? F MG  .   MG  ? ? ? 1_555 CA HOH .  O     ? ? A MG  402 A HOH 524 1_555 ? ? ? ? ? ? ?            2.298 ? ? 
metalc12 metalc ? ? F MG  .   MG  ? ? ? 1_555 FA HOH .  O     ? ? A MG  402 D HOH 109 1_555 ? ? ? ? ? ? ?            2.141 ? ? 
metalc13 metalc ? ? G MG  .   MG  ? ? ? 1_555 U  OUY .  OAE   ? ? A MG  403 A OUY 417 1_555 ? ? ? ? ? ? ?            2.176 ? ? 
metalc14 metalc ? ? G MG  .   MG  ? ? ? 1_555 U  OUY .  OAF   ? ? A MG  403 A OUY 417 1_555 ? ? ? ? ? ? ?            1.966 ? ? 
metalc15 metalc ? ? G MG  .   MG  ? ? ? 1_555 FA HOH .  O     ? ? A MG  403 D HOH 103 1_555 ? ? ? ? ? ? ?            2.124 ? ? 
metalc16 metalc ? ? B ASP 131 OD1 ? ? ? 1_555 X  MG  .  MG    ? ? B ASP 128 B MG  401 1_555 ? ? ? ? ? ? ?            2.081 ? ? 
metalc17 metalc ? ? B ASP 188 OD2 ? ? ? 1_555 X  MG  .  MG    ? ? B ASP 185 B MG  401 1_555 ? ? ? ? ? ? ?            2.122 ? ? 
metalc18 metalc ? ? X MG  .   MG  ? ? ? 4_454 C  DA  19 "O3'" ? ? B MG  401 C DA  19  1_555 ? ? ? ? ? ? ?            2.301 ? ? 
hydrog1  hydrog ? ? C DG  4   N1  ? ? ? 1_555 D  DC  16 N3    ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? C DG  4   N2  ? ? ? 1_555 D  DC  16 O2    ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? C DG  4   O6  ? ? ? 1_555 D  DC  16 N4    ? ? C DG  4   D DC  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? C DT  5   N3  ? ? ? 1_555 D  DA  15 N1    ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? C DT  5   O4  ? ? ? 1_555 D  DA  15 N6    ? ? C DT  5   D DA  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? C DC  6   N3  ? ? ? 1_555 D  DG  14 N1    ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? C DC  6   N4  ? ? ? 1_555 D  DG  14 O6    ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? C DC  6   O2  ? ? ? 1_555 D  DG  14 N2    ? ? C DC  6   D DG  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? C DA  7   N1  ? ? ? 1_555 D  DT  13 N3    ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? C DA  7   N6  ? ? ? 1_555 D  DT  13 O4    ? ? C DA  7   D DT  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? C DT  8   N3  ? ? ? 1_555 D  DA  12 N1    ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? C DT  8   O4  ? ? ? 1_555 D  DA  12 N6    ? ? C DT  8   D DA  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? C DG  9   N1  ? ? ? 1_555 D  DC  11 N3    ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? C DG  9   N2  ? ? ? 1_555 D  DC  11 O2    ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? C DG  9   O6  ? ? ? 1_555 D  DC  11 N4    ? ? C DG  9   D DC  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? C DG  10  N1  ? ? ? 1_555 D  DC  10 N3    ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? C DG  10  N2  ? ? ? 1_555 D  DC  10 O2    ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? C DG  10  O6  ? ? ? 1_555 D  DC  10 N4    ? ? C DG  10  D DC  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? C DA  11  N1  ? ? ? 1_555 D  DT  9  N3    ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? C DA  11  N6  ? ? ? 1_555 D  DT  9  O4    ? ? C DA  11  D DT  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? C DA  12  N1  ? ? ? 1_555 D  DT  8  N3    ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? C DA  12  N6  ? ? ? 1_555 D  DT  8  O4    ? ? C DA  12  D DT  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? C DT  13  N3  ? ? ? 1_555 D  DA  7  N1    ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? C DT  13  O4  ? ? ? 1_555 D  DA  7  N6    ? ? C DT  13  D DA  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? C DT  14  N3  ? ? ? 1_555 D  DA  6  N1    ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? C DT  14  O4  ? ? ? 1_555 D  DA  6  N6    ? ? C DT  14  D DA  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? C DT  15  N3  ? ? ? 1_555 D  DA  5  N1    ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? C DT  15  O4  ? ? ? 1_555 D  DA  5  N6    ? ? C DT  15  D DA  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? C DC  16  N3  ? ? ? 1_555 D  DG  4  N1    ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? C DC  16  N4  ? ? ? 1_555 D  DG  4  O6    ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ? ? C DC  16  O2  ? ? ? 1_555 D  DG  4  N2    ? ? C DC  16  D DG  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ? ? C DG  17  N1  ? ? ? 1_555 D  DC  3  N3    ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ? ? C DG  17  N2  ? ? ? 1_555 D  DC  3  O2    ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ? ? C DG  17  O6  ? ? ? 1_555 D  DC  3  N4    ? ? C DG  17  D DC  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ? ? C DC  18  N3  ? ? ? 1_555 D  DG  2  N1    ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ? ? C DC  18  N4  ? ? ? 1_555 D  DG  2  O6    ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ? ? C DC  18  O2  ? ? ? 1_555 D  DG  2  N2    ? ? C DC  18  D DG  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ? ? C DA  19  N1  ? ? ? 1_555 D  DT  1  N3    ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ? ? C DA  19  N6  ? ? ? 1_555 D  DT  1  O4    ? ? C DA  19  D DT  1   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 134 A . ? GLY 131 A PRO 135 A ? PRO 132 A 1 3.66 
2 GLY 134 B . ? GLY 131 B PRO 135 B ? PRO 132 B 1 1.34 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 2 ? 
AA3 ? 5 ? 
AA4 ? 5 ? 
AA5 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA3 4 5 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA4 4 5 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? parallel      
AA5 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 TYR A 33  ? GLU A 36  ? TYR A 30  GLU A 33  
AA1 2 LYS A 39  ? ARG A 44  ? LYS A 36  ARG A 41  
AA1 3 GLY A 47  ? ILE A 50  ? GLY A 44  ILE A 47  
AA2 1 ALA A 111 ? SER A 112 ? ALA A 108 SER A 109 
AA2 2 SER A 317 ? TRP A 318 ? SER A 314 TRP A 315 
AA3 1 THR A 156 ? THR A 161 ? THR A 153 THR A 158 
AA3 2 TYR A 144 ? ASP A 150 ? TYR A 141 ASP A 147 
AA3 3 LYS A 127 ? ILE A 133 ? LYS A 124 ILE A 130 
AA3 4 VAL A 184 ? SER A 187 ? VAL A 181 SER A 184 
AA3 5 HIS A 208 ? PHE A 211 ? HIS A 205 PHE A 208 
AA4 1 ASN A 364 ? SER A 368 ? ASN A 361 SER A 365 
AA4 2 THR A 354 ? LEU A 358 ? THR A 351 LEU A 355 
AA4 3 SER A 344 ? ASN A 351 ? SER A 341 ASN A 348 
AA4 4 LEU A 325 ? GLU A 328 ? LEU A 322 GLU A 325 
AA4 5 LEU A 372 ? PRO A 374 ? LEU A 369 PRO A 371 
AA5 1 THR B 156 ? THR B 161 ? THR B 153 THR B 158 
AA5 2 TYR B 144 ? ASP B 150 ? TYR B 141 ASP B 147 
AA5 3 LYS B 127 ? ILE B 133 ? LYS B 124 ILE B 130 
AA5 4 VAL B 184 ? SER B 187 ? VAL B 181 SER B 184 
AA5 5 HIS B 208 ? PHE B 211 ? HIS B 205 PHE B 208 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 34  ? N PHE A 31  O LYS A 41  ? O LYS A 38  
AA1 2 3 N VAL A 42  ? N VAL A 39  O LYS A 49  ? O LYS A 46  
AA2 1 2 N ALA A 111 ? N ALA A 108 O TRP A 318 ? O TRP A 315 
AA3 1 2 O TYR A 159 ? O TYR A 156 N LEU A 146 ? N LEU A 143 
AA3 2 3 O VAL A 149 ? O VAL A 146 N PHE A 129 ? N PHE A 126 
AA3 3 4 N PHE A 128 ? N PHE A 125 O HIS A 186 ? O HIS A 183 
AA3 4 5 N ILE A 185 ? N ILE A 182 O GLU A 210 ? O GLU A 207 
AA4 1 2 O ARG A 365 ? O ARG A 362 N ILE A 357 ? N ILE A 354 
AA4 2 3 O VAL A 356 ? O VAL A 353 N LEU A 347 ? N LEU A 344 
AA4 3 4 O SER A 344 ? O SER A 341 N VAL A 326 ? N VAL A 323 
AA4 4 5 N GLN A 327 ? N GLN A 324 O LYS A 373 ? O LYS A 370 
AA5 1 2 O TYR B 159 ? O TYR B 156 N LEU B 146 ? N LEU B 143 
AA5 2 3 O VAL B 147 ? O VAL B 144 N ASP B 131 ? N ASP B 128 
AA5 3 4 N PHE B 128 ? N PHE B 125 O HIS B 186 ? O HIS B 183 
AA5 4 5 N ILE B 185 ? N ILE B 182 O HIS B 208 ? O HIS B 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  401 ? 4  'binding site for residue ZN A 401'  
AC2 Software A MG  402 ? 5  'binding site for residue MG A 402'  
AC3 Software A MG  403 ? 5  'binding site for residue MG A 403'  
AC4 Software A SO4 404 ? 3  'binding site for residue SO4 A 404' 
AC5 Software A SO4 405 ? 2  'binding site for residue SO4 A 405' 
AC6 Software A SO4 406 ? 6  'binding site for residue SO4 A 406' 
AC7 Software A SO4 407 ? 3  'binding site for residue SO4 A 407' 
AC8 Software A SO4 408 ? 2  'binding site for residue SO4 A 408' 
AC9 Software A SO4 409 ? 4  'binding site for residue SO4 A 409' 
AD1 Software A SO4 410 ? 4  'binding site for residue SO4 A 410' 
AD2 Software A SO4 411 ? 5  'binding site for residue SO4 A 411' 
AD3 Software A GOL 412 ? 3  'binding site for residue GOL A 412' 
AD4 Software A GOL 413 ? 2  'binding site for residue GOL A 413' 
AD5 Software A GOL 414 ? 4  'binding site for residue GOL A 414' 
AD6 Software A GOL 415 ? 5  'binding site for residue GOL A 415' 
AD7 Software A GOL 416 ? 5  'binding site for residue GOL A 416' 
AD8 Software A OUY 417 ? 17 'binding site for residue OUY A 417' 
AD9 Software A HEZ 418 ? 5  'binding site for residue HEZ A 418' 
AE1 Software A HEZ 419 ? 6  'binding site for residue HEZ A 419' 
AE2 Software B MG  401 ? 3  'binding site for residue MG B 401'  
AE3 Software B SO4 402 ? 5  'binding site for residue SO4 B 402' 
AE4 Software B GOL 403 ? 1  'binding site for residue GOL B 403' 
AE5 Software B HEZ 404 ? 5  'binding site for residue HEZ B 404' 
AE6 Software C GOL 101 ? 6  'binding site for residue GOL C 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 4  HIS A  65  ? HIS A 62  . ? 1_555 ? 
2   AC1 4  HIS A  69  ? HIS A 66  . ? 1_555 ? 
3   AC1 4  CYS A  99  ? CYS A 96  . ? 1_555 ? 
4   AC1 4  CYS A  102 ? CYS A 99  . ? 1_555 ? 
5   AC2 5  ASP A  131 ? ASP A 128 . ? 1_555 ? 
6   AC2 5  ASP A  188 ? ASP A 185 . ? 1_555 ? 
7   AC2 5  OUY U  .   ? OUY A 417 . ? 1_555 ? 
8   AC2 5  HOH CA .   ? HOH A 524 . ? 1_555 ? 
9   AC2 5  HOH FA .   ? HOH D 109 . ? 1_555 ? 
10  AC3 5  ASP A  131 ? ASP A 128 . ? 1_555 ? 
11  AC3 5  GLU A  224 ? GLU A 221 . ? 1_555 ? 
12  AC3 5  ASN A  227 ? ASN A 224 . ? 1_555 ? 
13  AC3 5  OUY U  .   ? OUY A 417 . ? 1_555 ? 
14  AC3 5  HOH FA .   ? HOH D 103 . ? 1_555 ? 
15  AC4 3  SER A  139 ? SER A 136 . ? 1_555 ? 
16  AC4 3  GLN A  140 ? GLN A 137 . ? 1_555 ? 
17  AC4 3  LYS A  244 ? LYS A 241 . ? 1_555 ? 
18  AC5 2  ALA A  191 ? ALA A 188 . ? 1_555 ? 
19  AC5 2  OUY U  .   ? OUY A 417 . ? 1_555 ? 
20  AC6 6  LYS A  231 ? LYS A 228 . ? 8_554 ? 
21  AC6 6  SER A  335 ? SER A 332 . ? 1_555 ? 
22  AC6 6  LEU A  336 ? LEU A 333 . ? 1_555 ? 
23  AC6 6  ARG A  339 ? ARG A 336 . ? 1_555 ? 
24  AC6 6  HOH CA .   ? HOH A 501 . ? 1_555 ? 
25  AC6 6  HOH CA .   ? HOH A 502 . ? 1_555 ? 
26  AC7 3  HIS A  341 ? HIS A 338 . ? 1_555 ? 
27  AC7 3  LYS A  342 ? LYS A 339 . ? 1_555 ? 
28  AC7 3  HIS A  360 ? HIS A 357 . ? 1_555 ? 
29  AC8 2  LYS A  162 ? LYS A 159 . ? 1_555 ? 
30  AC8 2  ALA A  168 ? ALA A 165 . ? 1_555 ? 
31  AC9 4  GLN A  63  ? GLN A 60  . ? 1_555 ? 
32  AC9 4  TYR A  83  ? TYR A 80  . ? 1_555 ? 
33  AC9 4  PHE A  281 ? PHE A 278 . ? 8_554 ? 
34  AC9 4  HOH CA .   ? HOH A 532 . ? 1_555 ? 
35  AD1 4  ASN A  174 ? ASN A 171 . ? 1_555 ? 
36  AD1 4  THR A  177 ? THR A 174 . ? 1_555 ? 
37  AD1 4  ARG A  205 ? ARG A 202 . ? 1_555 ? 
38  AD1 4  PRO B  250 ? PRO B 247 . ? 1_555 ? 
39  AD2 5  ARG A  117 ? ARG A 114 . ? 1_555 ? 
40  AD2 5  TYR A  306 ? TYR A 303 . ? 1_555 ? 
41  AD2 5  PRO A  308 ? PRO A 305 . ? 1_555 ? 
42  AD2 5  DC  C  6   ? DC  C 6   . ? 1_555 ? 
43  AD2 5  GOL BA .   ? GOL C 101 . ? 1_555 ? 
44  AD3 3  SER A  165 ? SER A 162 . ? 1_555 ? 
45  AD3 3  THR A  166 ? THR A 163 . ? 1_555 ? 
46  AD3 3  SER A  167 ? SER A 164 . ? 1_555 ? 
47  AD4 2  ASP A  119 ? ASP A 116 . ? 1_555 ? 
48  AD4 2  DT  C  3   ? DT  C 3   . ? 1_555 ? 
49  AD5 4  HIS A  22  ? HIS A 19  . ? 1_555 ? 
50  AD5 4  TYR A  23  ? TYR A 20  . ? 1_555 ? 
51  AD5 4  THR B  213 ? THR B 210 . ? 6_454 ? 
52  AD5 4  HIS B  216 ? HIS B 213 . ? 6_454 ? 
53  AD6 5  SER A  228 ? SER A 225 . ? 8_554 ? 
54  AD6 5  THR A  235 ? THR A 232 . ? 8_554 ? 
55  AD6 5  ARG A  337 ? ARG A 334 . ? 1_555 ? 
56  AD6 5  HOH CA .   ? HOH A 522 . ? 1_555 ? 
57  AD6 5  DC  D  16  ? DC  D 16  . ? 8_554 ? 
58  AD7 5  LEU A  295 ? LEU A 292 . ? 1_555 ? 
59  AD7 5  GLN A  299 ? GLN A 296 . ? 1_555 ? 
60  AD7 5  TYR B  266 ? TYR B 263 . ? 1_555 ? 
61  AD7 5  GLY B  274 ? GLY B 271 . ? 1_555 ? 
62  AD7 5  ASP B  276 ? ASP B 273 . ? 1_555 ? 
63  AD8 17 ASP A  131 ? ASP A 128 . ? 1_555 ? 
64  AD8 17 ASP A  188 ? ASP A 185 . ? 1_555 ? 
65  AD8 17 GLN A  189 ? GLN A 186 . ? 1_555 ? 
66  AD8 17 TYR A  215 ? TYR A 212 . ? 1_555 ? 
67  AD8 17 PRO A  217 ? PRO A 214 . ? 1_555 ? 
68  AD8 17 GLN A  218 ? GLN A 215 . ? 1_555 ? 
69  AD8 17 GLU A  224 ? GLU A 221 . ? 1_555 ? 
70  AD8 17 ARG A  332 ? ARG A 329 . ? 1_555 ? 
71  AD8 17 MG  F  .   ? MG  A 402 . ? 1_555 ? 
72  AD8 17 MG  G  .   ? MG  A 403 . ? 1_555 ? 
73  AD8 17 SO4 I  .   ? SO4 A 405 . ? 1_555 ? 
74  AD8 17 HOH CA .   ? HOH A 503 . ? 1_555 ? 
75  AD8 17 HOH CA .   ? HOH A 508 . ? 1_555 ? 
76  AD8 17 DG  C  4   ? DG  C 4   . ? 1_555 ? 
77  AD8 17 DC  D  16  ? DC  D 16  . ? 1_555 ? 
78  AD8 17 DA  D  17  ? DA  D 17  . ? 1_555 ? 
79  AD8 17 HOH FA .   ? HOH D 109 . ? 1_555 ? 
80  AD9 5  TRP A  318 ? TRP A 315 . ? 1_555 ? 
81  AD9 5  THR A  375 ? THR A 372 . ? 1_555 ? 
82  AD9 5  HIS A  377 ? HIS A 374 . ? 1_555 ? 
83  AD9 5  GLN A  378 ? GLN A 375 . ? 1_555 ? 
84  AD9 5  DG  C  10  ? DG  C 10  . ? 8_554 ? 
85  AE1 6  TYR A  260 ? TYR A 257 . ? 1_555 ? 
86  AE1 6  LYS A  265 ? LYS A 262 . ? 1_555 ? 
87  AE1 6  GLN A  270 ? GLN A 267 . ? 1_555 ? 
88  AE1 6  GLY A  274 ? GLY A 271 . ? 1_555 ? 
89  AE1 6  ASN A  283 ? ASN A 280 . ? 1_555 ? 
90  AE1 6  ILE A  301 ? ILE A 298 . ? 1_555 ? 
91  AE2 3  ASP B  131 ? ASP B 128 . ? 1_555 ? 
92  AE2 3  ASP B  188 ? ASP B 185 . ? 1_555 ? 
93  AE2 3  DA  C  19  ? DA  C 19  . ? 3_555 ? 
94  AE3 5  LYS B  222 ? LYS B 219 . ? 1_555 ? 
95  AE3 5  ARG B  225 ? ARG B 222 . ? 1_555 ? 
96  AE3 5  SER B  261 ? SER B 258 . ? 1_555 ? 
97  AE3 5  PRO B  262 ? PRO B 259 . ? 1_555 ? 
98  AE3 5  VAL B  263 ? VAL B 260 . ? 1_555 ? 
99  AE4 1  GLY B  221 ? GLY B 218 . ? 1_555 ? 
100 AE5 5  SER A  178 ? SER A 175 . ? 1_555 ? 
101 AE5 5  LEU B  158 ? LEU B 155 . ? 1_555 ? 
102 AE5 5  TYR B  159 ? TYR B 156 . ? 1_555 ? 
103 AE5 5  TYR B  246 ? TYR B 243 . ? 1_555 ? 
104 AE5 5  GLN B  253 ? GLN B 250 . ? 1_555 ? 
105 AE6 6  VAL A  263 ? VAL A 260 . ? 1_555 ? 
106 AE6 6  SO4 O  .   ? SO4 A 411 . ? 1_555 ? 
107 AE6 6  DC  C  6   ? DC  C 6   . ? 1_555 ? 
108 AE6 6  DA  C  7   ? DA  C 7   . ? 1_555 ? 
109 AE6 6  DT  C  8   ? DT  C 8   . ? 1_555 ? 
110 AE6 6  DC  D  11  ? DC  D 11  . ? 1_555 ? 
# 
_atom_sites.entry_id                    5MMB 
_atom_sites.fract_transf_matrix[1][1]   0.006231 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006231 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008076 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
F  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . ASP A  1  12  ? -78.780 16.709 -59.946 1.00 136.53 ? 9   ASP A N     1 
ATOM   2    C  CA    . ASP A  1  12  ? -79.302 16.828 -61.302 1.00 145.86 ? 9   ASP A CA    1 
ATOM   3    C  C     . ASP A  1  12  ? -80.799 17.124 -61.309 1.00 143.49 ? 9   ASP A C     1 
ATOM   4    O  O     . ASP A  1  12  ? -81.303 17.784 -62.217 1.00 148.90 ? 9   ASP A O     1 
ATOM   5    C  CB    . ASP A  1  12  ? -79.018 15.555 -62.099 1.00 153.38 ? 9   ASP A CB    1 
ATOM   6    C  CG    . ASP A  1  12  ? -77.588 15.485 -62.592 1.00 155.16 ? 9   ASP A CG    1 
ATOM   7    O  OD1   . ASP A  1  12  ? -76.906 16.533 -62.601 1.00 152.95 ? 9   ASP A OD1   1 
ATOM   8    O  OD2   . ASP A  1  12  ? -77.150 14.384 -62.984 1.00 157.41 ? 9   ASP A OD2   1 
ATOM   9    N  N     . ALA A  1  13  ? -81.508 16.626 -60.293 1.00 137.69 ? 10  ALA A N     1 
ATOM   10   C  CA    . ALA A  1  13  ? -82.940 16.895 -60.199 1.00 134.60 ? 10  ALA A CA    1 
ATOM   11   C  C     . ALA A  1  13  ? -83.204 18.374 -59.955 1.00 136.49 ? 10  ALA A C     1 
ATOM   12   O  O     . ALA A  1  13  ? -84.115 18.958 -60.555 1.00 131.63 ? 10  ALA A O     1 
ATOM   13   C  CB    . ALA A  1  13  ? -83.564 16.048 -59.091 1.00 130.46 ? 10  ALA A CB    1 
ATOM   14   N  N     . GLU A  1  14  ? -82.416 18.993 -59.075 1.00 134.75 ? 11  GLU A N     1 
ATOM   15   C  CA    . GLU A  1  14  ? -82.545 20.424 -58.826 1.00 135.87 ? 11  GLU A CA    1 
ATOM   16   C  C     . GLU A  1  14  ? -82.256 21.225 -60.090 1.00 127.15 ? 11  GLU A C     1 
ATOM   17   O  O     . GLU A  1  14  ? -83.053 22.078 -60.499 1.00 130.11 ? 11  GLU A O     1 
ATOM   18   C  CB    . GLU A  1  14  ? -81.599 20.830 -57.696 1.00 134.03 ? 11  GLU A CB    1 
ATOM   19   C  CG    . GLU A  1  14  ? -81.846 22.205 -57.107 1.00 140.03 ? 11  GLU A CG    1 
ATOM   20   C  CD    . GLU A  1  14  ? -80.817 22.561 -56.051 1.00 144.31 ? 11  GLU A CD    1 
ATOM   21   O  OE1   . GLU A  1  14  ? -79.607 22.420 -56.330 1.00 143.80 ? 11  GLU A OE1   1 
ATOM   22   O  OE2   . GLU A  1  14  ? -81.214 22.966 -54.939 1.00 145.60 ? 11  GLU A OE2   1 
ATOM   23   N  N     . LEU A  1  15  ? -81.116 20.951 -60.729 1.00 119.65 ? 12  LEU A N     1 
ATOM   24   C  CA    . LEU A  1  15  ? -80.733 21.659 -61.945 1.00 113.32 ? 12  LEU A CA    1 
ATOM   25   C  C     . LEU A  1  15  ? -81.660 21.353 -63.114 1.00 115.19 ? 12  LEU A C     1 
ATOM   26   O  O     . LEU A  1  15  ? -81.643 22.087 -64.108 1.00 114.88 ? 12  LEU A O     1 
ATOM   27   C  CB    . LEU A  1  15  ? -79.292 21.307 -62.325 1.00 104.93 ? 12  LEU A CB    1 
ATOM   28   C  CG    . LEU A  1  15  ? -78.137 22.127 -61.739 1.00 95.98  ? 12  LEU A CG    1 
ATOM   29   C  CD1   . LEU A  1  15  ? -78.268 22.319 -60.235 1.00 93.33  ? 12  LEU A CD1   1 
ATOM   30   C  CD2   . LEU A  1  15  ? -76.808 21.466 -62.074 1.00 90.57  ? 12  LEU A CD2   1 
ATOM   31   N  N     . ASP A  1  16  ? -82.462 20.290 -63.021 1.00 117.26 ? 13  ASP A N     1 
ATOM   32   C  CA    . ASP A  1  16  ? -83.385 19.961 -64.102 1.00 123.35 ? 13  ASP A CA    1 
ATOM   33   C  C     . ASP A  1  16  ? -84.492 21.004 -64.209 1.00 130.10 ? 13  ASP A C     1 
ATOM   34   O  O     . ASP A  1  16  ? -84.749 21.543 -65.292 1.00 129.15 ? 13  ASP A O     1 
ATOM   35   C  CB    . ASP A  1  16  ? -83.975 18.567 -63.883 1.00 127.60 ? 13  ASP A CB    1 
ATOM   36   C  CG    . ASP A  1  16  ? -84.324 17.870 -65.186 1.00 131.37 ? 13  ASP A CG    1 
ATOM   37   O  OD1   . ASP A  1  16  ? -84.740 18.557 -66.142 1.00 133.94 ? 13  ASP A OD1   1 
ATOM   38   O  OD2   . ASP A  1  16  ? -84.174 16.631 -65.255 1.00 131.33 ? 13  ASP A OD2   1 
ATOM   39   N  N     . GLN A  1  17  ? -85.154 21.307 -63.089 1.00 140.17 ? 14  GLN A N     1 
ATOM   40   C  CA    . GLN A  1  17  ? -86.207 22.316 -63.092 1.00 147.39 ? 14  GLN A CA    1 
ATOM   41   C  C     . GLN A  1  17  ? -85.679 23.700 -63.438 1.00 138.85 ? 14  GLN A C     1 
ATOM   42   O  O     . GLN A  1  17  ? -86.457 24.563 -63.860 1.00 142.58 ? 14  GLN A O     1 
ATOM   43   C  CB    . GLN A  1  17  ? -86.903 22.361 -61.730 1.00 153.43 ? 14  GLN A CB    1 
ATOM   44   C  CG    . GLN A  1  17  ? -87.397 21.015 -61.232 1.00 157.93 ? 14  GLN A CG    1 
ATOM   45   C  CD    . GLN A  1  17  ? -88.365 21.149 -60.073 1.00 163.83 ? 14  GLN A CD    1 
ATOM   46   O  OE1   . GLN A  1  17  ? -89.107 22.127 -59.979 1.00 167.55 ? 14  GLN A OE1   1 
ATOM   47   N  NE2   . GLN A  1  17  ? -88.363 20.165 -59.182 1.00 164.15 ? 14  GLN A NE2   1 
ATOM   48   N  N     . LEU A  1  18  ? -84.376 23.931 -63.266 1.00 125.40 ? 15  LEU A N     1 
ATOM   49   C  CA    . LEU A  1  18  ? -83.806 25.239 -63.565 1.00 119.55 ? 15  LEU A CA    1 
ATOM   50   C  C     . LEU A  1  18  ? -83.748 25.489 -65.068 1.00 123.12 ? 15  LEU A C     1 
ATOM   51   O  O     . LEU A  1  18  ? -83.956 26.618 -65.523 1.00 126.55 ? 15  LEU A O     1 
ATOM   52   C  CB    . LEU A  1  18  ? -82.413 25.348 -62.944 1.00 110.73 ? 15  LEU A CB    1 
ATOM   53   C  CG    . LEU A  1  18  ? -81.808 26.737 -62.744 1.00 106.62 ? 15  LEU A CG    1 
ATOM   54   C  CD1   . LEU A  1  18  ? -82.514 27.476 -61.617 1.00 107.25 ? 15  LEU A CD1   1 
ATOM   55   C  CD2   . LEU A  1  18  ? -80.321 26.617 -62.464 1.00 103.23 ? 15  LEU A CD2   1 
ATOM   56   N  N     . LEU A  1  19  ? -83.473 24.445 -65.855 1.00 122.11 ? 16  LEU A N     1 
ATOM   57   C  CA    . LEU A  1  19  ? -83.311 24.618 -67.295 1.00 122.95 ? 16  LEU A CA    1 
ATOM   58   C  C     . LEU A  1  19  ? -84.634 24.959 -67.968 1.00 129.35 ? 16  LEU A C     1 
ATOM   59   O  O     . LEU A  1  19  ? -84.664 25.732 -68.935 1.00 129.55 ? 16  LEU A O     1 
ATOM   60   C  CB    . LEU A  1  19  ? -82.710 23.357 -67.908 1.00 120.99 ? 16  LEU A CB    1 
ATOM   61   C  CG    . LEU A  1  19  ? -81.222 23.087 -67.663 1.00 118.60 ? 16  LEU A CG    1 
ATOM   62   C  CD1   . LEU A  1  19  ? -80.798 21.819 -68.383 1.00 117.71 ? 16  LEU A CD1   1 
ATOM   63   C  CD2   . LEU A  1  19  ? -80.391 24.273 -68.121 1.00 117.08 ? 16  LEU A CD2   1 
ATOM   64   N  N     . GLN A  1  20  ? -85.736 24.396 -67.477 1.00 132.47 ? 17  GLN A N     1 
ATOM   65   C  CA    . GLN A  1  20  ? -87.027 24.641 -68.101 1.00 138.46 ? 17  GLN A CA    1 
ATOM   66   C  C     . GLN A  1  20  ? -87.607 26.000 -67.735 1.00 134.00 ? 17  GLN A C     1 
ATOM   67   O  O     . GLN A  1  20  ? -88.452 26.513 -68.476 1.00 139.58 ? 17  GLN A O     1 
ATOM   68   C  CB    . GLN A  1  20  ? -88.011 23.529 -67.731 1.00 144.03 ? 17  GLN A CB    1 
ATOM   69   C  CG    . GLN A  1  20  ? -88.078 23.204 -66.250 1.00 146.10 ? 17  GLN A CG    1 
ATOM   70   C  CD    . GLN A  1  20  ? -88.683 21.840 -65.982 1.00 150.90 ? 17  GLN A CD    1 
ATOM   71   O  OE1   . GLN A  1  20  ? -89.711 21.724 -65.316 1.00 156.82 ? 17  GLN A OE1   1 
ATOM   72   N  NE2   . GLN A  1  20  ? -88.042 20.796 -66.495 1.00 145.76 ? 17  GLN A NE2   1 
ATOM   73   N  N     . GLY A  1  21  ? -87.174 26.597 -66.628 1.00 125.26 ? 18  GLY A N     1 
ATOM   74   C  CA    . GLY A  1  21  ? -87.625 27.922 -66.241 1.00 117.57 ? 18  GLY A CA    1 
ATOM   75   C  C     . GLY A  1  21  ? -88.267 28.012 -64.873 1.00 117.47 ? 18  GLY A C     1 
ATOM   76   O  O     . GLY A  1  21  ? -88.696 29.108 -64.485 1.00 117.26 ? 18  GLY A O     1 
ATOM   77   N  N     . HIS A  1  22  ? -88.368 26.920 -64.117 1.00 115.52 ? 19  HIS A N     1 
ATOM   78   C  CA    . HIS A  1  22  ? -88.938 26.988 -62.782 1.00 121.24 ? 19  HIS A CA    1 
ATOM   79   C  C     . HIS A  1  22  ? -87.964 27.663 -61.817 1.00 121.22 ? 19  HIS A C     1 
ATOM   80   O  O     . HIS A  1  22  ? -86.752 27.713 -62.045 1.00 119.29 ? 19  HIS A O     1 
ATOM   81   C  CB    . HIS A  1  22  ? -89.299 25.590 -62.276 1.00 122.17 ? 19  HIS A CB    1 
ATOM   82   C  CG    . HIS A  1  22  ? -90.534 25.020 -62.902 1.00 132.55 ? 19  HIS A CG    1 
ATOM   83   N  ND1   . HIS A  1  22  ? -91.490 25.805 -63.511 1.00 138.56 ? 19  HIS A ND1   1 
ATOM   84   C  CD2   . HIS A  1  22  ? -90.971 23.743 -63.011 1.00 136.38 ? 19  HIS A CD2   1 
ATOM   85   C  CE1   . HIS A  1  22  ? -92.463 25.037 -63.968 1.00 140.46 ? 19  HIS A CE1   1 
ATOM   86   N  NE2   . HIS A  1  22  ? -92.172 23.781 -63.678 1.00 140.56 ? 19  HIS A NE2   1 
ATOM   87   N  N     . TYR A  1  23  ? -88.514 28.186 -60.724 1.00 120.61 ? 20  TYR A N     1 
ATOM   88   C  CA    . TYR A  1  23  ? -87.731 28.901 -59.726 1.00 114.50 ? 20  TYR A CA    1 
ATOM   89   C  C     . TYR A  1  23  ? -87.266 27.959 -58.623 1.00 113.40 ? 20  TYR A C     1 
ATOM   90   O  O     . TYR A  1  23  ? -88.011 27.078 -58.185 1.00 115.01 ? 20  TYR A O     1 
ATOM   91   C  CB    . TYR A  1  23  ? -88.545 30.047 -59.121 1.00 114.55 ? 20  TYR A CB    1 
ATOM   92   C  CG    . TYR A  1  23  ? -87.937 30.640 -57.868 1.00 117.80 ? 20  TYR A CG    1 
ATOM   93   C  CD1   . TYR A  1  23  ? -86.888 31.548 -57.945 1.00 120.70 ? 20  TYR A CD1   1 
ATOM   94   C  CD2   . TYR A  1  23  ? -88.412 30.293 -56.609 1.00 110.67 ? 20  TYR A CD2   1 
ATOM   95   C  CE1   . TYR A  1  23  ? -86.329 32.091 -56.803 1.00 118.49 ? 20  TYR A CE1   1 
ATOM   96   C  CE2   . TYR A  1  23  ? -87.859 30.830 -55.463 1.00 111.47 ? 20  TYR A CE2   1 
ATOM   97   C  CZ    . TYR A  1  23  ? -86.818 31.728 -55.565 1.00 115.91 ? 20  TYR A CZ    1 
ATOM   98   O  OH    . TYR A  1  23  ? -86.266 32.266 -54.426 1.00 111.03 ? 20  TYR A OH    1 
ATOM   99   N  N     . ILE A  1  24  ? -86.026 28.153 -58.179 1.00 110.16 ? 21  ILE A N     1 
ATOM   100  C  CA    . ILE A  1  24  ? -85.449 27.414 -57.063 1.00 109.63 ? 21  ILE A CA    1 
ATOM   101  C  C     . ILE A  1  24  ? -84.780 28.420 -56.137 1.00 103.24 ? 21  ILE A C     1 
ATOM   102  O  O     . ILE A  1  24  ? -84.012 29.273 -56.597 1.00 100.53 ? 21  ILE A O     1 
ATOM   103  C  CB    . ILE A  1  24  ? -84.437 26.348 -57.531 1.00 107.00 ? 21  ILE A CB    1 
ATOM   104  C  CG1   . ILE A  1  24  ? -85.137 25.226 -58.303 1.00 111.01 ? 21  ILE A CG1   1 
ATOM   105  C  CG2   . ILE A  1  24  ? -83.676 25.774 -56.346 1.00 100.32 ? 21  ILE A CG2   1 
ATOM   106  C  CD1   . ILE A  1  24  ? -85.201 25.444 -59.801 1.00 115.07 ? 21  ILE A CD1   1 
ATOM   107  N  N     . LYS A  1  25  ? -85.077 28.326 -54.840 1.00 101.65 ? 22  LYS A N     1 
ATOM   108  C  CA    . LYS A  1  25  ? -84.545 29.282 -53.874 1.00 100.26 ? 22  LYS A CA    1 
ATOM   109  C  C     . LYS A  1  25  ? -83.023 29.279 -53.888 1.00 99.60  ? 22  LYS A C     1 
ATOM   110  O  O     . LYS A  1  25  ? -82.388 28.223 -53.823 1.00 95.92  ? 22  LYS A O     1 
ATOM   111  C  CB    . LYS A  1  25  ? -85.054 28.967 -52.466 1.00 101.89 ? 22  LYS A CB    1 
ATOM   112  C  CG    . LYS A  1  25  ? -84.443 29.863 -51.395 1.00 103.65 ? 22  LYS A CG    1 
ATOM   113  C  CD    . LYS A  1  25  ? -84.891 29.485 -49.993 1.00 110.48 ? 22  LYS A CD    1 
ATOM   114  C  CE    . LYS A  1  25  ? -84.257 30.408 -48.961 1.00 111.42 ? 22  LYS A CE    1 
ATOM   115  N  NZ    . LYS A  1  25  ? -84.674 30.079 -47.570 1.00 111.70 ? 22  LYS A NZ    1 
ATOM   116  N  N     . GLY A  1  26  ? -82.440 30.477 -53.962 1.00 97.67  ? 23  GLY A N     1 
ATOM   117  C  CA    . GLY A  1  26  ? -81.015 30.665 -54.079 1.00 95.25  ? 23  GLY A CA    1 
ATOM   118  C  C     . GLY A  1  26  ? -80.564 31.041 -55.476 1.00 95.20  ? 23  GLY A C     1 
ATOM   119  O  O     . GLY A  1  26  ? -79.565 31.755 -55.625 1.00 95.27  ? 23  GLY A O     1 
ATOM   120  N  N     . TYR A  1  27  ? -81.280 30.581 -56.500 1.00 93.39  ? 24  TYR A N     1 
ATOM   121  C  CA    . TYR A  1  27  ? -80.953 30.896 -57.882 1.00 88.03  ? 24  TYR A CA    1 
ATOM   122  C  C     . TYR A  1  27  ? -81.785 32.089 -58.323 1.00 93.06  ? 24  TYR A C     1 
ATOM   123  O  O     . TYR A  1  27  ? -83.007 31.950 -58.490 1.00 96.43  ? 24  TYR A O     1 
ATOM   124  C  CB    . TYR A  1  27  ? -81.220 29.695 -58.785 1.00 84.99  ? 24  TYR A CB    1 
ATOM   125  C  CG    . TYR A  1  27  ? -80.416 28.466 -58.420 1.00 85.97  ? 24  TYR A CG    1 
ATOM   126  C  CD1   . TYR A  1  27  ? -80.842 27.603 -57.418 1.00 87.49  ? 24  TYR A CD1   1 
ATOM   127  C  CD2   . TYR A  1  27  ? -79.230 28.168 -59.079 1.00 86.85  ? 24  TYR A CD2   1 
ATOM   128  C  CE1   . TYR A  1  27  ? -80.110 26.482 -57.080 1.00 87.16  ? 24  TYR A CE1   1 
ATOM   129  C  CE2   . TYR A  1  27  ? -78.492 27.048 -58.749 1.00 85.60  ? 24  TYR A CE2   1 
ATOM   130  C  CZ    . TYR A  1  27  ? -78.937 26.209 -57.749 1.00 89.73  ? 24  TYR A CZ    1 
ATOM   131  O  OH    . TYR A  1  27  ? -78.206 25.093 -57.416 1.00 92.95  ? 24  TYR A OH    1 
ATOM   132  N  N     . PRO A  1  28  ? -81.190 33.268 -58.516 1.00 93.06  ? 25  PRO A N     1 
ATOM   133  C  CA    . PRO A  1  28  ? -81.983 34.440 -58.906 1.00 95.03  ? 25  PRO A CA    1 
ATOM   134  C  C     . PRO A  1  28  ? -82.691 34.222 -60.236 1.00 98.34  ? 25  PRO A C     1 
ATOM   135  O  O     . PRO A  1  28  ? -82.142 33.627 -61.166 1.00 84.84  ? 25  PRO A O     1 
ATOM   136  C  CB    . PRO A  1  28  ? -80.941 35.563 -58.992 1.00 89.16  ? 25  PRO A CB    1 
ATOM   137  C  CG    . PRO A  1  28  ? -79.627 34.865 -59.134 1.00 83.21  ? 25  PRO A CG    1 
ATOM   138  C  CD    . PRO A  1  28  ? -79.760 33.585 -58.373 1.00 88.12  ? 25  PRO A CD    1 
ATOM   139  N  N     . LYS A  1  29  ? -83.926 34.718 -60.314 1.00 108.65 ? 26  LYS A N     1 
ATOM   140  C  CA    . LYS A  1  29  ? -84.799 34.433 -61.447 1.00 116.92 ? 26  LYS A CA    1 
ATOM   141  C  C     . LYS A  1  29  ? -84.422 35.222 -62.697 1.00 117.70 ? 26  LYS A C     1 
ATOM   142  O  O     . LYS A  1  29  ? -84.607 34.727 -63.815 1.00 117.99 ? 26  LYS A O     1 
ATOM   143  C  CB    . LYS A  1  29  ? -86.251 34.722 -61.055 1.00 122.37 ? 26  LYS A CB    1 
ATOM   144  C  CG    . LYS A  1  29  ? -87.257 34.703 -62.196 1.00 131.88 ? 26  LYS A CG    1 
ATOM   145  C  CD    . LYS A  1  29  ? -87.494 33.298 -62.719 1.00 130.96 ? 26  LYS A CD    1 
ATOM   146  C  CE    . LYS A  1  29  ? -88.627 33.285 -63.733 1.00 129.55 ? 26  LYS A CE    1 
ATOM   147  N  NZ    . LYS A  1  29  ? -89.012 31.905 -64.136 1.00 130.84 ? 26  LYS A NZ    1 
ATOM   148  N  N     . GLN A  1  30  ? -83.886 36.429 -62.537 1.00 117.95 ? 27  GLN A N     1 
ATOM   149  C  CA    . GLN A  1  30  ? -83.636 37.312 -63.678 1.00 123.12 ? 27  GLN A CA    1 
ATOM   150  C  C     . GLN A  1  30  ? -82.457 36.874 -64.557 1.00 113.72 ? 27  GLN A C     1 
ATOM   151  O  O     . GLN A  1  30  ? -82.077 37.653 -65.441 1.00 110.17 ? 27  GLN A O     1 
ATOM   152  C  CB    . GLN A  1  30  ? -83.409 38.743 -63.188 1.00 126.22 ? 27  GLN A CB    1 
ATOM   153  C  CG    . GLN A  1  30  ? -82.360 38.870 -62.098 1.00 123.53 ? 27  GLN A CG    1 
ATOM   154  C  CD    . GLN A  1  30  ? -81.912 40.303 -61.895 1.00 127.84 ? 27  GLN A CD    1 
ATOM   155  O  OE1   . GLN A  1  30  ? -81.956 41.114 -62.820 1.00 132.10 ? 27  GLN A OE1   1 
ATOM   156  N  NE2   . GLN A  1  30  ? -81.480 40.624 -60.682 1.00 127.20 ? 27  GLN A NE2   1 
ATOM   157  N  N     . TYR A  1  31  ? -81.865 35.697 -64.375 1.00 110.88 ? 28  TYR A N     1 
ATOM   158  C  CA    . TYR A  1  31  ? -80.800 35.213 -65.238 1.00 109.63 ? 28  TYR A CA    1 
ATOM   159  C  C     . TYR A  1  31  ? -81.295 34.029 -66.060 1.00 111.83 ? 28  TYR A C     1 
ATOM   160  O  O     . TYR A  1  31  ? -82.177 33.281 -65.631 1.00 112.67 ? 28  TYR A O     1 
ATOM   161  C  CB    . TYR A  1  31  ? -79.569 34.798 -64.422 1.00 107.68 ? 28  TYR A CB    1 
ATOM   162  C  CG    . TYR A  1  31  ? -78.869 35.948 -63.735 1.00 105.45 ? 28  TYR A CG    1 
ATOM   163  C  CD1   . TYR A  1  31  ? -77.843 36.639 -64.368 1.00 105.86 ? 28  TYR A CD1   1 
ATOM   164  C  CD2   . TYR A  1  31  ? -79.231 36.340 -62.454 1.00 104.45 ? 28  TYR A CD2   1 
ATOM   165  C  CE1   . TYR A  1  31  ? -77.200 37.689 -63.744 1.00 109.78 ? 28  TYR A CE1   1 
ATOM   166  C  CE2   . TYR A  1  31  ? -78.594 37.390 -61.822 1.00 105.40 ? 28  TYR A CE2   1 
ATOM   167  C  CZ    . TYR A  1  31  ? -77.579 38.060 -62.472 1.00 108.61 ? 28  TYR A CZ    1 
ATOM   168  O  OH    . TYR A  1  31  ? -76.941 39.105 -61.847 1.00 106.29 ? 28  TYR A OH    1 
ATOM   169  N  N     . THR A  1  32  ? -80.722 33.866 -67.249 1.00 114.94 ? 29  THR A N     1 
ATOM   170  C  CA    . THR A  1  32  ? -81.073 32.756 -68.124 1.00 124.01 ? 29  THR A CA    1 
ATOM   171  C  C     . THR A  1  32  ? -80.094 31.609 -67.901 1.00 115.54 ? 29  THR A C     1 
ATOM   172  O  O     . THR A  1  32  ? -78.893 31.750 -68.160 1.00 106.74 ? 29  THR A O     1 
ATOM   173  C  CB    . THR A  1  32  ? -81.076 33.187 -69.592 1.00 122.05 ? 29  THR A CB    1 
ATOM   174  O  OG1   . THR A  1  32  ? -79.798 33.739 -69.938 1.00 122.57 ? 29  THR A OG1   1 
ATOM   175  C  CG2   . THR A  1  32  ? -82.163 34.220 -69.839 1.00 116.42 ? 29  THR A CG2   1 
ATOM   176  N  N     . TYR A  1  33  ? -80.609 30.483 -67.410 1.00 111.57 ? 30  TYR A N     1 
ATOM   177  C  CA    . TYR A  1  33  ? -79.824 29.273 -67.197 1.00 94.76  ? 30  TYR A CA    1 
ATOM   178  C  C     . TYR A  1  33  ? -80.074 28.329 -68.369 1.00 101.36 ? 30  TYR A C     1 
ATOM   179  O  O     . TYR A  1  33  ? -81.219 27.936 -68.615 1.00 109.55 ? 30  TYR A O     1 
ATOM   180  C  CB    . TYR A  1  33  ? -80.198 28.589 -65.880 1.00 86.75  ? 30  TYR A CB    1 
ATOM   181  C  CG    . TYR A  1  33  ? -80.295 29.499 -64.670 1.00 87.73  ? 30  TYR A CG    1 
ATOM   182  C  CD1   . TYR A  1  33  ? -81.479 30.160 -64.366 1.00 89.82  ? 30  TYR A CD1   1 
ATOM   183  C  CD2   . TYR A  1  33  ? -79.213 29.671 -63.814 1.00 83.64  ? 30  TYR A CD2   1 
ATOM   184  C  CE1   . TYR A  1  33  ? -81.577 30.981 -63.259 1.00 87.34  ? 30  TYR A CE1   1 
ATOM   185  C  CE2   . TYR A  1  33  ? -79.303 30.488 -62.703 1.00 82.22  ? 30  TYR A CE2   1 
ATOM   186  C  CZ    . TYR A  1  33  ? -80.486 31.141 -62.431 1.00 85.31  ? 30  TYR A CZ    1 
ATOM   187  O  OH    . TYR A  1  33  ? -80.578 31.955 -61.327 1.00 85.70  ? 30  TYR A OH    1 
ATOM   188  N  N     . PHE A  1  34  ? -79.013 27.965 -69.087 1.00 98.00  ? 31  PHE A N     1 
ATOM   189  C  CA    . PHE A  1  34  ? -79.126 27.126 -70.274 1.00 98.91  ? 31  PHE A CA    1 
ATOM   190  C  C     . PHE A  1  34  ? -78.185 25.933 -70.155 1.00 106.18 ? 31  PHE A C     1 
ATOM   191  O  O     . PHE A  1  34  ? -77.391 25.831 -69.216 1.00 105.63 ? 31  PHE A O     1 
ATOM   192  C  CB    . PHE A  1  34  ? -78.825 27.921 -71.552 1.00 99.87  ? 31  PHE A CB    1 
ATOM   193  C  CG    . PHE A  1  34  ? -77.428 28.473 -71.610 1.00 95.52  ? 31  PHE A CG    1 
ATOM   194  C  CD1   . PHE A  1  34  ? -77.133 29.698 -71.038 1.00 96.96  ? 31  PHE A CD1   1 
ATOM   195  C  CD2   . PHE A  1  34  ? -76.411 27.770 -72.237 1.00 92.85  ? 31  PHE A CD2   1 
ATOM   196  C  CE1   . PHE A  1  34  ? -75.852 30.212 -71.085 1.00 93.27  ? 31  PHE A CE1   1 
ATOM   197  C  CE2   . PHE A  1  34  ? -75.127 28.278 -72.287 1.00 90.56  ? 31  PHE A CE2   1 
ATOM   198  C  CZ    . PHE A  1  34  ? -74.848 29.501 -71.711 1.00 89.29  ? 31  PHE A CZ    1 
ATOM   199  N  N     . LEU A  1  35  ? -78.279 25.023 -71.123 1.00 111.97 ? 32  LEU A N     1 
ATOM   200  C  CA    . LEU A  1  35  ? -77.433 23.838 -71.195 1.00 109.53 ? 32  LEU A CA    1 
ATOM   201  C  C     . LEU A  1  35  ? -76.505 23.939 -72.399 1.00 103.19 ? 32  LEU A C     1 
ATOM   202  O  O     . LEU A  1  35  ? -76.891 24.455 -73.450 1.00 108.26 ? 32  LEU A O     1 
ATOM   203  C  CB    . LEU A  1  35  ? -78.280 22.564 -71.290 1.00 114.07 ? 32  LEU A CB    1 
ATOM   204  C  CG    . LEU A  1  35  ? -77.536 21.225 -71.251 1.00 114.65 ? 32  LEU A CG    1 
ATOM   205  C  CD1   . LEU A  1  35  ? -78.304 20.203 -70.432 1.00 114.36 ? 32  LEU A CD1   1 
ATOM   206  C  CD2   . LEU A  1  35  ? -77.285 20.691 -72.653 1.00 114.48 ? 32  LEU A CD2   1 
ATOM   207  N  N     . GLU A  1  36  ? -75.285 23.430 -72.253 1.00 97.24  ? 33  GLU A N     1 
ATOM   208  C  CA    . GLU A  1  36  ? -74.275 23.550 -73.295 1.00 99.63  ? 33  GLU A CA    1 
ATOM   209  C  C     . GLU A  1  36  ? -73.157 22.588 -72.960 1.00 105.52 ? 33  GLU A C     1 
ATOM   210  O  O     . GLU A  1  36  ? -72.628 22.631 -71.845 1.00 103.62 ? 33  GLU A O     1 
ATOM   211  C  CB    . GLU A  1  36  ? -73.729 24.983 -73.386 1.00 97.89  ? 33  GLU A CB    1 
ATOM   212  C  CG    . GLU A  1  36  ? -72.566 25.175 -74.347 1.00 105.17 ? 33  GLU A CG    1 
ATOM   213  C  CD    . GLU A  1  36  ? -72.244 26.641 -74.553 1.00 113.27 ? 33  GLU A CD    1 
ATOM   214  O  OE1   . GLU A  1  36  ? -73.154 27.406 -74.941 1.00 115.85 ? 33  GLU A OE1   1 
ATOM   215  O  OE2   . GLU A  1  36  ? -71.083 27.030 -74.316 1.00 113.96 ? 33  GLU A OE2   1 
ATOM   216  N  N     . ASP A  1  37  ? -72.811 21.725 -73.918 1.00 110.75 ? 34  ASP A N     1 
ATOM   217  C  CA    . ASP A  1  37  ? -71.762 20.714 -73.767 1.00 115.91 ? 34  ASP A CA    1 
ATOM   218  C  C     . ASP A  1  37  ? -72.054 19.759 -72.614 1.00 110.56 ? 34  ASP A C     1 
ATOM   219  O  O     . ASP A  1  37  ? -71.134 19.238 -71.982 1.00 106.53 ? 34  ASP A O     1 
ATOM   220  C  CB    . ASP A  1  37  ? -70.382 21.356 -73.587 1.00 122.03 ? 34  ASP A CB    1 
ATOM   221  C  CG    . ASP A  1  37  ? -69.856 21.984 -74.864 1.00 126.06 ? 34  ASP A CG    1 
ATOM   222  O  OD1   . ASP A  1  37  ? -69.833 21.297 -75.907 1.00 128.58 ? 34  ASP A OD1   1 
ATOM   223  O  OD2   . ASP A  1  37  ? -69.460 23.168 -74.820 1.00 124.03 ? 34  ASP A OD2   1 
ATOM   224  N  N     . GLY A  1  38  ? -73.334 19.525 -72.335 1.00 110.16 ? 35  GLY A N     1 
ATOM   225  C  CA    . GLY A  1  38  ? -73.706 18.662 -71.230 1.00 111.44 ? 35  GLY A CA    1 
ATOM   226  C  C     . GLY A  1  38  ? -73.462 19.263 -69.864 1.00 109.54 ? 35  GLY A C     1 
ATOM   227  O  O     . GLY A  1  38  ? -73.270 18.522 -68.895 1.00 108.65 ? 35  GLY A O     1 
ATOM   228  N  N     . LYS A  1  39  ? -73.458 20.590 -69.762 1.00 102.10 ? 36  LYS A N     1 
ATOM   229  C  CA    . LYS A  1  39  ? -73.209 21.275 -68.503 1.00 91.88  ? 36  LYS A CA    1 
ATOM   230  C  C     . LYS A  1  39  ? -74.207 22.412 -68.338 1.00 91.37  ? 36  LYS A C     1 
ATOM   231  O  O     . LYS A  1  39  ? -74.453 23.174 -69.281 1.00 97.80  ? 36  LYS A O     1 
ATOM   232  C  CB    . LYS A  1  39  ? -71.779 21.824 -68.428 1.00 89.34  ? 36  LYS A CB    1 
ATOM   233  C  CG    . LYS A  1  39  ? -70.690 20.764 -68.523 1.00 91.38  ? 36  LYS A CG    1 
ATOM   234  C  CD    . LYS A  1  39  ? -69.305 21.389 -68.479 1.00 91.01  ? 36  LYS A CD    1 
ATOM   235  C  CE    . LYS A  1  39  ? -68.217 20.327 -68.478 1.00 96.47  ? 36  LYS A CE    1 
ATOM   236  N  NZ    . LYS A  1  39  ? -66.856 20.925 -68.383 1.00 95.03  ? 36  LYS A NZ    1 
ATOM   237  N  N     . VAL A  1  40  ? -74.775 22.528 -67.139 1.00 85.59  ? 37  VAL A N     1 
ATOM   238  C  CA    . VAL A  1  40  ? -75.658 23.648 -66.837 1.00 84.76  ? 37  VAL A CA    1 
ATOM   239  C  C     . VAL A  1  40  ? -74.825 24.906 -66.641 1.00 87.11  ? 37  VAL A C     1 
ATOM   240  O  O     . VAL A  1  40  ? -73.850 24.918 -65.874 1.00 86.53  ? 37  VAL A O     1 
ATOM   241  C  CB    . VAL A  1  40  ? -76.514 23.339 -65.600 1.00 83.11  ? 37  VAL A CB    1 
ATOM   242  C  CG1   . VAL A  1  40  ? -77.512 24.461 -65.349 1.00 84.48  ? 37  VAL A CG1   1 
ATOM   243  C  CG2   . VAL A  1  40  ? -77.233 22.003 -65.769 1.00 79.44  ? 37  VAL A CG2   1 
ATOM   244  N  N     . LYS A  1  41  ? -75.204 25.981 -67.328 1.00 89.32  ? 38  LYS A N     1 
ATOM   245  C  CA    . LYS A  1  41  ? -74.457 27.229 -67.295 1.00 87.19  ? 38  LYS A CA    1 
ATOM   246  C  C     . LYS A  1  41  ? -75.400 28.396 -67.029 1.00 89.10  ? 38  LYS A C     1 
ATOM   247  O  O     . LYS A  1  41  ? -76.626 28.255 -67.040 1.00 97.05  ? 38  LYS A O     1 
ATOM   248  C  CB    . LYS A  1  41  ? -73.686 27.451 -68.606 1.00 86.57  ? 38  LYS A CB    1 
ATOM   249  C  CG    . LYS A  1  41  ? -72.657 26.371 -68.916 1.00 85.92  ? 38  LYS A CG    1 
ATOM   250  C  CD    . LYS A  1  41  ? -71.855 26.701 -70.167 1.00 89.85  ? 38  LYS A CD    1 
ATOM   251  C  CE    . LYS A  1  41  ? -70.836 25.612 -70.468 1.00 91.56  ? 38  LYS A CE    1 
ATOM   252  N  NZ    . LYS A  1  41  ? -70.052 25.896 -71.702 1.00 87.71  ? 38  LYS A NZ    1 
ATOM   253  N  N     . VAL A  1  42  ? -74.806 29.565 -66.785 1.00 87.06  ? 39  VAL A N     1 
ATOM   254  C  CA    . VAL A  1  42  ? -75.557 30.786 -66.518 1.00 85.37  ? 39  VAL A CA    1 
ATOM   255  C  C     . VAL A  1  42  ? -74.726 31.967 -67.000 1.00 85.11  ? 39  VAL A C     1 
ATOM   256  O  O     . VAL A  1  42  ? -73.493 31.938 -66.963 1.00 79.29  ? 39  VAL A O     1 
ATOM   257  C  CB    . VAL A  1  42  ? -75.920 30.915 -65.017 1.00 81.46  ? 39  VAL A CB    1 
ATOM   258  C  CG1   . VAL A  1  42  ? -74.665 30.960 -64.160 1.00 72.80  ? 39  VAL A CG1   1 
ATOM   259  C  CG2   . VAL A  1  42  ? -76.796 32.141 -64.767 1.00 77.28  ? 39  VAL A CG2   1 
ATOM   260  N  N     . SER A  1  43  ? -75.412 33.008 -67.471 1.00 97.00  ? 40  SER A N     1 
ATOM   261  C  CA    . SER A  1  43  ? -74.769 34.204 -68.018 1.00 103.26 ? 40  SER A CA    1 
ATOM   262  C  C     . SER A  1  43  ? -74.778 35.291 -66.948 1.00 107.61 ? 40  SER A C     1 
ATOM   263  O  O     . SER A  1  43  ? -75.699 36.104 -66.868 1.00 116.03 ? 40  SER A O     1 
ATOM   264  C  CB    . SER A  1  43  ? -75.475 34.663 -69.289 1.00 105.62 ? 40  SER A CB    1 
ATOM   265  O  OG    . SER A  1  43  ? -74.965 35.910 -69.733 1.00 110.61 ? 40  SER A OG    1 
ATOM   266  N  N     . ARG A  1  44  ? -73.733 35.309 -66.127 1.00 104.30 ? 41  ARG A N     1 
ATOM   267  C  CA    . ARG A  1  44  ? -73.593 36.309 -65.082 1.00 104.09 ? 41  ARG A CA    1 
ATOM   268  C  C     . ARG A  1  44  ? -72.803 37.508 -65.595 1.00 105.67 ? 41  ARG A C     1 
ATOM   269  O  O     . ARG A  1  44  ? -72.120 37.419 -66.620 1.00 107.26 ? 41  ARG A O     1 
ATOM   270  C  CB    . ARG A  1  44  ? -72.913 35.693 -63.860 1.00 100.68 ? 41  ARG A CB    1 
ATOM   271  C  CG    . ARG A  1  44  ? -73.768 34.644 -63.171 1.00 101.39 ? 41  ARG A CG    1 
ATOM   272  C  CD    . ARG A  1  44  ? -73.338 34.410 -61.736 1.00 98.63  ? 41  ARG A CD    1 
ATOM   273  N  NE    . ARG A  1  44  ? -73.511 35.592 -60.895 1.00 97.01  ? 41  ARG A NE    1 
ATOM   274  C  CZ    . ARG A  1  44  ? -74.673 35.977 -60.373 1.00 97.04  ? 41  ARG A CZ    1 
ATOM   275  N  NH1   . ARG A  1  44  ? -75.776 35.280 -60.612 1.00 95.29  ? 41  ARG A NH1   1 
ATOM   276  N  NH2   . ARG A  1  44  ? -74.734 37.064 -59.616 1.00 96.04  ? 41  ARG A NH2   1 
ATOM   277  N  N     . PRO A  1  45  ? -72.903 38.660 -64.916 1.00 105.55 ? 42  PRO A N     1 
ATOM   278  C  CA    . PRO A  1  45  ? -72.182 39.858 -65.388 1.00 104.67 ? 42  PRO A CA    1 
ATOM   279  C  C     . PRO A  1  45  ? -70.705 39.629 -65.664 1.00 103.96 ? 42  PRO A C     1 
ATOM   280  O  O     . PRO A  1  45  ? -70.182 40.128 -66.666 1.00 106.10 ? 42  PRO A O     1 
ATOM   281  C  CB    . PRO A  1  45  ? -72.393 40.854 -64.241 1.00 102.06 ? 42  PRO A CB    1 
ATOM   282  C  CG    . PRO A  1  45  ? -73.696 40.465 -63.656 1.00 99.51  ? 42  PRO A CG    1 
ATOM   283  C  CD    . PRO A  1  45  ? -73.784 38.968 -63.772 1.00 98.96  ? 42  PRO A CD    1 
ATOM   284  N  N     . GLU A  1  46  ? -70.021 38.874 -64.803 1.00 104.47 ? 43  GLU A N     1 
ATOM   285  C  CA    . GLU A  1  46  ? -68.597 38.622 -64.986 1.00 107.21 ? 43  GLU A CA    1 
ATOM   286  C  C     . GLU A  1  46  ? -68.320 37.711 -66.175 1.00 106.59 ? 43  GLU A C     1 
ATOM   287  O  O     . GLU A  1  46  ? -67.195 37.702 -66.684 1.00 111.27 ? 43  GLU A O     1 
ATOM   288  C  CB    . GLU A  1  46  ? -68.006 38.010 -63.713 1.00 113.65 ? 43  GLU A CB    1 
ATOM   289  C  CG    . GLU A  1  46  ? -68.431 38.702 -62.420 1.00 121.33 ? 43  GLU A CG    1 
ATOM   290  C  CD    . GLU A  1  46  ? -69.811 38.275 -61.946 1.00 129.06 ? 43  GLU A CD    1 
ATOM   291  O  OE1   . GLU A  1  46  ? -70.172 37.096 -62.147 1.00 128.66 ? 43  GLU A OE1   1 
ATOM   292  O  OE2   . GLU A  1  46  ? -70.538 39.123 -61.388 1.00 130.41 ? 43  GLU A OE2   1 
ATOM   293  N  N     . GLY A  1  47  ? -69.310 36.958 -66.623 1.00 103.32 ? 44  GLY A N     1 
ATOM   294  C  CA    . GLY A  1  47  ? -69.138 36.046 -67.733 1.00 97.02  ? 44  GLY A CA    1 
ATOM   295  C  C     . GLY A  1  47  ? -70.041 34.841 -67.563 1.00 94.38  ? 44  GLY A C     1 
ATOM   296  O  O     . GLY A  1  47  ? -70.938 34.826 -66.725 1.00 103.30 ? 44  GLY A O     1 
ATOM   297  N  N     . VAL A  1  48  ? -69.781 33.828 -68.381 1.00 85.09  ? 45  VAL A N     1 
ATOM   298  C  CA    . VAL A  1  48  ? -70.535 32.580 -68.341 1.00 77.92  ? 45  VAL A CA    1 
ATOM   299  C  C     . VAL A  1  48  ? -69.819 31.605 -67.418 1.00 77.48  ? 45  VAL A C     1 
ATOM   300  O  O     . VAL A  1  48  ? -68.624 31.336 -67.589 1.00 85.25  ? 45  VAL A O     1 
ATOM   301  C  CB    . VAL A  1  48  ? -70.699 31.991 -69.750 1.00 75.70  ? 45  VAL A CB    1 
ATOM   302  C  CG1   . VAL A  1  48  ? -71.484 30.688 -69.692 1.00 73.08  ? 45  VAL A CG1   1 
ATOM   303  C  CG2   . VAL A  1  48  ? -71.384 32.993 -70.668 1.00 74.82  ? 45  VAL A CG2   1 
ATOM   304  N  N     . LYS A  1  49  ? -70.548 31.075 -66.440 1.00 76.57  ? 46  LYS A N     1 
ATOM   305  C  CA    . LYS A  1  49  ? -69.998 30.141 -65.472 1.00 75.02  ? 46  LYS A CA    1 
ATOM   306  C  C     . LYS A  1  49  ? -70.780 28.834 -65.499 1.00 82.89  ? 46  LYS A C     1 
ATOM   307  O  O     . LYS A  1  49  ? -71.953 28.789 -65.882 1.00 82.54  ? 46  LYS A O     1 
ATOM   308  C  CB    . LYS A  1  49  ? -70.018 30.733 -64.057 1.00 68.13  ? 46  LYS A CB    1 
ATOM   309  C  CG    . LYS A  1  49  ? -69.401 32.120 -63.954 1.00 64.91  ? 46  LYS A CG    1 
ATOM   310  C  CD    . LYS A  1  49  ? -67.903 32.102 -64.218 1.00 63.14  ? 46  LYS A CD    1 
ATOM   311  C  CE    . LYS A  1  49  ? -67.324 33.510 -64.168 1.00 72.66  ? 46  LYS A CE    1 
ATOM   312  N  NZ    . LYS A  1  49  ? -65.839 33.507 -64.286 1.00 68.24  ? 46  LYS A NZ    1 
ATOM   313  N  N     . ILE A  1  50  ? -70.108 27.767 -65.085 1.00 84.37  ? 47  ILE A N     1 
ATOM   314  C  CA    . ILE A  1  50  ? -70.712 26.445 -64.978 1.00 80.36  ? 47  ILE A CA    1 
ATOM   315  C  C     . ILE A  1  50  ? -71.369 26.312 -63.613 1.00 77.82  ? 47  ILE A C     1 
ATOM   316  O  O     . ILE A  1  50  ? -70.800 26.718 -62.592 1.00 78.74  ? 47  ILE A O     1 
ATOM   317  C  CB    . ILE A  1  50  ? -69.653 25.347 -65.197 1.00 74.32  ? 47  ILE A CB    1 
ATOM   318  C  CG1   . ILE A  1  50  ? -69.188 25.331 -66.655 1.00 69.63  ? 47  ILE A CG1   1 
ATOM   319  C  CG2   . ILE A  1  50  ? -70.186 23.979 -64.780 1.00 67.00  ? 47  ILE A CG2   1 
ATOM   320  C  CD1   . ILE A  1  50  ? -68.000 24.426 -66.904 1.00 67.59  ? 47  ILE A CD1   1 
ATOM   321  N  N     . ILE A  1  51  ? -72.577 25.758 -63.587 1.00 74.10  ? 48  ILE A N     1 
ATOM   322  C  CA    . ILE A  1  51  ? -73.245 25.451 -62.325 1.00 74.44  ? 48  ILE A CA    1 
ATOM   323  C  C     . ILE A  1  51  ? -73.132 23.952 -62.075 1.00 76.02  ? 48  ILE A C     1 
ATOM   324  O  O     . ILE A  1  51  ? -73.924 23.172 -62.622 1.00 82.96  ? 48  ILE A O     1 
ATOM   325  C  CB    . ILE A  1  51  ? -74.715 25.897 -62.335 1.00 76.57  ? 48  ILE A CB    1 
ATOM   326  C  CG1   . ILE A  1  51  ? -74.847 27.315 -62.891 1.00 77.62  ? 48  ILE A CG1   1 
ATOM   327  C  CG2   . ILE A  1  51  ? -75.296 25.830 -60.927 1.00 71.74  ? 48  ILE A CG2   1 
ATOM   328  C  CD1   . ILE A  1  51  ? -76.270 27.829 -62.894 1.00 78.41  ? 48  ILE A CD1   1 
ATOM   329  N  N     . PRO A  1  52  ? -72.169 23.502 -61.267 1.00 75.78  ? 49  PRO A N     1 
ATOM   330  C  CA    . PRO A  1  52  ? -72.054 22.073 -61.009 1.00 79.86  ? 49  PRO A CA    1 
ATOM   331  C  C     . PRO A  1  52  ? -73.168 21.605 -60.099 1.00 84.34  ? 49  PRO A C     1 
ATOM   332  O  O     . PRO A  1  52  ? -73.659 22.370 -59.248 1.00 80.39  ? 49  PRO A O     1 
ATOM   333  C  CB    . PRO A  1  52  ? -70.679 21.947 -60.329 1.00 80.16  ? 49  PRO A CB    1 
ATOM   334  C  CG    . PRO A  1  52  ? -70.505 23.252 -59.638 1.00 73.94  ? 49  PRO A CG    1 
ATOM   335  C  CD    . PRO A  1  52  ? -71.166 24.283 -60.521 1.00 75.20  ? 49  PRO A CD    1 
ATOM   336  N  N     . PRO A  1  53  ? -73.617 20.358 -60.239 1.00 86.43  ? 50  PRO A N     1 
ATOM   337  C  CA    . PRO A  1  53  ? -74.635 19.834 -59.327 1.00 85.23  ? 50  PRO A CA    1 
ATOM   338  C  C     . PRO A  1  53  ? -74.142 19.856 -57.889 1.00 85.33  ? 50  PRO A C     1 
ATOM   339  O  O     . PRO A  1  53  ? -72.943 19.948 -57.615 1.00 88.17  ? 50  PRO A O     1 
ATOM   340  C  CB    . PRO A  1  53  ? -74.860 18.401 -59.822 1.00 85.42  ? 50  PRO A CB    1 
ATOM   341  C  CG    . PRO A  1  53  ? -73.612 18.060 -60.572 1.00 85.08  ? 50  PRO A CG    1 
ATOM   342  C  CD    . PRO A  1  53  ? -73.166 19.342 -61.206 1.00 83.97  ? 50  PRO A CD    1 
ATOM   343  N  N     . GLN A  1  54  ? -75.101 19.785 -56.961 1.00 85.21  ? 51  GLN A N     1 
ATOM   344  C  CA    . GLN A  1  54  ? -74.775 19.820 -55.538 1.00 80.82  ? 51  GLN A CA    1 
ATOM   345  C  C     . GLN A  1  54  ? -73.728 18.775 -55.177 1.00 79.08  ? 51  GLN A C     1 
ATOM   346  O  O     . GLN A  1  54  ? -72.787 19.058 -54.425 1.00 79.20  ? 51  GLN A O     1 
ATOM   347  C  CB    . GLN A  1  54  ? -76.044 19.605 -54.712 1.00 89.12  ? 51  GLN A CB    1 
ATOM   348  C  CG    . GLN A  1  54  ? -75.820 19.605 -53.209 1.00 97.27  ? 51  GLN A CG    1 
ATOM   349  C  CD    . GLN A  1  54  ? -75.747 21.002 -52.627 1.00 108.28 ? 51  GLN A CD    1 
ATOM   350  O  OE1   . GLN A  1  54  ? -76.075 21.984 -53.293 1.00 114.30 ? 51  GLN A OE1   1 
ATOM   351  N  NE2   . GLN A  1  54  ? -75.319 21.099 -51.374 1.00 110.29 ? 51  GLN A NE2   1 
ATOM   352  N  N     . SER A  1  55  ? -73.860 17.565 -55.725 1.00 84.13  ? 52  SER A N     1 
ATOM   353  C  CA    . SER A  1  55  ? -72.993 16.450 -55.364 1.00 82.58  ? 52  SER A CA    1 
ATOM   354  C  C     . SER A  1  55  ? -71.545 16.640 -55.806 1.00 80.89  ? 52  SER A C     1 
ATOM   355  O  O     . SER A  1  55  ? -70.685 15.868 -55.372 1.00 88.26  ? 52  SER A O     1 
ATOM   356  C  CB    . SER A  1  55  ? -73.540 15.153 -55.961 1.00 86.55  ? 52  SER A CB    1 
ATOM   357  O  OG    . SER A  1  55  ? -73.487 15.182 -57.377 1.00 89.13  ? 52  SER A OG    1 
ATOM   358  N  N     . ASP A  1  56  ? -71.256 17.627 -56.654 1.00 79.56  ? 53  ASP A N     1 
ATOM   359  C  CA    . ASP A  1  56  ? -69.900 17.875 -57.124 1.00 76.90  ? 53  ASP A CA    1 
ATOM   360  C  C     . ASP A  1  56  ? -69.224 19.048 -56.431 1.00 78.67  ? 53  ASP A C     1 
ATOM   361  O  O     . ASP A  1  56  ? -68.016 19.238 -56.612 1.00 81.03  ? 53  ASP A O     1 
ATOM   362  C  CB    . ASP A  1  56  ? -69.894 18.137 -58.636 1.00 89.08  ? 53  ASP A CB    1 
ATOM   363  C  CG    . ASP A  1  56  ? -69.988 16.869 -59.452 1.00 99.44  ? 53  ASP A CG    1 
ATOM   364  O  OD1   . ASP A  1  56  ? -69.553 15.808 -58.959 1.00 102.15 ? 53  ASP A OD1   1 
ATOM   365  O  OD2   . ASP A  1  56  ? -70.489 16.936 -60.594 1.00 106.49 ? 53  ASP A OD2   1 
ATOM   366  N  N     . ARG A  1  57  ? -69.962 19.831 -55.646 1.00 81.58  ? 54  ARG A N     1 
ATOM   367  C  CA    . ARG A  1  57  ? -69.434 21.107 -55.174 1.00 76.97  ? 54  ARG A CA    1 
ATOM   368  C  C     . ARG A  1  57  ? -68.386 20.940 -54.079 1.00 75.37  ? 54  ARG A C     1 
ATOM   369  O  O     . ARG A  1  57  ? -67.423 21.712 -54.029 1.00 79.73  ? 54  ARG A O     1 
ATOM   370  C  CB    . ARG A  1  57  ? -70.589 21.993 -54.703 1.00 77.87  ? 54  ARG A CB    1 
ATOM   371  C  CG    . ARG A  1  57  ? -71.562 22.305 -55.830 1.00 78.47  ? 54  ARG A CG    1 
ATOM   372  C  CD    . ARG A  1  57  ? -72.756 23.128 -55.384 1.00 80.86  ? 54  ARG A CD    1 
ATOM   373  N  NE    . ARG A  1  57  ? -73.736 23.246 -56.462 1.00 83.02  ? 54  ARG A NE    1 
ATOM   374  C  CZ    . ARG A  1  57  ? -74.913 23.852 -56.348 1.00 84.32  ? 54  ARG A CZ    1 
ATOM   375  N  NH1   . ARG A  1  57  ? -75.270 24.403 -55.196 1.00 82.73  ? 54  ARG A NH1   1 
ATOM   376  N  NH2   . ARG A  1  57  ? -75.735 23.906 -57.388 1.00 89.92  ? 54  ARG A NH2   1 
ATOM   377  N  N     . GLN A  1  58  ? -68.545 19.951 -53.195 1.00 76.46  ? 55  GLN A N     1 
ATOM   378  C  CA    . GLN A  1  58  ? -67.530 19.708 -52.172 1.00 70.90  ? 55  GLN A CA    1 
ATOM   379  C  C     . GLN A  1  58  ? -66.183 19.373 -52.802 1.00 74.39  ? 55  GLN A C     1 
ATOM   380  O  O     . GLN A  1  58  ? -65.145 19.915 -52.404 1.00 79.69  ? 55  GLN A O     1 
ATOM   381  C  CB    . GLN A  1  58  ? -67.977 18.585 -51.233 1.00 78.88  ? 55  GLN A CB    1 
ATOM   382  C  CG    . GLN A  1  58  ? -66.835 17.970 -50.439 1.00 89.44  ? 55  GLN A CG    1 
ATOM   383  C  CD    . GLN A  1  58  ? -67.294 17.296 -49.163 1.00 103.01 ? 55  GLN A CD    1 
ATOM   384  O  OE1   . GLN A  1  58  ? -68.427 17.482 -48.720 1.00 107.26 ? 55  GLN A OE1   1 
ATOM   385  N  NE2   . GLN A  1  58  ? -66.410 16.509 -48.562 1.00 102.92 ? 55  GLN A NE2   1 
ATOM   386  N  N     . LYS A  1  59  ? -66.182 18.488 -53.803 1.00 74.78  ? 56  LYS A N     1 
ATOM   387  C  CA    . LYS A  1  59  ? -64.930 18.093 -54.438 1.00 70.63  ? 56  LYS A CA    1 
ATOM   388  C  C     . LYS A  1  59  ? -64.278 19.261 -55.169 1.00 72.12  ? 56  LYS A C     1 
ATOM   389  O  O     . LYS A  1  59  ? -63.047 19.316 -55.275 1.00 72.39  ? 56  LYS A O     1 
ATOM   390  C  CB    . LYS A  1  59  ? -65.174 16.932 -55.403 1.00 73.85  ? 56  LYS A CB    1 
ATOM   391  C  CG    . LYS A  1  59  ? -63.899 16.303 -55.953 1.00 78.63  ? 56  LYS A CG    1 
ATOM   392  C  CD    . LYS A  1  59  ? -64.191 15.278 -57.037 1.00 92.53  ? 56  LYS A CD    1 
ATOM   393  C  CE    . LYS A  1  59  ? -62.907 14.631 -57.534 1.00 103.33 ? 56  LYS A CE    1 
ATOM   394  N  NZ    . LYS A  1  59  ? -63.120 13.815 -58.761 1.00 105.39 ? 56  LYS A NZ    1 
ATOM   395  N  N     . ILE A  1  60  ? -65.078 20.202 -55.672 1.00 71.85  ? 57  ILE A N     1 
ATOM   396  C  CA    . ILE A  1  60  ? -64.517 21.347 -56.382 1.00 63.51  ? 57  ILE A CA    1 
ATOM   397  C  C     . ILE A  1  60  ? -63.849 22.304 -55.403 1.00 62.49  ? 57  ILE A C     1 
ATOM   398  O  O     . ILE A  1  60  ? -62.736 22.786 -55.645 1.00 66.02  ? 57  ILE A O     1 
ATOM   399  C  CB    . ILE A  1  60  ? -65.605 22.048 -57.214 1.00 59.42  ? 57  ILE A CB    1 
ATOM   400  C  CG1   . ILE A  1  60  ? -66.005 21.173 -58.405 1.00 61.60  ? 57  ILE A CG1   1 
ATOM   401  C  CG2   . ILE A  1  60  ? -65.127 23.414 -57.686 1.00 58.29  ? 57  ILE A CG2   1 
ATOM   402  C  CD1   . ILE A  1  60  ? -67.074 21.784 -59.285 1.00 61.42  ? 57  ILE A CD1   1 
ATOM   403  N  N     . VAL A  1  61  ? -64.518 22.593 -54.284 1.00 62.25  ? 58  VAL A N     1 
ATOM   404  C  CA    . VAL A  1  61  ? -63.918 23.443 -53.258 1.00 59.81  ? 58  VAL A CA    1 
ATOM   405  C  C     . VAL A  1  61  ? -62.620 22.827 -52.753 1.00 58.26  ? 58  VAL A C     1 
ATOM   406  O  O     . VAL A  1  61  ? -61.625 23.528 -52.530 1.00 57.19  ? 58  VAL A O     1 
ATOM   407  C  CB    . VAL A  1  61  ? -64.911 23.680 -52.106 1.00 62.05  ? 58  VAL A CB    1 
ATOM   408  C  CG1   . VAL A  1  61  ? -64.267 24.524 -51.015 1.00 57.38  ? 58  VAL A CG1   1 
ATOM   409  C  CG2   . VAL A  1  61  ? -66.179 24.341 -52.624 1.00 61.38  ? 58  VAL A CG2   1 
ATOM   410  N  N     . LEU A  1  62  ? -62.607 21.503 -52.577 1.00 58.83  ? 59  LEU A N     1 
ATOM   411  C  CA    . LEU A  1  62  ? -61.411 20.822 -52.094 1.00 59.15  ? 59  LEU A CA    1 
ATOM   412  C  C     . LEU A  1  62  ? -60.255 20.976 -53.075 1.00 63.26  ? 59  LEU A C     1 
ATOM   413  O  O     . LEU A  1  62  ? -59.125 21.281 -52.676 1.00 70.04  ? 59  LEU A O     1 
ATOM   414  C  CB    . LEU A  1  62  ? -61.718 19.345 -51.852 1.00 70.49  ? 59  LEU A CB    1 
ATOM   415  C  CG    . LEU A  1  62  ? -60.630 18.546 -51.136 1.00 82.59  ? 59  LEU A CG    1 
ATOM   416  C  CD1   . LEU A  1  62  ? -60.406 19.092 -49.736 1.00 80.83  ? 59  LEU A CD1   1 
ATOM   417  C  CD2   . LEU A  1  62  ? -60.989 17.073 -51.081 1.00 85.36  ? 59  LEU A CD2   1 
ATOM   418  N  N     . GLN A  1  63  ? -60.522 20.774 -54.368 1.00 66.91  ? 60  GLN A N     1 
ATOM   419  C  CA    . GLN A  1  63  ? -59.459 20.849 -55.366 1.00 68.64  ? 60  GLN A CA    1 
ATOM   420  C  C     . GLN A  1  63  ? -58.882 22.256 -55.463 1.00 66.88  ? 60  GLN A C     1 
ATOM   421  O  O     . GLN A  1  63  ? -57.667 22.426 -55.614 1.00 64.32  ? 60  GLN A O     1 
ATOM   422  C  CB    . GLN A  1  63  ? -59.982 20.384 -56.725 1.00 75.40  ? 60  GLN A CB    1 
ATOM   423  C  CG    . GLN A  1  63  ? -60.206 18.883 -56.816 1.00 92.50  ? 60  GLN A CG    1 
ATOM   424  C  CD    . GLN A  1  63  ? -60.799 18.454 -58.143 1.00 103.85 ? 60  GLN A CD    1 
ATOM   425  O  OE1   . GLN A  1  63  ? -61.238 19.285 -58.939 1.00 102.63 ? 60  GLN A OE1   1 
ATOM   426  N  NE2   . GLN A  1  63  ? -60.815 17.150 -58.387 1.00 105.80 ? 60  GLN A NE2   1 
ATOM   427  N  N     . ALA A  1  64  ? -59.737 23.278 -55.377 1.00 65.46  ? 61  ALA A N     1 
ATOM   428  C  CA    . ALA A  1  64  ? -59.244 24.650 -55.443 1.00 53.09  ? 61  ALA A CA    1 
ATOM   429  C  C     . ALA A  1  64  ? -58.462 25.020 -54.189 1.00 61.33  ? 61  ALA A C     1 
ATOM   430  O  O     . ALA A  1  64  ? -57.419 25.679 -54.275 1.00 63.10  ? 61  ALA A O     1 
ATOM   431  C  CB    . ALA A  1  64  ? -60.407 25.617 -55.658 1.00 53.38  ? 61  ALA A CB    1 
ATOM   432  N  N     . HIS A  1  65  ? -58.945 24.606 -53.016 1.00 58.49  ? 62  HIS A N     1 
ATOM   433  C  CA    . HIS A  1  65  ? -58.218 24.894 -51.785 1.00 53.12  ? 62  HIS A CA    1 
ATOM   434  C  C     . HIS A  1  65  ? -56.849 24.227 -51.780 1.00 55.99  ? 62  HIS A C     1 
ATOM   435  O  O     . HIS A  1  65  ? -55.853 24.845 -51.395 1.00 56.55  ? 62  HIS A O     1 
ATOM   436  C  CB    . HIS A  1  65  ? -59.026 24.443 -50.572 1.00 54.17  ? 62  HIS A CB    1 
ATOM   437  C  CG    . HIS A  1  65  ? -58.259 24.501 -49.288 1.00 54.33  ? 62  HIS A CG    1 
ATOM   438  N  ND1   . HIS A  1  65  ? -58.016 25.682 -48.620 1.00 53.87  ? 62  HIS A ND1   1 
ATOM   439  C  CD2   . HIS A  1  65  ? -57.666 23.527 -48.558 1.00 55.10  ? 62  HIS A CD2   1 
ATOM   440  C  CE1   . HIS A  1  65  ? -57.315 25.431 -47.528 1.00 55.61  ? 62  HIS A CE1   1 
ATOM   441  N  NE2   . HIS A  1  65  ? -57.089 24.131 -47.468 1.00 55.11  ? 62  HIS A NE2   1 
ATOM   442  N  N     . ASN A  1  66  ? -56.776 22.969 -52.220 1.00 54.37  ? 63  ASN A N     1 
ATOM   443  C  CA    . ASN A  1  66  ? -55.551 22.193 -52.068 1.00 54.47  ? 63  ASN A CA    1 
ATOM   444  C  C     . ASN A  1  66  ? -54.424 22.644 -52.989 1.00 61.75  ? 63  ASN A C     1 
ATOM   445  O  O     . ASN A  1  66  ? -53.297 22.165 -52.823 1.00 68.78  ? 63  ASN A O     1 
ATOM   446  C  CB    . ASN A  1  66  ? -55.835 20.709 -52.295 1.00 55.10  ? 63  ASN A CB    1 
ATOM   447  C  CG    . ASN A  1  66  ? -56.451 20.044 -51.081 1.00 68.48  ? 63  ASN A CG    1 
ATOM   448  O  OD1   . ASN A  1  66  ? -56.514 20.635 -50.004 1.00 73.15  ? 63  ASN A OD1   1 
ATOM   449  N  ND2   . ASN A  1  66  ? -56.896 18.804 -51.245 1.00 80.89  ? 63  ASN A ND2   1 
ATOM   450  N  N     . LEU A  1  67  ? -54.689 23.541 -53.944 1.00 63.97  ? 64  LEU A N     1 
ATOM   451  C  CA    . LEU A  1  67  ? -53.626 24.008 -54.829 1.00 58.88  ? 64  LEU A CA    1 
ATOM   452  C  C     . LEU A  1  67  ? -52.500 24.661 -54.035 1.00 60.18  ? 64  LEU A C     1 
ATOM   453  O  O     . LEU A  1  67  ? -51.323 24.330 -54.218 1.00 65.07  ? 64  LEU A O     1 
ATOM   454  C  CB    . LEU A  1  67  ? -54.192 24.981 -55.864 1.00 57.69  ? 64  LEU A CB    1 
ATOM   455  C  CG    . LEU A  1  67  ? -55.206 24.406 -56.856 1.00 57.63  ? 64  LEU A CG    1 
ATOM   456  C  CD1   . LEU A  1  67  ? -55.775 25.505 -57.739 1.00 50.96  ? 64  LEU A CD1   1 
ATOM   457  C  CD2   . LEU A  1  67  ? -54.572 23.311 -57.700 1.00 51.51  ? 64  LEU A CD2   1 
ATOM   458  N  N     . ALA A  1  68  ? -52.845 25.588 -53.137 1.00 60.64  ? 65  ALA A N     1 
ATOM   459  C  CA    . ALA A  1  68  ? -51.848 26.212 -52.275 1.00 58.27  ? 65  ALA A CA    1 
ATOM   460  C  C     . ALA A  1  68  ? -52.345 26.364 -50.841 1.00 61.29  ? 65  ALA A C     1 
ATOM   461  O  O     . ALA A  1  68  ? -51.748 27.123 -50.068 1.00 61.29  ? 65  ALA A O     1 
ATOM   462  C  CB    . ALA A  1  68  ? -51.427 27.576 -52.824 1.00 49.73  ? 65  ALA A CB    1 
ATOM   463  N  N     . HIS A  1  69  ? -53.414 25.655 -50.472 1.00 59.09  ? 66  HIS A N     1 
ATOM   464  C  CA    . HIS A  1  69  ? -54.022 25.751 -49.146 1.00 60.40  ? 66  HIS A CA    1 
ATOM   465  C  C     . HIS A  1  69  ? -54.318 27.204 -48.788 1.00 64.83  ? 66  HIS A C     1 
ATOM   466  O  O     . HIS A  1  69  ? -53.971 27.702 -47.714 1.00 76.75  ? 66  HIS A O     1 
ATOM   467  C  CB    . HIS A  1  69  ? -53.156 25.064 -48.095 1.00 53.29  ? 66  HIS A CB    1 
ATOM   468  C  CG    . HIS A  1  69  ? -53.253 23.571 -48.135 1.00 54.27  ? 66  HIS A CG    1 
ATOM   469  N  ND1   . HIS A  1  69  ? -54.232 22.874 -47.459 1.00 56.47  ? 66  HIS A ND1   1 
ATOM   470  C  CD2   . HIS A  1  69  ? -52.518 22.644 -48.794 1.00 59.11  ? 66  HIS A CD2   1 
ATOM   471  C  CE1   . HIS A  1  69  ? -54.086 21.581 -47.686 1.00 64.40  ? 66  HIS A CE1   1 
ATOM   472  N  NE2   . HIS A  1  69  ? -53.052 21.414 -48.492 1.00 68.36  ? 66  HIS A NE2   1 
ATOM   473  N  N     . THR A  1  70  ? -54.980 27.883 -49.719 1.00 55.63  ? 67  THR A N     1 
ATOM   474  C  CA    . THR A  1  70  ? -55.337 29.282 -49.582 1.00 54.33  ? 67  THR A CA    1 
ATOM   475  C  C     . THR A  1  70  ? -56.583 29.445 -48.715 1.00 56.11  ? 67  THR A C     1 
ATOM   476  O  O     . THR A  1  70  ? -57.367 28.510 -48.516 1.00 52.35  ? 67  THR A O     1 
ATOM   477  C  CB    . THR A  1  70  ? -55.569 29.899 -50.959 1.00 56.66  ? 67  THR A CB    1 
ATOM   478  O  OG1   . THR A  1  70  ? -56.538 29.123 -51.675 1.00 50.72  ? 67  THR A OG1   1 
ATOM   479  C  CG2   . THR A  1  70  ? -54.266 29.933 -51.747 1.00 50.88  ? 67  THR A CG2   1 
ATOM   480  N  N     . GLY A  1  71  ? -56.757 30.658 -48.200 1.00 56.84  ? 68  GLY A N     1 
ATOM   481  C  CA    . GLY A  1  71  ? -57.870 30.988 -47.329 1.00 52.30  ? 68  GLY A CA    1 
ATOM   482  C  C     . GLY A  1  71  ? -59.155 31.259 -48.080 1.00 57.40  ? 68  GLY A C     1 
ATOM   483  O  O     . GLY A  1  71  ? -59.381 30.748 -49.181 1.00 69.20  ? 68  GLY A O     1 
ATOM   484  N  N     . ARG A  1  72  ? -60.005 32.095 -47.482 1.00 58.40  ? 69  ARG A N     1 
ATOM   485  C  CA    . ARG A  1  72  ? -61.361 32.277 -47.988 1.00 58.67  ? 69  ARG A CA    1 
ATOM   486  C  C     . ARG A  1  72  ? -61.362 32.916 -49.374 1.00 53.07  ? 69  ARG A C     1 
ATOM   487  O  O     . ARG A  1  72  ? -61.869 32.335 -50.339 1.00 66.98  ? 69  ARG A O     1 
ATOM   488  C  CB    . ARG A  1  72  ? -62.172 33.119 -47.003 1.00 54.30  ? 69  ARG A CB    1 
ATOM   489  C  CG    . ARG A  1  72  ? -63.663 33.137 -47.289 1.00 55.24  ? 69  ARG A CG    1 
ATOM   490  C  CD    . ARG A  1  72  ? -64.222 34.530 -47.107 1.00 55.65  ? 69  ARG A CD    1 
ATOM   491  N  NE    . ARG A  1  72  ? -63.929 35.057 -45.779 1.00 66.98  ? 69  ARG A NE    1 
ATOM   492  C  CZ    . ARG A  1  72  ? -63.698 36.339 -45.520 1.00 68.03  ? 69  ARG A CZ    1 
ATOM   493  N  NH1   . ARG A  1  72  ? -63.712 37.229 -46.503 1.00 63.04  ? 69  ARG A NH1   1 
ATOM   494  N  NH2   . ARG A  1  72  ? -63.441 36.730 -44.281 1.00 76.11  ? 69  ARG A NH2   1 
ATOM   495  N  N     . GLU A  1  73  ? -60.792 34.117 -49.493 1.00 58.92  ? 70  GLU A N     1 
ATOM   496  C  CA    . GLU A  1  73  ? -60.930 34.872 -50.735 1.00 60.71  ? 70  GLU A CA    1 
ATOM   497  C  C     . GLU A  1  73  ? -60.048 34.317 -51.850 1.00 61.08  ? 70  GLU A C     1 
ATOM   498  O  O     . GLU A  1  73  ? -60.461 34.298 -53.014 1.00 68.02  ? 70  GLU A O     1 
ATOM   499  C  CB    . GLU A  1  73  ? -60.619 36.350 -50.493 1.00 52.53  ? 70  GLU A CB    1 
ATOM   500  C  CG    . GLU A  1  73  ? -61.656 37.070 -49.643 1.00 70.48  ? 70  GLU A CG    1 
ATOM   501  C  CD    . GLU A  1  73  ? -63.032 37.074 -50.279 1.00 73.04  ? 70  GLU A CD    1 
ATOM   502  O  OE1   . GLU A  1  73  ? -63.149 37.493 -51.450 1.00 72.87  ? 70  GLU A OE1   1 
ATOM   503  O  OE2   . GLU A  1  73  ? -63.994 36.645 -49.608 1.00 64.41  ? 70  GLU A OE2   1 
ATOM   504  N  N     . ALA A  1  74  ? -58.834 33.868 -51.523 1.00 56.68  ? 71  ALA A N     1 
ATOM   505  C  CA    . ALA A  1  74  ? -57.957 33.326 -52.557 1.00 54.31  ? 71  ALA A CA    1 
ATOM   506  C  C     . ALA A  1  74  ? -58.479 31.999 -53.097 1.00 65.76  ? 71  ALA A C     1 
ATOM   507  O  O     . ALA A  1  74  ? -58.254 31.677 -54.270 1.00 71.88  ? 71  ALA A O     1 
ATOM   508  C  CB    . ALA A  1  74  ? -56.535 33.170 -52.017 1.00 51.49  ? 71  ALA A CB    1 
ATOM   509  N  N     . THR A  1  75  ? -59.185 31.224 -52.269 1.00 61.96  ? 72  THR A N     1 
ATOM   510  C  CA    . THR A  1  75  ? -59.819 30.007 -52.769 1.00 59.26  ? 72  THR A CA    1 
ATOM   511  C  C     . THR A  1  75  ? -61.038 30.335 -53.623 1.00 63.85  ? 72  THR A C     1 
ATOM   512  O  O     . THR A  1  75  ? -61.263 29.702 -54.661 1.00 68.62  ? 72  THR A O     1 
ATOM   513  C  CB    . THR A  1  75  ? -60.215 29.096 -51.607 1.00 55.56  ? 72  THR A CB    1 
ATOM   514  O  OG1   . THR A  1  75  ? -59.064 28.827 -50.794 1.00 53.11  ? 72  THR A OG1   1 
ATOM   515  C  CG2   . THR A  1  75  ? -60.779 27.783 -52.120 1.00 53.18  ? 72  THR A CG2   1 
ATOM   516  N  N     . LEU A  1  76  ? -61.833 31.326 -53.205 1.00 58.94  ? 73  LEU A N     1 
ATOM   517  C  CA    . LEU A  1  76  ? -63.031 31.671 -53.964 1.00 67.19  ? 73  LEU A CA    1 
ATOM   518  C  C     . LEU A  1  76  ? -62.679 32.205 -55.345 1.00 62.23  ? 73  LEU A C     1 
ATOM   519  O  O     . LEU A  1  76  ? -63.313 31.836 -56.340 1.00 64.68  ? 73  LEU A O     1 
ATOM   520  C  CB    . LEU A  1  76  ? -63.870 32.698 -53.209 1.00 60.89  ? 73  LEU A CB    1 
ATOM   521  C  CG    . LEU A  1  76  ? -65.069 33.102 -54.074 1.00 62.23  ? 73  LEU A CG    1 
ATOM   522  C  CD1   . LEU A  1  76  ? -66.353 32.430 -53.602 1.00 63.44  ? 73  LEU A CD1   1 
ATOM   523  C  CD2   . LEU A  1  76  ? -65.223 34.611 -54.169 1.00 62.88  ? 73  LEU A CD2   1 
ATOM   524  N  N     . LEU A  1  77  ? -61.675 33.081 -55.424 1.00 61.94  ? 74  LEU A N     1 
ATOM   525  C  CA    . LEU A  1  77  ? -61.297 33.657 -56.710 1.00 61.36  ? 74  LEU A CA    1 
ATOM   526  C  C     . LEU A  1  77  ? -60.919 32.581 -57.720 1.00 68.42  ? 74  LEU A C     1 
ATOM   527  O  O     . LEU A  1  77  ? -61.178 32.738 -58.919 1.00 62.98  ? 74  LEU A O     1 
ATOM   528  C  CB    . LEU A  1  77  ? -60.150 34.648 -56.517 1.00 52.25  ? 74  LEU A CB    1 
ATOM   529  C  CG    . LEU A  1  77  ? -60.560 35.996 -55.918 1.00 57.88  ? 74  LEU A CG    1 
ATOM   530  C  CD1   . LEU A  1  77  ? -59.408 36.628 -55.152 1.00 51.93  ? 74  LEU A CD1   1 
ATOM   531  C  CD2   . LEU A  1  77  ? -61.053 36.930 -57.016 1.00 53.60  ? 74  LEU A CD2   1 
ATOM   532  N  N     . LYS A  1  78  ? -60.321 31.480 -57.258 1.00 60.62  ? 75  LYS A N     1 
ATOM   533  C  CA    . LYS A  1  78  ? -60.017 30.368 -58.153 1.00 56.79  ? 75  LYS A CA    1 
ATOM   534  C  C     . LYS A  1  78  ? -61.293 29.692 -58.641 1.00 56.72  ? 75  LYS A C     1 
ATOM   535  O  O     . LYS A  1  78  ? -61.452 29.434 -59.840 1.00 65.73  ? 75  LYS A O     1 
ATOM   536  C  CB    . LYS A  1  78  ? -59.112 29.358 -57.447 1.00 51.66  ? 75  LYS A CB    1 
ATOM   537  C  CG    . LYS A  1  78  ? -57.640 29.697 -57.506 1.00 50.76  ? 75  LYS A CG    1 
ATOM   538  C  CD    . LYS A  1  78  ? -57.132 29.635 -58.932 1.00 54.15  ? 75  LYS A CD    1 
ATOM   539  C  CE    . LYS A  1  78  ? -55.628 29.792 -58.977 1.00 52.79  ? 75  LYS A CE    1 
ATOM   540  N  NZ    . LYS A  1  78  ? -55.086 29.729 -60.360 1.00 67.09  ? 75  LYS A NZ    1 
ATOM   541  N  N     . ILE A  1  79  ? -62.215 29.398 -57.721 1.00 56.74  ? 76  ILE A N     1 
ATOM   542  C  CA    . ILE A  1  79  ? -63.460 28.736 -58.102 1.00 61.08  ? 76  ILE A CA    1 
ATOM   543  C  C     . ILE A  1  79  ? -64.278 29.623 -59.032 1.00 61.08  ? 76  ILE A C     1 
ATOM   544  O  O     . ILE A  1  79  ? -64.821 29.155 -60.039 1.00 59.53  ? 76  ILE A O     1 
ATOM   545  C  CB    . ILE A  1  79  ? -64.266 28.342 -56.852 1.00 61.00  ? 76  ILE A CB    1 
ATOM   546  C  CG1   . ILE A  1  79  ? -63.391 27.568 -55.868 1.00 61.60  ? 76  ILE A CG1   1 
ATOM   547  C  CG2   . ILE A  1  79  ? -65.475 27.514 -57.246 1.00 64.52  ? 76  ILE A CG2   1 
ATOM   548  C  CD1   . ILE A  1  79  ? -64.111 27.171 -54.599 1.00 55.66  ? 76  ILE A CD1   1 
ATOM   549  N  N     . ALA A  1  80  ? -64.375 30.918 -58.713 1.00 63.11  ? 77  ALA A N     1 
ATOM   550  C  CA    . ALA A  1  80  ? -65.189 31.837 -59.502 1.00 57.19  ? 77  ALA A CA    1 
ATOM   551  C  C     . ALA A  1  80  ? -64.694 31.982 -60.936 1.00 65.61  ? 77  ALA A C     1 
ATOM   552  O  O     . ALA A  1  80  ? -65.438 32.488 -61.784 1.00 70.25  ? 77  ALA A O     1 
ATOM   553  C  CB    . ALA A  1  80  ? -65.237 33.208 -58.826 1.00 57.12  ? 77  ALA A CB    1 
ATOM   554  N  N     . ASN A  1  81  ? -63.458 31.563 -61.227 1.00 56.25  ? 78  ASN A N     1 
ATOM   555  C  CA    . ASN A  1  81  ? -62.976 31.593 -62.604 1.00 63.31  ? 78  ASN A CA    1 
ATOM   556  C  C     . ASN A  1  81  ? -63.798 30.685 -63.507 1.00 65.39  ? 78  ASN A C     1 
ATOM   557  O  O     . ASN A  1  81  ? -63.973 30.985 -64.693 1.00 58.78  ? 78  ASN A O     1 
ATOM   558  C  CB    . ASN A  1  81  ? -61.501 31.189 -62.660 1.00 62.59  ? 78  ASN A CB    1 
ATOM   559  C  CG    . ASN A  1  81  ? -60.567 32.340 -62.349 1.00 66.47  ? 78  ASN A CG    1 
ATOM   560  O  OD1   . ASN A  1  81  ? -60.948 33.505 -62.450 1.00 71.62  ? 78  ASN A OD1   1 
ATOM   561  N  ND2   . ASN A  1  81  ? -59.333 32.019 -61.976 1.00 62.80  ? 78  ASN A ND2   1 
ATOM   562  N  N     . LEU A  1  82  ? -64.318 29.586 -62.970 1.00 64.80  ? 79  LEU A N     1 
ATOM   563  C  CA    . LEU A  1  82  ? -65.034 28.601 -63.767 1.00 63.93  ? 79  LEU A CA    1 
ATOM   564  C  C     . LEU A  1  82  ? -66.474 28.379 -63.341 1.00 67.40  ? 79  LEU A C     1 
ATOM   565  O  O     . LEU A  1  82  ? -67.317 28.107 -64.200 1.00 76.11  ? 79  LEU A O     1 
ATOM   566  C  CB    . LEU A  1  82  ? -64.302 27.250 -63.729 1.00 58.49  ? 79  LEU A CB    1 
ATOM   567  C  CG    . LEU A  1  82  ? -62.913 27.209 -64.363 1.00 63.35  ? 79  LEU A CG    1 
ATOM   568  C  CD1   . LEU A  1  82  ? -62.411 25.775 -64.450 1.00 57.30  ? 79  LEU A CD1   1 
ATOM   569  C  CD2   . LEU A  1  82  ? -62.944 27.858 -65.738 1.00 69.71  ? 79  LEU A CD2   1 
ATOM   570  N  N     . TYR A  1  83  ? -66.792 28.487 -62.056 1.00 66.62  ? 80  TYR A N     1 
ATOM   571  C  CA    . TYR A  1  83  ? -68.071 28.021 -61.548 1.00 67.12  ? 80  TYR A CA    1 
ATOM   572  C  C     . TYR A  1  83  ? -68.842 29.140 -60.862 1.00 66.73  ? 80  TYR A C     1 
ATOM   573  O  O     . TYR A  1  83  ? -68.304 30.198 -60.532 1.00 64.92  ? 80  TYR A O     1 
ATOM   574  C  CB    . TYR A  1  83  ? -67.885 26.858 -60.565 1.00 67.36  ? 80  TYR A CB    1 
ATOM   575  C  CG    . TYR A  1  83  ? -67.159 25.682 -61.165 1.00 70.71  ? 80  TYR A CG    1 
ATOM   576  C  CD1   . TYR A  1  83  ? -67.803 24.821 -62.042 1.00 68.49  ? 80  TYR A CD1   1 
ATOM   577  C  CD2   . TYR A  1  83  ? -65.827 25.434 -60.860 1.00 69.49  ? 80  TYR A CD2   1 
ATOM   578  C  CE1   . TYR A  1  83  ? -67.144 23.745 -62.598 1.00 66.19  ? 80  TYR A CE1   1 
ATOM   579  C  CE2   . TYR A  1  83  ? -65.159 24.359 -61.411 1.00 67.39  ? 80  TYR A CE2   1 
ATOM   580  C  CZ    . TYR A  1  83  ? -65.823 23.518 -62.279 1.00 72.45  ? 80  TYR A CZ    1 
ATOM   581  O  OH    . TYR A  1  83  ? -65.163 22.446 -62.831 1.00 81.68  ? 80  TYR A OH    1 
ATOM   582  N  N     . TRP A  1  84  ? -70.132 28.872 -60.661 1.00 70.69  ? 81  TRP A N     1 
ATOM   583  C  CA    . TRP A  1  84  ? -70.993 29.701 -59.834 1.00 69.24  ? 81  TRP A CA    1 
ATOM   584  C  C     . TRP A  1  84  ? -72.092 28.828 -59.252 1.00 70.72  ? 81  TRP A C     1 
ATOM   585  O  O     . TRP A  1  84  ? -72.625 27.952 -59.939 1.00 73.84  ? 81  TRP A O     1 
ATOM   586  C  CB    . TRP A  1  84  ? -71.619 30.859 -60.620 1.00 70.25  ? 81  TRP A CB    1 
ATOM   587  C  CG    . TRP A  1  84  ? -72.486 31.715 -59.749 1.00 70.00  ? 81  TRP A CG    1 
ATOM   588  C  CD1   . TRP A  1  84  ? -72.107 32.830 -59.062 1.00 67.94  ? 81  TRP A CD1   1 
ATOM   589  C  CD2   . TRP A  1  84  ? -73.873 31.508 -59.442 1.00 74.19  ? 81  TRP A CD2   1 
ATOM   590  N  NE1   . TRP A  1  84  ? -73.171 33.339 -58.359 1.00 66.91  ? 81  TRP A NE1   1 
ATOM   591  C  CE2   . TRP A  1  84  ? -74.267 32.545 -58.574 1.00 72.22  ? 81  TRP A CE2   1 
ATOM   592  C  CE3   . TRP A  1  84  ? -74.820 30.551 -59.823 1.00 78.57  ? 81  TRP A CE3   1 
ATOM   593  C  CZ2   . TRP A  1  84  ? -75.565 32.652 -58.079 1.00 74.92  ? 81  TRP A CZ2   1 
ATOM   594  C  CZ3   . TRP A  1  84  ? -76.108 30.658 -59.328 1.00 76.99  ? 81  TRP A CZ3   1 
ATOM   595  C  CH2   . TRP A  1  84  ? -76.468 31.702 -58.466 1.00 78.24  ? 81  TRP A CH2   1 
ATOM   596  N  N     . TRP A  1  85  ? -72.427 29.072 -57.989 1.00 65.47  ? 82  TRP A N     1 
ATOM   597  C  CA    . TRP A  1  85  ? -73.585 28.455 -57.357 1.00 69.54  ? 82  TRP A CA    1 
ATOM   598  C  C     . TRP A  1  85  ? -73.953 29.279 -56.129 1.00 70.72  ? 82  TRP A C     1 
ATOM   599  O  O     . TRP A  1  85  ? -73.157 30.111 -55.681 1.00 73.18  ? 82  TRP A O     1 
ATOM   600  C  CB    . TRP A  1  85  ? -73.313 26.980 -56.995 1.00 66.74  ? 82  TRP A CB    1 
ATOM   601  C  CG    . TRP A  1  85  ? -72.279 26.718 -55.939 1.00 73.09  ? 82  TRP A CG    1 
ATOM   602  C  CD1   . TRP A  1  85  ? -72.443 26.815 -54.587 1.00 75.45  ? 82  TRP A CD1   1 
ATOM   603  C  CD2   . TRP A  1  85  ? -70.936 26.260 -56.146 1.00 69.71  ? 82  TRP A CD2   1 
ATOM   604  N  NE1   . TRP A  1  85  ? -71.280 26.470 -53.942 1.00 71.78  ? 82  TRP A NE1   1 
ATOM   605  C  CE2   . TRP A  1  85  ? -70.340 26.124 -54.877 1.00 68.22  ? 82  TRP A CE2   1 
ATOM   606  C  CE3   . TRP A  1  85  ? -70.178 25.963 -57.283 1.00 67.31  ? 82  TRP A CE3   1 
ATOM   607  C  CZ2   . TRP A  1  85  ? -69.020 25.706 -54.712 1.00 63.09  ? 82  TRP A CZ2   1 
ATOM   608  C  CZ3   . TRP A  1  85  ? -68.867 25.548 -57.118 1.00 65.87  ? 82  TRP A CZ3   1 
ATOM   609  C  CH2   . TRP A  1  85  ? -68.303 25.424 -55.842 1.00 68.29  ? 82  TRP A CH2   1 
ATOM   610  N  N     . PRO A  1  86  ? -75.163 29.111 -55.596 1.00 73.73  ? 83  PRO A N     1 
ATOM   611  C  CA    . PRO A  1  86  ? -75.580 29.936 -54.454 1.00 71.47  ? 83  PRO A CA    1 
ATOM   612  C  C     . PRO A  1  86  ? -74.675 29.738 -53.247 1.00 67.37  ? 83  PRO A C     1 
ATOM   613  O  O     . PRO A  1  86  ? -74.381 28.609 -52.846 1.00 75.45  ? 83  PRO A O     1 
ATOM   614  C  CB    . PRO A  1  86  ? -77.008 29.458 -54.172 1.00 71.23  ? 83  PRO A CB    1 
ATOM   615  C  CG    . PRO A  1  86  ? -77.482 28.907 -55.468 1.00 82.23  ? 83  PRO A CG    1 
ATOM   616  C  CD    . PRO A  1  86  ? -76.278 28.295 -56.115 1.00 78.66  ? 83  PRO A CD    1 
ATOM   617  N  N     . ASN A  1  87  ? -74.226 30.859 -52.676 1.00 66.51  ? 84  ASN A N     1 
ATOM   618  C  CA    . ASN A  1  87  ? -73.481 30.883 -51.418 1.00 71.01  ? 84  ASN A CA    1 
ATOM   619  C  C     . ASN A  1  87  ? -72.200 30.053 -51.515 1.00 71.88  ? 84  ASN A C     1 
ATOM   620  O  O     . ASN A  1  87  ? -71.991 29.091 -50.774 1.00 71.77  ? 84  ASN A O     1 
ATOM   621  C  CB    . ASN A  1  87  ? -74.364 30.402 -50.261 1.00 72.21  ? 84  ASN A CB    1 
ATOM   622  C  CG    . ASN A  1  87  ? -75.671 31.163 -50.169 1.00 75.36  ? 84  ASN A CG    1 
ATOM   623  O  OD1   . ASN A  1  87  ? -75.684 32.390 -50.081 1.00 83.64  ? 84  ASN A OD1   1 
ATOM   624  N  ND2   . ASN A  1  87  ? -76.781 30.435 -50.199 1.00 74.04  ? 84  ASN A ND2   1 
ATOM   625  N  N     . MET A  1  88  ? -71.335 30.450 -52.452 1.00 72.56  ? 85  MET A N     1 
ATOM   626  C  CA    . MET A  1  88  ? -70.083 29.725 -52.658 1.00 66.14  ? 85  MET A CA    1 
ATOM   627  C  C     . MET A  1  88  ? -69.205 29.781 -51.415 1.00 65.75  ? 85  MET A C     1 
ATOM   628  O  O     . MET A  1  88  ? -68.711 28.751 -50.943 1.00 65.93  ? 85  MET A O     1 
ATOM   629  C  CB    . MET A  1  88  ? -69.332 30.293 -53.862 1.00 67.41  ? 85  MET A CB    1 
ATOM   630  C  CG    . MET A  1  88  ? -70.203 30.578 -55.064 1.00 75.85  ? 85  MET A CG    1 
ATOM   631  S  SD    . MET A  1  88  ? -69.258 30.805 -56.581 1.00 76.72  ? 85  MET A SD    1 
ATOM   632  C  CE    . MET A  1  88  ? -68.614 29.154 -56.807 1.00 76.29  ? 85  MET A CE    1 
ATOM   633  N  N     . ARG A  1  89  ? -69.001 30.985 -50.871 1.00 65.37  ? 86  ARG A N     1 
ATOM   634  C  CA    . ARG A  1  89  ? -68.121 31.145 -49.718 1.00 62.34  ? 86  ARG A CA    1 
ATOM   635  C  C     . ARG A  1  89  ? -68.574 30.307 -48.531 1.00 65.10  ? 86  ARG A C     1 
ATOM   636  O  O     . ARG A  1  89  ? -67.738 29.874 -47.730 1.00 70.42  ? 86  ARG A O     1 
ATOM   637  C  CB    . ARG A  1  89  ? -68.042 32.616 -49.318 1.00 63.84  ? 86  ARG A CB    1 
ATOM   638  C  CG    . ARG A  1  89  ? -67.203 33.471 -50.247 1.00 57.72  ? 86  ARG A CG    1 
ATOM   639  C  CD    . ARG A  1  89  ? -67.312 34.927 -49.854 1.00 63.33  ? 86  ARG A CD    1 
ATOM   640  N  NE    . ARG A  1  89  ? -66.351 35.784 -50.543 1.00 70.69  ? 86  ARG A NE    1 
ATOM   641  C  CZ    . ARG A  1  89  ? -66.591 36.406 -51.692 1.00 64.33  ? 86  ARG A CZ    1 
ATOM   642  N  NH1   . ARG A  1  89  ? -67.760 36.257 -52.300 1.00 58.63  ? 86  ARG A NH1   1 
ATOM   643  N  NH2   . ARG A  1  89  ? -65.657 37.173 -52.240 1.00 56.69  ? 86  ARG A NH2   1 
ATOM   644  N  N     . LYS A  1  90  ? -69.882 30.076 -48.391 1.00 62.77  ? 87  LYS A N     1 
ATOM   645  C  CA    . LYS A  1  90  ? -70.356 29.195 -47.328 1.00 64.74  ? 87  LYS A CA    1 
ATOM   646  C  C     . LYS A  1  90  ? -69.727 27.813 -47.452 1.00 70.09  ? 87  LYS A C     1 
ATOM   647  O  O     . LYS A  1  90  ? -69.234 27.250 -46.469 1.00 77.44  ? 87  LYS A O     1 
ATOM   648  C  CB    . LYS A  1  90  ? -71.883 29.098 -47.353 1.00 72.73  ? 87  LYS A CB    1 
ATOM   649  C  CG    . LYS A  1  90  ? -72.463 28.384 -46.138 1.00 84.98  ? 87  LYS A CG    1 
ATOM   650  C  CD    . LYS A  1  90  ? -73.914 27.981 -46.338 1.00 95.97  ? 87  LYS A CD    1 
ATOM   651  C  CE    . LYS A  1  90  ? -74.423 27.207 -45.131 1.00 103.00 ? 87  LYS A CE    1 
ATOM   652  N  NZ    . LYS A  1  90  ? -75.834 26.763 -45.285 1.00 108.63 ? 87  LYS A NZ    1 
ATOM   653  N  N     . ASP A  1  91  ? -69.720 27.256 -48.665 1.00 72.06  ? 88  ASP A N     1 
ATOM   654  C  CA    . ASP A  1  91  ? -69.091 25.960 -48.887 1.00 71.66  ? 88  ASP A CA    1 
ATOM   655  C  C     . ASP A  1  91  ? -67.575 26.052 -48.775 1.00 67.89  ? 88  ASP A C     1 
ATOM   656  O  O     . ASP A  1  91  ? -66.913 25.053 -48.471 1.00 67.03  ? 88  ASP A O     1 
ATOM   657  C  CB    . ASP A  1  91  ? -69.488 25.408 -50.258 1.00 74.76  ? 88  ASP A CB    1 
ATOM   658  C  CG    . ASP A  1  91  ? -70.961 25.050 -50.343 1.00 85.52  ? 88  ASP A CG    1 
ATOM   659  O  OD1   . ASP A  1  91  ? -71.432 24.284 -49.479 1.00 92.17  ? 88  ASP A OD1   1 
ATOM   660  O  OD2   . ASP A  1  91  ? -71.643 25.534 -51.273 1.00 89.22  ? 88  ASP A OD2   1 
ATOM   661  N  N     . VAL A  1  92  ? -67.010 27.235 -49.017 1.00 59.04  ? 89  VAL A N     1 
ATOM   662  C  CA    . VAL A  1  92  ? -65.565 27.395 -48.912 1.00 57.69  ? 89  VAL A CA    1 
ATOM   663  C  C     . VAL A  1  92  ? -65.140 27.396 -47.452 1.00 63.05  ? 89  VAL A C     1 
ATOM   664  O  O     . VAL A  1  92  ? -64.208 26.686 -47.062 1.00 67.22  ? 89  VAL A O     1 
ATOM   665  C  CB    . VAL A  1  92  ? -65.109 28.673 -49.637 1.00 56.64  ? 89  VAL A CB    1 
ATOM   666  C  CG1   . VAL A  1  92  ? -63.638 28.970 -49.321 1.00 60.27  ? 89  VAL A CG1   1 
ATOM   667  C  CG2   . VAL A  1  92  ? -65.312 28.534 -51.134 1.00 56.55  ? 89  VAL A CG2   1 
ATOM   668  N  N     . VAL A  1  93  ? -65.814 28.203 -46.626 1.00 59.48  ? 90  VAL A N     1 
ATOM   669  C  CA    . VAL A  1  93  ? -65.532 28.230 -45.193 1.00 58.87  ? 90  VAL A CA    1 
ATOM   670  C  C     . VAL A  1  93  ? -65.755 26.857 -44.573 1.00 65.90  ? 90  VAL A C     1 
ATOM   671  O  O     . VAL A  1  93  ? -65.059 26.474 -43.624 1.00 63.20  ? 90  VAL A O     1 
ATOM   672  C  CB    . VAL A  1  93  ? -66.392 29.313 -44.510 1.00 59.51  ? 90  VAL A CB    1 
ATOM   673  C  CG1   . VAL A  1  93  ? -66.188 29.302 -43.002 1.00 60.22  ? 90  VAL A CG1   1 
ATOM   674  C  CG2   . VAL A  1  93  ? -66.068 30.683 -45.082 1.00 58.50  ? 90  VAL A CG2   1 
ATOM   675  N  N     . LYS A  1  94  ? -66.712 26.089 -45.103 1.00 60.97  ? 91  LYS A N     1 
ATOM   676  C  CA    . LYS A  1  94  ? -66.962 24.749 -44.580 1.00 62.59  ? 91  LYS A CA    1 
ATOM   677  C  C     . LYS A  1  94  ? -65.740 23.853 -44.746 1.00 64.02  ? 91  LYS A C     1 
ATOM   678  O  O     . LYS A  1  94  ? -65.416 23.062 -43.852 1.00 76.68  ? 91  LYS A O     1 
ATOM   679  C  CB    . LYS A  1  94  ? -68.181 24.136 -45.273 1.00 65.98  ? 91  LYS A CB    1 
ATOM   680  C  CG    . LYS A  1  94  ? -68.610 22.787 -44.710 1.00 77.71  ? 91  LYS A CG    1 
ATOM   681  C  CD    . LYS A  1  94  ? -69.954 22.344 -45.275 1.00 87.81  ? 91  LYS A CD    1 
ATOM   682  C  CE    . LYS A  1  94  ? -70.347 20.968 -44.754 1.00 102.63 ? 91  LYS A CE    1 
ATOM   683  N  NZ    . LYS A  1  94  ? -71.727 20.573 -45.155 1.00 105.35 ? 91  LYS A NZ    1 
ATOM   684  N  N     . GLN A  1  95  ? -65.041 23.973 -45.877 1.00 67.31  ? 92  GLN A N     1 
ATOM   685  C  CA    . GLN A  1  95  ? -63.845 23.166 -46.097 1.00 74.17  ? 92  GLN A CA    1 
ATOM   686  C  C     . GLN A  1  95  ? -62.659 23.667 -45.283 1.00 80.44  ? 92  GLN A C     1 
ATOM   687  O  O     . GLN A  1  95  ? -61.854 22.862 -44.802 1.00 81.76  ? 92  GLN A O     1 
ATOM   688  C  CB    . GLN A  1  95  ? -63.495 23.140 -47.584 1.00 80.52  ? 92  GLN A CB    1 
ATOM   689  C  CG    . GLN A  1  95  ? -64.236 22.062 -48.346 1.00 95.51  ? 92  GLN A CG    1 
ATOM   690  C  CD    . GLN A  1  95  ? -63.971 20.678 -47.784 1.00 103.22 ? 92  GLN A CD    1 
ATOM   691  O  OE1   . GLN A  1  95  ? -62.832 20.213 -47.764 1.00 107.10 ? 92  GLN A OE1   1 
ATOM   692  N  NE2   . GLN A  1  95  ? -65.023 20.018 -47.313 1.00 98.96  ? 92  GLN A NE2   1 
ATOM   693  N  N     . LEU A  1  96  ? -62.529 24.987 -45.124 1.00 77.01  ? 93  LEU A N     1 
ATOM   694  C  CA    . LEU A  1  96  ? -61.407 25.541 -44.370 1.00 66.63  ? 93  LEU A CA    1 
ATOM   695  C  C     . LEU A  1  96  ? -61.427 25.071 -42.921 1.00 68.47  ? 93  LEU A C     1 
ATOM   696  O  O     . LEU A  1  96  ? -60.373 24.822 -42.323 1.00 73.99  ? 93  LEU A O     1 
ATOM   697  C  CB    . LEU A  1  96  ? -61.432 27.069 -44.445 1.00 57.12  ? 93  LEU A CB    1 
ATOM   698  C  CG    . LEU A  1  96  ? -61.388 27.688 -45.845 1.00 66.83  ? 93  LEU A CG    1 
ATOM   699  C  CD1   . LEU A  1  96  ? -61.402 29.206 -45.757 1.00 62.02  ? 93  LEU A CD1   1 
ATOM   700  C  CD2   . LEU A  1  96  ? -60.167 27.204 -46.607 1.00 60.09  ? 93  LEU A CD2   1 
ATOM   701  N  N     . GLY A  1  97  ? -62.618 24.933 -42.342 1.00 60.66  ? 94  GLY A N     1 
ATOM   702  C  CA    . GLY A  1  97  ? -62.738 24.435 -40.984 1.00 62.26  ? 94  GLY A CA    1 
ATOM   703  C  C     . GLY A  1  97  ? -62.521 22.948 -40.838 1.00 69.34  ? 94  GLY A C     1 
ATOM   704  O  O     . GLY A  1  97  ? -62.444 22.460 -39.708 1.00 72.24  ? 94  GLY A O     1 
ATOM   705  N  N     . ARG A  1  98  ? -62.425 22.215 -41.951 1.00 65.05  ? 95  ARG A N     1 
ATOM   706  C  CA    . ARG A  1  98  ? -62.148 20.790 -41.926 1.00 64.24  ? 95  ARG A CA    1 
ATOM   707  C  C     . ARG A  1  98  ? -60.749 20.448 -42.419 1.00 65.83  ? 95  ARG A C     1 
ATOM   708  O  O     . ARG A  1  98  ? -60.366 19.272 -42.390 1.00 69.46  ? 95  ARG A O     1 
ATOM   709  C  CB    . ARG A  1  98  ? -63.180 20.025 -42.767 1.00 75.07  ? 95  ARG A CB    1 
ATOM   710  C  CG    . ARG A  1  98  ? -64.621 20.211 -42.325 1.00 86.86  ? 95  ARG A CG    1 
ATOM   711  C  CD    . ARG A  1  98  ? -65.549 19.297 -43.113 1.00 97.73  ? 95  ARG A CD    1 
ATOM   712  N  NE    . ARG A  1  98  ? -66.958 19.621 -42.910 1.00 106.98 ? 95  ARG A NE    1 
ATOM   713  C  CZ    . ARG A  1  98  ? -67.725 19.071 -41.975 1.00 117.79 ? 95  ARG A CZ    1 
ATOM   714  N  NH1   . ARG A  1  98  ? -67.221 18.167 -41.147 1.00 119.85 ? 95  ARG A NH1   1 
ATOM   715  N  NH2   . ARG A  1  98  ? -68.999 19.426 -41.867 1.00 121.31 ? 95  ARG A NH2   1 
ATOM   716  N  N     . CYS A  1  99  ? -59.980 21.433 -42.879 1.00 61.76  ? 96  CYS A N     1 
ATOM   717  C  CA    . CYS A  1  99  ? -58.621 21.187 -43.348 1.00 66.63  ? 96  CYS A CA    1 
ATOM   718  C  C     . CYS A  1  99  ? -57.685 21.199 -42.148 1.00 73.00  ? 96  CYS A C     1 
ATOM   719  O  O     . CYS A  1  99  ? -57.397 22.261 -41.585 1.00 74.39  ? 96  CYS A O     1 
ATOM   720  C  CB    . CYS A  1  99  ? -58.201 22.228 -44.382 1.00 59.11  ? 96  CYS A CB    1 
ATOM   721  S  SG    . CYS A  1  99  ? -56.559 21.919 -45.072 1.00 70.46  ? 96  CYS A SG    1 
ATOM   722  N  N     . GLN A  1  100 ? -57.207 20.017 -41.759 1.00 69.12  ? 97  GLN A N     1 
ATOM   723  C  CA    . GLN A  1  100 ? -56.371 19.915 -40.568 1.00 64.61  ? 97  GLN A CA    1 
ATOM   724  C  C     . GLN A  1  100 ? -55.034 20.622 -40.763 1.00 75.66  ? 97  GLN A C     1 
ATOM   725  O  O     . GLN A  1  100 ? -54.533 21.273 -39.839 1.00 63.86  ? 97  GLN A O     1 
ATOM   726  C  CB    . GLN A  1  100 ? -56.159 18.446 -40.201 1.00 69.70  ? 97  GLN A CB    1 
ATOM   727  C  CG    . GLN A  1  100 ? -55.673 18.218 -38.774 1.00 86.29  ? 97  GLN A CG    1 
ATOM   728  C  CD    . GLN A  1  100 ? -56.749 18.473 -37.726 1.00 99.63  ? 97  GLN A CD    1 
ATOM   729  O  OE1   . GLN A  1  100 ? -57.864 18.888 -38.046 1.00 100.63 ? 97  GLN A OE1   1 
ATOM   730  N  NE2   . GLN A  1  100 ? -56.416 18.220 -36.467 1.00 102.53 ? 97  GLN A NE2   1 
ATOM   731  N  N     . GLN A  1  101 ? -54.443 20.512 -41.957 1.00 65.68  ? 98  GLN A N     1 
ATOM   732  C  CA    . GLN A  1  101 ? -53.141 21.132 -42.193 1.00 63.28  ? 98  GLN A CA    1 
ATOM   733  C  C     . GLN A  1  101 ? -53.216 22.650 -42.083 1.00 62.64  ? 98  GLN A C     1 
ATOM   734  O  O     . GLN A  1  101 ? -52.299 23.285 -41.549 1.00 61.94  ? 98  GLN A O     1 
ATOM   735  C  CB    . GLN A  1  101 ? -52.598 20.731 -43.564 1.00 66.73  ? 98  GLN A CB    1 
ATOM   736  C  CG    . GLN A  1  101 ? -52.479 19.236 -43.785 1.00 76.26  ? 98  GLN A CG    1 
ATOM   737  C  CD    . GLN A  1  101 ? -53.660 18.670 -44.544 1.00 79.85  ? 98  GLN A CD    1 
ATOM   738  O  OE1   . GLN A  1  101 ? -54.754 18.530 -43.999 1.00 80.29  ? 98  GLN A OE1   1 
ATOM   739  N  NE2   . GLN A  1  101 ? -53.446 18.349 -45.815 1.00 75.72  ? 98  GLN A NE2   1 
ATOM   740  N  N     . CYS A  1  102 ? -54.293 23.253 -42.591 1.00 57.35  ? 99  CYS A N     1 
ATOM   741  C  CA    . CYS A  1  102 ? -54.432 24.702 -42.494 1.00 64.88  ? 99  CYS A CA    1 
ATOM   742  C  C     . CYS A  1  102 ? -54.665 25.143 -41.054 1.00 60.54  ? 99  CYS A C     1 
ATOM   743  O  O     . CYS A  1  102 ? -54.112 26.158 -40.615 1.00 54.89  ? 99  CYS A O     1 
ATOM   744  C  CB    . CYS A  1  102 ? -55.568 25.185 -43.395 1.00 56.75  ? 99  CYS A CB    1 
ATOM   745  S  SG    . CYS A  1  102 ? -55.057 25.555 -45.084 1.00 68.91  ? 99  CYS A SG    1 
ATOM   746  N  N     . LEU A  1  103 ? -55.469 24.387 -40.302 1.00 64.78  ? 100 LEU A N     1 
ATOM   747  C  CA    . LEU A  1  103 ? -55.819 24.794 -38.944 1.00 56.48  ? 100 LEU A CA    1 
ATOM   748  C  C     . LEU A  1  103 ? -54.610 24.807 -38.016 1.00 62.31  ? 100 LEU A C     1 
ATOM   749  O  O     . LEU A  1  103 ? -54.555 25.623 -37.089 1.00 57.03  ? 100 LEU A O     1 
ATOM   750  C  CB    . LEU A  1  103 ? -56.902 23.875 -38.381 1.00 57.72  ? 100 LEU A CB    1 
ATOM   751  C  CG    . LEU A  1  103 ? -58.299 23.942 -39.003 1.00 58.61  ? 100 LEU A CG    1 
ATOM   752  C  CD1   . LEU A  1  103 ? -59.182 22.846 -38.427 1.00 59.98  ? 100 LEU A CD1   1 
ATOM   753  C  CD2   . LEU A  1  103 ? -58.932 25.308 -38.783 1.00 58.04  ? 100 LEU A CD2   1 
ATOM   754  N  N     . ILE A  1  104 ? -53.636 23.921 -38.237 1.00 57.46  ? 101 ILE A N     1 
ATOM   755  C  CA    . ILE A  1  104 ? -52.486 23.824 -37.341 1.00 57.06  ? 101 ILE A CA    1 
ATOM   756  C  C     . ILE A  1  104 ? -51.281 24.620 -37.825 1.00 61.83  ? 101 ILE A C     1 
ATOM   757  O  O     . ILE A  1  104 ? -50.333 24.814 -37.047 1.00 65.55  ? 101 ILE A O     1 
ATOM   758  C  CB    . ILE A  1  104 ? -52.071 22.355 -37.110 1.00 56.27  ? 101 ILE A CB    1 
ATOM   759  C  CG1   . ILE A  1  104 ? -51.657 21.689 -38.425 1.00 58.15  ? 101 ILE A CG1   1 
ATOM   760  C  CG2   . ILE A  1  104 ? -53.197 21.583 -36.438 1.00 57.36  ? 101 ILE A CG2   1 
ATOM   761  C  CD1   . ILE A  1  104 ? -51.318 20.218 -38.278 1.00 57.90  ? 101 ILE A CD1   1 
ATOM   762  N  N     . THR A  1  105 ? -51.281 25.091 -39.071 1.00 63.36  ? 102 THR A N     1 
ATOM   763  C  CA    . THR A  1  105 ? -50.128 25.799 -39.614 1.00 53.32  ? 102 THR A CA    1 
ATOM   764  C  C     . THR A  1  105 ? -50.335 27.307 -39.702 1.00 52.45  ? 102 THR A C     1 
ATOM   765  O  O     . THR A  1  105 ? -49.393 28.068 -39.461 1.00 59.55  ? 102 THR A O     1 
ATOM   766  C  CB    . THR A  1  105 ? -49.774 25.255 -41.004 1.00 57.64  ? 102 THR A CB    1 
ATOM   767  O  OG1   . THR A  1  105 ? -49.634 23.829 -40.939 1.00 63.19  ? 102 THR A OG1   1 
ATOM   768  C  CG2   . THR A  1  105 ? -48.465 25.859 -41.503 1.00 53.14  ? 102 THR A CG2   1 
ATOM   769  N  N     . ASN A  1  106 ? -51.545 27.757 -40.033 1.00 52.69  ? 103 ASN A N     1 
ATOM   770  C  CA    . ASN A  1  106 ? -51.784 29.181 -40.220 1.00 57.48  ? 103 ASN A CA    1 
ATOM   771  C  C     . ASN A  1  106 ? -51.603 29.945 -38.912 1.00 54.78  ? 103 ASN A C     1 
ATOM   772  O  O     . ASN A  1  106 ? -51.719 29.397 -37.813 1.00 57.25  ? 103 ASN A O     1 
ATOM   773  C  CB    . ASN A  1  106 ? -53.190 29.431 -40.767 1.00 56.13  ? 103 ASN A CB    1 
ATOM   774  C  CG    . ASN A  1  106 ? -53.334 29.012 -42.214 1.00 57.55  ? 103 ASN A CG    1 
ATOM   775  O  OD1   . ASN A  1  106 ? -52.342 28.872 -42.930 1.00 58.55  ? 103 ASN A OD1   1 
ATOM   776  N  ND2   . ASN A  1  106 ? -54.570 28.818 -42.656 1.00 55.82  ? 103 ASN A ND2   1 
ATOM   777  N  N     . ALA A  1  107 ? -51.312 31.234 -39.050 1.00 56.80  ? 104 ALA A N     1 
ATOM   778  C  CA    . ALA A  1  107 ? -51.185 32.112 -37.902 1.00 57.21  ? 104 ALA A CA    1 
ATOM   779  C  C     . ALA A  1  107 ? -52.552 32.640 -37.480 1.00 61.28  ? 104 ALA A C     1 
ATOM   780  O  O     . ALA A  1  107 ? -53.518 32.637 -38.248 1.00 71.27  ? 104 ALA A O     1 
ATOM   781  C  CB    . ALA A  1  107 ? -50.246 33.275 -38.213 1.00 49.26  ? 104 ALA A CB    1 
ATOM   782  N  N     . SER A  1  108 ? -52.626 33.089 -36.233 1.00 59.77  ? 105 SER A N     1 
ATOM   783  C  CA    . SER A  1  108 ? -53.815 33.768 -35.746 1.00 59.70  ? 105 SER A CA    1 
ATOM   784  C  C     . SER A  1  108 ? -53.812 35.215 -36.221 1.00 57.29  ? 105 SER A C     1 
ATOM   785  O  O     . SER A  1  108 ? -52.761 35.793 -36.509 1.00 66.17  ? 105 SER A O     1 
ATOM   786  C  CB    . SER A  1  108 ? -53.871 33.715 -34.219 1.00 60.09  ? 105 SER A CB    1 
ATOM   787  O  OG    . SER A  1  108 ? -55.066 34.296 -33.727 1.00 62.96  ? 105 SER A OG    1 
ATOM   788  N  N     . ASN A  1  109 ? -55.008 35.802 -36.318 1.00 57.09  ? 106 ASN A N     1 
ATOM   789  C  CA    . ASN A  1  109 ? -55.124 37.232 -36.582 1.00 59.73  ? 106 ASN A CA    1 
ATOM   790  C  C     . ASN A  1  109 ? -56.023 37.924 -35.563 1.00 55.13  ? 106 ASN A C     1 
ATOM   791  O  O     . ASN A  1  109 ? -56.514 39.027 -35.823 1.00 66.77  ? 106 ASN A O     1 
ATOM   792  C  CB    . ASN A  1  109 ? -55.614 37.503 -38.009 1.00 55.54  ? 106 ASN A CB    1 
ATOM   793  C  CG    . ASN A  1  109 ? -56.926 36.818 -38.326 1.00 64.05  ? 106 ASN A CG    1 
ATOM   794  O  OD1   . ASN A  1  109 ? -57.554 36.208 -37.461 1.00 66.03  ? 106 ASN A OD1   1 
ATOM   795  N  ND2   . ASN A  1  109 ? -57.352 36.923 -39.579 1.00 69.40  ? 106 ASN A ND2   1 
ATOM   796  N  N     . LYS A  1  110 ? -56.244 37.299 -34.409 1.00 59.50  ? 107 LYS A N     1 
ATOM   797  C  CA    . LYS A  1  110 ? -56.919 37.927 -33.283 1.00 66.11  ? 107 LYS A CA    1 
ATOM   798  C  C     . LYS A  1  110 ? -55.944 38.020 -32.120 1.00 63.18  ? 107 LYS A C     1 
ATOM   799  O  O     . LYS A  1  110 ? -55.342 37.016 -31.726 1.00 62.54  ? 107 LYS A O     1 
ATOM   800  C  CB    . LYS A  1  110 ? -58.169 37.146 -32.866 1.00 68.66  ? 107 LYS A CB    1 
ATOM   801  C  CG    . LYS A  1  110 ? -59.300 37.182 -33.884 1.00 69.72  ? 107 LYS A CG    1 
ATOM   802  C  CD    . LYS A  1  110 ? -59.389 35.883 -34.672 1.00 83.73  ? 107 LYS A CD    1 
ATOM   803  C  CE    . LYS A  1  110 ? -60.506 35.931 -35.706 1.00 95.47  ? 107 LYS A CE    1 
ATOM   804  N  NZ    . LYS A  1  110 ? -60.225 36.930 -36.774 1.00 101.44 ? 107 LYS A NZ    1 
ATOM   805  N  N     . ALA A  1  111 ? -55.788 39.223 -31.578 1.00 61.20  ? 108 ALA A N     1 
ATOM   806  C  CA    . ALA A  1  111 ? -54.881 39.435 -30.465 1.00 57.72  ? 108 ALA A CA    1 
ATOM   807  C  C     . ALA A  1  111 ? -55.511 38.953 -29.160 1.00 55.70  ? 108 ALA A C     1 
ATOM   808  O  O     . ALA A  1  111 ? -56.725 38.766 -29.054 1.00 51.76  ? 108 ALA A O     1 
ATOM   809  C  CB    . ALA A  1  111 ? -54.500 40.910 -30.353 1.00 48.83  ? 108 ALA A CB    1 
ATOM   810  N  N     . SER A  1  112 ? -54.659 38.743 -28.162 1.00 72.41  ? 109 SER A N     1 
ATOM   811  C  CA    . SER A  1  112 ? -55.151 38.401 -26.840 1.00 57.95  ? 109 SER A CA    1 
ATOM   812  C  C     . SER A  1  112 ? -55.811 39.613 -26.188 1.00 61.71  ? 109 SER A C     1 
ATOM   813  O  O     . SER A  1  112 ? -55.581 40.764 -26.576 1.00 68.91  ? 109 SER A O     1 
ATOM   814  C  CB    . SER A  1  112 ? -54.013 37.893 -25.954 1.00 51.62  ? 109 SER A CB    1 
ATOM   815  O  OG    . SER A  1  112 ? -53.347 36.789 -26.542 1.00 69.66  ? 109 SER A OG    1 
ATOM   816  N  N     . GLY A  1  113 ? -56.646 39.341 -25.191 1.00 56.05  ? 110 GLY A N     1 
ATOM   817  C  CA    . GLY A  1  113 ? -57.224 40.382 -24.377 1.00 50.97  ? 110 GLY A CA    1 
ATOM   818  C  C     . GLY A  1  113 ? -56.149 41.104 -23.591 1.00 50.85  ? 110 GLY A C     1 
ATOM   819  O  O     . GLY A  1  113 ? -55.017 40.627 -23.465 1.00 49.51  ? 110 GLY A O     1 
ATOM   820  N  N     . PRO A  1  114 ? -56.481 42.272 -23.049 1.00 53.74  ? 111 PRO A N     1 
ATOM   821  C  CA    . PRO A  1  114 ? -55.478 43.063 -22.329 1.00 57.97  ? 111 PRO A CA    1 
ATOM   822  C  C     . PRO A  1  114 ? -54.978 42.351 -21.079 1.00 57.29  ? 111 PRO A C     1 
ATOM   823  O  O     . PRO A  1  114 ? -55.660 41.511 -20.487 1.00 60.44  ? 111 PRO A O     1 
ATOM   824  C  CB    . PRO A  1  114 ? -56.224 44.352 -21.974 1.00 55.98  ? 111 PRO A CB    1 
ATOM   825  C  CG    . PRO A  1  114 ? -57.673 43.966 -21.993 1.00 51.43  ? 111 PRO A CG    1 
ATOM   826  C  CD    . PRO A  1  114 ? -57.806 42.917 -23.054 1.00 51.39  ? 111 PRO A CD    1 
ATOM   827  N  N     . ILE A  1  115 ? -53.758 42.718 -20.679 1.00 48.90  ? 112 ILE A N     1 
ATOM   828  C  CA    . ILE A  1  115 ? -53.085 42.039 -19.581 1.00 62.58  ? 112 ILE A CA    1 
ATOM   829  C  C     . ILE A  1  115 ? -53.723 42.420 -18.249 1.00 60.66  ? 112 ILE A C     1 
ATOM   830  O  O     . ILE A  1  115 ? -54.330 43.490 -18.097 1.00 62.81  ? 112 ILE A O     1 
ATOM   831  C  CB    . ILE A  1  115 ? -51.581 42.369 -19.575 1.00 60.49  ? 112 ILE A CB    1 
ATOM   832  C  CG1   . ILE A  1  115 ? -51.367 43.883 -19.514 1.00 61.08  ? 112 ILE A CG1   1 
ATOM   833  C  CG2   . ILE A  1  115 ? -50.894 41.763 -20.786 1.00 47.29  ? 112 ILE A CG2   1 
ATOM   834  C  CD1   . ILE A  1  115 ? -49.956 44.287 -19.164 1.00 53.45  ? 112 ILE A CD1   1 
ATOM   835  N  N     . LEU A  1  116 ? -53.580 41.531 -17.273 1.00 65.62  ? 113 LEU A N     1 
ATOM   836  C  CA    . LEU A  1  116 ? -53.980 41.800 -15.905 1.00 69.27  ? 113 LEU A CA    1 
ATOM   837  C  C     . LEU A  1  116 ? -52.818 42.414 -15.137 1.00 58.15  ? 113 LEU A C     1 
ATOM   838  O  O     . LEU A  1  116 ? -51.651 42.111 -15.395 1.00 58.17  ? 113 LEU A O     1 
ATOM   839  C  CB    . LEU A  1  116 ? -54.436 40.522 -15.202 1.00 62.56  ? 113 LEU A CB    1 
ATOM   840  C  CG    . LEU A  1  116 ? -55.629 39.766 -15.784 1.00 58.83  ? 113 LEU A CG    1 
ATOM   841  C  CD1   . LEU A  1  116 ? -55.795 38.426 -15.084 1.00 55.51  ? 113 LEU A CD1   1 
ATOM   842  C  CD2   . LEU A  1  116 ? -56.895 40.597 -15.660 1.00 60.08  ? 113 LEU A CD2   1 
ATOM   843  N  N     . ARG A  1  117 ? -53.142 43.284 -14.195 1.00 57.10  ? 114 ARG A N     1 
ATOM   844  C  CA    . ARG A  1  117 ? -52.122 43.786 -13.284 1.00 53.69  ? 114 ARG A CA    1 
ATOM   845  C  C     . ARG A  1  117 ? -52.437 43.273 -11.884 1.00 50.89  ? 114 ARG A C     1 
ATOM   846  O  O     . ARG A  1  117 ? -53.097 43.968 -11.101 1.00 59.77  ? 114 ARG A O     1 
ATOM   847  C  CB    . ARG A  1  117 ? -52.053 45.314 -13.311 1.00 54.37  ? 114 ARG A CB    1 
ATOM   848  C  CG    . ARG A  1  117 ? -51.865 45.916 -14.703 1.00 52.39  ? 114 ARG A CG    1 
ATOM   849  C  CD    . ARG A  1  117 ? -50.780 45.205 -15.500 1.00 48.04  ? 114 ARG A CD    1 
ATOM   850  N  NE    . ARG A  1  117 ? -49.486 45.200 -14.825 1.00 58.14  ? 114 ARG A NE    1 
ATOM   851  C  CZ    . ARG A  1  117 ? -48.575 46.159 -14.944 1.00 53.64  ? 114 ARG A CZ    1 
ATOM   852  N  NH1   . ARG A  1  117 ? -48.817 47.212 -15.712 1.00 51.79  ? 114 ARG A NH1   1 
ATOM   853  N  NH2   . ARG A  1  117 ? -47.424 46.067 -14.292 1.00 51.22  ? 114 ARG A NH2   1 
ATOM   854  N  N     . PRO A  1  118 ? -51.988 42.064 -11.541 1.00 51.20  ? 115 PRO A N     1 
ATOM   855  C  CA    . PRO A  1  118 ? -52.382 41.462 -10.262 1.00 53.83  ? 115 PRO A CA    1 
ATOM   856  C  C     . PRO A  1  118 ? -51.949 42.313 -9.081  1.00 53.16  ? 115 PRO A C     1 
ATOM   857  O  O     . PRO A  1  118 ? -50.958 43.043 -9.142  1.00 52.25  ? 115 PRO A O     1 
ATOM   858  C  CB    . PRO A  1  118 ? -51.661 40.108 -10.269 1.00 50.28  ? 115 PRO A CB    1 
ATOM   859  C  CG    . PRO A  1  118 ? -50.530 40.280 -11.239 1.00 56.15  ? 115 PRO A CG    1 
ATOM   860  C  CD    . PRO A  1  118 ? -51.053 41.210 -12.291 1.00 56.21  ? 115 PRO A CD    1 
ATOM   861  N  N     . ASP A  1  119 ? -52.720 42.214 -7.999  1.00 61.90  ? 116 ASP A N     1 
ATOM   862  C  CA    . ASP A  1  119 ? -52.460 43.009 -6.808  1.00 61.77  ? 116 ASP A CA    1 
ATOM   863  C  C     . ASP A  1  119 ? -51.054 42.758 -6.281  1.00 63.10  ? 116 ASP A C     1 
ATOM   864  O  O     . ASP A  1  119 ? -50.582 41.618 -6.237  1.00 51.43  ? 116 ASP A O     1 
ATOM   865  C  CB    . ASP A  1  119 ? -53.484 42.687 -5.718  1.00 64.54  ? 116 ASP A CB    1 
ATOM   866  C  CG    . ASP A  1  119 ? -54.816 43.372 -5.946  1.00 80.77  ? 116 ASP A CG    1 
ATOM   867  O  OD1   . ASP A  1  119 ? -54.818 44.511 -6.459  1.00 91.36  ? 116 ASP A OD1   1 
ATOM   868  O  OD2   . ASP A  1  119 ? -55.860 42.775 -5.607  1.00 78.78  ? 116 ASP A OD2   1 
ATOM   869  N  N     . ARG A  1  120 ? -50.383 43.835 -5.892  1.00 56.45  ? 117 ARG A N     1 
ATOM   870  C  CA    . ARG A  1  120 ? -49.101 43.694 -5.225  1.00 52.80  ? 117 ARG A CA    1 
ATOM   871  C  C     . ARG A  1  120 ? -49.291 42.911 -3.929  1.00 56.57  ? 117 ARG A C     1 
ATOM   872  O  O     . ARG A  1  120 ? -50.269 43.144 -3.204  1.00 62.55  ? 117 ARG A O     1 
ATOM   873  C  CB    . ARG A  1  120 ? -48.489 45.066 -4.927  1.00 52.98  ? 117 ARG A CB    1 
ATOM   874  C  CG    . ARG A  1  120 ? -47.097 45.007 -4.307  1.00 56.72  ? 117 ARG A CG    1 
ATOM   875  C  CD    . ARG A  1  120 ? -46.579 46.389 -3.925  1.00 58.09  ? 117 ARG A CD    1 
ATOM   876  N  NE    . ARG A  1  120 ? -46.415 47.265 -5.082  1.00 57.28  ? 117 ARG A NE    1 
ATOM   877  C  CZ    . ARG A  1  120 ? -45.298 47.358 -5.797  1.00 58.97  ? 117 ARG A CZ    1 
ATOM   878  N  NH1   . ARG A  1  120 ? -44.238 46.626 -5.480  1.00 57.19  ? 117 ARG A NH1   1 
ATOM   879  N  NH2   . ARG A  1  120 ? -45.239 48.184 -6.833  1.00 58.82  ? 117 ARG A NH2   1 
ATOM   880  N  N     . PRO A  1  121 ? -48.413 41.955 -3.629  1.00 56.84  ? 118 PRO A N     1 
ATOM   881  C  CA    . PRO A  1  121 ? -48.496 41.261 -2.340  1.00 57.48  ? 118 PRO A CA    1 
ATOM   882  C  C     . PRO A  1  121 ? -48.518 42.264 -1.196  1.00 61.46  ? 118 PRO A C     1 
ATOM   883  O  O     . PRO A  1  121 ? -47.858 43.304 -1.249  1.00 62.59  ? 118 PRO A O     1 
ATOM   884  C  CB    . PRO A  1  121 ? -47.229 40.400 -2.325  1.00 63.34  ? 118 PRO A CB    1 
ATOM   885  C  CG    . PRO A  1  121 ? -46.936 40.157 -3.770  1.00 56.61  ? 118 PRO A CG    1 
ATOM   886  C  CD    . PRO A  1  121 ? -47.342 41.416 -4.484  1.00 49.69  ? 118 PRO A CD    1 
ATOM   887  N  N     . GLN A  1  122 ? -49.313 41.963 -0.172  1.00 61.93  ? 119 GLN A N     1 
ATOM   888  C  CA    . GLN A  1  122 ? -49.589 42.965 0.855   1.00 55.05  ? 119 GLN A CA    1 
ATOM   889  C  C     . GLN A  1  122 ? -48.395 43.187 1.774   1.00 58.88  ? 119 GLN A C     1 
ATOM   890  O  O     . GLN A  1  122 ? -48.125 44.322 2.180   1.00 59.95  ? 119 GLN A O     1 
ATOM   891  C  CB    . GLN A  1  122 ? -50.816 42.565 1.668   1.00 66.90  ? 119 GLN A CB    1 
ATOM   892  C  CG    . GLN A  1  122 ? -52.135 42.735 0.932   1.00 73.69  ? 119 GLN A CG    1 
ATOM   893  C  CD    . GLN A  1  122 ? -53.334 42.520 1.833   1.00 85.57  ? 119 GLN A CD    1 
ATOM   894  O  OE1   . GLN A  1  122 ? -53.211 42.507 3.059   1.00 89.62  ? 119 GLN A OE1   1 
ATOM   895  N  NE2   . GLN A  1  122 ? -54.502 42.351 1.229   1.00 81.96  ? 119 GLN A NE2   1 
ATOM   896  N  N     . LYS A  1  123 ? -47.675 42.127 2.117   1.00 54.67  ? 120 LYS A N     1 
ATOM   897  C  CA    . LYS A  1  123 ? -46.567 42.191 3.054   1.00 66.72  ? 120 LYS A CA    1 
ATOM   898  C  C     . LYS A  1  123 ? -45.308 41.623 2.423   1.00 57.34  ? 120 LYS A C     1 
ATOM   899  O  O     . LYS A  1  123 ? -45.377 40.849 1.460   1.00 53.12  ? 120 LYS A O     1 
ATOM   900  C  CB    . LYS A  1  123 ? -46.876 41.412 4.342   1.00 69.87  ? 120 LYS A CB    1 
ATOM   901  C  CG    . LYS A  1  123 ? -48.122 41.846 5.079   1.00 68.95  ? 120 LYS A CG    1 
ATOM   902  C  CD    . LYS A  1  123 ? -48.408 40.857 6.195   1.00 76.16  ? 120 LYS A CD    1 
ATOM   903  C  CE    . LYS A  1  123 ? -49.694 41.175 6.930   1.00 85.06  ? 120 LYS A CE    1 
ATOM   904  N  NZ    . LYS A  1  123 ? -49.994 40.134 7.953   1.00 91.68  ? 120 LYS A NZ    1 
ATOM   905  N  N     . PRO A  1  124 ? -44.135 41.993 2.940   1.00 57.79  ? 121 PRO A N     1 
ATOM   906  C  CA    . PRO A  1  124 ? -42.916 41.267 2.573   1.00 52.96  ? 121 PRO A CA    1 
ATOM   907  C  C     . PRO A  1  124 ? -43.038 39.804 2.966   1.00 56.41  ? 121 PRO A C     1 
ATOM   908  O  O     . PRO A  1  124 ? -43.716 39.455 3.936   1.00 71.33  ? 121 PRO A O     1 
ATOM   909  C  CB    . PRO A  1  124 ? -41.820 41.977 3.378   1.00 55.22  ? 121 PRO A CB    1 
ATOM   910  C  CG    . PRO A  1  124 ? -42.371 43.332 3.657   1.00 56.40  ? 121 PRO A CG    1 
ATOM   911  C  CD    . PRO A  1  124 ? -43.852 43.151 3.807   1.00 54.45  ? 121 PRO A CD    1 
ATOM   912  N  N     . PHE A  1  125 ? -42.390 38.948 2.179   1.00 56.27  ? 122 PHE A N     1 
ATOM   913  C  CA    . PHE A  1  125 ? -42.347 37.500 2.360   1.00 58.71  ? 122 PHE A CA    1 
ATOM   914  C  C     . PHE A  1  125 ? -43.693 36.829 2.121   1.00 60.10  ? 122 PHE A C     1 
ATOM   915  O  O     . PHE A  1  125 ? -43.838 35.633 2.398   1.00 64.73  ? 122 PHE A O     1 
ATOM   916  C  CB    . PHE A  1  125 ? -41.817 37.119 3.747   1.00 53.01  ? 122 PHE A CB    1 
ATOM   917  C  CG    . PHE A  1  125 ? -40.492 37.746 4.073   1.00 56.71  ? 122 PHE A CG    1 
ATOM   918  C  CD1   . PHE A  1  125 ? -39.346 37.342 3.411   1.00 51.10  ? 122 PHE A CD1   1 
ATOM   919  C  CD2   . PHE A  1  125 ? -40.393 38.740 5.033   1.00 51.76  ? 122 PHE A CD2   1 
ATOM   920  C  CE1   . PHE A  1  125 ? -38.124 37.914 3.698   1.00 50.78  ? 122 PHE A CE1   1 
ATOM   921  C  CE2   . PHE A  1  125 ? -39.171 39.315 5.328   1.00 51.41  ? 122 PHE A CE2   1 
ATOM   922  C  CZ    . PHE A  1  125 ? -38.036 38.902 4.659   1.00 55.55  ? 122 PHE A CZ    1 
ATOM   923  N  N     . ASP A  1  126 ? -44.688 37.557 1.612   1.00 55.35  ? 123 ASP A N     1 
ATOM   924  C  CA    . ASP A  1  126 ? -45.924 36.900 1.198   1.00 52.58  ? 123 ASP A CA    1 
ATOM   925  C  C     . ASP A  1  126 ? -45.694 36.038 -0.037  1.00 61.57  ? 123 ASP A C     1 
ATOM   926  O  O     . ASP A  1  126 ? -46.190 34.908 -0.114  1.00 63.10  ? 123 ASP A O     1 
ATOM   927  C  CB    . ASP A  1  126 ? -47.016 37.934 0.927   1.00 59.09  ? 123 ASP A CB    1 
ATOM   928  C  CG    . ASP A  1  126 ? -47.793 38.301 2.174   1.00 66.21  ? 123 ASP A CG    1 
ATOM   929  O  OD1   . ASP A  1  126 ? -47.624 37.617 3.205   1.00 81.40  ? 123 ASP A OD1   1 
ATOM   930  O  OD2   . ASP A  1  126 ? -48.584 39.266 2.118   1.00 72.13  ? 123 ASP A OD2   1 
ATOM   931  N  N     . LYS A  1  127 ? -44.938 36.549 -1.007  1.00 52.85  ? 124 LYS A N     1 
ATOM   932  C  CA    . LYS A  1  127 ? -44.711 35.828 -2.249  1.00 50.85  ? 124 LYS A CA    1 
ATOM   933  C  C     . LYS A  1  127 ? -43.321 36.143 -2.780  1.00 58.22  ? 124 LYS A C     1 
ATOM   934  O  O     . LYS A  1  127 ? -42.956 37.315 -2.911  1.00 62.78  ? 124 LYS A O     1 
ATOM   935  C  CB    . LYS A  1  127 ? -45.770 36.191 -3.298  1.00 50.73  ? 124 LYS A CB    1 
ATOM   936  C  CG    . LYS A  1  127 ? -45.581 35.488 -4.629  1.00 66.88  ? 124 LYS A CG    1 
ATOM   937  C  CD    . LYS A  1  127 ? -46.685 35.834 -5.613  1.00 68.88  ? 124 LYS A CD    1 
ATOM   938  C  CE    . LYS A  1  127 ? -48.034 35.311 -5.155  1.00 69.56  ? 124 LYS A CE    1 
ATOM   939  N  NZ    . LYS A  1  127 ? -48.984 35.198 -6.298  1.00 69.86  ? 124 LYS A NZ    1 
ATOM   940  N  N     . PHE A  1  128 ? -42.555 35.097 -3.075  1.00 58.35  ? 125 PHE A N     1 
ATOM   941  C  CA    . PHE A  1  128 ? -41.272 35.217 -3.748  1.00 58.17  ? 125 PHE A CA    1 
ATOM   942  C  C     . PHE A  1  128 ? -41.429 34.866 -5.222  1.00 54.79  ? 125 PHE A C     1 
ATOM   943  O  O     . PHE A  1  128 ? -42.211 33.981 -5.583  1.00 60.39  ? 125 PHE A O     1 
ATOM   944  C  CB    . PHE A  1  128 ? -40.219 34.296 -3.124  1.00 60.92  ? 125 PHE A CB    1 
ATOM   945  C  CG    . PHE A  1  128 ? -39.558 34.856 -1.896  1.00 59.22  ? 125 PHE A CG    1 
ATOM   946  C  CD1   . PHE A  1  128 ? -39.880 36.117 -1.424  1.00 58.26  ? 125 PHE A CD1   1 
ATOM   947  C  CD2   . PHE A  1  128 ? -38.601 34.116 -1.219  1.00 59.90  ? 125 PHE A CD2   1 
ATOM   948  C  CE1   . PHE A  1  128 ? -39.266 36.624 -0.293  1.00 52.95  ? 125 PHE A CE1   1 
ATOM   949  C  CE2   . PHE A  1  128 ? -37.983 34.618 -0.091  1.00 60.14  ? 125 PHE A CE2   1 
ATOM   950  C  CZ    . PHE A  1  128 ? -38.316 35.871 0.373   1.00 52.94  ? 125 PHE A CZ    1 
ATOM   951  N  N     . PHE A  1  129 ? -40.682 35.566 -6.070  1.00 58.27  ? 126 PHE A N     1 
ATOM   952  C  CA    . PHE A  1  129 ? -40.550 35.223 -7.479  1.00 53.97  ? 126 PHE A CA    1 
ATOM   953  C  C     . PHE A  1  129 ? -39.104 34.824 -7.726  1.00 56.34  ? 126 PHE A C     1 
ATOM   954  O  O     . PHE A  1  129 ? -38.185 35.600 -7.442  1.00 57.82  ? 126 PHE A O     1 
ATOM   955  C  CB    . PHE A  1  129 ? -40.949 36.396 -8.376  1.00 49.86  ? 126 PHE A CB    1 
ATOM   956  C  CG    . PHE A  1  129 ? -42.417 36.709 -8.351  1.00 51.32  ? 126 PHE A CG    1 
ATOM   957  C  CD1   . PHE A  1  129 ? -42.953 37.498 -7.350  1.00 48.79  ? 126 PHE A CD1   1 
ATOM   958  C  CD2   . PHE A  1  129 ? -43.260 36.217 -9.335  1.00 54.05  ? 126 PHE A CD2   1 
ATOM   959  C  CE1   . PHE A  1  129 ? -44.302 37.790 -7.327  1.00 53.39  ? 126 PHE A CE1   1 
ATOM   960  C  CE2   . PHE A  1  129 ? -44.610 36.505 -9.316  1.00 56.99  ? 126 PHE A CE2   1 
ATOM   961  C  CZ    . PHE A  1  129 ? -45.131 37.294 -8.312  1.00 56.54  ? 126 PHE A CZ    1 
ATOM   962  N  N     . ILE A  1  130 ? -38.896 33.610 -8.230  1.00 48.05  ? 127 ILE A N     1 
ATOM   963  C  CA    . ILE A  1  130 ? -37.550 33.104 -8.455  1.00 53.09  ? 127 ILE A CA    1 
ATOM   964  C  C     . ILE A  1  130 ? -37.408 32.666 -9.901  1.00 55.62  ? 127 ILE A C     1 
ATOM   965  O  O     . ILE A  1  130 ? -38.389 32.314 -10.566 1.00 57.71  ? 127 ILE A O     1 
ATOM   966  C  CB    . ILE A  1  130 ? -37.192 31.942 -7.500  1.00 56.29  ? 127 ILE A CB    1 
ATOM   967  C  CG1   . ILE A  1  130 ? -38.015 30.693 -7.823  1.00 57.16  ? 127 ILE A CG1   1 
ATOM   968  C  CG2   . ILE A  1  130 ? -37.385 32.364 -6.057  1.00 55.76  ? 127 ILE A CG2   1 
ATOM   969  C  CD1   . ILE A  1  130 ? -37.610 29.488 -6.997  1.00 67.42  ? 127 ILE A CD1   1 
ATOM   970  N  N     . ASP A  1  131 ? -36.169 32.674 -10.380 1.00 56.75  ? 128 ASP A N     1 
ATOM   971  C  CA    . ASP A  1  131 ? -35.837 32.381 -11.767 1.00 56.82  ? 128 ASP A CA    1 
ATOM   972  C  C     . ASP A  1  131 ? -34.321 32.308 -11.872 1.00 54.96  ? 128 ASP A C     1 
ATOM   973  O  O     . ASP A  1  131 ? -33.601 32.788 -10.991 1.00 51.98  ? 128 ASP A O     1 
ATOM   974  C  CB    . ASP A  1  131 ? -36.395 33.449 -12.721 1.00 58.65  ? 128 ASP A CB    1 
ATOM   975  C  CG    . ASP A  1  131 ? -36.258 33.063 -14.183 1.00 60.24  ? 128 ASP A CG    1 
ATOM   976  O  OD1   . ASP A  1  131 ? -36.454 31.873 -14.505 1.00 63.60  ? 128 ASP A OD1   1 
ATOM   977  O  OD2   . ASP A  1  131 ? -35.944 33.946 -15.011 1.00 65.96  ? 128 ASP A OD2   1 
ATOM   978  N  N     . TYR A  1  132 ? -33.844 31.696 -12.951 1.00 48.26  ? 129 TYR A N     1 
ATOM   979  C  CA    . TYR A  1  132 ? -32.419 31.602 -13.222 1.00 47.95  ? 129 TYR A CA    1 
ATOM   980  C  C     . TYR A  1  132 ? -32.045 32.496 -14.396 1.00 55.65  ? 129 TYR A C     1 
ATOM   981  O  O     . TYR A  1  132 ? -32.812 32.640 -15.353 1.00 67.92  ? 129 TYR A O     1 
ATOM   982  C  CB    . TYR A  1  132 ? -32.000 30.161 -13.522 1.00 48.76  ? 129 TYR A CB    1 
ATOM   983  C  CG    . TYR A  1  132 ? -31.624 29.372 -12.292 1.00 59.84  ? 129 TYR A CG    1 
ATOM   984  C  CD1   . TYR A  1  132 ? -30.408 29.581 -11.653 1.00 59.31  ? 129 TYR A CD1   1 
ATOM   985  C  CD2   . TYR A  1  132 ? -32.483 28.415 -11.768 1.00 63.64  ? 129 TYR A CD2   1 
ATOM   986  C  CE1   . TYR A  1  132 ? -30.061 28.863 -10.525 1.00 57.86  ? 129 TYR A CE1   1 
ATOM   987  C  CE2   . TYR A  1  132 ? -32.144 27.692 -10.642 1.00 62.19  ? 129 TYR A CE2   1 
ATOM   988  C  CZ    . TYR A  1  132 ? -30.932 27.920 -10.025 1.00 60.22  ? 129 TYR A CZ    1 
ATOM   989  O  OH    . TYR A  1  132 ? -30.587 27.202 -8.902  1.00 70.18  ? 129 TYR A OH    1 
ATOM   990  N  N     . ILE A  1  133 ? -30.867 33.104 -14.304 1.00 53.03  ? 130 ILE A N     1 
ATOM   991  C  CA    . ILE A  1  133 ? -30.228 33.789 -15.418 1.00 49.17  ? 130 ILE A CA    1 
ATOM   992  C  C     . ILE A  1  133 ? -29.052 32.936 -15.865 1.00 62.81  ? 130 ILE A C     1 
ATOM   993  O  O     . ILE A  1  133 ? -28.342 32.358 -15.033 1.00 62.74  ? 130 ILE A O     1 
ATOM   994  C  CB    . ILE A  1  133 ? -29.759 35.207 -15.033 1.00 50.87  ? 130 ILE A CB    1 
ATOM   995  C  CG1   . ILE A  1  133 ? -30.947 36.107 -14.697 1.00 61.92  ? 130 ILE A CG1   1 
ATOM   996  C  CG2   . ILE A  1  133 ? -28.928 35.834 -16.146 1.00 59.69  ? 130 ILE A CG2   1 
ATOM   997  C  CD1   . ILE A  1  133 ? -30.521 37.484 -14.241 1.00 68.73  ? 130 ILE A CD1   1 
ATOM   998  N  N     . GLY A  1  134 ? -28.853 32.845 -17.174 1.00 64.12  ? 131 GLY A N     1 
ATOM   999  C  CA    . GLY A  1  134 ? -27.709 32.124 -17.694 1.00 54.65  ? 131 GLY A CA    1 
ATOM   1000 C  C     . GLY A  1  134 ? -28.029 31.153 -18.807 1.00 58.49  ? 131 GLY A C     1 
ATOM   1001 O  O     . GLY A  1  134 ? -29.195 30.989 -19.171 1.00 62.71  ? 131 GLY A O     1 
ATOM   1002 N  N     . PRO A  1  135 ? -26.994 30.485 -19.346 1.00 62.95  ? 132 PRO A N     1 
ATOM   1003 C  CA    . PRO A  1  135 ? -25.595 30.562 -18.896 1.00 68.67  ? 132 PRO A CA    1 
ATOM   1004 C  C     . PRO A  1  135 ? -24.876 31.869 -19.245 1.00 67.67  ? 132 PRO A C     1 
ATOM   1005 O  O     . PRO A  1  135 ? -25.192 32.513 -20.240 1.00 64.86  ? 132 PRO A O     1 
ATOM   1006 C  CB    . PRO A  1  135 ? -24.938 29.384 -19.624 1.00 65.92  ? 132 PRO A CB    1 
ATOM   1007 C  CG    . PRO A  1  135 ? -25.749 29.208 -20.845 1.00 58.79  ? 132 PRO A CG    1 
ATOM   1008 C  CD    . PRO A  1  135 ? -27.161 29.515 -20.442 1.00 60.04  ? 132 PRO A CD    1 
ATOM   1009 N  N     . LEU A  1  136 ? -23.930 32.248 -18.398 1.00 64.49  ? 133 LEU A N     1 
ATOM   1010 C  CA    . LEU A  1  136 ? -23.082 33.416 -18.549 1.00 61.90  ? 133 LEU A CA    1 
ATOM   1011 C  C     . LEU A  1  136 ? -21.653 32.971 -18.833 1.00 70.33  ? 133 LEU A C     1 
ATOM   1012 O  O     . LEU A  1  136 ? -21.330 31.786 -18.720 1.00 77.90  ? 133 LEU A O     1 
ATOM   1013 C  CB    . LEU A  1  136 ? -23.127 34.264 -17.272 1.00 59.51  ? 133 LEU A CB    1 
ATOM   1014 C  CG    . LEU A  1  136 ? -24.466 34.722 -16.696 1.00 60.31  ? 133 LEU A CG    1 
ATOM   1015 C  CD1   . LEU A  1  136 ? -24.228 35.480 -15.397 1.00 52.79  ? 133 LEU A CD1   1 
ATOM   1016 C  CD2   . LEU A  1  136 ? -25.232 35.583 -17.690 1.00 56.97  ? 133 LEU A CD2   1 
ATOM   1017 N  N     . PRO A  1  137 ? -20.765 33.890 -19.218 1.00 69.29  ? 134 PRO A N     1 
ATOM   1018 C  CA    . PRO A  1  137 ? -19.339 33.557 -19.282 1.00 66.36  ? 134 PRO A CA    1 
ATOM   1019 C  C     . PRO A  1  137 ? -18.859 32.976 -17.965 1.00 71.65  ? 134 PRO A C     1 
ATOM   1020 O  O     . PRO A  1  137 ? -19.181 33.510 -16.893 1.00 68.97  ? 134 PRO A O     1 
ATOM   1021 C  CB    . PRO A  1  137 ? -18.675 34.911 -19.571 1.00 58.19  ? 134 PRO A CB    1 
ATOM   1022 C  CG    . PRO A  1  137 ? -19.713 35.673 -20.313 1.00 62.40  ? 134 PRO A CG    1 
ATOM   1023 C  CD    . PRO A  1  137 ? -21.037 35.243 -19.730 1.00 65.25  ? 134 PRO A CD    1 
ATOM   1024 N  N     . PRO A  1  138 ? -18.103 31.879 -18.003 1.00 74.79  ? 135 PRO A N     1 
ATOM   1025 C  CA    . PRO A  1  138 ? -17.648 31.248 -16.756 1.00 69.93  ? 135 PRO A CA    1 
ATOM   1026 C  C     . PRO A  1  138 ? -16.849 32.220 -15.900 1.00 69.44  ? 135 PRO A C     1 
ATOM   1027 O  O     . PRO A  1  138 ? -15.895 32.847 -16.365 1.00 71.69  ? 135 PRO A O     1 
ATOM   1028 C  CB    . PRO A  1  138 ? -16.785 30.080 -17.246 1.00 69.76  ? 135 PRO A CB    1 
ATOM   1029 C  CG    . PRO A  1  138 ? -17.299 29.781 -18.613 1.00 69.52  ? 135 PRO A CG    1 
ATOM   1030 C  CD    . PRO A  1  138 ? -17.720 31.100 -19.192 1.00 71.17  ? 135 PRO A CD    1 
ATOM   1031 N  N     . SER A  1  139 ? -17.264 32.354 -14.643 1.00 67.56  ? 136 SER A N     1 
ATOM   1032 C  CA    . SER A  1  139 ? -16.601 33.222 -13.676 1.00 64.31  ? 136 SER A CA    1 
ATOM   1033 C  C     . SER A  1  139 ? -16.403 32.426 -12.396 1.00 66.83  ? 136 SER A C     1 
ATOM   1034 O  O     . SER A  1  139 ? -17.381 32.043 -11.745 1.00 67.58  ? 136 SER A O     1 
ATOM   1035 C  CB    . SER A  1  139 ? -17.414 34.490 -13.411 1.00 58.58  ? 136 SER A CB    1 
ATOM   1036 O  OG    . SER A  1  139 ? -16.748 35.339 -12.492 1.00 69.23  ? 136 SER A OG    1 
ATOM   1037 N  N     . GLN A  1  140 ? -15.140 32.168 -12.047 1.00 66.64  ? 137 GLN A N     1 
ATOM   1038 C  CA    . GLN A  1  140 ? -14.784 31.384 -10.864 1.00 70.53  ? 137 GLN A CA    1 
ATOM   1039 C  C     . GLN A  1  140 ? -15.410 29.993 -10.898 1.00 71.86  ? 137 GLN A C     1 
ATOM   1040 O  O     . GLN A  1  140 ? -15.649 29.382 -9.853  1.00 76.89  ? 137 GLN A O     1 
ATOM   1041 C  CB    . GLN A  1  140 ? -15.176 32.113 -9.574  1.00 78.99  ? 137 GLN A CB    1 
ATOM   1042 C  CG    . GLN A  1  140 ? -14.429 33.415 -9.334  1.00 85.47  ? 137 GLN A CG    1 
ATOM   1043 C  CD    . GLN A  1  140 ? -13.135 33.216 -8.568  1.00 93.21  ? 137 GLN A CD    1 
ATOM   1044 O  OE1   . GLN A  1  140 ? -13.145 33.014 -7.354  1.00 100.56 ? 137 GLN A OE1   1 
ATOM   1045 N  NE2   . GLN A  1  140 ? -12.012 33.275 -9.274  1.00 90.72  ? 137 GLN A NE2   1 
ATOM   1046 N  N     . GLY A  1  141 ? -15.678 29.482 -12.099 1.00 71.09  ? 138 GLY A N     1 
ATOM   1047 C  CA    . GLY A  1  141 ? -16.334 28.203 -12.262 1.00 69.14  ? 138 GLY A CA    1 
ATOM   1048 C  C     . GLY A  1  141 ? -17.845 28.246 -12.227 1.00 68.99  ? 138 GLY A C     1 
ATOM   1049 O  O     . GLY A  1  141 ? -18.480 27.185 -12.309 1.00 70.45  ? 138 GLY A O     1 
ATOM   1050 N  N     . TYR A  1  142 ? -18.444 29.428 -12.113 1.00 64.52  ? 139 TYR A N     1 
ATOM   1051 C  CA    . TYR A  1  142 ? -19.888 29.573 -12.023 1.00 61.04  ? 139 TYR A CA    1 
ATOM   1052 C  C     . TYR A  1  142 ? -20.462 30.047 -13.353 1.00 63.83  ? 139 TYR A C     1 
ATOM   1053 O  O     . TYR A  1  142 ? -19.813 30.768 -14.113 1.00 56.53  ? 139 TYR A O     1 
ATOM   1054 C  CB    . TYR A  1  142 ? -20.265 30.549 -10.906 1.00 60.15  ? 139 TYR A CB    1 
ATOM   1055 C  CG    . TYR A  1  142 ? -19.994 30.003 -9.523  1.00 67.24  ? 139 TYR A CG    1 
ATOM   1056 C  CD1   . TYR A  1  142 ? -18.750 30.156 -8.925  1.00 74.81  ? 139 TYR A CD1   1 
ATOM   1057 C  CD2   . TYR A  1  142 ? -20.979 29.320 -8.821  1.00 68.69  ? 139 TYR A CD2   1 
ATOM   1058 C  CE1   . TYR A  1  142 ? -18.497 29.651 -7.662  1.00 78.64  ? 139 TYR A CE1   1 
ATOM   1059 C  CE2   . TYR A  1  142 ? -20.736 28.813 -7.559  1.00 64.90  ? 139 TYR A CE2   1 
ATOM   1060 C  CZ    . TYR A  1  142 ? -19.494 28.981 -6.985  1.00 69.56  ? 139 TYR A CZ    1 
ATOM   1061 O  OH    . TYR A  1  142 ? -19.251 28.476 -5.729  1.00 69.45  ? 139 TYR A OH    1 
ATOM   1062 N  N     . LEU A  1  143 ? -21.702 29.632 -13.624 1.00 60.67  ? 140 LEU A N     1 
ATOM   1063 C  CA    . LEU A  1  143 ? -22.336 29.875 -14.914 1.00 66.23  ? 140 LEU A CA    1 
ATOM   1064 C  C     . LEU A  1  143 ? -23.727 30.487 -14.838 1.00 67.22  ? 140 LEU A C     1 
ATOM   1065 O  O     . LEU A  1  143 ? -24.165 31.078 -15.832 1.00 63.54  ? 140 LEU A O     1 
ATOM   1066 C  CB    . LEU A  1  143 ? -22.432 28.569 -15.717 1.00 68.08  ? 140 LEU A CB    1 
ATOM   1067 C  CG    . LEU A  1  143 ? -21.146 27.993 -16.308 1.00 61.31  ? 140 LEU A CG    1 
ATOM   1068 C  CD1   . LEU A  1  143 ? -21.422 26.650 -16.968 1.00 62.70  ? 140 LEU A CD1   1 
ATOM   1069 C  CD2   . LEU A  1  143 ? -20.550 28.967 -17.303 1.00 56.50  ? 140 LEU A CD2   1 
ATOM   1070 N  N     . TYR A  1  144 ? -24.438 30.362 -13.720 1.00 64.05  ? 141 TYR A N     1 
ATOM   1071 C  CA    . TYR A  1  144 ? -25.811 30.831 -13.612 1.00 64.04  ? 141 TYR A CA    1 
ATOM   1072 C  C     . TYR A  1  144 ? -25.968 31.667 -12.350 1.00 64.97  ? 141 TYR A C     1 
ATOM   1073 O  O     . TYR A  1  144 ? -25.101 31.679 -11.471 1.00 69.86  ? 141 TYR A O     1 
ATOM   1074 C  CB    . TYR A  1  144 ? -26.805 29.659 -13.603 1.00 57.18  ? 141 TYR A CB    1 
ATOM   1075 C  CG    . TYR A  1  144 ? -26.808 28.831 -14.872 1.00 67.50  ? 141 TYR A CG    1 
ATOM   1076 C  CD1   . TYR A  1  144 ? -25.844 27.855 -15.092 1.00 70.09  ? 141 TYR A CD1   1 
ATOM   1077 C  CD2   . TYR A  1  144 ? -27.783 29.018 -15.845 1.00 63.52  ? 141 TYR A CD2   1 
ATOM   1078 C  CE1   . TYR A  1  144 ? -25.843 27.096 -16.248 1.00 69.79  ? 141 TYR A CE1   1 
ATOM   1079 C  CE2   . TYR A  1  144 ? -27.792 28.261 -17.003 1.00 63.35  ? 141 TYR A CE2   1 
ATOM   1080 C  CZ    . TYR A  1  144 ? -26.820 27.303 -17.200 1.00 66.48  ? 141 TYR A CZ    1 
ATOM   1081 O  OH    . TYR A  1  144 ? -26.827 26.549 -18.351 1.00 66.12  ? 141 TYR A OH    1 
ATOM   1082 N  N     . VAL A  1  145 ? -27.090 32.379 -12.267 1.00 57.21  ? 142 VAL A N     1 
ATOM   1083 C  CA    . VAL A  1  145 ? -27.430 33.191 -11.102 1.00 57.50  ? 142 VAL A CA    1 
ATOM   1084 C  C     . VAL A  1  145 ? -28.877 32.910 -10.729 1.00 56.53  ? 142 VAL A C     1 
ATOM   1085 O  O     . VAL A  1  145 ? -29.780 33.074 -11.560 1.00 59.82  ? 142 VAL A O     1 
ATOM   1086 C  CB    . VAL A  1  145 ? -27.227 34.695 -11.356 1.00 60.14  ? 142 VAL A CB    1 
ATOM   1087 C  CG1   . VAL A  1  145 ? -27.740 35.501 -10.169 1.00 57.58  ? 142 VAL A CG1   1 
ATOM   1088 C  CG2   . VAL A  1  145 ? -25.763 35.005 -11.617 1.00 53.55  ? 142 VAL A CG2   1 
ATOM   1089 N  N     . LEU A  1  146 ? -29.099 32.489 -9.488  1.00 58.20  ? 143 LEU A N     1 
ATOM   1090 C  CA    . LEU A  1  146 ? -30.452 32.375 -8.961  1.00 53.79  ? 143 LEU A CA    1 
ATOM   1091 C  C     . LEU A  1  146 ? -30.908 33.746 -8.478  1.00 54.05  ? 143 LEU A C     1 
ATOM   1092 O  O     . LEU A  1  146 ? -30.253 34.360 -7.629  1.00 55.51  ? 143 LEU A O     1 
ATOM   1093 C  CB    . LEU A  1  146 ? -30.511 31.360 -7.823  1.00 49.43  ? 143 LEU A CB    1 
ATOM   1094 C  CG    . LEU A  1  146 ? -31.905 31.212 -7.209  1.00 59.65  ? 143 LEU A CG    1 
ATOM   1095 C  CD1   . LEU A  1  146 ? -32.878 30.638 -8.231  1.00 74.42  ? 143 LEU A CD1   1 
ATOM   1096 C  CD2   . LEU A  1  146 ? -31.873 30.360 -5.947  1.00 61.01  ? 143 LEU A CD2   1 
ATOM   1097 N  N     . VAL A  1  147 ? -32.023 34.226 -9.019  1.00 47.53  ? 144 VAL A N     1 
ATOM   1098 C  CA    . VAL A  1  147 ? -32.570 35.533 -8.676  1.00 47.01  ? 144 VAL A CA    1 
ATOM   1099 C  C     . VAL A  1  147 ? -33.852 35.316 -7.885  1.00 58.71  ? 144 VAL A C     1 
ATOM   1100 O  O     . VAL A  1  147 ? -34.784 34.661 -8.367  1.00 54.75  ? 144 VAL A O     1 
ATOM   1101 C  CB    . VAL A  1  147 ? -32.826 36.385 -9.927  1.00 49.39  ? 144 VAL A CB    1 
ATOM   1102 C  CG1   . VAL A  1  147 ? -33.378 37.742 -9.535  1.00 46.02  ? 144 VAL A CG1   1 
ATOM   1103 C  CG2   . VAL A  1  147 ? -31.543 36.538 -10.730 1.00 46.37  ? 144 VAL A CG2   1 
ATOM   1104 N  N     . VAL A  1  148 ? -33.898 35.863 -6.673  1.00 49.06  ? 145 VAL A N     1 
ATOM   1105 C  CA    . VAL A  1  148 ? -35.057 35.752 -5.793  1.00 55.12  ? 145 VAL A CA    1 
ATOM   1106 C  C     . VAL A  1  148 ? -35.547 37.159 -5.485  1.00 59.84  ? 145 VAL A C     1 
ATOM   1107 O  O     . VAL A  1  148 ? -34.813 37.962 -4.897  1.00 59.13  ? 145 VAL A O     1 
ATOM   1108 C  CB    . VAL A  1  148 ? -34.726 34.996 -4.498  1.00 52.92  ? 145 VAL A CB    1 
ATOM   1109 C  CG1   . VAL A  1  148 ? -35.976 34.855 -3.648  1.00 54.15  ? 145 VAL A CG1   1 
ATOM   1110 C  CG2   . VAL A  1  148 ? -34.128 33.632 -4.814  1.00 48.74  ? 145 VAL A CG2   1 
ATOM   1111 N  N     . VAL A  1  149 ? -36.786 37.450 -5.871  1.00 57.92  ? 146 VAL A N     1 
ATOM   1112 C  CA    . VAL A  1  149 ? -37.362 38.786 -5.760  1.00 51.51  ? 146 VAL A CA    1 
ATOM   1113 C  C     . VAL A  1  149 ? -38.580 38.709 -4.850  1.00 55.94  ? 146 VAL A C     1 
ATOM   1114 O  O     . VAL A  1  149 ? -39.516 37.946 -5.120  1.00 61.65  ? 146 VAL A O     1 
ATOM   1115 C  CB    . VAL A  1  149 ? -37.744 39.357 -7.133  1.00 46.26  ? 146 VAL A CB    1 
ATOM   1116 C  CG1   . VAL A  1  149 ? -38.512 40.662 -6.974  1.00 46.14  ? 146 VAL A CG1   1 
ATOM   1117 C  CG2   . VAL A  1  149 ? -36.502 39.556 -7.990  1.00 50.52  ? 146 VAL A CG2   1 
ATOM   1118 N  N     . ASP A  1  150 ? -38.571 39.498 -3.778  1.00 47.38  ? 147 ASP A N     1 
ATOM   1119 C  CA    . ASP A  1  150 ? -39.748 39.637 -2.936  1.00 49.55  ? 147 ASP A CA    1 
ATOM   1120 C  C     . ASP A  1  150 ? -40.771 40.518 -3.640  1.00 50.62  ? 147 ASP A C     1 
ATOM   1121 O  O     . ASP A  1  150 ? -40.467 41.649 -4.032  1.00 54.22  ? 147 ASP A O     1 
ATOM   1122 C  CB    . ASP A  1  150 ? -39.379 40.225 -1.574  1.00 48.18  ? 147 ASP A CB    1 
ATOM   1123 C  CG    . ASP A  1  150 ? -40.595 40.634 -0.769  1.00 59.02  ? 147 ASP A CG    1 
ATOM   1124 O  OD1   . ASP A  1  150 ? -41.389 39.746 -0.394  1.00 55.98  ? 147 ASP A OD1   1 
ATOM   1125 O  OD2   . ASP A  1  150 ? -40.757 41.843 -0.507  1.00 61.56  ? 147 ASP A OD2   1 
ATOM   1126 N  N     . GLY A  1  151 ? -41.989 39.993 -3.797  1.00 52.42  ? 148 GLY A N     1 
ATOM   1127 C  CA    . GLY A  1  151 ? -42.973 40.645 -4.643  1.00 61.51  ? 148 GLY A CA    1 
ATOM   1128 C  C     . GLY A  1  151 ? -43.469 41.975 -4.112  1.00 60.49  ? 148 GLY A C     1 
ATOM   1129 O  O     . GLY A  1  151 ? -43.826 42.860 -4.895  1.00 65.73  ? 148 GLY A O     1 
ATOM   1130 N  N     . MET A  1  152 ? -43.508 42.140 -2.790  1.00 61.22  ? 149 MET A N     1 
ATOM   1131 C  CA    . MET A  1  152 ? -44.027 43.384 -2.232  1.00 56.72  ? 149 MET A CA    1 
ATOM   1132 C  C     . MET A  1  152 ? -42.994 44.502 -2.293  1.00 53.78  ? 149 MET A C     1 
ATOM   1133 O  O     . MET A  1  152 ? -43.324 45.635 -2.658  1.00 54.83  ? 149 MET A O     1 
ATOM   1134 C  CB    . MET A  1  152 ? -44.492 43.164 -0.790  1.00 56.97  ? 149 MET A CB    1 
ATOM   1135 C  CG    . MET A  1  152 ? -45.185 44.371 -0.164  1.00 66.11  ? 149 MET A CG    1 
ATOM   1136 S  SD    . MET A  1  152 ? -44.073 45.580 0.579   1.00 66.98  ? 149 MET A SD    1 
ATOM   1137 C  CE    . MET A  1  152 ? -44.741 47.096 -0.097  1.00 61.46  ? 149 MET A CE    1 
ATOM   1138 N  N     . THR A  1  153 ? -41.745 44.202 -1.942  1.00 48.15  ? 150 THR A N     1 
ATOM   1139 C  CA    . THR A  1  153 ? -40.701 45.213 -1.831  1.00 55.29  ? 150 THR A CA    1 
ATOM   1140 C  C     . THR A  1  153 ? -39.837 45.342 -3.076  1.00 63.10  ? 150 THR A C     1 
ATOM   1141 O  O     . THR A  1  153 ? -39.277 46.416 -3.316  1.00 73.74  ? 150 THR A O     1 
ATOM   1142 C  CB    . THR A  1  153 ? -39.788 44.902 -0.641  1.00 52.29  ? 150 THR A CB    1 
ATOM   1143 O  OG1   . THR A  1  153 ? -39.166 43.625 -0.839  1.00 47.94  ? 150 THR A OG1   1 
ATOM   1144 C  CG2   . THR A  1  153 ? -40.588 44.872 0.648   1.00 49.58  ? 150 THR A CG2   1 
ATOM   1145 N  N     . GLY A  1  154 ? -39.714 44.283 -3.872  1.00 49.11  ? 151 GLY A N     1 
ATOM   1146 C  CA    . GLY A  1  154 ? -38.712 44.243 -4.912  1.00 52.25  ? 151 GLY A CA    1 
ATOM   1147 C  C     . GLY A  1  154 ? -37.323 43.902 -4.421  1.00 56.21  ? 151 GLY A C     1 
ATOM   1148 O  O     . GLY A  1  154 ? -36.404 43.791 -5.242  1.00 58.34  ? 151 GLY A O     1 
ATOM   1149 N  N     . PHE A  1  155 ? -37.143 43.745 -3.111  1.00 57.40  ? 152 PHE A N     1 
ATOM   1150 C  CA    . PHE A  1  155 ? -35.860 43.333 -2.561  1.00 46.86  ? 152 PHE A CA    1 
ATOM   1151 C  C     . PHE A  1  155 ? -35.419 42.018 -3.192  1.00 53.38  ? 152 PHE A C     1 
ATOM   1152 O  O     . PHE A  1  155 ? -36.217 41.092 -3.361  1.00 60.73  ? 152 PHE A O     1 
ATOM   1153 C  CB    . PHE A  1  155 ? -35.969 43.192 -1.044  1.00 49.96  ? 152 PHE A CB    1 
ATOM   1154 C  CG    . PHE A  1  155 ? -34.661 43.335 -0.320  1.00 50.58  ? 152 PHE A CG    1 
ATOM   1155 C  CD1   . PHE A  1  155 ? -33.870 42.227 -0.071  1.00 47.96  ? 152 PHE A CD1   1 
ATOM   1156 C  CD2   . PHE A  1  155 ? -34.230 44.575 0.121   1.00 47.63  ? 152 PHE A CD2   1 
ATOM   1157 C  CE1   . PHE A  1  155 ? -32.667 42.354 0.600   1.00 48.11  ? 152 PHE A CE1   1 
ATOM   1158 C  CE2   . PHE A  1  155 ? -33.029 44.709 0.791   1.00 47.85  ? 152 PHE A CE2   1 
ATOM   1159 C  CZ    . PHE A  1  155 ? -32.247 43.597 1.032   1.00 48.03  ? 152 PHE A CZ    1 
ATOM   1160 N  N     . THR A  1  156 ? -34.136 41.939 -3.542  1.00 46.64  ? 153 THR A N     1 
ATOM   1161 C  CA    . THR A  1  156 ? -33.632 40.869 -4.390  1.00 46.56  ? 153 THR A CA    1 
ATOM   1162 C  C     . THR A  1  156 ? -32.403 40.217 -3.769  1.00 51.48  ? 153 THR A C     1 
ATOM   1163 O  O     . THR A  1  156 ? -31.553 40.898 -3.185  1.00 60.77  ? 153 THR A O     1 
ATOM   1164 C  CB    . THR A  1  156 ? -33.297 41.410 -5.790  1.00 50.96  ? 153 THR A CB    1 
ATOM   1165 O  OG1   . THR A  1  156 ? -34.480 41.971 -6.378  1.00 55.42  ? 153 THR A OG1   1 
ATOM   1166 C  CG2   . THR A  1  156 ? -32.765 40.310 -6.691  1.00 46.09  ? 153 THR A CG2   1 
ATOM   1167 N  N     . TRP A  1  157 ? -32.323 38.892 -3.892  1.00 47.88  ? 154 TRP A N     1 
ATOM   1168 C  CA    . TRP A  1  157 ? -31.176 38.105 -3.455  1.00 52.33  ? 154 TRP A CA    1 
ATOM   1169 C  C     . TRP A  1  157 ? -30.555 37.419 -4.666  1.00 50.44  ? 154 TRP A C     1 
ATOM   1170 O  O     . TRP A  1  157 ? -31.273 36.837 -5.485  1.00 56.34  ? 154 TRP A O     1 
ATOM   1171 C  CB    . TRP A  1  157 ? -31.583 37.053 -2.419  1.00 57.71  ? 154 TRP A CB    1 
ATOM   1172 C  CG    . TRP A  1  157 ? -31.929 37.598 -1.068  1.00 59.22  ? 154 TRP A CG    1 
ATOM   1173 C  CD1   . TRP A  1  157 ? -31.088 37.748 -0.005  1.00 56.88  ? 154 TRP A CD1   1 
ATOM   1174 C  CD2   . TRP A  1  157 ? -33.215 38.049 -0.627  1.00 57.08  ? 154 TRP A CD2   1 
ATOM   1175 N  NE1   . TRP A  1  157 ? -31.767 38.268 1.067   1.00 57.69  ? 154 TRP A NE1   1 
ATOM   1176 C  CE2   . TRP A  1  157 ? -33.074 38.466 0.712   1.00 59.01  ? 154 TRP A CE2   1 
ATOM   1177 C  CE3   . TRP A  1  157 ? -34.471 38.145 -1.235  1.00 58.64  ? 154 TRP A CE3   1 
ATOM   1178 C  CZ2   . TRP A  1  157 ? -34.142 38.967 1.455   1.00 62.09  ? 154 TRP A CZ2   1 
ATOM   1179 C  CZ3   . TRP A  1  157 ? -35.530 38.645 -0.498  1.00 59.96  ? 154 TRP A CZ3   1 
ATOM   1180 C  CH2   . TRP A  1  157 ? -35.357 39.050 0.833   1.00 63.56  ? 154 TRP A CH2   1 
ATOM   1181 N  N     . LEU A  1  158 ? -29.229 37.477 -4.774  1.00 47.78  ? 155 LEU A N     1 
ATOM   1182 C  CA    . LEU A  1  158 ? -28.500 36.909 -5.898  1.00 47.84  ? 155 LEU A CA    1 
ATOM   1183 C  C     . LEU A  1  158 ? -27.589 35.791 -5.417  1.00 54.49  ? 155 LEU A C     1 
ATOM   1184 O  O     . LEU A  1  158 ? -26.794 35.991 -4.490  1.00 61.58  ? 155 LEU A O     1 
ATOM   1185 C  CB    . LEU A  1  158 ? -27.681 37.983 -6.618  1.00 47.55  ? 155 LEU A CB    1 
ATOM   1186 C  CG    . LEU A  1  158 ? -28.501 39.167 -7.127  1.00 52.98  ? 155 LEU A CG    1 
ATOM   1187 C  CD1   . LEU A  1  158 ? -27.637 40.120 -7.938  1.00 57.77  ? 155 LEU A CD1   1 
ATOM   1188 C  CD2   . LEU A  1  158 ? -29.677 38.661 -7.940  1.00 52.16  ? 155 LEU A CD2   1 
ATOM   1189 N  N     . TYR A  1  159 ? -27.691 34.625 -6.051  1.00 64.33  ? 156 TYR A N     1 
ATOM   1190 C  CA    . TYR A  1  159 ? -26.871 33.467 -5.700  1.00 62.70  ? 156 TYR A CA    1 
ATOM   1191 C  C     . TYR A  1  159 ? -26.240 32.913 -6.970  1.00 67.21  ? 156 TYR A C     1 
ATOM   1192 O  O     . TYR A  1  159 ? -26.972 32.599 -7.936  1.00 70.59  ? 156 TYR A O     1 
ATOM   1193 C  CB    . TYR A  1  159 ? -27.701 32.399 -4.993  1.00 56.84  ? 156 TYR A CB    1 
ATOM   1194 C  CG    . TYR A  1  159 ? -28.256 32.849 -3.662  1.00 67.32  ? 156 TYR A CG    1 
ATOM   1195 C  CD1   . TYR A  1  159 ? -27.516 32.708 -2.496  1.00 66.96  ? 156 TYR A CD1   1 
ATOM   1196 C  CD2   . TYR A  1  159 ? -29.517 33.421 -3.574  1.00 62.05  ? 156 TYR A CD2   1 
ATOM   1197 C  CE1   . TYR A  1  159 ? -28.017 33.121 -1.279  1.00 66.51  ? 156 TYR A CE1   1 
ATOM   1198 C  CE2   . TYR A  1  159 ? -30.027 33.837 -2.362  1.00 64.26  ? 156 TYR A CE2   1 
ATOM   1199 C  CZ    . TYR A  1  159 ? -29.273 33.685 -1.218  1.00 66.97  ? 156 TYR A CZ    1 
ATOM   1200 O  OH    . TYR A  1  159 ? -29.775 34.098 -0.006  1.00 69.44  ? 156 TYR A OH    1 
ATOM   1201 N  N     . PRO A  1  160 ? -24.915 32.792 -7.041  1.00 61.25  ? 157 PRO A N     1 
ATOM   1202 C  CA    . PRO A  1  160 ? -24.277 32.164 -8.203  1.00 57.94  ? 157 PRO A CA    1 
ATOM   1203 C  C     . PRO A  1  160 ? -24.264 30.646 -8.081  1.00 63.49  ? 157 PRO A C     1 
ATOM   1204 O  O     . PRO A  1  160 ? -23.986 30.091 -7.015  1.00 72.13  ? 157 PRO A O     1 
ATOM   1205 C  CB    . PRO A  1  160 ? -22.860 32.733 -8.178  1.00 58.78  ? 157 PRO A CB    1 
ATOM   1206 C  CG    . PRO A  1  160 ? -22.600 32.972 -6.723  1.00 57.47  ? 157 PRO A CG    1 
ATOM   1207 C  CD    . PRO A  1  160 ? -23.923 33.376 -6.116  1.00 50.73  ? 157 PRO A CD    1 
ATOM   1208 N  N     . THR A  1  161 ? -24.573 29.969 -9.187  1.00 62.44  ? 158 THR A N     1 
ATOM   1209 C  CA    . THR A  1  161 ? -24.577 28.513 -9.231  1.00 66.27  ? 158 THR A CA    1 
ATOM   1210 C  C     . THR A  1  161 ? -23.837 28.036 -10.474 1.00 68.39  ? 158 THR A C     1 
ATOM   1211 O  O     . THR A  1  161 ? -23.537 28.810 -11.386 1.00 71.18  ? 158 THR A O     1 
ATOM   1212 C  CB    . THR A  1  161 ? -26.002 27.932 -9.230  1.00 64.07  ? 158 THR A CB    1 
ATOM   1213 O  OG1   . THR A  1  161 ? -26.594 28.101 -10.524 1.00 64.18  ? 158 THR A OG1   1 
ATOM   1214 C  CG2   . THR A  1  161 ? -26.872 28.617 -8.191  1.00 64.22  ? 158 THR A CG2   1 
ATOM   1215 N  N     . LYS A  1  162 ? -23.551 26.734 -10.498 1.00 67.49  ? 159 LYS A N     1 
ATOM   1216 C  CA    . LYS A  1  162 ? -22.907 26.108 -11.642 1.00 64.35  ? 159 LYS A CA    1 
ATOM   1217 C  C     . LYS A  1  162 ? -23.905 25.495 -12.617 1.00 64.64  ? 159 LYS A C     1 
ATOM   1218 O  O     . LYS A  1  162 ? -23.539 25.219 -13.764 1.00 80.03  ? 159 LYS A O     1 
ATOM   1219 C  CB    . LYS A  1  162 ? -21.924 25.030 -11.169 1.00 59.56  ? 159 LYS A CB    1 
ATOM   1220 C  CG    . LYS A  1  162 ? -20.720 25.594 -10.426 1.00 67.05  ? 159 LYS A CG    1 
ATOM   1221 C  CD    . LYS A  1  162 ? -19.831 24.506 -9.846  1.00 81.09  ? 159 LYS A CD    1 
ATOM   1222 C  CE    . LYS A  1  162 ? -18.630 25.119 -9.139  1.00 86.50  ? 159 LYS A CE    1 
ATOM   1223 N  NZ    . LYS A  1  162 ? -17.785 24.096 -8.464  1.00 93.57  ? 159 LYS A NZ    1 
ATOM   1224 N  N     . ALA A  1  163 ? -25.146 25.283 -12.188 1.00 61.81  ? 160 ALA A N     1 
ATOM   1225 C  CA    . ALA A  1  163 ? -26.201 24.762 -13.042 1.00 61.76  ? 160 ALA A CA    1 
ATOM   1226 C  C     . ALA A  1  163 ? -27.538 25.219 -12.481 1.00 62.81  ? 160 ALA A C     1 
ATOM   1227 O  O     . ALA A  1  163 ? -27.654 25.432 -11.269 1.00 72.44  ? 160 ALA A O     1 
ATOM   1228 C  CB    . ALA A  1  163 ? -26.156 23.228 -13.127 1.00 55.43  ? 160 ALA A CB    1 
ATOM   1229 N  N     . PRO A  1  164 ? -28.572 25.387 -13.339 1.00 64.53  ? 161 PRO A N     1 
ATOM   1230 C  CA    . PRO A  1  164 ? -29.927 25.661 -12.832 1.00 61.40  ? 161 PRO A CA    1 
ATOM   1231 C  C     . PRO A  1  164 ? -30.579 24.406 -12.267 1.00 64.28  ? 161 PRO A C     1 
ATOM   1232 O  O     . PRO A  1  164 ? -31.610 23.936 -12.750 1.00 59.60  ? 161 PRO A O     1 
ATOM   1233 C  CB    . PRO A  1  164 ? -30.648 26.184 -14.085 1.00 63.24  ? 161 PRO A CB    1 
ATOM   1234 C  CG    . PRO A  1  164 ? -29.995 25.459 -15.192 1.00 58.22  ? 161 PRO A CG    1 
ATOM   1235 C  CD    . PRO A  1  164 ? -28.543 25.317 -14.812 1.00 60.04  ? 161 PRO A CD    1 
ATOM   1236 N  N     . SER A  1  165 ? -29.952 23.841 -11.240 1.00 68.47  ? 162 SER A N     1 
ATOM   1237 C  CA    . SER A  1  165 ? -30.330 22.545 -10.694 1.00 68.22  ? 162 SER A CA    1 
ATOM   1238 C  C     . SER A  1  165 ? -31.215 22.711 -9.468  1.00 66.62  ? 162 SER A C     1 
ATOM   1239 O  O     . SER A  1  165 ? -31.213 23.750 -8.804  1.00 58.86  ? 162 SER A O     1 
ATOM   1240 C  CB    . SER A  1  165 ? -29.082 21.735 -10.333 1.00 72.56  ? 162 SER A CB    1 
ATOM   1241 O  OG    . SER A  1  165 ? -28.253 22.452 -9.431  1.00 65.37  ? 162 SER A OG    1 
ATOM   1242 N  N     . THR A  1  166 ? -31.990 21.662 -9.179  1.00 69.64  ? 163 THR A N     1 
ATOM   1243 C  CA    . THR A  1  166 ? -32.752 21.628 -7.935  1.00 69.65  ? 163 THR A CA    1 
ATOM   1244 C  C     . THR A  1  166 ? -31.825 21.683 -6.728  1.00 67.82  ? 163 THR A C     1 
ATOM   1245 O  O     . THR A  1  166 ? -32.111 22.379 -5.747  1.00 70.60  ? 163 THR A O     1 
ATOM   1246 C  CB    . THR A  1  166 ? -33.620 20.370 -7.888  1.00 73.16  ? 163 THR A CB    1 
ATOM   1247 O  OG1   . THR A  1  166 ? -34.594 20.417 -8.938  1.00 71.01  ? 163 THR A OG1   1 
ATOM   1248 C  CG2   . THR A  1  166 ? -34.334 20.262 -6.552  1.00 63.86  ? 163 THR A CG2   1 
ATOM   1249 N  N     . SER A  1  167 ? -30.700 20.963 -6.789  1.00 68.74  ? 164 SER A N     1 
ATOM   1250 C  CA    . SER A  1  167 ? -29.783 20.921 -5.653  1.00 67.08  ? 164 SER A CA    1 
ATOM   1251 C  C     . SER A  1  167 ? -29.205 22.300 -5.357  1.00 74.19  ? 164 SER A C     1 
ATOM   1252 O  O     . SER A  1  167 ? -29.063 22.682 -4.189  1.00 84.87  ? 164 SER A O     1 
ATOM   1253 C  CB    . SER A  1  167 ? -28.660 19.916 -5.916  1.00 62.01  ? 164 SER A CB    1 
ATOM   1254 O  OG    . SER A  1  167 ? -27.590 20.516 -6.627  1.00 79.06  ? 164 SER A OG    1 
ATOM   1255 N  N     . ALA A  1  168 ? -28.866 23.062 -6.399  1.00 69.04  ? 165 ALA A N     1 
ATOM   1256 C  CA    . ALA A  1  168 ? -28.328 24.401 -6.182  1.00 67.17  ? 165 ALA A CA    1 
ATOM   1257 C  C     . ALA A  1  168 ? -29.404 25.374 -5.718  1.00 68.31  ? 165 ALA A C     1 
ATOM   1258 O  O     . ALA A  1  168 ? -29.095 26.352 -5.028  1.00 69.66  ? 165 ALA A O     1 
ATOM   1259 C  CB    . ALA A  1  168 ? -27.660 24.919 -7.455  1.00 69.31  ? 165 ALA A CB    1 
ATOM   1260 N  N     . THR A  1  169 ? -30.663 25.130 -6.084  1.00 60.25  ? 166 THR A N     1 
ATOM   1261 C  CA    . THR A  1  169 ? -31.747 25.987 -5.613  1.00 59.39  ? 166 THR A CA    1 
ATOM   1262 C  C     . THR A  1  169 ? -32.016 25.757 -4.131  1.00 64.06  ? 166 THR A C     1 
ATOM   1263 O  O     . THR A  1  169 ? -32.160 26.713 -3.360  1.00 64.83  ? 166 THR A O     1 
ATOM   1264 C  CB    . THR A  1  169 ? -33.011 25.737 -6.436  1.00 60.97  ? 166 THR A CB    1 
ATOM   1265 O  OG1   . THR A  1  169 ? -32.718 25.900 -7.829  1.00 62.05  ? 166 THR A OG1   1 
ATOM   1266 C  CG2   . THR A  1  169 ? -34.103 26.718 -6.040  1.00 60.08  ? 166 THR A CG2   1 
ATOM   1267 N  N     . VAL A  1  170 ? -32.089 24.488 -3.717  1.00 61.62  ? 167 VAL A N     1 
ATOM   1268 C  CA    . VAL A  1  170 ? -32.316 24.169 -2.309  1.00 64.97  ? 167 VAL A CA    1 
ATOM   1269 C  C     . VAL A  1  170 ? -31.193 24.728 -1.445  1.00 64.27  ? 167 VAL A C     1 
ATOM   1270 O  O     . VAL A  1  170 ? -31.439 25.301 -0.377  1.00 64.06  ? 167 VAL A O     1 
ATOM   1271 C  CB    . VAL A  1  170 ? -32.467 22.647 -2.127  1.00 62.29  ? 167 VAL A CB    1 
ATOM   1272 C  CG1   . VAL A  1  170 ? -32.316 22.268 -0.663  1.00 58.20  ? 167 VAL A CG1   1 
ATOM   1273 C  CG2   . VAL A  1  170 ? -33.812 22.181 -2.660  1.00 58.07  ? 167 VAL A CG2   1 
ATOM   1274 N  N     . LYS A  1  171 ? -29.944 24.575 -1.895  1.00 63.39  ? 168 LYS A N     1 
ATOM   1275 C  CA    . LYS A  1  171 ? -28.809 25.108 -1.148  1.00 67.10  ? 168 LYS A CA    1 
ATOM   1276 C  C     . LYS A  1  171 ? -28.945 26.610 -0.928  1.00 68.27  ? 168 LYS A C     1 
ATOM   1277 O  O     . LYS A  1  171 ? -28.747 27.106 0.188   1.00 66.61  ? 168 LYS A O     1 
ATOM   1278 C  CB    . LYS A  1  171 ? -27.504 24.801 -1.881  1.00 67.67  ? 168 LYS A CB    1 
ATOM   1279 C  CG    . LYS A  1  171 ? -26.859 23.475 -1.523  1.00 82.09  ? 168 LYS A CG    1 
ATOM   1280 C  CD    . LYS A  1  171 ? -25.452 23.401 -2.095  1.00 96.88  ? 168 LYS A CD    1 
ATOM   1281 C  CE    . LYS A  1  171 ? -24.630 24.615 -1.681  1.00 106.25 ? 168 LYS A CE    1 
ATOM   1282 N  NZ    . LYS A  1  171 ? -23.281 24.636 -2.313  1.00 108.54 ? 168 LYS A NZ    1 
ATOM   1283 N  N     . SER A  1  172 ? -29.287 27.349 -1.984  1.00 64.39  ? 169 SER A N     1 
ATOM   1284 C  CA    . SER A  1  172 ? -29.344 28.804 -1.885  1.00 62.37  ? 169 SER A CA    1 
ATOM   1285 C  C     . SER A  1  172 ? -30.539 29.261 -1.059  1.00 65.01  ? 169 SER A C     1 
ATOM   1286 O  O     . SER A  1  172 ? -30.424 30.196 -0.258  1.00 64.13  ? 169 SER A O     1 
ATOM   1287 C  CB    . SER A  1  172 ? -29.386 29.419 -3.284  1.00 59.47  ? 169 SER A CB    1 
ATOM   1288 O  OG    . SER A  1  172 ? -28.277 28.992 -4.057  1.00 60.43  ? 169 SER A OG    1 
ATOM   1289 N  N     . LEU A  1  173 ? -31.697 28.620 -1.239  1.00 62.73  ? 170 LEU A N     1 
ATOM   1290 C  CA    . LEU A  1  173 ? -32.882 29.032 -0.496  1.00 59.34  ? 170 LEU A CA    1 
ATOM   1291 C  C     . LEU A  1  173 ? -32.785 28.656 0.978   1.00 63.19  ? 170 LEU A C     1 
ATOM   1292 O  O     . LEU A  1  173 ? -33.411 29.306 1.822   1.00 65.48  ? 170 LEU A O     1 
ATOM   1293 C  CB    . LEU A  1  173 ? -34.136 28.428 -1.129  1.00 53.53  ? 170 LEU A CB    1 
ATOM   1294 C  CG    . LEU A  1  173 ? -34.515 28.991 -2.502  1.00 53.93  ? 170 LEU A CG    1 
ATOM   1295 C  CD1   . LEU A  1  173 ? -35.837 28.408 -2.981  1.00 52.38  ? 170 LEU A CD1   1 
ATOM   1296 C  CD2   . LEU A  1  173 ? -34.576 30.513 -2.460  1.00 52.57  ? 170 LEU A CD2   1 
ATOM   1297 N  N     . ASN A  1  174 ? -32.011 27.618 1.308   1.00 63.75  ? 171 ASN A N     1 
ATOM   1298 C  CA    . ASN A  1  174 ? -31.750 27.319 2.713   1.00 63.28  ? 171 ASN A CA    1 
ATOM   1299 C  C     . ASN A  1  174 ? -31.003 28.465 3.381   1.00 68.11  ? 171 ASN A C     1 
ATOM   1300 O  O     . ASN A  1  174 ? -31.278 28.806 4.537   1.00 72.46  ? 171 ASN A O     1 
ATOM   1301 C  CB    . ASN A  1  174 ? -30.956 26.019 2.842   1.00 56.55  ? 171 ASN A CB    1 
ATOM   1302 C  CG    . ASN A  1  174 ? -31.829 24.785 2.731   1.00 57.44  ? 171 ASN A CG    1 
ATOM   1303 O  OD1   . ASN A  1  174 ? -33.049 24.856 2.880   1.00 57.41  ? 171 ASN A OD1   1 
ATOM   1304 N  ND2   . ASN A  1  174 ? -31.205 23.641 2.481   1.00 58.36  ? 171 ASN A ND2   1 
ATOM   1305 N  N     . VAL A  1  175 ? -30.055 29.073 2.664   1.00 62.84  ? 172 VAL A N     1 
ATOM   1306 C  CA    . VAL A  1  175 ? -29.328 30.217 3.202   1.00 65.20  ? 172 VAL A CA    1 
ATOM   1307 C  C     . VAL A  1  175 ? -30.237 31.435 3.288   1.00 66.40  ? 172 VAL A C     1 
ATOM   1308 O  O     . VAL A  1  175 ? -30.226 32.167 4.284   1.00 68.34  ? 172 VAL A O     1 
ATOM   1309 C  CB    . VAL A  1  175 ? -28.079 30.504 2.348   1.00 58.96  ? 172 VAL A CB    1 
ATOM   1310 C  CG1   . VAL A  1  175 ? -27.427 31.813 2.776   1.00 61.45  ? 172 VAL A CG1   1 
ATOM   1311 C  CG2   . VAL A  1  175 ? -27.094 29.350 2.448   1.00 57.21  ? 172 VAL A CG2   1 
ATOM   1312 N  N     . LEU A  1  176 ? -31.038 31.668 2.247   1.00 63.43  ? 173 LEU A N     1 
ATOM   1313 C  CA    . LEU A  1  176 ? -31.937 32.817 2.232   1.00 63.23  ? 173 LEU A CA    1 
ATOM   1314 C  C     . LEU A  1  176 ? -32.967 32.724 3.351   1.00 70.67  ? 173 LEU A C     1 
ATOM   1315 O  O     . LEU A  1  176 ? -33.086 33.631 4.181   1.00 69.32  ? 173 LEU A O     1 
ATOM   1316 C  CB    . LEU A  1  176 ? -32.616 32.918 0.866   1.00 66.40  ? 173 LEU A CB    1 
ATOM   1317 C  CG    . LEU A  1  176 ? -33.840 33.819 0.696   1.00 65.30  ? 173 LEU A CG    1 
ATOM   1318 C  CD1   . LEU A  1  176 ? -33.611 35.206 1.266   1.00 63.51  ? 173 LEU A CD1   1 
ATOM   1319 C  CD2   . LEU A  1  176 ? -34.176 33.910 -0.774  1.00 64.74  ? 173 LEU A CD2   1 
ATOM   1320 N  N     . THR A  1  177 ? -33.717 31.622 3.398   1.00 72.08  ? 174 THR A N     1 
ATOM   1321 C  CA    . THR A  1  177 ? -34.770 31.483 4.397   1.00 66.06  ? 174 THR A CA    1 
ATOM   1322 C  C     . THR A  1  177 ? -34.236 31.353 5.817   1.00 66.91  ? 174 THR A C     1 
ATOM   1323 O  O     . THR A  1  177 ? -35.034 31.141 6.740   1.00 66.35  ? 174 THR A O     1 
ATOM   1324 C  CB    . THR A  1  177 ? -35.658 30.285 4.064   1.00 63.62  ? 174 THR A CB    1 
ATOM   1325 O  OG1   . THR A  1  177 ? -34.863 29.094 4.027   1.00 67.03  ? 174 THR A OG1   1 
ATOM   1326 C  CG2   . THR A  1  177 ? -36.344 30.496 2.716   1.00 62.62  ? 174 THR A CG2   1 
ATOM   1327 N  N     . SER A  1  178 ? -32.920 31.467 6.021   1.00 73.25  ? 175 SER A N     1 
ATOM   1328 C  CA    . SER A  1  178 ? -32.411 31.699 7.366   1.00 66.90  ? 175 SER A CA    1 
ATOM   1329 C  C     . SER A  1  178 ? -32.935 32.999 7.955   1.00 66.07  ? 175 SER A C     1 
ATOM   1330 O  O     . SER A  1  178 ? -32.986 33.131 9.180   1.00 75.08  ? 175 SER A O     1 
ATOM   1331 C  CB    . SER A  1  178 ? -30.880 31.732 7.375   1.00 67.24  ? 175 SER A CB    1 
ATOM   1332 O  OG    . SER A  1  178 ? -30.337 30.473 7.033   1.00 82.15  ? 175 SER A OG    1 
ATOM   1333 N  N     . ILE A  1  179 ? -33.328 33.958 7.116   1.00 60.57  ? 176 ILE A N     1 
ATOM   1334 C  CA    . ILE A  1  179 ? -33.814 35.247 7.599   1.00 62.18  ? 176 ILE A CA    1 
ATOM   1335 C  C     . ILE A  1  179 ? -35.331 35.241 7.796   1.00 64.29  ? 176 ILE A C     1 
ATOM   1336 O  O     . ILE A  1  179 ? -35.832 35.773 8.789   1.00 70.85  ? 176 ILE A O     1 
ATOM   1337 C  CB    . ILE A  1  179 ? -33.359 36.374 6.642   1.00 52.16  ? 176 ILE A CB    1 
ATOM   1338 C  CG1   . ILE A  1  179 ? -33.449 37.737 7.324   1.00 65.80  ? 176 ILE A CG1   1 
ATOM   1339 C  CG2   . ILE A  1  179 ? -34.149 36.376 5.332   1.00 57.09  ? 176 ILE A CG2   1 
ATOM   1340 C  CD1   . ILE A  1  179 ? -32.950 38.868 6.460   1.00 56.99  ? 176 ILE A CD1   1 
ATOM   1341 N  N     . ALA A  1  180 ? -36.074 34.615 6.884   1.00 58.35  ? 177 ALA A N     1 
ATOM   1342 C  CA    . ALA A  1  180 ? -37.529 34.583 6.953   1.00 53.58  ? 177 ALA A CA    1 
ATOM   1343 C  C     . ALA A  1  180 ? -38.045 33.564 5.949   1.00 62.57  ? 177 ALA A C     1 
ATOM   1344 O  O     . ALA A  1  180 ? -37.438 33.351 4.897   1.00 65.24  ? 177 ALA A O     1 
ATOM   1345 C  CB    . ALA A  1  180 ? -38.141 35.961 6.674   1.00 52.97  ? 177 ALA A CB    1 
ATOM   1346 N  N     . ILE A  1  181 ? -39.169 32.950 6.285   1.00 59.12  ? 178 ILE A N     1 
ATOM   1347 C  CA    . ILE A  1  181 ? -39.822 31.959 5.432   1.00 58.42  ? 178 ILE A CA    1 
ATOM   1348 C  C     . ILE A  1  181 ? -40.963 32.641 4.687   1.00 56.81  ? 178 ILE A C     1 
ATOM   1349 O  O     . ILE A  1  181 ? -41.777 33.324 5.324   1.00 58.53  ? 178 ILE A O     1 
ATOM   1350 C  CB    . ILE A  1  181 ? -40.344 30.764 6.249   1.00 62.17  ? 178 ILE A CB    1 
ATOM   1351 C  CG1   . ILE A  1  181 ? -39.184 29.957 6.837   1.00 70.68  ? 178 ILE A CG1   1 
ATOM   1352 C  CG2   . ILE A  1  181 ? -41.239 29.876 5.391   1.00 59.32  ? 178 ILE A CG2   1 
ATOM   1353 C  CD1   . ILE A  1  181 ? -38.510 29.049 5.842   1.00 75.47  ? 178 ILE A CD1   1 
ATOM   1354 N  N     . PRO A  1  182 ? -41.057 32.493 3.368   1.00 59.02  ? 179 PRO A N     1 
ATOM   1355 C  CA    . PRO A  1  182 ? -42.184 33.071 2.640   1.00 57.18  ? 179 PRO A CA    1 
ATOM   1356 C  C     . PRO A  1  182 ? -43.408 32.168 2.676   1.00 57.65  ? 179 PRO A C     1 
ATOM   1357 O  O     . PRO A  1  182 ? -43.326 30.963 2.923   1.00 65.94  ? 179 PRO A O     1 
ATOM   1358 C  CB    . PRO A  1  182 ? -41.641 33.193 1.210   1.00 56.88  ? 179 PRO A CB    1 
ATOM   1359 C  CG    . PRO A  1  182 ? -40.710 32.042 1.094   1.00 57.41  ? 179 PRO A CG    1 
ATOM   1360 C  CD    . PRO A  1  182 ? -40.087 31.853 2.465   1.00 57.60  ? 179 PRO A CD    1 
ATOM   1361 N  N     . LYS A  1  183 ? -44.564 32.785 2.429   1.00 54.32  ? 180 LYS A N     1 
ATOM   1362 C  CA    . LYS A  1  183 ? -45.788 32.007 2.276   1.00 55.48  ? 180 LYS A CA    1 
ATOM   1363 C  C     . LYS A  1  183 ? -45.771 31.227 0.970   1.00 63.82  ? 180 LYS A C     1 
ATOM   1364 O  O     . LYS A  1  183 ? -46.047 30.021 0.946   1.00 73.65  ? 180 LYS A O     1 
ATOM   1365 C  CB    . LYS A  1  183 ? -47.015 32.920 2.322   1.00 55.38  ? 180 LYS A CB    1 
ATOM   1366 C  CG    . LYS A  1  183 ? -47.297 33.597 3.650   1.00 58.36  ? 180 LYS A CG    1 
ATOM   1367 C  CD    . LYS A  1  183 ? -48.688 34.223 3.624   1.00 63.53  ? 180 LYS A CD    1 
ATOM   1368 C  CE    . LYS A  1  183 ? -49.079 34.820 4.968   1.00 65.83  ? 180 LYS A CE    1 
ATOM   1369 N  NZ    . LYS A  1  183 ? -48.413 36.126 5.228   1.00 66.38  ? 180 LYS A NZ    1 
ATOM   1370 N  N     . VAL A  1  184 ? -45.439 31.903 -0.128  1.00 57.09  ? 181 VAL A N     1 
ATOM   1371 C  CA    . VAL A  1  184 ? -45.550 31.354 -1.475  1.00 57.38  ? 181 VAL A CA    1 
ATOM   1372 C  C     . VAL A  1  184 ? -44.274 31.670 -2.243  1.00 60.94  ? 181 VAL A C     1 
ATOM   1373 O  O     . VAL A  1  184 ? -43.700 32.756 -2.097  1.00 60.80  ? 181 VAL A O     1 
ATOM   1374 C  CB    . VAL A  1  184 ? -46.786 31.921 -2.209  1.00 62.52  ? 181 VAL A CB    1 
ATOM   1375 C  CG1   . VAL A  1  184 ? -46.824 31.459 -3.660  1.00 53.19  ? 181 VAL A CG1   1 
ATOM   1376 C  CG2   . VAL A  1  184 ? -48.072 31.520 -1.494  1.00 65.12  ? 181 VAL A CG2   1 
ATOM   1377 N  N     . ILE A  1  185 ? -43.825 30.715 -3.052  1.00 57.17  ? 182 ILE A N     1 
ATOM   1378 C  CA    . ILE A  1  185 ? -42.749 30.925 -4.013  1.00 51.73  ? 182 ILE A CA    1 
ATOM   1379 C  C     . ILE A  1  185 ? -43.323 30.718 -5.408  1.00 64.32  ? 182 ILE A C     1 
ATOM   1380 O  O     . ILE A  1  185 ? -43.932 29.676 -5.685  1.00 71.56  ? 182 ILE A O     1 
ATOM   1381 C  CB    . ILE A  1  185 ? -41.564 29.975 -3.763  1.00 52.03  ? 182 ILE A CB    1 
ATOM   1382 C  CG1   . ILE A  1  185 ? -40.804 30.384 -2.498  1.00 52.09  ? 182 ILE A CG1   1 
ATOM   1383 C  CG2   . ILE A  1  185 ? -40.638 29.945 -4.969  1.00 58.18  ? 182 ILE A CG2   1 
ATOM   1384 C  CD1   . ILE A  1  185 ? -39.653 29.462 -2.158  1.00 56.37  ? 182 ILE A CD1   1 
ATOM   1385 N  N     . HIS A  1  186 ? -43.140 31.707 -6.278  1.00 59.09  ? 183 HIS A N     1 
ATOM   1386 C  CA    . HIS A  1  186 ? -43.593 31.626 -7.660  1.00 52.68  ? 183 HIS A CA    1 
ATOM   1387 C  C     . HIS A  1  186 ? -42.396 31.445 -8.584  1.00 52.85  ? 183 HIS A C     1 
ATOM   1388 O  O     . HIS A  1  186 ? -41.439 32.223 -8.531  1.00 57.93  ? 183 HIS A O     1 
ATOM   1389 C  CB    . HIS A  1  186 ? -44.385 32.870 -8.066  1.00 57.19  ? 183 HIS A CB    1 
ATOM   1390 C  CG    . HIS A  1  186 ? -44.965 32.789 -9.445  1.00 66.41  ? 183 HIS A CG    1 
ATOM   1391 N  ND1   . HIS A  1  186 ? -46.321 32.715 -9.682  1.00 66.69  ? 183 HIS A ND1   1 
ATOM   1392 C  CD2   . HIS A  1  186 ? -44.369 32.756 -10.661 1.00 58.11  ? 183 HIS A CD2   1 
ATOM   1393 C  CE1   . HIS A  1  186 ? -46.535 32.647 -10.984 1.00 62.93  ? 183 HIS A CE1   1 
ATOM   1394 N  NE2   . HIS A  1  186 ? -45.367 32.668 -11.601 1.00 59.45  ? 183 HIS A NE2   1 
ATOM   1395 N  N     . SER A  1  187 ? -42.465 30.427 -9.437  1.00 50.07  ? 184 SER A N     1 
ATOM   1396 C  CA    . SER A  1  187 ? -41.419 30.139 -10.404 1.00 55.28  ? 184 SER A CA    1 
ATOM   1397 C  C     . SER A  1  187 ? -42.066 29.784 -11.733 1.00 56.47  ? 184 SER A C     1 
ATOM   1398 O  O     . SER A  1  187 ? -43.253 29.461 -11.798 1.00 50.19  ? 184 SER A O     1 
ATOM   1399 C  CB    . SER A  1  187 ? -40.519 28.988 -9.939  1.00 50.34  ? 184 SER A CB    1 
ATOM   1400 O  OG    . SER A  1  187 ? -41.211 27.750 -10.013 1.00 58.47  ? 184 SER A OG    1 
ATOM   1401 N  N     . ASP A  1  188 ? -41.273 29.847 -12.800 1.00 55.13  ? 185 ASP A N     1 
ATOM   1402 C  CA    . ASP A  1  188 ? -41.730 29.283 -14.059 1.00 57.05  ? 185 ASP A CA    1 
ATOM   1403 C  C     . ASP A  1  188 ? -41.600 27.762 -13.996 1.00 56.31  ? 185 ASP A C     1 
ATOM   1404 O  O     . ASP A  1  188 ? -41.217 27.188 -12.974 1.00 55.68  ? 185 ASP A O     1 
ATOM   1405 C  CB    . ASP A  1  188 ? -40.969 29.891 -15.242 1.00 52.38  ? 185 ASP A CB    1 
ATOM   1406 C  CG    . ASP A  1  188 ? -39.459 29.666 -15.174 1.00 55.66  ? 185 ASP A CG    1 
ATOM   1407 O  OD1   . ASP A  1  188 ? -39.003 28.625 -14.660 1.00 59.23  ? 185 ASP A OD1   1 
ATOM   1408 O  OD2   . ASP A  1  188 ? -38.717 30.546 -15.663 1.00 60.89  ? 185 ASP A OD2   1 
ATOM   1409 N  N     . GLN A  1  189 ? -41.918 27.088 -15.100 1.00 61.12  ? 186 GLN A N     1 
ATOM   1410 C  CA    . GLN A  1  189 ? -41.895 25.631 -15.116 1.00 61.54  ? 186 GLN A CA    1 
ATOM   1411 C  C     . GLN A  1  189 ? -40.554 25.066 -15.567 1.00 61.23  ? 186 GLN A C     1 
ATOM   1412 O  O     . GLN A  1  189 ? -40.512 24.023 -16.235 1.00 66.71  ? 186 GLN A O     1 
ATOM   1413 C  CB    . GLN A  1  189 ? -43.041 25.095 -15.972 1.00 55.78  ? 186 GLN A CB    1 
ATOM   1414 C  CG    . GLN A  1  189 ? -44.396 25.252 -15.285 1.00 60.13  ? 186 GLN A CG    1 
ATOM   1415 C  CD    . GLN A  1  189 ? -45.527 24.561 -16.016 1.00 74.72  ? 186 GLN A CD    1 
ATOM   1416 O  OE1   . GLN A  1  189 ? -45.317 23.574 -16.722 1.00 82.28  ? 186 GLN A OE1   1 
ATOM   1417 N  NE2   . GLN A  1  189 ? -46.739 25.077 -15.849 1.00 77.55  ? 186 GLN A NE2   1 
ATOM   1418 N  N     . GLY A  1  190 ? -39.452 25.720 -15.208 1.00 56.87  ? 187 GLY A N     1 
ATOM   1419 C  CA    . GLY A  1  190 ? -38.144 25.144 -15.453 1.00 57.13  ? 187 GLY A CA    1 
ATOM   1420 C  C     . GLY A  1  190 ? -37.918 23.895 -14.623 1.00 67.90  ? 187 GLY A C     1 
ATOM   1421 O  O     . GLY A  1  190 ? -38.614 23.630 -13.642 1.00 69.65  ? 187 GLY A O     1 
ATOM   1422 N  N     . ALA A  1  191 ? -36.906 23.125 -15.024 1.00 72.99  ? 188 ALA A N     1 
ATOM   1423 C  CA    . ALA A  1  191 ? -36.703 21.800 -14.448 1.00 68.54  ? 188 ALA A CA    1 
ATOM   1424 C  C     . ALA A  1  191 ? -36.339 21.868 -12.969 1.00 63.54  ? 188 ALA A C     1 
ATOM   1425 O  O     . ALA A  1  191 ? -36.774 21.019 -12.181 1.00 58.36  ? 188 ALA A O     1 
ATOM   1426 C  CB    . ALA A  1  191 ? -35.623 21.051 -15.230 1.00 55.01  ? 188 ALA A CB    1 
ATOM   1427 N  N     . ALA A  1  192 ? -35.539 22.862 -12.572 1.00 63.09  ? 189 ALA A N     1 
ATOM   1428 C  CA    . ALA A  1  192 ? -35.102 22.953 -11.180 1.00 64.36  ? 189 ALA A CA    1 
ATOM   1429 C  C     . ALA A  1  192 ? -36.274 23.120 -10.224 1.00 67.05  ? 189 ALA A C     1 
ATOM   1430 O  O     . ALA A  1  192 ? -36.206 22.677 -9.072  1.00 66.31  ? 189 ALA A O     1 
ATOM   1431 C  CB    . ALA A  1  192 ? -34.126 24.116 -11.009 1.00 64.15  ? 189 ALA A CB    1 
ATOM   1432 N  N     . PHE A  1  193 ? -37.356 23.744 -10.683 1.00 63.18  ? 190 PHE A N     1 
ATOM   1433 C  CA    . PHE A  1  193 ? -38.464 24.106 -9.813  1.00 61.32  ? 190 PHE A CA    1 
ATOM   1434 C  C     . PHE A  1  193 ? -39.621 23.117 -9.860  1.00 69.27  ? 190 PHE A C     1 
ATOM   1435 O  O     . PHE A  1  193 ? -40.450 23.117 -8.942  1.00 70.38  ? 190 PHE A O     1 
ATOM   1436 C  CB    . PHE A  1  193 ? -38.968 25.505 -10.182 1.00 54.51  ? 190 PHE A CB    1 
ATOM   1437 C  CG    . PHE A  1  193 ? -37.870 26.527 -10.287 1.00 60.05  ? 190 PHE A CG    1 
ATOM   1438 C  CD1   . PHE A  1  193 ? -36.924 26.653 -9.283  1.00 56.74  ? 190 PHE A CD1   1 
ATOM   1439 C  CD2   . PHE A  1  193 ? -37.770 27.349 -11.400 1.00 68.02  ? 190 PHE A CD2   1 
ATOM   1440 C  CE1   . PHE A  1  193 ? -35.909 27.585 -9.378  1.00 52.08  ? 190 PHE A CE1   1 
ATOM   1441 C  CE2   . PHE A  1  193 ? -36.757 28.284 -11.501 1.00 58.86  ? 190 PHE A CE2   1 
ATOM   1442 C  CZ    . PHE A  1  193 ? -35.826 28.402 -10.487 1.00 55.27  ? 190 PHE A CZ    1 
ATOM   1443 N  N     . THR A  1  194 ? -39.693 22.274 -10.886 1.00 70.07  ? 191 THR A N     1 
ATOM   1444 C  CA    . THR A  1  194 ? -40.802 21.346 -11.056 1.00 63.02  ? 191 THR A CA    1 
ATOM   1445 C  C     . THR A  1  194 ? -40.483 19.932 -10.594 1.00 62.27  ? 191 THR A C     1 
ATOM   1446 O  O     . THR A  1  194 ? -41.358 19.064 -10.660 1.00 69.06  ? 191 THR A O     1 
ATOM   1447 C  CB    . THR A  1  194 ? -41.245 21.312 -12.520 1.00 64.88  ? 191 THR A CB    1 
ATOM   1448 O  OG1   . THR A  1  194 ? -40.179 20.804 -13.333 1.00 75.59  ? 191 THR A OG1   1 
ATOM   1449 C  CG2   . THR A  1  194 ? -41.613 22.706 -12.986 1.00 57.20  ? 191 THR A CG2   1 
ATOM   1450 N  N     . SER A  1  195 ? -39.259 19.675 -10.140 1.00 60.31  ? 192 SER A N     1 
ATOM   1451 C  CA    . SER A  1  195 ? -38.924 18.354 -9.634  1.00 69.62  ? 192 SER A CA    1 
ATOM   1452 C  C     . SER A  1  195 ? -39.684 18.076 -8.341  1.00 77.43  ? 192 SER A C     1 
ATOM   1453 O  O     . SER A  1  195 ? -40.147 18.987 -7.650  1.00 80.91  ? 192 SER A O     1 
ATOM   1454 C  CB    . SER A  1  195 ? -37.420 18.233 -9.389  1.00 75.77  ? 192 SER A CB    1 
ATOM   1455 O  OG    . SER A  1  195 ? -37.019 19.035 -8.291  1.00 76.23  ? 192 SER A OG    1 
ATOM   1456 N  N     . SER A  1  196 ? -39.818 16.788 -8.020  1.00 79.17  ? 193 SER A N     1 
ATOM   1457 C  CA    . SER A  1  196 ? -40.453 16.417 -6.761  1.00 75.76  ? 193 SER A CA    1 
ATOM   1458 C  C     . SER A  1  196 ? -39.570 16.764 -5.571  1.00 77.72  ? 193 SER A C     1 
ATOM   1459 O  O     . SER A  1  196 ? -40.084 17.088 -4.494  1.00 77.94  ? 193 SER A O     1 
ATOM   1460 C  CB    . SER A  1  196 ? -40.794 14.927 -6.758  1.00 71.70  ? 193 SER A CB    1 
ATOM   1461 O  OG    . SER A  1  196 ? -39.652 14.139 -7.045  1.00 84.39  ? 193 SER A OG    1 
ATOM   1462 N  N     . THR A  1  197 ? -38.246 16.708 -5.748  1.00 78.96  ? 194 THR A N     1 
ATOM   1463 C  CA    . THR A  1  197 ? -37.332 17.088 -4.674  1.00 76.60  ? 194 THR A CA    1 
ATOM   1464 C  C     . THR A  1  197 ? -37.575 18.524 -4.226  1.00 76.52  ? 194 THR A C     1 
ATOM   1465 O  O     . THR A  1  197 ? -37.508 18.831 -3.029  1.00 66.34  ? 194 THR A O     1 
ATOM   1466 C  CB    . THR A  1  197 ? -35.883 16.904 -5.131  1.00 74.37  ? 194 THR A CB    1 
ATOM   1467 O  OG1   . THR A  1  197 ? -35.629 15.514 -5.374  1.00 84.18  ? 194 THR A OG1   1 
ATOM   1468 C  CG2   . THR A  1  197 ? -34.908 17.417 -4.073  1.00 61.76  ? 194 THR A CG2   1 
ATOM   1469 N  N     . PHE A  1  198 ? -37.872 19.418 -5.173  1.00 78.05  ? 195 PHE A N     1 
ATOM   1470 C  CA    . PHE A  1  198 ? -38.178 20.796 -4.806  1.00 73.78  ? 195 PHE A CA    1 
ATOM   1471 C  C     . PHE A  1  198 ? -39.533 20.901 -4.118  1.00 70.58  ? 195 PHE A C     1 
ATOM   1472 O  O     . PHE A  1  198 ? -39.709 21.735 -3.221  1.00 68.56  ? 195 PHE A O     1 
ATOM   1473 C  CB    . PHE A  1  198 ? -38.134 21.693 -6.043  1.00 57.14  ? 195 PHE A CB    1 
ATOM   1474 C  CG    . PHE A  1  198 ? -38.155 23.158 -5.726  1.00 57.97  ? 195 PHE A CG    1 
ATOM   1475 C  CD1   . PHE A  1  198 ? -37.180 23.716 -4.917  1.00 55.83  ? 195 PHE A CD1   1 
ATOM   1476 C  CD2   . PHE A  1  198 ? -39.137 23.983 -6.249  1.00 58.60  ? 195 PHE A CD2   1 
ATOM   1477 C  CE1   . PHE A  1  198 ? -37.190 25.064 -4.627  1.00 57.48  ? 195 PHE A CE1   1 
ATOM   1478 C  CE2   . PHE A  1  198 ? -39.151 25.334 -5.962  1.00 60.88  ? 195 PHE A CE2   1 
ATOM   1479 C  CZ    . PHE A  1  198 ? -38.176 25.874 -5.150  1.00 58.95  ? 195 PHE A CZ    1 
ATOM   1480 N  N     . ALA A  1  199 ? -40.496 20.066 -4.516  1.00 72.60  ? 196 ALA A N     1 
ATOM   1481 C  CA    . ALA A  1  199 ? -41.800 20.082 -3.861  1.00 60.00  ? 196 ALA A CA    1 
ATOM   1482 C  C     . ALA A  1  199 ? -41.708 19.596 -2.419  1.00 76.92  ? 196 ALA A C     1 
ATOM   1483 O  O     . ALA A  1  199 ? -42.307 20.194 -1.520  1.00 71.89  ? 196 ALA A O     1 
ATOM   1484 C  CB    . ALA A  1  199 ? -42.798 19.228 -4.643  1.00 60.83  ? 196 ALA A CB    1 
ATOM   1485 N  N     . GLU A  1  200 ? -40.977 18.501 -2.183  1.00 75.79  ? 197 GLU A N     1 
ATOM   1486 C  CA    . GLU A  1  200 ? -40.790 18.011 -0.821  1.00 80.05  ? 197 GLU A CA    1 
ATOM   1487 C  C     . GLU A  1  200 ? -40.061 19.033 0.042   1.00 77.97  ? 197 GLU A C     1 
ATOM   1488 O  O     . GLU A  1  200 ? -40.361 19.175 1.233   1.00 79.82  ? 197 GLU A O     1 
ATOM   1489 C  CB    . GLU A  1  200 ? -40.024 16.688 -0.838  1.00 96.06  ? 197 GLU A CB    1 
ATOM   1490 C  CG    . GLU A  1  200 ? -40.713 15.585 -1.620  1.00 117.34 ? 197 GLU A CG    1 
ATOM   1491 C  CD    . GLU A  1  200 ? -39.809 14.397 -1.870  1.00 132.62 ? 197 GLU A CD    1 
ATOM   1492 O  OE1   . GLU A  1  200 ? -38.654 14.416 -1.395  1.00 137.74 ? 197 GLU A OE1   1 
ATOM   1493 O  OE2   . GLU A  1  200 ? -40.251 13.446 -2.545  1.00 132.21 ? 197 GLU A OE2   1 
ATOM   1494 N  N     . TRP A  1  201 ? -39.100 19.753 -0.540  1.00 73.22  ? 198 TRP A N     1 
ATOM   1495 C  CA    . TRP A  1  201 ? -38.391 20.783 0.211   1.00 70.75  ? 198 TRP A CA    1 
ATOM   1496 C  C     . TRP A  1  201 ? -39.326 21.907 0.637   1.00 78.16  ? 198 TRP A C     1 
ATOM   1497 O  O     . TRP A  1  201 ? -39.172 22.471 1.727   1.00 81.43  ? 198 TRP A O     1 
ATOM   1498 C  CB    . TRP A  1  201 ? -37.240 21.339 -0.624  1.00 69.40  ? 198 TRP A CB    1 
ATOM   1499 C  CG    . TRP A  1  201 ? -36.523 22.469 0.035   1.00 67.66  ? 198 TRP A CG    1 
ATOM   1500 C  CD1   . TRP A  1  201 ? -35.446 22.383 0.865   1.00 61.88  ? 198 TRP A CD1   1 
ATOM   1501 C  CD2   . TRP A  1  201 ? -36.840 23.860 -0.071  1.00 65.94  ? 198 TRP A CD2   1 
ATOM   1502 N  NE1   . TRP A  1  201 ? -35.067 23.637 1.280   1.00 61.33  ? 198 TRP A NE1   1 
ATOM   1503 C  CE2   . TRP A  1  201 ? -35.908 24.561 0.720   1.00 60.94  ? 198 TRP A CE2   1 
ATOM   1504 C  CE3   . TRP A  1  201 ? -37.819 24.582 -0.760  1.00 62.94  ? 198 TRP A CE3   1 
ATOM   1505 C  CZ2   . TRP A  1  201 ? -35.927 25.947 0.840   1.00 63.13  ? 198 TRP A CZ2   1 
ATOM   1506 C  CZ3   . TRP A  1  201 ? -37.838 25.956 -0.638  1.00 60.03  ? 198 TRP A CZ3   1 
ATOM   1507 C  CH2   . TRP A  1  201 ? -36.899 26.625 0.156   1.00 62.88  ? 198 TRP A CH2   1 
ATOM   1508 N  N     . ALA A  1  202 ? -40.299 22.252 -0.211  1.00 68.47  ? 199 ALA A N     1 
ATOM   1509 C  CA    . ALA A  1  202 ? -41.221 23.335 0.113   1.00 60.47  ? 199 ALA A CA    1 
ATOM   1510 C  C     . ALA A  1  202 ? -42.317 22.878 1.068   1.00 72.07  ? 199 ALA A C     1 
ATOM   1511 O  O     . ALA A  1  202 ? -42.696 23.623 1.977   1.00 73.63  ? 199 ALA A O     1 
ATOM   1512 C  CB    . ALA A  1  202 ? -41.833 23.905 -1.166  1.00 57.64  ? 199 ALA A CB    1 
ATOM   1513 N  N     . LYS A  1  203 ? -42.842 21.664 0.874   1.00 71.29  ? 200 LYS A N     1 
ATOM   1514 C  CA    . LYS A  1  203 ? -43.881 21.162 1.769   1.00 72.45  ? 200 LYS A CA    1 
ATOM   1515 C  C     . LYS A  1  203 ? -43.368 21.052 3.200   1.00 75.37  ? 200 LYS A C     1 
ATOM   1516 O  O     . LYS A  1  203 ? -44.110 21.313 4.154   1.00 73.20  ? 200 LYS A O     1 
ATOM   1517 C  CB    . LYS A  1  203 ? -44.398 19.809 1.277   1.00 68.72  ? 200 LYS A CB    1 
ATOM   1518 C  CG    . LYS A  1  203 ? -45.614 19.305 2.045   1.00 77.50  ? 200 LYS A CG    1 
ATOM   1519 C  CD    . LYS A  1  203 ? -46.128 17.985 1.496   1.00 81.59  ? 200 LYS A CD    1 
ATOM   1520 C  CE    . LYS A  1  203 ? -47.354 17.523 2.270   1.00 91.28  ? 200 LYS A CE    1 
ATOM   1521 N  NZ    . LYS A  1  203 ? -47.961 16.291 1.696   1.00 95.62  ? 200 LYS A NZ    1 
ATOM   1522 N  N     . GLU A  1  204 ? -42.094 20.685 3.367   1.00 71.98  ? 201 GLU A N     1 
ATOM   1523 C  CA    . GLU A  1  204 ? -41.509 20.572 4.698   1.00 68.32  ? 201 GLU A CA    1 
ATOM   1524 C  C     . GLU A  1  204 ? -41.499 21.896 5.453   1.00 73.88  ? 201 GLU A C     1 
ATOM   1525 O  O     . GLU A  1  204 ? -41.349 21.895 6.679   1.00 88.45  ? 201 GLU A O     1 
ATOM   1526 C  CB    . GLU A  1  204 ? -40.079 20.032 4.599   1.00 75.63  ? 201 GLU A CB    1 
ATOM   1527 C  CG    . GLU A  1  204 ? -39.984 18.523 4.432   1.00 93.41  ? 201 GLU A CG    1 
ATOM   1528 C  CD    . GLU A  1  204 ? -38.570 18.055 4.144   1.00 104.57 ? 201 GLU A CD    1 
ATOM   1529 O  OE1   . GLU A  1  204 ? -37.671 18.913 4.016   1.00 101.37 ? 201 GLU A OE1   1 
ATOM   1530 O  OE2   . GLU A  1  204 ? -38.358 16.829 4.040   1.00 105.61 ? 201 GLU A OE2   1 
ATOM   1531 N  N     . ARG A  1  205 ? -41.659 23.022 4.757   1.00 67.17  ? 202 ARG A N     1 
ATOM   1532 C  CA    . ARG A  1  205 ? -41.526 24.338 5.369   1.00 64.78  ? 202 ARG A CA    1 
ATOM   1533 C  C     . ARG A  1  205 ? -42.803 25.166 5.296   1.00 66.34  ? 202 ARG A C     1 
ATOM   1534 O  O     . ARG A  1  205 ? -42.759 26.375 5.548   1.00 72.38  ? 202 ARG A O     1 
ATOM   1535 C  CB    . ARG A  1  205 ? -40.372 25.100 4.714   1.00 65.23  ? 202 ARG A CB    1 
ATOM   1536 C  CG    . ARG A  1  205 ? -39.012 24.493 5.002   1.00 66.60  ? 202 ARG A CG    1 
ATOM   1537 C  CD    . ARG A  1  205 ? -38.045 24.702 3.852   1.00 70.03  ? 202 ARG A CD    1 
ATOM   1538 N  NE    . ARG A  1  205 ? -36.689 24.308 4.223   1.00 71.57  ? 202 ARG A NE    1 
ATOM   1539 C  CZ    . ARG A  1  205 ? -36.223 23.066 4.146   1.00 70.41  ? 202 ARG A CZ    1 
ATOM   1540 N  NH1   . ARG A  1  205 ? -37.006 22.090 3.706   1.00 70.34  ? 202 ARG A NH1   1 
ATOM   1541 N  NH2   . ARG A  1  205 ? -34.976 22.798 4.507   1.00 67.89  ? 202 ARG A NH2   1 
ATOM   1542 N  N     . GLY A  1  206 ? -43.937 24.552 4.967   1.00 61.00  ? 203 GLY A N     1 
ATOM   1543 C  CA    . GLY A  1  206 ? -45.165 25.306 4.831   1.00 60.84  ? 203 GLY A CA    1 
ATOM   1544 C  C     . GLY A  1  206 ? -45.200 26.258 3.659   1.00 68.96  ? 203 GLY A C     1 
ATOM   1545 O  O     . GLY A  1  206 ? -46.086 27.117 3.604   1.00 70.58  ? 203 GLY A O     1 
ATOM   1546 N  N     . ILE A  1  207 ? -44.264 26.135 2.722   1.00 70.56  ? 204 ILE A N     1 
ATOM   1547 C  CA    . ILE A  1  207 ? -44.202 27.005 1.553   1.00 68.50  ? 204 ILE A CA    1 
ATOM   1548 C  C     . ILE A  1  207 ? -45.064 26.405 0.452   1.00 67.14  ? 204 ILE A C     1 
ATOM   1549 O  O     . ILE A  1  207 ? -44.884 25.243 0.072   1.00 78.94  ? 204 ILE A O     1 
ATOM   1550 C  CB    . ILE A  1  207 ? -42.753 27.184 1.073   1.00 68.10  ? 204 ILE A CB    1 
ATOM   1551 C  CG1   . ILE A  1  207 ? -41.878 27.741 2.197   1.00 67.67  ? 204 ILE A CG1   1 
ATOM   1552 C  CG2   . ILE A  1  207 ? -42.704 28.090 -0.147  1.00 58.61  ? 204 ILE A CG2   1 
ATOM   1553 C  CD1   . ILE A  1  207 ? -40.446 28.009 1.777   1.00 60.70  ? 204 ILE A CD1   1 
ATOM   1554 N  N     . HIS A  1  208 ? -46.000 27.196 -0.063  1.00 60.20  ? 205 HIS A N     1 
ATOM   1555 C  CA    . HIS A  1  208 ? -46.810 26.782 -1.197  1.00 66.77  ? 205 HIS A CA    1 
ATOM   1556 C  C     . HIS A  1  208 ? -46.102 27.161 -2.491  1.00 61.14  ? 205 HIS A C     1 
ATOM   1557 O  O     . HIS A  1  208 ? -45.708 28.316 -2.673  1.00 56.32  ? 205 HIS A O     1 
ATOM   1558 C  CB    . HIS A  1  208 ? -48.195 27.428 -1.153  1.00 69.84  ? 205 HIS A CB    1 
ATOM   1559 C  CG    . HIS A  1  208 ? -49.030 27.142 -2.363  1.00 86.83  ? 205 HIS A CG    1 
ATOM   1560 N  ND1   . HIS A  1  208 ? -49.487 25.878 -2.670  1.00 91.23  ? 205 HIS A ND1   1 
ATOM   1561 C  CD2   . HIS A  1  208 ? -49.482 27.956 -3.348  1.00 87.59  ? 205 HIS A CD2   1 
ATOM   1562 C  CE1   . HIS A  1  208 ? -50.190 25.927 -3.788  1.00 93.48  ? 205 HIS A CE1   1 
ATOM   1563 N  NE2   . HIS A  1  208 ? -50.202 27.175 -4.220  1.00 91.61  ? 205 HIS A NE2   1 
ATOM   1564 N  N     . LEU A  1  209 ? -45.941 26.190 -3.384  1.00 56.32  ? 206 LEU A N     1 
ATOM   1565 C  CA    . LEU A  1  209 ? -45.330 26.438 -4.678  1.00 60.90  ? 206 LEU A CA    1 
ATOM   1566 C  C     . LEU A  1  209 ? -46.402 26.831 -5.687  1.00 62.56  ? 206 LEU A C     1 
ATOM   1567 O  O     . LEU A  1  209 ? -47.449 26.181 -5.780  1.00 61.43  ? 206 LEU A O     1 
ATOM   1568 C  CB    . LEU A  1  209 ? -44.559 25.214 -5.168  1.00 55.77  ? 206 LEU A CB    1 
ATOM   1569 C  CG    . LEU A  1  209 ? -43.296 24.853 -4.383  1.00 57.24  ? 206 LEU A CG    1 
ATOM   1570 C  CD1   . LEU A  1  209 ? -42.467 23.826 -5.144  1.00 56.21  ? 206 LEU A CD1   1 
ATOM   1571 C  CD2   . LEU A  1  209 ? -42.475 26.098 -4.068  1.00 54.82  ? 206 LEU A CD2   1 
ATOM   1572 N  N     . GLU A  1  210 ? -46.131 27.895 -6.439  1.00 60.08  ? 207 GLU A N     1 
ATOM   1573 C  CA    . GLU A  1  210 ? -47.064 28.463 -7.400  1.00 64.42  ? 207 GLU A CA    1 
ATOM   1574 C  C     . GLU A  1  210 ? -46.315 28.619 -8.715  1.00 61.47  ? 207 GLU A C     1 
ATOM   1575 O  O     . GLU A  1  210 ? -45.259 29.256 -8.752  1.00 67.49  ? 207 GLU A O     1 
ATOM   1576 C  CB    . GLU A  1  210 ? -47.598 29.808 -6.905  1.00 64.78  ? 207 GLU A CB    1 
ATOM   1577 C  CG    . GLU A  1  210 ? -48.601 30.500 -7.809  1.00 70.47  ? 207 GLU A CG    1 
ATOM   1578 C  CD    . GLU A  1  210 ? -48.958 31.885 -7.299  1.00 79.08  ? 207 GLU A CD    1 
ATOM   1579 O  OE1   . GLU A  1  210 ? -48.047 32.734 -7.198  1.00 73.27  ? 207 GLU A OE1   1 
ATOM   1580 O  OE2   . GLU A  1  210 ? -50.142 32.120 -6.981  1.00 86.94  ? 207 GLU A OE2   1 
ATOM   1581 N  N     . PHE A  1  211 ? -46.843 28.033 -9.787  1.00 59.15  ? 208 PHE A N     1 
ATOM   1582 C  CA    . PHE A  1  211 ? -46.127 27.943 -11.050 1.00 60.03  ? 208 PHE A CA    1 
ATOM   1583 C  C     . PHE A  1  211 ? -46.797 28.781 -12.130 1.00 51.75  ? 208 PHE A C     1 
ATOM   1584 O  O     . PHE A  1  211 ? -48.025 28.796 -12.250 1.00 60.35  ? 208 PHE A O     1 
ATOM   1585 C  CB    . PHE A  1  211 ? -46.028 26.492 -11.524 1.00 57.98  ? 208 PHE A CB    1 
ATOM   1586 C  CG    . PHE A  1  211 ? -45.210 25.613 -10.622 1.00 56.21  ? 208 PHE A CG    1 
ATOM   1587 C  CD1   . PHE A  1  211 ? -43.826 25.648 -10.668 1.00 53.27  ? 208 PHE A CD1   1 
ATOM   1588 C  CD2   . PHE A  1  211 ? -45.825 24.747 -9.735  1.00 54.95  ? 208 PHE A CD2   1 
ATOM   1589 C  CE1   . PHE A  1  211 ? -43.071 24.839 -9.838  1.00 57.51  ? 208 PHE A CE1   1 
ATOM   1590 C  CE2   . PHE A  1  211 ? -45.077 23.936 -8.905  1.00 60.20  ? 208 PHE A CE2   1 
ATOM   1591 C  CZ    . PHE A  1  211 ? -43.698 23.980 -8.956  1.00 60.88  ? 208 PHE A CZ    1 
ATOM   1592 N  N     . SER A  1  212 ? -45.976 29.475 -12.917 1.00 51.57  ? 209 SER A N     1 
ATOM   1593 C  CA    . SER A  1  212 ? -46.467 30.155 -14.105 1.00 53.35  ? 209 SER A CA    1 
ATOM   1594 C  C     . SER A  1  212 ? -47.082 29.150 -15.070 1.00 56.98  ? 209 SER A C     1 
ATOM   1595 O  O     . SER A  1  212 ? -46.760 27.960 -15.054 1.00 59.98  ? 209 SER A O     1 
ATOM   1596 C  CB    . SER A  1  212 ? -45.335 30.904 -14.808 1.00 55.80  ? 209 SER A CB    1 
ATOM   1597 O  OG    . SER A  1  212 ? -44.934 32.053 -14.085 1.00 72.57  ? 209 SER A OG    1 
ATOM   1598 N  N     . THR A  1  213 ? -47.984 29.641 -15.917 1.00 60.39  ? 210 THR A N     1 
ATOM   1599 C  CA    . THR A  1  213 ? -48.402 28.855 -17.061 1.00 51.17  ? 210 THR A CA    1 
ATOM   1600 C  C     . THR A  1  213 ? -47.186 28.607 -17.958 1.00 55.15  ? 210 THR A C     1 
ATOM   1601 O  O     . THR A  1  213 ? -46.267 29.432 -18.005 1.00 60.37  ? 210 THR A O     1 
ATOM   1602 C  CB    . THR A  1  213 ? -49.506 29.571 -17.838 1.00 51.09  ? 210 THR A CB    1 
ATOM   1603 O  OG1   . THR A  1  213 ? -49.154 30.948 -18.021 1.00 63.07  ? 210 THR A OG1   1 
ATOM   1604 C  CG2   . THR A  1  213 ? -50.835 29.474 -17.091 1.00 51.98  ? 210 THR A CG2   1 
ATOM   1605 N  N     . PRO A  1  214 ? -47.142 27.478 -18.664 1.00 54.54  ? 211 PRO A N     1 
ATOM   1606 C  CA    . PRO A  1  214 ? -45.919 27.119 -19.382 1.00 57.44  ? 211 PRO A CA    1 
ATOM   1607 C  C     . PRO A  1  214 ? -45.617 28.068 -20.529 1.00 55.00  ? 211 PRO A C     1 
ATOM   1608 O  O     . PRO A  1  214 ? -46.515 28.575 -21.204 1.00 58.68  ? 211 PRO A O     1 
ATOM   1609 C  CB    . PRO A  1  214 ? -46.215 25.706 -19.900 1.00 57.77  ? 211 PRO A CB    1 
ATOM   1610 C  CG    . PRO A  1  214 ? -47.703 25.649 -19.993 1.00 58.58  ? 211 PRO A CG    1 
ATOM   1611 C  CD    . PRO A  1  214 ? -48.206 26.474 -18.842 1.00 58.45  ? 211 PRO A CD    1 
ATOM   1612 N  N     . TYR A  1  215 ? -44.318 28.310 -20.731 1.00 53.99  ? 212 TYR A N     1 
ATOM   1613 C  CA    . TYR A  1  215 ? -43.811 29.081 -21.866 1.00 59.38  ? 212 TYR A CA    1 
ATOM   1614 C  C     . TYR A  1  215 ? -44.488 30.448 -21.950 1.00 62.11  ? 212 TYR A C     1 
ATOM   1615 O  O     . TYR A  1  215 ? -44.986 30.866 -22.998 1.00 69.29  ? 212 TYR A O     1 
ATOM   1616 C  CB    . TYR A  1  215 ? -43.965 28.296 -23.163 1.00 49.19  ? 212 TYR A CB    1 
ATOM   1617 C  CG    . TYR A  1  215 ? -43.355 26.913 -23.085 1.00 52.16  ? 212 TYR A CG    1 
ATOM   1618 C  CD1   . TYR A  1  215 ? -41.996 26.721 -23.292 1.00 55.94  ? 212 TYR A CD1   1 
ATOM   1619 C  CD2   . TYR A  1  215 ? -44.135 25.804 -22.783 1.00 54.89  ? 212 TYR A CD2   1 
ATOM   1620 C  CE1   . TYR A  1  215 ? -41.432 25.463 -23.210 1.00 65.25  ? 212 TYR A CE1   1 
ATOM   1621 C  CE2   . TYR A  1  215 ? -43.581 24.543 -22.699 1.00 67.34  ? 212 TYR A CE2   1 
ATOM   1622 C  CZ    . TYR A  1  215 ? -42.229 24.378 -22.913 1.00 74.08  ? 212 TYR A CZ    1 
ATOM   1623 O  OH    . TYR A  1  215 ? -41.669 23.124 -22.832 1.00 78.86  ? 212 TYR A OH    1 
ATOM   1624 N  N     . HIS A  1  216 ? -44.490 31.148 -20.816 1.00 56.74  ? 213 HIS A N     1 
ATOM   1625 C  CA    . HIS A  1  216 ? -45.102 32.470 -20.709 1.00 58.95  ? 213 HIS A CA    1 
ATOM   1626 C  C     . HIS A  1  216 ? -44.367 33.280 -19.642 1.00 56.36  ? 213 HIS A C     1 
ATOM   1627 O  O     . HIS A  1  216 ? -44.859 33.458 -18.524 1.00 58.68  ? 213 HIS A O     1 
ATOM   1628 C  CB    . HIS A  1  216 ? -46.584 32.337 -20.386 1.00 54.08  ? 213 HIS A CB    1 
ATOM   1629 C  CG    . HIS A  1  216 ? -47.360 33.603 -20.537 1.00 53.99  ? 213 HIS A CG    1 
ATOM   1630 N  ND1   . HIS A  1  216 ? -47.802 34.330 -19.453 1.00 59.55  ? 213 HIS A ND1   1 
ATOM   1631 C  CD2   . HIS A  1  216 ? -47.783 34.269 -21.638 1.00 59.35  ? 213 HIS A CD2   1 
ATOM   1632 C  CE1   . HIS A  1  216 ? -48.464 35.391 -19.880 1.00 65.93  ? 213 HIS A CE1   1 
ATOM   1633 N  NE2   . HIS A  1  216 ? -48.466 35.378 -21.201 1.00 65.53  ? 213 HIS A NE2   1 
ATOM   1634 N  N     . PRO A  1  217 ? -43.168 33.779 -19.959 1.00 52.83  ? 214 PRO A N     1 
ATOM   1635 C  CA    . PRO A  1  217 ? -42.368 34.471 -18.934 1.00 51.69  ? 214 PRO A CA    1 
ATOM   1636 C  C     . PRO A  1  217 ? -43.006 35.737 -18.385 1.00 55.54  ? 214 PRO A C     1 
ATOM   1637 O  O     . PRO A  1  217 ? -42.558 36.219 -17.335 1.00 54.05  ? 214 PRO A O     1 
ATOM   1638 C  CB    . PRO A  1  217 ? -41.046 34.773 -19.658 1.00 50.20  ? 214 PRO A CB    1 
ATOM   1639 C  CG    . PRO A  1  217 ? -41.322 34.563 -21.121 1.00 45.74  ? 214 PRO A CG    1 
ATOM   1640 C  CD    . PRO A  1  217 ? -42.405 33.537 -21.193 1.00 51.78  ? 214 PRO A CD    1 
ATOM   1641 N  N     . GLN A  1  218 ? -44.020 36.297 -19.056 1.00 57.28  ? 215 GLN A N     1 
ATOM   1642 C  CA    A GLN A  1  218 ? -44.715 37.453 -18.499 0.49 51.82  ? 215 GLN A CA    1 
ATOM   1643 C  CA    B GLN A  1  218 ? -44.736 37.447 -18.503 0.51 51.96  ? 215 GLN A CA    1 
ATOM   1644 C  C     . GLN A  1  218 ? -45.212 37.159 -17.090 1.00 58.68  ? 215 GLN A C     1 
ATOM   1645 O  O     . GLN A  1  218 ? -45.217 38.045 -16.226 1.00 59.54  ? 215 GLN A O     1 
ATOM   1646 C  CB    A GLN A  1  218 ? -45.879 37.858 -19.408 0.49 49.60  ? 215 GLN A CB    1 
ATOM   1647 C  CB    B GLN A  1  218 ? -45.946 37.802 -19.369 0.51 50.04  ? 215 GLN A CB    1 
ATOM   1648 C  CG    A GLN A  1  218 ? -45.479 38.284 -20.821 0.49 56.55  ? 215 GLN A CG    1 
ATOM   1649 C  CG    B GLN A  1  218 ? -45.655 38.377 -20.739 0.51 56.00  ? 215 GLN A CG    1 
ATOM   1650 C  CD    A GLN A  1  218 ? -45.344 37.107 -21.767 0.49 56.63  ? 215 GLN A CD    1 
ATOM   1651 C  CD    B GLN A  1  218 ? -46.927 38.831 -21.432 0.51 57.90  ? 215 GLN A CD    1 
ATOM   1652 O  OE1   A GLN A  1  218 ? -44.611 36.158 -21.493 0.49 45.84  ? 215 GLN A OE1   1 
ATOM   1653 O  OE1   B GLN A  1  218 ? -48.009 38.797 -20.846 0.51 46.74  ? 215 GLN A OE1   1 
ATOM   1654 N  NE2   A GLN A  1  218 ? -46.065 37.157 -22.881 0.49 58.70  ? 215 GLN A NE2   1 
ATOM   1655 N  NE2   B GLN A  1  218 ? -46.804 39.256 -22.684 0.51 60.81  ? 215 GLN A NE2   1 
ATOM   1656 N  N     . SER A  1  219 ? -45.620 35.913 -16.836 1.00 56.15  ? 216 SER A N     1 
ATOM   1657 C  CA    . SER A  1  219 ? -46.187 35.554 -15.542 1.00 58.54  ? 216 SER A CA    1 
ATOM   1658 C  C     . SER A  1  219 ? -45.166 35.672 -14.415 1.00 64.65  ? 216 SER A C     1 
ATOM   1659 O  O     . SER A  1  219 ? -45.535 35.996 -13.279 1.00 62.18  ? 216 SER A O     1 
ATOM   1660 C  CB    . SER A  1  219 ? -46.760 34.139 -15.604 1.00 58.98  ? 216 SER A CB    1 
ATOM   1661 O  OG    . SER A  1  219 ? -47.794 34.055 -16.569 1.00 54.08  ? 216 SER A OG    1 
ATOM   1662 N  N     . SER A  1  220 ? -43.889 35.412 -14.699 1.00 57.35  ? 217 SER A N     1 
ATOM   1663 C  CA    . SER A  1  220 ? -42.812 35.711 -13.762 1.00 51.53  ? 217 SER A CA    1 
ATOM   1664 C  C     . SER A  1  220 ? -42.256 37.117 -13.956 1.00 55.13  ? 217 SER A C     1 
ATOM   1665 O  O     . SER A  1  220 ? -41.088 37.367 -13.634 1.00 52.66  ? 217 SER A O     1 
ATOM   1666 C  CB    . SER A  1  220 ? -41.689 34.680 -13.884 1.00 54.20  ? 217 SER A CB    1 
ATOM   1667 O  OG    . SER A  1  220 ? -42.049 33.447 -13.286 1.00 60.38  ? 217 SER A OG    1 
ATOM   1668 N  N     . GLY A  1  221 ? -43.077 38.040 -14.463 1.00 52.64  ? 218 GLY A N     1 
ATOM   1669 C  CA    . GLY A  1  221 ? -42.565 39.323 -14.923 1.00 55.11  ? 218 GLY A CA    1 
ATOM   1670 C  C     . GLY A  1  221 ? -41.855 40.130 -13.856 1.00 61.80  ? 218 GLY A C     1 
ATOM   1671 O  O     . GLY A  1  221 ? -40.992 40.954 -14.171 1.00 55.04  ? 218 GLY A O     1 
ATOM   1672 N  N     . LYS A  1  222 ? -42.200 39.913 -12.585 1.00 56.00  ? 219 LYS A N     1 
ATOM   1673 C  CA    . LYS A  1  222 ? -41.561 40.676 -11.518 1.00 46.40  ? 219 LYS A CA    1 
ATOM   1674 C  C     . LYS A  1  222 ? -40.073 40.359 -11.429 1.00 47.32  ? 219 LYS A C     1 
ATOM   1675 O  O     . LYS A  1  222 ? -39.238 41.267 -11.347 1.00 59.33  ? 219 LYS A O     1 
ATOM   1676 C  CB    . LYS A  1  222 ? -42.256 40.406 -10.183 1.00 51.31  ? 219 LYS A CB    1 
ATOM   1677 C  CG    . LYS A  1  222 ? -43.108 41.568 -9.699  1.00 55.84  ? 219 LYS A CG    1 
ATOM   1678 C  CD    . LYS A  1  222 ? -42.827 41.887 -8.242  1.00 68.28  ? 219 LYS A CD    1 
ATOM   1679 C  CE    . LYS A  1  222 ? -43.272 43.296 -7.894  1.00 69.69  ? 219 LYS A CE    1 
ATOM   1680 N  NZ    . LYS A  1  222 ? -44.737 43.500 -8.063  1.00 57.02  ? 219 LYS A NZ    1 
ATOM   1681 N  N     . VAL A  1  223 ? -39.718 39.074 -11.452 1.00 59.32  ? 220 VAL A N     1 
ATOM   1682 C  CA    . VAL A  1  223 ? -38.306 38.711 -11.370 1.00 59.55  ? 220 VAL A CA    1 
ATOM   1683 C  C     . VAL A  1  223 ? -37.630 38.846 -12.730 1.00 56.78  ? 220 VAL A C     1 
ATOM   1684 O  O     . VAL A  1  223 ? -36.458 39.231 -12.813 1.00 53.23  ? 220 VAL A O     1 
ATOM   1685 C  CB    . VAL A  1  223 ? -38.142 37.295 -10.784 1.00 54.11  ? 220 VAL A CB    1 
ATOM   1686 C  CG1   . VAL A  1  223 ? -38.950 36.280 -11.576 1.00 56.13  ? 220 VAL A CG1   1 
ATOM   1687 C  CG2   . VAL A  1  223 ? -36.672 36.902 -10.740 1.00 45.96  ? 220 VAL A CG2   1 
ATOM   1688 N  N     . GLU A  1  224 ? -38.350 38.547 -13.818 1.00 51.68  ? 221 GLU A N     1 
ATOM   1689 C  CA    . GLU A  1  224 ? -37.778 38.754 -15.146 1.00 47.75  ? 221 GLU A CA    1 
ATOM   1690 C  C     . GLU A  1  224 ? -37.350 40.204 -15.337 1.00 53.44  ? 221 GLU A C     1 
ATOM   1691 O  O     . GLU A  1  224 ? -36.282 40.473 -15.895 1.00 50.60  ? 221 GLU A O     1 
ATOM   1692 C  CB    . GLU A  1  224 ? -38.773 38.342 -16.235 1.00 45.72  ? 221 GLU A CB    1 
ATOM   1693 C  CG    . GLU A  1  224 ? -39.203 36.874 -16.211 1.00 46.06  ? 221 GLU A CG    1 
ATOM   1694 C  CD    . GLU A  1  224 ? -38.087 35.904 -16.569 1.00 47.10  ? 221 GLU A CD    1 
ATOM   1695 O  OE1   . GLU A  1  224 ? -36.982 36.349 -16.946 1.00 58.04  ? 221 GLU A OE1   1 
ATOM   1696 O  OE2   . GLU A  1  224 ? -38.322 34.682 -16.473 1.00 55.67  ? 221 GLU A OE2   1 
ATOM   1697 N  N     . ARG A  1  225 ? -38.160 41.152 -14.862 1.00 51.91  ? 222 ARG A N     1 
ATOM   1698 C  CA    . ARG A  1  225 ? -37.797 42.560 -14.987 1.00 46.44  ? 222 ARG A CA    1 
ATOM   1699 C  C     . ARG A  1  225 ? -36.582 42.892 -14.131 1.00 50.40  ? 222 ARG A C     1 
ATOM   1700 O  O     . ARG A  1  225 ? -35.747 43.721 -14.521 1.00 50.87  ? 222 ARG A O     1 
ATOM   1701 C  CB    . ARG A  1  225 ? -38.983 43.439 -14.610 1.00 45.35  ? 222 ARG A CB    1 
ATOM   1702 C  CG    . ARG A  1  225 ? -38.721 44.924 -14.738 1.00 47.00  ? 222 ARG A CG    1 
ATOM   1703 C  CD    . ARG A  1  225 ? -38.158 45.261 -16.109 1.00 47.48  ? 222 ARG A CD    1 
ATOM   1704 N  NE    . ARG A  1  225 ? -38.126 46.702 -16.336 1.00 55.13  ? 222 ARG A NE    1 
ATOM   1705 C  CZ    . ARG A  1  225 ? -37.117 47.490 -15.980 1.00 55.08  ? 222 ARG A CZ    1 
ATOM   1706 N  NH1   . ARG A  1  225 ? -36.053 46.976 -15.380 1.00 44.14  ? 222 ARG A NH1   1 
ATOM   1707 N  NH2   . ARG A  1  225 ? -37.173 48.792 -16.225 1.00 56.17  ? 222 ARG A NH2   1 
ATOM   1708 N  N     . LYS A  1  226 ? -36.459 42.254 -12.967 1.00 44.44  ? 223 LYS A N     1 
ATOM   1709 C  CA    . LYS A  1  226 ? -35.273 42.466 -12.149 1.00 44.55  ? 223 LYS A CA    1 
ATOM   1710 C  C     . LYS A  1  226 ? -34.043 41.879 -12.826 1.00 47.25  ? 223 LYS A C     1 
ATOM   1711 O  O     . LYS A  1  226 ? -32.947 42.439 -12.720 1.00 47.49  ? 223 LYS A O     1 
ATOM   1712 C  CB    . LYS A  1  226 ? -35.475 41.864 -10.759 1.00 49.13  ? 223 LYS A CB    1 
ATOM   1713 C  CG    . LYS A  1  226 ? -34.387 42.243 -9.754  1.00 45.03  ? 223 LYS A CG    1 
ATOM   1714 C  CD    . LYS A  1  226 ? -34.453 43.717 -9.364  1.00 44.99  ? 223 LYS A CD    1 
ATOM   1715 C  CE    . LYS A  1  226 ? -35.700 44.026 -8.549  1.00 49.14  ? 223 LYS A CE    1 
ATOM   1716 N  NZ    . LYS A  1  226 ? -35.603 45.341 -7.856  1.00 57.66  ? 223 LYS A NZ    1 
ATOM   1717 N  N     . ASN A  1  227 ? -34.211 40.753 -13.531 1.00 45.12  ? 224 ASN A N     1 
ATOM   1718 C  CA    . ASN A  1  227 ? -33.116 40.183 -14.311 1.00 50.28  ? 224 ASN A CA    1 
ATOM   1719 C  C     . ASN A  1  227 ? -32.516 41.212 -15.256 1.00 54.16  ? 224 ASN A C     1 
ATOM   1720 O  O     . ASN A  1  227 ? -31.293 41.263 -15.440 1.00 54.24  ? 224 ASN A O     1 
ATOM   1721 C  CB    . ASN A  1  227 ? -33.607 38.975 -15.109 1.00 54.28  ? 224 ASN A CB    1 
ATOM   1722 C  CG    . ASN A  1  227 ? -33.988 37.803 -14.229 1.00 57.63  ? 224 ASN A CG    1 
ATOM   1723 O  OD1   . ASN A  1  227 ? -33.698 37.786 -13.033 1.00 59.16  ? 224 ASN A OD1   1 
ATOM   1724 N  ND2   . ASN A  1  227 ? -34.629 36.803 -14.826 1.00 54.03  ? 224 ASN A ND2   1 
ATOM   1725 N  N     . SER A  1  228 ? -33.366 42.043 -15.865 1.00 47.53  ? 225 SER A N     1 
ATOM   1726 C  CA    . SER A  1  228 ? -32.882 43.066 -16.788 1.00 46.37  ? 225 SER A CA    1 
ATOM   1727 C  C     . SER A  1  228 ? -31.985 44.068 -16.072 1.00 49.95  ? 225 SER A C     1 
ATOM   1728 O  O     . SER A  1  228 ? -30.864 44.340 -16.515 1.00 49.97  ? 225 SER A O     1 
ATOM   1729 C  CB    . SER A  1  228 ? -34.066 43.771 -17.450 1.00 46.83  ? 225 SER A CB    1 
ATOM   1730 O  OG    . SER A  1  228 ? -33.626 44.698 -18.428 1.00 54.66  ? 225 SER A OG    1 
ATOM   1731 N  N     . ASP A  1  229 ? -32.465 44.625 -14.954 1.00 50.10  ? 226 ASP A N     1 
ATOM   1732 C  CA    . ASP A  1  229 ? -31.655 45.566 -14.183 1.00 53.38  ? 226 ASP A CA    1 
ATOM   1733 C  C     . ASP A  1  229 ? -30.326 44.945 -13.767 1.00 60.56  ? 226 ASP A C     1 
ATOM   1734 O  O     . ASP A  1  229 ? -29.282 45.609 -13.810 1.00 58.17  ? 226 ASP A O     1 
ATOM   1735 C  CB    . ASP A  1  229 ? -32.423 46.039 -12.948 1.00 62.42  ? 226 ASP A CB    1 
ATOM   1736 C  CG    . ASP A  1  229 ? -33.541 47.008 -13.286 1.00 69.53  ? 226 ASP A CG    1 
ATOM   1737 O  OD1   . ASP A  1  229 ? -33.485 47.629 -14.367 1.00 61.07  ? 226 ASP A OD1   1 
ATOM   1738 O  OD2   . ASP A  1  229 ? -34.472 47.154 -12.464 1.00 77.41  ? 226 ASP A OD2   1 
ATOM   1739 N  N     . ILE A  1  230 ? -30.348 43.674 -13.358 1.00 62.98  ? 227 ILE A N     1 
ATOM   1740 C  CA    . ILE A  1  230 ? -29.126 43.001 -12.920 1.00 45.24  ? 227 ILE A CA    1 
ATOM   1741 C  C     . ILE A  1  230 ? -28.116 42.945 -14.059 1.00 52.75  ? 227 ILE A C     1 
ATOM   1742 O  O     . ILE A  1  230 ? -26.966 43.377 -13.919 1.00 59.27  ? 227 ILE A O     1 
ATOM   1743 C  CB    . ILE A  1  230 ? -29.451 41.595 -12.391 1.00 50.73  ? 227 ILE A CB    1 
ATOM   1744 C  CG1   . ILE A  1  230 ? -30.312 41.688 -11.130 1.00 52.22  ? 227 ILE A CG1   1 
ATOM   1745 C  CG2   . ILE A  1  230 ? -28.175 40.814 -12.122 1.00 45.85  ? 227 ILE A CG2   1 
ATOM   1746 C  CD1   . ILE A  1  230 ? -30.946 40.379 -10.732 1.00 54.06  ? 227 ILE A CD1   1 
ATOM   1747 N  N     . LYS A  1  231 ? -28.537 42.407 -15.206 1.00 56.46  ? 228 LYS A N     1 
ATOM   1748 C  CA    . LYS A  1  231 ? -27.640 42.315 -16.353 1.00 53.19  ? 228 LYS A CA    1 
ATOM   1749 C  C     . LYS A  1  231 ? -27.183 43.693 -16.807 1.00 56.51  ? 228 LYS A C     1 
ATOM   1750 O  O     . LYS A  1  231 ? -26.014 43.879 -17.164 1.00 59.32  ? 228 LYS A O     1 
ATOM   1751 C  CB    . LYS A  1  231 ? -28.327 41.584 -17.503 1.00 57.84  ? 228 LYS A CB    1 
ATOM   1752 C  CG    . LYS A  1  231 ? -28.398 40.083 -17.336 1.00 60.21  ? 228 LYS A CG    1 
ATOM   1753 C  CD    . LYS A  1  231 ? -28.968 39.441 -18.583 1.00 45.45  ? 228 LYS A CD    1 
ATOM   1754 C  CE    . LYS A  1  231 ? -28.285 38.119 -18.886 1.00 57.29  ? 228 LYS A CE    1 
ATOM   1755 N  NZ    . LYS A  1  231 ? -28.907 37.438 -20.054 1.00 61.26  ? 228 LYS A NZ    1 
ATOM   1756 N  N     . ARG A  1  232 ? -28.092 44.671 -16.796 1.00 49.16  ? 229 ARG A N     1 
ATOM   1757 C  CA    . ARG A  1  232 ? -27.737 46.009 -17.257 1.00 50.58  ? 229 ARG A CA    1 
ATOM   1758 C  C     . ARG A  1  232 ? -26.643 46.618 -16.392 1.00 52.30  ? 229 ARG A C     1 
ATOM   1759 O  O     . ARG A  1  232 ? -25.714 47.247 -16.909 1.00 55.24  ? 229 ARG A O     1 
ATOM   1760 C  CB    . ARG A  1  232 ? -28.972 46.911 -17.276 1.00 45.07  ? 229 ARG A CB    1 
ATOM   1761 C  CG    . ARG A  1  232 ? -28.669 48.364 -17.627 1.00 45.34  ? 229 ARG A CG    1 
ATOM   1762 C  CD    . ARG A  1  232 ? -29.895 49.083 -18.177 1.00 45.12  ? 229 ARG A CD    1 
ATOM   1763 N  NE    . ARG A  1  232 ? -30.965 49.209 -17.191 1.00 51.21  ? 229 ARG A NE    1 
ATOM   1764 C  CZ    . ARG A  1  232 ? -31.192 50.305 -16.473 1.00 52.35  ? 229 ARG A CZ    1 
ATOM   1765 N  NH1   . ARG A  1  232 ? -30.420 51.372 -16.629 1.00 45.53  ? 229 ARG A NH1   1 
ATOM   1766 N  NH2   . ARG A  1  232 ? -32.190 50.337 -15.599 1.00 50.16  ? 229 ARG A NH2   1 
ATOM   1767 N  N     . LEU A  1  233 ? -26.727 46.430 -15.073 1.00 62.09  ? 230 LEU A N     1 
ATOM   1768 C  CA    . LEU A  1  233 ? -25.712 46.992 -14.188 1.00 55.25  ? 230 LEU A CA    1 
ATOM   1769 C  C     . LEU A  1  233 ? -24.402 46.218 -14.285 1.00 58.76  ? 230 LEU A C     1 
ATOM   1770 O  O     . LEU A  1  233 ? -23.321 46.818 -14.260 1.00 66.10  ? 230 LEU A O     1 
ATOM   1771 C  CB    . LEU A  1  233 ? -26.222 47.014 -12.747 1.00 51.42  ? 230 LEU A CB    1 
ATOM   1772 C  CG    . LEU A  1  233 ? -25.294 47.602 -11.681 1.00 50.42  ? 230 LEU A CG    1 
ATOM   1773 C  CD1   . LEU A  1  233 ? -24.794 48.980 -12.095 1.00 47.02  ? 230 LEU A CD1   1 
ATOM   1774 C  CD2   . LEU A  1  233 ? -26.012 47.670 -10.342 1.00 54.72  ? 230 LEU A CD2   1 
ATOM   1775 N  N     . LEU A  1  234 ? -24.477 44.887 -14.385 1.00 57.92  ? 231 LEU A N     1 
ATOM   1776 C  CA    . LEU A  1  234 ? -23.272 44.093 -14.598 1.00 56.19  ? 231 LEU A CA    1 
ATOM   1777 C  C     . LEU A  1  234 ? -22.564 44.504 -15.882 1.00 61.82  ? 231 LEU A C     1 
ATOM   1778 O  O     . LEU A  1  234 ? -21.331 44.584 -15.923 1.00 65.83  ? 231 LEU A O     1 
ATOM   1779 C  CB    . LEU A  1  234 ? -23.618 42.604 -14.633 1.00 47.19  ? 231 LEU A CB    1 
ATOM   1780 C  CG    . LEU A  1  234 ? -23.838 41.904 -13.291 1.00 53.58  ? 231 LEU A CG    1 
ATOM   1781 C  CD1   . LEU A  1  234 ? -24.364 40.495 -13.503 1.00 47.18  ? 231 LEU A CD1   1 
ATOM   1782 C  CD2   . LEU A  1  234 ? -22.543 41.873 -12.497 1.00 54.03  ? 231 LEU A CD2   1 
ATOM   1783 N  N     . THR A  1  235 ? -23.333 44.776 -16.940 1.00 58.83  ? 232 THR A N     1 
ATOM   1784 C  CA    . THR A  1  235 ? -22.742 45.198 -18.208 1.00 54.27  ? 232 THR A CA    1 
ATOM   1785 C  C     . THR A  1  235 ? -21.932 46.477 -18.038 1.00 54.95  ? 232 THR A C     1 
ATOM   1786 O  O     . THR A  1  235 ? -20.771 46.552 -18.458 1.00 59.52  ? 232 THR A O     1 
ATOM   1787 C  CB    . THR A  1  235 ? -23.837 45.393 -19.257 1.00 54.07  ? 232 THR A CB    1 
ATOM   1788 O  OG1   . THR A  1  235 ? -24.483 44.142 -19.518 1.00 55.11  ? 232 THR A OG1   1 
ATOM   1789 C  CG2   . THR A  1  235 ? -23.244 45.927 -20.550 1.00 49.99  ? 232 THR A CG2   1 
ATOM   1790 N  N     . LYS A  1  236 ? -22.530 47.497 -17.416 1.00 53.08  ? 233 LYS A N     1 
ATOM   1791 C  CA    . LYS A  1  236 ? -21.837 48.768 -17.239 1.00 55.13  ? 233 LYS A CA    1 
ATOM   1792 C  C     . LYS A  1  236 ? -20.580 48.604 -16.392 1.00 58.99  ? 233 LYS A C     1 
ATOM   1793 O  O     . LYS A  1  236 ? -19.533 49.187 -16.701 1.00 63.69  ? 233 LYS A O     1 
ATOM   1794 C  CB    . LYS A  1  236 ? -22.776 49.791 -16.603 1.00 50.13  ? 233 LYS A CB    1 
ATOM   1795 C  CG    . LYS A  1  236 ? -24.081 49.994 -17.353 1.00 52.66  ? 233 LYS A CG    1 
ATOM   1796 C  CD    . LYS A  1  236 ? -24.953 51.003 -16.636 1.00 52.01  ? 233 LYS A CD    1 
ATOM   1797 C  CE    . LYS A  1  236 ? -26.285 51.179 -17.333 1.00 58.24  ? 233 LYS A CE    1 
ATOM   1798 N  NZ    . LYS A  1  236 ? -27.208 52.032 -16.539 1.00 65.69  ? 233 LYS A NZ    1 
ATOM   1799 N  N     . LEU A  1  237 ? -20.661 47.808 -15.324 1.00 55.27  ? 234 LEU A N     1 
ATOM   1800 C  CA    . LEU A  1  237 ? -19.514 47.631 -14.443 1.00 55.95  ? 234 LEU A CA    1 
ATOM   1801 C  C     . LEU A  1  237 ? -18.375 46.877 -15.119 1.00 57.30  ? 234 LEU A C     1 
ATOM   1802 O  O     . LEU A  1  237 ? -17.218 47.036 -14.719 1.00 64.45  ? 234 LEU A O     1 
ATOM   1803 C  CB    . LEU A  1  237 ? -19.941 46.902 -13.167 1.00 52.05  ? 234 LEU A CB    1 
ATOM   1804 C  CG    . LEU A  1  237 ? -20.838 47.700 -12.223 1.00 54.58  ? 234 LEU A CG    1 
ATOM   1805 C  CD1   . LEU A  1  237 ? -21.080 46.934 -10.928 1.00 48.65  ? 234 LEU A CD1   1 
ATOM   1806 C  CD2   . LEU A  1  237 ? -20.222 49.064 -11.942 1.00 49.32  ? 234 LEU A CD2   1 
ATOM   1807 N  N     . LEU A  1  238 ? -18.671 46.082 -16.141 1.00 58.26  ? 235 LEU A N     1 
ATOM   1808 C  CA    . LEU A  1  238 ? -17.666 45.262 -16.799 1.00 50.69  ? 235 LEU A CA    1 
ATOM   1809 C  C     . LEU A  1  238 ? -17.174 45.850 -18.116 1.00 60.62  ? 235 LEU A C     1 
ATOM   1810 O  O     . LEU A  1  238 ? -16.394 45.194 -18.810 1.00 63.22  ? 235 LEU A O     1 
ATOM   1811 C  CB    . LEU A  1  238 ? -18.215 43.855 -17.044 1.00 50.33  ? 235 LEU A CB    1 
ATOM   1812 C  CG    . LEU A  1  238 ? -18.494 43.050 -15.773 1.00 54.62  ? 235 LEU A CG    1 
ATOM   1813 C  CD1   . LEU A  1  238 ? -19.332 41.819 -16.075 1.00 55.04  ? 235 LEU A CD1   1 
ATOM   1814 C  CD2   . LEU A  1  238 ? -17.192 42.653 -15.103 1.00 51.07  ? 235 LEU A CD2   1 
ATOM   1815 N  N     . VAL A  1  239 ? -17.614 47.060 -18.476 1.00 59.14  ? 236 VAL A N     1 
ATOM   1816 C  CA    . VAL A  1  239 ? -17.134 47.697 -19.696 1.00 61.84  ? 236 VAL A CA    1 
ATOM   1817 C  C     . VAL A  1  239 ? -15.621 47.830 -19.644 1.00 69.66  ? 236 VAL A C     1 
ATOM   1818 O  O     . VAL A  1  239 ? -15.055 48.320 -18.659 1.00 70.82  ? 236 VAL A O     1 
ATOM   1819 C  CB    . VAL A  1  239 ? -17.812 49.063 -19.884 1.00 55.31  ? 236 VAL A CB    1 
ATOM   1820 C  CG1   . VAL A  1  239 ? -17.065 49.899 -20.904 1.00 52.24  ? 236 VAL A CG1   1 
ATOM   1821 C  CG2   . VAL A  1  239 ? -19.262 48.885 -20.305 1.00 52.64  ? 236 VAL A CG2   1 
ATOM   1822 N  N     . GLY A  1  240 ? -14.955 47.380 -20.707 1.00 73.83  ? 237 GLY A N     1 
ATOM   1823 C  CA    . GLY A  1  240 ? -13.514 47.471 -20.798 1.00 72.64  ? 237 GLY A CA    1 
ATOM   1824 C  C     . GLY A  1  240 ? -12.751 46.412 -20.028 1.00 74.14  ? 237 GLY A C     1 
ATOM   1825 O  O     . GLY A  1  240 ? -11.562 46.215 -20.288 1.00 84.08  ? 237 GLY A O     1 
ATOM   1826 N  N     . ARG A  1  241 ? -13.396 45.721 -19.099 1.00 69.36  ? 238 ARG A N     1 
ATOM   1827 C  CA    . ARG A  1  241 ? -12.771 44.674 -18.305 1.00 68.54  ? 238 ARG A CA    1 
ATOM   1828 C  C     . ARG A  1  241 ? -13.230 43.300 -18.773 1.00 71.60  ? 238 ARG A C     1 
ATOM   1829 O  O     . ARG A  1  241 ? -14.251 43.171 -19.454 1.00 73.88  ? 238 ARG A O     1 
ATOM   1830 C  CB    . ARG A  1  241 ? -13.122 44.852 -16.823 1.00 72.55  ? 238 ARG A CB    1 
ATOM   1831 C  CG    . ARG A  1  241 ? -12.693 46.182 -16.223 1.00 81.54  ? 238 ARG A CG    1 
ATOM   1832 C  CD    . ARG A  1  241 ? -12.999 46.218 -14.732 1.00 90.31  ? 238 ARG A CD    1 
ATOM   1833 N  NE    . ARG A  1  241 ? -12.533 47.451 -14.105 1.00 100.84 ? 238 ARG A NE    1 
ATOM   1834 C  CZ    . ARG A  1  241 ? -13.218 48.590 -14.102 1.00 109.50 ? 238 ARG A CZ    1 
ATOM   1835 N  NH1   . ARG A  1  241 ? -14.402 48.658 -14.698 1.00 112.60 ? 238 ARG A NH1   1 
ATOM   1836 N  NH2   . ARG A  1  241 ? -12.718 49.664 -13.506 1.00 109.89 ? 238 ARG A NH2   1 
ATOM   1837 N  N     . PRO A  1  242 ? -12.485 42.247 -18.442 1.00 69.24  ? 239 PRO A N     1 
ATOM   1838 C  CA    . PRO A  1  242 ? -12.991 40.893 -18.684 1.00 70.04  ? 239 PRO A CA    1 
ATOM   1839 C  C     . PRO A  1  242 ? -14.208 40.605 -17.818 1.00 73.93  ? 239 PRO A C     1 
ATOM   1840 O  O     . PRO A  1  242 ? -14.348 41.119 -16.706 1.00 76.26  ? 239 PRO A O     1 
ATOM   1841 C  CB    . PRO A  1  242 ? -11.807 39.993 -18.310 1.00 65.08  ? 239 PRO A CB    1 
ATOM   1842 C  CG    . PRO A  1  242 ? -10.930 40.839 -17.443 1.00 69.44  ? 239 PRO A CG    1 
ATOM   1843 C  CD    . PRO A  1  242 ? -11.093 42.237 -17.961 1.00 65.54  ? 239 PRO A CD    1 
ATOM   1844 N  N     . THR A  1  243 ? -15.094 39.761 -18.346 1.00 75.51  ? 240 THR A N     1 
ATOM   1845 C  CA    . THR A  1  243 ? -16.393 39.522 -17.726 1.00 76.69  ? 240 THR A CA    1 
ATOM   1846 C  C     . THR A  1  243 ? -16.298 38.678 -16.459 1.00 76.08  ? 240 THR A C     1 
ATOM   1847 O  O     . THR A  1  243 ? -16.877 37.588 -16.389 1.00 73.95  ? 240 THR A O     1 
ATOM   1848 C  CB    . THR A  1  243 ? -17.337 38.852 -18.730 1.00 69.69  ? 240 THR A CB    1 
ATOM   1849 O  OG1   . THR A  1  243 ? -16.656 37.776 -19.387 1.00 76.72  ? 240 THR A OG1   1 
ATOM   1850 C  CG2   . THR A  1  243 ? -17.811 39.858 -19.768 1.00 59.07  ? 240 THR A CG2   1 
ATOM   1851 N  N     . LYS A  1  244 ? -15.586 39.176 -15.446 1.00 77.17  ? 241 LYS A N     1 
ATOM   1852 C  CA    . LYS A  1  244 ? -15.512 38.525 -14.137 1.00 75.77  ? 241 LYS A CA    1 
ATOM   1853 C  C     . LYS A  1  244 ? -16.663 39.050 -13.288 1.00 68.94  ? 241 LYS A C     1 
ATOM   1854 O  O     . LYS A  1  244 ? -16.531 40.045 -12.574 1.00 73.24  ? 241 LYS A O     1 
ATOM   1855 C  CB    . LYS A  1  244 ? -14.170 38.793 -13.464 1.00 86.50  ? 241 LYS A CB    1 
ATOM   1856 C  CG    . LYS A  1  244 ? -12.936 38.377 -14.249 1.00 100.58 ? 241 LYS A CG    1 
ATOM   1857 C  CD    . LYS A  1  244 ? -11.682 38.648 -13.424 1.00 106.31 ? 241 LYS A CD    1 
ATOM   1858 C  CE    . LYS A  1  244 ? -10.411 38.286 -14.172 1.00 108.89 ? 241 LYS A CE    1 
ATOM   1859 N  NZ    . LYS A  1  244 ? -9.201  38.484 -13.324 1.00 111.93 ? 241 LYS A NZ    1 
ATOM   1860 N  N     . TRP A  1  245 ? -17.808 38.369 -13.353 1.00 61.12  ? 242 TRP A N     1 
ATOM   1861 C  CA    . TRP A  1  245 ? -19.017 38.841 -12.688 1.00 56.70  ? 242 TRP A CA    1 
ATOM   1862 C  C     . TRP A  1  245 ? -19.248 38.231 -11.312 1.00 60.53  ? 242 TRP A C     1 
ATOM   1863 O  O     . TRP A  1  245 ? -20.097 38.739 -10.571 1.00 69.09  ? 242 TRP A O     1 
ATOM   1864 C  CB    . TRP A  1  245 ? -20.247 38.574 -13.566 1.00 53.62  ? 242 TRP A CB    1 
ATOM   1865 C  CG    . TRP A  1  245 ? -20.373 37.160 -14.031 1.00 57.43  ? 242 TRP A CG    1 
ATOM   1866 C  CD1   . TRP A  1  245 ? -19.905 36.642 -15.201 1.00 60.33  ? 242 TRP A CD1   1 
ATOM   1867 C  CD2   . TRP A  1  245 ? -21.017 36.081 -13.341 1.00 61.59  ? 242 TRP A CD2   1 
ATOM   1868 N  NE1   . TRP A  1  245 ? -20.214 35.307 -15.284 1.00 67.69  ? 242 TRP A NE1   1 
ATOM   1869 C  CE2   . TRP A  1  245 ? -20.896 34.938 -14.155 1.00 65.39  ? 242 TRP A CE2   1 
ATOM   1870 C  CE3   . TRP A  1  245 ? -21.682 35.970 -12.116 1.00 60.56  ? 242 TRP A CE3   1 
ATOM   1871 C  CZ2   . TRP A  1  245 ? -21.415 33.699 -13.784 1.00 65.06  ? 242 TRP A CZ2   1 
ATOM   1872 C  CZ3   . TRP A  1  245 ? -22.196 34.738 -11.749 1.00 58.12  ? 242 TRP A CZ3   1 
ATOM   1873 C  CH2   . TRP A  1  245 ? -22.060 33.619 -12.581 1.00 59.10  ? 242 TRP A CH2   1 
ATOM   1874 N  N     . TYR A  1  246 ? -18.524 37.169 -10.948 1.00 63.68  ? 243 TYR A N     1 
ATOM   1875 C  CA    . TYR A  1  246 ? -18.766 36.504 -9.669  1.00 65.15  ? 243 TYR A CA    1 
ATOM   1876 C  C     . TYR A  1  246 ? -18.582 37.467 -8.500  1.00 65.59  ? 243 TYR A C     1 
ATOM   1877 O  O     . TYR A  1  246 ? -19.442 37.561 -7.617  1.00 67.15  ? 243 TYR A O     1 
ATOM   1878 C  CB    . TYR A  1  246 ? -17.843 35.293 -9.519  1.00 70.86  ? 243 TYR A CB    1 
ATOM   1879 C  CG    . TYR A  1  246 ? -17.961 34.584 -8.187  1.00 74.25  ? 243 TYR A CG    1 
ATOM   1880 C  CD1   . TYR A  1  246 ? -18.925 33.604 -7.980  1.00 76.05  ? 243 TYR A CD1   1 
ATOM   1881 C  CD2   . TYR A  1  246 ? -17.104 34.888 -7.136  1.00 74.65  ? 243 TYR A CD2   1 
ATOM   1882 C  CE1   . TYR A  1  246 ? -19.035 32.955 -6.766  1.00 72.37  ? 243 TYR A CE1   1 
ATOM   1883 C  CE2   . TYR A  1  246 ? -17.208 34.246 -5.919  1.00 69.61  ? 243 TYR A CE2   1 
ATOM   1884 C  CZ    . TYR A  1  246 ? -18.174 33.280 -5.740  1.00 73.94  ? 243 TYR A CZ    1 
ATOM   1885 O  OH    . TYR A  1  246 ? -18.280 32.635 -4.529  1.00 82.24  ? 243 TYR A OH    1 
ATOM   1886 N  N     . ASP A  1  247 ? -17.468 38.197 -8.482  1.00 65.11  ? 244 ASP A N     1 
ATOM   1887 C  CA    . ASP A  1  247 ? -17.190 39.123 -7.390  1.00 63.78  ? 244 ASP A CA    1 
ATOM   1888 C  C     . ASP A  1  247 ? -18.056 40.374 -7.427  1.00 63.52  ? 244 ASP A C     1 
ATOM   1889 O  O     . ASP A  1  247 ? -17.965 41.189 -6.504  1.00 73.67  ? 244 ASP A O     1 
ATOM   1890 C  CB    . ASP A  1  247 ? -15.713 39.521 -7.403  1.00 64.80  ? 244 ASP A CB    1 
ATOM   1891 C  CG    . ASP A  1  247 ? -14.801 38.390 -6.972  1.00 76.29  ? 244 ASP A CG    1 
ATOM   1892 O  OD1   . ASP A  1  247 ? -15.249 37.532 -6.182  1.00 78.31  ? 244 ASP A OD1   1 
ATOM   1893 O  OD2   . ASP A  1  247 ? -13.636 38.361 -7.420  1.00 77.83  ? 244 ASP A OD2   1 
ATOM   1894 N  N     . LEU A  1  248 ? -18.889 40.551 -8.454  1.00 65.06  ? 245 LEU A N     1 
ATOM   1895 C  CA    . LEU A  1  248 ? -19.749 41.722 -8.551  1.00 59.51  ? 245 LEU A CA    1 
ATOM   1896 C  C     . LEU A  1  248 ? -21.179 41.473 -8.087  1.00 60.27  ? 245 LEU A C     1 
ATOM   1897 O  O     . LEU A  1  248 ? -21.904 42.442 -7.841  1.00 68.19  ? 245 LEU A O     1 
ATOM   1898 C  CB    . LEU A  1  248 ? -19.790 42.246 -9.991  1.00 57.61  ? 245 LEU A CB    1 
ATOM   1899 C  CG    . LEU A  1  248 ? -18.576 43.023 -10.501 1.00 62.76  ? 245 LEU A CG    1 
ATOM   1900 C  CD1   . LEU A  1  248 ? -18.798 43.428 -11.943 1.00 61.25  ? 245 LEU A CD1   1 
ATOM   1901 C  CD2   . LEU A  1  248 ? -18.315 44.249 -9.644  1.00 52.02  ? 245 LEU A CD2   1 
ATOM   1902 N  N     . LEU A  1  249 ? -21.602 40.214 -7.976  1.00 51.13  ? 246 LEU A N     1 
ATOM   1903 C  CA    . LEU A  1  249 ? -22.964 39.918 -7.532  1.00 48.60  ? 246 LEU A CA    1 
ATOM   1904 C  C     . LEU A  1  249 ? -23.334 40.593 -6.214  1.00 48.53  ? 246 LEU A C     1 
ATOM   1905 O  O     . LEU A  1  249 ? -24.407 41.209 -6.149  1.00 52.57  ? 246 LEU A O     1 
ATOM   1906 C  CB    . LEU A  1  249 ? -23.163 38.397 -7.450  1.00 48.90  ? 246 LEU A CB    1 
ATOM   1907 C  CG    . LEU A  1  249 ? -23.266 37.642 -8.776  1.00 62.92  ? 246 LEU A CG    1 
ATOM   1908 C  CD1   . LEU A  1  249 ? -23.894 36.272 -8.558  1.00 62.98  ? 246 LEU A CD1   1 
ATOM   1909 C  CD2   . LEU A  1  249 ? -24.063 38.444 -9.791  1.00 55.50  ? 246 LEU A CD2   1 
ATOM   1910 N  N     . PRO A  1  250 ? -22.521 40.534 -5.149  1.00 58.89  ? 247 PRO A N     1 
ATOM   1911 C  CA    . PRO A  1  250 ? -22.897 41.268 -3.929  1.00 58.67  ? 247 PRO A CA    1 
ATOM   1912 C  C     . PRO A  1  250 ? -22.982 42.768 -4.149  1.00 54.01  ? 247 PRO A C     1 
ATOM   1913 O  O     . PRO A  1  250 ? -23.869 43.427 -3.587  1.00 53.90  ? 247 PRO A O     1 
ATOM   1914 C  CB    . PRO A  1  250 ? -21.788 40.897 -2.935  1.00 65.81  ? 247 PRO A CB    1 
ATOM   1915 C  CG    . PRO A  1  250 ? -21.198 39.630 -3.470  1.00 64.82  ? 247 PRO A CG    1 
ATOM   1916 C  CD    . PRO A  1  250 ? -21.278 39.761 -4.952  1.00 58.68  ? 247 PRO A CD    1 
ATOM   1917 N  N     . VAL A  1  251 ? -22.081 43.325 -4.962  1.00 49.94  ? 248 VAL A N     1 
ATOM   1918 C  CA    . VAL A  1  251 ? -22.130 44.751 -5.270  1.00 53.33  ? 248 VAL A CA    1 
ATOM   1919 C  C     . VAL A  1  251 ? -23.432 45.091 -5.979  1.00 57.60  ? 248 VAL A C     1 
ATOM   1920 O  O     . VAL A  1  251 ? -24.115 46.064 -5.636  1.00 60.24  ? 248 VAL A O     1 
ATOM   1921 C  CB    . VAL A  1  251 ? -20.908 45.165 -6.111  1.00 54.64  ? 248 VAL A CB    1 
ATOM   1922 C  CG1   . VAL A  1  251 ? -20.895 46.674 -6.334  1.00 52.17  ? 248 VAL A CG1   1 
ATOM   1923 C  CG2   . VAL A  1  251 ? -19.616 44.701 -5.453  1.00 55.88  ? 248 VAL A CG2   1 
ATOM   1924 N  N     . VAL A  1  252 ? -23.802 44.280 -6.970  1.00 52.54  ? 249 VAL A N     1 
ATOM   1925 C  CA    . VAL A  1  252 ? -25.008 44.545 -7.751  1.00 53.20  ? 249 VAL A CA    1 
ATOM   1926 C  C     . VAL A  1  252 ? -26.252 44.386 -6.883  1.00 50.97  ? 249 VAL A C     1 
ATOM   1927 O  O     . VAL A  1  252 ? -27.170 45.213 -6.934  1.00 49.12  ? 249 VAL A O     1 
ATOM   1928 C  CB    . VAL A  1  252 ? -25.053 43.630 -8.984  1.00 58.52  ? 249 VAL A CB    1 
ATOM   1929 C  CG1   . VAL A  1  252 ? -26.430 43.666 -9.630  1.00 52.80  ? 249 VAL A CG1   1 
ATOM   1930 C  CG2   . VAL A  1  252 ? -23.982 44.043 -9.982  1.00 61.39  ? 249 VAL A CG2   1 
ATOM   1931 N  N     . GLN A  1  253 ? -26.301 43.321 -6.077  1.00 49.52  ? 250 GLN A N     1 
ATOM   1932 C  CA    . GLN A  1  253 ? -27.447 43.090 -5.207  1.00 50.22  ? 250 GLN A CA    1 
ATOM   1933 C  C     . GLN A  1  253 ? -27.686 44.275 -4.278  1.00 53.41  ? 250 GLN A C     1 
ATOM   1934 O  O     . GLN A  1  253 ? -28.816 44.764 -4.151  1.00 50.25  ? 250 GLN A O     1 
ATOM   1935 C  CB    . GLN A  1  253 ? -27.234 41.807 -4.401  1.00 47.34  ? 250 GLN A CB    1 
ATOM   1936 C  CG    . GLN A  1  253 ? -28.249 41.576 -3.297  1.00 51.76  ? 250 GLN A CG    1 
ATOM   1937 C  CD    . GLN A  1  253 ? -27.837 40.454 -2.365  1.00 58.30  ? 250 GLN A CD    1 
ATOM   1938 O  OE1   . GLN A  1  253 ? -27.857 39.282 -2.739  1.00 61.85  ? 250 GLN A OE1   1 
ATOM   1939 N  NE2   . GLN A  1  253 ? -27.450 40.811 -1.145  1.00 57.18  ? 250 GLN A NE2   1 
ATOM   1940 N  N     . LEU A  1  254 ? -26.626 44.761 -3.630  1.00 57.06  ? 251 LEU A N     1 
ATOM   1941 C  CA    . LEU A  1  254 ? -26.763 45.889 -2.714  1.00 59.03  ? 251 LEU A CA    1 
ATOM   1942 C  C     . LEU A  1  254 ? -27.149 47.165 -3.454  1.00 58.99  ? 251 LEU A C     1 
ATOM   1943 O  O     . LEU A  1  254 ? -27.971 47.948 -2.964  1.00 53.04  ? 251 LEU A O     1 
ATOM   1944 C  CB    . LEU A  1  254 ? -25.460 46.093 -1.942  1.00 58.52  ? 251 LEU A CB    1 
ATOM   1945 C  CG    . LEU A  1  254 ? -25.420 47.263 -0.956  1.00 56.33  ? 251 LEU A CG    1 
ATOM   1946 C  CD1   . LEU A  1  254 ? -26.171 46.927 0.322   1.00 54.56  ? 251 LEU A CD1   1 
ATOM   1947 C  CD2   . LEU A  1  254 ? -23.985 47.666 -0.656  1.00 49.11  ? 251 LEU A CD2   1 
ATOM   1948 N  N     . ALA A  1  255 ? -26.568 47.389 -4.635  1.00 60.26  ? 252 ALA A N     1 
ATOM   1949 C  CA    . ALA A  1  255 ? -26.849 48.609 -5.384  1.00 57.12  ? 252 ALA A CA    1 
ATOM   1950 C  C     . ALA A  1  255 ? -28.317 48.684 -5.788  1.00 57.72  ? 252 ALA A C     1 
ATOM   1951 O  O     . ALA A  1  255 ? -28.980 49.707 -5.580  1.00 53.68  ? 252 ALA A O     1 
ATOM   1952 C  CB    . ALA A  1  255 ? -25.947 48.684 -6.617  1.00 47.98  ? 252 ALA A CB    1 
ATOM   1953 N  N     . LEU A  1  256 ? -28.847 47.599 -6.357  1.00 55.74  ? 253 LEU A N     1 
ATOM   1954 C  CA    . LEU A  1  256 ? -30.231 47.612 -6.817  1.00 55.81  ? 253 LEU A CA    1 
ATOM   1955 C  C     . LEU A  1  256 ? -31.207 47.647 -5.648  1.00 60.02  ? 253 LEU A C     1 
ATOM   1956 O  O     . LEU A  1  256 ? -32.251 48.306 -5.725  1.00 62.84  ? 253 LEU A O     1 
ATOM   1957 C  CB    . LEU A  1  256 ? -30.499 46.400 -7.709  1.00 45.69  ? 253 LEU A CB    1 
ATOM   1958 C  CG    . LEU A  1  256 ? -29.663 46.325 -8.988  1.00 54.65  ? 253 LEU A CG    1 
ATOM   1959 C  CD1   . LEU A  1  256 ? -30.023 45.089 -9.795  1.00 55.12  ? 253 LEU A CD1   1 
ATOM   1960 C  CD2   . LEU A  1  256 ? -29.847 47.586 -9.820  1.00 45.54  ? 253 LEU A CD2   1 
ATOM   1961 N  N     . ASN A  1  257 ? -30.885 46.952 -4.553  1.00 55.18  ? 254 ASN A N     1 
ATOM   1962 C  CA    . ASN A  1  257 ? -31.759 46.968 -3.384  1.00 54.92  ? 254 ASN A CA    1 
ATOM   1963 C  C     . ASN A  1  257 ? -31.858 48.349 -2.753  1.00 57.32  ? 254 ASN A C     1 
ATOM   1964 O  O     . ASN A  1  257 ? -32.769 48.588 -1.954  1.00 56.94  ? 254 ASN A O     1 
ATOM   1965 C  CB    . ASN A  1  257 ? -31.276 45.954 -2.343  1.00 54.73  ? 254 ASN A CB    1 
ATOM   1966 C  CG    . ASN A  1  257 ? -31.758 44.545 -2.632  1.00 58.47  ? 254 ASN A CG    1 
ATOM   1967 O  OD1   . ASN A  1  257 ? -32.789 44.350 -3.278  1.00 62.34  ? 254 ASN A OD1   1 
ATOM   1968 N  ND2   . ASN A  1  257 ? -31.016 43.554 -2.149  1.00 50.75  ? 254 ASN A ND2   1 
ATOM   1969 N  N     . ASN A  1  258 ? -30.950 49.266 -3.091  1.00 52.04  ? 255 ASN A N     1 
ATOM   1970 C  CA    . ASN A  1  258 ? -30.988 50.627 -2.568  1.00 47.37  ? 255 ASN A CA    1 
ATOM   1971 C  C     . ASN A  1  258 ? -31.216 51.657 -3.670  1.00 52.10  ? 255 ASN A C     1 
ATOM   1972 O  O     . ASN A  1  258 ? -30.955 52.845 -3.462  1.00 47.69  ? 255 ASN A O     1 
ATOM   1973 C  CB    . ASN A  1  258 ? -29.705 50.939 -1.797  1.00 50.66  ? 255 ASN A CB    1 
ATOM   1974 C  CG    . ASN A  1  258 ? -29.632 50.206 -0.470  1.00 56.64  ? 255 ASN A CG    1 
ATOM   1975 O  OD1   . ASN A  1  258 ? -30.304 50.577 0.491   1.00 70.74  ? 255 ASN A OD1   1 
ATOM   1976 N  ND2   . ASN A  1  258 ? -28.814 49.161 -0.411  1.00 55.52  ? 255 ASN A ND2   1 
ATOM   1977 N  N     . THR A  1  259 ? -31.704 51.232 -4.829  1.00 60.33  ? 256 THR A N     1 
ATOM   1978 C  CA    . THR A  1  259 ? -31.990 52.140 -5.930  1.00 47.38  ? 256 THR A CA    1 
ATOM   1979 C  C     . THR A  1  259 ? -33.445 52.588 -5.870  1.00 50.93  ? 256 THR A C     1 
ATOM   1980 O  O     . THR A  1  259 ? -34.344 51.782 -5.622  1.00 57.52  ? 256 THR A O     1 
ATOM   1981 C  CB    . THR A  1  259 ? -31.698 51.464 -7.272  1.00 55.55  ? 256 THR A CB    1 
ATOM   1982 O  OG1   . THR A  1  259 ? -30.283 51.405 -7.482  1.00 64.53  ? 256 THR A OG1   1 
ATOM   1983 C  CG2   . THR A  1  259 ? -32.355 52.218 -8.423  1.00 46.29  ? 256 THR A CG2   1 
ATOM   1984 N  N     . TYR A  1  260 ? -33.668 53.882 -6.088  1.00 51.96  ? 257 TYR A N     1 
ATOM   1985 C  CA    . TYR A  1  260 ? -35.020 54.418 -6.066  1.00 52.10  ? 257 TYR A CA    1 
ATOM   1986 C  C     . TYR A  1  260 ? -35.802 53.999 -7.305  1.00 59.57  ? 257 TYR A C     1 
ATOM   1987 O  O     . TYR A  1  260 ? -35.270 53.966 -8.418  1.00 64.50  ? 257 TYR A O     1 
ATOM   1988 C  CB    . TYR A  1  260 ? -34.991 55.942 -5.969  1.00 50.32  ? 257 TYR A CB    1 
ATOM   1989 C  CG    . TYR A  1  260 ? -34.824 56.453 -4.561  1.00 54.15  ? 257 TYR A CG    1 
ATOM   1990 C  CD1   . TYR A  1  260 ? -35.925 56.625 -3.733  1.00 58.49  ? 257 TYR A CD1   1 
ATOM   1991 C  CD2   . TYR A  1  260 ? -33.569 56.761 -4.057  1.00 57.71  ? 257 TYR A CD2   1 
ATOM   1992 C  CE1   . TYR A  1  260 ? -35.780 57.089 -2.442  1.00 53.93  ? 257 TYR A CE1   1 
ATOM   1993 C  CE2   . TYR A  1  260 ? -33.414 57.226 -2.765  1.00 57.02  ? 257 TYR A CE2   1 
ATOM   1994 C  CZ    . TYR A  1  260 ? -34.523 57.389 -1.963  1.00 54.10  ? 257 TYR A CZ    1 
ATOM   1995 O  OH    . TYR A  1  260 ? -34.375 57.852 -0.677  1.00 60.66  ? 257 TYR A OH    1 
ATOM   1996 N  N     . SER A  1  261 ? -37.076 53.671 -7.097  1.00 60.68  ? 258 SER A N     1 
ATOM   1997 C  CA    . SER A  1  261 ? -38.020 53.524 -8.192  1.00 47.00  ? 258 SER A CA    1 
ATOM   1998 C  C     . SER A  1  261 ? -38.717 54.866 -8.371  1.00 56.11  ? 258 SER A C     1 
ATOM   1999 O  O     . SER A  1  261 ? -39.473 55.280 -7.477  1.00 59.31  ? 258 SER A O     1 
ATOM   2000 C  CB    . SER A  1  261 ? -39.034 52.430 -7.895  1.00 51.05  ? 258 SER A CB    1 
ATOM   2001 O  OG    . SER A  1  261 ? -40.065 52.406 -8.865  1.00 60.04  ? 258 SER A OG    1 
ATOM   2002 N  N     . PRO A  1  262 ? -38.482 55.586 -9.469  1.00 53.98  ? 259 PRO A N     1 
ATOM   2003 C  CA    . PRO A  1  262 ? -39.050 56.938 -9.607  1.00 52.31  ? 259 PRO A CA    1 
ATOM   2004 C  C     . PRO A  1  262 ? -40.559 57.007 -9.431  1.00 58.51  ? 259 PRO A C     1 
ATOM   2005 O  O     . PRO A  1  262 ? -41.070 58.020 -8.934  1.00 57.05  ? 259 PRO A O     1 
ATOM   2006 C  CB    . PRO A  1  262 ? -38.627 57.343 -11.025 1.00 53.54  ? 259 PRO A CB    1 
ATOM   2007 C  CG    . PRO A  1  262 ? -37.373 56.577 -11.262 1.00 47.43  ? 259 PRO A CG    1 
ATOM   2008 C  CD    . PRO A  1  262 ? -37.576 55.250 -10.583 1.00 46.97  ? 259 PRO A CD    1 
ATOM   2009 N  N     . VAL A  1  263 ? -41.292 55.959 -9.809  1.00 63.63  ? 260 VAL A N     1 
ATOM   2010 C  CA    . VAL A  1  263 ? -42.745 56.006 -9.671  1.00 58.02  ? 260 VAL A CA    1 
ATOM   2011 C  C     . VAL A  1  263 ? -43.175 55.723 -8.233  1.00 57.46  ? 260 VAL A C     1 
ATOM   2012 O  O     . VAL A  1  263 ? -44.196 56.246 -7.775  1.00 65.49  ? 260 VAL A O     1 
ATOM   2013 C  CB    . VAL A  1  263 ? -43.409 55.037 -10.667 1.00 52.64  ? 260 VAL A CB    1 
ATOM   2014 C  CG1   . VAL A  1  263 ? -43.078 53.588 -10.327 1.00 49.99  ? 260 VAL A CG1   1 
ATOM   2015 C  CG2   . VAL A  1  263 ? -44.920 55.264 -10.723 1.00 48.67  ? 260 VAL A CG2   1 
ATOM   2016 N  N     . LEU A  1  264 ? -42.411 54.917 -7.491  1.00 59.65  ? 261 LEU A N     1 
ATOM   2017 C  CA    . LEU A  1  264 ? -42.785 54.604 -6.116  1.00 60.24  ? 261 LEU A CA    1 
ATOM   2018 C  C     . LEU A  1  264 ? -42.278 55.647 -5.130  1.00 64.39  ? 261 LEU A C     1 
ATOM   2019 O  O     . LEU A  1  264 ? -42.912 55.867 -4.093  1.00 74.64  ? 261 LEU A O     1 
ATOM   2020 C  CB    . LEU A  1  264 ? -42.258 53.224 -5.717  1.00 54.56  ? 261 LEU A CB    1 
ATOM   2021 C  CG    . LEU A  1  264 ? -42.832 51.973 -6.388  1.00 47.90  ? 261 LEU A CG    1 
ATOM   2022 C  CD1   . LEU A  1  264 ? -42.272 50.727 -5.717  1.00 47.61  ? 261 LEU A CD1   1 
ATOM   2023 C  CD2   . LEU A  1  264 ? -44.350 51.986 -6.331  1.00 48.46  ? 261 LEU A CD2   1 
ATOM   2024 N  N     . LYS A  1  265 ? -41.153 56.298 -5.447  1.00 63.28  ? 262 LYS A N     1 
ATOM   2025 C  CA    . LYS A  1  265 ? -40.433 57.212 -4.564  1.00 66.60  ? 262 LYS A CA    1 
ATOM   2026 C  C     . LYS A  1  265 ? -39.761 56.496 -3.398  1.00 64.68  ? 262 LYS A C     1 
ATOM   2027 O  O     . LYS A  1  265 ? -39.491 57.114 -2.365  1.00 71.60  ? 262 LYS A O     1 
ATOM   2028 C  CB    . LYS A  1  265 ? -41.338 58.325 -4.020  1.00 68.08  ? 262 LYS A CB    1 
ATOM   2029 C  CG    . LYS A  1  265 ? -42.077 59.109 -5.078  1.00 72.05  ? 262 LYS A CG    1 
ATOM   2030 C  CD    . LYS A  1  265 ? -41.130 59.957 -5.899  1.00 66.46  ? 262 LYS A CD    1 
ATOM   2031 C  CE    . LYS A  1  265 ? -41.906 60.964 -6.718  1.00 72.39  ? 262 LYS A CE    1 
ATOM   2032 N  NZ    . LYS A  1  265 ? -42.812 61.766 -5.849  1.00 72.96  ? 262 LYS A NZ    1 
ATOM   2033 N  N     . TYR A  1  266 ? -39.485 55.201 -3.534  1.00 57.24  ? 263 TYR A N     1 
ATOM   2034 C  CA    . TYR A  1  266 ? -38.845 54.442 -2.469  1.00 51.10  ? 263 TYR A CA    1 
ATOM   2035 C  C     . TYR A  1  266 ? -37.932 53.393 -3.083  1.00 53.04  ? 263 TYR A C     1 
ATOM   2036 O  O     . TYR A  1  266 ? -38.110 52.974 -4.231  1.00 51.53  ? 263 TYR A O     1 
ATOM   2037 C  CB    . TYR A  1  266 ? -39.875 53.769 -1.548  1.00 56.07  ? 263 TYR A CB    1 
ATOM   2038 C  CG    . TYR A  1  266 ? -40.783 54.738 -0.830  1.00 63.25  ? 263 TYR A CG    1 
ATOM   2039 C  CD1   . TYR A  1  266 ? -40.398 55.328 0.366   1.00 61.17  ? 263 TYR A CD1   1 
ATOM   2040 C  CD2   . TYR A  1  266 ? -42.027 55.062 -1.349  1.00 63.10  ? 263 TYR A CD2   1 
ATOM   2041 C  CE1   . TYR A  1  266 ? -41.227 56.217 1.021   1.00 60.33  ? 263 TYR A CE1   1 
ATOM   2042 C  CE2   . TYR A  1  266 ? -42.861 55.951 -0.706  1.00 68.37  ? 263 TYR A CE2   1 
ATOM   2043 C  CZ    . TYR A  1  266 ? -42.458 56.524 0.480   1.00 68.33  ? 263 TYR A CZ    1 
ATOM   2044 O  OH    . TYR A  1  266 ? -43.289 57.409 1.125   1.00 70.77  ? 263 TYR A OH    1 
ATOM   2045 N  N     . THR A  1  267 ? -36.944 52.978 -2.303  1.00 51.62  ? 264 THR A N     1 
ATOM   2046 C  CA    . THR A  1  267 ? -36.060 51.886 -2.675  1.00 57.71  ? 264 THR A CA    1 
ATOM   2047 C  C     . THR A  1  267 ? -36.570 50.578 -2.081  1.00 56.62  ? 264 THR A C     1 
ATOM   2048 O  O     . THR A  1  267 ? -37.289 50.588 -1.075  1.00 58.18  ? 264 THR A O     1 
ATOM   2049 C  CB    . THR A  1  267 ? -34.637 52.155 -2.179  1.00 59.21  ? 264 THR A CB    1 
ATOM   2050 O  OG1   . THR A  1  267 ? -34.588 52.005 -0.755  1.00 66.71  ? 264 THR A OG1   1 
ATOM   2051 C  CG2   . THR A  1  267 ? -34.207 53.562 -2.542  1.00 51.25  ? 264 THR A CG2   1 
ATOM   2052 N  N     . PRO A  1  268 ? -36.234 49.436 -2.688  1.00 54.94  ? 265 PRO A N     1 
ATOM   2053 C  CA    . PRO A  1  268 ? -36.672 48.153 -2.110  1.00 54.04  ? 265 PRO A CA    1 
ATOM   2054 C  C     . PRO A  1  268 ? -36.200 47.944 -0.685  1.00 53.07  ? 265 PRO A C     1 
ATOM   2055 O  O     . PRO A  1  268 ? -36.910 47.317 0.111   1.00 52.97  ? 265 PRO A O     1 
ATOM   2056 C  CB    . PRO A  1  268 ? -36.065 47.117 -3.066  1.00 50.34  ? 265 PRO A CB    1 
ATOM   2057 C  CG    . PRO A  1  268 ? -35.899 47.847 -4.357  1.00 46.35  ? 265 PRO A CG    1 
ATOM   2058 C  CD    . PRO A  1  268 ? -35.545 49.254 -3.978  1.00 46.62  ? 265 PRO A CD    1 
ATOM   2059 N  N     . HIS A  1  269 ? -35.016 48.448 -0.336  1.00 54.48  ? 266 HIS A N     1 
ATOM   2060 C  CA    . HIS A  1  269 ? -34.563 48.383 1.047   1.00 62.54  ? 266 HIS A CA    1 
ATOM   2061 C  C     . HIS A  1  269 ? -35.516 49.134 1.968   1.00 61.63  ? 266 HIS A C     1 
ATOM   2062 O  O     . HIS A  1  269 ? -35.879 48.643 3.044   1.00 55.73  ? 266 HIS A O     1 
ATOM   2063 C  CB    . HIS A  1  269 ? -33.152 48.955 1.152   1.00 60.56  ? 266 HIS A CB    1 
ATOM   2064 C  CG    . HIS A  1  269 ? -32.608 48.972 2.544   1.00 67.35  ? 266 HIS A CG    1 
ATOM   2065 N  ND1   . HIS A  1  269 ? -32.917 49.960 3.451   1.00 71.50  ? 266 HIS A ND1   1 
ATOM   2066 C  CD2   . HIS A  1  269 ? -31.763 48.128 3.180   1.00 64.52  ? 266 HIS A CD2   1 
ATOM   2067 C  CE1   . HIS A  1  269 ? -32.286 49.721 4.587   1.00 62.76  ? 266 HIS A CE1   1 
ATOM   2068 N  NE2   . HIS A  1  269 ? -31.582 48.613 4.451   1.00 62.79  ? 266 HIS A NE2   1 
ATOM   2069 N  N     . GLN A  1  270 ? -35.941 50.329 1.551   1.00 58.65  ? 267 GLN A N     1 
ATOM   2070 C  CA    . GLN A  1  270 ? -36.823 51.139 2.384   1.00 56.90  ? 267 GLN A CA    1 
ATOM   2071 C  C     . GLN A  1  270 ? -38.172 50.462 2.584   1.00 57.27  ? 267 GLN A C     1 
ATOM   2072 O  O     . GLN A  1  270 ? -38.734 50.495 3.685   1.00 61.14  ? 267 GLN A O     1 
ATOM   2073 C  CB    . GLN A  1  270 ? -36.995 52.524 1.760   1.00 52.76  ? 267 GLN A CB    1 
ATOM   2074 C  CG    . GLN A  1  270 ? -35.742 53.375 1.847   1.00 52.63  ? 267 GLN A CG    1 
ATOM   2075 C  CD    . GLN A  1  270 ? -35.736 54.533 0.870   1.00 58.65  ? 267 GLN A CD    1 
ATOM   2076 O  OE1   . GLN A  1  270 ? -36.598 54.632 -0.002  1.00 64.89  ? 267 GLN A OE1   1 
ATOM   2077 N  NE2   . GLN A  1  270 ? -34.754 55.418 1.011   1.00 62.08  ? 267 GLN A NE2   1 
ATOM   2078 N  N     . LEU A  1  271 ? -38.706 49.836 1.535   1.00 49.07  ? 268 LEU A N     1 
ATOM   2079 C  CA    . LEU A  1  271 ? -39.977 49.136 1.675   1.00 50.94  ? 268 LEU A CA    1 
ATOM   2080 C  C     . LEU A  1  271 ? -39.856 47.928 2.595   1.00 61.65  ? 268 LEU A C     1 
ATOM   2081 O  O     . LEU A  1  271 ? -40.835 47.548 3.249   1.00 66.62  ? 268 LEU A O     1 
ATOM   2082 C  CB    . LEU A  1  271 ? -40.496 48.712 0.301   1.00 49.22  ? 268 LEU A CB    1 
ATOM   2083 C  CG    . LEU A  1  271 ? -40.848 49.872 -0.631  1.00 51.28  ? 268 LEU A CG    1 
ATOM   2084 C  CD1   . LEU A  1  271 ? -41.232 49.367 -2.013  1.00 48.27  ? 268 LEU A CD1   1 
ATOM   2085 C  CD2   . LEU A  1  271 ? -41.968 50.710 -0.033  1.00 52.03  ? 268 LEU A CD2   1 
ATOM   2086 N  N     . LEU A  1  272 ? -38.671 47.320 2.670   1.00 60.97  ? 269 LEU A N     1 
ATOM   2087 C  CA    . LEU A  1  272 ? -38.497 46.143 3.513   1.00 57.83  ? 269 LEU A CA    1 
ATOM   2088 C  C     . LEU A  1  272 ? -38.267 46.526 4.970   1.00 59.55  ? 269 LEU A C     1 
ATOM   2089 O  O     . LEU A  1  272 ? -38.892 45.958 5.872   1.00 54.56  ? 269 LEU A O     1 
ATOM   2090 C  CB    . LEU A  1  272 ? -37.334 45.290 3.001   1.00 57.84  ? 269 LEU A CB    1 
ATOM   2091 C  CG    . LEU A  1  272 ? -37.119 43.963 3.733   1.00 49.43  ? 269 LEU A CG    1 
ATOM   2092 C  CD1   . LEU A  1  272 ? -38.365 43.096 3.635   1.00 53.27  ? 269 LEU A CD1   1 
ATOM   2093 C  CD2   . LEU A  1  272 ? -35.906 43.226 3.184   1.00 49.08  ? 269 LEU A CD2   1 
ATOM   2094 N  N     . PHE A  1  273 ? -37.382 47.496 5.220   1.00 61.98  ? 270 PHE A N     1 
ATOM   2095 C  CA    . PHE A  1  273 ? -36.972 47.828 6.577   1.00 54.16  ? 270 PHE A CA    1 
ATOM   2096 C  C     . PHE A  1  273 ? -37.552 49.132 7.110   1.00 57.90  ? 270 PHE A C     1 
ATOM   2097 O  O     . PHE A  1  273 ? -37.557 49.325 8.330   1.00 62.05  ? 270 PHE A O     1 
ATOM   2098 C  CB    . PHE A  1  273 ? -35.440 47.909 6.672   1.00 55.54  ? 270 PHE A CB    1 
ATOM   2099 C  CG    . PHE A  1  273 ? -34.734 46.649 6.262   1.00 54.85  ? 270 PHE A CG    1 
ATOM   2100 C  CD1   . PHE A  1  273 ? -34.751 45.526 7.074   1.00 53.94  ? 270 PHE A CD1   1 
ATOM   2101 C  CD2   . PHE A  1  273 ? -34.037 46.592 5.068   1.00 58.74  ? 270 PHE A CD2   1 
ATOM   2102 C  CE1   . PHE A  1  273 ? -34.095 44.369 6.698   1.00 50.41  ? 270 PHE A CE1   1 
ATOM   2103 C  CE2   . PHE A  1  273 ? -33.379 45.440 4.685   1.00 54.96  ? 270 PHE A CE2   1 
ATOM   2104 C  CZ    . PHE A  1  273 ? -33.407 44.327 5.501   1.00 53.71  ? 270 PHE A CZ    1 
ATOM   2105 N  N     . GLY A  1  274 ? -38.026 50.027 6.244   1.00 66.79  ? 271 GLY A N     1 
ATOM   2106 C  CA    . GLY A  1  274 ? -38.525 51.308 6.694   1.00 66.08  ? 271 GLY A CA    1 
ATOM   2107 C  C     . GLY A  1  274 ? -37.466 52.314 7.092   1.00 66.53  ? 271 GLY A C     1 
ATOM   2108 O  O     . GLY A  1  274 ? -37.814 53.388 7.594   1.00 65.89  ? 271 GLY A O     1 
ATOM   2109 N  N     . ILE A  1  275 ? -36.189 52.011 6.883   1.00 64.24  ? 272 ILE A N     1 
ATOM   2110 C  CA    . ILE A  1  275 ? -35.101 52.903 7.272   1.00 62.71  ? 272 ILE A CA    1 
ATOM   2111 C  C     . ILE A  1  275 ? -33.845 52.452 6.551   1.00 61.08  ? 272 ILE A C     1 
ATOM   2112 O  O     . ILE A  1  275 ? -33.520 51.263 6.564   1.00 59.54  ? 272 ILE A O     1 
ATOM   2113 C  CB    . ILE A  1  275 ? -34.887 52.903 8.796   1.00 54.76  ? 272 ILE A CB    1 
ATOM   2114 C  CG1   . ILE A  1  275 ? -33.646 53.713 9.164   1.00 55.61  ? 272 ILE A CG1   1 
ATOM   2115 C  CG2   . ILE A  1  275 ? -34.767 51.468 9.331   1.00 54.39  ? 272 ILE A CG2   1 
ATOM   2116 C  CD1   . ILE A  1  275 ? -33.458 53.866 10.656  1.00 67.13  ? 272 ILE A CD1   1 
ATOM   2117 N  N     . ASP A  1  276 ? -33.124 53.389 5.932   1.00 57.14  ? 273 ASP A N     1 
ATOM   2118 C  CA    . ASP A  1  276 ? -31.883 53.049 5.250   1.00 51.87  ? 273 ASP A CA    1 
ATOM   2119 C  C     . ASP A  1  276 ? -30.822 52.584 6.244   1.00 54.64  ? 273 ASP A C     1 
ATOM   2120 O  O     . ASP A  1  276 ? -30.869 52.885 7.439   1.00 65.87  ? 273 ASP A O     1 
ATOM   2121 C  CB    . ASP A  1  276 ? -31.355 54.242 4.452   1.00 50.65  ? 273 ASP A CB    1 
ATOM   2122 C  CG    . ASP A  1  276 ? -32.138 54.484 3.178   1.00 62.94  ? 273 ASP A CG    1 
ATOM   2123 O  OD1   . ASP A  1  276 ? -32.752 53.524 2.667   1.00 63.13  ? 273 ASP A OD1   1 
ATOM   2124 O  OD2   . ASP A  1  276 ? -32.135 55.631 2.683   1.00 65.24  ? 273 ASP A OD2   1 
ATOM   2125 N  N     . SER A  1  277 ? -29.859 51.821 5.734   1.00 60.14  ? 274 SER A N     1 
ATOM   2126 C  CA    . SER A  1  277 ? -28.694 51.427 6.504   1.00 50.95  ? 274 SER A CA    1 
ATOM   2127 C  C     . SER A  1  277 ? -27.542 52.363 6.163   1.00 55.53  ? 274 SER A C     1 
ATOM   2128 O  O     . SER A  1  277 ? -27.720 53.405 5.521   1.00 54.14  ? 274 SER A O     1 
ATOM   2129 C  CB    . SER A  1  277 ? -28.343 49.960 6.241   1.00 55.91  ? 274 SER A CB    1 
ATOM   2130 O  OG    . SER A  1  277 ? -27.846 49.773 4.926   1.00 69.03  ? 274 SER A OG    1 
ATOM   2131 N  N     . ASN A  1  278 ? -26.333 51.995 6.587   1.00 61.87  ? 275 ASN A N     1 
ATOM   2132 C  CA    . ASN A  1  278 ? -25.163 52.850 6.404   1.00 60.51  ? 275 ASN A CA    1 
ATOM   2133 C  C     . ASN A  1  278 ? -24.644 52.767 4.966   1.00 58.26  ? 275 ASN A C     1 
ATOM   2134 O  O     . ASN A  1  278 ? -23.510 52.367 4.708   1.00 62.84  ? 275 ASN A O     1 
ATOM   2135 C  CB    . ASN A  1  278 ? -24.073 52.471 7.394   1.00 52.52  ? 275 ASN A CB    1 
ATOM   2136 C  CG    . ASN A  1  278 ? -22.901 53.434 7.384   1.00 56.72  ? 275 ASN A CG    1 
ATOM   2137 O  OD1   . ASN A  1  278 ? -23.027 54.590 6.971   1.00 59.09  ? 275 ASN A OD1   1 
ATOM   2138 N  ND2   . ASN A  1  278 ? -21.754 52.965 7.854   1.00 53.61  ? 275 ASN A ND2   1 
ATOM   2139 N  N     . THR A  1  279 ? -25.497 53.148 4.024   1.00 52.08  ? 276 THR A N     1 
ATOM   2140 C  CA    . THR A  1  279 ? -25.146 53.227 2.615   1.00 54.54  ? 276 THR A CA    1 
ATOM   2141 C  C     . THR A  1  279 ? -25.036 54.683 2.180   1.00 60.63  ? 276 THR A C     1 
ATOM   2142 O  O     . THR A  1  279 ? -25.525 55.585 2.868   1.00 77.59  ? 276 THR A O     1 
ATOM   2143 C  CB    . THR A  1  279 ? -26.187 52.500 1.750   1.00 55.00  ? 276 THR A CB    1 
ATOM   2144 O  OG1   . THR A  1  279 ? -27.505 52.814 2.217   1.00 65.97  ? 276 THR A OG1   1 
ATOM   2145 C  CG2   . THR A  1  279 ? -25.970 50.993 1.804   1.00 49.67  ? 276 THR A CG2   1 
ATOM   2146 N  N     . PRO A  1  280 ? -24.360 54.954 1.061   1.00 55.77  ? 277 PRO A N     1 
ATOM   2147 C  CA    . PRO A  1  280 ? -24.228 56.343 0.599   1.00 56.26  ? 277 PRO A CA    1 
ATOM   2148 C  C     . PRO A  1  280 ? -25.584 56.993 0.373   1.00 55.06  ? 277 PRO A C     1 
ATOM   2149 O  O     . PRO A  1  280 ? -26.515 56.369 -0.143  1.00 51.77  ? 277 PRO A O     1 
ATOM   2150 C  CB    . PRO A  1  280 ? -23.445 56.204 -0.710  1.00 60.16  ? 277 PRO A CB    1 
ATOM   2151 C  CG    . PRO A  1  280 ? -22.664 54.954 -0.534  1.00 54.99  ? 277 PRO A CG    1 
ATOM   2152 C  CD    . PRO A  1  280 ? -23.531 54.032 0.265   1.00 52.76  ? 277 PRO A CD    1 
ATOM   2153 N  N     . PHE A  1  281 ? -25.686 58.257 0.789   1.00 51.96  ? 278 PHE A N     1 
ATOM   2154 C  CA    . PHE A  1  281 ? -26.886 59.073 0.594   1.00 52.02  ? 278 PHE A CA    1 
ATOM   2155 C  C     . PHE A  1  281 ? -28.090 58.488 1.326   1.00 56.62  ? 278 PHE A C     1 
ATOM   2156 O  O     . PHE A  1  281 ? -29.211 58.480 0.813   1.00 68.61  ? 278 PHE A O     1 
ATOM   2157 C  CB    . PHE A  1  281 ? -27.187 59.264 -0.894  1.00 53.83  ? 278 PHE A CB    1 
ATOM   2158 C  CG    . PHE A  1  281 ? -26.083 59.946 -1.647  1.00 55.01  ? 278 PHE A CG    1 
ATOM   2159 C  CD1   . PHE A  1  281 ? -25.094 59.206 -2.273  1.00 55.80  ? 278 PHE A CD1   1 
ATOM   2160 C  CD2   . PHE A  1  281 ? -26.028 61.328 -1.721  1.00 55.32  ? 278 PHE A CD2   1 
ATOM   2161 C  CE1   . PHE A  1  281 ? -24.074 59.831 -2.964  1.00 54.01  ? 278 PHE A CE1   1 
ATOM   2162 C  CE2   . PHE A  1  281 ? -25.010 61.959 -2.411  1.00 53.51  ? 278 PHE A CE2   1 
ATOM   2163 C  CZ    . PHE A  1  281 ? -24.031 61.209 -3.034  1.00 54.98  ? 278 PHE A CZ    1 
ATOM   2164 N  N     . ALA A  1  282 ? -27.858 58.007 2.545   1.00 52.19  ? 279 ALA A N     1 
ATOM   2165 C  CA    . ALA A  1  282 ? -28.935 57.440 3.344   1.00 56.90  ? 279 ALA A CA    1 
ATOM   2166 C  C     . ALA A  1  282 ? -29.958 58.509 3.705   1.00 63.56  ? 279 ALA A C     1 
ATOM   2167 O  O     . ALA A  1  282 ? -29.606 59.588 4.192   1.00 63.61  ? 279 ALA A O     1 
ATOM   2168 C  CB    . ALA A  1  282 ? -28.367 56.800 4.610   1.00 54.94  ? 279 ALA A CB    1 
ATOM   2169 N  N     . ASN A  1  283 ? -31.231 58.205 3.459   1.00 62.50  ? 280 ASN A N     1 
ATOM   2170 C  CA    . ASN A  1  283 ? -32.311 59.113 3.822   1.00 68.04  ? 280 ASN A CA    1 
ATOM   2171 C  C     . ASN A  1  283 ? -32.446 59.176 5.341   1.00 68.57  ? 280 ASN A C     1 
ATOM   2172 O  O     . ASN A  1  283 ? -32.520 58.144 6.012   1.00 68.45  ? 280 ASN A O     1 
ATOM   2173 C  CB    . ASN A  1  283 ? -33.618 58.651 3.179   1.00 70.23  ? 280 ASN A CB    1 
ATOM   2174 C  CG    . ASN A  1  283 ? -34.767 59.603 3.439   1.00 77.88  ? 280 ASN A CG    1 
ATOM   2175 O  OD1   . ASN A  1  283 ? -35.512 59.442 4.404   1.00 72.24  ? 280 ASN A OD1   1 
ATOM   2176 N  ND2   . ASN A  1  283 ? -34.921 60.598 2.573   1.00 82.82  ? 280 ASN A ND2   1 
ATOM   2177 N  N     . GLN A  1  284 ? -32.480 60.396 5.883   1.00 76.13  ? 281 GLN A N     1 
ATOM   2178 C  CA    A GLN A  1  284 ? -32.488 60.632 7.322   0.59 81.69  ? 281 GLN A CA    1 
ATOM   2179 C  CA    B GLN A  1  284 ? -32.497 60.611 7.327   0.41 81.52  ? 281 GLN A CA    1 
ATOM   2180 C  C     . GLN A  1  284 ? -33.768 61.324 7.782   1.00 81.74  ? 281 GLN A C     1 
ATOM   2181 O  O     . GLN A  1  284 ? -33.762 62.034 8.789   1.00 85.98  ? 281 GLN A O     1 
ATOM   2182 C  CB    A GLN A  1  284 ? -31.276 61.466 7.738   0.59 83.33  ? 281 GLN A CB    1 
ATOM   2183 C  CB    B GLN A  1  284 ? -31.260 61.397 7.765   0.41 83.43  ? 281 GLN A CB    1 
ATOM   2184 C  CG    A GLN A  1  284 ? -29.929 60.799 7.539   0.59 83.55  ? 281 GLN A CG    1 
ATOM   2185 C  CG    B GLN A  1  284 ? -29.931 60.735 7.430   0.41 83.29  ? 281 GLN A CG    1 
ATOM   2186 C  CD    A GLN A  1  284 ? -28.779 61.771 7.731   0.59 86.41  ? 281 GLN A CD    1 
ATOM   2187 C  CD    B GLN A  1  284 ? -29.638 59.536 8.308   0.41 81.19  ? 281 GLN A CD    1 
ATOM   2188 O  OE1   A GLN A  1  284 ? -28.953 62.985 7.621   0.59 78.66  ? 281 GLN A OE1   1 
ATOM   2189 O  OE1   B GLN A  1  284 ? -29.769 58.390 7.877   0.41 81.05  ? 281 GLN A OE1   1 
ATOM   2190 N  NE2   A GLN A  1  284 ? -27.597 61.240 8.020   0.59 94.13  ? 281 GLN A NE2   1 
ATOM   2191 N  NE2   B GLN A  1  284 ? -29.234 59.793 9.547   0.41 75.64  ? 281 GLN A NE2   1 
ATOM   2192 N  N     . ASP A  1  285 ? -34.874 61.135 7.058   1.00 76.79  ? 282 ASP A N     1 
ATOM   2193 C  CA    . ASP A  1  285 ? -36.084 61.894 7.366   1.00 82.25  ? 282 ASP A CA    1 
ATOM   2194 C  C     . ASP A  1  285 ? -36.720 61.485 8.691   1.00 84.24  ? 282 ASP A C     1 
ATOM   2195 O  O     . ASP A  1  285 ? -37.339 62.322 9.357   1.00 85.80  ? 282 ASP A O     1 
ATOM   2196 C  CB    . ASP A  1  285 ? -37.099 61.755 6.229   1.00 85.25  ? 282 ASP A CB    1 
ATOM   2197 C  CG    . ASP A  1  285 ? -36.759 62.628 5.035   1.00 82.33  ? 282 ASP A CG    1 
ATOM   2198 O  OD1   . ASP A  1  285 ? -36.034 63.628 5.220   1.00 73.59  ? 282 ASP A OD1   1 
ATOM   2199 O  OD2   . ASP A  1  285 ? -37.219 62.320 3.915   1.00 88.61  ? 282 ASP A OD2   1 
ATOM   2200 N  N     . THR A  1  286 ? -36.587 60.222 9.095   1.00 75.77  ? 283 THR A N     1 
ATOM   2201 C  CA    . THR A  1  286 ? -37.268 59.711 10.280  1.00 73.66  ? 283 THR A CA    1 
ATOM   2202 C  C     . THR A  1  286 ? -36.347 59.608 11.493  1.00 81.15  ? 283 THR A C     1 
ATOM   2203 O  O     . THR A  1  286 ? -36.596 58.793 12.389  1.00 84.89  ? 283 THR A O     1 
ATOM   2204 C  CB    . THR A  1  286 ? -37.896 58.349 9.985   1.00 70.41  ? 283 THR A CB    1 
ATOM   2205 O  OG1   . THR A  1  286 ? -36.919 57.490 9.383   1.00 68.69  ? 283 THR A OG1   1 
ATOM   2206 C  CG2   . THR A  1  286 ? -39.073 58.497 9.045   1.00 61.88  ? 283 THR A CG2   1 
ATOM   2207 N  N     . LEU A  1  287 ? -35.301 60.435 11.549  1.00 80.46  ? 284 LEU A N     1 
ATOM   2208 C  CA    . LEU A  1  287 ? -34.299 60.301 12.602  1.00 82.26  ? 284 LEU A CA    1 
ATOM   2209 C  C     . LEU A  1  287 ? -34.878 60.580 13.985  1.00 83.44  ? 284 LEU A C     1 
ATOM   2210 O  O     . LEU A  1  287 ? -34.400 60.024 14.980  1.00 83.97  ? 284 LEU A O     1 
ATOM   2211 C  CB    . LEU A  1  287 ? -33.123 61.236 12.312  1.00 87.24  ? 284 LEU A CB    1 
ATOM   2212 C  CG    . LEU A  1  287 ? -31.743 60.850 12.842  1.00 94.28  ? 284 LEU A CG    1 
ATOM   2213 C  CD1   . LEU A  1  287 ? -31.424 59.403 12.505  1.00 96.24  ? 284 LEU A CD1   1 
ATOM   2214 C  CD2   . LEU A  1  287 ? -30.692 61.776 12.253  1.00 95.53  ? 284 LEU A CD2   1 
ATOM   2215 N  N     . ASP A  1  288 ? -35.908 61.423 14.070  1.00 80.86  ? 285 ASP A N     1 
ATOM   2216 C  CA    . ASP A  1  288 ? -36.476 61.817 15.353  1.00 79.77  ? 285 ASP A CA    1 
ATOM   2217 C  C     . ASP A  1  288 ? -37.653 60.954 15.790  1.00 81.54  ? 285 ASP A C     1 
ATOM   2218 O  O     . ASP A  1  288 ? -38.052 61.028 16.957  1.00 85.58  ? 285 ASP A O     1 
ATOM   2219 C  CB    . ASP A  1  288 ? -36.914 63.283 15.309  1.00 82.48  ? 285 ASP A CB    1 
ATOM   2220 C  CG    . ASP A  1  288 ? -35.741 64.237 15.247  1.00 98.04  ? 285 ASP A CG    1 
ATOM   2221 O  OD1   . ASP A  1  288 ? -34.680 63.909 15.819  1.00 102.98 ? 285 ASP A OD1   1 
ATOM   2222 O  OD2   . ASP A  1  288 ? -35.876 65.313 14.628  1.00 102.28 ? 285 ASP A OD2   1 
ATOM   2223 N  N     . LEU A  1  289 ? -38.222 60.155 14.895  1.00 75.57  ? 286 LEU A N     1 
ATOM   2224 C  CA    . LEU A  1  289 ? -39.283 59.240 15.280  1.00 73.81  ? 286 LEU A CA    1 
ATOM   2225 C  C     . LEU A  1  289 ? -38.702 58.049 16.029  1.00 70.97  ? 286 LEU A C     1 
ATOM   2226 O  O     . LEU A  1  289 ? -37.543 57.677 15.836  1.00 77.51  ? 286 LEU A O     1 
ATOM   2227 C  CB    . LEU A  1  289 ? -40.049 58.751 14.049  1.00 71.16  ? 286 LEU A CB    1 
ATOM   2228 C  CG    . LEU A  1  289 ? -40.748 59.824 13.215  1.00 70.23  ? 286 LEU A CG    1 
ATOM   2229 C  CD1   . LEU A  1  289 ? -41.348 59.223 11.957  1.00 67.04  ? 286 LEU A CD1   1 
ATOM   2230 C  CD2   . LEU A  1  289 ? -41.820 60.519 14.035  1.00 67.17  ? 286 LEU A CD2   1 
ATOM   2231 N  N     . THR A  1  290 ? -39.511 57.460 16.904  1.00 77.62  ? 287 THR A N     1 
ATOM   2232 C  CA    . THR A  1  290 ? -39.140 56.174 17.467  1.00 77.06  ? 287 THR A CA    1 
ATOM   2233 C  C     . THR A  1  290 ? -39.283 55.093 16.400  1.00 74.46  ? 287 THR A C     1 
ATOM   2234 O  O     . THR A  1  290 ? -39.835 55.317 15.319  1.00 78.52  ? 287 THR A O     1 
ATOM   2235 C  CB    . THR A  1  290 ? -40.003 55.839 18.683  1.00 81.01  ? 287 THR A CB    1 
ATOM   2236 O  OG1   . THR A  1  290 ? -41.380 55.754 18.290  1.00 91.15  ? 287 THR A OG1   1 
ATOM   2237 C  CG2   . THR A  1  290 ? -39.846 56.901 19.760  1.00 69.18  ? 287 THR A CG2   1 
ATOM   2238 N  N     . ARG A  1  291 ? -38.767 53.902 16.706  1.00 68.56  ? 288 ARG A N     1 
ATOM   2239 C  CA    . ARG A  1  291 ? -38.916 52.793 15.771  1.00 69.38  ? 288 ARG A CA    1 
ATOM   2240 C  C     . ARG A  1  291 ? -40.385 52.449 15.560  1.00 76.74  ? 288 ARG A C     1 
ATOM   2241 O  O     . ARG A  1  291 ? -40.804 52.143 14.437  1.00 78.96  ? 288 ARG A O     1 
ATOM   2242 C  CB    . ARG A  1  291 ? -38.143 51.573 16.267  1.00 63.51  ? 288 ARG A CB    1 
ATOM   2243 C  CG    . ARG A  1  291 ? -38.217 50.373 15.336  1.00 65.05  ? 288 ARG A CG    1 
ATOM   2244 C  CD    . ARG A  1  291 ? -37.824 50.749 13.916  1.00 63.13  ? 288 ARG A CD    1 
ATOM   2245 N  NE    . ARG A  1  291 ? -37.775 49.585 13.038  1.00 66.50  ? 288 ARG A NE    1 
ATOM   2246 C  CZ    . ARG A  1  291 ? -37.570 49.648 11.726  1.00 65.12  ? 288 ARG A CZ    1 
ATOM   2247 N  NH1   . ARG A  1  291 ? -37.402 50.823 11.135  1.00 64.37  ? 288 ARG A NH1   1 
ATOM   2248 N  NH2   . ARG A  1  291 ? -37.540 48.536 11.004  1.00 58.03  ? 288 ARG A NH2   1 
ATOM   2249 N  N     . GLU A  1  292 ? -41.188 52.510 16.626  1.00 74.53  ? 289 GLU A N     1 
ATOM   2250 C  CA    . GLU A  1  292 ? -42.612 52.216 16.496  1.00 77.40  ? 289 GLU A CA    1 
ATOM   2251 C  C     . GLU A  1  292 ? -43.316 53.237 15.612  1.00 79.36  ? 289 GLU A C     1 
ATOM   2252 O  O     . GLU A  1  292 ? -44.162 52.873 14.788  1.00 83.69  ? 289 GLU A O     1 
ATOM   2253 C  CB    . GLU A  1  292 ? -43.266 52.162 17.874  1.00 89.08  ? 289 GLU A CB    1 
ATOM   2254 C  CG    . GLU A  1  292 ? -42.839 50.970 18.710  1.00 100.21 ? 289 GLU A CG    1 
ATOM   2255 C  CD    . GLU A  1  292 ? -43.911 50.543 19.690  1.00 105.98 ? 289 GLU A CD    1 
ATOM   2256 O  OE1   . GLU A  1  292 ? -44.973 51.199 19.729  1.00 105.36 ? 289 GLU A OE1   1 
ATOM   2257 O  OE2   . GLU A  1  292 ? -43.697 49.550 20.415  1.00 106.38 ? 289 GLU A OE2   1 
ATOM   2258 N  N     . GLU A  1  293 ? -42.995 54.522 15.780  1.00 76.54  ? 290 GLU A N     1 
ATOM   2259 C  CA    . GLU A  1  293 ? -43.546 55.539 14.891  1.00 72.68  ? 290 GLU A CA    1 
ATOM   2260 C  C     . GLU A  1  293 ? -43.048 55.347 13.464  1.00 73.69  ? 290 GLU A C     1 
ATOM   2261 O  O     . GLU A  1  293 ? -43.782 55.612 12.504  1.00 73.69  ? 290 GLU A O     1 
ATOM   2262 C  CB    . GLU A  1  293 ? -43.192 56.932 15.417  1.00 65.50  ? 290 GLU A CB    1 
ATOM   2263 C  CG    . GLU A  1  293 ? -43.826 57.235 16.772  1.00 74.95  ? 290 GLU A CG    1 
ATOM   2264 C  CD    . GLU A  1  293 ? -43.166 58.393 17.496  1.00 80.46  ? 290 GLU A CD    1 
ATOM   2265 O  OE1   . GLU A  1  293 ? -42.010 58.728 17.165  1.00 78.78  ? 290 GLU A OE1   1 
ATOM   2266 O  OE2   . GLU A  1  293 ? -43.808 58.967 18.401  1.00 85.68  ? 290 GLU A OE2   1 
ATOM   2267 N  N     . GLU A  1  294 ? -41.813 54.863 13.308  1.00 77.09  ? 291 GLU A N     1 
ATOM   2268 C  CA    . GLU A  1  294 ? -41.275 54.581 11.982  1.00 68.76  ? 291 GLU A CA    1 
ATOM   2269 C  C     . GLU A  1  294 ? -42.021 53.430 11.316  1.00 70.29  ? 291 GLU A C     1 
ATOM   2270 O  O     . GLU A  1  294 ? -42.369 53.508 10.132  1.00 67.97  ? 291 GLU A O     1 
ATOM   2271 C  CB    . GLU A  1  294 ? -39.785 54.258 12.091  1.00 64.70  ? 291 GLU A CB    1 
ATOM   2272 C  CG    . GLU A  1  294 ? -38.907 54.883 11.024  1.00 65.23  ? 291 GLU A CG    1 
ATOM   2273 C  CD    . GLU A  1  294 ? -37.437 54.593 11.259  1.00 71.52  ? 291 GLU A CD    1 
ATOM   2274 O  OE1   . GLU A  1  294 ? -37.104 53.430 11.571  1.00 70.92  ? 291 GLU A OE1   1 
ATOM   2275 O  OE2   . GLU A  1  294 ? -36.617 55.528 11.147  1.00 74.46  ? 291 GLU A OE2   1 
ATOM   2276 N  N     . LEU A  1  295 ? -42.271 52.350 12.063  1.00 73.58  ? 292 LEU A N     1 
ATOM   2277 C  CA    . LEU A  1  295 ? -42.997 51.211 11.512  1.00 66.40  ? 292 LEU A CA    1 
ATOM   2278 C  C     . LEU A  1  295 ? -44.454 51.555 11.236  1.00 67.44  ? 292 LEU A C     1 
ATOM   2279 O  O     . LEU A  1  295 ? -45.073 50.961 10.346  1.00 72.94  ? 292 LEU A O     1 
ATOM   2280 C  CB    . LEU A  1  295 ? -42.913 50.020 12.464  1.00 67.40  ? 292 LEU A CB    1 
ATOM   2281 C  CG    . LEU A  1  295 ? -41.521 49.446 12.733  1.00 73.40  ? 292 LEU A CG    1 
ATOM   2282 C  CD1   . LEU A  1  295 ? -41.584 48.397 13.828  1.00 70.99  ? 292 LEU A CD1   1 
ATOM   2283 C  CD2   . LEU A  1  295 ? -40.933 48.856 11.465  1.00 56.36  ? 292 LEU A CD2   1 
ATOM   2284 N  N     . SER A  1  296 ? -45.021 52.489 12.001  1.00 67.17  ? 293 SER A N     1 
ATOM   2285 C  CA    . SER A  1  296 ? -46.371 52.961 11.717  1.00 63.65  ? 293 SER A CA    1 
ATOM   2286 C  C     . SER A  1  296 ? -46.421 53.676 10.373  1.00 63.10  ? 293 SER A C     1 
ATOM   2287 O  O     . SER A  1  296 ? -47.326 53.442 9.565   1.00 63.28  ? 293 SER A O     1 
ATOM   2288 C  CB    . SER A  1  296 ? -46.851 53.880 12.841  1.00 64.40  ? 293 SER A CB    1 
ATOM   2289 O  OG    . SER A  1  296 ? -48.233 54.167 12.718  1.00 65.52  ? 293 SER A OG    1 
ATOM   2290 N  N     . LEU A  1  297 ? -45.443 54.550 10.116  1.00 64.00  ? 294 LEU A N     1 
ATOM   2291 C  CA    . LEU A  1  297 ? -45.347 55.208 8.817   1.00 66.82  ? 294 LEU A CA    1 
ATOM   2292 C  C     . LEU A  1  297 ? -45.051 54.214 7.702   1.00 73.82  ? 294 LEU A C     1 
ATOM   2293 O  O     . LEU A  1  297 ? -45.434 54.445 6.550   1.00 69.71  ? 294 LEU A O     1 
ATOM   2294 C  CB    . LEU A  1  297 ? -44.267 56.290 8.855   1.00 63.22  ? 294 LEU A CB    1 
ATOM   2295 C  CG    . LEU A  1  297 ? -44.105 57.122 7.582   1.00 66.86  ? 294 LEU A CG    1 
ATOM   2296 C  CD1   . LEU A  1  297 ? -45.313 58.025 7.384   1.00 80.29  ? 294 LEU A CD1   1 
ATOM   2297 C  CD2   . LEU A  1  297 ? -42.818 57.929 7.620   1.00 65.17  ? 294 LEU A CD2   1 
ATOM   2298 N  N     . LEU A  1  298 ? -44.374 53.107 8.021   1.00 68.24  ? 295 LEU A N     1 
ATOM   2299 C  CA    . LEU A  1  298 ? -44.038 52.124 6.995   1.00 67.32  ? 295 LEU A CA    1 
ATOM   2300 C  C     . LEU A  1  298 ? -45.268 51.350 6.538   1.00 74.41  ? 295 LEU A C     1 
ATOM   2301 O  O     . LEU A  1  298 ? -45.436 51.095 5.339   1.00 75.92  ? 295 LEU A O     1 
ATOM   2302 C  CB    . LEU A  1  298 ? -42.970 51.165 7.518   1.00 64.02  ? 295 LEU A CB    1 
ATOM   2303 C  CG    . LEU A  1  298 ? -42.557 50.058 6.549   1.00 63.04  ? 295 LEU A CG    1 
ATOM   2304 C  CD1   . LEU A  1  298 ? -42.002 50.655 5.264   1.00 59.74  ? 295 LEU A CD1   1 
ATOM   2305 C  CD2   . LEU A  1  298 ? -41.544 49.136 7.203   1.00 63.91  ? 295 LEU A CD2   1 
ATOM   2306 N  N     . GLN A  1  299 ? -46.135 50.960 7.476   1.00 69.05  ? 296 GLN A N     1 
ATOM   2307 C  CA    . GLN A  1  299 ? -47.345 50.234 7.104   1.00 71.28  ? 296 GLN A CA    1 
ATOM   2308 C  C     . GLN A  1  299 ? -48.275 51.090 6.253   1.00 75.22  ? 296 GLN A C     1 
ATOM   2309 O  O     . GLN A  1  299 ? -48.978 50.564 5.382   1.00 73.46  ? 296 GLN A O     1 
ATOM   2310 C  CB    . GLN A  1  299 ? -48.060 49.734 8.360   1.00 73.13  ? 296 GLN A CB    1 
ATOM   2311 C  CG    . GLN A  1  299 ? -47.319 48.602 9.060   1.00 89.76  ? 296 GLN A CG    1 
ATOM   2312 C  CD    . GLN A  1  299 ? -47.688 48.459 10.523  1.00 101.42 ? 296 GLN A CD    1 
ATOM   2313 O  OE1   . GLN A  1  299 ? -46.828 48.207 11.367  1.00 102.76 ? 296 GLN A OE1   1 
ATOM   2314 N  NE2   . GLN A  1  299 ? -48.971 48.611 10.832  1.00 99.68  ? 296 GLN A NE2   1 
ATOM   2315 N  N     . GLU A  1  300 ? -48.287 52.406 6.479   1.00 70.93  ? 297 GLU A N     1 
ATOM   2316 C  CA    . GLU A  1  300 ? -49.106 53.288 5.655   1.00 78.88  ? 297 GLU A CA    1 
ATOM   2317 C  C     . GLU A  1  300 ? -48.523 53.437 4.254   1.00 75.13  ? 297 GLU A C     1 
ATOM   2318 O  O     . GLU A  1  300 ? -49.266 53.453 3.265   1.00 76.80  ? 297 GLU A O     1 
ATOM   2319 C  CB    . GLU A  1  300 ? -49.247 54.652 6.332   1.00 78.13  ? 297 GLU A CB    1 
ATOM   2320 C  CG    . GLU A  1  300 ? -49.979 55.693 5.502   1.00 95.03  ? 297 GLU A CG    1 
ATOM   2321 C  CD    . GLU A  1  300 ? -51.383 55.263 5.126   1.00 112.38 ? 297 GLU A CD    1 
ATOM   2322 O  OE1   . GLU A  1  300 ? -52.052 54.600 5.947   1.00 117.36 ? 297 GLU A OE1   1 
ATOM   2323 O  OE2   . GLU A  1  300 ? -51.816 55.588 4.001   1.00 117.78 ? 297 GLU A OE2   1 
ATOM   2324 N  N     . ILE A  1  301 ? -47.196 53.548 4.153   1.00 65.18  ? 298 ILE A N     1 
ATOM   2325 C  CA    . ILE A  1  301 ? -46.548 53.667 2.848   1.00 67.05  ? 298 ILE A CA    1 
ATOM   2326 C  C     . ILE A  1  301 ? -46.762 52.403 2.026   1.00 66.86  ? 298 ILE A C     1 
ATOM   2327 O  O     . ILE A  1  301 ? -47.010 52.467 0.816   1.00 62.67  ? 298 ILE A O     1 
ATOM   2328 C  CB    . ILE A  1  301 ? -45.051 53.981 3.020   1.00 66.39  ? 298 ILE A CB    1 
ATOM   2329 C  CG1   . ILE A  1  301 ? -44.853 55.421 3.497   1.00 73.70  ? 298 ILE A CG1   1 
ATOM   2330 C  CG2   . ILE A  1  301 ? -44.290 53.726 1.719   1.00 60.00  ? 298 ILE A CG2   1 
ATOM   2331 C  CD1   . ILE A  1  301 ? -43.429 55.738 3.892   1.00 75.42  ? 298 ILE A CD1   1 
ATOM   2332 N  N     . ARG A  1  302 ? -46.675 51.235 2.670   1.00 66.89  ? 299 ARG A N     1 
ATOM   2333 C  CA    . ARG A  1  302 ? -46.802 49.972 1.948   1.00 62.69  ? 299 ARG A CA    1 
ATOM   2334 C  C     . ARG A  1  302 ? -48.182 49.789 1.330   1.00 68.80  ? 299 ARG A C     1 
ATOM   2335 O  O     . ARG A  1  302 ? -48.316 49.067 0.336   1.00 78.41  ? 299 ARG A O     1 
ATOM   2336 C  CB    . ARG A  1  302 ? -46.502 48.799 2.879   1.00 61.64  ? 299 ARG A CB    1 
ATOM   2337 C  CG    . ARG A  1  302 ? -45.033 48.574 3.168   1.00 57.62  ? 299 ARG A CG    1 
ATOM   2338 C  CD    . ARG A  1  302 ? -44.870 47.458 4.181   1.00 60.80  ? 299 ARG A CD    1 
ATOM   2339 N  NE    . ARG A  1  302 ? -43.475 47.118 4.438   1.00 62.94  ? 299 ARG A NE    1 
ATOM   2340 C  CZ    . ARG A  1  302 ? -43.060 46.476 5.526   1.00 65.51  ? 299 ARG A CZ    1 
ATOM   2341 N  NH1   . ARG A  1  302 ? -43.935 46.122 6.458   1.00 69.37  ? 299 ARG A NH1   1 
ATOM   2342 N  NH2   . ARG A  1  302 ? -41.775 46.197 5.690   1.00 56.55  ? 299 ARG A NH2   1 
ATOM   2343 N  N     . THR A  1  303 ? -49.216 50.406 1.903   1.00 60.50  ? 300 THR A N     1 
ATOM   2344 C  CA    . THR A  1  303 ? -50.579 50.256 1.409   1.00 68.31  ? 300 THR A CA    1 
ATOM   2345 C  C     . THR A  1  303 ? -51.008 51.372 0.465   1.00 72.46  ? 300 THR A C     1 
ATOM   2346 O  O     . THR A  1  303 ? -52.104 51.294 -0.102  1.00 78.13  ? 300 THR A O     1 
ATOM   2347 C  CB    . THR A  1  303 ? -51.559 50.183 2.587   1.00 69.93  ? 300 THR A CB    1 
ATOM   2348 O  OG1   . THR A  1  303 ? -51.428 51.361 3.391   1.00 71.31  ? 300 THR A OG1   1 
ATOM   2349 C  CG2   . THR A  1  303 ? -51.266 48.956 3.440   1.00 73.60  ? 300 THR A CG2   1 
ATOM   2350 N  N     . SER A  1  304 ? -50.179 52.399 0.274   1.00 62.97  ? 301 SER A N     1 
ATOM   2351 C  CA    . SER A  1  304 ? -50.512 53.523 -0.591  1.00 65.16  ? 301 SER A CA    1 
ATOM   2352 C  C     . SER A  1  304 ? -49.653 53.560 -1.849  1.00 70.20  ? 301 SER A C     1 
ATOM   2353 O  O     . SER A  1  304 ? -49.591 54.595 -2.521  1.00 66.04  ? 301 SER A O     1 
ATOM   2354 C  CB    . SER A  1  304 ? -50.377 54.841 0.171   1.00 68.03  ? 301 SER A CB    1 
ATOM   2355 O  OG    . SER A  1  304 ? -49.015 55.209 0.315   1.00 78.73  ? 301 SER A OG    1 
ATOM   2356 N  N     . LEU A  1  305 ? -48.985 52.459 -2.178  1.00 67.11  ? 302 LEU A N     1 
ATOM   2357 C  CA    . LEU A  1  305 ? -48.120 52.439 -3.347  1.00 64.99  ? 302 LEU A CA    1 
ATOM   2358 C  C     . LEU A  1  305 ? -48.941 52.472 -4.631  1.00 67.70  ? 302 LEU A C     1 
ATOM   2359 O  O     . LEU A  1  305 ? -50.068 51.974 -4.691  1.00 69.32  ? 302 LEU A O     1 
ATOM   2360 C  CB    . LEU A  1  305 ? -47.228 51.197 -3.332  1.00 65.21  ? 302 LEU A CB    1 
ATOM   2361 C  CG    . LEU A  1  305 ? -46.177 51.107 -2.224  1.00 58.02  ? 302 LEU A CG    1 
ATOM   2362 C  CD1   . LEU A  1  305 ? -45.342 49.846 -2.395  1.00 56.81  ? 302 LEU A CD1   1 
ATOM   2363 C  CD2   . LEU A  1  305 ? -45.295 52.348 -2.210  1.00 58.26  ? 302 LEU A CD2   1 
ATOM   2364 N  N     . TYR A  1  306 ? -48.357 53.077 -5.664  1.00 68.00  ? 303 TYR A N     1 
ATOM   2365 C  CA    . TYR A  1  306 ? -49.004 53.147 -6.966  1.00 66.42  ? 303 TYR A CA    1 
ATOM   2366 C  C     . TYR A  1  306 ? -49.246 51.748 -7.517  1.00 68.24  ? 303 TYR A C     1 
ATOM   2367 O  O     . TYR A  1  306 ? -48.397 50.860 -7.397  1.00 74.02  ? 303 TYR A O     1 
ATOM   2368 C  CB    . TYR A  1  306 ? -48.140 53.954 -7.939  1.00 66.32  ? 303 TYR A CB    1 
ATOM   2369 C  CG    . TYR A  1  306 ? -48.508 53.763 -9.393  1.00 76.38  ? 303 TYR A CG    1 
ATOM   2370 C  CD1   . TYR A  1  306 ? -49.575 54.452 -9.950  1.00 86.24  ? 303 TYR A CD1   1 
ATOM   2371 C  CD2   . TYR A  1  306 ? -47.788 52.897 -10.208 1.00 73.19  ? 303 TYR A CD2   1 
ATOM   2372 C  CE1   . TYR A  1  306 ? -49.918 54.282 -11.273 1.00 86.91  ? 303 TYR A CE1   1 
ATOM   2373 C  CE2   . TYR A  1  306 ? -48.125 52.720 -11.532 1.00 79.19  ? 303 TYR A CE2   1 
ATOM   2374 C  CZ    . TYR A  1  306 ? -49.191 53.416 -12.059 1.00 88.07  ? 303 TYR A CZ    1 
ATOM   2375 O  OH    . TYR A  1  306 ? -49.533 53.247 -13.379 1.00 97.58  ? 303 TYR A OH    1 
ATOM   2376 N  N     . HIS A  1  307 ? -50.417 51.549 -8.125  1.00 64.90  ? 304 HIS A N     1 
ATOM   2377 C  CA    . HIS A  1  307 ? -50.716 50.284 -8.776  1.00 74.93  ? 304 HIS A CA    1 
ATOM   2378 C  C     . HIS A  1  307 ? -51.321 50.536 -10.153 1.00 68.42  ? 304 HIS A C     1 
ATOM   2379 O  O     . HIS A  1  307 ? -52.326 51.260 -10.270 1.00 73.82  ? 304 HIS A O     1 
ATOM   2380 C  CB    . HIS A  1  307 ? -51.659 49.418 -7.937  1.00 80.69  ? 304 HIS A CB    1 
ATOM   2381 C  CG    . HIS A  1  307 ? -51.678 47.986 -8.367  1.00 83.56  ? 304 HIS A CG    1 
ATOM   2382 N  ND1   . HIS A  1  307 ? -50.575 47.165 -8.254  1.00 76.54  ? 304 HIS A ND1   1 
ATOM   2383 C  CD2   . HIS A  1  307 ? -52.651 47.236 -8.937  1.00 81.09  ? 304 HIS A CD2   1 
ATOM   2384 C  CE1   . HIS A  1  307 ? -50.874 45.967 -8.723  1.00 73.99  ? 304 HIS A CE1   1 
ATOM   2385 N  NE2   . HIS A  1  307 ? -52.127 45.983 -9.143  1.00 78.13  ? 304 HIS A NE2   1 
ATOM   2386 N  N     . PRO A  1  308 ? -50.759 49.948 -11.207 1.00 60.04  ? 305 PRO A N     1 
ATOM   2387 C  CA    . PRO A  1  308 ? -51.264 50.193 -12.560 1.00 71.54  ? 305 PRO A CA    1 
ATOM   2388 C  C     . PRO A  1  308 ? -52.574 49.458 -12.809 1.00 74.01  ? 305 PRO A C     1 
ATOM   2389 O  O     . PRO A  1  308 ? -52.994 48.582 -12.052 1.00 72.32  ? 305 PRO A O     1 
ATOM   2390 C  CB    . PRO A  1  308 ? -50.142 49.658 -13.451 1.00 68.50  ? 305 PRO A CB    1 
ATOM   2391 C  CG    . PRO A  1  308 ? -49.510 48.588 -12.632 1.00 69.39  ? 305 PRO A CG    1 
ATOM   2392 C  CD    . PRO A  1  308 ? -49.592 49.051 -11.203 1.00 58.52  ? 305 PRO A CD    1 
ATOM   2393 N  N     . SER A  1  309 ? -53.222 49.833 -13.911 1.00 75.37  ? 306 SER A N     1 
ATOM   2394 C  CA    . SER A  1  309 ? -54.517 49.295 -14.285 1.00 83.29  ? 306 SER A CA    1 
ATOM   2395 C  C     . SER A  1  309 ? -54.429 48.589 -15.632 1.00 80.42  ? 306 SER A C     1 
ATOM   2396 O  O     . SER A  1  309 ? -53.527 48.850 -16.436 1.00 73.44  ? 306 SER A O     1 
ATOM   2397 C  CB    . SER A  1  309 ? -55.582 50.401 -14.344 1.00 90.87  ? 306 SER A CB    1 
ATOM   2398 O  OG    . SER A  1  309 ? -55.100 51.536 -15.043 1.00 95.47  ? 306 SER A OG    1 
ATOM   2399 N  N     . THR A  1  310 ? -55.379 47.689 -15.860 1.00 84.28  ? 307 THR A N     1 
ATOM   2400 C  CA    . THR A  1  310 ? -55.460 46.964 -17.120 1.00 76.22  ? 307 THR A CA    1 
ATOM   2401 C  C     . THR A  1  310 ? -55.570 47.948 -18.282 1.00 68.40  ? 307 THR A C     1 
ATOM   2402 O  O     . THR A  1  310 ? -56.365 48.896 -18.212 1.00 71.50  ? 307 THR A O     1 
ATOM   2403 C  CB    . THR A  1  310 ? -56.665 46.018 -17.104 1.00 76.23  ? 307 THR A CB    1 
ATOM   2404 O  OG1   . THR A  1  310 ? -56.431 44.948 -16.176 1.00 80.80  ? 307 THR A OG1   1 
ATOM   2405 C  CG2   . THR A  1  310 ? -56.932 45.442 -18.489 1.00 77.17  ? 307 THR A CG2   1 
ATOM   2406 N  N     . PRO A  1  311 ? -54.791 47.775 -19.347 1.00 68.71  ? 308 PRO A N     1 
ATOM   2407 C  CA    . PRO A  1  311 ? -54.815 48.734 -20.457 1.00 71.05  ? 308 PRO A CA    1 
ATOM   2408 C  C     . PRO A  1  311 ? -56.027 48.510 -21.344 1.00 64.42  ? 308 PRO A C     1 
ATOM   2409 O  O     . PRO A  1  311 ? -56.760 47.525 -21.171 1.00 64.51  ? 308 PRO A O     1 
ATOM   2410 C  CB    . PRO A  1  311 ? -53.510 48.426 -21.204 1.00 62.07  ? 308 PRO A CB    1 
ATOM   2411 C  CG    . PRO A  1  311 ? -53.283 46.977 -20.947 1.00 61.01  ? 308 PRO A CG    1 
ATOM   2412 C  CD    . PRO A  1  311 ? -53.772 46.727 -19.543 1.00 63.58  ? 308 PRO A CD    1 
ATOM   2413 N  N     . PRO A  1  312 ? -56.286 49.408 -22.297 1.00 67.63  ? 309 PRO A N     1 
ATOM   2414 C  CA    . PRO A  1  312 ? -57.408 49.194 -23.216 1.00 70.71  ? 309 PRO A CA    1 
ATOM   2415 C  C     . PRO A  1  312 ? -57.172 47.988 -24.109 1.00 67.48  ? 309 PRO A C     1 
ATOM   2416 O  O     . PRO A  1  312 ? -56.057 47.742 -24.573 1.00 64.56  ? 309 PRO A O     1 
ATOM   2417 C  CB    . PRO A  1  312 ? -57.452 50.489 -24.038 1.00 71.86  ? 309 PRO A CB    1 
ATOM   2418 C  CG    . PRO A  1  312 ? -56.714 51.493 -23.221 1.00 67.12  ? 309 PRO A CG    1 
ATOM   2419 C  CD    . PRO A  1  312 ? -55.657 50.727 -22.498 1.00 65.57  ? 309 PRO A CD    1 
ATOM   2420 N  N     . ALA A  1  313 ? -58.240 47.229 -24.344 1.00 66.30  ? 310 ALA A N     1 
ATOM   2421 C  CA    . ALA A  1  313 ? -58.175 46.123 -25.284 1.00 65.84  ? 310 ALA A CA    1 
ATOM   2422 C  C     . ALA A  1  313 ? -57.923 46.643 -26.693 1.00 78.14  ? 310 ALA A C     1 
ATOM   2423 O  O     . ALA A  1  313 ? -58.271 47.776 -27.037 1.00 79.99  ? 310 ALA A O     1 
ATOM   2424 C  CB    . ALA A  1  313 ? -59.467 45.311 -25.249 1.00 66.66  ? 310 ALA A CB    1 
ATOM   2425 N  N     . SER A  1  314 ? -57.304 45.803 -27.517 1.00 73.30  ? 311 SER A N     1 
ATOM   2426 C  CA    . SER A  1  314 ? -57.031 46.205 -28.884 1.00 75.42  ? 311 SER A CA    1 
ATOM   2427 C  C     . SER A  1  314 ? -58.270 45.993 -29.750 1.00 76.60  ? 311 SER A C     1 
ATOM   2428 O  O     . SER A  1  314 ? -59.258 45.380 -29.335 1.00 72.57  ? 311 SER A O     1 
ATOM   2429 C  CB    . SER A  1  314 ? -55.834 45.440 -29.442 1.00 70.37  ? 311 SER A CB    1 
ATOM   2430 O  OG    . SER A  1  314 ? -56.173 44.100 -29.755 1.00 70.48  ? 311 SER A OG    1 
ATOM   2431 N  N     . SER A  1  315 ? -58.199 46.509 -30.980 1.00 79.07  ? 312 SER A N     1 
ATOM   2432 C  CA    . SER A  1  315 ? -59.375 46.550 -31.845 1.00 78.47  ? 312 SER A CA    1 
ATOM   2433 C  C     . SER A  1  315 ? -59.963 45.162 -32.068 1.00 68.91  ? 312 SER A C     1 
ATOM   2434 O  O     . SER A  1  315 ? -61.188 44.997 -32.085 1.00 70.09  ? 312 SER A O     1 
ATOM   2435 C  CB    . SER A  1  315 ? -59.015 47.185 -33.188 1.00 81.57  ? 312 SER A CB    1 
ATOM   2436 O  OG    . SER A  1  315 ? -58.291 48.388 -33.005 1.00 87.05  ? 312 SER A OG    1 
ATOM   2437 N  N     . ARG A  1  316 ? -59.109 44.151 -32.244 1.00 67.61  ? 313 ARG A N     1 
ATOM   2438 C  CA    . ARG A  1  316 ? -59.543 42.813 -32.631 1.00 67.55  ? 313 ARG A CA    1 
ATOM   2439 C  C     . ARG A  1  316 ? -58.953 41.789 -31.664 1.00 73.11  ? 313 ARG A C     1 
ATOM   2440 O  O     . ARG A  1  316 ? -58.127 40.952 -32.038 1.00 76.49  ? 313 ARG A O     1 
ATOM   2441 C  CB    . ARG A  1  316 ? -59.154 42.514 -34.074 1.00 70.21  ? 313 ARG A CB    1 
ATOM   2442 C  CG    . ARG A  1  316 ? -59.722 43.523 -35.043 1.00 68.89  ? 313 ARG A CG    1 
ATOM   2443 C  CD    . ARG A  1  316 ? -59.362 43.206 -36.473 1.00 76.24  ? 313 ARG A CD    1 
ATOM   2444 N  NE    . ARG A  1  316 ? -59.892 44.218 -37.379 1.00 77.08  ? 313 ARG A NE    1 
ATOM   2445 C  CZ    . ARG A  1  316 ? -59.661 44.242 -38.686 1.00 70.55  ? 313 ARG A CZ    1 
ATOM   2446 N  NH1   . ARG A  1  316 ? -58.906 43.307 -39.244 1.00 69.57  ? 313 ARG A NH1   1 
ATOM   2447 N  NH2   . ARG A  1  316 ? -60.185 45.202 -39.435 1.00 73.48  ? 313 ARG A NH2   1 
ATOM   2448 N  N     . SER A  1  317 ? -59.398 41.852 -30.416 1.00 72.66  ? 314 SER A N     1 
ATOM   2449 C  CA    . SER A  1  317 ? -59.000 40.905 -29.389 1.00 70.34  ? 314 SER A CA    1 
ATOM   2450 C  C     . SER A  1  317 ? -60.096 39.869 -29.167 1.00 69.26  ? 314 SER A C     1 
ATOM   2451 O  O     . SER A  1  317 ? -61.276 40.105 -29.435 1.00 68.66  ? 314 SER A O     1 
ATOM   2452 C  CB    . SER A  1  317 ? -58.684 41.631 -28.078 1.00 64.79  ? 314 SER A CB    1 
ATOM   2453 O  OG    . SER A  1  317 ? -59.749 42.485 -27.702 1.00 72.88  ? 314 SER A OG    1 
ATOM   2454 N  N     . TRP A  1  318 ? -59.684 38.703 -28.679 1.00 67.93  ? 315 TRP A N     1 
ATOM   2455 C  CA    . TRP A  1  318 ? -60.597 37.616 -28.369 1.00 68.37  ? 315 TRP A CA    1 
ATOM   2456 C  C     . TRP A  1  318 ? -60.465 37.247 -26.900 1.00 79.56  ? 315 TRP A C     1 
ATOM   2457 O  O     . TRP A  1  318 ? -59.385 37.348 -26.312 1.00 82.53  ? 315 TRP A O     1 
ATOM   2458 C  CB    . TRP A  1  318 ? -60.319 36.385 -29.243 1.00 66.99  ? 315 TRP A CB    1 
ATOM   2459 C  CG    . TRP A  1  318 ? -59.108 35.598 -28.834 1.00 66.51  ? 315 TRP A CG    1 
ATOM   2460 C  CD1   . TRP A  1  318 ? -57.803 35.944 -29.030 1.00 70.47  ? 315 TRP A CD1   1 
ATOM   2461 C  CD2   . TRP A  1  318 ? -59.091 34.325 -28.175 1.00 62.26  ? 315 TRP A CD2   1 
ATOM   2462 N  NE1   . TRP A  1  318 ? -56.974 34.970 -28.528 1.00 65.17  ? 315 TRP A NE1   1 
ATOM   2463 C  CE2   . TRP A  1  318 ? -57.739 33.965 -27.997 1.00 60.73  ? 315 TRP A CE2   1 
ATOM   2464 C  CE3   . TRP A  1  318 ? -60.086 33.457 -27.716 1.00 73.10  ? 315 TRP A CE3   1 
ATOM   2465 C  CZ2   . TRP A  1  318 ? -57.358 32.774 -27.383 1.00 63.13  ? 315 TRP A CZ2   1 
ATOM   2466 C  CZ3   . TRP A  1  318 ? -59.705 32.274 -27.104 1.00 70.94  ? 315 TRP A CZ3   1 
ATOM   2467 C  CH2   . TRP A  1  318 ? -58.353 31.945 -26.942 1.00 65.53  ? 315 TRP A CH2   1 
ATOM   2468 N  N     . SER A  1  319 ? -61.579 36.826 -26.305 1.00 78.99  ? 316 SER A N     1 
ATOM   2469 C  CA    . SER A  1  319 ? -61.549 36.340 -24.937 1.00 87.17  ? 316 SER A CA    1 
ATOM   2470 C  C     . SER A  1  319 ? -62.207 34.970 -24.864 1.00 80.63  ? 316 SER A C     1 
ATOM   2471 O  O     . SER A  1  319 ? -63.232 34.729 -25.515 1.00 79.60  ? 316 SER A O     1 
ATOM   2472 C  CB    . SER A  1  319 ? -62.243 37.317 -23.978 1.00 88.51  ? 316 SER A CB    1 
ATOM   2473 O  OG    . SER A  1  319 ? -61.328 38.306 -23.534 1.00 81.97  ? 316 SER A OG    1 
ATOM   2474 N  N     . PRO A  1  320 ? -61.643 34.059 -24.077 1.00 81.04  ? 317 PRO A N     1 
ATOM   2475 C  CA    . PRO A  1  320 ? -62.056 32.654 -24.145 1.00 79.50  ? 317 PRO A CA    1 
ATOM   2476 C  C     . PRO A  1  320 ? -63.398 32.401 -23.479 1.00 81.40  ? 317 PRO A C     1 
ATOM   2477 O  O     . PRO A  1  320 ? -63.784 33.061 -22.510 1.00 78.49  ? 317 PRO A O     1 
ATOM   2478 C  CB    . PRO A  1  320 ? -60.930 31.929 -23.403 1.00 80.83  ? 317 PRO A CB    1 
ATOM   2479 C  CG    . PRO A  1  320 ? -60.452 32.941 -22.413 1.00 84.04  ? 317 PRO A CG    1 
ATOM   2480 C  CD    . PRO A  1  320 ? -60.572 34.276 -23.090 1.00 84.11  ? 317 PRO A CD    1 
ATOM   2481 N  N     . VAL A  1  321 ? -64.101 31.406 -24.013 1.00 77.55  ? 318 VAL A N     1 
ATOM   2482 C  CA    . VAL A  1  321 ? -65.427 31.014 -23.552 1.00 77.55  ? 318 VAL A CA    1 
ATOM   2483 C  C     . VAL A  1  321 ? -65.414 29.512 -23.300 1.00 78.19  ? 318 VAL A C     1 
ATOM   2484 O  O     . VAL A  1  321 ? -64.756 28.760 -24.027 1.00 80.33  ? 318 VAL A O     1 
ATOM   2485 C  CB    . VAL A  1  321 ? -66.511 31.405 -24.582 1.00 73.65  ? 318 VAL A CB    1 
ATOM   2486 C  CG1   . VAL A  1  321 ? -67.830 30.696 -24.301 1.00 74.13  ? 318 VAL A CG1   1 
ATOM   2487 C  CG2   . VAL A  1  321 ? -66.707 32.914 -24.593 1.00 70.82  ? 318 VAL A CG2   1 
ATOM   2488 N  N     . VAL A  1  322 ? -66.124 29.079 -22.254 1.00 76.64  ? 319 VAL A N     1 
ATOM   2489 C  CA    . VAL A  1  322 ? -66.178 27.658 -21.918 1.00 74.31  ? 319 VAL A CA    1 
ATOM   2490 C  C     . VAL A  1  322 ? -66.789 26.886 -23.077 1.00 78.15  ? 319 VAL A C     1 
ATOM   2491 O  O     . VAL A  1  322 ? -67.843 27.255 -23.611 1.00 80.91  ? 319 VAL A O     1 
ATOM   2492 C  CB    . VAL A  1  322 ? -66.967 27.443 -20.621 1.00 70.86  ? 319 VAL A CB    1 
ATOM   2493 C  CG1   . VAL A  1  322 ? -67.030 25.962 -20.272 1.00 67.64  ? 319 VAL A CG1   1 
ATOM   2494 C  CG2   . VAL A  1  322 ? -66.346 28.237 -19.481 1.00 66.69  ? 319 VAL A CG2   1 
ATOM   2495 N  N     . GLY A  1  323 ? -66.126 25.797 -23.472 1.00 74.61  ? 320 GLY A N     1 
ATOM   2496 C  CA    . GLY A  1  323 ? -66.575 24.976 -24.574 1.00 73.72  ? 320 GLY A CA    1 
ATOM   2497 C  C     . GLY A  1  323 ? -66.046 25.383 -25.933 1.00 77.43  ? 320 GLY A C     1 
ATOM   2498 O  O     . GLY A  1  323 ? -66.224 24.632 -26.899 1.00 75.02  ? 320 GLY A O     1 
ATOM   2499 N  N     . GLN A  1  324 ? -65.407 26.545 -26.035 1.00 74.81  ? 321 GLN A N     1 
ATOM   2500 C  CA    . GLN A  1  324 ? -64.867 27.011 -27.304 1.00 72.87  ? 321 GLN A CA    1 
ATOM   2501 C  C     . GLN A  1  324 ? -63.728 26.109 -27.770 1.00 75.34  ? 321 GLN A C     1 
ATOM   2502 O  O     . GLN A  1  324 ? -63.032 25.480 -26.967 1.00 80.63  ? 321 GLN A O     1 
ATOM   2503 C  CB    . GLN A  1  324 ? -64.373 28.451 -27.165 1.00 71.26  ? 321 GLN A CB    1 
ATOM   2504 C  CG    . GLN A  1  324 ? -63.913 29.110 -28.454 1.00 75.71  ? 321 GLN A CG    1 
ATOM   2505 C  CD    . GLN A  1  324 ? -63.458 30.541 -28.245 1.00 83.14  ? 321 GLN A CD    1 
ATOM   2506 O  OE1   . GLN A  1  324 ? -63.253 30.983 -27.115 1.00 75.99  ? 321 GLN A OE1   1 
ATOM   2507 N  NE2   . GLN A  1  324 ? -63.303 31.278 -29.340 1.00 94.85  ? 321 GLN A NE2   1 
ATOM   2508 N  N     . LEU A  1  325 ? -63.555 26.041 -29.090 1.00 70.25  ? 322 LEU A N     1 
ATOM   2509 C  CA    . LEU A  1  325 ? -62.415 25.359 -29.689 1.00 63.62  ? 322 LEU A CA    1 
ATOM   2510 C  C     . LEU A  1  325 ? -61.246 26.331 -29.761 1.00 59.94  ? 322 LEU A C     1 
ATOM   2511 O  O     . LEU A  1  325 ? -61.364 27.410 -30.351 1.00 69.44  ? 322 LEU A O     1 
ATOM   2512 C  CB    . LEU A  1  325 ? -62.756 24.824 -31.079 1.00 73.73  ? 322 LEU A CB    1 
ATOM   2513 C  CG    . LEU A  1  325 ? -63.706 23.626 -31.135 1.00 73.71  ? 322 LEU A CG    1 
ATOM   2514 C  CD1   . LEU A  1  325 ? -63.751 23.049 -32.535 1.00 72.29  ? 322 LEU A CD1   1 
ATOM   2515 C  CD2   . LEU A  1  325 ? -63.297 22.557 -30.133 1.00 70.60  ? 322 LEU A CD2   1 
ATOM   2516 N  N     . VAL A  1  326 ? -60.129 25.954 -29.141 1.00 61.96  ? 323 VAL A N     1 
ATOM   2517 C  CA    . VAL A  1  326 ? -58.900 26.734 -29.157 1.00 58.37  ? 323 VAL A CA    1 
ATOM   2518 C  C     . VAL A  1  326 ? -57.745 25.794 -29.484 1.00 58.52  ? 323 VAL A C     1 
ATOM   2519 O  O     . VAL A  1  326 ? -57.894 24.573 -29.505 1.00 59.74  ? 323 VAL A O     1 
ATOM   2520 C  CB    . VAL A  1  326 ? -58.651 27.461 -27.820 1.00 64.41  ? 323 VAL A CB    1 
ATOM   2521 C  CG1   . VAL A  1  326 ? -59.774 28.452 -27.526 1.00 57.88  ? 323 VAL A CG1   1 
ATOM   2522 C  CG2   . VAL A  1  326 ? -58.509 26.452 -26.692 1.00 59.21  ? 323 VAL A CG2   1 
ATOM   2523 N  N     . GLN A  1  327 ? -56.579 26.379 -29.743 1.00 57.36  ? 324 GLN A N     1 
ATOM   2524 C  CA    . GLN A  1  327 ? -55.396 25.597 -30.086 1.00 57.44  ? 324 GLN A CA    1 
ATOM   2525 C  C     . GLN A  1  327 ? -54.192 26.138 -29.335 1.00 61.18  ? 324 GLN A C     1 
ATOM   2526 O  O     . GLN A  1  327 ? -53.974 27.351 -29.301 1.00 57.06  ? 324 GLN A O     1 
ATOM   2527 C  CB    . GLN A  1  327 ? -55.135 25.622 -31.595 1.00 56.88  ? 324 GLN A CB    1 
ATOM   2528 C  CG    . GLN A  1  327 ? -56.224 24.957 -32.414 1.00 57.78  ? 324 GLN A CG    1 
ATOM   2529 C  CD    . GLN A  1  327 ? -56.004 25.091 -33.905 1.00 65.22  ? 324 GLN A CD    1 
ATOM   2530 O  OE1   . GLN A  1  327 ? -56.873 25.576 -34.629 1.00 76.08  ? 324 GLN A OE1   1 
ATOM   2531 N  NE2   . GLN A  1  327 ? -54.839 24.658 -34.374 1.00 66.67  ? 324 GLN A NE2   1 
ATOM   2532 N  N     . GLU A  1  328 ? -53.409 25.236 -28.746 1.00 60.97  ? 325 GLU A N     1 
ATOM   2533 C  CA    . GLU A  1  328 ? -52.225 25.614 -27.988 1.00 59.77  ? 325 GLU A CA    1 
ATOM   2534 C  C     . GLU A  1  328 ? -51.020 25.727 -28.911 1.00 64.89  ? 325 GLU A C     1 
ATOM   2535 O  O     . GLU A  1  328 ? -50.845 24.919 -29.828 1.00 65.34  ? 325 GLU A O     1 
ATOM   2536 C  CB    . GLU A  1  328 ? -51.938 24.598 -26.879 1.00 61.72  ? 325 GLU A CB    1 
ATOM   2537 C  CG    . GLU A  1  328 ? -50.869 25.041 -25.893 1.00 68.21  ? 325 GLU A CG    1 
ATOM   2538 C  CD    . GLU A  1  328 ? -50.518 23.968 -24.879 1.00 73.39  ? 325 GLU A CD    1 
ATOM   2539 O  OE1   . GLU A  1  328 ? -51.147 22.890 -24.907 1.00 74.02  ? 325 GLU A OE1   1 
ATOM   2540 O  OE2   . GLU A  1  328 ? -49.609 24.205 -24.055 1.00 68.09  ? 325 GLU A OE2   1 
ATOM   2541 N  N     . ARG A  1  329 ? -50.194 26.741 -28.666 1.00 71.96  ? 326 ARG A N     1 
ATOM   2542 C  CA    . ARG A  1  329 ? -48.968 26.912 -29.430 1.00 61.94  ? 326 ARG A CA    1 
ATOM   2543 C  C     . ARG A  1  329 ? -48.001 25.769 -29.148 1.00 65.65  ? 326 ARG A C     1 
ATOM   2544 O  O     . ARG A  1  329 ? -47.850 25.327 -28.006 1.00 71.75  ? 326 ARG A O     1 
ATOM   2545 C  CB    . ARG A  1  329 ? -48.315 28.249 -29.082 1.00 57.47  ? 326 ARG A CB    1 
ATOM   2546 C  CG    . ARG A  1  329 ? -47.048 28.552 -29.864 1.00 69.70  ? 326 ARG A CG    1 
ATOM   2547 C  CD    . ARG A  1  329 ? -46.358 29.798 -29.327 1.00 79.21  ? 326 ARG A CD    1 
ATOM   2548 N  NE    . ARG A  1  329 ? -47.297 30.896 -29.111 1.00 80.30  ? 326 ARG A NE    1 
ATOM   2549 C  CZ    . ARG A  1  329 ? -47.673 31.753 -30.056 1.00 84.95  ? 326 ARG A CZ    1 
ATOM   2550 N  NH1   . ARG A  1  329 ? -47.188 31.640 -31.286 1.00 73.57  ? 326 ARG A NH1   1 
ATOM   2551 N  NH2   . ARG A  1  329 ? -48.533 32.722 -29.774 1.00 80.92  ? 326 ARG A NH2   1 
ATOM   2552 N  N     . VAL A  1  330 ? -47.347 25.284 -30.204 1.00 55.43  ? 327 VAL A N     1 
ATOM   2553 C  CA    . VAL A  1  330 ? -46.351 24.234 -30.047 1.00 56.33  ? 327 VAL A CA    1 
ATOM   2554 C  C     . VAL A  1  330 ? -45.109 24.831 -29.401 1.00 55.90  ? 327 VAL A C     1 
ATOM   2555 O  O     . VAL A  1  330 ? -44.644 25.908 -29.793 1.00 69.70  ? 327 VAL A O     1 
ATOM   2556 C  CB    . VAL A  1  330 ? -46.034 23.585 -31.404 1.00 56.46  ? 327 VAL A CB    1 
ATOM   2557 C  CG1   . VAL A  1  330 ? -44.868 22.615 -31.275 1.00 58.82  ? 327 VAL A CG1   1 
ATOM   2558 C  CG2   . VAL A  1  330 ? -47.264 22.871 -31.947 1.00 61.04  ? 327 VAL A CG2   1 
ATOM   2559 N  N     . ALA A  1  331 ? -44.582 24.140 -28.391 1.00 66.83  ? 328 ALA A N     1 
ATOM   2560 C  CA    . ALA A  1  331 ? -43.503 24.670 -27.563 1.00 78.32  ? 328 ALA A CA    1 
ATOM   2561 C  C     . ALA A  1  331 ? -42.245 24.966 -28.372 1.00 82.29  ? 328 ALA A C     1 
ATOM   2562 O  O     . ALA A  1  331 ? -41.876 26.134 -28.542 1.00 84.74  ? 328 ALA A O     1 
ATOM   2563 C  CB    . ALA A  1  331 ? -43.185 23.698 -26.427 1.00 79.57  ? 328 ALA A CB    1 
ATOM   2564 N  N     . ARG A  1  332 ? -41.579 23.928 -28.871 1.00 77.73  ? 329 ARG A N     1 
ATOM   2565 C  CA    . ARG A  1  332 ? -40.329 24.066 -29.616 1.00 80.76  ? 329 ARG A CA    1 
ATOM   2566 C  C     . ARG A  1  332 ? -40.510 23.368 -30.960 1.00 72.91  ? 329 ARG A C     1 
ATOM   2567 O  O     . ARG A  1  332 ? -39.995 22.260 -31.186 1.00 69.66  ? 329 ARG A O     1 
ATOM   2568 C  CB    . ARG A  1  332 ? -39.153 23.515 -28.806 1.00 90.11  ? 329 ARG A CB    1 
ATOM   2569 C  CG    . ARG A  1  332 ? -38.607 24.572 -27.857 1.00 93.38  ? 329 ARG A CG    1 
ATOM   2570 C  CD    . ARG A  1  332 ? -38.088 24.027 -26.543 1.00 102.24 ? 329 ARG A CD    1 
ATOM   2571 N  NE    . ARG A  1  332 ? -37.582 25.130 -25.730 1.00 115.12 ? 329 ARG A NE    1 
ATOM   2572 C  CZ    . ARG A  1  332 ? -37.465 25.105 -24.407 1.00 113.20 ? 329 ARG A CZ    1 
ATOM   2573 N  NH1   . ARG A  1  332 ? -37.824 24.027 -23.725 1.00 107.88 ? 329 ARG A NH1   1 
ATOM   2574 N  NH2   . ARG A  1  332 ? -36.996 26.166 -23.764 1.00 107.77 ? 329 ARG A NH2   1 
ATOM   2575 N  N     . PRO A  1  333 ? -41.232 24.000 -31.886 1.00 67.13  ? 330 PRO A N     1 
ATOM   2576 C  CA    . PRO A  1  333 ? -41.586 23.342 -33.151 1.00 61.16  ? 330 PRO A CA    1 
ATOM   2577 C  C     . PRO A  1  333 ? -40.358 23.119 -34.023 1.00 60.47  ? 330 PRO A C     1 
ATOM   2578 O  O     . PRO A  1  333 ? -39.526 24.014 -34.190 1.00 58.31  ? 330 PRO A O     1 
ATOM   2579 C  CB    . PRO A  1  333 ? -42.564 24.319 -33.796 1.00 59.88  ? 330 PRO A CB    1 
ATOM   2580 C  CG    . PRO A  1  333 ? -42.148 25.651 -33.253 1.00 59.31  ? 330 PRO A CG    1 
ATOM   2581 C  CD    . PRO A  1  333 ? -41.696 25.399 -31.845 1.00 62.47  ? 330 PRO A CD    1 
ATOM   2582 N  N     . ALA A  1  334 ? -40.257 21.916 -34.583 1.00 58.55  ? 331 ALA A N     1 
ATOM   2583 C  CA    . ALA A  1  334 ? -39.154 21.594 -35.470 1.00 57.40  ? 331 ALA A CA    1 
ATOM   2584 C  C     . ALA A  1  334 ? -39.267 22.395 -36.765 1.00 62.85  ? 331 ALA A C     1 
ATOM   2585 O  O     . ALA A  1  334 ? -40.260 23.079 -37.028 1.00 63.81  ? 331 ALA A O     1 
ATOM   2586 C  CB    . ALA A  1  334 ? -39.127 20.096 -35.771 1.00 59.11  ? 331 ALA A CB    1 
ATOM   2587 N  N     . SER A  1  335 ? -38.220 22.307 -37.579 1.00 61.37  ? 332 SER A N     1 
ATOM   2588 C  CA    . SER A  1  335 ? -38.228 22.972 -38.872 1.00 57.05  ? 332 SER A CA    1 
ATOM   2589 C  C     . SER A  1  335 ? -39.268 22.338 -39.786 1.00 60.88  ? 332 SER A C     1 
ATOM   2590 O  O     . SER A  1  335 ? -39.415 21.113 -39.831 1.00 67.49  ? 332 SER A O     1 
ATOM   2591 C  CB    . SER A  1  335 ? -36.843 22.900 -39.514 1.00 68.93  ? 332 SER A CB    1 
ATOM   2592 O  OG    . SER A  1  335 ? -36.827 23.530 -40.783 1.00 87.35  ? 332 SER A OG    1 
ATOM   2593 N  N     . LEU A  1  336 ? -39.998 23.189 -40.509 1.00 55.79  ? 333 LEU A N     1 
ATOM   2594 C  CA    . LEU A  1  336 ? -41.038 22.763 -41.447 1.00 59.74  ? 333 LEU A CA    1 
ATOM   2595 C  C     . LEU A  1  336 ? -42.135 21.958 -40.756 1.00 60.88  ? 333 LEU A C     1 
ATOM   2596 O  O     . LEU A  1  336 ? -42.736 21.067 -41.360 1.00 69.97  ? 333 LEU A O     1 
ATOM   2597 C  CB    . LEU A  1  336 ? -40.448 21.967 -42.615 1.00 55.36  ? 333 LEU A CB    1 
ATOM   2598 C  CG    . LEU A  1  336 ? -39.398 22.687 -43.461 1.00 54.58  ? 333 LEU A CG    1 
ATOM   2599 C  CD1   . LEU A  1  336 ? -39.065 21.883 -44.710 1.00 55.28  ? 333 LEU A CD1   1 
ATOM   2600 C  CD2   . LEU A  1  336 ? -39.868 24.091 -43.819 1.00 53.16  ? 333 LEU A CD2   1 
ATOM   2601 N  N     . ARG A  1  337 ? -42.405 22.264 -39.488 1.00 55.53  ? 334 ARG A N     1 
ATOM   2602 C  CA    . ARG A  1  337 ? -43.461 21.605 -38.737 1.00 57.40  ? 334 ARG A CA    1 
ATOM   2603 C  C     . ARG A  1  337 ? -44.472 22.631 -38.233 1.00 55.51  ? 334 ARG A C     1 
ATOM   2604 O  O     . ARG A  1  337 ? -44.125 23.799 -38.032 1.00 62.96  ? 334 ARG A O     1 
ATOM   2605 C  CB    . ARG A  1  337 ? -42.889 20.819 -37.549 1.00 57.42  ? 334 ARG A CB    1 
ATOM   2606 C  CG    . ARG A  1  337 ? -42.068 19.598 -37.946 1.00 58.64  ? 334 ARG A CG    1 
ATOM   2607 C  CD    . ARG A  1  337 ? -42.891 18.603 -38.755 1.00 59.63  ? 334 ARG A CD    1 
ATOM   2608 N  NE    . ARG A  1  337 ? -42.133 17.395 -39.072 1.00 73.76  ? 334 ARG A NE    1 
ATOM   2609 C  CZ    . ARG A  1  337 ? -42.488 16.511 -39.999 1.00 75.88  ? 334 ARG A CZ    1 
ATOM   2610 N  NH1   . ARG A  1  337 ? -43.592 16.701 -40.709 1.00 76.52  ? 334 ARG A NH1   1 
ATOM   2611 N  NH2   . ARG A  1  337 ? -41.739 15.439 -40.221 1.00 74.03  ? 334 ARG A NH2   1 
ATOM   2612 N  N     . PRO A  1  338 ? -45.729 22.229 -38.036 1.00 56.09  ? 335 PRO A N     1 
ATOM   2613 C  CA    . PRO A  1  338 ? -46.757 23.193 -37.622 1.00 59.77  ? 335 PRO A CA    1 
ATOM   2614 C  C     . PRO A  1  338 ? -46.428 23.849 -36.290 1.00 69.39  ? 335 PRO A C     1 
ATOM   2615 O  O     . PRO A  1  338 ? -45.799 23.251 -35.414 1.00 61.32  ? 335 PRO A O     1 
ATOM   2616 C  CB    . PRO A  1  338 ? -48.025 22.336 -37.520 1.00 56.48  ? 335 PRO A CB    1 
ATOM   2617 C  CG    . PRO A  1  338 ? -47.773 21.181 -38.419 1.00 60.27  ? 335 PRO A CG    1 
ATOM   2618 C  CD    . PRO A  1  338 ? -46.302 20.902 -38.322 1.00 58.18  ? 335 PRO A CD    1 
ATOM   2619 N  N     . ARG A  1  339 ? -46.868 25.100 -36.146 1.00 70.21  ? 336 ARG A N     1 
ATOM   2620 C  CA    . ARG A  1  339 ? -46.672 25.865 -34.921 1.00 60.95  ? 336 ARG A CA    1 
ATOM   2621 C  C     . ARG A  1  339 ? -47.818 25.707 -33.926 1.00 60.12  ? 336 ARG A C     1 
ATOM   2622 O  O     . ARG A  1  339 ? -47.721 26.228 -32.810 1.00 67.40  ? 336 ARG A O     1 
ATOM   2623 C  CB    . ARG A  1  339 ? -46.490 27.355 -35.247 1.00 52.04  ? 336 ARG A CB    1 
ATOM   2624 C  CG    . ARG A  1  339 ? -45.325 27.673 -36.182 1.00 51.43  ? 336 ARG A CG    1 
ATOM   2625 C  CD    . ARG A  1  339 ? -43.987 27.536 -35.487 1.00 73.23  ? 336 ARG A CD    1 
ATOM   2626 N  NE    . ARG A  1  339 ? -42.873 27.979 -36.324 1.00 80.79  ? 336 ARG A NE    1 
ATOM   2627 C  CZ    . ARG A  1  339 ? -42.031 27.160 -36.946 1.00 82.58  ? 336 ARG A CZ    1 
ATOM   2628 N  NH1   . ARG A  1  339 ? -42.166 25.847 -36.824 1.00 73.65  ? 336 ARG A NH1   1 
ATOM   2629 N  NH2   . ARG A  1  339 ? -41.046 27.654 -37.686 1.00 96.43  ? 336 ARG A NH2   1 
ATOM   2630 N  N     . TRP A  1  340 ? -48.889 25.003 -34.292 1.00 61.95  ? 337 TRP A N     1 
ATOM   2631 C  CA    . TRP A  1  340 ? -50.074 24.895 -33.453 1.00 60.46  ? 337 TRP A CA    1 
ATOM   2632 C  C     . TRP A  1  340 ? -50.494 23.440 -33.309 1.00 60.63  ? 337 TRP A C     1 
ATOM   2633 O  O     . TRP A  1  340 ? -50.345 22.635 -34.233 1.00 62.27  ? 337 TRP A O     1 
ATOM   2634 C  CB    . TRP A  1  340 ? -51.235 25.715 -34.024 1.00 58.35  ? 337 TRP A CB    1 
ATOM   2635 C  CG    . TRP A  1  340 ? -50.939 27.172 -34.083 1.00 60.79  ? 337 TRP A CG    1 
ATOM   2636 C  CD1   . TRP A  1  340 ? -50.432 27.864 -35.141 1.00 55.31  ? 337 TRP A CD1   1 
ATOM   2637 C  CD2   . TRP A  1  340 ? -51.117 28.124 -33.028 1.00 68.03  ? 337 TRP A CD2   1 
ATOM   2638 N  NE1   . TRP A  1  340 ? -50.288 29.189 -34.814 1.00 52.77  ? 337 TRP A NE1   1 
ATOM   2639 C  CE2   . TRP A  1  340 ? -50.702 29.375 -33.522 1.00 60.03  ? 337 TRP A CE2   1 
ATOM   2640 C  CE3   . TRP A  1  340 ? -51.592 28.040 -31.714 1.00 68.78  ? 337 TRP A CE3   1 
ATOM   2641 C  CZ2   . TRP A  1  340 ? -50.747 30.534 -32.750 1.00 57.80  ? 337 TRP A CZ2   1 
ATOM   2642 C  CZ3   . TRP A  1  340 ? -51.634 29.192 -30.949 1.00 63.93  ? 337 TRP A CZ3   1 
ATOM   2643 C  CH2   . TRP A  1  340 ? -51.214 30.422 -31.470 1.00 62.63  ? 337 TRP A CH2   1 
ATOM   2644 N  N     . HIS A  1  341 ? -51.021 23.115 -32.131 1.00 59.35  ? 338 HIS A N     1 
ATOM   2645 C  CA    . HIS A  1  341 ? -51.524 21.781 -31.853 1.00 65.22  ? 338 HIS A CA    1 
ATOM   2646 C  C     . HIS A  1  341 ? -52.925 21.603 -32.434 1.00 59.77  ? 338 HIS A C     1 
ATOM   2647 O  O     . HIS A  1  341 ? -53.583 22.562 -32.854 1.00 58.91  ? 338 HIS A O     1 
ATOM   2648 C  CB    . HIS A  1  341 ? -51.551 21.512 -30.349 1.00 60.00  ? 338 HIS A CB    1 
ATOM   2649 C  CG    . HIS A  1  341 ? -50.201 21.275 -29.749 1.00 60.07  ? 338 HIS A CG    1 
ATOM   2650 N  ND1   . HIS A  1  341 ? -49.387 20.233 -30.137 1.00 61.32  ? 338 HIS A ND1   1 
ATOM   2651 C  CD2   . HIS A  1  341 ? -49.531 21.934 -28.774 1.00 62.83  ? 338 HIS A CD2   1 
ATOM   2652 C  CE1   . HIS A  1  341 ? -48.269 20.266 -29.434 1.00 63.25  ? 338 HIS A CE1   1 
ATOM   2653 N  NE2   . HIS A  1  341 ? -48.331 21.289 -28.600 1.00 63.21  ? 338 HIS A NE2   1 
ATOM   2654 N  N     . LYS A  1  342 ? -53.377 20.350 -32.456 1.00 62.82  ? 339 LYS A N     1 
ATOM   2655 C  CA    . LYS A  1  342 ? -54.749 20.045 -32.824 1.00 68.79  ? 339 LYS A CA    1 
ATOM   2656 C  C     . LYS A  1  342 ? -55.708 20.788 -31.895 1.00 68.86  ? 339 LYS A C     1 
ATOM   2657 O  O     . LYS A  1  342 ? -55.346 21.128 -30.762 1.00 68.54  ? 339 LYS A O     1 
ATOM   2658 C  CB    . LYS A  1  342 ? -55.000 18.536 -32.761 1.00 85.35  ? 339 LYS A CB    1 
ATOM   2659 C  CG    . LYS A  1  342 ? -54.292 17.728 -33.839 1.00 106.08 ? 339 LYS A CG    1 
ATOM   2660 C  CD    . LYS A  1  342 ? -54.590 16.243 -33.696 1.00 118.53 ? 339 LYS A CD    1 
ATOM   2661 C  CE    . LYS A  1  342 ? -53.930 15.438 -34.803 1.00 119.55 ? 339 LYS A CE    1 
ATOM   2662 N  NZ    . LYS A  1  342 ? -54.236 13.984 -34.698 1.00 120.03 ? 339 LYS A NZ    1 
ATOM   2663 N  N     . PRO A  1  343 ? -56.930 21.068 -32.351 1.00 73.31  ? 340 PRO A N     1 
ATOM   2664 C  CA    . PRO A  1  343 ? -57.853 21.871 -31.538 1.00 70.77  ? 340 PRO A CA    1 
ATOM   2665 C  C     . PRO A  1  343 ? -58.167 21.222 -30.197 1.00 70.15  ? 340 PRO A C     1 
ATOM   2666 O  O     . PRO A  1  343 ? -58.170 19.997 -30.054 1.00 66.34  ? 340 PRO A O     1 
ATOM   2667 C  CB    . PRO A  1  343 ? -59.106 21.964 -32.417 1.00 66.55  ? 340 PRO A CB    1 
ATOM   2668 C  CG    . PRO A  1  343 ? -58.595 21.790 -33.809 1.00 61.91  ? 340 PRO A CG    1 
ATOM   2669 C  CD    . PRO A  1  343 ? -57.468 20.806 -33.696 1.00 62.38  ? 340 PRO A CD    1 
ATOM   2670 N  N     . SER A  1  344 ? -58.435 22.075 -29.211 1.00 68.81  ? 341 SER A N     1 
ATOM   2671 C  CA    . SER A  1  344 ? -58.774 21.655 -27.860 1.00 68.76  ? 341 SER A CA    1 
ATOM   2672 C  C     . SER A  1  344 ? -60.029 22.388 -27.406 1.00 68.43  ? 341 SER A C     1 
ATOM   2673 O  O     . SER A  1  344 ? -60.422 23.407 -27.983 1.00 73.32  ? 341 SER A O     1 
ATOM   2674 C  CB    . SER A  1  344 ? -57.624 21.925 -26.878 1.00 70.15  ? 341 SER A CB    1 
ATOM   2675 O  OG    . SER A  1  344 ? -56.417 21.327 -27.317 1.00 78.46  ? 341 SER A OG    1 
ATOM   2676 N  N     . THR A  1  345 ? -60.654 21.859 -26.359 1.00 68.69  ? 342 THR A N     1 
ATOM   2677 C  CA    . THR A  1  345 ? -61.854 22.454 -25.786 1.00 69.46  ? 342 THR A CA    1 
ATOM   2678 C  C     . THR A  1  345 ? -61.522 23.176 -24.487 1.00 74.99  ? 342 THR A C     1 
ATOM   2679 O  O     . THR A  1  345 ? -60.792 22.655 -23.637 1.00 79.56  ? 342 THR A O     1 
ATOM   2680 C  CB    . THR A  1  345 ? -62.927 21.392 -25.525 1.00 71.45  ? 342 THR A CB    1 
ATOM   2681 O  OG1   . THR A  1  345 ? -63.028 20.524 -26.662 1.00 70.68  ? 342 THR A OG1   1 
ATOM   2682 C  CG2   . THR A  1  345 ? -64.277 22.052 -25.290 1.00 71.97  ? 342 THR A CG2   1 
ATOM   2683 N  N     . VAL A  1  346 ? -62.066 24.381 -24.337 1.00 71.31  ? 343 VAL A N     1 
ATOM   2684 C  CA    . VAL A  1  346 ? -61.884 25.142 -23.107 1.00 63.65  ? 343 VAL A CA    1 
ATOM   2685 C  C     . VAL A  1  346 ? -62.775 24.545 -22.027 1.00 69.56  ? 343 VAL A C     1 
ATOM   2686 O  O     . VAL A  1  346 ? -63.992 24.416 -22.207 1.00 73.18  ? 343 VAL A O     1 
ATOM   2687 C  CB    . VAL A  1  346 ? -62.197 26.629 -23.327 1.00 65.08  ? 343 VAL A CB    1 
ATOM   2688 C  CG1   . VAL A  1  346 ? -61.973 27.414 -22.040 1.00 67.20  ? 343 VAL A CG1   1 
ATOM   2689 C  CG2   . VAL A  1  346 ? -61.352 27.192 -24.457 1.00 64.07  ? 343 VAL A CG2   1 
ATOM   2690 N  N     . LEU A  1  347 ? -62.173 24.175 -20.898 1.00 71.13  ? 344 LEU A N     1 
ATOM   2691 C  CA    . LEU A  1  347 ? -62.919 23.581 -19.795 1.00 71.74  ? 344 LEU A CA    1 
ATOM   2692 C  C     . LEU A  1  347 ? -63.390 24.629 -18.791 1.00 76.84  ? 344 LEU A C     1 
ATOM   2693 O  O     . LEU A  1  347 ? -64.577 24.670 -18.448 1.00 81.15  ? 344 LEU A O     1 
ATOM   2694 C  CB    . LEU A  1  347 ? -62.065 22.522 -19.092 1.00 68.11  ? 344 LEU A CB    1 
ATOM   2695 C  CG    . LEU A  1  347 ? -61.795 21.235 -19.874 1.00 71.25  ? 344 LEU A CG    1 
ATOM   2696 C  CD1   . LEU A  1  347 ? -60.837 20.331 -19.112 1.00 73.89  ? 344 LEU A CD1   1 
ATOM   2697 C  CD2   . LEU A  1  347 ? -63.099 20.509 -20.175 1.00 73.92  ? 344 LEU A CD2   1 
ATOM   2698 N  N     . LYS A  1  348 ? -62.481 25.474 -18.310 1.00 74.56  ? 345 LYS A N     1 
ATOM   2699 C  CA    . LYS A  1  348 ? -62.814 26.504 -17.337 1.00 73.86  ? 345 LYS A CA    1 
ATOM   2700 C  C     . LYS A  1  348 ? -62.012 27.761 -17.644 1.00 74.97  ? 345 LYS A C     1 
ATOM   2701 O  O     . LYS A  1  348 ? -60.912 27.695 -18.199 1.00 70.69  ? 345 LYS A O     1 
ATOM   2702 C  CB    . LYS A  1  348 ? -62.538 26.033 -15.899 1.00 72.70  ? 345 LYS A CB    1 
ATOM   2703 C  CG    . LYS A  1  348 ? -63.130 26.918 -14.806 1.00 77.27  ? 345 LYS A CG    1 
ATOM   2704 C  CD    . LYS A  1  348 ? -62.768 26.393 -13.421 1.00 92.86  ? 345 LYS A CD    1 
ATOM   2705 C  CE    . LYS A  1  348 ? -63.371 27.243 -12.310 1.00 95.41  ? 345 LYS A CE    1 
ATOM   2706 N  NZ    . LYS A  1  348 ? -64.832 27.015 -12.139 1.00 99.00  ? 345 LYS A NZ    1 
ATOM   2707 N  N     . VAL A  1  349 ? -62.580 28.907 -17.287 1.00 77.34  ? 346 VAL A N     1 
ATOM   2708 C  CA    . VAL A  1  349 ? -61.943 30.205 -17.473 1.00 71.05  ? 346 VAL A CA    1 
ATOM   2709 C  C     . VAL A  1  349 ? -61.586 30.721 -16.083 1.00 78.29  ? 346 VAL A C     1 
ATOM   2710 O  O     . VAL A  1  349 ? -62.446 31.233 -15.356 1.00 84.66  ? 346 VAL A O     1 
ATOM   2711 C  CB    . VAL A  1  349 ? -62.847 31.188 -18.227 1.00 61.35  ? 346 VAL A CB    1 
ATOM   2712 C  CG1   . VAL A  1  349 ? -62.196 32.560 -18.308 1.00 59.96  ? 346 VAL A CG1   1 
ATOM   2713 C  CG2   . VAL A  1  349 ? -63.157 30.662 -19.623 1.00 61.26  ? 346 VAL A CG2   1 
ATOM   2714 N  N     . LEU A  1  350 ? -60.313 30.579 -15.703 1.00 74.35  ? 347 LEU A N     1 
ATOM   2715 C  CA    . LEU A  1  350 ? -59.882 31.001 -14.373 1.00 72.39  ? 347 LEU A CA    1 
ATOM   2716 C  C     . LEU A  1  350 ? -59.839 32.521 -14.262 1.00 77.65  ? 347 LEU A C     1 
ATOM   2717 O  O     . LEU A  1  350 ? -60.192 33.085 -13.219 1.00 82.97  ? 347 LEU A O     1 
ATOM   2718 C  CB    . LEU A  1  350 ? -58.515 30.395 -14.055 1.00 64.90  ? 347 LEU A CB    1 
ATOM   2719 C  CG    . LEU A  1  350 ? -58.350 28.904 -14.365 1.00 63.37  ? 347 LEU A CG    1 
ATOM   2720 C  CD1   . LEU A  1  350 ? -56.952 28.429 -13.994 1.00 64.34  ? 347 LEU A CD1   1 
ATOM   2721 C  CD2   . LEU A  1  350 ? -59.413 28.078 -13.652 1.00 64.43  ? 347 LEU A CD2   1 
ATOM   2722 N  N     . ASN A  1  351 ? -59.392 33.190 -15.318 1.00 78.11  ? 348 ASN A N     1 
ATOM   2723 C  CA    . ASN A  1  351 ? -59.480 34.637 -15.449 1.00 73.91  ? 348 ASN A CA    1 
ATOM   2724 C  C     . ASN A  1  351 ? -59.433 34.959 -16.938 1.00 69.79  ? 348 ASN A C     1 
ATOM   2725 O  O     . ASN A  1  351 ? -59.165 34.071 -17.759 1.00 73.34  ? 348 ASN A O     1 
ATOM   2726 C  CB    . ASN A  1  351 ? -58.356 35.346 -14.660 1.00 70.77  ? 348 ASN A CB    1 
ATOM   2727 C  CG    . ASN A  1  351 ? -56.963 34.942 -15.105 1.00 77.25  ? 348 ASN A CG    1 
ATOM   2728 O  OD1   . ASN A  1  351 ? -56.644 34.954 -16.291 1.00 81.29  ? 348 ASN A OD1   1 
ATOM   2729 N  ND2   . ASN A  1  351 ? -56.117 34.593 -14.142 1.00 73.26  ? 348 ASN A ND2   1 
ATOM   2730 N  N     . PRO A  1  352 ? -59.714 36.220 -17.337 1.00 72.62  ? 349 PRO A N     1 
ATOM   2731 C  CA    . PRO A  1  352 ? -59.774 36.521 -18.777 1.00 66.68  ? 349 PRO A CA    1 
ATOM   2732 C  C     . PRO A  1  352 ? -58.482 36.225 -19.534 1.00 71.70  ? 349 PRO A C     1 
ATOM   2733 O  O     . PRO A  1  352 ? -58.441 36.342 -20.762 1.00 80.39  ? 349 PRO A O     1 
ATOM   2734 C  CB    . PRO A  1  352 ? -60.099 38.021 -18.807 1.00 59.55  ? 349 PRO A CB    1 
ATOM   2735 C  CG    . PRO A  1  352 ? -60.782 38.278 -17.522 1.00 60.28  ? 349 PRO A CG    1 
ATOM   2736 C  CD    . PRO A  1  352 ? -60.112 37.389 -16.527 1.00 63.82  ? 349 PRO A CD    1 
ATOM   2737 N  N     . ARG A  1  353 ? -57.430 35.829 -18.816 1.00 65.29  ? 350 ARG A N     1 
ATOM   2738 C  CA    . ARG A  1  353 ? -56.130 35.565 -19.411 1.00 55.61  ? 350 ARG A CA    1 
ATOM   2739 C  C     . ARG A  1  353 ? -55.622 34.147 -19.172 1.00 57.70  ? 350 ARG A C     1 
ATOM   2740 O  O     . ARG A  1  353 ? -54.542 33.805 -19.668 1.00 57.41  ? 350 ARG A O     1 
ATOM   2741 C  CB    . ARG A  1  353 ? -55.096 36.565 -18.874 1.00 57.36  ? 350 ARG A CB    1 
ATOM   2742 C  CG    . ARG A  1  353 ? -55.408 38.019 -19.188 1.00 53.36  ? 350 ARG A CG    1 
ATOM   2743 C  CD    . ARG A  1  353 ? -54.744 38.434 -20.482 1.00 56.15  ? 350 ARG A CD    1 
ATOM   2744 N  NE    . ARG A  1  353 ? -53.299 38.241 -20.412 1.00 55.95  ? 350 ARG A NE    1 
ATOM   2745 C  CZ    . ARG A  1  353 ? -52.501 38.193 -21.472 1.00 55.03  ? 350 ARG A CZ    1 
ATOM   2746 N  NH1   . ARG A  1  353 ? -53.008 38.316 -22.692 1.00 51.93  ? 350 ARG A NH1   1 
ATOM   2747 N  NH2   . ARG A  1  353 ? -51.196 38.013 -21.314 1.00 52.51  ? 350 ARG A NH2   1 
ATOM   2748 N  N     . THR A  1  354 ? -56.356 33.317 -18.431 1.00 56.64  ? 351 THR A N     1 
ATOM   2749 C  CA    . THR A  1  354 ? -55.906 31.975 -18.092 1.00 60.27  ? 351 THR A CA    1 
ATOM   2750 C  C     . THR A  1  354 ? -57.069 31.004 -18.219 1.00 61.75  ? 351 THR A C     1 
ATOM   2751 O  O     . THR A  1  354 ? -58.180 31.297 -17.766 1.00 64.62  ? 351 THR A O     1 
ATOM   2752 C  CB    . THR A  1  354 ? -55.343 31.917 -16.665 1.00 62.06  ? 351 THR A CB    1 
ATOM   2753 O  OG1   . THR A  1  354 ? -54.587 33.104 -16.398 1.00 63.80  ? 351 THR A OG1   1 
ATOM   2754 C  CG2   . THR A  1  354 ? -54.444 30.702 -16.498 1.00 64.61  ? 351 THR A CG2   1 
ATOM   2755 N  N     . VAL A  1  355 ? -56.813 29.847 -18.835 1.00 66.07  ? 352 VAL A N     1 
ATOM   2756 C  CA    . VAL A  1  355 ? -57.840 28.833 -19.047 1.00 69.81  ? 352 VAL A CA    1 
ATOM   2757 C  C     . VAL A  1  355 ? -57.270 27.445 -18.800 1.00 74.91  ? 352 VAL A C     1 
ATOM   2758 O  O     . VAL A  1  355 ? -56.058 27.224 -18.837 1.00 74.48  ? 352 VAL A O     1 
ATOM   2759 C  CB    . VAL A  1  355 ? -58.439 28.881 -20.472 1.00 62.52  ? 352 VAL A CB    1 
ATOM   2760 C  CG1   . VAL A  1  355 ? -59.112 30.207 -20.726 1.00 58.83  ? 352 VAL A CG1   1 
ATOM   2761 C  CG2   . VAL A  1  355 ? -57.361 28.604 -21.503 1.00 59.83  ? 352 VAL A CG2   1 
ATOM   2762 N  N     . VAL A  1  356 ? -58.177 26.507 -18.548 1.00 72.49  ? 353 VAL A N     1 
ATOM   2763 C  CA    . VAL A  1  356 ? -57.881 25.079 -18.554 1.00 69.18  ? 353 VAL A CA    1 
ATOM   2764 C  C     . VAL A  1  356 ? -58.447 24.496 -19.837 1.00 75.10  ? 353 VAL A C     1 
ATOM   2765 O  O     . VAL A  1  356 ? -59.576 24.820 -20.232 1.00 82.04  ? 353 VAL A O     1 
ATOM   2766 C  CB    . VAL A  1  356 ? -58.478 24.376 -17.320 1.00 68.46  ? 353 VAL A CB    1 
ATOM   2767 C  CG1   . VAL A  1  356 ? -58.011 22.927 -17.247 1.00 67.97  ? 353 VAL A CG1   1 
ATOM   2768 C  CG2   . VAL A  1  356 ? -58.123 25.133 -16.050 1.00 67.48  ? 353 VAL A CG2   1 
ATOM   2769 N  N     . ILE A  1  357 ? -57.673 23.644 -20.502 1.00 72.70  ? 354 ILE A N     1 
ATOM   2770 C  CA    . ILE A  1  357 ? -58.108 23.029 -21.753 1.00 69.75  ? 354 ILE A CA    1 
ATOM   2771 C  C     . ILE A  1  357 ? -57.997 21.521 -21.640 1.00 76.60  ? 354 ILE A C     1 
ATOM   2772 O  O     . ILE A  1  357 ? -57.201 20.994 -20.853 1.00 73.31  ? 354 ILE A O     1 
ATOM   2773 C  CB    . ILE A  1  357 ? -57.289 23.539 -22.965 1.00 62.80  ? 354 ILE A CB    1 
ATOM   2774 C  CG1   . ILE A  1  357 ? -55.813 23.155 -22.825 1.00 62.61  ? 354 ILE A CG1   1 
ATOM   2775 C  CG2   . ILE A  1  357 ? -57.458 25.038 -23.125 1.00 61.36  ? 354 ILE A CG2   1 
ATOM   2776 C  CD1   . ILE A  1  357 ? -54.968 23.585 -24.005 1.00 61.35  ? 354 ILE A CD1   1 
ATOM   2777 N  N     . LEU A  1  358 ? -58.808 20.821 -22.426 1.00 82.27  ? 355 LEU A N     1 
ATOM   2778 C  CA    . LEU A  1  358 ? -58.658 19.375 -22.594 1.00 88.46  ? 355 LEU A CA    1 
ATOM   2779 C  C     . LEU A  1  358 ? -57.587 19.146 -23.656 1.00 97.23  ? 355 LEU A C     1 
ATOM   2780 O  O     . LEU A  1  358 ? -57.832 19.337 -24.850 1.00 88.25  ? 355 LEU A O     1 
ATOM   2781 C  CB    . LEU A  1  358 ? -59.987 18.734 -22.984 1.00 90.20  ? 355 LEU A CB    1 
ATOM   2782 C  CG    . LEU A  1  358 ? -60.027 17.206 -22.952 1.00 78.90  ? 355 LEU A CG    1 
ATOM   2783 C  CD1   . LEU A  1  358 ? -59.406 16.668 -21.670 1.00 72.78  ? 355 LEU A CD1   1 
ATOM   2784 C  CD2   . LEU A  1  358 ? -61.457 16.708 -23.099 1.00 75.17  ? 355 LEU A CD2   1 
ATOM   2785 N  N     . ASP A  1  359 ? -56.404 18.719 -23.215 1.00 107.96 ? 356 ASP A N     1 
ATOM   2786 C  CA    . ASP A  1  359 ? -55.181 18.791 -24.001 1.00 110.57 ? 356 ASP A CA    1 
ATOM   2787 C  C     . ASP A  1  359 ? -55.251 17.907 -25.247 1.00 105.41 ? 356 ASP A C     1 
ATOM   2788 O  O     . ASP A  1  359 ? -56.120 17.046 -25.386 1.00 104.27 ? 356 ASP A O     1 
ATOM   2789 C  CB    . ASP A  1  359 ? -53.996 18.379 -23.116 1.00 125.16 ? 356 ASP A CB    1 
ATOM   2790 C  CG    . ASP A  1  359 ? -52.663 18.510 -23.808 1.00 138.60 ? 356 ASP A CG    1 
ATOM   2791 O  OD1   . ASP A  1  359 ? -52.125 19.635 -23.859 1.00 142.55 ? 356 ASP A OD1   1 
ATOM   2792 O  OD2   . ASP A  1  359 ? -52.140 17.476 -24.271 1.00 145.87 ? 356 ASP A OD2   1 
ATOM   2793 N  N     . HIS A  1  360 ? -54.304 18.139 -26.166 1.00 112.49 ? 357 HIS A N     1 
ATOM   2794 C  CA    . HIS A  1  360 ? -54.221 17.328 -27.376 1.00 120.44 ? 357 HIS A CA    1 
ATOM   2795 C  C     . HIS A  1  360 ? -53.870 15.882 -27.057 1.00 128.44 ? 357 HIS A C     1 
ATOM   2796 O  O     . HIS A  1  360 ? -54.248 14.971 -27.805 1.00 136.11 ? 357 HIS A O     1 
ATOM   2797 C  CB    . HIS A  1  360 ? -53.193 17.926 -28.341 1.00 113.28 ? 357 HIS A CB    1 
ATOM   2798 C  CG    . HIS A  1  360 ? -51.795 17.959 -27.801 1.00 110.04 ? 357 HIS A CG    1 
ATOM   2799 N  ND1   . HIS A  1  360 ? -51.332 18.972 -26.989 1.00 108.09 ? 357 HIS A ND1   1 
ATOM   2800 C  CD2   . HIS A  1  360 ? -50.751 17.113 -27.978 1.00 102.47 ? 357 HIS A CD2   1 
ATOM   2801 C  CE1   . HIS A  1  360 ? -50.067 18.744 -26.680 1.00 102.46 ? 357 HIS A CE1   1 
ATOM   2802 N  NE2   . HIS A  1  360 ? -49.691 17.622 -27.268 1.00 96.79  ? 357 HIS A NE2   1 
ATOM   2803 N  N     . LEU A  1  361 ? -53.150 15.653 -25.958 1.00 122.90 ? 358 LEU A N     1 
ATOM   2804 C  CA    . LEU A  1  361 ? -52.897 14.289 -25.518 1.00 116.05 ? 358 LEU A CA    1 
ATOM   2805 C  C     . LEU A  1  361 ? -54.090 13.697 -24.779 1.00 112.60 ? 358 LEU A C     1 
ATOM   2806 O  O     . LEU A  1  361 ? -54.347 12.495 -24.897 1.00 113.37 ? 358 LEU A O     1 
ATOM   2807 C  CB    . LEU A  1  361 ? -51.660 14.243 -24.615 1.00 109.25 ? 358 LEU A CB    1 
ATOM   2808 C  CG    . LEU A  1  361 ? -50.366 14.801 -25.206 1.00 99.34  ? 358 LEU A CG    1 
ATOM   2809 C  CD1   . LEU A  1  361 ? -49.307 14.975 -24.128 1.00 92.04  ? 358 LEU A CD1   1 
ATOM   2810 C  CD2   . LEU A  1  361 ? -49.846 13.911 -26.323 1.00 94.86  ? 358 LEU A CD2   1 
ATOM   2811 N  N     . GLY A  1  362 ? -54.819 14.512 -24.014 1.00 110.01 ? 359 GLY A N     1 
ATOM   2812 C  CA    . GLY A  1  362 ? -55.991 14.052 -23.293 1.00 105.34 ? 359 GLY A CA    1 
ATOM   2813 C  C     . GLY A  1  362 ? -56.018 14.514 -21.850 1.00 99.24  ? 359 GLY A C     1 
ATOM   2814 O  O     . GLY A  1  362 ? -56.960 14.214 -21.111 1.00 86.69  ? 359 GLY A O     1 
ATOM   2815 N  N     . ASN A  1  363 ? -54.992 15.250 -21.437 1.00 104.08 ? 360 ASN A N     1 
ATOM   2816 C  CA    . ASN A  1  363 ? -54.867 15.681 -20.055 1.00 102.53 ? 360 ASN A CA    1 
ATOM   2817 C  C     . ASN A  1  363 ? -55.500 17.056 -19.853 1.00 93.31  ? 360 ASN A C     1 
ATOM   2818 O  O     . ASN A  1  363 ? -55.895 17.738 -20.799 1.00 86.58  ? 360 ASN A O     1 
ATOM   2819 C  CB    . ASN A  1  363 ? -53.398 15.718 -19.634 1.00 100.99 ? 360 ASN A CB    1 
ATOM   2820 C  CG    . ASN A  1  363 ? -52.601 14.555 -20.188 1.00 103.46 ? 360 ASN A CG    1 
ATOM   2821 O  OD1   . ASN A  1  363 ? -51.917 14.684 -21.203 1.00 104.83 ? 360 ASN A OD1   1 
ATOM   2822 N  ND2   . ASN A  1  363 ? -52.684 13.410 -19.522 1.00 105.42 ? 360 ASN A ND2   1 
ATOM   2823 N  N     . ASN A  1  364 ? -55.599 17.458 -18.589 1.00 92.06  ? 361 ASN A N     1 
ATOM   2824 C  CA    . ASN A  1  364 ? -55.926 18.837 -18.261 1.00 82.02  ? 361 ASN A CA    1 
ATOM   2825 C  C     . ASN A  1  364 ? -54.655 19.674 -18.263 1.00 78.98  ? 361 ASN A C     1 
ATOM   2826 O  O     . ASN A  1  364 ? -53.608 19.242 -17.773 1.00 85.53  ? 361 ASN A O     1 
ATOM   2827 C  CB    . ASN A  1  364 ? -56.612 18.927 -16.898 1.00 83.38  ? 361 ASN A CB    1 
ATOM   2828 C  CG    . ASN A  1  364 ? -58.088 18.585 -16.963 1.00 91.44  ? 361 ASN A CG    1 
ATOM   2829 O  OD1   . ASN A  1  364 ? -58.559 17.991 -17.932 1.00 99.80  ? 361 ASN A OD1   1 
ATOM   2830 N  ND2   . ASN A  1  364 ? -58.829 18.964 -15.927 1.00 91.40  ? 361 ASN A ND2   1 
ATOM   2831 N  N     . ARG A  1  365 ? -54.747 20.875 -18.826 1.00 69.22  ? 362 ARG A N     1 
ATOM   2832 C  CA    . ARG A  1  365 ? -53.592 21.755 -18.926 1.00 69.41  ? 362 ARG A CA    1 
ATOM   2833 C  C     . ARG A  1  365 ? -54.033 23.186 -18.670 1.00 68.24  ? 362 ARG A C     1 
ATOM   2834 O  O     . ARG A  1  365 ? -55.020 23.650 -19.250 1.00 73.71  ? 362 ARG A O     1 
ATOM   2835 C  CB    . ARG A  1  365 ? -52.923 21.626 -20.300 1.00 69.67  ? 362 ARG A CB    1 
ATOM   2836 C  CG    . ARG A  1  365 ? -51.466 22.062 -20.336 1.00 73.82  ? 362 ARG A CG    1 
ATOM   2837 C  CD    . ARG A  1  365 ? -50.770 21.544 -21.588 1.00 70.60  ? 362 ARG A CD    1 
ATOM   2838 N  NE    . ARG A  1  365 ? -49.473 22.180 -21.799 1.00 65.83  ? 362 ARG A NE    1 
ATOM   2839 C  CZ    . ARG A  1  365 ? -48.353 21.817 -21.183 1.00 73.10  ? 362 ARG A CZ    1 
ATOM   2840 N  NH1   . ARG A  1  365 ? -48.364 20.823 -20.305 1.00 77.23  ? 362 ARG A NH1   1 
ATOM   2841 N  NH2   . ARG A  1  365 ? -47.219 22.455 -21.440 1.00 70.24  ? 362 ARG A NH2   1 
ATOM   2842 N  N     . THR A  1  366 ? -53.315 23.871 -17.786 1.00 69.27  ? 363 THR A N     1 
ATOM   2843 C  CA    . THR A  1  366 ? -53.554 25.277 -17.496 1.00 68.52  ? 363 THR A CA    1 
ATOM   2844 C  C     . THR A  1  366 ? -52.573 26.101 -18.318 1.00 72.64  ? 363 THR A C     1 
ATOM   2845 O  O     . THR A  1  366 ? -51.356 25.991 -18.131 1.00 86.67  ? 363 THR A O     1 
ATOM   2846 C  CB    . THR A  1  366 ? -53.389 25.570 -16.005 1.00 65.75  ? 363 THR A CB    1 
ATOM   2847 O  OG1   . THR A  1  366 ? -54.245 24.700 -15.251 1.00 70.55  ? 363 THR A OG1   1 
ATOM   2848 C  CG2   . THR A  1  366 ? -53.742 27.022 -15.703 1.00 65.49  ? 363 THR A CG2   1 
ATOM   2849 N  N     . VAL A  1  367 ? -53.101 26.917 -19.232 1.00 59.92  ? 364 VAL A N     1 
ATOM   2850 C  CA    . VAL A  1  367 ? -52.283 27.619 -20.210 1.00 58.61  ? 364 VAL A CA    1 
ATOM   2851 C  C     . VAL A  1  367 ? -52.661 29.094 -20.243 1.00 57.51  ? 364 VAL A C     1 
ATOM   2852 O  O     . VAL A  1  367 ? -53.767 29.491 -19.870 1.00 60.19  ? 364 VAL A O     1 
ATOM   2853 C  CB    . VAL A  1  367 ? -52.419 27.005 -21.620 1.00 58.46  ? 364 VAL A CB    1 
ATOM   2854 C  CG1   . VAL A  1  367 ? -51.983 25.545 -21.611 1.00 59.63  ? 364 VAL A CG1   1 
ATOM   2855 C  CG2   . VAL A  1  367 ? -53.849 27.139 -22.119 1.00 61.44  ? 364 VAL A CG2   1 
ATOM   2856 N  N     . SER A  1  368 ? -51.712 29.906 -20.700 1.00 56.43  ? 365 SER A N     1 
ATOM   2857 C  CA    . SER A  1  368 ? -51.954 31.326 -20.894 1.00 63.00  ? 365 SER A CA    1 
ATOM   2858 C  C     . SER A  1  368 ? -52.620 31.565 -22.242 1.00 58.44  ? 365 SER A C     1 
ATOM   2859 O  O     . SER A  1  368 ? -52.369 30.854 -23.220 1.00 59.52  ? 365 SER A O     1 
ATOM   2860 C  CB    . SER A  1  368 ? -50.647 32.116 -20.812 1.00 58.86  ? 365 SER A CB    1 
ATOM   2861 O  OG    . SER A  1  368 ? -50.852 33.472 -21.172 1.00 56.41  ? 365 SER A OG    1 
ATOM   2862 N  N     . ILE A  1  369 ? -53.484 32.583 -22.283 1.00 56.47  ? 366 ILE A N     1 
ATOM   2863 C  CA    . ILE A  1  369 ? -54.197 32.916 -23.509 1.00 62.05  ? 366 ILE A CA    1 
ATOM   2864 C  C     . ILE A  1  369 ? -53.241 33.362 -24.608 1.00 59.73  ? 366 ILE A C     1 
ATOM   2865 O  O     . ILE A  1  369 ? -53.563 33.246 -25.794 1.00 62.45  ? 366 ILE A O     1 
ATOM   2866 C  CB    . ILE A  1  369 ? -55.267 33.993 -23.220 1.00 63.37  ? 366 ILE A CB    1 
ATOM   2867 C  CG1   . ILE A  1  369 ? -56.222 34.152 -24.405 1.00 70.33  ? 366 ILE A CG1   1 
ATOM   2868 C  CG2   . ILE A  1  369 ? -54.612 35.324 -22.868 1.00 68.84  ? 366 ILE A CG2   1 
ATOM   2869 C  CD1   . ILE A  1  369 ? -57.144 35.346 -24.284 1.00 76.84  ? 366 ILE A CD1   1 
ATOM   2870 N  N     . ASP A  1  370 ? -52.056 33.863 -24.239 1.00 53.99  ? 367 ASP A N     1 
ATOM   2871 C  CA    . ASP A  1  370 ? -51.069 34.266 -25.235 1.00 55.35  ? 367 ASP A CA    1 
ATOM   2872 C  C     . ASP A  1  370 ? -50.496 33.079 -25.999 1.00 57.25  ? 367 ASP A C     1 
ATOM   2873 O  O     . ASP A  1  370 ? -49.895 33.275 -27.060 1.00 64.47  ? 367 ASP A O     1 
ATOM   2874 C  CB    . ASP A  1  370 ? -49.928 35.046 -24.579 1.00 50.89  ? 367 ASP A CB    1 
ATOM   2875 C  CG    . ASP A  1  370 ? -50.339 36.446 -24.170 1.00 65.93  ? 367 ASP A CG    1 
ATOM   2876 O  OD1   . ASP A  1  370 ? -51.459 36.861 -24.525 1.00 55.84  ? 367 ASP A OD1   1 
ATOM   2877 O  OD2   . ASP A  1  370 ? -49.536 37.136 -23.505 1.00 69.03  ? 367 ASP A OD2   1 
ATOM   2878 N  N     . ASN A  1  371 ? -50.654 31.862 -25.481 1.00 59.08  ? 368 ASN A N     1 
ATOM   2879 C  CA    . ASN A  1  371 ? -50.234 30.651 -26.171 1.00 53.06  ? 368 ASN A CA    1 
ATOM   2880 C  C     . ASN A  1  371 ? -51.427 29.881 -26.727 1.00 57.81  ? 368 ASN A C     1 
ATOM   2881 O  O     . ASN A  1  371 ? -51.382 28.658 -26.871 1.00 54.55  ? 368 ASN A O     1 
ATOM   2882 C  CB    . ASN A  1  371 ? -49.401 29.770 -25.241 1.00 53.94  ? 368 ASN A CB    1 
ATOM   2883 C  CG    . ASN A  1  371 ? -48.024 30.349 -24.977 1.00 66.30  ? 368 ASN A CG    1 
ATOM   2884 O  OD1   . ASN A  1  371 ? -47.363 30.844 -25.889 1.00 72.99  ? 368 ASN A OD1   1 
ATOM   2885 N  ND2   . ASN A  1  371 ? -47.591 30.301 -23.723 1.00 54.76  ? 368 ASN A ND2   1 
ATOM   2886 N  N     . LEU A  1  372 ? -52.505 30.596 -27.041 1.00 58.72  ? 369 LEU A N     1 
ATOM   2887 C  CA    . LEU A  1  372 ? -53.700 30.011 -27.624 1.00 61.21  ? 369 LEU A CA    1 
ATOM   2888 C  C     . LEU A  1  372 ? -54.157 30.852 -28.803 1.00 60.94  ? 369 LEU A C     1 
ATOM   2889 O  O     . LEU A  1  372 ? -53.895 32.056 -28.870 1.00 67.40  ? 369 LEU A O     1 
ATOM   2890 C  CB    . LEU A  1  372 ? -54.852 29.921 -26.616 1.00 58.82  ? 369 LEU A CB    1 
ATOM   2891 C  CG    . LEU A  1  372 ? -54.774 28.927 -25.462 1.00 61.23  ? 369 LEU A CG    1 
ATOM   2892 C  CD1   . LEU A  1  372 ? -56.111 28.878 -24.761 1.00 56.77  ? 369 LEU A CD1   1 
ATOM   2893 C  CD2   . LEU A  1  372 ? -54.391 27.552 -25.961 1.00 66.27  ? 369 LEU A CD2   1 
ATOM   2894 N  N     . LYS A  1  373 ? -54.844 30.201 -29.732 1.00 62.01  ? 370 LYS A N     1 
ATOM   2895 C  CA    . LYS A  1  373 ? -55.627 30.901 -30.731 1.00 55.92  ? 370 LYS A CA    1 
ATOM   2896 C  C     . LYS A  1  373 ? -57.003 30.256 -30.811 1.00 58.38  ? 370 LYS A C     1 
ATOM   2897 O  O     . LYS A  1  373 ? -57.142 29.051 -30.587 1.00 61.16  ? 370 LYS A O     1 
ATOM   2898 C  CB    . LYS A  1  373 ? -54.959 30.878 -32.115 1.00 56.93  ? 370 LYS A CB    1 
ATOM   2899 C  CG    . LYS A  1  373 ? -55.077 29.568 -32.883 1.00 53.18  ? 370 LYS A CG    1 
ATOM   2900 C  CD    . LYS A  1  373 ? -54.557 29.727 -34.305 1.00 62.13  ? 370 LYS A CD    1 
ATOM   2901 C  CE    . LYS A  1  373 ? -54.598 28.417 -35.076 1.00 63.57  ? 370 LYS A CE    1 
ATOM   2902 N  NZ    . LYS A  1  373 ? -54.364 28.633 -36.532 1.00 65.02  ? 370 LYS A NZ    1 
ATOM   2903 N  N     . PRO A  1  374 ? -58.041 31.044 -31.083 1.00 60.61  ? 371 PRO A N     1 
ATOM   2904 C  CA    . PRO A  1  374 ? -59.348 30.449 -31.371 1.00 57.13  ? 371 PRO A CA    1 
ATOM   2905 C  C     . PRO A  1  374 ? -59.310 29.756 -32.724 1.00 59.45  ? 371 PRO A C     1 
ATOM   2906 O  O     . PRO A  1  374 ? -58.806 30.305 -33.706 1.00 66.06  ? 371 PRO A O     1 
ATOM   2907 C  CB    . PRO A  1  374 ? -60.298 31.651 -31.373 1.00 57.36  ? 371 PRO A CB    1 
ATOM   2908 C  CG    . PRO A  1  374 ? -59.429 32.807 -31.719 1.00 63.08  ? 371 PRO A CG    1 
ATOM   2909 C  CD    . PRO A  1  374 ? -58.087 32.517 -31.103 1.00 64.01  ? 371 PRO A CD    1 
ATOM   2910 N  N     . THR A  1  375 ? -59.821 28.527 -32.762 1.00 61.59  ? 372 THR A N     1 
ATOM   2911 C  CA    . THR A  1  375 ? -59.871 27.785 -34.010 1.00 64.46  ? 372 THR A CA    1 
ATOM   2912 C  C     . THR A  1  375 ? -60.817 28.483 -34.980 1.00 62.15  ? 372 THR A C     1 
ATOM   2913 O  O     . THR A  1  375 ? -61.965 28.782 -34.639 1.00 65.12  ? 372 THR A O     1 
ATOM   2914 C  CB    . THR A  1  375 ? -60.324 26.347 -33.760 1.00 65.16  ? 372 THR A CB    1 
ATOM   2915 O  OG1   . THR A  1  375 ? -59.437 25.723 -32.823 1.00 64.22  ? 372 THR A OG1   1 
ATOM   2916 C  CG2   . THR A  1  375 ? -60.312 25.554 -35.058 1.00 58.92  ? 372 THR A CG2   1 
ATOM   2917 N  N     . SER A  1  376 ? -60.329 28.754 -36.187 1.00 67.84  ? 373 SER A N     1 
ATOM   2918 C  CA    . SER A  1  376 ? -61.098 29.515 -37.154 1.00 61.49  ? 373 SER A CA    1 
ATOM   2919 C  C     . SER A  1  376 ? -62.216 28.673 -37.766 1.00 63.98  ? 373 SER A C     1 
ATOM   2920 O  O     . SER A  1  376 ? -62.153 27.439 -37.822 1.00 69.04  ? 373 SER A O     1 
ATOM   2921 C  CB    . SER A  1  376 ? -60.181 30.068 -38.251 1.00 55.06  ? 373 SER A CB    1 
ATOM   2922 O  OG    . SER A  1  376 ? -59.259 31.018 -37.735 1.00 67.80  ? 373 SER A OG    1 
ATOM   2923 N  N     . HIS A  1  377 ? -63.261 29.366 -38.226 1.00 62.34  ? 374 HIS A N     1 
ATOM   2924 C  CA    . HIS A  1  377 ? -64.404 28.756 -38.914 1.00 67.69  ? 374 HIS A CA    1 
ATOM   2925 C  C     . HIS A  1  377 ? -65.159 27.797 -37.997 1.00 77.36  ? 374 HIS A C     1 
ATOM   2926 O  O     . HIS A  1  377 ? -65.821 26.868 -38.466 1.00 76.94  ? 374 HIS A O     1 
ATOM   2927 C  CB    . HIS A  1  377 ? -63.971 28.050 -40.201 1.00 64.05  ? 374 HIS A CB    1 
ATOM   2928 C  CG    . HIS A  1  377 ? -62.802 28.693 -40.883 1.00 65.24  ? 374 HIS A CG    1 
ATOM   2929 N  ND1   . HIS A  1  377 ? -62.827 29.995 -41.339 1.00 63.59  ? 374 HIS A ND1   1 
ATOM   2930 C  CD2   . HIS A  1  377 ? -61.570 28.213 -41.179 1.00 63.47  ? 374 HIS A CD2   1 
ATOM   2931 C  CE1   . HIS A  1  377 ? -61.660 30.287 -41.887 1.00 59.34  ? 374 HIS A CE1   1 
ATOM   2932 N  NE2   . HIS A  1  377 ? -60.880 29.224 -41.803 1.00 57.71  ? 374 HIS A NE2   1 
ATOM   2933 N  N     . GLN A  1  378 ? -65.058 28.027 -36.690 1.00 89.79  ? 375 GLN A N     1 
ATOM   2934 C  CA    . GLN A  1  378 ? -65.779 27.246 -35.691 1.00 89.54  ? 375 GLN A CA    1 
ATOM   2935 C  C     . GLN A  1  378 ? -65.461 25.756 -35.764 1.00 85.58  ? 375 GLN A C     1 
ATOM   2936 O  O     . GLN A  1  378 ? -64.320 25.360 -35.997 1.00 78.17  ? 375 GLN A O     1 
ATOM   2937 C  CB    . GLN A  1  378 ? -67.290 27.450 -35.841 1.00 87.34  ? 375 GLN A CB    1 
ATOM   2938 C  CG    . GLN A  1  378 ? -67.743 28.888 -35.683 1.00 92.67  ? 375 GLN A CG    1 
ATOM   2939 C  CD    . GLN A  1  378 ? -69.222 29.078 -35.966 1.00 105.57 ? 375 GLN A CD    1 
ATOM   2940 O  OE1   . GLN A  1  378 ? -69.894 28.180 -36.474 1.00 113.27 ? 375 GLN A OE1   1 
ATOM   2941 N  NE2   . GLN A  1  378 ? -69.734 30.257 -35.637 1.00 104.20 ? 375 GLN A NE2   1 
ATOM   2942 N  N     . ASP B  1  119 ? -31.565 63.224 22.567  1.00 135.87 ? 116 ASP B N     1 
ATOM   2943 C  CA    . ASP B  1  119 ? -30.845 62.234 21.776  1.00 135.57 ? 116 ASP B CA    1 
ATOM   2944 C  C     . ASP B  1  119 ? -31.802 61.522 20.821  1.00 128.35 ? 116 ASP B C     1 
ATOM   2945 O  O     . ASP B  1  119 ? -33.000 61.431 21.084  1.00 132.60 ? 116 ASP B O     1 
ATOM   2946 C  CB    . ASP B  1  119 ? -30.146 61.224 22.689  1.00 135.81 ? 116 ASP B CB    1 
ATOM   2947 C  CG    . ASP B  1  119 ? -28.919 60.608 22.046  1.00 135.01 ? 116 ASP B CG    1 
ATOM   2948 O  OD1   . ASP B  1  119 ? -28.890 60.487 20.803  1.00 135.15 ? 116 ASP B OD1   1 
ATOM   2949 O  OD2   . ASP B  1  119 ? -27.980 60.245 22.786  1.00 131.79 ? 116 ASP B OD2   1 
ATOM   2950 N  N     . ARG B  1  120 ? -31.263 61.015 19.711  1.00 116.09 ? 117 ARG B N     1 
ATOM   2951 C  CA    . ARG B  1  120 ? -32.079 60.369 18.693  1.00 100.81 ? 117 ARG B CA    1 
ATOM   2952 C  C     . ARG B  1  120 ? -32.473 58.962 19.141  1.00 81.92  ? 117 ARG B C     1 
ATOM   2953 O  O     . ARG B  1  120 ? -31.658 58.249 19.735  1.00 72.56  ? 117 ARG B O     1 
ATOM   2954 C  CB    . ARG B  1  120 ? -31.322 60.295 17.368  1.00 101.90 ? 117 ARG B CB    1 
ATOM   2955 C  CG    . ARG B  1  120 ? -30.573 61.567 17.008  1.00 112.03 ? 117 ARG B CG    1 
ATOM   2956 C  CD    . ARG B  1  120 ? -31.490 62.620 16.409  1.00 118.04 ? 117 ARG B CD    1 
ATOM   2957 N  NE    . ARG B  1  120 ? -30.894 63.952 16.471  1.00 126.56 ? 117 ARG B NE    1 
ATOM   2958 C  CZ    . ARG B  1  120 ? -29.932 64.382 15.659  1.00 128.03 ? 117 ARG B CZ    1 
ATOM   2959 N  NH1   . ARG B  1  120 ? -29.443 63.584 14.719  1.00 119.66 ? 117 ARG B NH1   1 
ATOM   2960 N  NH2   . ARG B  1  120 ? -29.452 65.610 15.792  1.00 130.72 ? 117 ARG B NH2   1 
ATOM   2961 N  N     . PRO B  1  121 ? -33.711 58.543 18.873  1.00 75.35  ? 118 PRO B N     1 
ATOM   2962 C  CA    . PRO B  1  121 ? -34.123 57.181 19.234  1.00 68.32  ? 118 PRO B CA    1 
ATOM   2963 C  C     . PRO B  1  121 ? -33.270 56.134 18.533  1.00 78.47  ? 118 PRO B C     1 
ATOM   2964 O  O     . PRO B  1  121 ? -32.805 56.328 17.408  1.00 80.84  ? 118 PRO B O     1 
ATOM   2965 C  CB    . PRO B  1  121 ? -35.582 57.117 18.767  1.00 68.62  ? 118 PRO B CB    1 
ATOM   2966 C  CG    . PRO B  1  121 ? -36.034 58.539 18.744  1.00 71.27  ? 118 PRO B CG    1 
ATOM   2967 C  CD    . PRO B  1  121 ? -34.829 59.339 18.340  1.00 73.19  ? 118 PRO B CD    1 
ATOM   2968 N  N     . GLN B  1  122 ? -33.064 55.014 19.221  1.00 77.85  ? 119 GLN B N     1 
ATOM   2969 C  CA    . GLN B  1  122 ? -32.242 53.939 18.680  1.00 75.44  ? 119 GLN B CA    1 
ATOM   2970 C  C     . GLN B  1  122 ? -32.973 53.235 17.544  1.00 67.49  ? 119 GLN B C     1 
ATOM   2971 O  O     . GLN B  1  122 ? -34.195 53.065 17.578  1.00 66.43  ? 119 GLN B O     1 
ATOM   2972 C  CB    . GLN B  1  122 ? -31.881 52.945 19.783  1.00 87.83  ? 119 GLN B CB    1 
ATOM   2973 C  CG    . GLN B  1  122 ? -30.793 51.951 19.401  1.00 104.17 ? 119 GLN B CG    1 
ATOM   2974 C  CD    . GLN B  1  122 ? -30.351 51.095 20.573  1.00 111.15 ? 119 GLN B CD    1 
ATOM   2975 O  OE1   . GLN B  1  122 ? -30.790 51.297 21.704  1.00 105.50 ? 119 GLN B OE1   1 
ATOM   2976 N  NE2   . GLN B  1  122 ? -29.475 50.133 20.306  1.00 110.61 ? 119 GLN B NE2   1 
ATOM   2977 N  N     . LYS B  1  123 ? -32.218 52.822 16.535  1.00 69.11  ? 120 LYS B N     1 
ATOM   2978 C  CA    . LYS B  1  123 ? -32.767 52.324 15.285  1.00 62.39  ? 120 LYS B CA    1 
ATOM   2979 C  C     . LYS B  1  123 ? -32.014 51.077 14.854  1.00 66.78  ? 120 LYS B C     1 
ATOM   2980 O  O     . LYS B  1  123 ? -30.872 50.859 15.274  1.00 62.26  ? 120 LYS B O     1 
ATOM   2981 C  CB    . LYS B  1  123 ? -32.677 53.388 14.185  1.00 60.94  ? 120 LYS B CB    1 
ATOM   2982 C  CG    . LYS B  1  123 ? -33.582 54.575 14.417  1.00 59.89  ? 120 LYS B CG    1 
ATOM   2983 C  CD    . LYS B  1  123 ? -35.032 54.136 14.459  1.00 60.14  ? 120 LYS B CD    1 
ATOM   2984 C  CE    . LYS B  1  123 ? -35.944 55.311 14.726  1.00 62.44  ? 120 LYS B CE    1 
ATOM   2985 N  NZ    . LYS B  1  123 ? -35.705 56.421 13.763  1.00 67.33  ? 120 LYS B NZ    1 
ATOM   2986 N  N     . PRO B  1  124 ? -32.626 50.238 14.015  1.00 66.09  ? 121 PRO B N     1 
ATOM   2987 C  CA    . PRO B  1  124 ? -31.873 49.134 13.417  1.00 56.75  ? 121 PRO B CA    1 
ATOM   2988 C  C     . PRO B  1  124 ? -30.701 49.675 12.617  1.00 56.67  ? 121 PRO B C     1 
ATOM   2989 O  O     . PRO B  1  124 ? -30.714 50.819 12.156  1.00 68.76  ? 121 PRO B O     1 
ATOM   2990 C  CB    . PRO B  1  124 ? -32.899 48.444 12.510  1.00 57.80  ? 121 PRO B CB    1 
ATOM   2991 C  CG    . PRO B  1  124 ? -34.232 48.891 13.013  1.00 61.46  ? 121 PRO B CG    1 
ATOM   2992 C  CD    . PRO B  1  124 ? -34.026 50.267 13.558  1.00 66.77  ? 121 PRO B CD    1 
ATOM   2993 N  N     . PHE B  1  125 ? -29.669 48.845 12.476  1.00 56.25  ? 122 PHE B N     1 
ATOM   2994 C  CA    . PHE B  1  125 ? -28.435 49.150 11.756  1.00 56.06  ? 122 PHE B CA    1 
ATOM   2995 C  C     . PHE B  1  125 ? -27.608 50.227 12.448  1.00 59.08  ? 122 PHE B C     1 
ATOM   2996 O  O     . PHE B  1  125 ? -26.563 50.618 11.916  1.00 57.17  ? 122 PHE B O     1 
ATOM   2997 C  CB    . PHE B  1  125 ? -28.702 49.572 10.303  1.00 51.15  ? 122 PHE B CB    1 
ATOM   2998 C  CG    . PHE B  1  125 ? -29.686 48.690 9.592   1.00 54.34  ? 122 PHE B CG    1 
ATOM   2999 C  CD1   . PHE B  1  125 ? -29.564 47.313 9.655   1.00 53.90  ? 122 PHE B CD1   1 
ATOM   3000 C  CD2   . PHE B  1  125 ? -30.745 49.232 8.881   1.00 61.51  ? 122 PHE B CD2   1 
ATOM   3001 C  CE1   . PHE B  1  125 ? -30.469 46.492 9.017   1.00 53.95  ? 122 PHE B CE1   1 
ATOM   3002 C  CE2   . PHE B  1  125 ? -31.654 48.413 8.236   1.00 55.46  ? 122 PHE B CE2   1 
ATOM   3003 C  CZ    . PHE B  1  125 ? -31.514 47.042 8.303   1.00 49.96  ? 122 PHE B CZ    1 
ATOM   3004 N  N     . ASP B  1  126 ? -28.037 50.725 13.612  1.00 60.63  ? 123 ASP B N     1 
ATOM   3005 C  CA    . ASP B  1  126 ? -27.211 51.670 14.355  1.00 57.16  ? 123 ASP B CA    1 
ATOM   3006 C  C     . ASP B  1  126 ? -25.953 50.997 14.887  1.00 56.20  ? 123 ASP B C     1 
ATOM   3007 O  O     . ASP B  1  126 ? -24.875 51.602 14.895  1.00 59.32  ? 123 ASP B O     1 
ATOM   3008 C  CB    . ASP B  1  126 ? -28.003 52.286 15.508  1.00 58.23  ? 123 ASP B CB    1 
ATOM   3009 C  CG    . ASP B  1  126 ? -28.818 53.491 15.081  1.00 71.71  ? 123 ASP B CG    1 
ATOM   3010 O  OD1   . ASP B  1  126 ? -28.666 53.933 13.924  1.00 85.21  ? 123 ASP B OD1   1 
ATOM   3011 O  OD2   . ASP B  1  126 ? -29.600 54.006 15.909  1.00 75.96  ? 123 ASP B OD2   1 
ATOM   3012 N  N     . LYS B  1  127 ? -26.068 49.746 15.329  1.00 57.22  ? 124 LYS B N     1 
ATOM   3013 C  CA    . LYS B  1  127 ? -24.936 49.064 15.937  1.00 56.42  ? 124 LYS B CA    1 
ATOM   3014 C  C     . LYS B  1  127 ? -25.113 47.561 15.786  1.00 53.62  ? 124 LYS B C     1 
ATOM   3015 O  O     . LYS B  1  127 ? -26.178 47.024 16.107  1.00 58.54  ? 124 LYS B O     1 
ATOM   3016 C  CB    . LYS B  1  127 ? -24.800 49.442 17.419  1.00 55.25  ? 124 LYS B CB    1 
ATOM   3017 C  CG    . LYS B  1  127 ? -23.494 49.003 18.055  1.00 63.15  ? 124 LYS B CG    1 
ATOM   3018 C  CD    . LYS B  1  127 ? -23.348 49.545 19.470  1.00 69.34  ? 124 LYS B CD    1 
ATOM   3019 C  CE    . LYS B  1  127 ? -23.209 51.060 19.486  1.00 74.62  ? 124 LYS B CE    1 
ATOM   3020 N  NZ    . LYS B  1  127 ? -22.843 51.561 20.841  1.00 78.80  ? 124 LYS B NZ    1 
ATOM   3021 N  N     . PHE B  1  128 ? -24.076 46.894 15.288  1.00 58.60  ? 125 PHE B N     1 
ATOM   3022 C  CA    . PHE B  1  128 ? -24.017 45.442 15.216  1.00 58.44  ? 125 PHE B CA    1 
ATOM   3023 C  C     . PHE B  1  128 ? -23.026 44.936 16.254  1.00 61.87  ? 125 PHE B C     1 
ATOM   3024 O  O     . PHE B  1  128 ? -21.907 45.449 16.353  1.00 63.49  ? 125 PHE B O     1 
ATOM   3025 C  CB    . PHE B  1  128 ? -23.593 44.964 13.824  1.00 59.73  ? 125 PHE B CB    1 
ATOM   3026 C  CG    . PHE B  1  128 ? -24.702 44.957 12.806  1.00 55.12  ? 125 PHE B CG    1 
ATOM   3027 C  CD1   . PHE B  1  128 ? -25.972 45.403 13.130  1.00 62.61  ? 125 PHE B CD1   1 
ATOM   3028 C  CD2   . PHE B  1  128 ? -24.470 44.485 11.523  1.00 54.05  ? 125 PHE B CD2   1 
ATOM   3029 C  CE1   . PHE B  1  128 ? -26.986 45.390 12.187  1.00 63.21  ? 125 PHE B CE1   1 
ATOM   3030 C  CE2   . PHE B  1  128 ? -25.478 44.470 10.579  1.00 49.05  ? 125 PHE B CE2   1 
ATOM   3031 C  CZ    . PHE B  1  128 ? -26.737 44.922 10.911  1.00 49.14  ? 125 PHE B CZ    1 
ATOM   3032 N  N     . PHE B  1  129 ? -23.437 43.934 17.025  1.00 59.75  ? 126 PHE B N     1 
ATOM   3033 C  CA    . PHE B  1  129 ? -22.562 43.271 17.980  1.00 57.84  ? 126 PHE B CA    1 
ATOM   3034 C  C     . PHE B  1  129 ? -22.133 41.931 17.397  1.00 55.78  ? 126 PHE B C     1 
ATOM   3035 O  O     . PHE B  1  129 ? -22.979 41.103 17.044  1.00 62.25  ? 126 PHE B O     1 
ATOM   3036 C  CB    . PHE B  1  129 ? -23.260 43.080 19.327  1.00 57.21  ? 126 PHE B CB    1 
ATOM   3037 C  CG    . PHE B  1  129 ? -23.528 44.365 20.056  1.00 58.44  ? 126 PHE B CG    1 
ATOM   3038 C  CD1   . PHE B  1  129 ? -24.679 45.093 19.803  1.00 61.66  ? 126 PHE B CD1   1 
ATOM   3039 C  CD2   . PHE B  1  129 ? -22.629 44.850 20.991  1.00 65.95  ? 126 PHE B CD2   1 
ATOM   3040 C  CE1   . PHE B  1  129 ? -24.930 46.277 20.469  1.00 66.25  ? 126 PHE B CE1   1 
ATOM   3041 C  CE2   . PHE B  1  129 ? -22.874 46.037 21.658  1.00 57.18  ? 126 PHE B CE2   1 
ATOM   3042 C  CZ    . PHE B  1  129 ? -24.027 46.747 21.400  1.00 57.10  ? 126 PHE B CZ    1 
ATOM   3043 N  N     . ILE B  1  130 ? -20.823 41.726 17.283  1.00 53.23  ? 127 ILE B N     1 
ATOM   3044 C  CA    . ILE B  1  130 ? -20.287 40.505 16.703  1.00 57.97  ? 127 ILE B CA    1 
ATOM   3045 C  C     . ILE B  1  130 ? -19.392 39.813 17.720  1.00 65.78  ? 127 ILE B C     1 
ATOM   3046 O  O     . ILE B  1  130 ? -18.815 40.448 18.609  1.00 73.01  ? 127 ILE B O     1 
ATOM   3047 C  CB    . ILE B  1  130 ? -19.518 40.768 15.389  1.00 56.25  ? 127 ILE B CB    1 
ATOM   3048 C  CG1   . ILE B  1  130 ? -18.243 41.568 15.656  1.00 60.32  ? 127 ILE B CG1   1 
ATOM   3049 C  CG2   . ILE B  1  130 ? -20.408 41.491 14.388  1.00 53.25  ? 127 ILE B CG2   1 
ATOM   3050 C  CD1   . ILE B  1  130 ? -17.368 41.720 14.433  1.00 69.42  ? 127 ILE B CD1   1 
ATOM   3051 N  N     . ASP B  1  131 ? -19.286 38.492 17.582  1.00 67.22  ? 128 ASP B N     1 
ATOM   3052 C  CA    . ASP B  1  131 ? -18.481 37.658 18.464  1.00 72.05  ? 128 ASP B CA    1 
ATOM   3053 C  C     . ASP B  1  131 ? -18.395 36.269 17.850  1.00 66.35  ? 128 ASP B C     1 
ATOM   3054 O  O     . ASP B  1  131 ? -19.201 35.904 16.989  1.00 71.09  ? 128 ASP B O     1 
ATOM   3055 C  CB    . ASP B  1  131 ? -19.075 37.591 19.877  1.00 81.49  ? 128 ASP B CB    1 
ATOM   3056 C  CG    . ASP B  1  131 ? -18.072 37.119 20.911  1.00 95.48  ? 128 ASP B CG    1 
ATOM   3057 O  OD1   . ASP B  1  131 ? -16.883 37.484 20.800  1.00 103.68 ? 128 ASP B OD1   1 
ATOM   3058 O  OD2   . ASP B  1  131 ? -18.474 36.383 21.837  1.00 98.30  ? 128 ASP B OD2   1 
ATOM   3059 N  N     . TYR B  1  132 ? -17.412 35.497 18.304  1.00 58.94  ? 129 TYR B N     1 
ATOM   3060 C  CA    . TYR B  1  132 ? -17.187 34.146 17.810  1.00 59.45  ? 129 TYR B CA    1 
ATOM   3061 C  C     . TYR B  1  132 ? -17.566 33.116 18.864  1.00 62.87  ? 129 TYR B C     1 
ATOM   3062 O  O     . TYR B  1  132 ? -17.281 33.291 20.053  1.00 67.16  ? 129 TYR B O     1 
ATOM   3063 C  CB    . TYR B  1  132 ? -15.726 33.943 17.398  1.00 62.14  ? 129 TYR B CB    1 
ATOM   3064 C  CG    . TYR B  1  132 ? -15.459 34.241 15.941  1.00 62.77  ? 129 TYR B CG    1 
ATOM   3065 C  CD1   . TYR B  1  132 ? -15.946 33.405 14.944  1.00 73.01  ? 129 TYR B CD1   1 
ATOM   3066 C  CD2   . TYR B  1  132 ? -14.715 35.349 15.563  1.00 59.74  ? 129 TYR B CD2   1 
ATOM   3067 C  CE1   . TYR B  1  132 ? -15.703 33.670 13.610  1.00 67.85  ? 129 TYR B CE1   1 
ATOM   3068 C  CE2   . TYR B  1  132 ? -14.467 35.621 14.233  1.00 60.12  ? 129 TYR B CE2   1 
ATOM   3069 C  CZ    . TYR B  1  132 ? -14.964 34.778 13.259  1.00 66.16  ? 129 TYR B CZ    1 
ATOM   3070 O  OH    . TYR B  1  132 ? -14.721 35.043 11.931  1.00 65.53  ? 129 TYR B OH    1 
ATOM   3071 N  N     . ILE B  1  133 ? -18.212 32.042 18.417  1.00 66.72  ? 130 ILE B N     1 
ATOM   3072 C  CA    . ILE B  1  133 ? -18.549 30.897 19.256  1.00 66.14  ? 130 ILE B CA    1 
ATOM   3073 C  C     . ILE B  1  133 ? -17.750 29.707 18.749  1.00 74.52  ? 130 ILE B C     1 
ATOM   3074 O  O     . ILE B  1  133 ? -17.895 29.303 17.588  1.00 71.61  ? 130 ILE B O     1 
ATOM   3075 C  CB    . ILE B  1  133 ? -20.054 30.593 19.235  1.00 68.25  ? 130 ILE B CB    1 
ATOM   3076 C  CG1   . ILE B  1  133 ? -20.843 31.689 19.954  1.00 74.99  ? 130 ILE B CG1   1 
ATOM   3077 C  CG2   . ILE B  1  133 ? -20.332 29.229 19.858  1.00 72.21  ? 130 ILE B CG2   1 
ATOM   3078 C  CD1   . ILE B  1  133 ? -22.323 31.389 20.072  1.00 75.36  ? 130 ILE B CD1   1 
ATOM   3079 N  N     . GLY B  1  134 ? -16.907 29.146 19.610  1.00 78.64  ? 131 GLY B N     1 
ATOM   3080 C  CA    . GLY B  1  134 ? -16.132 27.978 19.237  1.00 77.02  ? 131 GLY B CA    1 
ATOM   3081 C  C     . GLY B  1  134 ? -14.834 27.794 19.996  1.00 83.40  ? 131 GLY B C     1 
ATOM   3082 O  O     . GLY B  1  134 ? -14.513 28.585 20.884  1.00 89.52  ? 131 GLY B O     1 
ATOM   3083 N  N     . PRO B  1  135 ? -14.067 26.749 19.640  1.00 84.99  ? 132 PRO B N     1 
ATOM   3084 C  CA    . PRO B  1  135 ? -14.385 25.804 18.561  1.00 85.01  ? 132 PRO B CA    1 
ATOM   3085 C  C     . PRO B  1  135 ? -15.425 24.741 18.930  1.00 84.27  ? 132 PRO B C     1 
ATOM   3086 O  O     . PRO B  1  135 ? -15.469 24.267 20.065  1.00 89.96  ? 132 PRO B O     1 
ATOM   3087 C  CB    . PRO B  1  135 ? -13.032 25.148 18.270  1.00 82.96  ? 132 PRO B CB    1 
ATOM   3088 C  CG    . PRO B  1  135 ? -12.308 25.214 19.561  1.00 81.77  ? 132 PRO B CG    1 
ATOM   3089 C  CD    . PRO B  1  135 ? -12.726 26.509 20.202  1.00 81.23  ? 132 PRO B CD    1 
ATOM   3090 N  N     . LEU B  1  136 ? -16.251 24.386 17.957  1.00 83.15  ? 133 LEU B N     1 
ATOM   3091 C  CA    . LEU B  1  136 ? -17.293 23.379 18.068  1.00 82.46  ? 133 LEU B CA    1 
ATOM   3092 C  C     . LEU B  1  136 ? -16.833 22.078 17.429  1.00 91.64  ? 133 LEU B C     1 
ATOM   3093 O  O     . LEU B  1  136 ? -15.812 22.038 16.736  1.00 93.44  ? 133 LEU B O     1 
ATOM   3094 C  CB    . LEU B  1  136 ? -18.572 23.881 17.390  1.00 75.88  ? 133 LEU B CB    1 
ATOM   3095 C  CG    . LEU B  1  136 ? -19.156 25.214 17.859  1.00 78.08  ? 133 LEU B CG    1 
ATOM   3096 C  CD1   . LEU B  1  136 ? -20.364 25.584 17.013  1.00 76.17  ? 133 LEU B CD1   1 
ATOM   3097 C  CD2   . LEU B  1  136 ? -19.530 25.154 19.331  1.00 81.08  ? 133 LEU B CD2   1 
ATOM   3098 N  N     . PRO B  1  137 ? -17.552 20.979 17.652  1.00 91.35  ? 134 PRO B N     1 
ATOM   3099 C  CA    . PRO B  1  137 ? -17.265 19.747 16.908  1.00 94.04  ? 134 PRO B CA    1 
ATOM   3100 C  C     . PRO B  1  137 ? -17.365 19.990 15.414  1.00 87.80  ? 134 PRO B C     1 
ATOM   3101 O  O     . PRO B  1  137 ? -18.239 20.744 14.959  1.00 81.06  ? 134 PRO B O     1 
ATOM   3102 C  CB    . PRO B  1  137 ? -18.355 18.780 17.391  1.00 91.73  ? 134 PRO B CB    1 
ATOM   3103 C  CG    . PRO B  1  137 ? -18.696 19.262 18.751  1.00 90.83  ? 134 PRO B CG    1 
ATOM   3104 C  CD    . PRO B  1  137 ? -18.564 20.758 18.703  1.00 86.59  ? 134 PRO B CD    1 
ATOM   3105 N  N     . PRO B  1  138 ? -16.483 19.386 14.618  1.00 85.38  ? 135 PRO B N     1 
ATOM   3106 C  CA    . PRO B  1  138 ? -16.487 19.648 13.173  1.00 81.77  ? 135 PRO B CA    1 
ATOM   3107 C  C     . PRO B  1  138 ? -17.804 19.240 12.526  1.00 81.06  ? 135 PRO B C     1 
ATOM   3108 O  O     . PRO B  1  138 ? -18.294 18.125 12.715  1.00 87.66  ? 135 PRO B O     1 
ATOM   3109 C  CB    . PRO B  1  138 ? -15.317 18.801 12.657  1.00 84.64  ? 135 PRO B CB    1 
ATOM   3110 C  CG    . PRO B  1  138 ? -14.428 18.619 13.847  1.00 90.82  ? 135 PRO B CG    1 
ATOM   3111 C  CD    . PRO B  1  138 ? -15.355 18.529 15.023  1.00 90.76  ? 135 PRO B CD    1 
ATOM   3112 N  N     . SER B  1  139 ? -18.377 20.165 11.757  1.00 78.48  ? 136 SER B N     1 
ATOM   3113 C  CA    . SER B  1  139 ? -19.615 19.933 11.020  1.00 85.99  ? 136 SER B CA    1 
ATOM   3114 C  C     . SER B  1  139 ? -19.423 20.457 9.605   1.00 87.76  ? 136 SER B C     1 
ATOM   3115 O  O     . SER B  1  139 ? -19.407 21.674 9.388   1.00 82.73  ? 136 SER B O     1 
ATOM   3116 C  CB    . SER B  1  139 ? -20.804 20.616 11.698  1.00 83.70  ? 136 SER B CB    1 
ATOM   3117 O  OG    . SER B  1  139 ? -21.997 20.407 10.962  1.00 85.18  ? 136 SER B OG    1 
ATOM   3118 N  N     . GLN B  1  140 ? -19.272 19.538 8.650   1.00 91.25  ? 137 GLN B N     1 
ATOM   3119 C  CA    . GLN B  1  140 ? -19.027 19.878 7.248   1.00 94.57  ? 137 GLN B CA    1 
ATOM   3120 C  C     . GLN B  1  140 ? -17.816 20.795 7.101   1.00 90.60  ? 137 GLN B C     1 
ATOM   3121 O  O     . GLN B  1  140 ? -17.793 21.706 6.272   1.00 86.32  ? 137 GLN B O     1 
ATOM   3122 C  CB    . GLN B  1  140 ? -20.267 20.502 6.602   1.00 97.66  ? 137 GLN B CB    1 
ATOM   3123 C  CG    . GLN B  1  140 ? -21.465 19.569 6.527   1.00 110.16 ? 137 GLN B CG    1 
ATOM   3124 C  CD    . GLN B  1  140 ? -22.395 19.909 5.378   1.00 117.83 ? 137 GLN B CD    1 
ATOM   3125 O  OE1   . GLN B  1  140 ? -21.990 20.540 4.402   1.00 115.74 ? 137 GLN B OE1   1 
ATOM   3126 N  NE2   . GLN B  1  140 ? -23.650 19.489 5.488   1.00 120.13 ? 137 GLN B NE2   1 
ATOM   3127 N  N     . GLY B  1  141 ? -16.795 20.551 7.922   1.00 88.54  ? 138 GLY B N     1 
ATOM   3128 C  CA    . GLY B  1  141 ? -15.556 21.292 7.844   1.00 89.53  ? 138 GLY B CA    1 
ATOM   3129 C  C     . GLY B  1  141 ? -15.532 22.608 8.589   1.00 89.06  ? 138 GLY B C     1 
ATOM   3130 O  O     . GLY B  1  141 ? -14.488 23.273 8.596   1.00 87.48  ? 138 GLY B O     1 
ATOM   3131 N  N     . TYR B  1  142 ? -16.633 23.010 9.213   1.00 86.78  ? 139 TYR B N     1 
ATOM   3132 C  CA    . TYR B  1  142 ? -16.687 24.256 9.961   1.00 82.32  ? 139 TYR B CA    1 
ATOM   3133 C  C     . TYR B  1  142 ? -16.523 23.992 11.452  1.00 83.23  ? 139 TYR B C     1 
ATOM   3134 O  O     . TYR B  1  142 ? -16.923 22.944 11.967  1.00 81.20  ? 139 TYR B O     1 
ATOM   3135 C  CB    . TYR B  1  142 ? -18.001 24.995 9.699   1.00 82.82  ? 139 TYR B CB    1 
ATOM   3136 C  CG    . TYR B  1  142 ? -18.166 25.428 8.259   1.00 89.35  ? 139 TYR B CG    1 
ATOM   3137 C  CD1   . TYR B  1  142 ? -17.598 26.609 7.799   1.00 90.49  ? 139 TYR B CD1   1 
ATOM   3138 C  CD2   . TYR B  1  142 ? -18.885 24.652 7.359   1.00 92.25  ? 139 TYR B CD2   1 
ATOM   3139 C  CE1   . TYR B  1  142 ? -17.743 27.007 6.482   1.00 88.88  ? 139 TYR B CE1   1 
ATOM   3140 C  CE2   . TYR B  1  142 ? -19.035 25.042 6.041   1.00 93.48  ? 139 TYR B CE2   1 
ATOM   3141 C  CZ    . TYR B  1  142 ? -18.464 26.220 5.608   1.00 88.75  ? 139 TYR B CZ    1 
ATOM   3142 O  OH    . TYR B  1  142 ? -18.612 26.611 4.296   1.00 86.11  ? 139 TYR B OH    1 
ATOM   3143 N  N     . LEU B  1  143 ? -15.925 24.962 12.143  1.00 86.06  ? 140 LEU B N     1 
ATOM   3144 C  CA    . LEU B  1  143 ? -15.625 24.833 13.563  1.00 83.54  ? 140 LEU B CA    1 
ATOM   3145 C  C     . LEU B  1  143 ? -16.152 25.973 14.422  1.00 79.32  ? 140 LEU B C     1 
ATOM   3146 O  O     . LEU B  1  143 ? -16.249 25.798 15.642  1.00 82.38  ? 140 LEU B O     1 
ATOM   3147 C  CB    . LEU B  1  143 ? -14.108 24.727 13.782  1.00 84.34  ? 140 LEU B CB    1 
ATOM   3148 C  CG    . LEU B  1  143 ? -13.387 23.546 13.132  1.00 83.32  ? 140 LEU B CG    1 
ATOM   3149 C  CD1   . LEU B  1  143 ? -11.888 23.792 13.097  1.00 82.20  ? 140 LEU B CD1   1 
ATOM   3150 C  CD2   . LEU B  1  143 ? -13.696 22.260 13.877  1.00 86.25  ? 140 LEU B CD2   1 
ATOM   3151 N  N     . TYR B  1  144 ? -16.489 27.122 13.842  1.00 76.17  ? 141 TYR B N     1 
ATOM   3152 C  CA    . TYR B  1  144 ? -16.886 28.300 14.597  1.00 74.80  ? 141 TYR B CA    1 
ATOM   3153 C  C     . TYR B  1  144 ? -18.197 28.849 14.049  1.00 74.89  ? 141 TYR B C     1 
ATOM   3154 O  O     . TYR B  1  144 ? -18.644 28.489 12.956  1.00 78.80  ? 141 TYR B O     1 
ATOM   3155 C  CB    . TYR B  1  144 ? -15.801 29.382 14.552  1.00 73.05  ? 141 TYR B CB    1 
ATOM   3156 C  CG    . TYR B  1  144 ? -14.536 29.033 15.304  1.00 79.16  ? 141 TYR B CG    1 
ATOM   3157 C  CD1   . TYR B  1  144 ? -13.575 28.203 14.741  1.00 81.55  ? 141 TYR B CD1   1 
ATOM   3158 C  CD2   . TYR B  1  144 ? -14.298 29.544 16.573  1.00 76.20  ? 141 TYR B CD2   1 
ATOM   3159 C  CE1   . TYR B  1  144 ? -12.421 27.883 15.424  1.00 88.52  ? 141 TYR B CE1   1 
ATOM   3160 C  CE2   . TYR B  1  144 ? -13.146 29.232 17.264  1.00 74.46  ? 141 TYR B CE2   1 
ATOM   3161 C  CZ    . TYR B  1  144 ? -12.211 28.402 16.685  1.00 84.88  ? 141 TYR B CZ    1 
ATOM   3162 O  OH    . TYR B  1  144 ? -11.061 28.091 17.371  1.00 85.71  ? 141 TYR B OH    1 
ATOM   3163 N  N     . VAL B  1  145 ? -18.814 29.728 14.833  1.00 71.83  ? 142 VAL B N     1 
ATOM   3164 C  CA    . VAL B  1  145 ? -19.992 30.480 14.415  1.00 67.66  ? 142 VAL B CA    1 
ATOM   3165 C  C     . VAL B  1  145 ? -19.741 31.946 14.727  1.00 67.67  ? 142 VAL B C     1 
ATOM   3166 O  O     . VAL B  1  145 ? -19.476 32.300 15.881  1.00 64.60  ? 142 VAL B O     1 
ATOM   3167 C  CB    . VAL B  1  145 ? -21.275 29.995 15.109  1.00 60.63  ? 142 VAL B CB    1 
ATOM   3168 C  CG1   . VAL B  1  145 ? -22.409 30.982 14.869  1.00 61.63  ? 142 VAL B CG1   1 
ATOM   3169 C  CG2   . VAL B  1  145 ? -21.660 28.613 14.613  1.00 59.63  ? 142 VAL B CG2   1 
ATOM   3170 N  N     . LEU B  1  146 ? -19.812 32.791 13.704  1.00 66.53  ? 143 LEU B N     1 
ATOM   3171 C  CA    . LEU B  1  146 ? -19.757 34.234 13.887  1.00 60.86  ? 143 LEU B CA    1 
ATOM   3172 C  C     . LEU B  1  146 ? -21.165 34.741 14.173  1.00 60.93  ? 143 LEU B C     1 
ATOM   3173 O  O     . LEU B  1  146 ? -22.055 34.631 13.322  1.00 63.01  ? 143 LEU B O     1 
ATOM   3174 C  CB    . LEU B  1  146 ? -19.172 34.920 12.655  1.00 65.27  ? 143 LEU B CB    1 
ATOM   3175 C  CG    . LEU B  1  146 ? -19.147 36.450 12.703  1.00 65.10  ? 143 LEU B CG    1 
ATOM   3176 C  CD1   . LEU B  1  146 ? -18.261 36.947 13.837  1.00 54.13  ? 143 LEU B CD1   1 
ATOM   3177 C  CD2   . LEU B  1  146 ? -18.694 37.029 11.374  1.00 61.30  ? 143 LEU B CD2   1 
ATOM   3178 N  N     . VAL B  1  147 ? -21.368 35.281 15.369  1.00 64.33  ? 144 VAL B N     1 
ATOM   3179 C  CA    . VAL B  1  147 ? -22.668 35.776 15.801  1.00 53.30  ? 144 VAL B CA    1 
ATOM   3180 C  C     . VAL B  1  147 ? -22.733 37.271 15.527  1.00 58.17  ? 144 VAL B C     1 
ATOM   3181 O  O     . VAL B  1  147 ? -21.833 38.019 15.926  1.00 61.19  ? 144 VAL B O     1 
ATOM   3182 C  CB    . VAL B  1  147 ? -22.906 35.485 17.291  1.00 57.49  ? 144 VAL B CB    1 
ATOM   3183 C  CG1   . VAL B  1  147 ? -24.272 35.991 17.716  1.00 57.43  ? 144 VAL B CG1   1 
ATOM   3184 C  CG2   . VAL B  1  147 ? -22.768 33.998 17.564  1.00 59.64  ? 144 VAL B CG2   1 
ATOM   3185 N  N     . VAL B  1  148 ? -23.786 37.707 14.842  1.00 56.65  ? 145 VAL B N     1 
ATOM   3186 C  CA    . VAL B  1  148 ? -24.051 39.123 14.617  1.00 58.34  ? 145 VAL B CA    1 
ATOM   3187 C  C     . VAL B  1  148 ? -25.448 39.418 15.145  1.00 62.88  ? 145 VAL B C     1 
ATOM   3188 O  O     . VAL B  1  148 ? -26.425 38.790 14.714  1.00 68.53  ? 145 VAL B O     1 
ATOM   3189 C  CB    . VAL B  1  148 ? -23.938 39.509 13.135  1.00 60.27  ? 145 VAL B CB    1 
ATOM   3190 C  CG1   . VAL B  1  148 ? -23.978 41.022 12.988  1.00 58.22  ? 145 VAL B CG1   1 
ATOM   3191 C  CG2   . VAL B  1  148 ? -22.667 38.935 12.529  1.00 50.69  ? 145 VAL B CG2   1 
ATOM   3192 N  N     . VAL B  1  149 ? -25.546 40.367 16.072  1.00 56.93  ? 146 VAL B N     1 
ATOM   3193 C  CA    . VAL B  1  149 ? -26.815 40.757 16.671  1.00 58.71  ? 146 VAL B CA    1 
ATOM   3194 C  C     . VAL B  1  149 ? -27.007 42.254 16.473  1.00 58.84  ? 146 VAL B C     1 
ATOM   3195 O  O     . VAL B  1  149 ? -26.121 43.048 16.811  1.00 56.27  ? 146 VAL B O     1 
ATOM   3196 C  CB    . VAL B  1  149 ? -26.880 40.394 18.166  1.00 55.87  ? 146 VAL B CB    1 
ATOM   3197 C  CG1   . VAL B  1  149 ? -28.071 41.075 18.827  1.00 54.29  ? 146 VAL B CG1   1 
ATOM   3198 C  CG2   . VAL B  1  149 ? -26.968 38.886 18.342  1.00 52.68  ? 146 VAL B CG2   1 
ATOM   3199 N  N     . ASP B  1  150 ? -28.156 42.632 15.919  1.00 52.89  ? 147 ASP B N     1 
ATOM   3200 C  CA    . ASP B  1  150 ? -28.517 44.038 15.825  1.00 58.50  ? 147 ASP B CA    1 
ATOM   3201 C  C     . ASP B  1  150 ? -28.905 44.559 17.204  1.00 60.52  ? 147 ASP B C     1 
ATOM   3202 O  O     . ASP B  1  150 ? -29.705 43.938 17.910  1.00 53.74  ? 147 ASP B O     1 
ATOM   3203 C  CB    . ASP B  1  150 ? -29.668 44.226 14.840  1.00 55.26  ? 147 ASP B CB    1 
ATOM   3204 C  CG    . ASP B  1  150 ? -30.126 45.667 14.746  1.00 62.04  ? 147 ASP B CG    1 
ATOM   3205 O  OD1   . ASP B  1  150 ? -29.293 46.538 14.419  1.00 69.39  ? 147 ASP B OD1   1 
ATOM   3206 O  OD2   . ASP B  1  150 ? -31.319 45.927 15.010  1.00 61.66  ? 147 ASP B OD2   1 
ATOM   3207 N  N     . GLY B  1  151 ? -28.340 45.707 17.584  1.00 56.13  ? 148 GLY B N     1 
ATOM   3208 C  CA    . GLY B  1  151 ? -28.524 46.193 18.941  1.00 56.68  ? 148 GLY B CA    1 
ATOM   3209 C  C     . GLY B  1  151 ? -29.949 46.620 19.243  1.00 67.45  ? 148 GLY B C     1 
ATOM   3210 O  O     . GLY B  1  151 ? -30.452 46.392 20.348  1.00 80.58  ? 148 GLY B O     1 
ATOM   3211 N  N     . MET B  1  152 ? -30.622 47.239 18.273  1.00 61.51  ? 149 MET B N     1 
ATOM   3212 C  CA    . MET B  1  152 ? -31.950 47.784 18.534  1.00 58.31  ? 149 MET B CA    1 
ATOM   3213 C  C     . MET B  1  152 ? -33.023 46.700 18.499  1.00 59.64  ? 149 MET B C     1 
ATOM   3214 O  O     . MET B  1  152 ? -33.860 46.619 19.405  1.00 71.93  ? 149 MET B O     1 
ATOM   3215 C  CB    . MET B  1  152 ? -32.270 48.897 17.533  1.00 55.97  ? 149 MET B CB    1 
ATOM   3216 C  CG    . MET B  1  152 ? -33.566 49.644 17.825  1.00 58.21  ? 149 MET B CG    1 
ATOM   3217 S  SD    . MET B  1  152 ? -35.028 48.860 17.114  1.00 66.41  ? 149 MET B SD    1 
ATOM   3218 C  CE    . MET B  1  152 ? -36.280 49.364 18.288  1.00 62.67  ? 149 MET B CE    1 
ATOM   3219 N  N     . THR B  1  153 ? -33.019 45.860 17.462  1.00 55.72  ? 150 THR B N     1 
ATOM   3220 C  CA    . THR B  1  153 ? -34.069 44.863 17.284  1.00 56.04  ? 150 THR B CA    1 
ATOM   3221 C  C     . THR B  1  153 ? -33.773 43.537 17.969  1.00 56.78  ? 150 THR B C     1 
ATOM   3222 O  O     . THR B  1  153 ? -34.713 42.789 18.267  1.00 70.04  ? 150 THR B O     1 
ATOM   3223 C  CB    . THR B  1  153 ? -34.305 44.595 15.794  1.00 57.82  ? 150 THR B CB    1 
ATOM   3224 O  OG1   . THR B  1  153 ? -33.112 44.057 15.206  1.00 55.43  ? 150 THR B OG1   1 
ATOM   3225 C  CG2   . THR B  1  153 ? -34.700 45.879 15.079  1.00 60.16  ? 150 THR B CG2   1 
ATOM   3226 N  N     . GLY B  1  154 ? -32.507 43.225 18.225  1.00 61.71  ? 151 GLY B N     1 
ATOM   3227 C  CA    . GLY B  1  154 ? -32.144 41.903 18.687  1.00 60.77  ? 151 GLY B CA    1 
ATOM   3228 C  C     . GLY B  1  154 ? -32.080 40.858 17.597  1.00 67.55  ? 151 GLY B C     1 
ATOM   3229 O  O     . GLY B  1  154 ? -31.898 39.673 17.906  1.00 55.16  ? 151 GLY B O     1 
ATOM   3230 N  N     . PHE B  1  155 ? -32.225 41.259 16.337  1.00 61.90  ? 152 PHE B N     1 
ATOM   3231 C  CA    . PHE B  1  155 ? -32.174 40.322 15.224  1.00 57.07  ? 152 PHE B CA    1 
ATOM   3232 C  C     . PHE B  1  155 ? -30.777 39.724 15.098  1.00 58.26  ? 152 PHE B C     1 
ATOM   3233 O  O     . PHE B  1  155 ? -29.770 40.421 15.256  1.00 63.02  ? 152 PHE B O     1 
ATOM   3234 C  CB    . PHE B  1  155 ? -32.570 41.030 13.930  1.00 65.57  ? 152 PHE B CB    1 
ATOM   3235 C  CG    . PHE B  1  155 ? -32.991 40.101 12.829  1.00 55.23  ? 152 PHE B CG    1 
ATOM   3236 C  CD1   . PHE B  1  155 ? -32.063 39.610 11.928  1.00 52.29  ? 152 PHE B CD1   1 
ATOM   3237 C  CD2   . PHE B  1  155 ? -34.318 39.732 12.689  1.00 54.73  ? 152 PHE B CD2   1 
ATOM   3238 C  CE1   . PHE B  1  155 ? -32.449 38.760 10.910  1.00 55.77  ? 152 PHE B CE1   1 
ATOM   3239 C  CE2   . PHE B  1  155 ? -34.710 38.882 11.671  1.00 54.61  ? 152 PHE B CE2   1 
ATOM   3240 C  CZ    . PHE B  1  155 ? -33.773 38.395 10.781  1.00 49.95  ? 152 PHE B CZ    1 
ATOM   3241 N  N     . THR B  1  156 ? -30.716 38.427 14.800  1.00 61.78  ? 153 THR B N     1 
ATOM   3242 C  CA    . THR B  1  156 ? -29.473 37.669 14.861  1.00 59.94  ? 153 THR B CA    1 
ATOM   3243 C  C     . THR B  1  156 ? -29.180 36.997 13.526  1.00 62.37  ? 153 THR B C     1 
ATOM   3244 O  O     . THR B  1  156 ? -30.056 36.348 12.944  1.00 62.45  ? 153 THR B O     1 
ATOM   3245 C  CB    . THR B  1  156 ? -29.529 36.611 15.971  1.00 55.50  ? 153 THR B CB    1 
ATOM   3246 O  OG1   . THR B  1  156 ? -29.724 37.252 17.237  1.00 62.53  ? 153 THR B OG1   1 
ATOM   3247 C  CG2   . THR B  1  156 ? -28.236 35.811 16.006  1.00 52.20  ? 153 THR B CG2   1 
ATOM   3248 N  N     . TRP B  1  157 ? -27.946 37.159 13.051  1.00 56.68  ? 154 TRP B N     1 
ATOM   3249 C  CA    . TRP B  1  157 ? -27.401 36.405 11.931  1.00 50.42  ? 154 TRP B CA    1 
ATOM   3250 C  C     . TRP B  1  157 ? -26.304 35.479 12.441  1.00 61.20  ? 154 TRP B C     1 
ATOM   3251 O  O     . TRP B  1  157 ? -25.501 35.869 13.294  1.00 59.77  ? 154 TRP B O     1 
ATOM   3252 C  CB    . TRP B  1  157 ? -26.815 37.329 10.857  1.00 55.68  ? 154 TRP B CB    1 
ATOM   3253 C  CG    . TRP B  1  157 ? -27.793 38.242 10.169  1.00 57.09  ? 154 TRP B CG    1 
ATOM   3254 C  CD1   . TRP B  1  157 ? -28.415 38.029 8.972   1.00 60.57  ? 154 TRP B CD1   1 
ATOM   3255 C  CD2   . TRP B  1  157 ? -28.230 39.529 10.623  1.00 63.77  ? 154 TRP B CD2   1 
ATOM   3256 N  NE1   . TRP B  1  157 ? -29.222 39.096 8.661   1.00 59.03  ? 154 TRP B NE1   1 
ATOM   3257 C  CE2   . TRP B  1  157 ? -29.127 40.030 9.658   1.00 58.00  ? 154 TRP B CE2   1 
ATOM   3258 C  CE3   . TRP B  1  157 ? -27.958 40.303 11.756  1.00 57.57  ? 154 TRP B CE3   1 
ATOM   3259 C  CZ2   . TRP B  1  157 ? -29.752 41.269 9.791   1.00 56.63  ? 154 TRP B CZ2   1 
ATOM   3260 C  CZ3   . TRP B  1  157 ? -28.579 41.531 11.886  1.00 61.84  ? 154 TRP B CZ3   1 
ATOM   3261 C  CH2   . TRP B  1  157 ? -29.466 42.002 10.910  1.00 64.28  ? 154 TRP B CH2   1 
ATOM   3262 N  N     . LEU B  1  158 ? -26.257 34.260 11.907  1.00 68.36  ? 155 LEU B N     1 
ATOM   3263 C  CA    . LEU B  1  158 ? -25.255 33.271 12.291  1.00 70.87  ? 155 LEU B CA    1 
ATOM   3264 C  C     . LEU B  1  158 ? -24.492 32.824 11.053  1.00 75.05  ? 155 LEU B C     1 
ATOM   3265 O  O     . LEU B  1  158 ? -25.097 32.335 10.094  1.00 89.56  ? 155 LEU B O     1 
ATOM   3266 C  CB    . LEU B  1  158 ? -25.904 32.066 12.976  1.00 62.32  ? 155 LEU B CB    1 
ATOM   3267 C  CG    . LEU B  1  158 ? -26.722 32.325 14.242  1.00 65.22  ? 155 LEU B CG    1 
ATOM   3268 C  CD1   . LEU B  1  158 ? -27.335 31.027 14.749  1.00 64.55  ? 155 LEU B CD1   1 
ATOM   3269 C  CD2   . LEU B  1  158 ? -25.862 32.973 15.313  1.00 65.12  ? 155 LEU B CD2   1 
ATOM   3270 N  N     . TYR B  1  159 ? -23.170 32.975 11.079  1.00 69.74  ? 156 TYR B N     1 
ATOM   3271 C  CA    . TYR B  1  159 ? -22.326 32.568 9.961   1.00 66.22  ? 156 TYR B CA    1 
ATOM   3272 C  C     . TYR B  1  159 ? -21.322 31.517 10.411  1.00 69.53  ? 156 TYR B C     1 
ATOM   3273 O  O     . TYR B  1  159 ? -20.561 31.758 11.365  1.00 72.31  ? 156 TYR B O     1 
ATOM   3274 C  CB    . TYR B  1  159 ? -21.602 33.771 9.357   1.00 65.38  ? 156 TYR B CB    1 
ATOM   3275 C  CG    . TYR B  1  159 ? -22.548 34.751 8.713   1.00 65.91  ? 156 TYR B CG    1 
ATOM   3276 C  CD1   . TYR B  1  159 ? -23.168 34.453 7.507   1.00 60.00  ? 156 TYR B CD1   1 
ATOM   3277 C  CD2   . TYR B  1  159 ? -22.836 35.967 9.316   1.00 55.61  ? 156 TYR B CD2   1 
ATOM   3278 C  CE1   . TYR B  1  159 ? -24.043 35.340 6.916   1.00 63.36  ? 156 TYR B CE1   1 
ATOM   3279 C  CE2   . TYR B  1  159 ? -23.710 36.863 8.733   1.00 61.45  ? 156 TYR B CE2   1 
ATOM   3280 C  CZ    . TYR B  1  159 ? -24.310 36.544 7.532   1.00 71.05  ? 156 TYR B CZ    1 
ATOM   3281 O  OH    . TYR B  1  159 ? -25.181 37.431 6.945   1.00 81.37  ? 156 TYR B OH    1 
ATOM   3282 N  N     . PRO B  1  160 ? -21.284 30.352 9.770   1.00 68.38  ? 157 PRO B N     1 
ATOM   3283 C  CA    . PRO B  1  160 ? -20.264 29.356 10.104  1.00 73.32  ? 157 PRO B CA    1 
ATOM   3284 C  C     . PRO B  1  160 ? -18.942 29.685 9.434   1.00 70.79  ? 157 PRO B C     1 
ATOM   3285 O  O     . PRO B  1  160 ? -18.889 30.058 8.260   1.00 71.56  ? 157 PRO B O     1 
ATOM   3286 C  CB    . PRO B  1  160 ? -20.856 28.053 9.554   1.00 75.22  ? 157 PRO B CB    1 
ATOM   3287 C  CG    . PRO B  1  160 ? -21.663 28.502 8.381   1.00 70.60  ? 157 PRO B CG    1 
ATOM   3288 C  CD    . PRO B  1  160 ? -22.214 29.866 8.733   1.00 63.24  ? 157 PRO B CD    1 
ATOM   3289 N  N     . THR B  1  161 ? -17.858 29.559 10.201  1.00 67.69  ? 158 THR B N     1 
ATOM   3290 C  CA    . THR B  1  161 ? -16.516 29.792 9.691   1.00 70.57  ? 158 THR B CA    1 
ATOM   3291 C  C     . THR B  1  161 ? -15.618 28.623 10.073  1.00 77.19  ? 158 THR B C     1 
ATOM   3292 O  O     . THR B  1  161 ? -15.997 27.739 10.845  1.00 71.73  ? 158 THR B O     1 
ATOM   3293 C  CB    . THR B  1  161 ? -15.919 31.105 10.221  1.00 65.33  ? 158 THR B CB    1 
ATOM   3294 O  OG1   . THR B  1  161 ? -15.553 30.948 11.598  1.00 65.14  ? 158 THR B OG1   1 
ATOM   3295 C  CG2   . THR B  1  161 ? -16.917 32.253 10.088  1.00 58.65  ? 158 THR B CG2   1 
ATOM   3296 N  N     . LYS B  1  162 ? -14.405 28.631 9.517   1.00 76.92  ? 159 LYS B N     1 
ATOM   3297 C  CA    . LYS B  1  162 ? -13.422 27.590 9.780   1.00 79.96  ? 159 LYS B CA    1 
ATOM   3298 C  C     . LYS B  1  162 ? -12.344 28.016 10.769  1.00 76.64  ? 159 LYS B C     1 
ATOM   3299 O  O     . LYS B  1  162 ? -11.559 27.168 11.205  1.00 80.02  ? 159 LYS B O     1 
ATOM   3300 C  CB    . LYS B  1  162 ? -12.764 27.141 8.467   1.00 85.09  ? 159 LYS B CB    1 
ATOM   3301 C  CG    . LYS B  1  162 ? -13.716 26.443 7.507   1.00 89.03  ? 159 LYS B CG    1 
ATOM   3302 C  CD    . LYS B  1  162 ? -13.016 26.027 6.223   1.00 92.75  ? 159 LYS B CD    1 
ATOM   3303 C  CE    . LYS B  1  162 ? -13.961 25.262 5.311   1.00 94.77  ? 159 LYS B CE    1 
ATOM   3304 N  NZ    . LYS B  1  162 ? -13.320 24.886 4.021   1.00 98.31  ? 159 LYS B NZ    1 
ATOM   3305 N  N     . ALA B  1  163 ? -12.291 29.295 11.136  1.00 75.09  ? 160 ALA B N     1 
ATOM   3306 C  CA    . ALA B  1  163 ? -11.290 29.799 12.066  1.00 73.73  ? 160 ALA B CA    1 
ATOM   3307 C  C     . ALA B  1  163 ? -11.739 31.165 12.553  1.00 72.61  ? 160 ALA B C     1 
ATOM   3308 O  O     . ALA B  1  163 ? -12.428 31.880 11.818  1.00 67.34  ? 160 ALA B O     1 
ATOM   3309 C  CB    . ALA B  1  163 ? -9.910  29.895 11.400  1.00 68.35  ? 160 ALA B CB    1 
ATOM   3310 N  N     . PRO B  1  164 ? -11.372 31.561 13.790  1.00 70.30  ? 161 PRO B N     1 
ATOM   3311 C  CA    . PRO B  1  164 ? -11.663 32.913 14.283  1.00 68.70  ? 161 PRO B CA    1 
ATOM   3312 C  C     . PRO B  1  164 ? -10.690 33.947 13.721  1.00 71.20  ? 161 PRO B C     1 
ATOM   3313 O  O     . PRO B  1  164 ? -10.064 34.707 14.461  1.00 76.25  ? 161 PRO B O     1 
ATOM   3314 C  CB    . PRO B  1  164 ? -11.521 32.756 15.800  1.00 69.98  ? 161 PRO B CB    1 
ATOM   3315 C  CG    . PRO B  1  164 ? -10.456 31.717 15.946  1.00 75.03  ? 161 PRO B CG    1 
ATOM   3316 C  CD    . PRO B  1  164 ? -10.627 30.765 14.783  1.00 71.45  ? 161 PRO B CD    1 
ATOM   3317 N  N     . SER B  1  165 ? -10.554 33.962 12.400  1.00 67.91  ? 162 SER B N     1 
ATOM   3318 C  CA    . SER B  1  165 ? -9.567  34.768 11.703  1.00 70.05  ? 162 SER B CA    1 
ATOM   3319 C  C     . SER B  1  165 ? -10.219 35.987 11.066  1.00 71.47  ? 162 SER B C     1 
ATOM   3320 O  O     . SER B  1  165 ? -11.438 36.050 10.886  1.00 75.02  ? 162 SER B O     1 
ATOM   3321 C  CB    . SER B  1  165 ? -8.859  33.941 10.627  1.00 64.60  ? 162 SER B CB    1 
ATOM   3322 O  OG    . SER B  1  165 ? -9.785  33.499 9.648   1.00 70.03  ? 162 SER B OG    1 
ATOM   3323 N  N     . THR B  1  166 ? -9.375  36.963 10.719  1.00 69.13  ? 163 THR B N     1 
ATOM   3324 C  CA    . THR B  1  166 ? -9.859  38.134 9.999   1.00 66.34  ? 163 THR B CA    1 
ATOM   3325 C  C     . THR B  1  166 ? -10.433 37.740 8.644   1.00 67.91  ? 163 THR B C     1 
ATOM   3326 O  O     . THR B  1  166 ? -11.466 38.272 8.220   1.00 70.88  ? 163 THR B O     1 
ATOM   3327 C  CB    . THR B  1  166 ? -8.731  39.154 9.827   1.00 66.27  ? 163 THR B CB    1 
ATOM   3328 O  OG1   . THR B  1  166 ? -8.191  39.502 11.109  1.00 75.87  ? 163 THR B OG1   1 
ATOM   3329 C  CG2   . THR B  1  166 ? -9.248  40.410 9.146   1.00 59.65  ? 163 THR B CG2   1 
ATOM   3330 N  N     . SER B  1  167 ? -9.779  36.800 7.958   1.00 68.23  ? 164 SER B N     1 
ATOM   3331 C  CA    A SER B  1  167 ? -10.264 36.347 6.658   0.42 68.66  ? 164 SER B CA    1 
ATOM   3332 C  CA    B SER B  1  167 ? -10.263 36.345 6.658   0.58 68.09  ? 164 SER B CA    1 
ATOM   3333 C  C     . SER B  1  167 ? -11.686 35.810 6.762   1.00 66.46  ? 164 SER B C     1 
ATOM   3334 O  O     . SER B  1  167 ? -12.594 36.275 6.063   1.00 67.04  ? 164 SER B O     1 
ATOM   3335 C  CB    A SER B  1  167 ? -9.323  35.283 6.088   0.42 63.08  ? 164 SER B CB    1 
ATOM   3336 C  CB    B SER B  1  167 ? -9.323  35.279 6.097   0.58 63.09  ? 164 SER B CB    1 
ATOM   3337 O  OG    A SER B  1  167 ? -8.082  35.847 5.704   0.42 64.22  ? 164 SER B OG    1 
ATOM   3338 O  OG    B SER B  1  167 ? -9.884  34.656 4.956   0.58 63.25  ? 164 SER B OG    1 
ATOM   3339 N  N     . ALA B  1  168 ? -11.898 34.825 7.639   1.00 74.85  ? 165 ALA B N     1 
ATOM   3340 C  CA    . ALA B  1  168 ? -13.232 34.257 7.808   1.00 69.23  ? 165 ALA B CA    1 
ATOM   3341 C  C     . ALA B  1  168 ? -14.236 35.320 8.233   1.00 65.63  ? 165 ALA B C     1 
ATOM   3342 O  O     . ALA B  1  168 ? -15.387 35.314 7.781   1.00 69.30  ? 165 ALA B O     1 
ATOM   3343 C  CB    . ALA B  1  168 ? -13.188 33.119 8.826   1.00 61.98  ? 165 ALA B CB    1 
ATOM   3344 N  N     . THR B  1  169 ? -13.813 36.252 9.090   1.00 65.11  ? 166 THR B N     1 
ATOM   3345 C  CA    . THR B  1  169 ? -14.705 37.322 9.525   1.00 60.70  ? 166 THR B CA    1 
ATOM   3346 C  C     . THR B  1  169 ? -15.104 38.214 8.357   1.00 59.65  ? 166 THR B C     1 
ATOM   3347 O  O     . THR B  1  169 ? -16.290 38.497 8.152   1.00 57.42  ? 166 THR B O     1 
ATOM   3348 C  CB    . THR B  1  169 ? -14.034 38.145 10.626  1.00 57.72  ? 166 THR B CB    1 
ATOM   3349 O  OG1   . THR B  1  169 ? -13.777 37.309 11.760  1.00 62.09  ? 166 THR B OG1   1 
ATOM   3350 C  CG2   . THR B  1  169 ? -14.927 39.306 11.041  1.00 54.82  ? 166 THR B CG2   1 
ATOM   3351 N  N     . VAL B  1  170 ? -14.119 38.669 7.578   1.00 55.41  ? 167 VAL B N     1 
ATOM   3352 C  CA    . VAL B  1  170 ? -14.409 39.526 6.430   1.00 59.68  ? 167 VAL B CA    1 
ATOM   3353 C  C     . VAL B  1  170 ? -15.260 38.783 5.409   1.00 62.31  ? 167 VAL B C     1 
ATOM   3354 O  O     . VAL B  1  170 ? -16.221 39.335 4.860   1.00 63.16  ? 167 VAL B O     1 
ATOM   3355 C  CB    . VAL B  1  170 ? -13.099 40.048 5.811   1.00 59.55  ? 167 VAL B CB    1 
ATOM   3356 C  CG1   . VAL B  1  170 ? -13.334 40.540 4.389   1.00 59.53  ? 167 VAL B CG1   1 
ATOM   3357 C  CG2   . VAL B  1  170 ? -12.520 41.163 6.668   1.00 55.86  ? 167 VAL B CG2   1 
ATOM   3358 N  N     . LYS B  1  171 ? -14.927 37.516 5.145   1.00 57.16  ? 168 LYS B N     1 
ATOM   3359 C  CA    . LYS B  1  171 ? -15.698 36.731 4.184   1.00 58.01  ? 168 LYS B CA    1 
ATOM   3360 C  C     . LYS B  1  171 ? -17.155 36.609 4.610   1.00 58.56  ? 168 LYS B C     1 
ATOM   3361 O  O     . LYS B  1  171 ? -18.062 36.672 3.772   1.00 67.56  ? 168 LYS B O     1 
ATOM   3362 C  CB    . LYS B  1  171 ? -15.067 35.347 4.011   1.00 61.64  ? 168 LYS B CB    1 
ATOM   3363 C  CG    . LYS B  1  171 ? -15.878 34.385 3.149   1.00 69.64  ? 168 LYS B CG    1 
ATOM   3364 C  CD    . LYS B  1  171 ? -15.075 33.142 2.788   1.00 85.34  ? 168 LYS B CD    1 
ATOM   3365 C  CE    . LYS B  1  171 ? -15.898 32.187 1.935   1.00 97.15  ? 168 LYS B CE    1 
ATOM   3366 N  NZ    . LYS B  1  171 ? -15.078 31.079 1.370   1.00 101.67 ? 168 LYS B NZ    1 
ATOM   3367 N  N     . SER B  1  172 ? -17.403 36.453 5.913   1.00 62.86  ? 169 SER B N     1 
ATOM   3368 C  CA    . SER B  1  172 ? -18.772 36.294 6.392   1.00 60.45  ? 169 SER B CA    1 
ATOM   3369 C  C     . SER B  1  172 ? -19.509 37.627 6.452   1.00 60.88  ? 169 SER B C     1 
ATOM   3370 O  O     . SER B  1  172 ? -20.687 37.703 6.084   1.00 61.71  ? 169 SER B O     1 
ATOM   3371 C  CB    . SER B  1  172 ? -18.775 35.620 7.763   1.00 57.54  ? 169 SER B CB    1 
ATOM   3372 O  OG    . SER B  1  172 ? -18.324 34.279 7.673   1.00 65.68  ? 169 SER B OG    1 
ATOM   3373 N  N     . LEU B  1  173 ? -18.839 38.686 6.915   1.00 59.21  ? 170 LEU B N     1 
ATOM   3374 C  CA    . LEU B  1  173 ? -19.490 39.990 6.978   1.00 54.75  ? 170 LEU B CA    1 
ATOM   3375 C  C     . LEU B  1  173 ? -19.721 40.575 5.590   1.00 54.96  ? 170 LEU B C     1 
ATOM   3376 O  O     . LEU B  1  173 ? -20.639 41.384 5.408   1.00 53.90  ? 170 LEU B O     1 
ATOM   3377 C  CB    . LEU B  1  173 ? -18.663 40.953 7.830   1.00 52.22  ? 170 LEU B CB    1 
ATOM   3378 C  CG    . LEU B  1  173 ? -18.584 40.627 9.321   1.00 53.00  ? 170 LEU B CG    1 
ATOM   3379 C  CD1   . LEU B  1  173 ? -17.802 41.701 10.063  1.00 65.89  ? 170 LEU B CD1   1 
ATOM   3380 C  CD2   . LEU B  1  173 ? -19.978 40.463 9.910   1.00 53.61  ? 170 LEU B CD2   1 
ATOM   3381 N  N     . ASN B  1  174 ? -18.906 40.185 4.605   1.00 59.16  ? 171 ASN B N     1 
ATOM   3382 C  CA    . ASN B  1  174 ? -19.155 40.619 3.233   1.00 59.12  ? 171 ASN B CA    1 
ATOM   3383 C  C     . ASN B  1  174 ? -20.507 40.131 2.734   1.00 62.93  ? 171 ASN B C     1 
ATOM   3384 O  O     . ASN B  1  174 ? -21.152 40.808 1.925   1.00 65.80  ? 171 ASN B O     1 
ATOM   3385 C  CB    . ASN B  1  174 ? -18.043 40.127 2.305   1.00 52.44  ? 171 ASN B CB    1 
ATOM   3386 C  CG    . ASN B  1  174 ? -16.953 41.159 2.103   1.00 55.44  ? 171 ASN B CG    1 
ATOM   3387 O  OD1   . ASN B  1  174 ? -17.116 42.327 2.456   1.00 56.71  ? 171 ASN B OD1   1 
ATOM   3388 N  ND2   . ASN B  1  174 ? -15.838 40.736 1.520   1.00 54.04  ? 171 ASN B ND2   1 
ATOM   3389 N  N     . VAL B  1  175 ? -20.951 38.964 3.203   1.00 58.53  ? 172 VAL B N     1 
ATOM   3390 C  CA    . VAL B  1  175 ? -22.284 38.484 2.859   1.00 50.73  ? 172 VAL B CA    1 
ATOM   3391 C  C     . VAL B  1  175 ? -23.347 39.342 3.533   1.00 64.83  ? 172 VAL B C     1 
ATOM   3392 O  O     . VAL B  1  175 ? -24.335 39.743 2.907   1.00 67.52  ? 172 VAL B O     1 
ATOM   3393 C  CB    . VAL B  1  175 ? -22.436 36.999 3.236   1.00 51.63  ? 172 VAL B CB    1 
ATOM   3394 C  CG1   . VAL B  1  175 ? -23.830 36.499 2.881   1.00 51.30  ? 172 VAL B CG1   1 
ATOM   3395 C  CG2   . VAL B  1  175 ? -21.371 36.163 2.544   1.00 52.73  ? 172 VAL B CG2   1 
ATOM   3396 N  N     . LEU B  1  176 ? -23.156 39.643 4.820   1.00 65.72  ? 173 LEU B N     1 
ATOM   3397 C  CA    . LEU B  1  176 ? -24.154 40.406 5.561   1.00 62.34  ? 173 LEU B CA    1 
ATOM   3398 C  C     . LEU B  1  176 ? -24.242 41.845 5.065   1.00 66.26  ? 173 LEU B C     1 
ATOM   3399 O  O     . LEU B  1  176 ? -25.341 42.396 4.940   1.00 68.70  ? 173 LEU B O     1 
ATOM   3400 C  CB    . LEU B  1  176 ? -23.835 40.375 7.055   1.00 52.39  ? 173 LEU B CB    1 
ATOM   3401 C  CG    . LEU B  1  176 ? -24.804 41.137 7.960   1.00 54.41  ? 173 LEU B CG    1 
ATOM   3402 C  CD1   . LEU B  1  176 ? -26.213 40.576 7.833   1.00 59.67  ? 173 LEU B CD1   1 
ATOM   3403 C  CD2   . LEU B  1  176 ? -24.335 41.098 9.402   1.00 57.28  ? 173 LEU B CD2   1 
ATOM   3404 N  N     . THR B  1  177 ? -23.101 42.470 4.777   1.00 56.71  ? 174 THR B N     1 
ATOM   3405 C  CA    . THR B  1  177 ? -23.089 43.871 4.376   1.00 55.06  ? 174 THR B CA    1 
ATOM   3406 C  C     . THR B  1  177 ? -23.509 44.084 2.927   1.00 66.64  ? 174 THR B C     1 
ATOM   3407 O  O     . THR B  1  177 ? -23.580 45.238 2.489   1.00 75.96  ? 174 THR B O     1 
ATOM   3408 C  CB    . THR B  1  177 ? -21.707 44.481 4.611   1.00 54.52  ? 174 THR B CB    1 
ATOM   3409 O  OG1   . THR B  1  177 ? -20.693 43.572 4.165   1.00 62.18  ? 174 THR B OG1   1 
ATOM   3410 C  CG2   . THR B  1  177 ? -21.511 44.779 6.090   1.00 49.34  ? 174 THR B CG2   1 
ATOM   3411 N  N     . SER B  1  178 ? -23.777 43.019 2.175   1.00 67.29  ? 175 SER B N     1 
ATOM   3412 C  CA    . SER B  1  178 ? -24.467 43.146 0.899   1.00 66.02  ? 175 SER B CA    1 
ATOM   3413 C  C     . SER B  1  178 ? -25.978 43.152 1.070   1.00 63.06  ? 175 SER B C     1 
ATOM   3414 O  O     . SER B  1  178 ? -26.704 43.158 0.071   1.00 63.46  ? 175 SER B O     1 
ATOM   3415 C  CB    . SER B  1  178 ? -24.061 42.015 -0.054  1.00 71.01  ? 175 SER B CB    1 
ATOM   3416 O  OG    . SER B  1  178 ? -24.614 40.775 0.347   1.00 86.91  ? 175 SER B OG    1 
ATOM   3417 N  N     . ILE B  1  179 ? -26.460 43.132 2.314   1.00 55.71  ? 176 ILE B N     1 
ATOM   3418 C  CA    . ILE B  1  179 ? -27.873 43.267 2.640   1.00 52.00  ? 176 ILE B CA    1 
ATOM   3419 C  C     . ILE B  1  179 ? -28.133 44.546 3.426   1.00 53.39  ? 176 ILE B C     1 
ATOM   3420 O  O     . ILE B  1  179 ? -29.045 45.314 3.106   1.00 62.30  ? 176 ILE B O     1 
ATOM   3421 C  CB    . ILE B  1  179 ? -28.386 42.033 3.417   1.00 52.79  ? 176 ILE B CB    1 
ATOM   3422 C  CG1   . ILE B  1  179 ? -28.527 40.835 2.476   1.00 63.81  ? 176 ILE B CG1   1 
ATOM   3423 C  CG2   . ILE B  1  179 ? -29.700 42.345 4.124   1.00 52.31  ? 176 ILE B CG2   1 
ATOM   3424 C  CD1   . ILE B  1  179 ? -28.889 39.546 3.179   1.00 78.43  ? 176 ILE B CD1   1 
ATOM   3425 N  N     . ALA B  1  180 ? -27.331 44.795 4.459   1.00 49.50  ? 177 ALA B N     1 
ATOM   3426 C  CA    . ALA B  1  180 ? -27.420 46.012 5.247   1.00 52.42  ? 177 ALA B CA    1 
ATOM   3427 C  C     . ALA B  1  180 ? -26.066 46.281 5.877   1.00 57.19  ? 177 ALA B C     1 
ATOM   3428 O  O     . ALA B  1  180 ? -25.352 45.348 6.245   1.00 65.86  ? 177 ALA B O     1 
ATOM   3429 C  CB    . ALA B  1  180 ? -28.503 45.898 6.328   1.00 52.46  ? 177 ALA B CB    1 
ATOM   3430 N  N     . ILE B  1  181 ? -25.719 47.550 5.985   1.00 55.54  ? 178 ILE B N     1 
ATOM   3431 C  CA    . ILE B  1  181 ? -24.428 47.993 6.515   1.00 56.12  ? 178 ILE B CA    1 
ATOM   3432 C  C     . ILE B  1  181 ? -24.680 48.736 7.819   1.00 58.38  ? 178 ILE B C     1 
ATOM   3433 O  O     . ILE B  1  181 ? -25.470 49.686 7.829   1.00 55.18  ? 178 ILE B O     1 
ATOM   3434 C  CB    . ILE B  1  181 ? -23.672 48.891 5.518   1.00 58.29  ? 178 ILE B CB    1 
ATOM   3435 C  CG1   . ILE B  1  181 ? -23.524 48.166 4.182   1.00 59.82  ? 178 ILE B CG1   1 
ATOM   3436 C  CG2   . ILE B  1  181 ? -22.307 49.270 6.075   1.00 60.19  ? 178 ILE B CG2   1 
ATOM   3437 C  CD1   . ILE B  1  181 ? -22.835 48.967 3.100   1.00 50.05  ? 178 ILE B CD1   1 
ATOM   3438 N  N     . PRO B  1  182 ? -24.052 48.343 8.920   1.00 60.70  ? 179 PRO B N     1 
ATOM   3439 C  CA    . PRO B  1  182 ? -24.264 49.045 10.183  1.00 57.96  ? 179 PRO B CA    1 
ATOM   3440 C  C     . PRO B  1  182 ? -23.410 50.295 10.273  1.00 51.82  ? 179 PRO B C     1 
ATOM   3441 O  O     . PRO B  1  182 ? -22.356 50.409 9.644   1.00 67.92  ? 179 PRO B O     1 
ATOM   3442 C  CB    . PRO B  1  182 ? -23.830 48.012 11.226  1.00 60.01  ? 179 PRO B CB    1 
ATOM   3443 C  CG    . PRO B  1  182 ? -22.730 47.274 10.538  1.00 63.75  ? 179 PRO B CG    1 
ATOM   3444 C  CD    . PRO B  1  182 ? -23.132 47.201 9.076   1.00 61.07  ? 179 PRO B CD    1 
ATOM   3445 N  N     . LYS B  1  183 ? -23.884 51.250 11.074  1.00 59.04  ? 180 LYS B N     1 
ATOM   3446 C  CA    . LYS B  1  183 ? -23.074 52.434 11.338  1.00 59.33  ? 180 LYS B CA    1 
ATOM   3447 C  C     . LYS B  1  183 ? -21.875 52.086 12.210  1.00 57.88  ? 180 LYS B C     1 
ATOM   3448 O  O     . LYS B  1  183 ? -20.775 52.611 12.002  1.00 59.64  ? 180 LYS B O     1 
ATOM   3449 C  CB    . LYS B  1  183 ? -23.926 53.523 11.990  1.00 64.84  ? 180 LYS B CB    1 
ATOM   3450 C  CG    . LYS B  1  183 ? -25.011 54.085 11.081  1.00 68.14  ? 180 LYS B CG    1 
ATOM   3451 C  CD    . LYS B  1  183 ? -25.785 55.219 11.737  1.00 72.90  ? 180 LYS B CD    1 
ATOM   3452 C  CE    . LYS B  1  183 ? -26.868 55.743 10.803  1.00 80.89  ? 180 LYS B CE    1 
ATOM   3453 N  NZ    . LYS B  1  183 ? -27.700 56.808 11.425  1.00 81.60  ? 180 LYS B NZ    1 
ATOM   3454 N  N     . VAL B  1  184 ? -22.064 51.189 13.177  1.00 61.67  ? 181 VAL B N     1 
ATOM   3455 C  CA    . VAL B  1  184 ? -21.021 50.802 14.119  1.00 64.57  ? 181 VAL B CA    1 
ATOM   3456 C  C     . VAL B  1  184 ? -21.033 49.284 14.272  1.00 63.20  ? 181 VAL B C     1 
ATOM   3457 O  O     . VAL B  1  184 ? -22.099 48.661 14.294  1.00 57.94  ? 181 VAL B O     1 
ATOM   3458 C  CB    . VAL B  1  184 ? -21.213 51.489 15.490  1.00 56.09  ? 181 VAL B CB    1 
ATOM   3459 C  CG1   . VAL B  1  184 ? -20.224 50.951 16.517  1.00 56.69  ? 181 VAL B CG1   1 
ATOM   3460 C  CG2   . VAL B  1  184 ? -21.078 53.002 15.359  1.00 57.43  ? 181 VAL B CG2   1 
ATOM   3461 N  N     . ILE B  1  185 ? -19.844 48.691 14.360  1.00 60.26  ? 182 ILE B N     1 
ATOM   3462 C  CA    . ILE B  1  185 ? -19.676 47.300 14.760  1.00 64.20  ? 182 ILE B CA    1 
ATOM   3463 C  C     . ILE B  1  185 ? -18.974 47.283 16.110  1.00 67.12  ? 182 ILE B C     1 
ATOM   3464 O  O     . ILE B  1  185 ? -17.953 47.957 16.293  1.00 71.67  ? 182 ILE B O     1 
ATOM   3465 C  CB    . ILE B  1  185 ? -18.881 46.490 13.718  1.00 57.55  ? 182 ILE B CB    1 
ATOM   3466 C  CG1   . ILE B  1  185 ? -19.718 46.258 12.460  1.00 55.98  ? 182 ILE B CG1   1 
ATOM   3467 C  CG2   . ILE B  1  185 ? -18.437 45.159 14.305  1.00 53.05  ? 182 ILE B CG2   1 
ATOM   3468 C  CD1   . ILE B  1  185 ? -19.012 45.425 11.408  1.00 51.57  ? 182 ILE B CD1   1 
ATOM   3469 N  N     . HIS B  1  186 ? -19.524 46.523 17.056  1.00 62.74  ? 183 HIS B N     1 
ATOM   3470 C  CA    . HIS B  1  186 ? -18.966 46.396 18.393  1.00 59.05  ? 183 HIS B CA    1 
ATOM   3471 C  C     . HIS B  1  186 ? -18.522 44.959 18.634  1.00 67.68  ? 183 HIS B C     1 
ATOM   3472 O  O     . HIS B  1  186 ? -19.218 44.012 18.255  1.00 74.96  ? 183 HIS B O     1 
ATOM   3473 C  CB    . HIS B  1  186 ? -19.982 46.813 19.462  1.00 56.43  ? 183 HIS B CB    1 
ATOM   3474 C  CG    . HIS B  1  186 ? -19.492 46.644 20.866  1.00 59.48  ? 183 HIS B CG    1 
ATOM   3475 N  ND1   . HIS B  1  186 ? -19.111 47.708 21.655  1.00 60.89  ? 183 HIS B ND1   1 
ATOM   3476 C  CD2   . HIS B  1  186 ? -19.317 45.534 21.622  1.00 58.71  ? 183 HIS B CD2   1 
ATOM   3477 C  CE1   . HIS B  1  186 ? -18.725 47.261 22.837  1.00 65.67  ? 183 HIS B CE1   1 
ATOM   3478 N  NE2   . HIS B  1  186 ? -18.838 45.945 22.842  1.00 61.44  ? 183 HIS B NE2   1 
ATOM   3479 N  N     . SER B  1  187 ? -17.368 44.801 19.281  1.00 67.70  ? 184 SER B N     1 
ATOM   3480 C  CA    . SER B  1  187 ? -16.836 43.478 19.571  1.00 72.27  ? 184 SER B CA    1 
ATOM   3481 C  C     . SER B  1  187 ? -15.867 43.577 20.742  1.00 69.21  ? 184 SER B C     1 
ATOM   3482 O  O     . SER B  1  187 ? -15.512 44.669 21.192  1.00 63.17  ? 184 SER B O     1 
ATOM   3483 C  CB    . SER B  1  187 ? -16.138 42.877 18.346  1.00 71.80  ? 184 SER B CB    1 
ATOM   3484 O  OG    . SER B  1  187 ? -15.006 43.647 17.979  1.00 69.57  ? 184 SER B OG    1 
ATOM   3485 N  N     . ASP B  1  188 ? -15.446 42.412 21.237  1.00 65.92  ? 185 ASP B N     1 
ATOM   3486 C  CA    . ASP B  1  188 ? -14.350 42.367 22.189  1.00 60.83  ? 185 ASP B CA    1 
ATOM   3487 C  C     . ASP B  1  188 ? -13.035 42.590 21.436  1.00 70.09  ? 185 ASP B C     1 
ATOM   3488 O  O     . ASP B  1  188 ? -13.005 42.708 20.213  1.00 76.40  ? 185 ASP B O     1 
ATOM   3489 C  CB    . ASP B  1  188 ? -14.361 41.047 22.970  1.00 61.52  ? 185 ASP B CB    1 
ATOM   3490 C  CG    . ASP B  1  188 ? -14.288 39.809 22.075  1.00 83.46  ? 185 ASP B CG    1 
ATOM   3491 O  OD1   . ASP B  1  188 ? -13.664 39.863 20.997  1.00 84.02  ? 185 ASP B OD1   1 
ATOM   3492 O  OD2   . ASP B  1  188 ? -14.850 38.761 22.464  1.00 99.37  ? 185 ASP B OD2   1 
ATOM   3493 N  N     . GLN B  1  189 ? -11.928 42.639 22.176  1.00 66.46  ? 186 GLN B N     1 
ATOM   3494 C  CA    . GLN B  1  189 ? -10.606 42.825 21.585  1.00 66.24  ? 186 GLN B CA    1 
ATOM   3495 C  C     . GLN B  1  189 ? -10.007 41.542 21.005  1.00 68.37  ? 186 GLN B C     1 
ATOM   3496 O  O     . GLN B  1  189 ? -8.782  41.379 21.026  1.00 74.73  ? 186 GLN B O     1 
ATOM   3497 C  CB    . GLN B  1  189 ? -9.670  43.453 22.613  1.00 71.59  ? 186 GLN B CB    1 
ATOM   3498 C  CG    . GLN B  1  189 ? -10.179 44.798 23.114  1.00 73.11  ? 186 GLN B CG    1 
ATOM   3499 C  CD    . GLN B  1  189 ? -9.206  45.935 22.867  1.00 84.96  ? 186 GLN B CD    1 
ATOM   3500 O  OE1   . GLN B  1  189 ? -8.016  45.711 22.658  1.00 95.54  ? 186 GLN B OE1   1 
ATOM   3501 N  NE2   . GLN B  1  189 ? -9.709  47.166 22.894  1.00 84.62  ? 186 GLN B NE2   1 
ATOM   3502 N  N     . GLY B  1  190 ? -10.837 40.638 20.480  1.00 69.16  ? 187 GLY B N     1 
ATOM   3503 C  CA    . GLY B  1  190 ? -10.296 39.449 19.836  1.00 69.50  ? 187 GLY B CA    1 
ATOM   3504 C  C     . GLY B  1  190 ? -9.427  39.801 18.643  1.00 70.27  ? 187 GLY B C     1 
ATOM   3505 O  O     . GLY B  1  190 ? -9.640  40.810 17.967  1.00 67.48  ? 187 GLY B O     1 
ATOM   3506 N  N     . ALA B  1  191 ? -8.435  38.947 18.395  1.00 71.21  ? 188 ALA B N     1 
ATOM   3507 C  CA    . ALA B  1  191 ? -7.394  39.269 17.426  1.00 71.88  ? 188 ALA B CA    1 
ATOM   3508 C  C     . ALA B  1  191 ? -7.966  39.500 16.033  1.00 73.06  ? 188 ALA B C     1 
ATOM   3509 O  O     . ALA B  1  191 ? -7.478  40.362 15.293  1.00 78.54  ? 188 ALA B O     1 
ATOM   3510 C  CB    . ALA B  1  191 ? -6.354  38.153 17.401  1.00 71.75  ? 188 ALA B CB    1 
ATOM   3511 N  N     . ALA B  1  192 ? -9.001  38.744 15.657  1.00 67.07  ? 189 ALA B N     1 
ATOM   3512 C  CA    . ALA B  1  192 ? -9.577  38.898 14.325  1.00 66.84  ? 189 ALA B CA    1 
ATOM   3513 C  C     . ALA B  1  192 ? -10.199 40.275 14.134  1.00 74.68  ? 189 ALA B C     1 
ATOM   3514 O  O     . ALA B  1  192 ? -10.232 40.790 13.010  1.00 73.31  ? 189 ALA B O     1 
ATOM   3515 C  CB    . ALA B  1  192 ? -10.618 37.808 14.070  1.00 69.17  ? 189 ALA B CB    1 
ATOM   3516 N  N     . PHE B  1  193 ? -10.686 40.889 15.211  1.00 71.12  ? 190 PHE B N     1 
ATOM   3517 C  CA    . PHE B  1  193 ? -11.357 42.178 15.116  1.00 65.84  ? 190 PHE B CA    1 
ATOM   3518 C  C     . PHE B  1  193 ? -10.408 43.360 15.270  1.00 65.86  ? 190 PHE B C     1 
ATOM   3519 O  O     . PHE B  1  193 ? -10.695 44.445 14.754  1.00 65.44  ? 190 PHE B O     1 
ATOM   3520 C  CB    . PHE B  1  193 ? -12.463 42.267 16.171  1.00 65.84  ? 190 PHE B CB    1 
ATOM   3521 C  CG    . PHE B  1  193 ? -13.364 41.064 16.209  1.00 67.36  ? 190 PHE B CG    1 
ATOM   3522 C  CD1   . PHE B  1  193 ? -13.906 40.543 15.044  1.00 63.67  ? 190 PHE B CD1   1 
ATOM   3523 C  CD2   . PHE B  1  193 ? -13.661 40.447 17.413  1.00 66.79  ? 190 PHE B CD2   1 
ATOM   3524 C  CE1   . PHE B  1  193 ? -14.734 39.435 15.083  1.00 62.08  ? 190 PHE B CE1   1 
ATOM   3525 C  CE2   . PHE B  1  193 ? -14.485 39.341 17.458  1.00 62.61  ? 190 PHE B CE2   1 
ATOM   3526 C  CZ    . PHE B  1  193 ? -15.023 38.834 16.293  1.00 65.81  ? 190 PHE B CZ    1 
ATOM   3527 N  N     . THR B  1  194 ? -9.287  43.180 15.968  1.00 69.95  ? 191 THR B N     1 
ATOM   3528 C  CA    . THR B  1  194 ? -8.334  44.256 16.207  1.00 71.15  ? 191 THR B CA    1 
ATOM   3529 C  C     . THR B  1  194 ? -7.221  44.305 15.168  1.00 68.64  ? 191 THR B C     1 
ATOM   3530 O  O     . THR B  1  194 ? -6.295  45.113 15.304  1.00 70.53  ? 191 THR B O     1 
ATOM   3531 C  CB    . THR B  1  194 ? -7.731  44.127 17.609  1.00 65.82  ? 191 THR B CB    1 
ATOM   3532 O  OG1   . THR B  1  194 ? -7.262  42.786 17.812  1.00 65.74  ? 191 THR B OG1   1 
ATOM   3533 C  CG2   . THR B  1  194 ? -8.767  44.475 18.677  1.00 64.88  ? 191 THR B CG2   1 
ATOM   3534 N  N     . SER B  1  195 ? -7.285  43.471 14.135  1.00 66.36  ? 192 SER B N     1 
ATOM   3535 C  CA    . SER B  1  195 ? -6.245  43.463 13.120  1.00 67.62  ? 192 SER B CA    1 
ATOM   3536 C  C     . SER B  1  195 ? -6.377  44.675 12.207  1.00 67.17  ? 192 SER B C     1 
ATOM   3537 O  O     . SER B  1  195 ? -7.467  45.216 12.003  1.00 68.17  ? 192 SER B O     1 
ATOM   3538 C  CB    . SER B  1  195 ? -6.312  42.184 12.288  1.00 68.78  ? 192 SER B CB    1 
ATOM   3539 O  OG    . SER B  1  195 ? -7.408  42.218 11.391  1.00 71.75  ? 192 SER B OG    1 
ATOM   3540 N  N     . SER B  1  196 ? -5.241  45.097 11.644  1.00 66.74  ? 193 SER B N     1 
ATOM   3541 C  CA    . SER B  1  196 ? -5.252  46.222 10.716  1.00 71.97  ? 193 SER B CA    1 
ATOM   3542 C  C     . SER B  1  196 ? -5.983  45.891 9.423   1.00 74.36  ? 193 SER B C     1 
ATOM   3543 O  O     . SER B  1  196 ? -6.465  46.807 8.747   1.00 70.38  ? 193 SER B O     1 
ATOM   3544 C  CB    . SER B  1  196 ? -3.823  46.673 10.407  1.00 75.47  ? 193 SER B CB    1 
ATOM   3545 O  OG    . SER B  1  196 ? -3.095  45.660 9.736   1.00 89.37  ? 193 SER B OG    1 
ATOM   3546 N  N     . THR B  1  197 ? -6.074  44.609 9.063   1.00 70.05  ? 194 THR B N     1 
ATOM   3547 C  CA    . THR B  1  197 ? -6.842  44.224 7.883   1.00 66.93  ? 194 THR B CA    1 
ATOM   3548 C  C     . THR B  1  197 ? -8.324  44.502 8.096   1.00 66.04  ? 194 THR B C     1 
ATOM   3549 O  O     . THR B  1  197 ? -8.971  45.163 7.273   1.00 66.97  ? 194 THR B O     1 
ATOM   3550 C  CB    . THR B  1  197 ? -6.617  42.745 7.562   1.00 78.19  ? 194 THR B CB    1 
ATOM   3551 O  OG1   . THR B  1  197 ? -5.213  42.453 7.571   1.00 96.51  ? 194 THR B OG1   1 
ATOM   3552 C  CG2   . THR B  1  197 ? -7.194  42.405 6.193   1.00 69.70  ? 194 THR B CG2   1 
ATOM   3553 N  N     . PHE B  1  198 ? -8.876  44.005 9.207   1.00 69.79  ? 195 PHE B N     1 
ATOM   3554 C  CA    . PHE B  1  198 ? -10.275 44.267 9.521   1.00 64.27  ? 195 PHE B CA    1 
ATOM   3555 C  C     . PHE B  1  198 ? -10.548 45.759 9.661   1.00 61.60  ? 195 PHE B C     1 
ATOM   3556 O  O     . PHE B  1  198 ? -11.633 46.227 9.301   1.00 56.49  ? 195 PHE B O     1 
ATOM   3557 C  CB    . PHE B  1  198 ? -10.674 43.532 10.803  1.00 64.14  ? 195 PHE B CB    1 
ATOM   3558 C  CG    . PHE B  1  198 ? -12.157 43.507 11.051  1.00 64.84  ? 195 PHE B CG    1 
ATOM   3559 C  CD1   . PHE B  1  198 ? -13.006 42.835 10.185  1.00 57.10  ? 195 PHE B CD1   1 
ATOM   3560 C  CD2   . PHE B  1  198 ? -12.700 44.129 12.163  1.00 61.81  ? 195 PHE B CD2   1 
ATOM   3561 C  CE1   . PHE B  1  198 ? -14.368 42.800 10.415  1.00 54.20  ? 195 PHE B CE1   1 
ATOM   3562 C  CE2   . PHE B  1  198 ? -14.062 44.095 12.401  1.00 54.99  ? 195 PHE B CE2   1 
ATOM   3563 C  CZ    . PHE B  1  198 ? -14.897 43.429 11.525  1.00 56.97  ? 195 PHE B CZ    1 
ATOM   3564 N  N     . ALA B  1  199 ? -9.578  46.521 10.177  1.00 63.12  ? 196 ALA B N     1 
ATOM   3565 C  CA    . ALA B  1  199 ? -9.736  47.970 10.267  1.00 59.44  ? 196 ALA B CA    1 
ATOM   3566 C  C     . ALA B  1  199 ? -9.861  48.601 8.885   1.00 64.43  ? 196 ALA B C     1 
ATOM   3567 O  O     . ALA B  1  199 ? -10.701 49.484 8.670   1.00 73.69  ? 196 ALA B O     1 
ATOM   3568 C  CB    . ALA B  1  199 ? -8.558  48.580 11.030  1.00 60.69  ? 196 ALA B CB    1 
ATOM   3569 N  N     . GLU B  1  200 ? -9.036  48.159 7.933   1.00 79.29  ? 197 GLU B N     1 
ATOM   3570 C  CA    . GLU B  1  200 ? -9.143  48.670 6.570   1.00 86.25  ? 197 GLU B CA    1 
ATOM   3571 C  C     . GLU B  1  200 ? -10.460 48.251 5.927   1.00 83.16  ? 197 GLU B C     1 
ATOM   3572 O  O     . GLU B  1  200 ? -11.064 49.027 5.178   1.00 87.93  ? 197 GLU B O     1 
ATOM   3573 C  CB    . GLU B  1  200 ? -7.955  48.194 5.734   1.00 95.12  ? 197 GLU B CB    1 
ATOM   3574 C  CG    . GLU B  1  200 ? -6.641  48.865 6.104   1.00 112.96 ? 197 GLU B CG    1 
ATOM   3575 C  CD    . GLU B  1  200 ? -5.431  48.113 5.590   1.00 123.99 ? 197 GLU B CD    1 
ATOM   3576 O  OE1   . GLU B  1  200 ? -5.597  47.216 4.737   1.00 126.23 ? 197 GLU B OE1   1 
ATOM   3577 O  OE2   . GLU B  1  200 ? -4.310  48.418 6.047   1.00 123.99 ? 197 GLU B OE2   1 
ATOM   3578 N  N     . TRP B  1  201 ? -10.920 47.030 6.211   1.00 76.97  ? 198 TRP B N     1 
ATOM   3579 C  CA    . TRP B  1  201 ? -12.209 46.585 5.689   1.00 75.28  ? 198 TRP B CA    1 
ATOM   3580 C  C     . TRP B  1  201 ? -13.345 47.459 6.205   1.00 75.57  ? 198 TRP B C     1 
ATOM   3581 O  O     . TRP B  1  201 ? -14.250 47.827 5.447   1.00 66.47  ? 198 TRP B O     1 
ATOM   3582 C  CB    . TRP B  1  201 ? -12.451 45.122 6.059   1.00 75.58  ? 198 TRP B CB    1 
ATOM   3583 C  CG    . TRP B  1  201 ? -13.813 44.626 5.681   1.00 72.75  ? 198 TRP B CG    1 
ATOM   3584 C  CD1   . TRP B  1  201 ? -14.173 44.035 4.506   1.00 66.69  ? 198 TRP B CD1   1 
ATOM   3585 C  CD2   . TRP B  1  201 ? -15.000 44.678 6.484   1.00 68.69  ? 198 TRP B CD2   1 
ATOM   3586 N  NE1   . TRP B  1  201 ? -15.509 43.715 4.526   1.00 73.53  ? 198 TRP B NE1   1 
ATOM   3587 C  CE2   . TRP B  1  201 ? -16.040 44.101 5.729   1.00 66.87  ? 198 TRP B CE2   1 
ATOM   3588 C  CE3   . TRP B  1  201 ? -15.284 45.157 7.767   1.00 74.33  ? 198 TRP B CE3   1 
ATOM   3589 C  CZ2   . TRP B  1  201 ? -17.341 43.989 6.213   1.00 66.53  ? 198 TRP B CZ2   1 
ATOM   3590 C  CZ3   . TRP B  1  201 ? -16.575 45.046 8.246   1.00 71.69  ? 198 TRP B CZ3   1 
ATOM   3591 C  CH2   . TRP B  1  201 ? -17.588 44.466 7.471   1.00 70.63  ? 198 TRP B CH2   1 
ATOM   3592 N  N     . ALA B  1  202 ? -13.317 47.798 7.496   1.00 72.58  ? 199 ALA B N     1 
ATOM   3593 C  CA    . ALA B  1  202 ? -14.380 48.615 8.070   1.00 67.54  ? 199 ALA B CA    1 
ATOM   3594 C  C     . ALA B  1  202 ? -14.325 50.045 7.548   1.00 67.16  ? 199 ALA B C     1 
ATOM   3595 O  O     . ALA B  1  202 ? -15.368 50.671 7.329   1.00 70.51  ? 199 ALA B O     1 
ATOM   3596 C  CB    . ALA B  1  202 ? -14.290 48.596 9.595   1.00 68.47  ? 199 ALA B CB    1 
ATOM   3597 N  N     . LYS B  1  203 ? -13.119 50.579 7.344   1.00 68.32  ? 200 LYS B N     1 
ATOM   3598 C  CA    . LYS B  1  203 ? -12.988 51.948 6.857   1.00 68.09  ? 200 LYS B CA    1 
ATOM   3599 C  C     . LYS B  1  203 ? -13.518 52.083 5.434   1.00 75.46  ? 200 LYS B C     1 
ATOM   3600 O  O     . LYS B  1  203 ? -14.141 53.095 5.091   1.00 76.40  ? 200 LYS B O     1 
ATOM   3601 C  CB    . LYS B  1  203 ? -11.527 52.390 6.936   1.00 69.71  ? 200 LYS B CB    1 
ATOM   3602 C  CG    . LYS B  1  203 ? -11.295 53.872 6.682   1.00 69.74  ? 200 LYS B CG    1 
ATOM   3603 C  CD    . LYS B  1  203 ? -9.816  54.214 6.779   1.00 82.26  ? 200 LYS B CD    1 
ATOM   3604 C  CE    . LYS B  1  203 ? -9.560  55.677 6.460   1.00 89.46  ? 200 LYS B CE    1 
ATOM   3605 N  NZ    . LYS B  1  203 ? -8.117  56.024 6.580   1.00 95.58  ? 200 LYS B NZ    1 
ATOM   3606 N  N     . GLU B  1  204 ? -13.289 51.067 4.595   1.00 73.46  ? 201 GLU B N     1 
ATOM   3607 C  CA    . GLU B  1  204 ? -13.756 51.118 3.212   1.00 75.84  ? 201 GLU B CA    1 
ATOM   3608 C  C     . GLU B  1  204 ? -15.273 51.211 3.127   1.00 75.10  ? 201 GLU B C     1 
ATOM   3609 O  O     . GLU B  1  204 ? -15.806 51.802 2.181   1.00 78.84  ? 201 GLU B O     1 
ATOM   3610 C  CB    . GLU B  1  204 ? -13.265 49.890 2.445   1.00 77.19  ? 201 GLU B CB    1 
ATOM   3611 C  CG    . GLU B  1  204 ? -11.780 49.893 2.132   1.00 86.72  ? 201 GLU B CG    1 
ATOM   3612 C  CD    . GLU B  1  204 ? -11.262 48.514 1.779   1.00 96.10  ? 201 GLU B CD    1 
ATOM   3613 O  OE1   . GLU B  1  204 ? -12.076 47.569 1.715   1.00 91.89  ? 201 GLU B OE1   1 
ATOM   3614 O  OE2   . GLU B  1  204 ? -10.039 48.371 1.572   1.00 100.87 ? 201 GLU B OE2   1 
ATOM   3615 N  N     . ARG B  1  205 ? -15.984 50.634 4.093   1.00 69.59  ? 202 ARG B N     1 
ATOM   3616 C  CA    . ARG B  1  205 ? -17.439 50.621 4.085   1.00 64.02  ? 202 ARG B CA    1 
ATOM   3617 C  C     . ARG B  1  205 ? -18.043 51.701 4.974   1.00 63.81  ? 202 ARG B C     1 
ATOM   3618 O  O     . ARG B  1  205 ? -19.266 51.737 5.141   1.00 63.89  ? 202 ARG B O     1 
ATOM   3619 C  CB    . ARG B  1  205 ? -17.950 49.240 4.502   1.00 61.91  ? 202 ARG B CB    1 
ATOM   3620 C  CG    . ARG B  1  205 ? -17.814 48.200 3.402   1.00 63.24  ? 202 ARG B CG    1 
ATOM   3621 C  CD    . ARG B  1  205 ? -17.485 46.822 3.948   1.00 68.50  ? 202 ARG B CD    1 
ATOM   3622 N  NE    . ARG B  1  205 ? -17.114 45.901 2.877   1.00 74.75  ? 202 ARG B NE    1 
ATOM   3623 C  CZ    . ARG B  1  205 ? -15.911 45.864 2.311   1.00 77.95  ? 202 ARG B CZ    1 
ATOM   3624 N  NH1   . ARG B  1  205 ? -14.961 46.696 2.715   1.00 75.81  ? 202 ARG B NH1   1 
ATOM   3625 N  NH2   . ARG B  1  205 ? -15.655 44.996 1.342   1.00 80.94  ? 202 ARG B NH2   1 
ATOM   3626 N  N     . GLY B  1  206 ? -17.221 52.587 5.531   1.00 62.87  ? 203 GLY B N     1 
ATOM   3627 C  CA    . GLY B  1  206 ? -17.736 53.624 6.400   1.00 62.70  ? 203 GLY B CA    1 
ATOM   3628 C  C     . GLY B  1  206 ? -18.246 53.126 7.731   1.00 69.35  ? 203 GLY B C     1 
ATOM   3629 O  O     . GLY B  1  206 ? -19.056 53.804 8.368   1.00 69.51  ? 203 GLY B O     1 
ATOM   3630 N  N     . ILE B  1  207 ? -17.797 51.954 8.166   1.00 68.59  ? 204 ILE B N     1 
ATOM   3631 C  CA    . ILE B  1  207 ? -18.214 51.378 9.437   1.00 64.00  ? 204 ILE B CA    1 
ATOM   3632 C  C     . ILE B  1  207 ? -17.226 51.799 10.514  1.00 67.68  ? 204 ILE B C     1 
ATOM   3633 O  O     . ILE B  1  207 ? -16.009 51.640 10.353  1.00 75.11  ? 204 ILE B O     1 
ATOM   3634 C  CB    . ILE B  1  207 ? -18.297 49.845 9.344   1.00 70.01  ? 204 ILE B CB    1 
ATOM   3635 C  CG1   . ILE B  1  207 ? -19.154 49.427 8.148   1.00 62.52  ? 204 ILE B CG1   1 
ATOM   3636 C  CG2   . ILE B  1  207 ? -18.854 49.265 10.634  1.00 64.28  ? 204 ILE B CG2   1 
ATOM   3637 C  CD1   . ILE B  1  207 ? -19.109 47.943 7.855   1.00 62.58  ? 204 ILE B CD1   1 
ATOM   3638 N  N     . HIS B  1  208 ? -17.742 52.335 11.615  1.00 65.70  ? 205 HIS B N     1 
ATOM   3639 C  CA    . HIS B  1  208 ? -16.916 52.667 12.769  1.00 67.22  ? 205 HIS B CA    1 
ATOM   3640 C  C     . HIS B  1  208 ? -16.776 51.430 13.644  1.00 68.04  ? 205 HIS B C     1 
ATOM   3641 O  O     . HIS B  1  208 ? -17.763 50.741 13.913  1.00 67.30  ? 205 HIS B O     1 
ATOM   3642 C  CB    . HIS B  1  208 ? -17.534 53.816 13.567  1.00 74.87  ? 205 HIS B CB    1 
ATOM   3643 C  CG    . HIS B  1  208 ? -16.819 54.113 14.850  1.00 84.92  ? 205 HIS B CG    1 
ATOM   3644 N  ND1   . HIS B  1  208 ? -15.596 54.749 14.892  1.00 94.03  ? 205 HIS B ND1   1 
ATOM   3645 C  CD2   . HIS B  1  208 ? -17.155 53.859 16.138  1.00 77.03  ? 205 HIS B CD2   1 
ATOM   3646 C  CE1   . HIS B  1  208 ? -15.211 54.876 16.149  1.00 88.17  ? 205 HIS B CE1   1 
ATOM   3647 N  NE2   . HIS B  1  208 ? -16.138 54.344 16.925  1.00 82.27  ? 205 HIS B NE2   1 
ATOM   3648 N  N     . LEU B  1  209 ? -15.549 51.142 14.072  1.00 71.96  ? 206 LEU B N     1 
ATOM   3649 C  CA    . LEU B  1  209 ? -15.281 50.017 14.954  1.00 74.71  ? 206 LEU B CA    1 
ATOM   3650 C  C     . LEU B  1  209 ? -15.239 50.492 16.400  1.00 71.59  ? 206 LEU B C     1 
ATOM   3651 O  O     . LEU B  1  209 ? -14.711 51.567 16.698  1.00 72.23  ? 206 LEU B O     1 
ATOM   3652 C  CB    . LEU B  1  209 ? -13.963 49.326 14.592  1.00 71.81  ? 206 LEU B CB    1 
ATOM   3653 C  CG    . LEU B  1  209 ? -13.933 48.569 13.263  1.00 71.07  ? 206 LEU B CG    1 
ATOM   3654 C  CD1   . LEU B  1  209 ? -12.688 47.693 13.176  1.00 72.48  ? 206 LEU B CD1   1 
ATOM   3655 C  CD2   . LEU B  1  209 ? -15.199 47.741 13.081  1.00 69.74  ? 206 LEU B CD2   1 
ATOM   3656 N  N     . GLU B  1  210 ? -15.805 49.684 17.292  1.00 71.77  ? 207 GLU B N     1 
ATOM   3657 C  CA    . GLU B  1  210 ? -15.928 50.029 18.703  1.00 72.66  ? 207 GLU B CA    1 
ATOM   3658 C  C     . GLU B  1  210 ? -15.622 48.788 19.524  1.00 73.77  ? 207 GLU B C     1 
ATOM   3659 O  O     . GLU B  1  210 ? -16.270 47.753 19.347  1.00 73.14  ? 207 GLU B O     1 
ATOM   3660 C  CB    . GLU B  1  210 ? -17.331 50.561 19.010  1.00 83.42  ? 207 GLU B CB    1 
ATOM   3661 C  CG    . GLU B  1  210 ? -17.693 50.609 20.479  1.00 83.92  ? 207 GLU B CG    1 
ATOM   3662 C  CD    . GLU B  1  210 ? -19.120 51.069 20.697  1.00 88.14  ? 207 GLU B CD    1 
ATOM   3663 O  OE1   . GLU B  1  210 ? -19.436 52.223 20.338  1.00 92.46  ? 207 GLU B OE1   1 
ATOM   3664 O  OE2   . GLU B  1  210 ? -19.932 50.271 21.211  1.00 85.26  ? 207 GLU B OE2   1 
ATOM   3665 N  N     . PHE B  1  211 ? -14.637 48.885 20.409  1.00 77.04  ? 208 PHE B N     1 
ATOM   3666 C  CA    . PHE B  1  211 ? -14.162 47.745 21.174  1.00 76.74  ? 208 PHE B CA    1 
ATOM   3667 C  C     . PHE B  1  211 ? -14.504 47.913 22.647  1.00 77.59  ? 208 PHE B C     1 
ATOM   3668 O  O     . PHE B  1  211 ? -14.452 49.023 23.185  1.00 88.06  ? 208 PHE B O     1 
ATOM   3669 C  CB    . PHE B  1  211 ? -12.650 47.569 21.013  1.00 78.20  ? 208 PHE B CB    1 
ATOM   3670 C  CG    . PHE B  1  211 ? -12.209 47.431 19.590  1.00 79.73  ? 208 PHE B CG    1 
ATOM   3671 C  CD1   . PHE B  1  211 ? -12.306 46.213 18.937  1.00 83.67  ? 208 PHE B CD1   1 
ATOM   3672 C  CD2   . PHE B  1  211 ? -11.696 48.516 18.901  1.00 81.08  ? 208 PHE B CD2   1 
ATOM   3673 C  CE1   . PHE B  1  211 ? -11.901 46.082 17.625  1.00 81.22  ? 208 PHE B CE1   1 
ATOM   3674 C  CE2   . PHE B  1  211 ? -11.289 48.391 17.588  1.00 79.23  ? 208 PHE B CE2   1 
ATOM   3675 C  CZ    . PHE B  1  211 ? -11.392 47.173 16.951  1.00 76.51  ? 208 PHE B CZ    1 
ATOM   3676 N  N     . SER B  1  212 ? -14.865 46.808 23.290  1.00 77.97  ? 209 SER B N     1 
ATOM   3677 C  CA    . SER B  1  212 ? -14.988 46.804 24.734  1.00 79.13  ? 209 SER B CA    1 
ATOM   3678 C  C     . SER B  1  212 ? -13.608 46.664 25.369  1.00 86.60  ? 209 SER B C     1 
ATOM   3679 O  O     . SER B  1  212 ? -12.659 46.170 24.753  1.00 84.47  ? 209 SER B O     1 
ATOM   3680 C  CB    . SER B  1  212 ? -15.912 45.678 25.200  1.00 80.68  ? 209 SER B CB    1 
ATOM   3681 O  OG    . SER B  1  212 ? -15.495 44.425 24.685  1.00 82.72  ? 209 SER B OG    1 
ATOM   3682 N  N     . THR B  1  213 ? -13.503 47.128 26.607  1.00 91.17  ? 210 THR B N     1 
ATOM   3683 C  CA    . THR B  1  213 ? -12.231 47.093 27.311  1.00 96.65  ? 210 THR B CA    1 
ATOM   3684 C  C     . THR B  1  213 ? -11.771 45.646 27.484  1.00 98.99  ? 210 THR B C     1 
ATOM   3685 O  O     . THR B  1  213 ? -12.604 44.751 27.679  1.00 101.78 ? 210 THR B O     1 
ATOM   3686 C  CB    . THR B  1  213 ? -12.369 47.789 28.670  1.00 105.55 ? 210 THR B CB    1 
ATOM   3687 O  OG1   . THR B  1  213 ? -12.287 49.210 28.492  1.00 106.75 ? 210 THR B OG1   1 
ATOM   3688 C  CG2   . THR B  1  213 ? -11.293 47.336 29.649  1.00 107.77 ? 210 THR B CG2   1 
ATOM   3689 N  N     . PRO B  1  214 ? -10.470 45.373 27.368  1.00 97.54  ? 211 PRO B N     1 
ATOM   3690 C  CA    . PRO B  1  214 ? -9.969  44.013 27.607  1.00 93.55  ? 211 PRO B CA    1 
ATOM   3691 C  C     . PRO B  1  214 ? -10.441 43.454 28.942  1.00 97.43  ? 211 PRO B C     1 
ATOM   3692 O  O     . PRO B  1  214 ? -10.382 44.125 29.975  1.00 98.24  ? 211 PRO B O     1 
ATOM   3693 C  CB    . PRO B  1  214 ? -8.449  44.194 27.575  1.00 91.05  ? 211 PRO B CB    1 
ATOM   3694 C  CG    . PRO B  1  214 ? -8.240  45.349 26.660  1.00 88.20  ? 211 PRO B CG    1 
ATOM   3695 C  CD    . PRO B  1  214 ? -9.409  46.275 26.883  1.00 91.21  ? 211 PRO B CD    1 
ATOM   3696 N  N     . TYR B  1  215 ? -10.928 42.213 28.904  1.00 99.15  ? 212 TYR B N     1 
ATOM   3697 C  CA    . TYR B  1  215 ? -11.425 41.437 30.039  1.00 105.71 ? 212 TYR B CA    1 
ATOM   3698 C  C     . TYR B  1  215 ? -12.703 42.012 30.641  1.00 113.30 ? 212 TYR B C     1 
ATOM   3699 O  O     . TYR B  1  215 ? -13.241 41.427 31.589  1.00 114.77 ? 212 TYR B O     1 
ATOM   3700 C  CB    . TYR B  1  215 ? -10.363 41.281 31.137  1.00 91.26  ? 212 TYR B CB    1 
ATOM   3701 C  CG    . TYR B  1  215 ? -9.036  40.792 30.605  1.00 95.80  ? 212 TYR B CG    1 
ATOM   3702 C  CD1   . TYR B  1  215 ? -8.828  39.445 30.342  1.00 97.05  ? 212 TYR B CD1   1 
ATOM   3703 C  CD2   . TYR B  1  215 ? -7.995  41.677 30.353  1.00 104.45 ? 212 TYR B CD2   1 
ATOM   3704 C  CE1   . TYR B  1  215 ? -7.622  38.993 29.851  1.00 101.57 ? 212 TYR B CE1   1 
ATOM   3705 C  CE2   . TYR B  1  215 ? -6.785  41.234 29.862  1.00 104.70 ? 212 TYR B CE2   1 
ATOM   3706 C  CZ    . TYR B  1  215 ? -6.605  39.892 29.613  1.00 102.14 ? 212 TYR B CZ    1 
ATOM   3707 O  OH    . TYR B  1  215 ? -5.400  39.447 29.125  1.00 102.03 ? 212 TYR B OH    1 
ATOM   3708 N  N     . HIS B  1  216 ? -13.223 43.121 30.113  1.00 125.11 ? 213 HIS B N     1 
ATOM   3709 C  CA    . HIS B  1  216 ? -14.472 43.723 30.575  1.00 130.55 ? 213 HIS B CA    1 
ATOM   3710 C  C     . HIS B  1  216 ? -15.461 43.767 29.414  1.00 127.71 ? 213 HIS B C     1 
ATOM   3711 O  O     . HIS B  1  216 ? -15.726 44.838 28.851  1.00 120.08 ? 213 HIS B O     1 
ATOM   3712 C  CB    . HIS B  1  216 ? -14.241 45.126 31.132  1.00 141.13 ? 213 HIS B CB    1 
ATOM   3713 C  CG    . HIS B  1  216 ? -13.339 45.166 32.326  1.00 153.93 ? 213 HIS B CG    1 
ATOM   3714 N  ND1   . HIS B  1  216 ? -13.206 44.106 33.197  1.00 158.78 ? 213 HIS B ND1   1 
ATOM   3715 C  CD2   . HIS B  1  216 ? -12.528 46.143 32.795  1.00 157.06 ? 213 HIS B CD2   1 
ATOM   3716 C  CE1   . HIS B  1  216 ? -12.351 44.428 34.151  1.00 159.92 ? 213 HIS B CE1   1 
ATOM   3717 N  NE2   . HIS B  1  216 ? -11.925 45.659 33.930  1.00 160.26 ? 213 HIS B NE2   1 
ATOM   3718 N  N     . PRO B  1  217 ? -16.029 42.623 29.032  1.00 127.73 ? 214 PRO B N     1 
ATOM   3719 C  CA    . PRO B  1  217 ? -16.984 42.621 27.920  1.00 125.14 ? 214 PRO B CA    1 
ATOM   3720 C  C     . PRO B  1  217 ? -18.272 43.332 28.304  1.00 129.88 ? 214 PRO B C     1 
ATOM   3721 O  O     . PRO B  1  217 ? -18.817 43.127 29.392  1.00 140.21 ? 214 PRO B O     1 
ATOM   3722 C  CB    . PRO B  1  217 ? -17.221 41.130 27.658  1.00 121.51 ? 214 PRO B CB    1 
ATOM   3723 C  CG    . PRO B  1  217 ? -16.967 40.485 28.972  1.00 126.33 ? 214 PRO B CG    1 
ATOM   3724 C  CD    . PRO B  1  217 ? -15.872 41.284 29.627  1.00 127.21 ? 214 PRO B CD    1 
ATOM   3725 N  N     . GLN B  1  218 ? -18.754 44.180 27.398  1.00 121.53 ? 215 GLN B N     1 
ATOM   3726 C  CA    . GLN B  1  218 ? -19.979 44.924 27.639  1.00 120.01 ? 215 GLN B CA    1 
ATOM   3727 C  C     . GLN B  1  218 ? -20.709 45.138 26.321  1.00 116.28 ? 215 GLN B C     1 
ATOM   3728 O  O     . GLN B  1  218 ? -20.117 45.083 25.240  1.00 112.95 ? 215 GLN B O     1 
ATOM   3729 C  CB    . GLN B  1  218 ? -19.705 46.272 28.317  1.00 126.02 ? 215 GLN B CB    1 
ATOM   3730 C  CG    . GLN B  1  218 ? -19.334 47.385 27.352  1.00 133.03 ? 215 GLN B CG    1 
ATOM   3731 C  CD    . GLN B  1  218 ? -19.715 48.756 27.873  1.00 136.75 ? 215 GLN B CD    1 
ATOM   3732 O  OE1   . GLN B  1  218 ? -19.284 49.168 28.950  1.00 135.94 ? 215 GLN B OE1   1 
ATOM   3733 N  NE2   . GLN B  1  218 ? -20.534 49.470 27.110  1.00 136.37 ? 215 GLN B NE2   1 
ATOM   3734 N  N     . SER B  1  219 ? -22.011 45.390 26.432  1.00 114.65 ? 216 SER B N     1 
ATOM   3735 C  CA    . SER B  1  219 ? -22.861 45.620 25.272  1.00 108.35 ? 216 SER B CA    1 
ATOM   3736 C  C     . SER B  1  219 ? -24.167 46.270 25.707  1.00 111.35 ? 216 SER B C     1 
ATOM   3737 O  O     . SER B  1  219 ? -24.216 47.479 25.955  1.00 119.33 ? 216 SER B O     1 
ATOM   3738 C  CB    . SER B  1  219 ? -23.127 44.302 24.537  1.00 103.47 ? 216 SER B CB    1 
ATOM   3739 O  OG    . SER B  1  219 ? -23.413 43.254 25.444  1.00 102.65 ? 216 SER B OG    1 
ATOM   3740 N  N     . SER B  1  220 ? -25.229 45.475 25.798  1.00 102.24 ? 217 SER B N     1 
ATOM   3741 C  CA    . SER B  1  220 ? -26.487 45.926 26.369  1.00 93.78  ? 217 SER B CA    1 
ATOM   3742 C  C     . SER B  1  220 ? -27.179 44.722 26.985  1.00 93.75  ? 217 SER B C     1 
ATOM   3743 O  O     . SER B  1  220 ? -26.849 43.572 26.680  1.00 92.01  ? 217 SER B O     1 
ATOM   3744 C  CB    . SER B  1  220 ? -27.391 46.596 25.327  1.00 81.62  ? 217 SER B CB    1 
ATOM   3745 O  OG    . SER B  1  220 ? -27.911 45.651 24.407  1.00 71.32  ? 217 SER B OG    1 
ATOM   3746 N  N     . GLY B  1  221 ? -28.139 45.000 27.868  1.00 91.27  ? 218 GLY B N     1 
ATOM   3747 C  CA    . GLY B  1  221 ? -28.894 43.920 28.481  1.00 77.48  ? 218 GLY B CA    1 
ATOM   3748 C  C     . GLY B  1  221 ? -29.569 43.035 27.453  1.00 80.66  ? 218 GLY B C     1 
ATOM   3749 O  O     . GLY B  1  221 ? -29.525 41.806 27.545  1.00 81.13  ? 218 GLY B O     1 
ATOM   3750 N  N     . LYS B  1  222 ? -30.190 43.654 26.446  1.00 77.34  ? 219 LYS B N     1 
ATOM   3751 C  CA    . LYS B  1  222 ? -30.847 42.884 25.395  1.00 73.03  ? 219 LYS B CA    1 
ATOM   3752 C  C     . LYS B  1  222 ? -29.848 42.009 24.645  1.00 74.13  ? 219 LYS B C     1 
ATOM   3753 O  O     . LYS B  1  222 ? -30.134 40.844 24.347  1.00 71.15  ? 219 LYS B O     1 
ATOM   3754 C  CB    . LYS B  1  222 ? -31.570 43.827 24.433  1.00 71.77  ? 219 LYS B CB    1 
ATOM   3755 C  CG    . LYS B  1  222 ? -32.413 43.117 23.387  1.00 73.05  ? 219 LYS B CG    1 
ATOM   3756 C  CD    . LYS B  1  222 ? -33.180 44.107 22.529  1.00 74.87  ? 219 LYS B CD    1 
ATOM   3757 C  CE    . LYS B  1  222 ? -33.998 43.382 21.474  1.00 79.44  ? 219 LYS B CE    1 
ATOM   3758 N  NZ    . LYS B  1  222 ? -34.925 42.387 22.080  1.00 84.74  ? 219 LYS B NZ    1 
ATOM   3759 N  N     . VAL B  1  223 ? -28.665 42.549 24.343  1.00 70.32  ? 220 VAL B N     1 
ATOM   3760 C  CA    . VAL B  1  223 ? -27.679 41.783 23.585  1.00 69.29  ? 220 VAL B CA    1 
ATOM   3761 C  C     . VAL B  1  223 ? -27.048 40.703 24.457  1.00 70.49  ? 220 VAL B C     1 
ATOM   3762 O  O     . VAL B  1  223 ? -26.839 39.570 24.006  1.00 69.60  ? 220 VAL B O     1 
ATOM   3763 C  CB    . VAL B  1  223 ? -26.618 42.722 22.982  1.00 67.47  ? 220 VAL B CB    1 
ATOM   3764 C  CG1   . VAL B  1  223 ? -25.496 41.920 22.340  1.00 66.32  ? 220 VAL B CG1   1 
ATOM   3765 C  CG2   . VAL B  1  223 ? -27.259 43.655 21.961  1.00 71.19  ? 220 VAL B CG2   1 
ATOM   3766 N  N     . GLU B  1  224 ? -26.731 41.033 25.714  1.00 71.98  ? 221 GLU B N     1 
ATOM   3767 C  CA    . GLU B  1  224 ? -26.211 40.031 26.642  1.00 83.13  ? 221 GLU B CA    1 
ATOM   3768 C  C     . GLU B  1  224 ? -27.129 38.818 26.704  1.00 79.14  ? 221 GLU B C     1 
ATOM   3769 O  O     . GLU B  1  224 ? -26.679 37.671 26.591  1.00 74.11  ? 221 GLU B O     1 
ATOM   3770 C  CB    . GLU B  1  224 ? -26.046 40.633 28.040  1.00 85.84  ? 221 GLU B CB    1 
ATOM   3771 C  CG    . GLU B  1  224 ? -24.824 41.516 28.234  1.00 98.79  ? 221 GLU B CG    1 
ATOM   3772 C  CD    . GLU B  1  224 ? -24.634 41.913 29.687  1.00 116.66 ? 221 GLU B CD    1 
ATOM   3773 O  OE1   . GLU B  1  224 ? -24.681 41.018 30.558  1.00 118.32 ? 221 GLU B OE1   1 
ATOM   3774 O  OE2   . GLU B  1  224 ? -24.453 43.118 29.963  1.00 123.92 ? 221 GLU B OE2   1 
ATOM   3775 N  N     . ARG B  1  225 ? -28.430 39.060 26.874  1.00 75.31  ? 222 ARG B N     1 
ATOM   3776 C  CA    . ARG B  1  225 ? -29.376 37.960 27.006  1.00 75.78  ? 222 ARG B CA    1 
ATOM   3777 C  C     . ARG B  1  225 ? -29.523 37.197 25.697  1.00 73.93  ? 222 ARG B C     1 
ATOM   3778 O  O     . ARG B  1  225 ? -29.621 35.963 25.700  1.00 74.43  ? 222 ARG B O     1 
ATOM   3779 C  CB    . ARG B  1  225 ? -30.726 38.494 27.486  1.00 77.14  ? 222 ARG B CB    1 
ATOM   3780 C  CG    . ARG B  1  225 ? -30.662 39.126 28.869  1.00 93.22  ? 222 ARG B CG    1 
ATOM   3781 C  CD    . ARG B  1  225 ? -32.040 39.475 29.411  1.00 92.61  ? 222 ARG B CD    1 
ATOM   3782 N  NE    . ARG B  1  225 ? -32.573 40.709 28.841  1.00 83.77  ? 222 ARG B NE    1 
ATOM   3783 C  CZ    . ARG B  1  225 ? -32.307 41.926 29.307  1.00 82.58  ? 222 ARG B CZ    1 
ATOM   3784 N  NH1   . ARG B  1  225 ? -31.502 42.081 30.350  1.00 87.48  ? 222 ARG B NH1   1 
ATOM   3785 N  NH2   . ARG B  1  225 ? -32.843 42.991 28.725  1.00 81.41  ? 222 ARG B NH2   1 
ATOM   3786 N  N     . LYS B  1  226 ? -29.532 37.909 24.567  1.00 71.92  ? 223 LYS B N     1 
ATOM   3787 C  CA    . LYS B  1  226 ? -29.615 37.236 23.274  1.00 71.65  ? 223 LYS B CA    1 
ATOM   3788 C  C     . LYS B  1  226 ? -28.431 36.299 23.074  1.00 69.79  ? 223 LYS B C     1 
ATOM   3789 O  O     . LYS B  1  226 ? -28.599 35.146 22.664  1.00 69.77  ? 223 LYS B O     1 
ATOM   3790 C  CB    . LYS B  1  226 ? -29.694 38.261 22.141  1.00 73.38  ? 223 LYS B CB    1 
ATOM   3791 C  CG    . LYS B  1  226 ? -29.908 37.639 20.766  1.00 66.51  ? 223 LYS B CG    1 
ATOM   3792 C  CD    . LYS B  1  226 ? -31.193 36.821 20.710  1.00 67.30  ? 223 LYS B CD    1 
ATOM   3793 C  CE    . LYS B  1  226 ? -32.423 37.716 20.721  1.00 67.55  ? 223 LYS B CE    1 
ATOM   3794 N  NZ    . LYS B  1  226 ? -33.683 36.921 20.691  1.00 68.50  ? 223 LYS B NZ    1 
ATOM   3795 N  N     . ASN B  1  227 ? -27.220 36.773 23.385  1.00 75.46  ? 224 ASN B N     1 
ATOM   3796 C  CA    . ASN B  1  227 ? -26.046 35.914 23.274  1.00 76.03  ? 224 ASN B CA    1 
ATOM   3797 C  C     . ASN B  1  227 ? -26.081 34.776 24.286  1.00 79.18  ? 224 ASN B C     1 
ATOM   3798 O  O     . ASN B  1  227 ? -25.481 33.721 24.049  1.00 82.37  ? 224 ASN B O     1 
ATOM   3799 C  CB    . ASN B  1  227 ? -24.769 36.736 23.441  1.00 74.05  ? 224 ASN B CB    1 
ATOM   3800 C  CG    . ASN B  1  227 ? -24.349 37.422 22.157  1.00 80.20  ? 224 ASN B CG    1 
ATOM   3801 O  OD1   . ASN B  1  227 ? -23.836 36.782 21.239  1.00 78.33  ? 224 ASN B OD1   1 
ATOM   3802 N  ND2   . ASN B  1  227 ? -24.553 38.732 22.088  1.00 78.15  ? 224 ASN B ND2   1 
ATOM   3803 N  N     . SER B  1  228 ? -26.762 34.969 25.417  1.00 78.85  ? 225 SER B N     1 
ATOM   3804 C  CA    . SER B  1  228 ? -26.994 33.856 26.331  1.00 81.27  ? 225 SER B CA    1 
ATOM   3805 C  C     . SER B  1  228 ? -27.892 32.808 25.685  1.00 75.19  ? 225 SER B C     1 
ATOM   3806 O  O     . SER B  1  228 ? -27.579 31.611 25.702  1.00 75.81  ? 225 SER B O     1 
ATOM   3807 C  CB    . SER B  1  228 ? -27.607 34.365 27.636  1.00 85.89  ? 225 SER B CB    1 
ATOM   3808 O  OG    . SER B  1  228 ? -27.926 33.289 28.502  1.00 79.42  ? 225 SER B OG    1 
ATOM   3809 N  N     . ASP B  1  229 ? -29.008 33.247 25.094  1.00 74.49  ? 226 ASP B N     1 
ATOM   3810 C  CA    . ASP B  1  229 ? -29.929 32.318 24.445  1.00 77.19  ? 226 ASP B CA    1 
ATOM   3811 C  C     . ASP B  1  229 ? -29.237 31.524 23.344  1.00 75.13  ? 226 ASP B C     1 
ATOM   3812 O  O     . ASP B  1  229 ? -29.497 30.327 23.177  1.00 79.44  ? 226 ASP B O     1 
ATOM   3813 C  CB    . ASP B  1  229 ? -31.127 33.076 23.870  1.00 90.17  ? 226 ASP B CB    1 
ATOM   3814 C  CG    . ASP B  1  229 ? -31.917 33.820 24.929  1.00 106.46 ? 226 ASP B CG    1 
ATOM   3815 O  OD1   . ASP B  1  229 ? -31.767 33.495 26.126  1.00 117.76 ? 226 ASP B OD1   1 
ATOM   3816 O  OD2   . ASP B  1  229 ? -32.696 34.725 24.562  1.00 107.82 ? 226 ASP B OD2   1 
ATOM   3817 N  N     . ILE B  1  230 ? -28.350 32.171 22.586  1.00 76.72  ? 227 ILE B N     1 
ATOM   3818 C  CA    . ILE B  1  230 ? -27.706 31.503 21.459  1.00 73.74  ? 227 ILE B CA    1 
ATOM   3819 C  C     . ILE B  1  230 ? -26.789 30.388 21.949  1.00 74.94  ? 227 ILE B C     1 
ATOM   3820 O  O     . ILE B  1  230 ? -26.809 29.271 21.418  1.00 76.68  ? 227 ILE B O     1 
ATOM   3821 C  CB    . ILE B  1  230 ? -26.947 32.523 20.594  1.00 72.11  ? 227 ILE B CB    1 
ATOM   3822 C  CG1   . ILE B  1  230 ? -27.914 33.568 20.041  1.00 73.63  ? 227 ILE B CG1   1 
ATOM   3823 C  CG2   . ILE B  1  230 ? -26.219 31.819 19.459  1.00 66.81  ? 227 ILE B CG2   1 
ATOM   3824 C  CD1   . ILE B  1  230 ? -27.238 34.699 19.315  1.00 69.68  ? 227 ILE B CD1   1 
ATOM   3825 N  N     . LYS B  1  231 ? -25.971 30.673 22.965  1.00 76.46  ? 228 LYS B N     1 
ATOM   3826 C  CA    . LYS B  1  231 ? -25.099 29.642 23.520  1.00 78.82  ? 228 LYS B CA    1 
ATOM   3827 C  C     . LYS B  1  231 ? -25.914 28.474 24.063  1.00 78.75  ? 228 LYS B C     1 
ATOM   3828 O  O     . LYS B  1  231 ? -25.588 27.306 23.818  1.00 81.28  ? 228 LYS B O     1 
ATOM   3829 C  CB    . LYS B  1  231 ? -24.208 30.227 24.618  1.00 85.08  ? 228 LYS B CB    1 
ATOM   3830 C  CG    . LYS B  1  231 ? -23.162 31.226 24.142  1.00 89.33  ? 228 LYS B CG    1 
ATOM   3831 C  CD    . LYS B  1  231 ? -22.021 31.328 25.149  1.00 102.81 ? 228 LYS B CD    1 
ATOM   3832 C  CE    . LYS B  1  231 ? -21.150 32.551 24.910  1.00 108.04 ? 228 LYS B CE    1 
ATOM   3833 N  NZ    . LYS B  1  231 ? -21.754 33.788 25.481  1.00 108.55 ? 228 LYS B NZ    1 
ATOM   3834 N  N     . ARG B  1  232 ? -26.990 28.772 24.795  1.00 76.28  ? 229 ARG B N     1 
ATOM   3835 C  CA    . ARG B  1  232 ? -27.806 27.710 25.372  1.00 81.42  ? 229 ARG B CA    1 
ATOM   3836 C  C     . ARG B  1  232 ? -28.553 26.933 24.294  1.00 80.44  ? 229 ARG B C     1 
ATOM   3837 O  O     . ARG B  1  232 ? -28.603 25.698 24.337  1.00 82.30  ? 229 ARG B O     1 
ATOM   3838 C  CB    . ARG B  1  232 ? -28.785 28.291 26.392  1.00 82.07  ? 229 ARG B CB    1 
ATOM   3839 C  CG    . ARG B  1  232 ? -28.115 28.899 27.614  1.00 83.09  ? 229 ARG B CG    1 
ATOM   3840 C  CD    . ARG B  1  232 ? -28.893 28.579 28.882  1.00 87.55  ? 229 ARG B CD    1 
ATOM   3841 N  NE    . ARG B  1  232 ? -30.139 29.333 28.985  1.00 88.17  ? 229 ARG B NE    1 
ATOM   3842 C  CZ    . ARG B  1  232 ? -31.167 28.973 29.748  1.00 96.56  ? 229 ARG B CZ    1 
ATOM   3843 N  NH1   . ARG B  1  232 ? -31.106 27.858 30.466  1.00 93.51  ? 229 ARG B NH1   1 
ATOM   3844 N  NH2   . ARG B  1  232 ? -32.263 29.719 29.787  1.00 101.72 ? 229 ARG B NH2   1 
ATOM   3845 N  N     . LEU B  1  233 ? -29.139 27.635 23.320  1.00 80.50  ? 230 LEU B N     1 
ATOM   3846 C  CA    . LEU B  1  233 ? -29.892 26.949 22.273  1.00 81.96  ? 230 LEU B CA    1 
ATOM   3847 C  C     . LEU B  1  233 ? -28.992 26.031 21.454  1.00 81.19  ? 230 LEU B C     1 
ATOM   3848 O  O     . LEU B  1  233 ? -29.402 24.929 21.072  1.00 75.61  ? 230 LEU B O     1 
ATOM   3849 C  CB    . LEU B  1  233 ? -30.587 27.965 21.366  1.00 73.59  ? 230 LEU B CB    1 
ATOM   3850 C  CG    . LEU B  1  233 ? -31.482 27.374 20.275  1.00 74.77  ? 230 LEU B CG    1 
ATOM   3851 C  CD1   . LEU B  1  233 ? -32.545 26.474 20.887  1.00 75.22  ? 230 LEU B CD1   1 
ATOM   3852 C  CD2   . LEU B  1  233 ? -32.121 28.473 19.439  1.00 71.35  ? 230 LEU B CD2   1 
ATOM   3853 N  N     . LEU B  1  234 ? -27.760 26.466 21.178  1.00 73.70  ? 231 LEU B N     1 
ATOM   3854 C  CA    . LEU B  1  234 ? -26.829 25.614 20.446  1.00 80.71  ? 231 LEU B CA    1 
ATOM   3855 C  C     . LEU B  1  234 ? -26.473 24.368 21.249  1.00 85.88  ? 231 LEU B C     1 
ATOM   3856 O  O     . LEU B  1  234 ? -26.421 23.262 20.698  1.00 93.62  ? 231 LEU B O     1 
ATOM   3857 C  CB    . LEU B  1  234 ? -25.568 26.399 20.082  1.00 71.94  ? 231 LEU B CB    1 
ATOM   3858 C  CG    . LEU B  1  234 ? -25.703 27.405 18.937  1.00 75.84  ? 231 LEU B CG    1 
ATOM   3859 C  CD1   . LEU B  1  234 ? -24.369 28.088 18.662  1.00 74.71  ? 231 LEU B CD1   1 
ATOM   3860 C  CD2   . LEU B  1  234 ? -26.231 26.718 17.686  1.00 69.07  ? 231 LEU B CD2   1 
ATOM   3861 N  N     . THR B  1  235 ? -26.235 24.526 22.555  1.00 85.08  ? 232 THR B N     1 
ATOM   3862 C  CA    . THR B  1  235 ? -25.879 23.381 23.387  1.00 84.02  ? 232 THR B CA    1 
ATOM   3863 C  C     . THR B  1  235 ? -26.981 22.327 23.383  1.00 85.83  ? 232 THR B C     1 
ATOM   3864 O  O     . THR B  1  235 ? -26.699 21.125 23.321  1.00 81.78  ? 232 THR B O     1 
ATOM   3865 C  CB    . THR B  1  235 ? -25.590 23.837 24.818  1.00 86.83  ? 232 THR B CB    1 
ATOM   3866 O  OG1   . THR B  1  235 ? -24.553 24.825 24.806  1.00 87.74  ? 232 THR B OG1   1 
ATOM   3867 C  CG2   . THR B  1  235 ? -25.152 22.656 25.678  1.00 82.70  ? 232 THR B CG2   1 
ATOM   3868 N  N     . LYS B  1  236 ? -28.243 22.760 23.440  1.00 86.37  ? 233 LYS B N     1 
ATOM   3869 C  CA    . LYS B  1  236 ? -29.345 21.809 23.543  1.00 96.08  ? 233 LYS B CA    1 
ATOM   3870 C  C     . LYS B  1  236 ? -29.488 20.964 22.283  1.00 106.30 ? 233 LYS B C     1 
ATOM   3871 O  O     . LYS B  1  236 ? -29.937 19.814 22.358  1.00 111.92 ? 233 LYS B O     1 
ATOM   3872 C  CB    . LYS B  1  236 ? -30.650 22.546 23.843  1.00 94.38  ? 233 LYS B CB    1 
ATOM   3873 C  CG    . LYS B  1  236 ? -31.822 21.624 24.152  1.00 95.87  ? 233 LYS B CG    1 
ATOM   3874 C  CD    . LYS B  1  236 ? -33.007 22.390 24.718  1.00 96.97  ? 233 LYS B CD    1 
ATOM   3875 C  CE    . LYS B  1  236 ? -34.202 21.473 24.938  1.00 100.63 ? 233 LYS B CE    1 
ATOM   3876 N  NZ    . LYS B  1  236 ? -33.888 20.341 25.855  1.00 101.26 ? 233 LYS B NZ    1 
ATOM   3877 N  N     . LEU B  1  237 ? -29.115 21.503 21.123  1.00 111.02 ? 234 LEU B N     1 
ATOM   3878 C  CA    . LEU B  1  237 ? -29.176 20.746 19.882  1.00 118.10 ? 234 LEU B CA    1 
ATOM   3879 C  C     . LEU B  1  237 ? -27.836 20.133 19.494  1.00 115.41 ? 234 LEU B C     1 
ATOM   3880 O  O     . LEU B  1  237 ? -27.801 19.267 18.613  1.00 111.00 ? 234 LEU B O     1 
ATOM   3881 C  CB    . LEU B  1  237 ? -29.698 21.635 18.747  1.00 117.61 ? 234 LEU B CB    1 
ATOM   3882 C  CG    . LEU B  1  237 ? -31.068 22.255 19.041  1.00 118.54 ? 234 LEU B CG    1 
ATOM   3883 C  CD1   . LEU B  1  237 ? -31.637 22.954 17.817  1.00 115.39 ? 234 LEU B CD1   1 
ATOM   3884 C  CD2   . LEU B  1  237 ? -32.041 21.205 19.565  1.00 117.65 ? 234 LEU B CD2   1 
ATOM   3885 N  N     . LEU B  1  238 ? -26.741 20.559 20.130  1.00 118.56 ? 235 LEU B N     1 
ATOM   3886 C  CA    . LEU B  1  238 ? -25.465 19.875 19.950  1.00 126.10 ? 235 LEU B CA    1 
ATOM   3887 C  C     . LEU B  1  238 ? -25.557 18.428 20.415  1.00 128.82 ? 235 LEU B C     1 
ATOM   3888 O  O     . LEU B  1  238 ? -25.128 17.508 19.711  1.00 132.74 ? 235 LEU B O     1 
ATOM   3889 C  CB    . LEU B  1  238 ? -24.358 20.606 20.713  1.00 130.81 ? 235 LEU B CB    1 
ATOM   3890 C  CG    . LEU B  1  238 ? -23.599 21.736 20.014  1.00 127.93 ? 235 LEU B CG    1 
ATOM   3891 C  CD1   . LEU B  1  238 ? -22.549 22.313 20.947  1.00 123.39 ? 235 LEU B CD1   1 
ATOM   3892 C  CD2   . LEU B  1  238 ? -22.955 21.240 18.732  1.00 127.43 ? 235 LEU B CD2   1 
ATOM   3893 N  N     . VAL B  1  239 ? -26.127 18.205 21.602  1.00 125.63 ? 236 VAL B N     1 
ATOM   3894 C  CA    . VAL B  1  239 ? -26.177 16.861 22.163  1.00 119.04 ? 236 VAL B CA    1 
ATOM   3895 C  C     . VAL B  1  239 ? -26.974 15.946 21.244  1.00 119.46 ? 236 VAL B C     1 
ATOM   3896 O  O     . VAL B  1  239 ? -27.975 16.348 20.638  1.00 115.72 ? 236 VAL B O     1 
ATOM   3897 C  CB    . VAL B  1  239 ? -26.762 16.900 23.585  1.00 112.81 ? 236 VAL B CB    1 
ATOM   3898 C  CG1   . VAL B  1  239 ? -25.953 17.841 24.462  1.00 109.71 ? 236 VAL B CG1   1 
ATOM   3899 C  CG2   . VAL B  1  239 ? -28.223 17.326 23.570  1.00 106.31 ? 236 VAL B CG2   1 
ATOM   3900 N  N     . GLY B  1  240 ? -26.511 14.708 21.100  1.00 118.76 ? 237 GLY B N     1 
ATOM   3901 C  CA    . GLY B  1  240 ? -27.204 13.759 20.242  1.00 125.93 ? 237 GLY B CA    1 
ATOM   3902 C  C     . GLY B  1  240 ? -26.736 13.799 18.804  1.00 127.01 ? 237 GLY B C     1 
ATOM   3903 O  O     . GLY B  1  240 ? -26.695 12.777 18.118  1.00 130.27 ? 237 GLY B O     1 
ATOM   3904 N  N     . ARG B  1  241 ? -26.371 14.992 18.341  1.00 120.31 ? 238 ARG B N     1 
ATOM   3905 C  CA    . ARG B  1  241 ? -25.917 15.183 16.969  1.00 109.09 ? 238 ARG B CA    1 
ATOM   3906 C  C     . ARG B  1  241 ? -24.896 16.312 16.896  1.00 101.25 ? 238 ARG B C     1 
ATOM   3907 O  O     . ARG B  1  241 ? -25.128 17.313 16.205  1.00 93.77  ? 238 ARG B O     1 
ATOM   3908 C  CB    . ARG B  1  241 ? -27.109 15.478 16.057  1.00 106.62 ? 238 ARG B CB    1 
ATOM   3909 C  CG    . ARG B  1  241 ? -28.170 16.367 16.694  1.00 106.54 ? 238 ARG B CG    1 
ATOM   3910 C  CD    . ARG B  1  241 ? -29.349 16.615 15.763  1.00 108.39 ? 238 ARG B CD    1 
ATOM   3911 N  NE    . ARG B  1  241 ? -30.404 17.372 16.432  1.00 113.56 ? 238 ARG B NE    1 
ATOM   3912 C  CZ    . ARG B  1  241 ? -31.468 17.878 15.818  1.00 114.33 ? 238 ARG B CZ    1 
ATOM   3913 N  NH1   . ARG B  1  241 ? -31.622 17.712 14.513  1.00 114.42 ? 238 ARG B NH1   1 
ATOM   3914 N  NH2   . ARG B  1  241 ? -32.378 18.553 16.508  1.00 112.26 ? 238 ARG B NH2   1 
ATOM   3915 N  N     . PRO B  1  242 ? -23.743 16.175 17.559  1.00 94.33  ? 239 PRO B N     1 
ATOM   3916 C  CA    . PRO B  1  242 ? -22.806 17.308 17.652  1.00 96.89  ? 239 PRO B CA    1 
ATOM   3917 C  C     . PRO B  1  242 ? -22.195 17.720 16.327  1.00 101.78 ? 239 PRO B C     1 
ATOM   3918 O  O     . PRO B  1  242 ? -21.618 18.812 16.247  1.00 100.43 ? 239 PRO B O     1 
ATOM   3919 C  CB    . PRO B  1  242 ? -21.733 16.795 18.620  1.00 86.63  ? 239 PRO B CB    1 
ATOM   3920 C  CG    . PRO B  1  242 ? -21.774 15.307 18.456  1.00 86.04  ? 239 PRO B CG    1 
ATOM   3921 C  CD    . PRO B  1  242 ? -23.216 14.966 18.215  1.00 86.08  ? 239 PRO B CD    1 
ATOM   3922 N  N     . THR B  1  243 ? -22.307 16.896 15.286  1.00 103.07 ? 240 THR B N     1 
ATOM   3923 C  CA    . THR B  1  243 ? -21.683 17.176 14.001  1.00 105.34 ? 240 THR B CA    1 
ATOM   3924 C  C     . THR B  1  243 ? -22.696 17.509 12.913  1.00 104.03 ? 240 THR B C     1 
ATOM   3925 O  O     . THR B  1  243 ? -22.339 17.505 11.730  1.00 105.37 ? 240 THR B O     1 
ATOM   3926 C  CB    . THR B  1  243 ? -20.821 15.990 13.566  1.00 104.55 ? 240 THR B CB    1 
ATOM   3927 O  OG1   . THR B  1  243 ? -21.641 14.821 13.442  1.00 104.52 ? 240 THR B OG1   1 
ATOM   3928 C  CG2   . THR B  1  243 ? -19.731 15.728 14.590  1.00 105.81 ? 240 THR B CG2   1 
ATOM   3929 N  N     . LYS B  1  244 ? -23.945 17.800 13.278  1.00 95.52  ? 241 LYS B N     1 
ATOM   3930 C  CA    . LYS B  1  244 ? -24.981 18.121 12.303  1.00 87.24  ? 241 LYS B CA    1 
ATOM   3931 C  C     . LYS B  1  244 ? -25.508 19.544 12.471  1.00 82.13  ? 241 LYS B C     1 
ATOM   3932 O  O     . LYS B  1  244 ? -26.592 19.861 11.972  1.00 88.49  ? 241 LYS B O     1 
ATOM   3933 C  CB    . LYS B  1  244 ? -26.128 17.109 12.388  1.00 94.31  ? 241 LYS B CB    1 
ATOM   3934 C  CG    . LYS B  1  244 ? -25.690 15.667 12.158  1.00 109.40 ? 241 LYS B CG    1 
ATOM   3935 C  CD    . LYS B  1  244 ? -26.827 14.795 11.644  1.00 117.08 ? 241 LYS B CD    1 
ATOM   3936 C  CE    . LYS B  1  244 ? -26.300 13.441 11.195  1.00 117.24 ? 241 LYS B CE    1 
ATOM   3937 N  NZ    . LYS B  1  244 ? -27.356 12.577 10.602  1.00 114.63 ? 241 LYS B NZ    1 
ATOM   3938 N  N     . TRP B  1  245 ? -24.754 20.415 13.147  1.00 76.58  ? 242 TRP B N     1 
ATOM   3939 C  CA    . TRP B  1  245 ? -25.249 21.757 13.426  1.00 73.91  ? 242 TRP B CA    1 
ATOM   3940 C  C     . TRP B  1  245 ? -25.151 22.696 12.230  1.00 84.02  ? 242 TRP B C     1 
ATOM   3941 O  O     . TRP B  1  245 ? -25.793 23.751 12.244  1.00 91.77  ? 242 TRP B O     1 
ATOM   3942 C  CB    . TRP B  1  245 ? -24.513 22.371 14.623  1.00 73.66  ? 242 TRP B CB    1 
ATOM   3943 C  CG    . TRP B  1  245 ? -23.012 22.445 14.505  1.00 77.61  ? 242 TRP B CG    1 
ATOM   3944 C  CD1   . TRP B  1  245 ? -22.112 21.530 14.968  1.00 82.29  ? 242 TRP B CD1   1 
ATOM   3945 C  CD2   . TRP B  1  245 ? -22.239 23.504 13.919  1.00 79.89  ? 242 TRP B CD2   1 
ATOM   3946 N  NE1   . TRP B  1  245 ? -20.830 21.944 14.698  1.00 77.71  ? 242 TRP B NE1   1 
ATOM   3947 C  CE2   . TRP B  1  245 ? -20.880 23.152 14.054  1.00 75.83  ? 242 TRP B CE2   1 
ATOM   3948 C  CE3   . TRP B  1  245 ? -22.563 24.709 13.288  1.00 81.98  ? 242 TRP B CE3   1 
ATOM   3949 C  CZ2   . TRP B  1  245 ? -19.847 23.960 13.580  1.00 76.95  ? 242 TRP B CZ2   1 
ATOM   3950 C  CZ3   . TRP B  1  245 ? -21.534 25.511 12.818  1.00 75.67  ? 242 TRP B CZ3   1 
ATOM   3951 C  CH2   . TRP B  1  245 ? -20.194 25.133 12.967  1.00 72.83  ? 242 TRP B CH2   1 
ATOM   3952 N  N     . TYR B  1  246 ? -24.374 22.343 11.202  1.00 80.23  ? 243 TYR B N     1 
ATOM   3953 C  CA    . TYR B  1  246 ? -24.294 23.204 10.024  1.00 74.89  ? 243 TYR B CA    1 
ATOM   3954 C  C     . TYR B  1  246 ? -25.659 23.365 9.369   1.00 79.07  ? 243 TYR B C     1 
ATOM   3955 O  O     . TYR B  1  246 ? -26.040 24.473 8.976   1.00 84.01  ? 243 TYR B O     1 
ATOM   3956 C  CB    . TYR B  1  246 ? -23.287 22.649 9.015   1.00 77.21  ? 243 TYR B CB    1 
ATOM   3957 C  CG    . TYR B  1  246 ? -23.256 23.429 7.716   1.00 79.33  ? 243 TYR B CG    1 
ATOM   3958 C  CD1   . TYR B  1  246 ? -22.427 24.533 7.565   1.00 76.03  ? 243 TYR B CD1   1 
ATOM   3959 C  CD2   . TYR B  1  246 ? -24.065 23.066 6.644   1.00 86.51  ? 243 TYR B CD2   1 
ATOM   3960 C  CE1   . TYR B  1  246 ? -22.403 25.250 6.386   1.00 79.59  ? 243 TYR B CE1   1 
ATOM   3961 C  CE2   . TYR B  1  246 ? -24.048 23.778 5.465   1.00 85.00  ? 243 TYR B CE2   1 
ATOM   3962 C  CZ    . TYR B  1  246 ? -23.215 24.867 5.340   1.00 85.25  ? 243 TYR B CZ    1 
ATOM   3963 O  OH    . TYR B  1  246 ? -23.194 25.577 4.163   1.00 89.27  ? 243 TYR B OH    1 
ATOM   3964 N  N     . ASP B  1  247 ? -26.407 22.268 9.236   1.00 80.32  ? 244 ASP B N     1 
ATOM   3965 C  CA    . ASP B  1  247 ? -27.721 22.324 8.610   1.00 75.63  ? 244 ASP B CA    1 
ATOM   3966 C  C     . ASP B  1  247 ? -28.779 22.938 9.518   1.00 71.27  ? 244 ASP B C     1 
ATOM   3967 O  O     . ASP B  1  247 ? -29.824 23.371 9.020   1.00 68.53  ? 244 ASP B O     1 
ATOM   3968 C  CB    . ASP B  1  247 ? -28.163 20.922 8.189   1.00 83.19  ? 244 ASP B CB    1 
ATOM   3969 C  CG    . ASP B  1  247 ? -27.240 20.309 7.158   1.00 89.86  ? 244 ASP B CG    1 
ATOM   3970 O  OD1   . ASP B  1  247 ? -26.748 21.051 6.282   1.00 90.10  ? 244 ASP B OD1   1 
ATOM   3971 O  OD2   . ASP B  1  247 ? -27.005 19.084 7.225   1.00 94.17  ? 244 ASP B OD2   1 
ATOM   3972 N  N     . LEU B  1  248 ? -28.533 22.987 10.823  1.00 75.76  ? 245 LEU B N     1 
ATOM   3973 C  CA    . LEU B  1  248 ? -29.521 23.509 11.757  1.00 77.20  ? 245 LEU B CA    1 
ATOM   3974 C  C     . LEU B  1  248 ? -29.422 25.013 11.960  1.00 69.96  ? 245 LEU B C     1 
ATOM   3975 O  O     . LEU B  1  248 ? -30.364 25.611 12.489  1.00 74.40  ? 245 LEU B O     1 
ATOM   3976 C  CB    . LEU B  1  248 ? -29.395 22.796 13.107  1.00 79.51  ? 245 LEU B CB    1 
ATOM   3977 C  CG    . LEU B  1  248 ? -29.781 21.318 13.031  1.00 77.67  ? 245 LEU B CG    1 
ATOM   3978 C  CD1   . LEU B  1  248 ? -29.700 20.651 14.392  1.00 73.62  ? 245 LEU B CD1   1 
ATOM   3979 C  CD2   . LEU B  1  248 ? -31.175 21.172 12.438  1.00 73.44  ? 245 LEU B CD2   1 
ATOM   3980 N  N     . LEU B  1  249 ? -28.317 25.634 11.552  1.00 64.75  ? 246 LEU B N     1 
ATOM   3981 C  CA    . LEU B  1  249 ? -28.194 27.087 11.666  1.00 67.42  ? 246 LEU B CA    1 
ATOM   3982 C  C     . LEU B  1  249 ? -29.383 27.852 11.092  1.00 67.77  ? 246 LEU B C     1 
ATOM   3983 O  O     . LEU B  1  249 ? -29.797 28.840 11.720  1.00 69.19  ? 246 LEU B O     1 
ATOM   3984 C  CB    . LEU B  1  249 ? -26.889 27.554 11.003  1.00 65.84  ? 246 LEU B CB    1 
ATOM   3985 C  CG    . LEU B  1  249 ? -25.584 27.273 11.748  1.00 72.83  ? 246 LEU B CG    1 
ATOM   3986 C  CD1   . LEU B  1  249 ? -24.407 27.869 10.995  1.00 74.47  ? 246 LEU B CD1   1 
ATOM   3987 C  CD2   . LEU B  1  249 ? -25.647 27.823 13.164  1.00 66.86  ? 246 LEU B CD2   1 
ATOM   3988 N  N     . PRO B  1  250 ? -29.964 27.484 9.941   1.00 72.27  ? 247 PRO B N     1 
ATOM   3989 C  CA    . PRO B  1  250 ? -31.169 28.204 9.489   1.00 72.59  ? 247 PRO B CA    1 
ATOM   3990 C  C     . PRO B  1  250 ? -32.326 28.157 10.477  1.00 77.66  ? 247 PRO B C     1 
ATOM   3991 O  O     . PRO B  1  250 ? -32.928 29.201 10.764  1.00 76.74  ? 247 PRO B O     1 
ATOM   3992 C  CB    . PRO B  1  250 ? -31.508 27.506 8.167   1.00 61.71  ? 247 PRO B CB    1 
ATOM   3993 C  CG    . PRO B  1  250 ? -30.191 27.050 7.653   1.00 64.15  ? 247 PRO B CG    1 
ATOM   3994 C  CD    . PRO B  1  250 ? -29.432 26.610 8.875   1.00 66.44  ? 247 PRO B CD    1 
ATOM   3995 N  N     . VAL B  1  251 ? -32.665 26.979 11.009  1.00 79.72  ? 248 VAL B N     1 
ATOM   3996 C  CA    . VAL B  1  251 ? -33.801 26.912 11.924  1.00 73.69  ? 248 VAL B CA    1 
ATOM   3997 C  C     . VAL B  1  251 ? -33.458 27.566 13.257  1.00 70.46  ? 248 VAL B C     1 
ATOM   3998 O  O     . VAL B  1  251 ? -34.348 28.060 13.961  1.00 69.23  ? 248 VAL B O     1 
ATOM   3999 C  CB    . VAL B  1  251 ? -34.282 25.456 12.105  1.00 67.28  ? 248 VAL B CB    1 
ATOM   4000 C  CG1   . VAL B  1  251 ? -33.252 24.620 12.848  1.00 68.47  ? 248 VAL B CG1   1 
ATOM   4001 C  CG2   . VAL B  1  251 ? -35.627 25.415 12.827  1.00 68.67  ? 248 VAL B CG2   1 
ATOM   4002 N  N     . VAL B  1  252 ? -32.173 27.604 13.621  1.00 70.75  ? 249 VAL B N     1 
ATOM   4003 C  CA    . VAL B  1  252 ? -31.775 28.259 14.865  1.00 66.74  ? 249 VAL B CA    1 
ATOM   4004 C  C     . VAL B  1  252 ? -32.034 29.758 14.774  1.00 67.83  ? 249 VAL B C     1 
ATOM   4005 O  O     . VAL B  1  252 ? -32.528 30.378 15.724  1.00 67.62  ? 249 VAL B O     1 
ATOM   4006 C  CB    . VAL B  1  252 ? -30.301 27.954 15.192  1.00 67.77  ? 249 VAL B CB    1 
ATOM   4007 C  CG1   . VAL B  1  252 ? -29.824 28.792 16.371  1.00 66.56  ? 249 VAL B CG1   1 
ATOM   4008 C  CG2   . VAL B  1  252 ? -30.117 26.473 15.502  1.00 67.95  ? 249 VAL B CG2   1 
ATOM   4009 N  N     . GLN B  1  253 ? -31.730 30.359 13.621  1.00 67.42  ? 250 GLN B N     1 
ATOM   4010 C  CA    . GLN B  1  253 ? -31.935 31.795 13.463  1.00 64.26  ? 250 GLN B CA    1 
ATOM   4011 C  C     . GLN B  1  253 ? -33.415 32.149 13.462  1.00 67.42  ? 250 GLN B C     1 
ATOM   4012 O  O     . GLN B  1  253 ? -33.817 33.159 14.052  1.00 73.42  ? 250 GLN B O     1 
ATOM   4013 C  CB    . GLN B  1  253 ? -31.280 32.285 12.175  1.00 64.17  ? 250 GLN B CB    1 
ATOM   4014 C  CG    . GLN B  1  253 ? -29.771 32.361 12.229  1.00 74.81  ? 250 GLN B CG    1 
ATOM   4015 C  CD    . GLN B  1  253 ? -29.183 32.883 10.937  1.00 72.85  ? 250 GLN B CD    1 
ATOM   4016 O  OE1   . GLN B  1  253 ? -28.435 32.183 10.257  1.00 85.44  ? 250 GLN B OE1   1 
ATOM   4017 N  NE2   . GLN B  1  253 ? -29.520 34.120 10.588  1.00 68.97  ? 250 GLN B NE2   1 
ATOM   4018 N  N     . LEU B  1  254 ? -34.237 31.343 12.786  1.00 66.82  ? 251 LEU B N     1 
ATOM   4019 C  CA    . LEU B  1  254 ? -35.675 31.587 12.786  1.00 69.69  ? 251 LEU B CA    1 
ATOM   4020 C  C     . LEU B  1  254 ? -36.231 31.565 14.203  1.00 75.22  ? 251 LEU B C     1 
ATOM   4021 O  O     . LEU B  1  254 ? -37.039 32.424 14.577  1.00 83.87  ? 251 LEU B O     1 
ATOM   4022 C  CB    . LEU B  1  254 ? -36.378 30.551 11.911  1.00 71.27  ? 251 LEU B CB    1 
ATOM   4023 C  CG    . LEU B  1  254 ? -36.093 30.691 10.416  1.00 71.17  ? 251 LEU B CG    1 
ATOM   4024 C  CD1   . LEU B  1  254 ? -36.618 29.490 9.644   1.00 73.99  ? 251 LEU B CD1   1 
ATOM   4025 C  CD2   . LEU B  1  254 ? -36.703 31.982 9.893   1.00 72.89  ? 251 LEU B CD2   1 
ATOM   4026 N  N     . ALA B  1  255 ? -35.793 30.599 15.011  1.00 76.91  ? 252 ALA B N     1 
ATOM   4027 C  CA    . ALA B  1  255 ? -36.230 30.536 16.401  1.00 68.09  ? 252 ALA B CA    1 
ATOM   4028 C  C     . ALA B  1  255 ? -35.802 31.782 17.167  1.00 67.84  ? 252 ALA B C     1 
ATOM   4029 O  O     . ALA B  1  255 ? -36.623 32.439 17.816  1.00 68.74  ? 252 ALA B O     1 
ATOM   4030 C  CB    . ALA B  1  255 ? -35.675 29.277 17.067  1.00 69.60  ? 252 ALA B CB    1 
ATOM   4031 N  N     . LEU B  1  256 ? -34.514 32.129 17.087  1.00 66.76  ? 253 LEU B N     1 
ATOM   4032 C  CA    . LEU B  1  256 ? -34.004 33.283 17.821  1.00 66.64  ? 253 LEU B CA    1 
ATOM   4033 C  C     . LEU B  1  256 ? -34.707 34.568 17.401  1.00 72.48  ? 253 LEU B C     1 
ATOM   4034 O  O     . LEU B  1  256 ? -35.010 35.422 18.242  1.00 66.53  ? 253 LEU B O     1 
ATOM   4035 C  CB    . LEU B  1  256 ? -32.495 33.414 17.609  1.00 65.68  ? 253 LEU B CB    1 
ATOM   4036 C  CG    . LEU B  1  256 ? -31.607 32.279 18.120  1.00 69.35  ? 253 LEU B CG    1 
ATOM   4037 C  CD1   . LEU B  1  256 ? -30.212 32.394 17.527  1.00 65.18  ? 253 LEU B CD1   1 
ATOM   4038 C  CD2   . LEU B  1  256 ? -31.544 32.282 19.639  1.00 68.44  ? 253 LEU B CD2   1 
ATOM   4039 N  N     . ASN B  1  257 ? -34.979 34.723 16.105  1.00 71.06  ? 254 ASN B N     1 
ATOM   4040 C  CA    . ASN B  1  257 ? -35.541 35.964 15.591  1.00 65.80  ? 254 ASN B CA    1 
ATOM   4041 C  C     . ASN B  1  257 ? -37.057 36.046 15.729  1.00 64.17  ? 254 ASN B C     1 
ATOM   4042 O  O     . ASN B  1  257 ? -37.614 37.137 15.577  1.00 64.40  ? 254 ASN B O     1 
ATOM   4043 C  CB    . ASN B  1  257 ? -35.145 36.148 14.125  1.00 61.02  ? 254 ASN B CB    1 
ATOM   4044 C  CG    . ASN B  1  257 ? -33.682 36.508 13.966  1.00 65.50  ? 254 ASN B CG    1 
ATOM   4045 O  OD1   . ASN B  1  257 ? -33.126 37.252 14.773  1.00 68.50  ? 254 ASN B OD1   1 
ATOM   4046 N  ND2   . ASN B  1  257 ? -33.047 35.974 12.930  1.00 58.75  ? 254 ASN B ND2   1 
ATOM   4047 N  N     . ASN B  1  258 ? -37.733 34.933 16.003  1.00 65.57  ? 255 ASN B N     1 
ATOM   4048 C  CA    . ASN B  1  258 ? -39.162 34.949 16.288  1.00 66.96  ? 255 ASN B CA    1 
ATOM   4049 C  C     . ASN B  1  258 ? -39.451 34.610 17.745  1.00 80.78  ? 255 ASN B C     1 
ATOM   4050 O  O     . ASN B  1  258 ? -40.546 34.141 18.073  1.00 87.17  ? 255 ASN B O     1 
ATOM   4051 C  CB    . ASN B  1  258 ? -39.902 34.002 15.345  1.00 66.86  ? 255 ASN B CB    1 
ATOM   4052 C  CG    . ASN B  1  258 ? -39.809 34.447 13.899  1.00 76.08  ? 255 ASN B CG    1 
ATOM   4053 O  OD1   . ASN B  1  258 ? -40.412 35.445 13.509  1.00 78.93  ? 255 ASN B OD1   1 
ATOM   4054 N  ND2   . ASN B  1  258 ? -39.038 33.719 13.100  1.00 67.63  ? 255 ASN B ND2   1 
ATOM   4055 N  N     . THR B  1  259 ? -38.475 34.839 18.620  1.00 83.79  ? 256 THR B N     1 
ATOM   4056 C  CA    . THR B  1  259 ? -38.654 34.699 20.056  1.00 89.60  ? 256 THR B CA    1 
ATOM   4057 C  C     . THR B  1  259 ? -39.175 36.011 20.633  1.00 86.64  ? 256 THR B C     1 
ATOM   4058 O  O     . THR B  1  259 ? -38.686 37.092 20.286  1.00 84.08  ? 256 THR B O     1 
ATOM   4059 C  CB    . THR B  1  259 ? -37.334 34.300 20.725  1.00 93.19  ? 256 THR B CB    1 
ATOM   4060 O  OG1   . THR B  1  259 ? -37.029 32.936 20.404  1.00 98.80  ? 256 THR B OG1   1 
ATOM   4061 C  CG2   . THR B  1  259 ? -37.416 34.454 22.234  1.00 83.71  ? 256 THR B CG2   1 
ATOM   4062 N  N     . TYR B  1  260 ? -40.173 35.908 21.503  1.00 86.93  ? 257 TYR B N     1 
ATOM   4063 C  CA    . TYR B  1  260 ? -40.826 37.078 22.069  1.00 95.42  ? 257 TYR B CA    1 
ATOM   4064 C  C     . TYR B  1  260 ? -39.946 37.755 23.116  1.00 100.54 ? 257 TYR B C     1 
ATOM   4065 O  O     . TYR B  1  260 ? -39.358 37.096 23.983  1.00 108.52 ? 257 TYR B O     1 
ATOM   4066 C  CB    . TYR B  1  260 ? -42.172 36.677 22.673  1.00 106.94 ? 257 TYR B CB    1 
ATOM   4067 C  CG    . TYR B  1  260 ? -42.918 37.797 23.355  1.00 117.60 ? 257 TYR B CG    1 
ATOM   4068 C  CD1   . TYR B  1  260 ? -43.535 38.799 22.618  1.00 119.15 ? 257 TYR B CD1   1 
ATOM   4069 C  CD2   . TYR B  1  260 ? -43.027 37.838 24.739  1.00 112.72 ? 257 TYR B CD2   1 
ATOM   4070 C  CE1   . TYR B  1  260 ? -44.225 39.816 23.241  1.00 121.49 ? 257 TYR B CE1   1 
ATOM   4071 C  CE2   . TYR B  1  260 ? -43.714 38.850 25.369  1.00 111.68 ? 257 TYR B CE2   1 
ATOM   4072 C  CZ    . TYR B  1  260 ? -44.311 39.837 24.616  1.00 117.42 ? 257 TYR B CZ    1 
ATOM   4073 O  OH    . TYR B  1  260 ? -44.999 40.849 25.240  1.00 121.15 ? 257 TYR B OH    1 
ATOM   4074 N  N     . SER B  1  261 ? -39.866 39.084 23.035  1.00 93.95  ? 258 SER B N     1 
ATOM   4075 C  CA    . SER B  1  261 ? -39.026 39.864 23.934  1.00 91.65  ? 258 SER B CA    1 
ATOM   4076 C  C     . SER B  1  261 ? -39.876 40.456 25.046  1.00 93.45  ? 258 SER B C     1 
ATOM   4077 O  O     . SER B  1  261 ? -40.783 41.251 24.760  1.00 79.38  ? 258 SER B O     1 
ATOM   4078 C  CB    . SER B  1  261 ? -38.315 40.975 23.174  1.00 74.46  ? 258 SER B CB    1 
ATOM   4079 O  OG    . SER B  1  261 ? -37.709 41.902 24.063  1.00 82.48  ? 258 SER B OG    1 
ATOM   4080 N  N     . PRO B  1  262 ? -39.624 40.116 26.313  1.00 94.27  ? 259 PRO B N     1 
ATOM   4081 C  CA    . PRO B  1  262 ? -40.462 40.654 27.398  1.00 104.19 ? 259 PRO B CA    1 
ATOM   4082 C  C     . PRO B  1  262 ? -40.367 42.164 27.577  1.00 111.66 ? 259 PRO B C     1 
ATOM   4083 O  O     . PRO B  1  262 ? -41.344 42.786 28.015  1.00 110.86 ? 259 PRO B O     1 
ATOM   4084 C  CB    . PRO B  1  262 ? -39.941 39.912 28.638  1.00 103.66 ? 259 PRO B CB    1 
ATOM   4085 C  CG    . PRO B  1  262 ? -39.295 38.679 28.101  1.00 97.55  ? 259 PRO B CG    1 
ATOM   4086 C  CD    . PRO B  1  262 ? -38.697 39.074 26.790  1.00 89.38  ? 259 PRO B CD    1 
ATOM   4087 N  N     . VAL B  1  263 ? -39.226 42.774 27.262  1.00 113.92 ? 260 VAL B N     1 
ATOM   4088 C  CA    . VAL B  1  263 ? -39.069 44.210 27.477  1.00 110.92 ? 260 VAL B CA    1 
ATOM   4089 C  C     . VAL B  1  263 ? -39.748 45.006 26.368  1.00 106.16 ? 260 VAL B C     1 
ATOM   4090 O  O     . VAL B  1  263 ? -40.554 45.905 26.633  1.00 104.81 ? 260 VAL B O     1 
ATOM   4091 C  CB    . VAL B  1  263 ? -37.579 44.572 27.601  1.00 99.62  ? 260 VAL B CB    1 
ATOM   4092 C  CG1   . VAL B  1  263 ? -37.395 46.080 27.544  1.00 87.36  ? 260 VAL B CG1   1 
ATOM   4093 C  CG2   . VAL B  1  263 ? -37.008 44.013 28.893  1.00 83.63  ? 260 VAL B CG2   1 
ATOM   4094 N  N     . LEU B  1  264 ? -39.427 44.697 25.110  1.00 104.40 ? 261 LEU B N     1 
ATOM   4095 C  CA    . LEU B  1  264 ? -39.990 45.433 23.984  1.00 103.95 ? 261 LEU B CA    1 
ATOM   4096 C  C     . LEU B  1  264 ? -41.374 44.937 23.581  1.00 101.14 ? 261 LEU B C     1 
ATOM   4097 O  O     . LEU B  1  264 ? -42.081 45.650 22.859  1.00 103.02 ? 261 LEU B O     1 
ATOM   4098 C  CB    . LEU B  1  264 ? -39.044 45.360 22.784  1.00 97.19  ? 261 LEU B CB    1 
ATOM   4099 C  CG    . LEU B  1  264 ? -37.795 46.239 22.870  1.00 93.33  ? 261 LEU B CG    1 
ATOM   4100 C  CD1   . LEU B  1  264 ? -36.703 45.718 21.957  1.00 86.30  ? 261 LEU B CD1   1 
ATOM   4101 C  CD2   . LEU B  1  264 ? -38.138 47.678 22.521  1.00 94.52  ? 261 LEU B CD2   1 
ATOM   4102 N  N     . LYS B  1  265 ? -41.770 43.743 24.028  1.00 94.55  ? 262 LYS B N     1 
ATOM   4103 C  CA    . LYS B  1  265 ? -43.076 43.160 23.714  1.00 92.00  ? 262 LYS B CA    1 
ATOM   4104 C  C     . LYS B  1  265 ? -43.263 42.972 22.208  1.00 86.42  ? 262 LYS B C     1 
ATOM   4105 O  O     . LYS B  1  265 ? -44.376 43.072 21.686  1.00 82.68  ? 262 LYS B O     1 
ATOM   4106 C  CB    . LYS B  1  265 ? -44.214 43.992 24.319  1.00 100.07 ? 262 LYS B CB    1 
ATOM   4107 C  CG    . LYS B  1  265 ? -44.149 44.071 25.845  1.00 115.60 ? 262 LYS B CG    1 
ATOM   4108 C  CD    . LYS B  1  265 ? -45.225 44.970 26.435  1.00 120.49 ? 262 LYS B CD    1 
ATOM   4109 C  CE    . LYS B  1  265 ? -45.112 45.014 27.954  1.00 120.14 ? 262 LYS B CE    1 
ATOM   4110 N  NZ    . LYS B  1  265 ? -46.151 45.873 28.584  1.00 125.61 ? 262 LYS B NZ    1 
ATOM   4111 N  N     . TYR B  1  266 ? -42.164 42.688 21.509  1.00 83.82  ? 263 TYR B N     1 
ATOM   4112 C  CA    . TYR B  1  266 ? -42.167 42.406 20.080  1.00 72.56  ? 263 TYR B CA    1 
ATOM   4113 C  C     . TYR B  1  266 ? -40.964 41.529 19.758  1.00 74.44  ? 263 TYR B C     1 
ATOM   4114 O  O     . TYR B  1  266 ? -39.919 41.626 20.406  1.00 81.36  ? 263 TYR B O     1 
ATOM   4115 C  CB    . TYR B  1  266 ? -42.114 43.685 19.232  1.00 71.01  ? 263 TYR B CB    1 
ATOM   4116 C  CG    . TYR B  1  266 ? -43.399 44.485 19.174  1.00 80.91  ? 263 TYR B CG    1 
ATOM   4117 C  CD1   . TYR B  1  266 ? -44.542 43.958 18.585  1.00 84.13  ? 263 TYR B CD1   1 
ATOM   4118 C  CD2   . TYR B  1  266 ? -43.460 45.777 19.680  1.00 82.25  ? 263 TYR B CD2   1 
ATOM   4119 C  CE1   . TYR B  1  266 ? -45.714 44.686 18.524  1.00 81.59  ? 263 TYR B CE1   1 
ATOM   4120 C  CE2   . TYR B  1  266 ? -44.626 46.515 19.620  1.00 83.78  ? 263 TYR B CE2   1 
ATOM   4121 C  CZ    . TYR B  1  266 ? -45.748 45.965 19.040  1.00 83.33  ? 263 TYR B CZ    1 
ATOM   4122 O  OH    . TYR B  1  266 ? -46.912 46.695 18.977  1.00 80.49  ? 263 TYR B OH    1 
ATOM   4123 N  N     . THR B  1  267 ? -41.114 40.677 18.746  1.00 69.79  ? 264 THR B N     1 
ATOM   4124 C  CA    . THR B  1  267 ? -40.012 39.830 18.317  1.00 72.42  ? 264 THR B CA    1 
ATOM   4125 C  C     . THR B  1  267 ? -39.032 40.619 17.451  1.00 66.15  ? 264 THR B C     1 
ATOM   4126 O  O     . THR B  1  267 ? -39.375 41.678 16.919  1.00 65.41  ? 264 THR B O     1 
ATOM   4127 C  CB    . THR B  1  267 ? -40.537 38.626 17.537  1.00 74.39  ? 264 THR B CB    1 
ATOM   4128 O  OG1   . THR B  1  267 ? -41.099 39.065 16.295  1.00 76.73  ? 264 THR B OG1   1 
ATOM   4129 C  CG2   . THR B  1  267 ? -41.596 37.886 18.339  1.00 70.45  ? 264 THR B CG2   1 
ATOM   4130 N  N     . PRO B  1  268 ? -37.792 40.134 17.312  1.00 65.17  ? 265 PRO B N     1 
ATOM   4131 C  CA    . PRO B  1  268 ? -36.855 40.800 16.389  1.00 63.07  ? 265 PRO B CA    1 
ATOM   4132 C  C     . PRO B  1  268 ? -37.376 40.881 14.966  1.00 64.72  ? 265 PRO B C     1 
ATOM   4133 O  O     . PRO B  1  268 ? -37.178 41.901 14.294  1.00 63.44  ? 265 PRO B O     1 
ATOM   4134 C  CB    . PRO B  1  268 ? -35.596 39.927 16.484  1.00 63.15  ? 265 PRO B CB    1 
ATOM   4135 C  CG    . PRO B  1  268 ? -35.670 39.306 17.832  1.00 64.74  ? 265 PRO B CG    1 
ATOM   4136 C  CD    . PRO B  1  268 ? -37.132 39.079 18.103  1.00 66.15  ? 265 PRO B CD    1 
ATOM   4137 N  N     . HIS B  1  269 ? -38.041 39.824 14.491  1.00 66.70  ? 266 HIS B N     1 
ATOM   4138 C  CA    . HIS B  1  269 ? -38.612 39.844 13.148  1.00 60.30  ? 266 HIS B CA    1 
ATOM   4139 C  C     . HIS B  1  269 ? -39.591 40.999 12.984  1.00 62.70  ? 266 HIS B C     1 
ATOM   4140 O  O     . HIS B  1  269 ? -39.590 41.680 11.952  1.00 60.58  ? 266 HIS B O     1 
ATOM   4141 C  CB    . HIS B  1  269 ? -39.305 38.511 12.855  1.00 60.94  ? 266 HIS B CB    1 
ATOM   4142 C  CG    . HIS B  1  269 ? -39.813 38.389 11.450  1.00 63.88  ? 266 HIS B CG    1 
ATOM   4143 N  ND1   . HIS B  1  269 ? -41.023 38.911 11.046  1.00 62.58  ? 266 HIS B ND1   1 
ATOM   4144 C  CD2   . HIS B  1  269 ? -39.272 37.803 10.355  1.00 61.15  ? 266 HIS B CD2   1 
ATOM   4145 C  CE1   . HIS B  1  269 ? -41.206 38.654 9.763   1.00 66.59  ? 266 HIS B CE1   1 
ATOM   4146 N  NE2   . HIS B  1  269 ? -40.159 37.980 9.321   1.00 66.81  ? 266 HIS B NE2   1 
ATOM   4147 N  N     . GLN B  1  270 ? -40.422 41.244 13.998  1.00 67.16  ? 267 GLN B N     1 
ATOM   4148 C  CA    . GLN B  1  270 ? -41.415 42.310 13.904  1.00 62.70  ? 267 GLN B CA    1 
ATOM   4149 C  C     . GLN B  1  270 ? -40.764 43.687 13.958  1.00 69.37  ? 267 GLN B C     1 
ATOM   4150 O  O     . GLN B  1  270 ? -41.181 44.604 13.241  1.00 78.17  ? 267 GLN B O     1 
ATOM   4151 C  CB    . GLN B  1  270 ? -42.448 42.158 15.018  1.00 65.16  ? 267 GLN B CB    1 
ATOM   4152 C  CG    . GLN B  1  270 ? -43.300 40.904 14.901  1.00 68.84  ? 267 GLN B CG    1 
ATOM   4153 C  CD    . GLN B  1  270 ? -44.171 40.677 16.117  1.00 70.78  ? 267 GLN B CD    1 
ATOM   4154 O  OE1   . GLN B  1  270 ? -43.840 41.109 17.220  1.00 69.91  ? 267 GLN B OE1   1 
ATOM   4155 N  NE2   . GLN B  1  270 ? -45.296 39.999 15.920  1.00 71.14  ? 267 GLN B NE2   1 
ATOM   4156 N  N     . LEU B  1  271 ? -39.743 43.854 14.799  1.00 63.70  ? 268 LEU B N     1 
ATOM   4157 C  CA    . LEU B  1  271 ? -39.086 45.154 14.899  1.00 62.06  ? 268 LEU B CA    1 
ATOM   4158 C  C     . LEU B  1  271 ? -38.283 45.480 13.649  1.00 59.95  ? 268 LEU B C     1 
ATOM   4159 O  O     . LEU B  1  271 ? -38.097 46.658 13.322  1.00 58.97  ? 268 LEU B O     1 
ATOM   4160 C  CB    . LEU B  1  271 ? -38.194 45.192 16.141  1.00 64.35  ? 268 LEU B CB    1 
ATOM   4161 C  CG    . LEU B  1  271 ? -38.926 45.230 17.485  1.00 69.82  ? 268 LEU B CG    1 
ATOM   4162 C  CD1   . LEU B  1  271 ? -37.945 45.044 18.626  1.00 75.85  ? 268 LEU B CD1   1 
ATOM   4163 C  CD2   . LEU B  1  271 ? -39.682 46.538 17.643  1.00 70.65  ? 268 LEU B CD2   1 
ATOM   4164 N  N     . LEU B  1  272 ? -37.809 44.463 12.927  1.00 58.40  ? 269 LEU B N     1 
ATOM   4165 C  CA    . LEU B  1  272 ? -36.980 44.711 11.754  1.00 63.06  ? 269 LEU B CA    1 
ATOM   4166 C  C     . LEU B  1  272 ? -37.827 44.909 10.505  1.00 64.80  ? 269 LEU B C     1 
ATOM   4167 O  O     . LEU B  1  272 ? -37.489 45.735 9.646   1.00 61.64  ? 269 LEU B O     1 
ATOM   4168 C  CB    . LEU B  1  272 ? -35.990 43.564 11.557  1.00 59.41  ? 269 LEU B CB    1 
ATOM   4169 C  CG    . LEU B  1  272 ? -35.050 43.702 10.356  1.00 53.86  ? 269 LEU B CG    1 
ATOM   4170 C  CD1   . LEU B  1  272 ? -34.218 44.970 10.486  1.00 53.41  ? 269 LEU B CD1   1 
ATOM   4171 C  CD2   . LEU B  1  272 ? -34.160 42.477 10.203  1.00 53.56  ? 269 LEU B CD2   1 
ATOM   4172 N  N     . PHE B  1  273 ? -38.937 44.179 10.386  1.00 58.27  ? 270 PHE B N     1 
ATOM   4173 C  CA    . PHE B  1  273 ? -39.759 44.226 9.188   1.00 55.17  ? 270 PHE B CA    1 
ATOM   4174 C  C     . PHE B  1  273 ? -41.122 44.871 9.391   1.00 61.01  ? 270 PHE B C     1 
ATOM   4175 O  O     . PHE B  1  273 ? -41.800 45.151 8.397   1.00 65.14  ? 270 PHE B O     1 
ATOM   4176 C  CB    . PHE B  1  273 ? -39.968 42.813 8.620   1.00 58.83  ? 270 PHE B CB    1 
ATOM   4177 C  CG    . PHE B  1  273 ? -38.694 42.077 8.315   1.00 60.34  ? 270 PHE B CG    1 
ATOM   4178 C  CD1   . PHE B  1  273 ? -37.788 42.573 7.391   1.00 66.66  ? 270 PHE B CD1   1 
ATOM   4179 C  CD2   . PHE B  1  273 ? -38.415 40.875 8.941   1.00 55.05  ? 270 PHE B CD2   1 
ATOM   4180 C  CE1   . PHE B  1  273 ? -36.620 41.887 7.111   1.00 59.60  ? 270 PHE B CE1   1 
ATOM   4181 C  CE2   . PHE B  1  273 ? -37.253 40.186 8.666   1.00 56.41  ? 270 PHE B CE2   1 
ATOM   4182 C  CZ    . PHE B  1  273 ? -36.353 40.692 7.750   1.00 56.55  ? 270 PHE B CZ    1 
ATOM   4183 N  N     . GLY B  1  274 ? -41.550 45.103 10.631  1.00 63.67  ? 271 GLY B N     1 
ATOM   4184 C  CA    . GLY B  1  274 ? -42.839 45.728 10.865  1.00 59.39  ? 271 GLY B CA    1 
ATOM   4185 C  C     . GLY B  1  274 ? -44.041 44.874 10.530  1.00 64.97  ? 271 GLY B C     1 
ATOM   4186 O  O     . GLY B  1  274 ? -45.123 45.414 10.289  1.00 60.72  ? 271 GLY B O     1 
ATOM   4187 N  N     . ILE B  1  275 ? -43.885 43.548 10.502  1.00 64.34  ? 272 ILE B N     1 
ATOM   4188 C  CA    . ILE B  1  275 ? -44.976 42.633 10.188  1.00 66.36  ? 272 ILE B CA    1 
ATOM   4189 C  C     . ILE B  1  275 ? -44.868 41.401 11.074  1.00 62.27  ? 272 ILE B C     1 
ATOM   4190 O  O     . ILE B  1  275 ? -43.820 41.112 11.655  1.00 67.52  ? 272 ILE B O     1 
ATOM   4191 C  CB    . ILE B  1  275 ? -44.985 42.189 8.707   1.00 61.55  ? 272 ILE B CB    1 
ATOM   4192 C  CG1   . ILE B  1  275 ? -43.676 41.475 8.367   1.00 62.49  ? 272 ILE B CG1   1 
ATOM   4193 C  CG2   . ILE B  1  275 ? -45.231 43.365 7.779   1.00 60.10  ? 272 ILE B CG2   1 
ATOM   4194 C  CD1   . ILE B  1  275 ? -43.637 40.896 6.971   1.00 71.92  ? 272 ILE B CD1   1 
ATOM   4195 N  N     . ASP B  1  276 ? -45.974 40.668 11.161  1.00 63.68  ? 273 ASP B N     1 
ATOM   4196 C  CA    . ASP B  1  276 ? -45.934 39.338 11.743  1.00 68.33  ? 273 ASP B CA    1 
ATOM   4197 C  C     . ASP B  1  276 ? -45.167 38.395 10.822  1.00 69.03  ? 273 ASP B C     1 
ATOM   4198 O  O     . ASP B  1  276 ? -44.982 38.656 9.631   1.00 73.48  ? 273 ASP B O     1 
ATOM   4199 C  CB    . ASP B  1  276 ? -47.347 38.804 11.985  1.00 72.57  ? 273 ASP B CB    1 
ATOM   4200 C  CG    . ASP B  1  276 ? -47.940 39.289 13.294  1.00 88.52  ? 273 ASP B CG    1 
ATOM   4201 O  OD1   . ASP B  1  276 ? -47.478 40.330 13.805  1.00 87.11  ? 273 ASP B OD1   1 
ATOM   4202 O  OD2   . ASP B  1  276 ? -48.869 38.631 13.810  1.00 97.28  ? 273 ASP B OD2   1 
ATOM   4203 N  N     . SER B  1  277 ? -44.719 37.284 11.392  1.00 73.27  ? 274 SER B N     1 
ATOM   4204 C  CA    . SER B  1  277 ? -43.905 36.314 10.678  1.00 63.09  ? 274 SER B CA    1 
ATOM   4205 C  C     . SER B  1  277 ? -44.733 35.101 10.277  1.00 67.68  ? 274 SER B C     1 
ATOM   4206 O  O     . SER B  1  277 ? -45.701 34.736 10.948  1.00 86.18  ? 274 SER B O     1 
ATOM   4207 C  CB    . SER B  1  277 ? -42.721 35.874 11.536  1.00 63.32  ? 274 SER B CB    1 
ATOM   4208 O  OG    . SER B  1  277 ? -42.315 34.553 11.226  1.00 67.35  ? 274 SER B OG    1 
ATOM   4209 N  N     . ASN B  1  278 ? -44.340 34.478 9.167   1.00 62.91  ? 275 ASN B N     1 
ATOM   4210 C  CA    . ASN B  1  278 ? -44.993 33.259 8.711   1.00 66.20  ? 275 ASN B CA    1 
ATOM   4211 C  C     . ASN B  1  278 ? -44.551 32.029 9.491   1.00 66.99  ? 275 ASN B C     1 
ATOM   4212 O  O     . ASN B  1  278 ? -45.120 30.951 9.289   1.00 66.44  ? 275 ASN B O     1 
ATOM   4213 C  CB    . ASN B  1  278 ? -44.730 33.050 7.219   1.00 62.27  ? 275 ASN B CB    1 
ATOM   4214 C  CG    . ASN B  1  278 ? -45.248 34.194 6.376   1.00 61.03  ? 275 ASN B CG    1 
ATOM   4215 O  OD1   . ASN B  1  278 ? -46.335 34.716 6.622   1.00 61.89  ? 275 ASN B OD1   1 
ATOM   4216 N  ND2   . ASN B  1  278 ? -44.467 34.599 5.381   1.00 60.87  ? 275 ASN B ND2   1 
ATOM   4217 N  N     . THR B  1  279 ? -43.556 32.164 10.365  1.00 74.33  ? 276 THR B N     1 
ATOM   4218 C  CA    . THR B  1  279 ? -43.130 31.094 11.266  1.00 80.92  ? 276 THR B CA    1 
ATOM   4219 C  C     . THR B  1  279 ? -43.142 31.637 12.687  1.00 87.45  ? 276 THR B C     1 
ATOM   4220 O  O     . THR B  1  279 ? -42.088 31.965 13.248  1.00 87.23  ? 276 THR B O     1 
ATOM   4221 C  CB    . THR B  1  279 ? -41.739 30.570 10.906  1.00 76.99  ? 276 THR B CB    1 
ATOM   4222 O  OG1   . THR B  1  279 ? -40.770 31.605 11.113  1.00 75.24  ? 276 THR B OG1   1 
ATOM   4223 C  CG2   . THR B  1  279 ? -41.697 30.124 9.461   1.00 73.46  ? 276 THR B CG2   1 
ATOM   4224 N  N     . PRO B  1  280 ? -44.322 31.756 13.302  1.00 91.39  ? 277 PRO B N     1 
ATOM   4225 C  CA    . PRO B  1  280 ? -44.381 32.170 14.710  1.00 93.40  ? 277 PRO B CA    1 
ATOM   4226 C  C     . PRO B  1  280 ? -44.103 30.976 15.612  1.00 90.60  ? 277 PRO B C     1 
ATOM   4227 O  O     . PRO B  1  280 ? -44.817 29.972 15.572  1.00 96.54  ? 277 PRO B O     1 
ATOM   4228 C  CB    . PRO B  1  280 ? -45.817 32.680 14.868  1.00 98.10  ? 277 PRO B CB    1 
ATOM   4229 C  CG    . PRO B  1  280 ? -46.595 31.890 13.876  1.00 98.26  ? 277 PRO B CG    1 
ATOM   4230 C  CD    . PRO B  1  280 ? -45.666 31.563 12.727  1.00 91.42  ? 277 PRO B CD    1 
ATOM   4231 N  N     . PHE B  1  281 ? -43.046 31.080 16.416  1.00 92.10  ? 278 PHE B N     1 
ATOM   4232 C  CA    . PHE B  1  281 ? -42.655 29.997 17.316  1.00 103.72 ? 278 PHE B CA    1 
ATOM   4233 C  C     . PHE B  1  281 ? -43.431 30.160 18.619  1.00 112.52 ? 278 PHE B C     1 
ATOM   4234 O  O     . PHE B  1  281 ? -42.930 30.657 19.631  1.00 116.96 ? 278 PHE B O     1 
ATOM   4235 C  CB    . PHE B  1  281 ? -41.147 29.990 17.530  1.00 104.90 ? 278 PHE B CB    1 
ATOM   4236 C  CG    . PHE B  1  281 ? -40.376 29.384 16.384  1.00 100.39 ? 278 PHE B CG    1 
ATOM   4237 C  CD1   . PHE B  1  281 ? -40.461 29.924 15.111  1.00 91.65  ? 278 PHE B CD1   1 
ATOM   4238 C  CD2   . PHE B  1  281 ? -39.562 28.281 16.585  1.00 99.98  ? 278 PHE B CD2   1 
ATOM   4239 C  CE1   . PHE B  1  281 ? -39.757 29.372 14.058  1.00 83.86  ? 278 PHE B CE1   1 
ATOM   4240 C  CE2   . PHE B  1  281 ? -38.853 27.725 15.534  1.00 99.37  ? 278 PHE B CE2   1 
ATOM   4241 C  CZ    . PHE B  1  281 ? -38.951 28.271 14.271  1.00 88.24  ? 278 PHE B CZ    1 
ATOM   4242 N  N     . ALA B  1  282 ? -44.696 29.735 18.577  1.00 124.47 ? 279 ALA B N     1 
ATOM   4243 C  CA    . ALA B  1  282 ? -45.551 29.835 19.755  1.00 136.10 ? 279 ALA B CA    1 
ATOM   4244 C  C     . ALA B  1  282 ? -45.096 28.886 20.856  1.00 158.18 ? 279 ALA B C     1 
ATOM   4245 O  O     . ALA B  1  282 ? -45.044 29.269 22.029  1.00 157.04 ? 279 ALA B O     1 
ATOM   4246 C  CB    . ALA B  1  282 ? -47.007 29.558 19.378  1.00 120.16 ? 279 ALA B CB    1 
ATOM   4247 N  N     . ASN B  1  283 ? -44.780 27.638 20.501  1.00 179.42 ? 280 ASN B N     1 
ATOM   4248 C  CA    . ASN B  1  283 ? -44.252 26.678 21.464  1.00 175.50 ? 280 ASN B CA    1 
ATOM   4249 C  C     . ASN B  1  283 ? -42.888 27.126 21.971  1.00 167.13 ? 280 ASN B C     1 
ATOM   4250 O  O     . ASN B  1  283 ? -41.857 26.789 21.379  1.00 170.04 ? 280 ASN B O     1 
ATOM   4251 C  CB    . ASN B  1  283 ? -44.151 25.283 20.840  1.00 173.65 ? 280 ASN B CB    1 
ATOM   4252 C  CG    . ASN B  1  283 ? -45.487 24.571 20.785  1.00 169.67 ? 280 ASN B CG    1 
ATOM   4253 O  OD1   . ASN B  1  283 ? -46.342 24.769 21.648  1.00 168.21 ? 280 ASN B OD1   1 
ATOM   4254 N  ND2   . ASN B  1  283 ? -45.671 23.733 19.773  1.00 165.75 ? 280 ASN B ND2   1 
ATOM   4255 N  N     . GLN B  1  284 ? -42.872 27.890 23.060  1.00 208.17 ? 281 GLN B N     1 
ATOM   4256 C  CA    . GLN B  1  284 ? -41.617 28.367 23.628  1.00 191.22 ? 281 GLN B CA    1 
ATOM   4257 C  C     . GLN B  1  284 ? -40.870 27.209 24.277  1.00 187.31 ? 281 GLN B C     1 
ATOM   4258 O  O     . GLN B  1  284 ? -41.356 26.603 25.239  1.00 185.06 ? 281 GLN B O     1 
ATOM   4259 C  CB    . GLN B  1  284 ? -41.884 29.483 24.635  1.00 182.43 ? 281 GLN B CB    1 
ATOM   4260 C  CG    . GLN B  1  284 ? -42.418 30.759 23.996  1.00 180.14 ? 281 GLN B CG    1 
ATOM   4261 C  CD    . GLN B  1  284 ? -42.802 31.813 25.014  1.00 176.61 ? 281 GLN B CD    1 
ATOM   4262 O  OE1   . GLN B  1  284 ? -42.684 31.599 26.220  1.00 173.85 ? 281 GLN B OE1   1 
ATOM   4263 N  NE2   . GLN B  1  284 ? -43.269 32.960 24.532  1.00 173.66 ? 281 GLN B NE2   1 
ATOM   4264 N  N     . ASP B  1  285 ? -39.688 26.906 23.744  1.00 177.99 ? 282 ASP B N     1 
ATOM   4265 C  CA    . ASP B  1  285 ? -38.896 25.777 24.208  1.00 174.80 ? 282 ASP B CA    1 
ATOM   4266 C  C     . ASP B  1  285 ? -38.436 25.992 25.649  1.00 174.08 ? 282 ASP B C     1 
ATOM   4267 O  O     . ASP B  1  285 ? -38.441 27.110 26.176  1.00 168.03 ? 282 ASP B O     1 
ATOM   4268 C  CB    . ASP B  1  285 ? -37.690 25.572 23.290  1.00 169.30 ? 282 ASP B CB    1 
ATOM   4269 C  CG    . ASP B  1  285 ? -36.933 24.291 23.589  1.00 165.97 ? 282 ASP B CG    1 
ATOM   4270 O  OD1   . ASP B  1  285 ? -37.578 23.274 23.920  1.00 166.57 ? 282 ASP B OD1   1 
ATOM   4271 O  OD2   . ASP B  1  285 ? -35.688 24.307 23.494  1.00 162.32 ? 282 ASP B OD2   1 
ATOM   4272 N  N     . THR B  1  286 ? -38.040 24.889 26.291  1.00 174.66 ? 283 THR B N     1 
ATOM   4273 C  CA    . THR B  1  286 ? -37.585 24.961 27.673  1.00 170.81 ? 283 THR B CA    1 
ATOM   4274 C  C     . THR B  1  286 ? -36.208 25.604 27.772  1.00 162.16 ? 283 THR B C     1 
ATOM   4275 O  O     . THR B  1  286 ? -35.915 26.282 28.762  1.00 161.90 ? 283 THR B O     1 
ATOM   4276 C  CB    . THR B  1  286 ? -37.548 23.570 28.304  1.00 172.93 ? 283 THR B CB    1 
ATOM   4277 O  OG1   . THR B  1  286 ? -36.643 22.734 27.569  1.00 169.99 ? 283 THR B OG1   1 
ATOM   4278 C  CG2   . THR B  1  286 ? -38.928 22.959 28.295  1.00 175.56 ? 283 THR B CG2   1 
ATOM   4279 N  N     . LEU B  1  287 ? -35.358 25.401 26.765  1.00 149.92 ? 284 LEU B N     1 
ATOM   4280 C  CA    . LEU B  1  287 ? -33.992 25.902 26.700  1.00 136.41 ? 284 LEU B CA    1 
ATOM   4281 C  C     . LEU B  1  287 ? -33.101 25.332 27.788  1.00 133.23 ? 284 LEU B C     1 
ATOM   4282 O  O     . LEU B  1  287 ? -31.938 25.716 27.853  1.00 122.11 ? 284 LEU B O     1 
ATOM   4283 C  CB    . LEU B  1  287 ? -33.895 27.435 26.777  1.00 128.47 ? 284 LEU B CB    1 
ATOM   4284 C  CG    . LEU B  1  287 ? -32.790 28.168 25.997  1.00 121.54 ? 284 LEU B CG    1 
ATOM   4285 C  CD1   . LEU B  1  287 ? -32.895 27.845 24.510  1.00 123.29 ? 284 LEU B CD1   1 
ATOM   4286 C  CD2   . LEU B  1  287 ? -32.909 29.668 26.236  1.00 120.51 ? 284 LEU B CD2   1 
ATOM   4287 N  N     . ASP B  1  288 ? -33.608 24.452 28.648  1.00 138.39 ? 285 ASP B N     1 
ATOM   4288 C  CA    . ASP B  1  288 ? -32.844 23.758 29.676  1.00 137.46 ? 285 ASP B CA    1 
ATOM   4289 C  C     . ASP B  1  288 ? -32.632 22.308 29.261  1.00 131.41 ? 285 ASP B C     1 
ATOM   4290 O  O     . ASP B  1  288 ? -33.425 21.738 28.510  1.00 134.10 ? 285 ASP B O     1 
ATOM   4291 C  CB    . ASP B  1  288 ? -33.561 23.806 31.034  1.00 141.63 ? 285 ASP B CB    1 
ATOM   4292 C  CG    . ASP B  1  288 ? -33.540 25.187 31.649  1.00 141.30 ? 285 ASP B CG    1 
ATOM   4293 O  OD1   . ASP B  1  288 ? -34.422 26.013 31.327  1.00 145.17 ? 285 ASP B OD1   1 
ATOM   4294 O  OD2   . ASP B  1  288 ? -32.624 25.447 32.452  1.00 132.95 ? 285 ASP B OD2   1 
ATOM   4295 N  N     . LEU B  1  289 ? -31.539 21.724 29.747  1.00 126.19 ? 286 LEU B N     1 
ATOM   4296 C  CA    . LEU B  1  289 ? -31.195 20.351 29.411  1.00 126.81 ? 286 LEU B CA    1 
ATOM   4297 C  C     . LEU B  1  289 ? -32.017 19.388 30.256  1.00 134.60 ? 286 LEU B C     1 
ATOM   4298 O  O     . LEU B  1  289 ? -32.050 19.502 31.486  1.00 134.13 ? 286 LEU B O     1 
ATOM   4299 C  CB    . LEU B  1  289 ? -29.702 20.117 29.634  1.00 125.18 ? 286 LEU B CB    1 
ATOM   4300 C  CG    . LEU B  1  289 ? -28.763 21.038 28.852  1.00 123.52 ? 286 LEU B CG    1 
ATOM   4301 C  CD1   . LEU B  1  289 ? -27.322 20.823 29.284  1.00 121.77 ? 286 LEU B CD1   1 
ATOM   4302 C  CD2   . LEU B  1  289 ? -28.916 20.812 27.356  1.00 125.19 ? 286 LEU B CD2   1 
ATOM   4303 N  N     . THR B  1  290 ? -32.689 18.449 29.595  1.00 136.61 ? 287 THR B N     1 
ATOM   4304 C  CA    . THR B  1  290 ? -33.380 17.391 30.311  1.00 135.43 ? 287 THR B CA    1 
ATOM   4305 C  C     . THR B  1  290 ? -32.364 16.479 30.995  1.00 136.95 ? 287 THR B C     1 
ATOM   4306 O  O     . THR B  1  290 ? -31.155 16.562 30.758  1.00 130.56 ? 287 THR B O     1 
ATOM   4307 C  CB    . THR B  1  290 ? -34.266 16.584 29.361  1.00 135.28 ? 287 THR B CB    1 
ATOM   4308 O  OG1   . THR B  1  290 ? -33.446 15.748 28.535  1.00 136.04 ? 287 THR B OG1   1 
ATOM   4309 C  CG2   . THR B  1  290 ? -35.080 17.516 28.474  1.00 135.76 ? 287 THR B CG2   1 
ATOM   4310 N  N     . ARG B  1  291 ? -32.868 15.593 31.855  1.00 141.24 ? 288 ARG B N     1 
ATOM   4311 C  CA    . ARG B  1  291 ? -31.968 14.731 32.615  1.00 149.18 ? 288 ARG B CA    1 
ATOM   4312 C  C     . ARG B  1  291 ? -31.169 13.814 31.696  1.00 155.66 ? 288 ARG B C     1 
ATOM   4313 O  O     . ARG B  1  291 ? -29.979 13.574 31.930  1.00 153.10 ? 288 ARG B O     1 
ATOM   4314 C  CB    . ARG B  1  291 ? -32.748 13.913 33.643  1.00 149.36 ? 288 ARG B CB    1 
ATOM   4315 C  CG    . ARG B  1  291 ? -31.836 13.149 34.586  1.00 148.36 ? 288 ARG B CG    1 
ATOM   4316 C  CD    . ARG B  1  291 ? -32.582 12.164 35.461  1.00 148.10 ? 288 ARG B CD    1 
ATOM   4317 N  NE    . ARG B  1  291 ? -31.645 11.271 36.134  1.00 147.45 ? 288 ARG B NE    1 
ATOM   4318 C  CZ    . ARG B  1  291 ? -31.162 10.159 35.590  1.00 148.06 ? 288 ARG B CZ    1 
ATOM   4319 N  NH1   . ARG B  1  291 ? -31.535 9.800  34.369  1.00 150.78 ? 288 ARG B NH1   1 
ATOM   4320 N  NH2   . ARG B  1  291 ? -30.306 9.405  36.265  1.00 144.19 ? 288 ARG B NH2   1 
ATOM   4321 N  N     . GLU B  1  292 ? -31.801 13.297 30.640  1.00 155.73 ? 289 GLU B N     1 
ATOM   4322 C  CA    . GLU B  1  292 ? -31.097 12.414 29.714  1.00 155.71 ? 289 GLU B CA    1 
ATOM   4323 C  C     . GLU B  1  292 ? -30.005 13.167 28.963  1.00 150.17 ? 289 GLU B C     1 
ATOM   4324 O  O     . GLU B  1  292 ? -28.875 12.678 28.831  1.00 151.05 ? 289 GLU B O     1 
ATOM   4325 C  CB    . GLU B  1  292 ? -32.086 11.777 28.738  1.00 158.50 ? 289 GLU B CB    1 
ATOM   4326 C  CG    . GLU B  1  292 ? -32.808 10.556 29.293  1.00 158.76 ? 289 GLU B CG    1 
ATOM   4327 C  CD    . GLU B  1  292 ? -32.946 9.449  28.266  1.00 158.87 ? 289 GLU B CD    1 
ATOM   4328 O  OE1   . GLU B  1  292 ? -32.580 9.676  27.093  1.00 158.55 ? 289 GLU B OE1   1 
ATOM   4329 O  OE2   . GLU B  1  292 ? -33.415 8.351  28.632  1.00 156.69 ? 289 GLU B OE2   1 
ATOM   4330 N  N     . GLU B  1  293 ? -30.323 14.365 28.470  1.00 144.61 ? 290 GLU B N     1 
ATOM   4331 C  CA    . GLU B  1  293 ? -29.325 15.156 27.761  1.00 143.77 ? 290 GLU B CA    1 
ATOM   4332 C  C     . GLU B  1  293 ? -28.202 15.596 28.689  1.00 139.69 ? 290 GLU B C     1 
ATOM   4333 O  O     . GLU B  1  293 ? -27.049 15.708 28.257  1.00 136.47 ? 290 GLU B O     1 
ATOM   4334 C  CB    . GLU B  1  293 ? -29.979 16.373 27.112  1.00 132.32 ? 290 GLU B CB    1 
ATOM   4335 C  CG    . GLU B  1  293 ? -31.030 16.041 26.069  1.00 136.83 ? 290 GLU B CG    1 
ATOM   4336 C  CD    . GLU B  1  293 ? -31.809 17.265 25.631  1.00 139.98 ? 290 GLU B CD    1 
ATOM   4337 O  OE1   . GLU B  1  293 ? -31.706 18.311 26.309  1.00 139.13 ? 290 GLU B OE1   1 
ATOM   4338 O  OE2   . GLU B  1  293 ? -32.524 17.183 24.611  1.00 142.18 ? 290 GLU B OE2   1 
ATOM   4339 N  N     . GLU B  1  294 ? -28.520 15.858 29.959  1.00 149.65 ? 291 GLU B N     1 
ATOM   4340 C  CA    . GLU B  1  294 ? -27.483 16.192 30.932  1.00 150.24 ? 291 GLU B CA    1 
ATOM   4341 C  C     . GLU B  1  294 ? -26.472 15.059 31.056  1.00 152.05 ? 291 GLU B C     1 
ATOM   4342 O  O     . GLU B  1  294 ? -25.256 15.286 31.030  1.00 149.25 ? 291 GLU B O     1 
ATOM   4343 C  CB    . GLU B  1  294 ? -28.121 16.497 32.288  1.00 149.71 ? 291 GLU B CB    1 
ATOM   4344 C  CG    . GLU B  1  294 ? -27.861 17.902 32.802  1.00 148.59 ? 291 GLU B CG    1 
ATOM   4345 C  CD    . GLU B  1  294 ? -28.817 18.303 33.910  1.00 149.22 ? 291 GLU B CD    1 
ATOM   4346 O  OE1   . GLU B  1  294 ? -28.647 17.836 35.057  1.00 150.81 ? 291 GLU B OE1   1 
ATOM   4347 O  OE2   . GLU B  1  294 ? -29.751 19.081 33.626  1.00 146.23 ? 291 GLU B OE2   1 
ATOM   4348 N  N     . LEU B  1  295 ? -26.962 13.823 31.175  1.00 156.03 ? 292 LEU B N     1 
ATOM   4349 C  CA    . LEU B  1  295 ? -26.071 12.674 31.287  1.00 153.85 ? 292 LEU B CA    1 
ATOM   4350 C  C     . LEU B  1  295 ? -25.272 12.470 30.006  1.00 155.09 ? 292 LEU B C     1 
ATOM   4351 O  O     . LEU B  1  295 ? -24.052 12.270 30.046  1.00 151.65 ? 292 LEU B O     1 
ATOM   4352 C  CB    . LEU B  1  295 ? -26.878 11.417 31.619  1.00 151.73 ? 292 LEU B CB    1 
ATOM   4353 C  CG    . LEU B  1  295 ? -27.618 11.367 32.956  1.00 149.41 ? 292 LEU B CG    1 
ATOM   4354 C  CD1   . LEU B  1  295 ? -28.500 10.132 33.022  1.00 153.30 ? 292 LEU B CD1   1 
ATOM   4355 C  CD2   . LEU B  1  295 ? -26.634 11.383 34.114  1.00 143.75 ? 292 LEU B CD2   1 
ATOM   4356 N  N     . SER B  1  296 ? -25.945 12.523 28.853  1.00 156.09 ? 293 SER B N     1 
ATOM   4357 C  CA    . SER B  1  296 ? -25.287 12.182 27.595  1.00 155.58 ? 293 SER B CA    1 
ATOM   4358 C  C     . SER B  1  296 ? -24.242 13.222 27.208  1.00 152.70 ? 293 SER B C     1 
ATOM   4359 O  O     . SER B  1  296 ? -23.196 12.877 26.647  1.00 156.50 ? 293 SER B O     1 
ATOM   4360 C  CB    . SER B  1  296 ? -26.324 12.025 26.483  1.00 154.52 ? 293 SER B CB    1 
ATOM   4361 O  OG    . SER B  1  296 ? -26.784 13.286 26.030  1.00 152.50 ? 293 SER B OG    1 
ATOM   4362 N  N     . LEU B  1  297 ? -24.506 14.500 27.488  1.00 151.19 ? 294 LEU B N     1 
ATOM   4363 C  CA    . LEU B  1  297 ? -23.515 15.532 27.200  1.00 146.04 ? 294 LEU B CA    1 
ATOM   4364 C  C     . LEU B  1  297 ? -22.275 15.363 28.067  1.00 154.06 ? 294 LEU B C     1 
ATOM   4365 O  O     . LEU B  1  297 ? -21.158 15.654 27.624  1.00 152.47 ? 294 LEU B O     1 
ATOM   4366 C  CB    . LEU B  1  297 ? -24.126 16.918 27.402  1.00 137.67 ? 294 LEU B CB    1 
ATOM   4367 C  CG    . LEU B  1  297 ? -23.223 18.137 27.197  1.00 129.04 ? 294 LEU B CG    1 
ATOM   4368 C  CD1   . LEU B  1  297 ? -22.565 18.110 25.825  1.00 125.41 ? 294 LEU B CD1   1 
ATOM   4369 C  CD2   . LEU B  1  297 ? -24.014 19.423 27.387  1.00 125.29 ? 294 LEU B CD2   1 
ATOM   4370 N  N     . LEU B  1  298 ? -22.454 14.874 29.296  1.00 169.90 ? 295 LEU B N     1 
ATOM   4371 C  CA    . LEU B  1  298 ? -21.332 14.732 30.218  1.00 176.26 ? 295 LEU B CA    1 
ATOM   4372 C  C     . LEU B  1  298 ? -20.315 13.714 29.720  1.00 185.75 ? 295 LEU B C     1 
ATOM   4373 O  O     . LEU B  1  298 ? -19.115 13.860 29.983  1.00 189.44 ? 295 LEU B O     1 
ATOM   4374 C  CB    . LEU B  1  298 ? -21.855 14.337 31.602  1.00 172.89 ? 295 LEU B CB    1 
ATOM   4375 C  CG    . LEU B  1  298 ? -20.943 14.373 32.836  1.00 167.67 ? 295 LEU B CG    1 
ATOM   4376 C  CD1   . LEU B  1  298 ? -20.123 13.097 32.994  1.00 168.56 ? 295 LEU B CD1   1 
ATOM   4377 C  CD2   . LEU B  1  298 ? -20.048 15.604 32.830  1.00 162.06 ? 295 LEU B CD2   1 
ATOM   4378 N  N     . GLN B  1  299 ? -20.768 12.684 28.998  1.00 187.36 ? 296 GLN B N     1 
ATOM   4379 C  CA    . GLN B  1  299 ? -19.865 11.612 28.583  1.00 183.65 ? 296 GLN B CA    1 
ATOM   4380 C  C     . GLN B  1  299 ? -18.774 12.122 27.650  1.00 179.46 ? 296 GLN B C     1 
ATOM   4381 O  O     . GLN B  1  299 ? -17.671 11.563 27.622  1.00 174.95 ? 296 GLN B O     1 
ATOM   4382 C  CB    . GLN B  1  299 ? -20.656 10.485 27.911  1.00 183.88 ? 296 GLN B CB    1 
ATOM   4383 C  CG    . GLN B  1  299 ? -20.965 10.722 26.437  1.00 183.39 ? 296 GLN B CG    1 
ATOM   4384 C  CD    . GLN B  1  299 ? -22.170 9.939  25.951  1.00 182.44 ? 296 GLN B CD    1 
ATOM   4385 O  OE1   . GLN B  1  299 ? -22.657 9.038  26.633  1.00 182.25 ? 296 GLN B OE1   1 
ATOM   4386 N  NE2   . GLN B  1  299 ? -22.661 10.287 24.767  1.00 180.29 ? 296 GLN B NE2   1 
ATOM   4387 N  N     . GLU B  1  300 ? -19.052 13.178 26.892  1.00 173.45 ? 297 GLU B N     1 
ATOM   4388 C  CA    . GLU B  1  300 ? -18.094 13.708 25.931  1.00 164.99 ? 297 GLU B CA    1 
ATOM   4389 C  C     . GLU B  1  300 ? -17.102 14.649 26.604  1.00 154.96 ? 297 GLU B C     1 
ATOM   4390 O  O     . GLU B  1  300 ? -16.271 14.221 27.405  1.00 149.77 ? 297 GLU B O     1 
ATOM   4391 C  CB    . GLU B  1  300 ? -18.825 14.432 24.800  1.00 165.35 ? 297 GLU B CB    1 
ATOM   4392 C  CG    . GLU B  1  300 ? -19.733 13.532 23.976  1.00 169.01 ? 297 GLU B CG    1 
ATOM   4393 C  CD    . GLU B  1  300 ? -20.691 14.313 23.098  1.00 171.73 ? 297 GLU B CD    1 
ATOM   4394 O  OE1   . GLU B  1  300 ? -21.517 15.074 23.645  1.00 169.46 ? 297 GLU B OE1   1 
ATOM   4395 O  OE2   . GLU B  1  300 ? -20.615 14.169 21.861  1.00 173.34 ? 297 GLU B OE2   1 
ATOM   4396 O  "O5'" . DA  C  2  1   ? -53.312 26.024 -6.560  1.00 124.33 ? 1   DA  C "O5'" 1 
ATOM   4397 C  "C5'" . DA  C  2  1   ? -54.337 25.643 -7.464  1.00 124.84 ? 1   DA  C "C5'" 1 
ATOM   4398 C  "C4'" . DA  C  2  1   ? -53.798 25.535 -8.878  1.00 125.80 ? 1   DA  C "C4'" 1 
ATOM   4399 O  "O4'" . DA  C  2  1   ? -54.455 24.441 -9.544  1.00 131.54 ? 1   DA  C "O4'" 1 
ATOM   4400 C  "C3'" . DA  C  2  1   ? -54.086 26.735 -9.765  1.00 122.37 ? 1   DA  C "C3'" 1 
ATOM   4401 O  "O3'" . DA  C  2  1   ? -53.084 27.779 -9.603  1.00 120.98 ? 1   DA  C "O3'" 1 
ATOM   4402 C  "C2'" . DA  C  2  1   ? -54.114 26.144 -11.182 1.00 118.32 ? 1   DA  C "C2'" 1 
ATOM   4403 C  "C1'" . DA  C  2  1   ? -54.429 24.658 -10.942 1.00 126.79 ? 1   DA  C "C1'" 1 
ATOM   4404 N  N9    . DA  C  2  1   ? -55.701 24.201 -11.517 1.00 129.04 ? 1   DA  C N9    1 
ATOM   4405 C  C8    . DA  C  2  1   ? -55.866 23.220 -12.455 1.00 127.11 ? 1   DA  C C8    1 
ATOM   4406 N  N7    . DA  C  2  1   ? -57.117 23.005 -12.790 1.00 125.06 ? 1   DA  C N7    1 
ATOM   4407 C  C5    . DA  C  2  1   ? -57.827 23.905 -12.016 1.00 128.09 ? 1   DA  C C5    1 
ATOM   4408 C  C6    . DA  C  2  1   ? -59.206 24.179 -11.905 1.00 123.43 ? 1   DA  C C6    1 
ATOM   4409 N  N6    . DA  C  2  1   ? -60.144 23.537 -12.609 1.00 117.97 ? 1   DA  C N6    1 
ATOM   4410 N  N1    . DA  C  2  1   ? -59.583 25.140 -11.038 1.00 123.53 ? 1   DA  C N1    1 
ATOM   4411 C  C2    . DA  C  2  1   ? -58.641 25.780 -10.334 1.00 123.60 ? 1   DA  C C2    1 
ATOM   4412 N  N3    . DA  C  2  1   ? -57.318 25.612 -10.352 1.00 125.62 ? 1   DA  C N3    1 
ATOM   4413 C  C4    . DA  C  2  1   ? -56.972 24.651 -11.222 1.00 130.09 ? 1   DA  C C4    1 
ATOM   4414 P  P     . DT  C  2  2   ? -51.501 27.517 -9.784  1.00 112.03 ? 2   DT  C P     1 
ATOM   4415 O  OP1   . DT  C  2  2   ? -51.212 26.193 -10.375 1.00 107.60 ? 2   DT  C OP1   1 
ATOM   4416 O  OP2   . DT  C  2  2   ? -50.865 27.875 -8.500  1.00 96.69  ? 2   DT  C OP2   1 
ATOM   4417 O  "O5'" . DT  C  2  2   ? -51.063 28.634 -10.839 1.00 107.99 ? 2   DT  C "O5'" 1 
ATOM   4418 C  "C5'" . DT  C  2  2   ? -51.199 28.380 -12.228 1.00 90.29  ? 2   DT  C "C5'" 1 
ATOM   4419 C  "C4'" . DT  C  2  2   ? -51.871 29.540 -12.941 1.00 72.04  ? 2   DT  C "C4'" 1 
ATOM   4420 O  "O4'" . DT  C  2  2   ? -53.250 29.664 -12.506 1.00 71.94  ? 2   DT  C "O4'" 1 
ATOM   4421 C  "C3'" . DT  C  2  2   ? -51.229 30.919 -12.720 1.00 69.78  ? 2   DT  C "C3'" 1 
ATOM   4422 O  "O3'" . DT  C  2  2   ? -51.029 31.550 -13.978 1.00 64.60  ? 2   DT  C "O3'" 1 
ATOM   4423 C  "C2'" . DT  C  2  2   ? -52.276 31.664 -11.888 1.00 73.84  ? 2   DT  C "C2'" 1 
ATOM   4424 C  "C1'" . DT  C  2  2   ? -53.553 31.029 -12.408 1.00 75.31  ? 2   DT  C "C1'" 1 
ATOM   4425 N  N1    . DT  C  2  2   ? -54.738 31.210 -11.519 1.00 90.51  ? 2   DT  C N1    1 
ATOM   4426 C  C2    . DT  C  2  2   ? -55.437 32.394 -11.572 1.00 107.48 ? 2   DT  C C2    1 
ATOM   4427 O  O2    . DT  C  2  2   ? -55.133 33.318 -12.306 1.00 120.53 ? 2   DT  C O2    1 
ATOM   4428 N  N3    . DT  C  2  2   ? -56.512 32.463 -10.726 1.00 111.60 ? 2   DT  C N3    1 
ATOM   4429 C  C4    . DT  C  2  2   ? -56.951 31.485 -9.851  1.00 113.11 ? 2   DT  C C4    1 
ATOM   4430 O  O4    . DT  C  2  2   ? -57.930 31.642 -9.129  1.00 117.68 ? 2   DT  C O4    1 
ATOM   4431 C  C5    . DT  C  2  2   ? -56.179 30.267 -9.847  1.00 107.78 ? 2   DT  C C5    1 
ATOM   4432 C  C7    . DT  C  2  2   ? -56.566 29.139 -8.937  1.00 107.60 ? 2   DT  C C7    1 
ATOM   4433 C  C6    . DT  C  2  2   ? -55.122 30.187 -10.673 1.00 99.12  ? 2   DT  C C6    1 
ATOM   4434 P  P     . DT  C  2  3   ? -49.771 32.515 -14.226 1.00 60.34  ? 3   DT  C P     1 
ATOM   4435 O  OP1   . DT  C  2  3   ? -49.064 31.996 -15.419 1.00 78.00  ? 3   DT  C OP1   1 
ATOM   4436 O  OP2   . DT  C  2  3   ? -49.048 32.687 -12.946 1.00 61.27  ? 3   DT  C OP2   1 
ATOM   4437 O  "O5'" . DT  C  2  3   ? -50.439 33.923 -14.581 1.00 58.89  ? 3   DT  C "O5'" 1 
ATOM   4438 C  "C5'" . DT  C  2  3   ? -51.595 33.974 -15.410 1.00 57.33  ? 3   DT  C "C5'" 1 
ATOM   4439 C  "C4'" . DT  C  2  3   ? -52.227 35.356 -15.376 1.00 57.12  ? 3   DT  C "C4'" 1 
ATOM   4440 O  "O4'" . DT  C  2  3   ? -52.897 35.554 -14.103 1.00 65.73  ? 3   DT  C "O4'" 1 
ATOM   4441 C  "C3'" . DT  C  2  3   ? -51.245 36.518 -15.516 1.00 55.49  ? 3   DT  C "C3'" 1 
ATOM   4442 O  "O3'" . DT  C  2  3   ? -51.840 37.571 -16.256 1.00 65.00  ? 3   DT  C "O3'" 1 
ATOM   4443 C  "C2'" . DT  C  2  3   ? -51.008 36.930 -14.068 1.00 62.37  ? 3   DT  C "C2'" 1 
ATOM   4444 C  "C1'" . DT  C  2  3   ? -52.394 36.716 -13.482 1.00 64.13  ? 3   DT  C "C1'" 1 
ATOM   4445 N  N1    . DT  C  2  3   ? -52.393 36.506 -12.012 1.00 69.31  ? 3   DT  C N1    1 
ATOM   4446 C  C2    . DT  C  2  3   ? -53.253 37.240 -11.230 1.00 75.07  ? 3   DT  C C2    1 
ATOM   4447 O  O2    . DT  C  2  3   ? -54.027 38.063 -11.683 1.00 77.87  ? 3   DT  C O2    1 
ATOM   4448 N  N3    . DT  C  2  3   ? -53.175 36.975 -9.890  1.00 79.20  ? 3   DT  C N3    1 
ATOM   4449 C  C4    . DT  C  2  3   ? -52.340 36.069 -9.265  1.00 74.48  ? 3   DT  C C4    1 
ATOM   4450 O  O4    . DT  C  2  3   ? -52.346 35.904 -8.050  1.00 80.33  ? 3   DT  C O4    1 
ATOM   4451 C  C5    . DT  C  2  3   ? -51.462 35.332 -10.144 1.00 69.03  ? 3   DT  C C5    1 
ATOM   4452 C  C7    . DT  C  2  3   ? -50.508 34.318 -9.585  1.00 64.04  ? 3   DT  C C7    1 
ATOM   4453 C  C6    . DT  C  2  3   ? -51.530 35.585 -11.460 1.00 70.28  ? 3   DT  C C6    1 
ATOM   4454 P  P     . DG  C  2  4   ? -51.187 38.056 -17.645 1.00 53.25  ? 4   DG  C P     1 
ATOM   4455 O  OP1   . DG  C  2  4   ? -52.054 39.128 -18.179 1.00 55.14  ? 4   DG  C OP1   1 
ATOM   4456 O  OP2   . DG  C  2  4   ? -50.914 36.849 -18.453 1.00 64.45  ? 4   DG  C OP2   1 
ATOM   4457 O  "O5'" . DG  C  2  4   ? -49.784 38.689 -17.216 1.00 52.10  ? 4   DG  C "O5'" 1 
ATOM   4458 C  "C5'" . DG  C  2  4   ? -49.732 39.978 -16.617 1.00 51.97  ? 4   DG  C "C5'" 1 
ATOM   4459 C  "C4'" . DG  C  2  4   ? -48.381 40.212 -15.970 1.00 58.83  ? 4   DG  C "C4'" 1 
ATOM   4460 O  "O4'" . DG  C  2  4   ? -47.344 40.165 -16.980 1.00 52.74  ? 4   DG  C "O4'" 1 
ATOM   4461 C  "C3'" . DG  C  2  4   ? -48.221 41.554 -15.246 1.00 51.14  ? 4   DG  C "C3'" 1 
ATOM   4462 O  "O3'" . DG  C  2  4   ? -47.654 41.329 -13.958 1.00 58.67  ? 4   DG  C "O3'" 1 
ATOM   4463 C  "C2'" . DG  C  2  4   ? -47.275 42.343 -16.157 1.00 49.72  ? 4   DG  C "C2'" 1 
ATOM   4464 C  "C1'" . DG  C  2  4   ? -46.450 41.229 -16.781 1.00 55.06  ? 4   DG  C "C1'" 1 
ATOM   4465 N  N9    . DG  C  2  4   ? -45.860 41.576 -18.071 1.00 56.71  ? 4   DG  C N9    1 
ATOM   4466 C  C8    . DG  C  2  4   ? -46.527 41.868 -19.236 1.00 58.60  ? 4   DG  C C8    1 
ATOM   4467 N  N7    . DG  C  2  4   ? -45.733 42.135 -20.237 1.00 59.40  ? 4   DG  C N7    1 
ATOM   4468 C  C5    . DG  C  2  4   ? -44.457 42.007 -19.704 1.00 58.19  ? 4   DG  C C5    1 
ATOM   4469 C  C6    . DG  C  2  4   ? -43.191 42.176 -20.316 1.00 55.73  ? 4   DG  C C6    1 
ATOM   4470 O  O6    . DG  C  2  4   ? -42.941 42.483 -21.488 1.00 60.06  ? 4   DG  C O6    1 
ATOM   4471 N  N1    . DG  C  2  4   ? -42.151 41.951 -19.418 1.00 61.85  ? 4   DG  C N1    1 
ATOM   4472 C  C2    . DG  C  2  4   ? -42.313 41.606 -18.096 1.00 58.54  ? 4   DG  C C2    1 
ATOM   4473 N  N2    . DG  C  2  4   ? -41.187 41.432 -17.386 1.00 51.84  ? 4   DG  C N2    1 
ATOM   4474 N  N3    . DG  C  2  4   ? -43.491 41.445 -17.510 1.00 50.92  ? 4   DG  C N3    1 
ATOM   4475 C  C4    . DG  C  2  4   ? -44.517 41.661 -18.372 1.00 54.00  ? 4   DG  C C4    1 
ATOM   4476 P  P     . DT  C  2  5   ? -47.579 42.510 -12.872 1.00 57.86  ? 5   DT  C P     1 
ATOM   4477 O  OP1   . DT  C  2  5   ? -47.498 41.866 -11.540 1.00 61.41  ? 5   DT  C OP1   1 
ATOM   4478 O  OP2   . DT  C  2  5   ? -48.653 43.486 -13.160 1.00 68.66  ? 5   DT  C OP2   1 
ATOM   4479 O  "O5'" . DT  C  2  5   ? -46.174 43.206 -13.170 1.00 56.41  ? 5   DT  C "O5'" 1 
ATOM   4480 C  "C5'" . DT  C  2  5   ? -44.987 42.437 -13.093 1.00 60.26  ? 5   DT  C "C5'" 1 
ATOM   4481 C  "C4'" . DT  C  2  5   ? -43.766 43.299 -13.344 1.00 58.13  ? 5   DT  C "C4'" 1 
ATOM   4482 O  "O4'" . DT  C  2  5   ? -43.521 43.392 -14.762 1.00 54.25  ? 5   DT  C "O4'" 1 
ATOM   4483 C  "C3'" . DT  C  2  5   ? -43.868 44.734 -12.823 1.00 57.32  ? 5   DT  C "C3'" 1 
ATOM   4484 O  "O3'" . DT  C  2  5   ? -42.853 44.950 -11.849 1.00 54.07  ? 5   DT  C "O3'" 1 
ATOM   4485 C  "C2'" . DT  C  2  5   ? -43.673 45.614 -14.072 1.00 59.06  ? 5   DT  C "C2'" 1 
ATOM   4486 C  "C1'" . DT  C  2  5   ? -43.009 44.661 -15.059 1.00 55.22  ? 5   DT  C "C1'" 1 
ATOM   4487 N  N1    . DT  C  2  5   ? -43.314 44.948 -16.497 1.00 61.53  ? 5   DT  C N1    1 
ATOM   4488 C  C2    . DT  C  2  5   ? -42.278 45.094 -17.388 1.00 62.72  ? 5   DT  C C2    1 
ATOM   4489 O  O2    . DT  C  2  5   ? -41.108 45.017 -17.067 1.00 67.80  ? 5   DT  C O2    1 
ATOM   4490 N  N3    . DT  C  2  5   ? -42.661 45.341 -18.679 1.00 58.43  ? 5   DT  C N3    1 
ATOM   4491 C  C4    . DT  C  2  5   ? -43.951 45.449 -19.162 1.00 61.92  ? 5   DT  C C4    1 
ATOM   4492 O  O4    . DT  C  2  5   ? -44.192 45.673 -20.344 1.00 59.68  ? 5   DT  C O4    1 
ATOM   4493 C  C5    . DT  C  2  5   ? -44.994 45.279 -18.177 1.00 63.74  ? 5   DT  C C5    1 
ATOM   4494 C  C7    . DT  C  2  5   ? -46.435 45.375 -18.582 1.00 56.72  ? 5   DT  C C7    1 
ATOM   4495 C  C6    . DT  C  2  5   ? -44.629 45.036 -16.907 1.00 61.04  ? 5   DT  C C6    1 
ATOM   4496 P  P     . DC  C  2  6   ? -42.942 46.184 -10.823 1.00 58.26  ? 6   DC  C P     1 
ATOM   4497 O  OP1   . DC  C  2  6   ? -42.381 45.733 -9.532  1.00 61.92  ? 6   DC  C OP1   1 
ATOM   4498 O  OP2   . DC  C  2  6   ? -44.301 46.764 -10.875 1.00 60.63  ? 6   DC  C OP2   1 
ATOM   4499 O  "O5'" . DC  C  2  6   ? -41.902 47.230 -11.421 1.00 51.94  ? 6   DC  C "O5'" 1 
ATOM   4500 C  "C5'" . DC  C  2  6   ? -40.541 46.857 -11.528 1.00 50.44  ? 6   DC  C "C5'" 1 
ATOM   4501 C  "C4'" . DC  C  2  6   ? -39.794 47.790 -12.458 1.00 51.75  ? 6   DC  C "C4'" 1 
ATOM   4502 O  "O4'" . DC  C  2  6   ? -40.287 47.635 -13.818 1.00 57.37  ? 6   DC  C "O4'" 1 
ATOM   4503 C  "C3'" . DC  C  2  6   ? -39.935 49.280 -12.139 1.00 51.91  ? 6   DC  C "C3'" 1 
ATOM   4504 O  "O3'" . DC  C  2  6   ? -38.708 49.915 -12.399 1.00 51.02  ? 6   DC  C "O3'" 1 
ATOM   4505 C  "C2'" . DC  C  2  6   ? -40.980 49.729 -13.152 1.00 48.61  ? 6   DC  C "C2'" 1 
ATOM   4506 C  "C1'" . DC  C  2  6   ? -40.513 48.919 -14.340 1.00 55.45  ? 6   DC  C "C1'" 1 
ATOM   4507 N  N1    . DC  C  2  6   ? -41.491 48.839 -15.448 1.00 61.55  ? 6   DC  C N1    1 
ATOM   4508 C  C2    . DC  C  2  6   ? -41.027 48.854 -16.766 1.00 55.36  ? 6   DC  C C2    1 
ATOM   4509 O  O2    . DC  C  2  6   ? -39.809 48.918 -16.975 1.00 62.90  ? 6   DC  C O2    1 
ATOM   4510 N  N3    . DC  C  2  6   ? -41.922 48.792 -17.776 1.00 50.02  ? 6   DC  C N3    1 
ATOM   4511 C  C4    . DC  C  2  6   ? -43.225 48.724 -17.507 1.00 59.34  ? 6   DC  C C4    1 
ATOM   4512 N  N4    . DC  C  2  6   ? -44.072 48.664 -18.541 1.00 59.32  ? 6   DC  C N4    1 
ATOM   4513 C  C5    . DC  C  2  6   ? -43.719 48.714 -16.169 1.00 55.07  ? 6   DC  C C5    1 
ATOM   4514 C  C6    . DC  C  2  6   ? -42.824 48.777 -15.179 1.00 55.75  ? 6   DC  C C6    1 
ATOM   4515 P  P     . DA  C  2  7   ? -38.130 51.017 -11.382 1.00 54.41  ? 7   DA  C P     1 
ATOM   4516 O  OP1   . DA  C  2  7   ? -37.670 50.287 -10.181 1.00 65.30  ? 7   DA  C OP1   1 
ATOM   4517 O  OP2   . DA  C  2  7   ? -39.143 52.085 -11.258 1.00 57.49  ? 7   DA  C OP2   1 
ATOM   4518 O  "O5'" . DA  C  2  7   ? -36.860 51.601 -12.159 1.00 56.15  ? 7   DA  C "O5'" 1 
ATOM   4519 C  "C5'" . DA  C  2  7   ? -35.719 50.779 -12.357 1.00 55.24  ? 7   DA  C "C5'" 1 
ATOM   4520 C  "C4'" . DA  C  2  7   ? -34.971 51.158 -13.628 1.00 54.25  ? 7   DA  C "C4'" 1 
ATOM   4521 O  "O4'" . DA  C  2  7   ? -35.823 50.949 -14.783 1.00 54.91  ? 7   DA  C "O4'" 1 
ATOM   4522 C  "C3'" . DA  C  2  7   ? -34.506 52.603 -13.716 1.00 48.88  ? 7   DA  C "C3'" 1 
ATOM   4523 O  "O3'" . DA  C  2  7   ? -33.303 52.655 -14.469 1.00 55.24  ? 7   DA  C "O3'" 1 
ATOM   4524 C  "C2'" . DA  C  2  7   ? -35.662 53.274 -14.456 1.00 51.90  ? 7   DA  C "C2'" 1 
ATOM   4525 C  "C1'" . DA  C  2  7   ? -36.072 52.180 -15.432 1.00 51.71  ? 7   DA  C "C1'" 1 
ATOM   4526 N  N9    . DA  C  2  7   ? -37.484 52.209 -15.797 1.00 57.94  ? 7   DA  C N9    1 
ATOM   4527 C  C8    . DA  C  2  7   ? -38.552 52.263 -14.948 1.00 63.98  ? 7   DA  C C8    1 
ATOM   4528 N  N7    . DA  C  2  7   ? -39.712 52.260 -15.559 1.00 62.39  ? 7   DA  C N7    1 
ATOM   4529 C  C5    . DA  C  2  7   ? -39.381 52.189 -16.901 1.00 62.29  ? 7   DA  C C5    1 
ATOM   4530 C  C6    . DA  C  2  7   ? -40.164 52.151 -18.071 1.00 56.42  ? 7   DA  C C6    1 
ATOM   4531 N  N6    . DA  C  2  7   ? -41.500 52.178 -18.065 1.00 57.49  ? 7   DA  C N6    1 
ATOM   4532 N  N1    . DA  C  2  7   ? -39.518 52.082 -19.254 1.00 48.67  ? 7   DA  C N1    1 
ATOM   4533 C  C2    . DA  C  2  7   ? -38.181 52.052 -19.258 1.00 55.84  ? 7   DA  C C2    1 
ATOM   4534 N  N3    . DA  C  2  7   ? -37.339 52.084 -18.227 1.00 66.39  ? 7   DA  C N3    1 
ATOM   4535 C  C4    . DA  C  2  7   ? -38.011 52.153 -17.065 1.00 64.24  ? 7   DA  C C4    1 
ATOM   4536 P  P     . DT  C  2  8   ? -32.479 54.027 -14.620 1.00 57.61  ? 8   DT  C P     1 
ATOM   4537 O  OP1   . DT  C  2  8   ? -31.093 53.646 -14.967 1.00 58.25  ? 8   DT  C OP1   1 
ATOM   4538 O  OP2   . DT  C  2  8   ? -32.741 54.868 -13.432 1.00 54.58  ? 8   DT  C OP2   1 
ATOM   4539 O  "O5'" . DT  C  2  8   ? -33.133 54.727 -15.899 1.00 58.74  ? 8   DT  C "O5'" 1 
ATOM   4540 C  "C5'" . DT  C  2  8   ? -32.831 54.248 -17.206 1.00 59.50  ? 8   DT  C "C5'" 1 
ATOM   4541 C  "C4'" . DT  C  2  8   ? -33.589 55.038 -18.256 1.00 45.27  ? 8   DT  C "C4'" 1 
ATOM   4542 O  "O4'" . DT  C  2  8   ? -34.977 54.682 -18.202 1.00 48.16  ? 8   DT  C "O4'" 1 
ATOM   4543 C  "C3'" . DT  C  2  8   ? -33.553 56.552 -18.073 1.00 57.82  ? 8   DT  C "C3'" 1 
ATOM   4544 O  "O3'" . DT  C  2  8   ? -32.604 57.125 -18.964 1.00 63.57  ? 8   DT  C "O3'" 1 
ATOM   4545 C  "C2'" . DT  C  2  8   ? -34.981 57.022 -18.401 1.00 51.22  ? 8   DT  C "C2'" 1 
ATOM   4546 C  "C1'" . DT  C  2  8   ? -35.728 55.733 -18.740 1.00 45.41  ? 8   DT  C "C1'" 1 
ATOM   4547 N  N1    . DT  C  2  8   ? -37.092 55.673 -18.158 1.00 55.80  ? 8   DT  C N1    1 
ATOM   4548 C  C2    . DT  C  2  8   ? -38.170 55.507 -18.992 1.00 59.50  ? 8   DT  C C2    1 
ATOM   4549 O  O2    . DT  C  2  8   ? -38.067 55.403 -20.202 1.00 58.33  ? 8   DT  C O2    1 
ATOM   4550 N  N3    . DT  C  2  8   ? -39.385 55.463 -18.356 1.00 64.76  ? 8   DT  C N3    1 
ATOM   4551 C  C4    . DT  C  2  8   ? -39.618 55.568 -16.994 1.00 53.90  ? 8   DT  C C4    1 
ATOM   4552 O  O4    . DT  C  2  8   ? -40.746 55.518 -16.515 1.00 56.79  ? 8   DT  C O4    1 
ATOM   4553 C  C5    . DT  C  2  8   ? -38.441 55.741 -16.178 1.00 56.26  ? 8   DT  C C5    1 
ATOM   4554 C  C7    . DT  C  2  8   ? -38.565 55.867 -14.688 1.00 56.10  ? 8   DT  C C7    1 
ATOM   4555 C  C6    . DT  C  2  8   ? -37.250 55.784 -16.793 1.00 58.35  ? 8   DT  C C6    1 
ATOM   4556 P  P     . DG  C  2  9   ? -31.983 58.574 -18.657 1.00 73.12  ? 9   DG  C P     1 
ATOM   4557 O  OP1   . DG  C  2  9   ? -30.517 58.499 -18.845 1.00 70.52  ? 9   DG  C OP1   1 
ATOM   4558 O  OP2   . DG  C  2  9   ? -32.546 59.017 -17.362 1.00 60.99  ? 9   DG  C OP2   1 
ATOM   4559 O  "O5'" . DG  C  2  9   ? -32.614 59.517 -19.782 1.00 83.66  ? 9   DG  C "O5'" 1 
ATOM   4560 C  "C5'" . DG  C  2  9   ? -32.833 59.032 -21.101 1.00 61.97  ? 9   DG  C "C5'" 1 
ATOM   4561 C  "C4'" . DG  C  2  9   ? -33.887 59.865 -21.816 1.00 54.45  ? 9   DG  C "C4'" 1 
ATOM   4562 O  "O4'" . DG  C  2  9   ? -35.202 59.546 -21.291 1.00 54.80  ? 9   DG  C "O4'" 1 
ATOM   4563 C  "C3'" . DG  C  2  9   ? -33.747 61.376 -21.653 1.00 51.53  ? 9   DG  C "C3'" 1 
ATOM   4564 O  "O3'" . DG  C  2  9   ? -34.305 62.028 -22.776 1.00 61.24  ? 9   DG  C "O3'" 1 
ATOM   4565 C  "C2'" . DG  C  2  9   ? -34.592 61.640 -20.416 1.00 52.90  ? 9   DG  C "C2'" 1 
ATOM   4566 C  "C1'" . DG  C  2  9   ? -35.754 60.688 -20.661 1.00 55.49  ? 9   DG  C "C1'" 1 
ATOM   4567 N  N9    . DG  C  2  9   ? -36.426 60.266 -19.441 1.00 58.78  ? 9   DG  C N9    1 
ATOM   4568 C  C8    . DG  C  2  9   ? -35.898 60.239 -18.174 1.00 47.59  ? 9   DG  C C8    1 
ATOM   4569 N  N7    . DG  C  2  9   ? -36.737 59.811 -17.273 1.00 52.14  ? 9   DG  C N7    1 
ATOM   4570 C  C5    . DG  C  2  9   ? -37.896 59.541 -17.989 1.00 49.82  ? 9   DG  C C5    1 
ATOM   4571 C  C6    . DG  C  2  9   ? -39.144 59.054 -17.546 1.00 59.00  ? 9   DG  C C6    1 
ATOM   4572 O  O6    . DG  C  2  9   ? -39.485 58.753 -16.394 1.00 68.81  ? 9   DG  C O6    1 
ATOM   4573 N  N1    . DG  C  2  9   ? -40.050 58.923 -18.599 1.00 60.79  ? 9   DG  C N1    1 
ATOM   4574 C  C2    . DG  C  2  9   ? -39.779 59.227 -19.913 1.00 57.43  ? 9   DG  C C2    1 
ATOM   4575 N  N2    . DG  C  2  9   ? -40.778 59.036 -20.788 1.00 55.58  ? 9   DG  C N2    1 
ATOM   4576 N  N3    . DG  C  2  9   ? -38.610 59.686 -20.339 1.00 52.48  ? 9   DG  C N3    1 
ATOM   4577 C  C4    . DG  C  2  9   ? -37.720 59.817 -19.325 1.00 54.93  ? 9   DG  C C4    1 
ATOM   4578 P  P     . DG  C  2  10  ? -33.381 62.469 -24.016 1.00 56.17  ? 10  DG  C P     1 
ATOM   4579 O  OP1   . DG  C  2  10  ? -32.955 61.227 -24.696 1.00 69.05  ? 10  DG  C OP1   1 
ATOM   4580 O  OP2   . DG  C  2  10  ? -32.376 63.443 -23.533 1.00 59.07  ? 10  DG  C OP2   1 
ATOM   4581 O  "O5'" . DG  C  2  10  ? -34.400 63.249 -24.973 1.00 54.94  ? 10  DG  C "O5'" 1 
ATOM   4582 C  "C5'" . DG  C  2  10  ? -35.180 64.329 -24.455 1.00 51.96  ? 10  DG  C "C5'" 1 
ATOM   4583 C  "C4'" . DG  C  2  10  ? -36.634 64.215 -24.887 1.00 55.00  ? 10  DG  C "C4'" 1 
ATOM   4584 O  "O4'" . DG  C  2  10  ? -37.360 63.374 -23.950 1.00 55.37  ? 10  DG  C "O4'" 1 
ATOM   4585 C  "C3'" . DG  C  2  10  ? -37.395 65.537 -24.938 1.00 66.84  ? 10  DG  C "C3'" 1 
ATOM   4586 O  "O3'" . DG  C  2  10  ? -38.322 65.524 -26.012 1.00 81.58  ? 10  DG  C "O3'" 1 
ATOM   4587 C  "C2'" . DG  C  2  10  ? -38.101 65.584 -23.588 1.00 61.57  ? 10  DG  C "C2'" 1 
ATOM   4588 C  "C1'" . DG  C  2  10  ? -38.397 64.113 -23.329 1.00 58.86  ? 10  DG  C "C1'" 1 
ATOM   4589 N  N9    . DG  C  2  10  ? -38.413 63.781 -21.908 1.00 63.46  ? 10  DG  C N9    1 
ATOM   4590 C  C8    . DG  C  2  10  ? -37.384 63.954 -21.014 1.00 61.49  ? 10  DG  C C8    1 
ATOM   4591 N  N7    . DG  C  2  10  ? -37.680 63.575 -19.803 1.00 57.65  ? 10  DG  C N7    1 
ATOM   4592 C  C5    . DG  C  2  10  ? -38.990 63.125 -19.896 1.00 58.26  ? 10  DG  C C5    1 
ATOM   4593 C  C6    . DG  C  2  10  ? -39.843 62.595 -18.900 1.00 63.00  ? 10  DG  C C6    1 
ATOM   4594 O  O6    . DG  C  2  10  ? -39.599 62.412 -17.699 1.00 62.67  ? 10  DG  C O6    1 
ATOM   4595 N  N1    . DG  C  2  10  ? -41.095 62.262 -19.415 1.00 68.56  ? 10  DG  C N1    1 
ATOM   4596 C  C2    . DG  C  2  10  ? -41.473 62.421 -20.729 1.00 67.38  ? 10  DG  C C2    1 
ATOM   4597 N  N2    . DG  C  2  10  ? -42.722 62.043 -21.039 1.00 68.32  ? 10  DG  C N2    1 
ATOM   4598 N  N3    . DG  C  2  10  ? -40.681 62.918 -21.673 1.00 64.68  ? 10  DG  C N3    1 
ATOM   4599 C  C4    . DG  C  2  10  ? -39.459 63.247 -21.186 1.00 61.32  ? 10  DG  C C4    1 
ATOM   4600 P  P     . DA  C  2  11  ? -39.163 66.846 -26.368 1.00 82.03  ? 11  DA  C P     1 
ATOM   4601 O  OP1   . DA  C  2  11  ? -39.414 66.841 -27.825 1.00 83.83  ? 11  DA  C OP1   1 
ATOM   4602 O  OP2   . DA  C  2  11  ? -38.480 68.005 -25.750 1.00 75.86  ? 11  DA  C OP2   1 
ATOM   4603 O  "O5'" . DA  C  2  11  ? -40.555 66.628 -25.611 1.00 69.98  ? 11  DA  C "O5'" 1 
ATOM   4604 C  "C5'" . DA  C  2  11  ? -41.321 65.458 -25.867 1.00 66.96  ? 11  DA  C "C5'" 1 
ATOM   4605 C  "C4'" . DA  C  2  11  ? -42.650 65.491 -25.128 1.00 69.98  ? 11  DA  C "C4'" 1 
ATOM   4606 O  "O4'" . DA  C  2  11  ? -42.450 65.142 -23.734 1.00 72.21  ? 11  DA  C "O4'" 1 
ATOM   4607 C  "C3'" . DA  C  2  11  ? -43.382 66.830 -25.129 1.00 69.91  ? 11  DA  C "C3'" 1 
ATOM   4608 O  "O3'" . DA  C  2  11  ? -44.781 66.588 -25.227 1.00 77.56  ? 11  DA  C "O3'" 1 
ATOM   4609 C  "C2'" . DA  C  2  11  ? -43.003 67.422 -23.771 1.00 64.77  ? 11  DA  C "C2'" 1 
ATOM   4610 C  "C1'" . DA  C  2  11  ? -42.942 66.172 -22.904 1.00 68.31  ? 11  DA  C "C1'" 1 
ATOM   4611 N  N9    . DA  C  2  11  ? -42.049 66.289 -21.755 1.00 69.44  ? 11  DA  C N9    1 
ATOM   4612 C  C8    . DA  C  2  11  ? -40.795 66.835 -21.735 1.00 65.52  ? 11  DA  C C8    1 
ATOM   4613 N  N7    . DA  C  2  11  ? -40.216 66.788 -20.559 1.00 63.47  ? 11  DA  C N7    1 
ATOM   4614 C  C5    . DA  C  2  11  ? -41.151 66.161 -19.755 1.00 66.97  ? 11  DA  C C5    1 
ATOM   4615 C  C6    . DA  C  2  11  ? -41.146 65.807 -18.391 1.00 58.53  ? 11  DA  C C6    1 
ATOM   4616 N  N6    . DA  C  2  11  ? -40.120 66.052 -17.572 1.00 54.32  ? 11  DA  C N6    1 
ATOM   4617 N  N1    . DA  C  2  11  ? -42.241 65.189 -17.899 1.00 59.12  ? 11  DA  C N1    1 
ATOM   4618 C  C2    . DA  C  2  11  ? -43.267 64.944 -18.723 1.00 68.42  ? 11  DA  C C2    1 
ATOM   4619 N  N3    . DA  C  2  11  ? -43.388 65.229 -20.019 1.00 76.77  ? 11  DA  C N3    1 
ATOM   4620 C  C4    . DA  C  2  11  ? -42.285 65.842 -20.478 1.00 69.63  ? 11  DA  C C4    1 
ATOM   4621 P  P     . DA  C  2  12  ? -45.834 67.798 -25.332 1.00 81.99  ? 12  DA  C P     1 
ATOM   4622 O  OP1   . DA  C  2  12  ? -46.755 67.468 -26.441 1.00 86.00  ? 12  DA  C OP1   1 
ATOM   4623 O  OP2   . DA  C  2  12  ? -45.102 69.084 -25.353 1.00 80.75  ? 12  DA  C OP2   1 
ATOM   4624 O  "O5'" . DA  C  2  12  ? -46.648 67.695 -23.961 1.00 81.21  ? 12  DA  C "O5'" 1 
ATOM   4625 C  "C5'" . DA  C  2  12  ? -47.161 66.437 -23.546 1.00 76.12  ? 12  DA  C "C5'" 1 
ATOM   4626 C  "C4'" . DA  C  2  12  ? -47.769 66.525 -22.160 1.00 70.20  ? 12  DA  C "C4'" 1 
ATOM   4627 O  "O4'" . DA  C  2  12  ? -46.716 66.565 -21.163 1.00 76.02  ? 12  DA  C "O4'" 1 
ATOM   4628 C  "C3'" . DA  C  2  12  ? -48.649 67.744 -21.906 1.00 72.30  ? 12  DA  C "C3'" 1 
ATOM   4629 O  "O3'" . DA  C  2  12  ? -49.773 67.351 -21.136 1.00 73.11  ? 12  DA  C "O3'" 1 
ATOM   4630 C  "C2'" . DA  C  2  12  ? -47.724 68.685 -21.130 1.00 73.27  ? 12  DA  C "C2'" 1 
ATOM   4631 C  "C1'" . DA  C  2  12  ? -46.870 67.703 -20.342 1.00 72.71  ? 12  DA  C "C1'" 1 
ATOM   4632 N  N9    . DA  C  2  12  ? -45.536 68.204 -20.023 1.00 71.21  ? 12  DA  C N9    1 
ATOM   4633 C  C8    . DA  C  2  12  ? -44.676 68.855 -20.863 1.00 71.89  ? 12  DA  C C8    1 
ATOM   4634 N  N7    . DA  C  2  12  ? -43.534 69.179 -20.305 1.00 67.19  ? 12  DA  C N7    1 
ATOM   4635 C  C5    . DA  C  2  12  ? -43.649 68.701 -19.011 1.00 67.31  ? 12  DA  C C5    1 
ATOM   4636 C  C6    . DA  C  2  12  ? -42.773 68.725 -17.907 1.00 66.41  ? 12  DA  C C6    1 
ATOM   4637 N  N6    . DA  C  2  12  ? -41.556 69.277 -17.947 1.00 59.71  ? 12  DA  C N6    1 
ATOM   4638 N  N1    . DA  C  2  12  ? -43.197 68.157 -16.759 1.00 64.74  ? 12  DA  C N1    1 
ATOM   4639 C  C2    . DA  C  2  12  ? -44.416 67.605 -16.725 1.00 66.06  ? 12  DA  C C2    1 
ATOM   4640 N  N3    . DA  C  2  12  ? -45.326 67.521 -17.695 1.00 71.83  ? 12  DA  C N3    1 
ATOM   4641 C  C4    . DA  C  2  12  ? -44.876 68.093 -18.822 1.00 68.85  ? 12  DA  C C4    1 
ATOM   4642 P  P     . DT  C  2  13  ? -50.927 68.403 -20.760 1.00 86.15  ? 13  DT  C P     1 
ATOM   4643 O  OP1   . DT  C  2  13  ? -52.215 67.685 -20.871 1.00 87.67  ? 13  DT  C OP1   1 
ATOM   4644 O  OP2   . DT  C  2  13  ? -50.712 69.647 -21.531 1.00 89.51  ? 13  DT  C OP2   1 
ATOM   4645 O  "O5'" . DT  C  2  13  ? -50.657 68.707 -19.216 1.00 84.45  ? 13  DT  C "O5'" 1 
ATOM   4646 C  "C5'" . DT  C  2  13  ? -50.552 67.627 -18.304 1.00 71.23  ? 13  DT  C "C5'" 1 
ATOM   4647 C  "C4'" . DT  C  2  13  ? -50.022 68.099 -16.966 1.00 65.99  ? 13  DT  C "C4'" 1 
ATOM   4648 O  "O4'" . DT  C  2  13  ? -48.641 68.486 -17.096 1.00 69.42  ? 13  DT  C "O4'" 1 
ATOM   4649 C  "C3'" . DT  C  2  13  ? -50.751 69.304 -16.366 1.00 66.91  ? 13  DT  C "C3'" 1 
ATOM   4650 O  "O3'" . DT  C  2  13  ? -51.424 68.894 -15.182 1.00 78.66  ? 13  DT  C "O3'" 1 
ATOM   4651 C  "C2'" . DT  C  2  13  ? -49.636 70.329 -16.079 1.00 61.78  ? 13  DT  C "C2'" 1 
ATOM   4652 C  "C1'" . DT  C  2  13  ? -48.368 69.488 -16.159 1.00 65.99  ? 13  DT  C "C1'" 1 
ATOM   4653 N  N1    . DT  C  2  13  ? -47.163 70.240 -16.623 1.00 77.42  ? 13  DT  C N1    1 
ATOM   4654 C  C2    . DT  C  2  13  ? -46.080 70.359 -15.785 1.00 80.90  ? 13  DT  C C2    1 
ATOM   4655 O  O2    . DT  C  2  13  ? -46.051 69.889 -14.662 1.00 81.97  ? 13  DT  C O2    1 
ATOM   4656 N  N3    . DT  C  2  13  ? -45.023 71.054 -16.309 1.00 80.84  ? 13  DT  C N3    1 
ATOM   4657 C  C4    . DT  C  2  13  ? -44.939 71.629 -17.563 1.00 78.03  ? 13  DT  C C4    1 
ATOM   4658 O  O4    . DT  C  2  13  ? -43.943 72.236 -17.942 1.00 78.46  ? 13  DT  C O4    1 
ATOM   4659 C  C5    . DT  C  2  13  ? -46.109 71.464 -18.396 1.00 74.69  ? 13  DT  C C5    1 
ATOM   4660 C  C7    . DT  C  2  13  ? -46.138 72.044 -19.779 1.00 68.41  ? 13  DT  C C7    1 
ATOM   4661 C  C6    . DT  C  2  13  ? -47.150 70.783 -17.893 1.00 81.24  ? 13  DT  C C6    1 
ATOM   4662 P  P     . DT  C  2  14  ? -52.209 69.949 -14.259 1.00 84.83  ? 14  DT  C P     1 
ATOM   4663 O  OP1   . DT  C  2  14  ? -53.348 69.223 -13.658 1.00 81.09  ? 14  DT  C OP1   1 
ATOM   4664 O  OP2   . DT  C  2  14  ? -52.456 71.191 -15.025 1.00 81.70  ? 14  DT  C OP2   1 
ATOM   4665 O  "O5'" . DT  C  2  14  ? -51.166 70.267 -13.097 1.00 80.44  ? 14  DT  C "O5'" 1 
ATOM   4666 C  "C5'" . DT  C  2  14  ? -50.565 69.193 -12.396 1.00 71.52  ? 14  DT  C "C5'" 1 
ATOM   4667 C  "C4'" . DT  C  2  14  ? -49.495 69.698 -11.453 1.00 67.77  ? 14  DT  C "C4'" 1 
ATOM   4668 O  "O4'" . DT  C  2  14  ? -48.388 70.234 -12.215 1.00 67.69  ? 14  DT  C "O4'" 1 
ATOM   4669 C  "C3'" . DT  C  2  14  ? -49.943 70.801 -10.493 1.00 68.77  ? 14  DT  C "C3'" 1 
ATOM   4670 O  "O3'" . DT  C  2  14  ? -49.553 70.449 -9.172  1.00 74.79  ? 14  DT  C "O3'" 1 
ATOM   4671 C  "C2'" . DT  C  2  14  ? -49.208 72.049 -11.003 1.00 66.19  ? 14  DT  C "C2'" 1 
ATOM   4672 C  "C1'" . DT  C  2  14  ? -47.966 71.443 -11.637 1.00 69.04  ? 14  DT  C "C1'" 1 
ATOM   4673 N  N1    . DT  C  2  14  ? -47.343 72.284 -12.713 1.00 72.59  ? 14  DT  C N1    1 
ATOM   4674 C  C2    . DT  C  2  14  ? -46.040 72.700 -12.568 1.00 70.38  ? 14  DT  C C2    1 
ATOM   4675 O  O2    . DT  C  2  14  ? -45.360 72.431 -11.594 1.00 74.80  ? 14  DT  C O2    1 
ATOM   4676 N  N3    . DT  C  2  14  ? -45.558 73.453 -13.607 1.00 75.81  ? 14  DT  C N3    1 
ATOM   4677 C  C4    . DT  C  2  14  ? -46.232 73.822 -14.758 1.00 79.85  ? 14  DT  C C4    1 
ATOM   4678 O  O4    . DT  C  2  14  ? -45.710 74.504 -15.637 1.00 81.87  ? 14  DT  C O4    1 
ATOM   4679 C  C5    . DT  C  2  14  ? -47.594 73.349 -14.854 1.00 77.66  ? 14  DT  C C5    1 
ATOM   4680 C  C7    . DT  C  2  14  ? -48.426 73.688 -16.057 1.00 72.90  ? 14  DT  C C7    1 
ATOM   4681 C  C6    . DT  C  2  14  ? -48.078 72.609 -13.840 1.00 79.36  ? 14  DT  C C6    1 
ATOM   4682 P  P     . DT  C  2  15  ? -49.986 71.341 -7.908  1.00 81.75  ? 15  DT  C P     1 
ATOM   4683 O  OP1   . DT  C  2  15  ? -50.384 70.407 -6.832  1.00 87.23  ? 15  DT  C OP1   1 
ATOM   4684 O  OP2   . DT  C  2  15  ? -50.926 72.395 -8.347  1.00 82.14  ? 15  DT  C OP2   1 
ATOM   4685 O  "O5'" . DT  C  2  15  ? -48.617 72.030 -7.478  1.00 77.59  ? 15  DT  C "O5'" 1 
ATOM   4686 C  "C5'" . DT  C  2  15  ? -47.428 71.262 -7.498  1.00 74.47  ? 15  DT  C "C5'" 1 
ATOM   4687 C  "C4'" . DT  C  2  15  ? -46.212 72.145 -7.328  1.00 71.28  ? 15  DT  C "C4'" 1 
ATOM   4688 O  "O4'" . DT  C  2  15  ? -45.892 72.788 -8.587  1.00 77.68  ? 15  DT  C "O4'" 1 
ATOM   4689 C  "C3'" . DT  C  2  15  ? -46.363 73.263 -6.296  1.00 66.92  ? 15  DT  C "C3'" 1 
ATOM   4690 O  "O3'" . DT  C  2  15  ? -45.203 73.295 -5.494  1.00 73.12  ? 15  DT  C "O3'" 1 
ATOM   4691 C  "C2'" . DT  C  2  15  ? -46.497 74.522 -7.158  1.00 62.65  ? 15  DT  C "C2'" 1 
ATOM   4692 C  "C1'" . DT  C  2  15  ? -45.642 74.154 -8.357  1.00 68.79  ? 15  DT  C "C1'" 1 
ATOM   4693 N  N1    . DT  C  2  15  ? -45.965 74.909 -9.608  1.00 69.24  ? 15  DT  C N1    1 
ATOM   4694 C  C2    . DT  C  2  15  ? -44.949 75.540 -10.285 1.00 73.58  ? 15  DT  C C2    1 
ATOM   4695 O  O2    . DT  C  2  15  ? -43.790 75.525 -9.914  1.00 69.54  ? 15  DT  C O2    1 
ATOM   4696 N  N3    . DT  C  2  15  ? -45.337 76.198 -11.421 1.00 82.45  ? 15  DT  C N3    1 
ATOM   4697 C  C4    . DT  C  2  15  ? -46.614 76.285 -11.940 1.00 81.76  ? 15  DT  C C4    1 
ATOM   4698 O  O4    . DT  C  2  15  ? -46.859 76.904 -12.970 1.00 85.79  ? 15  DT  C O4    1 
ATOM   4699 C  C5    . DT  C  2  15  ? -47.636 75.598 -11.185 1.00 75.08  ? 15  DT  C C5    1 
ATOM   4700 C  C7    . DT  C  2  15  ? -49.063 75.623 -11.652 1.00 72.22  ? 15  DT  C C7    1 
ATOM   4701 C  C6    . DT  C  2  15  ? -47.267 74.948 -10.068 1.00 72.82  ? 15  DT  C C6    1 
ATOM   4702 P  P     . DC  C  2  16  ? -45.158 74.145 -4.133  1.00 84.37  ? 16  DC  C P     1 
ATOM   4703 O  OP1   . DC  C  2  16  ? -44.711 73.227 -3.062  1.00 88.52  ? 16  DC  C OP1   1 
ATOM   4704 O  OP2   . DC  C  2  16  ? -46.426 74.890 -3.976  1.00 78.83  ? 16  DC  C OP2   1 
ATOM   4705 O  "O5'" . DC  C  2  16  ? -43.978 75.181 -4.406  1.00 81.32  ? 16  DC  C "O5'" 1 
ATOM   4706 C  "C5'" . DC  C  2  16  ? -42.757 74.700 -4.945  1.00 78.75  ? 16  DC  C "C5'" 1 
ATOM   4707 C  "C4'" . DC  C  2  16  ? -41.963 75.822 -5.581  1.00 77.16  ? 16  DC  C "C4'" 1 
ATOM   4708 O  "O4'" . DC  C  2  16  ? -42.597 76.239 -6.817  1.00 77.29  ? 16  DC  C "O4'" 1 
ATOM   4709 C  "C3'" . DC  C  2  16  ? -41.822 77.082 -4.725  1.00 76.03  ? 16  DC  C "C3'" 1 
ATOM   4710 O  "O3'" . DC  C  2  16  ? -40.466 77.465 -4.680  1.00 84.91  ? 16  DC  C "O3'" 1 
ATOM   4711 C  "C2'" . DC  C  2  16  ? -42.671 78.119 -5.465  1.00 71.78  ? 16  DC  C "C2'" 1 
ATOM   4712 C  "C1'" . DC  C  2  16  ? -42.543 77.639 -6.898  1.00 72.52  ? 16  DC  C "C1'" 1 
ATOM   4713 N  N1    . DC  C  2  16  ? -43.639 78.106 -7.790  1.00 78.27  ? 16  DC  C N1    1 
ATOM   4714 C  C2    . DC  C  2  16  ? -43.329 78.854 -8.931  1.00 71.01  ? 16  DC  C C2    1 
ATOM   4715 O  O2    . DC  C  2  16  ? -42.146 79.116 -9.177  1.00 65.31  ? 16  DC  C O2    1 
ATOM   4716 N  N3    . DC  C  2  16  ? -44.335 79.271 -9.736  1.00 71.59  ? 16  DC  C N3    1 
ATOM   4717 C  C4    . DC  C  2  16  ? -45.597 78.968 -9.437  1.00 76.03  ? 16  DC  C C4    1 
ATOM   4718 N  N4    . DC  C  2  16  ? -46.554 79.402 -10.263 1.00 78.69  ? 16  DC  C N4    1 
ATOM   4719 C  C5    . DC  C  2  16  ? -45.935 78.206 -8.279  1.00 81.25  ? 16  DC  C C5    1 
ATOM   4720 C  C6    . DC  C  2  16  ? -44.934 77.799 -7.491  1.00 85.20  ? 16  DC  C C6    1 
ATOM   4721 P  P     . DG  C  2  17  ? -39.889 78.244 -3.401  1.00 92.61  ? 17  DG  C P     1 
ATOM   4722 O  OP1   . DG  C  2  17  ? -38.641 77.561 -2.998  1.00 87.34  ? 17  DG  C OP1   1 
ATOM   4723 O  OP2   . DG  C  2  17  ? -40.986 78.407 -2.422  1.00 85.59  ? 17  DG  C OP2   1 
ATOM   4724 O  "O5'" . DG  C  2  17  ? -39.514 79.681 -3.982  1.00 92.67  ? 17  DG  C "O5'" 1 
ATOM   4725 C  "C5'" . DG  C  2  17  ? -38.659 79.778 -5.107  1.00 83.61  ? 17  DG  C "C5'" 1 
ATOM   4726 C  "C4'" . DG  C  2  17  ? -38.700 81.173 -5.694  1.00 75.13  ? 17  DG  C "C4'" 1 
ATOM   4727 O  "O4'" . DG  C  2  17  ? -39.842 81.301 -6.577  1.00 80.12  ? 17  DG  C "O4'" 1 
ATOM   4728 C  "C3'" . DG  C  2  17  ? -38.817 82.303 -4.673  1.00 74.49  ? 17  DG  C "C3'" 1 
ATOM   4729 O  "O3'" . DG  C  2  17  ? -37.936 83.349 -5.037  1.00 79.04  ? 17  DG  C "O3'" 1 
ATOM   4730 C  "C2'" . DG  C  2  17  ? -40.283 82.730 -4.780  1.00 74.11  ? 17  DG  C "C2'" 1 
ATOM   4731 C  "C1'" . DG  C  2  17  ? -40.572 82.459 -6.248  1.00 80.03  ? 17  DG  C "C1'" 1 
ATOM   4732 N  N9    . DG  C  2  17  ? -41.980 82.201 -6.540  1.00 80.87  ? 17  DG  C N9    1 
ATOM   4733 C  C8    . DG  C  2  17  ? -42.870 81.487 -5.775  1.00 78.43  ? 17  DG  C C8    1 
ATOM   4734 N  N7    . DG  C  2  17  ? -44.062 81.410 -6.300  1.00 78.07  ? 17  DG  C N7    1 
ATOM   4735 C  C5    . DG  C  2  17  ? -43.954 82.113 -7.493  1.00 83.13  ? 17  DG  C C5    1 
ATOM   4736 C  C6    . DG  C  2  17  ? -44.924 82.373 -8.492  1.00 80.90  ? 17  DG  C C6    1 
ATOM   4737 O  O6    . DG  C  2  17  ? -46.112 82.020 -8.521  1.00 82.21  ? 17  DG  C O6    1 
ATOM   4738 N  N1    . DG  C  2  17  ? -44.396 83.126 -9.538  1.00 78.23  ? 17  DG  C N1    1 
ATOM   4739 C  C2    . DG  C  2  17  ? -43.097 83.570 -9.609  1.00 78.00  ? 17  DG  C C2    1 
ATOM   4740 N  N2    . DG  C  2  17  ? -42.771 84.283 -10.697 1.00 78.01  ? 17  DG  C N2    1 
ATOM   4741 N  N3    . DG  C  2  17  ? -42.180 83.334 -8.681  1.00 80.21  ? 17  DG  C N3    1 
ATOM   4742 C  C4    . DG  C  2  17  ? -42.678 82.603 -7.656  1.00 86.12  ? 17  DG  C C4    1 
ATOM   4743 P  P     . DC  C  2  18  ? -37.625 84.552 -4.020  1.00 83.97  ? 18  DC  C P     1 
ATOM   4744 O  OP1   . DC  C  2  18  ? -36.186 84.871 -4.164  1.00 85.22  ? 18  DC  C OP1   1 
ATOM   4745 O  OP2   . DC  C  2  18  ? -38.164 84.183 -2.693  1.00 80.89  ? 18  DC  C OP2   1 
ATOM   4746 O  "O5'" . DC  C  2  18  ? -38.488 85.762 -4.610  1.00 89.52  ? 18  DC  C "O5'" 1 
ATOM   4747 C  "C5'" . DC  C  2  18  ? -38.369 86.090 -5.987  1.00 81.95  ? 18  DC  C "C5'" 1 
ATOM   4748 C  "C4'" . DC  C  2  18  ? -39.572 86.873 -6.486  1.00 82.04  ? 18  DC  C "C4'" 1 
ATOM   4749 O  "O4'" . DC  C  2  18  ? -40.728 86.020 -6.585  1.00 78.14  ? 18  DC  C "O4'" 1 
ATOM   4750 C  "C3'" . DC  C  2  18  ? -40.007 88.059 -5.615  1.00 78.39  ? 18  DC  C "C3'" 1 
ATOM   4751 O  "O3'" . DC  C  2  18  ? -39.653 89.273 -6.271  1.00 77.98  ? 18  DC  C "O3'" 1 
ATOM   4752 C  "C2'" . DC  C  2  18  ? -41.539 87.897 -5.491  1.00 78.00  ? 18  DC  C "C2'" 1 
ATOM   4753 C  "C1'" . DC  C  2  18  ? -41.852 86.852 -6.557  1.00 78.45  ? 18  DC  C "C1'" 1 
ATOM   4754 N  N1    . DC  C  2  18  ? -43.066 86.023 -6.277  1.00 82.30  ? 18  DC  C N1    1 
ATOM   4755 C  C2    . DC  C  2  18  ? -44.103 85.984 -7.219  1.00 82.24  ? 18  DC  C C2    1 
ATOM   4756 O  O2    . DC  C  2  18  ? -43.994 86.637 -8.263  1.00 82.58  ? 18  DC  C O2    1 
ATOM   4757 N  N3    . DC  C  2  18  ? -45.198 85.228 -6.959  1.00 86.00  ? 18  DC  C N3    1 
ATOM   4758 C  C4    . DC  C  2  18  ? -45.279 84.537 -5.820  1.00 85.41  ? 18  DC  C C4    1 
ATOM   4759 N  N4    . DC  C  2  18  ? -46.378 83.806 -5.609  1.00 83.51  ? 18  DC  C N4    1 
ATOM   4760 C  C5    . DC  C  2  18  ? -44.233 84.563 -4.849  1.00 83.38  ? 18  DC  C C5    1 
ATOM   4761 C  C6    . DC  C  2  18  ? -43.156 85.312 -5.117  1.00 85.01  ? 18  DC  C C6    1 
ATOM   4762 P  P     . DA  C  2  19  ? -39.859 90.693 -5.550  1.00 86.36  ? 19  DA  C P     1 
ATOM   4763 O  OP1   . DA  C  2  19  ? -38.763 91.576 -6.010  1.00 80.29  ? 19  DA  C OP1   1 
ATOM   4764 O  OP2   . DA  C  2  19  ? -40.067 90.461 -4.103  1.00 86.88  ? 19  DA  C OP2   1 
ATOM   4765 O  "O5'" . DA  C  2  19  ? -41.232 91.230 -6.164  1.00 85.55  ? 19  DA  C "O5'" 1 
ATOM   4766 C  "C5'" . DA  C  2  19  ? -41.373 91.355 -7.571  1.00 84.24  ? 19  DA  C "C5'" 1 
ATOM   4767 C  "C4'" . DA  C  2  19  ? -42.816 91.637 -7.940  1.00 86.88  ? 19  DA  C "C4'" 1 
ATOM   4768 O  "O4'" . DA  C  2  19  ? -43.627 90.467 -7.668  1.00 81.55  ? 19  DA  C "O4'" 1 
ATOM   4769 C  "C3'" . DA  C  2  19  ? -43.457 92.795 -7.170  1.00 85.16  ? 19  DA  C "C3'" 1 
ATOM   4770 O  "O3'" . DA  C  2  19  ? -44.065 93.701 -8.077  1.00 97.90  ? 19  DA  C "O3'" 1 
ATOM   4771 C  "C2'" . DA  C  2  19  ? -44.493 92.112 -6.274  1.00 84.20  ? 19  DA  C "C2'" 1 
ATOM   4772 C  "C1'" . DA  C  2  19  ? -44.839 90.879 -7.087  1.00 82.75  ? 19  DA  C "C1'" 1 
ATOM   4773 N  N9    . DA  C  2  19  ? -45.373 89.780 -6.287  1.00 86.83  ? 19  DA  C N9    1 
ATOM   4774 C  C8    . DA  C  2  19  ? -44.874 89.294 -5.111  1.00 88.80  ? 19  DA  C C8    1 
ATOM   4775 N  N7    . DA  C  2  19  ? -45.565 88.295 -4.615  1.00 89.84  ? 19  DA  C N7    1 
ATOM   4776 C  C5    . DA  C  2  19  ? -46.588 88.113 -5.531  1.00 93.38  ? 19  DA  C C5    1 
ATOM   4777 C  C6    . DA  C  2  19  ? -47.665 87.206 -5.586  1.00 96.42  ? 19  DA  C C6    1 
ATOM   4778 N  N6    . DA  C  2  19  ? -47.892 86.274 -4.655  1.00 95.18  ? 19  DA  C N6    1 
ATOM   4779 N  N1    . DA  C  2  19  ? -48.504 87.296 -6.640  1.00 99.91  ? 19  DA  C N1    1 
ATOM   4780 C  C2    . DA  C  2  19  ? -48.274 88.230 -7.571  1.00 102.23 ? 19  DA  C C2    1 
ATOM   4781 N  N3    . DA  C  2  19  ? -47.300 89.135 -7.625  1.00 102.34 ? 19  DA  C N3    1 
ATOM   4782 C  C4    . DA  C  2  19  ? -46.483 89.021 -6.567  1.00 95.86  ? 19  DA  C C4    1 
ATOM   4783 O  "O5'" . DT  D  3  1   ? -55.636 90.520 -8.338  1.00 130.76 ? 1   DT  D "O5'" 1 
ATOM   4784 C  "C5'" . DT  D  3  1   ? -56.350 89.432 -8.909  1.00 134.99 ? 1   DT  D "C5'" 1 
ATOM   4785 C  "C4'" . DT  D  3  1   ? -55.419 88.540 -9.709  1.00 137.95 ? 1   DT  D "C4'" 1 
ATOM   4786 O  "O4'" . DT  D  3  1   ? -54.258 88.227 -8.914  1.00 136.75 ? 1   DT  D "O4'" 1 
ATOM   4787 C  "C3'" . DT  D  3  1   ? -56.017 87.194 -10.127 1.00 137.58 ? 1   DT  D "C3'" 1 
ATOM   4788 O  "O3'" . DT  D  3  1   ? -56.301 87.190 -11.558 1.00 136.09 ? 1   DT  D "O3'" 1 
ATOM   4789 C  "C2'" . DT  D  3  1   ? -54.979 86.141 -9.690  1.00 133.04 ? 1   DT  D "C2'" 1 
ATOM   4790 C  "C1'" . DT  D  3  1   ? -53.761 86.981 -9.317  1.00 132.75 ? 1   DT  D "C1'" 1 
ATOM   4791 N  N1    . DT  D  3  1   ? -52.952 86.413 -8.198  1.00 131.33 ? 1   DT  D N1    1 
ATOM   4792 C  C2    . DT  D  3  1   ? -51.781 87.036 -7.840  1.00 127.32 ? 1   DT  D C2    1 
ATOM   4793 O  O2    . DT  D  3  1   ? -51.364 88.035 -8.393  1.00 123.70 ? 1   DT  D O2    1 
ATOM   4794 N  N3    . DT  D  3  1   ? -51.110 86.446 -6.805  1.00 122.52 ? 1   DT  D N3    1 
ATOM   4795 C  C4    . DT  D  3  1   ? -51.482 85.317 -6.103  1.00 121.04 ? 1   DT  D C4    1 
ATOM   4796 O  O4    . DT  D  3  1   ? -50.807 84.863 -5.185  1.00 115.16 ? 1   DT  D O4    1 
ATOM   4797 C  C5    . DT  D  3  1   ? -52.721 84.709 -6.527  1.00 124.87 ? 1   DT  D C5    1 
ATOM   4798 C  C7    . DT  D  3  1   ? -53.229 83.477 -5.840  1.00 121.65 ? 1   DT  D C7    1 
ATOM   4799 C  C6    . DT  D  3  1   ? -53.390 85.280 -7.543  1.00 128.66 ? 1   DT  D C6    1 
ATOM   4800 P  P     . DG  D  3  2   ? -55.374 86.432 -12.641 1.00 136.93 ? 2   DG  D P     1 
ATOM   4801 O  OP1   . DG  D  3  2   ? -55.847 86.903 -13.960 1.00 134.52 ? 2   DG  D OP1   1 
ATOM   4802 O  OP2   . DG  D  3  2   ? -55.351 84.974 -12.391 1.00 130.63 ? 2   DG  D OP2   1 
ATOM   4803 O  "O5'" . DG  D  3  2   ? -53.909 87.037 -12.427 1.00 130.53 ? 2   DG  D "O5'" 1 
ATOM   4804 C  "C5'" . DG  D  3  2   ? -53.440 88.080 -13.271 1.00 114.26 ? 2   DG  D "C5'" 1 
ATOM   4805 C  "C4'" . DG  D  3  2   ? -51.996 87.842 -13.677 1.00 94.99  ? 2   DG  D "C4'" 1 
ATOM   4806 O  "O4'" . DG  D  3  2   ? -51.207 87.495 -12.507 1.00 91.89  ? 2   DG  D "O4'" 1 
ATOM   4807 C  "C3'" . DG  D  3  2   ? -51.776 86.708 -14.683 1.00 87.65  ? 2   DG  D "C3'" 1 
ATOM   4808 O  "O3'" . DG  D  3  2   ? -50.779 87.097 -15.610 1.00 87.72  ? 2   DG  D "O3'" 1 
ATOM   4809 C  "C2'" . DG  D  3  2   ? -51.291 85.564 -13.799 1.00 81.78  ? 2   DG  D "C2'" 1 
ATOM   4810 C  "C1'" . DG  D  3  2   ? -50.469 86.326 -12.776 1.00 85.51  ? 2   DG  D "C1'" 1 
ATOM   4811 N  N9    . DG  D  3  2   ? -50.264 85.602 -11.525 1.00 89.29  ? 2   DG  D N9    1 
ATOM   4812 C  C8    . DG  D  3  2   ? -51.151 84.756 -10.905 1.00 90.91  ? 2   DG  D C8    1 
ATOM   4813 N  N7    . DG  D  3  2   ? -50.693 84.247 -9.795  1.00 92.89  ? 2   DG  D N7    1 
ATOM   4814 C  C5    . DG  D  3  2   ? -49.421 84.791 -9.670  1.00 88.87  ? 2   DG  D C5    1 
ATOM   4815 C  C6    . DG  D  3  2   ? -48.446 84.605 -8.661  1.00 82.55  ? 2   DG  D C6    1 
ATOM   4816 O  O6    . DG  D  3  2   ? -48.518 83.899 -7.645  1.00 88.42  ? 2   DG  D O6    1 
ATOM   4817 N  N1    . DG  D  3  2   ? -47.291 85.343 -8.918  1.00 78.82  ? 2   DG  D N1    1 
ATOM   4818 C  C2    . DG  D  3  2   ? -47.105 86.157 -10.012 1.00 81.23  ? 2   DG  D C2    1 
ATOM   4819 N  N2    . DG  D  3  2   ? -45.924 86.791 -10.089 1.00 85.67  ? 2   DG  D N2    1 
ATOM   4820 N  N3    . DG  D  3  2   ? -48.012 86.339 -10.963 1.00 83.76  ? 2   DG  D N3    1 
ATOM   4821 C  C4    . DG  D  3  2   ? -49.141 85.627 -10.727 1.00 87.36  ? 2   DG  D C4    1 
ATOM   4822 P  P     . DC  D  3  3   ? -50.620 86.339 -17.018 1.00 88.06  ? 3   DC  D P     1 
ATOM   4823 O  OP1   . DC  D  3  3   ? -51.175 87.234 -18.056 1.00 87.03  ? 3   DC  D OP1   1 
ATOM   4824 O  OP2   . DC  D  3  3   ? -51.141 84.959 -16.889 1.00 95.09  ? 3   DC  D OP2   1 
ATOM   4825 O  "O5'" . DC  D  3  3   ? -49.036 86.252 -17.208 1.00 82.06  ? 3   DC  D "O5'" 1 
ATOM   4826 C  "C5'" . DC  D  3  3   ? -48.230 87.399 -16.952 1.00 83.58  ? 3   DC  D "C5'" 1 
ATOM   4827 C  "C4'" . DC  D  3  3   ? -46.857 86.994 -16.443 1.00 79.10  ? 3   DC  D "C4'" 1 
ATOM   4828 O  "O4'" . DC  D  3  3   ? -46.971 86.489 -15.093 1.00 79.17  ? 3   DC  D "O4'" 1 
ATOM   4829 C  "C3'" . DC  D  3  3   ? -46.162 85.902 -17.257 1.00 73.85  ? 3   DC  D "C3'" 1 
ATOM   4830 O  "O3'" . DC  D  3  3   ? -44.974 86.417 -17.841 1.00 74.52  ? 3   DC  D "O3'" 1 
ATOM   4831 C  "C2'" . DC  D  3  3   ? -45.858 84.787 -16.240 1.00 77.30  ? 3   DC  D "C2'" 1 
ATOM   4832 C  "C1'" . DC  D  3  3   ? -46.010 85.489 -14.897 1.00 77.68  ? 3   DC  D "C1'" 1 
ATOM   4833 N  N1    . DC  D  3  3   ? -46.494 84.584 -13.809 1.00 79.21  ? 3   DC  D N1    1 
ATOM   4834 C  C2    . DC  D  3  3   ? -45.708 84.383 -12.667 1.00 84.29  ? 3   DC  D C2    1 
ATOM   4835 O  O2    . DC  D  3  3   ? -44.618 84.960 -12.575 1.00 83.67  ? 3   DC  D O2    1 
ATOM   4836 N  N3    . DC  D  3  3   ? -46.168 83.559 -11.691 1.00 85.00  ? 3   DC  D N3    1 
ATOM   4837 C  C4    . DC  D  3  3   ? -47.350 82.954 -11.829 1.00 81.97  ? 3   DC  D C4    1 
ATOM   4838 N  N4    . DC  D  3  3   ? -47.762 82.150 -10.842 1.00 86.45  ? 3   DC  D N4    1 
ATOM   4839 C  C5    . DC  D  3  3   ? -48.162 83.147 -12.984 1.00 79.41  ? 3   DC  D C5    1 
ATOM   4840 C  C6    . DC  D  3  3   ? -47.700 83.962 -13.938 1.00 77.25  ? 3   DC  D C6    1 
ATOM   4841 P  P     . DG  D  3  4   ? -44.356 85.741 -19.162 1.00 73.46  ? 4   DG  D P     1 
ATOM   4842 O  OP1   . DG  D  3  4   ? -43.871 86.831 -20.035 1.00 75.56  ? 4   DG  D OP1   1 
ATOM   4843 O  OP2   . DG  D  3  4   ? -45.322 84.747 -19.679 1.00 79.86  ? 4   DG  D OP2   1 
ATOM   4844 O  "O5'" . DG  D  3  4   ? -43.081 84.953 -18.622 1.00 69.72  ? 4   DG  D "O5'" 1 
ATOM   4845 C  "C5'" . DG  D  3  4   ? -41.926 85.676 -18.253 1.00 76.49  ? 4   DG  D "C5'" 1 
ATOM   4846 C  "C4'" . DG  D  3  4   ? -40.970 84.800 -17.472 1.00 71.00  ? 4   DG  D "C4'" 1 
ATOM   4847 O  "O4'" . DG  D  3  4   ? -41.653 84.239 -16.325 1.00 72.27  ? 4   DG  D "O4'" 1 
ATOM   4848 C  "C3'" . DG  D  3  4   ? -40.379 83.628 -18.251 1.00 66.44  ? 4   DG  D "C3'" 1 
ATOM   4849 O  "O3'" . DG  D  3  4   ? -38.978 83.582 -18.016 1.00 65.63  ? 4   DG  D "O3'" 1 
ATOM   4850 C  "C2'" . DG  D  3  4   ? -41.114 82.405 -17.685 1.00 65.74  ? 4   DG  D "C2'" 1 
ATOM   4851 C  "C1'" . DG  D  3  4   ? -41.439 82.847 -16.267 1.00 73.31  ? 4   DG  D "C1'" 1 
ATOM   4852 N  N9    . DG  D  3  4   ? -42.646 82.236 -15.715 1.00 72.84  ? 4   DG  D N9    1 
ATOM   4853 C  C8    . DG  D  3  4   ? -43.848 82.042 -16.352 1.00 71.78  ? 4   DG  D C8    1 
ATOM   4854 N  N7    . DG  D  3  4   ? -44.753 81.482 -15.597 1.00 68.01  ? 4   DG  D N7    1 
ATOM   4855 C  C5    . DG  D  3  4   ? -44.110 81.299 -14.378 1.00 77.58  ? 4   DG  D C5    1 
ATOM   4856 C  C6    . DG  D  3  4   ? -44.586 80.736 -13.170 1.00 78.91  ? 4   DG  D C6    1 
ATOM   4857 O  O6    . DG  D  3  4   ? -45.708 80.272 -12.930 1.00 68.44  ? 4   DG  D O6    1 
ATOM   4858 N  N1    . DG  D  3  4   ? -43.609 80.742 -12.179 1.00 67.78  ? 4   DG  D N1    1 
ATOM   4859 C  C2    . DG  D  3  4   ? -42.334 81.231 -12.336 1.00 76.21  ? 4   DG  D C2    1 
ATOM   4860 N  N2    . DG  D  3  4   ? -41.531 81.151 -11.265 1.00 74.86  ? 4   DG  D N2    1 
ATOM   4861 N  N3    . DG  D  3  4   ? -41.874 81.760 -13.461 1.00 79.28  ? 4   DG  D N3    1 
ATOM   4862 C  C4    . DG  D  3  4   ? -42.814 81.762 -14.436 1.00 78.12  ? 4   DG  D C4    1 
ATOM   4863 P  P     . DA  D  3  5   ? -38.076 82.370 -18.559 1.00 80.18  ? 5   DA  D P     1 
ATOM   4864 O  OP1   . DA  D  3  5   ? -36.738 82.926 -18.853 1.00 74.72  ? 5   DA  D OP1   1 
ATOM   4865 O  OP2   . DA  D  3  5   ? -38.805 81.615 -19.601 1.00 90.64  ? 5   DA  D OP2   1 
ATOM   4866 O  "O5'" . DA  D  3  5   ? -37.927 81.442 -17.281 1.00 81.66  ? 5   DA  D "O5'" 1 
ATOM   4867 C  "C5'" . DA  D  3  5   ? -37.473 82.004 -16.069 1.00 86.52  ? 5   DA  D "C5'" 1 
ATOM   4868 C  "C4'" . DA  D  3  5   ? -37.359 80.939 -15.008 1.00 91.26  ? 5   DA  D "C4'" 1 
ATOM   4869 O  "O4'" . DA  D  3  5   ? -38.686 80.544 -14.576 1.00 93.81  ? 5   DA  D "O4'" 1 
ATOM   4870 C  "C3'" . DA  D  3  5   ? -36.661 79.659 -15.461 1.00 93.41  ? 5   DA  D "C3'" 1 
ATOM   4871 O  "O3'" . DA  D  3  5   ? -35.858 79.178 -14.408 1.00 103.71 ? 5   DA  D "O3'" 1 
ATOM   4872 C  "C2'" . DA  D  3  5   ? -37.830 78.718 -15.756 1.00 81.62  ? 5   DA  D "C2'" 1 
ATOM   4873 C  "C1'" . DA  D  3  5   ? -38.821 79.146 -14.688 1.00 84.63  ? 5   DA  D "C1'" 1 
ATOM   4874 N  N9    . DA  D  3  5   ? -40.213 78.840 -15.008 1.00 73.51  ? 5   DA  D N9    1 
ATOM   4875 C  C8    . DA  D  3  5   ? -40.836 78.959 -16.220 1.00 73.99  ? 5   DA  D C8    1 
ATOM   4876 N  N7    . DA  D  3  5   ? -42.104 78.615 -16.199 1.00 72.38  ? 5   DA  D N7    1 
ATOM   4877 C  C5    . DA  D  3  5   ? -42.325 78.250 -14.880 1.00 72.63  ? 5   DA  D C5    1 
ATOM   4878 C  C6    . DA  D  3  5   ? -43.468 77.787 -14.198 1.00 69.86  ? 5   DA  D C6    1 
ATOM   4879 N  N6    . DA  D  3  5   ? -44.654 77.606 -14.787 1.00 64.14  ? 5   DA  D N6    1 
ATOM   4880 N  N1    . DA  D  3  5   ? -43.344 77.515 -12.882 1.00 68.82  ? 5   DA  D N1    1 
ATOM   4881 C  C2    . DA  D  3  5   ? -42.155 77.697 -12.295 1.00 68.84  ? 5   DA  D C2    1 
ATOM   4882 N  N3    . DA  D  3  5   ? -41.015 78.125 -12.830 1.00 73.75  ? 5   DA  D N3    1 
ATOM   4883 C  C4    . DA  D  3  5   ? -41.169 78.386 -14.136 1.00 74.11  ? 5   DA  D C4    1 
ATOM   4884 P  P     . DA  D  3  6   ? -34.748 78.046 -14.663 1.00 103.00 ? 6   DA  D P     1 
ATOM   4885 O  OP1   . DA  D  3  6   ? -33.425 78.665 -14.425 1.00 104.44 ? 6   DA  D OP1   1 
ATOM   4886 O  OP2   . DA  D  3  6   ? -35.013 77.384 -15.959 1.00 92.80  ? 6   DA  D OP2   1 
ATOM   4887 O  "O5'" . DA  D  3  6   ? -35.034 77.014 -13.484 1.00 95.92  ? 6   DA  D "O5'" 1 
ATOM   4888 C  "C5'" . DA  D  3  6   ? -35.290 77.518 -12.183 1.00 84.34  ? 6   DA  D "C5'" 1 
ATOM   4889 C  "C4'" . DA  D  3  6   ? -36.196 76.590 -11.400 1.00 74.29  ? 6   DA  D "C4'" 1 
ATOM   4890 O  "O4'" . DA  D  3  6   ? -37.521 76.581 -11.984 1.00 75.28  ? 6   DA  D "O4'" 1 
ATOM   4891 C  "C3'" . DA  D  3  6   ? -35.735 75.135 -11.336 1.00 72.75  ? 6   DA  D "C3'" 1 
ATOM   4892 O  "O3'" . DA  D  3  6   ? -35.748 74.712 -9.983  1.00 77.06  ? 6   DA  D "O3'" 1 
ATOM   4893 C  "C2'" . DA  D  3  6   ? -36.765 74.383 -12.192 1.00 68.90  ? 6   DA  D "C2'" 1 
ATOM   4894 C  "C1'" . DA  D  3  6   ? -38.000 75.260 -12.047 1.00 75.27  ? 6   DA  D "C1'" 1 
ATOM   4895 N  N9    . DA  D  3  6   ? -38.931 75.177 -13.173 1.00 72.99  ? 6   DA  D N9    1 
ATOM   4896 C  C8    . DA  D  3  6   ? -38.660 75.441 -14.488 1.00 71.55  ? 6   DA  D C8    1 
ATOM   4897 N  N7    . DA  D  3  6   ? -39.697 75.301 -15.281 1.00 70.89  ? 6   DA  D N7    1 
ATOM   4898 C  C5    . DA  D  3  6   ? -40.721 74.928 -14.427 1.00 67.43  ? 6   DA  D C5    1 
ATOM   4899 C  C6    . DA  D  3  6   ? -42.081 74.627 -14.649 1.00 69.80  ? 6   DA  D C6    1 
ATOM   4900 N  N6    . DA  D  3  6   ? -42.656 74.661 -15.858 1.00 63.37  ? 6   DA  D N6    1 
ATOM   4901 N  N1    . DA  D  3  6   ? -42.830 74.290 -13.578 1.00 64.98  ? 6   DA  D N1    1 
ATOM   4902 C  C2    . DA  D  3  6   ? -42.252 74.258 -12.373 1.00 61.51  ? 6   DA  D C2    1 
ATOM   4903 N  N3    . DA  D  3  6   ? -40.988 74.519 -12.040 1.00 72.59  ? 6   DA  D N3    1 
ATOM   4904 C  C4    . DA  D  3  6   ? -40.269 74.850 -13.124 1.00 69.11  ? 6   DA  D C4    1 
ATOM   4905 P  P     . DA  D  3  7   ? -35.085 73.318 -9.546  1.00 67.97  ? 7   DA  D P     1 
ATOM   4906 O  OP1   . DA  D  3  7   ? -34.285 73.575 -8.326  1.00 81.37  ? 7   DA  D OP1   1 
ATOM   4907 O  OP2   . DA  D  3  7   ? -34.450 72.701 -10.732 1.00 68.25  ? 7   DA  D OP2   1 
ATOM   4908 O  "O5'" . DA  D  3  7   ? -36.350 72.443 -9.139  1.00 63.89  ? 7   DA  D "O5'" 1 
ATOM   4909 C  "C5'" . DA  D  3  7   ? -37.440 73.073 -8.490  1.00 58.71  ? 7   DA  D "C5'" 1 
ATOM   4910 C  "C4'" . DA  D  3  7   ? -38.648 72.165 -8.474  1.00 65.73  ? 7   DA  D "C4'" 1 
ATOM   4911 O  "O4'" . DA  D  3  7   ? -39.396 72.330 -9.700  1.00 70.04  ? 7   DA  D "O4'" 1 
ATOM   4912 C  "C3'" . DA  D  3  7   ? -38.325 70.679 -8.347  1.00 67.91  ? 7   DA  D "C3'" 1 
ATOM   4913 O  "O3'" . DA  D  3  7   ? -39.092 70.126 -7.288  1.00 76.54  ? 7   DA  D "O3'" 1 
ATOM   4914 C  "C2'" . DA  D  3  7   ? -38.700 70.095 -9.718  1.00 63.34  ? 7   DA  D "C2'" 1 
ATOM   4915 C  "C1'" . DA  D  3  7   ? -39.756 71.073 -10.215 1.00 65.63  ? 7   DA  D "C1'" 1 
ATOM   4916 N  N9    . DA  D  3  7   ? -39.823 71.197 -11.670 1.00 62.03  ? 7   DA  D N9    1 
ATOM   4917 C  C8    . DA  D  3  7   ? -38.788 71.461 -12.525 1.00 69.22  ? 7   DA  D C8    1 
ATOM   4918 N  N7    . DA  D  3  7   ? -39.148 71.537 -13.784 1.00 71.34  ? 7   DA  D N7    1 
ATOM   4919 C  C5    . DA  D  3  7   ? -40.514 71.319 -13.753 1.00 69.53  ? 7   DA  D C5    1 
ATOM   4920 C  C6    . DA  D  3  7   ? -41.490 71.273 -14.767 1.00 67.21  ? 7   DA  D C6    1 
ATOM   4921 N  N6    . DA  D  3  7   ? -41.212 71.456 -16.061 1.00 60.27  ? 7   DA  D N6    1 
ATOM   4922 N  N1    . DA  D  3  7   ? -42.765 71.034 -14.398 1.00 63.99  ? 7   DA  D N1    1 
ATOM   4923 C  C2    . DA  D  3  7   ? -43.038 70.854 -13.100 1.00 70.61  ? 7   DA  D C2    1 
ATOM   4924 N  N3    . DA  D  3  7   ? -42.207 70.873 -12.058 1.00 72.45  ? 7   DA  D N3    1 
ATOM   4925 C  C4    . DA  D  3  7   ? -40.948 71.113 -12.457 1.00 65.30  ? 7   DA  D C4    1 
ATOM   4926 P  P     . DT  D  3  8   ? -38.948 68.580 -6.879  1.00 73.04  ? 8   DT  D P     1 
ATOM   4927 O  OP1   . DT  D  3  8   ? -39.196 68.496 -5.422  1.00 79.58  ? 8   DT  D OP1   1 
ATOM   4928 O  OP2   . DT  D  3  8   ? -37.697 68.039 -7.454  1.00 75.80  ? 8   DT  D OP2   1 
ATOM   4929 O  "O5'" . DT  D  3  8   ? -40.186 67.905 -7.612  1.00 66.90  ? 8   DT  D "O5'" 1 
ATOM   4930 C  "C5'" . DT  D  3  8   ? -41.475 68.434 -7.393  1.00 60.21  ? 8   DT  D "C5'" 1 
ATOM   4931 C  "C4'" . DT  D  3  8   ? -42.455 67.905 -8.411  1.00 59.14  ? 8   DT  D "C4'" 1 
ATOM   4932 O  "O4'" . DT  D  3  8   ? -42.045 68.307 -9.732  1.00 67.86  ? 8   DT  D "O4'" 1 
ATOM   4933 C  "C3'" . DT  D  3  8   ? -42.584 66.382 -8.455  1.00 60.83  ? 8   DT  D "C3'" 1 
ATOM   4934 O  "O3'" . DT  D  3  8   ? -43.882 66.021 -8.007  1.00 62.79  ? 8   DT  D "O3'" 1 
ATOM   4935 C  "C2'" . DT  D  3  8   ? -42.354 66.020 -9.941  1.00 55.34  ? 8   DT  D "C2'" 1 
ATOM   4936 C  "C1'" . DT  D  3  8   ? -42.542 67.364 -10.632 1.00 65.85  ? 8   DT  D "C1'" 1 
ATOM   4937 N  N1    . DT  D  3  8   ? -41.812 67.523 -11.932 1.00 65.37  ? 8   DT  D N1    1 
ATOM   4938 C  C2    . DT  D  3  8   ? -42.535 67.570 -13.101 1.00 63.79  ? 8   DT  D C2    1 
ATOM   4939 O  O2    . DT  D  3  8   ? -43.748 67.469 -13.138 1.00 69.96  ? 8   DT  D O2    1 
ATOM   4940 N  N3    . DT  D  3  8   ? -41.786 67.734 -14.234 1.00 62.57  ? 8   DT  D N3    1 
ATOM   4941 C  C4    . DT  D  3  8   ? -40.414 67.860 -14.318 1.00 67.06  ? 8   DT  D C4    1 
ATOM   4942 O  O4    . DT  D  3  8   ? -39.830 68.002 -15.388 1.00 68.32  ? 8   DT  D O4    1 
ATOM   4943 C  C5    . DT  D  3  8   ? -39.713 67.812 -13.060 1.00 66.48  ? 8   DT  D C5    1 
ATOM   4944 C  C7    . DT  D  3  8   ? -38.223 67.940 -13.032 1.00 53.68  ? 8   DT  D C7    1 
ATOM   4945 C  C6    . DT  D  3  8   ? -40.436 67.653 -11.936 1.00 67.52  ? 8   DT  D C6    1 
ATOM   4946 P  P     . DT  D  3  9   ? -44.292 64.480 -7.818  1.00 65.04  ? 9   DT  D P     1 
ATOM   4947 O  OP1   . DT  D  3  9   ? -45.300 64.427 -6.736  1.00 69.92  ? 9   DT  D OP1   1 
ATOM   4948 O  OP2   . DT  D  3  9   ? -43.053 63.683 -7.716  1.00 74.54  ? 9   DT  D OP2   1 
ATOM   4949 O  "O5'" . DT  D  3  9   ? -45.029 64.133 -9.188  1.00 67.65  ? 9   DT  D "O5'" 1 
ATOM   4950 C  "C5'" . DT  D  3  9   ? -46.146 64.906 -9.573  1.00 64.96  ? 9   DT  D "C5'" 1 
ATOM   4951 C  "C4'" . DT  D  3  9   ? -46.563 64.593 -10.992 1.00 62.76  ? 9   DT  D "C4'" 1 
ATOM   4952 O  "O4'" . DT  D  3  9   ? -45.522 64.999 -11.903 1.00 63.27  ? 9   DT  D "O4'" 1 
ATOM   4953 C  "C3'" . DT  D  3  9   ? -46.848 63.119 -11.279 1.00 56.86  ? 9   DT  D "C3'" 1 
ATOM   4954 O  "O3'" . DT  D  3  9   ? -48.184 63.002 -11.741 1.00 66.75  ? 9   DT  D "O3'" 1 
ATOM   4955 C  "C2'" . DT  D  3  9   ? -45.816 62.739 -12.359 1.00 55.78  ? 9   DT  D "C2'" 1 
ATOM   4956 C  "C1'" . DT  D  3  9   ? -45.469 64.092 -12.965 1.00 58.16  ? 9   DT  D "C1'" 1 
ATOM   4957 N  N1    . DT  D  3  9   ? -44.101 64.176 -13.565 1.00 66.22  ? 9   DT  D N1    1 
ATOM   4958 C  C2    . DT  D  3  9   ? -43.968 64.502 -14.895 1.00 67.03  ? 9   DT  D C2    1 
ATOM   4959 O  O2    . DT  D  3  9   ? -44.917 64.704 -15.629 1.00 66.06  ? 9   DT  D O2    1 
ATOM   4960 N  N3    . DT  D  3  9   ? -42.674 64.570 -15.343 1.00 59.66  ? 9   DT  D N3    1 
ATOM   4961 C  C4    . DT  D  3  9   ? -41.523 64.361 -14.607 1.00 56.23  ? 9   DT  D C4    1 
ATOM   4962 O  O4    . DT  D  3  9   ? -40.401 64.447 -15.102 1.00 52.43  ? 9   DT  D O4    1 
ATOM   4963 C  C5    . DT  D  3  9   ? -41.733 64.034 -13.215 1.00 58.13  ? 9   DT  D C5    1 
ATOM   4964 C  C7    . DT  D  3  9   ? -40.561 63.782 -12.313 1.00 54.36  ? 9   DT  D C7    1 
ATOM   4965 C  C6    . DT  D  3  9   ? -42.997 63.963 -12.766 1.00 63.95  ? 9   DT  D C6    1 
ATOM   4966 P  P     . DC  D  3  10  ? -48.784 61.592 -12.224 1.00 75.51  ? 10  DC  D P     1 
ATOM   4967 O  OP1   . DC  D  3  10  ? -50.246 61.665 -12.008 1.00 71.22  ? 10  DC  D OP1   1 
ATOM   4968 O  OP2   . DC  D  3  10  ? -48.007 60.492 -11.613 1.00 70.94  ? 10  DC  D OP2   1 
ATOM   4969 O  "O5'" . DC  D  3  10  ? -48.529 61.608 -13.798 1.00 73.75  ? 10  DC  D "O5'" 1 
ATOM   4970 C  "C5'" . DC  D  3  10  ? -48.963 62.728 -14.554 1.00 63.10  ? 10  DC  D "C5'" 1 
ATOM   4971 C  "C4'" . DC  D  3  10  ? -48.680 62.538 -16.029 1.00 61.43  ? 10  DC  D "C4'" 1 
ATOM   4972 O  "O4'" . DC  D  3  10  ? -47.275 62.773 -16.292 1.00 65.90  ? 10  DC  D "O4'" 1 
ATOM   4973 C  "C3'" . DC  D  3  10  ? -49.000 61.150 -16.581 1.00 60.56  ? 10  DC  D "C3'" 1 
ATOM   4974 O  "O3'" . DC  D  3  10  ? -49.670 61.287 -17.825 1.00 67.91  ? 10  DC  D "O3'" 1 
ATOM   4975 C  "C2'" . DC  D  3  10  ? -47.620 60.506 -16.744 1.00 61.94  ? 10  DC  D "C2'" 1 
ATOM   4976 C  "C1'" . DC  D  3  10  ? -46.755 61.716 -17.064 1.00 62.40  ? 10  DC  D "C1'" 1 
ATOM   4977 N  N1    . DC  D  3  10  ? -45.319 61.554 -16.701 1.00 66.37  ? 10  DC  D N1    1 
ATOM   4978 C  C2    . DC  D  3  10  ? -44.334 61.685 -17.686 1.00 69.04  ? 10  DC  D C2    1 
ATOM   4979 O  O2    . DC  D  3  10  ? -44.672 61.917 -18.852 1.00 69.06  ? 10  DC  D O2    1 
ATOM   4980 N  N3    . DC  D  3  10  ? -43.032 61.547 -17.335 1.00 72.09  ? 10  DC  D N3    1 
ATOM   4981 C  C4    . DC  D  3  10  ? -42.705 61.298 -16.066 1.00 68.34  ? 10  DC  D C4    1 
ATOM   4982 N  N4    . DC  D  3  10  ? -41.409 61.170 -15.769 1.00 63.68  ? 10  DC  D N4    1 
ATOM   4983 C  C5    . DC  D  3  10  ? -43.695 61.167 -15.046 1.00 64.00  ? 10  DC  D C5    1 
ATOM   4984 C  C6    . DC  D  3  10  ? -44.975 61.304 -15.405 1.00 69.06  ? 10  DC  D C6    1 
ATOM   4985 P  P     . DC  D  3  11  ? -50.522 60.068 -18.429 1.00 70.25  ? 11  DC  D P     1 
ATOM   4986 O  OP1   . DC  D  3  11  ? -51.521 60.643 -19.356 1.00 75.55  ? 11  DC  D OP1   1 
ATOM   4987 O  OP2   . DC  D  3  11  ? -50.963 59.201 -17.315 1.00 68.04  ? 11  DC  D OP2   1 
ATOM   4988 O  "O5'" . DC  D  3  11  ? -49.448 59.254 -19.281 1.00 66.59  ? 11  DC  D "O5'" 1 
ATOM   4989 C  "C5'" . DC  D  3  11  ? -48.831 59.871 -20.396 1.00 60.15  ? 11  DC  D "C5'" 1 
ATOM   4990 C  "C4'" . DC  D  3  11  ? -47.827 58.939 -21.043 1.00 61.46  ? 11  DC  D "C4'" 1 
ATOM   4991 O  "O4'" . DC  D  3  11  ? -46.533 59.078 -20.393 1.00 62.53  ? 11  DC  D "O4'" 1 
ATOM   4992 C  "C3'" . DC  D  3  11  ? -48.170 57.450 -20.960 1.00 61.09  ? 11  DC  D "C3'" 1 
ATOM   4993 O  "O3'" . DC  D  3  11  ? -47.745 56.810 -22.144 1.00 69.79  ? 11  DC  D "O3'" 1 
ATOM   4994 C  "C2'" . DC  D  3  11  ? -47.324 56.995 -19.776 1.00 58.35  ? 11  DC  D "C2'" 1 
ATOM   4995 C  "C1'" . DC  D  3  11  ? -46.068 57.793 -20.056 1.00 57.30  ? 11  DC  D "C1'" 1 
ATOM   4996 N  N1    . DC  D  3  11  ? -45.135 57.893 -18.909 1.00 66.47  ? 11  DC  D N1    1 
ATOM   4997 C  C2    . DC  D  3  11  ? -43.796 58.222 -19.144 1.00 65.63  ? 11  DC  D C2    1 
ATOM   4998 O  O2    . DC  D  3  11  ? -43.425 58.434 -20.305 1.00 64.48  ? 11  DC  D O2    1 
ATOM   4999 N  N3    . DC  D  3  11  ? -42.946 58.305 -18.091 1.00 65.52  ? 11  DC  D N3    1 
ATOM   5000 C  C4    . DC  D  3  11  ? -43.390 58.068 -16.855 1.00 58.11  ? 11  DC  D C4    1 
ATOM   5001 N  N4    . DC  D  3  11  ? -42.514 58.161 -15.850 1.00 67.16  ? 11  DC  D N4    1 
ATOM   5002 C  C5    . DC  D  3  11  ? -44.749 57.726 -16.596 1.00 55.99  ? 11  DC  D C5    1 
ATOM   5003 C  C6    . DC  D  3  11  ? -45.579 57.647 -17.643 1.00 73.87  ? 11  DC  D C6    1 
ATOM   5004 P  P     . DA  D  3  12  ? -48.816 56.172 -23.159 1.00 64.60  ? 12  DA  D P     1 
ATOM   5005 O  OP1   . DA  D  3  12  ? -49.789 57.233 -23.493 1.00 62.05  ? 12  DA  D OP1   1 
ATOM   5006 O  OP2   . DA  D  3  12  ? -49.291 54.896 -22.584 1.00 69.62  ? 12  DA  D OP2   1 
ATOM   5007 O  "O5'" . DA  D  3  12  ? -47.940 55.837 -24.455 1.00 62.48  ? 12  DA  D "O5'" 1 
ATOM   5008 C  "C5'" . DA  D  3  12  ? -47.500 56.894 -25.299 1.00 61.69  ? 12  DA  D "C5'" 1 
ATOM   5009 C  "C4'" . DA  D  3  12  ? -46.061 56.694 -25.756 1.00 62.76  ? 12  DA  D "C4'" 1 
ATOM   5010 O  "O4'" . DA  D  3  12  ? -45.160 56.751 -24.622 1.00 70.15  ? 12  DA  D "O4'" 1 
ATOM   5011 C  "C3'" . DA  D  3  12  ? -45.756 55.377 -26.455 1.00 61.57  ? 12  DA  D "C3'" 1 
ATOM   5012 O  "O3'" . DA  D  3  12  ? -44.723 55.599 -27.398 1.00 71.89  ? 12  DA  D "O3'" 1 
ATOM   5013 C  "C2'" . DA  D  3  12  ? -45.273 54.501 -25.301 1.00 56.96  ? 12  DA  D "C2'" 1 
ATOM   5014 C  "C1'" . DA  D  3  12  ? -44.491 55.513 -24.473 1.00 62.36  ? 12  DA  D "C1'" 1 
ATOM   5015 N  N9    . DA  D  3  12  ? -44.436 55.211 -23.047 1.00 65.57  ? 12  DA  D N9    1 
ATOM   5016 C  C8    . DA  D  3  12  ? -45.461 54.776 -22.254 1.00 59.80  ? 12  DA  D C8    1 
ATOM   5017 N  N7    . DA  D  3  12  ? -45.123 54.610 -20.999 1.00 60.49  ? 12  DA  D N7    1 
ATOM   5018 C  C5    . DA  D  3  12  ? -43.788 54.971 -20.964 1.00 59.81  ? 12  DA  D C5    1 
ATOM   5019 C  C6    . DA  D  3  12  ? -42.847 55.015 -19.919 1.00 66.17  ? 12  DA  D C6    1 
ATOM   5020 N  N6    . DA  D  3  12  ? -43.135 54.676 -18.658 1.00 56.15  ? 12  DA  D N6    1 
ATOM   5021 N  N1    . DA  D  3  12  ? -41.596 55.422 -20.220 1.00 69.59  ? 12  DA  D N1    1 
ATOM   5022 C  C2    . DA  D  3  12  ? -41.314 55.760 -21.483 1.00 61.95  ? 12  DA  D C2    1 
ATOM   5023 N  N3    . DA  D  3  12  ? -42.113 55.759 -22.548 1.00 61.10  ? 12  DA  D N3    1 
ATOM   5024 C  C4    . DA  D  3  12  ? -43.349 55.350 -22.216 1.00 57.12  ? 12  DA  D C4    1 
ATOM   5025 P  P     . DT  D  3  13  ? -44.443 54.556 -28.585 1.00 70.88  ? 13  DT  D P     1 
ATOM   5026 O  OP1   . DT  D  3  13  ? -44.130 55.375 -29.774 1.00 83.81  ? 13  DT  D OP1   1 
ATOM   5027 O  OP2   . DT  D  3  13  ? -45.532 53.555 -28.626 1.00 73.83  ? 13  DT  D OP2   1 
ATOM   5028 O  "O5'" . DT  D  3  13  ? -43.092 53.839 -28.133 1.00 69.07  ? 13  DT  D "O5'" 1 
ATOM   5029 C  "C5'" . DT  D  3  13  ? -41.923 54.623 -27.945 1.00 63.87  ? 13  DT  D "C5'" 1 
ATOM   5030 C  "C4'" . DT  D  3  13  ? -40.857 53.846 -27.198 1.00 59.70  ? 13  DT  D "C4'" 1 
ATOM   5031 O  "O4'" . DT  D  3  13  ? -41.175 53.791 -25.794 1.00 55.58  ? 13  DT  D "O4'" 1 
ATOM   5032 C  "C3'" . DT  D  3  13  ? -40.678 52.394 -27.647 1.00 53.17  ? 13  DT  D "C3'" 1 
ATOM   5033 O  "O3'" . DT  D  3  13  ? -39.424 52.260 -28.306 1.00 57.07  ? 13  DT  D "O3'" 1 
ATOM   5034 C  "C2'" . DT  D  3  13  ? -40.739 51.572 -26.341 1.00 52.89  ? 13  DT  D "C2'" 1 
ATOM   5035 C  "C1'" . DT  D  3  13  ? -40.586 52.639 -25.262 1.00 52.20  ? 13  DT  D "C1'" 1 
ATOM   5036 N  N1    . DT  D  3  13  ? -41.269 52.316 -23.970 1.00 56.26  ? 13  DT  D N1    1 
ATOM   5037 C  C2    . DT  D  3  13  ? -40.549 52.378 -22.799 1.00 57.64  ? 13  DT  D C2    1 
ATOM   5038 O  O2    . DT  D  3  13  ? -39.368 52.676 -22.756 1.00 57.45  ? 13  DT  D O2    1 
ATOM   5039 N  N3    . DT  D  3  13  ? -41.265 52.076 -21.670 1.00 60.24  ? 13  DT  D N3    1 
ATOM   5040 C  C4    . DT  D  3  13  ? -42.603 51.727 -21.597 1.00 66.56  ? 13  DT  D C4    1 
ATOM   5041 O  O4    . DT  D  3  13  ? -43.159 51.471 -20.534 1.00 64.48  ? 13  DT  D O4    1 
ATOM   5042 C  C5    . DT  D  3  13  ? -43.299 51.684 -22.860 1.00 61.84  ? 13  DT  D C5    1 
ATOM   5043 C  C7    . DT  D  3  13  ? -44.752 51.318 -22.905 1.00 53.62  ? 13  DT  D C7    1 
ATOM   5044 C  C6    . DT  D  3  13  ? -42.608 51.978 -23.973 1.00 58.49  ? 13  DT  D C6    1 
ATOM   5045 P  P     . DG  D  3  14  ? -39.116 50.994 -29.244 1.00 68.42  ? 14  DG  D P     1 
ATOM   5046 O  OP1   . DG  D  3  14  ? -38.245 51.463 -30.344 1.00 84.03  ? 14  DG  D OP1   1 
ATOM   5047 O  OP2   . DG  D  3  14  ? -40.396 50.319 -29.558 1.00 70.90  ? 14  DG  D OP2   1 
ATOM   5048 O  "O5'" . DG  D  3  14  ? -38.262 50.034 -28.295 1.00 58.63  ? 14  DG  D "O5'" 1 
ATOM   5049 C  "C5'" . DG  D  3  14  ? -37.235 50.589 -27.484 1.00 52.48  ? 14  DG  D "C5'" 1 
ATOM   5050 C  "C4'" . DG  D  3  14  ? -36.880 49.653 -26.345 1.00 56.37  ? 14  DG  D "C4'" 1 
ATOM   5051 O  "O4'" . DG  D  3  14  ? -37.905 49.716 -25.321 1.00 56.20  ? 14  DG  D "O4'" 1 
ATOM   5052 C  "C3'" . DG  D  3  14  ? -36.758 48.179 -26.739 1.00 58.34  ? 14  DG  D "C3'" 1 
ATOM   5053 O  "O3'" . DG  D  3  14  ? -35.541 47.650 -26.238 1.00 62.39  ? 14  DG  D "O3'" 1 
ATOM   5054 C  "C2'" . DG  D  3  14  ? -37.973 47.524 -26.074 1.00 53.33  ? 14  DG  D "C2'" 1 
ATOM   5055 C  "C1'" . DG  D  3  14  ? -38.165 48.414 -24.862 1.00 60.43  ? 14  DG  D "C1'" 1 
ATOM   5056 N  N9    . DG  D  3  14  ? -39.514 48.377 -24.303 1.00 66.62  ? 14  DG  D N9    1 
ATOM   5057 C  C8    . DG  D  3  14  ? -40.697 48.273 -24.992 1.00 62.95  ? 14  DG  D C8    1 
ATOM   5058 N  N7    . DG  D  3  14  ? -41.750 48.268 -24.220 1.00 53.53  ? 14  DG  D N7    1 
ATOM   5059 C  C5    . DG  D  3  14  ? -41.231 48.381 -22.936 1.00 63.54  ? 14  DG  D C5    1 
ATOM   5060 C  C6    . DG  D  3  14  ? -41.891 48.428 -21.684 1.00 60.92  ? 14  DG  D C6    1 
ATOM   5061 O  O6    . DG  D  3  14  ? -43.108 48.379 -21.455 1.00 61.57  ? 14  DG  D O6    1 
ATOM   5062 N  N1    . DG  D  3  14  ? -40.986 48.543 -20.629 1.00 56.21  ? 14  DG  D N1    1 
ATOM   5063 C  C2    . DG  D  3  14  ? -39.618 48.605 -20.770 1.00 57.31  ? 14  DG  D C2    1 
ATOM   5064 N  N2    . DG  D  3  14  ? -38.905 48.715 -19.638 1.00 59.28  ? 14  DG  D N2    1 
ATOM   5065 N  N3    . DG  D  3  14  ? -38.989 48.560 -21.936 1.00 63.58  ? 14  DG  D N3    1 
ATOM   5066 C  C4    . DG  D  3  14  ? -39.855 48.448 -22.972 1.00 68.35  ? 14  DG  D C4    1 
ATOM   5067 P  P     . DA  D  3  15  ? -34.911 46.318 -26.882 1.00 75.01  ? 15  DA  D P     1 
ATOM   5068 O  OP1   . DA  D  3  15  ? -33.625 46.673 -27.519 1.00 71.99  ? 15  DA  D OP1   1 
ATOM   5069 O  OP2   . DA  D  3  15  ? -35.967 45.642 -27.666 1.00 72.27  ? 15  DA  D OP2   1 
ATOM   5070 O  "O5'" . DA  D  3  15  ? -34.608 45.394 -25.619 1.00 68.92  ? 15  DA  D "O5'" 1 
ATOM   5071 C  "C5'" . DA  D  3  15  ? -33.815 45.873 -24.545 1.00 60.58  ? 15  DA  D "C5'" 1 
ATOM   5072 C  "C4'" . DA  D  3  15  ? -33.958 44.954 -23.347 1.00 61.64  ? 15  DA  D "C4'" 1 
ATOM   5073 O  "O4'" . DA  D  3  15  ? -35.251 45.181 -22.725 1.00 58.19  ? 15  DA  D "O4'" 1 
ATOM   5074 C  "C3'" . DA  D  3  15  ? -33.909 43.462 -23.682 1.00 59.59  ? 15  DA  D "C3'" 1 
ATOM   5075 O  "O3'" . DA  D  3  15  ? -33.243 42.739 -22.655 1.00 65.69  ? 15  DA  D "O3'" 1 
ATOM   5076 C  "C2'" . DA  D  3  15  ? -35.383 43.081 -23.767 1.00 60.97  ? 15  DA  D "C2'" 1 
ATOM   5077 C  "C1'" . DA  D  3  15  ? -35.989 43.975 -22.700 1.00 62.02  ? 15  DA  D "C1'" 1 
ATOM   5078 N  N9    . DA  D  3  15  ? -37.399 44.275 -22.935 1.00 60.66  ? 15  DA  D N9    1 
ATOM   5079 C  C8    . DA  D  3  15  ? -38.063 44.236 -24.130 1.00 56.39  ? 15  DA  D C8    1 
ATOM   5080 N  N7    . DA  D  3  15  ? -39.337 44.543 -24.038 1.00 54.30  ? 15  DA  D N7    1 
ATOM   5081 C  C5    . DA  D  3  15  ? -39.519 44.796 -22.689 1.00 63.26  ? 15  DA  D C5    1 
ATOM   5082 C  C6    . DA  D  3  15  ? -40.649 45.173 -21.938 1.00 63.35  ? 15  DA  D C6    1 
ATOM   5083 N  N6    . DA  D  3  15  ? -41.859 45.366 -22.473 1.00 59.41  ? 15  DA  D N6    1 
ATOM   5084 N  N1    . DA  D  3  15  ? -40.487 45.343 -20.608 1.00 57.36  ? 15  DA  D N1    1 
ATOM   5085 C  C2    . DA  D  3  15  ? -39.276 45.147 -20.076 1.00 52.63  ? 15  DA  D C2    1 
ATOM   5086 N  N3    . DA  D  3  15  ? -38.143 44.793 -20.679 1.00 61.21  ? 15  DA  D N3    1 
ATOM   5087 C  C4    . DA  D  3  15  ? -38.335 44.632 -21.996 1.00 64.77  ? 15  DA  D C4    1 
ATOM   5088 P  P     . DC  D  3  16  ? -32.733 41.238 -22.935 1.00 69.34  ? 16  DC  D P     1 
ATOM   5089 O  OP1   . DC  D  3  16  ? -31.259 41.234 -22.826 1.00 74.25  ? 16  DC  D OP1   1 
ATOM   5090 O  OP2   . DC  D  3  16  ? -33.367 40.761 -24.184 1.00 55.86  ? 16  DC  D OP2   1 
ATOM   5091 O  "O5'" . DC  D  3  16  ? -33.348 40.386 -21.729 1.00 70.46  ? 16  DC  D "O5'" 1 
ATOM   5092 C  "C5'" . DC  D  3  16  ? -32.774 40.466 -20.430 1.00 60.64  ? 16  DC  D "C5'" 1 
ATOM   5093 C  "C4'" . DC  D  3  16  ? -33.823 40.210 -19.363 1.00 54.78  ? 16  DC  D "C4'" 1 
ATOM   5094 O  "O4'" . DC  D  3  16  ? -34.903 41.148 -19.538 1.00 55.38  ? 16  DC  D "O4'" 1 
ATOM   5095 C  "C3'" . DC  D  3  16  ? -34.481 38.839 -19.423 1.00 55.45  ? 16  DC  D "C3'" 1 
ATOM   5096 O  "O3'" . DC  D  3  16  ? -33.743 37.906 -18.637 1.00 63.08  ? 16  DC  D "O3'" 1 
ATOM   5097 C  "C2'" . DC  D  3  16  ? -35.862 39.093 -18.813 1.00 55.14  ? 16  DC  D "C2'" 1 
ATOM   5098 C  "C1'" . DC  D  3  16  ? -36.104 40.587 -19.049 1.00 54.24  ? 16  DC  D "C1'" 1 
ATOM   5099 N  N1    . DC  D  3  16  ? -37.193 40.869 -20.022 1.00 63.05  ? 16  DC  D N1    1 
ATOM   5100 C  C2    . DC  D  3  16  ? -38.339 41.547 -19.597 1.00 61.90  ? 16  DC  D C2    1 
ATOM   5101 O  O2    . DC  D  3  16  ? -38.421 41.908 -18.416 1.00 59.91  ? 16  DC  D O2    1 
ATOM   5102 N  N3    . DC  D  3  16  ? -39.327 41.795 -20.494 1.00 63.18  ? 16  DC  D N3    1 
ATOM   5103 C  C4    . DC  D  3  16  ? -39.197 41.390 -21.758 1.00 55.16  ? 16  DC  D C4    1 
ATOM   5104 N  N4    . DC  D  3  16  ? -40.194 41.654 -22.605 1.00 55.58  ? 16  DC  D N4    1 
ATOM   5105 C  C5    . DC  D  3  16  ? -38.036 40.695 -22.209 1.00 55.55  ? 16  DC  D C5    1 
ATOM   5106 C  C6    . DC  D  3  16  ? -37.070 40.457 -21.316 1.00 62.80  ? 16  DC  D C6    1 
ATOM   5107 P  P     . DA  D  3  17  ? -32.670 36.923 -19.318 1.00 69.79  ? 17  DA  D P     1 
ATOM   5108 O  OP1   . DA  D  3  17  ? -32.676 35.653 -18.556 1.00 64.80  ? 17  DA  D OP1   1 
ATOM   5109 O  OP2   . DA  D  3  17  ? -31.414 37.683 -19.479 1.00 75.62  ? 17  DA  D OP2   1 
ATOM   5110 O  "O5'" . DA  D  3  17  ? -33.251 36.653 -20.781 1.00 78.12  ? 17  DA  D "O5'" 1 
ATOM   5111 C  "C5'" . DA  D  3  17  ? -32.356 36.564 -21.879 1.00 82.54  ? 17  DA  D "C5'" 1 
ATOM   5112 C  "C4'" . DA  D  3  17  ? -32.906 35.661 -22.968 1.00 78.29  ? 17  DA  D "C4'" 1 
ATOM   5113 O  "O4'" . DA  D  3  17  ? -32.753 34.283 -22.597 1.00 79.31  ? 17  DA  D "O4'" 1 
ATOM   5114 C  "C3'" . DA  D  3  17  ? -34.393 35.816 -23.257 1.00 78.31  ? 17  DA  D "C3'" 1 
ATOM   5115 O  "O3'" . DA  D  3  17  ? -34.581 36.721 -24.334 1.00 74.93  ? 17  DA  D "O3'" 1 
ATOM   5116 C  "C2'" . DA  D  3  17  ? -34.855 34.389 -23.626 1.00 82.28  ? 17  DA  D "C2'" 1 
ATOM   5117 C  "C1'" . DA  D  3  17  ? -33.587 33.547 -23.447 1.00 89.59  ? 17  DA  D "C1'" 1 
ATOM   5118 N  N9    . DA  D  3  17  ? -33.827 32.214 -22.883 1.00 99.75  ? 17  DA  D N9    1 
ATOM   5119 C  C8    . DA  D  3  17  ? -34.185 31.094 -23.581 1.00 102.30 ? 17  DA  D C8    1 
ATOM   5120 N  N7    . DA  D  3  17  ? -34.338 30.026 -22.834 1.00 97.83  ? 17  DA  D N7    1 
ATOM   5121 C  C5    . DA  D  3  17  ? -34.060 30.470 -21.552 1.00 94.34  ? 17  DA  D C5    1 
ATOM   5122 C  C6    . DA  D  3  17  ? -34.047 29.814 -20.302 1.00 95.78  ? 17  DA  D C6    1 
ATOM   5123 N  N6    . DA  D  3  17  ? -34.333 28.517 -20.147 1.00 94.19  ? 17  DA  D N6    1 
ATOM   5124 N  N1    . DA  D  3  17  ? -33.727 30.547 -19.214 1.00 96.49  ? 17  DA  D N1    1 
ATOM   5125 C  C2    . DA  D  3  17  ? -33.442 31.844 -19.373 1.00 92.11  ? 17  DA  D C2    1 
ATOM   5126 N  N3    . DA  D  3  17  ? -33.420 32.571 -20.492 1.00 84.80  ? 17  DA  D N3    1 
ATOM   5127 C  C4    . DA  D  3  17  ? -33.741 31.818 -21.558 1.00 89.65  ? 17  DA  D C4    1 
HETATM 5128 ZN ZN    . ZN  E  4  .   ? -55.611 23.627 -46.184 1.00 69.70  ? 401 ZN  A ZN    1 
HETATM 5129 MG MG    . MG  F  5  .   ? -36.653 30.600 -16.138 1.00 59.01  ? 402 MG  A MG    1 
HETATM 5130 MG MG    . MG  G  5  .   ? -36.342 34.364 -17.009 1.00 49.97  ? 403 MG  A MG    1 
HETATM 5131 S  S     . SO4 H  6  .   ? -12.549 34.465 -13.432 1.00 128.96 ? 404 SO4 A S     1 
HETATM 5132 O  O1    . SO4 H  6  .   ? -12.684 33.445 -14.467 1.00 130.83 ? 404 SO4 A O1    1 
HETATM 5133 O  O2    . SO4 H  6  .   ? -11.341 35.246 -13.678 1.00 128.50 ? 404 SO4 A O2    1 
HETATM 5134 O  O3    . SO4 H  6  .   ? -13.715 35.343 -13.461 1.00 120.77 ? 404 SO4 A O3    1 
HETATM 5135 O  O4    . SO4 H  6  .   ? -12.457 33.824 -12.124 1.00 129.62 ? 404 SO4 A O4    1 
HETATM 5136 S  S     . SO4 I  6  .   ? -34.562 24.253 -18.082 1.00 143.38 ? 405 SO4 A S     1 
HETATM 5137 O  O1    . SO4 I  6  .   ? -35.800 23.491 -17.952 1.00 136.28 ? 405 SO4 A O1    1 
HETATM 5138 O  O2    . SO4 I  6  .   ? -34.120 24.231 -19.473 1.00 148.74 ? 405 SO4 A O2    1 
HETATM 5139 O  O3    . SO4 I  6  .   ? -34.795 25.634 -17.667 1.00 144.97 ? 405 SO4 A O3    1 
HETATM 5140 O  O4    . SO4 I  6  .   ? -33.533 23.656 -17.236 1.00 141.13 ? 405 SO4 A O4    1 
HETATM 5141 S  S     . SO4 J  6  .   ? -38.000 27.179 -39.120 1.00 161.41 ? 406 SO4 A S     1 
HETATM 5142 O  O1    . SO4 J  6  .   ? -38.874 26.317 -39.909 1.00 161.02 ? 406 SO4 A O1    1 
HETATM 5143 O  O2    . SO4 J  6  .   ? -36.629 27.051 -39.607 1.00 157.67 ? 406 SO4 A O2    1 
HETATM 5144 O  O3    . SO4 J  6  .   ? -38.434 28.567 -39.247 1.00 161.13 ? 406 SO4 A O3    1 
HETATM 5145 O  O4    . SO4 J  6  .   ? -38.061 26.779 -37.719 1.00 163.51 ? 406 SO4 A O4    1 
HETATM 5146 S  S     . SO4 K  6  .   ? -50.816 17.017 -32.032 1.00 139.67 ? 407 SO4 A S     1 
HETATM 5147 O  O1    . SO4 K  6  .   ? -51.646 18.218 -32.008 1.00 132.32 ? 407 SO4 A O1    1 
HETATM 5148 O  O2    . SO4 K  6  .   ? -50.949 16.357 -33.328 1.00 145.83 ? 407 SO4 A O2    1 
HETATM 5149 O  O3    . SO4 K  6  .   ? -49.421 17.388 -31.816 1.00 138.51 ? 407 SO4 A O3    1 
HETATM 5150 O  O4    . SO4 K  6  .   ? -51.249 16.107 -30.976 1.00 144.56 ? 407 SO4 A O4    1 
HETATM 5151 S  S     . SO4 L  6  .   ? -23.663 24.585 -7.110  1.00 166.99 ? 408 SO4 A S     1 
HETATM 5152 O  O1    . SO4 L  6  .   ? -22.263 24.608 -7.523  1.00 170.21 ? 408 SO4 A O1    1 
HETATM 5153 O  O2    . SO4 L  6  .   ? -24.517 24.588 -8.294  1.00 166.11 ? 408 SO4 A O2    1 
HETATM 5154 O  O3    . SO4 L  6  .   ? -23.921 23.379 -6.327  1.00 167.45 ? 408 SO4 A O3    1 
HETATM 5155 O  O4    . SO4 L  6  .   ? -23.950 25.763 -6.297  1.00 164.77 ? 408 SO4 A O4    1 
HETATM 5156 S  S     . SO4 M  6  .   ? -61.009 21.548 -62.672 1.00 158.70 ? 409 SO4 A S     1 
HETATM 5157 O  O1    . SO4 M  6  .   ? -60.294 22.684 -63.247 1.00 153.80 ? 409 SO4 A O1    1 
HETATM 5158 O  O2    . SO4 M  6  .   ? -61.450 20.659 -63.743 1.00 161.47 ? 409 SO4 A O2    1 
HETATM 5159 O  O3    . SO4 M  6  .   ? -60.120 20.822 -61.770 1.00 161.04 ? 409 SO4 A O3    1 
HETATM 5160 O  O4    . SO4 M  6  .   ? -62.170 22.029 -61.929 1.00 153.65 ? 409 SO4 A O4    1 
HETATM 5161 S  S     . SO4 N  6  .   ? -34.629 26.003 6.308   1.00 179.26 ? 410 SO4 A S     1 
HETATM 5162 O  O1    . SO4 N  6  .   ? -33.344 25.996 5.615   1.00 179.85 ? 410 SO4 A O1    1 
HETATM 5163 O  O2    . SO4 N  6  .   ? -35.700 26.199 5.337   1.00 180.13 ? 410 SO4 A O2    1 
HETATM 5164 O  O3    . SO4 N  6  .   ? -34.820 24.729 6.996   1.00 180.88 ? 410 SO4 A O3    1 
HETATM 5165 O  O4    . SO4 N  6  .   ? -34.657 27.091 7.280   1.00 178.91 ? 410 SO4 A O4    1 
HETATM 5166 S  S     . SO4 O  6  .   ? -47.543 50.773 -16.175 1.00 124.69 ? 411 SO4 A S     1 
HETATM 5167 O  O1    . SO4 O  6  .   ? -46.414 50.827 -17.099 1.00 132.06 ? 411 SO4 A O1    1 
HETATM 5168 O  O2    . SO4 O  6  .   ? -48.789 50.702 -16.933 1.00 128.35 ? 411 SO4 A O2    1 
HETATM 5169 O  O3    . SO4 O  6  .   ? -47.420 49.591 -15.327 1.00 125.13 ? 411 SO4 A O3    1 
HETATM 5170 O  O4    . SO4 O  6  .   ? -47.549 51.971 -15.341 1.00 126.05 ? 411 SO4 A O4    1 
HETATM 5171 C  C1    . GOL P  7  .   ? -31.630 18.067 -10.947 1.00 93.12  ? 412 GOL A C1    1 
HETATM 5172 O  O1    . GOL P  7  .   ? -32.404 19.211 -11.233 1.00 83.65  ? 412 GOL A O1    1 
HETATM 5173 C  C2    . GOL P  7  .   ? -30.651 18.379 -9.820  1.00 93.32  ? 412 GOL A C2    1 
HETATM 5174 O  O2    . GOL P  7  .   ? -30.986 17.629 -8.675  1.00 92.35  ? 412 GOL A O2    1 
HETATM 5175 C  C3    . GOL P  7  .   ? -29.230 18.041 -10.252 1.00 93.53  ? 412 GOL A C3    1 
HETATM 5176 O  O3    . GOL P  7  .   ? -28.390 18.016 -9.119  1.00 88.57  ? 412 GOL A O3    1 
HETATM 5177 C  C1    . GOL Q  7  .   ? -56.614 39.381 -9.366  1.00 93.77  ? 413 GOL A C1    1 
HETATM 5178 O  O1    . GOL Q  7  .   ? -56.417 39.792 -10.701 1.00 88.47  ? 413 GOL A O1    1 
HETATM 5179 C  C2    . GOL Q  7  .   ? -55.367 39.703 -8.550  1.00 87.78  ? 413 GOL A C2    1 
HETATM 5180 O  O2    . GOL Q  7  .   ? -55.477 41.008 -8.028  1.00 77.62  ? 413 GOL A O2    1 
HETATM 5181 C  C3    . GOL Q  7  .   ? -55.226 38.702 -7.410  1.00 87.20  ? 413 GOL A C3    1 
HETATM 5182 O  O3    . GOL Q  7  .   ? -53.902 38.728 -6.924  1.00 86.26  ? 413 GOL A O3    1 
HETATM 5183 C  C1    . GOL R  7  .   ? -91.834 28.150 -60.946 1.00 110.06 ? 414 GOL A C1    1 
HETATM 5184 O  O1    . GOL R  7  .   ? -92.294 26.919 -60.436 1.00 108.94 ? 414 GOL A O1    1 
HETATM 5185 C  C2    . GOL R  7  .   ? -92.690 28.564 -62.139 1.00 110.24 ? 414 GOL A C2    1 
HETATM 5186 O  O2    . GOL R  7  .   ? -94.056 28.422 -61.820 1.00 107.02 ? 414 GOL A O2    1 
HETATM 5187 C  C3    . GOL R  7  .   ? -92.393 30.015 -62.496 1.00 111.96 ? 414 GOL A C3    1 
HETATM 5188 O  O3    . GOL R  7  .   ? -93.597 30.716 -62.717 1.00 114.50 ? 414 GOL A O3    1 
HETATM 5189 C  C1    . GOL S  7  .   ? -43.850 27.859 -40.741 1.00 96.50  ? 415 GOL A C1    1 
HETATM 5190 O  O1    . GOL S  7  .   ? -44.437 26.878 -39.914 1.00 91.58  ? 415 GOL A O1    1 
HETATM 5191 C  C2    . GOL S  7  .   ? -44.594 29.180 -40.587 1.00 103.71 ? 415 GOL A C2    1 
HETATM 5192 O  O2    . GOL S  7  .   ? -44.416 29.669 -39.275 1.00 111.25 ? 415 GOL A O2    1 
HETATM 5193 C  C3    . GOL S  7  .   ? -44.026 30.187 -41.581 1.00 93.04  ? 415 GOL A C3    1 
HETATM 5194 O  O3    . GOL S  7  .   ? -44.905 31.283 -41.700 1.00 83.36  ? 415 GOL A O3    1 
HETATM 5195 C  C1    . GOL T  7  .   ? -45.702 44.105 14.430  1.00 81.68  ? 416 GOL A C1    1 
HETATM 5196 O  O1    . GOL T  7  .   ? -46.747 43.892 13.507  1.00 77.34  ? 416 GOL A O1    1 
HETATM 5197 C  C2    . GOL T  7  .   ? -45.106 45.493 14.225  1.00 88.51  ? 416 GOL A C2    1 
HETATM 5198 O  O2    . GOL T  7  .   ? -46.046 46.326 13.583  1.00 93.23  ? 416 GOL A O2    1 
HETATM 5199 C  C3    . GOL T  7  .   ? -44.735 46.090 15.578  1.00 92.13  ? 416 GOL A C3    1 
HETATM 5200 O  O3    . GOL T  7  .   ? -44.421 47.456 15.435  1.00 92.83  ? 416 GOL A O3    1 
HETATM 5201 F  FAH   . OUY U  8  .   ? -38.222 37.221 -19.629 1.00 69.26  ? 417 OUY A FAH   1 
HETATM 5202 C  CAY   . OUY U  8  .   ? -39.090 37.466 -20.612 1.00 59.04  ? 417 OUY A CAY   1 
HETATM 5203 C  CAL   . OUY U  8  .   ? -40.222 38.234 -20.360 1.00 49.97  ? 417 OUY A CAL   1 
HETATM 5204 C  CAV   . OUY U  8  .   ? -41.131 38.490 -21.379 1.00 57.66  ? 417 OUY A CAV   1 
HETATM 5205 F  FAG   . OUY U  8  .   ? -42.232 39.238 -21.128 1.00 62.95  ? 417 OUY A FAG   1 
HETATM 5206 C  CAI   . OUY U  8  .   ? -40.908 37.976 -22.651 1.00 49.97  ? 417 OUY A CAI   1 
HETATM 5207 C  CAJ   . OUY U  8  .   ? -39.777 37.209 -22.902 1.00 49.97  ? 417 OUY A CAJ   1 
HETATM 5208 C  CAZ   . OUY U  8  .   ? -38.868 36.948 -21.883 1.00 52.47  ? 417 OUY A CAZ   1 
HETATM 5209 C  CAP   . OUY U  8  .   ? -37.741 36.181 -22.162 1.00 49.97  ? 417 OUY A CAP   1 
HETATM 5210 N  NAR   . OUY U  8  .   ? -37.587 35.038 -21.244 1.00 57.54  ? 417 OUY A NAR   1 
HETATM 5211 C  CAU   . OUY U  8  .   ? -37.743 33.774 -21.672 1.00 63.20  ? 417 OUY A CAU   1 
HETATM 5212 O  OAD   . OUY U  8  .   ? -38.021 33.476 -22.834 1.00 55.68  ? 417 OUY A OAD   1 
HETATM 5213 C  CBA   . OUY U  8  .   ? -37.573 32.780 -20.711 1.00 65.41  ? 417 OUY A CBA   1 
HETATM 5214 C  CBB   . OUY U  8  .   ? -37.216 33.093 -19.403 1.00 62.15  ? 417 OUY A CBB   1 
HETATM 5215 O  OAE   . OUY U  8  .   ? -37.055 34.262 -19.062 1.00 50.87  ? 417 OUY A OAE   1 
HETATM 5216 N  NBE   . OUY U  8  .   ? -37.049 32.110 -18.496 1.00 68.07  ? 417 OUY A NBE   1 
HETATM 5217 O  OAF   . OUY U  8  .   ? -36.698 32.440 -17.197 1.00 54.57  ? 417 OUY A OAF   1 
HETATM 5218 C  CAX   . OUY U  8  .   ? -37.732 31.443 -21.041 1.00 68.63  ? 417 OUY A CAX   1 
HETATM 5219 N  NAB   . OUY U  8  .   ? -38.070 31.118 -22.285 1.00 64.24  ? 417 OUY A NAB   1 
HETATM 5220 C  CBC   . OUY U  8  .   ? -37.561 30.435 -20.105 1.00 70.59  ? 417 OUY A CBC   1 
HETATM 5221 C  CAM   . OUY U  8  .   ? -37.729 29.093 -20.435 1.00 70.44  ? 417 OUY A CAM   1 
HETATM 5222 C  CBD   . OUY U  8  .   ? -37.210 30.811 -18.811 1.00 71.30  ? 417 OUY A CBD   1 
HETATM 5223 N  NAQ   . OUY U  8  .   ? -37.029 29.879 -17.864 1.00 66.46  ? 417 OUY A NAQ   1 
HETATM 5224 C  CAK   . OUY U  8  .   ? -37.192 28.521 -18.167 1.00 73.26  ? 417 OUY A CAK   1 
HETATM 5225 C  CAW   . OUY U  8  .   ? -37.544 28.125 -19.452 1.00 80.02  ? 417 OUY A CAW   1 
HETATM 5226 C  CAO   . OUY U  8  .   ? -37.694 26.764 -19.717 1.00 79.17  ? 417 OUY A CAO   1 
HETATM 5227 C  CAN   . OUY U  8  .   ? -39.163 26.353 -19.569 1.00 77.00  ? 417 OUY A CAN   1 
HETATM 5228 C  CAT   . OUY U  8  .   ? -39.316 24.848 -19.826 1.00 80.58  ? 417 OUY A CAT   1 
HETATM 5229 O  OAC   . OUY U  8  .   ? -38.392 24.187 -20.299 1.00 82.76  ? 417 OUY A OAC   1 
HETATM 5230 O  OAS   . OUY U  8  .   ? -40.520 24.326 -19.462 1.00 75.68  ? 417 OUY A OAS   1 
HETATM 5231 C  CAA   . OUY U  8  .   ? -40.555 22.919 -19.721 1.00 73.62  ? 417 OUY A CAA   1 
HETATM 5232 O  O1    . HEZ V  9  .   ? -65.231 30.848 -35.828 1.00 87.99  ? 418 HEZ A O1    1 
HETATM 5233 C  C1    . HEZ V  9  .   ? -64.264 31.105 -34.848 1.00 85.33  ? 418 HEZ A C1    1 
HETATM 5234 C  C2    . HEZ V  9  .   ? -64.621 32.396 -34.115 1.00 87.47  ? 418 HEZ A C2    1 
HETATM 5235 C  C3    . HEZ V  9  .   ? -63.423 32.859 -33.289 1.00 92.68  ? 418 HEZ A C3    1 
HETATM 5236 C  C4    . HEZ V  9  .   ? -63.469 34.379 -33.157 1.00 97.48  ? 418 HEZ A C4    1 
HETATM 5237 C  C5    . HEZ V  9  .   ? -63.256 34.778 -31.697 1.00 98.67  ? 418 HEZ A C5    1 
HETATM 5238 C  C6    . HEZ V  9  .   ? -62.968 36.276 -31.611 1.00 104.10 ? 418 HEZ A C6    1 
HETATM 5239 O  O6    . HEZ V  9  .   ? -63.569 36.935 -32.693 1.00 111.19 ? 418 HEZ A O6    1 
HETATM 5240 O  O1    . HEZ W  9  .   ? -39.905 55.595 4.756   1.00 88.95  ? 419 HEZ A O1    1 
HETATM 5241 C  C1    . HEZ W  9  .   ? -38.516 55.672 4.922   1.00 87.63  ? 419 HEZ A C1    1 
HETATM 5242 C  C2    . HEZ W  9  .   ? -37.850 55.945 3.573   1.00 82.72  ? 419 HEZ A C2    1 
HETATM 5243 C  C3    . HEZ W  9  .   ? -38.164 57.374 3.132   1.00 87.53  ? 419 HEZ A C3    1 
HETATM 5244 C  C4    . HEZ W  9  .   ? -37.472 57.679 1.805   1.00 91.66  ? 419 HEZ A C4    1 
HETATM 5245 C  C5    . HEZ W  9  .   ? -38.080 58.950 1.216   1.00 98.36  ? 419 HEZ A C5    1 
HETATM 5246 C  C6    . HEZ W  9  .   ? -37.489 59.223 -0.166  1.00 99.49  ? 419 HEZ A C6    1 
HETATM 5247 O  O6    . HEZ W  9  .   ? -38.381 60.016 -0.900  1.00 100.10 ? 419 HEZ A O6    1 
HETATM 5248 MG MG    . MG  X  5  .   ? -14.927 36.985 21.305  1.00 138.15 ? 401 MG  B MG    1 
HETATM 5249 S  S     . SO4 Y  6  .   ? -35.116 41.236 26.066  1.00 113.84 ? 402 SO4 B S     1 
HETATM 5250 O  O1    . SO4 Y  6  .   ? -35.924 42.258 25.408  1.00 117.06 ? 402 SO4 B O1    1 
HETATM 5251 O  O2    . SO4 Y  6  .   ? -34.632 40.282 25.073  1.00 119.01 ? 402 SO4 B O2    1 
HETATM 5252 O  O3    . SO4 Y  6  .   ? -33.981 41.869 26.730  1.00 116.61 ? 402 SO4 B O3    1 
HETATM 5253 O  O4    . SO4 Y  6  .   ? -35.925 40.536 27.058  1.00 115.10 ? 402 SO4 B O4    1 
HETATM 5254 C  C1    . GOL Z  7  .   ? -30.656 47.326 30.835  1.00 103.93 ? 403 GOL B C1    1 
HETATM 5255 O  O1    . GOL Z  7  .   ? -31.598 46.297 30.625  1.00 96.37  ? 403 GOL B O1    1 
HETATM 5256 C  C2    . GOL Z  7  .   ? -29.658 47.353 29.682  1.00 110.91 ? 403 GOL B C2    1 
HETATM 5257 O  O2    . GOL Z  7  .   ? -30.348 47.398 28.451  1.00 116.05 ? 403 GOL B O2    1 
HETATM 5258 C  C3    . GOL Z  7  .   ? -28.769 48.584 29.805  1.00 102.91 ? 403 GOL B C3    1 
HETATM 5259 O  O3    . GOL Z  7  .   ? -27.991 48.719 28.636  1.00 100.42 ? 403 GOL B O3    1 
HETATM 5260 O  O1    . HEZ AA 9  .   ? -26.938 33.930 8.236   1.00 80.73  ? 404 HEZ B O1    1 
HETATM 5261 C  C1    . HEZ AA 9  .   ? -27.337 32.938 7.329   1.00 86.01  ? 404 HEZ B C1    1 
HETATM 5262 C  C2    . HEZ AA 9  .   ? -26.306 31.810 7.306   1.00 84.69  ? 404 HEZ B C2    1 
HETATM 5263 C  C3    . HEZ AA 9  .   ? -26.988 30.525 6.845   1.00 91.70  ? 404 HEZ B C3    1 
HETATM 5264 C  C4    . HEZ AA 9  .   ? -26.080 29.318 7.062   1.00 93.90  ? 404 HEZ B C4    1 
HETATM 5265 C  C5    . HEZ AA 9  .   ? -26.540 28.207 6.121   1.00 92.33  ? 404 HEZ B C5    1 
HETATM 5266 C  C6    . HEZ AA 9  .   ? -26.177 26.836 6.687   1.00 88.12  ? 404 HEZ B C6    1 
HETATM 5267 O  O6    . HEZ AA 9  .   ? -26.853 25.851 5.950   1.00 86.11  ? 404 HEZ B O6    1 
HETATM 5268 C  C1    . GOL BA 7  .   ? -43.067 52.421 -15.137 1.00 83.62  ? 101 GOL C C1    1 
HETATM 5269 O  O1    . GOL BA 7  .   ? -44.172 51.616 -14.795 1.00 95.36  ? 101 GOL C O1    1 
HETATM 5270 C  C2    . GOL BA 7  .   ? -43.376 53.870 -14.787 1.00 77.62  ? 101 GOL C C2    1 
HETATM 5271 O  O2    . GOL BA 7  .   ? -44.544 53.904 -13.997 1.00 79.00  ? 101 GOL C O2    1 
HETATM 5272 C  C3    . GOL BA 7  .   ? -42.210 54.448 -13.995 1.00 87.46  ? 101 GOL C C3    1 
HETATM 5273 O  O3    . GOL BA 7  .   ? -42.252 55.857 -14.053 1.00 91.58  ? 101 GOL C O3    1 
HETATM 5274 O  O     . HOH CA 10 .   ? -40.970 26.579 -40.446 1.00 73.79  ? 501 HOH A O     1 
HETATM 5275 O  O     . HOH CA 10 .   ? -36.675 26.032 -36.201 1.00 80.74  ? 502 HOH A O     1 
HETATM 5276 O  O     . HOH CA 10 .   ? -39.530 32.524 -16.496 1.00 70.10  ? 503 HOH A O     1 
HETATM 5277 O  O     . HOH CA 10 .   ? -46.658 44.766 -7.861  1.00 49.97  ? 504 HOH A O     1 
HETATM 5278 O  O     . HOH CA 10 .   ? -46.312 46.477 6.869   1.00 69.22  ? 505 HOH A O     1 
HETATM 5279 O  O     . HOH CA 10 .   ? -35.517 45.791 -19.515 1.00 77.74  ? 506 HOH A O     1 
HETATM 5280 O  O     . HOH CA 10 .   ? -43.980 30.282 -18.226 1.00 58.92  ? 507 HOH A O     1 
HETATM 5281 O  O     . HOH CA 10 .   ? -42.418 25.932 -19.471 1.00 86.42  ? 508 HOH A O     1 
HETATM 5282 O  O     . HOH CA 10 .   ? -54.655 14.778 -30.296 1.00 66.71  ? 509 HOH A O     1 
HETATM 5283 O  O     . HOH CA 10 .   ? -43.869 39.364 -0.810  1.00 62.50  ? 510 HOH A O     1 
HETATM 5284 O  O     . HOH CA 10 .   ? -55.535 43.846 -13.340 1.00 84.55  ? 511 HOH A O     1 
HETATM 5285 O  O     . HOH CA 10 .   ? -49.115 28.688 -21.363 1.00 68.58  ? 512 HOH A O     1 
HETATM 5286 O  O     . HOH CA 10 .   ? -33.616 24.648 -14.261 1.00 63.93  ? 513 HOH A O     1 
HETATM 5287 O  O     . HOH CA 10 .   ? -27.279 53.999 -0.936  1.00 58.32  ? 514 HOH A O     1 
HETATM 5288 O  O     . HOH CA 10 .   ? -48.540 48.257 -6.286  1.00 64.65  ? 515 HOH A O     1 
HETATM 5289 O  O     . HOH CA 10 .   ? -56.341 31.506 -61.955 1.00 63.90  ? 516 HOH A O     1 
HETATM 5290 O  O     . HOH CA 10 .   ? -34.375 34.710 10.872  1.00 50.93  ? 517 HOH A O     1 
HETATM 5291 O  O     . HOH CA 10 .   ? -32.913 47.317 -17.102 1.00 49.97  ? 518 HOH A O     1 
HETATM 5292 O  O     . HOH CA 10 .   ? -55.290 27.343 -53.333 1.00 69.12  ? 519 HOH A O     1 
HETATM 5293 O  O     . HOH CA 10 .   ? -39.508 31.919 -13.131 1.00 68.03  ? 520 HOH A O     1 
HETATM 5294 O  O     . HOH CA 10 .   ? -44.872 20.740 -34.708 1.00 54.92  ? 521 HOH A O     1 
HETATM 5295 O  O     . HOH CA 10 .   ? -47.051 26.805 -38.631 1.00 49.97  ? 522 HOH A O     1 
HETATM 5296 O  O     . HOH CA 10 .   ? -47.848 30.308 -38.740 1.00 63.46  ? 523 HOH A O     1 
HETATM 5297 O  O     . HOH CA 10 .   ? -36.196 28.687 -14.949 1.00 55.87  ? 524 HOH A O     1 
HETATM 5298 O  O     . HOH CA 10 .   ? -44.637 38.288 -11.828 1.00 61.42  ? 525 HOH A O     1 
HETATM 5299 O  O     . HOH CA 10 .   ? -25.598 21.400 -9.312  1.00 68.25  ? 526 HOH A O     1 
HETATM 5300 O  O     . HOH CA 10 .   ? -46.894 23.367 -24.404 1.00 68.70  ? 527 HOH A O     1 
HETATM 5301 O  O     . HOH CA 10 .   ? -57.284 19.610 -47.422 1.00 59.70  ? 528 HOH A O     1 
HETATM 5302 O  O     . HOH CA 10 .   ? -73.702 23.772 -52.286 1.00 67.50  ? 529 HOH A O     1 
HETATM 5303 O  O     . HOH CA 10 .   ? -38.351 34.962 10.021  1.00 78.75  ? 530 HOH A O     1 
HETATM 5304 O  O     . HOH CA 10 .   ? -42.571 32.590 -16.052 1.00 72.63  ? 531 HOH A O     1 
HETATM 5305 O  O     . HOH CA 10 .   ? -58.149 20.105 -59.703 1.00 69.88  ? 532 HOH A O     1 
HETATM 5306 O  O     . HOH CA 10 .   ? -39.357 14.690 -10.069 1.00 64.55  ? 533 HOH A O     1 
HETATM 5307 O  O     . HOH CA 10 .   ? -45.586 21.524 -27.384 1.00 76.55  ? 534 HOH A O     1 
HETATM 5308 O  O     . HOH CA 10 .   ? -52.336 18.695 -49.680 1.00 52.84  ? 535 HOH A O     1 
HETATM 5309 O  O     . HOH CA 10 .   ? -52.278 44.041 -23.070 1.00 58.36  ? 536 HOH A O     1 
HETATM 5310 O  O     . HOH CA 10 .   ? -52.761 53.596 -15.013 1.00 72.92  ? 537 HOH A O     1 
HETATM 5311 O  O     . HOH CA 10 .   ? -36.700 15.004 -8.273  1.00 74.71  ? 538 HOH A O     1 
HETATM 5312 O  O     . HOH CA 10 .   ? -38.802 28.634 -24.708 1.00 51.74  ? 539 HOH A O     1 
HETATM 5313 O  O     . HOH CA 10 .   ? -57.393 14.395 -27.375 1.00 62.92  ? 540 HOH A O     1 
HETATM 5314 O  O     . HOH CA 10 .   ? -43.438 20.493 -23.500 1.00 73.82  ? 541 HOH A O     1 
HETATM 5315 O  O     . HOH CA 10 .   ? -61.332 48.093 -23.569 1.00 83.36  ? 542 HOH A O     1 
HETATM 5316 O  O     . HOH CA 10 .   ? -49.296 23.274 -0.636  1.00 86.97  ? 543 HOH A O     1 
HETATM 5317 O  O     . HOH CA 10 .   ? -39.791 15.925 -37.250 1.00 65.48  ? 544 HOH A O     1 
HETATM 5318 O  O     . HOH CA 10 .   ? -63.364 39.409 -54.160 1.00 61.83  ? 545 HOH A O     1 
HETATM 5319 O  O     . HOH CA 10 .   ? -62.097 46.340 -36.076 1.00 70.12  ? 546 HOH A O     1 
HETATM 5320 O  O     . HOH CA 10 .   ? -41.986 28.495 -18.120 1.00 49.97  ? 547 HOH A O     1 
HETATM 5321 O  O     . HOH CA 10 .   ? -46.245 55.920 -4.739  1.00 79.27  ? 548 HOH A O     1 
HETATM 5322 O  O     . HOH CA 10 .   ? -24.310 38.198 -3.388  1.00 77.36  ? 549 HOH A O     1 
HETATM 5323 O  O     . HOH CA 10 .   ? -62.599 20.336 -37.011 1.00 76.10  ? 550 HOH A O     1 
HETATM 5324 O  O     . HOH CA 10 .   ? -50.298 22.931 -16.299 1.00 66.24  ? 551 HOH A O     1 
HETATM 5325 O  O     . HOH CA 10 .   ? -30.115 20.968 -14.074 1.00 65.62  ? 552 HOH A O     1 
HETATM 5326 O  O     . HOH CA 10 .   ? -56.384 46.812 -12.478 1.00 86.17  ? 553 HOH A O     1 
HETATM 5327 O  O     . HOH CA 10 .   ? -43.318 20.611 -28.408 1.00 71.82  ? 554 HOH A O     1 
HETATM 5328 O  O     . HOH CA 10 .   ? -47.034 22.522 -12.824 1.00 56.17  ? 555 HOH A O     1 
HETATM 5329 O  O     . HOH CA 10 .   ? -48.294 56.413 -15.491 1.00 71.04  ? 556 HOH A O     1 
HETATM 5330 O  O     . HOH CA 10 .   ? -16.786 46.645 -24.248 1.00 83.68  ? 557 HOH A O     1 
HETATM 5331 O  O     . HOH CA 10 .   ? -58.899 46.928 -13.311 1.00 91.70  ? 558 HOH A O     1 
HETATM 5332 O  O     . HOH CA 10 .   ? -24.989 51.290 -2.279  1.00 49.97  ? 559 HOH A O     1 
HETATM 5333 O  O     . HOH CA 10 .   ? -45.343 21.426 -11.722 1.00 60.97  ? 560 HOH A O     1 
HETATM 5334 O  O     . HOH DA 10 .   ? -28.829 44.565 -0.396  1.00 59.60  ? 501 HOH B O     1 
HETATM 5335 O  O     . HOH DA 10 .   ? -41.994 34.623 7.873   1.00 59.89  ? 502 HOH B O     1 
HETATM 5336 O  O     . HOH DA 10 .   ? -32.523 36.992 17.556  1.00 66.36  ? 503 HOH B O     1 
HETATM 5337 O  O     . HOH DA 10 .   ? -15.490 54.279 19.629  1.00 81.54  ? 504 HOH B O     1 
HETATM 5338 O  O     . HOH DA 10 .   ? -19.595 45.131 1.776   1.00 64.58  ? 505 HOH B O     1 
HETATM 5339 O  O     . HOH DA 10 .   ? -35.327 31.018 21.921  1.00 72.85  ? 506 HOH B O     1 
HETATM 5340 O  O     . HOH DA 10 .   ? -11.269 32.025 5.376   1.00 66.31  ? 507 HOH B O     1 
HETATM 5341 O  O     . HOH DA 10 .   ? -4.593  40.117 9.438   1.00 70.27  ? 508 HOH B O     1 
HETATM 5342 O  O     . HOH DA 10 .   ? -5.414  34.190 6.276   1.00 79.71  ? 509 HOH B O     1 
HETATM 5343 O  O     . HOH DA 10 .   ? -44.850 36.867 15.063  1.00 87.28  ? 510 HOH B O     1 
HETATM 5344 O  O     . HOH DA 10 .   ? -13.951 30.325 6.725   1.00 54.99  ? 511 HOH B O     1 
HETATM 5345 O  O     . HOH DA 10 .   ? -34.231 54.667 22.395  1.00 77.35  ? 512 HOH B O     1 
HETATM 5346 O  O     . HOH DA 10 .   ? -21.078 40.570 21.164  1.00 75.98  ? 513 HOH B O     1 
HETATM 5347 O  O     . HOH DA 10 .   ? -20.648 43.374 -0.535  1.00 70.94  ? 514 HOH B O     1 
HETATM 5348 O  O     . HOH DA 10 .   ? -38.873 29.401 20.134  1.00 69.29  ? 515 HOH B O     1 
HETATM 5349 O  O     . HOH DA 10 .   ? -10.009 43.862 3.336   1.00 74.23  ? 516 HOH B O     1 
HETATM 5350 O  O     . HOH EA 10 .   ? -45.693 70.447 -23.535 1.00 71.95  ? 201 HOH C O     1 
HETATM 5351 O  O     . HOH EA 10 .   ? -30.719 56.580 -20.682 1.00 64.01  ? 202 HOH C O     1 
HETATM 5352 O  O     . HOH EA 10 .   ? -46.562 39.638 -10.555 1.00 59.92  ? 203 HOH C O     1 
HETATM 5353 O  O     . HOH EA 10 .   ? -48.183 42.511 -9.047  1.00 58.95  ? 204 HOH C O     1 
HETATM 5354 O  O     . HOH EA 10 .   ? -48.405 35.313 -12.555 1.00 69.24  ? 205 HOH C O     1 
HETATM 5355 O  O     . HOH EA 10 .   ? -46.194 79.967 -5.339  1.00 78.14  ? 206 HOH C O     1 
HETATM 5356 O  O     . HOH EA 10 .   ? -45.686 86.543 -2.348  1.00 85.30  ? 207 HOH C O     1 
HETATM 5357 O  O     . HOH EA 10 .   ? -44.537 41.838 -23.837 1.00 55.77  ? 208 HOH C O     1 
HETATM 5358 O  O     . HOH EA 10 .   ? -34.492 50.847 -19.045 1.00 65.55  ? 209 HOH C O     1 
HETATM 5359 O  O     . HOH EA 10 .   ? -46.537 82.365 -2.666  1.00 70.24  ? 210 HOH C O     1 
HETATM 5360 O  O     . HOH EA 10 .   ? -40.721 70.837 -20.896 1.00 67.95  ? 211 HOH C O     1 
HETATM 5361 O  O     . HOH EA 10 .   ? -48.623 37.391 -10.485 1.00 55.50  ? 212 HOH C O     1 
HETATM 5362 O  O     . HOH FA 10 .   ? -35.687 75.357 -16.194 1.00 88.94  ? 101 HOH D O     1 
HETATM 5363 O  O     . HOH FA 10 .   ? -34.755 80.676 -12.941 1.00 93.68  ? 102 HOH D O     1 
HETATM 5364 O  O     . HOH FA 10 .   ? -34.227 34.421 -17.199 1.00 49.97  ? 103 HOH D O     1 
HETATM 5365 O  O     . HOH FA 10 .   ? -35.140 39.116 -23.538 1.00 83.62  ? 104 HOH D O     1 
HETATM 5366 O  O     . HOH FA 10 .   ? -30.578 34.029 -18.830 1.00 77.39  ? 105 HOH D O     1 
HETATM 5367 O  O     . HOH FA 10 .   ? -43.842 87.281 -22.707 1.00 56.28  ? 106 HOH D O     1 
HETATM 5368 O  O     . HOH FA 10 .   ? -38.417 51.852 -33.159 1.00 67.78  ? 107 HOH D O     1 
HETATM 5369 O  O     . HOH FA 10 .   ? -36.716 51.536 -22.738 1.00 60.67  ? 108 HOH D O     1 
HETATM 5370 O  O     . HOH FA 10 .   ? -34.536 30.492 -16.438 1.00 83.81  ? 109 HOH D O     1 
HETATM 5371 O  O     . HOH FA 10 .   ? -36.243 49.478 -21.534 1.00 72.24  ? 110 HOH D O     1 
HETATM 5372 O  O     . HOH FA 10 .   ? -40.666 59.807 -12.948 1.00 57.22  ? 111 HOH D O     1 
HETATM 5373 O  O     . HOH FA 10 .   ? -35.537 48.129 -19.205 1.00 71.92  ? 112 HOH D O     1 
HETATM 5374 O  O     . HOH FA 10 .   ? -38.282 82.533 -11.709 1.00 69.79  ? 113 HOH D O     1 
HETATM 5375 O  O     . HOH FA 10 .   ? -34.507 69.323 -6.028  1.00 71.35  ? 114 HOH D O     1 
HETATM 5376 O  O     . HOH FA 10 .   ? -38.724 64.384 -5.595  1.00 64.01  ? 115 HOH D O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N     . ASP A 12  ? 1.4909 1.8082 1.8884 -0.2952 -0.0264 -0.2674 9   ASP A N     
2    C CA    . ASP A 12  ? 1.5929 1.9469 2.0022 -0.2885 -0.0487 -0.2877 9   ASP A CA    
3    C C     . ASP A 12  ? 1.5263 1.9451 1.9805 -0.2919 -0.0555 -0.3163 9   ASP A C     
4    O O     . ASP A 12  ? 1.5782 2.0365 2.0426 -0.2750 -0.0807 -0.3284 9   ASP A O     
5    C CB    . ASP A 12  ? 1.6967 2.0317 2.0994 -0.3078 -0.0414 -0.2979 9   ASP A CB    
6    C CG    . ASP A 12  ? 1.7505 2.0337 2.1111 -0.2973 -0.0449 -0.2748 9   ASP A CG    
7    O OD1   . ASP A 12  ? 1.7345 2.0049 2.0718 -0.2728 -0.0584 -0.2547 9   ASP A OD1   
8    O OD2   . ASP A 12  ? 1.7909 2.0465 2.1433 -0.3139 -0.0333 -0.2783 9   ASP A OD2   
9    N N     . ALA A 13  ? 1.4405 1.8701 1.9212 -0.3135 -0.0329 -0.3273 10  ALA A N     
10   C CA    . ALA A 13  ? 1.3645 1.8576 1.8922 -0.3182 -0.0369 -0.3566 10  ALA A CA    
11   C C     . ALA A 13  ? 1.3768 1.8972 1.9120 -0.2897 -0.0554 -0.3498 10  ALA A C     
12   O O     . ALA A 13  ? 1.2875 1.8621 1.8517 -0.2771 -0.0760 -0.3699 10  ALA A O     
13   C CB    . ALA A 13  ? 1.3042 1.7971 1.8554 -0.3493 -0.0049 -0.3687 10  ALA A CB    
14   N N     . GLU A 14  ? 1.3753 1.8592 1.8854 -0.2787 -0.0482 -0.3221 11  GLU A N     
15   C CA    . GLU A 14  ? 1.3817 1.8846 1.8962 -0.2514 -0.0635 -0.3140 11  GLU A CA    
16   C C     . GLU A 14  ? 1.2739 1.7845 1.7727 -0.2223 -0.0946 -0.3088 11  GLU A C     
17   O O     . GLU A 14  ? 1.2885 1.8441 1.8111 -0.2036 -0.1145 -0.3212 11  GLU A O     
18   C CB    . GLU A 14  ? 1.3829 1.8406 1.8689 -0.2474 -0.0485 -0.2854 11  GLU A CB    
19   C CG    . GLU A 14  ? 1.4490 1.9259 1.9456 -0.2262 -0.0554 -0.2801 11  GLU A CG    
20   C CD    . GLU A 14  ? 1.5285 1.9606 1.9940 -0.2235 -0.0409 -0.2530 11  GLU A CD    
21   O OE1   . GLU A 14  ? 1.5502 1.9370 1.9767 -0.2175 -0.0428 -0.2314 11  GLU A OE1   
22   O OE2   . GLU A 14  ? 1.5359 1.9797 2.0167 -0.2280 -0.0274 -0.2546 11  GLU A OE2   
23   N N     . LEU A 15  ? 1.2074 1.6735 1.6653 -0.2180 -0.0986 -0.2907 12  LEU A N     
24   C CA    . LEU A 15  ? 1.1348 1.6006 1.5704 -0.1923 -0.1255 -0.2838 12  LEU A CA    
25   C C     . LEU A 15  ? 1.1353 1.6489 1.5926 -0.1929 -0.1447 -0.3106 12  LEU A C     
26   O O     . LEU A 15  ? 1.1317 1.6573 1.5760 -0.1689 -0.1701 -0.3082 12  LEU A O     
27   C CB    . LEU A 15  ? 1.0638 1.4707 1.4525 -0.1919 -0.1217 -0.2611 12  LEU A CB    
28   C CG    . LEU A 15  ? 0.9760 1.3385 1.3321 -0.1758 -0.1176 -0.2314 12  LEU A CG    
29   C CD1   . LEU A 15  ? 0.9388 1.2985 1.3089 -0.1831 -0.0979 -0.2254 12  LEU A CD1   
30   C CD2   . LEU A 15  ? 0.9380 1.2473 1.2560 -0.1819 -0.1102 -0.2151 12  LEU A CD2   
31   N N     . ASP A 16  ? 1.1419 1.6827 1.6307 -0.2198 -0.1326 -0.3363 13  ASP A N     
32   C CA    . ASP A 16  ? 1.1940 1.7860 1.7068 -0.2222 -0.1505 -0.3654 13  ASP A CA    
33   C C     . ASP A 16  ? 1.2482 1.9000 1.7950 -0.2004 -0.1722 -0.3799 13  ASP A C     
34   O O     . ASP A 16  ? 1.2286 1.9075 1.7709 -0.1788 -0.2007 -0.3850 13  ASP A O     
35   C CB    . ASP A 16  ? 1.2337 1.8396 1.7749 -0.2587 -0.1287 -0.3913 13  ASP A CB    
36   C CG    . ASP A 16  ? 1.2705 1.9040 1.8170 -0.2669 -0.1424 -0.4154 13  ASP A CG    
37   O OD1   . ASP A 16  ? 1.2894 1.9613 1.8383 -0.2446 -0.1723 -0.4236 13  ASP A OD1   
38   O OD2   . ASP A 16  ? 1.2757 1.8915 1.8228 -0.2954 -0.1230 -0.4260 13  ASP A OD2   
39   N N     . GLN A 17  ? 1.3576 2.0302 1.9379 -0.2051 -0.1589 -0.3864 14  GLN A N     
40   C CA    . GLN A 17  ? 1.4179 2.1472 2.0349 -0.1837 -0.1776 -0.4006 14  GLN A CA    
41   C C     . GLN A 17  ? 1.3245 2.0375 1.9136 -0.1455 -0.1997 -0.3754 14  GLN A C     
42   O O     . GLN A 17  ? 1.3494 2.1070 1.9609 -0.1211 -0.2231 -0.3852 14  GLN A O     
43   C CB    . GLN A 17  ? 1.4752 2.2233 2.1310 -0.1983 -0.1548 -0.4113 14  GLN A CB    
44   C CG    . GLN A 17  ? 1.5211 2.2777 2.2020 -0.2381 -0.1276 -0.4342 14  GLN A CG    
45   C CD    . GLN A 17  ? 1.5693 2.3598 2.2956 -0.2510 -0.1091 -0.4521 14  GLN A CD    
46   O OE1   . GLN A 17  ? 1.5916 2.4259 2.3488 -0.2308 -0.1237 -0.4619 14  GLN A OE1   
47   N NE2   . GLN A 17  ? 1.5794 2.3482 2.3094 -0.2847 -0.0761 -0.4565 14  GLN A NE2   
48   N N     . LEU A 18  ? 1.1909 1.8410 1.7326 -0.1396 -0.1922 -0.3438 15  LEU A N     
49   C CA    . LEU A 18  ? 1.1333 1.7624 1.6465 -0.1055 -0.2094 -0.3197 15  LEU A CA    
50   C C     . LEU A 18  ? 1.1834 1.8210 1.6736 -0.0852 -0.2388 -0.3195 15  LEU A C     
51   O O     . LEU A 18  ? 1.2242 1.8740 1.7100 -0.0539 -0.2606 -0.3123 15  LEU A O     
52   C CB    . LEU A 18  ? 1.0582 1.6199 1.5292 -0.1078 -0.1912 -0.2891 15  LEU A CB    
53   C CG    . LEU A 18  ? 1.0223 1.5578 1.4708 -0.0787 -0.1976 -0.2647 15  LEU A CG    
54   C CD1   . LEU A 18  ? 1.0097 1.5709 1.4945 -0.0739 -0.1891 -0.2702 15  LEU A CD1   
55   C CD2   . LEU A 18  ? 1.0163 1.4869 1.4190 -0.0834 -0.1828 -0.2382 15  LEU A CD2   
56   N N     . LEU A 19  ? 1.1784 1.8086 1.6527 -0.1026 -0.2393 -0.3273 16  LEU A N     
57   C CA    . LEU A 19  ? 1.1972 1.8312 1.6430 -0.0857 -0.2657 -0.3262 16  LEU A CA    
58   C C     . LEU A 19  ? 1.2433 1.9474 1.7238 -0.0705 -0.2928 -0.3511 16  LEU A C     
59   O O     . LEU A 19  ? 1.2506 1.9624 1.7095 -0.0420 -0.3200 -0.3439 16  LEU A O     
60   C CB    . LEU A 19  ? 1.1878 1.7982 1.6112 -0.1109 -0.2569 -0.3313 16  LEU A CB    
61   C CG    . LEU A 19  ? 1.1963 1.7348 1.5752 -0.1187 -0.2380 -0.3045 16  LEU A CG    
62   C CD1   . LEU A 19  ? 1.1951 1.7184 1.5588 -0.1425 -0.2314 -0.3144 16  LEU A CD1   
63   C CD2   . LEU A 19  ? 1.2030 1.7067 1.5389 -0.0882 -0.2520 -0.2771 16  LEU A CD2   
64   N N     . GLN A 20  ? 1.2480 2.0039 1.7816 -0.0887 -0.2858 -0.3808 17  GLN A N     
65   C CA    . GLN A 20  ? 1.2867 2.1156 1.8587 -0.0756 -0.3117 -0.4084 17  GLN A CA    
66   C C     . GLN A 20  ? 1.2149 2.0683 1.8082 -0.0428 -0.3265 -0.4025 17  GLN A C     
67   O O     . GLN A 20  ? 1.2625 2.1670 1.8738 -0.0196 -0.3557 -0.4162 17  GLN A O     
68   C CB    . GLN A 20  ? 1.3233 2.2012 1.9479 -0.1087 -0.2974 -0.4456 17  GLN A CB    
69   C CG    . GLN A 20  ? 1.3456 2.2092 1.9964 -0.1326 -0.2632 -0.4468 17  GLN A CG    
70   C CD    . GLN A 20  ? 1.3863 2.2752 2.0720 -0.1724 -0.2418 -0.4783 17  GLN A CD    
71   O OE1   . GLN A 20  ? 1.4288 2.3636 2.1659 -0.1844 -0.2322 -0.5035 17  GLN A OE1   
72   N NE2   . GLN A 20  ? 1.3407 2.1984 1.9993 -0.1938 -0.2322 -0.4778 17  GLN A NE2   
73   N N     . GLY A 21  ? 1.1163 1.9353 1.7078 -0.0397 -0.3076 -0.3831 18  GLY A N     
74   C CA    . GLY A 21  ? 1.0073 1.8427 1.6172 -0.0088 -0.3186 -0.3761 18  GLY A CA    
75   C C     . GLY A 21  ? 0.9822 1.8399 1.6410 -0.0216 -0.2967 -0.3891 18  GLY A C     
76   O O     . GLY A 21  ? 0.9673 1.8410 1.6468 0.0029  -0.3039 -0.3859 18  GLY A O     
77   N N     . HIS A 22  ? 0.9510 1.8094 1.6289 -0.0590 -0.2693 -0.4037 19  HIS A N     
78   C CA    . HIS A 22  ? 1.0038 1.8795 1.7234 -0.0734 -0.2460 -0.4152 19  HIS A CA    
79   C C     . HIS A 22  ? 1.0326 1.8506 1.7225 -0.0681 -0.2275 -0.3843 19  HIS A C     
80   O O     . HIS A 22  ? 1.0449 1.8048 1.6829 -0.0641 -0.2252 -0.3563 19  HIS A O     
81   C CB    . HIS A 22  ? 1.0036 1.8914 1.7467 -0.1160 -0.2203 -0.4386 19  HIS A CB    
82   C CG    . HIS A 22  ? 1.0957 2.0544 1.8860 -0.1246 -0.2332 -0.4776 19  HIS A CG    
83   N ND1   . HIS A 22  ? 1.1407 2.1596 1.9645 -0.0964 -0.2631 -0.4944 19  HIS A ND1   
84   C CD2   . HIS A 22  ? 1.1305 2.1103 1.9412 -0.1583 -0.2199 -0.5042 19  HIS A CD2   
85   C CE1   . HIS A 22  ? 1.1316 2.2095 1.9956 -0.1125 -0.2688 -0.5310 19  HIS A CE1   
86   N NE2   . HIS A 22  ? 1.1429 2.1978 1.9999 -0.1511 -0.2419 -0.5382 19  HIS A NE2   
87   N N     . TYR A 23  ? 1.0068 1.8438 1.7321 -0.0689 -0.2136 -0.3915 20  TYR A N     
88   C CA    . TYR A 23  ? 0.9518 1.7432 1.6556 -0.0640 -0.1960 -0.3666 20  TYR A CA    
89   C C     . TYR A 23  ? 0.9512 1.7115 1.6460 -0.1004 -0.1617 -0.3636 20  TYR A C     
90   O O     . TYR A 23  ? 0.9507 1.7406 1.6784 -0.1280 -0.1464 -0.3876 20  TYR A O     
91   C CB    . TYR A 23  ? 0.9266 1.7537 1.6720 -0.0442 -0.1989 -0.3757 20  TYR A CB    
92   C CG    . TYR A 23  ? 0.9839 1.7742 1.7179 -0.0472 -0.1748 -0.3582 20  TYR A CG    
93   C CD1   . TYR A 23  ? 1.0512 1.7919 1.7431 -0.0252 -0.1785 -0.3281 20  TYR A CD1   
94   C CD2   . TYR A 23  ? 0.8783 1.6840 1.6429 -0.0732 -0.1475 -0.3730 20  TYR A CD2   
95   C CE1   . TYR A 23  ? 1.0364 1.7469 1.7189 -0.0289 -0.1566 -0.3144 20  TYR A CE1   
96   C CE2   . TYR A 23  ? 0.9028 1.6772 1.6551 -0.0766 -0.1261 -0.3580 20  TYR A CE2   
97   C CZ    . TYR A 23  ? 0.9878 1.7162 1.7001 -0.0543 -0.1312 -0.3294 20  TYR A CZ    
98   O OH    . TYR A 23  ? 0.9389 1.6395 1.6401 -0.0584 -0.1100 -0.3167 20  TYR A OH    
99   N N     . ILE A 24  ? 0.9452 1.6456 1.5948 -0.1000 -0.1494 -0.3341 21  ILE A N     
100  C CA    . ILE A 24  ? 0.9552 1.6204 1.5896 -0.1293 -0.1185 -0.3257 21  ILE A CA    
101  C C     . ILE A 24  ? 0.8902 1.5249 1.5075 -0.1173 -0.1080 -0.3047 21  ILE A C     
102  O O     . ILE A 24  ? 0.8752 1.4818 1.4629 -0.0924 -0.1211 -0.2841 21  ILE A O     
103  C CB    . ILE A 24  ? 0.9517 1.5707 1.5430 -0.1449 -0.1135 -0.3114 21  ILE A CB    
104  C CG1   . ILE A 24  ? 0.9857 1.6352 1.5970 -0.1628 -0.1183 -0.3357 21  ILE A CG1   
105  C CG2   . ILE A 24  ? 0.8891 1.4648 1.4579 -0.1681 -0.0840 -0.2964 21  ILE A CG2   
106  C CD1   . ILE A 24  ? 1.0347 1.6999 1.6376 -0.1416 -0.1492 -0.3389 21  ILE A CD1   
107  N N     . LYS A 25  ? 0.8620 1.5025 1.4976 -0.1360 -0.0834 -0.3109 22  LYS A N     
108  C CA    . LYS A 25  ? 0.8558 1.4740 1.4797 -0.1270 -0.0720 -0.2951 22  LYS A CA    
109  C C     . LYS A 25  ? 0.8866 1.4433 1.4545 -0.1235 -0.0688 -0.2644 22  LYS A C     
110  O O     . LYS A 25  ? 0.8591 1.3854 1.4002 -0.1433 -0.0584 -0.2558 22  LYS A O     
111  C CB    . LYS A 25  ? 0.8644 1.4960 1.5110 -0.1529 -0.0437 -0.3070 22  LYS A CB    
112  C CG    . LYS A 25  ? 0.8996 1.5077 1.5310 -0.1473 -0.0297 -0.2916 22  LYS A CG    
113  C CD    . LYS A 25  ? 0.9774 1.5958 1.6247 -0.1750 -0.0006 -0.3023 22  LYS A CD    
114  C CE    . LYS A 25  ? 1.0017 1.5991 1.6326 -0.1690 0.0122  -0.2881 22  LYS A CE    
115  N NZ    . LYS A 25  ? 0.9985 1.6052 1.6405 -0.1962 0.0409  -0.2979 22  LYS A NZ    
116  N N     . GLY A 26  ? 0.8735 1.4120 1.4254 -0.0980 -0.0770 -0.2488 23  GLY A N     
117  C CA    . GLY A 26  ? 0.8772 1.3620 1.3798 -0.0910 -0.0762 -0.2222 23  GLY A CA    
118  C C     . GLY A 26  ? 0.8895 1.3588 1.3689 -0.0672 -0.1003 -0.2120 23  GLY A C     
119  O O     . GLY A 26  ? 0.9133 1.3459 1.3606 -0.0518 -0.1024 -0.1926 23  GLY A O     
120  N N     . TYR A 27  ? 0.8524 1.3495 1.3465 -0.0646 -0.1178 -0.2257 24  TYR A N     
121  C CA    . TYR A 27  ? 0.7962 1.2818 1.2669 -0.0427 -0.1416 -0.2175 24  TYR A CA    
122  C C     . TYR A 27  ? 0.8408 1.3587 1.3364 -0.0130 -0.1606 -0.2244 24  TYR A C     
123  O O     . TYR A 27  ? 0.8525 1.4217 1.3896 -0.0125 -0.1699 -0.2469 24  TYR A O     
124  C CB    . TYR A 27  ? 0.7540 1.2518 1.2236 -0.0567 -0.1506 -0.2288 24  TYR A CB    
125  C CG    . TYR A 27  ? 0.7856 1.2492 1.2316 -0.0847 -0.1320 -0.2218 24  TYR A CG    
126  C CD1   . TYR A 27  ? 0.7938 1.2690 1.2613 -0.1126 -0.1106 -0.2331 24  TYR A CD1   
127  C CD2   . TYR A 27  ? 0.8266 1.2450 1.2284 -0.0830 -0.1350 -0.2039 24  TYR A CD2   
128  C CE1   . TYR A 27  ? 0.8088 1.2496 1.2533 -0.1361 -0.0937 -0.2249 24  TYR A CE1   
129  C CE2   . TYR A 27  ? 0.8278 1.2147 1.2100 -0.1064 -0.1185 -0.1974 24  TYR A CE2   
130  C CZ    . TYR A 27  ? 0.8696 1.2670 1.2728 -0.1320 -0.0984 -0.2071 24  TYR A CZ    
131  O OH    . TYR A 27  ? 0.9288 1.2918 1.3112 -0.1534 -0.0820 -0.1990 24  TYR A OH    
132  N N     . PRO A 28  ? 0.8573 1.3476 1.3310 0.0124  -0.1663 -0.2069 25  PRO A N     
133  C CA    . PRO A 28  ? 0.8655 1.3826 1.3626 0.0430  -0.1836 -0.2118 25  PRO A CA    
134  C C     . PRO A 28  ? 0.8955 1.4427 1.3983 0.0571  -0.2118 -0.2214 25  PRO A C     
135  O O     . PRO A 28  ? 0.7427 1.2694 1.2114 0.0540  -0.2213 -0.2141 25  PRO A O     
136  C CB    . PRO A 28  ? 0.8200 1.2876 1.2800 0.0639  -0.1817 -0.1875 25  PRO A CB    
137  C CG    . PRO A 28  ? 0.7763 1.1957 1.1896 0.0477  -0.1721 -0.1712 25  PRO A CG    
138  C CD    . PRO A 28  ? 0.8292 1.2620 1.2568 0.0143  -0.1561 -0.1825 25  PRO A CD    
139  N N     . LYS A 29  ? 0.9943 1.5923 1.5415 0.0729  -0.2253 -0.2392 26  LYS A N     
140  C CA    . LYS A 29  ? 1.0800 1.7201 1.6421 0.0844  -0.2527 -0.2540 26  LYS A CA    
141  C C     . LYS A 29  ? 1.1105 1.7271 1.6345 0.1177  -0.2775 -0.2355 26  LYS A C     
142  O O     . LYS A 29  ? 1.1141 1.7444 1.6246 0.1215  -0.2982 -0.2399 26  LYS A O     
143  C CB    . LYS A 29  ? 1.1060 1.8116 1.7319 0.0911  -0.2588 -0.2808 26  LYS A CB    
144  C CG    . LYS A 29  ? 1.2023 1.9590 1.8497 0.1106  -0.2908 -0.2973 26  LYS A CG    
145  C CD    . LYS A 29  ? 1.1819 1.9623 1.8315 0.0838  -0.2942 -0.3150 26  LYS A CD    
146  C CE    . LYS A 29  ? 1.1337 1.9758 1.8127 0.1017  -0.3257 -0.3367 26  LYS A CE    
147  N NZ    . LYS A 29  ? 1.1353 2.0094 1.8267 0.0726  -0.3263 -0.3603 26  LYS A NZ    
148  N N     . GLN A 30  ? 1.1323 1.7125 1.6368 0.1409  -0.2747 -0.2153 27  GLN A N     
149  C CA    . GLN A 30  ? 1.2171 1.7741 1.6867 0.1751  -0.2970 -0.1974 27  GLN A CA    
150  C C     . GLN A 30  ? 1.1356 1.6420 1.5434 0.1692  -0.2988 -0.1783 27  GLN A C     
151  O O     . GLN A 30  ? 1.1130 1.5894 1.4835 0.1956  -0.3129 -0.1602 27  GLN A O     
152  C CB    . GLN A 30  ? 1.2659 1.7953 1.7345 0.1999  -0.2895 -0.1824 27  GLN A CB    
153  C CG    . GLN A 30  ? 1.2519 1.7367 1.7048 0.1809  -0.2581 -0.1708 27  GLN A CG    
154  C CD    . GLN A 30  ? 1.3237 1.7708 1.7630 0.2063  -0.2515 -0.1533 27  GLN A CD    
155  O OE1   . GLN A 30  ? 1.3898 1.8212 1.8083 0.2372  -0.2693 -0.1407 27  GLN A OE1   
156  N NE2   . GLN A 30  ? 1.3174 1.7486 1.7668 0.1932  -0.2251 -0.1525 27  GLN A NE2   
157  N N     . TYR A 31  ? 1.1083 1.6020 1.5026 0.1370  -0.2849 -0.1813 28  TYR A N     
158  C CA    . TYR A 31  ? 1.1250 1.5751 1.4654 0.1305  -0.2867 -0.1664 28  TYR A CA    
159  C C     . TYR A 31  ? 1.1401 1.6239 1.4852 0.1160  -0.3012 -0.1838 28  TYR A C     
160  O O     . TYR A 31  ? 1.1203 1.6515 1.5090 0.0985  -0.2992 -0.2071 28  TYR A O     
161  C CB    . TYR A 31  ? 1.1233 1.5265 1.4414 0.1060  -0.2584 -0.1548 28  TYR A CB    
162  C CG    . TYR A 31  ? 1.1123 1.4768 1.4176 0.1187  -0.2434 -0.1372 28  TYR A CG    
163  C CD1   . TYR A 31  ? 1.1511 1.4633 1.4078 0.1339  -0.2439 -0.1156 28  TYR A CD1   
164  C CD2   . TYR A 31  ? 1.0822 1.4624 1.4240 0.1141  -0.2272 -0.1439 28  TYR A CD2   
165  C CE1   . TYR A 31  ? 1.2157 1.4930 1.4623 0.1439  -0.2284 -0.1019 28  TYR A CE1   
166  C CE2   . TYR A 31  ? 1.1088 1.4555 1.4402 0.1244  -0.2125 -0.1301 28  TYR A CE2   
167  C CZ    . TYR A 31  ? 1.1821 1.4777 1.4668 0.1392  -0.2131 -0.1096 28  TYR A CZ    
168  O OH    . TYR A 31  ? 1.1668 1.4293 1.4425 0.1480  -0.1969 -0.0980 28  TYR A OH    
169  N N     . THR A 32  ? 1.2031 1.6617 1.5025 0.1221  -0.3144 -0.1735 29  THR A N     
170  C CA    . THR A 32  ? 1.3090 1.7955 1.6073 0.1078  -0.3277 -0.1897 29  THR A CA    
171  C C     . THR A 32  ? 1.2197 1.6726 1.4978 0.0747  -0.3062 -0.1880 29  THR A C     
172  O O     . THR A 32  ? 1.1415 1.5400 1.3741 0.0747  -0.2978 -0.1680 29  THR A O     
173  C CB    . THR A 32  ? 1.2985 1.7805 1.5582 0.1329  -0.3553 -0.1815 29  THR A CB    
174  O OG1   . THR A 32  ? 1.3460 1.7616 1.5494 0.1411  -0.3475 -0.1546 29  THR A OG1   
175  C CG2   . THR A 32  ? 1.2065 1.7272 1.4898 0.1671  -0.3791 -0.1849 29  THR A CG2   
176  N N     . TYR A 33  ? 1.1470 1.6319 1.4601 0.0468  -0.2964 -0.2092 30  TYR A N     
177  C CA    . TYR A 33  ? 0.9479 1.4052 1.2473 0.0152  -0.2765 -0.2098 30  TYR A CA    
178  C C     . TYR A 33  ? 1.0277 1.5048 1.3186 0.0050  -0.2908 -0.2252 30  TYR A C     
179  O O     . TYR A 33  ? 1.1010 1.6337 1.4277 0.0013  -0.3031 -0.2495 30  TYR A O     
180  C CB    . TYR A 33  ? 0.8274 1.3013 1.1673 -0.0107 -0.2535 -0.2225 30  TYR A CB    
181  C CG    . TYR A 33  ? 0.8342 1.3057 1.1936 -0.0019 -0.2413 -0.2147 30  TYR A CG    
182  C CD1   . TYR A 33  ? 0.8306 1.3502 1.2321 0.0122  -0.2509 -0.2285 30  TYR A CD1   
183  C CD2   . TYR A 33  ? 0.8055 1.2292 1.1433 -0.0084 -0.2198 -0.1955 30  TYR A CD2   
184  C CE1   . TYR A 33  ? 0.7934 1.3114 1.2139 0.0189  -0.2382 -0.2232 30  TYR A CE1   
185  C CE2   . TYR A 33  ? 0.7818 1.2052 1.1370 -0.0020 -0.2079 -0.1904 30  TYR A CE2   
186  C CZ    . TYR A 33  ? 0.7918 1.2614 1.1881 0.0111  -0.2165 -0.2042 30  TYR A CZ    
187  O OH    . TYR A 33  ? 0.7908 1.2602 1.2052 0.0165  -0.2033 -0.2006 30  TYR A OH    
188  N N     . PHE A 34  ? 1.0148 1.4486 1.2602 -0.0003 -0.2886 -0.2131 31  PHE A N     
189  C CA    . PHE A 34  ? 1.0265 1.4740 1.2577 -0.0097 -0.3014 -0.2267 31  PHE A CA    
190  C C     . PHE A 34  ? 1.1358 1.5469 1.3518 -0.0397 -0.2794 -0.2262 31  PHE A C     
191  O O     . PHE A 34  ? 1.1426 1.5162 1.3545 -0.0497 -0.2569 -0.2129 31  PHE A O     
192  C CB    . PHE A 34  ? 1.0587 1.4914 1.2444 0.0168  -0.3244 -0.2136 31  PHE A CB    
193  C CG    . PHE A 34  ? 1.0424 1.4080 1.1789 0.0240  -0.3130 -0.1859 31  PHE A CG    
194  C CD1   . PHE A 34  ? 1.0712 1.4124 1.2004 0.0455  -0.3092 -0.1661 31  PHE A CD1   
195  C CD2   . PHE A 34  ? 1.0335 1.3613 1.1332 0.0086  -0.3048 -0.1816 31  PHE A CD2   
196  C CE1   . PHE A 34  ? 1.0587 1.3402 1.1450 0.0506  -0.2973 -0.1433 31  PHE A CE1   
197  C CE2   . PHE A 34  ? 1.0382 1.3070 1.0957 0.0144  -0.2934 -0.1587 31  PHE A CE2   
198  C CZ    . PHE A 34  ? 1.0320 1.2781 1.0827 0.0351  -0.2895 -0.1398 31  PHE A CZ    
199  N N     . LEU A 35  ? 1.2077 1.6311 1.4155 -0.0534 -0.2864 -0.2417 32  LEU A N     
200  C CA    . LEU A 35  ? 1.1926 1.5829 1.3863 -0.0807 -0.2674 -0.2435 32  LEU A CA    
201  C C     . LEU A 35  ? 1.1413 1.4965 1.2829 -0.0735 -0.2759 -0.2327 32  LEU A C     
202  O O     . LEU A 35  ? 1.2052 1.5799 1.3284 -0.0558 -0.2998 -0.2354 32  LEU A O     
203  C CB    . LEU A 35  ? 1.2244 1.6556 1.4541 -0.1076 -0.2636 -0.2737 32  LEU A CB    
204  C CG    . LEU A 35  ? 1.2448 1.6436 1.4678 -0.1378 -0.2410 -0.2782 32  LEU A CG    
205  C CD1   . LEU A 35  ? 1.2168 1.6421 1.4864 -0.1648 -0.2234 -0.2993 32  LEU A CD1   
206  C CD2   . LEU A 35  ? 1.2518 1.6500 1.4479 -0.1432 -0.2522 -0.2887 32  LEU A CD2   
207  N N     . GLU A 36  ? 1.0909 1.3950 1.2086 -0.0873 -0.2562 -0.2211 33  GLU A N     
208  C CA    . GLU A 36  ? 1.1507 1.4161 1.2187 -0.0822 -0.2600 -0.2103 33  GLU A CA    
209  C C     . GLU A 36  ? 1.2426 1.4643 1.3025 -0.1050 -0.2351 -0.2065 33  GLU A C     
210  O O     . GLU A 36  ? 1.2235 1.4204 1.2931 -0.1085 -0.2171 -0.1940 33  GLU A O     
211  C CB    . GLU A 36  ? 1.1497 1.3857 1.1841 -0.0535 -0.2672 -0.1855 33  GLU A CB    
212  C CG    . GLU A 36  ? 1.2753 1.4644 1.2563 -0.0495 -0.2665 -0.1726 33  GLU A CG    
213  C CD    . GLU A 36  ? 1.3967 1.5618 1.3452 -0.0204 -0.2751 -0.1508 33  GLU A CD    
214  O OE1   . GLU A 36  ? 1.4189 1.6142 1.3686 0.0010  -0.2966 -0.1513 33  GLU A OE1   
215  O OE2   . GLU A 36  ? 1.4303 1.5463 1.3533 -0.0187 -0.2598 -0.1338 33  GLU A OE2   
216  N N     . ASP A 37  ? 1.3171 1.5309 1.3599 -0.1200 -0.2346 -0.2179 34  ASP A N     
217  C CA    . ASP A 37  ? 1.3982 1.5716 1.4342 -0.1414 -0.2121 -0.2168 34  ASP A CA    
218  C C     . ASP A 37  ? 1.3146 1.4942 1.3917 -0.1624 -0.1925 -0.2245 34  ASP A C     
219  O O     . ASP A 37  ? 1.2773 1.4180 1.3523 -0.1729 -0.1721 -0.2147 34  ASP A O     
220  C CB    . ASP A 37  ? 1.5053 1.6242 1.5071 -0.1306 -0.2021 -0.1924 34  ASP A CB    
221  C CG    . ASP A 37  ? 1.5781 1.6789 1.5329 -0.1174 -0.2148 -0.1866 34  ASP A CG    
222  O OD1   . ASP A 37  ? 1.6132 1.7182 1.5541 -0.1290 -0.2189 -0.2010 34  ASP A OD1   
223  O OD2   . ASP A 37  ? 1.5669 1.6478 1.4977 -0.0961 -0.2193 -0.1679 34  ASP A OD2   
224  N N     . GLY A 38  ? 1.2811 1.5093 1.3952 -0.1682 -0.1983 -0.2422 35  GLY A N     
225  C CA    . GLY A 38  ? 1.2828 1.5169 1.4345 -0.1887 -0.1786 -0.2498 35  GLY A CA    
226  C C     . GLY A 38  ? 1.2614 1.4789 1.4217 -0.1803 -0.1674 -0.2301 35  GLY A C     
227  O O     . GLY A 38  ? 1.2502 1.4510 1.4269 -0.1967 -0.1464 -0.2281 35  GLY A O     
228  N N     . LYS A 39  ? 1.1703 1.3906 1.3184 -0.1550 -0.1804 -0.2156 36  LYS A N     
229  C CA    . LYS A 39  ? 1.0433 1.2496 1.1981 -0.1461 -0.1705 -0.1980 36  LYS A CA    
230  C C     . LYS A 39  ? 1.0184 1.2637 1.1896 -0.1259 -0.1869 -0.1996 36  LYS A C     
231  O O     . LYS A 39  ? 1.1008 1.3595 1.2558 -0.1068 -0.2077 -0.1997 36  LYS A O     
232  C CB    . LYS A 39  ? 1.0406 1.1952 1.1588 -0.1349 -0.1640 -0.1743 36  LYS A CB    
233  C CG    . LYS A 39  ? 1.0848 1.1989 1.1883 -0.1521 -0.1475 -0.1715 36  LYS A CG    
234  C CD    . LYS A 39  ? 1.1063 1.1748 1.1768 -0.1400 -0.1423 -0.1507 36  LYS A CD    
235  C CE    . LYS A 39  ? 1.1913 1.2218 1.2523 -0.1558 -0.1257 -0.1485 36  LYS A CE    
236  N NZ    . LYS A 39  ? 1.1960 1.1857 1.2290 -0.1446 -0.1200 -0.1308 36  LYS A NZ    
237  N N     . VAL A 40  ? 0.9291 1.1914 1.1315 -0.1296 -0.1770 -0.2007 37  VAL A N     
238  C CA    . VAL A 40  ? 0.9007 1.1975 1.1221 -0.1100 -0.1898 -0.2017 37  VAL A CA    
239  C C     . VAL A 40  ? 0.9509 1.2150 1.1441 -0.0867 -0.1917 -0.1778 37  VAL A C     
240  O O     . VAL A 40  ? 0.9605 1.1866 1.1405 -0.0908 -0.1747 -0.1622 37  VAL A O     
241  C CB    . VAL A 40  ? 0.8564 1.1812 1.1203 -0.1238 -0.1761 -0.2124 37  VAL A CB    
242  C CG1   . VAL A 40  ? 0.8519 1.2172 1.1407 -0.1038 -0.1897 -0.2171 37  VAL A CG1   
243  C CG2   . VAL A 40  ? 0.7924 1.1431 1.0827 -0.1504 -0.1696 -0.2366 37  VAL A CG2   
244  N N     . LYS A 41  ? 0.9769 1.2557 1.1610 -0.0616 -0.2120 -0.1751 38  LYS A N     
245  C CA    . LYS A 41  ? 0.9703 1.2166 1.1260 -0.0388 -0.2137 -0.1536 38  LYS A CA    
246  C C     . LYS A 41  ? 0.9768 1.2545 1.1539 -0.0161 -0.2261 -0.1544 38  LYS A C     
247  O O     . LYS A 41  ? 1.0494 1.3765 1.2614 -0.0159 -0.2367 -0.1722 38  LYS A O     
248  C CB    . LYS A 41  ? 0.9878 1.2039 1.0973 -0.0285 -0.2246 -0.1446 38  LYS A CB    
249  C CG    . LYS A 41  ? 0.9981 1.1802 1.0861 -0.0494 -0.2116 -0.1439 38  LYS A CG    
250  C CD    . LYS A 41  ? 1.0741 1.2247 1.1151 -0.0392 -0.2202 -0.1351 38  LYS A CD    
251  C CE    . LYS A 41  ? 1.1123 1.2307 1.1358 -0.0603 -0.2064 -0.1365 38  LYS A CE    
252  N NZ    . LYS A 41  ? 1.0890 1.1770 1.0666 -0.0527 -0.2129 -0.1300 38  LYS A NZ    
253  N N     . VAL A 42  ? 0.9672 1.2159 1.1247 0.0032  -0.2237 -0.1360 39  VAL A N     
254  C CA    . VAL A 42  ? 0.9329 1.2031 1.1078 0.0272  -0.2333 -0.1341 39  VAL A CA    
255  C C     . VAL A 42  ? 0.9573 1.1849 1.0917 0.0505  -0.2361 -0.1132 39  VAL A C     
256  O O     . VAL A 42  ? 0.9094 1.0910 1.0124 0.0443  -0.2224 -0.1001 39  VAL A O     
257  C CB    . VAL A 42  ? 0.8654 1.1513 1.0784 0.0189  -0.2164 -0.1380 39  VAL A CB    
258  C CG1   . VAL A 42  ? 0.7773 1.0178 0.9709 0.0093  -0.1936 -0.1225 39  VAL A CG1   
259  C CG2   . VAL A 42  ? 0.7958 1.1081 1.0324 0.0435  -0.2262 -0.1392 39  VAL A CG2   
260  N N     . SER A 43  ? 1.1023 1.3452 1.2379 0.0778  -0.2537 -0.1107 40  SER A N     
261  C CA    . SER A 43  ? 1.2084 1.4105 1.3047 0.1021  -0.2570 -0.0909 40  SER A CA    
262  C C     . SER A 43  ? 1.2597 1.4544 1.3744 0.1140  -0.2445 -0.0835 40  SER A C     
263  O O     . SER A 43  ? 1.3504 1.5708 1.4876 0.1350  -0.2557 -0.0860 40  SER A O     
264  C CB    . SER A 43  ? 1.2381 1.4565 1.3185 0.1265  -0.2846 -0.0907 40  SER A CB    
265  O OG    . SER A 43  ? 1.3271 1.5047 1.3708 0.1518  -0.2864 -0.0706 40  SER A OG    
266  N N     . ARG A 44  ? 1.2324 1.3926 1.3379 0.1009  -0.2212 -0.0754 41  ARG A N     
267  C CA    . ARG A 44  ? 1.2282 1.3785 1.3482 0.1091  -0.2066 -0.0694 41  ARG A CA    
268  C C     . ARG A 44  ? 1.2772 1.3797 1.3582 0.1298  -0.2038 -0.0514 41  ARG A C     
269  O O     . ARG A 44  ? 1.3218 1.3926 1.3609 0.1323  -0.2084 -0.0425 41  ARG A O     
270  C CB    . ARG A 44  ? 1.1837 1.3261 1.3155 0.0836  -0.1832 -0.0715 41  ARG A CB    
271  C CG    . ARG A 44  ? 1.1646 1.3513 1.3366 0.0636  -0.1819 -0.0885 41  ARG A CG    
272  C CD    . ARG A 44  ? 1.1257 1.3084 1.3133 0.0452  -0.1590 -0.0890 41  ARG A CD    
273  N NE    . ARG A 44  ? 1.0991 1.2840 1.3028 0.0579  -0.1505 -0.0867 41  ARG A NE    
274  C CZ    . ARG A 44  ? 1.0731 1.2976 1.3163 0.0641  -0.1536 -0.0982 41  ARG A CZ    
275  N NH1   . ARG A 44  ? 1.0275 1.2945 1.2987 0.0587  -0.1656 -0.1134 41  ARG A NH1   
276  N NH2   . ARG A 44  ? 1.0565 1.2794 1.3130 0.0750  -0.1439 -0.0963 41  ARG A NH2   
277  N N     . PRO A 45  ? 1.2737 1.3694 1.3675 0.1445  -0.1950 -0.0466 42  PRO A N     
278  C CA    . PRO A 45  ? 1.2907 1.3380 1.3481 0.1641  -0.1898 -0.0299 42  PRO A CA    
279  C C     . PRO A 45  ? 1.3121 1.3103 1.3275 0.1507  -0.1748 -0.0205 42  PRO A C     
280  O O     . PRO A 45  ? 1.3657 1.3263 1.3392 0.1632  -0.1781 -0.0085 42  PRO A O     
281  C CB    . PRO A 45  ? 1.2466 1.2976 1.3335 0.1718  -0.1751 -0.0310 42  PRO A CB    
282  C CG    . PRO A 45  ? 1.1783 1.2871 1.3157 0.1696  -0.1845 -0.0471 42  PRO A CG    
283  C CD    . PRO A 45  ? 1.1613 1.2944 1.3041 0.1451  -0.1899 -0.0574 42  PRO A CD    
284  N N     . GLU A 46  ? 1.3154 1.3133 1.3407 0.1258  -0.1584 -0.0258 43  GLU A N     
285  C CA    . GLU A 46  ? 1.3756 1.3310 1.3667 0.1129  -0.1439 -0.0191 43  GLU A CA    
286  C C     . GLU A 46  ? 1.3806 1.3268 1.3424 0.1059  -0.1554 -0.0186 43  GLU A C     
287  O O     . GLU A 46  ? 1.4649 1.3714 1.3915 0.1010  -0.1464 -0.0120 43  GLU A O     
288  C CB    . GLU A 46  ? 1.4482 1.4101 1.4598 0.0901  -0.1257 -0.0252 43  GLU A CB    
289  C CG    . GLU A 46  ? 1.5278 1.5089 1.5734 0.0926  -0.1148 -0.0295 43  GLU A CG    
290  C CD    . GLU A 46  ? 1.5949 1.6271 1.6819 0.0910  -0.1254 -0.0409 43  GLU A CD    
291  O OE1   . GLU A 46  ? 1.5798 1.6340 1.6748 0.0771  -0.1338 -0.0478 43  GLU A OE1   
292  O OE2   . GLU A 46  ? 1.5975 1.6474 1.7101 0.1031  -0.1241 -0.0441 43  GLU A OE2   
293  N N     . GLY A 47  ? 1.3220 1.3051 1.2988 0.1045  -0.1740 -0.0273 44  GLY A N     
294  C CA    . GLY A 47  ? 1.2516 1.2308 1.2038 0.0964  -0.1849 -0.0296 44  GLY A CA    
295  C C     . GLY A 47  ? 1.1914 1.2177 1.1769 0.0813  -0.1949 -0.0452 44  GLY A C     
296  O O     . GLY A 47  ? 1.2787 1.3419 1.3044 0.0806  -0.1960 -0.0537 44  GLY A O     
297  N N     . VAL A 48  ? 1.0805 1.1040 1.0487 0.0681  -0.2003 -0.0502 45  VAL A N     
298  C CA    . VAL A 48  ? 0.9669 1.0302 0.9633 0.0509  -0.2075 -0.0664 45  VAL A CA    
299  C C     . VAL A 48  ? 0.9602 1.0141 0.9697 0.0256  -0.1876 -0.0695 45  VAL A C     
300  O O     . VAL A 48  ? 1.0797 1.0962 1.0631 0.0170  -0.1760 -0.0630 45  VAL A O     
301  C CB    . VAL A 48  ? 0.9457 1.0130 0.9175 0.0498  -0.2240 -0.0720 45  VAL A CB    
302  C CG1   . VAL A 48  ? 0.8881 0.9970 0.8916 0.0301  -0.2291 -0.0912 45  VAL A CG1   
303  C CG2   . VAL A 48  ? 0.9377 1.0129 0.8920 0.0775  -0.2453 -0.0666 45  VAL A CG2   
304  N N     . LYS A 49  ? 0.9239 1.0116 0.9737 0.0140  -0.1834 -0.0796 46  LYS A N     
305  C CA    . LYS A 49  ? 0.9025 0.9829 0.9652 -0.0086 -0.1652 -0.0815 46  LYS A CA    
306  C C     . LYS A 49  ? 0.9832 1.0951 1.0710 -0.0278 -0.1680 -0.0974 46  LYS A C     
307  O O     . LYS A 49  ? 0.9591 1.1096 1.0672 -0.0239 -0.1824 -0.1097 46  LYS A O     
308  C CB    . LYS A 49  ? 0.8064 0.8913 0.8909 -0.0074 -0.1517 -0.0774 46  LYS A CB    
309  C CG    . LYS A 49  ? 0.7806 0.8391 0.8464 0.0115  -0.1476 -0.0645 46  LYS A CG    
310  C CD    . LYS A 49  ? 0.7853 0.7976 0.8162 0.0078  -0.1366 -0.0543 46  LYS A CD    
311  C CE    . LYS A 49  ? 0.9208 0.9064 0.9335 0.0255  -0.1308 -0.0436 46  LYS A CE    
312  N NZ    . LYS A 49  ? 0.8884 0.8323 0.8722 0.0199  -0.1175 -0.0364 46  LYS A NZ    
313  N N     . ILE A 50  ? 1.0078 1.1027 1.0950 -0.0484 -0.1537 -0.0977 47  ILE A N     
314  C CA    . ILE A 50  ? 0.9421 1.0589 1.0523 -0.0697 -0.1509 -0.1120 47  ILE A CA    
315  C C     . ILE A 50  ? 0.8908 1.0308 1.0353 -0.0786 -0.1398 -0.1159 47  ILE A C     
316  O O     . ILE A 50  ? 0.9085 1.0320 1.0514 -0.0774 -0.1271 -0.1050 47  ILE A O     
317  C CB    . ILE A 50  ? 0.8828 0.9659 0.9750 -0.0865 -0.1396 -0.1095 47  ILE A CB    
318  C CG1   . ILE A 50  ? 0.8393 0.9058 0.9005 -0.0813 -0.1505 -0.1103 47  ILE A CG1   
319  C CG2   . ILE A 50  ? 0.7764 0.8751 0.8942 -0.1100 -0.1306 -0.1220 47  ILE A CG2   
320  C CD1   . ILE A 50  ? 0.8321 0.8616 0.8743 -0.0949 -0.1386 -0.1073 47  ILE A CD1   
321  N N     . ILE A 51  ? 0.8201 0.9997 0.9955 -0.0882 -0.1441 -0.1329 48  ILE A N     
322  C CA    . ILE A 51  ? 0.8064 1.0076 1.0142 -0.1011 -0.1309 -0.1391 48  ILE A CA    
323  C C     . ILE A 51  ? 0.8275 1.0199 1.0412 -0.1276 -0.1167 -0.1454 48  ILE A C     
324  O O     . ILE A 51  ? 0.9013 1.1185 1.1322 -0.1396 -0.1210 -0.1629 48  ILE A O     
325  C CB    . ILE A 51  ? 0.8045 1.0574 1.0473 -0.0948 -0.1423 -0.1556 48  ILE A CB    
326  C CG1   . ILE A 51  ? 0.8188 1.0778 1.0527 -0.0658 -0.1597 -0.1495 48  ILE A CG1   
327  C CG2   . ILE A 51  ? 0.7270 0.9984 1.0003 -0.1063 -0.1264 -0.1602 48  ILE A CG2   
328  C CD1   . ILE A 51  ? 0.7992 1.1101 1.0698 -0.0559 -0.1725 -0.1653 48  ILE A CD1   
329  N N     . PRO A 52  ? 0.8406 0.9981 1.0407 -0.1369 -0.0996 -0.1321 49  PRO A N     
330  C CA    . PRO A 52  ? 0.8951 1.0397 1.0996 -0.1605 -0.0852 -0.1363 49  PRO A CA    
331  C C     . PRO A 52  ? 0.9311 1.1051 1.1683 -0.1766 -0.0742 -0.1483 49  PRO A C     
332  O O     . PRO A 52  ? 0.8698 1.0632 1.1217 -0.1708 -0.0720 -0.1475 49  PRO A O     
333  C CB    . PRO A 52  ? 0.9220 1.0223 1.1016 -0.1603 -0.0724 -0.1162 49  PRO A CB    
334  C CG    . PRO A 52  ? 0.8430 0.9469 1.0195 -0.1436 -0.0740 -0.1060 49  PRO A CG    
335  C CD    . PRO A 52  ? 0.8487 0.9785 1.0300 -0.1260 -0.0926 -0.1135 49  PRO A CD    
336  N N     . PRO A 53  ? 0.9518 1.1298 1.2024 -0.1982 -0.0654 -0.1612 50  PRO A N     
337  C CA    . PRO A 53  ? 0.9186 1.1205 1.1991 -0.2166 -0.0511 -0.1733 50  PRO A CA    
338  C C     . PRO A 53  ? 0.9306 1.1088 1.2025 -0.2209 -0.0329 -0.1563 50  PRO A C     
339  O O     . PRO A 53  ? 0.9886 1.1291 1.2323 -0.2137 -0.0296 -0.1364 50  PRO A O     
340  C CB    . PRO A 53  ? 0.9207 1.1167 1.2084 -0.2397 -0.0419 -0.1869 50  PRO A CB    
341  C CG    . PRO A 53  ? 0.9404 1.0955 1.1966 -0.2346 -0.0453 -0.1745 50  PRO A CG    
342  C CD    . PRO A 53  ? 0.9313 1.0893 1.1698 -0.2084 -0.0655 -0.1660 50  PRO A CD    
343  N N     . GLN A 54  ? 0.9125 1.1157 1.2094 -0.2331 -0.0212 -0.1656 51  GLN A N     
344  C CA    . GLN A 54  ? 0.8656 1.0510 1.1540 -0.2386 -0.0036 -0.1512 51  GLN A CA    
345  C C     . GLN A 54  ? 0.8691 1.0053 1.1303 -0.2489 0.0108  -0.1342 51  GLN A C     
346  O O     . GLN A 54  ? 0.8874 0.9968 1.1252 -0.2414 0.0155  -0.1143 51  GLN A O     
347  C CB    . GLN A 54  ? 0.9496 1.1673 1.2692 -0.2560 0.0103  -0.1673 51  GLN A CB    
348  C CG    . GLN A 54  ? 1.0617 1.2631 1.3710 -0.2640 0.0298  -0.1538 51  GLN A CG    
349  C CD    . GLN A 54  ? 1.1956 1.4131 1.5054 -0.2459 0.0233  -0.1477 51  GLN A CD    
350  O OE1   . GLN A 54  ? 1.2584 1.5027 1.5819 -0.2282 0.0056  -0.1557 51  GLN A OE1   
351  N NE2   . GLN A 54  ? 1.2320 1.4323 1.5260 -0.2500 0.0379  -0.1336 51  GLN A NE2   
352  N N     . SER A 55  ? 0.9358 1.0603 1.2006 -0.2655 0.0175  -0.1427 52  SER A N     
353  C CA    . SER A 55  ? 0.9391 1.0164 1.1821 -0.2763 0.0331  -0.1280 52  SER A CA    
354  C C     . SER A 55  ? 0.9394 0.9816 1.1524 -0.2593 0.0236  -0.1097 52  SER A C     
355  O O     . SER A 55  ? 1.0524 1.0550 1.2462 -0.2635 0.0349  -0.0944 52  SER A O     
356  C CB    . SER A 55  ? 0.9855 1.0599 1.2429 -0.2981 0.0430  -0.1445 52  SER A CB    
357  O OG    . SER A 55  ? 1.0136 1.0986 1.2744 -0.2920 0.0263  -0.1567 52  SER A OG    
358  N N     . ASP A 56  ? 0.9199 0.9747 1.1284 -0.2401 0.0040  -0.1111 53  ASP A N     
359  C CA    . ASP A 56  ? 0.9056 0.9291 1.0872 -0.2249 -0.0039 -0.0964 53  ASP A CA    
360  C C     . ASP A 56  ? 0.9338 0.9543 1.1011 -0.2069 -0.0082 -0.0811 53  ASP A C     
361  O O     . ASP A 56  ? 0.9800 0.9733 1.1253 -0.1956 -0.0117 -0.0686 53  ASP A O     
362  C CB    . ASP A 56  ? 1.0570 1.0900 1.2376 -0.2167 -0.0211 -0.1077 53  ASP A CB    
363  C CG    . ASP A 56  ? 1.1905 1.2125 1.3754 -0.2329 -0.0163 -0.1192 53  ASP A CG    
364  O OD1   . ASP A 56  ? 1.2366 1.2280 1.4166 -0.2456 -0.0002 -0.1122 53  ASP A OD1   
365  O OD2   . ASP A 56  ? 1.2702 1.3135 1.4625 -0.2326 -0.0286 -0.1352 53  ASP A OD2   
366  N N     . ARG A 57  ? 0.9569 1.0052 1.1375 -0.2048 -0.0071 -0.0838 54  ARG A N     
367  C CA    . ARG A 57  ? 0.9010 0.9519 1.0715 -0.1870 -0.0126 -0.0738 54  ARG A CA    
368  C C     . ARG A 57  ? 0.8972 0.9197 1.0468 -0.1865 -0.0017 -0.0553 54  ARG A C     
369  O O     . ARG A 57  ? 0.9616 0.9726 1.0951 -0.1716 -0.0070 -0.0457 54  ARG A O     
370  C CB    . ARG A 57  ? 0.8913 0.9820 1.0854 -0.1849 -0.0141 -0.0844 54  ARG A CB    
371  C CG    . ARG A 57  ? 0.8817 1.0036 1.0962 -0.1805 -0.0286 -0.1022 54  ARG A CG    
372  C CD    . ARG A 57  ? 0.8886 1.0524 1.1314 -0.1776 -0.0305 -0.1145 54  ARG A CD    
373  N NE    . ARG A 57  ? 0.8981 1.0942 1.1621 -0.1739 -0.0453 -0.1326 54  ARG A NE    
374  C CZ    . ARG A 57  ? 0.8904 1.1285 1.1848 -0.1704 -0.0503 -0.1475 54  ARG A CZ    
375  N NH1   . ARG A 57  ? 0.8615 1.1132 1.1689 -0.1716 -0.0399 -0.1471 54  ARG A NH1   
376  N NH2   . ARG A 57  ? 0.9453 1.2136 1.2576 -0.1656 -0.0659 -0.1638 54  ARG A NH2   
377  N N     . GLN A 58  ? 0.9151 0.9261 1.0638 -0.2025 0.0136  -0.0504 55  GLN A N     
378  C CA    . GLN A 58  ? 0.8613 0.8452 0.9874 -0.2008 0.0222  -0.0317 55  GLN A CA    
379  C C     . GLN A 58  ? 0.9230 0.8740 1.0295 -0.1911 0.0164  -0.0218 55  GLN A C     
380  O O     . GLN A 58  ? 0.9992 0.9393 1.0896 -0.1785 0.0135  -0.0106 55  GLN A O     
381  C CB    . GLN A 58  ? 0.9665 0.9389 1.0916 -0.2197 0.0401  -0.0272 55  GLN A CB    
382  C CG    . GLN A 58  ? 1.1212 1.0576 1.2195 -0.2175 0.0473  -0.0064 55  GLN A CG    
383  C CD    . GLN A 58  ? 1.2980 1.2268 1.3893 -0.2326 0.0651  0.0016  55  GLN A CD    
384  O OE1   . GLN A 58  ? 1.3383 1.2921 1.4451 -0.2446 0.0731  -0.0089 55  GLN A OE1   
385  N NE2   . GLN A 58  ? 1.3164 1.2103 1.3837 -0.2317 0.0717  0.0202  55  GLN A NE2   
386  N N     . LYS A 59  ? 0.9316 0.8686 1.0412 -0.1975 0.0152  -0.0279 56  LYS A N     
387  C CA    . LYS A 59  ? 0.8947 0.8005 0.9883 -0.1897 0.0112  -0.0206 56  LYS A CA    
388  C C     . LYS A 59  ? 0.9140 0.8255 1.0007 -0.1721 -0.0027 -0.0224 56  LYS A C     
389  O O     . LYS A 59  ? 0.9299 0.8192 1.0014 -0.1625 -0.0048 -0.0139 56  LYS A O     
390  C CB    . LYS A 59  ? 0.9377 0.8299 1.0384 -0.2020 0.0140  -0.0297 56  LYS A CB    
391  C CG    . LYS A 59  ? 1.0147 0.8716 1.1012 -0.1967 0.0135  -0.0227 56  LYS A CG    
392  C CD    . LYS A 59  ? 1.1913 1.0381 1.2865 -0.2091 0.0160  -0.0352 56  LYS A CD    
393  C CE    . LYS A 59  ? 1.3440 1.1550 1.4272 -0.2041 0.0172  -0.0290 56  LYS A CE    
394  N NZ    . LYS A 59  ? 1.3699 1.1736 1.4610 -0.2151 0.0183  -0.0441 56  LYS A NZ    
395  N N     . ILE A 60  ? 0.8974 0.8375 0.9951 -0.1674 -0.0116 -0.0335 57  ILE A N     
396  C CA    . ILE A 60  ? 0.7942 0.7360 0.8828 -0.1508 -0.0231 -0.0344 57  ILE A CA    
397  C C     . ILE A 60  ? 0.7841 0.7262 0.8639 -0.1399 -0.0209 -0.0245 57  ILE A C     
398  O O     . ILE A 60  ? 0.8391 0.7651 0.9043 -0.1290 -0.0238 -0.0195 57  ILE A O     
399  C CB    . ILE A 60  ? 0.7284 0.6990 0.8302 -0.1472 -0.0340 -0.0480 57  ILE A CB    
400  C CG1   . ILE A 60  ? 0.7550 0.7243 0.8612 -0.1560 -0.0386 -0.0592 57  ILE A CG1   
401  C CG2   . ILE A 60  ? 0.7176 0.6890 0.8083 -0.1288 -0.0434 -0.0462 57  ILE A CG2   
402  C CD1   . ILE A 60  ? 0.7385 0.7386 0.8566 -0.1514 -0.0516 -0.0730 57  ILE A CD1   
403  N N     . VAL A 61  ? 0.7714 0.7331 0.8606 -0.1439 -0.0147 -0.0234 58  VAL A N     
404  C CA    . VAL A 61  ? 0.7423 0.7067 0.8236 -0.1358 -0.0112 -0.0155 58  VAL A CA    
405  C C     . VAL A 61  ? 0.7375 0.6751 0.8009 -0.1345 -0.0067 -0.0029 58  VAL A C     
406  O O     . VAL A 61  ? 0.7294 0.6615 0.7821 -0.1236 -0.0083 0.0013  58  VAL A O     
407  C CB    . VAL A 61  ? 0.7580 0.7476 0.8521 -0.1434 -0.0033 -0.0175 58  VAL A CB    
408  C CG1   . VAL A 61  ? 0.7005 0.6941 0.7855 -0.1364 0.0010  -0.0106 58  VAL A CG1   
409  C CG2   . VAL A 61  ? 0.7323 0.7517 0.8482 -0.1424 -0.0090 -0.0315 58  VAL A CG2   
410  N N     . LEU A 62  ? 0.7513 0.6717 0.8122 -0.1453 -0.0006 0.0026  59  LEU A N     
411  C CA    . LEU A 62  ? 0.7694 0.6636 0.8144 -0.1424 0.0028  0.0154  59  LEU A CA    
412  C C     . LEU A 62  ? 0.8299 0.7063 0.8674 -0.1316 -0.0045 0.0140  59  LEU A C     
413  O O     . LEU A 62  ? 0.9218 0.7904 0.9490 -0.1218 -0.0056 0.0202  59  LEU A O     
414  C CB    . LEU A 62  ? 0.9195 0.7949 0.9640 -0.1557 0.0116  0.0213  59  LEU A CB    
415  C CG    . LEU A 62  ? 1.0872 0.9355 1.1153 -0.1520 0.0158  0.0372  59  LEU A CG    
416  C CD1   . LEU A 62  ? 1.0646 0.9248 1.0816 -0.1477 0.0185  0.0470  59  LEU A CD1   
417  C CD2   . LEU A 62  ? 1.1303 0.9547 1.1582 -0.1650 0.0258  0.0425  59  LEU A CD2   
418  N N     . GLN A 63  ? 0.8759 0.7475 0.9187 -0.1337 -0.0093 0.0045  60  GLN A N     
419  C CA    . GLN A 63  ? 0.9069 0.7598 0.9414 -0.1257 -0.0144 0.0020  60  GLN A CA    
420  C C     . GLN A 63  ? 0.8839 0.7452 0.9122 -0.1126 -0.0190 -0.0005 60  GLN A C     
421  O O     . GLN A 63  ? 0.8592 0.7060 0.8787 -0.1048 -0.0193 0.0011  60  GLN A O     
422  C CB    . GLN A 63  ? 0.9923 0.8410 1.0317 -0.1321 -0.0182 -0.0089 60  GLN A CB    
423  C CG    . GLN A 63  ? 1.2125 1.0447 1.2572 -0.1452 -0.0115 -0.0082 60  GLN A CG    
424  C CD    . GLN A 63  ? 1.3540 1.1870 1.4047 -0.1532 -0.0151 -0.0218 60  GLN A CD    
425  O OE1   . GLN A 63  ? 1.3332 1.1827 1.3838 -0.1489 -0.0240 -0.0308 60  GLN A OE1   
426  N NE2   . GLN A 63  ? 1.3833 1.1980 1.4386 -0.1647 -0.0081 -0.0234 60  GLN A NE2   
427  N N     . ALA A 64  ? 0.8562 0.7407 0.8904 -0.1101 -0.0216 -0.0054 61  ALA A N     
428  C CA    . ALA A 64  ? 0.6997 0.5895 0.7282 -0.0982 -0.0238 -0.0078 61  ALA A CA    
429  C C     . ALA A 64  ? 0.8041 0.6975 0.8288 -0.0941 -0.0183 -0.0014 61  ALA A C     
430  O O     . ALA A 64  ? 0.8314 0.7177 0.8485 -0.0857 -0.0178 -0.0028 61  ALA A O     
431  C CB    . ALA A 64  ? 0.6928 0.6052 0.7303 -0.0954 -0.0277 -0.0143 61  ALA A CB    
432  N N     . HIS A 65  ? 0.7626 0.6678 0.7917 -0.1006 -0.0136 0.0046  62  HIS A N     
433  C CA    . HIS A 65  ? 0.6948 0.6057 0.7179 -0.0970 -0.0093 0.0106  62  HIS A CA    
434  C C     . HIS A 65  ? 0.7413 0.6316 0.7545 -0.0924 -0.0102 0.0163  62  HIS A C     
435  O O     . HIS A 65  ? 0.7490 0.6422 0.7574 -0.0845 -0.0100 0.0153  62  HIS A O     
436  C CB    . HIS A 65  ? 0.7027 0.6273 0.7284 -0.1062 -0.0036 0.0169  62  HIS A CB    
437  C CG    . HIS A 65  ? 0.7067 0.6357 0.7219 -0.1034 -0.0001 0.0248  62  HIS A CG    
438  N ND1   . HIS A 65  ? 0.6943 0.6429 0.7095 -0.0982 0.0018  0.0201  62  HIS A ND1   
439  C CD2   . HIS A 65  ? 0.7243 0.6410 0.7280 -0.1045 0.0014  0.0367  62  HIS A CD2   
440  C CE1   . HIS A 65  ? 0.7193 0.6705 0.7232 -0.0969 0.0035  0.0279  62  HIS A CE1   
441  N NE2   . HIS A 65  ? 0.7222 0.6537 0.7180 -0.0996 0.0027  0.0390  62  HIS A NE2   
442  N N     . ASN A 66  ? 0.7277 0.5980 0.7400 -0.0973 -0.0106 0.0209  63  ASN A N     
443  C CA    . ASN A 66  ? 0.7376 0.5888 0.7432 -0.0923 -0.0111 0.0274  63  ASN A CA    
444  C C     . ASN A 66  ? 0.8337 0.6744 0.8380 -0.0838 -0.0142 0.0192  63  ASN A C     
445  O O     . ASN A 66  ? 0.9274 0.7567 0.9293 -0.0778 -0.0150 0.0222  63  ASN A O     
446  C CB    . ASN A 66  ? 0.7524 0.5824 0.7588 -0.1002 -0.0088 0.0341  63  ASN A CB    
447  C CG    . ASN A 66  ? 0.9224 0.7548 0.9247 -0.1071 -0.0032 0.0460  63  ASN A CG    
448  O OD1   . ASN A 66  ? 0.9774 0.8276 0.9745 -0.1051 -0.0019 0.0502  63  ASN A OD1   
449  N ND2   . ASN A 66  ? 1.0856 0.8988 1.0892 -0.1162 0.0017  0.0511  63  ASN A ND2   
450  N N     . LEU A 67  ? 0.8604 0.7043 0.8660 -0.0827 -0.0157 0.0088  64  LEU A N     
451  C CA    . LEU A 67  ? 0.8013 0.6328 0.8030 -0.0762 -0.0162 0.0004  64  LEU A CA    
452  C C     . LEU A 67  ? 0.8153 0.6554 0.8158 -0.0681 -0.0143 -0.0010 64  LEU A C     
453  O O     . LEU A 67  ? 0.8809 0.7101 0.8815 -0.0634 -0.0142 -0.0036 64  LEU A O     
454  C CB    . LEU A 67  ? 0.7868 0.6196 0.7856 -0.0758 -0.0173 -0.0084 64  LEU A CB    
455  C CG    . LEU A 67  ? 0.7876 0.6147 0.7874 -0.0829 -0.0211 -0.0103 64  LEU A CG    
456  C CD1   . LEU A 67  ? 0.7035 0.5348 0.6979 -0.0792 -0.0241 -0.0171 64  LEU A CD1   
457  C CD2   . LEU A 67  ? 0.7185 0.5223 0.7162 -0.0866 -0.0210 -0.0123 64  LEU A CD2   
458  N N     . ALA A 68  ? 0.8137 0.6755 0.8148 -0.0666 -0.0123 -0.0011 65  ALA A N     
459  C CA    . ALA A 68  ? 0.7794 0.6541 0.7803 -0.0602 -0.0102 -0.0042 65  ALA A CA    
460  C C     . ALA A 68  ? 0.8101 0.7079 0.8108 -0.0619 -0.0093 0.0025  65  ALA A C     
461  O O     . ALA A 68  ? 0.8044 0.7193 0.8051 -0.0579 -0.0070 -0.0024 65  ALA A O     
462  C CB    . ALA A 68  ? 0.6708 0.5473 0.6714 -0.0565 -0.0055 -0.0171 65  ALA A CB    
463  N N     . HIS A 69  ? 0.7820 0.6810 0.7822 -0.0688 -0.0099 0.0120  66  HIS A N     
464  C CA    . HIS A 69  ? 0.7926 0.7119 0.7906 -0.0727 -0.0073 0.0182  66  HIS A CA    
465  C C     . HIS A 69  ? 0.8396 0.7813 0.8422 -0.0718 -0.0028 0.0083  66  HIS A C     
466  O O     . HIS A 69  ? 0.9851 0.9459 0.9852 -0.0705 -0.0002 0.0071  66  HIS A O     
467  C CB    . HIS A 69  ? 0.7049 0.6259 0.6941 -0.0687 -0.0095 0.0277  66  HIS A CB    
468  C CG    . HIS A 69  ? 0.7263 0.6254 0.7103 -0.0712 -0.0114 0.0409  66  HIS A CG    
469  N ND1   . HIS A 69  ? 0.7564 0.6544 0.7347 -0.0799 -0.0078 0.0519  66  HIS A ND1   
470  C CD2   . HIS A 69  ? 0.7952 0.6709 0.7797 -0.0668 -0.0149 0.0441  66  HIS A CD2   
471  C CE1   . HIS A 69  ? 0.8664 0.7395 0.8409 -0.0807 -0.0085 0.0620  66  HIS A CE1   
472  N NE2   . HIS A 69  ? 0.9196 0.7791 0.8986 -0.0724 -0.0132 0.0575  66  HIS A NE2   
473  N N     . THR A 70  ? 0.7219 0.6609 0.7311 -0.0722 -0.0019 0.0008  67  THR A N     
474  C CA    . THR A 70  ? 0.6981 0.6529 0.7132 -0.0701 0.0031  -0.0087 67  THR A CA    
475  C C     . THR A 70  ? 0.7115 0.6874 0.7332 -0.0767 0.0065  -0.0068 67  THR A C     
476  O O     . THR A 70  ? 0.6636 0.6393 0.6860 -0.0840 0.0051  0.0006  67  THR A O     
477  C CB    . THR A 70  ? 0.7317 0.6722 0.7488 -0.0659 0.0020  -0.0154 67  THR A CB    
478  O OG1   . THR A 70  ? 0.6582 0.5913 0.6778 -0.0703 -0.0034 -0.0110 67  THR A OG1   
479  C CG2   . THR A 70  ? 0.6676 0.5882 0.6775 -0.0606 0.0018  -0.0198 67  THR A CG2   
480  N N     . GLY A 71  ? 0.7127 0.7065 0.7403 -0.0750 0.0127  -0.0152 68  GLY A N     
481  C CA    . GLY A 71  ? 0.6448 0.6613 0.6810 -0.0812 0.0178  -0.0165 68  GLY A CA    
482  C C     . GLY A 71  ? 0.7044 0.7227 0.7539 -0.0815 0.0163  -0.0199 68  GLY A C     
483  O O     . GLY A 71  ? 0.8592 0.8616 0.9085 -0.0799 0.0095  -0.0177 68  GLY A O     
484  N N     . ARG A 72  ? 0.7056 0.7455 0.7677 -0.0832 0.0225  -0.0267 69  ARG A N     
485  C CA    . ARG A 72  ? 0.7007 0.7493 0.7792 -0.0835 0.0204  -0.0306 69  ARG A CA    
486  C C     . ARG A 72  ? 0.6344 0.6675 0.7146 -0.0719 0.0143  -0.0341 69  ARG A C     
487  O O     . ARG A 72  ? 0.8129 0.8377 0.8943 -0.0712 0.0059  -0.0319 69  ARG A O     
488  C CB    . ARG A 72  ? 0.6312 0.7069 0.7249 -0.0868 0.0295  -0.0386 69  ARG A CB    
489  C CG    . ARG A 72  ? 0.6311 0.7222 0.7455 -0.0887 0.0277  -0.0436 69  ARG A CG    
490  C CD    . ARG A 72  ? 0.6248 0.7322 0.7574 -0.0816 0.0335  -0.0547 69  ARG A CD    
491  N NE    . ARG A 72  ? 0.7630 0.8864 0.8954 -0.0877 0.0458  -0.0594 69  ARG A NE    
492  C CZ    . ARG A 72  ? 0.7722 0.9010 0.9117 -0.0811 0.0537  -0.0684 69  ARG A CZ    
493  N NH1   . ARG A 72  ? 0.7113 0.8270 0.8568 -0.0672 0.0509  -0.0717 69  ARG A NH1   
494  N NH2   . ARG A 72  ? 0.8689 1.0149 1.0079 -0.0886 0.0651  -0.0741 69  ARG A NH2   
495  N N     . GLU A 73  ? 0.7106 0.7388 0.7893 -0.0631 0.0192  -0.0399 70  GLU A N     
496  C CA    . GLU A 73  ? 0.7387 0.7511 0.8170 -0.0513 0.0152  -0.0424 70  GLU A CA    
497  C C     . GLU A 73  ? 0.7587 0.7429 0.8190 -0.0485 0.0087  -0.0375 70  GLU A C     
498  O O     . GLU A 73  ? 0.8518 0.8239 0.9087 -0.0426 0.0008  -0.0363 70  GLU A O     
499  C CB    . GLU A 73  ? 0.6341 0.6462 0.7158 -0.0436 0.0254  -0.0502 70  GLU A CB    
500  C CG    . GLU A 73  ? 0.8456 0.8840 0.9484 -0.0442 0.0318  -0.0571 70  GLU A CG    
501  C CD    . GLU A 73  ? 0.8699 0.9172 0.9879 -0.0387 0.0233  -0.0572 70  GLU A CD    
502  O OE1   . GLU A 73  ? 0.8753 0.9050 0.9882 -0.0267 0.0166  -0.0555 70  GLU A OE1   
503  O OE2   . GLU A 73  ? 0.7468 0.8193 0.8811 -0.0465 0.0233  -0.0597 70  GLU A OE2   
504  N N     . ALA A 74  ? 0.7101 0.6849 0.7587 -0.0523 0.0116  -0.0356 71  ALA A N     
505  C CA    . ALA A 74  ? 0.6937 0.6424 0.7275 -0.0503 0.0069  -0.0328 71  ALA A CA    
506  C C     . ALA A 74  ? 0.8404 0.7848 0.8734 -0.0559 -0.0026 -0.0265 71  ALA A C     
507  O O     . ALA A 74  ? 0.9276 0.8523 0.9511 -0.0535 -0.0081 -0.0258 71  ALA A O     
508  C CB    . ALA A 74  ? 0.6622 0.6059 0.6883 -0.0522 0.0122  -0.0342 71  ALA A CB    
509  N N     . THR A 75  ? 0.7834 0.7454 0.8255 -0.0644 -0.0033 -0.0228 72  THR A N     
510  C CA    . THR A 75  ? 0.7497 0.7082 0.7937 -0.0712 -0.0102 -0.0188 72  THR A CA    
511  C C     . THR A 75  ? 0.8020 0.7685 0.8555 -0.0681 -0.0167 -0.0234 72  THR A C     
512  O O     . THR A 75  ? 0.8669 0.8233 0.9170 -0.0692 -0.0241 -0.0235 72  THR A O     
513  C CB    . THR A 75  ? 0.6966 0.6686 0.7459 -0.0823 -0.0065 -0.0136 72  THR A CB    
514  O OG1   . THR A 75  ? 0.6711 0.6372 0.7098 -0.0827 -0.0024 -0.0084 72  THR A OG1   
515  C CG2   . THR A 75  ? 0.6682 0.6330 0.7195 -0.0909 -0.0108 -0.0104 72  THR A CG2   
516  N N     . LEU A 76  ? 0.7289 0.7151 0.7954 -0.0638 -0.0144 -0.0282 73  LEU A N     
517  C CA    . LEU A 76  ? 0.8257 0.8234 0.9039 -0.0585 -0.0221 -0.0330 73  LEU A CA    
518  C C     . LEU A 76  ? 0.7749 0.7512 0.8385 -0.0467 -0.0292 -0.0330 73  LEU A C     
519  O O     . LEU A 76  ? 0.8057 0.7824 0.8694 -0.0451 -0.0395 -0.0345 73  LEU A O     
520  C CB    . LEU A 76  ? 0.7316 0.7538 0.8284 -0.0544 -0.0174 -0.0387 73  LEU A CB    
521  C CG    . LEU A 76  ? 0.7399 0.7747 0.8500 -0.0457 -0.0275 -0.0439 73  LEU A CG    
522  C CD1   . LEU A 76  ? 0.7372 0.8022 0.8710 -0.0558 -0.0291 -0.0498 73  LEU A CD1   
523  C CD2   . LEU A 76  ? 0.7464 0.7818 0.8608 -0.0302 -0.0255 -0.0469 73  LEU A CD2   
524  N N     . LEU A 77  ? 0.7818 0.7396 0.8320 -0.0392 -0.0230 -0.0322 74  LEU A N     
525  C CA    . LEU A 77  ? 0.7885 0.7219 0.8208 -0.0286 -0.0271 -0.0316 74  LEU A CA    
526  C C     . LEU A 77  ? 0.8884 0.8048 0.9064 -0.0337 -0.0343 -0.0295 74  LEU A C     
527  O O     . LEU A 77  ? 0.8271 0.7323 0.8333 -0.0271 -0.0424 -0.0295 74  LEU A O     
528  C CB    . LEU A 77  ? 0.6834 0.5980 0.7039 -0.0233 -0.0155 -0.0325 74  LEU A CB    
529  C CG    . LEU A 77  ? 0.7477 0.6722 0.7791 -0.0150 -0.0080 -0.0361 74  LEU A CG    
530  C CD1   . LEU A 77  ? 0.6760 0.5933 0.7038 -0.0171 0.0066  -0.0400 74  LEU A CD1   
531  C CD2   . LEU A 77  ? 0.7015 0.6111 0.7241 -0.0001 -0.0127 -0.0347 74  LEU A CD2   
532  N N     . LYS A 78  ? 0.7904 0.7043 0.8086 -0.0450 -0.0315 -0.0276 75  LYS A N     
533  C CA    . LYS A 78  ? 0.7502 0.6489 0.7586 -0.0511 -0.0370 -0.0270 75  LYS A CA    
534  C C     . LYS A 78  ? 0.7404 0.6555 0.7593 -0.0555 -0.0470 -0.0295 75  LYS A C     
535  O O     . LYS A 78  ? 0.8610 0.7669 0.8697 -0.0542 -0.0549 -0.0319 75  LYS A O     
536  C CB    . LYS A 78  ? 0.6873 0.5794 0.6960 -0.0605 -0.0311 -0.0239 75  LYS A CB    
537  C CG    . LYS A 78  ? 0.6874 0.5585 0.6828 -0.0570 -0.0243 -0.0243 75  LYS A CG    
538  C CD    . LYS A 78  ? 0.7443 0.5905 0.7226 -0.0548 -0.0270 -0.0271 75  LYS A CD    
539  C CE    . LYS A 78  ? 0.7369 0.5635 0.7053 -0.0538 -0.0188 -0.0297 75  LYS A CE    
540  N NZ    . LYS A 78  ? 0.9326 0.7335 0.8829 -0.0533 -0.0192 -0.0336 75  LYS A NZ    
541  N N     . ILE A 79  ? 0.7253 0.6661 0.7647 -0.0617 -0.0461 -0.0306 76  ILE A N     
542  C CA    . ILE A 79  ? 0.7689 0.7293 0.8225 -0.0676 -0.0540 -0.0359 76  ILE A CA    
543  C C     . ILE A 79  ? 0.7653 0.7359 0.8196 -0.0550 -0.0650 -0.0404 76  ILE A C     
544  O O     . ILE A 79  ? 0.7447 0.7194 0.7976 -0.0560 -0.0753 -0.0452 76  ILE A O     
545  C CB    . ILE A 79  ? 0.7521 0.7377 0.8277 -0.0776 -0.0481 -0.0372 76  ILE A CB    
546  C CG1   . ILE A 79  ? 0.7659 0.7388 0.8359 -0.0872 -0.0377 -0.0300 76  ILE A CG1   
547  C CG2   . ILE A 79  ? 0.7847 0.7901 0.8768 -0.0867 -0.0541 -0.0451 76  ILE A CG2   
548  C CD1   . ILE A 79  ? 0.6785 0.6720 0.7642 -0.0979 -0.0300 -0.0298 76  ILE A CD1   
549  N N     . ALA A 80  ? 0.7891 0.7638 0.8452 -0.0424 -0.0631 -0.0393 77  ALA A N     
550  C CA    . ALA A 80  ? 0.7107 0.6944 0.7680 -0.0275 -0.0737 -0.0419 77  ALA A CA    
551  C C     . ALA A 80  ? 0.8353 0.7932 0.8646 -0.0195 -0.0816 -0.0393 77  ALA A C     
552  O O     . ALA A 80  ? 0.8925 0.8576 0.9189 -0.0075 -0.0937 -0.0407 77  ALA A O     
553  C CB    . ALA A 80  ? 0.7065 0.6935 0.7702 -0.0155 -0.0670 -0.0404 77  ALA A CB    
554  N N     . ASN A 81  ? 0.7334 0.6620 0.7417 -0.0254 -0.0752 -0.0357 78  ASN A N     
555  C CA    . ASN A 81  ? 0.8405 0.7441 0.8209 -0.0206 -0.0811 -0.0345 78  ASN A CA    
556  C C     . ASN A 81  ? 0.8614 0.7795 0.8438 -0.0257 -0.0946 -0.0405 78  ASN A C     
557  O O     . ASN A 81  ? 0.7869 0.6969 0.7495 -0.0173 -0.1047 -0.0406 78  ASN A O     
558  C CB    . ASN A 81  ? 0.8474 0.7206 0.8103 -0.0282 -0.0701 -0.0324 78  ASN A CB    
559  C CG    . ASN A 81  ? 0.9075 0.7598 0.8583 -0.0200 -0.0586 -0.0287 78  ASN A CG    
560  O OD1   . ASN A 81  ? 0.9743 0.8255 0.9214 -0.0070 -0.0592 -0.0265 78  ASN A OD1   
561  N ND2   . ASN A 81  ? 0.8683 0.7040 0.8140 -0.0273 -0.0476 -0.0289 78  ASN A ND2   
562  N N     . LEU A 82  ? 0.8394 0.7787 0.8442 -0.0399 -0.0945 -0.0459 79  LEU A N     
563  C CA    . LEU A 82  ? 0.8219 0.7757 0.8314 -0.0483 -0.1047 -0.0543 79  LEU A CA    
564  C C     . LEU A 82  ? 0.8420 0.8364 0.8825 -0.0512 -0.1114 -0.0627 79  LEU A C     
565  O O     . LEU A 82  ? 0.9447 0.9583 0.9889 -0.0506 -0.1245 -0.0713 79  LEU A O     
566  C CB    . LEU A 82  ? 0.7589 0.6969 0.7665 -0.0659 -0.0965 -0.0560 79  LEU A CB    
567  C CG    . LEU A 82  ? 0.8422 0.7428 0.8220 -0.0656 -0.0908 -0.0518 79  LEU A CG    
568  C CD1   . LEU A 82  ? 0.7684 0.6577 0.7510 -0.0821 -0.0848 -0.0556 79  LEU A CD1   
569  C CD2   . LEU A 82  ? 0.9349 0.8251 0.8886 -0.0549 -0.1010 -0.0528 79  LEU A CD2   
570  N N     . TYR A 83  ? 0.8193 0.8294 0.8826 -0.0550 -0.1028 -0.0620 80  TYR A N     
571  C CA    . TYR A 83  ? 0.8028 0.8500 0.8976 -0.0632 -0.1050 -0.0720 80  TYR A CA    
572  C C     . TYR A 83  ? 0.7833 0.8547 0.8973 -0.0511 -0.1062 -0.0729 80  TYR A C     
573  O O     . TYR A 83  ? 0.7685 0.8256 0.8727 -0.0388 -0.1018 -0.0648 80  TYR A O     
574  C CB    . TYR A 83  ? 0.8025 0.8478 0.9092 -0.0835 -0.0910 -0.0723 80  TYR A CB    
575  C CG    . TYR A 83  ? 0.8578 0.8789 0.9498 -0.0956 -0.0882 -0.0721 80  TYR A CG    
576  C CD1   . TYR A 83  ? 0.8235 0.8568 0.9219 -0.1048 -0.0954 -0.0837 80  TYR A CD1   
577  C CD2   . TYR A 83  ? 0.8596 0.8473 0.9334 -0.0977 -0.0783 -0.0618 80  TYR A CD2   
578  C CE1   . TYR A 83  ? 0.8059 0.8164 0.8926 -0.1165 -0.0914 -0.0849 80  TYR A CE1   
579  C CE2   . TYR A 83  ? 0.8440 0.8093 0.9070 -0.1079 -0.0753 -0.0624 80  TYR A CE2   
580  C CZ    . TYR A 83  ? 0.9026 0.8782 0.9720 -0.1175 -0.0812 -0.0738 80  TYR A CZ    
581  O OH    . TYR A 83  ? 1.0303 0.9828 1.0905 -0.1283 -0.0767 -0.0757 80  TYR A OH    
582  N N     . TRP A 84  ? 0.8109 0.9202 0.9547 -0.0558 -0.1111 -0.0849 81  TRP A N     
583  C CA    . TRP A 84  ? 0.7743 0.9119 0.9445 -0.0486 -0.1096 -0.0891 81  TRP A CA    
584  C C     . TRP A 84  ? 0.7703 0.9430 0.9736 -0.0658 -0.1059 -0.1030 81  TRP A C     
585  O O     . TRP A 84  ? 0.8027 0.9895 1.0132 -0.0749 -0.1130 -0.1134 81  TRP A O     
586  C CB    . TRP A 84  ? 0.7820 0.9333 0.9541 -0.0251 -0.1257 -0.0909 81  TRP A CB    
587  C CG    . TRP A 84  ? 0.7591 0.9391 0.9614 -0.0172 -0.1231 -0.0962 81  TRP A CG    
588  C CD1   . TRP A 84  ? 0.7375 0.9060 0.9381 -0.0062 -0.1143 -0.0889 81  TRP A CD1   
589  C CD2   . TRP A 84  ? 0.7837 1.0099 1.0251 -0.0213 -0.1275 -0.1123 81  TRP A CD2   
590  N NE1   . TRP A 84  ? 0.7010 0.9046 0.9366 -0.0025 -0.1132 -0.0988 81  TRP A NE1   
591  C CE2   . TRP A 84  ? 0.7475 0.9875 1.0092 -0.0114 -0.1213 -0.1133 81  TRP A CE2   
592  C CE3   . TRP A 84  ? 0.8213 1.0798 1.0843 -0.0330 -0.1351 -0.1278 81  TRP A CE3   
593  C CZ2   . TRP A 84  ? 0.7529 1.0377 1.0559 -0.0125 -0.1226 -0.1291 81  TRP A CZ2   
594  C CZ3   . TRP A 84  ? 0.7724 1.0763 1.0767 -0.0346 -0.1363 -0.1439 81  TRP A CZ3   
595  C CH2   . TRP A 84  ? 0.7773 1.0941 1.1014 -0.0241 -0.1303 -0.1443 81  TRP A CH2   
596  N N     . TRP A 85  ? 0.6925 0.8794 0.9156 -0.0713 -0.0935 -0.1045 82  TRP A N     
597  C CA    . TRP A 85  ? 0.7209 0.9436 0.9778 -0.0868 -0.0880 -0.1191 82  TRP A CA    
598  C C     . TRP A 85  ? 0.7241 0.9629 0.9999 -0.0844 -0.0773 -0.1203 82  TRP A C     
599  O O     . TRP A 85  ? 0.7675 0.9857 1.0274 -0.0746 -0.0719 -0.1088 82  TRP A O     
600  C CB    . TRP A 85  ? 0.6914 0.9008 0.9438 -0.1117 -0.0753 -0.1193 82  TRP A CB    
601  C CG    . TRP A 85  ? 0.7884 0.9671 1.0217 -0.1204 -0.0584 -0.1047 82  TRP A CG    
602  C CD1   . TRP A 85  ? 0.8127 0.9986 1.0555 -0.1291 -0.0434 -0.1033 82  TRP A CD1   
603  C CD2   . TRP A 85  ? 0.7697 0.9077 0.9714 -0.1215 -0.0553 -0.0906 82  TRP A CD2   
604  N NE1   . TRP A 85  ? 0.7857 0.9387 1.0030 -0.1341 -0.0327 -0.0882 82  TRP A NE1   
605  C CE2   . TRP A 85  ? 0.7582 0.8821 0.9520 -0.1291 -0.0399 -0.0806 82  TRP A CE2   
606  C CE3   . TRP A 85  ? 0.7549 0.8682 0.9345 -0.1165 -0.0641 -0.0863 82  TRP A CE3   
607  C CZ2   . TRP A 85  ? 0.7140 0.8021 0.8809 -0.1304 -0.0345 -0.0666 82  TRP A CZ2   
608  C CZ3   . TRP A 85  ? 0.7573 0.8340 0.9117 -0.1191 -0.0569 -0.0733 82  TRP A CZ3   
609  C CH2   . TRP A 85  ? 0.7934 0.8587 0.9428 -0.1251 -0.0430 -0.0637 82  TRP A CH2   
610  N N     . PRO A 86  ? 0.7378 1.0149 1.0487 -0.0934 -0.0736 -0.1359 83  PRO A N     
611  C CA    . PRO A 86  ? 0.6964 0.9915 1.0274 -0.0914 -0.0629 -0.1392 83  PRO A CA    
612  C C     . PRO A 86  ? 0.6596 0.9290 0.9713 -0.1040 -0.0435 -0.1270 83  PRO A C     
613  O O     . PRO A 86  ? 0.7700 1.0257 1.0713 -0.1234 -0.0331 -0.1235 83  PRO A O     
614  C CB    . PRO A 86  ? 0.6650 1.0048 1.0366 -0.1045 -0.0604 -0.1604 83  PRO A CB    
615  C CG    . PRO A 86  ? 0.7981 1.1512 1.1751 -0.1020 -0.0778 -0.1696 83  PRO A CG    
616  C CD    . PRO A 86  ? 0.7804 1.0905 1.1176 -0.1041 -0.0801 -0.1541 83  PRO A CD    
617  N N     . ASN A 87  ? 0.6527 0.9152 0.9593 -0.0920 -0.0389 -0.1206 84  ASN A N     
618  C CA    . ASN A 87  ? 0.7199 0.9665 1.0118 -0.1020 -0.0213 -0.1118 84  ASN A CA    
619  C C     . ASN A 87  ? 0.7556 0.9637 1.0119 -0.1089 -0.0187 -0.0963 84  ASN A C     
620  O O     . ASN A 87  ? 0.7597 0.9595 1.0076 -0.1269 -0.0071 -0.0922 84  ASN A O     
621  C CB    . ASN A 87  ? 0.7188 0.9916 1.0334 -0.1219 -0.0059 -0.1224 84  ASN A CB    
622  C CG    . ASN A 87  ? 0.7314 1.0457 1.0862 -0.1157 -0.0080 -0.1404 84  ASN A CG    
623  O OD1   . ASN A 87  ? 0.8314 1.1520 1.1944 -0.0989 -0.0102 -0.1416 84  ASN A OD1   
624  N ND2   . ASN A 87  ? 0.6961 1.0392 1.0779 -0.1293 -0.0067 -0.1557 84  ASN A ND2   
625  N N     . MET A 88  ? 0.7796 0.9629 1.0145 -0.0939 -0.0292 -0.0877 85  MET A N     
626  C CA    . MET A 88  ? 0.7204 0.8681 0.9243 -0.0984 -0.0278 -0.0748 85  MET A CA    
627  C C     . MET A 88  ? 0.7248 0.8594 0.9139 -0.1047 -0.0137 -0.0657 85  MET A C     
628  O O     . MET A 88  ? 0.7366 0.8564 0.9121 -0.1178 -0.0068 -0.0585 85  MET A O     
629  C CB    . MET A 88  ? 0.7506 0.8755 0.9351 -0.0812 -0.0398 -0.0691 85  MET A CB    
630  C CG    . MET A 88  ? 0.8485 0.9887 1.0447 -0.0700 -0.0556 -0.0774 85  MET A CG    
631  S SD    . MET A 88  ? 0.8812 0.9881 1.0458 -0.0555 -0.0683 -0.0693 85  MET A SD    
632  C CE    . MET A 88  ? 0.8873 0.9741 1.0371 -0.0746 -0.0650 -0.0660 85  MET A CE    
633  N N     . ARG A 89  ? 0.7173 0.8575 0.9088 -0.0949 -0.0093 -0.0664 86  ARG A N     
634  C CA    . ARG A 89  ? 0.6868 0.8180 0.8637 -0.0998 0.0029  -0.0595 86  ARG A CA    
635  C C     . ARG A 89  ? 0.7162 0.8600 0.8973 -0.1188 0.0148  -0.0598 86  ARG A C     
636  O O     . ARG A 89  ? 0.7949 0.9249 0.9559 -0.1258 0.0223  -0.0504 86  ARG A O     
637  C CB    . ARG A 89  ? 0.7004 0.8405 0.8845 -0.0881 0.0073  -0.0642 86  ARG A CB    
638  C CG    . ARG A 89  ? 0.6352 0.7526 0.8053 -0.0708 0.0006  -0.0605 86  ARG A CG    
639  C CD    . ARG A 89  ? 0.6994 0.8260 0.8808 -0.0600 0.0070  -0.0668 86  ARG A CD    
640  N NE    . ARG A 89  ? 0.8070 0.9074 0.9715 -0.0458 0.0054  -0.0629 86  ARG A NE    
641  C CZ    . ARG A 89  ? 0.7301 0.8198 0.8941 -0.0302 -0.0037 -0.0628 86  ARG A CZ    
642  N NH1   . ARG A 89  ? 0.6467 0.7532 0.8278 -0.0253 -0.0146 -0.0669 86  ARG A NH1   
643  N NH2   . ARG A 89  ? 0.6487 0.7111 0.7943 -0.0194 -0.0019 -0.0590 86  ARG A NH2   
644  N N     . LYS A 90  ? 0.6696 0.8396 0.8758 -0.1273 0.0172  -0.0707 87  LYS A N     
645  C CA    . LYS A 90  ? 0.6911 0.8696 0.8992 -0.1475 0.0305  -0.0711 87  LYS A CA    
646  C C     . LYS A 90  ? 0.7758 0.9263 0.9610 -0.1577 0.0314  -0.0590 87  LYS A C     
647  O O     . LYS A 90  ? 0.8791 1.0176 1.0455 -0.1678 0.0418  -0.0493 87  LYS A O     
648  C CB    . LYS A 90  ? 0.7702 0.9814 1.0119 -0.1557 0.0328  -0.0875 87  LYS A CB    
649  C CG    . LYS A 90  ? 0.9208 1.1424 1.1655 -0.1778 0.0504  -0.0901 87  LYS A CG    
650  C CD    . LYS A 90  ? 1.0392 1.2901 1.3172 -0.1891 0.0531  -0.1076 87  LYS A CD    
651  C CE    . LYS A 90  ? 1.1270 1.3827 1.4037 -0.2133 0.0735  -0.1095 87  LYS A CE    
652  N NZ    . LYS A 90  ? 1.1770 1.4623 1.4882 -0.2271 0.0787  -0.1290 87  LYS A NZ    
653  N N     . ASP A 91  ? 0.8044 0.9434 0.9900 -0.1545 0.0205  -0.0594 88  ASP A N     
654  C CA    . ASP A 91  ? 0.8155 0.9257 0.9815 -0.1631 0.0216  -0.0489 88  ASP A CA    
655  C C     . ASP A 91  ? 0.7867 0.8683 0.9243 -0.1538 0.0195  -0.0343 88  ASP A C     
656  O O     . ASP A 91  ? 0.7900 0.8479 0.9090 -0.1606 0.0239  -0.0230 88  ASP A O     
657  C CB    . ASP A 91  ? 0.8524 0.9604 1.0277 -0.1625 0.0108  -0.0559 88  ASP A CB    
658  C CG    . ASP A 91  ? 0.9691 1.1065 1.1736 -0.1747 0.0136  -0.0719 88  ASP A CG    
659  O OD1   . ASP A 91  ? 1.0515 1.1913 1.2593 -0.1927 0.0280  -0.0726 88  ASP A OD1   
660  O OD2   . ASP A 91  ? 1.0027 1.1610 1.2264 -0.1662 0.0016  -0.0841 88  ASP A OD2   
661  N N     . VAL A 92  ? 0.6751 0.7582 0.8099 -0.1380 0.0134  -0.0350 89  VAL A N     
662  C CA    . VAL A 92  ? 0.6737 0.7336 0.7849 -0.1297 0.0121  -0.0244 89  VAL A CA    
663  C C     . VAL A 92  ? 0.7443 0.8075 0.8439 -0.1356 0.0229  -0.0177 89  VAL A C     
664  O O     . VAL A 92  ? 0.8104 0.8539 0.8897 -0.1374 0.0244  -0.0062 89  VAL A O     
665  C CB    . VAL A 92  ? 0.6605 0.7194 0.7721 -0.1127 0.0048  -0.0287 89  VAL A CB    
666  C CG1   . VAL A 92  ? 0.7193 0.7602 0.8104 -0.1060 0.0064  -0.0212 89  VAL A CG1   
667  C CG2   . VAL A 92  ? 0.6615 0.7113 0.7758 -0.1063 -0.0069 -0.0322 89  VAL A CG2   
668  N N     . VAL A 93  ? 0.6863 0.7751 0.7984 -0.1381 0.0301  -0.0252 90  VAL A N     
669  C CA    . VAL A 93  ? 0.6805 0.7760 0.7805 -0.1454 0.0409  -0.0204 90  VAL A CA    
670  C C     . VAL A 93  ? 0.7771 0.8619 0.8648 -0.1607 0.0481  -0.0108 90  VAL A C     
671  O O     . VAL A 93  ? 0.7534 0.8293 0.8187 -0.1640 0.0531  0.0002  90  VAL A O     
672  C CB    . VAL A 93  ? 0.6717 0.7982 0.7911 -0.1473 0.0487  -0.0331 90  VAL A CB    
673  C CG1   . VAL A 93  ? 0.6823 0.8180 0.7877 -0.1571 0.0608  -0.0294 90  VAL A CG1   
674  C CG2   . VAL A 93  ? 0.6541 0.7854 0.7830 -0.1310 0.0433  -0.0408 90  VAL A CG2   
675  N N     . LYS A 94  ? 0.7101 0.7950 0.8114 -0.1702 0.0490  -0.0150 91  LYS A N     
676  C CA    . LYS A 94  ? 0.7394 0.8096 0.8290 -0.1859 0.0583  -0.0063 91  LYS A CA    
677  C C     . LYS A 94  ? 0.7776 0.8133 0.8414 -0.1813 0.0540  0.0101  91  LYS A C     
678  O O     . LYS A 94  ? 0.9502 0.9705 0.9926 -0.1884 0.0619  0.0232  91  LYS A O     
679  C CB    . LYS A 94  ? 0.7722 0.8500 0.8848 -0.1970 0.0602  -0.0173 91  LYS A CB    
680  C CG    . LYS A 94  ? 0.9288 0.9913 1.0323 -0.2161 0.0738  -0.0110 91  LYS A CG    
681  C CD    . LYS A 94  ? 1.0421 1.1206 1.1739 -0.2294 0.0781  -0.0271 91  LYS A CD    
682  C CE    . LYS A 94  ? 1.2396 1.2984 1.3617 -0.2501 0.0944  -0.0214 91  LYS A CE    
683  N NZ    . LYS A 94  ? 1.2569 1.3364 1.4095 -0.2660 0.1015  -0.0406 91  LYS A NZ    
684  N N     . GLN A 95  ? 0.8234 0.8461 0.8880 -0.1687 0.0418  0.0098  92  GLN A N     
685  C CA    . GLN A 95  ? 0.9274 0.9190 0.9716 -0.1631 0.0375  0.0233  92  GLN A CA    
686  C C     . GLN A 95  ? 1.0137 1.0038 1.0388 -0.1530 0.0357  0.0318  92  GLN A C     
687  O O     . GLN A 95  ? 1.0439 1.0137 1.0488 -0.1519 0.0363  0.0457  92  GLN A O     
688  C CB    . GLN A 95  ? 1.0095 0.9888 1.0611 -0.1546 0.0263  0.0181  92  GLN A CB    
689  C CG    . GLN A 95  ? 1.1996 1.1686 1.2608 -0.1656 0.0280  0.0146  92  GLN A CG    
690  C CD    . GLN A 95  ? 1.3112 1.2534 1.3572 -0.1753 0.0369  0.0280  92  GLN A CD    
691  O OE1   . GLN A 95  ? 1.3742 1.2919 1.4034 -0.1676 0.0340  0.0396  92  GLN A OE1   
692  N NE2   . GLN A 95  ? 1.2541 1.1999 1.3061 -0.1919 0.0486  0.0261  92  GLN A NE2   
693  N N     . LEU A 96  ? 0.9608 0.9726 0.9927 -0.1452 0.0336  0.0231  93  LEU A N     
694  C CA    . LEU A 96  ? 0.8335 0.8484 0.8499 -0.1366 0.0323  0.0275  93  LEU A CA    
695  C C     . LEU A 96  ? 0.8615 0.8804 0.8595 -0.1450 0.0407  0.0377  93  LEU A C     
696  O O     . LEU A 96  ? 0.9407 0.9519 0.9186 -0.1389 0.0378  0.0478  93  LEU A O     
697  C CB    . LEU A 96  ? 0.7011 0.7386 0.7307 -0.1293 0.0318  0.0139  93  LEU A CB    
698  C CG    . LEU A 96  ? 0.8213 0.8533 0.8647 -0.1195 0.0240  0.0050  93  LEU A CG    
699  C CD1   . LEU A 96  ? 0.7507 0.8013 0.8046 -0.1123 0.0262  -0.0067 93  LEU A CD1   
700  C CD2   . LEU A 96  ? 0.7483 0.7549 0.7800 -0.1111 0.0163  0.0109  93  LEU A CD2   
701  N N     . GLY A 97  ? 0.7566 0.7880 0.7603 -0.1589 0.0510  0.0349  94  GLY A N     
702  C CA    . GLY A 97  ? 0.7835 0.8160 0.7662 -0.1688 0.0608  0.0451  94  GLY A CA    
703  C C     . GLY A 97  ? 0.8907 0.8914 0.8527 -0.1736 0.0630  0.0627  94  GLY A C     
704  O O     . GLY A 97  ? 0.9372 0.9328 0.8749 -0.1796 0.0702  0.0749  94  GLY A O     
705  N N     . ARG A 98  ? 0.8412 0.8191 0.8111 -0.1712 0.0578  0.0644  95  ARG A N     
706  C CA    . ARG A 98  ? 0.8482 0.7918 0.8008 -0.1744 0.0605  0.0806  95  ARG A CA    
707  C C     . ARG A 98  ? 0.8787 0.8010 0.8215 -0.1581 0.0484  0.0896  95  ARG A C     
708  O O     . ARG A 98  ? 0.9397 0.8313 0.8682 -0.1578 0.0498  0.1041  95  ARG A O     
709  C CB    . ARG A 98  ? 0.9831 0.9157 0.9535 -0.1873 0.0667  0.0742  95  ARG A CB    
710  C CG    . ARG A 98  ? 1.1208 1.0747 1.1047 -0.2048 0.0798  0.0634  95  ARG A CG    
711  C CD    . ARG A 98  ? 1.2567 1.1992 1.2575 -0.2183 0.0864  0.0566  95  ARG A CD    
712  N NE    . ARG A 98  ? 1.3575 1.3275 1.3799 -0.2338 0.0968  0.0407  95  ARG A NE    
713  C CZ    . ARG A 98  ? 1.4977 1.4655 1.5123 -0.2518 0.1144  0.0432  95  ARG A CZ    
714  N NH1   . ARG A 98  ? 1.5450 1.4816 1.5271 -0.2558 0.1232  0.0632  95  ARG A NH1   
715  N NH2   . ARG A 98  ? 1.5245 1.5211 1.5637 -0.2655 0.1236  0.0255  95  ARG A NH2   
716  N N     . CYS A 99  ? 0.8196 0.7561 0.7709 -0.1447 0.0378  0.0808  96  CYS A N     
717  C CA    . CYS A 99  ? 0.8890 0.8087 0.8339 -0.1297 0.0271  0.0864  96  CYS A CA    
718  C C     . CYS A 99  ? 0.9760 0.9000 0.8977 -0.1215 0.0243  0.0980  96  CYS A C     
719  O O     . CYS A 99  ? 0.9848 0.9358 0.9059 -0.1175 0.0225  0.0906  96  CYS A O     
720  C CB    . CYS A 99  ? 0.7838 0.7154 0.7469 -0.1204 0.0190  0.0708  96  CYS A CB    
721  S SG    . CYS A 99  ? 0.9354 0.8472 0.8947 -0.1041 0.0079  0.0739  96  CYS A SG    
722  N N     . GLN A 100 ? 0.9421 0.8396 0.8446 -0.1185 0.0240  0.1159  97  GLN A N     
723  C CA    . GLN A 100 ? 0.8920 0.7935 0.7692 -0.1096 0.0199  0.1290  97  GLN A CA    
724  C C     . GLN A 100 ? 1.0253 0.9419 0.9076 -0.0926 0.0069  0.1217  97  GLN A C     
725  O O     . GLN A 100 ? 0.8713 0.8125 0.7426 -0.0875 0.0035  0.1205  97  GLN A O     
726  C CB    . GLN A 100 ? 0.9760 0.8412 0.8312 -0.1079 0.0220  0.1513  97  GLN A CB    
727  C CG    . GLN A 100 ? 1.1962 1.0642 1.0184 -0.1020 0.0203  0.1684  97  GLN A CG    
728  C CD    . GLN A 100 ? 1.3658 1.2474 1.1724 -0.1185 0.0333  0.1703  97  GLN A CD    
729  O OE1   . GLN A 100 ? 1.3690 1.2614 1.1933 -0.1338 0.0434  0.1571  97  GLN A OE1   
730  N NE2   . GLN A 100 ? 1.4134 1.2955 1.1866 -0.1150 0.0329  0.1863  97  GLN A NE2   
731  N N     . GLN A 101 ? 0.8975 0.8011 0.7968 -0.0849 0.0006  0.1149  98  GLN A N     
732  C CA    . GLN A 101 ? 0.8606 0.7772 0.7666 -0.0701 -0.0098 0.1061  98  GLN A CA    
733  C C     . GLN A 101 ? 0.8375 0.7883 0.7543 -0.0719 -0.0085 0.0878  98  GLN A C     
734  O O     . GLN A 101 ? 0.8225 0.7947 0.7364 -0.0632 -0.0139 0.0821  98  GLN A O     
735  C CB    . GLN A 101 ? 0.9061 0.8007 0.8286 -0.0642 -0.0141 0.1006  98  GLN A CB    
736  C CG    . GLN A 101 ? 1.0412 0.8997 0.9568 -0.0623 -0.0141 0.1165  98  GLN A CG    
737  C CD    . GLN A 101 ? 1.0905 0.9292 1.0141 -0.0769 -0.0049 0.1159  98  GLN A CD    
738  O OE1   . GLN A 101 ? 1.0978 0.9384 1.0145 -0.0897 0.0038  0.1207  98  GLN A OE1   
739  N NE2   . GLN A 101 ? 1.0389 0.8603 0.9779 -0.0761 -0.0064 0.1082  98  GLN A NE2   
740  N N     . CYS A 102 ? 0.8592 0.6345 0.6853 -0.2195 -0.0009 -0.0175 99  CYS A N     
741  C CA    . CYS A 102 ? 0.9351 0.7444 0.7857 -0.2112 0.0012  -0.0167 99  CYS A CA    
742  C C     . CYS A 102 ? 0.8677 0.6976 0.7349 -0.2124 0.0044  -0.0127 99  CYS A C     
743  O O     . CYS A 102 ? 0.7861 0.6311 0.6684 -0.2002 0.0081  -0.0114 99  CYS A O     
744  C CB    . CYS A 102 ? 0.8228 0.6532 0.6803 -0.2184 -0.0040 -0.0189 99  CYS A CB    
745  S SG    . CYS A 102 ? 0.9828 0.8036 0.8317 -0.2086 -0.0060 -0.0231 99  CYS A SG    
746  N N     . LEU A 103 ? 0.9225 0.7528 0.7860 -0.2276 0.0029  -0.0106 100 LEU A N     
747  C CA    . LEU A 103 ? 0.8047 0.6575 0.6837 -0.2300 0.0059  -0.0070 100 LEU A CA    
748  C C     . LEU A 103 ? 0.8833 0.7230 0.7613 -0.2184 0.0112  -0.0044 100 LEU A C     
749  O O     . LEU A 103 ? 0.8035 0.6648 0.6984 -0.2129 0.0145  -0.0024 100 LEU A O     
750  C CB    . LEU A 103 ? 0.8219 0.6767 0.6944 -0.2506 0.0033  -0.0051 100 LEU A CB    
751  C CG    . LEU A 103 ? 0.8236 0.7014 0.7018 -0.2645 -0.0018 -0.0072 100 LEU A CG    
752  C CD1   . LEU A 103 ? 0.8458 0.7199 0.7133 -0.2864 -0.0040 -0.0047 100 LEU A CD1   
753  C CD2   . LEU A 103 ? 0.7931 0.7142 0.6981 -0.2583 -0.0012 -0.0080 100 LEU A CD2   
754  N N     . ILE A 104 ? 0.8401 0.6449 0.6983 -0.2139 0.0117  -0.0048 101 ILE A N     
755  C CA    . ILE A 104 ? 0.8400 0.6319 0.6961 -0.2030 0.0161  -0.0024 101 ILE A CA    
756  C C     . ILE A 104 ? 0.8983 0.6907 0.7604 -0.1842 0.0194  -0.0043 101 ILE A C     
757  O O     . ILE A 104 ? 0.9451 0.7350 0.8107 -0.1739 0.0233  -0.0025 101 ILE A O     
758  C CB    . ILE A 104 ? 0.8515 0.6049 0.6816 -0.2078 0.0146  -0.0014 101 ILE A CB    
759  C CG1   . ILE A 104 ? 0.8909 0.6167 0.7016 -0.2046 0.0115  -0.0059 101 ILE A CG1   
760  C CG2   . ILE A 104 ? 0.8677 0.6204 0.6911 -0.2280 0.0117  0.0017  101 ILE A CG2   
761  C CD1   . ILE A 104 ? 0.9110 0.5956 0.6935 -0.2089 0.0087  -0.0057 101 ILE A CD1   
762  N N     . THR A 105 ? 0.9159 0.7122 0.7792 -0.1800 0.0178  -0.0078 102 THR A N     
763  C CA    . THR A 105 ? 0.7876 0.5838 0.6546 -0.1640 0.0210  -0.0094 102 THR A CA    
764  C C     . THR A 105 ? 0.7592 0.5859 0.6478 -0.1586 0.0219  -0.0089 102 THR A C     
765  O O     . THR A 105 ? 0.8443 0.6770 0.7413 -0.1468 0.0256  -0.0081 102 THR A O     
766  C CB    . THR A 105 ? 0.8548 0.6305 0.7047 -0.1615 0.0190  -0.0135 102 THR A CB    
767  O OG1   . THR A 105 ? 0.9430 0.6873 0.7706 -0.1663 0.0171  -0.0145 102 THR A OG1   
768  C CG2   . THR A 105 ? 0.7973 0.5726 0.6492 -0.1455 0.0230  -0.0150 102 THR A CG2   
769  N N     . ASN A 106 ? 0.7530 0.5988 0.6501 -0.1669 0.0182  -0.0095 103 ASN A N     
770  C CA    . ASN A 106 ? 0.7991 0.6707 0.7141 -0.1608 0.0179  -0.0095 103 ASN A CA    
771  C C     . ASN A 106 ? 0.7539 0.6426 0.6850 -0.1557 0.0211  -0.0068 103 ASN A C     
772  O O     . ASN A 106 ? 0.7856 0.6731 0.7166 -0.1605 0.0228  -0.0047 103 ASN A O     
773  C CB    . ASN A 106 ? 0.7742 0.6637 0.6947 -0.1701 0.0125  -0.0110 103 ASN A CB    
774  C CG    . ASN A 106 ? 0.8012 0.6774 0.7080 -0.1730 0.0088  -0.0141 103 ASN A CG    
775  O OD1   . ASN A 106 ? 0.8234 0.6816 0.7195 -0.1654 0.0105  -0.0152 103 ASN A OD1   
776  N ND2   . ASN A 106 ? 0.7756 0.6625 0.6828 -0.1839 0.0036  -0.0156 103 ASN A ND2   
777  N N     . ALA A 107 ? 0.7705 0.6739 0.7139 -0.1463 0.0216  -0.0067 104 ALA A N     
778  C CA    . ALA A 107 ? 0.7649 0.6851 0.7236 -0.1408 0.0239  -0.0048 104 ALA A CA    
779  C C     . ALA A 107 ? 0.8035 0.7495 0.7753 -0.1464 0.0207  -0.0054 104 ALA A C     
780  O O     . ALA A 107 ? 0.9274 0.8815 0.8991 -0.1522 0.0162  -0.0073 104 ALA A O     
781  C CB    . ALA A 107 ? 0.6615 0.5841 0.6259 -0.1288 0.0254  -0.0045 104 ALA A CB    
782  N N     . SER A 108 ? 0.7759 0.7361 0.7591 -0.1442 0.0229  -0.0040 105 SER A N     
783  C CA    . SER A 108 ? 0.7610 0.7491 0.7584 -0.1464 0.0203  -0.0052 105 SER A CA    
784  C C     . SER A 108 ? 0.7233 0.7232 0.7303 -0.1356 0.0175  -0.0067 105 SER A C     
785  O O     . SER A 108 ? 0.8403 0.8287 0.8453 -0.1267 0.0189  -0.0058 105 SER A O     
786  C CB    . SER A 108 ? 0.7600 0.7586 0.7646 -0.1476 0.0238  -0.0035 105 SER A CB    
787  O OG    . SER A 108 ? 0.7821 0.8099 0.8001 -0.1497 0.0216  -0.0053 105 SER A OG    
788  N N     . ASN A 109 ? 0.7098 0.7328 0.7267 -0.1366 0.0130  -0.0090 106 ASN A N     
789  C CA    . ASN A 109 ? 0.7364 0.7708 0.7622 -0.1256 0.0094  -0.0106 106 ASN A CA    
790  C C     . ASN A 109 ? 0.6641 0.7261 0.7046 -0.1226 0.0082  -0.0126 106 ASN A C     
791  O O     . ASN A 109 ? 0.8047 0.8799 0.8525 -0.1144 0.0034  -0.0149 106 ASN A O     
792  C CB    . ASN A 109 ? 0.6850 0.7187 0.7065 -0.1254 0.0036  -0.0123 106 ASN A CB    
793  C CG    . ASN A 109 ? 0.7874 0.8362 0.8099 -0.1360 0.0001  -0.0145 106 ASN A CG    
794  O OD1   . ASN A 109 ? 0.8065 0.8687 0.8338 -0.1440 0.0019  -0.0147 106 ASN A OD1   
795  N ND2   . ASN A 109 ? 0.8573 0.9047 0.8749 -0.1368 -0.0052 -0.0160 106 ASN A ND2   
796  N N     . LYS A 110 ? 0.7154 0.7860 0.7595 -0.1288 0.0121  -0.0118 107 LYS A N     
797  C CA    . LYS A 110 ? 0.7860 0.8826 0.8434 -0.1252 0.0123  -0.0137 107 LYS A CA    
798  C C     . LYS A 110 ? 0.7515 0.8398 0.8094 -0.1210 0.0176  -0.0114 107 LYS A C     
799  O O     . LYS A 110 ? 0.7511 0.8243 0.8010 -0.1278 0.0221  -0.0083 107 LYS A O     
800  C CB    . LYS A 110 ? 0.8092 0.9285 0.8711 -0.1375 0.0123  -0.0149 107 LYS A CB    
801  C CG    . LYS A 110 ? 0.8166 0.9514 0.8810 -0.1413 0.0062  -0.0179 107 LYS A CG    
802  C CD    . LYS A 110 ? 1.0034 1.1227 1.0551 -0.1556 0.0061  -0.0162 107 LYS A CD    
803  C CE    . LYS A 110 ? 1.1460 1.2814 1.2001 -0.1598 -0.0004 -0.0193 107 LYS A CE    
804  N NZ    . LYS A 110 ? 1.2244 1.3523 1.2776 -0.1473 -0.0053 -0.0208 107 LYS A NZ    
805  N N     . ALA A 111 ? 0.7206 0.8178 0.7870 -0.1094 0.0166  -0.0131 108 ALA A N     
806  C CA    . ALA A 111 ? 0.6783 0.7692 0.7457 -0.1047 0.0210  -0.0114 108 ALA A CA    
807  C C     . ALA A 111 ? 0.6443 0.7544 0.7175 -0.1105 0.0244  -0.0117 108 ALA A C     
808  O O     . ALA A 111 ? 0.5847 0.7180 0.6641 -0.1160 0.0230  -0.0140 108 ALA A O     
809  C CB    . ALA A 111 ? 0.5636 0.6555 0.6363 -0.0910 0.0181  -0.0133 108 ALA A CB    
810  N N     . SER A 112 ? 0.8597 0.9609 0.9308 -0.1096 0.0291  -0.0092 109 SER A N     
811  C CA    . SER A 112 ? 0.6692 0.7878 0.7450 -0.1143 0.0325  -0.0091 109 SER A CA    
812  C C     . SER A 112 ? 0.7040 0.8483 0.7924 -0.1046 0.0304  -0.0137 109 SER A C     
813  O O     . SER A 112 ? 0.7948 0.9369 0.8865 -0.0928 0.0266  -0.0163 109 SER A O     
814  C CB    . SER A 112 ? 0.5971 0.6982 0.6661 -0.1148 0.0374  -0.0052 109 SER A CB    
815  O OG    . SER A 112 ? 0.8382 0.9142 0.8945 -0.1216 0.0388  -0.0015 109 SER A OG    
816  N N     . GLY A 113 ? 0.6223 0.7906 0.7166 -0.1097 0.0328  -0.0149 110 GLY A N     
817  C CA    . GLY A 113 ? 0.5460 0.7395 0.6513 -0.1000 0.0317  -0.0198 110 GLY A CA    
818  C C     . GLY A 113 ? 0.5490 0.7298 0.6534 -0.0897 0.0332  -0.0194 110 GLY A C     
819  O O     . GLY A 113 ? 0.5428 0.6996 0.6389 -0.0920 0.0361  -0.0150 110 GLY A O     
820  N N     . PRO A 114 ? 0.5775 0.7743 0.6899 -0.0778 0.0308  -0.0245 111 PRO A N     
821  C CA    . PRO A 114 ? 0.6358 0.8199 0.7468 -0.0680 0.0313  -0.0247 111 PRO A CA    
822  C C     . PRO A 114 ? 0.6284 0.8117 0.7365 -0.0740 0.0374  -0.0214 111 PRO A C     
823  O O     . PRO A 114 ? 0.6626 0.8623 0.7717 -0.0837 0.0411  -0.0204 111 PRO A O     
824  C CB    . PRO A 114 ? 0.6009 0.8056 0.7204 -0.0547 0.0269  -0.0318 111 PRO A CB    
825  C CG    . PRO A 114 ? 0.5302 0.7666 0.6574 -0.0596 0.0268  -0.0349 111 PRO A CG    
826  C CD    . PRO A 114 ? 0.5341 0.7617 0.6568 -0.0723 0.0271  -0.0307 111 PRO A CD    
827  N N     . ILE A 115 ? 0.5301 0.6939 0.6338 -0.0686 0.0383  -0.0196 112 ILE A N     
828  C CA    . ILE A 115 ? 0.7067 0.8651 0.8059 -0.0734 0.0435  -0.0159 112 ILE A CA    
829  C C     . ILE A 115 ? 0.6722 0.8553 0.7773 -0.0703 0.0453  -0.0196 112 ILE A C     
830  O O     . ILE A 115 ? 0.6917 0.8909 0.8039 -0.0604 0.0420  -0.0256 112 ILE A O     
831  C CB    . ILE A 115 ? 0.6905 0.8235 0.7843 -0.0680 0.0433  -0.0133 112 ILE A CB    
832  C CG1   . ILE A 115 ? 0.6965 0.8298 0.7944 -0.0552 0.0388  -0.0180 112 ILE A CG1   
833  C CG2   . ILE A 115 ? 0.5332 0.6437 0.6201 -0.0724 0.0430  -0.0094 112 ILE A CG2   
834  C CD1   . ILE A 115 ? 0.6076 0.7219 0.7012 -0.0509 0.0391  -0.0160 112 ILE A CD1   
835  N N     . LEU A 116 ? 0.7356 0.9209 0.8366 -0.0785 0.0503  -0.0160 113 LEU A N     
836  C CA    . LEU A 116 ? 0.7737 0.9800 0.8782 -0.0763 0.0529  -0.0186 113 LEU A CA    
837  C C     . LEU A 116 ? 0.6385 0.8307 0.7401 -0.0678 0.0529  -0.0185 113 LEU A C     
838  O O     . LEU A 116 ? 0.6494 0.8165 0.7444 -0.0686 0.0531  -0.0141 113 LEU A O     
839  C CB    . LEU A 116 ? 0.6872 0.9029 0.7870 -0.0907 0.0582  -0.0142 113 LEU A CB    
840  C CG    . LEU A 116 ? 0.6338 0.8658 0.7354 -0.1025 0.0587  -0.0137 113 LEU A CG    
841  C CD1   . LEU A 116 ? 0.5947 0.8269 0.6874 -0.1185 0.0636  -0.0077 113 LEU A CD1   
842  C CD2   . LEU A 116 ? 0.6337 0.9012 0.7476 -0.0967 0.0571  -0.0211 113 LEU A CD2   
843  N N     . ARG A 117 ? 0.6180 0.8273 0.7244 -0.0594 0.0525  -0.0238 114 ARG A N     
844  C CA    . ARG A 117 ? 0.5795 0.7780 0.6825 -0.0529 0.0528  -0.0238 114 ARG A CA    
845  C C     . ARG A 117 ? 0.5390 0.7545 0.6402 -0.0577 0.0577  -0.0231 114 ARG A C     
846  O O     . ARG A 117 ? 0.6425 0.8801 0.7486 -0.0512 0.0577  -0.0290 114 ARG A O     
847  C CB    . ARG A 117 ? 0.5867 0.7856 0.6937 -0.0383 0.0474  -0.0307 114 ARG A CB    
848  C CG    . ARG A 117 ? 0.5665 0.7497 0.6742 -0.0337 0.0419  -0.0314 114 ARG A CG    
849  C CD    . ARG A 117 ? 0.5221 0.6795 0.6237 -0.0407 0.0429  -0.0245 114 ARG A CD    
850  N NE    . ARG A 117 ? 0.6569 0.7987 0.7534 -0.0400 0.0443  -0.0215 114 ARG A NE    
851  C CZ    . ARG A 117 ? 0.6055 0.7324 0.7003 -0.0330 0.0407  -0.0227 114 ARG A CZ    
852  N NH1   . ARG A 117 ? 0.5828 0.7057 0.6791 -0.0260 0.0351  -0.0265 114 ARG A NH1   
853  N NH2   . ARG A 117 ? 0.5798 0.6956 0.6706 -0.0333 0.0421  -0.0200 114 ARG A NH2   
854  N N     . PRO A 118 ? 0.5489 0.7542 0.6422 -0.0686 0.0618  -0.0162 115 PRO A N     
855  C CA    . PRO A 118 ? 0.5781 0.7993 0.6680 -0.0754 0.0666  -0.0145 115 PRO A CA    
856  C C     . PRO A 118 ? 0.5676 0.7943 0.6578 -0.0657 0.0665  -0.0183 115 PRO A C     
857  O O     . PRO A 118 ? 0.5620 0.7717 0.6516 -0.0567 0.0633  -0.0195 115 PRO A O     
858  C CB    . PRO A 118 ? 0.5444 0.7433 0.6228 -0.0867 0.0691  -0.0058 115 PRO A CB    
859  C CG    . PRO A 118 ? 0.6286 0.7997 0.7052 -0.0813 0.0657  -0.0041 115 PRO A CG    
860  C CD    . PRO A 118 ? 0.6242 0.8017 0.7100 -0.0746 0.0618  -0.0096 115 PRO A CD    
861  N N     . ASP A 119 ? 0.6698 0.9215 0.7606 -0.0683 0.0701  -0.0202 116 ASP A N     
862  C CA    . ASP A 119 ? 0.6654 0.9255 0.7560 -0.0592 0.0702  -0.0246 116 ASP A CA    
863  C C     . ASP A 119 ? 0.6936 0.9285 0.7753 -0.0590 0.0702  -0.0196 116 ASP A C     
864  O O     . ASP A 119 ? 0.5534 0.7741 0.6268 -0.0690 0.0726  -0.0119 116 ASP A O     
865  C CB    . ASP A 119 ? 0.6901 0.9814 0.7808 -0.0647 0.0753  -0.0262 116 ASP A CB    
866  C CG    . ASP A 119 ? 0.8815 1.2044 0.9830 -0.0592 0.0746  -0.0343 116 ASP A CG    
867  O OD1   . ASP A 119 ? 1.0141 1.3352 1.1219 -0.0455 0.0694  -0.0411 116 ASP A OD1   
868  O OD2   . ASP A 119 ? 0.8467 1.1967 0.9500 -0.0685 0.0789  -0.0340 116 ASP A OD2   
869  N N     . ARG A 120 ? 0.6111 0.8400 0.6938 -0.0472 0.0668  -0.0242 117 ARG A N     
870  C CA    . ARG A 120 ? 0.5735 0.7839 0.6488 -0.0464 0.0666  -0.0204 117 ARG A CA    
871  C C     . ARG A 120 ? 0.6199 0.8416 0.6879 -0.0535 0.0715  -0.0170 117 ARG A C     
872  O O     . ARG A 120 ? 0.6863 0.9338 0.7565 -0.0531 0.0740  -0.0213 117 ARG A O     
873  C CB    . ARG A 120 ? 0.5767 0.7821 0.6541 -0.0335 0.0619  -0.0267 117 ARG A CB    
874  C CG    . ARG A 120 ? 0.6324 0.8196 0.7031 -0.0325 0.0609  -0.0232 117 ARG A CG    
875  C CD    . ARG A 120 ? 0.6506 0.8341 0.7224 -0.0213 0.0560  -0.0299 117 ARG A CD    
876  N NE    . ARG A 120 ? 0.6429 0.8144 0.7192 -0.0158 0.0509  -0.0329 117 ARG A NE    
877  C CZ    . ARG A 120 ? 0.6717 0.8219 0.7470 -0.0165 0.0481  -0.0295 117 ARG A CZ    
878  N NH1   . ARG A 120 ? 0.6542 0.7938 0.7251 -0.0212 0.0497  -0.0235 117 ARG A NH1   
879  N NH2   . ARG A 120 ? 0.6722 0.8124 0.7504 -0.0123 0.0435  -0.0321 117 ARG A NH2   
880  N N     . PRO A 121 ? 0.6323 0.8363 0.6910 -0.0599 0.0728  -0.0094 118 PRO A N     
881  C CA    . PRO A 121 ? 0.6409 0.8526 0.6904 -0.0663 0.0768  -0.0057 118 PRO A CA    
882  C C     . PRO A 121 ? 0.6859 0.9129 0.7366 -0.0572 0.0764  -0.0123 118 PRO A C     
883  O O     . PRO A 121 ? 0.7013 0.9209 0.7558 -0.0465 0.0722  -0.0171 118 PRO A O     
884  C CB    . PRO A 121 ? 0.7276 0.9119 0.7672 -0.0694 0.0758  0.0022  118 PRO A CB    
885  C CG    . PRO A 121 ? 0.6469 0.8140 0.6899 -0.0702 0.0736  0.0041  118 PRO A CG    
886  C CD    . PRO A 121 ? 0.5522 0.7286 0.6074 -0.0616 0.0708  -0.0038 118 PRO A CD    
887  N N     . GLN A 122 ? 0.6857 0.9346 0.7327 -0.0622 0.0808  -0.0125 119 GLN A N     
888  C CA    . GLN A 122 ? 0.5915 0.8597 0.6403 -0.0530 0.0808  -0.0204 119 GLN A CA    
889  C C     . GLN A 122 ? 0.6475 0.9012 0.6885 -0.0481 0.0787  -0.0193 119 GLN A C     
890  O O     . GLN A 122 ? 0.6592 0.9156 0.7028 -0.0369 0.0755  -0.0266 119 GLN A O     
891  C CB    . GLN A 122 ? 0.7319 1.0309 0.7790 -0.0602 0.0866  -0.0213 119 GLN A CB    
892  C CG    . GLN A 122 ? 0.8066 1.1292 0.8642 -0.0615 0.0880  -0.0258 119 GLN A CG    
893  C CD    . GLN A 122 ? 0.9452 1.3038 1.0023 -0.0672 0.0938  -0.0282 119 GLN A CD    
894  O OE1   . GLN A 122 ? 0.9960 1.3634 1.0457 -0.0674 0.0965  -0.0283 119 GLN A OE1   
895  N NE2   . GLN A 122 ? 0.8892 1.2705 0.9544 -0.0723 0.0959  -0.0302 119 GLN A NE2   
896  N N     . LYS A 123 ? 0.6030 0.8408 0.6336 -0.0562 0.0800  -0.0104 120 LYS A N     
897  C CA    . LYS A 123 ? 0.7622 0.9883 0.7847 -0.0524 0.0781  -0.0086 120 LYS A CA    
898  C C     . LYS A 123 ? 0.6541 0.8514 0.6733 -0.0533 0.0749  -0.0019 120 LYS A C     
899  O O     . LYS A 123 ? 0.6043 0.7904 0.6237 -0.0595 0.0755  0.0030  120 LYS A O     
900  C CB    . LYS A 123 ? 0.8025 1.0393 0.8129 -0.0603 0.0825  -0.0041 120 LYS A CB    
901  C CG    . LYS A 123 ? 0.7794 1.0484 0.7919 -0.0605 0.0867  -0.0103 120 LYS A CG    
902  C CD    . LYS A 123 ? 0.8726 1.1498 0.8715 -0.0716 0.0915  -0.0037 120 LYS A CD    
903  C CE    . LYS A 123 ? 0.9728 1.2857 0.9735 -0.0733 0.0966  -0.0094 120 LYS A CE    
904  N NZ    . LYS A 123 ? 1.0590 1.3794 1.0450 -0.0865 0.1016  -0.0018 120 LYS A NZ    
905  N N     . PRO A 124 ? 0.6646 0.8504 0.6807 -0.0470 0.0714  -0.0021 121 PRO A N     
906  C CA    . PRO A 124 ? 0.6130 0.7751 0.6241 -0.0481 0.0689  0.0048  121 PRO A CA    
907  C C     . PRO A 124 ? 0.6633 0.8185 0.6615 -0.0580 0.0720  0.0138  121 PRO A C     
908  O O     . PRO A 124 ? 0.8506 1.0186 0.8411 -0.0635 0.0754  0.0152  121 PRO A O     
909  C CB    . PRO A 124 ? 0.6434 0.8018 0.6529 -0.0401 0.0650  0.0022  121 PRO A CB    
910  C CG    . PRO A 124 ? 0.6508 0.8249 0.6674 -0.0332 0.0639  -0.0074 121 PRO A CG    
911  C CD    . PRO A 124 ? 0.6192 0.8133 0.6365 -0.0378 0.0688  -0.0094 121 PRO A CD    
912  N N     . PHE A 125 ? 0.6697 0.8040 0.6645 -0.0605 0.0706  0.0199  122 PHE A N     
913  C CA    . PHE A 125 ? 0.7101 0.8303 0.6904 -0.0691 0.0720  0.0288  122 PHE A CA    
914  C C     . PHE A 125 ? 0.7260 0.8544 0.7031 -0.0809 0.0764  0.0313  122 PHE A C     
915  O O     . PHE A 125 ? 0.7931 0.9104 0.7559 -0.0902 0.0776  0.0389  122 PHE A O     
916  C CB    . PHE A 125 ? 0.6430 0.7610 0.6102 -0.0689 0.0714  0.0327  122 PHE A CB    
917  C CG    . PHE A 125 ? 0.6908 0.8030 0.6608 -0.0581 0.0668  0.0304  122 PHE A CG    
918  C CD1   . PHE A 125 ? 0.6264 0.7192 0.5960 -0.0535 0.0632  0.0335  122 PHE A CD1   
919  C CD2   . PHE A 125 ? 0.6222 0.7493 0.5950 -0.0526 0.0661  0.0248  122 PHE A CD2   
920  C CE1   . PHE A 125 ? 0.6219 0.7124 0.5949 -0.0445 0.0590  0.0313  122 PHE A CE1   
921  C CE2   . PHE A 125 ? 0.6187 0.7409 0.5938 -0.0439 0.0614  0.0227  122 PHE A CE2   
922  C CZ    . PHE A 125 ? 0.6768 0.7816 0.6525 -0.0403 0.0580  0.0261  122 PHE A CZ    
923  N N     . ASP A 126 ? 0.6554 0.8027 0.6447 -0.0812 0.0783  0.0251  123 ASP A N     
924  C CA    . ASP A 126 ? 0.6179 0.7739 0.6059 -0.0929 0.0820  0.0272  123 ASP A CA    
925  C C     . ASP A 126 ? 0.7402 0.8737 0.7255 -0.0974 0.0805  0.0320  123 ASP A C     
926  O O     . ASP A 126 ? 0.7657 0.8917 0.7400 -0.1094 0.0822  0.0383  123 ASP A O     
927  C CB    . ASP A 126 ? 0.6864 0.8698 0.6888 -0.0902 0.0837  0.0187  123 ASP A CB    
928  C CG    . ASP A 126 ? 0.7681 0.9784 0.7690 -0.0916 0.0873  0.0154  123 ASP A CG    
929  O OD1   . ASP A 126 ? 0.9658 1.1738 0.9534 -0.0976 0.0891  0.0209  123 ASP A OD1   
930  O OD2   . ASP A 126 ? 0.8314 1.0654 0.8438 -0.0863 0.0881  0.0073  123 ASP A OD2   
931  N N     . LYS A 127 ? 0.6306 0.7527 0.6248 -0.0885 0.0770  0.0291  124 LYS A N     
932  C CA    . LYS A 127 ? 0.6125 0.7146 0.6049 -0.0915 0.0756  0.0325  124 LYS A CA    
933  C C     . LYS A 127 ? 0.7105 0.7955 0.7062 -0.0807 0.0717  0.0317  124 LYS A C     
934  O O     . LYS A 127 ? 0.7616 0.8549 0.7689 -0.0717 0.0700  0.0258  124 LYS A O     
935  C CB    . LYS A 127 ? 0.6032 0.7178 0.6066 -0.0948 0.0768  0.0283  124 LYS A CB    
936  C CG    . LYS A 127 ? 0.8150 0.9096 0.8163 -0.0978 0.0752  0.0312  124 LYS A CG    
937  C CD    . LYS A 127 ? 0.8325 0.9408 0.8440 -0.1016 0.0760  0.0272  124 LYS A CD    
938  C CE    . LYS A 127 ? 0.8362 0.9625 0.8442 -0.1144 0.0797  0.0287  124 LYS A CE    
939  N NZ    . LYS A 127 ? 0.8358 0.9686 0.8499 -0.1205 0.0797  0.0269  124 LYS A NZ    
940  N N     . PHE A 128 ? 0.7236 0.7850 0.7084 -0.0816 0.0701  0.0376  125 PHE A N     
941  C CA    . PHE A 128 ? 0.7253 0.7717 0.7130 -0.0723 0.0668  0.0372  125 PHE A CA    
942  C C     . PHE A 128 ? 0.6854 0.7209 0.6757 -0.0743 0.0665  0.0371  125 PHE A C     
943  O O     . PHE A 128 ? 0.7611 0.7899 0.7436 -0.0836 0.0679  0.0404  125 PHE A O     
944  C CB    . PHE A 128 ? 0.7711 0.7990 0.7448 -0.0695 0.0646  0.0429  125 PHE A CB    
945  C CG    . PHE A 128 ? 0.7466 0.7831 0.7204 -0.0633 0.0634  0.0419  125 PHE A CG    
946  C CD1   . PHE A 128 ? 0.7236 0.7812 0.7088 -0.0605 0.0641  0.0359  125 PHE A CD1   
947  C CD2   . PHE A 128 ? 0.7641 0.7863 0.7256 -0.0596 0.0608  0.0467  125 PHE A CD2   
948  C CE1   . PHE A 128 ? 0.6543 0.7188 0.6385 -0.0551 0.0626  0.0346  125 PHE A CE1   
949  C CE2   . PHE A 128 ? 0.7645 0.7949 0.7257 -0.0541 0.0593  0.0458  125 PHE A CE2   
950  C CZ    . PHE A 128 ? 0.6625 0.7140 0.6350 -0.0523 0.0602  0.0397  125 PHE A CZ    
951  N N     . PHE A 129 ? 0.7266 0.7604 0.7270 -0.0662 0.0645  0.0335  126 PHE A N     
952  C CA    . PHE A 129 ? 0.6758 0.6973 0.6774 -0.0663 0.0638  0.0335  126 PHE A CA    
953  C C     . PHE A 129 ? 0.7125 0.7183 0.7100 -0.0583 0.0615  0.0354  126 PHE A C     
954  O O     . PHE A 129 ? 0.7267 0.7388 0.7313 -0.0506 0.0599  0.0330  126 PHE A O     
955  C CB    . PHE A 129 ? 0.6147 0.6486 0.6311 -0.0641 0.0637  0.0277  126 PHE A CB    
956  C CG    . PHE A 129 ? 0.6264 0.6764 0.6473 -0.0709 0.0656  0.0253  126 PHE A CG    
957  C CD1   . PHE A 129 ? 0.5864 0.6554 0.6122 -0.0699 0.0664  0.0221  126 PHE A CD1   
958  C CD2   . PHE A 129 ? 0.6621 0.7093 0.6823 -0.0777 0.0664  0.0258  126 PHE A CD2   
959  C CE1   . PHE A 129 ? 0.6372 0.7239 0.6677 -0.0750 0.0682  0.0192  126 PHE A CE1   
960  C CE2   . PHE A 129 ? 0.6917 0.7567 0.7170 -0.0837 0.0680  0.0233  126 PHE A CE2   
961  C CZ    . PHE A 129 ? 0.6773 0.7630 0.7081 -0.0819 0.0690  0.0199  126 PHE A CZ    
962  N N     . ILE A 130 ? 0.6181 0.6040 0.6037 -0.0600 0.0609  0.0394  127 ILE A N     
963  C CA    . ILE A 130 ? 0.6884 0.6599 0.6689 -0.0512 0.0585  0.0408  127 ILE A CA    
964  C C     . ILE A 130 ? 0.7248 0.6839 0.7045 -0.0504 0.0583  0.0400  127 ILE A C     
965  O O     . ILE A 130 ? 0.7536 0.7084 0.7307 -0.0583 0.0595  0.0403  127 ILE A O     
966  C CB    . ILE A 130 ? 0.7401 0.6957 0.7030 -0.0510 0.0569  0.0464  127 ILE A CB    
967  C CG1   . ILE A 130 ? 0.7627 0.6992 0.7099 -0.0602 0.0572  0.0507  127 ILE A CG1   
968  C CG2   . ILE A 130 ? 0.7291 0.6977 0.6919 -0.0525 0.0574  0.0473  127 ILE A CG2   
969  C CD1   . ILE A 130 ? 0.9065 0.8219 0.8333 -0.0597 0.0547  0.0567  127 ILE A CD1   
970  N N     . ASP A 131 ? 0.7399 0.6947 0.7216 -0.0407 0.0567  0.0389  128 ASP A N     
971  C CA    . ASP A 131 ? 0.7437 0.6893 0.7257 -0.0380 0.0566  0.0373  128 ASP A CA    
972  C C     . ASP A 131 ? 0.7203 0.6647 0.7033 -0.0263 0.0549  0.0364  128 ASP A C     
973  O O     . ASP A 131 ? 0.6775 0.6323 0.6651 -0.0212 0.0538  0.0363  128 ASP A O     
974  C CB    . ASP A 131 ? 0.7578 0.7167 0.7538 -0.0414 0.0581  0.0332  128 ASP A CB    
975  C CG    . ASP A 131 ? 0.7820 0.7306 0.7762 -0.0404 0.0583  0.0319  128 ASP A CG    
976  O OD1   . ASP A 131 ? 0.8353 0.7652 0.8159 -0.0422 0.0578  0.0342  128 ASP A OD1   
977  O OD2   . ASP A 131 ? 0.8476 0.8058 0.8527 -0.0381 0.0587  0.0286  128 ASP A OD2   
978  N N     . TYR A 132 ? 0.6409 0.5736 0.6193 -0.0218 0.0545  0.0356  129 TYR A N     
979  C CA    . TYR A 132 ? 0.6357 0.5701 0.6159 -0.0102 0.0532  0.0340  129 TYR A CA    
980  C C     . TYR A 132 ? 0.7244 0.6719 0.7180 -0.0090 0.0549  0.0300  129 TYR A C     
981  O O     . TYR A 132 ? 0.8802 0.8250 0.8753 -0.0150 0.0564  0.0288  129 TYR A O     
982  C CB    . TYR A 132 ? 0.6596 0.5706 0.6225 -0.0038 0.0512  0.0357  129 TYR A CB    
983  C CG    . TYR A 132 ? 0.8079 0.7080 0.7579 0.0008  0.0482  0.0394  129 TYR A CG    
984  C CD1   . TYR A 132 ? 0.7961 0.7069 0.7503 0.0114  0.0462  0.0388  129 TYR A CD1   
985  C CD2   . TYR A 132 ? 0.8686 0.7479 0.8014 -0.0061 0.0469  0.0438  129 TYR A CD2   
986  C CE1   . TYR A 132 ? 0.7855 0.6858 0.7271 0.0162  0.0429  0.0424  129 TYR A CE1   
987  C CE2   . TYR A 132 ? 0.8587 0.7262 0.7778 -0.0023 0.0437  0.0478  129 TYR A CE2   
988  C CZ    . TYR A 132 ? 0.8290 0.7066 0.7524 0.0095  0.0416  0.0470  129 TYR A CZ    
989  O OH    . TYR A 132 ? 0.9641 0.8295 0.8730 0.0139  0.0379  0.0511  129 TYR A OH    
990  N N     . ILE A 133 ? 0.6832 0.6456 0.6860 -0.0018 0.0545  0.0281  130 ILE A N     
991  C CA    . ILE A 133 ? 0.6270 0.6012 0.6401 0.0002  0.0559  0.0248  130 ILE A CA    
992  C C     . ILE A 133 ? 0.8028 0.7733 0.8104 0.0114  0.0552  0.0238  130 ILE A C     
993  O O     . ILE A 133 ? 0.8043 0.7731 0.8066 0.0192  0.0530  0.0249  130 ILE A O     
994  C CB    . ILE A 133 ? 0.6364 0.6322 0.6642 -0.0016 0.0557  0.0232  130 ILE A CB    
995  C CG1   . ILE A 133 ? 0.7736 0.7726 0.8063 -0.0109 0.0560  0.0231  130 ILE A CG1   
996  C CG2   . ILE A 133 ? 0.7411 0.7490 0.7778 0.0001  0.0570  0.0205  130 ILE A CG2   
997  C CD1   . ILE A 133 ? 0.8502 0.8665 0.8947 -0.0125 0.0550  0.0213  130 ILE A CD1   
998  N N     . GLY A 134 ? 0.8195 0.7892 0.8277 0.0127  0.0570  0.0214  131 GLY A N     
999  C CA    . GLY A 134 ? 0.7010 0.6705 0.7050 0.0244  0.0567  0.0194  131 GLY A CA    
1000 C C     . GLY A 134 ? 0.7598 0.7106 0.7519 0.0265  0.0574  0.0181  131 GLY A C     
1001 O O     . GLY A 134 ? 0.8197 0.7565 0.8063 0.0178  0.0579  0.0192  131 GLY A O     
1002 N N     . PRO A 135 ? 0.8178 0.7687 0.8054 0.0385  0.0572  0.0153  132 PRO A N     
1003 C CA    . PRO A 135 ? 0.8821 0.8512 0.8758 0.0499  0.0563  0.0137  132 PRO A CA    
1004 C C     . PRO A 135 ? 0.8530 0.8528 0.8652 0.0467  0.0589  0.0118  132 PRO A C     
1005 O O     . PRO A 135 ? 0.8137 0.8191 0.8317 0.0394  0.0617  0.0106  132 PRO A O     
1006 C CB    . PRO A 135 ? 0.8551 0.8130 0.8366 0.0633  0.0555  0.0105  132 PRO A CB    
1007 C CG    . PRO A 135 ? 0.7711 0.7156 0.7470 0.0570  0.0577  0.0093  132 PRO A CG    
1008 C CD    . PRO A 135 ? 0.7914 0.7237 0.7661 0.0425  0.0575  0.0132  132 PRO A CD    
1009 N N     . LEU A 136 ? 0.8037 0.8223 0.8241 0.0516  0.0575  0.0117  133 LEU A N     
1010 C CA    . LEU A 136 ? 0.7557 0.8038 0.7924 0.0486  0.0591  0.0102  133 LEU A CA    
1011 C C     . LEU A 136 ? 0.8556 0.9217 0.8948 0.0619  0.0592  0.0068  133 LEU A C     
1012 O O     . LEU A 136 ? 0.9592 1.0134 0.9871 0.0748  0.0572  0.0056  133 LEU A O     
1013 C CB    . LEU A 136 ? 0.7197 0.7774 0.7641 0.0427  0.0569  0.0125  133 LEU A CB    
1014 C CG    . LEU A 136 ? 0.7351 0.7789 0.7777 0.0316  0.0563  0.0154  133 LEU A CG    
1015 C CD1   . LEU A 136 ? 0.6335 0.6894 0.6831 0.0289  0.0539  0.0166  133 LEU A CD1   
1016 C CD2   . LEU A 136 ? 0.6911 0.7347 0.7387 0.0205  0.0588  0.0149  133 LEU A CD2   
1017 N N     . PRO A 137 ? 0.8283 0.9231 0.8812 0.0592  0.0612  0.0049  134 PRO A N     
1018 C CA    . PRO A 137 ? 0.7818 0.9001 0.8395 0.0717  0.0611  0.0016  134 PRO A CA    
1019 C C     . PRO A 137 ? 0.8501 0.9678 0.9046 0.0822  0.0565  0.0024  134 PRO A C     
1020 O O     . PRO A 137 ? 0.8155 0.9321 0.8731 0.0756  0.0541  0.0053  134 PRO A O     
1021 C CB    . PRO A 137 ? 0.6625 0.8119 0.7365 0.0615  0.0634  0.0011  134 PRO A CB    
1022 C CG    . PRO A 137 ? 0.7196 0.8575 0.7937 0.0469  0.0658  0.0029  134 PRO A CG    
1023 C CD    . PRO A 137 ? 0.7696 0.8765 0.8333 0.0445  0.0637  0.0057  134 PRO A CD    
1024 N N     . PRO A 138 ? 0.8923 1.0097 0.9396 0.0991  0.0548  -0.0005 135 PRO A N     
1025 C CA    . PRO A 138 ? 0.8336 0.9479 0.8757 0.1104  0.0495  0.0005  135 PRO A CA    
1026 C C     . PRO A 138 ? 0.8119 0.9569 0.8695 0.1067  0.0481  0.0009  135 PRO A C     
1027 O O     . PRO A 138 ? 0.8252 1.0024 0.8965 0.1062  0.0503  -0.0020 135 PRO A O     
1028 C CB    . PRO A 138 ? 0.8338 0.9488 0.8677 0.1302  0.0483  -0.0040 135 PRO A CB    
1029 C CG    . PRO A 138 ? 0.8373 0.9392 0.8649 0.1283  0.0523  -0.0061 135 PRO A CG    
1030 C CD    . PRO A 138 ? 0.8488 0.9652 0.8900 0.1097  0.0570  -0.0048 135 PRO A CD    
1031 N N     . SER A 139 ? 0.7924 0.9275 0.8472 0.1031  0.0445  0.0045  136 SER A N     
1032 C CA    . SER A 139 ? 0.7388 0.8988 0.8059 0.0995  0.0422  0.0051  136 SER A CA    
1033 C C     . SER A 139 ? 0.7774 0.9270 0.8347 0.1107  0.0364  0.0068  136 SER A C     
1034 O O     . SER A 139 ? 0.8003 0.9219 0.8454 0.1076  0.0347  0.0106  136 SER A O     
1035 C CB    . SER A 139 ? 0.6641 0.8233 0.7383 0.0807  0.0436  0.0077  136 SER A CB    
1036 O OG    . SER A 139 ? 0.7878 0.9698 0.8727 0.0769  0.0410  0.0078  136 SER A OG    
1037 N N     . GLN A 140 ? 0.7656 0.9386 0.8280 0.1236  0.0334  0.0042  137 GLN A N     
1038 C CA    . GLN A 140 ? 0.8206 0.9860 0.8733 0.1365  0.0271  0.0056  137 GLN A CA    
1039 C C     . GLN A 140 ? 0.8577 0.9846 0.8882 0.1468  0.0249  0.0073  137 GLN A C     
1040 O O     . GLN A 140 ? 0.9322 1.0396 0.9496 0.1518  0.0199  0.0107  137 GLN A O     
1041 C CB    . GLN A 140 ? 0.9271 1.0920 0.9821 0.1258  0.0245  0.0094  137 GLN A CB    
1042 C CG    . GLN A 140 ? 0.9906 1.1918 1.0651 0.1169  0.0249  0.0076  137 GLN A CG    
1043 C CD    . GLN A 140 ? 1.0783 1.3053 1.1580 0.1294  0.0197  0.0057  137 GLN A CD    
1044 O OE1   . GLN A 140 ? 1.1758 1.3960 1.2490 0.1329  0.0146  0.0081  137 GLN A OE1   
1045 N NE2   . GLN A 140 ? 1.0325 1.2907 1.1238 0.1363  0.0208  0.0013  137 GLN A NE2   
1046 N N     . GLY A 141 ? 0.8537 0.9686 0.8787 0.1496  0.0282  0.0051  138 GLY A N     
1047 C CA    . GLY A 141 ? 0.8495 0.9254 0.8521 0.1573  0.0261  0.0066  138 GLY A CA    
1048 C C     . GLY A 141 ? 0.8611 0.9062 0.8542 0.1417  0.0280  0.0112  138 GLY A C     
1049 O O     . GLY A 141 ? 0.8975 0.9084 0.8708 0.1455  0.0260  0.0131  138 GLY A O     
1050 N N     . TYR A 142 ? 0.7965 0.8525 0.8023 0.1242  0.0315  0.0130  139 TYR A N     
1051 C CA    . TYR A 142 ? 0.7627 0.7947 0.7617 0.1094  0.0334  0.0170  139 TYR A CA    
1052 C C     . TYR A 142 ? 0.7958 0.8284 0.8009 0.0997  0.0389  0.0151  139 TYR A C     
1053 O O     . TYR A 142 ? 0.6901 0.7482 0.7097 0.0987  0.0420  0.0116  139 TYR A O     
1054 C CB    . TYR A 142 ? 0.7456 0.7871 0.7526 0.0979  0.0329  0.0200  139 TYR A CB    
1055 C CG    . TYR A 142 ? 0.8411 0.8754 0.8382 0.1052  0.0274  0.0230  139 TYR A CG    
1056 C CD1   . TYR A 142 ? 0.9267 0.9845 0.9312 0.1154  0.0239  0.0212  139 TYR A CD1   
1057 C CD2   . TYR A 142 ? 0.8753 0.8799 0.8549 0.1015  0.0255  0.0278  139 TYR A CD2   
1058 C CE1   . TYR A 142 ? 0.9809 1.0316 0.9754 0.1225  0.0184  0.0240  139 TYR A CE1   
1059 C CE2   . TYR A 142 ? 0.8333 0.8302 0.8022 0.1078  0.0203  0.0310  139 TYR A CE2   
1060 C CZ    . TYR A 142 ? 0.8825 0.9018 0.8586 0.1187  0.0166  0.0291  139 TYR A CZ    
1061 O OH    . TYR A 142 ? 0.8877 0.8990 0.8523 0.1253  0.0110  0.0324  139 TYR A OH    
1062 N N     . LEU A 143 ? 0.7689 0.7738 0.7624 0.0919  0.0400  0.0176  140 LEU A N     
1063 C CA    . LEU A 143 ? 0.8399 0.8407 0.8357 0.0840  0.0444  0.0159  140 LEU A CA    
1064 C C     . LEU A 143 ? 0.8554 0.8463 0.8524 0.0672  0.0466  0.0189  140 LEU A C     
1065 O O     . LEU A 143 ? 0.8050 0.8004 0.8088 0.0592  0.0501  0.0174  140 LEU A O     
1066 C CB    . LEU A 143 ? 0.8775 0.8533 0.8561 0.0932  0.0436  0.0144  140 LEU A CB    
1067 C CG    . LEU A 143 ? 0.7883 0.7750 0.7663 0.1106  0.0427  0.0095  140 LEU A CG    
1068 C CD1   . LEU A 143 ? 0.8234 0.7786 0.7805 0.1194  0.0409  0.0081  140 LEU A CD1   
1069 C CD2   . LEU A 143 ? 0.7109 0.7288 0.7070 0.1075  0.0476  0.0056  140 LEU A CD2   
1070 N N     . TYR A 144 ? 0.8216 0.8002 0.8119 0.0621  0.0445  0.0229  141 TYR A N     
1071 C CA    . TYR A 144 ? 0.8242 0.7943 0.8146 0.0474  0.0464  0.0253  141 TYR A CA    
1072 C C     . TYR A 144 ? 0.8295 0.8119 0.8272 0.0417  0.0454  0.0272  141 TYR A C     
1073 O O     . TYR A 144 ? 0.8876 0.8799 0.8868 0.0488  0.0426  0.0275  141 TYR A O     
1074 C CB    . TYR A 144 ? 0.7542 0.6930 0.7253 0.0449  0.0452  0.0283  141 TYR A CB    
1075 C CG    . TYR A 144 ? 0.8932 0.8164 0.8552 0.0493  0.0459  0.0261  141 TYR A CG    
1076 C CD1   . TYR A 144 ? 0.9322 0.8468 0.8840 0.0642  0.0432  0.0243  141 TYR A CD1   
1077 C CD2   . TYR A 144 ? 0.8447 0.7615 0.8073 0.0393  0.0487  0.0255  141 TYR A CD2   
1078 C CE1   . TYR A 144 ? 0.9367 0.8361 0.8788 0.0690  0.0436  0.0216  141 TYR A CE1   
1079 C CE2   . TYR A 144 ? 0.8505 0.7525 0.8038 0.0431  0.0491  0.0231  141 TYR A CE2   
1080 C CZ    . TYR A 144 ? 0.8968 0.7897 0.8395 0.0580  0.0466  0.0211  141 TYR A CZ    
1081 O OH    . TYR A 144 ? 0.9008 0.7782 0.8332 0.0625  0.0468  0.0181  141 TYR A OH    
1082 N N     . VAL A 145 ? 0.7298 0.7122 0.7317 0.0293  0.0474  0.0282  142 VAL A N     
1083 C CA    . VAL A 145 ? 0.7284 0.7207 0.7358 0.0233  0.0467  0.0294  142 VAL A CA    
1084 C C     . VAL A 145 ? 0.7240 0.7013 0.7227 0.0139  0.0476  0.0323  142 VAL A C     
1085 O O     . VAL A 145 ? 0.7667 0.7394 0.7668 0.0065  0.0500  0.0315  142 VAL A O     
1086 C CB    . VAL A 145 ? 0.7487 0.7631 0.7733 0.0180  0.0480  0.0264  142 VAL A CB    
1087 C CG1   . VAL A 145 ? 0.7128 0.7341 0.7409 0.0120  0.0471  0.0271  142 VAL A CG1   
1088 C CG2   . VAL A 145 ? 0.6562 0.6887 0.6896 0.0255  0.0471  0.0240  142 VAL A CG2   
1089 N N     . LEU A 146 ? 0.7502 0.7211 0.7399 0.0137  0.0457  0.0355  143 LEU A N     
1090 C CA    . LEU A 146 ? 0.6994 0.6619 0.6825 0.0034  0.0469  0.0381  143 LEU A CA    
1091 C C     . LEU A 146 ? 0.6917 0.6737 0.6882 -0.0030 0.0483  0.0359  143 LEU A C     
1092 O O     . LEU A 146 ? 0.7041 0.6990 0.7061 0.0004  0.0466  0.0350  143 LEU A O     
1093 C CB    . LEU A 146 ? 0.6547 0.6024 0.6210 0.0050  0.0444  0.0429  143 LEU A CB    
1094 C CG    . LEU A 146 ? 0.7887 0.7303 0.7476 -0.0069 0.0461  0.0460  143 LEU A CG    
1095 C CD1   . LEU A 146 ? 0.9825 0.9098 0.9355 -0.0144 0.0481  0.0466  143 LEU A CD1   
1096 C CD2   . LEU A 146 ? 0.8156 0.7447 0.7577 -0.0062 0.0434  0.0511  143 LEU A CD2   
1097 N N     . VAL A 147 ? 0.6070 0.5907 0.6081 -0.0116 0.0508  0.0346  144 VAL A N     
1098 C CA    . VAL A 147 ? 0.5912 0.5911 0.6037 -0.0166 0.0517  0.0317  144 VAL A CA    
1099 C C     . VAL A 147 ? 0.7423 0.7401 0.7483 -0.0242 0.0530  0.0336  144 VAL A C     
1100 O O     . VAL A 147 ? 0.6976 0.6856 0.6972 -0.0302 0.0547  0.0353  144 VAL A O     
1101 C CB    . VAL A 147 ? 0.6158 0.6216 0.6392 -0.0194 0.0531  0.0282  144 VAL A CB    
1102 C CG1   . VAL A 147 ? 0.5651 0.5850 0.5983 -0.0233 0.0530  0.0249  144 VAL A CG1   
1103 C CG2   . VAL A 147 ? 0.5745 0.5839 0.6035 -0.0130 0.0523  0.0266  144 VAL A CG2   
1104 N N     . VAL A 148 ? 0.6161 0.6244 0.6234 -0.0244 0.0524  0.0333  145 VAL A N     
1105 C CA    . VAL A 148 ? 0.6939 0.7046 0.6957 -0.0314 0.0540  0.0346  145 VAL A CA    
1106 C C     . VAL A 148 ? 0.7438 0.7726 0.7574 -0.0328 0.0544  0.0297  145 VAL A C     
1107 O O     . VAL A 148 ? 0.7300 0.7677 0.7489 -0.0282 0.0524  0.0273  145 VAL A O     
1108 C CB    . VAL A 148 ? 0.6721 0.6772 0.6612 -0.0299 0.0526  0.0389  145 VAL A CB    
1109 C CG1   . VAL A 148 ? 0.6885 0.6977 0.6711 -0.0385 0.0549  0.0406  145 VAL A CG1   
1110 C CG2   . VAL A 148 ? 0.6306 0.6151 0.6064 -0.0264 0.0509  0.0435  145 VAL A CG2   
1111 N N     . VAL A 149 ? 0.7167 0.7504 0.7335 -0.0389 0.0566  0.0278  146 VAL A N     
1112 C CA    . VAL A 149 ? 0.6270 0.6760 0.6542 -0.0391 0.0566  0.0224  146 VAL A CA    
1113 C C     . VAL A 149 ? 0.6812 0.7398 0.7046 -0.0443 0.0588  0.0222  146 VAL A C     
1114 O O     . VAL A 149 ? 0.7558 0.8120 0.7744 -0.0511 0.0613  0.0246  146 VAL A O     
1115 C CB    . VAL A 149 ? 0.5576 0.6067 0.5935 -0.0400 0.0566  0.0193  146 VAL A CB    
1116 C CG1   . VAL A 149 ? 0.5487 0.6116 0.5929 -0.0395 0.0559  0.0136  146 VAL A CG1   
1117 C CG2   . VAL A 149 ? 0.6123 0.6549 0.6522 -0.0352 0.0547  0.0191  146 VAL A CG2   
1118 N N     . ASP A 150 ? 0.5681 0.6387 0.5935 -0.0417 0.0581  0.0192  147 ASP A N     
1119 C CA    . ASP A 150 ? 0.5917 0.6758 0.6151 -0.0457 0.0605  0.0176  147 ASP A CA    
1120 C C     . ASP A 150 ? 0.5983 0.6935 0.6316 -0.0461 0.0610  0.0120  147 ASP A C     
1121 O O     . ASP A 150 ? 0.6404 0.7378 0.6819 -0.0405 0.0583  0.0071  147 ASP A O     
1122 C CB    . ASP A 150 ? 0.5719 0.6652 0.5934 -0.0417 0.0593  0.0155  147 ASP A CB    
1123 C CG    . ASP A 150 ? 0.7033 0.8144 0.7248 -0.0442 0.0618  0.0120  147 ASP A CG    
1124 O OD1   . ASP A 150 ? 0.6663 0.7805 0.6802 -0.0515 0.0652  0.0158  147 ASP A OD1   
1125 O OD2   . ASP A 150 ? 0.7297 0.8516 0.7578 -0.0389 0.0602  0.0053  147 ASP A OD2   
1126 N N     . GLY A 151 ? 0.6193 0.7212 0.6510 -0.0530 0.0642  0.0130  148 GLY A N     
1127 C CA    . GLY A 151 ? 0.7283 0.8399 0.7690 -0.0532 0.0643  0.0082  148 GLY A CA    
1128 C C     . GLY A 151 ? 0.7073 0.8359 0.7551 -0.0470 0.0630  0.0007  148 GLY A C     
1129 O O     . GLY A 151 ? 0.7701 0.9017 0.8258 -0.0430 0.0609  -0.0042 148 GLY A O     
1130 N N     . MET A 152 ? 0.7146 0.8532 0.7583 -0.0456 0.0640  -0.0005 149 MET A N     
1131 C CA    . MET A 152 ? 0.6506 0.8050 0.6994 -0.0388 0.0626  -0.0085 149 MET A CA    
1132 C C     . MET A 152 ? 0.6156 0.7604 0.6674 -0.0304 0.0575  -0.0124 149 MET A C     
1133 O O     . MET A 152 ? 0.6258 0.7741 0.6834 -0.0243 0.0545  -0.0189 149 MET A O     
1134 C CB    . MET A 152 ? 0.6507 0.8206 0.6933 -0.0406 0.0657  -0.0088 149 MET A CB    
1135 C CG    . MET A 152 ? 0.7588 0.9474 0.8057 -0.0329 0.0648  -0.0179 149 MET A CG    
1136 S SD    . MET A 152 ? 0.7729 0.9539 0.8183 -0.0227 0.0595  -0.0231 149 MET A SD    
1137 C CE    . MET A 152 ? 0.6983 0.8845 0.7523 -0.0129 0.0552  -0.0333 149 MET A CE    
1138 N N     . THR A 153 ? 0.5498 0.6826 0.5972 -0.0302 0.0561  -0.0085 150 THR A N     
1139 C CA    . THR A 153 ? 0.6420 0.7677 0.6912 -0.0240 0.0513  -0.0118 150 THR A CA    
1140 C C     . THR A 153 ? 0.7444 0.8553 0.7979 -0.0239 0.0487  -0.0098 150 THR A C     
1141 O O     . THR A 153 ? 0.8797 0.9859 0.9363 -0.0200 0.0444  -0.0136 150 THR A O     
1142 C CB    . THR A 153 ? 0.6067 0.7311 0.6491 -0.0234 0.0509  -0.0093 150 THR A CB    
1143 O OG1   . THR A 153 ? 0.5564 0.6710 0.5941 -0.0278 0.0526  -0.0015 150 THR A OG1   
1144 C CG2   . THR A 153 ? 0.5690 0.7086 0.6061 -0.0234 0.0534  -0.0115 150 THR A CG2   
1145 N N     . GLY A 154 ? 0.5700 0.6732 0.6227 -0.0286 0.0511  -0.0041 151 GLY A N     
1146 C CA    . GLY A 154 ? 0.6131 0.7037 0.6685 -0.0284 0.0492  -0.0017 151 GLY A CA    
1147 C C     . GLY A 154 ? 0.6662 0.7511 0.7184 -0.0270 0.0479  0.0015  151 GLY A C     
1148 O O     . GLY A 154 ? 0.6950 0.7720 0.7496 -0.0267 0.0467  0.0035  151 GLY A O     
1149 N N     . PHE A 155 ? 0.6812 0.7715 0.7282 -0.0258 0.0479  0.0019  152 PHE A N     
1150 C CA    . PHE A 155 ? 0.5503 0.6367 0.5937 -0.0238 0.0463  0.0051  152 PHE A CA    
1151 C C     . PHE A 155 ? 0.6374 0.7137 0.6771 -0.0254 0.0481  0.0113  152 PHE A C     
1152 O O     . PHE A 155 ? 0.7334 0.8060 0.7680 -0.0292 0.0512  0.0145  152 PHE A O     
1153 C CB    . PHE A 155 ? 0.5895 0.6830 0.6259 -0.0230 0.0465  0.0052  152 PHE A CB    
1154 C CG    . PHE A 155 ? 0.5980 0.6912 0.6326 -0.0195 0.0430  0.0058  152 PHE A CG    
1155 C CD1   . PHE A 155 ? 0.5688 0.6562 0.5973 -0.0186 0.0430  0.0116  152 PHE A CD1   
1156 C CD2   . PHE A 155 ? 0.5578 0.6561 0.5958 -0.0168 0.0391  0.0004  152 PHE A CD2   
1157 C CE1   . PHE A 155 ? 0.5703 0.6599 0.5978 -0.0148 0.0394  0.0119  152 PHE A CE1   
1158 C CE2   . PHE A 155 ? 0.5606 0.6604 0.5973 -0.0144 0.0356  0.0009  152 PHE A CE2   
1159 C CZ    . PHE A 155 ? 0.5654 0.6621 0.5974 -0.0132 0.0359  0.0066  152 PHE A CZ    
1160 N N     . THR A 156 ? 0.5528 0.6248 0.5945 -0.0223 0.0459  0.0128  153 THR A N     
1161 C CA    . THR A 156 ? 0.5559 0.6179 0.5952 -0.0219 0.0470  0.0171  153 THR A CA    
1162 C C     . THR A 156 ? 0.6204 0.6807 0.6550 -0.0171 0.0451  0.0203  153 THR A C     
1163 O O     . THR A 156 ? 0.7343 0.8024 0.7724 -0.0142 0.0421  0.0182  153 THR A O     
1164 C CB    . THR A 156 ? 0.6095 0.6697 0.6571 -0.0221 0.0466  0.0152  153 THR A CB    
1165 O OG1   . THR A 156 ? 0.6645 0.7255 0.7156 -0.0257 0.0478  0.0125  153 THR A OG1   
1166 C CG2   . THR A 156 ? 0.5519 0.6026 0.5966 -0.0207 0.0479  0.0189  153 THR A CG2   
1167 N N     . TRP A 157 ? 0.5815 0.6308 0.6071 -0.0162 0.0462  0.0250  154 TRP A N     
1168 C CA    . TRP A 157 ? 0.6411 0.6864 0.6608 -0.0100 0.0439  0.0282  154 TRP A CA    
1169 C C     . TRP A 157 ? 0.6198 0.6568 0.6400 -0.0065 0.0442  0.0295  154 TRP A C     
1170 O O     . TRP A 157 ? 0.6991 0.7256 0.7158 -0.0098 0.0465  0.0308  154 TRP A O     
1171 C CB    . TRP A 157 ? 0.7170 0.7537 0.7221 -0.0107 0.0441  0.0329  154 TRP A CB    
1172 C CG    . TRP A 157 ? 0.7336 0.7799 0.7365 -0.0125 0.0435  0.0319  154 TRP A CG    
1173 C CD1   . TRP A 157 ? 0.7029 0.7549 0.7033 -0.0079 0.0402  0.0321  154 TRP A CD1   
1174 C CD2   . TRP A 157 ? 0.7047 0.7570 0.7072 -0.0190 0.0462  0.0302  154 TRP A CD2   
1175 N NE1   . TRP A 157 ? 0.7114 0.7715 0.7092 -0.0112 0.0409  0.0306  154 TRP A NE1   
1176 C CE2   . TRP A 157 ? 0.7272 0.7884 0.7265 -0.0177 0.0447  0.0293  154 TRP A CE2   
1177 C CE3   . TRP A 157 ? 0.7234 0.7763 0.7282 -0.0254 0.0497  0.0290  154 TRP A CE3   
1178 C CZ2   . TRP A 157 ? 0.7636 0.8342 0.7615 -0.0222 0.0468  0.0269  154 TRP A CZ2   
1179 C CZ3   . TRP A 157 ? 0.7368 0.8004 0.7412 -0.0296 0.0517  0.0268  154 TRP A CZ3   
1180 C CH2   . TRP A 157 ? 0.7805 0.8530 0.7814 -0.0278 0.0504  0.0256  154 TRP A CH2   
1181 N N     . LEU A 158 ? 0.5828 0.6256 0.6072 0.0002  0.0417  0.0288  155 LEU A N     
1182 C CA    . LEU A 158 ? 0.5845 0.6231 0.6102 0.0049  0.0419  0.0291  155 LEU A CA    
1183 C C     . LEU A 158 ? 0.6739 0.7063 0.6901 0.0140  0.0393  0.0321  155 LEU A C     
1184 O O     . LEU A 158 ? 0.7602 0.8022 0.7774 0.0185  0.0362  0.0320  155 LEU A O     
1185 C CB    . LEU A 158 ? 0.5711 0.6247 0.6108 0.0051  0.0415  0.0253  155 LEU A CB    
1186 C CG    . LEU A 158 ? 0.6360 0.6935 0.6836 -0.0030 0.0430  0.0223  155 LEU A CG    
1187 C CD1   . LEU A 158 ? 0.6890 0.7581 0.7477 -0.0039 0.0422  0.0194  155 LEU A CD1   
1188 C CD2   . LEU A 158 ? 0.6312 0.6760 0.6745 -0.0071 0.0461  0.0233  155 LEU A CD2   
1189 N N     . TYR A 159 ? 0.8072 0.8231 0.8137 0.0172  0.0399  0.0344  156 TYR A N     
1190 C CA    . TYR A 159 ? 0.7937 0.7998 0.7887 0.0274  0.0368  0.0370  156 TYR A CA    
1191 C C     . TYR A 159 ? 0.8520 0.8539 0.8477 0.0343  0.0372  0.0355  156 TYR A C     
1192 O O     . TYR A 159 ? 0.8997 0.8897 0.8925 0.0299  0.0399  0.0354  156 TYR A O     
1193 C CB    . TYR A 159 ? 0.7330 0.7173 0.7093 0.0249  0.0361  0.0421  156 TYR A CB    
1194 C CG    . TYR A 159 ? 0.8647 0.8545 0.8388 0.0190  0.0358  0.0437  156 TYR A CG    
1195 C CD1   . TYR A 159 ? 0.8605 0.8541 0.8295 0.0252  0.0319  0.0454  156 TYR A CD1   
1196 C CD2   . TYR A 159 ? 0.7961 0.7886 0.7731 0.0079  0.0392  0.0433  156 TYR A CD2   
1197 C CE1   . TYR A 159 ? 0.8540 0.8530 0.8201 0.0199  0.0317  0.0466  156 TYR A CE1   
1198 C CE2   . TYR A 159 ? 0.8226 0.8218 0.7972 0.0032  0.0392  0.0441  156 TYR A CE2   
1199 C CZ    . TYR A 159 ? 0.8579 0.8599 0.8268 0.0090  0.0356  0.0458  156 TYR A CZ    
1200 O OH    . TYR A 159 ? 0.8879 0.8968 0.8536 0.0044  0.0357  0.0465  156 TYR A OH    
1201 N N     . PRO A 160 ? 0.7715 0.7844 0.7713 0.0450  0.0348  0.0337  157 PRO A N     
1202 C CA    . PRO A 160 ? 0.7309 0.7407 0.7300 0.0533  0.0352  0.0317  157 PRO A CA    
1203 C C     . PRO A 160 ? 0.8163 0.8006 0.7955 0.0622  0.0324  0.0346  157 PRO A C     
1204 O O     . PRO A 160 ? 0.9315 0.9088 0.9003 0.0678  0.0284  0.0375  157 PRO A O     
1205 C CB    . PRO A 160 ? 0.7283 0.7645 0.7405 0.0609  0.0336  0.0284  157 PRO A CB    
1206 C CG    . PRO A 160 ? 0.7099 0.7528 0.7210 0.0618  0.0300  0.0302  157 PRO A CG    
1207 C CD    . PRO A 160 ? 0.6291 0.6619 0.6364 0.0496  0.0316  0.0326  157 PRO A CD    
1208 N N     . THR A 161 ? 0.8105 0.7791 0.7829 0.0633  0.0340  0.0339  158 THR A N     
1209 C CA    . THR A 161 ? 0.8754 0.8158 0.8269 0.0716  0.0309  0.0361  158 THR A CA    
1210 C C     . THR A 161 ? 0.9022 0.8425 0.8540 0.0824  0.0312  0.0319  158 THR A C     
1211 O O     . THR A 161 ? 0.9256 0.8859 0.8931 0.0805  0.0348  0.0279  158 THR A O     
1212 C CB    . THR A 161 ? 0.8614 0.7748 0.7982 0.0601  0.0319  0.0401  158 THR A CB    
1213 O OG1   . THR A 161 ? 0.8620 0.7731 0.8033 0.0538  0.0358  0.0376  158 THR A OG1   
1214 C CG2   . THR A 161 ? 0.8601 0.7797 0.8001 0.0477  0.0332  0.0431  158 THR A CG2   
1215 N N     . LYS A 162 ? 0.9051 0.8214 0.8379 0.0938  0.0272  0.0327  159 LYS A N     
1216 C CA    . LYS A 162 ? 0.8678 0.7800 0.7970 0.1057  0.0271  0.0283  159 LYS A CA    
1217 C C     . LYS A 162 ? 0.8845 0.7701 0.8015 0.0989  0.0289  0.0286  159 LYS A C     
1218 O O     . LYS A 162 ? 1.0795 0.9649 0.9965 0.1057  0.0302  0.0242  159 LYS A O     
1219 C CB    . LYS A 162 ? 0.8159 0.7167 0.7303 0.1247  0.0207  0.0280  159 LYS A CB    
1220 C CG    . LYS A 162 ? 0.8958 0.8276 0.8241 0.1342  0.0186  0.0263  159 LYS A CG    
1221 C CD    . LYS A 162 ? 1.0831 1.0024 0.9954 0.1536  0.0114  0.0264  159 LYS A CD    
1222 C CE    . LYS A 162 ? 1.1350 1.0889 1.0628 0.1625  0.0093  0.0243  159 LYS A CE    
1223 N NZ    . LYS A 162 ? 1.2334 1.1762 1.1457 0.1821  0.0015  0.0246  159 LYS A NZ    
1224 N N     . ALA A 163 ? 0.8591 0.7240 0.7656 0.0855  0.0290  0.0334  160 ALA A N     
1225 C CA    . ALA A 163 ? 0.8699 0.7112 0.7653 0.0764  0.0306  0.0340  160 ALA A CA    
1226 C C     . ALA A 163 ? 0.8836 0.7225 0.7803 0.0579  0.0328  0.0384  160 ALA A C     
1227 O O     . ALA A 163 ? 1.0044 0.8473 0.9008 0.0546  0.0315  0.0421  160 ALA A O     
1228 C CB    . ALA A 163 ? 0.8115 0.6151 0.6794 0.0853  0.0253  0.0353  160 ALA A CB    
1229 N N     . PRO A 164 ? 0.9065 0.7404 0.8049 0.0457  0.0362  0.0379  161 PRO A N     
1230 C CA    . PRO A 164 ? 0.8681 0.6989 0.7657 0.0286  0.0380  0.0419  161 PRO A CA    
1231 C C     . PRO A 164 ? 0.9242 0.7218 0.7964 0.0240  0.0344  0.0473  161 PRO A C     
1232 O O     . PRO A 164 ? 0.8739 0.6544 0.7362 0.0130  0.0350  0.0488  161 PRO A O     
1233 C CB    . PRO A 164 ? 0.8860 0.7234 0.7935 0.0199  0.0421  0.0388  161 PRO A CB    
1234 C CG    . PRO A 164 ? 0.8294 0.6538 0.7289 0.0305  0.0409  0.0353  161 PRO A CG    
1235 C CD    . PRO A 164 ? 0.8494 0.6817 0.7501 0.0475  0.0384  0.0334  161 PRO A CD    
1236 N N     . SER A 165 ? 0.9845 0.7722 0.8448 0.0323  0.0301  0.0503  162 SER A N     
1237 C CA    . SER A 165 ? 1.0025 0.7546 0.8349 0.0303  0.0253  0.0557  162 SER A CA    
1238 C C     . SER A 165 ? 0.9831 0.7365 0.8117 0.0163  0.0260  0.0617  162 SER A C     
1239 O O     . SER A 165 ? 0.8697 0.6509 0.7157 0.0135  0.0288  0.0613  162 SER A O     
1240 C CB    . SER A 165 ? 1.0670 0.8045 0.8856 0.0492  0.0193  0.0555  162 SER A CB    
1241 O OG    . SER A 165 ? 0.9628 0.7258 0.7950 0.0569  0.0189  0.0552  162 SER A OG    
1242 N N     . THR A 166 ? 1.0398 0.7621 0.8440 0.0071  0.0232  0.0671  163 THR A N     
1243 C CA    . THR A 166 ? 1.0429 0.7639 0.8393 -0.0057 0.0234  0.0735  163 THR A CA    
1244 C C     . THR A 166 ? 1.0190 0.7449 0.8128 0.0053  0.0200  0.0757  163 THR A C     
1245 O O     . THR A 166 ? 1.0446 0.7905 0.8472 -0.0011 0.0223  0.0777  163 THR A O     
1246 C CB    . THR A 166 ? 1.1095 0.7932 0.8771 -0.0175 0.0203  0.0794  163 THR A CB    
1247 O OG1   . THR A 166 ? 1.0810 0.7642 0.8527 -0.0299 0.0236  0.0774  163 THR A OG1   
1248 C CG2   . THR A 166 ? 0.9956 0.6780 0.7529 -0.0308 0.0204  0.0866  163 THR A CG2   
1249 N N     . SER A 167 ? 1.0404 0.7491 0.8222 0.0226  0.0143  0.0749  164 SER A N     
1250 C CA    . SER A 167 ? 1.0197 0.7317 0.7974 0.0341  0.0101  0.0771  164 SER A CA    
1251 C C     . SER A 167 ? 1.0860 0.8401 0.8929 0.0386  0.0138  0.0727  164 SER A C     
1252 O O     . SER A 167 ? 1.2167 0.9827 1.0254 0.0378  0.0131  0.0753  164 SER A O     
1253 C CB    . SER A 167 ? 0.9691 0.6569 0.7299 0.0539  0.0030  0.0758  164 SER A CB    
1254 O OG    . SER A 167 ? 1.1699 0.8827 0.9514 0.0692  0.0042  0.0684  164 SER A OG    
1255 N N     . ALA A 168 ? 1.0062 0.7824 0.8348 0.0426  0.0176  0.0660  165 ALA A N     
1256 C CA    . ALA A 168 ? 0.9610 0.7752 0.8160 0.0453  0.0207  0.0619  165 ALA A CA    
1257 C C     . ALA A 168 ? 0.9653 0.7977 0.8325 0.0287  0.0257  0.0630  165 ALA A C     
1258 O O     . ALA A 168 ? 0.9690 0.8267 0.8511 0.0292  0.0269  0.0616  165 ALA A O     
1259 C CB    . ALA A 168 ? 0.9764 0.8077 0.8492 0.0531  0.0231  0.0550  165 ALA A CB    
1260 N N     . THR A 169 ? 0.8692 0.6900 0.7302 0.0144  0.0286  0.0651  166 THR A N     
1261 C CA    . THR A 169 ? 0.8488 0.6875 0.7202 -0.0003 0.0331  0.0658  166 THR A CA    
1262 C C     . THR A 169 ? 0.9132 0.7484 0.7723 -0.0050 0.0315  0.0713  166 THR A C     
1263 O O     . THR A 169 ? 0.9109 0.7697 0.7825 -0.0082 0.0337  0.0703  166 THR A O     
1264 C CB    . THR A 169 ? 0.8729 0.7023 0.7412 -0.0140 0.0363  0.0662  166 THR A CB    
1265 O OG1   . THR A 169 ? 0.8830 0.7140 0.7608 -0.0091 0.0374  0.0612  166 THR A OG1   
1266 C CG2   . THR A 169 ? 0.8496 0.7020 0.7312 -0.0272 0.0411  0.0657  166 THR A CG2   
1267 N N     . VAL A 170 ? 0.9011 0.7057 0.7344 -0.0056 0.0274  0.0772  167 VAL A N     
1268 C CA    . VAL A 170 ? 0.9505 0.7491 0.7689 -0.0104 0.0254  0.0833  167 VAL A CA    
1269 C C     . VAL A 170 ? 0.9333 0.7490 0.7598 0.0024  0.0228  0.0818  167 VAL A C     
1270 O O     . VAL A 170 ? 0.9242 0.7556 0.7541 -0.0026 0.0241  0.0833  167 VAL A O     
1271 C CB    . VAL A 170 ? 0.9406 0.6988 0.7272 -0.0123 0.0203  0.0902  167 VAL A CB    
1272 C CG1   . VAL A 170 ? 0.8973 0.6474 0.6668 -0.0127 0.0167  0.0966  167 VAL A CG1   
1273 C CG2   . VAL A 170 ? 0.8947 0.6393 0.6722 -0.0301 0.0232  0.0928  167 VAL A CG2   
1274 N N     . LYS A 171 ? 0.9215 0.7359 0.7513 0.0190  0.0190  0.0786  168 LYS A N     
1275 C CA    . LYS A 171 ? 0.9594 0.7923 0.7980 0.0313  0.0161  0.0767  168 LYS A CA    
1276 C C     . LYS A 171 ? 0.9538 0.8225 0.8178 0.0262  0.0208  0.0721  168 LYS A C     
1277 O O     . LYS A 171 ? 0.9276 0.8098 0.7937 0.0263  0.0199  0.0730  168 LYS A O     
1278 C CB    . LYS A 171 ? 0.9659 0.7974 0.8078 0.0493  0.0123  0.0727  168 LYS A CB    
1279 C CG    . LYS A 171 ? 1.1671 0.9685 0.9835 0.0615  0.0048  0.0767  168 LYS A CG    
1280 C CD    . LYS A 171 ? 1.3488 1.1590 1.1731 0.0813  0.0013  0.0714  168 LYS A CD    
1281 C CE    . LYS A 171 ? 1.4464 1.2954 1.2952 0.0861  0.0024  0.0670  168 LYS A CE    
1282 N NZ    . LYS A 171 ? 1.4670 1.3306 1.3263 0.1038  -0.0002 0.0614  168 LYS A NZ    
1283 N N     . SER A 172 ? 0.8939 0.7766 0.7759 0.0218  0.0255  0.0671  169 SER A N     
1284 C CA    . SER A 172 ? 0.8504 0.7642 0.7553 0.0182  0.0291  0.0623  169 SER A CA    
1285 C C     . SER A 172 ? 0.8818 0.8024 0.7858 0.0047  0.0324  0.0642  169 SER A C     
1286 O O     . SER A 172 ? 0.8607 0.8015 0.7744 0.0042  0.0328  0.0622  169 SER A O     
1287 C CB    . SER A 172 ? 0.8046 0.7285 0.7265 0.0175  0.0325  0.0569  169 SER A CB    
1288 O OG    . SER A 172 ? 0.8178 0.7379 0.7405 0.0301  0.0300  0.0548  169 SER A OG    
1289 N N     . LEU A 173 ? 0.8620 0.7671 0.7542 -0.0064 0.0346  0.0678  170 LEU A N     
1290 C CA    . LEU A 173 ? 0.8159 0.7309 0.7079 -0.0194 0.0383  0.0692  170 LEU A CA    
1291 C C     . LEU A 173 ? 0.8711 0.7820 0.7479 -0.0200 0.0359  0.0742  170 LEU A C     
1292 O O     . LEU A 173 ? 0.8934 0.8208 0.7739 -0.0269 0.0385  0.0738  170 LEU A O     
1293 C CB    . LEU A 173 ? 0.7493 0.6514 0.6333 -0.0321 0.0414  0.0716  170 LEU A CB    
1294 C CG    . LEU A 173 ? 0.7460 0.6567 0.6464 -0.0341 0.0445  0.0663  170 LEU A CG    
1295 C CD1   . LEU A 173 ? 0.7325 0.6330 0.6246 -0.0480 0.0473  0.0689  170 LEU A CD1   
1296 C CD2   . LEU A 173 ? 0.7114 0.6518 0.6344 -0.0334 0.0473  0.0601  170 LEU A CD2   
1297 N N     . ASN A 174 ? 0.8915 0.7804 0.7503 -0.0122 0.0306  0.0788  171 ASN A N     
1298 C CA    . ASN A 174 ? 0.8916 0.7769 0.7360 -0.0109 0.0273  0.0836  171 ASN A CA    
1299 C C     . ASN A 174 ? 0.9383 0.8507 0.7991 -0.0036 0.0267  0.0789  171 ASN A C     
1300 O O     . ASN A 174 ? 0.9914 0.9135 0.8484 -0.0078 0.0271  0.0803  171 ASN A O     
1301 C CB    . ASN A 174 ? 0.8238 0.6791 0.6457 -0.0015 0.0206  0.0888  171 ASN A CB    
1302 C CG    . ASN A 174 ? 0.8538 0.6777 0.6511 -0.0120 0.0202  0.0958  171 ASN A CG    
1303 O OD1   . ASN A 174 ? 0.8531 0.6802 0.6481 -0.0279 0.0249  0.0979  171 ASN A OD1   
1304 N ND2   . ASN A 174 ? 0.8820 0.6756 0.6599 -0.0032 0.0142  0.0992  171 ASN A ND2   
1305 N N     . VAL A 175 ? 0.8615 0.7864 0.7398 0.0067  0.0255  0.0731  172 VAL A N     
1306 C CA    . VAL A 175 ? 0.8774 0.8280 0.7717 0.0123  0.0246  0.0683  172 VAL A CA    
1307 C C     . VAL A 175 ? 0.8807 0.8524 0.7897 0.0025  0.0298  0.0639  172 VAL A C     
1308 O O     . VAL A 175 ? 0.8991 0.8862 0.8113 0.0015  0.0295  0.0623  172 VAL A O     
1309 C CB    . VAL A 175 ? 0.7909 0.7499 0.6992 0.0244  0.0221  0.0636  172 VAL A CB    
1310 C CG1   . VAL A 175 ? 0.8073 0.7939 0.7335 0.0272  0.0215  0.0582  172 VAL A CG1   
1311 C CG2   . VAL A 175 ? 0.7798 0.7209 0.6732 0.0369  0.0161  0.0672  172 VAL A CG2   
1312 N N     . LEU A 176 ? 0.8400 0.8125 0.7574 -0.0042 0.0341  0.0615  173 LEU A N     
1313 C CA    . LEU A 176 ? 0.8266 0.8183 0.7578 -0.0121 0.0385  0.0569  173 LEU A CA    
1314 C C     . LEU A 176 ? 0.9234 0.9178 0.8440 -0.0212 0.0409  0.0597  173 LEU A C     
1315 O O     . LEU A 176 ? 0.8985 0.9105 0.8249 -0.0218 0.0414  0.0564  173 LEU A O     
1316 C CB    . LEU A 176 ? 0.8645 0.8541 0.8043 -0.0170 0.0421  0.0545  173 LEU A CB    
1317 C CG    . LEU A 176 ? 0.8421 0.8468 0.7923 -0.0259 0.0466  0.0506  173 LEU A CG    
1318 C CD1   . LEU A 176 ? 0.8079 0.8339 0.7712 -0.0231 0.0462  0.0448  173 LEU A CD1   
1319 C CD2   . LEU A 176 ? 0.8330 0.8347 0.7923 -0.0278 0.0486  0.0482  173 LEU A CD2   
1320 N N     . THR A 177 ? 0.9525 0.9296 0.8564 -0.0288 0.0421  0.0658  174 THR A N     
1321 C CA    . THR A 177 ? 0.8785 0.8599 0.7718 -0.0394 0.0450  0.0689  174 THR A CA    
1322 C C     . THR A 177 ? 0.8930 0.8750 0.7744 -0.0360 0.0420  0.0720  174 THR A C     
1323 O O     . THR A 177 ? 0.8888 0.8736 0.7587 -0.0448 0.0442  0.0753  174 THR A O     
1324 C CB    . THR A 177 ? 0.8596 0.8212 0.7366 -0.0501 0.0467  0.0752  174 THR A CB    
1325 O OG1   . THR A 177 ? 0.9179 0.8518 0.7771 -0.0447 0.0417  0.0811  174 THR A OG1   
1326 C CG2   . THR A 177 ? 0.8419 0.8061 0.7312 -0.0547 0.0501  0.0717  174 THR A CG2   
1327 N N     . SER A 178 ? 0.9730 0.9538 0.8565 -0.0239 0.0368  0.0710  175 SER A N     
1328 C CA    . SER A 178 ? 0.8923 0.8804 0.7693 -0.0201 0.0339  0.0719  175 SER A CA    
1329 C C     . SER A 178 ? 0.8689 0.8830 0.7584 -0.0235 0.0372  0.0657  175 SER A C     
1330 O O     . SER A 178 ? 0.9836 1.0044 0.8645 -0.0246 0.0365  0.0669  175 SER A O     
1331 C CB    . SER A 178 ? 0.8958 0.8827 0.7765 -0.0062 0.0277  0.0707  175 SER A CB    
1332 O OG    . SER A 178 ? 1.0977 1.0600 0.9638 -0.0008 0.0237  0.0763  175 SER A OG    
1333 N N     . ILE A 179 ? 0.7885 0.8163 0.6967 -0.0248 0.0403  0.0590  176 ILE A N     
1334 C CA    . ILE A 179 ? 0.7975 0.8480 0.7170 -0.0264 0.0426  0.0522  176 ILE A CA    
1335 C C     . ILE A 179 ? 0.8227 0.8810 0.7390 -0.0373 0.0485  0.0523  176 ILE A C     
1336 O O     . ILE A 179 ? 0.9016 0.9747 0.8156 -0.0397 0.0503  0.0499  176 ILE A O     
1337 C CB    . ILE A 179 ? 0.6605 0.7209 0.6007 -0.0212 0.0418  0.0446  176 ILE A CB    
1338 C CG1   . ILE A 179 ? 0.8238 0.9036 0.7728 -0.0197 0.0415  0.0374  176 ILE A CG1   
1339 C CG2   . ILE A 179 ? 0.7209 0.7787 0.6696 -0.0259 0.0455  0.0432  176 ILE A CG2   
1340 C CD1   . ILE A 179 ? 0.7040 0.7908 0.6706 -0.0155 0.0398  0.0306  176 ILE A CD1   
1341 N N     . ALA A 180 ? 0.7507 0.8003 0.6660 -0.0440 0.0515  0.0549  177 ALA A N     
1342 C CA    . ALA A 180 ? 0.6876 0.7471 0.6012 -0.0549 0.0572  0.0548  177 ALA A CA    
1343 C C     . ALA A 180 ? 0.8086 0.8518 0.7169 -0.0622 0.0587  0.0597  177 ALA A C     
1344 O O     . ALA A 180 ? 0.8450 0.8752 0.7584 -0.0574 0.0564  0.0595  177 ALA A O     
1345 C CB    . ALA A 180 ? 0.6661 0.7486 0.5981 -0.0534 0.0597  0.0455  177 ALA A CB    
1346 N N     . ILE A 181 ? 0.7680 0.8128 0.6656 -0.0744 0.0626  0.0638  178 ILE A N     
1347 C CA    . ILE A 181 ? 0.7664 0.7963 0.6569 -0.0840 0.0642  0.0686  178 ILE A CA    
1348 C C     . ILE A 181 ? 0.7342 0.7841 0.6404 -0.0894 0.0688  0.0627  178 ILE A C     
1349 O O     . ILE A 181 ? 0.7461 0.8203 0.6576 -0.0928 0.0724  0.0589  178 ILE A O     
1350 C CB    . ILE A 181 ? 0.8260 0.8435 0.6925 -0.0961 0.0651  0.0776  178 ILE A CB    
1351 C CG1   . ILE A 181 ? 0.9480 0.9406 0.7968 -0.0896 0.0594  0.0840  178 ILE A CG1   
1352 C CG2   . ILE A 181 ? 0.7960 0.8018 0.6560 -0.1087 0.0672  0.0817  178 ILE A CG2   
1353 C CD1   . ILE A 181 ? 1.0208 0.9839 0.8628 -0.0854 0.0551  0.0875  178 ILE A CD1   
1354 N N     . PRO A 182 ? 0.7625 0.8039 0.6761 -0.0897 0.0685  0.0616  179 PRO A N     
1355 C CA    . PRO A 182 ? 0.7284 0.7882 0.6559 -0.0949 0.0723  0.0564  179 PRO A CA    
1356 C C     . PRO A 182 ? 0.7378 0.7983 0.6543 -0.1109 0.0759  0.0615  179 PRO A C     
1357 O O     . PRO A 182 ? 0.8563 0.8957 0.7535 -0.1185 0.0748  0.0696  179 PRO A O     
1358 C CB    . PRO A 182 ? 0.7253 0.7729 0.6630 -0.0885 0.0699  0.0539  179 PRO A CB    
1359 C CG    . PRO A 182 ? 0.7469 0.7652 0.6691 -0.0867 0.0662  0.0607  179 PRO A CG    
1360 C CD    . PRO A 182 ? 0.7542 0.7699 0.6644 -0.0837 0.0644  0.0642  179 PRO A CD    
1361 N N     . LYS A 183 ? 0.6832 0.7689 0.6118 -0.1160 0.0799  0.0564  180 LYS A N     
1362 C CA    . LYS A 183 ? 0.6987 0.7891 0.6200 -0.1321 0.0834  0.0603  180 LYS A CA    
1363 C C     . LYS A 183 ? 0.8129 0.8808 0.7313 -0.1364 0.0814  0.0632  180 LYS A C     
1364 O O     . LYS A 183 ? 0.9493 0.9988 0.8503 -0.1485 0.0812  0.0707  180 LYS A O     
1365 C CB    . LYS A 183 ? 0.6803 0.8069 0.6168 -0.1348 0.0879  0.0532  180 LYS A CB    
1366 C CG    . LYS A 183 ? 0.7094 0.8613 0.6468 -0.1327 0.0907  0.0500  180 LYS A CG    
1367 C CD    . LYS A 183 ? 0.7589 0.9465 0.7086 -0.1373 0.0953  0.0437  180 LYS A CD    
1368 C CE    . LYS A 183 ? 0.7792 0.9939 0.7283 -0.1358 0.0987  0.0402  180 LYS A CE    
1369 N NZ    . LYS A 183 ? 0.7801 1.0012 0.7407 -0.1183 0.0961  0.0317  180 LYS A NZ    
1370 N N     . VAL A 184 ? 0.7224 0.7902 0.6565 -0.1268 0.0797  0.0574  181 VAL A N     
1371 C CA    . VAL A 184 ? 0.7314 0.7829 0.6657 -0.1302 0.0782  0.0584  181 VAL A CA    
1372 C C     . VAL A 184 ? 0.7801 0.8147 0.7206 -0.1159 0.0742  0.0560  181 VAL A C     
1373 O O     . VAL A 184 ? 0.7702 0.8164 0.7236 -0.1044 0.0734  0.0506  181 VAL A O     
1374 C CB    . VAL A 184 ? 0.7835 0.8592 0.7326 -0.1356 0.0810  0.0531  181 VAL A CB    
1375 C CG1   . VAL A 184 ? 0.6707 0.7296 0.6208 -0.1378 0.0791  0.0534  181 VAL A CG1   
1376 C CG2   . VAL A 184 ? 0.8120 0.9071 0.7550 -0.1510 0.0853  0.0556  181 VAL A CG2   
1377 N N     . ILE A 185 ? 0.7448 0.7522 0.6751 -0.1171 0.0717  0.0600  182 ILE A N     
1378 C CA    . ILE A 185 ? 0.6784 0.6719 0.6150 -0.1050 0.0685  0.0574  182 ILE A CA    
1379 C C     . ILE A 185 ? 0.8381 0.8269 0.7790 -0.1098 0.0687  0.0557  182 ILE A C     
1380 O O     . ILE A 185 ? 0.9388 0.9137 0.8665 -0.1211 0.0688  0.0602  182 ILE A O     
1381 C CB    . ILE A 185 ? 0.6971 0.6623 0.6174 -0.0992 0.0647  0.0627  182 ILE A CB    
1382 C CG1   . ILE A 185 ? 0.6960 0.6678 0.6153 -0.0916 0.0637  0.0631  182 ILE A CG1   
1383 C CG2   . ILE A 185 ? 0.7782 0.7290 0.7032 -0.0892 0.0620  0.0602  182 ILE A CG2   
1384 C CD1   . ILE A 185 ? 0.7642 0.7102 0.6672 -0.0848 0.0594  0.0681  182 ILE A CD1   
1385 N N     . HIS A 186 ? 0.7626 0.7620 0.7206 -0.1019 0.0685  0.0496  183 HIS A N     
1386 C CA    . HIS A 186 ? 0.6810 0.6766 0.6439 -0.1049 0.0683  0.0475  183 HIS A CA    
1387 C C     . HIS A 186 ? 0.6900 0.6658 0.6521 -0.0949 0.0655  0.0470  183 HIS A C     
1388 O O     . HIS A 186 ? 0.7498 0.7303 0.7209 -0.0838 0.0644  0.0440  183 HIS A O     
1389 C CB    . HIS A 186 ? 0.7231 0.7452 0.7047 -0.1039 0.0699  0.0409  183 HIS A CB    
1390 C CG    . HIS A 186 ? 0.8391 0.8590 0.8252 -0.1077 0.0695  0.0390  183 HIS A CG    
1391 N ND1   . HIS A 186 ? 0.8368 0.8714 0.8257 -0.1183 0.0712  0.0381  183 HIS A ND1   
1392 C CD2   . HIS A 186 ? 0.7380 0.7438 0.7259 -0.1025 0.0675  0.0377  183 HIS A CD2   
1393 C CE1   . HIS A 186 ? 0.7902 0.8187 0.7822 -0.1193 0.0699  0.0363  183 HIS A CE1   
1394 N NE2   . HIS A 186 ? 0.7524 0.7630 0.7436 -0.1098 0.0678  0.0361  183 HIS A NE2   
1395 N N     . SER A 187 ? 0.6655 0.6202 0.6166 -0.0994 0.0642  0.0495  184 SER A N     
1396 C CA    . SER A 187 ? 0.7383 0.6747 0.6872 -0.0903 0.0619  0.0487  184 SER A CA    
1397 C C     . SER A 187 ? 0.7561 0.6851 0.7043 -0.0963 0.0618  0.0474  184 SER A C     
1398 O O     . SER A 187 ? 0.6763 0.6093 0.6214 -0.1087 0.0629  0.0486  184 SER A O     
1399 C CB    . SER A 187 ? 0.6908 0.6011 0.6209 -0.0864 0.0592  0.0536  184 SER A CB    
1400 O OG    . SER A 187 ? 0.8068 0.6967 0.7183 -0.0976 0.0583  0.0583  184 SER A OG    
1401 N N     . ASP A 188 ? 0.7413 0.6610 0.6922 -0.0878 0.0604  0.0448  185 ASP A N     
1402 C CA    . ASP A 188 ? 0.7715 0.6787 0.7174 -0.0929 0.0597  0.0441  185 ASP A CA    
1403 C C     . ASP A 188 ? 0.7800 0.6567 0.7027 -0.0969 0.0574  0.0489  185 ASP A C     
1404 O O     . ASP A 188 ? 0.7795 0.6457 0.6905 -0.0960 0.0563  0.0529  185 ASP A O     
1405 C CB    . ASP A 188 ? 0.7085 0.6171 0.6644 -0.0830 0.0593  0.0396  185 ASP A CB    
1406 C CG    . ASP A 188 ? 0.7551 0.6526 0.7072 -0.0699 0.0579  0.0397  185 ASP A CG    
1407 O OD1   . ASP A 188 ? 0.8121 0.6900 0.7483 -0.0681 0.0561  0.0433  185 ASP A OD1   
1408 O OD2   . ASP A 188 ? 0.8133 0.7220 0.7780 -0.0616 0.0584  0.0362  185 ASP A OD2   
1409 N N     . GLN A 189 ? 0.8491 0.7096 0.7636 -0.1012 0.0561  0.0483  186 GLN A N     
1410 C CA    . GLN A 189 ? 0.8733 0.7015 0.7635 -0.1059 0.0531  0.0525  186 GLN A CA    
1411 C C     . GLN A 189 ? 0.8801 0.6857 0.7606 -0.0915 0.0504  0.0515  186 GLN A C     
1412 O O     . GLN A 189 ? 0.9646 0.7427 0.8276 -0.0926 0.0475  0.0521  186 GLN A O     
1413 C CB    . GLN A 189 ? 0.8049 0.6259 0.6886 -0.1198 0.0526  0.0525  186 GLN A CB    
1414 C CG    . GLN A 189 ? 0.8527 0.6922 0.7396 -0.1360 0.0547  0.0549  186 GLN A CG    
1415 C CD    . GLN A 189 ? 1.0432 0.8746 0.9211 -0.1517 0.0536  0.0557  186 GLN A CD    
1416 O OE1   . GLN A 189 ? 1.1546 0.9564 1.0152 -0.1530 0.0503  0.0565  186 GLN A OE1   
1417 N NE2   . GLN A 189 ? 1.0663 0.9246 0.9557 -0.1633 0.0560  0.0551  186 GLN A NE2   
1418 N N     . GLY A 190 ? 0.8178 0.6345 0.7087 -0.0777 0.0509  0.0497  187 GLY A N     
1419 C CA    . GLY A 190 ? 0.8302 0.6288 0.7118 -0.0633 0.0482  0.0488  187 GLY A CA    
1420 C C     . GLY A 190 ? 0.9841 0.7542 0.8416 -0.0632 0.0444  0.0540  187 GLY A C     
1421 O O     . GLY A 190 ? 1.0095 0.7776 0.8593 -0.0738 0.0443  0.0588  187 GLY A O     
1422 N N     . ALA A 191 ? 1.0603 0.8082 0.9049 -0.0505 0.0410  0.0529  188 ALA A N     
1423 C CA    . ALA A 191 ? 1.0243 0.7381 0.8418 -0.0495 0.0361  0.0575  188 ALA A CA    
1424 C C     . ALA A 191 ? 0.9603 0.6785 0.7753 -0.0469 0.0351  0.0620  188 ALA A C     
1425 O O     . ALA A 191 ? 0.9087 0.6055 0.7032 -0.0550 0.0323  0.0679  188 ALA A O     
1426 C CB    . ALA A 191 ? 0.8646 0.5559 0.6699 -0.0333 0.0324  0.0542  188 ALA A CB    
1427 N N     . ALA A 192 ? 0.9392 0.6843 0.7735 -0.0365 0.0371  0.0594  189 ALA A N     
1428 C CA    . ALA A 192 ? 0.9543 0.7044 0.7865 -0.0329 0.0358  0.0631  189 ALA A CA    
1429 C C     . ALA A 192 ? 0.9865 0.7440 0.8171 -0.0497 0.0379  0.0679  189 ALA A C     
1430 O O     . ALA A 192 ? 0.9847 0.7329 0.8020 -0.0512 0.0357  0.0730  189 ALA A O     
1431 C CB    . ALA A 192 ? 0.9339 0.7145 0.7891 -0.0209 0.0378  0.0588  189 ALA A CB    
1432 N N     . PHE A 193 ? 0.9273 0.7023 0.7707 -0.0623 0.0420  0.0662  190 PHE A N     
1433 C CA    . PHE A 193 ? 0.8976 0.6882 0.7442 -0.0770 0.0449  0.0693  190 PHE A CA    
1434 C C     . PHE A 193 ? 1.0112 0.7819 0.8387 -0.0943 0.0442  0.0741  190 PHE A C     
1435 O O     . PHE A 193 ? 1.0237 0.8027 0.8476 -0.1069 0.0459  0.0781  190 PHE A O     
1436 C CB    . PHE A 193 ? 0.7907 0.6164 0.6642 -0.0794 0.0497  0.0641  190 PHE A CB    
1437 C CG    . PHE A 193 ? 0.8486 0.6928 0.7404 -0.0646 0.0502  0.0593  190 PHE A CG    
1438 C CD1   . PHE A 193 ? 0.8060 0.6530 0.6969 -0.0550 0.0486  0.0605  190 PHE A CD1   
1439 C CD2   . PHE A 193 ? 0.9391 0.7974 0.8480 -0.0608 0.0520  0.0537  190 PHE A CD2   
1440 C CE1   . PHE A 193 ? 0.7355 0.6003 0.6429 -0.0429 0.0488  0.0562  190 PHE A CE1   
1441 C CE2   . PHE A 193 ? 0.8124 0.6872 0.7368 -0.0491 0.0524  0.0498  190 PHE A CE2   
1442 C CZ    . PHE A 193 ? 0.7659 0.6444 0.6899 -0.0405 0.0508  0.0509  190 PHE A CZ    
1443 N N     . THR A 194 ? 1.0341 0.7795 0.8487 -0.0957 0.0416  0.0736  191 THR A N     
1444 C CA    . THR A 194 ? 0.9574 0.6834 0.7536 -0.1135 0.0404  0.0778  191 THR A CA    
1445 C C     . THR A 194 ? 0.9726 0.6569 0.7365 -0.1145 0.0346  0.0840  191 THR A C     
1446 O O     . THR A 194 ? 1.0718 0.7356 0.8166 -0.1306 0.0329  0.0883  191 THR A O     
1447 C CB    . THR A 194 ? 0.9804 0.7036 0.7812 -0.1168 0.0408  0.0733  191 THR A CB    
1448 O OG1   . THR A 194 ? 1.1266 0.8264 0.9189 -0.1016 0.0372  0.0703  191 THR A OG1   
1449 C CG2   . THR A 194 ? 0.8602 0.6223 0.6909 -0.1161 0.0458  0.0677  191 THR A CG2   
1450 N N     . SER A 195 ? 0.9548 0.6256 0.7111 -0.0979 0.0311  0.0845  192 SER A N     
1451 C CA    . SER A 195 ? 1.0972 0.7267 0.8212 -0.0972 0.0247  0.0905  192 SER A CA    
1452 C C     . SER A 195 ? 1.2008 0.8290 0.9120 -0.1134 0.0250  0.0984  192 SER A C     
1453 O O     . SER A 195 ? 1.2275 0.8897 0.9568 -0.1195 0.0302  0.0985  192 SER A O     
1454 C CB    . SER A 195 ? 1.1793 0.7995 0.9003 -0.0741 0.0207  0.0887  192 SER A CB    
1455 O OG    . SER A 195 ? 1.1717 0.8181 0.9065 -0.0691 0.0229  0.0897  192 SER A OG    
1456 N N     . SER A 196 ? 1.2475 0.8350 0.9258 -0.1205 0.0193  0.1050  193 SER A N     
1457 C CA    . SER A 196 ? 1.2111 0.7940 0.8734 -0.1361 0.0192  0.1135  193 SER A CA    
1458 C C     . SER A 196 ? 1.2323 0.8241 0.8967 -0.1231 0.0183  0.1154  193 SER A C     
1459 O O     . SER A 196 ? 1.2287 0.8382 0.8946 -0.1337 0.0214  0.1198  193 SER A O     
1460 C CB    . SER A 196 ? 1.1891 0.7222 0.8128 -0.1478 0.0124  0.1205  193 SER A CB    
1461 O OG    . SER A 196 ? 1.3689 0.8644 0.9732 -0.1289 0.0049  0.1197  193 SER A OG    
1462 N N     . THR A 197 ? 1.2513 0.8328 0.9158 -0.1003 0.0142  0.1120  194 THR A N     
1463 C CA    . THR A 197 ? 1.2166 0.8090 0.8849 -0.0868 0.0130  0.1131  194 THR A CA    
1464 C C     . THR A 197 ? 1.1883 0.8302 0.8887 -0.0886 0.0204  0.1095  194 THR A C     
1465 O O     . THR A 197 ? 1.0553 0.7098 0.7556 -0.0898 0.0212  0.1130  194 THR A O     
1466 C CB    . THR A 197 ? 1.1924 0.7726 0.8605 -0.0614 0.0080  0.1084  194 THR A CB    
1467 O OG1   . THR A 197 ? 1.3443 0.8752 0.9788 -0.0581 0.0000  0.1119  194 THR A OG1   
1468 C CG2   . THR A 197 ? 1.0246 0.6217 0.7004 -0.0471 0.0068  0.1086  194 THR A CG2   
1469 N N     . PHE A 198 ? 1.1899 0.8590 0.9165 -0.0888 0.0256  0.1025  195 PHE A N     
1470 C CA    . PHE A 198 ? 1.1115 0.8249 0.8670 -0.0907 0.0320  0.0987  195 PHE A CA    
1471 C C     . PHE A 198 ? 1.0671 0.7942 0.8205 -0.1119 0.0362  0.1030  195 PHE A C     
1472 O O     . PHE A 198 ? 1.0277 0.7833 0.7940 -0.1134 0.0398  0.1026  195 PHE A O     
1473 C CB    . PHE A 198 ? 0.8846 0.6202 0.6661 -0.0851 0.0356  0.0904  195 PHE A CB    
1474 C CG    . PHE A 198 ? 0.8719 0.6487 0.6820 -0.0823 0.0406  0.0856  195 PHE A CG    
1475 C CD1   . PHE A 198 ? 0.8381 0.6276 0.6556 -0.0697 0.0396  0.0846  195 PHE A CD1   
1476 C CD2   . PHE A 198 ? 0.8653 0.6675 0.6939 -0.0919 0.0457  0.0818  195 PHE A CD2   
1477 C CE1   . PHE A 198 ? 0.8392 0.6637 0.6810 -0.0674 0.0436  0.0799  195 PHE A CE1   
1478 C CE2   . PHE A 198 ? 0.8745 0.7114 0.7272 -0.0884 0.0495  0.0770  195 PHE A CE2   
1479 C CZ    . PHE A 198 ? 0.8447 0.6917 0.7034 -0.0765 0.0484  0.0761  195 PHE A CZ    
1480 N N     . ALA A 199 ? 1.1044 0.8126 0.8416 -0.1285 0.0357  0.1068  196 ALA A N     
1481 C CA    . ALA A 199 ? 0.9409 0.6636 0.6751 -0.1499 0.0398  0.1111  196 ALA A CA    
1482 C C     . ALA A 199 ? 1.1655 0.8779 0.8794 -0.1546 0.0380  0.1190  196 ALA A C     
1483 O O     . ALA A 199 ? 1.0896 0.8302 0.8117 -0.1630 0.0426  0.1201  196 ALA A O     
1484 C CB    . ALA A 199 ? 0.9626 0.6662 0.6824 -0.1676 0.0390  0.1137  196 ALA A CB    
1485 N N     . GLU A 200 ? 1.1741 0.8455 0.8601 -0.1490 0.0309  0.1244  197 GLU A N     
1486 C CA    . GLU A 200 ? 1.2395 0.8979 0.9041 -0.1520 0.0282  0.1323  197 GLU A CA    
1487 C C     . GLU A 200 ? 1.1971 0.8851 0.8802 -0.1379 0.0302  0.1291  197 GLU A C     
1488 O O     . GLU A 200 ? 1.2186 0.9181 0.8962 -0.1453 0.0320  0.1336  197 GLU A O     
1489 C CB    . GLU A 200 ? 1.4706 1.0773 1.1019 -0.1450 0.0191  0.1378  197 GLU A CB    
1490 C CG    . GLU A 200 ? 1.7596 1.3311 1.3678 -0.1596 0.0159  0.1414  197 GLU A CG    
1491 C CD    . GLU A 200 ? 1.9805 1.5001 1.5585 -0.1474 0.0062  0.1442  197 GLU A CD    
1492 O OE1   . GLU A 200 ? 2.0484 1.5613 1.6238 -0.1274 0.0020  0.1436  197 GLU A OE1   
1493 O OE2   . GLU A 200 ? 1.9938 1.4793 1.5501 -0.1574 0.0024  0.1467  197 GLU A OE2   
1494 N N     . TRP A 201 ? 1.1256 0.8264 0.8299 -0.1182 0.0299  0.1214  198 TRP A N     
1495 C CA    . TRP A 201 ? 1.0786 0.8081 0.8015 -0.1055 0.0315  0.1178  198 TRP A CA    
1496 C C     . TRP A 201 ? 1.1514 0.9225 0.8959 -0.1160 0.0391  0.1148  198 TRP A C     
1497 O O     . TRP A 201 ? 1.1851 0.9750 0.9338 -0.1139 0.0405  0.1152  198 TRP A O     
1498 C CB    . TRP A 201 ? 1.0529 0.7892 0.7947 -0.0848 0.0299  0.1101  198 TRP A CB    
1499 C CG    . TRP A 201 ? 1.0138 0.7807 0.7761 -0.0730 0.0314  0.1057  198 TRP A CG    
1500 C CD1   . TRP A 201 ? 0.9444 0.7065 0.7001 -0.0597 0.0268  0.1073  198 TRP A CD1   
1501 C CD2   . TRP A 201 ? 0.9694 0.7754 0.7607 -0.0737 0.0372  0.0990  198 TRP A CD2   
1502 N NE1   . TRP A 201 ? 0.9182 0.7145 0.6975 -0.0531 0.0296  0.1019  198 TRP A NE1   
1503 C CE2   . TRP A 201 ? 0.8975 0.7198 0.6981 -0.0613 0.0359  0.0968  198 TRP A CE2   
1504 C CE3   . TRP A 201 ? 0.9180 0.7461 0.7275 -0.0831 0.0429  0.0945  198 TRP A CE3   
1505 C CZ2   . TRP A 201 ? 0.9051 0.7624 0.7312 -0.0588 0.0399  0.0903  198 TRP A CZ2   
1506 C CZ3   . TRP A 201 ? 0.8612 0.7238 0.6959 -0.0793 0.0468  0.0881  198 TRP A CZ3   
1507 C CH2   . TRP A 201 ? 0.8903 0.7661 0.7325 -0.0676 0.0452  0.0860  198 TRP A CH2   
1508 N N     . ALA A 202 ? 1.0191 0.8053 0.7770 -0.1264 0.0437  0.1112  199 ALA A N     
1509 C CA    . ALA A 202 ? 0.8975 0.7238 0.6763 -0.1346 0.0505  0.1073  199 ALA A CA    
1510 C C     . ALA A 202 ? 1.0483 0.8784 0.8116 -0.1543 0.0532  0.1141  199 ALA A C     
1511 O O     . ALA A 202 ? 1.0553 0.9145 0.8278 -0.1571 0.0574  0.1128  199 ALA A O     
1512 C CB    . ALA A 202 ? 0.8494 0.6918 0.6487 -0.1371 0.0539  0.1007  199 ALA A CB    
1513 N N     . LYS A 203 ? 1.0562 0.8573 0.7951 -0.1686 0.0510  0.1210  200 LYS A N     
1514 C CA    . LYS A 203 ? 1.0755 0.8795 0.7977 -0.1895 0.0535  0.1283  200 LYS A CA    
1515 C C     . LYS A 203 ? 1.1184 0.9190 0.8263 -0.1864 0.0520  0.1336  200 LYS A C     
1516 O O     . LYS A 203 ? 1.0836 0.9071 0.7905 -0.1983 0.0566  0.1360  200 LYS A O     
1517 C CB    . LYS A 203 ? 1.0493 0.8169 0.7447 -0.2054 0.0501  0.1354  200 LYS A CB    
1518 C CG    . LYS A 203 ? 1.1639 0.9376 0.8431 -0.2306 0.0534  0.1428  200 LYS A CG    
1519 C CD    . LYS A 203 ? 1.2374 0.9735 0.8893 -0.2479 0.0494  0.1497  200 LYS A CD    
1520 C CE    . LYS A 203 ? 1.3621 1.1076 0.9986 -0.2750 0.0530  0.1573  200 LYS A CE    
1521 N NZ    . LYS A 203 ? 1.4373 1.1480 1.0477 -0.2947 0.0492  0.1639  200 LYS A NZ    
1522 N N     . GLU A 204 ? 1.0881 0.8620 0.7850 -0.1700 0.0455  0.1352  201 GLU A N     
1523 C CA    . GLU A 204 ? 1.0479 0.8171 0.7308 -0.1653 0.0430  0.1401  201 GLU A CA    
1524 C C     . GLU A 204 ? 1.0961 0.9082 0.8027 -0.1593 0.0482  0.1342  201 GLU A C     
1525 O O     . GLU A 204 ? 1.2831 1.0989 0.9787 -0.1603 0.0478  0.1383  201 GLU A O     
1526 C CB    . GLU A 204 ? 1.1555 0.8919 0.8261 -0.1458 0.0347  0.1412  201 GLU A CB    
1527 C CG    . GLU A 204 ? 1.4092 1.0954 1.0447 -0.1514 0.0276  0.1498  201 GLU A CG    
1528 C CD    . GLU A 204 ? 1.5632 1.2200 1.1899 -0.1292 0.0193  0.1489  201 GLU A CD    
1529 O OE1   . GLU A 204 ? 1.5081 1.1858 1.1576 -0.1106 0.0195  0.1417  201 GLU A OE1   
1530 O OE2   . GLU A 204 ? 1.6013 1.2140 1.1976 -0.1302 0.0124  0.1553  201 GLU A OE2   
1531 N N     . ARG A 205 ? 0.9907 0.8338 0.7279 -0.1531 0.0525  0.1247  202 ARG A N     
1532 C CA    . ARG A 205 ? 0.9406 0.8207 0.7000 -0.1448 0.0562  0.1179  202 ARG A CA    
1533 C C     . ARG A 205 ? 0.9418 0.8593 0.7196 -0.1559 0.0638  0.1130  202 ARG A C     
1534 O O     . ARG A 205 ? 1.0009 0.9492 0.8000 -0.1478 0.0668  0.1055  202 ARG A O     
1535 C CB    . ARG A 205 ? 0.9383 0.8222 0.7178 -0.1241 0.0535  0.1103  202 ARG A CB    
1536 C CG    . ARG A 205 ? 0.9698 0.8259 0.7347 -0.1101 0.0462  0.1138  202 ARG A CG    
1537 C CD    . ARG A 205 ? 1.0110 0.8601 0.7896 -0.0943 0.0431  0.1081  202 ARG A CD    
1538 N NE    . ARG A 205 ? 1.0399 0.8707 0.8086 -0.0786 0.0364  0.1100  202 ARG A NE    
1539 C CZ    . ARG A 205 ? 1.0456 0.8398 0.7898 -0.0758 0.0304  0.1161  202 ARG A CZ    
1540 N NH1   . ARG A 205 ? 1.0589 0.8288 0.7850 -0.0889 0.0302  0.1212  202 ARG A NH1   
1541 N NH2   . ARG A 205 ? 1.0203 0.8019 0.7573 -0.0598 0.0241  0.1169  202 ARG A NH2   
1542 N N     . GLY A 206 ? 0.8774 0.7933 0.6470 -0.1742 0.0667  0.1166  203 GLY A N     
1543 C CA    . GLY A 206 ? 0.8569 0.8103 0.6446 -0.1839 0.0735  0.1114  203 GLY A CA    
1544 C C     . GLY A 206 ? 0.9447 0.9153 0.7601 -0.1741 0.0748  0.1017  203 GLY A C     
1545 O O     . GLY A 206 ? 0.9478 0.9528 0.7812 -0.1775 0.0799  0.0957  203 GLY A O     
1546 N N     . ILE A 207 ? 0.9714 0.9196 0.7899 -0.1618 0.0702  0.0999  204 ILE A N     
1547 C CA    . ILE A 207 ? 0.9328 0.8942 0.7756 -0.1526 0.0710  0.0914  204 ILE A CA    
1548 C C     . ILE A 207 ? 0.9188 0.8725 0.7596 -0.1648 0.0717  0.0924  204 ILE A C     
1549 O O     . ILE A 207 ? 1.0858 1.0066 0.9070 -0.1703 0.0682  0.0984  204 ILE A O     
1550 C CB    . ILE A 207 ? 0.9321 0.8759 0.7794 -0.1340 0.0660  0.0889  204 ILE A CB    
1551 C CG1   . ILE A 207 ? 0.9237 0.8754 0.7722 -0.1228 0.0647  0.0881  204 ILE A CG1   
1552 C CG2   . ILE A 207 ? 0.7996 0.7567 0.6705 -0.1259 0.0669  0.0806  204 ILE A CG2   
1553 C CD1   . ILE A 207 ? 0.8370 0.7772 0.6921 -0.1049 0.0601  0.0851  204 ILE A CD1   
1554 N N     . HIS A 208 ? 0.8147 0.7979 0.6749 -0.1686 0.0759  0.0862  205 HIS A N     
1555 C CA    . HIS A 208 ? 0.8984 0.8783 0.7602 -0.1789 0.0764  0.0859  205 HIS A CA    
1556 C C     . HIS A 208 ? 0.8263 0.7960 0.7008 -0.1655 0.0735  0.0805  205 HIS A C     
1557 O O     . HIS A 208 ? 0.7525 0.7404 0.6469 -0.1523 0.0741  0.0735  205 HIS A O     
1558 C CB    . HIS A 208 ? 0.9196 0.9380 0.7961 -0.1892 0.0818  0.0817  205 HIS A CB    
1559 C CG    . HIS A 208 ? 1.1329 1.1522 1.0139 -0.1987 0.0820  0.0803  205 HIS A CG    
1560 N ND1   . HIS A 208 ? 1.2029 1.1995 1.0642 -0.2152 0.0806  0.0872  205 HIS A ND1   
1561 C CD2   . HIS A 208 ? 1.1290 1.1680 1.0310 -0.1941 0.0829  0.0729  205 HIS A CD2   
1562 C CE1   . HIS A 208 ? 1.2257 1.2295 1.0965 -0.2206 0.0808  0.0838  205 HIS A CE1   
1563 N NE2   . HIS A 208 ? 1.1852 1.2149 1.0807 -0.2077 0.0823  0.0752  205 HIS A NE2   
1564 N N     . LEU A 209 ? 0.7794 0.7194 0.6413 -0.1692 0.0703  0.0837  206 LEU A N     
1565 C CA    . LEU A 209 ? 0.8373 0.7672 0.7094 -0.1579 0.0679  0.0789  206 LEU A CA    
1566 C C     . LEU A 209 ? 0.8476 0.7959 0.7337 -0.1655 0.0702  0.0744  206 LEU A C     
1567 O O     . LEU A 209 ? 0.8359 0.7848 0.7134 -0.1822 0.0714  0.0776  206 LEU A O     
1568 C CB    . LEU A 209 ? 0.7933 0.6815 0.6441 -0.1559 0.0628  0.0837  206 LEU A CB    
1569 C CG    . LEU A 209 ? 0.8229 0.6910 0.6611 -0.1441 0.0592  0.0871  206 LEU A CG    
1570 C CD1   . LEU A 209 ? 0.8283 0.6579 0.6497 -0.1376 0.0539  0.0893  206 LEU A CD1   
1571 C CD2   . LEU A 209 ? 0.7779 0.6684 0.6365 -0.1279 0.0602  0.0813  206 LEU A CD2   
1572 N N     . GLU A 210 ? 0.8041 0.7675 0.7111 -0.1536 0.0706  0.0672  207 GLU A N     
1573 C CA    . GLU A 210 ? 0.8474 0.8305 0.7699 -0.1577 0.0722  0.0620  207 GLU A CA    
1574 C C     . GLU A 210 ? 0.8131 0.7810 0.7413 -0.1470 0.0694  0.0585  207 GLU A C     
1575 O O     . GLU A 210 ? 0.8873 0.8537 0.8232 -0.1324 0.0683  0.0557  207 GLU A O     
1576 C CB    . GLU A 210 ? 0.8327 0.8532 0.7753 -0.1534 0.0754  0.0560  207 GLU A CB    
1577 C CG    . GLU A 210 ? 0.8915 0.9352 0.8507 -0.1558 0.0766  0.0501  207 GLU A CG    
1578 C CD    . GLU A 210 ? 0.9833 1.0603 0.9609 -0.1479 0.0787  0.0435  207 GLU A CD    
1579 O OE1   . GLU A 210 ? 0.9074 0.9835 0.8929 -0.1337 0.0773  0.0401  207 GLU A OE1   
1580 O OE2   . GLU A 210 ? 1.0719 1.1760 1.0554 -0.1559 0.0815  0.0415  207 GLU A OE2   
1581 N N     . PHE A 211 ? 0.7889 0.7460 0.7127 -0.1549 0.0683  0.0588  208 PHE A N     
1582 C CA    . PHE A 211 ? 0.8059 0.7445 0.7306 -0.1462 0.0656  0.0563  208 PHE A CA    
1583 C C     . PHE A 211 ? 0.6885 0.6467 0.6309 -0.1460 0.0664  0.0504  208 PHE A C     
1584 O O     . PHE A 211 ? 0.7907 0.7657 0.7368 -0.1577 0.0678  0.0497  208 PHE A O     
1585 C CB    . PHE A 211 ? 0.7991 0.7029 0.7011 -0.1537 0.0626  0.0612  208 PHE A CB    
1586 C CG    . PHE A 211 ? 0.7917 0.6701 0.6739 -0.1512 0.0605  0.0670  208 PHE A CG    
1587 C CD1   . PHE A 211 ? 0.7598 0.6235 0.6406 -0.1349 0.0582  0.0660  208 PHE A CD1   
1588 C CD2   . PHE A 211 ? 0.7846 0.6544 0.6490 -0.1655 0.0605  0.0734  208 PHE A CD2   
1589 C CE1   . PHE A 211 ? 0.8274 0.6681 0.6897 -0.1313 0.0555  0.0712  208 PHE A CE1   
1590 C CE2   . PHE A 211 ? 0.8662 0.7106 0.7106 -0.1629 0.0577  0.0791  208 PHE A CE2   
1591 C CZ    . PHE A 211 ? 0.8800 0.7096 0.7234 -0.1451 0.0550  0.0778  208 PHE A CZ    
1592 N N     . SER A 212 ? 0.6833 0.6400 0.6361 -0.1328 0.0652  0.0461  209 SER A N     
1593 C CA    . SER A 212 ? 0.6976 0.6661 0.6636 -0.1318 0.0650  0.0411  209 SER A CA    
1594 C C     . SER A 212 ? 0.7526 0.7051 0.7073 -0.1426 0.0635  0.0427  209 SER A C     
1595 O O     . SER A 212 ? 0.8059 0.7313 0.7419 -0.1470 0.0619  0.0470  209 SER A O     
1596 C CB    . SER A 212 ? 0.7269 0.6914 0.7018 -0.1170 0.0638  0.0375  209 SER A CB    
1597 O OG    . SER A 212 ? 0.9290 0.9116 0.9166 -0.1081 0.0647  0.0349  209 SER A OG    
1598 N N     . THR A 213 ? 0.7867 0.7554 0.7522 -0.1467 0.0635  0.0390  210 THR A N     
1599 C CA    . THR A 213 ? 0.6781 0.6313 0.6348 -0.1546 0.0614  0.0393  210 THR A CA    
1600 C C     . THR A 213 ? 0.7390 0.6668 0.6896 -0.1435 0.0594  0.0384  210 THR A C     
1601 O O     . THR A 213 ? 0.8004 0.7326 0.7608 -0.1302 0.0598  0.0359  210 THR A O     
1602 C CB    . THR A 213 ? 0.6642 0.6418 0.6353 -0.1587 0.0613  0.0348  210 THR A CB    
1603 O OG1   . THR A 213 ? 0.8042 0.7992 0.7929 -0.1454 0.0616  0.0300  210 THR A OG1   
1604 C CG2   . THR A 213 ? 0.6666 0.6680 0.6403 -0.1724 0.0631  0.0359  210 THR A CG2   
1605 N N     . PRO A 214 ? 0.7458 0.6470 0.6797 -0.1490 0.0571  0.0402  211 PRO A N     
1606 C CA    . PRO A 214 ? 0.7932 0.6699 0.7192 -0.1376 0.0554  0.0393  211 PRO A CA    
1607 C C     . PRO A 214 ? 0.7541 0.6413 0.6943 -0.1285 0.0555  0.0341  211 PRO A C     
1608 O O     . PRO A 214 ? 0.7925 0.6952 0.7420 -0.1338 0.0553  0.0315  211 PRO A O     
1609 C CB    . PRO A 214 ? 0.8146 0.6617 0.7185 -0.1474 0.0525  0.0418  211 PRO A CB    
1610 C CG    . PRO A 214 ? 0.8191 0.6813 0.7256 -0.1641 0.0527  0.0422  211 PRO A CG    
1611 C CD    . PRO A 214 ? 0.8025 0.6951 0.7232 -0.1661 0.0558  0.0429  211 PRO A CD    
1612 N N     . TYR A 215 ? 0.7435 0.6230 0.6849 -0.1147 0.0556  0.0328  212 TYR A N     
1613 C CA    . TYR A 215 ? 0.8066 0.6917 0.7580 -0.1060 0.0556  0.0286  212 TYR A CA    
1614 C C     . TYR A 215 ? 0.8253 0.7388 0.7959 -0.1066 0.0566  0.0258  212 TYR A C     
1615 O O     . TYR A 215 ? 0.9125 0.8319 0.8885 -0.1083 0.0556  0.0230  212 TYR A O     
1616 C CB    . TYR A 215 ? 0.6877 0.5538 0.6275 -0.1091 0.0537  0.0272  212 TYR A CB    
1617 C CG    . TYR A 215 ? 0.7428 0.5779 0.6612 -0.1078 0.0519  0.0294  212 TYR A CG    
1618 C CD1   . TYR A 215 ? 0.7963 0.6192 0.7101 -0.0941 0.0519  0.0282  212 TYR A CD1   
1619 C CD2   . TYR A 215 ? 0.7885 0.6067 0.6905 -0.1201 0.0500  0.0326  212 TYR A CD2   
1620 C CE1   . TYR A 215 ? 0.9307 0.7245 0.8240 -0.0909 0.0496  0.0296  212 TYR A CE1   
1621 C CE2   . TYR A 215 ? 0.9641 0.7503 0.8441 -0.1184 0.0475  0.0346  212 TYR A CE2   
1622 C CZ    . TYR A 215 ? 1.0551 0.8288 0.9307 -0.1028 0.0471  0.0329  212 TYR A CZ    
1623 O OH    . TYR A 215 ? 1.1342 0.8752 0.9870 -0.0992 0.0439  0.0344  212 TYR A OH    
1624 N N     . HIS A 216 ? 0.7485 0.6787 0.7285 -0.1045 0.0579  0.0264  213 HIS A N     
1625 C CA    . HIS A 216 ? 0.7623 0.7183 0.7592 -0.1035 0.0583  0.0234  213 HIS A CA    
1626 C C     . HIS A 216 ? 0.7234 0.6897 0.7282 -0.0952 0.0594  0.0233  213 HIS A C     
1627 O O     . HIS A 216 ? 0.7477 0.7264 0.7553 -0.0982 0.0605  0.0241  213 HIS A O     
1628 C CB    . HIS A 216 ? 0.6952 0.6656 0.6940 -0.1150 0.0584  0.0236  213 HIS A CB    
1629 C CG    . HIS A 216 ? 0.6803 0.6760 0.6950 -0.1132 0.0578  0.0195  213 HIS A CG    
1630 N ND1   . HIS A 216 ? 0.7407 0.7574 0.7646 -0.1121 0.0589  0.0184  213 HIS A ND1   
1631 C CD2   . HIS A 216 ? 0.7434 0.7460 0.7654 -0.1116 0.0558  0.0162  213 HIS A CD2   
1632 C CE1   . HIS A 216 ? 0.8114 0.8463 0.8474 -0.1090 0.0574  0.0142  213 HIS A CE1   
1633 N NE2   . HIS A 216 ? 0.8095 0.8360 0.8445 -0.1088 0.0554  0.0130  213 HIS A NE2   
1634 N N     . PRO A 217 ? 0.6791 0.6412 0.6871 -0.0853 0.0593  0.0222  214 PRO A N     
1635 C CA    . PRO A 217 ? 0.6599 0.6301 0.6740 -0.0781 0.0599  0.0222  214 PRO A CA    
1636 C C     . PRO A 217 ? 0.6972 0.6890 0.7242 -0.0775 0.0596  0.0195  214 PRO A C     
1637 O O     . PRO A 217 ? 0.6747 0.6737 0.7053 -0.0734 0.0600  0.0195  214 PRO A O     
1638 C CB    . PRO A 217 ? 0.6429 0.6063 0.6584 -0.0693 0.0596  0.0212  214 PRO A CB    
1639 C CG    . PRO A 217 ? 0.5896 0.5456 0.6026 -0.0715 0.0589  0.0198  214 PRO A CG    
1640 C CD    . PRO A 217 ? 0.6717 0.6201 0.6755 -0.0809 0.0587  0.0213  214 PRO A CD    
1641 N N     . GLN A 218 ? 0.7136 0.7157 0.7470 -0.0807 0.0585  0.0168  215 GLN A N     
1642 C CA    A GLN A 218 ? 0.6341 0.6562 0.6784 -0.0789 0.0578  0.0136  215 GLN A CA    
1643 C CA    B GLN A 218 ? 0.6359 0.6581 0.6801 -0.0791 0.0578  0.0136  215 GLN A CA    
1644 C C     . GLN A 218 ? 0.7181 0.7503 0.7611 -0.0824 0.0596  0.0148  215 GLN A C     
1645 O O     . GLN A 218 ? 0.7224 0.7676 0.7722 -0.0778 0.0594  0.0125  215 GLN A O     
1646 C CB    A GLN A 218 ? 0.6011 0.6327 0.6506 -0.0822 0.0559  0.0107  215 GLN A CB    
1647 C CB    B GLN A 218 ? 0.6066 0.6387 0.6559 -0.0827 0.0561  0.0108  215 GLN A CB    
1648 C CG    A GLN A 218 ? 0.6918 0.7146 0.7422 -0.0788 0.0538  0.0094  215 GLN A CG    
1649 C CG    B GLN A 218 ? 0.6835 0.7092 0.7350 -0.0790 0.0537  0.0090  215 GLN A CG    
1650 C CD    A GLN A 218 ? 0.7016 0.7080 0.7420 -0.0839 0.0544  0.0117  215 GLN A CD    
1651 C CD    B GLN A 218 ? 0.7017 0.7395 0.7586 -0.0816 0.0513  0.0060  215 GLN A CD    
1652 O OE1   A GLN A 218 ? 0.5725 0.5651 0.6041 -0.0845 0.0562  0.0146  215 GLN A OE1   
1653 O OE1   B GLN A 218 ? 0.5538 0.6077 0.6144 -0.0854 0.0515  0.0047  215 GLN A OE1   
1654 N NE2   A GLN A 218 ? 0.7274 0.7347 0.7683 -0.0871 0.0526  0.0102  215 GLN A NE2   
1655 N NE2   B GLN A 218 ? 0.7405 0.7722 0.7977 -0.0794 0.0488  0.0049  215 GLN A NE2   
1656 N N     . SER A 219 ? 0.6916 0.7170 0.7249 -0.0910 0.0612  0.0183  216 SER A N     
1657 C CA    . SER A 219 ? 0.7195 0.7549 0.7500 -0.0964 0.0631  0.0201  216 SER A CA    
1658 C C     . SER A 219 ? 0.7988 0.8306 0.8269 -0.0902 0.0638  0.0217  216 SER A C     
1659 O O     . SER A 219 ? 0.7620 0.8082 0.7925 -0.0907 0.0651  0.0212  216 SER A O     
1660 C CB    . SER A 219 ? 0.7329 0.7575 0.7506 -0.1083 0.0641  0.0244  216 SER A CB    
1661 O OG    . SER A 219 ? 0.6679 0.6987 0.6883 -0.1151 0.0632  0.0226  216 SER A OG    
1662 N N     . SER A 220 ? 0.7137 0.7282 0.7372 -0.0841 0.0630  0.0234  217 SER A N     
1663 C CA    . SER A 220 ? 0.6403 0.6537 0.6638 -0.0768 0.0629  0.0241  217 SER A CA    
1664 C C     . SER A 220 ? 0.6788 0.7016 0.7143 -0.0683 0.0614  0.0198  217 SER A C     
1665 O O     . SER A 220 ? 0.6487 0.6675 0.6846 -0.0617 0.0607  0.0202  217 SER A O     
1666 C CB    . SER A 220 ? 0.6851 0.6771 0.6972 -0.0739 0.0625  0.0278  217 SER A CB    
1667 O OG    . SER A 220 ? 0.7716 0.7527 0.7700 -0.0810 0.0632  0.0324  217 SER A OG    
1668 N N     . GLY A 221 ? 0.6401 0.6753 0.6847 -0.0684 0.0605  0.0158  218 GLY A N     
1669 C CA    . GLY A 221 ? 0.6674 0.7060 0.7205 -0.0614 0.0581  0.0122  218 GLY A CA    
1670 C C     . GLY A 221 ? 0.7491 0.7936 0.8055 -0.0556 0.0573  0.0108  218 GLY A C     
1671 O O     . GLY A 221 ? 0.6630 0.7049 0.7232 -0.0505 0.0553  0.0093  218 GLY A O     
1672 N N     . LYS A 222 ? 0.6737 0.7263 0.7279 -0.0569 0.0587  0.0114  219 LYS A N     
1673 C CA    . LYS A 222 ? 0.5493 0.6078 0.6058 -0.0514 0.0576  0.0097  219 LYS A CA    
1674 C C     . LYS A 222 ? 0.5659 0.6131 0.6190 -0.0479 0.0570  0.0125  219 LYS A C     
1675 O O     . LYS A 222 ? 0.7161 0.7645 0.7736 -0.0430 0.0548  0.0104  219 LYS A O     
1676 C CB    . LYS A 222 ? 0.6088 0.6786 0.6623 -0.0539 0.0595  0.0099  219 LYS A CB    
1677 C CG    . LYS A 222 ? 0.6580 0.7451 0.7185 -0.0508 0.0585  0.0040  219 LYS A CG    
1678 C CD    . LYS A 222 ? 0.8136 0.9086 0.8722 -0.0478 0.0587  0.0030  219 LYS A CD    
1679 C CE    . LYS A 222 ? 0.8252 0.9325 0.8903 -0.0414 0.0562  -0.0040 219 LYS A CE    
1680 N NZ    . LYS A 222 ? 0.6580 0.7813 0.7273 -0.0426 0.0572  -0.0077 219 LYS A NZ    
1681 N N     . VAL A 223 ? 0.7245 0.7606 0.7690 -0.0502 0.0586  0.0170  220 VAL A N     
1682 C CA    . VAL A 223 ? 0.7314 0.7586 0.7727 -0.0454 0.0579  0.0193  220 VAL A CA    
1683 C C     . VAL A 223 ? 0.6976 0.7180 0.7420 -0.0431 0.0572  0.0187  220 VAL A C     
1684 O O     . VAL A 223 ? 0.6515 0.6722 0.6988 -0.0383 0.0560  0.0183  220 VAL A O     
1685 C CB    . VAL A 223 ? 0.6702 0.6866 0.6993 -0.0470 0.0590  0.0242  220 VAL A CB    
1686 C CG1   . VAL A 223 ? 0.7016 0.7073 0.7236 -0.0534 0.0604  0.0264  220 VAL A CG1   
1687 C CG2   . VAL A 223 ? 0.5707 0.5791 0.5967 -0.0402 0.0577  0.0259  220 VAL A CG2   
1688 N N     . GLU A 224 ? 0.6348 0.6503 0.6784 -0.0470 0.0579  0.0185  221 GLU A N     
1689 C CA    . GLU A 224 ? 0.5861 0.5962 0.6321 -0.0452 0.0574  0.0177  221 GLU A CA    
1690 C C     . GLU A 224 ? 0.6522 0.6707 0.7073 -0.0426 0.0553  0.0146  221 GLU A C     
1691 O O     . GLU A 224 ? 0.6163 0.6332 0.6732 -0.0398 0.0548  0.0146  221 GLU A O     
1692 C CB    . GLU A 224 ? 0.5628 0.5676 0.6066 -0.0503 0.0580  0.0175  221 GLU A CB    
1693 C CG    . GLU A 224 ? 0.5747 0.5679 0.6075 -0.0545 0.0595  0.0207  221 GLU A CG    
1694 C CD    . GLU A 224 ? 0.5954 0.5741 0.6199 -0.0502 0.0597  0.0228  221 GLU A CD    
1695 O OE1   . GLU A 224 ? 0.7320 0.7125 0.7607 -0.0442 0.0593  0.0217  221 GLU A OE1   
1696 O OE2   . GLU A 224 ? 0.7122 0.6777 0.7253 -0.0529 0.0601  0.0255  221 GLU A OE2   
1697 N N     . ARG A 225 ? 0.6284 0.6558 0.6883 -0.0434 0.0539  0.0118  222 ARG A N     
1698 C CA    . ARG A 225 ? 0.5556 0.5875 0.6216 -0.0411 0.0510  0.0088  222 ARG A CA    
1699 C C     . ARG A 225 ? 0.6044 0.6392 0.6714 -0.0379 0.0500  0.0091  222 ARG A C     
1700 O O     . ARG A 225 ? 0.6093 0.6442 0.6794 -0.0371 0.0480  0.0082  222 ARG A O     
1701 C CB    . ARG A 225 ? 0.5380 0.5776 0.6074 -0.0411 0.0491  0.0051  222 ARG A CB    
1702 C CG    . ARG A 225 ? 0.5575 0.5979 0.6306 -0.0385 0.0451  0.0017  222 ARG A CG    
1703 C CD    . ARG A 225 ? 0.5663 0.5985 0.6395 -0.0399 0.0439  0.0027  222 ARG A CD    
1704 N NE    . ARG A 225 ? 0.6634 0.6934 0.7379 -0.0387 0.0393  -0.0002 222 ARG A NE    
1705 C CZ    . ARG A 225 ? 0.6632 0.6917 0.7377 -0.0384 0.0369  -0.0005 222 ARG A CZ    
1706 N NH1   . ARG A 225 ? 0.5234 0.5552 0.5984 -0.0386 0.0389  0.0016  222 ARG A NH1   
1707 N NH2   . ARG A 225 ? 0.6792 0.7025 0.7526 -0.0381 0.0320  -0.0030 222 ARG A NH2   
1708 N N     . LYS A 226 ? 0.5292 0.5665 0.5930 -0.0367 0.0512  0.0105  223 LYS A N     
1709 C CA    . LYS A 226 ? 0.5292 0.5699 0.5936 -0.0334 0.0500  0.0109  223 LYS A CA    
1710 C C     . LYS A 226 ? 0.5650 0.6017 0.6286 -0.0315 0.0507  0.0133  223 LYS A C     
1711 O O     . LYS A 226 ? 0.5652 0.6069 0.6324 -0.0297 0.0491  0.0127  223 LYS A O     
1712 C CB    . LYS A 226 ? 0.5878 0.6315 0.6475 -0.0324 0.0508  0.0122  223 LYS A CB    
1713 C CG    . LYS A 226 ? 0.5337 0.5829 0.5943 -0.0289 0.0488  0.0119  223 LYS A CG    
1714 C CD    . LYS A 226 ? 0.5293 0.5851 0.5949 -0.0288 0.0456  0.0076  223 LYS A CD    
1715 C CE    . LYS A 226 ? 0.5807 0.6415 0.6448 -0.0292 0.0459  0.0050  223 LYS A CE    
1716 N NZ    . LYS A 226 ? 0.6862 0.7521 0.7525 -0.0272 0.0422  0.0004  223 LYS A NZ    
1717 N N     . ASN A 227 ? 0.5424 0.5709 0.6011 -0.0318 0.0530  0.0156  224 ASN A N     
1718 C CA    . ASN A 227 ? 0.6092 0.6343 0.6668 -0.0287 0.0538  0.0169  224 ASN A CA    
1719 C C     . ASN A 227 ? 0.6545 0.6847 0.7187 -0.0299 0.0529  0.0152  224 ASN A C     
1720 O O     . ASN A 227 ? 0.6529 0.6886 0.7194 -0.0273 0.0528  0.0154  224 ASN A O     
1721 C CB    . ASN A 227 ? 0.6663 0.6795 0.7165 -0.0294 0.0559  0.0187  224 ASN A CB    
1722 C CG    . ASN A 227 ? 0.7146 0.7198 0.7554 -0.0289 0.0565  0.0214  224 ASN A CG    
1723 O OD1   . ASN A 227 ? 0.7329 0.7421 0.7726 -0.0268 0.0556  0.0223  224 ASN A OD1   
1724 N ND2   . ASN A 227 ? 0.6757 0.6686 0.7085 -0.0314 0.0577  0.0229  224 ASN A ND2   
1725 N N     . SER A 228 ? 0.5701 0.5990 0.6367 -0.0340 0.0520  0.0135  225 SER A N     
1726 C CA    . SER A 228 ? 0.5534 0.5845 0.6241 -0.0364 0.0506  0.0123  225 SER A CA    
1727 C C     . SER A 228 ? 0.5945 0.6338 0.6694 -0.0365 0.0480  0.0113  225 SER A C     
1728 O O     . SER A 228 ? 0.5923 0.6369 0.6696 -0.0373 0.0479  0.0118  225 SER A O     
1729 C CB    . SER A 228 ? 0.5606 0.5871 0.6315 -0.0399 0.0491  0.0107  225 SER A CB    
1730 O OG    . SER A 228 ? 0.6596 0.6852 0.7320 -0.0427 0.0475  0.0104  225 SER A OG    
1731 N N     . ASP A 229 ? 0.5956 0.6369 0.6710 -0.0362 0.0458  0.0097  226 ASP A N     
1732 C CA    . ASP A 229 ? 0.6341 0.6819 0.7123 -0.0367 0.0427  0.0083  226 ASP A CA    
1733 C C     . ASP A 229 ? 0.7219 0.7778 0.8015 -0.0340 0.0437  0.0101  226 ASP A C     
1734 O O     . ASP A 229 ? 0.6881 0.7512 0.7711 -0.0361 0.0420  0.0098  226 ASP A O     
1735 C CB    . ASP A 229 ? 0.7486 0.7972 0.8258 -0.0353 0.0406  0.0059  226 ASP A CB    
1736 C CG    . ASP A 229 ? 0.8407 0.8839 0.9173 -0.0367 0.0381  0.0029  226 ASP A CG    
1737 O OD1   . ASP A 229 ? 0.7353 0.7732 0.8120 -0.0397 0.0366  0.0029  226 ASP A OD1   
1738 O OD2   . ASP A 229 ? 0.9403 0.9850 1.0158 -0.0346 0.0375  0.0006  226 ASP A OD2   
1739 N N     . ILE A 230 ? 0.7539 0.8088 0.8303 -0.0295 0.0462  0.0119  227 ILE A N     
1740 C CA    . ILE A 230 ? 0.5266 0.5890 0.6035 -0.0249 0.0466  0.0133  227 ILE A CA    
1741 C C     . ILE A 230 ? 0.6187 0.6866 0.6988 -0.0250 0.0478  0.0137  227 ILE A C     
1742 O O     . ILE A 230 ? 0.6957 0.7758 0.7805 -0.0252 0.0466  0.0133  227 ILE A O     
1743 C CB    . ILE A 230 ? 0.6006 0.6563 0.6705 -0.0199 0.0484  0.0155  227 ILE A CB    
1744 C CG1   . ILE A 230 ? 0.6212 0.6751 0.6879 -0.0205 0.0473  0.0153  227 ILE A CG1   
1745 C CG2   . ILE A 230 ? 0.5371 0.5987 0.6063 -0.0133 0.0482  0.0168  227 ILE A CG2   
1746 C CD1   . ILE A 230 ? 0.6505 0.6951 0.7085 -0.0186 0.0492  0.0180  227 ILE A CD1   
1747 N N     . LYS A 231 ? 0.6691 0.7294 0.7466 -0.0252 0.0504  0.0144  228 LYS A N     
1748 C CA    . LYS A 231 ? 0.6250 0.6912 0.7047 -0.0251 0.0522  0.0145  228 LYS A CA    
1749 C C     . LYS A 231 ? 0.6628 0.7367 0.7478 -0.0324 0.0505  0.0136  228 LYS A C     
1750 O O     . LYS A 231 ? 0.6926 0.7795 0.7817 -0.0331 0.0510  0.0137  228 LYS A O     
1751 C CB    . LYS A 231 ? 0.6894 0.7443 0.7641 -0.0248 0.0549  0.0149  228 LYS A CB    
1752 C CG    . LYS A 231 ? 0.7244 0.7713 0.7921 -0.0177 0.0566  0.0159  228 LYS A CG    
1753 C CD    . LYS A 231 ? 0.5429 0.5787 0.6052 -0.0182 0.0588  0.0159  228 LYS A CD    
1754 C CE    . LYS A 231 ? 0.6962 0.7284 0.7522 -0.0098 0.0604  0.0159  228 LYS A CE    
1755 N NZ    . LYS A 231 ? 0.7532 0.7723 0.8021 -0.0105 0.0622  0.0156  228 LYS A NZ    
1756 N N     . ARG A 232 ? 0.5724 0.6385 0.6568 -0.0378 0.0482  0.0129  229 ARG A N     
1757 C CA    . ARG A 232 ? 0.5889 0.6575 0.6753 -0.0453 0.0456  0.0124  229 ARG A CA    
1758 C C     . ARG A 232 ? 0.6053 0.6863 0.6957 -0.0472 0.0431  0.0119  229 ARG A C     
1759 O O     . ARG A 232 ? 0.6387 0.7286 0.7317 -0.0530 0.0425  0.0124  229 ARG A O     
1760 C CB    . ARG A 232 ? 0.5245 0.5803 0.6078 -0.0487 0.0426  0.0111  229 ARG A CB    
1761 C CG    . ARG A 232 ? 0.5289 0.5825 0.6114 -0.0564 0.0386  0.0107  229 ARG A CG    
1762 C CD    . ARG A 232 ? 0.5325 0.5714 0.6103 -0.0584 0.0359  0.0097  229 ARG A CD    
1763 N NE    . ARG A 232 ? 0.6117 0.6455 0.6885 -0.0539 0.0338  0.0071  229 ARG A NE    
1764 C CZ    . ARG A 232 ? 0.6284 0.6576 0.7031 -0.0549 0.0289  0.0046  229 ARG A CZ    
1765 N NH1   . ARG A 232 ? 0.5435 0.5703 0.6160 -0.0611 0.0250  0.0048  229 ARG A NH1   
1766 N NH2   . ARG A 232 ? 0.6016 0.6286 0.6755 -0.0499 0.0276  0.0018  229 ARG A NH2   
1767 N N     . LEU A 233 ? 0.7286 0.8113 0.8193 -0.0431 0.0415  0.0110  230 LEU A N     
1768 C CA    . LEU A 233 ? 0.6367 0.7315 0.7309 -0.0449 0.0386  0.0103  230 LEU A CA    
1769 C C     . LEU A 233 ? 0.6741 0.7857 0.7729 -0.0412 0.0407  0.0113  230 LEU A C     
1770 O O     . LEU A 233 ? 0.7608 0.8866 0.8641 -0.0458 0.0391  0.0111  230 LEU A O     
1771 C CB    . LEU A 233 ? 0.5900 0.6816 0.6821 -0.0413 0.0361  0.0089  230 LEU A CB    
1772 C CG    . LEU A 233 ? 0.5728 0.6755 0.6674 -0.0429 0.0324  0.0077  230 LEU A CG    
1773 C CD1   . LEU A 233 ? 0.5291 0.6328 0.6246 -0.0527 0.0288  0.0068  230 LEU A CD1   
1774 C CD2   . LEU A 233 ? 0.6302 0.7276 0.7211 -0.0394 0.0303  0.0060  230 LEU A CD2   
1775 N N     . LEU A 234 ? 0.6644 0.7749 0.7614 -0.0327 0.0440  0.0122  231 LEU A N     
1776 C CA    . LEU A 234 ? 0.6361 0.7620 0.7366 -0.0270 0.0459  0.0126  231 LEU A CA    
1777 C C     . LEU A 234 ? 0.7027 0.8391 0.8071 -0.0324 0.0479  0.0126  231 LEU A C     
1778 O O     . LEU A 234 ? 0.7449 0.9015 0.8551 -0.0326 0.0480  0.0122  231 LEU A O     
1779 C CB    . LEU A 234 ? 0.5269 0.6442 0.6219 -0.0169 0.0485  0.0134  231 LEU A CB    
1780 C CG    . LEU A 234 ? 0.6109 0.7233 0.7017 -0.0101 0.0467  0.0140  231 LEU A CG    
1781 C CD1   . LEU A 234 ? 0.5374 0.6355 0.6197 -0.0025 0.0489  0.0153  231 LEU A CD1   
1782 C CD2   . LEU A 234 ? 0.6089 0.7398 0.7044 -0.0057 0.0444  0.0135  231 LEU A CD2   
1783 N N     . THR A 235 ? 0.6699 0.7942 0.7710 -0.0372 0.0495  0.0132  232 THR A N     
1784 C CA    . THR A 235 ? 0.6087 0.7416 0.7117 -0.0433 0.0516  0.0136  232 THR A CA    
1785 C C     . THR A 235 ? 0.6117 0.7571 0.7190 -0.0537 0.0486  0.0138  232 THR A C     
1786 O O     . THR A 235 ? 0.6612 0.8269 0.7735 -0.0564 0.0501  0.0139  232 THR A O     
1787 C CB    . THR A 235 ? 0.6140 0.7292 0.7112 -0.0472 0.0527  0.0143  232 THR A CB    
1788 O OG1   . THR A 235 ? 0.6320 0.7371 0.7250 -0.0387 0.0555  0.0141  232 THR A OG1   
1789 C CG2   . THR A 235 ? 0.5595 0.6828 0.6573 -0.0548 0.0546  0.0152  232 THR A CG2   
1790 N N     . LYS A 236 ? 0.5927 0.7265 0.6975 -0.0599 0.0442  0.0136  233 LYS A N     
1791 C CA    . LYS A 236 ? 0.6158 0.7569 0.7220 -0.0710 0.0405  0.0138  233 LYS A CA    
1792 C C     . LYS A 236 ? 0.6547 0.8187 0.7680 -0.0695 0.0396  0.0131  233 LYS A C     
1793 O O     . LYS A 236 ? 0.7072 0.8883 0.8244 -0.0780 0.0391  0.0136  233 LYS A O     
1794 C CB    . LYS A 236 ? 0.5608 0.6825 0.6613 -0.0753 0.0353  0.0129  233 LYS A CB    
1795 C CG    . LYS A 236 ? 0.6023 0.7026 0.6961 -0.0755 0.0353  0.0132  233 LYS A CG    
1796 C CD    . LYS A 236 ? 0.6014 0.6849 0.6898 -0.0777 0.0297  0.0114  233 LYS A CD    
1797 C CE    . LYS A 236 ? 0.6886 0.7531 0.7711 -0.0764 0.0294  0.0112  233 LYS A CE    
1798 N NZ    . LYS A 236 ? 0.7896 0.8394 0.8670 -0.0754 0.0241  0.0084  233 LYS A NZ    
1799 N N     . LEU A 237 ? 0.6066 0.7721 0.7213 -0.0593 0.0392  0.0119  234 LEU A N     
1800 C CA    . LEU A 237 ? 0.6060 0.7929 0.7268 -0.0567 0.0376  0.0111  234 LEU A CA    
1801 C C     . LEU A 237 ? 0.6130 0.8237 0.7403 -0.0524 0.0414  0.0111  234 LEU A C     
1802 O O     . LEU A 237 ? 0.6934 0.9277 0.8275 -0.0539 0.0400  0.0104  234 LEU A O     
1803 C CB    . LEU A 237 ? 0.5594 0.7400 0.6782 -0.0462 0.0361  0.0102  234 LEU A CB    
1804 C CG    . LEU A 237 ? 0.5987 0.7626 0.7123 -0.0498 0.0319  0.0093  234 LEU A CG    
1805 C CD1   . LEU A 237 ? 0.5249 0.6870 0.6365 -0.0400 0.0308  0.0087  234 LEU A CD1   
1806 C CD2   . LEU A 237 ? 0.5295 0.6999 0.6446 -0.0615 0.0272  0.0083  234 LEU A CD2   
1807 N N     . LEU A 238 ? 0.6274 0.8336 0.7528 -0.0469 0.0460  0.0115  235 LEU A N     
1808 C CA    . LEU A 238 ? 0.5227 0.7505 0.6530 -0.0403 0.0499  0.0107  235 LEU A CA    
1809 C C     . LEU A 238 ? 0.6437 0.8834 0.7762 -0.0504 0.0528  0.0114  235 LEU A C     
1810 O O     . LEU A 238 ? 0.6690 0.9277 0.8053 -0.0450 0.0567  0.0103  235 LEU A O     
1811 C CB    . LEU A 238 ? 0.5240 0.7392 0.6491 -0.0263 0.0528  0.0102  235 LEU A CB    
1812 C CG    . LEU A 238 ? 0.5822 0.7888 0.7043 -0.0153 0.0503  0.0099  235 LEU A CG    
1813 C CD1   . LEU A 238 ? 0.5972 0.7833 0.7106 -0.0052 0.0526  0.0102  235 LEU A CD1   
1814 C CD2   . LEU A 238 ? 0.5266 0.7586 0.6552 -0.0077 0.0487  0.0085  235 LEU A CD2   
1815 N N     . VAL A 239 ? 0.6298 0.8582 0.7589 -0.0645 0.0509  0.0132  236 VAL A N     
1816 C CA    . VAL A 239 ? 0.6606 0.8992 0.7900 -0.0760 0.0533  0.0146  236 VAL A CA    
1817 C C     . VAL A 239 ? 0.7447 1.0188 0.8834 -0.0798 0.0541  0.0139  236 VAL A C     
1818 O O     . VAL A 239 ? 0.7542 1.0393 0.8973 -0.0837 0.0501  0.0135  236 VAL A O     
1819 C CB    . VAL A 239 ? 0.5870 0.8052 0.7093 -0.0907 0.0494  0.0168  236 VAL A CB    
1820 C CG1   . VAL A 239 ? 0.5437 0.7753 0.6658 -0.1055 0.0506  0.0190  236 VAL A CG1   
1821 C CG2   . VAL A 239 ? 0.5660 0.7543 0.6799 -0.0868 0.0497  0.0173  236 VAL A CG2   
1822 N N     . GLY A 240 ? 0.7899 1.0836 0.9316 -0.0785 0.0594  0.0135  237 GLY A N     
1823 C CA    . GLY A 240 ? 0.7589 1.0908 0.9103 -0.0820 0.0609  0.0125  237 GLY A CA    
1824 C C     . GLY A 240 ? 0.7680 1.1217 0.9275 -0.0658 0.0612  0.0091  237 GLY A C     
1825 O O     . GLY A 240 ? 0.8792 1.2681 1.0474 -0.0647 0.0636  0.0074  237 GLY A O     
1826 N N     . ARG A 241 ? 0.7147 1.0494 0.8711 -0.0530 0.0586  0.0082  238 ARG A N     
1827 C CA    . ARG A 241 ? 0.6975 1.0476 0.8589 -0.0365 0.0578  0.0054  238 ARG A CA    
1828 C C     . ARG A 241 ? 0.7428 1.0795 0.8983 -0.0193 0.0612  0.0037  238 ARG A C     
1829 O O     . ARG A 241 ? 0.7830 1.0939 0.9302 -0.0204 0.0632  0.0050  238 ARG A O     
1830 C CB    . ARG A 241 ? 0.7530 1.0903 0.9131 -0.0348 0.0519  0.0058  238 ARG A CB    
1831 C CG    . ARG A 241 ? 0.8622 1.2095 1.0264 -0.0510 0.0476  0.0069  238 ARG A CG    
1832 C CD    . ARG A 241 ? 0.9776 1.3137 1.1400 -0.0469 0.0420  0.0066  238 ARG A CD    
1833 N NE    . ARG A 241 ? 1.1070 1.4523 1.2724 -0.0617 0.0371  0.0070  238 ARG A NE    
1834 C CZ    . ARG A 241 ? 1.2258 1.5499 1.3848 -0.0756 0.0344  0.0085  238 ARG A CZ    
1835 N NH1   . ARG A 241 ? 1.2777 1.5726 1.4282 -0.0763 0.0362  0.0099  238 ARG A NH1   
1836 N NH2   . ARG A 241 ? 1.2277 1.5596 1.3881 -0.0887 0.0294  0.0085  238 ARG A NH2   
1837 N N     . PRO A 242 ? 0.7061 1.0597 0.8650 -0.0029 0.0613  0.0008  239 PRO A N     
1838 C CA    . PRO A 242 ? 0.7253 1.0600 0.8757 0.0142  0.0629  -0.0007 239 PRO A CA    
1839 C C     . PRO A 242 ? 0.7899 1.0885 0.9306 0.0168  0.0596  0.0015  239 PRO A C     
1840 O O     . PRO A 242 ? 0.8201 1.1152 0.9623 0.0124  0.0553  0.0029  239 PRO A O     
1841 C CB    . PRO A 242 ? 0.6517 1.0135 0.8076 0.0308  0.0622  -0.0044 239 PRO A CB    
1842 C CG    . PRO A 242 ? 0.6941 1.0833 0.8610 0.0230  0.0586  -0.0042 239 PRO A CG    
1843 C CD    . PRO A 242 ? 0.6427 1.0346 0.8127 0.0008  0.0599  -0.0015 239 PRO A CD    
1844 N N     . THR A 243 ? 0.8220 1.0945 0.9524 0.0238  0.0615  0.0015  240 THR A N     
1845 C CA    . THR A 243 ? 0.8515 1.0901 0.9723 0.0238  0.0593  0.0039  240 THR A CA    
1846 C C     . THR A 243 ? 0.8472 1.0796 0.9640 0.0362  0.0553  0.0039  240 THR A C     
1847 O O     . THR A 243 ? 0.8313 1.0413 0.9373 0.0463  0.0550  0.0041  240 THR A O     
1848 C CB    . THR A 243 ? 0.7743 0.9885 0.8851 0.0263  0.0625  0.0039  240 THR A CB    
1849 O OG1   . THR A 243 ? 0.8614 1.0840 0.9697 0.0401  0.0647  0.0008  240 THR A OG1   
1850 C CG2   . THR A 243 ? 0.6400 0.8520 0.7523 0.0116  0.0652  0.0052  240 THR A CG2   
1851 N N     . LYS A 244 ? 0.8525 1.1031 0.9766 0.0349  0.0517  0.0039  241 LYS A N     
1852 C CA    . LYS A 244 ? 0.8382 1.0829 0.9579 0.0452  0.0473  0.0044  241 LYS A CA    
1853 C C     . LYS A 244 ? 0.7611 0.9826 0.8756 0.0362  0.0451  0.0073  241 LYS A C     
1854 O O     . LYS A 244 ? 0.8108 1.0410 0.9309 0.0272  0.0425  0.0077  241 LYS A O     
1855 C CB    . LYS A 244 ? 0.9596 1.2371 1.0898 0.0485  0.0443  0.0026  241 LYS A CB    
1856 C CG    . LYS A 244 ? 1.1255 1.4330 1.2630 0.0573  0.0465  -0.0009 241 LYS A CG    
1857 C CD    . LYS A 244 ? 1.1834 1.5243 1.3315 0.0603  0.0427  -0.0026 241 LYS A CD    
1858 C CE    . LYS A 244 ? 1.2013 1.5776 1.3583 0.0692  0.0450  -0.0066 241 LYS A CE    
1859 N NZ    . LYS A 244 ? 1.2248 1.6356 1.3925 0.0730  0.0408  -0.0084 241 LYS A NZ    
1860 N N     . TRP A 245 ? 0.6758 0.8678 0.7789 0.0387  0.0460  0.0090  242 TRP A N     
1861 C CA    . TRP A 245 ? 0.6283 0.7997 0.7264 0.0302  0.0447  0.0113  242 TRP A CA    
1862 C C     . TRP A 245 ? 0.6828 0.8436 0.7734 0.0369  0.0410  0.0129  242 TRP A C     
1863 O O     . TRP A 245 ? 0.7958 0.9455 0.8837 0.0299  0.0397  0.0144  242 TRP A O     
1864 C CB    . TRP A 245 ? 0.5997 0.7472 0.6903 0.0264  0.0479  0.0123  242 TRP A CB    
1865 C CG    . TRP A 245 ? 0.6562 0.7893 0.7367 0.0377  0.0492  0.0123  242 TRP A CG    
1866 C CD1   . TRP A 245 ? 0.6915 0.8291 0.7718 0.0432  0.0520  0.0102  242 TRP A CD1   
1867 C CD2   . TRP A 245 ? 0.7207 0.8312 0.7884 0.0444  0.0474  0.0143  242 TRP A CD2   
1868 N NE1   . TRP A 245 ? 0.7956 0.9131 0.8631 0.0536  0.0517  0.0105  242 TRP A NE1   
1869 C CE2   . TRP A 245 ? 0.7751 0.8750 0.8343 0.0539  0.0487  0.0133  242 TRP A CE2   
1870 C CE3   . TRP A 245 ? 0.7140 0.8117 0.7753 0.0429  0.0448  0.0169  242 TRP A CE3   
1871 C CZ2   . TRP A 245 ? 0.7844 0.8592 0.8282 0.0612  0.0470  0.0152  242 TRP A CZ2   
1872 C CZ3   . TRP A 245 ? 0.6955 0.7705 0.7422 0.0495  0.0435  0.0191  242 TRP A CZ3   
1873 C CH2   . TRP A 245 ? 0.7151 0.7777 0.7527 0.0583  0.0444  0.0184  242 TRP A CH2   
1874 N N     . TYR A 246 ? 0.7232 0.8871 0.8094 0.0506  0.0390  0.0127  243 TYR A N     
1875 C CA    . TYR A 246 ? 0.7492 0.9003 0.8257 0.0571  0.0352  0.0149  243 TYR A CA    
1876 C C     . TYR A 246 ? 0.7488 0.9120 0.8311 0.0506  0.0320  0.0152  243 TYR A C     
1877 O O     . TYR A 246 ? 0.7758 0.9242 0.8514 0.0466  0.0307  0.0173  243 TYR A O     
1878 C CB    . TYR A 246 ? 0.8224 0.9766 0.8933 0.0740  0.0327  0.0143  243 TYR A CB    
1879 C CG    . TYR A 246 ? 0.8736 1.0145 0.9329 0.0812  0.0280  0.0170  243 TYR A CG    
1880 C CD1   . TYR A 246 ? 0.9124 1.0220 0.9549 0.0836  0.0277  0.0203  243 TYR A CD1   
1881 C CD2   . TYR A 246 ? 0.8708 1.0306 0.9351 0.0848  0.0236  0.0167  243 TYR A CD2   
1882 C CE1   . TYR A 246 ? 0.8743 0.9709 0.9046 0.0892  0.0233  0.0234  243 TYR A CE1   
1883 C CE2   . TYR A 246 ? 0.8149 0.9622 0.8675 0.0913  0.0191  0.0195  243 TYR A CE2   
1884 C CZ    . TYR A 246 ? 0.8864 1.0016 0.9215 0.0934  0.0191  0.0230  243 TYR A CZ    
1885 O OH    . TYR A 246 ? 1.0004 1.1022 1.0222 0.0989  0.0145  0.0265  243 TYR A OH    
1886 N N     . ASP A 247 ? 0.7294 0.9205 0.8240 0.0491  0.0306  0.0129  244 ASP A N     
1887 C CA    . ASP A 247 ? 0.7069 0.9101 0.8065 0.0428  0.0268  0.0126  244 ASP A CA    
1888 C C     . ASP A 247 ? 0.7051 0.9012 0.8072 0.0277  0.0279  0.0125  244 ASP A C     
1889 O O     . ASP A 247 ? 0.8309 1.0331 0.9353 0.0220  0.0246  0.0119  244 ASP A O     
1890 C CB    . ASP A 247 ? 0.7046 0.9410 0.8164 0.0446  0.0247  0.0101  244 ASP A CB    
1891 C CG    . ASP A 247 ? 0.8479 1.0938 0.9571 0.0613  0.0217  0.0096  244 ASP A CG    
1892 O OD1   . ASP A 247 ? 0.8839 1.1105 0.9810 0.0696  0.0194  0.0119  244 ASP A OD1   
1893 O OD2   . ASP A 247 ? 0.8550 1.1282 0.9738 0.0662  0.0216  0.0071  244 ASP A OD2   
1894 N N     . LEU A 248 ? 0.7295 0.9123 0.8304 0.0217  0.0319  0.0128  245 LEU A N     
1895 C CA    . LEU A 248 ? 0.6614 0.8360 0.7636 0.0090  0.0323  0.0124  245 LEU A CA    
1896 C C     . LEU A 248 ? 0.6824 0.8328 0.7748 0.0081  0.0331  0.0139  245 LEU A C     
1897 O O     . LEU A 248 ? 0.7845 0.9291 0.8772 -0.0004 0.0323  0.0131  245 LEU A O     
1898 C CB    . LEU A 248 ? 0.6351 0.8116 0.7422 0.0018  0.0357  0.0117  245 LEU A CB    
1899 C CG    . LEU A 248 ? 0.6885 0.8900 0.8060 -0.0039 0.0352  0.0101  245 LEU A CG    
1900 C CD1   . LEU A 248 ? 0.6696 0.8688 0.7889 -0.0110 0.0390  0.0102  245 LEU A CD1   
1901 C CD2   . LEU A 248 ? 0.5487 0.7580 0.6698 -0.0132 0.0309  0.0091  245 LEU A CD2   
1902 N N     . LEU A 249 ? 0.5742 0.7108 0.6576 0.0163  0.0343  0.0160  246 LEU A N     
1903 C CA    . LEU A 249 ? 0.5522 0.6682 0.6262 0.0141  0.0352  0.0178  246 LEU A CA    
1904 C C     . LEU A 249 ? 0.5515 0.6684 0.6240 0.0104  0.0324  0.0174  246 LEU A C     
1905 O O     . LEU A 249 ? 0.6059 0.7144 0.6771 0.0036  0.0334  0.0167  246 LEU A O     
1906 C CB    . LEU A 249 ? 0.5647 0.6660 0.6273 0.0231  0.0359  0.0206  246 LEU A CB    
1907 C CG    . LEU A 249 ? 0.7461 0.8385 0.8062 0.0260  0.0391  0.0208  246 LEU A CG    
1908 C CD1   . LEU A 249 ? 0.7591 0.8294 0.8044 0.0315  0.0392  0.0238  246 LEU A CD1   
1909 C CD2   . LEU A 249 ? 0.6514 0.7407 0.7166 0.0163  0.0421  0.0195  246 LEU A CD2   
1910 N N     . PRO A 250 ? 0.6793 0.8067 0.7516 0.0149  0.0287  0.0174  247 PRO A N     
1911 C CA    . PRO A 250 ? 0.6769 0.8052 0.7472 0.0108  0.0261  0.0165  247 PRO A CA    
1912 C C     . PRO A 250 ? 0.6130 0.7478 0.6911 0.0013  0.0251  0.0130  247 PRO A C     
1913 O O     . PRO A 250 ? 0.6150 0.7430 0.6899 -0.0033 0.0246  0.0116  247 PRO A O     
1914 C CB    . PRO A 250 ? 0.7635 0.9040 0.8330 0.0179  0.0219  0.0170  247 PRO A CB    
1915 C CG    . PRO A 250 ? 0.7524 0.8914 0.8191 0.0278  0.0226  0.0192  247 PRO A CG    
1916 C CD    . PRO A 250 ? 0.6727 0.8113 0.7455 0.0248  0.0265  0.0181  247 PRO A CD    
1917 N N     . VAL A 251 ? 0.5543 0.7018 0.6414 -0.0018 0.0247  0.0116  248 VAL A N     
1918 C CA    . VAL A 251 ? 0.5945 0.7449 0.6868 -0.0118 0.0231  0.0088  248 VAL A CA    
1919 C C     . VAL A 251 ? 0.6551 0.7889 0.7445 -0.0164 0.0259  0.0085  248 VAL A C     
1920 O O     . VAL A 251 ? 0.6913 0.8186 0.7789 -0.0216 0.0241  0.0061  248 VAL A O     
1921 C CB    . VAL A 251 ? 0.6023 0.7699 0.7038 -0.0154 0.0227  0.0082  248 VAL A CB    
1922 C CG1   . VAL A 251 ? 0.5699 0.7382 0.6743 -0.0271 0.0201  0.0058  248 VAL A CG1   
1923 C CG2   . VAL A 251 ? 0.6103 0.7974 0.7155 -0.0094 0.0200  0.0083  248 VAL A CG2   
1924 N N     . VAL A 252 ? 0.5938 0.7205 0.6822 -0.0138 0.0300  0.0104  249 VAL A N     
1925 C CA    . VAL A 252 ? 0.6074 0.7201 0.6937 -0.0179 0.0324  0.0101  249 VAL A CA    
1926 C C     . VAL A 252 ? 0.5851 0.6869 0.6645 -0.0168 0.0327  0.0099  249 VAL A C     
1927 O O     . VAL A 252 ? 0.5641 0.6595 0.6428 -0.0211 0.0322  0.0077  249 VAL A O     
1928 C CB    . VAL A 252 ? 0.6763 0.7846 0.7624 -0.0153 0.0365  0.0121  249 VAL A CB    
1929 C CG1   . VAL A 252 ? 0.6100 0.7034 0.6926 -0.0184 0.0388  0.0121  249 VAL A CG1   
1930 C CG2   . VAL A 252 ? 0.7063 0.8267 0.7996 -0.0182 0.0367  0.0116  249 VAL A CG2   
1931 N N     . GLN A 253 ? 0.5693 0.6693 0.6429 -0.0109 0.0333  0.0122  250 GLN A N     
1932 C CA    . GLN A 253 ? 0.5832 0.6752 0.6496 -0.0108 0.0341  0.0124  250 GLN A CA    
1933 C C     . GLN A 253 ? 0.6220 0.7183 0.6890 -0.0138 0.0309  0.0088  250 GLN A C     
1934 O O     . GLN A 253 ? 0.5844 0.6755 0.6494 -0.0163 0.0316  0.0067  250 GLN A O     
1935 C CB    . GLN A 253 ? 0.5503 0.6397 0.6088 -0.0047 0.0343  0.0160  250 GLN A CB    
1936 C CG    . GLN A 253 ? 0.6108 0.6950 0.6609 -0.0055 0.0349  0.0167  250 GLN A CG    
1937 C CD    . GLN A 253 ? 0.6976 0.7791 0.7384 0.0000  0.0338  0.0206  250 GLN A CD    
1938 O OE1   . GLN A 253 ? 0.7481 0.8195 0.7823 0.0030  0.0353  0.0242  250 GLN A OE1   
1939 N NE2   . GLN A 253 ? 0.6816 0.7706 0.7203 0.0015  0.0308  0.0198  250 GLN A NE2   
1940 N N     . LEU A 254 ? 0.6640 0.7704 0.7335 -0.0133 0.0272  0.0076  251 LEU A N     
1941 C CA    . LEU A 254 ? 0.6883 0.7976 0.7570 -0.0160 0.0235  0.0037  251 LEU A CA    
1942 C C     . LEU A 254 ? 0.6883 0.7929 0.7603 -0.0219 0.0221  0.0001  251 LEU A C     
1943 O O     . LEU A 254 ? 0.6156 0.7155 0.6842 -0.0230 0.0206  -0.0035 251 LEU A O     
1944 C CB    . LEU A 254 ? 0.6772 0.7986 0.7477 -0.0149 0.0193  0.0032  251 LEU A CB    
1945 C CG    . LEU A 254 ? 0.6492 0.7733 0.7178 -0.0180 0.0147  -0.0011 251 LEU A CG    
1946 C CD1   . LEU A 254 ? 0.6304 0.7520 0.6905 -0.0141 0.0149  -0.0016 251 LEU A CD1   
1947 C CD2   . LEU A 254 ? 0.5519 0.6892 0.6249 -0.0197 0.0101  -0.0018 251 LEU A CD2   
1948 N N     . ALA A 255 ? 0.7021 0.8078 0.7797 -0.0253 0.0224  0.0010  252 ALA A N     
1949 C CA    . ALA A 255 ? 0.6640 0.7634 0.7430 -0.0315 0.0204  -0.0017 252 ALA A CA    
1950 C C     . ALA A 255 ? 0.6765 0.7642 0.7524 -0.0307 0.0225  -0.0029 252 ALA A C     
1951 O O     . ALA A 255 ? 0.6285 0.7096 0.7014 -0.0321 0.0196  -0.0068 252 ALA A O     
1952 C CB    . ALA A 255 ? 0.5449 0.6486 0.6295 -0.0358 0.0210  0.0002  252 ALA A CB    
1953 N N     . LEU A 256 ? 0.6523 0.7374 0.7282 -0.0280 0.0272  0.0001  253 LEU A N     
1954 C CA    . LEU A 256 ? 0.6567 0.7332 0.7305 -0.0279 0.0292  -0.0009 253 LEU A CA    
1955 C C     . LEU A 256 ? 0.7113 0.7885 0.7805 -0.0250 0.0292  -0.0033 253 LEU A C     
1956 O O     . LEU A 256 ? 0.7488 0.8220 0.8168 -0.0249 0.0285  -0.0068 253 LEU A O     
1957 C CB    . LEU A 256 ? 0.5294 0.6030 0.6036 -0.0269 0.0339  0.0029  253 LEU A CB    
1958 C CG    . LEU A 256 ? 0.6415 0.7152 0.7197 -0.0291 0.0347  0.0048  253 LEU A CG    
1959 C CD1   . LEU A 256 ? 0.6496 0.7185 0.7263 -0.0273 0.0390  0.0079  253 LEU A CD1   
1960 C CD2   . LEU A 256 ? 0.5272 0.5959 0.6070 -0.0342 0.0321  0.0025  253 LEU A CD2   
1961 N N     . ASN A 257 ? 0.6491 0.7320 0.7153 -0.0222 0.0298  -0.0018 254 ASN A N     
1962 C CA    . ASN A 257 ? 0.6468 0.7321 0.7078 -0.0200 0.0302  -0.0039 254 ASN A CA    
1963 C C     . ASN A 257 ? 0.6773 0.7633 0.7372 -0.0198 0.0256  -0.0098 254 ASN A C     
1964 O O     . ASN A 257 ? 0.6730 0.7613 0.7290 -0.0175 0.0258  -0.0130 254 ASN A O     
1965 C CB    . ASN A 257 ? 0.6444 0.7344 0.7007 -0.0174 0.0312  -0.0005 254 ASN A CB    
1966 C CG    . ASN A 257 ? 0.6944 0.7803 0.7471 -0.0170 0.0358  0.0045  254 ASN A CG    
1967 O OD1   . ASN A 257 ? 0.7446 0.8266 0.7975 -0.0190 0.0386  0.0046  254 ASN A OD1   
1968 N ND2   . ASN A 257 ? 0.5979 0.6839 0.6463 -0.0144 0.0359  0.0087  254 ASN A ND2   
1969 N N     . ASN A 258 ? 0.6103 0.6944 0.6728 -0.0225 0.0213  -0.0114 255 ASN A N     
1970 C CA    . ASN A 258 ? 0.5532 0.6340 0.6126 -0.0229 0.0159  -0.0171 255 ASN A CA    
1971 C C     . ASN A 258 ? 0.6164 0.6866 0.6766 -0.0260 0.0131  -0.0194 255 ASN A C     
1972 O O     . ASN A 258 ? 0.5637 0.6277 0.6204 -0.0278 0.0074  -0.0235 255 ASN A O     
1973 C CB    . ASN A 258 ? 0.5933 0.6795 0.6520 -0.0247 0.0119  -0.0174 255 ASN A CB    
1974 C CG    . ASN A 258 ? 0.6674 0.7622 0.7224 -0.0207 0.0131  -0.0166 255 ASN A CG    
1975 O OD1   . ASN A 258 ? 0.8476 0.9429 0.8971 -0.0178 0.0121  -0.0206 255 ASN A OD1   
1976 N ND2   . ASN A 258 ? 0.6502 0.7517 0.7075 -0.0200 0.0151  -0.0115 255 ASN A ND2   
1977 N N     . THR A 259 ? 0.7207 0.7873 0.7842 -0.0268 0.0163  -0.0169 256 THR A N     
1978 C CA    . THR A 259 ? 0.5604 0.6161 0.6236 -0.0295 0.0136  -0.0184 256 THR A CA    
1979 C C     . THR A 259 ? 0.6080 0.6591 0.6680 -0.0246 0.0130  -0.0230 256 THR A C     
1980 O O     . THR A 259 ? 0.6887 0.7467 0.7499 -0.0210 0.0174  -0.0225 256 THR A O     
1981 C CB    . THR A 259 ? 0.6627 0.7176 0.7306 -0.0329 0.0171  -0.0134 256 THR A CB    
1982 O OG1   . THR A 259 ? 0.7738 0.8334 0.8446 -0.0376 0.0164  -0.0105 256 THR A OG1   
1983 C CG2   . THR A 259 ? 0.5496 0.5930 0.6160 -0.0345 0.0151  -0.0147 256 THR A CG2   
1984 N N     . TYR A 260 ? 0.6264 0.6661 0.6817 -0.0244 0.0071  -0.0274 257 TYR A N     
1985 C CA    . TYR A 260 ? 0.6305 0.6663 0.6826 -0.0181 0.0056  -0.0326 257 TYR A CA    
1986 C C     . TYR A 260 ? 0.7246 0.7587 0.7803 -0.0180 0.0085  -0.0303 257 TYR A C     
1987 O O     . TYR A 260 ? 0.7885 0.8161 0.8459 -0.0233 0.0084  -0.0264 257 TYR A O     
1988 C CB    . TYR A 260 ? 0.6157 0.6365 0.6596 -0.0169 -0.0026 -0.0383 257 TYR A CB    
1989 C CG    . TYR A 260 ? 0.6654 0.6882 0.7038 -0.0135 -0.0059 -0.0434 257 TYR A CG    
1990 C CD1   . TYR A 260 ? 0.7196 0.7478 0.7550 -0.0046 -0.0058 -0.0495 257 TYR A CD1   
1991 C CD2   . TYR A 260 ? 0.7120 0.7327 0.7480 -0.0192 -0.0090 -0.0424 257 TYR A CD2   
1992 C CE1   . TYR A 260 ? 0.6632 0.6933 0.6926 -0.0011 -0.0086 -0.0547 257 TYR A CE1   
1993 C CE2   . TYR A 260 ? 0.7047 0.7269 0.7349 -0.0162 -0.0123 -0.0474 257 TYR A CE2   
1994 C CZ    . TYR A 260 ? 0.6677 0.6938 0.6942 -0.0070 -0.0121 -0.0535 257 TYR A CZ    
1995 O OH    . TYR A 260 ? 0.7524 0.7800 0.7722 -0.0037 -0.0153 -0.0588 257 TYR A OH    
1996 N N     . SER A 261 ? 0.7356 0.7772 0.7926 -0.0124 0.0111  -0.0329 258 SER A N     
1997 C CA    . SER A 261 ? 0.5621 0.6022 0.6216 -0.0112 0.0122  -0.0325 258 SER A CA    
1998 C C     . SER A 261 ? 0.6828 0.7125 0.7367 -0.0053 0.0054  -0.0390 258 SER A C     
1999 O O     . SER A 261 ? 0.7223 0.7578 0.7737 0.0020  0.0039  -0.0451 258 SER A O     
2000 C CB    . SER A 261 ? 0.6069 0.6623 0.6706 -0.0092 0.0184  -0.0318 258 SER A CB    
2001 O OG    . SER A 261 ? 0.7198 0.7754 0.7858 -0.0077 0.0187  -0.0326 258 SER A OG    
2002 N N     . PRO A 262 ? 0.6621 0.6761 0.7126 -0.0077 0.0008  -0.0381 259 PRO A N     
2003 C CA    . PRO A 262 ? 0.6484 0.6482 0.6908 -0.0015 -0.0071 -0.0442 259 PRO A CA    
2004 C C     . PRO A 262 ? 0.7234 0.7326 0.7672 0.0087  -0.0071 -0.0500 259 PRO A C     
2005 O O     . PRO A 262 ? 0.7092 0.7122 0.7461 0.0171  -0.0131 -0.0571 259 PRO A O     
2006 C CB    . PRO A 262 ? 0.6705 0.6538 0.7098 -0.0075 -0.0103 -0.0401 259 PRO A CB    
2007 C CG    . PRO A 262 ? 0.5903 0.5776 0.6342 -0.0175 -0.0056 -0.0331 259 PRO A CG    
2008 C CD    . PRO A 262 ? 0.5750 0.5823 0.6274 -0.0163 0.0022  -0.0315 259 PRO A CD    
2009 N N     . VAL A 263 ? 0.7804 0.8048 0.8322 0.0083  -0.0009 -0.0475 260 VAL A N     
2010 C CA    . VAL A 263 ? 0.7045 0.7416 0.7586 0.0172  -0.0007 -0.0530 260 VAL A CA    
2011 C C     . VAL A 263 ? 0.6907 0.7462 0.7465 0.0219  0.0027  -0.0573 260 VAL A C     
2012 O O     . VAL A 263 ? 0.7899 0.8541 0.8445 0.0316  0.0005  -0.0646 260 VAL A O     
2013 C CB    . VAL A 263 ? 0.6307 0.6773 0.6922 0.0138  0.0041  -0.0489 260 VAL A CB    
2014 C CG1   . VAL A 263 ? 0.5906 0.6506 0.6582 0.0060  0.0125  -0.0429 260 VAL A CG1   
2015 C CG2   . VAL A 263 ? 0.5751 0.6350 0.6391 0.0230  0.0028  -0.0550 260 VAL A CG2   
2016 N N     . LEU A 264 ? 0.7155 0.7776 0.7732 0.0156  0.0077  -0.0531 261 LEU A N     
2017 C CA    . LEU A 264 ? 0.7172 0.7964 0.7751 0.0190  0.0111  -0.0564 261 LEU A CA    
2018 C C     . LEU A 264 ? 0.7751 0.8462 0.8252 0.0240  0.0057  -0.0621 261 LEU A C     
2019 O O     . LEU A 264 ? 0.9015 0.9849 0.9495 0.0310  0.0061  -0.0682 261 LEU A O     
2020 C CB    . LEU A 264 ? 0.6407 0.7297 0.7025 0.0106  0.0185  -0.0492 261 LEU A CB    
2021 C CG    . LEU A 264 ? 0.5511 0.6499 0.6190 0.0051  0.0247  -0.0438 261 LEU A CG    
2022 C CD1   . LEU A 264 ? 0.5452 0.6505 0.6133 -0.0016 0.0307  -0.0376 261 LEU A CD1   
2023 C CD2   . LEU A 264 ? 0.5513 0.6675 0.6224 0.0102  0.0262  -0.0487 261 LEU A CD2   
2024 N N     . LYS A 265 ? 0.7695 0.8205 0.8144 0.0201  0.0006  -0.0603 262 LYS A N     
2025 C CA    . LYS A 265 ? 0.8177 0.8584 0.8543 0.0219  -0.0050 -0.0645 262 LYS A CA    
2026 C C     . LYS A 265 ? 0.7892 0.8415 0.8269 0.0181  -0.0006 -0.0621 262 LYS A C     
2027 O O     . LYS A 265 ? 0.8796 0.9300 0.9107 0.0215  -0.0040 -0.0671 262 LYS A O     
2028 C CB    . LYS A 265 ? 0.8398 0.8779 0.8690 0.0340  -0.0108 -0.0747 262 LYS A CB    
2029 C CG    . LYS A 265 ? 0.8952 0.9209 0.9215 0.0400  -0.0163 -0.0779 262 LYS A CG    
2030 C CD    . LYS A 265 ? 0.8363 0.8341 0.8548 0.0343  -0.0236 -0.0753 262 LYS A CD    
2031 C CE    . LYS A 265 ? 0.9190 0.9008 0.9305 0.0425  -0.0311 -0.0800 262 LYS A CE    
2032 N NZ    . LYS A 265 ? 0.9279 0.9117 0.9325 0.0570  -0.0358 -0.0907 262 LYS A NZ    
2033 N N     . TYR A 266 ? 0.6890 0.7522 0.7338 0.0115  0.0064  -0.0548 263 TYR A N     
2034 C CA    . TYR A 266 ? 0.6078 0.6810 0.6526 0.0083  0.0102  -0.0518 263 TYR A CA    
2035 C C     . TYR A 266 ? 0.6310 0.7034 0.6810 -0.0002 0.0141  -0.0429 263 TYR A C     
2036 O O     . TYR A 266 ? 0.6114 0.6807 0.6658 -0.0032 0.0161  -0.0391 263 TYR A O     
2037 C CB    . TYR A 266 ? 0.6639 0.7568 0.7096 0.0122  0.0157  -0.0538 263 TYR A CB    
2038 C CG    . TYR A 266 ? 0.7548 0.8526 0.7956 0.0219  0.0125  -0.0634 263 TYR A CG    
2039 C CD1   . TYR A 266 ? 0.7311 0.8285 0.7647 0.0255  0.0094  -0.0683 263 TYR A CD1   
2040 C CD2   . TYR A 266 ? 0.7504 0.8538 0.7934 0.0282  0.0123  -0.0680 263 TYR A CD2   
2041 C CE1   . TYR A 266 ? 0.7209 0.8225 0.7490 0.0356  0.0063  -0.0779 263 TYR A CE1   
2042 C CE2   . TYR A 266 ? 0.8167 0.9257 0.8552 0.0389  0.0091  -0.0776 263 TYR A CE2   
2043 C CZ    . TYR A 266 ? 0.8193 0.9270 0.8500 0.0427  0.0062  -0.0827 263 TYR A CZ    
2044 O OH    . TYR A 266 ? 0.8502 0.9633 0.8753 0.0545  0.0029  -0.0930 263 TYR A OH    
2045 N N     . THR A 267 ? 0.6125 0.6878 0.6612 -0.0033 0.0149  -0.0400 264 THR A N     
2046 C CA    . THR A 267 ? 0.6878 0.7645 0.7405 -0.0092 0.0186  -0.0322 264 THR A CA    
2047 C C     . THR A 267 ? 0.6697 0.7588 0.7229 -0.0093 0.0250  -0.0287 264 THR A C     
2048 O O     . THR A 267 ? 0.6875 0.7859 0.7373 -0.0058 0.0263  -0.0320 264 THR A O     
2049 C CB    . THR A 267 ? 0.7083 0.7821 0.7593 -0.0122 0.0151  -0.0310 264 THR A CB    
2050 O OG1   . THR A 267 ? 0.8019 0.8842 0.8485 -0.0095 0.0153  -0.0330 264 THR A OG1   
2051 C CG2   . THR A 267 ? 0.6127 0.6738 0.6607 -0.0134 0.0081  -0.0352 264 THR A CG2   
2052 N N     . PRO A 268 ? 0.6476 0.7363 0.7037 -0.0133 0.0290  -0.0219 265 PRO A N     
2053 C CA    . PRO A 268 ? 0.6342 0.7311 0.6881 -0.0144 0.0344  -0.0179 265 PRO A CA    
2054 C C     . PRO A 268 ? 0.6217 0.7246 0.6700 -0.0131 0.0341  -0.0177 265 PRO A C     
2055 O O     . PRO A 268 ? 0.6191 0.7303 0.6632 -0.0132 0.0376  -0.0169 265 PRO A O     
2056 C CB    . PRO A 268 ? 0.5887 0.6792 0.6449 -0.0182 0.0368  -0.0111 265 PRO A CB    
2057 C CG    . PRO A 268 ? 0.5391 0.6218 0.6002 -0.0191 0.0343  -0.0125 265 PRO A CG    
2058 C CD    . PRO A 268 ? 0.5436 0.6239 0.6039 -0.0170 0.0288  -0.0180 265 PRO A CD    
2059 N N     . HIS A 269 ? 0.6408 0.7405 0.6886 -0.0126 0.0299  -0.0183 266 HIS A N     
2060 C CA    . HIS A 269 ? 0.7429 0.8484 0.7849 -0.0109 0.0287  -0.0188 266 HIS A CA    
2061 C C     . HIS A 269 ? 0.7306 0.8429 0.7683 -0.0072 0.0281  -0.0255 266 HIS A C     
2062 O O     . HIS A 269 ? 0.6548 0.7757 0.6868 -0.0063 0.0306  -0.0251 266 HIS A O     
2063 C CB    . HIS A 269 ? 0.7186 0.8207 0.7617 -0.0115 0.0236  -0.0192 266 HIS A CB    
2064 C CG    . HIS A 269 ? 0.8045 0.9126 0.8417 -0.0098 0.0214  -0.0201 266 HIS A CG    
2065 N ND1   . HIS A 269 ? 0.8581 0.9683 0.8904 -0.0071 0.0182  -0.0268 266 HIS A ND1   
2066 C CD2   . HIS A 269 ? 0.7683 0.8802 0.8029 -0.0097 0.0216  -0.0155 266 HIS A CD2   
2067 C CE1   . HIS A 269 ? 0.7473 0.8630 0.7745 -0.0062 0.0167  -0.0260 266 HIS A CE1   
2068 N NE2   . HIS A 269 ? 0.7468 0.8638 0.7753 -0.0077 0.0186  -0.0190 266 HIS A NE2   
2069 N N     . GLN A 270 ? 0.6936 0.8017 0.7329 -0.0046 0.0246  -0.0319 267 GLN A N     
2070 C CA    . GLN A 270 ? 0.6711 0.7852 0.7058 0.0008  0.0233  -0.0396 267 GLN A CA    
2071 C C     . GLN A 270 ? 0.6714 0.7985 0.7062 0.0018  0.0293  -0.0396 267 GLN A C     
2072 O O     . GLN A 270 ? 0.7182 0.8568 0.7479 0.0047  0.0309  -0.0430 267 GLN A O     
2073 C CB    . GLN A 270 ? 0.6220 0.7256 0.6571 0.0041  0.0175  -0.0462 267 GLN A CB    
2074 C CG    . GLN A 270 ? 0.6250 0.7170 0.6575 0.0022  0.0109  -0.0476 267 GLN A CG    
2075 C CD    . GLN A 270 ? 0.7065 0.7833 0.7388 0.0025  0.0052  -0.0512 267 GLN A CD    
2076 O OE1   . GLN A 270 ? 0.7854 0.8598 0.8205 0.0045  0.0063  -0.0520 267 GLN A OE1   
2077 N NE2   . GLN A 270 ? 0.7549 0.8209 0.7830 -0.0001 -0.0013 -0.0531 267 GLN A NE2   
2078 N N     . LEU A 271 ? 0.5659 0.6926 0.6061 -0.0012 0.0328  -0.0357 268 LEU A N     
2079 C CA    . LEU A 271 ? 0.5848 0.7252 0.6253 -0.0022 0.0385  -0.0352 268 LEU A CA    
2080 C C     . LEU A 271 ? 0.7201 0.8675 0.7548 -0.0067 0.0430  -0.0292 268 LEU A C     
2081 O O     . LEU A 271 ? 0.7792 0.9411 0.8110 -0.0076 0.0472  -0.0300 268 LEU A O     
2082 C CB    . LEU A 271 ? 0.5622 0.6991 0.6091 -0.0054 0.0405  -0.0322 268 LEU A CB    
2083 C CG    . LEU A 271 ? 0.5888 0.7195 0.6401 -0.0007 0.0361  -0.0380 268 LEU A CG    
2084 C CD1   . LEU A 271 ? 0.5502 0.6767 0.6072 -0.0045 0.0379  -0.0342 268 LEU A CD1   
2085 C CD2   . LEU A 271 ? 0.5946 0.7378 0.6447 0.0067  0.0351  -0.0467 268 LEU A CD2   
2086 N N     . LEU A 272 ? 0.7153 0.8533 0.7478 -0.0096 0.0421  -0.0231 269 LEU A N     
2087 C CA    . LEU A 272 ? 0.6769 0.8182 0.7020 -0.0134 0.0455  -0.0169 269 LEU A CA    
2088 C C     . LEU A 272 ? 0.6987 0.8474 0.7164 -0.0103 0.0440  -0.0200 269 LEU A C     
2089 O O     . LEU A 272 ? 0.6344 0.7934 0.6452 -0.0124 0.0478  -0.0185 269 LEU A O     
2090 C CB    . LEU A 272 ? 0.6815 0.8098 0.7063 -0.0161 0.0446  -0.0095 269 LEU A CB    
2091 C CG    . LEU A 272 ? 0.5786 0.7057 0.5939 -0.0195 0.0472  -0.0021 269 LEU A CG    
2092 C CD1   . LEU A 272 ? 0.6268 0.7587 0.6385 -0.0253 0.0527  0.0010  269 LEU A CD1   
2093 C CD2   . LEU A 272 ? 0.5785 0.6927 0.5936 -0.0195 0.0453  0.0038  269 LEU A CD2   
2094 N N     . PHE A 273 ? 0.7309 0.8747 0.7492 -0.0062 0.0384  -0.0243 270 PHE A N     
2095 C CA    . PHE A 273 ? 0.6327 0.7816 0.6434 -0.0035 0.0362  -0.0270 270 PHE A CA    
2096 C C     . PHE A 273 ? 0.6785 0.8336 0.6878 0.0024  0.0336  -0.0370 270 PHE A C     
2097 O O     . PHE A 273 ? 0.7311 0.8937 0.7327 0.0048  0.0331  -0.0400 270 PHE A O     
2098 C CB    . PHE A 273 ? 0.6533 0.7932 0.6638 -0.0035 0.0311  -0.0245 270 PHE A CB    
2099 C CG    . PHE A 273 ? 0.6464 0.7804 0.6571 -0.0070 0.0328  -0.0154 270 PHE A CG    
2100 C CD1   . PHE A 273 ? 0.6371 0.7736 0.6389 -0.0087 0.0355  -0.0095 270 PHE A CD1   
2101 C CD2   . PHE A 273 ? 0.6962 0.8212 0.7146 -0.0082 0.0313  -0.0129 270 PHE A CD2   
2102 C CE1   . PHE A 273 ? 0.5956 0.7240 0.5957 -0.0106 0.0362  -0.0016 270 PHE A CE1   
2103 C CE2   . PHE A 273 ? 0.6502 0.7698 0.6681 -0.0098 0.0325  -0.0055 270 PHE A CE2   
2104 C CZ    . PHE A 273 ? 0.6374 0.7577 0.6458 -0.0105 0.0347  0.0000  270 PHE A CZ    
2105 N N     . GLY A 274 ? 0.7905 0.9417 0.8057 0.0054  0.0315  -0.0425 271 GLY A N     
2106 C CA    . GLY A 274 ? 0.7816 0.9353 0.7940 0.0125  0.0279  -0.0526 271 GLY A CA    
2107 C C     . GLY A 274 ? 0.7923 0.9349 0.8007 0.0147  0.0204  -0.0569 271 GLY A C     
2108 O O     . GLY A 274 ? 0.7859 0.9282 0.7893 0.0210  0.0166  -0.0658 271 GLY A O     
2109 N N     . ILE A 275 ? 0.7657 0.8996 0.7756 0.0099  0.0180  -0.0512 272 ILE A N     
2110 C CA    . ILE A 275 ? 0.7505 0.8754 0.7567 0.0101  0.0108  -0.0546 272 ILE A CA    
2111 C C     . ILE A 275 ? 0.7302 0.8482 0.7422 0.0039  0.0093  -0.0474 272 ILE A C     
2112 O O     . ILE A 275 ? 0.7085 0.8314 0.7224 0.0012  0.0133  -0.0399 272 ILE A O     
2113 C CB    . ILE A 275 ? 0.6502 0.7834 0.6471 0.0123  0.0098  -0.0572 272 ILE A CB    
2114 C CG1   . ILE A 275 ? 0.6651 0.7895 0.6586 0.0109  0.0020  -0.0598 272 ILE A CG1   
2115 C CG2   . ILE A 275 ? 0.6427 0.7859 0.6381 0.0092  0.0154  -0.0488 272 ILE A CG2   
2116 C CD1   . ILE A 275 ? 0.8120 0.9433 0.7953 0.0137  0.0001  -0.0635 272 ILE A CD1   
2117 N N     . ASP A 276 ? 0.6836 0.7900 0.6976 0.0018  0.0033  -0.0497 273 ASP A N     
2118 C CA    . ASP A 276 ? 0.6159 0.7189 0.6359 -0.0042 0.0019  -0.0436 273 ASP A CA    
2119 C C     . ASP A 276 ? 0.6495 0.7599 0.6667 -0.0054 0.0003  -0.0409 273 ASP A C     
2120 O O     . ASP A 276 ? 0.7930 0.9074 0.8025 -0.0027 -0.0019 -0.0449 273 ASP A O     
2121 C CB    . ASP A 276 ? 0.6045 0.6945 0.6257 -0.0076 -0.0043 -0.0468 273 ASP A CB    
2122 C CG    . ASP A 276 ? 0.7615 0.8432 0.7867 -0.0075 -0.0028 -0.0470 273 ASP A CG    
2123 O OD1   . ASP A 276 ? 0.7605 0.8476 0.7907 -0.0067 0.0034  -0.0426 273 ASP A OD1   
2124 O OD2   . ASP A 276 ? 0.7959 0.8645 0.8183 -0.0084 -0.0083 -0.0513 273 ASP A OD2   
2125 N N     . SER A 277 ? 0.7163 0.8291 0.7395 -0.0089 0.0012  -0.0341 274 SER A N     
2126 C CA    . SER A 277 ? 0.5979 0.7181 0.6198 -0.0097 -0.0015 -0.0314 274 SER A CA    
2127 C C     . SER A 277 ? 0.6556 0.7733 0.6809 -0.0149 -0.0080 -0.0335 274 SER A C     
2128 O O     . SER A 277 ? 0.6411 0.7490 0.6669 -0.0178 -0.0110 -0.0375 274 SER A O     
2129 C CB    . SER A 277 ? 0.6578 0.7834 0.6831 -0.0089 0.0031  -0.0232 274 SER A CB    
2130 O OG    . SER A 277 ? 0.8220 0.9448 0.8562 -0.0119 0.0040  -0.0198 274 SER A OG    
2131 N N     . ASN A 278 ? 0.7323 0.8590 0.7593 -0.0164 -0.0107 -0.0305 275 ASN A N     
2132 C CA    . ASN A 278 ? 0.7136 0.8416 0.7437 -0.0226 -0.0171 -0.0324 275 ASN A CA    
2133 C C     . ASN A 278 ? 0.6820 0.8096 0.7219 -0.0276 -0.0157 -0.0286 275 ASN A C     
2134 O O     . ASN A 278 ? 0.7342 0.8727 0.7806 -0.0300 -0.0166 -0.0250 275 ASN A O     
2135 C CB    . ASN A 278 ? 0.6085 0.7495 0.6375 -0.0221 -0.0205 -0.0309 275 ASN A CB    
2136 C CG    . ASN A 278 ? 0.6598 0.8044 0.6910 -0.0297 -0.0278 -0.0336 275 ASN A CG    
2137 O OD1   . ASN A 278 ? 0.6940 0.8277 0.7232 -0.0355 -0.0314 -0.0379 275 ASN A OD1   
2138 N ND2   . ASN A 278 ? 0.6142 0.7739 0.6487 -0.0300 -0.0304 -0.0310 275 ASN A ND2   
2139 N N     . THR A 279 ? 0.6073 0.7233 0.6480 -0.0286 -0.0134 -0.0297 276 THR A N     
2140 C CA    . THR A 279 ? 0.6369 0.7502 0.6851 -0.0338 -0.0122 -0.0267 276 THR A CA    
2141 C C     . THR A 279 ? 0.7191 0.8204 0.7641 -0.0410 -0.0181 -0.0311 276 THR A C     
2142 O O     . THR A 279 ? 0.9401 1.0318 0.9764 -0.0401 -0.0224 -0.0370 276 THR A O     
2143 C CB    . THR A 279 ? 0.6436 0.7516 0.6944 -0.0300 -0.0056 -0.0239 276 THR A CB    
2144 O OG1   . THR A 279 ? 0.7875 0.8875 0.8316 -0.0255 -0.0047 -0.0281 276 THR A OG1   
2145 C CG2   . THR A 279 ? 0.5716 0.6895 0.6260 -0.0254 -0.0004 -0.0180 276 THR A CG2   
2146 N N     . PRO A 280 ? 0.6557 0.7568 0.7064 -0.0485 -0.0187 -0.0285 277 PRO A N     
2147 C CA    . PRO A 280 ? 0.6684 0.7554 0.7139 -0.0569 -0.0248 -0.0319 277 PRO A CA    
2148 C C     . PRO A 280 ? 0.6623 0.7297 0.7000 -0.0527 -0.0254 -0.0361 277 PRO A C     
2149 O O     . PRO A 280 ? 0.6203 0.6862 0.6608 -0.0469 -0.0198 -0.0345 277 PRO A O     
2150 C CB    . PRO A 280 ? 0.7134 0.8056 0.7669 -0.0647 -0.0230 -0.0269 277 PRO A CB    
2151 C CG    . PRO A 280 ? 0.6376 0.7514 0.7004 -0.0613 -0.0187 -0.0224 277 PRO A CG    
2152 C CD    . PRO A 280 ? 0.6097 0.7244 0.6705 -0.0501 -0.0147 -0.0225 277 PRO A CD    
2153 N N     . PHE A 281 ? 0.6315 0.6841 0.6588 -0.0555 -0.0327 -0.0419 278 PHE A N     
2154 C CA    . PHE A 281 ? 0.6418 0.6745 0.6602 -0.0508 -0.0352 -0.0470 278 PHE A CA    
2155 C C     . PHE A 281 ? 0.6988 0.7362 0.7162 -0.0386 -0.0306 -0.0499 278 PHE A C     
2156 O O     . PHE A 281 ? 0.8531 0.8838 0.8699 -0.0329 -0.0281 -0.0513 278 PHE A O     
2157 C CB    . PHE A 281 ? 0.6676 0.6896 0.6881 -0.0545 -0.0339 -0.0439 278 PHE A CB    
2158 C CG    . PHE A 281 ? 0.6847 0.7012 0.7043 -0.0677 -0.0384 -0.0411 278 PHE A CG    
2159 C CD1   . PHE A 281 ? 0.6854 0.7188 0.7159 -0.0742 -0.0343 -0.0346 278 PHE A CD1   
2160 C CD2   . PHE A 281 ? 0.7001 0.6947 0.7071 -0.0737 -0.0471 -0.0451 278 PHE A CD2   
2161 C CE1   . PHE A 281 ? 0.6635 0.6952 0.6935 -0.0874 -0.0379 -0.0320 278 PHE A CE1   
2162 C CE2   . PHE A 281 ? 0.6795 0.6691 0.6845 -0.0879 -0.0513 -0.0420 278 PHE A CE2   
2163 C CZ    . PHE A 281 ? 0.6873 0.6971 0.7045 -0.0952 -0.0464 -0.0353 278 PHE A CZ    
2164 N N     . ALA A 282 ? 0.6388 0.6887 0.6555 -0.0351 -0.0297 -0.0509 279 ALA A N     
2165 C CA    . ALA A 282 ? 0.6969 0.7533 0.7117 -0.0250 -0.0253 -0.0534 279 ALA A CA    
2166 C C     . ALA A 282 ? 0.7894 0.8320 0.7936 -0.0188 -0.0295 -0.0620 279 ALA A C     
2167 O O     . ALA A 282 ? 0.7971 0.8281 0.7917 -0.0207 -0.0371 -0.0675 279 ALA A O     
2168 C CB    . ALA A 282 ? 0.6673 0.7387 0.6815 -0.0235 -0.0245 -0.0525 279 ALA A CB    
2169 N N     . ASN A 283 ? 0.7752 0.8190 0.7806 -0.0112 -0.0248 -0.0633 280 ASN A N     
2170 C CA    . ASN A 283 ? 0.8516 0.8858 0.8476 -0.0029 -0.0282 -0.0721 280 ASN A CA    
2171 C C     . ASN A 283 ? 0.8581 0.9005 0.8467 0.0027  -0.0290 -0.0776 280 ASN A C     
2172 O O     . ASN A 283 ? 0.8495 0.9094 0.8419 0.0042  -0.0230 -0.0743 280 ASN A O     
2173 C CB    . ASN A 283 ? 0.8762 0.9150 0.8772 0.0036  -0.0224 -0.0718 280 ASN A CB    
2174 C CG    . ASN A 283 ? 0.9786 1.0094 0.9710 0.0137  -0.0261 -0.0813 280 ASN A CG    
2175 O OD1   . ASN A 283 ? 0.9042 0.9468 0.8936 0.0215  -0.0235 -0.0861 280 ASN A OD1   
2176 N ND2   . ASN A 283 ? 1.0494 1.0603 1.0369 0.0140  -0.0322 -0.0841 280 ASN A ND2   
2177 N N     . GLN A 284 ? 1.1144 0.7875 0.9908 -0.0937 0.0728  -0.1175 281 GLN A N     
2178 C CA    A GLN A 284 ? 1.1740 0.8773 1.0524 -0.0832 0.0723  -0.1210 281 GLN A CA    
2179 C CA    B GLN A 284 ? 1.1713 0.8756 1.0504 -0.0832 0.0724  -0.1208 281 GLN A CA    
2180 C C     . GLN A 284 ? 1.1757 0.8916 1.0384 -0.0539 0.0636  -0.1303 281 GLN A C     
2181 O O     . GLN A 284 ? 1.2336 0.9527 1.0807 -0.0417 0.0594  -0.1384 281 GLN A O     
2182 C CB    A GLN A 284 ? 1.2153 0.8817 1.0691 -0.0928 0.0700  -0.1277 281 GLN A CB    
2183 C CB    B GLN A 284 ? 1.2149 0.8841 1.0710 -0.0935 0.0706  -0.1269 281 GLN A CB    
2184 C CG    A GLN A 284 ? 1.2148 0.8742 1.0857 -0.1213 0.0791  -0.1182 281 GLN A CG    
2185 C CG    B GLN A 284 ? 1.2113 0.8699 1.0834 -0.1224 0.0795  -0.1174 281 GLN A CG    
2186 C CD    A GLN A 284 ? 1.2759 0.8899 1.1175 -0.1304 0.0752  -0.1260 281 GLN A CD    
2187 C CD    B GLN A 284 ? 1.1521 0.8673 1.0654 -0.1321 0.0903  -0.1053 281 GLN A CD    
2188 O OE1   A GLN A 284 ? 1.2030 0.7778 1.0079 -0.1180 0.0655  -0.1387 281 GLN A OE1   
2189 O OE1   B GLN A 284 ? 1.1307 0.8727 1.0762 -0.1423 0.0988  -0.0935 281 GLN A OE1   
2190 N NE2   A GLN A 284 ? 1.3664 0.9856 1.2247 -0.1522 0.0829  -0.1183 281 GLN A NE2   
2191 N NE2   B GLN A 284 ? 1.0760 0.8094 0.9884 -0.1291 0.0902  -0.1081 281 GLN A NE2   
2192 N N     . ASP A 285 ? 1.1093 0.8326 0.9757 -0.0422 0.0609  -0.1295 282 ASP A N     
2193 C CA    . ASP A 285 ? 1.1826 0.9116 1.0307 -0.0140 0.0520  -0.1387 282 ASP A CA    
2194 C C     . ASP A 285 ? 1.1809 0.9687 1.0510 0.0005  0.0548  -0.1365 282 ASP A C     
2195 O O     . ASP A 285 ? 1.2070 0.9960 1.0568 0.0223  0.0479  -0.1460 282 ASP A O     
2196 C CB    . ASP A 285 ? 1.2225 0.9461 1.0705 -0.0058 0.0484  -0.1377 282 ASP A CB    
2197 C CG    . ASP A 285 ? 1.2187 0.8779 1.0317 -0.0100 0.0418  -0.1444 282 ASP A CG    
2198 O OD1   . ASP A 285 ? 1.1320 0.7500 0.9143 -0.0112 0.0374  -0.1531 282 ASP A OD1   
2199 O OD2   . ASP A 285 ? 1.3003 0.9500 1.1164 -0.0120 0.0410  -0.1411 282 ASP A OD2   
2200 N N     . THR A 286 ? 1.0440 0.8801 0.9549 -0.0107 0.0650  -0.1241 283 THR A N     
2201 C CA    . THR A 286 ? 0.9893 0.8848 0.9248 0.0030  0.0685  -0.1205 283 THR A CA    
2202 C C     . THR A 286 ? 1.0757 0.9892 1.0184 -0.0049 0.0736  -0.1189 283 THR A C     
2203 O O     . THR A 286 ? 1.0948 1.0623 1.0684 -0.0023 0.0804  -0.1112 283 THR A O     
2204 C CB    . THR A 286 ? 0.9182 0.8610 0.8961 -0.0015 0.0767  -0.1074 283 THR A CB    
2205 O OG1   . THR A 286 ? 0.8918 0.8280 0.8899 -0.0287 0.0853  -0.0975 283 THR A OG1   
2206 C CG2   . THR A 286 ? 0.8146 0.7505 0.7861 0.0124  0.0705  -0.1100 283 THR A CG2   
2207 N N     . LEU A 287 ? 1.0908 0.9606 1.0056 -0.0140 0.0701  -0.1263 284 LEU A N     
2208 C CA    . LEU A 287 ? 1.1064 0.9906 1.0285 -0.0246 0.0750  -0.1243 284 LEU A CA    
2209 C C     . LEU A 287 ? 1.1091 1.0307 1.0307 -0.0039 0.0730  -0.1290 284 LEU A C     
2210 O O     . LEU A 287 ? 1.0967 1.0545 1.0392 -0.0099 0.0796  -0.1230 284 LEU A O     
2211 C CB    . LEU A 287 ? 1.1998 1.0258 1.0891 -0.0375 0.0705  -0.1324 284 LEU A CB    
2212 C CG    . LEU A 287 ? 1.2839 1.1132 1.1853 -0.0600 0.0774  -0.1267 284 LEU A CG    
2213 C CD1   . LEU A 287 ? 1.2837 1.1454 1.2274 -0.0793 0.0894  -0.1102 284 LEU A CD1   
2214 C CD2   . LEU A 287 ? 1.3317 1.0977 1.2002 -0.0730 0.0724  -0.1344 284 LEU A CD2   
2215 N N     . ASP A 288 ? 1.0867 1.0008 0.9848 0.0208  0.0642  -0.1392 285 ASP A N     
2216 C CA    . ASP A 288 ? 1.0644 1.0089 0.9574 0.0420  0.0616  -0.1450 285 ASP A CA    
2217 C C     . ASP A 288 ? 1.0560 1.0610 0.9813 0.0568  0.0661  -0.1370 285 ASP A C     
2218 O O     . ASP A 288 ? 1.0943 1.1342 1.0233 0.0720  0.0664  -0.1388 285 ASP A O     
2219 C CB    . ASP A 288 ? 1.1279 1.0301 0.9758 0.0618  0.0498  -0.1612 285 ASP A CB    
2220 C CG    . ASP A 288 ? 1.3539 1.2022 1.1689 0.0500  0.0453  -0.1707 285 ASP A CG    
2221 O OD1   . ASP A 288 ? 1.4104 1.2665 1.2357 0.0331  0.0504  -0.1669 285 ASP A OD1   
2222 O OD2   . ASP A 288 ? 1.4362 1.2346 1.2155 0.0577  0.0367  -0.1817 285 ASP A OD2   
2223 N N     . LEU A 289 ? 0.9684 0.9863 0.9165 0.0529  0.0696  -0.1283 286 LEU A N     
2224 C CA    . LEU A 289 ? 0.9151 0.9919 0.8975 0.0646  0.0747  -0.1195 286 LEU A CA    
2225 C C     . LEU A 289 ? 0.8501 0.9745 0.8719 0.0498  0.0866  -0.1064 286 LEU A C     
2226 O O     . LEU A 289 ? 0.9351 1.0458 0.9641 0.0265  0.0920  -0.1013 286 LEU A O     
2227 C CB    . LEU A 289 ? 0.8782 0.9529 0.8728 0.0640  0.0745  -0.1145 286 LEU A CB    
2228 C CG    . LEU A 289 ? 0.8926 0.9242 0.8515 0.0795  0.0631  -0.1259 286 LEU A CG    
2229 C CD1   . LEU A 289 ? 0.8478 0.8781 0.8214 0.0749  0.0637  -0.1197 286 LEU A CD1   
2230 C CD2   . LEU A 289 ? 0.8524 0.9024 0.7973 0.1090  0.0569  -0.1338 286 LEU A CD2   
2231 N N     . THR A 290 ? 0.9070 1.0878 0.9544 0.0638  0.0909  -0.1008 287 THR A N     
2232 C CA    . THR A 290 ? 0.8692 1.0996 0.9592 0.0505  0.1032  -0.0864 287 THR A CA    
2233 C C     . THR A 290 ? 0.8233 1.0623 0.9436 0.0353  0.1099  -0.0750 287 THR A C     
2234 O O     . THR A 290 ? 0.8868 1.1000 0.9964 0.0382  0.1046  -0.0782 287 THR A O     
2235 C CB    . THR A 290 ? 0.8933 1.1819 1.0026 0.0704  0.1063  -0.0833 287 THR A CB    
2236 O OG1   . THR A 290 ? 1.0140 1.3196 1.1297 0.0887  0.1032  -0.0834 287 THR A OG1   
2237 C CG2   . THR A 290 ? 0.7565 1.0367 0.8353 0.0853  0.0999  -0.0949 287 THR A CG2   
2238 N N     . ARG A 291 ? 0.7238 0.9992 0.8820 0.0188  0.1218  -0.0614 288 ARG A N     
2239 C CA    . ARG A 291 ? 0.7196 1.0072 0.9093 0.0043  0.1292  -0.0501 288 ARG A CA    
2240 C C     . ARG A 291 ? 0.7971 1.1163 1.0025 0.0224  0.1278  -0.0482 288 ARG A C     
2241 O O     . ARG A 291 ? 0.8275 1.1340 1.0384 0.0175  0.1269  -0.0463 288 ARG A O     
2242 C CB    . ARG A 291 ? 0.6199 0.9447 0.8486 -0.0148 0.1428  -0.0355 288 ARG A CB    
2243 C CG    . ARG A 291 ? 0.6238 0.9614 0.8864 -0.0313 0.1516  -0.0234 288 ARG A CG    
2244 C CD    . ARG A 291 ? 0.6257 0.9064 0.8665 -0.0445 0.1467  -0.0281 288 ARG A CD    
2245 N NE    . ARG A 291 ? 0.6544 0.9455 0.9269 -0.0622 0.1557  -0.0167 288 ARG A NE    
2246 C CZ    . ARG A 291 ? 0.6542 0.9042 0.9156 -0.0743 0.1534  -0.0183 288 ARG A CZ    
2247 N NH1   . ARG A 291 ? 0.6767 0.8726 0.8964 -0.0703 0.1423  -0.0306 288 ARG A NH1   
2248 N NH2   . ARG A 291 ? 0.5501 0.8130 0.8419 -0.0901 0.1622  -0.0077 288 ARG A NH2   
2249 N N     . GLU A 292 ? 0.7530 1.1134 0.9654 0.0434  0.1274  -0.0489 289 GLU A N     
2250 C CA    . GLU A 292 ? 0.7736 1.1660 1.0012 0.0618  0.1259  -0.0471 289 GLU A CA    
2251 C C     . GLU A 292 ? 0.8239 1.1746 1.0169 0.0755  0.1134  -0.0591 289 GLU A C     
2252 O O     . GLU A 292 ? 0.8729 1.2296 1.0773 0.0788  0.1122  -0.0565 289 GLU A O     
2253 C CB    . GLU A 292 ? 0.9009 1.3435 1.1403 0.0822  0.1280  -0.0459 289 GLU A CB    
2254 C CG    . GLU A 292 ? 1.0110 1.5049 1.2917 0.0712  0.1413  -0.0319 289 GLU A CG    
2255 C CD    . GLU A 292 ? 1.0564 1.6094 1.3611 0.0917  0.1449  -0.0269 289 GLU A CD    
2256 O OE1   . GLU A 292 ? 1.0538 1.6073 1.3423 0.1146  0.1368  -0.0346 289 GLU A OE1   
2257 O OE2   . GLU A 292 ? 1.0343 1.6334 1.3743 0.0853  0.1561  -0.0149 289 GLU A OE2   
2258 N N     . GLU A 293 ? 0.8162 1.1250 0.9669 0.0839  0.1040  -0.0722 290 GLU A N     
2259 C CA    . GLU A 293 ? 0.7938 1.0581 0.9095 0.0956  0.0924  -0.0834 290 GLU A CA    
2260 C C     . GLU A 293 ? 0.8212 1.0453 0.9333 0.0754  0.0921  -0.0817 290 GLU A C     
2261 O O     . GLU A 293 ? 0.8310 1.0364 0.9325 0.0825  0.0858  -0.0852 290 GLU A O     
2262 C CB    . GLU A 293 ? 0.7300 0.9569 0.8019 0.1071  0.0835  -0.0975 290 GLU A CB    
2263 C CG    . GLU A 293 ? 0.8375 1.1015 0.9088 0.1302  0.0826  -0.1007 290 GLU A CG    
2264 C CD    . GLU A 293 ? 0.9301 1.1629 0.9642 0.1358  0.0767  -0.1128 290 GLU A CD    
2265 O OE1   . GLU A 293 ? 0.9281 1.1200 0.9452 0.1176  0.0760  -0.1160 290 GLU A OE1   
2266 O OE2   . GLU A 293 ? 0.9947 1.2440 1.0168 0.1583  0.0730  -0.1192 290 GLU A OE2   
2267 N N     . GLU A 294 ? 0.8654 1.0771 0.9868 0.0503  0.0990  -0.0759 291 GLU A N     
2268 C CA    . GLU A 294 ? 0.7721 0.9479 0.8927 0.0297  0.1001  -0.0732 291 GLU A CA    
2269 C C     . GLU A 294 ? 0.7687 0.9770 0.9250 0.0254  0.1058  -0.0628 291 GLU A C     
2270 O O     . GLU A 294 ? 0.7508 0.9328 0.8988 0.0230  0.1015  -0.0646 291 GLU A O     
2271 C CB    . GLU A 294 ? 0.7241 0.8846 0.8496 0.0044  0.1074  -0.0683 291 GLU A CB    
2272 C CG    . GLU A 294 ? 0.7619 0.8588 0.8579 -0.0108 0.1029  -0.0739 291 GLU A CG    
2273 C CD    . GLU A 294 ? 0.8436 0.9286 0.9451 -0.0346 0.1101  -0.0689 291 GLU A CD    
2274 O OE1   . GLU A 294 ? 0.8108 0.9339 0.9498 -0.0481 0.1214  -0.0564 291 GLU A OE1   
2275 O OE2   . GLU A 294 ? 0.9073 0.9455 0.9762 -0.0396 0.1047  -0.0773 291 GLU A OE2   
2276 N N     . LEU A 295 ? 0.7778 1.0433 0.9744 0.0243  0.1157  -0.0518 292 LEU A N     
2277 C CA    . LEU A 295 ? 0.6634 0.9631 0.8965 0.0202  0.1217  -0.0418 292 LEU A CA    
2278 C C     . LEU A 295 ? 0.6747 0.9855 0.9021 0.0435  0.1135  -0.0467 292 LEU A C     
2279 O O     . LEU A 295 ? 0.7365 1.0547 0.9804 0.0402  0.1142  -0.0425 292 LEU A O     
2280 C CB    . LEU A 295 ? 0.6416 1.0004 0.9187 0.0145  0.1345  -0.0288 292 LEU A CB    
2281 C CG    . LEU A 295 ? 0.7138 1.0703 1.0046 -0.0097 0.1446  -0.0211 292 LEU A CG    
2282 C CD1   . LEU A 295 ? 0.6492 1.0672 0.9810 -0.0103 0.1563  -0.0091 292 LEU A CD1   
2283 C CD2   . LEU A 295 ? 0.5044 0.8335 0.8033 -0.0336 0.1489  -0.0159 292 LEU A CD2   
2284 N N     . SER A 296 ? 0.6779 0.9913 0.8828 0.0671  0.1059  -0.0555 293 SER A N     
2285 C CA    . SER A 296 ? 0.6348 0.9537 0.8299 0.0903  0.0972  -0.0612 293 SER A CA    
2286 C C     . SER A 296 ? 0.6566 0.9206 0.8204 0.0883  0.0878  -0.0691 293 SER A C     
2287 O O     . SER A 296 ? 0.6546 0.9241 0.8257 0.0938  0.0845  -0.0680 293 SER A O     
2288 C CB    . SER A 296 ? 0.6479 0.9766 0.8224 0.1155  0.0915  -0.0694 293 SER A CB    
2289 O OG    . SER A 296 ? 0.6575 1.0023 0.8296 0.1388  0.0849  -0.0726 293 SER A OG    
2290 N N     . LEU A 297 ? 0.6973 0.9081 0.8265 0.0803  0.0834  -0.0770 294 LEU A N     
2291 C CA    . LEU A 297 ? 0.7612 0.9172 0.8607 0.0762  0.0753  -0.0838 294 LEU A CA    
2292 C C     . LEU A 297 ? 0.8434 0.9959 0.9655 0.0536  0.0813  -0.0751 294 LEU A C     
2293 O O     . LEU A 297 ? 0.8051 0.9296 0.9138 0.0537  0.0753  -0.0782 294 LEU A O     
2294 C CB    . LEU A 297 ? 0.7467 0.8484 0.8070 0.0708  0.0707  -0.0932 294 LEU A CB    
2295 C CG    . LEU A 297 ? 0.8249 0.8656 0.8500 0.0679  0.0620  -0.1011 294 LEU A CG    
2296 C CD1   . LEU A 297 ? 1.0058 1.0382 1.0068 0.0946  0.0510  -0.1100 294 LEU A CD1   
2297 C CD2   . LEU A 297 ? 0.8303 0.8209 0.8248 0.0563  0.0603  -0.1077 294 LEU A CD2   
2298 N N     . LEU A 298 ? 0.7522 0.9324 0.9082 0.0344  0.0931  -0.0642 295 LEU A N     
2299 C CA    . LEU A 298 ? 0.7343 0.9111 0.9125 0.0120  0.0997  -0.0557 295 LEU A CA    
2300 C C     . LEU A 298 ? 0.8026 1.0161 1.0083 0.0191  0.1003  -0.0504 295 LEU A C     
2301 O O     . LEU A 298 ? 0.8283 1.0226 1.0339 0.0103  0.0986  -0.0496 295 LEU A O     
2302 C CB    . LEU A 298 ? 0.6761 0.8732 0.8833 -0.0098 0.1127  -0.0453 295 LEU A CB    
2303 C CG    . LEU A 298 ? 0.6552 0.8517 0.8883 -0.0339 0.1213  -0.0356 295 LEU A CG    
2304 C CD1   . LEU A 298 ? 0.6445 0.7792 0.8463 -0.0451 0.1153  -0.0416 295 LEU A CD1   
2305 C CD2   . LEU A 298 ? 0.6486 0.8689 0.9110 -0.0532 0.1345  -0.0249 295 LEU A CD2   
2306 N N     . GLN A 299 ? 0.7091 0.9759 0.9387 0.0347  0.1028  -0.0466 296 GLN A N     
2307 C CA    . GLN A 299 ? 0.7158 1.0200 0.9727 0.0422  0.1033  -0.0416 296 GLN A CA    
2308 C C     . GLN A 299 ? 0.7840 1.0615 1.0125 0.0587  0.0904  -0.0508 296 GLN A C     
2309 O O     . GLN A 299 ? 0.7539 1.0404 0.9968 0.0569  0.0893  -0.0478 296 GLN A O     
2310 C CB    . GLN A 299 ? 0.7089 1.0745 0.9952 0.0569  0.1085  -0.0359 296 GLN A CB    
2311 C CG    . GLN A 299 ? 0.8953 1.2964 1.2188 0.0395  0.1227  -0.0241 296 GLN A CG    
2312 C CD    . GLN A 299 ? 1.0208 1.4712 1.3615 0.0548  0.1270  -0.0207 296 GLN A CD    
2313 O OE1   . GLN A 299 ? 1.0311 1.4929 1.3806 0.0462  0.1346  -0.0164 296 GLN A OE1   
2314 N NE2   . GLN A 299 ? 0.9871 1.4675 1.3327 0.0777  0.1222  -0.0225 296 GLN A NE2   
2315 N N     . GLU A 300 ? 0.7541 0.9984 0.9424 0.0747  0.0806  -0.0620 297 GLU A N     
2316 C CA    . GLU A 300 ? 0.8743 1.0896 1.0332 0.0905  0.0684  -0.0708 297 GLU A CA    
2317 C C     . GLU A 300 ? 0.8501 1.0141 0.9903 0.0734  0.0654  -0.0730 297 GLU A C     
2318 O O     . GLU A 300 ? 0.8753 1.0311 1.0117 0.0776  0.0595  -0.0744 297 GLU A O     
2319 C CB    . GLU A 300 ? 0.8845 1.0782 1.0057 0.1122  0.0596  -0.0820 297 GLU A CB    
2320 C CG    . GLU A 300 ? 1.1220 1.2800 1.2086 0.1288  0.0470  -0.0916 297 GLU A CG    
2321 C CD    . GLU A 300 ? 1.3236 1.5167 1.4296 0.1427  0.0438  -0.0883 297 GLU A CD    
2322 O OE1   . GLU A 300 ? 1.3580 1.6058 1.4953 0.1514  0.0488  -0.0822 297 GLU A OE1   
2323 O OE2   . GLU A 300 ? 1.4062 1.5725 1.4963 0.1450  0.0364  -0.0918 297 GLU A OE2   
2324 N N     . ILE A 301 ? 0.7396 0.8690 0.8681 0.0541  0.0693  -0.0733 298 ILE A N     
2325 C CA    . ILE A 301 ? 0.7856 0.8655 0.8967 0.0367  0.0674  -0.0748 298 ILE A CA    
2326 C C     . ILE A 301 ? 0.7645 0.8661 0.9096 0.0206  0.0740  -0.0653 298 ILE A C     
2327 O O     . ILE A 301 ? 0.7238 0.7993 0.8581 0.0167  0.0692  -0.0672 298 ILE A O     
2328 C CB    . ILE A 301 ? 0.7949 0.8377 0.8899 0.0189  0.0714  -0.0761 298 ILE A CB    
2329 C CG1   . ILE A 301 ? 0.9134 0.9206 0.9663 0.0344  0.0625  -0.0878 298 ILE A CG1   
2330 C CG2   . ILE A 301 ? 0.7297 0.7317 0.8184 -0.0037 0.0732  -0.0740 298 ILE A CG2   
2331 C CD1   . ILE A 301 ? 0.9496 0.9272 0.9890 0.0187  0.0664  -0.0892 298 ILE A CD1   
2332 N N     . ARG A 302 ? 0.7350 0.8849 0.9216 0.0111  0.0853  -0.0550 299 ARG A N     
2333 C CA    . ARG A 302 ? 0.6633 0.8345 0.8841 -0.0058 0.0929  -0.0456 299 ARG A CA    
2334 C C     . ARG A 302 ? 0.7311 0.9225 0.9603 0.0076  0.0866  -0.0464 299 ARG A C     
2335 O O     . ARG A 302 ? 0.8483 1.0388 1.0922 -0.0055 0.0888  -0.0423 299 ARG A O     
2336 C CB    . ARG A 302 ? 0.6188 0.8404 0.8828 -0.0162 0.1064  -0.0343 299 ARG A CB    
2337 C CG    . ARG A 302 ? 0.5733 0.7773 0.8387 -0.0375 0.1153  -0.0302 299 ARG A CG    
2338 C CD    . ARG A 302 ? 0.5813 0.8394 0.8895 -0.0443 0.1283  -0.0189 299 ARG A CD    
2339 N NE    . ARG A 302 ? 0.6108 0.8562 0.9245 -0.0658 0.1377  -0.0136 299 ARG A NE    
2340 C CZ    . ARG A 302 ? 0.6215 0.9049 0.9625 -0.0703 0.1479  -0.0054 299 ARG A CZ    
2341 N NH1   . ARG A 302 ? 0.6453 0.9809 1.0097 -0.0546 0.1500  -0.0020 299 ARG A NH1   
2342 N NH2   . ARG A 302 ? 0.5115 0.7812 0.8562 -0.0901 0.1561  -0.0005 299 ARG A NH2   
2343 N N     . THR A 303 ? 0.6223 0.8330 0.8433 0.0334  0.0790  -0.0513 300 THR A N     
2344 C CA    . THR A 303 ? 0.7106 0.9443 0.9407 0.0478  0.0728  -0.0518 300 THR A CA    
2345 C C     . THR A 303 ? 0.7917 0.9802 0.9811 0.0600  0.0593  -0.0619 300 THR A C     
2346 O O     . THR A 303 ? 0.8573 1.0599 1.0515 0.0710  0.0532  -0.0626 300 THR A O     
2347 C CB    . THR A 303 ? 0.7071 0.9937 0.9560 0.0697  0.0730  -0.0500 300 THR A CB    
2348 O OG1   . THR A 303 ? 0.7412 1.0100 0.9583 0.0870  0.0671  -0.0582 300 THR A OG1   
2349 C CG2   . THR A 303 ? 0.7224 1.0584 1.0156 0.0579  0.0868  -0.0388 300 THR A CG2   
2350 N N     . SER A 304 ? 0.7024 0.8376 0.8527 0.0584  0.0546  -0.0695 301 SER A N     
2351 C CA    . SER A 304 ? 0.7589 0.8483 0.8687 0.0702  0.0422  -0.0791 301 SER A CA    
2352 C C     . SER A 304 ? 0.8453 0.8841 0.9376 0.0496  0.0418  -0.0801 301 SER A C     
2353 O O     . SER A 304 ? 0.8214 0.8126 0.8753 0.0562  0.0327  -0.0882 301 SER A O     
2354 C CB    . SER A 304 ? 0.8151 0.8805 0.8894 0.0884  0.0356  -0.0884 301 SER A CB    
2355 O OG    . SER A 304 ? 0.9694 0.9965 1.0255 0.0733  0.0391  -0.0905 301 SER A OG    
2356 N N     . LEU A 305 ? 0.7943 0.8419 0.9137 0.0251  0.0520  -0.0718 302 LEU A N     
2357 C CA    . LEU A 305 ? 0.7883 0.7887 0.8924 0.0047  0.0527  -0.0721 302 LEU A CA    
2358 C C     . LEU A 305 ? 0.8297 0.8175 0.9253 0.0086  0.0448  -0.0744 302 LEU A C     
2359 O O     . LEU A 305 ? 0.8300 0.8568 0.9472 0.0184  0.0428  -0.0719 302 LEU A O     
2360 C CB    . LEU A 305 ? 0.7748 0.7909 0.9122 -0.0220 0.0664  -0.0621 302 LEU A CB    
2361 C CG    . LEU A 305 ? 0.6792 0.7013 0.8240 -0.0307 0.0751  -0.0590 302 LEU A CG    
2362 C CD1   . LEU A 305 ? 0.6486 0.6838 0.8261 -0.0576 0.0885  -0.0485 302 LEU A CD1   
2363 C CD2   . LEU A 305 ? 0.7147 0.6820 0.8168 -0.0296 0.0696  -0.0673 302 LEU A CD2   
2364 N N     . TYR A 306 ? 0.8624 0.7949 0.9262 0.0006  0.0402  -0.0791 303 TYR A N     
2365 C CA    . TYR A 306 ? 0.8520 0.7670 0.9045 0.0025  0.0327  -0.0814 303 TYR A CA    
2366 C C     . TYR A 306 ? 0.8516 0.7989 0.9423 -0.0140 0.0400  -0.0729 303 TYR A C     
2367 O O     . TYR A 306 ? 0.9146 0.8696 1.0284 -0.0356 0.0513  -0.0660 303 TYR A O     
2368 C CB    . TYR A 306 ? 0.8860 0.7349 0.8992 -0.0063 0.0286  -0.0867 303 TYR A CB    
2369 C CG    . TYR A 306 ? 1.0224 0.8515 1.0283 -0.0121 0.0239  -0.0871 303 TYR A CG    
2370 C CD1   . TYR A 306 ? 1.1564 0.9786 1.1419 0.0080  0.0119  -0.0928 303 TYR A CD1   
2371 C CD2   . TYR A 306 ? 0.9815 0.7989 1.0005 -0.0374 0.0315  -0.0815 303 TYR A CD2   
2372 C CE1   . TYR A 306 ? 1.1729 0.9780 1.1514 0.0029  0.0072  -0.0931 303 TYR A CE1   
2373 C CE2   . TYR A 306 ? 1.0659 0.8655 1.0776 -0.0426 0.0272  -0.0821 303 TYR A CE2   
2374 C CZ    . TYR A 306 ? 1.1870 0.9807 1.1784 -0.0224 0.0148  -0.0879 303 TYR A CZ    
2375 O OH    . TYR A 306 ? 1.3158 1.0924 1.2993 -0.0274 0.0101  -0.0886 303 TYR A OH    
2376 N N     . HIS A 307 ? 0.8006 0.7672 0.8982 -0.0039 0.0334  -0.0735 304 HIS A N     
2377 C CA    . HIS A 307 ? 0.9074 0.9011 1.0385 -0.0191 0.0390  -0.0666 304 HIS A CA    
2378 C C     . HIS A 307 ? 0.8393 0.8088 0.9516 -0.0165 0.0294  -0.0707 304 HIS A C     
2379 O O     . HIS A 307 ? 0.9125 0.8841 1.0083 0.0056  0.0182  -0.0761 304 HIS A O     
2380 C CB    . HIS A 307 ? 0.9443 1.0043 1.1171 -0.0111 0.0432  -0.0608 304 HIS A CB    
2381 C CG    . HIS A 307 ? 0.9577 1.0473 1.1700 -0.0311 0.0525  -0.0525 304 HIS A CG    
2382 N ND1   . HIS A 307 ? 0.8631 0.9508 1.0944 -0.0552 0.0653  -0.0459 304 HIS A ND1   
2383 C CD2   . HIS A 307 ? 0.9084 1.0286 1.1442 -0.0310 0.0509  -0.0499 304 HIS A CD2   
2384 C CE1   . HIS A 307 ? 0.8102 0.9261 1.0751 -0.0688 0.0716  -0.0396 304 HIS A CE1   
2385 N NE2   . HIS A 307 ? 0.8548 0.9908 1.1231 -0.0548 0.0629  -0.0421 304 HIS A NE2   
2386 N N     . PRO A 308 ? 0.7397 0.6871 0.8544 -0.0380 0.0334  -0.0681 305 PRO A N     
2387 C CA    . PRO A 308 ? 0.9004 0.8224 0.9955 -0.0365 0.0243  -0.0721 305 PRO A CA    
2388 C C     . PRO A 308 ? 0.9067 0.8756 1.0298 -0.0295 0.0211  -0.0697 305 PRO A C     
2389 O O     . PRO A 308 ? 0.8553 0.8757 1.0168 -0.0301 0.0277  -0.0639 305 PRO A O     
2390 C CB    . PRO A 308 ? 0.8737 0.7619 0.9671 -0.0637 0.0318  -0.0690 305 PRO A CB    
2391 C CG    . PRO A 308 ? 0.8616 0.7820 0.9927 -0.0803 0.0462  -0.0608 305 PRO A CG    
2392 C CD    . PRO A 308 ? 0.7153 0.6587 0.8496 -0.0647 0.0467  -0.0614 305 PRO A CD    
2393 N N     . SER A 309 ? 0.9367 0.8869 1.0400 -0.0229 0.0107  -0.0741 306 SER A N     
2394 C CA    . SER A 309 ? 1.0169 1.0064 1.1413 -0.0147 0.0054  -0.0731 306 SER A CA    
2395 C C     . SER A 309 ? 0.9839 0.9596 1.1123 -0.0335 0.0060  -0.0718 306 SER A C     
2396 O O     . SER A 309 ? 0.9198 0.8470 1.0237 -0.0469 0.0069  -0.0736 306 SER A O     
2397 C CB    . SER A 309 ? 1.1228 1.1090 1.2210 0.0136  -0.0089 -0.0796 306 SER A CB    
2398 O OG    . SER A 309 ? 1.2161 1.1434 1.2681 0.0176  -0.0164 -0.0861 306 SER A OG    
2399 N N     . THR A 310 ? 1.0077 1.0268 1.1675 -0.0342 0.0057  -0.0686 307 THR A N     
2400 C CA    . THR A 310 ? 0.9060 0.9179 1.0722 -0.0506 0.0056  -0.0678 307 THR A CA    
2401 C C     . THR A 310 ? 0.8376 0.8011 0.9600 -0.0433 -0.0067 -0.0748 307 THR A C     
2402 O O     . THR A 310 ? 0.8847 0.8463 0.9858 -0.0198 -0.0182 -0.0796 307 THR A O     
2403 C CB    . THR A 310 ? 0.8744 0.9431 1.0788 -0.0476 0.0047  -0.0645 307 THR A CB    
2404 O OG1   . THR A 310 ? 0.9042 1.0148 1.1512 -0.0588 0.0180  -0.0571 307 THR A OG1   
2405 C CG2   . THR A 310 ? 0.8889 0.9487 1.0945 -0.0608 0.0016  -0.0654 307 THR A CG2   
2406 N N     . PRO A 311 ? 0.8598 0.7834 0.9674 -0.0622 -0.0043 -0.0753 308 PRO A N     
2407 C CA    . PRO A 311 ? 0.9201 0.7950 0.9846 -0.0556 -0.0154 -0.0816 308 PRO A CA    
2408 C C     . PRO A 311 ? 0.8285 0.7225 0.8967 -0.0482 -0.0254 -0.0835 308 PRO A C     
2409 O O     . PRO A 311 ? 0.8008 0.7439 0.9064 -0.0512 -0.0230 -0.0800 308 PRO A O     
2410 C CB    . PRO A 311 ? 0.8244 0.6559 0.8782 -0.0809 -0.0071 -0.0801 308 PRO A CB    
2411 C CG    . PRO A 311 ? 0.7838 0.6520 0.8821 -0.1016 0.0057  -0.0731 308 PRO A CG    
2412 C CD    . PRO A 311 ? 0.7894 0.7084 0.9178 -0.0903 0.0093  -0.0698 308 PRO A CD    
2413 N N     . PRO A 312 ? 0.8939 0.7512 0.9246 -0.0381 -0.0370 -0.0891 309 PRO A N     
2414 C CA    . PRO A 312 ? 0.9265 0.8006 0.9595 -0.0319 -0.0470 -0.0910 309 PRO A CA    
2415 C C     . PRO A 312 ? 0.8769 0.7561 0.9309 -0.0569 -0.0408 -0.0881 309 PRO A C     
2416 O O     . PRO A 312 ? 0.8543 0.6987 0.8999 -0.0770 -0.0329 -0.0869 309 PRO A O     
2417 C CB    . PRO A 312 ? 0.9740 0.7984 0.9579 -0.0180 -0.0590 -0.0971 309 PRO A CB    
2418 C CG    . PRO A 312 ? 0.9317 0.7268 0.8919 -0.0091 -0.0570 -0.0989 309 PRO A CG    
2419 C CD    . PRO A 312 ? 0.9017 0.7032 0.8863 -0.0294 -0.0421 -0.0940 309 PRO A CD    
2420 N N     . ALA A 313 ? 0.8381 0.7613 0.9196 -0.0554 -0.0443 -0.0870 310 ALA A N     
2421 C CA    . ALA A 313 ? 0.8242 0.7531 0.9241 -0.0773 -0.0401 -0.0853 310 ALA A CA    
2422 C C     . ALA A 313 ? 1.0096 0.8884 1.0711 -0.0812 -0.0477 -0.0899 310 ALA A C     
2423 O O     . ALA A 313 ? 1.0532 0.9065 1.0794 -0.0627 -0.0593 -0.0945 310 ALA A O     
2424 C CB    . ALA A 313 ? 0.8037 0.7901 0.9390 -0.0727 -0.0439 -0.0839 310 ALA A CB    
2425 N N     . SER A 314 ? 0.9507 0.8151 1.0191 -0.1054 -0.0406 -0.0885 311 SER A N     
2426 C CA    . SER A 314 ? 1.0049 0.8225 1.0384 -0.1107 -0.0469 -0.0924 311 SER A CA    
2427 C C     . SER A 314 ? 1.0114 0.8514 1.0476 -0.1035 -0.0587 -0.0955 311 SER A C     
2428 O O     . SER A 314 ? 0.9320 0.8243 1.0010 -0.0981 -0.0605 -0.0940 311 SER A O     
2429 C CB    . SER A 314 ? 0.9488 0.7389 0.9859 -0.1391 -0.0344 -0.0898 311 SER A CB    
2430 O OG    . SER A 314 ? 0.9265 0.7516 1.0000 -0.1558 -0.0289 -0.0873 311 SER A OG    
2431 N N     . SER A 315 ? 1.0678 0.8675 1.0691 -0.1036 -0.0667 -0.0995 312 SER A N     
2432 C CA    . SER A 315 ? 1.0566 0.8719 1.0528 -0.0935 -0.0801 -0.1030 312 SER A CA    
2433 C C     . SER A 315 ? 0.9065 0.7677 0.9441 -0.1082 -0.0766 -0.1012 312 SER A C     
2434 O O     . SER A 315 ? 0.9029 0.8042 0.9559 -0.0962 -0.0856 -0.1023 312 SER A O     
2435 C CB    . SER A 315 ? 1.1282 0.8898 1.0813 -0.0955 -0.0870 -0.1070 312 SER A CB    
2436 O OG    . SER A 315 ? 1.2256 0.9405 1.1415 -0.0856 -0.0880 -0.1083 312 SER A OG    
2437 N N     . ARG A 316 ? 0.8855 0.7417 0.9419 -0.1342 -0.0635 -0.0983 313 ARG A N     
2438 C CA    . ARG A 316 ? 0.8607 0.7528 0.9531 -0.1511 -0.0595 -0.0971 313 ARG A CA    
2439 C C     . ARG A 316 ? 0.9088 0.8275 1.0417 -0.1675 -0.0430 -0.0911 313 ARG A C     
2440 O O     . ARG A 316 ? 0.9523 0.8580 1.0959 -0.1914 -0.0316 -0.0890 313 ARG A O     
2441 C CB    . ARG A 316 ? 0.9124 0.7696 0.9855 -0.1680 -0.0605 -0.1001 313 ARG A CB    
2442 C CG    . ARG A 316 ? 0.9180 0.7488 0.9507 -0.1517 -0.0767 -0.1055 313 ARG A CG    
2443 C CD    . ARG A 316 ? 1.0284 0.8262 1.0422 -0.1682 -0.0778 -0.1084 313 ARG A CD    
2444 N NE    . ARG A 316 ? 1.0609 0.8330 1.0348 -0.1516 -0.0933 -0.1132 313 ARG A NE    
2445 C CZ    . ARG A 316 ? 0.9982 0.7361 0.9462 -0.1605 -0.0972 -0.1164 313 ARG A CZ    
2446 N NH1   . ARG A 316 ? 0.9870 0.7117 0.9447 -0.1862 -0.0866 -0.1155 313 ARG A NH1   
2447 N NH2   . ARG A 316 ? 1.0542 0.7712 0.9666 -0.1436 -0.1114 -0.1202 313 ARG A NH2   
2448 N N     . SER A 317 ? 0.8827 0.8396 1.0384 -0.1542 -0.0415 -0.0882 314 SER A N     
2449 C CA    . SER A 317 ? 0.8289 0.8181 1.0254 -0.1666 -0.0267 -0.0820 314 SER A CA    
2450 C C     . SER A 317 ? 0.7804 0.8302 1.0210 -0.1678 -0.0268 -0.0802 314 SER A C     
2451 O O     . SER A 317 ? 0.7650 0.8383 1.0053 -0.1524 -0.0395 -0.0833 314 SER A O     
2452 C CB    . SER A 317 ? 0.7590 0.7504 0.9524 -0.1519 -0.0237 -0.0795 314 SER A CB    
2453 O OG    . SER A 317 ? 0.8583 0.8686 1.0421 -0.1248 -0.0368 -0.0823 314 SER A OG    
2454 N N     . TRP A 318 ? 0.7424 0.8172 1.0216 -0.1865 -0.0122 -0.0748 315 TRP A N     
2455 C CA    . TRP A 318 ? 0.7133 0.8460 1.0384 -0.1901 -0.0097 -0.0722 315 TRP A CA    
2456 C C     . TRP A 318 ? 0.8316 1.0009 1.1904 -0.1875 0.0013  -0.0656 315 TRP A C     
2457 O O     . TRP A 318 ? 0.8774 1.0261 1.2324 -0.1944 0.0119  -0.0620 315 TRP A O     
2458 C CB    . TRP A 318 ? 0.6893 0.8221 1.0339 -0.2168 -0.0018 -0.0718 315 TRP A CB    
2459 C CG    . TRP A 318 ? 0.6800 0.8038 1.0434 -0.2390 0.0167  -0.0660 315 TRP A CG    
2460 C CD1   . TRP A 318 ? 0.7552 0.8293 1.0930 -0.2496 0.0239  -0.0652 315 TRP A CD1   
2461 C CD2   . TRP A 318 ? 0.5959 0.7616 1.0081 -0.2534 0.0306  -0.0598 315 TRP A CD2   
2462 N NE1   . TRP A 318 ? 0.6751 0.7582 1.0427 -0.2694 0.0413  -0.0588 315 TRP A NE1   
2463 C CE2   . TRP A 318 ? 0.5851 0.7238 0.9984 -0.2720 0.0458  -0.0553 315 TRP A CE2   
2464 C CE3   . TRP A 318 ? 0.6995 0.9230 1.1549 -0.2522 0.0319  -0.0573 315 TRP A CE3   
2465 C CZ2   . TRP A 318 ? 0.5919 0.7593 1.0475 -0.2890 0.0622  -0.0484 315 TRP A CZ2   
2466 C CZ3   . TRP A 318 ? 0.6487 0.9004 1.1463 -0.2692 0.0483  -0.0506 315 TRP A CZ3   
2467 C CH2   . TRP A 318 ? 0.5897 0.8132 1.0869 -0.2873 0.0633  -0.0461 315 TRP A CH2   
2468 N N     . SER A 319 ? 0.8802 1.0864 1.0345 -0.2061 0.0393  0.0042  316 SER A N     
2469 C CA    . SER A 319 ? 0.9913 1.1887 1.1319 -0.2046 0.0482  0.0105  316 SER A CA    
2470 C C     . SER A 319 ? 0.9133 1.0991 1.0511 -0.2172 0.0568  0.0145  316 SER A C     
2471 O O     . SER A 319 ? 0.8918 1.0883 1.0442 -0.2286 0.0581  0.0118  316 SER A O     
2472 C CB    . SER A 319 ? 1.0000 1.2170 1.1462 -0.2002 0.0522  0.0102  316 SER A CB    
2473 O OG    . SER A 319 ? 0.9195 1.1370 1.0579 -0.1876 0.0470  0.0088  316 SER A OG    
2474 N N     . PRO A 320 ? 0.9321 1.0961 1.0509 -0.2156 0.0628  0.0211  317 PRO A N     
2475 C CA    . PRO A 320 ? 0.9208 1.0667 1.0332 -0.2275 0.0706  0.0251  317 PRO A CA    
2476 C C     . PRO A 320 ? 0.9385 1.0959 1.0585 -0.2381 0.0810  0.0274  317 PRO A C     
2477 O O     . PRO A 320 ? 0.8962 1.0682 1.0180 -0.2333 0.0851  0.0290  317 PRO A O     
2478 C CB    . PRO A 320 ? 0.9546 1.0741 1.0424 -0.2190 0.0737  0.0321  317 PRO A CB    
2479 C CG    . PRO A 320 ? 0.9929 1.1240 1.0762 -0.2058 0.0719  0.0331  317 PRO A CG    
2480 C CD    . PRO A 320 ? 0.9800 1.1345 1.0811 -0.2025 0.0626  0.0253  317 PRO A CD    
2481 N N     . VAL A 321 ? 0.8908 1.0409 1.0148 -0.2532 0.0856  0.0273  318 VAL A N     
2482 C CA    . VAL A 321 ? 0.8842 1.0454 1.0171 -0.2665 0.0958  0.0292  318 VAL A CA    
2483 C C     . VAL A 321 ? 0.9077 1.0390 1.0241 -0.2768 0.1053  0.0350  318 VAL A C     
2484 O O     . VAL A 321 ? 0.9461 1.0536 1.0524 -0.2786 0.1022  0.0345  318 VAL A O     
2485 C CB    . VAL A 321 ? 0.8174 1.0053 0.9757 -0.2775 0.0916  0.0219  318 VAL A CB    
2486 C CG1   . VAL A 321 ? 0.8177 1.0142 0.9848 -0.2948 0.1021  0.0237  318 VAL A CG1   
2487 C CG2   . VAL A 321 ? 0.7665 0.9843 0.9399 -0.2668 0.0850  0.0175  318 VAL A CG2   
2488 N N     . VAL A 322 ? 0.8895 1.0207 1.0019 -0.2828 0.1173  0.0409  319 VAL A N     
2489 C CA    . VAL A 322 ? 0.8756 0.9769 0.9711 -0.2930 0.1280  0.0473  319 VAL A CA    
2490 C C     . VAL A 322 ? 0.9229 1.0190 1.0275 -0.3113 0.1274  0.0423  319 VAL A C     
2491 O O     . VAL A 322 ? 0.9411 1.0647 1.0685 -0.3224 0.1258  0.0366  319 VAL A O     
2492 C CB    . VAL A 322 ? 0.8313 0.9376 0.9235 -0.2973 0.1414  0.0542  319 VAL A CB    
2493 C CG1   . VAL A 322 ? 0.8081 0.8808 0.8812 -0.3082 0.1532  0.0613  319 VAL A CG1   
2494 C CG2   . VAL A 322 ? 0.7803 0.8917 0.8621 -0.2789 0.1413  0.0584  319 VAL A CG2   
2495 N N     . GLY A 323 ? 0.8959 0.9567 0.9821 -0.3141 0.1288  0.0443  320 GLY A N     
2496 C CA    . GLY A 323 ? 0.8866 0.9371 0.9773 -0.3313 0.1283  0.0392  320 GLY A CA    
2497 C C     . GLY A 323 ? 0.9296 0.9842 1.0281 -0.3275 0.1147  0.0310  320 GLY A C     
2498 O O     . GLY A 323 ? 0.9039 0.9447 1.0018 -0.3401 0.1135  0.0266  320 GLY A O     
2499 N N     . GLN A 324 ? 0.8884 0.9606 0.9933 -0.3110 0.1047  0.0286  321 GLN A N     
2500 C CA    . GLN A 324 ? 0.8599 0.9368 0.9719 -0.3064 0.0919  0.0212  321 GLN A CA    
2501 C C     . GLN A 324 ? 0.9110 0.9507 1.0009 -0.3017 0.0906  0.0229  321 GLN A C     
2502 O O     . GLN A 324 ? 0.9939 1.0076 1.0621 -0.2945 0.0971  0.0305  321 GLN A O     
2503 C CB    . GLN A 324 ? 0.8285 0.9294 0.9495 -0.2894 0.0830  0.0194  321 GLN A CB    
2504 C CG    . GLN A 324 ? 0.8785 0.9888 1.0093 -0.2845 0.0701  0.0119  321 GLN A CG    
2505 C CD    . GLN A 324 ? 0.9627 1.0948 1.1013 -0.2688 0.0625  0.0104  321 GLN A CD    
2506 O OE1   . GLN A 324 ? 0.8728 1.0086 1.0057 -0.2598 0.0663  0.0150  321 GLN A OE1   
2507 N NE2   . GLN A 324 ? 1.1025 1.2483 1.2531 -0.2658 0.0520  0.0038  321 GLN A NE2   
2508 N N     . LEU A 325 ? 0.8455 0.8832 0.9405 -0.3053 0.0823  0.0159  322 LEU A N     
2509 C CA    . LEU A 325 ? 0.7785 0.7846 0.8544 -0.2986 0.0795  0.0164  322 LEU A CA    
2510 C C     . LEU A 325 ? 0.7294 0.7437 0.8043 -0.2786 0.0700  0.0164  322 LEU A C     
2511 O O     . LEU A 325 ? 0.8348 0.8762 0.9275 -0.2753 0.0607  0.0106  322 LEU A O     
2512 C CB    . LEU A 325 ? 0.9072 0.9066 0.9876 -0.3119 0.0752  0.0086  322 LEU A CB    
2513 C CG    . LEU A 325 ? 0.9140 0.8966 0.9902 -0.3331 0.0847  0.0081  322 LEU A CG    
2514 C CD1   . LEU A 325 ? 0.9004 0.8705 0.9756 -0.3435 0.0796  0.0002  322 LEU A CD1   
2515 C CD2   . LEU A 325 ? 0.8953 0.8416 0.9458 -0.3315 0.0969  0.0174  322 LEU A CD2   
2516 N N     . VAL A 326 ? 0.7696 0.7612 0.8235 -0.2652 0.0725  0.0231  323 VAL A N     
2517 C CA    . VAL A 326 ? 0.7234 0.7205 0.7741 -0.2466 0.0642  0.0237  323 VAL A CA    
2518 C C     . VAL A 326 ? 0.7437 0.7079 0.7721 -0.2386 0.0647  0.0271  323 VAL A C     
2519 O O     . VAL A 326 ? 0.7738 0.7091 0.7871 -0.2460 0.0726  0.0299  323 VAL A O     
2520 C CB    . VAL A 326 ? 0.7961 0.8065 0.8448 -0.2353 0.0662  0.0292  323 VAL A CB    
2521 C CG1   . VAL A 326 ? 0.6953 0.7384 0.7657 -0.2416 0.0657  0.0256  323 VAL A CG1   
2522 C CG2   . VAL A 326 ? 0.7456 0.7311 0.7729 -0.2340 0.0776  0.0385  323 VAL A CG2   
2523 N N     . GLN A 327 ? 0.7283 0.6967 0.7542 -0.2233 0.0566  0.0269  324 GLN A N     
2524 C CA    . GLN A 327 ? 0.7451 0.6862 0.7511 -0.2132 0.0564  0.0301  324 GLN A CA    
2525 C C     . GLN A 327 ? 0.7931 0.7403 0.7911 -0.1943 0.0531  0.0354  324 GLN A C     
2526 O O     . GLN A 327 ? 0.7274 0.7015 0.7392 -0.1885 0.0454  0.0323  324 GLN A O     
2527 C CB    . GLN A 327 ? 0.7366 0.6763 0.7484 -0.2153 0.0485  0.0227  324 GLN A CB    
2528 C CG    . GLN A 327 ? 0.7491 0.6804 0.7659 -0.2340 0.0512  0.0170  324 GLN A CG    
2529 C CD    . GLN A 327 ? 0.8407 0.7735 0.8637 -0.2357 0.0426  0.0092  324 GLN A CD    
2530 O OE1   . GLN A 327 ? 0.9658 0.9182 1.0069 -0.2467 0.0379  0.0020  324 GLN A OE1   
2531 N NE2   . GLN A 327 ? 0.8709 0.7839 0.8785 -0.2242 0.0407  0.0108  324 GLN A NE2   
2532 N N     . GLU A 328 ? 0.8065 0.7283 0.7817 -0.1849 0.0590  0.0433  325 GLU A N     
2533 C CA    . GLU A 328 ? 0.7926 0.7198 0.7585 -0.1668 0.0562  0.0489  325 GLU A CA    
2534 C C     . GLU A 328 ? 0.8587 0.7846 0.8221 -0.1556 0.0481  0.0469  325 GLU A C     
2535 O O     . GLU A 328 ? 0.8742 0.7787 0.8298 -0.1576 0.0491  0.0454  325 GLU A O     
2536 C CB    . GLU A 328 ? 0.8337 0.7361 0.7755 -0.1604 0.0664  0.0592  325 GLU A CB    
2537 C CG    . GLU A 328 ? 0.9154 0.8280 0.8483 -0.1426 0.0638  0.0653  325 GLU A CG    
2538 C CD    . GLU A 328 ? 0.9983 0.8848 0.9054 -0.1344 0.0737  0.0761  325 GLU A CD    
2539 O OE1   . GLU A 328 ? 1.0192 0.8781 0.9150 -0.1434 0.0834  0.0790  325 GLU A OE1   
2540 O OE2   . GLU A 328 ? 0.9320 0.8256 0.8294 -0.1192 0.0718  0.0817  325 GLU A OE2   
2541 N N     . ARG A 329 ? 0.9385 0.8873 0.9082 -0.1441 0.0403  0.0465  326 ARG A N     
2542 C CA    . ARG A 329 ? 0.8117 0.7624 0.7794 -0.1326 0.0329  0.0453  326 ARG A CA    
2543 C C     . ARG A 329 ? 0.8755 0.8000 0.8190 -0.1200 0.0381  0.0535  326 ARG A C     
2544 O O     . ARG A 329 ? 0.9603 0.8764 0.8895 -0.1137 0.0443  0.0612  326 ARG A O     
2545 C CB    . ARG A 329 ? 0.7412 0.7224 0.7202 -0.1242 0.0243  0.0435  326 ARG A CB    
2546 C CG    . ARG A 329 ? 0.8937 0.8814 0.8733 -0.1133 0.0164  0.0421  326 ARG A CG    
2547 C CD    . ARG A 329 ? 1.0018 1.0178 0.9899 -0.1057 0.0091  0.0411  326 ARG A CD    
2548 N NE    . ARG A 329 ? 1.0033 1.0394 1.0084 -0.1153 0.0067  0.0355  326 ARG A NE    
2549 C CZ    . ARG A 329 ? 1.0518 1.1018 1.0743 -0.1221 0.0007  0.0279  326 ARG A CZ    
2550 N NH1   . ARG A 329 ? 0.9079 0.9543 0.9332 -0.1210 -0.0036 0.0249  326 ARG A NH1   
2551 N NH2   . ARG A 329 ? 0.9904 1.0575 1.0267 -0.1292 -0.0006 0.0236  326 ARG A NH2   
2552 N N     . VAL A 330 ? 0.7521 0.6636 0.6902 -0.1155 0.0358  0.0520  327 VAL A N     
2553 C CA    . VAL A 330 ? 0.7794 0.6665 0.6943 -0.1015 0.0404  0.0596  327 VAL A CA    
2554 C C     . VAL A 330 ? 0.7679 0.6753 0.6810 -0.0843 0.0349  0.0641  327 VAL A C     
2555 O O     . VAL A 330 ? 0.9283 0.8629 0.8572 -0.0821 0.0256  0.0592  327 VAL A O     
2556 C CB    . VAL A 330 ? 0.7892 0.6571 0.6990 -0.1015 0.0396  0.0561  327 VAL A CB    
2557 C CG1   . VAL A 330 ? 0.8344 0.6799 0.7205 -0.0840 0.0438  0.0641  327 VAL A CG1   
2558 C CG2   . VAL A 330 ? 0.8550 0.7006 0.7637 -0.1193 0.0457  0.0518  327 VAL A CG2   
2559 N N     . ALA A 331 ? 0.9171 0.8116 0.8105 -0.0725 0.0408  0.0736  328 ALA A N     
2560 C CA    . ALA A 331 ? 1.0564 0.9721 0.9471 -0.0570 0.0361  0.0784  328 ALA A CA    
2561 C C     . ALA A 331 ? 1.1013 1.0298 0.9956 -0.0452 0.0283  0.0769  328 ALA A C     
2562 O O     . ALA A 331 ? 1.1165 1.0753 1.0278 -0.0453 0.0192  0.0718  328 ALA A O     
2563 C CB    . ALA A 331 ? 1.0871 0.9831 0.9533 -0.0456 0.0447  0.0895  328 ALA A CB    
2564 N N     . ARG A 332 ? 1.0569 0.9620 0.9346 -0.0350 0.0321  0.0813  329 ARG A N     
2565 C CA    . ARG A 332 ? 1.0913 1.0071 0.9701 -0.0220 0.0260  0.0811  329 ARG A CA    
2566 C C     . ARG A 332 ? 1.0012 0.8926 0.8764 -0.0263 0.0284  0.0771  329 ARG A C     
2567 O O     . ARG A 332 ? 0.9756 0.8403 0.8308 -0.0156 0.0344  0.0826  329 ARG A O     
2568 C CB    . ARG A 332 ? 1.2161 1.1312 1.0766 -0.0013 0.0279  0.0914  329 ARG A CB    
2569 C CG    . ARG A 332 ? 1.2421 1.1935 1.1123 0.0040  0.0207  0.0923  329 ARG A CG    
2570 C CD    . ARG A 332 ? 1.3618 1.3102 1.2128 0.0185  0.0249  0.1028  329 ARG A CD    
2571 N NE    . ARG A 332 ? 1.5090 1.4944 1.3707 0.0217  0.0168  0.1019  329 ARG A NE    
2572 C CZ    . ARG A 332 ? 1.4860 1.4778 1.3373 0.0284  0.0185  0.1082  329 ARG A CZ    
2573 N NH1   . ARG A 332 ? 1.4353 1.3985 1.2650 0.0333  0.0285  0.1166  329 ARG A NH1   
2574 N NH2   . ARG A 332 ? 1.4024 1.4284 1.2639 0.0300  0.0103  0.1059  329 ARG A NH2   
2575 N N     . PRO A 333 ? 0.9192 0.8188 0.8126 -0.0413 0.0239  0.0676  330 PRO A N     
2576 C CA    . PRO A 333 ? 0.8528 0.7286 0.7426 -0.0479 0.0263  0.0628  330 PRO A CA    
2577 C C     . PRO A 333 ? 0.8461 0.7213 0.7303 -0.0335 0.0234  0.0636  330 PRO A C     
2578 O O     . PRO A 333 ? 0.8048 0.7095 0.7014 -0.0265 0.0154  0.0624  330 PRO A O     
2579 C CB    . PRO A 333 ? 0.8228 0.7165 0.7359 -0.0656 0.0204  0.0528  330 PRO A CB    
2580 C CG    . PRO A 333 ? 0.7976 0.7286 0.7274 -0.0623 0.0124  0.0519  330 PRO A CG    
2581 C CD    . PRO A 333 ? 0.8414 0.7732 0.7588 -0.0517 0.0161  0.0607  330 PRO A CD    
2582 N N     . ALA A 334 ? 0.8395 0.6804 0.7045 -0.0295 0.0302  0.0656  331 ALA A N     
2583 C CA    . ALA A 334 ? 0.8287 0.6659 0.6865 -0.0155 0.0287  0.0663  331 ALA A CA    
2584 C C     . ALA A 334 ? 0.8858 0.7397 0.7624 -0.0242 0.0208  0.0566  331 ALA A C     
2585 O O     . ALA A 334 ? 0.8889 0.7535 0.7822 -0.0410 0.0172  0.0493  331 ALA A O     
2586 C CB    . ALA A 334 ? 0.8742 0.6666 0.7049 -0.0099 0.0388  0.0701  331 ALA A CB    
2587 N N     . SER A 335 ? 0.8671 0.7242 0.7406 -0.0116 0.0185  0.0569  332 SER A N     
2588 C CA    . SER A 335 ? 0.8030 0.6733 0.6914 -0.0180 0.0119  0.0485  332 SER A CA    
2589 C C     . SER A 335 ? 0.8630 0.7044 0.7457 -0.0322 0.0154  0.0416  332 SER A C     
2590 O O     . SER A 335 ? 0.9660 0.7713 0.8270 -0.0301 0.0237  0.0441  332 SER A O     
2591 C CB    . SER A 335 ? 0.9523 0.8306 0.8363 -0.0003 0.0099  0.0511  332 SER A CB    
2592 O OG    . SER A 335 ? 1.1771 1.0675 1.0744 -0.0061 0.0040  0.0434  332 SER A OG    
2593 N N     . LEU A 336 ? 0.7868 0.6443 0.6886 -0.0469 0.0091  0.0329  333 LEU A N     
2594 C CA    . LEU A 336 ? 0.8442 0.6811 0.7444 -0.0621 0.0105  0.0251  333 LEU A CA    
2595 C C     . LEU A 336 ? 0.8705 0.6820 0.7608 -0.0739 0.0181  0.0260  333 LEU A C     
2596 O O     . LEU A 336 ? 0.9996 0.7815 0.8776 -0.0824 0.0228  0.0222  333 LEU A O     
2597 C CB    . LEU A 336 ? 0.8016 0.6156 0.6862 -0.0545 0.0128  0.0232  333 LEU A CB    
2598 C CG    . LEU A 336 ? 0.7809 0.6183 0.6746 -0.0437 0.0061  0.0219  333 LEU A CG    
2599 C CD1   . LEU A 336 ? 0.8033 0.6158 0.6814 -0.0391 0.0087  0.0186  333 LEU A CD1   
2600 C CD2   . LEU A 336 ? 0.7428 0.6142 0.6628 -0.0549 -0.0031 0.0156  333 LEU A CD2   
2601 N N     . ARG A 337 ? 0.7974 0.6201 0.6923 -0.0750 0.0194  0.0309  334 ARG A N     
2602 C CA    . ARG A 337 ? 0.8305 0.6328 0.7177 -0.0867 0.0269  0.0323  334 ARG A CA    
2603 C C     . ARG A 337 ? 0.7899 0.6195 0.6996 -0.1009 0.0227  0.0287  334 ARG A C     
2604 O O     . ARG A 337 ? 0.8677 0.7302 0.7944 -0.0972 0.0153  0.0281  334 ARG A O     
2605 C CB    . ARG A 337 ? 0.8432 0.6281 0.7103 -0.0735 0.0348  0.0431  334 ARG A CB    
2606 C CG    . ARG A 337 ? 0.8788 0.6296 0.7197 -0.0597 0.0414  0.0475  334 ARG A CG    
2607 C CD    . ARG A 337 ? 0.9079 0.6218 0.7358 -0.0729 0.0474  0.0420  334 ARG A CD    
2608 N NE    . ARG A 337 ? 1.1084 0.7857 0.9085 -0.0592 0.0549  0.0464  334 ARG A NE    
2609 C CZ    . ARG A 337 ? 1.1515 0.7949 0.9368 -0.0663 0.0594  0.0411  334 ARG A CZ    
2610 N NH1   . ARG A 337 ? 1.1555 0.7996 0.9523 -0.0874 0.0566  0.0312  334 ARG A NH1   
2611 N NH2   . ARG A 337 ? 1.1483 0.7576 0.9069 -0.0519 0.0667  0.0456  334 ARG A NH2   
2612 N N     . PRO A 338 ? 0.8016 0.6183 0.7114 -0.1175 0.0274  0.0260  335 PRO A N     
2613 C CA    . PRO A 338 ? 0.8321 0.6754 0.7636 -0.1307 0.0238  0.0223  335 PRO A CA    
2614 C C     . PRO A 338 ? 0.9455 0.8093 0.8818 -0.1226 0.0234  0.0288  335 PRO A C     
2615 O O     . PRO A 338 ? 0.8533 0.7038 0.7730 -0.1113 0.0290  0.0371  335 PRO A O     
2616 C CB    . PRO A 338 ? 0.7999 0.6205 0.7256 -0.1480 0.0313  0.0203  335 PRO A CB    
2617 C CG    . PRO A 338 ? 0.8659 0.6518 0.7722 -0.1477 0.0355  0.0186  335 PRO A CG    
2618 C CD    . PRO A 338 ? 0.8473 0.6249 0.7382 -0.1259 0.0361  0.0253  335 PRO A CD    
2619 N N     . ARG A 339 ? 0.9379 0.8337 0.8960 -0.1283 0.0168  0.0248  336 ARG A N     
2620 C CA    . ARG A 339 ? 0.8116 0.7287 0.7756 -0.1226 0.0157  0.0293  336 ARG A CA    
2621 C C     . ARG A 339 ? 0.8015 0.7162 0.7667 -0.1336 0.0221  0.0310  336 ARG A C     
2622 O O     . ARG A 339 ? 0.8881 0.8173 0.8553 -0.1290 0.0224  0.0351  336 ARG A O     
2623 C CB    . ARG A 339 ? 0.6801 0.6318 0.6655 -0.1221 0.0058  0.0241  336 ARG A CB    
2624 C CG    . ARG A 339 ? 0.6696 0.6283 0.6561 -0.1115 -0.0007 0.0226  336 ARG A CG    
2625 C CD    . ARG A 339 ? 0.9488 0.9097 0.9240 -0.0945 -0.0004 0.0301  336 ARG A CD    
2626 N NE    . ARG A 339 ? 1.0393 1.0122 1.0182 -0.0850 -0.0068 0.0286  336 ARG A NE    
2627 C CZ    . ARG A 339 ? 1.0719 1.0285 1.0373 -0.0750 -0.0049 0.0311  336 ARG A CZ    
2628 N NH1   . ARG A 339 ? 0.9757 0.9009 0.9217 -0.0731 0.0031  0.0351  336 ARG A NH1   
2629 N NH2   . ARG A 339 ? 1.2406 1.2117 1.2114 -0.0669 -0.0107 0.0298  336 ARG A NH2   
2630 N N     . TRP A 340 ? 0.8310 0.7283 0.7945 -0.1481 0.0273  0.0280  337 TRP A N     
2631 C CA    . TRP A 340 ? 0.8108 0.7085 0.7780 -0.1605 0.0334  0.0290  337 TRP A CA    
2632 C C     . TRP A 340 ? 0.8316 0.6929 0.7792 -0.1671 0.0441  0.0325  337 TRP A C     
2633 O O     . TRP A 340 ? 0.8635 0.7015 0.8008 -0.1693 0.0455  0.0300  337 TRP A O     
2634 C CB    . TRP A 340 ? 0.7686 0.6893 0.7591 -0.1755 0.0287  0.0205  337 TRP A CB    
2635 C CG    . TRP A 340 ? 0.7824 0.7364 0.7909 -0.1698 0.0194  0.0174  337 TRP A CG    
2636 C CD1   . TRP A 340 ? 0.7055 0.6725 0.7235 -0.1660 0.0106  0.0121  337 TRP A CD1   
2637 C CD2   . TRP A 340 ? 0.8633 0.8403 0.8812 -0.1672 0.0185  0.0193  337 TRP A CD2   
2638 N NE1   . TRP A 340 ? 0.6588 0.6545 0.6915 -0.1617 0.0045  0.0107  337 TRP A NE1   
2639 C CE2   . TRP A 340 ? 0.7487 0.7507 0.7813 -0.1623 0.0090  0.0148  337 TRP A CE2   
2640 C CE3   . TRP A 340 ? 0.8737 0.8516 0.8879 -0.1686 0.0251  0.0244  337 TRP A CE3   
2641 C CZ2   . TRP A 340 ? 0.7090 0.7352 0.7520 -0.1591 0.0060  0.0147  337 TRP A CZ2   
2642 C CZ3   . TRP A 340 ? 0.8004 0.8036 0.8252 -0.1648 0.0218  0.0243  337 TRP A CZ3   
2643 C CH2   . TRP A 340 ? 0.7715 0.7979 0.8103 -0.1603 0.0124  0.0192  337 TRP A CH2   
2644 N N     . HIS A 341 ? 0.8194 0.6748 0.7608 -0.1705 0.0521  0.0383  338 HIS A N     
2645 C CA    . HIS A 341 ? 0.9115 0.7321 0.8344 -0.1784 0.0635  0.0422  338 HIS A CA    
2646 C C     . HIS A 341 ? 0.8386 0.6592 0.7733 -0.2007 0.0654  0.0348  338 HIS A C     
2647 O O     . HIS A 341 ? 0.8100 0.6604 0.7680 -0.2090 0.0585  0.0278  338 HIS A O     
2648 C CB    . HIS A 341 ? 0.8513 0.6661 0.7624 -0.1734 0.0718  0.0517  338 HIS A CB    
2649 C CG    . HIS A 341 ? 0.8613 0.6672 0.7541 -0.1520 0.0724  0.0603  338 HIS A CG    
2650 N ND1   . HIS A 341 ? 0.8951 0.6691 0.7656 -0.1423 0.0763  0.0642  338 HIS A ND1   
2651 C CD2   . HIS A 341 ? 0.8897 0.7150 0.7827 -0.1382 0.0696  0.0656  338 HIS A CD2   
2652 C CE1   . HIS A 341 ? 0.9228 0.6990 0.7816 -0.1229 0.0757  0.0720  338 HIS A CE1   
2653 N NE2   . HIS A 341 ? 0.9073 0.7148 0.7795 -0.1206 0.0714  0.0728  338 HIS A NE2   
2654 N N     . LYS A 342 ? 0.8941 0.6806 0.8120 -0.2105 0.0751  0.0365  339 LYS A N     
2655 C CA    . LYS A 342 ? 0.9670 0.7523 0.8944 -0.2332 0.0786  0.0304  339 LYS A CA    
2656 C C     . LYS A 342 ? 0.9522 0.7665 0.8975 -0.2411 0.0800  0.0315  339 LYS A C     
2657 O O     . LYS A 342 ? 0.9468 0.7688 0.8887 -0.2302 0.0824  0.0388  339 LYS A O     
2658 C CB    . LYS A 342 ? 1.1997 0.9405 1.1028 -0.2419 0.0905  0.0336  339 LYS A CB    
2659 C CG    . LYS A 342 ? 1.4785 1.1883 1.3640 -0.2377 0.0898  0.0307  339 LYS A CG    
2660 C CD    . LYS A 342 ? 1.6604 1.3232 1.5200 -0.2469 0.1027  0.0339  339 LYS A CD    
2661 C CE    . LYS A 342 ? 1.6904 1.3207 1.5314 -0.2429 0.1023  0.0302  339 LYS A CE    
2662 N NZ    . LYS A 342 ? 1.7219 1.3030 1.5358 -0.2525 0.1154  0.0328  339 LYS A NZ    
2663 N N     . PRO A 343 ? 0.9963 0.8285 0.9609 -0.2595 0.0785  0.0242  340 PRO A N     
2664 C CA    . PRO A 343 ? 0.9474 0.8108 0.9309 -0.2659 0.0795  0.0247  340 PRO A CA    
2665 C C     . PRO A 343 ? 0.9494 0.7970 0.9192 -0.2680 0.0920  0.0338  340 PRO A C     
2666 O O     . PRO A 343 ? 0.9199 0.7317 0.8690 -0.2732 0.1016  0.0378  340 PRO A O     
2667 C CB    . PRO A 343 ? 0.8822 0.7612 0.8850 -0.2864 0.0769  0.0154  340 PRO A CB    
2668 C CG    . PRO A 343 ? 0.8275 0.6968 0.8278 -0.2853 0.0693  0.0086  340 PRO A CG    
2669 C CD    . PRO A 343 ? 0.8562 0.6859 0.8280 -0.2737 0.0743  0.0145  340 PRO A CD    
2670 N N     . SER A 344 ? 0.9199 0.7938 0.9006 -0.2636 0.0922  0.0370  341 SER A N     
2671 C CA    . SER A 344 ? 0.9259 0.7908 0.8959 -0.2645 0.1036  0.0457  341 SER A CA    
2672 C C     . SER A 344 ? 0.9032 0.8010 0.8957 -0.2763 0.1050  0.0431  341 SER A C     
2673 O O     . SER A 344 ? 0.9468 0.8766 0.9624 -0.2784 0.0960  0.0358  341 SER A O     
2674 C CB    . SER A 344 ? 0.9493 0.8114 0.9047 -0.2429 0.1034  0.0540  341 SER A CB    
2675 O OG    . SER A 344 ? 1.0696 0.9056 1.0058 -0.2302 0.1015  0.0564  341 SER A OG    
2676 N N     . THR A 345 ? 0.9119 0.8011 0.8969 -0.2831 0.1168  0.0497  342 THR A N     
2677 C CA    . THR A 345 ? 0.9053 0.8244 0.9096 -0.2935 0.1202  0.0487  342 THR A CA    
2678 C C     . THR A 345 ? 0.9716 0.9049 0.9729 -0.2788 0.1218  0.0553  342 THR A C     
2679 O O     . THR A 345 ? 1.0445 0.9551 1.0232 -0.2679 0.1277  0.0639  342 THR A O     
2680 C CB    . THR A 345 ? 0.9373 0.8401 0.9373 -0.3139 0.1330  0.0510  342 THR A CB    
2681 O OG1   . THR A 345 ? 0.9365 0.8171 0.9321 -0.3265 0.1324  0.0456  342 THR A OG1   
2682 C CG2   . THR A 345 ? 0.9231 0.8628 0.9487 -0.3271 0.1347  0.0475  342 THR A CG2   
2683 N N     . VAL A 346 ? 0.9051 0.8759 0.9285 -0.2780 0.1167  0.0511  343 VAL A N     
2684 C CA    . VAL A 346 ? 0.8035 0.7898 0.8251 -0.2656 0.1183  0.0561  343 VAL A CA    
2685 C C     . VAL A 346 ? 0.8821 0.8631 0.8978 -0.2751 0.1324  0.0629  343 VAL A C     
2686 O O     . VAL A 346 ? 0.9188 0.9123 0.9495 -0.2921 0.1373  0.0600  343 VAL A O     
2687 C CB    . VAL A 346 ? 0.8005 0.8261 0.8462 -0.2616 0.1089  0.0491  343 VAL A CB    
2688 C CG1   . VAL A 346 ? 0.8242 0.8634 0.8658 -0.2487 0.1107  0.0537  343 VAL A CG1   
2689 C CG2   . VAL A 346 ? 0.7844 0.8142 0.8359 -0.2536 0.0956  0.0426  343 VAL A CG2   
2690 N N     . LEU A 347 ? 0.9152 0.8784 0.9089 -0.2642 0.1392  0.0721  344 LEU A N     
2691 C CA    . LEU A 347 ? 0.9284 0.8839 0.9133 -0.2716 0.1534  0.0798  344 LEU A CA    
2692 C C     . LEU A 347 ? 0.9792 0.9658 0.9744 -0.2660 0.1547  0.0808  344 LEU A C     
2693 O O     . LEU A 347 ? 1.0245 1.0267 1.0320 -0.2787 0.1623  0.0808  344 LEU A O     
2694 C CB    . LEU A 347 ? 0.9059 0.8231 0.8590 -0.2626 0.1614  0.0902  344 LEU A CB    
2695 C CG    . LEU A 347 ? 0.9633 0.8427 0.9013 -0.2701 0.1649  0.0911  344 LEU A CG    
2696 C CD1   . LEU A 347 ? 1.0196 0.8628 0.9250 -0.2568 0.1721  0.1021  344 LEU A CD1   
2697 C CD2   . LEU A 347 ? 0.9963 0.8701 0.9423 -0.2945 0.1744  0.0893  344 LEU A CD2   
2698 N N     . LYS A 348 ? 0.9489 0.9451 0.9391 -0.2475 0.1475  0.0814  345 LYS A N     
2699 C CA    . LYS A 348 ? 0.9289 0.9518 0.9258 -0.2407 0.1482  0.0818  345 LYS A CA    
2700 C C     . LYS A 348 ? 0.9337 0.9763 0.9387 -0.2264 0.1343  0.0755  345 LYS A C     
2701 O O     . LYS A 348 ? 0.8860 0.9166 0.8833 -0.2175 0.1260  0.0743  345 LYS A O     
2702 C CB    . LYS A 348 ? 0.9273 0.9348 0.9002 -0.2325 0.1585  0.0925  345 LYS A CB    
2703 C CG    . LYS A 348 ? 0.9748 1.0078 0.9533 -0.2285 0.1624  0.0935  345 LYS A CG    
2704 C CD    . LYS A 348 ? 1.1868 1.2025 1.1390 -0.2196 0.1723  0.1043  345 LYS A CD    
2705 C CE    . LYS A 348 ? 1.2098 1.2497 1.1658 -0.2156 0.1768  0.1052  345 LYS A CE    
2706 N NZ    . LYS A 348 ? 1.2469 1.2982 1.2165 -0.2321 0.1883  0.1060  345 LYS A NZ    
2707 N N     . VAL A 349 ? 0.9486 1.0211 0.9689 -0.2245 0.1322  0.0714  346 VAL A N     
2708 C CA    . VAL A 349 ? 0.8599 0.9517 0.8878 -0.2121 0.1203  0.0652  346 VAL A CA    
2709 C C     . VAL A 349 ? 0.9547 1.0512 0.9688 -0.1995 0.1232  0.0697  346 VAL A C     
2710 O O     . VAL A 349 ? 1.0275 1.1414 1.0480 -0.2013 0.1291  0.0698  346 VAL A O     
2711 C CB    . VAL A 349 ? 0.7183 0.8393 0.7734 -0.2187 0.1151  0.0564  346 VAL A CB    
2712 C CG1   . VAL A 349 ? 0.6932 0.8313 0.7537 -0.2057 0.1040  0.0505  346 VAL A CG1   
2713 C CG2   . VAL A 349 ? 0.7143 0.8312 0.7819 -0.2310 0.1114  0.0517  346 VAL A CG2   
2714 N N     . LEU A 350 ? 0.9160 0.9980 0.9108 -0.1863 0.1191  0.0733  347 LEU A N     
2715 C CA    . LEU A 350 ? 0.8952 0.9807 0.8745 -0.1741 0.1213  0.0775  347 LEU A CA    
2716 C C     . LEU A 350 ? 0.9492 1.0610 0.9403 -0.1673 0.1131  0.0697  347 LEU A C     
2717 O O     . LEU A 350 ? 1.0141 1.1373 1.0012 -0.1630 0.1175  0.0707  347 LEU A O     
2718 C CB    . LEU A 350 ? 0.8153 0.8797 0.7711 -0.1619 0.1186  0.0835  347 LEU A CB    
2719 C CG    . LEU A 350 ? 0.8104 0.8445 0.7528 -0.1665 0.1252  0.0906  347 LEU A CG    
2720 C CD1   . LEU A 350 ? 0.8363 0.8529 0.7553 -0.1514 0.1220  0.0967  347 LEU A CD1   
2721 C CD2   . LEU A 350 ? 0.8294 0.8532 0.7656 -0.1765 0.1402  0.0976  347 LEU A CD2   
2722 N N     . ASN A 351 ? 0.9479 1.0681 0.9520 -0.1661 0.1016  0.0620  348 ASN A N     
2723 C CA    . ASN A 351 ? 0.8824 1.0258 0.9000 -0.1620 0.0941  0.0538  348 ASN A CA    
2724 C C     . ASN A 351 ? 0.8223 0.9711 0.8581 -0.1668 0.0849  0.0466  348 ASN A C     
2725 O O     . ASN A 351 ? 0.8725 1.0065 0.9077 -0.1717 0.0838  0.0480  348 ASN A O     
2726 C CB    . ASN A 351 ? 0.8468 0.9923 0.8497 -0.1479 0.0880  0.0534  348 ASN A CB    
2727 C CG    . ASN A 351 ? 0.9369 1.0689 0.9292 -0.1410 0.0800  0.0547  348 ASN A CG    
2728 O OD1   . ASN A 351 ? 0.9850 1.1157 0.9878 -0.1438 0.0729  0.0506  348 ASN A OD1   
2729 N ND2   . ASN A 351 ? 0.8964 1.0195 0.8676 -0.1313 0.0811  0.0606  348 ASN A ND2   
2730 N N     . PRO A 352 ? 0.8463 1.0153 0.8977 -0.1654 0.0786  0.0388  349 PRO A N     
2731 C CA    . PRO A 352 ? 0.7634 0.9381 0.8321 -0.1702 0.0706  0.0324  349 PRO A CA    
2732 C C     . PRO A 352 ? 0.8338 0.9948 0.8958 -0.1657 0.0618  0.0319  349 PRO A C     
2733 O O     . PRO A 352 ? 0.9391 1.1021 1.0132 -0.1695 0.0554  0.0272  349 PRO A O     
2734 C CB    . PRO A 352 ? 0.6619 0.8580 0.7428 -0.1658 0.0659  0.0253  349 PRO A CB    
2735 C CG    . PRO A 352 ? 0.6704 0.8742 0.7459 -0.1637 0.0747  0.0280  349 PRO A CG    
2736 C CD    . PRO A 352 ? 0.7284 0.9148 0.7819 -0.1598 0.0796  0.0357  349 PRO A CD    
2737 N N     . ARG A 353 ? 0.7633 0.9114 0.8059 -0.1572 0.0617  0.0368  350 ARG A N     
2738 C CA    . ARG A 353 ? 0.6468 0.7840 0.6821 -0.1512 0.0538  0.0370  350 ARG A CA    
2739 C C     . ARG A 353 ? 0.6870 0.8008 0.7046 -0.1499 0.0590  0.0452  350 ARG A C     
2740 O O     . ARG A 353 ? 0.6889 0.7929 0.6995 -0.1441 0.0534  0.0462  350 ARG A O     
2741 C CB    . ARG A 353 ? 0.6684 0.8145 0.6967 -0.1399 0.0464  0.0345  350 ARG A CB    
2742 C CG    . ARG A 353 ? 0.6063 0.7716 0.6495 -0.1399 0.0406  0.0261  350 ARG A CG    
2743 C CD    . ARG A 353 ? 0.6377 0.8049 0.6907 -0.1397 0.0306  0.0208  350 ARG A CD    
2744 N NE    . ARG A 353 ? 0.6417 0.8021 0.6822 -0.1316 0.0248  0.0228  350 ARG A NE    
2745 C CZ    . ARG A 353 ? 0.6296 0.7872 0.6741 -0.1306 0.0175  0.0207  350 ARG A CZ    
2746 N NH1   . ARG A 353 ? 0.5846 0.7442 0.6442 -0.1371 0.0150  0.0165  350 ARG A NH1   
2747 N NH2   . ARG A 353 ? 0.6027 0.7566 0.6358 -0.1226 0.0127  0.0230  350 ARG A NH2   
2748 N N     . THR A 354 ? 0.6794 0.7836 0.6891 -0.1547 0.0701  0.0515  351 THR A N     
2749 C CA    . THR A 354 ? 0.7401 0.8195 0.7304 -0.1527 0.0764  0.0601  351 THR A CA    
2750 C C     . THR A 354 ? 0.7618 0.8297 0.7546 -0.1663 0.0870  0.0632  351 THR A C     
2751 O O     . THR A 354 ? 0.7912 0.8713 0.7929 -0.1735 0.0932  0.0625  351 THR A O     
2752 C CB    . THR A 354 ? 0.7705 0.8469 0.7405 -0.1416 0.0800  0.0668  351 THR A CB    
2753 O OG1   . THR A 354 ? 0.7862 0.8803 0.7577 -0.1320 0.0706  0.0620  351 THR A OG1   
2754 C CG2   . THR A 354 ? 0.8183 0.8698 0.7668 -0.1346 0.0828  0.0753  351 THR A CG2   
2755 N N     . VAL A 355 ? 0.8270 0.8714 0.8118 -0.1699 0.0895  0.0665  352 VAL A N     
2756 C CA    . VAL A 355 ? 0.8787 0.9090 0.8646 -0.1843 0.0994  0.0690  352 VAL A CA    
2757 C C     . VAL A 355 ? 0.9624 0.9594 0.9243 -0.1815 0.1065  0.0777  352 VAL A C     
2758 O O     . VAL A 355 ? 0.9656 0.9509 0.9134 -0.1689 0.1018  0.0806  352 VAL A O     
2759 C CB    . VAL A 355 ? 0.7779 0.8139 0.7837 -0.1968 0.0948  0.0610  352 VAL A CB    
2760 C CG1   . VAL A 355 ? 0.7128 0.7808 0.7418 -0.1994 0.0890  0.0532  352 VAL A CG1   
2761 C CG2   . VAL A 355 ? 0.7497 0.7724 0.7510 -0.1911 0.0865  0.0589  352 VAL A CG2   
2762 N N     . VAL A 356 ? 0.9385 0.9202 0.8956 -0.1935 0.1182  0.0821  353 VAL A N     
2763 C CA    . VAL A 356 ? 0.9156 0.8614 0.8514 -0.1949 0.1263  0.0895  353 VAL A CA    
2764 C C     . VAL A 356 ? 0.9906 0.9262 0.9367 -0.2104 0.1262  0.0839  353 VAL A C     
2765 O O     . VAL A 356 ? 1.0659 1.0188 1.0323 -0.2251 0.1270  0.0781  353 VAL A O     
2766 C CB    . VAL A 356 ? 0.9161 0.8485 0.8365 -0.1983 0.1407  0.0989  353 VAL A CB    
2767 C CG1   . VAL A 356 ? 0.9321 0.8241 0.8265 -0.1967 0.1492  0.1075  353 VAL A CG1   
2768 C CG2   . VAL A 356 ? 0.9006 0.8493 0.8142 -0.1846 0.1402  0.1027  353 VAL A CG2   
2769 N N     . ILE A 357 ? 0.9739 0.8823 0.9060 -0.2069 0.1252  0.0855  354 ILE A N     
2770 C CA    . ILE A 357 ? 0.9386 0.8341 0.8774 -0.2211 0.1248  0.0798  354 ILE A CA    
2771 C C     . ILE A 357 ? 1.0477 0.9012 0.9617 -0.2247 0.1359  0.0871  354 ILE A C     
2772 O O     . ILE A 357 ? 1.0206 0.8537 0.9110 -0.2112 0.1407  0.0962  354 ILE A O     
2773 C CB    . ILE A 357 ? 0.8452 0.7482 0.7927 -0.2143 0.1114  0.0724  354 ILE A CB    
2774 C CG1   . ILE A 357 ? 0.8564 0.7401 0.7823 -0.1955 0.1089  0.0781  354 ILE A CG1   
2775 C CG2   . ILE A 357 ? 0.8059 0.7481 0.7774 -0.2119 0.1011  0.0651  354 ILE A CG2   
2776 C CD1   . ILE A 357 ? 0.8358 0.7259 0.7692 -0.1887 0.0968  0.0715  354 ILE A CD1   
2777 N N     . LEU A 358 ? 1.1225 0.9626 1.0409 -0.2429 0.1402  0.0830  355 LEU A N     
2778 C CA    . LEU A 358 ? 1.2234 1.0197 1.1179 -0.2476 0.1497  0.0880  355 LEU A CA    
2779 C C     . LEU A 358 ? 1.3421 1.1231 1.2292 -0.2378 0.1414  0.0847  355 LEU A C     
2780 O O     . LEU A 358 ? 1.2209 1.0095 1.1228 -0.2468 0.1343  0.0753  355 LEU A O     
2781 C CB    . LEU A 358 ? 1.2454 1.0342 1.1477 -0.2728 0.1578  0.0844  355 LEU A CB    
2782 C CG    . LEU A 358 ? 1.1269 0.8678 1.0029 -0.2807 0.1706  0.0902  355 LEU A CG    
2783 C CD1   . LEU A 358 ? 1.0665 0.7838 0.9149 -0.2659 0.1803  0.1034  355 LEU A CD1   
2784 C CD2   . LEU A 358 ? 1.0769 0.8166 0.9627 -0.3074 0.1793  0.0869  355 LEU A CD2   
2785 N N     . ASP A 359 ? 1.4928 1.2527 1.3563 -0.2189 0.1427  0.0926  356 ASP A N     
2786 C CA    . ASP A 359 ? 1.5294 1.2842 1.3875 -0.2038 0.1334  0.0905  356 ASP A CA    
2787 C C     . ASP A 359 ? 1.4754 1.2021 1.3275 -0.2136 0.1343  0.0854  356 ASP A C     
2788 O O     . ASP A 359 ? 1.4705 1.1746 1.3169 -0.2308 0.1437  0.0850  356 ASP A O     
2789 C CB    . ASP A 359 ? 1.7286 1.4660 1.5609 -0.1818 0.1365  0.1016  356 ASP A CB    
2790 C CG    . ASP A 359 ? 1.9008 1.6373 1.7281 -0.1644 0.1271  0.1004  356 ASP A CG    
2791 O OD1   . ASP A 359 ? 1.9347 1.7042 1.7774 -0.1552 0.1159  0.0967  356 ASP A OD1   
2792 O OD2   . ASP A 359 ? 2.0111 1.7131 1.8181 -0.1598 0.1315  0.1034  356 ASP A OD2   
2793 N N     . HIS A 360 ? 1.5642 1.2927 1.4172 -0.2026 0.1246  0.0813  357 HIS A N     
2794 C CA    . HIS A 360 ? 1.6766 1.3778 1.5216 -0.2091 0.1249  0.0762  357 HIS A CA    
2795 C C     . HIS A 360 ? 1.8054 1.4574 1.6174 -0.2051 0.1374  0.0848  357 HIS A C     
2796 O O     . HIS A 360 ? 1.9158 1.5377 1.7181 -0.2175 0.1425  0.0812  357 HIS A O     
2797 C CB    . HIS A 360 ? 1.5791 1.2940 1.4311 -0.1958 0.1123  0.0710  357 HIS A CB    
2798 C CG    . HIS A 360 ? 1.5442 1.2560 1.3806 -0.1710 0.1104  0.0791  357 HIS A CG    
2799 N ND1   . HIS A 360 ? 1.5058 1.2493 1.3516 -0.1588 0.1045  0.0821  357 HIS A ND1   
2800 C CD2   . HIS A 360 ? 1.4663 1.1484 1.2786 -0.1559 0.1133  0.0846  357 HIS A CD2   
2801 C CE1   . HIS A 360 ? 1.4430 1.1783 1.2720 -0.1380 0.1036  0.0890  357 HIS A CE1   
2802 N NE2   . HIS A 360 ? 1.3901 1.0888 1.1988 -0.1351 0.1090  0.0910  357 HIS A NE2   
2803 N N     . LEU A 361 ? 1.7446 1.3871 1.5380 -0.1878 0.1424  0.0959  358 LEU A N     
2804 C CA    . LEU A 361 ? 1.6847 1.2795 1.4451 -0.1834 0.1556  0.1054  358 LEU A CA    
2805 C C     . LEU A 361 ? 1.6480 1.2272 1.4032 -0.2017 0.1688  0.1091  358 LEU A C     
2806 O O     . LEU A 361 ? 1.6793 1.2156 1.4127 -0.2097 0.1801  0.1121  358 LEU A O     
2807 C CB    . LEU A 361 ? 1.6060 1.1975 1.3474 -0.1568 0.1561  0.1167  358 LEU A CB    
2808 C CG    . LEU A 361 ? 1.4736 1.0821 1.2189 -0.1369 0.1439  0.1146  358 LEU A CG    
2809 C CD1   . LEU A 361 ? 1.3828 0.9993 1.1148 -0.1128 0.1433  0.1252  358 LEU A CD1   
2810 C CD2   . LEU A 361 ? 1.4333 1.0080 1.1628 -0.1338 0.1452  0.1122  358 LEU A CD2   
2811 N N     . GLY A 362 ? 1.5980 1.2101 1.3719 -0.2086 0.1680  0.1090  359 GLY A N     
2812 C CA    . GLY A 362 ? 1.5427 1.1453 1.3146 -0.2264 0.1804  0.1124  359 GLY A CA    
2813 C C     . GLY A 362 ? 1.4601 1.0802 1.2303 -0.2173 0.1842  0.1213  359 GLY A C     
2814 O O     . GLY A 362 ? 1.3032 0.9187 1.0718 -0.2303 0.1949  0.1253  359 GLY A O     
2815 N N     . ASN A 363 ? 1.5145 1.1552 1.2848 -0.1953 0.1756  0.1243  360 ASN A N     
2816 C CA    . ASN A 363 ? 1.4913 1.1475 1.2569 -0.1843 0.1785  0.1327  360 ASN A CA    
2817 C C     . ASN A 363 ? 1.3483 1.0527 1.1445 -0.1906 0.1704  0.1256  360 ASN A C     
2818 O O     . ASN A 363 ? 1.2470 0.9746 1.0681 -0.2007 0.1613  0.1147  360 ASN A O     
2819 C CB    . ASN A 363 ? 1.4788 1.1319 1.2265 -0.1570 0.1738  0.1400  360 ASN A CB    
2820 C CG    . ASN A 363 ? 1.5329 1.1437 1.2546 -0.1478 0.1781  0.1444  360 ASN A CG    
2821 O OD1   . ASN A 363 ? 1.5479 1.1606 1.2744 -0.1418 0.1691  0.1386  360 ASN A OD1   
2822 N ND2   . ASN A 363 ? 1.5802 1.1517 1.2735 -0.1463 0.1923  0.1550  360 ASN A ND2   
2823 N N     . ASN A 364 ? 1.3287 1.0474 1.1217 -0.1840 0.1740  0.1322  361 ASN A N     
2824 C CA    . ASN A 364 ? 1.1784 0.9419 0.9960 -0.1841 0.1656  0.1265  361 ASN A CA    
2825 C C     . ASN A 364 ? 1.1328 0.9164 0.9518 -0.1632 0.1527  0.1253  361 ASN A C     
2826 O O     . ASN A 364 ? 1.2282 0.9965 1.0250 -0.1454 0.1535  0.1334  361 ASN A O     
2827 C CB    . ASN A 364 ? 1.1949 0.9653 1.0079 -0.1863 0.1754  0.1335  361 ASN A CB    
2828 C CG    . ASN A 364 ? 1.2940 1.0624 1.1179 -0.2103 0.1853  0.1313  361 ASN A CG    
2829 O OD1   . ASN A 364 ? 1.4034 1.1564 1.2320 -0.2254 0.1872  0.1264  361 ASN A OD1   
2830 N ND2   . ASN A 364 ? 1.2865 1.0716 1.1146 -0.2141 0.1919  0.1347  361 ASN A ND2   
2831 N N     . ARG A 365 ? 0.9888 0.8073 0.8339 -0.1656 0.1408  0.1153  362 ARG A N     
2832 C CA    . ARG A 365 ? 0.9829 0.8225 0.8320 -0.1486 0.1280  0.1129  362 ARG A CA    
2833 C C     . ARG A 365 ? 0.9469 0.8265 0.8196 -0.1513 0.1206  0.1059  362 ARG A C     
2834 O O     . ARG A 365 ? 1.0040 0.8986 0.8982 -0.1663 0.1192  0.0981  362 ARG A O     
2835 C CB    . ARG A 365 ? 0.9868 0.8198 0.8404 -0.1466 0.1197  0.1070  362 ARG A CB    
2836 C CG    . ARG A 365 ? 1.0379 0.8809 0.8862 -0.1264 0.1097  0.1081  362 ARG A CG    
2837 C CD    . ARG A 365 ? 1.0037 0.8302 0.8488 -0.1231 0.1054  0.1052  362 ARG A CD    
2838 N NE    . ARG A 365 ? 0.9367 0.7809 0.7836 -0.1063 0.0943  0.1042  362 ARG A NE    
2839 C CZ    . ARG A 365 ? 1.0376 0.8748 0.8650 -0.0876 0.0946  0.1125  362 ARG A CZ    
2840 N NH1   . ARG A 365 ? 1.1068 0.9177 0.9099 -0.0822 0.1055  0.1229  362 ARG A NH1   
2841 N NH2   . ARG A 365 ? 0.9933 0.8504 0.8253 -0.0742 0.0840  0.1107  362 ARG A NH2   
2842 N N     . THR A 366 ? 0.9559 0.8524 0.8235 -0.1365 0.1161  0.1087  363 THR A N     
2843 C CA    . THR A 366 ? 0.9282 0.8604 0.8147 -0.1366 0.1085  0.1021  363 THR A CA    
2844 C C     . THR A 366 ? 0.9710 0.9203 0.8685 -0.1283 0.0945  0.0951  363 THR A C     
2845 O O     . THR A 366 ? 1.1543 1.1003 1.0385 -0.1132 0.0900  0.0990  363 THR A O     
2846 C CB    . THR A 366 ? 0.8948 0.8351 0.7683 -0.1266 0.1122  0.1085  363 THR A CB    
2847 O OG1   . THR A 366 ? 0.9659 0.8875 0.8270 -0.1338 0.1263  0.1161  363 THR A OG1   
2848 C CG2   . THR A 366 ? 0.8738 0.8485 0.7659 -0.1279 0.1054  0.1010  363 THR A CG2   
2849 N N     . VAL A 367 ? 0.7958 0.7638 0.7171 -0.1381 0.0878  0.0852  364 VAL A N     
2850 C CA    . VAL A 367 ? 0.7710 0.7522 0.7036 -0.1329 0.0754  0.0784  364 VAL A CA    
2851 C C     . VAL A 367 ? 0.7394 0.7525 0.6930 -0.1358 0.0680  0.0700  364 VAL A C     
2852 O O     . VAL A 367 ? 0.7663 0.7904 0.7301 -0.1449 0.0723  0.0679  364 VAL A O     
2853 C CB    . VAL A 367 ? 0.7721 0.7384 0.7106 -0.1412 0.0742  0.0744  364 VAL A CB    
2854 C CG1   . VAL A 367 ? 0.8062 0.7378 0.7216 -0.1373 0.0819  0.0824  364 VAL A CG1   
2855 C CG2   . VAL A 367 ? 0.8017 0.7745 0.7583 -0.1593 0.0774  0.0686  364 VAL A CG2   
2856 N N     . SER A 368 ? 0.7189 0.7465 0.6786 -0.1277 0.0571  0.0655  365 SER A N     
2857 C CA    . SER A 368 ? 0.7868 0.8415 0.7653 -0.1299 0.0494  0.0571  365 SER A CA    
2858 C C     . SER A 368 ? 0.7211 0.7802 0.7191 -0.1411 0.0459  0.0496  365 SER A C     
2859 O O     . SER A 368 ? 0.7400 0.7846 0.7369 -0.1433 0.0450  0.0493  365 SER A O     
2860 C CB    . SER A 368 ? 0.7307 0.7988 0.7071 -0.1177 0.0395  0.0553  365 SER A CB    
2861 O OG    . SER A 368 ? 0.6863 0.7768 0.6804 -0.1207 0.0321  0.0468  365 SER A OG    
2862 N N     . ILE A 369 ? 0.6837 0.7630 0.6988 -0.1475 0.0442  0.0435  366 ILE A N     
2863 C CA    . ILE A 369 ? 0.7455 0.8324 0.7797 -0.1574 0.0406  0.0364  366 ILE A CA    
2864 C C     . ILE A 369 ? 0.7132 0.8035 0.7527 -0.1525 0.0303  0.0317  366 ILE A C     
2865 O O     . ILE A 369 ? 0.7446 0.8337 0.7946 -0.1593 0.0274  0.0274  366 ILE A O     
2866 C CB    . ILE A 369 ? 0.7494 0.8589 0.7996 -0.1627 0.0411  0.0315  366 ILE A CB    
2867 C CG1   . ILE A 369 ? 0.8286 0.9460 0.8979 -0.1738 0.0391  0.0254  366 ILE A CG1   
2868 C CG2   . ILE A 369 ? 0.8122 0.9387 0.8648 -0.1534 0.0337  0.0278  366 ILE A CG2   
2869 C CD1   . ILE A 369 ? 0.8974 1.0389 0.9833 -0.1763 0.0380  0.0203  366 ILE A CD1   
2870 N N     . ASP A 370 ? 0.6412 0.7366 0.6735 -0.1410 0.0246  0.0326  367 ASP A N     
2871 C CA    . ASP A 370 ? 0.6557 0.7550 0.6924 -0.1361 0.0154  0.0288  367 ASP A CA    
2872 C C     . ASP A 370 ? 0.6897 0.7683 0.7172 -0.1346 0.0162  0.0321  367 ASP A C     
2873 O O     . ASP A 370 ? 0.7787 0.8590 0.8117 -0.1328 0.0096  0.0285  367 ASP A O     
2874 C CB    . ASP A 370 ? 0.5973 0.7083 0.6282 -0.1251 0.0095  0.0291  367 ASP A CB    
2875 C CG    . ASP A 370 ? 0.7774 0.9086 0.8189 -0.1266 0.0064  0.0235  367 ASP A CG    
2876 O OD1   . ASP A 370 ? 0.6432 0.7806 0.6978 -0.1348 0.0080  0.0193  367 ASP A OD1   
2877 O OD2   . ASP A 370 ? 0.8153 0.9562 0.8515 -0.1193 0.0022  0.0230  367 ASP A OD2   
2878 N N     . ASN A 371 ? 0.7246 0.7829 0.7373 -0.1348 0.0246  0.0388  368 ASN A N     
2879 C CA    . ASN A 371 ? 0.6599 0.6946 0.6617 -0.1338 0.0271  0.0420  368 ASN A CA    
2880 C C     . ASN A 371 ? 0.7235 0.7441 0.7290 -0.1480 0.0334  0.0405  368 ASN A C     
2881 O O     . ASN A 371 ? 0.6953 0.6905 0.6870 -0.1492 0.0396  0.0448  368 ASN A O     
2882 C CB    . ASN A 371 ? 0.6840 0.7024 0.6632 -0.1225 0.0320  0.0512  368 ASN A CB    
2883 C CG    . ASN A 371 ? 0.8374 0.8691 0.8125 -0.1082 0.0245  0.0524  368 ASN A CG    
2884 O OD1   . ASN A 371 ? 0.9164 0.9571 0.8999 -0.1056 0.0166  0.0479  368 ASN A OD1   
2885 N ND2   . ASN A 371 ? 0.6949 0.7287 0.6570 -0.0994 0.0269  0.0584  368 ASN A ND2   
2886 N N     . LEU A 372 ? 0.7234 0.7605 0.7473 -0.1587 0.0321  0.0344  369 LEU A N     
2887 C CA    . LEU A 372 ? 0.7549 0.7848 0.7858 -0.1735 0.0368  0.0317  369 LEU A CA    
2888 C C     . LEU A 372 ? 0.7386 0.7867 0.7901 -0.1798 0.0290  0.0230  369 LEU A C     
2889 O O     . LEU A 372 ? 0.8099 0.8789 0.8720 -0.1745 0.0220  0.0193  369 LEU A O     
2890 C CB    . LEU A 372 ? 0.7225 0.7567 0.7555 -0.1816 0.0455  0.0343  369 LEU A CB    
2891 C CG    . LEU A 372 ? 0.7666 0.7804 0.7793 -0.1792 0.0558  0.0433  369 LEU A CG    
2892 C CD1   . LEU A 372 ? 0.7058 0.7263 0.7249 -0.1906 0.0642  0.0443  369 LEU A CD1   
2893 C CD2   . LEU A 372 ? 0.8465 0.8286 0.8429 -0.1804 0.0602  0.0469  369 LEU A CD2   
2894 N N     . LYS A 373 ? 0.7537 0.7928 0.8095 -0.1912 0.0304  0.0197  370 LYS A N     
2895 C CA    . LYS A 373 ? 0.6637 0.7216 0.7396 -0.1996 0.0247  0.0118  370 LYS A CA    
2896 C C     . LYS A 373 ? 0.6934 0.7494 0.7755 -0.2157 0.0313  0.0105  370 LYS A C     
2897 O O     . LYS A 373 ? 0.7408 0.7733 0.8096 -0.2215 0.0390  0.0143  370 LYS A O     
2898 C CB    . LYS A 373 ? 0.6777 0.7305 0.7547 -0.1973 0.0170  0.0073  370 LYS A CB    
2899 C CG    . LYS A 373 ? 0.6420 0.6696 0.7091 -0.2051 0.0205  0.0068  370 LYS A CG    
2900 C CD    . LYS A 373 ? 0.7543 0.7815 0.8250 -0.2032 0.0123  0.0013  370 LYS A CD    
2901 C CE    . LYS A 373 ? 0.7857 0.7855 0.8442 -0.2103 0.0158  0.0003  370 LYS A CE    
2902 N NZ    . LYS A 373 ? 0.8012 0.8039 0.8654 -0.2108 0.0079  -0.0063 370 LYS A NZ    
2903 N N     . PRO A 374 ? 0.7068 0.7875 0.8086 -0.2230 0.0289  0.0054  371 PRO A N     
2904 C CA    . PRO A 374 ? 0.6593 0.7420 0.7695 -0.2395 0.0338  0.0030  371 PRO A CA    
2905 C C     . PRO A 374 ? 0.6933 0.7630 0.8025 -0.2470 0.0302  -0.0019 371 PRO A C     
2906 O O     . PRO A 374 ? 0.7732 0.8493 0.8876 -0.2418 0.0213  -0.0064 371 PRO A O     
2907 C CB    . PRO A 374 ? 0.6436 0.7599 0.7758 -0.2417 0.0306  -0.0013 371 PRO A CB    
2908 C CG    . PRO A 374 ? 0.7112 0.8386 0.8470 -0.2284 0.0213  -0.0037 371 PRO A CG    
2909 C CD    . PRO A 374 ? 0.7357 0.8438 0.8524 -0.2165 0.0221  0.0017  371 PRO A CD    
2910 N N     . THR A 375 ? 0.7298 0.7797 0.8308 -0.2595 0.0374  -0.0008 372 THR A N     
2911 C CA    . THR A 375 ? 0.7719 0.8073 0.8701 -0.2682 0.0348  -0.0060 372 THR A CA    
2912 C C     . THR A 375 ? 0.7257 0.7894 0.8464 -0.2771 0.0277  -0.0141 372 THR A C     
2913 O O     . THR A 375 ? 0.7511 0.8364 0.8868 -0.2864 0.0303  -0.0153 372 THR A O     
2914 C CB    . THR A 375 ? 0.7947 0.8022 0.8790 -0.2814 0.0450  -0.0035 372 THR A CB    
2915 O OG1   . THR A 375 ? 0.7989 0.7801 0.8612 -0.2713 0.0518  0.0049  372 THR A OG1   
2916 C CG2   . THR A 375 ? 0.7234 0.7130 0.8023 -0.2904 0.0422  -0.0095 372 THR A CG2   
2917 N N     . SER A 376 ? 0.7967 0.8613 0.9195 -0.2734 0.0188  -0.0194 373 SER A N     
2918 C CA    . SER A 376 ? 0.7004 0.7926 0.8433 -0.2790 0.0110  -0.0266 373 SER A CA    
2919 C C     . SER A 376 ? 0.7305 0.8220 0.8784 -0.2984 0.0133  -0.0316 373 SER A C     
2920 O O     . SER A 376 ? 0.8091 0.8723 0.9419 -0.3072 0.0191  -0.0311 373 SER A O     
2921 C CB    . SER A 376 ? 0.6191 0.7116 0.7612 -0.2685 0.0012  -0.0302 373 SER A CB    
2922 O OG    . SER A 376 ? 0.7787 0.8777 0.9197 -0.2522 -0.0017 -0.0266 373 SER A OG    
2923 N N     . HIS A 377 ? 0.6920 0.8154 0.8611 -0.3052 0.0087  -0.0367 374 HIS A N     
2924 C CA    . HIS A 377 ? 0.7542 0.8853 0.9322 -0.3242 0.0088  -0.0427 374 HIS A CA    
2925 C C     . HIS A 377 ? 0.8812 1.0026 1.0555 -0.3387 0.0202  -0.0394 374 HIS A C     
2926 O O     . HIS A 377 ? 0.8790 0.9924 1.0521 -0.3561 0.0228  -0.0434 374 HIS A O     
2927 C CB    . HIS A 377 ? 0.7185 0.8293 0.8859 -0.3287 0.0038  -0.0484 374 HIS A CB    
2928 C CG    . HIS A 377 ? 0.7368 0.8433 0.8987 -0.3120 -0.0044 -0.0490 374 HIS A CG    
2929 N ND1   . HIS A 377 ? 0.7012 0.8363 0.8785 -0.3025 -0.0129 -0.0512 374 HIS A ND1   
2930 C CD2   . HIS A 377 ? 0.7306 0.8076 0.8732 -0.3029 -0.0048 -0.0474 374 HIS A CD2   
2931 C CE1   . HIS A 377 ? 0.6545 0.7779 0.8224 -0.2894 -0.0181 -0.0510 374 HIS A CE1   
2932 N NE2   . HIS A 377 ? 0.6519 0.7414 0.7993 -0.2892 -0.0135 -0.0487 374 HIS A NE2   
2933 N N     . GLN A 378 ? 1.0393 1.1612 1.2112 -0.3319 0.0272  -0.0321 375 GLN A N     
2934 C CA    . GLN A 378 ? 1.0395 1.1545 1.2083 -0.3442 0.0389  -0.0278 375 GLN A CA    
2935 C C     . GLN A 378 ? 1.0102 1.0844 1.1569 -0.3540 0.0459  -0.0266 375 GLN A C     
2936 O O     . GLN A 378 ? 0.9324 0.9775 1.0601 -0.3442 0.0447  -0.0249 375 GLN A O     
2937 C CB    . GLN A 378 ? 0.9927 1.1413 1.1845 -0.3599 0.0394  -0.0321 375 GLN A CB    
2938 C CG    . GLN A 378 ? 1.0397 1.2285 1.2529 -0.3501 0.0341  -0.0327 375 GLN A CG    
2939 C CD    . GLN A 378 ? 1.1833 1.4079 1.4199 -0.3646 0.0339  -0.0372 375 GLN A CD    
2940 O OE1   . GLN A 378 ? 1.2812 1.5028 1.5196 -0.3832 0.0357  -0.0412 375 GLN A OE1   
2941 N NE2   . GLN A 378 ? 1.1487 1.4076 1.4030 -0.3561 0.0316  -0.0366 375 GLN A NE2   
2942 N N     . ASP B 119 ? 1.7474 1.6352 1.7797 0.0958  0.0563  -0.3402 116 ASP B N     
2943 C CA    . ASP B 119 ? 1.7328 1.6471 1.7711 0.0746  0.0461  -0.3112 116 ASP B CA    
2944 C C     . ASP B 119 ? 1.6234 1.5659 1.6876 0.0842  0.0529  -0.2794 116 ASP B C     
2945 O O     . ASP B 119 ? 1.6695 1.6290 1.7397 0.1060  0.0669  -0.2791 116 ASP B O     
2946 C CB    . ASP B 119 ? 1.7335 1.6853 1.7414 0.0619  0.0445  -0.3167 116 ASP B CB    
2947 C CG    . ASP B 119 ? 1.7196 1.6813 1.7288 0.0366  0.0300  -0.2975 116 ASP B CG    
2948 O OD1   . ASP B 119 ? 1.7144 1.6724 1.7484 0.0314  0.0251  -0.2726 116 ASP B OD1   
2949 O OD2   . ASP B 119 ? 1.6820 1.6579 1.6675 0.0223  0.0237  -0.3069 116 ASP B OD2   
2950 N N     . ARG B 120 ? 1.4608 1.4105 1.5396 0.0672  0.0431  -0.2526 117 ARG B N     
2951 C CA    . ARG B 120 ? 1.2517 1.2253 1.3535 0.0719  0.0475  -0.2221 117 ARG B CA    
2952 C C     . ARG B 120 ? 1.0011 1.0232 1.0881 0.0737  0.0555  -0.2127 117 ARG B C     
2953 O O     . ARG B 120 ? 0.8848 0.9232 0.9491 0.0618  0.0515  -0.2180 117 ARG B O     
2954 C CB    . ARG B 120 ? 1.2624 1.2280 1.3814 0.0518  0.0346  -0.1989 117 ARG B CB    
2955 C CG    . ARG B 120 ? 1.4027 1.3225 1.5313 0.0423  0.0227  -0.2073 117 ARG B CG    
2956 C CD    . ARG B 120 ? 1.4788 1.3703 1.6361 0.0573  0.0254  -0.2016 117 ARG B CD    
2957 N NE    . ARG B 120 ? 1.6025 1.4429 1.7634 0.0522  0.0156  -0.2176 117 ARG B NE    
2958 C CZ    . ARG B 120 ? 1.6244 1.4452 1.7951 0.0304  0.0003  -0.2066 117 ARG B CZ    
2959 N NH1   . ARG B 120 ? 1.5063 1.3562 1.6839 0.0133  -0.0058 -0.1810 117 ARG B NH1   
2960 N NH2   . ARG B 120 ? 1.6740 1.4461 1.8468 0.0251  -0.0091 -0.2215 117 ARG B NH2   
2961 N N     . PRO B 121 ? 0.9055 0.9520 1.0054 0.0876  0.0659  -0.1969 118 PRO B N     
2962 C CA    . PRO B 121 ? 0.8061 0.8972 0.8927 0.0869  0.0721  -0.1849 118 PRO B CA    
2963 C C     . PRO B 121 ? 0.9322 1.0346 1.0149 0.0656  0.0625  -0.1658 118 PRO B C     
2964 O O     . PRO B 121 ? 0.9622 1.0484 1.0607 0.0542  0.0542  -0.1523 118 PRO B O     
2965 C CB    . PRO B 121 ? 0.7964 0.9068 0.9042 0.1024  0.0823  -0.1672 118 PRO B CB    
2966 C CG    . PRO B 121 ? 0.8345 0.9133 0.9600 0.1196  0.0859  -0.1804 118 PRO B CG    
2967 C CD    . PRO B 121 ? 0.8727 0.9082 1.0000 0.1055  0.0726  -0.1898 118 PRO B CD    
2968 N N     . GLN B 122 ? 0.9218 1.0528 0.9832 0.0608  0.0641  -0.1645 119 GLN B N     
2969 C CA    . GLN B 122 ? 0.8898 1.0310 0.9457 0.0436  0.0565  -0.1483 119 GLN B CA    
2970 C C     . GLN B 122 ? 0.7799 0.9335 0.8510 0.0406  0.0583  -0.1213 119 GLN B C     
2971 O O     . GLN B 122 ? 0.7585 0.9297 0.8360 0.0509  0.0668  -0.1126 119 GLN B O     
2972 C CB    . GLN B 122 ? 1.0465 1.2137 1.0768 0.0408  0.0576  -0.1531 119 GLN B CB    
2973 C CG    . GLN B 122 ? 1.2539 1.4266 1.2773 0.0251  0.0492  -0.1409 119 GLN B CG    
2974 C CD    . GLN B 122 ? 1.3422 1.5388 1.3421 0.0231  0.0490  -0.1454 119 GLN B CD    
2975 O OE1   . GLN B 122 ? 1.2705 1.4807 1.2573 0.0314  0.0547  -0.1593 119 GLN B OE1   
2976 N NE2   . GLN B 122 ? 1.3347 1.5382 1.3298 0.0124  0.0429  -0.1333 119 GLN B NE2   
2977 N N     . LYS B 123 ? 0.8010 0.9477 0.8772 0.0257  0.0504  -0.1080 120 LYS B N     
2978 C CA    . LYS B 123 ? 0.7092 0.8621 0.7994 0.0195  0.0504  -0.0844 120 LYS B CA    
2979 C C     . LYS B 123 ? 0.7659 0.9272 0.8443 0.0056  0.0460  -0.0733 120 LYS B C     
2980 O O     . LYS B 123 ? 0.7138 0.8716 0.7801 0.0002  0.0410  -0.0824 120 LYS B O     
2981 C CB    . LYS B 123 ? 0.6903 0.8210 0.8042 0.0161  0.0453  -0.0791 120 LYS B CB    
2982 C CG    . LYS B 123 ? 0.6752 0.7951 0.8053 0.0318  0.0502  -0.0857 120 LYS B CG    
2983 C CD    . LYS B 123 ? 0.6677 0.8137 0.8037 0.0427  0.0600  -0.0726 120 LYS B CD    
2984 C CE    . LYS B 123 ? 0.6935 0.8312 0.8475 0.0620  0.0665  -0.0792 120 LYS B CE    
2985 N NZ    . LYS B 123 ? 0.7570 0.8660 0.9352 0.0595  0.0595  -0.0741 120 LYS B NZ    
2986 N N     . PRO B 124 ? 0.7524 0.9248 0.8339 -0.0004 0.0478  -0.0537 121 PRO B N     
2987 C CA    . PRO B 124 ? 0.6370 0.8106 0.7086 -0.0131 0.0439  -0.0445 121 PRO B CA    
2988 C C     . PRO B 124 ? 0.6386 0.7962 0.7185 -0.0221 0.0364  -0.0471 121 PRO B C     
2989 O O     . PRO B 124 ? 0.7902 0.9355 0.8870 -0.0222 0.0335  -0.0489 121 PRO B O     
2990 C CB    . PRO B 124 ? 0.6456 0.8292 0.7212 -0.0190 0.0468  -0.0245 121 PRO B CB    
2991 C CG    . PRO B 124 ? 0.6849 0.8819 0.7682 -0.0078 0.0533  -0.0222 121 PRO B CG    
2992 C CD    . PRO B 124 ? 0.7529 0.9374 0.8467 0.0038  0.0534  -0.0391 121 PRO B CD    
2993 N N     . PHE B 125 ? 0.6365 0.7954 0.7053 -0.0294 0.0333  -0.0463 122 PHE B N     
2994 C CA    . PHE B 125 ? 0.6348 0.7859 0.7094 -0.0384 0.0267  -0.0473 122 PHE B CA    
2995 C C     . PHE B 125 ? 0.6750 0.8174 0.7526 -0.0369 0.0212  -0.0628 122 PHE B C     
2996 O O     . PHE B 125 ? 0.6500 0.7883 0.7339 -0.0456 0.0147  -0.0631 122 PHE B O     
2997 C CB    . PHE B 125 ? 0.5686 0.7152 0.6598 -0.0476 0.0248  -0.0346 122 PHE B CB    
2998 C CG    . PHE B 125 ? 0.6074 0.7619 0.6955 -0.0513 0.0296  -0.0197 122 PHE B CG    
2999 C CD1   . PHE B 125 ? 0.6059 0.7657 0.6763 -0.0533 0.0325  -0.0163 122 PHE B CD1   
3000 C CD2   . PHE B 125 ? 0.6926 0.8488 0.7958 -0.0532 0.0306  -0.0084 122 PHE B CD2   
3001 C CE1   . PHE B 125 ? 0.6068 0.7711 0.6719 -0.0592 0.0359  -0.0034 122 PHE B CE1   
3002 C CE2   . PHE B 125 ? 0.6140 0.7800 0.7131 -0.0594 0.0340  0.0061  122 PHE B CE2   
3003 C CZ    . PHE B 125 ? 0.5503 0.7191 0.6290 -0.0633 0.0364  0.0078  122 PHE B CZ    
3004 N N     . ASP B 126 ? 0.6969 0.8376 0.7692 -0.0272 0.0235  -0.0759 123 ASP B N     
3005 C CA    . ASP B 126 ? 0.6569 0.7878 0.7272 -0.0278 0.0177  -0.0928 123 ASP B CA    
3006 C C     . ASP B 126 ? 0.6453 0.7882 0.7017 -0.0330 0.0134  -0.0963 123 ASP B C     
3007 O O     . ASP B 126 ? 0.6856 0.8238 0.7444 -0.0410 0.0055  -0.1025 123 ASP B O     
3008 C CB    . ASP B 126 ? 0.6737 0.8008 0.7381 -0.0156 0.0225  -0.1082 123 ASP B CB    
3009 C CG    . ASP B 126 ? 0.8447 0.9525 0.9273 -0.0100 0.0238  -0.1102 123 ASP B CG    
3010 O OD1   . ASP B 126 ? 1.0136 1.1105 1.1137 -0.0178 0.0191  -0.0991 123 ASP B OD1   
3011 O OD2   . ASP B 126 ? 0.9005 1.0051 0.9804 0.0027  0.0297  -0.1225 123 ASP B OD2   
3012 N N     . LYS B 127 ? 0.6572 0.8168 0.7002 -0.0291 0.0177  -0.0906 124 LYS B N     
3013 C CA    . LYS B 127 ? 0.6463 0.8197 0.6776 -0.0316 0.0139  -0.0920 124 LYS B CA    
3014 C C     . LYS B 127 ? 0.6098 0.7945 0.6331 -0.0288 0.0185  -0.0782 124 LYS B C     
3015 O O     . LYS B 127 ? 0.6730 0.8615 0.6899 -0.0232 0.0244  -0.0740 124 LYS B O     
3016 C CB    . LYS B 127 ? 0.6337 0.8142 0.6513 -0.0279 0.0126  -0.1077 124 LYS B CB    
3017 C CG    . LYS B 127 ? 0.7314 0.9282 0.7398 -0.0327 0.0064  -0.1088 124 LYS B CG    
3018 C CD    . LYS B 127 ? 0.8122 1.0164 0.8059 -0.0323 0.0040  -0.1257 124 LYS B CD    
3019 C CE    . LYS B 127 ? 0.8847 1.0679 0.8828 -0.0377 -0.0008 -0.1426 124 LYS B CE    
3020 N NZ    . LYS B 127 ? 0.9412 1.1313 0.9216 -0.0403 -0.0044 -0.1610 124 LYS B NZ    
3021 N N     . PHE B 128 ? 0.6708 0.8608 0.6949 -0.0326 0.0158  -0.0710 125 PHE B N     
3022 C CA    . PHE B 128 ? 0.6694 0.8659 0.6851 -0.0292 0.0192  -0.0595 125 PHE B CA    
3023 C C     . PHE B 128 ? 0.7103 0.9232 0.7173 -0.0261 0.0156  -0.0608 125 PHE B C     
3024 O O     . PHE B 128 ? 0.7266 0.9473 0.7383 -0.0298 0.0098  -0.0653 125 PHE B O     
3025 C CB    . PHE B 128 ? 0.6855 0.8757 0.7084 -0.0334 0.0203  -0.0503 125 PHE B CB    
3026 C CG    . PHE B 128 ? 0.6298 0.8078 0.6567 -0.0371 0.0247  -0.0440 125 PHE B CG    
3027 C CD1   . PHE B 128 ? 0.7256 0.9005 0.7528 -0.0354 0.0272  -0.0450 125 PHE B CD1   
3028 C CD2   . PHE B 128 ? 0.6169 0.7899 0.6470 -0.0423 0.0265  -0.0365 125 PHE B CD2   
3029 C CE1   . PHE B 128 ? 0.7337 0.9020 0.7660 -0.0397 0.0305  -0.0366 125 PHE B CE1   
3030 C CE2   . PHE B 128 ? 0.5554 0.7203 0.5879 -0.0481 0.0296  -0.0298 125 PHE B CE2   
3031 C CZ    . PHE B 128 ? 0.5565 0.7197 0.5909 -0.0472 0.0311  -0.0287 125 PHE B CZ    
3032 N N     . PHE B 129 ? 0.6849 0.9053 0.6800 -0.0205 0.0183  -0.0548 126 PHE B N     
3033 C CA    . PHE B 129 ? 0.6572 0.8955 0.6450 -0.0172 0.0148  -0.0515 126 PHE B CA    
3034 C C     . PHE B 129 ? 0.6323 0.8667 0.6203 -0.0129 0.0169  -0.0373 126 PHE B C     
3035 O O     . PHE B 129 ? 0.7202 0.9421 0.7030 -0.0113 0.0215  -0.0293 126 PHE B O     
3036 C CB    . PHE B 129 ? 0.6492 0.9009 0.6235 -0.0142 0.0155  -0.0532 126 PHE B CB    
3037 C CG    . PHE B 129 ? 0.6643 0.9205 0.6356 -0.0166 0.0140  -0.0701 126 PHE B CG    
3038 C CD1   . PHE B 129 ? 0.7083 0.9525 0.6822 -0.0155 0.0189  -0.0774 126 PHE B CD1   
3039 C CD2   . PHE B 129 ? 0.7559 1.0283 0.7217 -0.0198 0.0078  -0.0790 126 PHE B CD2   
3040 C CE1   . PHE B 129 ? 0.7674 1.0116 0.7383 -0.0155 0.0185  -0.0948 126 PHE B CE1   
3041 C CE2   . PHE B 129 ? 0.6468 0.9189 0.6071 -0.0225 0.0067  -0.0973 126 PHE B CE2   
3042 C CZ    . PHE B 129 ? 0.6503 0.9064 0.6130 -0.0193 0.0125  -0.1061 126 PHE B CZ    
3043 N N     . ILE B 130 ? 0.5945 0.8395 0.5887 -0.0110 0.0135  -0.0344 127 ILE B N     
3044 C CA    . ILE B 130 ? 0.6556 0.8957 0.6513 -0.0041 0.0164  -0.0228 127 ILE B CA    
3045 C C     . ILE B 130 ? 0.7482 1.0090 0.7422 0.0028  0.0125  -0.0146 127 ILE B C     
3046 O O     . ILE B 130 ? 0.8320 1.1153 0.8266 -0.0003 0.0065  -0.0186 127 ILE B O     
3047 C CB    . ILE B 130 ? 0.6311 0.8672 0.6388 -0.0057 0.0179  -0.0241 127 ILE B CB    
3048 C CG1   . ILE B 130 ? 0.6714 0.9313 0.6891 -0.0085 0.0115  -0.0276 127 ILE B CG1   
3049 C CG2   . ILE B 130 ? 0.5980 0.8168 0.6084 -0.0140 0.0207  -0.0299 127 ILE B CG2   
3050 C CD1   . ILE B 130 ? 0.7812 1.0449 0.8114 -0.0097 0.0130  -0.0262 127 ILE B CD1   
3051 N N     . ASP B 131 ? 0.7700 1.0224 0.7617 0.0117  0.0156  -0.0024 128 ASP B N     
3052 C CA    . ASP B 131 ? 0.8250 1.0952 0.8174 0.0203  0.0122  0.0096  128 ASP B CA    
3053 C C     . ASP B 131 ? 0.7601 1.0086 0.7524 0.0310  0.0173  0.0209  128 ASP B C     
3054 O O     . ASP B 131 ? 0.8316 1.0514 0.8179 0.0291  0.0227  0.0189  128 ASP B O     
3055 C CB    . ASP B 131 ? 0.9434 1.2282 0.9246 0.0173  0.0079  0.0131  128 ASP B CB    
3056 C CG    . ASP B 131 ? 1.1099 1.4237 1.0940 0.0227  0.0018  0.0248  128 ASP B CG    
3057 O OD1   . ASP B 131 ? 1.2037 1.5366 1.1990 0.0244  -0.0013 0.0245  128 ASP B OD1   
3058 O OD2   . ASP B 131 ? 1.1461 1.4667 1.1221 0.0244  -0.0004 0.0362  128 ASP B OD2   
3059 N N     . TYR B 132 ? 0.6595 0.9217 0.6581 0.0422  0.0153  0.0329  129 TYR B N     
3060 C CA    . TYR B 132 ? 0.6731 0.9128 0.6727 0.0553  0.0201  0.0434  129 TYR B CA    
3061 C C     . TYR B 132 ? 0.7198 0.9566 0.7122 0.0595  0.0164  0.0594  129 TYR B C     
3062 O O     . TYR B 132 ? 0.7637 1.0308 0.7573 0.0581  0.0095  0.0668  129 TYR B O     
3063 C CB    . TYR B 132 ? 0.6965 0.9526 0.7122 0.0685  0.0219  0.0473  129 TYR B CB    
3064 C CG    . TYR B 132 ? 0.7070 0.9506 0.7274 0.0692  0.0293  0.0361  129 TYR B CG    
3065 C CD1   . TYR B 132 ? 0.8518 1.0579 0.8643 0.0738  0.0374  0.0334  129 TYR B CD1   
3066 C CD2   . TYR B 132 ? 0.6560 0.9263 0.6877 0.0635  0.0277  0.0286  129 TYR B CD2   
3067 C CE1   . TYR B 132 ? 0.7881 0.9865 0.8033 0.0733  0.0444  0.0229  129 TYR B CE1   
3068 C CE2   . TYR B 132 ? 0.6615 0.9249 0.6977 0.0628  0.0342  0.0201  129 TYR B CE2   
3069 C CZ    . TYR B 132 ? 0.7524 0.9813 0.7801 0.0681  0.0429  0.0171  129 TYR B CZ    
3070 O OH    . TYR B 132 ? 0.7446 0.9701 0.7750 0.0664  0.0495  0.0084  129 TYR B OH    
3071 N N     . ILE B 133 ? 0.7836 0.9840 0.7675 0.0628  0.0203  0.0651  130 ILE B N     
3072 C CA    . ILE B 133 ? 0.7813 0.9725 0.7591 0.0668  0.0165  0.0830  130 ILE B CA    
3073 C C     . ILE B 133 ? 0.8929 1.0608 0.8778 0.0846  0.0203  0.0922  130 ILE B C     
3074 O O     . ILE B 133 ? 0.8692 1.0021 0.8498 0.0878  0.0276  0.0839  130 ILE B O     
3075 C CB    . ILE B 133 ? 0.8224 0.9880 0.7830 0.0540  0.0167  0.0837  130 ILE B CB    
3076 C CG1   . ILE B 133 ? 0.9004 1.0935 0.8553 0.0401  0.0134  0.0768  130 ILE B CG1   
3077 C CG2   . ILE B 133 ? 0.8803 1.0283 0.8351 0.0580  0.0128  0.1041  130 ILE B CG2   
3078 C CD1   . ILE B 133 ? 0.9151 1.0928 0.8553 0.0282  0.0134  0.0807  130 ILE B CD1   
3079 N N     . GLY B 134 ? 0.9348 1.1226 0.9304 0.0966  0.0156  0.1091  131 GLY B N     
3080 C CA    . GLY B 134 ? 0.9187 1.0846 0.9233 0.1167  0.0194  0.1196  131 GLY B CA    
3081 C C     . GLY B 134 ? 0.9803 1.1840 1.0047 0.1320  0.0152  0.1356  131 GLY B C     
3082 O O     . GLY B 134 ? 1.0409 1.2903 1.0703 0.1244  0.0082  0.1389  131 GLY B O     
3083 N N     . PRO B 135 ? 1.0027 1.1880 1.0384 0.1539  0.0197  0.1456  132 PRO B N     
3084 C CA    . PRO B 135 ? 1.0249 1.1527 1.0524 0.1633  0.0286  0.1388  132 PRO B CA    
3085 C C     . PRO B 135 ? 1.0353 1.1192 1.0472 0.1577  0.0244  0.1506  132 PRO B C     
3086 O O     . PRO B 135 ? 1.1019 1.1988 1.1174 0.1579  0.0154  0.1723  132 PRO B O     
3087 C CB    . PRO B 135 ? 0.9904 1.1230 1.0387 0.1914  0.0344  0.1468  132 PRO B CB    
3088 C CG    . PRO B 135 ? 0.9531 1.1351 1.0186 0.1963  0.0247  0.1692  132 PRO B CG    
3089 C CD    . PRO B 135 ? 0.9350 1.1578 0.9937 0.1720  0.0170  0.1626  132 PRO B CD    
3090 N N     . LEU B 136 ? 1.0436 1.0780 1.0378 0.1510  0.0303  0.1371  133 LEU B N     
3091 C CA    . LEU B 136 ? 1.0566 1.0431 1.0334 0.1427  0.0267  0.1458  133 LEU B CA    
3092 C C     . LEU B 136 ? 1.1902 1.1243 1.1675 0.1630  0.0328  0.1482  133 LEU B C     
3093 O O     . LEU B 136 ? 1.2088 1.1436 1.1980 0.1832  0.0420  0.1391  133 LEU B O     
3094 C CB    . LEU B 136 ? 0.9868 0.9541 0.9422 0.1190  0.0285  0.1292  133 LEU B CB    
3095 C CG    . LEU B 136 ? 1.0003 1.0122 0.9540 0.1000  0.0244  0.1231  133 LEU B CG    
3096 C CD1   . LEU B 136 ? 0.9900 0.9790 0.9253 0.0804  0.0275  0.1083  133 LEU B CD1   
3097 C CD2   . LEU B 136 ? 1.0285 1.0693 0.9829 0.0926  0.0137  0.1432  133 LEU B CD2   
3098 N N     . PRO B 137 ? 1.2064 1.0938 1.1708 0.1585  0.0279  0.1607  134 PRO B N     
3099 C CA    . PRO B 137 ? 1.2626 1.0880 1.2225 0.1757  0.0344  0.1584  134 PRO B CA    
3100 C C     . PRO B 137 ? 1.1976 0.9949 1.1436 0.1740  0.0467  0.1289  134 PRO B C     
3101 O O     . PRO B 137 ? 1.1153 0.9184 1.0461 0.1508  0.0469  0.1150  134 PRO B O     
3102 C CB    . PRO B 137 ? 1.2539 1.0352 1.1963 0.1601  0.0246  0.1749  134 PRO B CB    
3103 C CG    . PRO B 137 ? 1.2229 1.0560 1.1723 0.1467  0.0125  0.1958  134 PRO B CG    
3104 C CD    . PRO B 137 ? 1.1480 1.0393 1.1029 0.1389  0.0157  0.1800  134 PRO B CD    
3105 N N     . PRO B 138 ? 1.1745 0.9440 1.1257 0.1986  0.0577  0.1190  135 PRO B N     
3106 C CA    . PRO B 138 ? 1.1400 0.8892 1.0776 0.1974  0.0703  0.0902  135 PRO B CA    
3107 C C     . PRO B 138 ? 1.1598 0.8547 1.0654 0.1726  0.0688  0.0795  135 PRO B C     
3108 O O     . PRO B 138 ? 1.2657 0.9067 1.1582 0.1707  0.0642  0.0887  135 PRO B O     
3109 C CB    . PRO B 138 ? 1.1808 0.9056 1.1296 0.2316  0.0817  0.0857  135 PRO B CB    
3110 C CG    . PRO B 138 ? 1.2373 0.9984 1.2152 0.2519  0.0756  0.1121  135 PRO B CG    
3111 C CD    . PRO B 138 ? 1.2374 1.0014 1.2098 0.2305  0.0597  0.1343  135 PRO B CD    
3112 N N     . SER B 139 ? 1.1259 0.8363 1.0196 0.1523  0.0720  0.0614  136 SER B N     
3113 C CA    . SER B 139 ? 1.2451 0.9133 1.1090 0.1265  0.0710  0.0505  136 SER B CA    
3114 C C     . SER B 139 ? 1.2703 0.9390 1.1251 0.1244  0.0831  0.0236  136 SER B C     
3115 O O     . SER B 139 ? 1.1876 0.9050 1.0509 0.1156  0.0842  0.0171  136 SER B O     
3116 C CB    . SER B 139 ? 1.2087 0.9040 1.0675 0.0978  0.0595  0.0618  136 SER B CB    
3117 O OG    . SER B 139 ? 1.2483 0.9080 1.0800 0.0721  0.0582  0.0533  136 SER B OG    
3118 N N     . GLN B 140 ? 1.3386 0.9527 1.1757 0.1324  0.0920  0.0081  137 GLN B N     
3119 C CA    . GLN B 140 ? 1.3850 0.9973 1.2108 0.1316  0.1046  -0.0182 137 GLN B CA    
3120 C C     . GLN B 140 ? 1.3060 0.9780 1.1585 0.1511  0.1127  -0.0230 137 GLN B C     
3121 O O     . GLN B 140 ? 1.2421 0.9445 1.0933 0.1410  0.1179  -0.0371 137 GLN B O     
3122 C CB    . GLN B 140 ? 1.4306 1.0447 1.2351 0.0965  0.1008  -0.0265 137 GLN B CB    
3123 C CG    . GLN B 140 ? 1.6186 1.1735 1.3935 0.0742  0.0936  -0.0238 137 GLN B CG    
3124 C CD    . GLN B 140 ? 1.7274 1.2731 1.4765 0.0452  0.0952  -0.0398 137 GLN B CD    
3125 O OE1   . GLN B 140 ? 1.6935 1.2616 1.4424 0.0464  0.1048  -0.0574 137 GLN B OE1   
3126 N NE2   . GLN B 140 ? 1.7736 1.2895 1.5012 0.0177  0.0854  -0.0318 137 GLN B NE2   
3127 N N     . GLY B 141 ? 1.2651 0.9562 1.1428 0.1781  0.1128  -0.0092 138 GLY B N     
3128 C CA    . GLY B 141 ? 1.2499 0.9977 1.1540 0.1977  0.1198  -0.0110 138 GLY B CA    
3129 C C     . GLY B 141 ? 1.2157 1.0292 1.1392 0.1854  0.1106  0.0006  138 GLY B C     
3130 O O     . GLY B 141 ? 1.1715 1.0349 1.1174 0.1989  0.1145  0.0012  138 GLY B O     
3131 N N     . TYR B 142 ? 1.1887 1.0045 1.1040 0.1602  0.0988  0.0096  139 TYR B N     
3132 C CA    . TYR B 142 ? 1.1081 0.9809 1.0390 0.1484  0.0904  0.0184  139 TYR B CA    
3133 C C     . TYR B 142 ? 1.1097 0.9983 1.0546 0.1555  0.0801  0.0417  139 TYR B C     
3134 O O     . TYR B 142 ? 1.0991 0.9500 1.0360 0.1581  0.0757  0.0535  139 TYR B O     
3135 C CB    . TYR B 142 ? 1.1198 0.9923 1.0345 0.1175  0.0851  0.0128  139 TYR B CB    
3136 C CG    . TYR B 142 ? 1.2083 1.0754 1.1112 0.1074  0.0937  -0.0076 139 TYR B CG    
3137 C CD1   . TYR B 142 ? 1.2026 1.1159 1.1197 0.1058  0.0967  -0.0151 139 TYR B CD1   
3138 C CD2   . TYR B 142 ? 1.2705 1.0871 1.1473 0.0977  0.0979  -0.0186 139 TYR B CD2   
3139 C CE1   . TYR B 142 ? 1.1861 1.0981 1.0930 0.0955  0.1039  -0.0314 139 TYR B CE1   
3140 C CE2   . TYR B 142 ? 1.2906 1.1060 1.1554 0.0869  0.1055  -0.0365 139 TYR B CE2   
3141 C CZ    . TYR B 142 ? 1.2090 1.0736 1.0896 0.0861  0.1085  -0.0422 139 TYR B CZ    
3142 O OH    . TYR B 142 ? 1.1785 1.0454 1.0478 0.0742  0.1154  -0.0578 139 TYR B OH    
3143 N N     . LEU B 143 ? 1.1198 1.0653 1.0850 0.1569  0.0755  0.0488  140 LEU B N     
3144 C CA    . LEU B 143 ? 1.0745 1.0456 1.0541 0.1631  0.0658  0.0706  140 LEU B CA    
3145 C C     . LEU B 143 ? 1.0064 1.0193 0.9881 0.1430  0.0560  0.0750  140 LEU B C     
3146 O O     . LEU B 143 ? 1.0385 1.0671 1.0246 0.1420  0.0469  0.0925  140 LEU B O     
3147 C CB    . LEU B 143 ? 1.0651 1.0691 1.0701 0.1895  0.0695  0.0783  140 LEU B CB    
3148 C CG    . LEU B 143 ? 1.0631 1.0314 1.0713 0.2166  0.0801  0.0765  140 LEU B CG    
3149 C CD1   . LEU B 143 ? 1.0244 1.0391 1.0597 0.2404  0.0857  0.0804  140 LEU B CD1   
3150 C CD2   . LEU B 143 ? 1.1151 1.0424 1.1195 0.2252  0.0746  0.0946  140 LEU B CD2   
3151 N N     . TYR B 144 ? 0.9616 0.9927 0.9400 0.1273  0.0575  0.0600  141 TYR B N     
3152 C CA    . TYR B 144 ? 0.9303 0.9999 0.9117 0.1108  0.0495  0.0611  141 TYR B CA    
3153 C C     . TYR B 144 ? 0.9425 0.9957 0.9073 0.0888  0.0496  0.0499  141 TYR B C     
3154 O O     . TYR B 144 ? 1.0073 1.0269 0.9598 0.0846  0.0558  0.0400  141 TYR B O     
3155 C CB    . TYR B 144 ? 0.8861 1.0033 0.8860 0.1147  0.0498  0.0562  141 TYR B CB    
3156 C CG    . TYR B 144 ? 0.9474 1.0943 0.9662 0.1335  0.0475  0.0706  141 TYR B CG    
3157 C CD1   . TYR B 144 ? 0.9773 1.1151 1.0062 0.1561  0.0554  0.0730  141 TYR B CD1   
3158 C CD2   . TYR B 144 ? 0.8940 1.0805 0.9207 0.1289  0.0377  0.0819  141 TYR B CD2   
3159 C CE1   . TYR B 144 ? 1.0485 1.2173 1.0974 0.1744  0.0533  0.0887  141 TYR B CE1   
3160 C CE2   . TYR B 144 ? 0.8554 1.0736 0.9000 0.1444  0.0346  0.0973  141 TYR B CE2   
3161 C CZ    . TYR B 144 ? 0.9859 1.1961 1.0430 0.1675  0.0422  0.1018  141 TYR B CZ    
3162 O OH    . TYR B 144 ? 0.9778 1.2234 1.0553 0.1841  0.0392  0.1196  141 TYR B OH    
3163 N N     . VAL B 145 ? 0.8952 0.9741 0.8597 0.0747  0.0427  0.0518  142 VAL B N     
3164 C CA    . VAL B 145 ? 0.8476 0.9217 0.8015 0.0555  0.0425  0.0425  142 VAL B CA    
3165 C C     . VAL B 145 ? 0.8308 0.9448 0.7958 0.0492  0.0394  0.0353  142 VAL B C     
3166 O O     . VAL B 145 ? 0.7803 0.9230 0.7511 0.0504  0.0333  0.0416  142 VAL B O     
3167 C CB    . VAL B 145 ? 0.7681 0.8279 0.7077 0.0440  0.0374  0.0525  142 VAL B CB    
3168 C CG1   . VAL B 145 ? 0.7799 0.8477 0.7139 0.0262  0.0369  0.0447  142 VAL B CG1   
3169 C CG2   . VAL B 145 ? 0.7756 0.7886 0.7014 0.0453  0.0397  0.0580  142 VAL B CG2   
3170 N N     . LEU B 146 ? 0.8151 0.9304 0.7824 0.0418  0.0432  0.0225  143 LEU B N     
3171 C CA    . LEU B 146 ? 0.7305 0.8754 0.7067 0.0333  0.0398  0.0150  143 LEU B CA    
3172 C C     . LEU B 146 ? 0.7358 0.8762 0.7030 0.0192  0.0374  0.0134  143 LEU B C     
3173 O O     . LEU B 146 ? 0.7719 0.8911 0.7310 0.0105  0.0408  0.0107  143 LEU B O     
3174 C CB    . LEU B 146 ? 0.7818 0.9317 0.7665 0.0313  0.0440  0.0047  143 LEU B CB    
3175 C CG    . LEU B 146 ? 0.7683 0.9424 0.7626 0.0207  0.0397  -0.0027 143 LEU B CG    
3176 C CD1   . LEU B 146 ? 0.6159 0.8213 0.6197 0.0248  0.0332  0.0000  143 LEU B CD1   
3177 C CD2   . LEU B 146 ? 0.7167 0.8938 0.7186 0.0164  0.0435  -0.0099 143 LEU B CD2   
3178 N N     . VAL B 147 ? 0.7710 0.9338 0.7393 0.0170  0.0319  0.0154  144 VAL B N     
3179 C CA    . VAL B 147 ? 0.6333 0.7976 0.5942 0.0067  0.0306  0.0141  144 VAL B CA    
3180 C C     . VAL B 147 ? 0.6876 0.8654 0.6572 0.0002  0.0300  0.0016  144 VAL B C     
3181 O O     . VAL B 147 ? 0.7163 0.9141 0.6945 0.0023  0.0266  -0.0040 144 VAL B O     
3182 C CB    . VAL B 147 ? 0.6823 0.8643 0.6375 0.0085  0.0258  0.0225  144 VAL B CB    
3183 C CG1   . VAL B 147 ? 0.6822 0.8697 0.6302 -0.0006 0.0260  0.0208  144 VAL B CG1   
3184 C CG2   . VAL B 147 ? 0.7167 0.8838 0.6655 0.0149  0.0251  0.0376  144 VAL B CG2   
3185 N N     . VAL B 148 ? 0.6727 0.8393 0.6405 -0.0085 0.0327  -0.0018 145 VAL B N     
3186 C CA    . VAL B 148 ? 0.6882 0.8637 0.6649 -0.0143 0.0319  -0.0117 145 VAL B CA    
3187 C C     . VAL B 148 ? 0.7465 0.9247 0.7178 -0.0185 0.0327  -0.0107 145 VAL B C     
3188 O O     . VAL B 148 ? 0.8245 0.9905 0.7888 -0.0233 0.0354  -0.0031 145 VAL B O     
3189 C CB    . VAL B 148 ? 0.7139 0.8781 0.6980 -0.0201 0.0345  -0.0150 145 VAL B CB    
3190 C CG1   . VAL B 148 ? 0.6808 0.8542 0.6771 -0.0252 0.0320  -0.0236 145 VAL B CG1   
3191 C CG2   . VAL B 148 ? 0.5921 0.7545 0.5792 -0.0145 0.0358  -0.0145 145 VAL B CG2   
3192 N N     . VAL B 149 ? 0.6648 0.8597 0.6387 -0.0171 0.0306  -0.0185 146 VAL B N     
3193 C CA    . VAL B 149 ? 0.6860 0.8886 0.6560 -0.0183 0.0326  -0.0193 146 VAL B CA    
3194 C C     . VAL B 149 ? 0.6835 0.8875 0.6645 -0.0192 0.0328  -0.0318 146 VAL B C     
3195 O O     . VAL B 149 ? 0.6478 0.8568 0.6334 -0.0181 0.0292  -0.0424 146 VAL B O     
3196 C CB    . VAL B 149 ? 0.6470 0.8693 0.6065 -0.0141 0.0310  -0.0175 146 VAL B CB    
3197 C CG1   . VAL B 149 ? 0.6232 0.8591 0.5803 -0.0135 0.0342  -0.0223 146 VAL B CG1   
3198 C CG2   . VAL B 149 ? 0.6114 0.8293 0.5609 -0.0141 0.0304  -0.0016 146 VAL B CG2   
3199 N N     . ASP B 150 ? 0.6082 0.8075 0.5940 -0.0219 0.0364  -0.0295 147 ASP B N     
3200 C CA    . ASP B 150 ? 0.6754 0.8744 0.6728 -0.0207 0.0370  -0.0397 147 ASP B CA    
3201 C C     . ASP B 150 ? 0.6980 0.9122 0.6894 -0.0136 0.0384  -0.0497 147 ASP B C     
3202 O O     . ASP B 150 ? 0.6106 0.8387 0.5924 -0.0110 0.0417  -0.0437 147 ASP B O     
3203 C CB    . ASP B 150 ? 0.6335 0.8267 0.6395 -0.0246 0.0405  -0.0314 147 ASP B CB    
3204 C CG    . ASP B 150 ? 0.7151 0.9065 0.7356 -0.0212 0.0413  -0.0398 147 ASP B CG    
3205 O OD1   . ASP B 150 ? 0.8083 0.9900 0.8381 -0.0228 0.0372  -0.0483 147 ASP B OD1   
3206 O OD2   . ASP B 150 ? 0.7063 0.9065 0.7298 -0.0166 0.0459  -0.0371 147 ASP B OD2   
3207 N N     . GLY B 151 ? 0.6415 0.8536 0.6374 -0.0115 0.0358  -0.0653 148 GLY B N     
3208 C CA    . GLY B 151 ? 0.6472 0.8729 0.6337 -0.0054 0.0370  -0.0783 148 GLY B CA    
3209 C C     . GLY B 151 ? 0.7806 1.0133 0.7687 0.0019  0.0444  -0.0803 148 GLY B C     
3210 O O     . GLY B 151 ? 0.9442 1.1970 0.9204 0.0070  0.0481  -0.0834 148 GLY B O     
3211 N N     . MET B 152 ? 0.7044 0.9244 0.7083 0.0027  0.0469  -0.0771 149 MET B N     
3212 C CA    . MET B 152 ? 0.6591 0.8878 0.6684 0.0120  0.0544  -0.0788 149 MET B CA    
3213 C C     . MET B 152 ? 0.6709 0.9192 0.6758 0.0110  0.0590  -0.0603 149 MET B C     
3214 O O     . MET B 152 ? 0.8213 1.0919 0.8196 0.0182  0.0649  -0.0614 149 MET B O     
3215 C CB    . MET B 152 ? 0.6289 0.8384 0.6592 0.0136  0.0545  -0.0800 149 MET B CB    
3216 C CG    . MET B 152 ? 0.6515 0.8690 0.6912 0.0267  0.0627  -0.0831 149 MET B CG    
3217 S SD    . MET B 152 ? 0.7455 0.9838 0.7938 0.0256  0.0683  -0.0575 149 MET B SD    
3218 C CE    . MET B 152 ? 0.6898 0.9539 0.7376 0.0441  0.0795  -0.0657 149 MET B CE    
3219 N N     . THR B 153 ? 0.6229 0.8639 0.6303 0.0010  0.0564  -0.0434 150 THR B N     
3220 C CA    . THR B 153 ? 0.6235 0.8790 0.6267 -0.0034 0.0593  -0.0247 150 THR B CA    
3221 C C     . THR B 153 ? 0.6361 0.9007 0.6206 -0.0082 0.0570  -0.0169 150 THR B C     
3222 O O     . THR B 153 ? 0.8004 1.0824 0.7783 -0.0109 0.0594  -0.0033 150 THR B O     
3223 C CB    . THR B 153 ? 0.6476 0.8893 0.6602 -0.0138 0.0573  -0.0107 150 THR B CB    
3224 O OG1   . THR B 153 ? 0.6253 0.8478 0.6328 -0.0215 0.0519  -0.0112 150 THR B OG1   
3225 C CG2   . THR B 153 ? 0.6722 0.9078 0.7057 -0.0097 0.0589  -0.0138 150 THR B CG2   
3226 N N     . GLY B 154 ? 0.7043 0.9591 0.6814 -0.0097 0.0520  -0.0231 151 GLY B N     
3227 C CA    . GLY B 154 ? 0.6959 0.9547 0.6584 -0.0141 0.0489  -0.0124 151 GLY B CA    
3228 C C     . GLY B 154 ? 0.7887 1.0282 0.7495 -0.0236 0.0465  0.0020  151 GLY B C     
3229 O O     . GLY B 154 ? 0.6364 0.8742 0.5854 -0.0272 0.0439  0.0127  151 GLY B O     
3230 N N     . PHE B 155 ? 0.7189 0.9429 0.6903 -0.0282 0.0471  0.0027  152 PHE B N     
3231 C CA    . PHE B 155 ? 0.6654 0.8703 0.6327 -0.0383 0.0455  0.0137  152 PHE B CA    
3232 C C     . PHE B 155 ? 0.6875 0.8765 0.6496 -0.0369 0.0422  0.0099  152 PHE B C     
3233 O O     . PHE B 155 ? 0.7452 0.9349 0.7142 -0.0312 0.0406  -0.0018 152 PHE B O     
3234 C CB    . PHE B 155 ? 0.7714 0.9684 0.7516 -0.0439 0.0467  0.0144  152 PHE B CB    
3235 C CG    . PHE B 155 ? 0.6472 0.8308 0.6204 -0.0570 0.0461  0.0269  152 PHE B CG    
3236 C CD1   . PHE B 155 ? 0.6184 0.7809 0.5874 -0.0616 0.0445  0.0245  152 PHE B CD1   
3237 C CD2   . PHE B 155 ? 0.6385 0.8322 0.6087 -0.0653 0.0472  0.0408  152 PHE B CD2   
3238 C CE1   . PHE B 155 ? 0.6705 0.8185 0.6300 -0.0745 0.0444  0.0333  152 PHE B CE1   
3239 C CE2   . PHE B 155 ? 0.6446 0.8247 0.6057 -0.0801 0.0458  0.0515  152 PHE B CE2   
3240 C CZ    . PHE B 155 ? 0.5960 0.7513 0.5505 -0.0848 0.0444  0.0466  152 PHE B CZ    
3241 N N     . THR B 156 ? 0.7407 0.9153 0.6912 -0.0423 0.0410  0.0202  153 THR B N     
3242 C CA    . THR B 156 ? 0.7235 0.8850 0.6689 -0.0379 0.0388  0.0189  153 THR B CA    
3243 C C     . THR B 156 ? 0.7641 0.8997 0.7059 -0.0440 0.0398  0.0210  153 THR B C     
3244 O O     . THR B 156 ? 0.7721 0.8955 0.7050 -0.0541 0.0405  0.0297  153 THR B O     
3245 C CB    . THR B 156 ? 0.6697 0.8359 0.6031 -0.0356 0.0363  0.0291  153 THR B CB    
3246 O OG1   . THR B 156 ? 0.7489 0.9432 0.6838 -0.0303 0.0358  0.0256  153 THR B OG1   
3247 C CG2   . THR B 156 ? 0.6331 0.7860 0.5641 -0.0289 0.0342  0.0298  153 THR B CG2   
3248 N N     . TRP B 157 ? 0.6922 0.8215 0.6399 -0.0385 0.0400  0.0129  154 TRP B N     
3249 C CA    . TRP B 157 ? 0.6223 0.7288 0.5647 -0.0406 0.0422  0.0126  154 TRP B CA    
3250 C C     . TRP B 157 ? 0.7626 0.8618 0.7011 -0.0294 0.0415  0.0139  154 TRP B C     
3251 O O     . TRP B 157 ? 0.7358 0.8530 0.6822 -0.0202 0.0392  0.0112  154 TRP B O     
3252 C CB    . TRP B 157 ? 0.6839 0.7935 0.6382 -0.0426 0.0438  0.0036  154 TRP B CB    
3253 C CG    . TRP B 157 ? 0.6975 0.8131 0.6585 -0.0533 0.0441  0.0042  154 TRP B CG    
3254 C CD1   . TRP B 157 ? 0.7467 0.8518 0.7029 -0.0654 0.0459  0.0079  154 TRP B CD1   
3255 C CD2   . TRP B 157 ? 0.7716 0.9052 0.7460 -0.0524 0.0425  0.0015  154 TRP B CD2   
3256 N NE1   . TRP B 157 ? 0.7189 0.8373 0.6868 -0.0719 0.0451  0.0102  154 TRP B NE1   
3257 C CE2   . TRP B 157 ? 0.6967 0.8305 0.6764 -0.0629 0.0433  0.0058  154 TRP B CE2   
3258 C CE3   . TRP B 157 ? 0.6857 0.8344 0.6673 -0.0440 0.0403  -0.0046 154 TRP B CE3   
3259 C CZ2   . TRP B 157 ? 0.6700 0.8171 0.6645 -0.0627 0.0425  0.0052  154 TRP B CZ2   
3260 C CZ3   . TRP B 157 ? 0.7325 0.8914 0.7259 -0.0444 0.0400  -0.0081 154 TRP B CZ3   
3261 C CH2   . TRP B 157 ? 0.7614 0.9186 0.7623 -0.0526 0.0412  -0.0027 154 TRP B CH2   
3262 N N     . LEU B 158 ? 0.8663 0.9386 0.7926 -0.0302 0.0434  0.0181  155 LEU B N     
3263 C CA    . LEU B 158 ? 0.9026 0.9638 0.8264 -0.0176 0.0434  0.0210  155 LEU B CA    
3264 C C     . LEU B 158 ? 0.9630 1.0037 0.8847 -0.0140 0.0489  0.0135  155 LEU B C     
3265 O O     . LEU B 158 ? 1.1592 1.1757 1.0682 -0.0238 0.0517  0.0119  155 LEU B O     
3266 C CB    . LEU B 158 ? 0.8048 0.8484 0.7148 -0.0197 0.0404  0.0341  155 LEU B CB    
3267 C CG    . LEU B 158 ? 0.8340 0.9006 0.7435 -0.0238 0.0356  0.0433  155 LEU B CG    
3268 C CD1   . LEU B 158 ? 0.8366 0.8841 0.7319 -0.0283 0.0320  0.0587  155 LEU B CD1   
3269 C CD2   . LEU B 158 ? 0.8184 0.9159 0.7399 -0.0126 0.0331  0.0411  155 LEU B CD2   
3270 N N     . TYR B 159 ? 0.8880 0.9407 0.8212 -0.0003 0.0507  0.0089  156 TYR B N     
3271 C CA    . TYR B 159 ? 0.8481 0.8875 0.7806 0.0061  0.0572  0.0012  156 TYR B CA    
3272 C C     . TYR B 159 ? 0.8927 0.9224 0.8266 0.0247  0.0590  0.0056  156 TYR B C     
3273 O O     . TYR B 159 ? 0.9152 0.9700 0.8621 0.0352  0.0554  0.0110  156 TYR B O     
3274 C CB    . TYR B 159 ? 0.8231 0.8902 0.7709 0.0054  0.0587  -0.0072 156 TYR B CB    
3275 C CG    . TYR B 159 ? 0.8279 0.9005 0.7758 -0.0119 0.0575  -0.0105 156 TYR B CG    
3276 C CD1   . TYR B 159 ? 0.7633 0.8169 0.6994 -0.0231 0.0615  -0.0139 156 TYR B CD1   
3277 C CD2   . TYR B 159 ? 0.6856 0.7820 0.6453 -0.0169 0.0522  -0.0100 156 TYR B CD2   
3278 C CE1   . TYR B 159 ? 0.8024 0.8641 0.7407 -0.0389 0.0598  -0.0139 156 TYR B CE1   
3279 C CE2   . TYR B 159 ? 0.7573 0.8579 0.7198 -0.0305 0.0512  -0.0113 156 TYR B CE2   
3280 C CZ    . TYR B 159 ? 0.8872 0.9723 0.8402 -0.0414 0.0547  -0.0119 156 TYR B CZ    
3281 O OH    . TYR B 159 ? 1.0138 1.1063 0.9717 -0.0549 0.0532  -0.0103 156 TYR B OH    
3282 N N     . PRO B 160 ? 0.8945 0.8884 0.8153 0.0294  0.0641  0.0039  157 PRO B N     
3283 C CA    . PRO B 160 ? 0.9594 0.9422 0.8841 0.0503  0.0669  0.0080  157 PRO B CA    
3284 C C     . PRO B 160 ? 0.9160 0.9191 0.8545 0.0644  0.0739  -0.0006 157 PRO B C     
3285 O O     . PRO B 160 ? 0.9269 0.9300 0.8621 0.0585  0.0799  -0.0125 157 PRO B O     
3286 C CB    . PRO B 160 ? 1.0080 0.9390 0.9110 0.0479  0.0701  0.0069  157 PRO B CB    
3287 C CG    . PRO B 160 ? 0.9566 0.8790 0.8468 0.0287  0.0730  -0.0043 157 PRO B CG    
3288 C CD    . PRO B 160 ? 0.8472 0.8074 0.7481 0.0152  0.0674  -0.0018 157 PRO B CD    
3289 N N     . THR B 161 ? 0.8639 0.8892 0.8187 0.0823  0.0727  0.0072  158 THR B N     
3290 C CA    . THR B 161 ? 0.8867 0.9373 0.8572 0.0975  0.0791  0.0023  158 THR B CA    
3291 C C     . THR B 161 ? 0.9721 1.0118 0.9490 0.1227  0.0828  0.0104  158 THR B C     
3292 O O     . THR B 161 ? 0.9132 0.9281 0.8842 0.1271  0.0787  0.0213  158 THR B O     
3293 C CB    . THR B 161 ? 0.7968 0.8989 0.7864 0.0933  0.0730  0.0051  158 THR B CB    
3294 O OG1   . THR B 161 ? 0.7852 0.9055 0.7844 0.1013  0.0655  0.0192  158 THR B OG1   
3295 C CG2   . THR B 161 ? 0.7117 0.8204 0.6963 0.0700  0.0678  -0.0004 158 THR B CG2   
3296 N N     . LYS B 162 ? 0.9572 1.0178 0.9478 0.1396  0.0906  0.0063  159 LYS B N     
3297 C CA    . LYS B 162 ? 0.9940 1.0493 0.9950 0.1673  0.0958  0.0140  159 LYS B CA    
3298 C C     . LYS B 162 ? 0.9260 1.0331 0.9527 0.1786  0.0900  0.0292  159 LYS B C     
3299 O O     . LYS B 162 ? 0.9645 1.0724 1.0033 0.2019  0.0923  0.0406  159 LYS B O     
3300 C CB    . LYS B 162 ? 1.0634 1.1074 1.0622 0.1823  0.1104  -0.0005 159 LYS B CB    
3301 C CG    . LYS B 162 ? 1.1417 1.1289 1.1123 0.1737  0.1167  -0.0156 159 LYS B CG    
3302 C CD    . LYS B 162 ? 1.1928 1.1721 1.1593 0.1888  0.1322  -0.0322 159 LYS B CD    
3303 C CE    . LYS B 162 ? 1.2486 1.1685 1.1837 0.1788  0.1379  -0.0481 159 LYS B CE    
3304 N NZ    . LYS B 162 ? 1.2984 1.2112 1.2258 0.1922  0.1538  -0.0672 159 LYS B NZ    
3305 N N     . ALA B 163 ? 0.8896 1.0389 0.9248 0.1625  0.0823  0.0302  160 ALA B N     
3306 C CA    . ALA B 163 ? 0.8479 1.0486 0.9050 0.1686  0.0754  0.0438  160 ALA B CA    
3307 C C     . ALA B 163 ? 0.8250 1.0526 0.8813 0.1439  0.0650  0.0414  160 ALA B C     
3308 O O     . ALA B 163 ? 0.7650 0.9824 0.8113 0.1269  0.0662  0.0282  160 ALA B O     
3309 C CB    . ALA B 163 ? 0.7616 0.9976 0.8379 0.1857  0.0835  0.0432  160 ALA B CB    
3310 N N     . PRO B 164 ? 0.7811 1.0427 0.8473 0.1414  0.0548  0.0538  161 PRO B N     
3311 C CA    . PRO B 164 ? 0.7525 1.0400 0.8179 0.1194  0.0453  0.0494  161 PRO B CA    
3312 C C     . PRO B 164 ? 0.7661 1.0929 0.8463 0.1146  0.0450  0.0449  161 PRO B C     
3313 O O     . PRO B 164 ? 0.8136 1.1796 0.9038 0.1077  0.0362  0.0507  161 PRO B O     
3314 C CB    . PRO B 164 ? 0.7605 1.0692 0.8291 0.1202  0.0353  0.0645  161 PRO B CB    
3315 C CG    . PRO B 164 ? 0.8154 1.1360 0.8993 0.1445  0.0388  0.0798  161 PRO B CG    
3316 C CD    . PRO B 164 ? 0.7860 1.0643 0.8646 0.1590  0.0514  0.0728  161 PRO B CD    
3317 N N     . SER B 165 ? 0.7274 1.0449 0.8079 0.1170  0.0544  0.0351  162 SER B N     
3318 C CA    . SER B 165 ? 0.7368 1.0925 0.8323 0.1142  0.0556  0.0330  162 SER B CA    
3319 C C     . SER B 165 ? 0.7584 1.1098 0.8473 0.0904  0.0524  0.0208  162 SER B C     
3320 O O     . SER B 165 ? 0.8205 1.1364 0.8936 0.0799  0.0526  0.0126  162 SER B O     
3321 C CB    . SER B 165 ? 0.6661 1.0209 0.7677 0.1345  0.0691  0.0313  162 SER B CB    
3322 O OG    . SER B 165 ? 0.7559 1.0657 0.8393 0.1323  0.0778  0.0181  162 SER B OG    
3323 N N     . THR B 166 ? 0.7113 1.1013 0.8141 0.0818  0.0489  0.0215  163 THR B N     
3324 C CA    . THR B 166 ? 0.6776 1.0652 0.7777 0.0601  0.0457  0.0122  163 THR B CA    
3325 C C     . THR B 166 ? 0.7099 1.0703 0.8003 0.0610  0.0567  0.0029  163 THR B C     
3326 O O     . THR B 166 ? 0.7587 1.0954 0.8389 0.0453  0.0551  -0.0047 163 THR B O     
3327 C CB    . THR B 166 ? 0.6551 1.0902 0.7728 0.0505  0.0395  0.0172  163 THR B CB    
3328 O OG1   . THR B 166 ? 0.7658 1.2267 0.8902 0.0475  0.0285  0.0255  163 THR B OG1   
3329 C CG2   . THR B 166 ? 0.5735 1.0034 0.6896 0.0270  0.0344  0.0097  163 THR B CG2   
3330 N N     . SER B 167 ? 0.7116 1.0761 0.8049 0.0796  0.0681  0.0033  164 SER B N     
3331 C CA    A SER B 167 ? 0.7294 1.0688 0.8105 0.0803  0.0793  -0.0072 164 SER B CA    
3332 C CA    B SER B 167 ? 0.7222 1.0616 0.8033 0.0803  0.0793  -0.0072 164 SER B CA    
3333 C C     . SER B 167 ? 0.7260 1.0136 0.7856 0.0753  0.0800  -0.0135 164 SER B C     
3334 O O     . SER B 167 ? 0.7426 1.0129 0.7919 0.0585  0.0797  -0.0206 164 SER B O     
3335 C CB    A SER B 167 ? 0.6544 1.0025 0.7400 0.1050  0.0925  -0.0074 164 SER B CB    
3336 C CB    B SER B 167 ? 0.6544 1.0025 0.7400 0.1051  0.0925  -0.0073 164 SER B CB    
3337 O OG    A SER B 167 ? 0.6447 1.0456 0.7498 0.1072  0.0935  -0.0018 164 SER B OG    
3338 O OG    B SER B 167 ? 0.6728 0.9890 0.7413 0.1067  0.1038  -0.0198 164 SER B OG    
3339 N N     . ALA B 168 ? 0.8418 1.1067 0.8955 0.0889  0.0801  -0.0090 165 ALA B N     
3340 C CA    . ALA B 168 ? 0.7927 1.0112 0.8264 0.0832  0.0798  -0.0126 165 ALA B CA    
3341 C C     . ALA B 168 ? 0.7490 0.9658 0.7791 0.0612  0.0699  -0.0133 165 ALA B C     
3342 O O     . ALA B 168 ? 0.8096 0.9983 0.8253 0.0491  0.0707  -0.0186 165 ALA B O     
3343 C CB    . ALA B 168 ? 0.7077 0.9082 0.7388 0.1001  0.0793  -0.0038 165 ALA B CB    
3344 N N     . THR B 169 ? 0.7280 0.9752 0.7709 0.0558  0.0606  -0.0082 166 THR B N     
3345 C CA    . THR B 169 ? 0.6736 0.9187 0.7138 0.0373  0.0520  -0.0106 166 THR B CA    
3346 C C     . THR B 169 ? 0.6603 0.9047 0.7012 0.0215  0.0530  -0.0174 166 THR B C     
3347 O O     . THR B 169 ? 0.6424 0.8651 0.6741 0.0098  0.0519  -0.0208 166 THR B O     
3348 C CB    . THR B 169 ? 0.6212 0.8983 0.6734 0.0344  0.0421  -0.0060 166 THR B CB    
3349 O OG1   . THR B 169 ? 0.6763 0.9559 0.7270 0.0473  0.0403  0.0023  166 THR B OG1   
3350 C CG2   . THR B 169 ? 0.5873 0.8593 0.6362 0.0169  0.0343  -0.0113 166 THR B CG2   
3351 N N     . VAL B 170 ? 0.5935 0.8651 0.6466 0.0205  0.0547  -0.0175 167 VAL B N     
3352 C CA    . VAL B 170 ? 0.6456 0.9209 0.7010 0.0045  0.0549  -0.0213 167 VAL B CA    
3353 C C     . VAL B 170 ? 0.6940 0.9402 0.7333 0.0031  0.0637  -0.0267 167 VAL B C     
3354 O O     . VAL B 170 ? 0.7104 0.9446 0.7450 -0.0124 0.0617  -0.0285 167 VAL B O     
3355 C CB    . VAL B 170 ? 0.6254 0.9404 0.6969 0.0039  0.0551  -0.0182 167 VAL B CB    
3356 C CG1   . VAL B 170 ? 0.6239 0.9426 0.6952 -0.0097 0.0584  -0.0209 167 VAL B CG1   
3357 C CG2   . VAL B 170 ? 0.5652 0.9063 0.6509 -0.0048 0.0431  -0.0133 167 VAL B CG2   
3358 N N     . LYS B 171 ? 0.6357 0.8697 0.6663 0.0189  0.0732  -0.0292 168 LYS B N     
3359 C CA    . LYS B 171 ? 0.6630 0.8663 0.6748 0.0164  0.0814  -0.0360 168 LYS B CA    
3360 C C     . LYS B 171 ? 0.6854 0.8562 0.6834 0.0060  0.0771  -0.0353 168 LYS B C     
3361 O O     . LYS B 171 ? 0.8081 0.9638 0.7950 -0.0079 0.0787  -0.0384 168 LYS B O     
3362 C CB    . LYS B 171 ? 0.7162 0.9058 0.7202 0.0374  0.0920  -0.0399 168 LYS B CB    
3363 C CG    . LYS B 171 ? 0.8386 0.9887 0.8187 0.0347  0.1001  -0.0488 168 LYS B CG    
3364 C CD    . LYS B 171 ? 1.0439 1.1813 1.0174 0.0568  0.1120  -0.0554 168 LYS B CD    
3365 C CE    . LYS B 171 ? 1.2173 1.3105 1.1636 0.0519  0.1193  -0.0664 168 LYS B CE    
3366 N NZ    . LYS B 171 ? 1.2817 1.3612 1.2203 0.0734  0.1327  -0.0766 168 LYS B NZ    
3367 N N     . SER B 172 ? 0.7418 0.9060 0.7408 0.0116  0.0713  -0.0300 169 SER B N     
3368 C CA    . SER B 172 ? 0.7238 0.8623 0.7105 0.0027  0.0676  -0.0278 169 SER B CA    
3369 C C     . SER B 172 ? 0.7229 0.8730 0.7172 -0.0136 0.0605  -0.0267 169 SER B C     
3370 O O     . SER B 172 ? 0.7416 0.8760 0.7272 -0.0256 0.0601  -0.0261 169 SER B O     
3371 C CB    . SER B 172 ? 0.6904 0.8212 0.6748 0.0143  0.0643  -0.0216 169 SER B CB    
3372 O OG    . SER B 172 ? 0.8027 0.9139 0.7790 0.0293  0.0707  -0.0212 169 SER B OG    
3373 N N     . LEU B 173 ? 0.6873 0.8642 0.6981 -0.0144 0.0546  -0.0258 170 LEU B N     
3374 C CA    . LEU B 173 ? 0.6259 0.8094 0.6448 -0.0282 0.0480  -0.0256 170 LEU B CA    
3375 C C     . LEU B 173 ? 0.6263 0.8132 0.6486 -0.0416 0.0495  -0.0260 170 LEU B C     
3376 O O     . LEU B 173 ? 0.6129 0.7961 0.6388 -0.0532 0.0457  -0.0241 170 LEU B O     
3377 C CB    . LEU B 173 ? 0.5813 0.7884 0.6146 -0.0271 0.0405  -0.0257 170 LEU B CB    
3378 C CG    . LEU B 173 ? 0.5918 0.8002 0.6216 -0.0178 0.0370  -0.0246 170 LEU B CG    
3379 C CD1   . LEU B 173 ? 0.7433 0.9752 0.7852 -0.0209 0.0288  -0.0262 170 LEU B CD1   
3380 C CD2   . LEU B 173 ? 0.6097 0.7985 0.6285 -0.0204 0.0366  -0.0244 170 LEU B CD2   
3381 N N     . ASN B 174 ? 0.6764 0.8727 0.6986 -0.0396 0.0553  -0.0278 171 ASN B N     
3382 C CA    . ASN B 174 ? 0.6738 0.8758 0.6967 -0.0536 0.0572  -0.0273 171 ASN B CA    
3383 C C     . ASN B 174 ? 0.7356 0.9129 0.7427 -0.0626 0.0598  -0.0269 171 ASN B C     
3384 O O     . ASN B 174 ? 0.7694 0.9511 0.7798 -0.0779 0.0576  -0.0230 171 ASN B O     
3385 C CB    . ASN B 174 ? 0.5839 0.8024 0.6062 -0.0482 0.0648  -0.0307 171 ASN B CB    
3386 C CG    . ASN B 174 ? 0.6033 0.8576 0.6455 -0.0521 0.0602  -0.0269 171 ASN B CG    
3387 O OD1   . ASN B 174 ? 0.6123 0.8746 0.6676 -0.0623 0.0507  -0.0222 171 ASN B OD1   
3388 N ND2   . ASN B 174 ? 0.5776 0.8536 0.6221 -0.0441 0.0670  -0.0288 171 ASN B ND2   
3389 N N     . VAL B 175 ? 0.6936 0.8461 0.6843 -0.0547 0.0637  -0.0291 172 VAL B N     
3390 C CA    . VAL B 175 ? 0.6076 0.7374 0.5825 -0.0653 0.0647  -0.0271 172 VAL B CA    
3391 C C     . VAL B 175 ? 0.7828 0.9144 0.7661 -0.0725 0.0575  -0.0202 172 VAL B C     
3392 O O     . VAL B 175 ? 0.8172 0.9483 0.7999 -0.0866 0.0559  -0.0152 172 VAL B O     
3393 C CB    . VAL B 175 ? 0.6352 0.7360 0.5903 -0.0559 0.0695  -0.0301 172 VAL B CB    
3394 C CG1   . VAL B 175 ? 0.6443 0.7228 0.5821 -0.0701 0.0692  -0.0268 172 VAL B CG1   
3395 C CG2   . VAL B 175 ? 0.6529 0.7499 0.6006 -0.0457 0.0780  -0.0384 172 VAL B CG2   
3396 N N     . LEU B 176 ? 0.7899 0.9257 0.7812 -0.0626 0.0534  -0.0198 173 LEU B N     
3397 C CA    . LEU B 176 ? 0.7445 0.8818 0.7423 -0.0665 0.0482  -0.0156 173 LEU B CA    
3398 C C     . LEU B 176 ? 0.7832 0.9355 0.7990 -0.0757 0.0436  -0.0135 173 LEU B C     
3399 O O     . LEU B 176 ? 0.8130 0.9642 0.8331 -0.0833 0.0416  -0.0081 173 LEU B O     
3400 C CB    . LEU B 176 ? 0.6169 0.7571 0.6165 -0.0541 0.0454  -0.0175 173 LEU B CB    
3401 C CG    . LEU B 176 ? 0.6397 0.7831 0.6444 -0.0553 0.0414  -0.0158 173 LEU B CG    
3402 C CD1   . LEU B 176 ? 0.7138 0.8458 0.7076 -0.0616 0.0435  -0.0089 173 LEU B CD1   
3403 C CD2   . LEU B 176 ? 0.6740 0.8242 0.6783 -0.0442 0.0388  -0.0191 173 LEU B CD2   
3404 N N     . THR B 177 ? 0.6531 0.8208 0.6809 -0.0752 0.0416  -0.0162 174 THR B N     
3405 C CA    . THR B 177 ? 0.6221 0.8018 0.6681 -0.0845 0.0357  -0.0131 174 THR B CA    
3406 C C     . THR B 177 ? 0.7665 0.9510 0.8146 -0.0990 0.0367  -0.0063 174 THR B C     
3407 O O     . THR B 177 ? 0.8759 1.0697 0.9404 -0.1080 0.0312  -0.0007 174 THR B O     
3408 C CB    . THR B 177 ? 0.6058 0.8022 0.6636 -0.0817 0.0316  -0.0164 174 THR B CB    
3409 O OG1   . THR B 177 ? 0.7021 0.9073 0.7532 -0.0763 0.0371  -0.0186 174 THR B OG1   
3410 C CG2   . THR B 177 ? 0.5402 0.7348 0.5998 -0.0725 0.0274  -0.0218 174 THR B CG2   
3411 N N     . SER B 178 ? 0.7824 0.9602 0.8139 -0.1023 0.0431  -0.0063 175 SER B N     
3412 C CA    . SER B 178 ? 0.7656 0.9477 0.7954 -0.1182 0.0437  0.0009  175 SER B CA    
3413 C C     . SER B 178 ? 0.7324 0.9043 0.7593 -0.1241 0.0422  0.0085  175 SER B C     
3414 O O     . SER B 178 ? 0.7369 0.9133 0.7610 -0.1384 0.0423  0.0163  175 SER B O     
3415 C CB    . SER B 178 ? 0.8359 1.0156 0.8464 -0.1211 0.0513  -0.0043 175 SER B CB    
3416 O OG    . SER B 178 ? 1.0523 1.2081 1.0418 -0.1161 0.0559  -0.0084 175 SER B OG    
3417 N N     . ILE B 179 ? 0.6423 0.8046 0.6697 -0.1137 0.0410  0.0070  176 ILE B N     
3418 C CA    . ILE B 179 ? 0.5962 0.7548 0.6246 -0.1169 0.0397  0.0150  176 ILE B CA    
3419 C C     . ILE B 179 ? 0.6052 0.7693 0.6542 -0.1103 0.0350  0.0163  176 ILE B C     
3420 O O     . ILE B 179 ? 0.7117 0.8818 0.7737 -0.1159 0.0325  0.0258  176 ILE B O     
3421 C CB    . ILE B 179 ? 0.6178 0.7615 0.6264 -0.1111 0.0432  0.0130  176 ILE B CB    
3422 C CG1   . ILE B 179 ? 0.7682 0.9009 0.7554 -0.1215 0.0472  0.0134  176 ILE B CG1   
3423 C CG2   . ILE B 179 ? 0.6091 0.7557 0.6226 -0.1103 0.0416  0.0208  176 ILE B CG2   
3424 C CD1   . ILE B 179 ? 0.9667 1.0800 0.9335 -0.1172 0.0496  0.0119  176 ILE B CD1   
3425 N N     . ALA B 180 ? 0.5556 0.7176 0.6075 -0.0982 0.0337  0.0066  177 ALA B N     
3426 C CA    . ALA B 180 ? 0.5867 0.7501 0.6550 -0.0920 0.0293  0.0038  177 ALA B CA    
3427 C C     . ALA B 180 ? 0.6458 0.8109 0.7161 -0.0856 0.0265  -0.0066 177 ALA B C     
3428 O O     . ALA B 180 ? 0.7599 0.9250 0.8174 -0.0799 0.0291  -0.0117 177 ALA B O     
3429 C CB    . ALA B 180 ? 0.5897 0.7496 0.6541 -0.0832 0.0315  0.0034  177 ALA B CB    
3430 N N     . ILE B 181 ? 0.6191 0.7853 0.7057 -0.0871 0.0206  -0.0087 178 ILE B N     
3431 C CA    . ILE B 181 ? 0.6240 0.7942 0.7141 -0.0849 0.0159  -0.0171 178 ILE B CA    
3432 C C     . ILE B 181 ? 0.6547 0.8167 0.7469 -0.0769 0.0130  -0.0266 178 ILE B C     
3433 O O     . ILE B 181 ? 0.6132 0.7665 0.7167 -0.0771 0.0111  -0.0256 178 ILE B O     
3434 C CB    . ILE B 181 ? 0.6437 0.8218 0.7494 -0.0969 0.0098  -0.0117 178 ILE B CB    
3435 C CG1   . ILE B 181 ? 0.6606 0.8498 0.7624 -0.1053 0.0139  -0.0033 178 ILE B CG1   
3436 C CG2   . ILE B 181 ? 0.6642 0.8499 0.7727 -0.0967 0.0043  -0.0188 178 ILE B CG2   
3437 C CD1   . ILE B 181 ? 0.5274 0.7303 0.6440 -0.1188 0.0084  0.0045  178 ILE B CD1   
3438 N N     . PRO B 182 ? 0.6865 0.8516 0.7682 -0.0693 0.0129  -0.0358 179 PRO B N     
3439 C CA    . PRO B 182 ? 0.6542 0.8132 0.7347 -0.0629 0.0105  -0.0469 179 PRO B CA    
3440 C C     . PRO B 182 ? 0.5741 0.7295 0.6655 -0.0696 0.0018  -0.0533 179 PRO B C     
3441 O O     . PRO B 182 ? 0.7730 0.9372 0.8704 -0.0782 -0.0028 -0.0492 179 PRO B O     
3442 C CB    . PRO B 182 ? 0.6827 0.8509 0.7466 -0.0549 0.0129  -0.0515 179 PRO B CB    
3443 C CG    . PRO B 182 ? 0.7268 0.9055 0.7899 -0.0582 0.0127  -0.0457 179 PRO B CG    
3444 C CD    . PRO B 182 ? 0.6917 0.8670 0.7618 -0.0657 0.0152  -0.0360 179 PRO B CD    
3445 N N     . LYS B 183 ? 0.6692 0.8114 0.7626 -0.0658 -0.0004 -0.0636 180 LYS B N     
3446 C CA    . LYS B 183 ? 0.6735 0.8071 0.7737 -0.0732 -0.0096 -0.0720 180 LYS B CA    
3447 C C     . LYS B 183 ? 0.6545 0.8021 0.7426 -0.0749 -0.0136 -0.0796 180 LYS B C     
3448 O O     . LYS B 183 ? 0.6732 0.8257 0.7671 -0.0860 -0.0220 -0.0792 180 LYS B O     
3449 C CB    . LYS B 183 ? 0.7495 0.8610 0.8530 -0.0674 -0.0100 -0.0835 180 LYS B CB    
3450 C CG    . LYS B 183 ? 0.7898 0.8887 0.9106 -0.0660 -0.0077 -0.0736 180 LYS B CG    
3451 C CD    . LYS B 183 ? 0.8561 0.9316 0.9822 -0.0573 -0.0075 -0.0857 180 LYS B CD    
3452 C CE    . LYS B 183 ? 0.9535 1.0200 1.1001 -0.0545 -0.0053 -0.0724 180 LYS B CE    
3453 N NZ    . LYS B 183 ? 0.9677 1.0110 1.1216 -0.0421 -0.0033 -0.0837 180 LYS B NZ    
3454 N N     . VAL B 184 ? 0.7045 0.8620 0.7768 -0.0652 -0.0084 -0.0842 181 VAL B N     
3455 C CA    . VAL B 184 ? 0.7394 0.9136 0.8003 -0.0658 -0.0121 -0.0895 181 VAL B CA    
3456 C C     . VAL B 184 ? 0.7199 0.9105 0.7710 -0.0571 -0.0054 -0.0810 181 VAL B C     
3457 O O     . VAL B 184 ? 0.6566 0.8424 0.7024 -0.0493 0.0020  -0.0777 181 VAL B O     
3458 C CB    . VAL B 184 ? 0.6381 0.8056 0.6874 -0.0637 -0.0146 -0.1069 181 VAL B CB    
3459 C CG1   . VAL B 184 ? 0.6425 0.8328 0.6786 -0.0650 -0.0185 -0.1100 181 VAL B CG1   
3460 C CG2   . VAL B 184 ? 0.6595 0.8050 0.7175 -0.0729 -0.0224 -0.1168 181 VAL B CG2   
3461 N N     . ILE B 185 ? 0.6766 0.8867 0.7262 -0.0587 -0.0083 -0.0761 182 ILE B N     
3462 C CA    . ILE B 185 ? 0.7250 0.9492 0.7650 -0.0493 -0.0035 -0.0689 182 ILE B CA    
3463 C C     . ILE B 185 ? 0.7592 1.0011 0.7898 -0.0488 -0.0088 -0.0744 182 ILE B C     
3464 O O     . ILE B 185 ? 0.8118 1.0647 0.8465 -0.0575 -0.0168 -0.0777 182 ILE B O     
3465 C CB    . ILE B 185 ? 0.6351 0.8694 0.6823 -0.0484 -0.0011 -0.0571 182 ILE B CB    
3466 C CG1   . ILE B 185 ? 0.6189 0.8376 0.6703 -0.0491 0.0052  -0.0515 182 ILE B CG1   
3467 C CG2   . ILE B 185 ? 0.5762 0.8243 0.6150 -0.0379 0.0020  -0.0503 182 ILE B CG2   
3468 C CD1   . ILE B 185 ? 0.5591 0.7862 0.6142 -0.0475 0.0092  -0.0427 182 ILE B CD1   
3469 N N     . HIS B 186 ? 0.7065 0.9532 0.7240 -0.0406 -0.0050 -0.0742 183 HIS B N     
3470 C CA    . HIS B 186 ? 0.6565 0.9237 0.6633 -0.0405 -0.0097 -0.0776 183 HIS B CA    
3471 C C     . HIS B 186 ? 0.7611 1.0453 0.7651 -0.0318 -0.0074 -0.0629 183 HIS B C     
3472 O O     . HIS B 186 ? 0.8574 1.1314 0.8594 -0.0241 -0.0006 -0.0545 183 HIS B O     
3473 C CB    . HIS B 186 ? 0.6295 0.8920 0.6226 -0.0388 -0.0079 -0.0899 183 HIS B CB    
3474 C CG    . HIS B 186 ? 0.6647 0.9513 0.6440 -0.0400 -0.0124 -0.0934 183 HIS B CG    
3475 N ND1   . HIS B 186 ? 0.6839 0.9744 0.6554 -0.0491 -0.0191 -0.1092 183 HIS B ND1   
3476 C CD2   . HIS B 186 ? 0.6504 0.9585 0.6217 -0.0346 -0.0119 -0.0824 183 HIS B CD2   
3477 C CE1   . HIS B 186 ? 0.7399 1.0567 0.6984 -0.0498 -0.0223 -0.1082 183 HIS B CE1   
3478 N NE2   . HIS B 186 ? 0.6821 1.0110 0.6415 -0.0408 -0.0182 -0.0908 183 HIS B NE2   
3479 N N     . SER B 187 ? 0.7528 1.0626 0.7568 -0.0335 -0.0138 -0.0589 184 SER B N     
3480 C CA    . SER B 187 ? 0.8049 1.1320 0.8089 -0.0239 -0.0125 -0.0433 184 SER B CA    
3481 C C     . SER B 187 ? 0.7566 1.1162 0.7568 -0.0280 -0.0210 -0.0414 184 SER B C     
3482 O O     . SER B 187 ? 0.6786 1.0458 0.6756 -0.0399 -0.0281 -0.0530 184 SER B O     
3483 C CB    . SER B 187 ? 0.7948 1.1204 0.8130 -0.0181 -0.0090 -0.0327 184 SER B CB    
3484 O OG    . SER B 187 ? 0.7572 1.0996 0.7868 -0.0260 -0.0150 -0.0340 184 SER B OG    
3485 N N     . ASP B 188 ? 0.7088 1.0867 0.7090 -0.0188 -0.0208 -0.0259 185 ASP B N     
3486 C CA    . ASP B 188 ? 0.6320 1.0467 0.6326 -0.0222 -0.0293 -0.0188 185 ASP B CA    
3487 C C     . ASP B 188 ? 0.7379 1.1693 0.7560 -0.0238 -0.0328 -0.0125 185 ASP B C     
3488 O O     . ASP B 188 ? 0.8199 1.2345 0.8485 -0.0216 -0.0280 -0.0137 185 ASP B O     
3489 C CB    . ASP B 188 ? 0.6368 1.0667 0.6340 -0.0112 -0.0285 -0.0013 185 ASP B CB    
3490 C CG    . ASP B 188 ? 0.9160 1.3307 0.9244 0.0048  -0.0210 0.0136  185 ASP B CG    
3491 O OD1   . ASP B 188 ? 0.9201 1.3301 0.9421 0.0084  -0.0182 0.0145  185 ASP B OD1   
3492 O OD2   . ASP B 188 ? 1.1219 1.5293 1.1246 0.0133  -0.0181 0.0245  185 ASP B OD2   
3493 N N     . GLN B 189 ? 0.6783 1.1473 0.6996 -0.0286 -0.0414 -0.0045 186 GLN B N     
3494 C CA    . GLN B 189 ? 0.6612 1.1555 0.7002 -0.0306 -0.0454 0.0043  186 GLN B CA    
3495 C C     . GLN B 189 ? 0.6793 1.1839 0.7343 -0.0108 -0.0387 0.0237  186 GLN B C     
3496 O O     . GLN B 189 ? 0.7429 1.2841 0.8123 -0.0085 -0.0428 0.0371  186 GLN B O     
3497 C CB    . GLN B 189 ? 0.7170 1.2502 0.7529 -0.0457 -0.0582 0.0057  186 GLN B CB    
3498 C CG    . GLN B 189 ? 0.7469 1.2652 0.7657 -0.0656 -0.0646 -0.0166 186 GLN B CG    
3499 C CD    . GLN B 189 ? 0.8901 1.4234 0.9149 -0.0847 -0.0750 -0.0211 186 GLN B CD    
3500 O OE1   . GLN B 189 ? 1.0070 1.5759 1.0471 -0.0855 -0.0797 -0.0052 186 GLN B OE1   
3501 N NE2   . GLN B 189 ? 0.8984 1.4049 0.9118 -0.1001 -0.0790 -0.0420 186 GLN B NE2   
3502 N N     . GLY B 190 ? 0.7004 1.1738 0.7534 0.0036  -0.0285 0.0255  187 GLY B N     
3503 C CA    . GLY B 190 ? 0.6995 1.1751 0.7662 0.0232  -0.0211 0.0406  187 GLY B CA    
3504 C C     . GLY B 190 ? 0.7003 1.1864 0.7832 0.0241  -0.0182 0.0406  187 GLY B C     
3505 O O     . GLY B 190 ? 0.6688 1.1441 0.7510 0.0108  -0.0191 0.0279  187 GLY B O     
3506 N N     . ALA B 191 ? 0.6992 1.2084 0.7980 0.0407  -0.0147 0.0562  188 ALA B N     
3507 C CA    . ALA B 191 ? 0.6937 1.2273 0.8100 0.0420  -0.0126 0.0592  188 ALA B CA    
3508 C C     . ALA B 191 ? 0.7201 1.2215 0.8344 0.0408  -0.0036 0.0465  188 ALA B C     
3509 O O     . ALA B 191 ? 0.7818 1.2982 0.9043 0.0297  -0.0055 0.0427  188 ALA B O     
3510 C CB    . ALA B 191 ? 0.6770 1.2385 0.8108 0.0650  -0.0077 0.0781  188 ALA B CB    
3511 N N     . ALA B 192 ? 0.6620 1.1211 0.7650 0.0501  0.0053  0.0411  189 ALA B N     
3512 C CA    . ALA B 192 ? 0.6699 1.1004 0.7696 0.0478  0.0136  0.0301  189 ALA B CA    
3513 C C     . ALA B 192 ? 0.7743 1.1950 0.8682 0.0251  0.0073  0.0174  189 ALA B C     
3514 O O     . ALA B 192 ? 0.7572 1.1729 0.8551 0.0182  0.0105  0.0118  189 ALA B O     
3515 C CB    . ALA B 192 ? 0.7183 1.1053 0.8047 0.0593  0.0226  0.0275  189 ALA B CB    
3516 N N     . PHE B 193 ? 0.7332 1.1515 0.8177 0.0136  -0.0014 0.0129  190 PHE B N     
3517 C CA    . PHE B 193 ? 0.6731 1.0765 0.7519 -0.0054 -0.0069 -0.0001 190 PHE B CA    
3518 C C     . PHE B 193 ? 0.6606 1.0934 0.7485 -0.0216 -0.0176 -0.0006 190 PHE B C     
3519 O O     . PHE B 193 ? 0.6589 1.0798 0.7476 -0.0365 -0.0213 -0.0092 190 PHE B O     
3520 C CB    . PHE B 193 ? 0.6854 1.0685 0.7477 -0.0088 -0.0094 -0.0072 190 PHE B CB    
3521 C CG    . PHE B 193 ? 0.7161 1.0745 0.7689 0.0047  -0.0011 -0.0038 190 PHE B CG    
3522 C CD1   . PHE B 193 ? 0.6781 1.0107 0.7304 0.0102  0.0081  -0.0048 190 PHE B CD1   
3523 C CD2   . PHE B 193 ? 0.7108 1.0729 0.7541 0.0099  -0.0032 0.0014  190 PHE B CD2   
3524 C CE1   . PHE B 193 ? 0.6697 0.9774 0.7116 0.0198  0.0145  -0.0013 190 PHE B CE1   
3525 C CE2   . PHE B 193 ? 0.6684 1.0074 0.7030 0.0201  0.0031  0.0065  190 PHE B CE2   
3526 C CZ    . PHE B 193 ? 0.7190 1.0291 0.7526 0.0247  0.0117  0.0049  190 PHE B CZ    
3527 N N     . THR B 194 ? 0.6972 1.1682 0.7923 -0.0198 -0.0235 0.0098  191 THR B N     
3528 C CA    . THR B 194 ? 0.6998 1.2015 0.8021 -0.0377 -0.0353 0.0108  191 THR B CA    
3529 C C     . THR B 194 ? 0.6513 1.1839 0.7729 -0.0371 -0.0338 0.0212  191 THR B C     
3530 O O     . THR B 194 ? 0.6619 1.2261 0.7917 -0.0526 -0.0441 0.0257  191 THR B O     
3531 C CB    . THR B 194 ? 0.6232 1.1556 0.7219 -0.0400 -0.0442 0.0174  191 THR B CB    
3532 O OG1   . THR B 194 ? 0.6132 1.1651 0.7195 -0.0185 -0.0380 0.0332  191 THR B OG1   
3533 C CG2   . THR B 194 ? 0.6266 1.1341 0.7045 -0.0472 -0.0480 0.0041  191 THR B CG2   
3534 N N     . SER B 195 ? 0.6227 1.1481 0.7506 -0.0208 -0.0214 0.0249  192 SER B N     
3535 C CA    . SER B 195 ? 0.6218 1.1801 0.7674 -0.0184 -0.0180 0.0341  192 SER B CA    
3536 C C     . SER B 195 ? 0.6170 1.1693 0.7657 -0.0394 -0.0226 0.0279  192 SER B C     
3537 O O     . SER B 195 ? 0.6464 1.1595 0.7844 -0.0486 -0.0231 0.0160  192 SER B O     
3538 C CB    . SER B 195 ? 0.6385 1.1880 0.7869 0.0060  -0.0022 0.0370  192 SER B CB    
3539 O OG    . SER B 195 ? 0.6933 1.2014 0.8313 0.0038  0.0049  0.0254  192 SER B OG    
3540 N N     . SER B 196 ? 0.5921 1.1864 0.7571 -0.0468 -0.0261 0.0380  193 SER B N     
3541 C CA    . SER B 196 ? 0.6570 1.2503 0.8272 -0.0678 -0.0313 0.0359  193 SER B CA    
3542 C C     . SER B 196 ? 0.6963 1.2647 0.8644 -0.0610 -0.0190 0.0307  193 SER B C     
3543 O O     . SER B 196 ? 0.6514 1.2033 0.8195 -0.0782 -0.0231 0.0266  193 SER B O     
3544 C CB    . SER B 196 ? 0.6762 1.3263 0.8650 -0.0781 -0.0380 0.0507  193 SER B CB    
3545 O OG    . SER B 196 ? 0.8370 1.5206 1.0380 -0.0567 -0.0252 0.0606  193 SER B OG    
3546 N N     . THR B 197 ? 0.6437 1.2083 0.8096 -0.0370 -0.0045 0.0311  194 THR B N     
3547 C CA    . THR B 197 ? 0.6150 1.1533 0.7748 -0.0318 0.0072  0.0244  194 THR B CA    
3548 C C     . THR B 197 ? 0.6263 1.1128 0.7702 -0.0388 0.0056  0.0127  194 THR B C     
3549 O O     . THR B 197 ? 0.6442 1.1137 0.7867 -0.0522 0.0048  0.0089  194 THR B O     
3550 C CB    . THR B 197 ? 0.7575 1.2977 0.9156 -0.0044 0.0226  0.0254  194 THR B CB    
3551 O OG1   . THR B 197 ? 0.9667 1.5585 1.1416 0.0058  0.0243  0.0374  194 THR B OG1   
3552 C CG2   . THR B 197 ? 0.6585 1.1798 0.8098 -0.0022 0.0344  0.0184  194 THR B CG2   
3553 N N     . PHE B 198 ? 0.6849 1.1492 0.8177 -0.0299 0.0049  0.0086  195 PHE B N     
3554 C CA    . PHE B 198 ? 0.6342 1.0549 0.7529 -0.0356 0.0036  -0.0015 195 PHE B CA    
3555 C C     . PHE B 198 ? 0.6017 1.0158 0.7230 -0.0579 -0.0084 -0.0057 195 PHE B C     
3556 O O     . PHE B 198 ? 0.5490 0.9323 0.6649 -0.0651 -0.0081 -0.0122 195 PHE B O     
3557 C CB    . PHE B 198 ? 0.6407 1.0481 0.7483 -0.0237 0.0038  -0.0031 195 PHE B CB    
3558 C CG    . PHE B 198 ? 0.6682 1.0345 0.7609 -0.0251 0.0057  -0.0119 195 PHE B CG    
3559 C CD1   . PHE B 198 ? 0.5814 0.9216 0.6668 -0.0193 0.0155  -0.0143 195 PHE B CD1   
3560 C CD2   . PHE B 198 ? 0.6358 0.9918 0.7210 -0.0325 -0.0021 -0.0179 195 PHE B CD2   
3561 C CE1   . PHE B 198 ? 0.5596 0.8672 0.6326 -0.0215 0.0168  -0.0201 195 PHE B CE1   
3562 C CE2   . PHE B 198 ? 0.5643 0.8879 0.6373 -0.0324 0.0006  -0.0250 195 PHE B CE2   
3563 C CZ    . PHE B 198 ? 0.5986 0.8994 0.6666 -0.0271 0.0097  -0.0248 195 PHE B CZ    
3564 N N     . ALA B 199 ? 0.6088 1.0509 0.7386 -0.0693 -0.0194 -0.0015 196 ALA B N     
3565 C CA    . ALA B 199 ? 0.5646 0.9971 0.6969 -0.0915 -0.0317 -0.0058 196 ALA B CA    
3566 C C     . ALA B 199 ? 0.6252 1.0555 0.7672 -0.1033 -0.0314 -0.0022 196 ALA B C     
3567 O O     . ALA B 199 ? 0.7526 1.1537 0.8935 -0.1150 -0.0359 -0.0075 196 ALA B O     
3568 C CB    . ALA B 199 ? 0.5674 1.0326 0.7058 -0.1036 -0.0443 -0.0009 196 ALA B CB    
3569 N N     . GLU B 200 ? 0.8455 1.3591 0.8081 0.0563  0.1073  0.1423  197 GLU B N     
3570 C CA    . GLU B 200 ? 0.9380 1.4296 0.9095 0.0451  0.1039  0.1402  197 GLU B CA    
3571 C C     . GLU B 200 ? 0.9261 1.3532 0.8802 0.0446  0.1135  0.1248  197 GLU B C     
3572 O O     . GLU B 200 ? 0.9924 1.3925 0.9559 0.0262  0.1026  0.1105  197 GLU B O     
3573 C CB    . GLU B 200 ? 1.0422 1.5573 1.0147 0.0598  0.1155  0.1661  197 GLU B CB    
3574 C CG    . GLU B 200 ? 1.2395 1.8173 1.2354 0.0553  0.1025  0.1802  197 GLU B CG    
3575 C CD    . GLU B 200 ? 1.3706 1.9759 1.3645 0.0755  0.1179  0.2074  197 GLU B CD    
3576 O OE1   . GLU B 200 ? 1.4152 1.9894 1.3916 0.0903  0.1371  0.2147  197 GLU B OE1   
3577 O OE2   . GLU B 200 ? 1.3475 2.0058 1.3579 0.0768  0.1106  0.2211  197 GLU B OE2   
3578 N N     . TRP B 201 ? 0.8647 1.2659 0.7939 0.0645  0.1333  0.1274  198 TRP B N     
3579 C CA    . TRP B 201 ? 0.8693 1.2089 0.7821 0.0648  0.1425  0.1122  198 TRP B CA    
3580 C C     . TRP B 201 ? 0.8774 1.1953 0.7987 0.0427  0.1260  0.0842  198 TRP B C     
3581 O O     . TRP B 201 ? 0.7758 1.0510 0.6986 0.0302  0.1217  0.0684  198 TRP B O     
3582 C CB    . TRP B 201 ? 0.8884 1.2089 0.7742 0.0902  0.1658  0.1205  198 TRP B CB    
3583 C CG    . TRP B 201 ? 0.8790 1.1372 0.7480 0.0910  0.1752  0.1042  198 TRP B CG    
3584 C CD1   . TRP B 201 ? 0.8204 1.0367 0.6768 0.0990  0.1883  0.1069  198 TRP B CD1   
3585 C CD2   . TRP B 201 ? 0.8387 1.0693 0.7019 0.0834  0.1723  0.0824  198 TRP B CD2   
3586 N NE1   . TRP B 201 ? 0.9285 1.0928 0.7724 0.0969  0.1932  0.0884  198 TRP B NE1   
3587 C CE2   . TRP B 201 ? 0.8401 1.0124 0.6884 0.0873  0.1838  0.0731  198 TRP B CE2   
3588 C CE3   . TRP B 201 ? 0.9017 1.1516 0.7710 0.0737  0.1611  0.0697  198 TRP B CE3   
3589 C CZ2   . TRP B 201 ? 0.8514 0.9847 0.6919 0.0818  0.1847  0.0517  198 TRP B CZ2   
3590 C CZ3   . TRP B 201 ? 0.8839 1.0952 0.7446 0.0681  0.1625  0.0483  198 TRP B CZ3   
3591 C CH2   . TRP B 201 ? 0.8942 1.0481 0.7413 0.0721  0.1743  0.0396  198 TRP B CH2   
3592 N N     . ALA B 202 ? 0.8280 1.1745 0.7552 0.0377  0.1165  0.0774  199 ALA B N     
3593 C CA    . ALA B 202 ? 0.7674 1.0957 0.7032 0.0173  0.1012  0.0502  199 ALA B CA    
3594 C C     . ALA B 202 ? 0.7507 1.0877 0.7135 -0.0085 0.0777  0.0392  199 ALA B C     
3595 O O     . ALA B 202 ? 0.8023 1.1049 0.7719 -0.0258 0.0674  0.0165  199 ALA B O     
3596 C CB    . ALA B 202 ? 0.7695 1.1287 0.7035 0.0191  0.0975  0.0467  199 ALA B CB    
3597 N N     . LYS B 203 ? 0.7445 1.1272 0.7239 -0.0114 0.0686  0.0550  200 LYS B N     
3598 C CA    . LYS B 203 ? 0.7291 1.1228 0.7351 -0.0360 0.0457  0.0462  200 LYS B CA    
3599 C C     . LYS B 203 ? 0.8376 1.1869 0.8427 -0.0430 0.0471  0.0417  200 LYS B C     
3600 O O     . LYS B 203 ? 0.8503 1.1814 0.8711 -0.0653 0.0294  0.0234  200 LYS B O     
3601 C CB    . LYS B 203 ? 0.7242 1.1773 0.7473 -0.0358 0.0375  0.0662  200 LYS B CB    
3602 C CG    . LYS B 203 ? 0.7080 1.1810 0.7608 -0.0618 0.0116  0.0575  200 LYS B CG    
3603 C CD    . LYS B 203 ? 0.8413 1.3737 0.9106 -0.0599 0.0052  0.0788  200 LYS B CD    
3604 C CE    . LYS B 203 ? 0.9160 1.4677 1.0153 -0.0857 -0.0205 0.0713  200 LYS B CE    
3605 N NZ    . LYS B 203 ? 0.9681 1.5786 1.0849 -0.0842 -0.0270 0.0919  200 LYS B NZ    
3606 N N     . GLU B 204 ? 0.8246 1.1552 0.8112 -0.0243 0.0676  0.0579  201 GLU B N     
3607 C CA    . GLU B 204 ? 0.8704 1.1580 0.8534 -0.0295 0.0702  0.0550  201 GLU B CA    
3608 C C     . GLU B 204 ? 0.8817 1.1130 0.8589 -0.0396 0.0674  0.0292  201 GLU B C     
3609 O O     . GLU B 204 ? 0.9373 1.1369 0.9212 -0.0546 0.0583  0.0188  201 GLU B O     
3610 C CB    . GLU B 204 ? 0.8979 1.1754 0.8597 -0.0052 0.0946  0.0765  201 GLU B CB    
3611 C CG    . GLU B 204 ? 0.9993 1.3260 0.9695 0.0025  0.0970  0.1019  201 GLU B CG    
3612 C CD    . GLU B 204 ? 1.1263 1.4504 1.0745 0.0306  0.1229  0.1229  201 GLU B CD    
3613 O OE1   . GLU B 204 ? 1.0944 1.3764 1.0206 0.0435  0.1385  0.1179  201 GLU B OE1   
3614 O OE2   . GLU B 204 ? 1.1714 1.5358 1.1253 0.0398  0.1275  0.1444  201 GLU B OE2   
3615 N N     . ARG B 205 ? 0.8205 1.0384 0.7852 -0.0319 0.0750  0.0188  202 ARG B N     
3616 C CA    . ARG B 205 ? 0.7697 0.9344 0.7284 -0.0397 0.0744  -0.0054 202 ARG B CA    
3617 C C     . ARG B 205 ? 0.7580 0.9305 0.7362 -0.0615 0.0531  -0.0292 202 ARG B C     
3618 O O     . ARG B 205 ? 0.7733 0.9056 0.7488 -0.0687 0.0517  -0.0511 202 ARG B O     
3619 C CB    . ARG B 205 ? 0.7605 0.8996 0.6922 -0.0171 0.0979  -0.0027 202 ARG B CB    
3620 C CG    . ARG B 205 ? 0.7934 0.9041 0.7052 0.0014  0.1182  0.0131  202 ARG B CG    
3621 C CD    . ARG B 205 ? 0.8653 0.9831 0.7542 0.0287  0.1413  0.0294  202 ARG B CD    
3622 N NE    . ARG B 205 ? 0.9559 1.0556 0.8285 0.0468  0.1594  0.0472  202 ARG B NE    
3623 C CZ    . ARG B 205 ? 0.9844 1.1167 0.8608 0.0539  0.1623  0.0688  202 ARG B CZ    
3624 N NH1   . ARG B 205 ? 0.9333 1.1177 0.8295 0.0444  0.1479  0.0757  202 ARG B NH1   
3625 N NH2   . ARG B 205 ? 1.0339 1.1469 0.8946 0.0706  0.1795  0.0833  202 ARG B NH2   
3626 N N     . GLY B 206 ? 0.7225 0.9453 0.7209 -0.0723 0.0364  -0.0259 203 GLY B N     
3627 C CA    . GLY B 206 ? 0.7108 0.9434 0.7280 -0.0927 0.0159  -0.0484 203 GLY B CA    
3628 C C     . GLY B 206 ? 0.7980 1.0332 0.8039 -0.0852 0.0230  -0.0581 203 GLY B C     
3629 O O     . GLY B 206 ? 0.7992 1.0257 0.8160 -0.1010 0.0099  -0.0817 203 GLY B O     
3630 N N     . ILE B 207 ? 0.7918 1.0383 0.7760 -0.0615 0.0434  -0.0405 204 ILE B N     
3631 C CA    . ILE B 207 ? 0.7372 0.9870 0.7077 -0.0527 0.0519  -0.0470 204 ILE B CA    
3632 C C     . ILE B 207 ? 0.7605 1.0702 0.7407 -0.0537 0.0418  -0.0387 204 ILE B C     
3633 O O     . ILE B 207 ? 0.8414 1.1889 0.8235 -0.0441 0.0439  -0.0156 204 ILE B O     
3634 C CB    . ILE B 207 ? 0.8306 1.0580 0.7714 -0.0263 0.0793  -0.0324 204 ILE B CB    
3635 C CG1   . ILE B 207 ? 0.7581 0.9276 0.6898 -0.0246 0.0889  -0.0382 204 ILE B CG1   
3636 C CG2   . ILE B 207 ? 0.7636 0.9894 0.6895 -0.0188 0.0880  -0.0406 204 ILE B CG2   
3637 C CD1   . ILE B 207 ? 0.7750 0.9233 0.6793 0.0017  0.1152  -0.0215 204 ILE B CD1   
3638 N N     . HIS B 208 ? 0.7303 1.0488 0.7170 -0.0652 0.0309  -0.0577 205 HIS B N     
3639 C CA    . HIS B 208 ? 0.7295 1.1020 0.7226 -0.0655 0.0219  -0.0518 205 HIS B CA    
3640 C C     . HIS B 208 ? 0.7465 1.1256 0.7131 -0.0429 0.0420  -0.0396 205 HIS B C     
3641 O O     . HIS B 208 ? 0.7555 1.0975 0.7041 -0.0367 0.0554  -0.0502 205 HIS B O     
3642 C CB    . HIS B 208 ? 0.8181 1.1971 0.8296 -0.0884 0.0007  -0.0784 205 HIS B CB    
3643 C CG    . HIS B 208 ? 0.9269 1.3575 0.9424 -0.0886 -0.0081 -0.0748 205 HIS B CG    
3644 N ND1   . HIS B 208 ? 1.0197 1.5003 1.0528 -0.0925 -0.0221 -0.0606 205 HIS B ND1   
3645 C CD2   . HIS B 208 ? 0.8278 1.2675 0.8317 -0.0855 -0.0051 -0.0835 205 HIS B CD2   
3646 C CE1   . HIS B 208 ? 0.9333 1.4512 0.9655 -0.0917 -0.0278 -0.0609 205 HIS B CE1   
3647 N NE2   . HIS B 208 ? 0.8726 1.3667 0.8865 -0.0875 -0.0177 -0.0747 205 HIS B NE2   
3648 N N     . LEU B 209 ? 0.7812 1.2071 0.7457 -0.0305 0.0441  -0.0172 206 LEU B N     
3649 C CA    . LEU B 209 ? 0.8202 1.2577 0.7607 -0.0092 0.0612  -0.0037 206 LEU B CA    
3650 C C     . LEU B 209 ? 0.7689 1.2390 0.7123 -0.0168 0.0495  -0.0136 206 LEU B C     
3651 O O     . LEU B 209 ? 0.7576 1.2637 0.7231 -0.0319 0.0288  -0.0177 206 LEU B O     
3652 C CB    . LEU B 209 ? 0.7749 1.2433 0.7103 0.0104  0.0713  0.0274  206 LEU B CB    
3653 C CG    . LEU B 209 ? 0.7790 1.2162 0.7052 0.0234  0.0878  0.0405  206 LEU B CG    
3654 C CD1   . LEU B 209 ? 0.7892 1.2579 0.7067 0.0461  0.1007  0.0706  206 LEU B CD1   
3655 C CD2   . LEU B 209 ? 0.7883 1.1682 0.6932 0.0302  0.1044  0.0287  206 LEU B CD2   
3656 N N     . GLU B 210 ? 0.7831 1.2399 0.7038 -0.0063 0.0628  -0.0175 207 GLU B N     
3657 C CA    . GLU B 210 ? 0.7869 1.2682 0.7058 -0.0128 0.0541  -0.0287 207 GLU B CA    
3658 C C     . GLU B 210 ? 0.8072 1.2976 0.6983 0.0098  0.0725  -0.0119 207 GLU B C     
3659 O O     . GLU B 210 ? 0.8189 1.2717 0.6883 0.0232  0.0924  -0.0102 207 GLU B O     
3660 C CB    . GLU B 210 ? 0.9339 1.3799 0.8559 -0.0303 0.0486  -0.0604 207 GLU B CB    
3661 C CG    . GLU B 210 ? 0.9388 1.3989 0.8509 -0.0334 0.0463  -0.0729 207 GLU B CG    
3662 C CD    . GLU B 210 ? 1.0037 1.4261 0.9192 -0.0498 0.0429  -0.1044 207 GLU B CD    
3663 O OE1   . GLU B 210 ? 1.0509 1.4705 0.9915 -0.0707 0.0242  -0.1226 207 GLU B OE1   
3664 O OE2   . GLU B 210 ? 0.9836 1.3787 0.8774 -0.0418 0.0590  -0.1108 207 GLU B OE2   
3665 N N     . PHE B 211 ? 0.8320 1.3715 0.7237 0.0141  0.0655  0.0007  208 PHE B N     
3666 C CA    . PHE B 211 ? 0.8317 1.3855 0.6985 0.0359  0.0809  0.0197  208 PHE B CA    
3667 C C     . PHE B 211 ? 0.8409 1.4095 0.6978 0.0304  0.0755  0.0071  208 PHE B C     
3668 O O     . PHE B 211 ? 0.9595 1.5527 0.8339 0.0121  0.0554  -0.0074 208 PHE B O     
3669 C CB    . PHE B 211 ? 0.8327 1.4323 0.7061 0.0485  0.0787  0.0479  208 PHE B CB    
3670 C CG    . PHE B 211 ? 0.8521 1.4418 0.7356 0.0539  0.0839  0.0613  208 PHE B CG    
3671 C CD1   . PHE B 211 ? 0.9180 1.4785 0.7825 0.0741  0.1063  0.0755  208 PHE B CD1   
3672 C CD2   . PHE B 211 ? 0.8532 1.4626 0.7648 0.0387  0.0664  0.0598  208 PHE B CD2   
3673 C CE1   . PHE B 211 ? 0.8874 1.4386 0.7600 0.0792  0.1115  0.0875  208 PHE B CE1   
3674 C CE2   . PHE B 211 ? 0.8302 1.4304 0.7498 0.0433  0.0717  0.0723  208 PHE B CE2   
3675 C CZ    . PHE B 211 ? 0.8120 1.3832 0.7118 0.0636  0.0944  0.0859  208 PHE B CZ    
3676 N N     . SER B 212 ? 0.8603 1.4133 0.6889 0.0460  0.0936  0.0124  209 SER B N     
3677 C CA    . SER B 212 ? 0.8731 1.4453 0.6883 0.0443  0.0905  0.0059  209 SER B CA    
3678 C C     . SER B 212 ? 0.9503 1.5758 0.7644 0.0550  0.0846  0.0292  209 SER B C     
3679 O O     . SER B 212 ? 0.9175 1.5581 0.7336 0.0698  0.0900  0.0533  209 SER B O     
3680 C CB    . SER B 212 ? 0.9152 1.4501 0.7001 0.0562  0.1120  0.0030  209 SER B CB    
3681 O OG    . SER B 212 ? 0.9503 1.4741 0.7184 0.0798  0.1313  0.0274  209 SER B OG    
3682 N N     . THR B 213 ? 0.9995 1.6537 0.8109 0.0472  0.0730  0.0213  210 THR B N     
3683 C CA    . THR B 213 ? 1.0517 1.7575 0.8629 0.0555  0.0649  0.0413  210 THR B CA    
3684 C C     . THR B 213 ? 1.0906 1.7949 0.8755 0.0819  0.0852  0.0670  210 THR B C     
3685 O O     . THR B 213 ? 1.1462 1.8144 0.9067 0.0907  0.1031  0.0639  210 THR B O     
3686 C CB    . THR B 213 ? 1.1568 1.8877 0.9660 0.0423  0.0501  0.0257  210 THR B CB    
3687 O OG1   . THR B 213 ? 1.1557 1.9051 0.9953 0.0200  0.0269  0.0092  210 THR B OG1   
3688 C CG2   . THR B 213 ? 1.1747 1.9488 0.9712 0.0558  0.0481  0.0469  210 THR B CG2   
3689 N N     . PRO B 214 ? 1.0582 1.7995 0.8484 0.0951  0.0830  0.0926  211 PRO B N     
3690 C CA    . PRO B 214 ? 1.0151 1.7581 0.7813 0.1205  0.1007  0.1175  211 PRO B CA    
3691 C C     . PRO B 214 ? 1.0751 1.8143 0.8126 0.1249  0.1069  0.1136  211 PRO B C     
3692 O O     . PRO B 214 ? 1.0765 1.8414 0.8147 0.1132  0.0923  0.1034  211 PRO B O     
3693 C CB    . PRO B 214 ? 0.9609 1.7556 0.7431 0.1278  0.0899  0.1404  211 PRO B CB    
3694 C CG    . PRO B 214 ? 0.9108 1.7148 0.7255 0.1109  0.0746  0.1318  211 PRO B CG    
3695 C CD    . PRO B 214 ? 0.9549 1.7358 0.7750 0.0878  0.0650  0.1004  211 PRO B CD    
3696 N N     . TYR B 215 ? 1.1166 1.8225 0.8282 0.1417  0.1289  0.1216  212 TYR B N     
3697 C CA    . TYR B 215 ? 1.2136 1.9089 0.8942 0.1491  0.1394  0.1211  212 TYR B CA    
3698 C C     . TYR B 215 ? 1.3196 1.9907 0.9945 0.1301  0.1365  0.0910  212 TYR B C     
3699 O O     . TYR B 215 ? 1.3509 2.0103 0.9995 0.1341  0.1457  0.0879  212 TYR B O     
3700 C CB    . TYR B 215 ? 1.0177 1.7601 0.6897 0.1574  0.1310  0.1385  212 TYR B CB    
3701 C CG    . TYR B 215 ? 1.0627 1.8336 0.7434 0.1753  0.1321  0.1677  212 TYR B CG    
3702 C CD1   . TYR B 215 ? 1.0900 1.8451 0.7522 0.1989  0.1516  0.1890  212 TYR B CD1   
3703 C CD2   . TYR B 215 ? 1.1488 1.9623 0.8574 0.1687  0.1135  0.1736  212 TYR B CD2   
3704 C CE1   . TYR B 215 ? 1.1357 1.9168 0.8068 0.2156  0.1529  0.2150  212 TYR B CE1   
3705 C CE2   . TYR B 215 ? 1.1401 1.9802 0.8579 0.1850  0.1150  0.1999  212 TYR B CE2   
3706 C CZ    . TYR B 215 ? 1.1193 1.9432 0.8184 0.2085  0.1348  0.2202  212 TYR B CZ    
3707 O OH    . TYR B 215 ? 1.1056 1.9563 0.8150 0.2249  0.1365  0.2458  212 TYR B OH    
3708 N N     . HIS B 216 ? 1.4643 2.1265 1.1627 0.1097  0.1244  0.0687  213 HIS B N     
3709 C CA    . HIS B 216 ? 1.5419 2.1796 1.2387 0.0909  0.1214  0.0384  213 HIS B CA    
3710 C C     . HIS B 216 ? 1.5189 2.1084 1.2252 0.0850  0.1297  0.0240  213 HIS B C     
3711 O O     . HIS B 216 ? 1.4146 2.0016 1.1463 0.0670  0.1157  0.0067  213 HIS B O     
3712 C CB    . HIS B 216 ? 1.6574 2.3297 1.3752 0.0695  0.0965  0.0218  213 HIS B CB    
3713 C CG    . HIS B 216 ? 1.8071 2.5258 1.5157 0.0734  0.0867  0.0333  213 HIS B CG    
3714 N ND1   . HIS B 216 ? 1.8782 2.5989 1.5557 0.0897  0.0997  0.0479  213 HIS B ND1   
3715 C CD2   . HIS B 216 ? 1.8256 2.5899 1.5519 0.0630  0.0645  0.0325  213 HIS B CD2   
3716 C CE1   . HIS B 216 ? 1.8783 2.6436 1.5542 0.0891  0.0858  0.0555  213 HIS B CE1   
3717 N NE2   . HIS B 216 ? 1.8637 2.6563 1.5692 0.0731  0.0644  0.0462  213 HIS B NE2   
3718 N N     . PRO B 217 ? 1.5389 2.0889 1.2254 0.0999  0.1517  0.0307  214 PRO B N     
3719 C CA    . PRO B 217 ? 1.5192 2.0217 1.2139 0.0950  0.1597  0.0173  214 PRO B CA    
3720 C C     . PRO B 217 ? 1.5863 2.0636 1.2848 0.0744  0.1550  -0.0152 214 PRO B C     
3721 O O     . PRO B 217 ? 1.7242 2.1987 1.4044 0.0723  0.1594  -0.0246 214 PRO B O     
3722 C CB    . PRO B 217 ? 1.4924 1.9628 1.1615 0.1175  0.1845  0.0337  214 PRO B CB    
3723 C CG    . PRO B 217 ? 1.5555 2.0453 1.1991 0.1274  0.1899  0.0438  214 PRO B CG    
3724 C CD    . PRO B 217 ? 1.5441 2.0896 1.1997 0.1213  0.1698  0.0500  214 PRO B CD    
3725 N N     . GLN B 218 ? 1.4786 1.9376 1.2013 0.0589  0.1458  -0.0324 215 GLN B N     
3726 C CA    . GLN B 218 ? 1.4650 1.8992 1.1957 0.0386  0.1401  -0.0643 215 GLN B CA    
3727 C C     . GLN B 218 ? 1.4264 1.8186 1.1731 0.0321  0.1422  -0.0759 215 GLN B C     
3728 O O     . GLN B 218 ? 1.3805 1.7727 1.1382 0.0381  0.1415  -0.0616 215 GLN B O     
3729 C CB    . GLN B 218 ? 1.5221 1.9938 1.2724 0.0184  0.1159  -0.0799 215 GLN B CB    
3730 C CG    . GLN B 218 ? 1.5962 2.0785 1.3798 0.0043  0.0971  -0.0853 215 GLN B CG    
3731 C CD    . GLN B 218 ? 1.6315 2.1283 1.4362 -0.0204 0.0756  -0.1123 215 GLN B CD    
3732 O OE1   . GLN B 218 ? 1.6098 2.1431 1.4122 -0.0251 0.0649  -0.1142 215 GLN B OE1   
3733 N NE2   . GLN B 218 ? 1.6297 2.0971 1.4548 -0.0362 0.0687  -0.1337 215 GLN B NE2   
3734 N N     . SER B 219 ? 1.5712 1.6839 1.1011 0.0565  -0.1062 -0.0936 216 SER B N     
3735 C CA    . SER B 219 ? 1.4761 1.5969 1.0439 0.0529  -0.0952 -0.1028 216 SER B CA    
3736 C C     . SER B 219 ? 1.5191 1.6413 1.0705 0.0606  -0.0805 -0.1192 216 SER B C     
3737 O O     . SER B 219 ? 1.6285 1.7419 1.1634 0.0660  -0.0936 -0.1371 216 SER B O     
3738 C CB    . SER B 219 ? 1.4003 1.5308 1.0001 0.0466  -0.0770 -0.0867 216 SER B CB    
3739 O OG    . SER B 219 ? 1.3970 1.5285 0.9747 0.0492  -0.0611 -0.0721 216 SER B OG    
3740 N N     . SER B 220 ? 1.3984 1.5315 0.9547 0.0614  -0.0539 -0.1126 217 SER B N     
3741 C CA    . SER B 220 ? 1.2953 1.4343 0.8336 0.0702  -0.0367 -0.1245 217 SER B CA    
3742 C C     . SER B 220 ? 1.2942 1.4448 0.8229 0.0704  -0.0116 -0.1076 217 SER B C     
3743 O O     . SER B 220 ? 1.2660 1.4187 0.8113 0.0623  -0.0069 -0.0886 217 SER B O     
3744 C CB    . SER B 220 ? 1.1275 1.2735 0.7003 0.0688  -0.0308 -0.1387 217 SER B CB    
3745 O OG    . SER B 220 ? 0.9803 1.1382 0.5913 0.0595  -0.0146 -0.1265 217 SER B OG    
3746 N N     . GLY B 221 ? 1.2695 1.4277 0.7705 0.0801  0.0041  -0.1143 218 GLY B N     
3747 C CA    . GLY B 221 ? 1.0930 1.2657 0.5850 0.0796  0.0285  -0.0972 218 GLY B CA    
3748 C C     . GLY B 221 ? 1.1146 1.2988 0.6513 0.0688  0.0444  -0.0850 218 GLY B C     
3749 O O     . GLY B 221 ? 1.1178 1.3050 0.6597 0.0615  0.0534  -0.0639 218 GLY B O     
3750 N N     . LYS B 222 ? 1.0599 1.2491 0.6294 0.0671  0.0465  -0.0980 219 LYS B N     
3751 C CA    . LYS B 222 ? 0.9879 1.1867 0.6002 0.0559  0.0597  -0.0877 219 LYS B CA    
3752 C C     . LYS B 222 ? 0.9984 1.1857 0.6324 0.0450  0.0484  -0.0742 219 LYS B C     
3753 O O     . LYS B 222 ? 0.9542 1.1445 0.6048 0.0365  0.0601  -0.0568 219 LYS B O     
3754 C CB    . LYS B 222 ? 0.9599 1.1647 0.6023 0.0560  0.0603  -0.1051 219 LYS B CB    
3755 C CG    . LYS B 222 ? 0.9584 1.1744 0.6429 0.0445  0.0748  -0.0956 219 LYS B CG    
3756 C CD    . LYS B 222 ? 0.9696 1.1931 0.6820 0.0452  0.0753  -0.1125 219 LYS B CD    
3757 C CE    . LYS B 222 ? 1.0103 1.2442 0.7639 0.0323  0.0882  -0.1023 219 LYS B CE    
3758 N NZ    . LYS B 222 ? 1.0741 1.3231 0.8224 0.0300  0.1113  -0.0845 219 LYS B NZ    
3759 N N     . VAL B 223 ? 0.9546 1.1287 0.5884 0.0453  0.0253  -0.0814 220 VAL B N     
3760 C CA    . VAL B 223 ? 0.9371 1.1027 0.5927 0.0370  0.0147  -0.0696 220 VAL B CA    
3761 C C     . VAL B 223 ? 0.9620 1.1219 0.5944 0.0373  0.0155  -0.0500 220 VAL B C     
3762 O O     . VAL B 223 ? 0.9458 1.1024 0.5963 0.0306  0.0197  -0.0343 220 VAL B O     
3763 C CB    . VAL B 223 ? 0.9137 1.0714 0.5785 0.0369  -0.0101 -0.0817 220 VAL B CB    
3764 C CG1   . VAL B 223 ? 0.8948 1.0468 0.5782 0.0308  -0.0207 -0.0685 220 VAL B CG1   
3765 C CG2   . VAL B 223 ? 0.9493 1.1126 0.6428 0.0343  -0.0110 -0.0983 220 VAL B CG2   
3766 N N     . GLU B 224 ? 0.9955 1.1526 0.5869 0.0454  0.0107  -0.0507 221 GLU B N     
3767 C CA    . GLU B 224 ? 1.1463 1.2990 0.7132 0.0456  0.0118  -0.0312 221 GLU B CA    
3768 C C     . GLU B 224 ? 1.0903 1.2506 0.6661 0.0400  0.0341  -0.0137 221 GLU B C     
3769 O O     . GLU B 224 ? 1.0260 1.1794 0.6103 0.0345  0.0341  0.0047  221 GLU B O     
3770 C CB    . GLU B 224 ? 1.1973 1.3487 0.7155 0.0550  0.0070  -0.0360 221 GLU B CB    
3771 C CG    . GLU B 224 ? 1.3708 1.5100 0.8729 0.0587  -0.0197 -0.0457 221 GLU B CG    
3772 C CD    . GLU B 224 ? 1.6158 1.7509 1.0657 0.0670  -0.0245 -0.0479 221 GLU B CD    
3773 O OE1   . GLU B 224 ? 1.6434 1.7812 1.0712 0.0670  -0.0152 -0.0308 221 GLU B OE1   
3774 O OE2   . GLU B 224 ? 1.7167 1.8449 1.1467 0.0733  -0.0382 -0.0666 221 GLU B OE2   
3775 N N     . ARG B 225 ? 1.0374 1.2118 0.6123 0.0412  0.0528  -0.0188 222 ARG B N     
3776 C CA    . ARG B 225 ? 1.0377 1.2216 0.6201 0.0347  0.0738  -0.0007 222 ARG B CA    
3777 C C     . ARG B 225 ? 1.0013 1.1804 0.6274 0.0235  0.0761  0.0062  222 ARG B C     
3778 O O     . ARG B 225 ? 1.0067 1.1816 0.6396 0.0162  0.0830  0.0262  222 ARG B O     
3779 C CB    . ARG B 225 ? 1.0513 1.2555 0.6240 0.0395  0.0930  -0.0079 222 ARG B CB    
3780 C CG    . ARG B 225 ? 1.2695 1.4784 0.7940 0.0516  0.0931  -0.0140 222 ARG B CG    
3781 C CD    . ARG B 225 ? 1.2574 1.4899 0.7716 0.0577  0.1153  -0.0180 222 ARG B CD    
3782 N NE    . ARG B 225 ? 1.1392 1.3765 0.6671 0.0646  0.1149  -0.0423 222 ARG B NE    
3783 C CZ    . ARG B 225 ? 1.1349 1.3666 0.6363 0.0774  0.1047  -0.0637 222 ARG B CZ    
3784 N NH1   . ARG B 225 ? 1.2147 1.4360 0.6731 0.0842  0.0937  -0.0642 222 ARG B NH1   
3785 N NH2   . ARG B 225 ? 1.1136 1.3486 0.6311 0.0831  0.1041  -0.0846 222 ARG B NH2   
3786 N N     . LYS B 226 ? 0.9665 1.1446 0.6214 0.0219  0.0695  -0.0099 223 LYS B N     
3787 C CA    . LYS B 226 ? 0.9520 1.1244 0.6462 0.0116  0.0704  -0.0051 223 LYS B CA    
3788 C C     . LYS B 226 ? 0.9331 1.0885 0.6301 0.0094  0.0585  0.0078  223 LYS B C     
3789 O O     . LYS B 226 ? 0.9302 1.0781 0.6428 0.0019  0.0646  0.0225  223 LYS B O     
3790 C CB    . LYS B 226 ? 0.9640 1.1389 0.6853 0.0107  0.0630  -0.0250 223 LYS B CB    
3791 C CG    . LYS B 226 ? 0.8653 1.0359 0.6258 -0.0001 0.0651  -0.0217 223 LYS B CG    
3792 C CD    . LYS B 226 ? 0.8690 1.0469 0.6411 -0.0084 0.0850  -0.0095 223 LYS B CD    
3793 C CE    . LYS B 226 ? 0.8637 1.0609 0.6421 -0.0071 0.0967  -0.0207 223 LYS B CE    
3794 N NZ    . LYS B 226 ? 0.8678 1.0756 0.6591 -0.0161 0.1158  -0.0066 223 LYS B NZ    
3795 N N     . ASN B 227 ? 1.0123 1.1609 0.6939 0.0161  0.0407  0.0031  224 ASN B N     
3796 C CA    . ASN B 227 ? 1.0233 1.1583 0.7073 0.0160  0.0292  0.0161  224 ASN B CA    
3797 C C     . ASN B 227 ? 1.0722 1.2021 0.7342 0.0155  0.0365  0.0378  224 ASN B C     
3798 O O     . ASN B 227 ? 1.1138 1.2310 0.7848 0.0134  0.0326  0.0521  224 ASN B O     
3799 C CB    . ASN B 227 ? 1.0028 1.1351 0.6756 0.0227  0.0079  0.0078  224 ASN B CB    
3800 C CG    . ASN B 227 ? 1.0700 1.2038 0.7734 0.0208  -0.0032 -0.0063 224 ASN B CG    
3801 O OD1   . ASN B 227 ? 1.0397 1.1683 0.7683 0.0178  -0.0066 -0.0010 224 ASN B OD1   
3802 N ND2   . ASN B 227 ? 1.0425 1.1833 0.7434 0.0228  -0.0092 -0.0242 224 ASN B ND2   
3803 N N     . SER B 228 ? 1.0745 1.2140 0.7073 0.0179  0.0467  0.0406  225 SER B N     
3804 C CA    . SER B 228 ? 1.1121 1.2496 0.7263 0.0152  0.0558  0.0630  225 SER B CA    
3805 C C     . SER B 228 ? 1.0270 1.1625 0.6674 0.0048  0.0699  0.0755  225 SER B C     
3806 O O     . SER B 228 ? 1.0380 1.1600 0.6824 0.0004  0.0687  0.0941  225 SER B O     
3807 C CB    . SER B 228 ? 1.1780 1.3302 0.7550 0.0202  0.0651  0.0624  225 SER B CB    
3808 O OG    . SER B 228 ? 1.1014 1.2548 0.6614 0.0162  0.0750  0.0856  225 SER B OG    
3809 N N     . ASP B 229 ? 1.0078 1.1555 0.6670 0.0005  0.0821  0.0656  226 ASP B N     
3810 C CA    . ASP B 229 ? 1.0340 1.1800 0.7187 -0.0110 0.0944  0.0772  226 ASP B CA    
3811 C C     . ASP B 229 ? 1.0063 1.1306 0.7175 -0.0155 0.0843  0.0807  226 ASP B C     
3812 O O     . ASP B 229 ? 1.0620 1.1741 0.7823 -0.0235 0.0885  0.0978  226 ASP B O     
3813 C CB    . ASP B 229 ? 1.1863 1.3498 0.8899 -0.0142 0.1064  0.0639  226 ASP B CB    
3814 C CG    . ASP B 229 ? 1.3932 1.5798 1.0718 -0.0080 0.1186  0.0601  226 ASP B CG    
3815 O OD1   . ASP B 229 ? 1.5458 1.7358 1.1927 -0.0044 0.1215  0.0724  226 ASP B OD1   
3816 O OD2   . ASP B 229 ? 1.4016 1.6031 1.0919 -0.0063 0.1255  0.0449  226 ASP B OD2   
3817 N N     . ILE B 230 ? 1.0243 1.1432 0.7474 -0.0102 0.0705  0.0648  227 ILE B N     
3818 C CA    . ILE B 230 ? 0.9840 1.0852 0.7326 -0.0128 0.0621  0.0658  227 ILE B CA    
3819 C C     . ILE B 230 ? 1.0091 1.0925 0.7460 -0.0097 0.0546  0.0839  227 ILE B C     
3820 O O     . ILE B 230 ? 1.0321 1.0981 0.7834 -0.0146 0.0555  0.0948  227 ILE B O     
3821 C CB    . ILE B 230 ? 0.9574 1.0618 0.7205 -0.0076 0.0492  0.0458  227 ILE B CB    
3822 C CG1   . ILE B 230 ? 0.9667 1.0867 0.7441 -0.0114 0.0560  0.0289  227 ILE B CG1   
3823 C CG2   . ILE B 230 ? 0.8876 0.9762 0.6748 -0.0085 0.0413  0.0469  227 ILE B CG2   
3824 C CD1   . ILE B 230 ? 0.9110 1.0362 0.7003 -0.0073 0.0426  0.0101  227 ILE B CD1   
3825 N N     . LYS B 231 ? 1.0363 1.1225 0.7465 -0.0015 0.0462  0.0873  228 LYS B N     
3826 C CA    . LYS B 231 ? 1.0751 1.1458 0.7737 0.0018  0.0386  0.1058  228 LYS B CA    
3827 C C     . LYS B 231 ? 1.0790 1.1423 0.7709 -0.0064 0.0500  0.1271  228 LYS B C     
3828 O O     . LYS B 231 ? 1.1149 1.1580 0.8155 -0.0083 0.0466  0.1413  228 LYS B O     
3829 C CB    . LYS B 231 ? 1.1623 1.2396 0.8309 0.0105  0.0278  0.1066  228 LYS B CB    
3830 C CG    . LYS B 231 ? 1.2125 1.2943 0.8875 0.0180  0.0121  0.0903  228 LYS B CG    
3831 C CD    . LYS B 231 ? 1.3921 1.4731 1.0411 0.0254  -0.0023 0.0984  228 LYS B CD    
3832 C CE    . LYS B 231 ? 1.4552 1.5449 1.1050 0.0311  -0.0181 0.0823  228 LYS B CE    
3833 N NZ    . LYS B 231 ? 1.4648 1.5666 1.0932 0.0313  -0.0159 0.0674  228 LYS B NZ    
3834 N N     . ARG B 232 ? 1.0472 1.1270 0.7240 -0.0111 0.0635  0.1299  229 ARG B N     
3835 C CA    . ARG B 232 ? 1.1155 1.1924 0.7857 -0.0203 0.0745  0.1524  229 ARG B CA    
3836 C C     . ARG B 232 ? 1.0969 1.1616 0.7979 -0.0313 0.0804  0.1563  229 ARG B C     
3837 O O     . ARG B 232 ? 1.1255 1.1717 0.8298 -0.0377 0.0796  0.1756  229 ARG B O     
3838 C CB    . ARG B 232 ? 1.1228 1.2253 0.7701 -0.0218 0.0886  0.1540  229 ARG B CB    
3839 C CG    . ARG B 232 ? 1.1450 1.2565 0.7556 -0.0119 0.0827  0.1530  229 ARG B CG    
3840 C CD    . ARG B 232 ? 1.2056 1.3328 0.7881 -0.0156 0.0958  0.1706  229 ARG B CD    
3841 N NE    . ARG B 232 ? 1.2051 1.3579 0.7869 -0.0169 0.1128  0.1610  229 ARG B NE    
3842 C CZ    . ARG B 232 ? 1.3093 1.4807 0.8787 -0.0227 0.1290  0.1767  229 ARG B CZ    
3843 N NH1   . ARG B 232 ? 1.2769 1.4427 0.8334 -0.0294 0.1295  0.2033  229 ARG B NH1   
3844 N NH2   . ARG B 232 ? 1.3657 1.5624 0.9367 -0.0218 0.1445  0.1668  229 ARG B NH2   
3845 N N     . LEU B 233 ? 1.0874 1.1607 0.8107 -0.0341 0.0852  0.1384  230 LEU B N     
3846 C CA    . LEU B 233 ? 1.1002 1.1620 0.8517 -0.0456 0.0901  0.1414  230 LEU B CA    
3847 C C     . LEU B 233 ? 1.0960 1.1273 0.8615 -0.0439 0.0777  0.1440  230 LEU B C     
3848 O O     . LEU B 233 ? 1.0282 1.0399 0.8049 -0.0530 0.0788  0.1571  230 LEU B O     
3849 C CB    . LEU B 233 ? 0.9820 1.0595 0.7544 -0.0481 0.0958  0.1208  230 LEU B CB    
3850 C CG    . LEU B 233 ? 0.9905 1.0587 0.7915 -0.0614 0.1010  0.1231  230 LEU B CG    
3851 C CD1   . LEU B 233 ? 0.9967 1.0672 0.7939 -0.0738 0.1121  0.1464  230 LEU B CD1   
3852 C CD2   . LEU B 233 ? 0.9348 1.0207 0.7556 -0.0633 0.1056  0.1029  230 LEU B CD2   
3853 N N     . LEU B 234 ? 1.0026 1.0297 0.7678 -0.0319 0.0653  0.1321  231 LEU B N     
3854 C CA    . LEU B 234 ? 1.0961 1.0969 0.8736 -0.0274 0.0541  0.1342  231 LEU B CA    
3855 C C     . LEU B 234 ? 1.1731 1.1540 0.9359 -0.0270 0.0502  0.1579  231 LEU B C     
3856 O O     . LEU B 234 ? 1.2762 1.2305 1.0505 -0.0298 0.0468  0.1663  231 LEU B O     
3857 C CB    . LEU B 234 ? 0.9823 0.9888 0.7624 -0.0144 0.0421  0.1187  231 LEU B CB    
3858 C CG    . LEU B 234 ? 1.0206 1.0391 0.8218 -0.0149 0.0420  0.0960  231 LEU B CG    
3859 C CD1   . LEU B 234 ? 1.0034 1.0285 0.8068 -0.0028 0.0286  0.0847  231 LEU B CD1   
3860 C CD2   . LEU B 234 ? 0.9323 0.9340 0.7581 -0.0226 0.0453  0.0932  231 LEU B CD2   
3861 N N     . THR B 235 ? 1.1680 1.1603 0.9045 -0.0235 0.0499  0.1688  232 THR B N     
3862 C CA    . THR B 235 ? 1.1652 1.1401 0.8869 -0.0236 0.0453  0.1928  232 THR B CA    
3863 C C     . THR B 235 ? 1.1906 1.1525 0.9179 -0.0382 0.0534  0.2106  232 THR B C     
3864 O O     . THR B 235 ? 1.1477 1.0816 0.8781 -0.0397 0.0466  0.2261  232 THR B O     
3865 C CB    . THR B 235 ? 1.2054 1.1983 0.8956 -0.0193 0.0448  0.2011  232 THR B CB    
3866 O OG1   . THR B 235 ? 1.2150 1.2184 0.9002 -0.0071 0.0351  0.1851  232 THR B OG1   
3867 C CG2   . THR B 235 ? 1.1639 1.1391 0.8391 -0.0196 0.0385  0.2270  232 THR B CG2   
3868 N N     . LYS B 236 ? 1.1902 1.1717 0.9198 -0.0491 0.0672  0.2091  233 LYS B N     
3869 C CA    . LYS B 236 ? 1.3141 1.2878 1.0487 -0.0648 0.0747  0.2289  233 LYS B CA    
3870 C C     . LYS B 236 ? 1.4452 1.3882 1.2054 -0.0710 0.0695  0.2273  233 LYS B C     
3871 O O     . LYS B 236 ? 1.5225 1.4446 1.2853 -0.0818 0.0681  0.2473  233 LYS B O     
3872 C CB    . LYS B 236 ? 1.2820 1.2883 1.0157 -0.0738 0.0912  0.2271  233 LYS B CB    
3873 C CG    . LYS B 236 ? 1.2999 1.3058 1.0369 -0.0910 0.0997  0.2514  233 LYS B CG    
3874 C CD    . LYS B 236 ? 1.3025 1.3475 1.0344 -0.0969 0.1171  0.2524  233 LYS B CD    
3875 C CE    . LYS B 236 ? 1.3455 1.3935 1.0846 -0.1155 0.1254  0.2783  233 LYS B CE    
3876 N NZ    . LYS B 236 ? 1.3644 1.3971 1.0858 -0.1201 0.1194  0.3064  233 LYS B NZ    
3877 N N     . LEU B 237 ? 1.5002 1.4394 1.2785 -0.0648 0.0658  0.2043  234 LEU B N     
3878 C CA    . LEU B 237 ? 1.5928 1.5019 1.3927 -0.0691 0.0603  0.2002  234 LEU B CA    
3879 C C     . LEU B 237 ? 1.5678 1.4486 1.3685 -0.0551 0.0462  0.1975  234 LEU B C     
3880 O O     . LEU B 237 ? 1.5181 1.3678 1.3316 -0.0570 0.0404  0.1972  234 LEU B O     
3881 C CB    . LEU B 237 ? 1.5752 1.4976 1.3957 -0.0724 0.0656  0.1776  234 LEU B CB    
3882 C CG    . LEU B 237 ? 1.5763 1.5279 1.3997 -0.0853 0.0799  0.1796  234 LEU B CG    
3883 C CD1   . LEU B 237 ? 1.5259 1.4856 1.3727 -0.0902 0.0834  0.1598  234 LEU B CD1   
3884 C CD2   . LEU B 237 ? 1.5688 1.5118 1.3897 -0.1011 0.0847  0.2057  234 LEU B CD2   
3885 N N     . LEU B 238 ? 1.6090 1.4999 1.3960 -0.0408 0.0403  0.1955  235 LEU B N     
3886 C CA    . LEU B 238 ? 1.7125 1.5791 1.4997 -0.0268 0.0273  0.1977  235 LEU B CA    
3887 C C     . LEU B 238 ? 1.7597 1.5944 1.5404 -0.0316 0.0220  0.2220  235 LEU B C     
3888 O O     . LEU B 238 ? 1.8171 1.6187 1.6076 -0.0267 0.0136  0.2224  235 LEU B O     
3889 C CB    . LEU B 238 ? 1.7703 1.6569 1.5431 -0.0129 0.0215  0.1951  235 LEU B CB    
3890 C CG    . LEU B 238 ? 1.7242 1.6295 1.5071 -0.0019 0.0181  0.1717  235 LEU B CG    
3891 C CD1   . LEU B 238 ? 1.6667 1.5889 1.4326 0.0094  0.0104  0.1744  235 LEU B CD1   
3892 C CD2   . LEU B 238 ? 1.7181 1.6023 1.5215 0.0065  0.0114  0.1613  235 LEU B CD2   
3893 N N     . VAL B 239 ? 1.7220 1.5660 1.4854 -0.0410 0.0266  0.2426  236 VAL B N     
3894 C CA    . VAL B 239 ? 1.6506 1.4659 1.4066 -0.0465 0.0202  0.2685  236 VAL B CA    
3895 C C     . VAL B 239 ? 1.6606 1.4451 1.4332 -0.0586 0.0193  0.2715  236 VAL B C     
3896 O O     . VAL B 239 ? 1.6058 1.4008 1.3901 -0.0704 0.0283  0.2627  236 VAL B O     
3897 C CB    . VAL B 239 ? 1.5717 1.4087 1.3060 -0.0563 0.0269  0.2902  236 VAL B CB    
3898 C CG1   . VAL B 239 ? 1.5294 1.3943 1.2446 -0.0441 0.0263  0.2852  236 VAL B CG1   
3899 C CG2   . VAL B 239 ? 1.4804 1.3402 1.2188 -0.0733 0.0418  0.2908  236 VAL B CG2   
3900 N N     . GLY B 240 ? 1.6646 1.4089 1.4386 -0.0555 0.0073  0.2835  237 GLY B N     
3901 C CA    . GLY B 240 ? 1.7629 1.4717 1.5500 -0.0669 0.0036  0.2867  237 GLY B CA    
3902 C C     . GLY B 240 ? 1.7777 1.4667 1.5812 -0.0562 -0.0009 0.2616  237 GLY B C     
3903 O O     . GLY B 240 ? 1.8310 1.4780 1.6407 -0.0562 -0.0102 0.2631  237 GLY B O     
3904 N N     . ARG B 241 ? 1.6809 1.3998 1.4904 -0.0469 0.0052  0.2385  238 ARG B N     
3905 C CA    . ARG B 241 ? 1.5376 1.2452 1.3622 -0.0369 0.0024  0.2139  238 ARG B CA    
3906 C C     . ARG B 241 ? 1.4274 1.1664 1.2532 -0.0199 0.0035  0.1962  238 ARG B C     
3907 O O     . ARG B 241 ? 1.3214 1.0838 1.1574 -0.0213 0.0100  0.1768  238 ARG B O     
3908 C CB    . ARG B 241 ? 1.5008 1.2112 1.3389 -0.0534 0.0098  0.2033  238 ARG B CB    
3909 C CG    . ARG B 241 ? 1.4874 1.2369 1.3237 -0.0686 0.0227  0.2081  238 ARG B CG    
3910 C CD    . ARG B 241 ? 1.5047 1.2569 1.3568 -0.0849 0.0291  0.1991  238 ARG B CD    
3911 N NE    . ARG B 241 ? 1.5580 1.3477 1.4092 -0.0983 0.0419  0.2060  238 ARG B NE    
3912 C CZ    . ARG B 241 ? 1.5579 1.3626 1.4234 -0.1119 0.0498  0.1987  238 ARG B CZ    
3913 N NH1   . ARG B 241 ? 1.5607 1.3454 1.4415 -0.1152 0.0456  0.1844  238 ARG B NH1   
3914 N NH2   . ARG B 241 ? 1.5202 1.3606 1.3846 -0.1215 0.0619  0.2057  238 ARG B NH2   
3915 N N     . PRO B 242 ? 1.3425 1.0823 1.1592 -0.0041 -0.0038 0.2029  239 PRO B N     
3916 C CA    . PRO B 242 ? 1.3639 1.1370 1.1805 0.0095  -0.0038 0.1895  239 PRO B CA    
3917 C C     . PRO B 242 ? 1.4195 1.1945 1.2533 0.0211  -0.0055 0.1659  239 PRO B C     
3918 O O     . PRO B 242 ? 1.3908 1.1971 1.2278 0.0284  -0.0048 0.1533  239 PRO B O     
3919 C CB    . PRO B 242 ? 1.2401 1.0069 1.0444 0.0225  -0.0134 0.2060  239 PRO B CB    
3920 C CG    . PRO B 242 ? 1.2473 0.9690 1.0527 0.0229  -0.0207 0.2195  239 PRO B CG    
3921 C CD    . PRO B 242 ? 1.2515 0.9605 1.0587 0.0016  -0.0140 0.2238  239 PRO B CD    
3922 N N     . THR B 243 ? 1.4432 1.1858 1.2872 0.0225  -0.0083 0.1596  240 THR B N     
3923 C CA    . THR B 243 ? 1.4668 1.2102 1.3255 0.0346  -0.0098 0.1379  240 THR B CA    
3924 C C     . THR B 243 ? 1.4466 1.1895 1.3165 0.0210  -0.0031 0.1224  240 THR B C     
3925 O O     . THR B 243 ? 1.4623 1.1981 1.3430 0.0289  -0.0045 0.1055  240 THR B O     
3926 C CB    . THR B 243 ? 1.4685 1.1751 1.3289 0.0516  -0.0192 0.1399  240 THR B CB    
3927 O OG1   . THR B 243 ? 1.4836 1.1478 1.3401 0.0409  -0.0216 0.1495  240 THR B OG1   
3928 C CG2   . THR B 243 ? 1.4860 1.1963 1.3381 0.0664  -0.0266 0.1551  240 THR B CG2   
3929 N N     . LYS B 244 ? 1.3366 1.0884 1.2042 0.0009  0.0044  0.1283  241 LYS B N     
3930 C CA    . LYS B 244 ? 1.2276 0.9804 1.1068 -0.0136 0.0103  0.1158  241 LYS B CA    
3931 C C     . LYS B 244 ? 1.1469 0.9430 1.0307 -0.0220 0.0192  0.1073  241 LYS B C     
3932 O O     . LYS B 244 ? 1.2227 1.0243 1.1152 -0.0373 0.0254  0.1021  241 LYS B O     
3933 C CB    . LYS B 244 ? 1.3283 1.0502 1.2049 -0.0314 0.0105  0.1305  241 LYS B CB    
3934 C CG    . LYS B 244 ? 1.5373 1.2104 1.4091 -0.0241 -0.0001 0.1381  241 LYS B CG    
3935 C CD    . LYS B 244 ? 1.6451 1.2840 1.5194 -0.0425 -0.0022 0.1440  241 LYS B CD    
3936 C CE    . LYS B 244 ? 1.6662 1.2526 1.5357 -0.0326 -0.0144 0.1462  241 LYS B CE    
3937 N NZ    . LYS B 244 ? 1.6453 1.1938 1.5163 -0.0508 -0.0191 0.1506  241 LYS B NZ    
3938 N N     . TRP B 245 ? 1.0685 0.8943 0.9467 -0.0119 0.0189  0.1057  242 TRP B N     
3939 C CA    . TRP B 245 ? 1.0216 0.8852 0.9013 -0.0188 0.0260  0.0980  242 TRP B CA    
3940 C C     . TRP B 245 ? 1.1384 1.0191 1.0350 -0.0177 0.0266  0.0757  242 TRP B C     
3941 O O     . TRP B 245 ? 1.2261 1.1333 1.1274 -0.0260 0.0324  0.0681  242 TRP B O     
3942 C CB    . TRP B 245 ? 1.0157 0.9023 0.8806 -0.0096 0.0238  0.1043  242 TRP B CB    
3943 C CG    . TRP B 245 ? 1.0647 0.9537 0.9302 0.0091  0.0140  0.0999  242 TRP B CG    
3944 C CD1   . TRP B 245 ? 1.1329 1.0030 0.9906 0.0209  0.0063  0.1127  242 TRP B CD1   
3945 C CD2   . TRP B 245 ? 1.0820 0.9959 0.9575 0.0176  0.0102  0.0834  242 TRP B CD2   
3946 N NE1   . TRP B 245 ? 1.0688 0.9520 0.9319 0.0369  -0.0012 0.1051  242 TRP B NE1   
3947 C CE2   . TRP B 245 ? 1.0322 0.9427 0.9061 0.0346  0.0009  0.0876  242 TRP B CE2   
3948 C CE3   . TRP B 245 ? 1.0964 1.0355 0.9831 0.0123  0.0132  0.0665  242 TRP B CE3   
3949 C CZ2   . TRP B 245 ? 1.0355 0.9690 0.9191 0.0455  -0.0053 0.0764  242 TRP B CZ2   
3950 C CZ3   . TRP B 245 ? 1.0067 0.9663 0.9021 0.0226  0.0062  0.0552  242 TRP B CZ3   
3951 C CH2   . TRP B 245 ? 0.9718 0.9296 0.8658 0.0386  -0.0028 0.0606  242 TRP B CH2   
3952 N N     . TYR B 246 ? 1.0919 0.9589 0.9977 -0.0074 0.0207  0.0654  243 TYR B N     
3953 C CA    . TYR B 246 ? 1.0132 0.8975 0.9350 -0.0075 0.0211  0.0454  243 TYR B CA    
3954 C C     . TYR B 246 ? 1.0635 0.9459 0.9951 -0.0260 0.0278  0.0399  243 TYR B C     
3955 O O     . TYR B 246 ? 1.1139 1.0225 1.0556 -0.0322 0.0310  0.0283  243 TYR B O     
3956 C CB    . TYR B 246 ? 1.0455 0.9143 0.9738 0.0071  0.0149  0.0365  243 TYR B CB    
3957 C CG    . TYR B 246 ? 1.0614 0.9471 1.0057 0.0056  0.0155  0.0171  243 TYR B CG    
3958 C CD1   . TYR B 246 ? 1.0058 0.9255 0.9574 0.0135  0.0124  0.0083  243 TYR B CD1   
3959 C CD2   . TYR B 246 ? 1.1557 1.0235 1.1076 -0.0049 0.0180  0.0086  243 TYR B CD2   
3960 C CE1   . TYR B 246 ? 1.0404 0.9768 1.0068 0.0111  0.0123  -0.0078 243 TYR B CE1   
3961 C CE2   . TYR B 246 ? 1.1267 1.0107 1.0922 -0.0070 0.0182  -0.0082 243 TYR B CE2   
3962 C CZ    . TYR B 246 ? 1.1158 1.0347 1.0888 0.0010  0.0156  -0.0160 243 TYR B CZ    
3963 O OH    . TYR B 246 ? 1.1562 1.0925 1.1431 -0.0021 0.0152  -0.0313 243 TYR B OH    
3964 N N     . ASP B 247 ? 1.0906 0.9414 1.0199 -0.0354 0.0289  0.0488  244 ASP B N     
3965 C CA    . ASP B 247 ? 1.0289 0.8765 0.9683 -0.0542 0.0341  0.0458  244 ASP B CA    
3966 C C     . ASP B 247 ? 0.9661 0.8375 0.9043 -0.0675 0.0427  0.0552  244 ASP B C     
3967 O O     . ASP B 247 ? 0.9241 0.8055 0.8743 -0.0818 0.0479  0.0506  244 ASP B O     
3968 C CB    . ASP B 247 ? 1.1400 0.9442 1.0767 -0.0609 0.0305  0.0536  244 ASP B CB    
3969 C CG    . ASP B 247 ? 1.2327 1.0115 1.1702 -0.0472 0.0230  0.0416  244 ASP B CG    
3970 O OD1   . ASP B 247 ? 1.2267 1.0234 1.1734 -0.0407 0.0227  0.0241  244 ASP B OD1   
3971 O OD2   . ASP B 247 ? 1.3028 1.0439 1.2313 -0.0426 0.0172  0.0499  244 ASP B OD2   
3972 N N     . LEU B 248 ? 1.0244 0.9059 0.9481 -0.0625 0.0443  0.0681  245 LEU B N     
3973 C CA    . LEU B 248 ? 1.0363 0.9409 0.9560 -0.0731 0.0535  0.0775  245 LEU B CA    
3974 C C     . LEU B 248 ? 0.9313 0.8735 0.8533 -0.0689 0.0568  0.0645  245 LEU B C     
3975 O O     . LEU B 248 ? 0.9804 0.9441 0.9023 -0.0773 0.0655  0.0675  245 LEU B O     
3976 C CB    . LEU B 248 ? 1.0745 0.9714 0.9749 -0.0710 0.0539  0.0988  245 LEU B CB    
3977 C CG    . LEU B 248 ? 1.0644 0.9239 0.9628 -0.0794 0.0507  0.1150  245 LEU B CG    
3978 C CD1   . LEU B 248 ? 1.0211 0.8753 0.9010 -0.0788 0.0507  0.1379  245 LEU B CD1   
3979 C CD2   . LEU B 248 ? 1.0071 0.8641 0.9193 -0.0992 0.0563  0.1172  245 LEU B CD2   
3980 N N     . LEU B 249 ? 0.8616 0.8125 0.7860 -0.0559 0.0498  0.0507  246 LEU B N     
3981 C CA    . LEU B 249 ? 0.8836 0.8671 0.8108 -0.0527 0.0504  0.0379  246 LEU B CA    
3982 C C     . LEU B 249 ? 0.8773 0.8773 0.8203 -0.0658 0.0574  0.0290  246 LEU B C     
3983 O O     . LEU B 249 ? 0.8882 0.9129 0.8278 -0.0664 0.0619  0.0261  246 LEU B O     
3984 C CB    . LEU B 249 ? 0.8600 0.8489 0.7929 -0.0399 0.0404  0.0249  246 LEU B CB    
3985 C CG    . LEU B 249 ? 0.9544 0.9401 0.8726 -0.0246 0.0326  0.0320  246 LEU B CG    
3986 C CD1   . LEU B 249 ? 0.9678 0.9656 0.8960 -0.0138 0.0234  0.0194  246 LEU B CD1   
3987 C CD2   . LEU B 249 ? 0.8796 0.8816 0.7791 -0.0229 0.0344  0.0399  246 LEU B CD2   
3988 N N     . PRO B 250 ? 0.9328 0.9205 0.8925 -0.0759 0.0580  0.0241  247 PRO B N     
3989 C CA    . PRO B 250 ? 0.9258 0.9309 0.9014 -0.0891 0.0647  0.0181  247 PRO B CA    
3990 C C     . PRO B 250 ? 0.9882 1.0040 0.9585 -0.0980 0.0754  0.0318  247 PRO B C     
3991 O O     . PRO B 250 ? 0.9662 1.0087 0.9409 -0.0998 0.0812  0.0263  247 PRO B O     
3992 C CB    . PRO B 250 ? 0.7904 0.7737 0.7807 -0.0988 0.0620  0.0142  247 PRO B CB    
3993 C CG    . PRO B 250 ? 0.8286 0.7947 0.8142 -0.0858 0.0528  0.0081  247 PRO B CG    
3994 C CD    . PRO B 250 ? 0.8659 0.8268 0.8317 -0.0739 0.0514  0.0202  247 PRO B CD    
3995 N N     . VAL B 251 ? 1.0239 1.0202 0.9851 -0.1033 0.0782  0.0500  248 VAL B N     
3996 C CA    . VAL B 251 ? 0.9440 0.9544 0.9015 -0.1126 0.0892  0.0650  248 VAL B CA    
3997 C C     . VAL B 251 ? 0.9026 0.9347 0.8401 -0.1014 0.0932  0.0677  248 VAL B C     
3998 O O     . VAL B 251 ? 0.8798 0.9356 0.8150 -0.1052 0.1037  0.0727  248 VAL B O     
3999 C CB    . VAL B 251 ? 0.8729 0.8565 0.8268 -0.1235 0.0897  0.0858  248 VAL B CB    
4000 C CG1   . VAL B 251 ? 0.9020 0.8646 0.8352 -0.1128 0.0834  0.0963  248 VAL B CG1   
4001 C CG2   . VAL B 251 ? 0.8834 0.8863 0.8395 -0.1365 0.1017  0.1021  248 VAL B CG2   
4002 N N     . VAL B 252 ? 0.9134 0.9389 0.8360 -0.0871 0.0849  0.0642  249 VAL B N     
4003 C CA    . VAL B 252 ? 0.8634 0.9075 0.7648 -0.0766 0.0866  0.0657  249 VAL B CA    
4004 C C     . VAL B 252 ? 0.8661 0.9383 0.7730 -0.0734 0.0889  0.0482  249 VAL B C     
4005 O O     . VAL B 252 ? 0.8606 0.9535 0.7551 -0.0711 0.0965  0.0499  249 VAL B O     
4006 C CB    . VAL B 252 ? 0.8862 0.9164 0.7725 -0.0629 0.0753  0.0666  249 VAL B CB    
4007 C CG1   . VAL B 252 ? 0.8717 0.9213 0.7361 -0.0525 0.0746  0.0652  249 VAL B CG1   
4008 C CG2   . VAL B 252 ? 0.9003 0.9028 0.7786 -0.0650 0.0733  0.0858  249 VAL B CG2   
4009 N N     . GLN B 253 ? 0.8544 0.9276 0.7799 -0.0731 0.0821  0.0314  250 GLN B N     
4010 C CA    . GLN B 253 ? 0.8040 0.9012 0.7364 -0.0705 0.0820  0.0148  250 GLN B CA    
4011 C C     . GLN B 253 ? 0.8344 0.9487 0.7786 -0.0805 0.0944  0.0160  250 GLN B C     
4012 O O     . GLN B 253 ? 0.9050 1.0410 0.8437 -0.0758 0.0991  0.0093  250 GLN B O     
4013 C CB    . GLN B 253 ? 0.7975 0.8922 0.7483 -0.0696 0.0713  -0.0011 250 GLN B CB    
4014 C CG    . GLN B 253 ? 0.9376 1.0264 0.8786 -0.0573 0.0587  -0.0050 250 GLN B CG    
4015 C CD    . GLN B 253 ? 0.9053 0.9967 0.8659 -0.0572 0.0491  -0.0195 250 GLN B CD    
4016 O OE1   . GLN B 253 ? 1.0680 1.1447 1.0334 -0.0546 0.0434  -0.0187 250 GLN B OE1   
4017 N NE2   . GLN B 253 ? 0.8461 0.9566 0.8178 -0.0595 0.0472  -0.0326 250 GLN B NE2   
4018 N N     . LEU B 254 ? 0.8244 0.9291 0.7853 -0.0940 0.0993  0.0241  251 LEU B N     
4019 C CA    . LEU B 254 ? 0.8502 0.9730 0.8248 -0.1045 0.1112  0.0282  251 LEU B CA    
4020 C C     . LEU B 254 ? 0.9211 1.0604 0.8767 -0.1013 0.1229  0.0412  251 LEU B C     
4021 O O     . LEU B 254 ? 1.0210 1.1862 0.9796 -0.0998 0.1320  0.0370  251 LEU B O     
4022 C CB    . LEU B 254 ? 0.8697 0.9758 0.8625 -0.1208 0.1124  0.0382  251 LEU B CB    
4023 C CG    . LEU B 254 ? 0.8657 0.9599 0.8787 -0.1255 0.1028  0.0240  251 LEU B CG    
4024 C CD1   . LEU B 254 ? 0.9057 0.9759 0.9298 -0.1405 0.1018  0.0345  251 LEU B CD1   
4025 C CD2   . LEU B 254 ? 0.8727 0.9921 0.9046 -0.1276 0.1047  0.0097  251 LEU B CD2   
4026 N N     . ALA B 255 ? 0.9538 1.0791 0.8892 -0.0993 0.1229  0.0570  252 ALA B N     
4027 C CA    . ALA B 255 ? 0.8438 0.9855 0.7580 -0.0960 0.1337  0.0704  252 ALA B CA    
4028 C C     . ALA B 255 ? 0.8405 1.0011 0.7362 -0.0807 0.1335  0.0562  252 ALA B C     
4029 O O     . ALA B 255 ? 0.8450 1.0310 0.7358 -0.0780 0.1449  0.0554  252 ALA B O     
4030 C CB    . ALA B 255 ? 0.8762 0.9966 0.7718 -0.0967 0.1307  0.0898  252 ALA B CB    
4031 N N     . LEU B 256 ? 0.8342 0.9827 0.7196 -0.0702 0.1201  0.0448  253 LEU B N     
4032 C CA    . LEU B 256 ? 0.8347 0.9968 0.7004 -0.0564 0.1167  0.0316  253 LEU B CA    
4033 C C     . LEU B 256 ? 0.8971 1.0795 0.7774 -0.0550 0.1200  0.0141  253 LEU B C     
4034 O O     . LEU B 256 ? 0.8213 1.0211 0.6853 -0.0461 0.1253  0.0077  253 LEU B O     
4035 C CB    . LEU B 256 ? 0.8305 0.9765 0.6885 -0.0478 0.0997  0.0236  253 LEU B CB    
4036 C CG    . LEU B 256 ? 0.8891 1.0154 0.7306 -0.0455 0.0942  0.0394  253 LEU B CG    
4037 C CD1   . LEU B 256 ? 0.8396 0.9524 0.6845 -0.0386 0.0777  0.0307  253 LEU B CD1   
4038 C CD2   . LEU B 256 ? 0.8858 1.0203 0.6944 -0.0386 0.0987  0.0493  253 LEU B CD2   
4039 N N     . ASN B 257 ? 0.8700 1.0496 0.7802 -0.0632 0.1166  0.0059  254 ASN B N     
4040 C CA    . ASN B 257 ? 0.7922 0.9889 0.7190 -0.0621 0.1170  -0.0110 254 ASN B CA    
4041 C C     . ASN B 257 ? 0.7603 0.9781 0.6998 -0.0683 0.1334  -0.0051 254 ASN B C     
4042 O O     . ASN B 257 ? 0.7542 0.9892 0.7036 -0.0644 0.1357  -0.0183 254 ASN B O     
4043 C CB    . ASN B 257 ? 0.7262 0.9128 0.6794 -0.0685 0.1053  -0.0219 254 ASN B CB    
4044 C CG    . ASN B 257 ? 0.7900 0.9651 0.7337 -0.0600 0.0887  -0.0317 254 ASN B CG    
4045 O OD1   . ASN B 257 ? 0.8332 1.0134 0.7563 -0.0488 0.0835  -0.0384 254 ASN B OD1   
4046 N ND2   . ASN B 257 ? 0.7047 0.8648 0.6627 -0.0652 0.0801  -0.0321 254 ASN B ND2   
4047 N N     . ASN B 258 ? 0.7778 0.9953 0.7185 -0.0778 0.1442  0.0150  255 ASN B N     
4048 C CA    . ASN B 258 ? 0.7835 1.0254 0.7351 -0.0835 0.1608  0.0243  255 ASN B CA    
4049 C C     . ASN B 258 ? 0.9633 1.2188 0.8873 -0.0775 0.1732  0.0388  255 ASN B C     
4050 O O     . ASN B 258 ? 1.0359 1.3091 0.9669 -0.0853 0.1876  0.0551  255 ASN B O     
4051 C CB    . ASN B 258 ? 0.7753 1.0102 0.7547 -0.1023 0.1632  0.0375  255 ASN B CB    
4052 C CG    . ASN B 258 ? 0.8857 1.1122 0.8926 -0.1086 0.1528  0.0226  255 ASN B CG    
4053 O OD1   . ASN B 258 ? 0.9100 1.1550 0.9340 -0.1074 0.1551  0.0109  255 ASN B OD1   
4054 N ND2   . ASN B 258 ? 0.7867 0.9856 0.7974 -0.1146 0.1412  0.0229  255 ASN B ND2   
4055 N N     . THR B 259 ? 1.0141 1.2627 0.9067 -0.0646 0.1675  0.0342  256 THR B N     
4056 C CA    . THR B 259 ? 1.0933 1.3560 0.9551 -0.0569 0.1782  0.0451  256 THR B CA    
4057 C C     . THR B 259 ? 1.0506 1.3388 0.9025 -0.0430 0.1861  0.0295  256 THR B C     
4058 O O     . THR B 259 ? 1.0194 1.3034 0.8718 -0.0339 0.1757  0.0076  256 THR B O     
4059 C CB    . THR B 259 ? 1.1558 1.3977 0.9874 -0.0499 0.1669  0.0481  256 THR B CB    
4060 O OG1   . THR B 259 ? 1.2318 1.4522 1.0700 -0.0616 0.1628  0.0664  256 THR B OG1   
4061 C CG2   . THR B 259 ? 1.0425 1.3001 0.8379 -0.0394 0.1760  0.0544  256 THR B CG2   
4062 N N     . TYR B 260 ? 1.0484 1.3631 0.8916 -0.0413 0.2042  0.0412  257 TYR B N     
4063 C CA    . TYR B 260 ? 1.1501 1.4911 0.9844 -0.0269 0.2145  0.0272  257 TYR B CA    
4064 C C     . TYR B 260 ? 1.2308 1.5660 1.0233 -0.0092 0.2082  0.0144  257 TYR B C     
4065 O O     . TYR B 260 ? 1.3440 1.6715 1.1077 -0.0082 0.2072  0.0267  257 TYR B O     
4066 C CB    . TYR B 260 ? 1.2834 1.6579 1.1219 -0.0303 0.2370  0.0458  257 TYR B CB    
4067 C CG    . TYR B 260 ? 1.4120 1.8167 1.2395 -0.0132 0.2505  0.0329  257 TYR B CG    
4068 C CD1   . TYR B 260 ? 1.4191 1.8352 1.2730 -0.0088 0.2514  0.0157  257 TYR B CD1   
4069 C CD2   . TYR B 260 ? 1.3568 1.7789 1.1471 -0.0010 0.2624  0.0382  257 TYR B CD2   
4070 C CE1   . TYR B 260 ? 1.4432 1.8857 1.2872 0.0087  0.2636  0.0031  257 TYR B CE1   
4071 C CE2   . TYR B 260 ? 1.3386 1.7879 1.1169 0.0165  0.2753  0.0251  257 TYR B CE2   
4072 C CZ    . TYR B 260 ? 1.3991 1.8579 1.2047 0.0220  0.2759  0.0073  257 TYR B CZ    
4073 O OH    . TYR B 260 ? 1.4416 1.9261 1.2352 0.0414  0.2886  -0.0066 257 TYR B OH    
4074 N N     . SER B 261 ? 1.1476 1.4854 0.9367 0.0041  0.2028  -0.0101 258 SER B N     
4075 C CA    . SER B 261 ? 1.1344 1.4635 0.8842 0.0205  0.1938  -0.0252 258 SER B CA    
4076 C C     . SER B 261 ? 1.1564 1.5125 0.8817 0.0356  0.2111  -0.0292 258 SER B C     
4077 O O     . SER B 261 ? 0.9665 1.3409 0.7087 0.0419  0.2196  -0.0406 258 SER B O     
4078 C CB    . SER B 261 ? 0.9196 1.2312 0.6783 0.0258  0.1741  -0.0498 258 SER B CB    
4079 O OG    . SER B 261 ? 1.0357 1.3410 0.7570 0.0423  0.1657  -0.0661 258 SER B OG    
4080 N N     . PRO B 262 ? 1.1788 1.5389 0.8640 0.0425  0.2168  -0.0203 259 PRO B N     
4081 C CA    . PRO B 262 ? 1.3037 1.6919 0.9629 0.0580  0.2350  -0.0241 259 PRO B CA    
4082 C C     . PRO B 262 ? 1.4049 1.7897 1.0478 0.0776  0.2282  -0.0544 259 PRO B C     
4083 O O     . PRO B 262 ? 1.3879 1.7983 1.0258 0.0907  0.2443  -0.0620 259 PRO B O     
4084 C CB    . PRO B 262 ? 1.3115 1.6982 0.9287 0.0593  0.2376  -0.0081 259 PRO B CB    
4085 C CG    . PRO B 262 ? 1.2353 1.6021 0.8692 0.0405  0.2280  0.0122  259 PRO B CG    
4086 C CD    . PRO B 262 ? 1.1295 1.4722 0.7942 0.0351  0.2094  -0.0028 259 PRO B CD    
4087 N N     . VAL B 263 ? 1.4465 1.8009 1.0809 0.0803  0.2043  -0.0715 260 VAL B N     
4088 C CA    . VAL B 263 ? 1.4172 1.7640 1.0333 0.0981  0.1947  -0.1000 260 VAL B CA    
4089 C C     . VAL B 263 ? 1.3414 1.6936 0.9985 0.0982  0.1938  -0.1143 260 VAL B C     
4090 O O     . VAL B 263 ? 1.3205 1.6879 0.9740 0.1134  0.2031  -0.1292 260 VAL B O     
4091 C CB    . VAL B 263 ? 1.2935 1.6067 0.8849 0.0996  0.1678  -0.1107 260 VAL B CB    
4092 C CG1   . VAL B 263 ? 1.1460 1.4463 0.7270 0.1144  0.1533  -0.1402 260 VAL B CG1   
4093 C CG2   . VAL B 263 ? 1.1077 1.4178 0.6522 0.1036  0.1692  -0.0997 260 VAL B CG2   
4094 N N     . LEU B 264 ? 1.3103 1.6501 1.0062 0.0819  0.1823  -0.1103 261 LEU B N     
4095 C CA    . LEU B 264 ? 1.2902 1.6336 1.0258 0.0799  0.1791  -0.1228 261 LEU B CA    
4096 C C     . LEU B 264 ? 1.2331 1.6067 1.0029 0.0729  0.2014  -0.1088 261 LEU B C     
4097 O O     . LEU B 264 ? 1.2439 1.6271 1.0435 0.0747  0.2027  -0.1194 261 LEU B O     
4098 C CB    . LEU B 264 ? 1.2042 1.5230 0.9655 0.0655  0.1569  -0.1248 261 LEU B CB    
4099 C CG    . LEU B 264 ? 1.1716 1.4633 0.9111 0.0724  0.1314  -0.1430 261 LEU B CG    
4100 C CD1   . LEU B 264 ? 1.0832 1.3551 0.8407 0.0571  0.1133  -0.1362 261 LEU B CD1   
4101 C CD2   . LEU B 264 ? 1.1843 1.4744 0.9326 0.0832  0.1228  -0.1670 261 LEU B CD2   
4102 N N     . LYS B 265 ? 1.1456 1.5345 0.9126 0.0643  0.2177  -0.0844 262 LYS B N     
4103 C CA    . LYS B 265 ? 1.0925 1.5116 0.8914 0.0553  0.2383  -0.0671 262 LYS B CA    
4104 C C     . LYS B 265 ? 1.0079 1.4201 0.8554 0.0378  0.2303  -0.0647 262 LYS B C     
4105 O O     . LYS B 265 ? 0.9420 1.3772 0.8221 0.0338  0.2420  -0.0607 262 LYS B O     
4106 C CB    . LYS B 265 ? 1.1856 1.6364 0.9800 0.0734  0.2567  -0.0761 262 LYS B CB    
4107 C CG    . LYS B 265 ? 1.3955 1.8569 1.1398 0.0906  0.2677  -0.0767 262 LYS B CG    
4108 C CD    . LYS B 265 ? 1.4493 1.9416 1.1870 0.1117  0.2858  -0.0886 262 LYS B CD    
4109 C CE    . LYS B 265 ? 1.4596 1.9617 1.1436 0.1288  0.2966  -0.0894 262 LYS B CE    
4110 N NZ    . LYS B 265 ? 1.5216 2.0550 1.1959 0.1520  0.3157  -0.1018 262 LYS B NZ    
4111 N N     . TYR B 266 ? 0.9837 1.3655 0.8357 0.0274  0.2104  -0.0666 263 TYR B N     
4112 C CA    . TYR B 266 ? 0.8307 1.2025 0.7237 0.0101  0.2012  -0.0640 263 TYR B CA    
4113 C C     . TYR B 266 ? 0.8663 1.2094 0.7528 -0.0011 0.1865  -0.0559 263 TYR B C     
4114 O O     . TYR B 266 ? 0.9699 1.2967 0.8245 0.0069  0.1763  -0.0610 263 TYR B O     
4115 C CB    . TYR B 266 ? 0.8064 1.1726 0.7192 0.0152  0.1879  -0.0872 263 TYR B CB    
4116 C CG    . TYR B 266 ? 0.9161 1.3096 0.8485 0.0233  0.2009  -0.0942 263 TYR B CG    
4117 C CD1   . TYR B 266 ? 0.9376 1.3532 0.9056 0.0109  0.2147  -0.0791 263 TYR B CD1   
4118 C CD2   . TYR B 266 ? 0.9376 1.3338 0.8536 0.0434  0.1982  -0.1159 263 TYR B CD2   
4119 C CE1   . TYR B 266 ? 0.8896 1.3325 0.8779 0.0189  0.2266  -0.0844 263 TYR B CE1   
4120 C CE2   . TYR B 266 ? 0.9425 1.3635 0.8774 0.0528  0.2101  -0.1228 263 TYR B CE2   
4121 C CZ    . TYR B 266 ? 0.9161 1.3619 0.8882 0.0406  0.2247  -0.1065 263 TYR B CZ    
4122 O OH    . TYR B 266 ? 0.8640 1.3370 0.8572 0.0505  0.2367  -0.1121 263 TYR B OH    
4123 N N     . THR B 267 ? 0.7993 1.1362 0.7160 -0.0192 0.1850  -0.0435 264 THR B N     
4124 C CA    . THR B 267 ? 0.8427 1.1523 0.7565 -0.0287 0.1714  -0.0368 264 THR B CA    
4125 C C     . THR B 267 ? 0.7669 1.0578 0.6889 -0.0271 0.1505  -0.0559 264 THR B C     
4126 O O     . THR B 267 ? 0.7495 1.0475 0.6881 -0.0236 0.1464  -0.0716 264 THR B O     
4127 C CB    . THR B 267 ? 0.8595 1.1665 0.8003 -0.0479 0.1766  -0.0177 264 THR B CB    
4128 O OG1   . THR B 267 ? 0.8755 1.1868 0.8531 -0.0565 0.1734  -0.0255 264 THR B OG1   
4129 C CG2   . THR B 267 ? 0.8037 1.1325 0.7406 -0.0516 0.1967  0.0033  264 THR B CG2   
4130 N N     . PRO B 268 ? 0.7657 1.0337 0.6767 -0.0293 0.1366  -0.0540 265 PRO B N     
4131 C CA    . PRO B 268 ? 0.7401 0.9936 0.6625 -0.0297 0.1168  -0.0692 265 PRO B CA    
4132 C C     . PRO B 268 ? 0.7472 1.0028 0.7089 -0.0424 0.1146  -0.0724 265 PRO B C     
4133 O O     . PRO B 268 ? 0.7264 0.9822 0.7018 -0.0409 0.1030  -0.0881 265 PRO B O     
4134 C CB    . PRO B 268 ? 0.7531 0.9857 0.6604 -0.0315 0.1067  -0.0605 265 PRO B CB    
4135 C CG    . PRO B 268 ? 0.7827 1.0181 0.6589 -0.0256 0.1173  -0.0474 265 PRO B CG    
4136 C CD    . PRO B 268 ? 0.7906 1.0469 0.6758 -0.0293 0.1375  -0.0384 265 PRO B CD    
4137 N N     . HIS B 269 ? 0.7661 1.0225 0.7458 -0.0557 0.1244  -0.0570 266 HIS B N     
4138 C CA    . HIS B 269 ? 0.6724 0.9307 0.6881 -0.0689 0.1226  -0.0589 266 HIS B CA    
4139 C C     . HIS B 269 ? 0.6899 0.9694 0.7230 -0.0655 0.1270  -0.0701 266 HIS B C     
4140 O O     . HIS B 269 ? 0.6554 0.9346 0.7118 -0.0701 0.1170  -0.0813 266 HIS B O     
4141 C CB    . HIS B 269 ? 0.6772 0.9328 0.7054 -0.0836 0.1330  -0.0393 266 HIS B CB    
4142 C CG    . HIS B 269 ? 0.7037 0.9573 0.7660 -0.0988 0.1295  -0.0402 266 HIS B CG    
4143 N ND1   . HIS B 269 ? 0.6720 0.9460 0.7597 -0.1044 0.1369  -0.0413 266 HIS B ND1   
4144 C CD2   . HIS B 269 ? 0.6716 0.9057 0.7460 -0.1091 0.1192  -0.0401 266 HIS B CD2   
4145 C CE1   . HIS B 269 ? 0.7168 0.9832 0.8303 -0.1188 0.1305  -0.0414 266 HIS B CE1   
4146 N NE2   . HIS B 269 ? 0.7305 0.9725 0.8354 -0.1217 0.1200  -0.0412 266 HIS B NE2   
4147 N N     . GLN B 270 ? 0.7438 1.0425 0.7656 -0.0566 0.1417  -0.0671 267 GLN B N     
4148 C CA    . GLN B 270 ? 0.6745 0.9946 0.7131 -0.0511 0.1474  -0.0773 267 GLN B CA    
4149 C C     . GLN B 270 ? 0.7641 1.0786 0.7933 -0.0377 0.1328  -0.0996 267 GLN B C     
4150 O O     . GLN B 270 ? 0.8654 1.1865 0.9182 -0.0382 0.1271  -0.1112 267 GLN B O     
4151 C CB    . GLN B 270 ? 0.7013 1.0457 0.7288 -0.0435 0.1684  -0.0676 267 GLN B CB    
4152 C CG    . GLN B 270 ? 0.7396 1.0937 0.7822 -0.0588 0.1825  -0.0438 267 GLN B CG    
4153 C CD    . GLN B 270 ? 0.7605 1.1405 0.7882 -0.0511 0.2031  -0.0315 267 GLN B CD    
4154 O OE1   . GLN B 270 ? 0.7591 1.1427 0.7546 -0.0346 0.2065  -0.0381 267 GLN B OE1   
4155 N NE2   . GLN B 270 ? 0.7510 1.1503 0.8018 -0.0636 0.2167  -0.0129 267 GLN B NE2   
4156 N N     . LEU B 271 ? 0.7078 1.0094 0.7030 -0.0265 0.1251  -0.1051 268 LEU B N     
4157 C CA    . LEU B 271 ? 0.6933 0.9871 0.6775 -0.0148 0.1089  -0.1255 268 LEU B CA    
4158 C C     . LEU B 271 ? 0.6642 0.9440 0.6697 -0.0246 0.0887  -0.1327 268 LEU B C     
4159 O O     . LEU B 271 ? 0.6503 0.9281 0.6622 -0.0199 0.0751  -0.1485 268 LEU B O     
4160 C CB    . LEU B 271 ? 0.7402 1.0234 0.6813 -0.0018 0.1048  -0.1278 268 LEU B CB    
4161 C CG    . LEU B 271 ? 0.8134 1.1117 0.7276 0.0118  0.1226  -0.1256 268 LEU B CG    
4162 C CD1   . LEU B 271 ? 0.9084 1.1939 0.7796 0.0212  0.1174  -0.1247 268 LEU B CD1   
4163 C CD2   . LEU B 271 ? 0.8189 1.1291 0.7365 0.0251  0.1244  -0.1433 268 LEU B CD2   
4164 N N     . LEU B 272 ? 0.6440 0.9143 0.6605 -0.0380 0.0861  -0.1213 269 LEU B N     
4165 C CA    . LEU B 272 ? 0.7007 0.9601 0.7351 -0.0466 0.0680  -0.1273 269 LEU B CA    
4166 C C     . LEU B 272 ? 0.7070 0.9755 0.7795 -0.0591 0.0688  -0.1286 269 LEU B C     
4167 O O     . LEU B 272 ? 0.6619 0.9289 0.7513 -0.0626 0.0537  -0.1391 269 LEU B O     
4168 C CB    . LEU B 272 ? 0.6623 0.9066 0.6886 -0.0528 0.0641  -0.1162 269 LEU B CB    
4169 C CG    . LEU B 272 ? 0.5892 0.8248 0.6324 -0.0608 0.0468  -0.1209 269 LEU B CG    
4170 C CD1   . LEU B 272 ? 0.5868 0.8208 0.6219 -0.0527 0.0284  -0.1350 269 LEU B CD1   
4171 C CD2   . LEU B 272 ? 0.5928 0.8145 0.6279 -0.0645 0.0456  -0.1095 269 LEU B CD2   
4172 N N     . PHE B 273 ? 0.6161 0.8949 0.7031 -0.0669 0.0854  -0.1169 270 PHE B N     
4173 C CA    . PHE B 273 ? 0.5621 0.8491 0.6852 -0.0807 0.0861  -0.1157 270 PHE B CA    
4174 C C     . PHE B 273 ? 0.6233 0.9322 0.7626 -0.0773 0.0975  -0.1176 270 PHE B C     
4175 O O     . PHE B 273 ? 0.6623 0.9794 0.8331 -0.0876 0.0957  -0.1185 270 PHE B O     
4176 C CB    . PHE B 273 ? 0.6075 0.8876 0.7403 -0.0960 0.0930  -0.0995 270 PHE B CB    
4177 C CG    . PHE B 273 ? 0.6381 0.8969 0.7579 -0.0988 0.0829  -0.0971 270 PHE B CG    
4178 C CD1   . PHE B 273 ? 0.7178 0.9690 0.8461 -0.1015 0.0660  -0.1073 270 PHE B CD1   
4179 C CD2   . PHE B 273 ? 0.5813 0.8290 0.6815 -0.0986 0.0905  -0.0838 270 PHE B CD2   
4180 C CE1   . PHE B 273 ? 0.6374 0.8723 0.7549 -0.1025 0.0578  -0.1046 270 PHE B CE1   
4181 C CE2   . PHE B 273 ? 0.6085 0.8369 0.6979 -0.0995 0.0815  -0.0816 270 PHE B CE2   
4182 C CZ    . PHE B 273 ? 0.6092 0.8321 0.7074 -0.1007 0.0657  -0.0923 270 PHE B CZ    
4183 N N     . GLY B 274 ? 0.6601 0.9798 0.7792 -0.0628 0.1095  -0.1179 271 GLY B N     
4184 C CA    . GLY B 274 ? 0.5930 0.9361 0.7274 -0.0570 0.1217  -0.1198 271 GLY B CA    
4185 C C     . GLY B 274 ? 0.6498 1.0099 0.8087 -0.0701 0.1378  -0.1022 271 GLY B C     
4186 O O     . GLY B 274 ? 0.5809 0.9617 0.7645 -0.0697 0.1446  -0.1031 271 GLY B O     
4187 N N     . ILE B 275 ? 0.6465 0.9980 0.8002 -0.0820 0.1430  -0.0855 272 ILE B N     
4188 C CA    . ILE B 275 ? 0.6603 1.0251 0.8360 -0.0968 0.1561  -0.0667 272 ILE B CA    
4189 C C     . ILE B 275 ? 0.6178 0.9783 0.7700 -0.0984 0.1672  -0.0490 272 ILE B C     
4190 O O     . ILE B 275 ? 0.7001 1.0430 0.8225 -0.0914 0.1621  -0.0510 272 ILE B O     
4191 C CB    . ILE B 275 ? 0.5940 0.9467 0.7979 -0.1174 0.1456  -0.0633 272 ILE B CB    
4192 C CG1   . ILE B 275 ? 0.6217 0.9444 0.8081 -0.1222 0.1332  -0.0640 272 ILE B CG1   
4193 C CG2   . ILE B 275 ? 0.5644 0.9242 0.7950 -0.1183 0.1351  -0.0777 272 ILE B CG2   
4194 C CD1   . ILE B 275 ? 0.7383 1.0474 0.9469 -0.1413 0.1241  -0.0605 272 ILE B CD1   
4195 N N     . ASP B 276 ? 0.6249 1.0026 0.7921 -0.1088 0.1816  -0.0301 273 ASP B N     
4196 C CA    . ASP B 276 ? 0.6913 1.0623 0.8426 -0.1161 0.1895  -0.0099 273 ASP B CA    
4197 C C     . ASP B 276 ? 0.7102 1.0489 0.8637 -0.1313 0.1760  -0.0059 273 ASP B C     
4198 O O     . ASP B 276 ? 0.7635 1.0914 0.9369 -0.1398 0.1639  -0.0151 273 ASP B O     
4199 C CB    . ASP B 276 ? 0.7295 1.1283 0.8997 -0.1255 0.2067  0.0112  273 ASP B CB    
4200 C CG    . ASP B 276 ? 0.9260 1.3559 1.0814 -0.1085 0.2241  0.0133  273 ASP B CG    
4201 O OD1   . ASP B 276 ? 0.9136 1.3452 1.0511 -0.0890 0.2220  -0.0058 273 ASP B OD1   
4202 O OD2   . ASP B 276 ? 1.0276 1.4802 1.1885 -0.1146 0.2396  0.0345  273 ASP B OD2   
4203 N N     . SER B 277 ? 0.7762 1.0996 0.9082 -0.1340 0.1781  0.0079  274 SER B N     
4204 C CA    . SER B 277 ? 0.6592 0.9497 0.7882 -0.1449 0.1660  0.0114  274 SER B CA    
4205 C C     . SER B 277 ? 0.7136 0.9995 0.8583 -0.1650 0.1705  0.0328  274 SER B C     
4206 O O     . SER B 277 ? 0.9399 1.2465 1.0880 -0.1692 0.1841  0.0502  274 SER B O     
4207 C CB    . SER B 277 ? 0.6800 0.9519 0.7741 -0.1339 0.1624  0.0118  274 SER B CB    
4208 O OG    . SER B 277 ? 0.7415 0.9864 0.8311 -0.1449 0.1573  0.0247  274 SER B OG    
4209 N N     . ASN B 278 ? 0.6592 0.9179 0.8131 -0.1776 0.1583  0.0317  275 ASN B N     
4210 C CA    . ASN B 278 ? 0.7010 0.9474 0.8668 -0.1975 0.1587  0.0508  275 ASN B CA    
4211 C C     . ASN B 278 ? 0.7259 0.9520 0.8673 -0.1983 0.1600  0.0671  275 ASN B C     
4212 O O     . ASN B 278 ? 0.7205 0.9351 0.8690 -0.2148 0.1602  0.0855  275 ASN B O     
4213 C CB    . ASN B 278 ? 0.6540 0.8764 0.8355 -0.2098 0.1445  0.0420  275 ASN B CB    
4214 C CG    . ASN B 278 ? 0.6229 0.8650 0.8309 -0.2120 0.1421  0.0285  275 ASN B CG    
4215 O OD1   . ASN B 278 ? 0.6177 0.8900 0.8438 -0.2141 0.1520  0.0342  275 ASN B OD1   
4216 N ND2   . ASN B 278 ? 0.6250 0.8519 0.8360 -0.2110 0.1290  0.0113  275 ASN B ND2   
4217 N N     . THR B 279 ? 0.8301 1.0507 0.9435 -0.1816 0.1596  0.0615  276 THR B N     
4218 C CA    . THR B 279 ? 0.9269 1.1317 1.0159 -0.1805 0.1614  0.0778  276 THR B CA    
4219 C C     . THR B 279 ? 1.0081 1.2385 1.0762 -0.1653 0.1730  0.0801  276 THR B C     
4220 O O     . THR B 279 ? 1.0158 1.2388 1.0599 -0.1498 0.1686  0.0700  276 THR B O     
4221 C CB    . THR B 279 ? 0.8949 1.0632 0.9673 -0.1750 0.1472  0.0697  276 THR B CB    
4222 O OG1   . THR B 279 ? 0.8750 1.0489 0.9350 -0.1570 0.1428  0.0499  276 THR B OG1   
4223 C CG2   . THR B 279 ? 0.8522 0.9960 0.9428 -0.1878 0.1360  0.0643  276 THR B CG2   
4224 N N     . PRO B 280 ? 1.0448 1.3068 1.1209 -0.1689 0.1879  0.0935  277 PRO B N     
4225 C CA    . PRO B 280 ? 1.0697 1.3565 1.1227 -0.1542 0.2003  0.0970  277 PRO B CA    
4226 C C     . PRO B 280 ? 1.0460 1.3204 1.0760 -0.1578 0.2024  0.1189  277 PRO B C     
4227 O O     . PRO B 280 ? 1.1181 1.3913 1.1586 -0.1744 0.2059  0.1416  277 PRO B O     
4228 C CB    . PRO B 280 ? 1.1087 1.4356 1.1831 -0.1577 0.2159  0.1041  277 PRO B CB    
4229 C CG    . PRO B 280 ? 1.1031 1.4228 1.2073 -0.1805 0.2128  0.1184  277 PRO B CG    
4230 C CD    . PRO B 280 ? 1.0290 1.3082 1.1362 -0.1862 0.1943  0.1060  277 PRO B CD    
4231 N N     . PHE B 281 ? 1.0786 1.3430 1.0776 -0.1429 0.1989  0.1129  278 PHE B N     
4232 C CA    . PHE B 281 ? 1.2380 1.4895 1.2132 -0.1449 0.1993  0.1330  278 PHE B CA    
4233 C C     . PHE B 281 ? 1.3422 1.6299 1.3033 -0.1403 0.2169  0.1472  278 PHE B C     
4234 O O     . PHE B 281 ? 1.4046 1.7019 1.3373 -0.1244 0.2206  0.1414  278 PHE B O     
4235 C CB    . PHE B 281 ? 1.2704 1.4947 1.2205 -0.1319 0.1863  0.1215  278 PHE B CB    
4236 C CG    . PHE B 281 ? 1.2222 1.4090 1.1831 -0.1382 0.1702  0.1156  278 PHE B CG    
4237 C CD1   . PHE B 281 ? 1.1047 1.2873 1.0901 -0.1419 0.1639  0.0987  278 PHE B CD1   
4238 C CD2   . PHE B 281 ? 1.2322 1.3885 1.1780 -0.1396 0.1613  0.1271  278 PHE B CD2   
4239 C CE1   . PHE B 281 ? 1.0143 1.1642 1.0076 -0.1465 0.1501  0.0927  278 PHE B CE1   
4240 C CE2   . PHE B 281 ? 1.2329 1.3553 1.1876 -0.1430 0.1474  0.1206  278 PHE B CE2   
4241 C CZ    . PHE B 281 ? 1.0851 1.2049 1.0627 -0.1463 0.1422  0.1031  278 PHE B CZ    
4242 N N     . ALA B 282 ? 1.4795 1.7889 1.4611 -0.1548 0.2280  0.1666  279 ALA B N     
4243 C CA    . ALA B 282 ? 1.6168 1.9658 1.5884 -0.1515 0.2466  0.1826  279 ALA B CA    
4244 C C     . ALA B 282 ? 1.9092 2.2501 1.8510 -0.1524 0.2473  0.2035  279 ALA B C     
4245 O O     . ALA B 282 ? 1.8960 2.2595 1.8112 -0.1392 0.2577  0.2049  279 ALA B O     
4246 C CB    . ALA B 282 ? 1.3951 1.7712 1.3993 -0.1685 0.2573  0.2010  279 ALA B CB    
4247 N N     . ASN B 283 ? 2.1881 2.4960 2.1331 -0.1677 0.2359  0.2199  280 ASN B N     
4248 C CA    . ASN B 283 ? 2.1518 2.4466 2.0699 -0.1692 0.2335  0.2401  280 ASN B CA    
4249 C C     . ASN B 283 ? 2.0619 2.3397 1.9485 -0.1497 0.2254  0.2221  280 ASN B C     
4250 O O     . ASN B 283 ? 2.1121 2.3519 1.9967 -0.1483 0.2091  0.2129  280 ASN B O     
4251 C CB    . ASN B 283 ? 2.1369 2.3942 2.0669 -0.1887 0.2202  0.2587  280 ASN B CB    
4252 C CG    . ASN B 283 ? 2.0728 2.3486 2.0252 -0.2105 0.2281  0.2867  280 ASN B CG    
4253 O OD1   . ASN B 283 ? 2.0412 2.3590 1.9912 -0.2111 0.2447  0.3020  280 ASN B OD1   
4254 N ND2   . ASN B 283 ? 2.0262 2.2713 2.0001 -0.2285 0.2159  0.2941  280 ASN B ND2   
4255 N N     . GLN B 284 ? 2.3094 2.8058 2.7943 0.0056  -0.2521 0.0690  281 GLN B N     
4256 C CA    . GLN B 284 ? 2.1064 2.5833 2.5757 0.0253  -0.2449 0.1060  281 GLN B CA    
4257 C C     . GLN B 284 ? 2.0733 2.5053 2.5383 0.0176  -0.2097 0.1217  281 GLN B C     
4258 O O     . GLN B 284 ? 2.0359 2.4689 2.5268 0.0017  -0.1925 0.1183  281 GLN B O     
4259 C CB    . GLN B 284 ? 1.9755 2.4887 2.4675 0.0343  -0.2584 0.1199  281 GLN B CB    
4260 C CG    . GLN B 284 ? 1.9322 2.4875 2.4247 0.0460  -0.2942 0.1098  281 GLN B CG    
4261 C CD    . GLN B 284 ? 1.8663 2.4596 2.3843 0.0528  -0.3074 0.1206  281 GLN B CD    
4262 O OE1   . GLN B 284 ? 1.8268 2.4157 2.3628 0.0486  -0.2899 0.1357  281 GLN B OE1   
4263 N NE2   . GLN B 284 ? 1.8158 2.4468 2.3357 0.0634  -0.3386 0.1129  281 GLN B NE2   
4264 N N     . ASP B 285 ? 1.9792 2.3719 2.4116 0.0289  -0.1992 0.1386  282 ASP B N     
4265 C CA    . ASP B 285 ? 1.9568 2.3035 2.3812 0.0226  -0.1663 0.1532  282 ASP B CA    
4266 C C     . ASP B 285 ? 1.9436 2.2874 2.3831 0.0275  -0.1522 0.1816  282 ASP B C     
4267 O O     . ASP B 285 ? 1.8547 2.2266 2.3031 0.0407  -0.1684 0.1956  282 ASP B O     
4268 C CB    . ASP B 285 ? 1.9131 2.2212 2.2982 0.0363  -0.1612 0.1666  282 ASP B CB    
4269 C CG    . ASP B 285 ? 1.8906 2.1495 2.2660 0.0281  -0.1275 0.1772  282 ASP B CG    
4270 O OD1   . ASP B 285 ? 1.8943 2.1466 2.2880 0.0066  -0.1103 0.1602  282 ASP B OD1   
4271 O OD2   . ASP B 285 ? 1.8637 2.0906 2.2132 0.0433  -0.1182 0.2026  282 ASP B OD2   
4272 N N     . THR B 286 ? 1.9617 2.2707 2.4040 0.0164  -0.1216 0.1900  283 THR B N     
4273 C CA    . THR B 286 ? 1.9104 2.2128 2.3667 0.0194  -0.1056 0.2168  283 THR B CA    
4274 C C     . THR B 286 ? 1.8160 2.0983 2.2469 0.0439  -0.1054 0.2519  283 THR B C     
4275 O O     . THR B 286 ? 1.8055 2.0989 2.2470 0.0538  -0.1062 0.2748  283 THR B O     
4276 C CB    . THR B 286 ? 1.9450 2.2147 2.4108 0.0001  -0.0728 0.2154  283 THR B CB    
4277 O OG1   . THR B 286 ? 1.9327 2.1571 2.3688 0.0020  -0.0568 0.2201  283 THR B OG1   
4278 C CG2   . THR B 286 ? 1.9623 2.2532 2.4550 -0.0243 -0.0726 0.1814  283 THR B CG2   
4279 N N     . LEU B 287 ? 1.6820 1.9348 2.0796 0.0539  -0.1044 0.2566  284 LEU B N     
4280 C CA    . LEU B 287 ? 1.5279 1.7573 1.8978 0.0768  -0.1032 0.2884  284 LEU B CA    
4281 C C     . LEU B 287 ? 1.4987 1.6940 1.8694 0.0775  -0.0745 0.3165  284 LEU B C     
4282 O O     . LEU B 287 ? 1.3719 1.5465 1.7213 0.0962  -0.0715 0.3446  284 LEU B O     
4283 C CB    . LEU B 287 ? 1.4163 1.6798 1.7853 0.0976  -0.1307 0.3022  284 LEU B CB    
4284 C CG    . LEU B 287 ? 1.3444 1.5948 1.6787 0.1220  -0.1429 0.3216  284 LEU B CG    
4285 C CD1   . LEU B 287 ? 1.3772 1.6187 1.6885 0.1198  -0.1521 0.2992  284 LEU B CD1   
4286 C CD2   . LEU B 287 ? 1.3163 1.6060 1.6565 0.1394  -0.1701 0.3325  284 LEU B CD2   
4287 N N     . ASP B 288 ? 1.5580 1.7475 1.9529 0.0580  -0.0538 0.3098  285 ASP B N     
4288 C CA    . ASP B 288 ? 1.5569 1.7122 1.9539 0.0556  -0.0246 0.3336  285 ASP B CA    
4289 C C     . ASP B 288 ? 1.4974 1.6114 1.8840 0.0404  0.0002  0.3229  285 ASP B C     
4290 O O     . ASP B 288 ? 1.5288 1.6480 1.9184 0.0253  -0.0027 0.2930  285 ASP B O     
4291 C CB    . ASP B 288 ? 1.5902 1.7683 2.0230 0.0441  -0.0183 0.3351  285 ASP B CB    
4292 C CG    . ASP B 288 ? 1.5714 1.7836 2.0138 0.0607  -0.0381 0.3526  285 ASP B CG    
4293 O OD1   . ASP B 288 ? 1.6024 1.8567 2.0567 0.0616  -0.0639 0.3356  285 ASP B OD1   
4294 O OD2   . ASP B 288 ? 1.4725 1.6690 1.9102 0.0729  -0.0278 0.3837  285 ASP B OD2   
4295 N N     . LEU B 289 ? 1.4494 1.5221 1.8232 0.0448  0.0246  0.3479  286 LEU B N     
4296 C CA    . LEU B 289 ? 1.4753 1.5053 1.8376 0.0320  0.0498  0.3414  286 LEU B CA    
4297 C C     . LEU B 289 ? 1.5643 1.5940 1.9559 0.0074  0.0690  0.3276  286 LEU B C     
4298 O O     . LEU B 289 ? 1.5496 1.5854 1.9615 0.0052  0.0782  0.3427  286 LEU B O     
4299 C CB    . LEU B 289 ? 1.4773 1.4636 1.8154 0.0464  0.0683  0.3740  286 LEU B CB    
4300 C CG    . LEU B 289 ? 1.4678 1.4504 1.7752 0.0715  0.0515  0.3906  286 LEU B CG    
4301 C CD1   . LEU B 289 ? 1.4660 1.4071 1.7537 0.0851  0.0711  0.4246  286 LEU B CD1   
4302 C CD2   . LEU B 289 ? 1.4976 1.4756 1.7836 0.0703  0.0405  0.3674  286 LEU B CD2   
4303 N N     . THR B 290 ? 1.5911 1.6143 1.9851 -0.0112 0.0748  0.2987  287 THR B N     
4304 C CA    . THR B 290 ? 1.5701 1.5870 1.9888 -0.0351 0.0957  0.2854  287 THR B CA    
4305 C C     . THR B 290 ? 1.6076 1.5773 2.0184 -0.0365 0.1270  0.3089  287 THR B C     
4306 O O     . THR B 290 ? 1.5454 1.4853 1.9299 -0.0201 0.1329  0.3321  287 THR B O     
4307 C CB    . THR B 290 ? 1.5671 1.5856 1.9876 -0.0538 0.0946  0.2493  287 THR B CB    
4308 O OG1   . THR B 290 ? 1.6005 1.5759 1.9926 -0.0525 0.1089  0.2507  287 THR B OG1   
4309 C CG2   . THR B 290 ? 1.5588 1.6191 1.9802 -0.0492 0.0624  0.2278  287 THR B CG2   
4310 N N     . ARG B 291 ? 1.6565 1.6193 2.0905 -0.0565 0.1474  0.3026  288 ARG B N     
4311 C CA    . ARG B 291 ? 1.7731 1.6928 2.2024 -0.0589 0.1774  0.3250  288 ARG B CA    
4312 C C     . ARG B 291 ? 1.8796 1.7546 2.2801 -0.0585 0.1919  0.3241  288 ARG B C     
4313 O O     . ARG B 291 ? 1.8653 1.7040 2.2478 -0.0477 0.2077  0.3504  288 ARG B O     
4314 C CB    . ARG B 291 ? 1.7645 1.6862 2.2245 -0.0820 0.1958  0.3155  288 ARG B CB    
4315 C CG    . ARG B 291 ? 1.7663 1.6469 2.2240 -0.0836 0.2255  0.3412  288 ARG B CG    
4316 C CD    . ARG B 291 ? 1.7549 1.6321 2.2400 -0.1082 0.2458  0.3294  288 ARG B CD    
4317 N NE    . ARG B 291 ? 1.7642 1.5959 2.2424 -0.1104 0.2753  0.3514  288 ARG B NE    
4318 C CZ    . ARG B 291 ? 1.7910 1.5820 2.2524 -0.1173 0.2941  0.3472  288 ARG B CZ    
4319 N NH1   . ARG B 291 ? 1.8296 1.6199 2.2795 -0.1228 0.2866  0.3216  288 ARG B NH1   
4320 N NH2   . ARG B 291 ? 1.7572 1.5080 2.2135 -0.1186 0.3202  0.3685  288 ARG B NH2   
4321 N N     . GLU B 292 ? 1.8814 1.7585 2.2772 -0.0700 0.1867  0.2941  289 GLU B N     
4322 C CA    . GLU B 292 ? 1.9039 1.7398 2.2727 -0.0703 0.1999  0.2912  289 GLU B CA    
4323 C C     . GLU B 292 ? 1.8482 1.6729 2.1847 -0.0454 0.1878  0.3101  289 GLU B C     
4324 O O     . GLU B 292 ? 1.8805 1.6640 2.1947 -0.0376 0.2045  0.3286  289 GLU B O     
4325 C CB    . GLU B 292 ? 1.9354 1.7798 2.3073 -0.0880 0.1949  0.2539  289 GLU B CB    
4326 C CG    . GLU B 292 ? 1.9344 1.7687 2.3288 -0.1141 0.2167  0.2370  289 GLU B CG    
4327 C CD    . GLU B 292 ? 1.9485 1.7578 2.3299 -0.1273 0.2264  0.2136  289 GLU B CD    
4328 O OE1   . GLU B 292 ? 1.9550 1.7583 2.3110 -0.1168 0.2144  0.2083  289 GLU B OE1   
4329 O OE2   . GLU B 292 ? 1.9207 1.7159 2.3169 -0.1482 0.2462  0.2005  289 GLU B OE2   
4330 N N     . GLU B 293 ? 1.7666 1.6276 2.1004 -0.0325 0.1588  0.3058  290 GLU B N     
4331 C CA    . GLU B 293 ? 1.7686 1.6218 2.0723 -0.0084 0.1457  0.3236  290 GLU B CA    
4332 C C     . GLU B 293 ? 1.7245 1.5610 2.0222 0.0085  0.1551  0.3617  290 GLU B C     
4333 O O     . GLU B 293 ? 1.7023 1.5111 1.9720 0.0250  0.1583  0.3811  290 GLU B O     
4334 C CB    . GLU B 293 ? 1.6083 1.5065 1.9128 0.0010  0.1120  0.3105  290 GLU B CB    
4335 C CG    . GLU B 293 ? 1.6588 1.5741 1.9661 -0.0135 0.1000  0.2733  290 GLU B CG    
4336 C CD    . GLU B 293 ? 1.6803 1.6441 1.9942 -0.0060 0.0668  0.2603  290 GLU B CD    
4337 O OE1   . GLU B 293 ? 1.6587 1.6464 1.9812 0.0071  0.0545  0.2782  290 GLU B OE1   
4338 O OE2   . GLU B 293 ? 1.7045 1.6827 2.0151 -0.0133 0.0529  0.2322  290 GLU B OE2   
4339 N N     . GLU B 294 ? 1.8364 1.6896 2.1599 0.0048  0.1593  0.3727  291 GLU B N     
4340 C CA    . GLU B 294 ? 1.8508 1.6870 2.1706 0.0192  0.1703  0.4088  291 GLU B CA    
4341 C C     . GLU B 294 ? 1.8968 1.6796 2.2009 0.0166  0.2001  0.4235  291 GLU B C     
4342 O O     . GLU B 294 ? 1.8774 1.6343 2.1591 0.0343  0.2053  0.4501  291 GLU B O     
4343 C CB    . GLU B 294 ? 1.8244 1.6868 2.1771 0.0118  0.1721  0.4144  291 GLU B CB    
4344 C CG    . GLU B 294 ? 1.7999 1.6905 2.1552 0.0318  0.1531  0.4362  291 GLU B CG    
4345 C CD    . GLU B 294 ? 1.7841 1.7112 2.1743 0.0223  0.1485  0.4325  291 GLU B CD    
4346 O OE1   . GLU B 294 ? 1.8040 1.7171 2.2090 0.0151  0.1689  0.4470  291 GLU B OE1   
4347 O OE2   . GLU B 294 ? 1.7278 1.6976 2.1306 0.0218  0.1242  0.4147  291 GLU B OE2   
4348 N N     . LEU B 295 ? 1.9490 1.7146 2.2647 -0.0057 0.2199  0.4060  292 LEU B N     
4349 C CA    . LEU B 295 ? 1.9429 1.6576 2.2451 -0.0100 0.2488  0.4178  292 LEU B CA    
4350 C C     . LEU B 295 ? 1.9791 1.6664 2.2471 0.0005  0.2473  0.4168  292 LEU B C     
4351 O O     . LEU B 295 ? 1.9545 1.6056 2.2017 0.0126  0.2609  0.4412  292 LEU B O     
4352 C CB    . LEU B 295 ? 1.9124 1.6177 2.2351 -0.0369 0.2683  0.3963  292 LEU B CB    
4353 C CG    . LEU B 295 ? 1.8651 1.5901 2.2218 -0.0503 0.2755  0.3973  292 LEU B CG    
4354 C CD1   . LEU B 295 ? 1.9109 1.6287 2.2852 -0.0773 0.2916  0.3709  292 LEU B CD1   
4355 C CD2   . LEU B 295 ? 1.8012 1.5027 2.1581 -0.0413 0.2931  0.4325  292 LEU B CD2   
4356 N N     . SER B 296 ? 1.9882 1.6924 2.2500 -0.0041 0.2307  0.3888  293 SER B N     
4357 C CA    . SER B 296 ? 2.0013 1.6784 2.2318 0.0026  0.2310  0.3841  293 SER B CA    
4358 C C     . SER B 296 ? 1.9741 1.6490 2.1788 0.0295  0.2169  0.4083  293 SER B C     
4359 O O     . SER B 296 ? 2.0432 1.6821 2.2208 0.0390  0.2266  0.4202  293 SER B O     
4360 C CB    . SER B 296 ? 1.9805 1.6787 2.2119 -0.0093 0.2157  0.3476  293 SER B CB    
4361 O OG    . SER B 296 ? 1.9411 1.6808 2.1723 0.0023  0.1848  0.3414  293 SER B OG    
4362 N N     . LEU B 297 ? 1.9396 1.6526 2.1522 0.0420  0.1939  0.4156  294 LEU B N     
4363 C CA    . LEU B 297 ? 1.8825 1.5945 2.0717 0.0679  0.1804  0.4398  294 LEU B CA    
4364 C C     . LEU B 297 ? 1.9983 1.6759 2.1796 0.0787  0.2011  0.4751  294 LEU B C     
4365 O O     . LEU B 297 ? 1.9946 1.6499 2.1486 0.0969  0.2009  0.4945  294 LEU B O     
4366 C CB    . LEU B 297 ? 1.7558 1.5172 1.9579 0.0778  0.1518  0.4397  294 LEU B CB    
4367 C CG    . LEU B 297 ? 1.6514 1.4187 1.8327 0.1048  0.1349  0.4646  294 LEU B CG    
4368 C CD1   . LEU B 297 ? 1.6235 1.3708 1.7706 0.1153  0.1284  0.4608  294 LEU B CD1   
4369 C CD2   . LEU B 297 ? 1.5814 1.4002 1.7788 0.1113  0.1065  0.4599  294 LEU B CD2   
4370 N N     . LEU B 298 ? 2.1929 1.8650 2.3974 0.0673  0.2195  0.4834  295 LEU B N     
4371 C CA    . LEU B 298 ? 2.2855 1.9268 2.4849 0.0769  0.2391  0.5171  295 LEU B CA    
4372 C C     . LEU B 298 ? 2.4310 2.0208 2.6059 0.0774  0.2613  0.5244  295 LEU B C     
4373 O O     . LEU B 298 ? 2.4923 2.0553 2.6503 0.0932  0.2704  0.5533  295 LEU B O     
4374 C CB    . LEU B 298 ? 2.2303 1.8774 2.4612 0.0620  0.2544  0.5210  295 LEU B CB    
4375 C CG    . LEU B 298 ? 2.1702 1.7962 2.4042 0.0705  0.2717  0.5557  295 LEU B CG    
4376 C CD1   . LEU B 298 ? 2.2024 1.7764 2.4258 0.0636  0.3024  0.5655  295 LEU B CD1   
4377 C CD2   . LEU B 298 ? 2.1025 1.7355 2.3195 0.0972  0.2564  0.5829  295 LEU B CD2   
4378 N N     . GLN B 299 ? 2.4569 2.0323 2.6295 0.0604  0.2700  0.4984  296 GLN B N     
4379 C CA    . GLN B 299 ? 2.4335 1.9593 2.5852 0.0587  0.2930  0.5039  296 GLN B CA    
4380 C C     . GLN B 299 ? 2.3975 1.9065 2.5148 0.0806  0.2843  0.5179  296 GLN B C     
4381 O O     . GLN B 299 ? 2.3604 1.8277 2.4592 0.0869  0.3030  0.5358  296 GLN B O     
4382 C CB    . GLN B 299 ? 2.4375 1.9553 2.5937 0.0362  0.3013  0.4710  296 GLN B CB    
4383 C CG    . GLN B 299 ? 2.4336 1.9630 2.5714 0.0389  0.2818  0.4475  296 GLN B CG    
4384 C CD    . GLN B 299 ? 2.4132 1.9537 2.5652 0.0154  0.2821  0.4111  296 GLN B CD    
4385 O OE1   . GLN B 299 ? 2.4068 1.9389 2.5792 -0.0036 0.3005  0.4033  296 GLN B OE1   
4386 N NE2   . GLN B 299 ? 2.3832 1.9429 2.5243 0.0166  0.2616  0.3885  296 GLN B NE2   
4387 N N     . GLU B 300 ? 2.3137 1.8543 2.4223 0.0923  0.2564  0.5102  297 GLU B N     
4388 C CA    . GLU B 300 ? 2.2218 1.7494 2.2976 0.1127  0.2462  0.5213  297 GLU B CA    
4389 C C     . GLU B 300 ? 2.0978 1.6239 2.1660 0.1352  0.2429  0.5569  297 GLU B C     
4390 O O     . GLU B 300 ? 2.0425 1.5382 2.1099 0.1381  0.2642  0.5809  297 GLU B O     
4391 C CB    . GLU B 300 ? 2.2172 1.7792 2.2863 0.1155  0.2173  0.4973  297 GLU B CB    
4392 C CG    . GLU B 300 ? 2.2623 1.8244 2.3351 0.0948  0.2192  0.4618  297 GLU B CG    
4393 C CD    . GLU B 300 ? 2.2824 1.8862 2.3564 0.0950  0.1894  0.4369  297 GLU B CD    
4394 O OE1   . GLU B 300 ? 2.2327 1.8767 2.3292 0.0937  0.1735  0.4326  297 GLU B OE1   
4395 O OE2   . GLU B 300 ? 2.3124 1.9087 2.3650 0.0965  0.1818  0.4217  297 GLU B OE2   
4396 O "O5'" . DA  C 1   ? 1.8971 1.4171 1.4098 -0.4525 0.1597  0.0329  1   DA  C "O5'" 
4397 C "C5'" . DA  C 1   ? 1.8824 1.4373 1.4238 -0.4718 0.1713  0.0253  1   DA  C "C5'" 
4398 C "C4'" . DA  C 1   ? 1.8749 1.4513 1.4538 -0.4459 0.1515  0.0322  1   DA  C "C4'" 
4399 O "O4'" . DA  C 1   ? 1.9587 1.5209 1.5184 -0.4682 0.1574  0.0303  1   DA  C "O4'" 
4400 C "C3'" . DA  C 1   ? 1.7732 1.4343 1.4419 -0.4277 0.1510  0.0262  1   DA  C "C3'" 
4401 O "O3'" . DA  C 1   ? 1.7421 1.4177 1.4370 -0.3952 0.1363  0.0318  1   DA  C "O3'" 
4402 C "C2'" . DA  C 1   ? 1.7101 1.3848 1.4006 -0.4212 0.1409  0.0293  1   DA  C "C2'" 
4403 C "C1'" . DA  C 1   ? 1.8623 1.4736 1.4815 -0.4499 0.1470  0.0310  1   DA  C "C1'" 
4404 N N9    . DA  C 1   ? 1.8749 1.5163 1.5116 -0.4785 0.1648  0.0199  1   DA  C N9    
4405 C C8    . DA  C 1   ? 1.8586 1.4865 1.4844 -0.4856 0.1604  0.0224  1   DA  C C8    
4406 N N7    . DA  C 1   ? 1.8137 1.4777 1.4604 -0.5136 0.1800  0.0091  1   DA  C N7    
4407 C C5    . DA  C 1   ? 1.8293 1.5346 1.5029 -0.5251 0.1983  -0.0038 1   DA  C C5    
4408 C C6    . DA  C 1   ? 1.7416 1.5010 1.4471 -0.5531 0.2231  -0.0235 1   DA  C C6    
4409 N N6    . DA  C 1   ? 1.6615 1.4435 1.3774 -0.5762 0.2344  -0.0338 1   DA  C N6    
4410 N N1    . DA  C 1   ? 1.7251 1.5166 1.4518 -0.5562 0.2356  -0.0335 1   DA  C N1    
4411 C C2    . DA  C 1   ? 1.7370 1.5061 1.4530 -0.5336 0.2244  -0.0234 1   DA  C C2    
4412 N N3    . DA  C 1   ? 1.7886 1.5086 1.4758 -0.5071 0.2017  -0.0053 1   DA  C N3    
4413 C C4    . DA  C 1   ? 1.8617 1.5522 1.5288 -0.5038 0.1893  0.0034  1   DA  C C4    
4414 P P     . DT  C 2   ? 1.6518 1.2849 1.3198 -0.3638 0.1087  0.0458  2   DT  C P     
4415 O OP1   . DT  C 2   ? 1.6251 1.2122 1.2510 -0.3665 0.0976  0.0527  2   DT  C OP1   
4416 O OP2   . DT  C 2   ? 1.4802 1.0804 1.1130 -0.3583 0.1071  0.0482  2   DT  C OP2   
4417 O "O5'" . DT  C 2   ? 1.5547 1.2506 1.2978 -0.3338 0.0965  0.0464  2   DT  C "O5'" 
4418 C "C5'" . DT  C 2   ? 1.3098 1.0333 1.0877 -0.3269 0.0892  0.0475  2   DT  C "C5'" 
4419 C "C4'" . DT  C 2   ? 1.0289 0.8262 0.8819 -0.3206 0.0961  0.0395  2   DT  C "C4'" 
4420 O "O4'" . DT  C 2   ? 1.0154 0.8386 0.8794 -0.3476 0.1196  0.0269  2   DT  C "O4'" 
4421 C "C3'" . DT  C 2   ? 0.9790 0.8051 0.8672 -0.2968 0.0897  0.0399  2   DT  C "C3'" 
4422 O "O3'" . DT  C 2   ? 0.8810 0.7505 0.8231 -0.2766 0.0793  0.0406  2   DT  C "O3'" 
4423 C "C2'" . DT  C 2   ? 1.0151 0.8703 0.9202 -0.3133 0.1107  0.0283  2   DT  C "C2'" 
4424 C "C1'" . DT  C 2   ? 1.0236 0.8990 0.9390 -0.3372 0.1249  0.0195  2   DT  C "C1'" 
4425 N N1    . DT  C 2   ? 1.2108 1.1032 1.1248 -0.3636 0.1484  0.0060  2   DT  C N1    
4426 C C2    . DT  C 2   ? 1.3880 1.3396 1.3561 -0.3585 0.1570  -0.0058 2   DT  C C2    
4427 O O2    . DT  C 2   ? 1.5264 1.5130 1.5404 -0.3337 0.1462  -0.0047 2   DT  C O2    
4428 N N3    . DT  C 2   ? 1.4364 1.4035 1.4004 -0.3839 0.1786  -0.0198 2   DT  C N3    
4429 C C4    . DT  C 2   ? 1.4862 1.4146 1.3968 -0.4156 0.1934  -0.0229 2   DT  C C4    
4430 O O4    . DT  C 2   ? 1.5371 1.4857 1.4485 -0.4387 0.2136  -0.0373 2   DT  C O4    
4431 C C5    . DT  C 2   ? 1.4609 1.3223 1.3121 -0.4199 0.1834  -0.0089 2   DT  C C5    
4432 C C7    . DT  C 2   ? 1.4991 1.3070 1.2823 -0.4541 0.1977  -0.0105 2   DT  C C7    
4433 C C6    . DT  C 2   ? 1.3538 1.2016 1.2105 -0.3928 0.1610  0.0044  2   DT  C C6    
4434 P P     . DT  C 3   ? 0.8165 0.6961 0.7801 -0.2463 0.0621  0.0464  3   DT  C P     
4435 O OP1   . DT  C 3   ? 1.0392 0.9155 1.0090 -0.2316 0.0447  0.0532  3   DT  C OP1   
4436 O OP2   . DT  C 3   ? 0.8520 0.6977 0.7783 -0.2435 0.0608  0.0489  3   DT  C OP2   
4437 O "O5'" . DT  C 3   ? 0.7583 0.6970 0.7821 -0.2398 0.0699  0.0383  3   DT  C "O5'" 
4438 C "C5'" . DT  C 3   ? 0.7130 0.6915 0.7739 -0.2480 0.0785  0.0305  3   DT  C "C5'" 
4439 C "C4'" . DT  C 3   ? 0.6794 0.7052 0.7858 -0.2413 0.0863  0.0210  3   DT  C "C4'" 
4440 O "O4'" . DT  C 3   ? 0.7938 0.8181 0.8856 -0.2581 0.1031  0.0129  3   DT  C "O4'" 
4441 C "C3'" . DT  C 3   ? 0.6497 0.6836 0.7749 -0.2167 0.0742  0.0256  3   DT  C "C3'" 
4442 O "O3'" . DT  C 3   ? 0.7390 0.8182 0.9125 -0.2061 0.0752  0.0185  3   DT  C "O3'" 
4443 C "C2'" . DT  C 3   ? 0.7515 0.7666 0.8517 -0.2212 0.0815  0.0245  3   DT  C "C2'" 
4444 C "C1'" . DT  C 3   ? 0.7684 0.7987 0.8694 -0.2442 0.1012  0.0130  3   DT  C "C1'" 
4445 N N1    . DT  C 3   ? 0.8572 0.8577 0.9184 -0.2591 0.1118  0.0118  3   DT  C N1    
4446 C C2    . DT  C 3   ? 0.9171 0.9427 0.9924 -0.2680 0.1272  0.0004  3   DT  C C2    
4447 O O2    . DT  C 3   ? 0.9227 0.9944 1.0417 -0.2628 0.1318  -0.0096 3   DT  C O2    
4448 N N3    . DT  C 3   ? 0.9936 0.9875 1.0283 -0.2823 0.1364  0.0003  3   DT  C N3    
4449 C C4    . DT  C 3   ? 0.9706 0.9086 0.9507 -0.2873 0.1308  0.0104  3   DT  C C4    
4450 O O4    . DT  C 3   ? 1.0662 0.9761 1.0097 -0.3001 0.1396  0.0095  3   DT  C O4    
4451 C C5    . DT  C 3   ? 0.9137 0.8279 0.8814 -0.2755 0.1134  0.0213  3   DT  C C5    
4452 C C7    . DT  C 3   ? 0.8907 0.7438 0.7986 -0.2765 0.1039  0.0312  3   DT  C C7    
4453 C C6    . DT  C 3   ? 0.9044 0.8520 0.9140 -0.2627 0.1053  0.0215  3   DT  C C6    
4454 P P     . DG  C 4   ? 0.5756 0.6697 0.7778 -0.1843 0.0589  0.0241  4   DG  C P     
4455 O OP1   . DG  C 4   ? 0.5715 0.7077 0.8161 -0.1764 0.0626  0.0144  4   DG  C OP1   
4456 O OP2   . DG  C 4   ? 0.7270 0.8051 0.9167 -0.1877 0.0508  0.0306  4   DG  C OP2   
4457 O "O5'" . DG  C 4   ? 0.5730 0.6458 0.7605 -0.1694 0.0483  0.0318  4   DG  C "O5'" 
4458 C "C5'" . DG  C 4   ? 0.5634 0.6484 0.7630 -0.1617 0.0520  0.0277  4   DG  C "C5'" 
4459 C "C4'" . DG  C 4   ? 0.6675 0.7254 0.8423 -0.1535 0.0440  0.0345  4   DG  C "C4'" 
4460 O "O4'" . DG  C 4   ? 0.5900 0.6446 0.7695 -0.1400 0.0285  0.0409  4   DG  C "O4'" 
4461 C "C3'" . DG  C 4   ? 0.5646 0.6309 0.7476 -0.1463 0.0479  0.0307  4   DG  C "C3'" 
4462 O "O3'" . DG  C 4   ? 0.6805 0.7191 0.8297 -0.1515 0.0506  0.0328  4   DG  C "O3'" 
4463 C "C2'" . DG  C 4   ? 0.5390 0.6121 0.7380 -0.1291 0.0350  0.0345  4   DG  C "C2'" 
4464 C "C1'" . DG  C 4   ? 0.6180 0.6732 0.8009 -0.1279 0.0232  0.0416  4   DG  C "C1'" 
4465 N N9    . DG  C 4   ? 0.6284 0.6956 0.8309 -0.1158 0.0116  0.0443  4   DG  C N9    
4466 C C8    . DG  C 4   ? 0.6347 0.7250 0.8666 -0.1120 0.0105  0.0426  4   DG  C C8    
4467 N N7    . DG  C 4   ? 0.6410 0.7344 0.8816 -0.1020 -0.0007 0.0458  4   DG  C N7    
4468 C C5    . DG  C 4   ? 0.6395 0.7141 0.8572 -0.0992 -0.0072 0.0487  4   DG  C C5    
4469 C C6    . DG  C 4   ? 0.6098 0.6823 0.8253 -0.0907 -0.0191 0.0508  4   DG  C C6    
4470 O O6    . DG  C 4   ? 0.6552 0.7394 0.8873 -0.0849 -0.0257 0.0515  4   DG  C O6    
4471 N N1    . DG  C 4   ? 0.7016 0.7567 0.8916 -0.0895 -0.0230 0.0506  4   DG  C N1    
4472 C C2    . DG  C 4   ? 0.6732 0.7110 0.8401 -0.0953 -0.0167 0.0501  4   DG  C C2    
4473 N N2    . DG  C 4   ? 0.6016 0.6236 0.7445 -0.0912 -0.0231 0.0492  4   DG  C N2    
4474 N N3    . DG  C 4   ? 0.5771 0.6140 0.7437 -0.1048 -0.0048 0.0492  4   DG  C N3    
4475 C C4    . DG  C 4   ? 0.6001 0.6579 0.7939 -0.1065 -0.0005 0.0480  4   DG  C C4    
4476 P P     . DT  C 5   ? 0.6691 0.7108 0.8184 -0.1486 0.0576  0.0285  5   DT  C P     
4477 O OP1   . DT  C 5   ? 0.7360 0.7492 0.8480 -0.1607 0.0643  0.0291  5   DT  C OP1   
4478 O OP2   . DT  C 5   ? 0.7833 0.8586 0.9669 -0.1466 0.0655  0.0201  5   DT  C OP2   
4479 O "O5'" . DT  C 5   ? 0.6527 0.6884 0.8020 -0.1324 0.0443  0.0332  5   DT  C "O5'" 
4480 C "C5'" . DT  C 5   ? 0.7191 0.7293 0.8413 -0.1290 0.0331  0.0390  5   DT  C "C5'" 
4481 C "C4'" . DT  C 5   ? 0.6893 0.7026 0.8168 -0.1153 0.0231  0.0398  5   DT  C "C4'" 
4482 O "O4'" . DT  C 5   ? 0.6276 0.6563 0.7773 -0.1078 0.0141  0.0415  5   DT  C "O4'" 
4483 C "C3'" . DT  C 5   ? 0.6706 0.6961 0.8113 -0.1117 0.0299  0.0354  5   DT  C "C3'" 
4484 O "O3'" . DT  C 5   ? 0.6426 0.6515 0.7604 -0.1087 0.0272  0.0353  5   DT  C "O3'" 
4485 C "C2'" . DT  C 5   ? 0.6769 0.7221 0.8452 -0.1020 0.0238  0.0351  5   DT  C "C2'" 
4486 C "C1'" . DT  C 5   ? 0.6306 0.6718 0.7958 -0.0992 0.0118  0.0395  5   DT  C "C1'" 
4487 N N1    . DT  C 5   ? 0.6956 0.7551 0.8873 -0.0944 0.0075  0.0401  5   DT  C N1    
4488 C C2    . DT  C 5   ? 0.7089 0.7705 0.9037 -0.0875 -0.0035 0.0416  5   DT  C C2    
4489 O O2    . DT  C 5   ? 0.7814 0.8341 0.9605 -0.0847 -0.0100 0.0412  5   DT  C O2    
4490 N N3    . DT  C 5   ? 0.6424 0.7183 0.8593 -0.0840 -0.0067 0.0423  5   DT  C N3    
4491 C C4    . DT  C 5   ? 0.6758 0.7648 0.9122 -0.0850 -0.0012 0.0411  5   DT  C C4    
4492 O O4    . DT  C 5   ? 0.6379 0.7378 0.8918 -0.0804 -0.0057 0.0416  5   DT  C O4    
4493 C C5    . DT  C 5   ? 0.6990 0.7892 0.9334 -0.0921 0.0102  0.0379  5   DT  C C5    
4494 C C7    . DT  C 5   ? 0.5963 0.7059 0.8529 -0.0935 0.0169  0.0333  5   DT  C C7    
4495 C C6    . DT  C 5   ? 0.6774 0.7523 0.8893 -0.0973 0.0144  0.0379  5   DT  C C6    
4496 P P     . DC  C 6   ? 0.6942 0.7063 0.8132 -0.1082 0.0361  0.0309  6   DC  C P     
4497 O OP1   . DC  C 6   ? 0.7594 0.7477 0.8458 -0.1112 0.0367  0.0311  6   DC  C OP1   
4498 O OP2   . DC  C 6   ? 0.7107 0.7413 0.8519 -0.1123 0.0474  0.0269  6   DC  C OP2   
4499 O "O5'" . DC  C 6   ? 0.6074 0.6283 0.7376 -0.0976 0.0280  0.0299  6   DC  C "O5'" 
4500 C "C5'" . DC  C 6   ? 0.5964 0.6084 0.7117 -0.0924 0.0165  0.0306  6   DC  C "C5'" 
4501 C "C4'" . DC  C 6   ? 0.6031 0.6288 0.7342 -0.0860 0.0105  0.0286  6   DC  C "C4'" 
4502 O "O4'" . DC  C 6   ? 0.6635 0.7013 0.8152 -0.0849 0.0074  0.0312  6   DC  C "O4'" 
4503 C "C3'" . DC  C 6   ? 0.6002 0.6318 0.7402 -0.0850 0.0177  0.0252  6   DC  C "C3'" 
4504 O "O3'" . DC  C 6   ? 0.5894 0.6232 0.7261 -0.0817 0.0116  0.0219  6   DC  C "O3'" 
4505 C "C2'" . DC  C 6   ? 0.5463 0.5905 0.7100 -0.0840 0.0206  0.0262  6   DC  C "C2'" 
4506 C "C1'" . DC  C 6   ? 0.6302 0.6782 0.7986 -0.0823 0.0104  0.0292  6   DC  C "C1'" 
4507 N N1    . DC  C 6   ? 0.6967 0.7559 0.8859 -0.0813 0.0104  0.0311  6   DC  C N1    
4508 C C2    . DC  C 6   ? 0.6133 0.6784 0.8119 -0.0779 0.0019  0.0326  6   DC  C C2    
4509 O O2    . DC  C 6   ? 0.7123 0.7753 0.9024 -0.0769 -0.0049 0.0314  6   DC  C O2    
4510 N N3    . DC  C 6   ? 0.5363 0.6109 0.7531 -0.0760 0.0014  0.0340  6   DC  C N3    
4511 C C4    . DC  C 6   ? 0.6489 0.7300 0.8759 -0.0771 0.0089  0.0327  6   DC  C C4    
4512 N N4    . DC  C 6   ? 0.6385 0.7312 0.8841 -0.0741 0.0074  0.0326  6   DC  C N4    
4513 C C5    . DC  C 6   ? 0.5987 0.6763 0.8173 -0.0818 0.0184  0.0302  6   DC  C C5    
4514 C C6    . DC  C 6   ? 0.6181 0.6831 0.8171 -0.0837 0.0188  0.0302  6   DC  C C6    
4515 P P     . DA  C 7   ? 0.6371 0.6666 0.7635 -0.0818 0.0164  0.0170  7   DA  C P     
4516 O OP1   . DA  C 7   ? 0.7861 0.8042 0.8908 -0.0821 0.0155  0.0158  7   DA  C OP1   
4517 O OP2   . DA  C 7   ? 0.6719 0.7032 0.8095 -0.0823 0.0259  0.0168  7   DA  C OP2   
4518 O "O5'" . DA  C 7   ? 0.6564 0.6932 0.7837 -0.0806 0.0092  0.0126  7   DA  C "O5'" 
4519 C "C5'" . DA  C 7   ? 0.6466 0.6871 0.7652 -0.0786 -0.0011 0.0093  7   DA  C "C5'" 
4520 C "C4'" . DA  C 7   ? 0.6268 0.6796 0.7548 -0.0795 -0.0070 0.0060  7   DA  C "C4'" 
4521 O "O4'" . DA  C 7   ? 0.6290 0.6845 0.7728 -0.0794 -0.0077 0.0121  7   DA  C "O4'" 
4522 C "C3'" . DA  C 7   ? 0.5585 0.6129 0.6860 -0.0840 -0.0020 0.0009  7   DA  C "C3'" 
4523 O "O3'" . DA  C 7   ? 0.6353 0.7018 0.7620 -0.0867 -0.0087 -0.0062 7   DA  C "O3'" 
4524 C "C2'" . DA  C 7   ? 0.5942 0.6435 0.7341 -0.0845 0.0033  0.0068  7   DA  C "C2'" 
4525 C "C1'" . DA  C 7   ? 0.5860 0.6413 0.7374 -0.0819 -0.0032 0.0118  7   DA  C "C1'" 
4526 N N9    . DA  C 7   ? 0.6615 0.7142 0.8258 -0.0796 0.0009  0.0179  7   DA  C N9    
4527 C C8    . DA  C 7   ? 0.7388 0.7872 0.9049 -0.0784 0.0086  0.0198  7   DA  C C8    
4528 N N7    . DA  C 7   ? 0.7127 0.7645 0.8933 -0.0759 0.0105  0.0227  7   DA  C N7    
4529 C C5    . DA  C 7   ? 0.7077 0.7636 0.8953 -0.0750 0.0033  0.0241  7   DA  C C5    
4530 C C6    . DA  C 7   ? 0.6270 0.6874 0.8293 -0.0717 0.0007  0.0267  7   DA  C C6    
4531 N N6    . DA  C 7   ? 0.6350 0.6996 0.8497 -0.0680 0.0050  0.0272  7   DA  C N6    
4532 N N1    . DA  C 7   ? 0.5276 0.5899 0.7316 -0.0723 -0.0067 0.0274  7   DA  C N1    
4533 C C2    . DA  C 7   ? 0.6219 0.6846 0.8151 -0.0766 -0.0106 0.0245  7   DA  C C2    
4534 N N3    . DA  C 7   ? 0.7603 0.8218 0.9406 -0.0793 -0.0091 0.0205  7   DA  C N3    
4535 C C4    . DA  C 7   ? 0.7356 0.7921 0.9131 -0.0780 -0.0022 0.0211  7   DA  C C4    
4536 P P     . DT  C 8   ? 0.6665 0.7352 0.7871 -0.0948 -0.0044 -0.0142 8   DT  C P     
4537 O OP1   . DT  C 8   ? 0.6696 0.7563 0.7872 -0.0972 -0.0120 -0.0249 8   DT  C OP1   
4538 O OP2   . DT  C 8   ? 0.6349 0.6925 0.7464 -0.0957 0.0042  -0.0148 8   DT  C OP2   
4539 O "O5'" . DT  C 8   ? 0.6806 0.7423 0.8090 -0.0984 -0.0020 -0.0091 8   DT  C "O5'" 
4540 C "C5'" . DT  C 8   ? 0.6846 0.7555 0.8207 -0.1000 -0.0088 -0.0091 8   DT  C "C5'" 
4541 C "C4'" . DT  C 8   ? 0.5075 0.5658 0.6467 -0.1021 -0.0060 -0.0037 8   DT  C "C4'" 
4542 O "O4'" . DT  C 8   ? 0.5427 0.5945 0.6929 -0.0938 -0.0048 0.0053  8   DT  C "O4'" 
4543 C "C3'" . DT  C 8   ? 0.6770 0.7184 0.8017 -0.1083 0.0017  -0.0064 8   DT  C "C3'" 
4544 O "O3'" . DT  C 8   ? 0.7529 0.7946 0.8678 -0.1193 0.0011  -0.0129 8   DT  C "O3'" 
4545 C "C2'" . DT  C 8   ? 0.5974 0.6220 0.7267 -0.1013 0.0042  0.0018  8   DT  C "C2'" 
4546 C "C1'" . DT  C 8   ? 0.5136 0.5500 0.6618 -0.0933 -0.0011 0.0081  8   DT  C "C1'" 
4547 N N1    . DT  C 8   ? 0.6437 0.6758 0.8007 -0.0850 0.0028  0.0131  8   DT  C N1    
4548 C C2    . DT  C 8   ? 0.6866 0.7179 0.8560 -0.0787 0.0007  0.0178  8   DT  C C2    
4549 O O2    . DT  C 8   ? 0.6707 0.7022 0.8434 -0.0793 -0.0047 0.0193  8   DT  C O2    
4550 N N3    . DT  C 8   ? 0.7501 0.7822 0.9283 -0.0721 0.0051  0.0195  8   DT  C N3    
4551 C C4    . DT  C 8   ? 0.6138 0.6457 0.7885 -0.0719 0.0118  0.0177  8   DT  C C4    
4552 O O4    . DT  C 8   ? 0.6464 0.6816 0.8299 -0.0670 0.0161  0.0180  8   DT  C O4    
4553 C C5    . DT  C 8   ? 0.6494 0.6789 0.8094 -0.0781 0.0134  0.0143  8   DT  C C5    
4554 C C7    . DT  C 8   ? 0.6501 0.6777 0.8037 -0.0783 0.0202  0.0123  8   DT  C C7    
4555 C C6    . DT  C 8   ? 0.6779 0.7086 0.8305 -0.0839 0.0087  0.0117  8   DT  C C6    
4556 P P     . DG  C 9   ? 0.8863 0.9130 0.9790 -0.1309 0.0088  -0.0200 9   DG  C P     
4557 O OP1   . DG  C 9   ? 0.8491 0.8944 0.9359 -0.1430 0.0078  -0.0323 9   DG  C OP1   
4558 O OP2   . DG  C 9   ? 0.7371 0.7539 0.8262 -0.1251 0.0145  -0.0179 9   DG  C OP2   
4559 O "O5'" . DG  C 9   ? 1.0325 1.0324 1.1137 -0.1336 0.0102  -0.0151 9   DG  C "O5'" 
4560 C "C5'" . DG  C 9   ? 0.7548 0.7564 0.8435 -0.1327 0.0042  -0.0112 9   DG  C "C5'" 
4561 C "C4'" . DG  C 9   ? 0.6729 0.6445 0.7516 -0.1277 0.0044  -0.0044 9   DG  C "C4'" 
4562 O "O4'" . DG  C 9   ? 0.6722 0.6434 0.7665 -0.1119 0.0035  0.0028  9   DG  C "O4'" 
4563 C "C3'" . DG  C 9   ? 0.6564 0.5964 0.7050 -0.1354 0.0108  -0.0076 9   DG  C "C3'" 
4564 O "O3'" . DG  C 9   ? 0.7942 0.7055 0.8272 -0.1341 0.0082  -0.0036 9   DG  C "O3'" 
4565 C "C2'" . DG  C 9   ? 0.6738 0.6092 0.7271 -0.1237 0.0142  -0.0047 9   DG  C "C2'" 
4566 C "C1'" . DG  C 9   ? 0.6938 0.6415 0.7729 -0.1084 0.0086  0.0028  9   DG  C "C1'" 
4567 N N9    . DG  C 9   ? 0.7264 0.6863 0.8207 -0.0989 0.0112  0.0045  9   DG  C N9    
4568 C C8    . DG  C 9   ? 0.5824 0.5510 0.6748 -0.1023 0.0162  0.0007  9   DG  C C8    
4569 N N7    . DG  C 9   ? 0.6330 0.6095 0.7386 -0.0931 0.0181  0.0034  9   DG  C N7    
4570 C C5    . DG  C 9   ? 0.5994 0.5752 0.7181 -0.0833 0.0145  0.0083  9   DG  C C5    
4571 C C6    . DG  C 9   ? 0.7069 0.6919 0.8430 -0.0728 0.0155  0.0110  9   DG  C C6    
4572 O O6    . DG  C 9   ? 0.8263 0.8198 0.9682 -0.0709 0.0203  0.0103  9   DG  C O6    
4573 N N1    . DG  C 9   ? 0.7263 0.7107 0.8727 -0.0649 0.0105  0.0137  9   DG  C N1    
4574 C C2    . DG  C 9   ? 0.6902 0.6629 0.8289 -0.0663 0.0049  0.0149  9   DG  C C2    
4575 N N2    . DG  C 9   ? 0.6626 0.6364 0.8128 -0.0566 -0.0001 0.0170  9   DG  C N2    
4576 N N3    . DG  C 9   ? 0.6375 0.5989 0.7577 -0.0773 0.0044  0.0130  9   DG  C N3    
4577 C C4    . DG  C 9   ? 0.6699 0.6352 0.7819 -0.0856 0.0096  0.0093  9   DG  C C4    
4578 P P     . DG  C 10  ? 0.7423 0.6399 0.7521 -0.1517 0.0083  -0.0081 10  DG  C P     
4579 O OP1   . DG  C 10  ? 0.8870 0.8164 0.9201 -0.1532 0.0029  -0.0086 10  DG  C OP1   
4580 O OP2   . DG  C 10  ? 0.7922 0.6774 0.7746 -0.1692 0.0165  -0.0170 10  DG  C OP2   
4581 O "O5'" . DG  C 10  ? 0.7467 0.6042 0.7366 -0.1434 0.0043  -0.0016 10  DG  C "O5'" 
4582 C "C5'" . DG  C 10  ? 0.7266 0.5511 0.6966 -0.1344 0.0060  0.0002  10  DG  C "C5'" 
4583 C "C4'" . DG  C 10  ? 0.7647 0.5795 0.7454 -0.1126 -0.0018 0.0070  10  DG  C "C4'" 
4584 O "O4'" . DG  C 10  ? 0.7468 0.5939 0.7630 -0.0986 -0.0021 0.0092  10  DG  C "O4'" 
4585 C "C3'" . DG  C 10  ? 0.9408 0.7097 0.8892 -0.1031 -0.0034 0.0074  10  DG  C "C3'" 
4586 O "O3'" . DG  C 10  ? 1.1334 0.8864 1.0800 -0.0890 -0.0126 0.0113  10  DG  C "O3'" 
4587 C "C2'" . DG  C 10  ? 0.8639 0.6460 0.8293 -0.0899 -0.0007 0.0068  10  DG  C "C2'" 
4588 C "C1'" . DG  C 10  ? 0.7988 0.6284 0.8092 -0.0838 -0.0021 0.0094  10  DG  C "C1'" 
4589 N N9    . DG  C 10  ? 0.8431 0.6965 0.8715 -0.0823 0.0038  0.0078  10  DG  C N9    
4590 C C8    . DG  C 10  ? 0.8188 0.6781 0.8396 -0.0957 0.0110  0.0037  10  DG  C C8    
4591 N N7    . DG  C 10  ? 0.7576 0.6367 0.7960 -0.0902 0.0147  0.0032  10  DG  C N7    
4592 C C5    . DG  C 10  ? 0.7553 0.6435 0.8148 -0.0736 0.0106  0.0066  10  DG  C C5    
4593 C C6    . DG  C 10  ? 0.8006 0.7099 0.8830 -0.0637 0.0131  0.0068  10  DG  C C6    
4594 O O6    . DG  C 10  ? 0.7908 0.7124 0.8781 -0.0668 0.0190  0.0051  10  DG  C O6    
4595 N N1    . DG  C 10  ? 0.8631 0.7793 0.9626 -0.0495 0.0082  0.0082  10  DG  C N1    
4596 C C2    . DG  C 10  ? 0.8540 0.7573 0.9490 -0.0436 0.0007  0.0098  10  DG  C C2    
4597 N N2    . DG  C 10  ? 0.8550 0.7708 0.9701 -0.0290 -0.0035 0.0093  10  DG  C N2    
4598 N N3    . DG  C 10  ? 0.8353 0.7153 0.9068 -0.0521 -0.0022 0.0108  10  DG  C N3    
4599 C C4    . DG  C 10  ? 0.8003 0.6744 0.8551 -0.0679 0.0036  0.0090  10  DG  C C4    
4600 P P     . DA  C 11  ? 1.1694 0.8696 1.0777 -0.0755 -0.0182 0.0110  11  DA  C P     
4601 O OP1   . DA  C 11  ? 1.2043 0.8826 1.0982 -0.0722 -0.0266 0.0138  11  DA  C OP1   
4602 O OP2   . DA  C 11  ? 1.1150 0.7823 0.9852 -0.0882 -0.0111 0.0071  11  DA  C OP2   
4603 O "O5'" . DA  C 11  ? 1.0005 0.7201 0.9381 -0.0500 -0.0220 0.0106  11  DA  C "O5'" 
4604 C "C5'" . DA  C 11  ? 0.9355 0.6937 0.9149 -0.0380 -0.0267 0.0128  11  DA  C "C5'" 
4605 C "C4'" . DA  C 11  ? 0.9623 0.7344 0.9622 -0.0161 -0.0291 0.0096  11  DA  C "C4'" 
4606 O "O4'" . DA  C 11  ? 0.9744 0.7748 0.9945 -0.0214 -0.0200 0.0081  11  DA  C "O4'" 
4607 C "C3'" . DA  C 11  ? 0.9862 0.7165 0.9536 0.0002  -0.0347 0.0051  11  DA  C "C3'" 
4608 O "O3'" . DA  C 11  ? 1.0695 0.8171 1.0605 0.0241  -0.0422 0.0010  11  DA  C "O3'" 
4609 C "C2'" . DA  C 11  ? 0.9250 0.6522 0.8837 -0.0061 -0.0258 0.0023  11  DA  C "C2'" 
4610 C "C1'" . DA  C 11  ? 0.9369 0.7178 0.9408 -0.0116 -0.0186 0.0034  11  DA  C "C1'" 
4611 N N9    . DA  C 11  ? 0.9502 0.7374 0.9506 -0.0266 -0.0084 0.0029  11  DA  C N9    
4612 C C8    . DA  C 11  ? 0.9174 0.6829 0.8891 -0.0456 -0.0033 0.0032  11  DA  C C8    
4613 N N7    . DA  C 11  ? 0.8847 0.6651 0.8618 -0.0549 0.0052  0.0015  11  DA  C N7    
4614 C C5    . DA  C 11  ? 0.9079 0.7191 0.9176 -0.0418 0.0059  0.0008  11  DA  C C5    
4615 C C6    . DA  C 11  ? 0.7868 0.6228 0.8143 -0.0432 0.0133  -0.0009 11  DA  C C6    
4616 N N6    . DA  C 11  ? 0.7377 0.5723 0.7538 -0.0573 0.0205  -0.0023 11  DA  C N6    
4617 N N1    . DA  C 11  ? 0.7757 0.6384 0.8323 -0.0304 0.0131  -0.0020 11  DA  C N1    
4618 C C2    . DA  C 11  ? 0.8877 0.7551 0.9570 -0.0165 0.0059  -0.0024 11  DA  C C2    
4619 N N3    . DA  C 11  ? 1.0046 0.8514 1.0608 -0.0117 -0.0024 -0.0010 11  DA  C N3    
4620 C C4    . DA  C 11  ? 0.9345 0.7518 0.9595 -0.0252 -0.0019 0.0011  11  DA  C C4    
4621 P P     . DA  C 12  ? 1.1463 0.8583 1.1108 0.0488  -0.0519 -0.0063 12  DA  C P     
4622 O OP1   . DA  C 12  ? 1.1923 0.9084 1.1670 0.0667  -0.0637 -0.0084 12  DA  C OP1   
4623 O OP2   . DA  C 12  ? 1.1671 0.8229 1.0780 0.0410  -0.0514 -0.0056 12  DA  C OP2   
4624 O "O5'" . DA  C 12  ? 1.1151 0.8613 1.1091 0.0599  -0.0470 -0.0133 12  DA  C "O5'" 
4625 C "C5'" . DA  C 12  ? 1.0155 0.8175 1.0590 0.0601  -0.0426 -0.0143 12  DA  C "C5'" 
4626 C "C4'" . DA  C 12  ? 0.9262 0.7528 0.9883 0.0663  -0.0360 -0.0213 12  DA  C "C4'" 
4627 O "O4'" . DA  C 12  ? 1.0027 0.8279 1.0577 0.0467  -0.0248 -0.0166 12  DA  C "O4'" 
4628 C "C3'" . DA  C 12  ? 0.9675 0.7701 1.0093 0.0887  -0.0430 -0.0313 12  DA  C "C3'" 
4629 O "O3'" . DA  C 12  ? 0.9518 0.7969 1.0291 0.1012  -0.0408 -0.0412 12  DA  C "O3'" 
4630 C "C2'" . DA  C 12  ? 1.0025 0.7712 1.0104 0.0770  -0.0366 -0.0286 12  DA  C "C2'" 
4631 C "C1'" . DA  C 12  ? 0.9761 0.7780 1.0086 0.0538  -0.0235 -0.0220 12  DA  C "C1'" 
4632 N N9    . DA  C 12  ? 0.9759 0.7506 0.9791 0.0341  -0.0168 -0.0164 12  DA  C N9    
4633 C C8    . DA  C 12  ? 1.0116 0.7438 0.9762 0.0244  -0.0198 -0.0122 12  DA  C C8    
4634 N N7    . DA  C 12  ? 0.9622 0.6822 0.9085 0.0050  -0.0112 -0.0097 12  DA  C N7    
4635 C C5    . DA  C 12  ? 0.9426 0.6979 0.9170 0.0034  -0.0031 -0.0116 12  DA  C C5    
4636 C C6    . DA  C 12  ? 0.9290 0.6921 0.9021 -0.0121 0.0073  -0.0111 12  DA  C C6    
4637 N N6    . DA  C 12  ? 0.8625 0.6007 0.8058 -0.0303 0.0117  -0.0096 12  DA  C N6    
4638 N N1    . DA  C 12  ? 0.8864 0.6843 0.8890 -0.0091 0.0132  -0.0132 12  DA  C N1    
4639 C C2    . DA  C 12  ? 0.8845 0.7091 0.9162 0.0065  0.0100  -0.0164 12  DA  C C2    
4640 N N3    . DA  C 12  ? 0.9554 0.7798 0.9938 0.0217  0.0009  -0.0184 12  DA  C N3    
4641 C C4    . DA  C 12  ? 0.9399 0.7278 0.9483 0.0202  -0.0059 -0.0154 12  DA  C C4    
4642 P P     . DT  C 13  ? 1.1228 0.9593 1.1911 0.1282  -0.0485 -0.0557 13  DT  C P     
4643 O OP1   . DT  C 13  ? 1.1126 0.9971 1.2215 0.1431  -0.0515 -0.0669 13  DT  C OP1   
4644 O OP2   . DT  C 13  ? 1.2021 0.9782 1.2206 0.1395  -0.0601 -0.0554 13  DT  C OP2   
4645 O "O5'" . DT  C 13  ? 1.0981 0.9427 1.1680 0.1194  -0.0365 -0.0574 13  DT  C "O5'" 
4646 C "C5'" . DT  C 13  ? 0.9038 0.7936 1.0092 0.1033  -0.0235 -0.0553 13  DT  C "C5'" 
4647 C "C4'" . DT  C 13  ? 0.8429 0.7265 0.9381 0.0934  -0.0134 -0.0546 13  DT  C "C4'" 
4648 O "O4'" . DT  C 13  ? 0.9093 0.7559 0.9726 0.0763  -0.0108 -0.0435 13  DT  C "O4'" 
4649 C "C3'" . DT  C 13  ? 0.8647 0.7332 0.9443 0.1131  -0.0175 -0.0664 13  DT  C "C3'" 
4650 O "O3'" . DT  C 13  ? 0.9893 0.9000 1.0995 0.1133  -0.0084 -0.0748 13  DT  C "O3'" 
4651 C "C2'" . DT  C 13  ? 0.8306 0.6497 0.8670 0.1034  -0.0155 -0.0594 13  DT  C "C2'" 
4652 C "C1'" . DT  C 13  ? 0.8811 0.7050 0.9212 0.0763  -0.0069 -0.0461 13  DT  C "C1'" 
4653 N N1    . DT  C 13  ? 1.0562 0.8316 1.0539 0.0640  -0.0079 -0.0383 13  DT  C N1    
4654 C C2    . DT  C 13  ? 1.1057 0.8754 1.0927 0.0445  0.0023  -0.0335 13  DT  C C2    
4655 O O2    . DT  C 13  ? 1.1020 0.9014 1.1109 0.0381  0.0115  -0.0344 13  DT  C O2    
4656 N N3    . DT  C 13  ? 1.1322 0.8593 1.0800 0.0320  0.0017  -0.0284 13  DT  C N3    
4657 C C4    . DT  C 13  ? 1.1207 0.8076 1.0366 0.0360  -0.0077 -0.0268 13  DT  C C4    
4658 O O4    . DT  C 13  ? 1.1509 0.8003 1.0301 0.0210  -0.0061 -0.0230 13  DT  C O4    
4659 C C5    . DT  C 13  ? 1.0727 0.7648 1.0002 0.0582  -0.0191 -0.0309 13  DT  C C5    
4660 C C7    . DT  C 13  ? 1.0201 0.6673 0.9121 0.0653  -0.0308 -0.0296 13  DT  C C7    
4661 C C6    . DT  C 13  ? 1.1268 0.8644 1.0956 0.0713  -0.0188 -0.0369 13  DT  C C6    
4662 P P     . DT  C 14  ? 1.0706 0.9789 1.1737 0.1313  -0.0097 -0.0888 14  DT  C P     
4663 O OP1   . DT  C 14  ? 0.9905 0.9549 1.1355 0.1363  -0.0043 -0.1015 14  DT  C OP1   
4664 O OP2   . DT  C 14  ? 1.0581 0.9211 1.1251 0.1533  -0.0246 -0.0938 14  DT  C OP2   
4665 O "O5'" . DT  C 14  ? 1.0257 0.9182 1.1123 0.1127  0.0020  -0.0810 14  DT  C "O5'" 
4666 C "C5'" . DT  C 14  ? 0.8965 0.8168 1.0042 0.0896  0.0151  -0.0731 14  DT  C "C5'" 
4667 C "C4'" . DT  C 14  ? 0.8641 0.7616 0.9493 0.0750  0.0233  -0.0665 14  DT  C "C4'" 
4668 O "O4'" . DT  C 14  ? 0.8891 0.7429 0.9400 0.0673  0.0188  -0.0569 14  DT  C "O4'" 
4669 C "C3'" . DT  C 14  ? 0.8848 0.7715 0.9568 0.0871  0.0241  -0.0762 14  DT  C "C3'" 
4670 O "O3'" . DT  C 14  ? 0.9515 0.8565 1.0335 0.0721  0.0371  -0.0744 14  DT  C "O3'" 
4671 C "C2'" . DT  C 14  ? 0.8867 0.7160 0.9123 0.0900  0.0169  -0.0720 14  DT  C "C2'" 
4672 C "C1'" . DT  C 14  ? 0.9289 0.7474 0.9470 0.0684  0.0197  -0.0583 14  DT  C "C1'" 
4673 N N1    . DT  C 14  ? 1.0045 0.7718 0.9817 0.0687  0.0111  -0.0536 14  DT  C N1    
4674 C C2    . DT  C 14  ? 0.9959 0.7340 0.9443 0.0495  0.0165  -0.0463 14  DT  C C2    
4675 O O2    . DT  C 14  ? 1.0447 0.7973 1.0003 0.0342  0.0270  -0.0437 14  DT  C O2    
4676 N N3    . DT  C 14  ? 1.0936 0.7842 1.0026 0.0483  0.0093  -0.0431 14  DT  C N3    
4677 C C4    . DT  C 14  ? 1.1578 0.8244 1.0516 0.0656  -0.0035 -0.0457 14  DT  C C4    
4678 O O4    . DT  C 14  ? 1.2128 0.8321 1.0659 0.0618  -0.0090 -0.0423 14  DT  C O4    
4679 C C5    . DT  C 14  ? 1.1076 0.8083 1.0348 0.0878  -0.0100 -0.0536 14  DT  C C5    
4680 C C7    . DT  C 14  ? 1.0584 0.7387 0.9729 0.1099  -0.0252 -0.0584 14  DT  C C7    
4681 C C6    . DT  C 14  ? 1.0990 0.8495 1.0668 0.0874  -0.0019 -0.0576 14  DT  C C6    
4682 P P     . DT  C 15  ? 1.0420 0.9463 1.1177 0.0803  0.0416  -0.0842 15  DT  C P     
4683 O OP1   . DT  C 15  ? 1.0863 1.0347 1.1933 0.0706  0.0535  -0.0876 15  DT  C OP1   
4684 O OP2   . DT  C 15  ? 1.0565 0.9447 1.1198 0.1064  0.0297  -0.0962 15  DT  C OP2   
4685 O "O5'" . DT  C 15  ? 1.0137 0.8789 1.0553 0.0659  0.0456  -0.0747 15  DT  C "O5'" 
4686 C "C5'" . DT  C 15  ? 0.9739 0.8402 1.0155 0.0436  0.0519  -0.0628 15  DT  C "C5'" 
4687 C "C4'" . DT  C 15  ? 0.9589 0.7854 0.9643 0.0329  0.0535  -0.0572 15  DT  C "C4'" 
4688 O "O4'" . DT  C 15  ? 1.0621 0.8503 1.0390 0.0365  0.0439  -0.0543 15  DT  C "O4'" 
4689 C "C3'" . DT  C 15  ? 0.9153 0.7248 0.9026 0.0394  0.0564  -0.0637 15  DT  C "C3'" 
4690 O "O3'" . DT  C 15  ? 0.9999 0.8028 0.9757 0.0208  0.0653  -0.0583 15  DT  C "O3'" 
4691 C "C2'" . DT  C 15  ? 0.8891 0.6514 0.8398 0.0531  0.0453  -0.0664 15  DT  C "C2'" 
4692 C "C1'" . DT  C 15  ? 0.9763 0.7222 0.9154 0.0406  0.0419  -0.0571 15  DT  C "C1'" 
4693 N N1    . DT  C 15  ? 1.0045 0.7112 0.9151 0.0542  0.0293  -0.0584 15  DT  C N1    
4694 C C2    . DT  C 15  ? 1.0877 0.7496 0.9584 0.0418  0.0277  -0.0526 15  DT  C C2    
4695 O O2    . DT  C 15  ? 1.0419 0.6983 0.9019 0.0203  0.0362  -0.0476 15  DT  C O2    
4696 N N3    . DT  C 15  ? 1.2227 0.8458 1.0645 0.0552  0.0156  -0.0540 15  DT  C N3    
4697 C C4    . DT  C 15  ? 1.2098 0.8366 1.0601 0.0814  0.0040  -0.0612 15  DT  C C4    
4698 O O4    . DT  C 15  ? 1.2846 0.8714 1.1037 0.0933  -0.0077 -0.0623 15  DT  C O4    
4699 C C5    . DT  C 15  ? 1.0919 0.7723 0.9885 0.0934  0.0065  -0.0687 15  DT  C C5    
4700 C C7    . DT  C 15  ? 1.0458 0.7406 0.9578 0.1217  -0.0052 -0.0798 15  DT  C C7    
4701 C C6    . DT  C 15  ? 1.0424 0.7587 0.9657 0.0783  0.0195  -0.0665 15  DT  C C6    
4702 P P     . DC  C 16  ? 1.1492 0.9438 1.1126 0.0215  0.0720  -0.0635 16  DC  C P     
4703 O OP1   . DC  C 16  ? 1.1844 1.0103 1.1684 0.0069  0.0827  -0.0606 16  DC  C OP1   
4704 O OP2   . DC  C 16  ? 1.0797 0.8721 1.0434 0.0442  0.0665  -0.0742 16  DC  C OP2   
4705 O "O5'" . DC  C 16  ? 1.1405 0.8881 1.0612 0.0110  0.0712  -0.0596 16  DC  C "O5'" 
4706 C "C5'" . DC  C 16  ? 1.1115 0.8552 1.0256 -0.0084 0.0733  -0.0519 16  DC  C "C5'" 
4707 C "C4'" . DC  C 16  ? 1.1224 0.8169 0.9922 -0.0154 0.0705  -0.0509 16  DC  C "C4'" 
4708 O "O4'" . DC  C 16  ? 1.1380 0.8061 0.9924 -0.0019 0.0595  -0.0514 16  DC  C "O4'" 
4709 C "C3'" . DC  C 16  ? 1.1282 0.7924 0.9681 -0.0142 0.0737  -0.0556 16  DC  C "C3'" 
4710 O "O3'" . DC  C 16  ? 1.2562 0.9002 1.0699 -0.0359 0.0796  -0.0534 16  DC  C "O3'" 
4711 C "C2'" . DC  C 16  ? 1.0973 0.7212 0.9089 0.0052  0.0628  -0.0596 16  DC  C "C2'" 
4712 C "C1'" . DC  C 16  ? 1.1093 0.7267 0.9193 0.0028  0.0559  -0.0546 16  DC  C "C1'" 
4713 N N1    . DC  C 16  ? 1.1934 0.7884 0.9919 0.0262  0.0430  -0.0584 16  DC  C N1    
4714 C C2    . DC  C 16  ? 1.1334 0.6765 0.8883 0.0252  0.0353  -0.0564 16  DC  C C2    
4715 O O2    . DC  C 16  ? 1.0783 0.5972 0.8060 0.0026  0.0408  -0.0519 16  DC  C O2    
4716 N N3    . DC  C 16  ? 1.1523 0.6732 0.8945 0.0488  0.0220  -0.0604 16  DC  C N3    
4717 C C4    . DC  C 16  ? 1.1871 0.7402 0.9614 0.0724  0.0167  -0.0677 16  DC  C C4    
4718 N N4    . DC  C 16  ? 1.2325 0.7642 0.9932 0.0969  0.0024  -0.0734 16  DC  C N4    
4719 C C5    . DC  C 16  ? 1.2195 0.8281 1.0396 0.0715  0.0258  -0.0705 16  DC  C C5    
4720 C C6    . DC  C 16  ? 1.2610 0.8861 1.0900 0.0482  0.0386  -0.0650 16  DC  C C6    
4721 P P     . DG  C 17  ? 1.3630 0.9964 1.1593 -0.0443 0.0882  -0.0571 17  DG  C P     
4722 O OP1   . DG  C 17  ? 1.2847 0.9423 1.0914 -0.0661 0.0965  -0.0552 17  DG  C OP1   
4723 O OP2   . DG  C 17  ? 1.2639 0.9114 1.0766 -0.0259 0.0883  -0.0617 17  DG  C OP2   
4724 O "O5'" . DG  C 17  ? 1.4024 0.9747 1.1440 -0.0482 0.0852  -0.0589 17  DG  C "O5'" 
4725 C "C5'" . DG  C 17  ? 1.3040 0.8522 1.0207 -0.0645 0.0840  -0.0561 17  DG  C "C5'" 
4726 C "C4'" . DG  C 17  ? 1.2368 0.7201 0.8977 -0.0628 0.0792  -0.0580 17  DG  C "C4'" 
4727 O "O4'" . DG  C 17  ? 1.3076 0.7726 0.9639 -0.0396 0.0665  -0.0575 17  DG  C "O4'" 
4728 C "C3'" . DG  C 17  ? 1.2468 0.7024 0.8811 -0.0585 0.0822  -0.0630 17  DG  C "C3'" 
4729 O "O3'" . DG  C 17  ? 1.3401 0.7429 0.9202 -0.0768 0.0852  -0.0643 17  DG  C "O3'" 
4730 C "C2'" . DG  C 17  ? 1.2475 0.6881 0.8803 -0.0270 0.0705  -0.0658 17  DG  C "C2'" 
4731 C "C1'" . DG  C 17  ? 1.3301 0.7552 0.9553 -0.0216 0.0607  -0.0624 17  DG  C "C1'" 
4732 N N9    . DG  C 17  ? 1.3288 0.7675 0.9763 0.0082  0.0493  -0.0652 17  DG  C N9    
4733 C C8    . DG  C 17  ? 1.2645 0.7550 0.9606 0.0236  0.0500  -0.0686 17  DG  C C8    
4734 N N7    . DG  C 17  ? 1.2547 0.7497 0.9619 0.0486  0.0387  -0.0729 17  DG  C N7    
4735 C C5    . DG  C 17  ? 1.3522 0.7923 1.0140 0.0517  0.0289  -0.0713 17  DG  C C5    
4736 C C6    . DG  C 17  ? 1.3355 0.7536 0.9847 0.0762  0.0136  -0.0751 17  DG  C C6    
4737 O O6    . DG  C 17  ? 1.3320 0.7800 1.0115 0.1008  0.0057  -0.0819 17  DG  C O6    
4738 N N1    . DG  C 17  ? 1.3414 0.6960 0.9349 0.0697  0.0075  -0.0714 17  DG  C N1    
4739 C C2    . DG  C 17  ? 1.3625 0.6823 0.9187 0.0408  0.0165  -0.0658 17  DG  C C2    
4740 N N2    . DG  C 17  ? 1.4021 0.6590 0.9028 0.0362  0.0098  -0.0635 17  DG  C N2    
4741 N N3    . DG  C 17  ? 1.3775 0.7220 0.9481 0.0176  0.0311  -0.0637 17  DG  C N3    
4742 C C4    . DG  C 17  ? 1.4150 0.8186 1.0385 0.0257  0.0359  -0.0662 17  DG  C C4    
4743 P P     . DC  C 18  ? 1.4254 0.7950 0.9702 -0.0820 0.0911  -0.0693 18  DC  C P     
4744 O OP1   . DC  C 18  ? 1.4564 0.8097 0.9720 -0.1147 0.1014  -0.0708 18  DC  C OP1   
4745 O OP2   . DC  C 18  ? 1.3589 0.7711 0.9434 -0.0688 0.0944  -0.0715 18  DC  C OP2   
4746 O "O5'" . DC  C 18  ? 1.5348 0.8375 1.0289 -0.0623 0.0792  -0.0710 18  DC  C "O5'" 
4747 C "C5'" . DC  C 18  ? 1.4675 0.7241 0.9222 -0.0667 0.0723  -0.0685 18  DC  C "C5'" 
4748 C "C4'" . DC  C 18  ? 1.4950 0.7038 0.9185 -0.0364 0.0568  -0.0705 18  DC  C "C4'" 
4749 O "O4'" . DC  C 18  ? 1.4139 0.6677 0.8874 -0.0094 0.0479  -0.0707 18  DC  C "O4'" 
4750 C "C3'" . DC  C 18  ? 1.4725 0.6430 0.8627 -0.0225 0.0543  -0.0763 18  DC  C "C3'" 
4751 O "O3'" . DC  C 18  ? 1.5199 0.6085 0.8345 -0.0303 0.0504  -0.0768 18  DC  C "O3'" 
4752 C "C2'" . DC  C 18  ? 1.4518 0.6417 0.8703 0.0166  0.0407  -0.0807 18  DC  C "C2'" 
4753 C "C1'" . DC  C 18  ? 1.4371 0.6565 0.8872 0.0212  0.0349  -0.0765 18  DC  C "C1'" 
4754 N N1    . DC  C 18  ? 1.4475 0.7242 0.9553 0.0481  0.0287  -0.0803 18  DC  C N1    
4755 C C2    . DC  C 18  ? 1.4507 0.7171 0.9569 0.0744  0.0132  -0.0832 18  DC  C C2    
4756 O O2    . DC  C 18  ? 1.4920 0.6986 0.9471 0.0760  0.0041  -0.0817 18  DC  C O2    
4757 N N3    . DC  C 18  ? 1.4622 0.7840 1.0215 0.0967  0.0087  -0.0886 18  DC  C N3    
4758 C C4    . DC  C 18  ? 1.4183 0.7996 1.0273 0.0923  0.0194  -0.0901 18  DC  C C4    
4759 N N4    . DC  C 18  ? 1.3605 0.7942 1.0182 0.1120  0.0158  -0.0964 18  DC  C N4    
4760 C C5    . DC  C 18  ? 1.3900 0.7791 0.9992 0.0668  0.0344  -0.0861 18  DC  C C5    
4761 C C6    . DC  C 18  ? 1.4441 0.7821 1.0039 0.0460  0.0384  -0.0817 18  DC  C C6    
4762 P P     . DA  C 19  ? 1.6634 0.6933 0.9247 -0.0213 0.0478  -0.0825 19  DA  C P     
4763 O OP1   . DA  C 19  ? 1.6311 0.5954 0.8240 -0.0518 0.0546  -0.0814 19  DA  C OP1   
4764 O OP2   . DA  C 19  ? 1.6378 0.7192 0.9440 -0.0148 0.0548  -0.0861 19  DA  C OP2   
4765 O "O5'" . DA  C 19  ? 1.6748 0.6643 0.9115 0.0183  0.0269  -0.0863 19  DA  C "O5'" 
4766 C "C5'" . DA  C 19  ? 1.6859 0.6296 0.8853 0.0220  0.0159  -0.0834 19  DA  C "C5'" 
4767 C "C4'" . DA  C 19  ? 1.7268 0.6533 0.9210 0.0656  -0.0049 -0.0894 19  DA  C "C4'" 
4768 O "O4'" . DA  C 19  ? 1.6051 0.6148 0.8787 0.0841  -0.0066 -0.0914 19  DA  C "O4'" 
4769 C "C3'" . DA  C 19  ? 1.7307 0.6158 0.8889 0.0897  -0.0134 -0.0979 19  DA  C "C3'" 
4770 O "O3'" . DA  C 19  ? 1.9399 0.7471 1.0327 0.1132  -0.0325 -0.1015 19  DA  C "O3'" 
4771 C "C2'" . DA  C 19  ? 1.6684 0.6312 0.8997 0.1166  -0.0158 -0.1049 19  DA  C "C2'" 
4772 C "C1'" . DA  C 19  ? 1.6155 0.6306 0.8979 0.1206  -0.0186 -0.1016 19  DA  C "C1'" 
4773 N N9    . DA  C 19  ? 1.6100 0.7155 0.9736 0.1280  -0.0124 -0.1044 19  DA  C N9    
4774 C C8    . DA  C 19  ? 1.6042 0.7610 1.0087 0.1099  0.0039  -0.1027 19  DA  C C8    
4775 N N7    . DA  C 19  ? 1.5707 0.8009 1.0418 0.1209  0.0061  -0.1060 19  DA  C N7    
4776 C C5    . DA  C 19  ? 1.6134 0.8441 1.0904 0.1478  -0.0095 -0.1110 19  DA  C C5    
4777 C C6    . DA  C 19  ? 1.6126 0.9046 1.1463 0.1684  -0.0146 -0.1174 19  DA  C C6    
4778 N N6    . DA  C 19  ? 1.5525 0.9166 1.1473 0.1636  -0.0036 -0.1191 19  DA  C N6    
4779 N N1    . DA  C 19  ? 1.6661 0.9412 1.1890 0.1936  -0.0315 -0.1227 19  DA  C N1    
4780 C C2    . DA  C 19  ? 1.7433 0.9411 1.2000 0.1983  -0.0430 -0.1208 19  DA  C C2    
4781 N N3    . DA  C 19  ? 1.7870 0.9184 1.1829 0.1792  -0.0392 -0.1143 19  DA  C N3    
4782 C C4    . DA  C 19  ? 1.6923 0.8464 1.1037 0.1537  -0.0217 -0.1100 19  DA  C C4    
4783 O "O5'" . DT  D 1   ? 1.8890 1.2501 1.8290 0.1596  0.3841  -0.1908 1   DT  D "O5'" 
4784 C "C5'" . DT  D 1   ? 1.9043 1.3351 1.8895 0.1704  0.3733  -0.1859 1   DT  D "C5'" 
4785 C "C4'" . DT  D 1   ? 1.9285 1.3941 1.9190 0.1562  0.3415  -0.1736 1   DT  D "C4'" 
4786 O "O4'" . DT  D 1   ? 1.9386 1.3732 1.8842 0.1213  0.3338  -0.1796 1   DT  D "O4'" 
4787 C "C3'" . DT  D 1   ? 1.8880 1.4227 1.9168 0.1592  0.3288  -0.1714 1   DT  D "C3'" 
4788 O "O3'" . DT  D 1   ? 1.8417 1.4186 1.9105 0.1829  0.3141  -0.1546 1   DT  D "O3'" 
4789 C "C2'" . DT  D 1   ? 1.8374 1.3765 1.8409 0.1255  0.3110  -0.1742 1   DT  D "C2'" 
4790 C "C1'" . DT  D 1   ? 1.8692 1.3485 1.8262 0.1073  0.3099  -0.1733 1   DT  D "C1'" 
4791 N N1    . DT  D 1   ? 1.8716 1.3292 1.7893 0.0719  0.3077  -0.1827 1   DT  D N1    
4792 C C2    . DT  D 1   ? 1.8516 1.2598 1.7263 0.0512  0.3039  -0.1806 1   DT  D C2    
4793 O O2    . DT  D 1   ? 1.8179 1.1976 1.6843 0.0602  0.3024  -0.1720 1   DT  D O2    
4794 N N3    . DT  D 1   ? 1.8064 1.2006 1.6481 0.0184  0.3016  -0.1881 1   DT  D N3    
4795 C C4    . DT  D 1   ? 1.7762 1.1992 1.6237 0.0051  0.3028  -0.1974 1   DT  D C4    
4796 O O4    . DT  D 1   ? 1.7170 1.1252 1.5334 -0.0249 0.3002  -0.2023 1   DT  D O4    
4797 C C5    . DT  D 1   ? 1.7929 1.2659 1.6858 0.0283  0.3069  -0.1997 1   DT  D C5    
4798 C C7    . DT  D 1   ? 1.7373 1.2446 1.6404 0.0160  0.3083  -0.2092 1   DT  D C7    
4799 C C6    . DT  D 1   ? 1.8250 1.3131 1.7503 0.0599  0.3090  -0.1922 1   DT  D C6    
4800 P P     . DG  D 2   ? 1.8387 1.4491 1.9149 0.1743  0.2826  -0.1403 2   DG  D P     
4801 O OP1   . DG  D 2   ? 1.7867 1.4252 1.8993 0.2031  0.2762  -0.1248 2   DG  D OP1   
4802 O OP2   . DG  D 2   ? 1.7440 1.3934 1.8261 0.1563  0.2709  -0.1456 2   DG  D OP2   
4803 O "O5'" . DG  D 2   ? 1.7904 1.3478 1.8214 0.1537  0.2751  -0.1371 2   DG  D "O5'" 
4804 C "C5'" . DG  D 2   ? 1.5919 1.1281 1.6213 0.1669  0.2699  -0.1237 2   DG  D "C5'" 
4805 C "C4'" . DG  D 2   ? 1.3579 0.8868 1.3643 0.1466  0.2469  -0.1134 2   DG  D "C4'" 
4806 O "O4'" . DG  D 2   ? 1.3428 0.8404 1.3084 0.1146  0.2484  -0.1238 2   DG  D "O4'" 
4807 C "C3'" . DG  D 2   ? 1.2370 0.8234 1.2697 0.1469  0.2229  -0.1029 2   DG  D "C3'" 
4808 O "O3'" . DG  D 2   ? 1.2419 0.8228 1.2682 0.1470  0.2054  -0.0869 2   DG  D "O3'" 
4809 C "C2'" . DG  D 2   ? 1.1674 0.7591 1.1806 0.1180  0.2179  -0.1126 2   DG  D "C2'" 
4810 C "C1'" . DG  D 2   ? 1.2507 0.7810 1.2172 0.0972  0.2270  -0.1183 2   DG  D "C1'" 
4811 N N9    . DG  D 2   ? 1.3100 0.8303 1.2522 0.0703  0.2322  -0.1314 2   DG  D N9    
4812 C C8    . DG  D 2   ? 1.3171 0.8634 1.2737 0.0688  0.2411  -0.1439 2   DG  D C8    
4813 N N7    . DG  D 2   ? 1.3571 0.8870 1.2852 0.0413  0.2437  -0.1531 2   DG  D N7    
4814 C C5    . DG  D 2   ? 1.3310 0.8222 1.2233 0.0231  0.2357  -0.1459 2   DG  D C5    
4815 C C6    . DG  D 2   ? 1.2744 0.7358 1.1262 -0.0098 0.2336  -0.1491 2   DG  D C6    
4816 O O6    . DG  D 2   ? 1.3524 0.8156 1.1916 -0.0296 0.2388  -0.1595 2   DG  D O6    
4817 N N1    . DG  D 2   ? 1.2471 0.6756 1.0721 -0.0200 0.2240  -0.1375 2   DG  D N1    
4818 C C2    . DG  D 2   ? 1.2755 0.6995 1.1114 -0.0004 0.2174  -0.1249 2   DG  D C2    
4819 N N2    . DG  D 2   ? 1.3526 0.7436 1.1587 -0.0152 0.2081  -0.1142 2   DG  D N2    
4820 N N3    . DG  D 2   ? 1.2857 0.7372 1.1597 0.0307  0.2194  -0.1219 2   DG  D N3    
4821 C C4    . DG  D 2   ? 1.3114 0.7959 1.2118 0.0406  0.2286  -0.1327 2   DG  D C4    
4822 P P     . DC  D 3   ? 1.2176 0.8538 1.2745 0.1566  0.1820  -0.0723 3   DC  D P     
4823 O OP1   . DC  D 3   ? 1.1927 0.8382 1.2760 0.1853  0.1829  -0.0606 3   DC  D OP1   
4824 O OP2   . DC  D 3   ? 1.2854 0.9668 1.3609 0.1509  0.1776  -0.0799 3   DC  D OP2   
4825 O "O5'" . DC  D 3   ? 1.1576 0.7758 1.1845 0.1353  0.1639  -0.0622 3   DC  D "O5'" 
4826 C "C5'" . DC  D 3   ? 1.2047 0.7706 1.2002 0.1284  0.1671  -0.0574 3   DC  D "C5'" 
4827 C "C4'" . DC  D 3   ? 1.1662 0.7128 1.1264 0.0979  0.1556  -0.0548 3   DC  D "C4'" 
4828 O "O4'" . DC  D 3   ? 1.1791 0.7100 1.1189 0.0771  0.1670  -0.0707 3   DC  D "O4'" 
4829 C "C3'" . DC  D 3   ? 1.0816 0.6710 1.0534 0.0919  0.1333  -0.0438 3   DC  D "C3'" 
4830 O "O3'" . DC  D 3   ? 1.1007 0.6746 1.0561 0.0861  0.1194  -0.0276 3   DC  D "O3'" 
4831 C "C2'" . DC  D 3   ? 1.1290 0.7228 1.0853 0.0664  0.1331  -0.0539 3   DC  D "C2'" 
4832 C "C1'" . DC  D 3   ? 1.1603 0.7046 1.0866 0.0535  0.1522  -0.0671 3   DC  D "C1'" 
4833 N N1    . DC  D 3   ? 1.1781 0.7304 1.1011 0.0391  0.1614  -0.0829 3   DC  D N1    
4834 C C2    . DC  D 3   ? 1.2641 0.7875 1.1510 0.0089  0.1630  -0.0876 3   DC  D C2    
4835 O O2    . DC  D 3   ? 1.2763 0.7683 1.1343 -0.0059 0.1565  -0.0785 3   DC  D O2    
4836 N N3    . DC  D 3   ? 1.2709 0.8030 1.1555 -0.0040 0.1713  -0.1013 3   DC  D N3    
4837 C C4    . DC  D 3   ? 1.2101 0.7775 1.1268 0.0119  0.1777  -0.1101 3   DC  D C4    
4838 N N4    . DC  D 3   ? 1.2654 0.8406 1.1787 -0.0022 0.1855  -0.1230 3   DC  D N4    
4839 C C5    . DC  D 3   ? 1.1554 0.7528 1.1088 0.0421  0.1759  -0.1051 3   DC  D C5    
4840 C C6    . DC  D 3   ? 1.1303 0.7192 1.0856 0.0546  0.1678  -0.0916 3   DC  D C6    
4841 P P     . DG  D 4   ? 1.0667 0.6839 1.0406 0.0918  0.0971  -0.0113 4   DG  D P     
4842 O OP1   . DG  D 4   ? 1.0989 0.7012 1.0708 0.1032  0.0905  0.0043  4   DG  D OP1   
4843 O OP2   . DG  D 4   ? 1.1193 0.7870 1.1281 0.1058  0.0952  -0.0167 4   DG  D OP2   
4844 O "O5'" . DG  D 4   ? 1.0298 0.6420 0.9771 0.0625  0.0863  -0.0076 4   DG  D "O5'" 
4845 C "C5'" . DG  D 4   ? 1.1401 0.7127 1.0536 0.0448  0.0828  0.0014  4   DG  D "C5'" 
4846 C "C4'" . DG  D 4   ? 1.0785 0.6495 0.9697 0.0160  0.0764  0.0021  4   DG  D "C4'" 
4847 O "O4'" . DG  D 4   ? 1.0972 0.6644 0.9843 0.0057  0.0896  -0.0161 4   DG  D "O4'" 
4848 C "C3'" . DG  D 4   ? 1.0010 0.6158 0.9077 0.0150  0.0594  0.0127  4   DG  D "C3'" 
4849 O "O3'" . DG  D 4   ? 1.0039 0.6047 0.8848 -0.0071 0.0489  0.0263  4   DG  D "O3'" 
4850 C "C2'" . DG  D 4   ? 0.9791 0.6195 0.8993 0.0112  0.0651  -0.0022 4   DG  D "C2'" 
4851 C "C1'" . DG  D 4   ? 1.0957 0.6977 0.9923 -0.0041 0.0814  -0.0165 4   DG  D "C1'" 
4852 N N9    . DG  D 4   ? 1.0791 0.6965 0.9919 0.0009  0.0937  -0.0344 4   DG  D N9    
4853 C C8    . DG  D 4   ? 1.0445 0.6922 0.9907 0.0251  0.0979  -0.0409 4   DG  D C8    
4854 N N7    . DG  D 4   ? 0.9913 0.6476 0.9452 0.0228  0.1093  -0.0565 4   DG  D N7    
4855 C C5    . DG  D 4   ? 1.1319 0.7612 1.0548 -0.0044 0.1132  -0.0610 4   DG  D C5    
4856 C C6    . DG  D 4   ? 1.1527 0.7777 1.0677 -0.0193 0.1247  -0.0760 4   DG  D C6    
4857 O O6    . DG  D 4   ? 1.0069 0.6518 0.9418 -0.0106 0.1342  -0.0887 4   DG  D O6    
4858 N N1    . DG  D 4   ? 1.0333 0.6288 0.9134 -0.0478 0.1241  -0.0744 4   DG  D N1    
4859 C C2    . DG  D 4   ? 1.1551 0.7289 1.0116 -0.0605 0.1136  -0.0596 4   DG  D C2    
4860 N N2    . DG  D 4   ? 1.1571 0.7060 0.9812 -0.0896 0.1141  -0.0590 4   DG  D N2    
4861 N N3    . DG  D 4   ? 1.1902 0.7679 1.0543 -0.0465 0.1029  -0.0453 4   DG  D N3    
4862 C C4    . DG  D 4   ? 1.1552 0.7606 1.0526 -0.0185 0.1035  -0.0473 4   DG  D C4    
4863 P P     . DA  D 5   ? 1.1734 0.8109 1.0620 -0.0141 0.0329  0.0390  5   DA  D P     
4864 O OP1   . DA  D 5   ? 1.1159 0.7383 0.9847 -0.0248 0.0214  0.0589  5   DA  D OP1   
4865 O OP2   . DA  D 5   ? 1.2798 0.9614 1.2028 0.0081  0.0287  0.0366  5   DA  D OP2   
4866 O "O5'" . DA  D 5   ? 1.1979 0.8322 1.0726 -0.0385 0.0378  0.0297  5   DA  D "O5'" 
4867 C "C5'" . DA  D 5   ? 1.2840 0.8778 1.1255 -0.0623 0.0444  0.0274  5   DA  D "C5'" 
4868 C "C4'" . DA  D 5   ? 1.3444 0.9449 1.1782 -0.0838 0.0472  0.0203  5   DA  D "C4'" 
4869 O "O4'" . DA  D 5   ? 1.3685 0.9778 1.2179 -0.0749 0.0603  -0.0002 5   DA  D "O4'" 
4870 C "C3'" . DA  D 5   ? 1.3548 0.9926 1.2017 -0.0878 0.0343  0.0318  5   DA  D "C3'" 
4871 O "O3'" . DA  D 5   ? 1.4958 1.1238 1.3208 -0.1162 0.0330  0.0362  5   DA  D "O3'" 
4872 C "C2'" . DA  D 5   ? 1.1843 0.8552 1.0616 -0.0712 0.0390  0.0172  5   DA  D "C2'" 
4873 C "C1'" . DA  D 5   ? 1.2332 0.8802 1.1020 -0.0754 0.0556  -0.0022 5   DA  D "C1'" 
4874 N N9    . DA  D 5   ? 1.0757 0.7449 0.9726 -0.0545 0.0636  -0.0174 5   DA  D N9    
4875 C C8    . DA  D 5   ? 1.0645 0.7579 0.9887 -0.0281 0.0602  -0.0161 5   DA  D C8    
4876 N N7    . DA  D 5   ? 1.0308 0.7424 0.9768 -0.0152 0.0689  -0.0306 5   DA  D N7    
4877 C C5    . DA  D 5   ? 1.0432 0.7410 0.9753 -0.0339 0.0791  -0.0427 5   DA  D C5    
4878 C C6    . DA  D 5   ? 1.0014 0.7083 0.9446 -0.0328 0.0914  -0.0600 5   DA  D C6    
4879 N N6    . DA  D 5   ? 0.9100 0.6441 0.8830 -0.0114 0.0952  -0.0677 5   DA  D N6    
4880 N N1    . DA  D 5   ? 1.0012 0.6898 0.9238 -0.0555 0.0994  -0.0681 5   DA  D N1    
4881 C C2    . DA  D 5   ? 1.0198 0.6832 0.9126 -0.0782 0.0948  -0.0590 5   DA  D C2    
4882 N N3    . DA  D 5   ? 1.0896 0.7429 0.9698 -0.0820 0.0831  -0.0421 5   DA  D N3    
4883 C C4    . DA  D 5   ? 1.0810 0.7524 0.9824 -0.0584 0.0759  -0.0349 5   DA  D C4    
4884 P P     . DA  D 6   ? 1.4758 1.1322 1.3055 -0.1267 0.0197  0.0537  6   DA  D P     
4885 O OP1   . DA  D 6   ? 1.5098 1.1453 1.3130 -0.1461 0.0116  0.0730  6   DA  D OP1   
4886 O OP2   . DA  D 6   ? 1.3240 1.0176 1.1844 -0.1026 0.0130  0.0565  6   DA  D OP2   
4887 O "O5'" . DA  D 6   ? 1.3852 1.0472 1.2122 -0.1450 0.0264  0.0427  6   DA  D "O5'" 
4888 C "C5'" . DA  D 6   ? 1.2576 0.8874 1.0597 -0.1644 0.0371  0.0316  6   DA  D "C5'" 
4889 C "C4'" . DA  D 6   ? 1.1228 0.7651 0.9347 -0.1686 0.0467  0.0141  6   DA  D "C4'" 
4890 O "O4'" . DA  D 6   ? 1.1222 0.7785 0.9596 -0.1426 0.0541  -0.0020 6   DA  D "O4'" 
4891 C "C3'" . DA  D 6   ? 1.0885 0.7626 0.9132 -0.1771 0.0395  0.0216  6   DA  D "C3'" 
4892 O "O3'" . DA  D 6   ? 1.1516 0.8160 0.9604 -0.2018 0.0460  0.0153  6   DA  D "O3'" 
4893 C "C2'" . DA  D 6   ? 1.0175 0.7239 0.8763 -0.1518 0.0409  0.0105  6   DA  D "C2'" 
4894 C "C1'" . DA  D 6   ? 1.1032 0.7931 0.9636 -0.1389 0.0536  -0.0081 6   DA  D "C1'" 
4895 N N9    . DA  D 6   ? 1.0565 0.7703 0.9465 -0.1101 0.0535  -0.0148 6   DA  D N9    
4896 C C8    . DA  D 6   ? 1.0294 0.7566 0.9326 -0.0911 0.0441  -0.0040 6   DA  D C8    
4897 N N7    . DA  D 6   ? 1.0051 0.7543 0.9341 -0.0683 0.0460  -0.0130 6   DA  D N7    
4898 C C5    . DA  D 6   ? 0.9592 0.7096 0.8931 -0.0720 0.0577  -0.0307 6   DA  D C5    
4899 C C6    . DA  D 6   ? 0.9742 0.7453 0.9325 -0.0559 0.0647  -0.0455 6   DA  D C6    
4900 N N6    . DA  D 6   ? 0.8766 0.6719 0.8592 -0.0324 0.0603  -0.0448 6   DA  D N6    
4901 N N1    . DA  D 6   ? 0.9148 0.6825 0.8716 -0.0656 0.0763  -0.0604 6   DA  D N1    
4902 C C2    . DA  D 6   ? 0.8871 0.6315 0.8185 -0.0902 0.0803  -0.0608 6   DA  D C2    
4903 N N3    . DA  D 6   ? 1.0425 0.7663 0.9491 -0.1081 0.0741  -0.0475 6   DA  D N3    
4904 C C4    . DA  D 6   ? 0.9959 0.7242 0.9057 -0.0974 0.0628  -0.0324 6   DA  D C4    
4905 P P     . DA  D 7   ? 1.0265 0.7154 0.8407 -0.2187 0.0396  0.0256  7   DA  D P     
4906 O OP1   . DA  D 7   ? 1.2142 0.8804 0.9972 -0.2505 0.0398  0.0334  7   DA  D OP1   
4907 O OP2   . DA  D 7   ? 1.0140 0.7307 0.8485 -0.2043 0.0278  0.0414  7   DA  D OP2   
4908 O "O5'" . DA  D 7   ? 0.9632 0.6685 0.7959 -0.2131 0.0495  0.0048  7   DA  D "O5'" 
4909 C "C5'" . DA  D 7   ? 0.9063 0.5926 0.7320 -0.2119 0.0633  -0.0156 7   DA  D "C5'" 
4910 C "C4'" . DA  D 7   ? 0.9784 0.6894 0.8295 -0.2005 0.0701  -0.0324 7   DA  D "C4'" 
4911 O "O4'" . DA  D 7   ? 1.0192 0.7464 0.8956 -0.1708 0.0693  -0.0377 7   DA  D "O4'" 
4912 C "C3'" . DA  D 7   ? 0.9919 0.7314 0.8568 -0.2094 0.0639  -0.0263 7   DA  D "C3'" 
4913 O "O3'" . DA  D 7   ? 1.1006 0.8422 0.9652 -0.2214 0.0737  -0.0409 7   DA  D "O3'" 
4914 C "C2'" . DA  D 7   ? 0.9139 0.6833 0.8096 -0.1832 0.0577  -0.0259 7   DA  D "C2'" 
4915 C "C1'" . DA  D 7   ? 0.9429 0.7048 0.8458 -0.1619 0.0650  -0.0396 7   DA  D "C1'" 
4916 N N9    . DA  D 7   ? 0.8853 0.6641 0.8076 -0.1370 0.0574  -0.0343 7   DA  D N9    
4917 C C8    . DA  D 7   ? 0.9773 0.7564 0.8963 -0.1323 0.0464  -0.0166 7   DA  D C8    
4918 N N7    . DA  D 7   ? 0.9917 0.7884 0.9303 -0.1087 0.0418  -0.0162 7   DA  D N7    
4919 C C5    . DA  D 7   ? 0.9588 0.7680 0.9150 -0.0975 0.0500  -0.0342 7   DA  D C5    
4920 C C6    . DA  D 7   ? 0.9138 0.7453 0.8946 -0.0738 0.0496  -0.0416 7   DA  D C6    
4921 N N6    . DA  D 7   ? 0.8182 0.6626 0.8093 -0.0568 0.0405  -0.0322 7   DA  D N6    
4922 N N1    . DA  D 7   ? 0.8650 0.7066 0.8596 -0.0691 0.0589  -0.0584 7   DA  D N1    
4923 C C2    . DA  D 7   ? 0.9567 0.7858 0.9404 -0.0864 0.0685  -0.0677 7   DA  D C2    
4924 N N3    . DA  D 7   ? 0.9954 0.8026 0.9549 -0.1095 0.0699  -0.0629 7   DA  D N3    
4925 C C4    . DA  D 7   ? 0.9119 0.7103 0.8588 -0.1142 0.0600  -0.0455 7   DA  D C4    
4926 P P     . DT  D 8   ? 1.0434 0.8110 0.9208 -0.2336 0.0703  -0.0376 8   DT  D P     
4927 O OP1   . DT  D 8   ? 1.1364 0.8912 0.9962 -0.2576 0.0793  -0.0459 8   DT  D OP1   
4928 O OP2   . DT  D 8   ? 1.0735 0.8527 0.9537 -0.2365 0.0573  -0.0157 8   DT  D OP2   
4929 O "O5'" . DT  D 8   ? 0.9461 0.7407 0.8551 -0.2107 0.0731  -0.0522 8   DT  D "O5'" 
4930 C "C5'" . DT  D 8   ? 0.8613 0.6514 0.7751 -0.2006 0.0848  -0.0715 8   DT  D "C5'" 
4931 C "C4'" . DT  D 8   ? 0.8279 0.6465 0.7728 -0.1765 0.0837  -0.0800 8   DT  D "C4'" 
4932 O "O4'" . DT  D 8   ? 0.9340 0.7574 0.8870 -0.1575 0.0747  -0.0702 8   DT  D "O4'" 
4933 C "C3'" . DT  D 8   ? 0.8338 0.6805 0.7970 -0.1806 0.0793  -0.0802 8   DT  D "C3'" 
4934 O "O3'" . DT  D 8   ? 0.8501 0.7091 0.8264 -0.1784 0.0886  -0.0975 8   DT  D "O3'" 
4935 C "C2'" . DT  D 8   ? 0.7516 0.6179 0.7333 -0.1605 0.0686  -0.0723 8   DT  D "C2'" 
4936 C "C1'" . DT  D 8   ? 0.8897 0.7435 0.8687 -0.1429 0.0696  -0.0728 8   DT  D "C1'" 
4937 N N1    . DT  D 8   ? 0.8798 0.7400 0.8639 -0.1284 0.0584  -0.0592 8   DT  D N1    
4938 C C2    . DT  D 8   ? 0.8466 0.7258 0.8514 -0.1052 0.0558  -0.0640 8   DT  D C2    
4939 O O2    . DT  D 8   ? 0.9151 0.8075 0.9355 -0.0960 0.0617  -0.0780 8   DT  D O2    
4940 N N3    . DT  D 8   ? 0.8290 0.7128 0.8357 -0.0938 0.0458  -0.0508 8   DT  D N3    
4941 C C4    . DT  D 8   ? 0.8947 0.7671 0.8861 -0.1021 0.0386  -0.0332 8   DT  D C4    
4942 O O4    . DT  D 8   ? 0.9074 0.7864 0.9022 -0.0902 0.0302  -0.0219 8   DT  D O4    
4943 C C5    . DT  D 8   ? 0.9003 0.7541 0.8715 -0.1265 0.0414  -0.0280 8   DT  D C5    
4944 C C7    . DT  D 8   ? 0.7472 0.5903 0.7020 -0.1381 0.0337  -0.0072 8   DT  D C7    
4945 C C6    . DT  D 8   ? 0.9164 0.7646 0.8843 -0.1387 0.0510  -0.0414 8   DT  D C6    
4946 P P     . DT  D 9   ? 0.8638 0.7495 0.8580 -0.1850 0.0868  -0.1017 9   DT  D P     
4947 O OP1   . DT  D 9   ? 0.9257 0.8115 0.9196 -0.1942 0.0989  -0.1169 9   DT  D OP1   
4948 O OP2   . DT  D 9   ? 0.9863 0.8723 0.9735 -0.1995 0.0779  -0.0856 9   DT  D OP2   
4949 O "O5'" . DT  D 9   ? 0.8794 0.7907 0.9004 -0.1604 0.0818  -0.1063 9   DT  D "O5'" 
4950 C "C5'" . DT  D 9   ? 0.8401 0.7559 0.8722 -0.1425 0.0882  -0.1177 9   DT  D "C5'" 
4951 C "C4'" . DT  D 9   ? 0.7968 0.7368 0.8512 -0.1212 0.0803  -0.1174 9   DT  D "C4'" 
4952 O "O4'" . DT  D 9   ? 0.8080 0.7403 0.8557 -0.1135 0.0709  -0.1033 9   DT  D "O4'" 
4953 C "C3'" . DT  D 9   ? 0.7080 0.6736 0.7788 -0.1243 0.0749  -0.1200 9   DT  D "C3'" 
4954 O "O3'" . DT  D 9   ? 0.8183 0.8071 0.9107 -0.1108 0.0775  -0.1318 9   DT  D "O3'" 
4955 C "C2'" . DT  D 9   ? 0.6935 0.6620 0.7638 -0.1182 0.0629  -0.1065 9   DT  D "C2'" 
4956 C "C1'" . DT  D 9   ? 0.7307 0.6854 0.7936 -0.1044 0.0616  -0.1001 9   DT  D "C1'" 
4957 N N1    . DT  D 9   ? 0.8397 0.7849 0.8914 -0.1042 0.0524  -0.0833 9   DT  D N1    
4958 C C2    . DT  D 9   ? 0.8446 0.7985 0.9038 -0.0855 0.0451  -0.0777 9   DT  D C2    
4959 O O2    . DT  D 9   ? 0.8217 0.7917 0.8966 -0.0695 0.0450  -0.0855 9   DT  D O2    
4960 N N3    . DT  D 9   ? 0.7579 0.7031 0.8060 -0.0865 0.0376  -0.0616 9   DT  D N3    
4961 C C4    . DT  D 9   ? 0.7250 0.6550 0.7567 -0.1041 0.0365  -0.0496 9   DT  D C4    
4962 O O4    . DT  D 9   ? 0.6809 0.6062 0.7049 -0.1032 0.0298  -0.0340 9   DT  D O4    
4963 C C5    . DT  D 9   ? 0.7541 0.6759 0.7786 -0.1239 0.0439  -0.0558 9   DT  D C5    
4964 C C7    . DT  D 9   ? 0.7168 0.6244 0.7241 -0.1452 0.0428  -0.0424 9   DT  D C7    
4965 C C6    . DT  D 9   ? 0.8222 0.7513 0.8564 -0.1229 0.0516  -0.0726 9   DT  D C6    
4966 P P     . DC  D 10  ? 0.9132 0.9308 1.0249 -0.1110 0.0721  -0.1372 10  DC  D P     
4967 O OP1   . DC  D 10  ? 0.8471 0.8832 0.9757 -0.1054 0.0794  -0.1504 10  DC  D OP1   
4968 O OP2   . DC  D 10  ? 0.8598 0.8725 0.9632 -0.1301 0.0694  -0.1322 10  DC  D OP2   
4969 O "O5'" . DC  D 10  ? 0.8844 0.9134 1.0043 -0.0929 0.0613  -0.1306 10  DC  D "O5'" 
4970 C "C5'" . DC  D 10  ? 0.7465 0.7784 0.8727 -0.0738 0.0615  -0.1304 10  DC  D "C5'" 
4971 C "C4'" . DC  D 10  ? 0.7186 0.7638 0.8517 -0.0596 0.0503  -0.1239 10  DC  D "C4'" 
4972 O "O4'" . DC  D 10  ? 0.7872 0.8133 0.9035 -0.0614 0.0448  -0.1103 10  DC  D "O4'" 
4973 C "C3'" . DC  D 10  ? 0.6965 0.7638 0.8407 -0.0625 0.0440  -0.1281 10  DC  D "C3'" 
4974 O "O3'" . DC  D 10  ? 0.7774 0.8668 0.9362 -0.0459 0.0381  -0.1298 10  DC  D "O3'" 
4975 C "C2'" . DC  D 10  ? 0.7233 0.7769 0.8532 -0.0704 0.0381  -0.1173 10  DC  D "C2'" 
4976 C "C1'" . DC  D 10  ? 0.7389 0.7750 0.8569 -0.0618 0.0364  -0.1057 10  DC  D "C1'" 
4977 N N1    . DC  D 10  ? 0.8019 0.8176 0.9022 -0.0727 0.0343  -0.0927 10  DC  D N1    
4978 C C2    . DC  D 10  ? 0.8387 0.8515 0.9332 -0.0640 0.0266  -0.0801 10  DC  D C2    
4979 O O2    . DC  D 10  ? 0.8315 0.8579 0.9345 -0.0479 0.0215  -0.0806 10  DC  D O2    
4980 N N3    . DC  D 10  ? 0.8875 0.8842 0.9675 -0.0738 0.0249  -0.0665 10  DC  D N3    
4981 C C4    . DC  D 10  ? 0.8471 0.8312 0.9182 -0.0923 0.0300  -0.0652 10  DC  D C4    
4982 N N4    . DC  D 10  ? 0.7968 0.7678 0.8549 -0.1019 0.0276  -0.0498 10  DC  D N4    
4983 C C5    . DC  D 10  ? 0.7901 0.7760 0.8656 -0.1019 0.0377  -0.0788 10  DC  D C5    
4984 C C6    . DC  D 10  ? 0.8439 0.8457 0.9342 -0.0913 0.0399  -0.0922 10  DC  D C6    
4985 P P     . DC  D 11  ? 0.7929 0.9100 0.9664 -0.0472 0.0329  -0.1381 11  DC  D P     
4986 O OP1   . DC  D 11  ? 0.8465 0.9873 1.0367 -0.0307 0.0301  -0.1405 11  DC  D OP1   
4987 O OP2   . DC  D 11  ? 0.7637 0.8822 0.9393 -0.0641 0.0387  -0.1466 11  DC  D OP2   
4988 O "O5'" . DC  D 11  ? 0.7517 0.8635 0.9148 -0.0483 0.0240  -0.1307 11  DC  D "O5'" 
4989 C "C5'" . DC  D 11  ? 0.6721 0.7823 0.8309 -0.0341 0.0175  -0.1214 11  DC  D "C5'" 
4990 C "C4'" . DC  D 11  ? 0.6942 0.7986 0.8425 -0.0370 0.0114  -0.1154 11  DC  D "C4'" 
4991 O "O4'" . DC  D 11  ? 0.7211 0.8007 0.8539 -0.0445 0.0137  -0.1046 11  DC  D "O4'" 
4992 C "C3'" . DC  D 11  ? 0.6858 0.7983 0.8371 -0.0486 0.0107  -0.1239 11  DC  D "C3'" 
4993 O "O3'" . DC  D 11  ? 0.7961 0.9129 0.9429 -0.0430 0.0038  -0.1215 11  DC  D "O3'" 
4994 C "C2'" . DC  D 11  ? 0.6616 0.7531 0.8024 -0.0640 0.0161  -0.1195 11  DC  D "C2'" 
4995 C "C1'" . DC  D 11  ? 0.6582 0.7327 0.7863 -0.0573 0.0142  -0.1048 11  DC  D "C1'" 
4996 N N1    . DC  D 11  ? 0.7852 0.8385 0.9018 -0.0701 0.0190  -0.0962 11  DC  D N1    
4997 C C2    . DC  D 11  ? 0.7836 0.8221 0.8877 -0.0679 0.0164  -0.0808 11  DC  D C2    
4998 O O2    . DC  D 11  ? 0.7681 0.8109 0.8709 -0.0546 0.0108  -0.0751 11  DC  D O2    
4999 N N3    . DC  D 11  ? 0.7915 0.8127 0.8851 -0.0812 0.0199  -0.0716 11  DC  D N3    
5000 C C4    . DC  D 11  ? 0.6987 0.7164 0.7930 -0.0962 0.0260  -0.0781 11  DC  D C4    
5001 N N4    . DC  D 11  ? 0.8224 0.8241 0.9052 -0.1104 0.0287  -0.0680 11  DC  D N4    
5002 C C5    . DC  D 11  ? 0.6627 0.6949 0.7696 -0.0979 0.0293  -0.0944 11  DC  D C5    
5003 C C6    . DC  D 11  ? 0.8795 0.9295 0.9976 -0.0847 0.0255  -0.1026 11  DC  D C6    
5004 P P     . DA  D 12  ? 0.7187 0.8605 0.8753 -0.0393 -0.0020 -0.1319 12  DA  D P     
5005 O OP1   . DA  D 12  ? 0.6755 0.8366 0.8456 -0.0279 -0.0035 -0.1338 12  DA  D OP1   
5006 O OP2   . DA  D 12  ? 0.7807 0.9247 0.9397 -0.0546 0.0003  -0.1416 12  DA  D OP2   
5007 O "O5'" . DA  D 12  ? 0.6971 0.8351 0.8420 -0.0311 -0.0083 -0.1254 12  DA  D "O5'" 
5008 C "C5'" . DA  D 12  ? 0.6873 0.8269 0.8296 -0.0160 -0.0125 -0.1159 12  DA  D "C5'" 
5009 C "C4'" . DA  D 12  ? 0.7121 0.8339 0.8387 -0.0128 -0.0136 -0.1044 12  DA  D "C4'" 
5010 O "O4'" . DA  D 12  ? 0.8151 0.9152 0.9349 -0.0214 -0.0077 -0.0966 12  DA  D "O4'" 
5011 C "C3'" . DA  D 12  ? 0.7004 0.8204 0.8184 -0.0163 -0.0152 -0.1082 12  DA  D "C3'" 
5012 O "O3'" . DA  D 12  ? 0.8370 0.9507 0.9438 -0.0057 -0.0182 -0.0973 12  DA  D "O3'" 
5013 C "C2'" . DA  D 12  ? 0.6493 0.7515 0.7635 -0.0309 -0.0084 -0.1081 12  DA  D "C2'" 
5014 C "C1'" . DA  D 12  ? 0.7229 0.8116 0.8348 -0.0303 -0.0053 -0.0957 12  DA  D "C1'" 
5015 N N9    . DA  D 12  ? 0.7669 0.8445 0.8800 -0.0452 0.0011  -0.0963 12  DA  D N9    
5016 C C8    . DA  D 12  ? 0.6884 0.7732 0.8106 -0.0560 0.0042  -0.1084 12  DA  D C8    
5017 N N7    . DA  D 12  ? 0.7019 0.7742 0.8223 -0.0688 0.0098  -0.1054 12  DA  D N7    
5018 C C5    . DA  D 12  ? 0.7023 0.7586 0.8117 -0.0667 0.0100  -0.0899 12  DA  D C5    
5019 C C6    . DA  D 12  ? 0.7907 0.8305 0.8930 -0.0775 0.0141  -0.0786 12  DA  D C6    
5020 N N6    . DA  D 12  ? 0.6644 0.7003 0.7689 -0.0930 0.0192  -0.0823 12  DA  D N6    
5021 N N1    . DA  D 12  ? 0.8408 0.8699 0.9336 -0.0724 0.0124  -0.0624 12  DA  D N1    
5022 C C2    . DA  D 12  ? 0.7431 0.7771 0.8335 -0.0570 0.0075  -0.0585 12  DA  D C2    
5023 N N3    . DA  D 12  ? 0.7258 0.7744 0.8215 -0.0459 0.0035  -0.0685 12  DA  D N3    
5024 C C4    . DA  D 12  ? 0.6685 0.7279 0.7737 -0.0518 0.0048  -0.0840 12  DA  D C4    
5025 P P     . DT  D 13  ? 0.8276 0.9420 0.9235 -0.0031 -0.0206 -0.1007 13  DT  D P     
5026 O OP1   . DT  D 13  ? 0.9898 1.1130 1.0816 0.0117  -0.0266 -0.0931 13  DT  D OP1   
5027 O OP2   . DT  D 13  ? 0.8604 0.9848 0.9602 -0.0128 -0.0213 -0.1166 13  DT  D OP2   
5028 O "O5'" . DT  D 13  ? 0.8165 0.9067 0.9010 -0.0077 -0.0143 -0.0911 13  DT  D "O5'" 
5029 C "C5'" . DT  D 13  ? 0.7559 0.8352 0.8358 -0.0017 -0.0132 -0.0742 13  DT  D "C5'" 
5030 C "C4'" . DT  D 13  ? 0.7116 0.7713 0.7853 -0.0097 -0.0064 -0.0653 13  DT  D "C4'" 
5031 O "O4'" . DT  D 13  ? 0.6588 0.7132 0.7396 -0.0233 -0.0025 -0.0678 13  DT  D "O4'" 
5032 C "C3'" . DT  D 13  ? 0.6338 0.6860 0.7003 -0.0125 -0.0025 -0.0711 13  DT  D "C3'" 
5033 O "O3'" . DT  D 13  ? 0.6900 0.7326 0.7460 -0.0033 -0.0004 -0.0576 13  DT  D "O3'" 
5034 C "C2'" . DT  D 13  ? 0.6325 0.6737 0.7035 -0.0282 0.0036  -0.0736 13  DT  D "C2'" 
5035 C "C1'" . DT  D 13  ? 0.6218 0.6625 0.6990 -0.0325 0.0035  -0.0650 13  DT  D "C1'" 
5036 N N1    . DT  D 13  ? 0.6710 0.7106 0.7562 -0.0480 0.0068  -0.0728 13  DT  D N1    
5037 C C2    . DT  D 13  ? 0.6924 0.7204 0.7773 -0.0579 0.0111  -0.0616 13  DT  D C2    
5038 O O2    . DT  D 13  ? 0.6951 0.7140 0.7739 -0.0551 0.0119  -0.0448 13  DT  D O2    
5039 N N3    . DT  D 13  ? 0.7228 0.7516 0.8146 -0.0722 0.0141  -0.0699 13  DT  D N3    
5040 C C4    . DT  D 13  ? 0.7962 0.8367 0.8960 -0.0769 0.0134  -0.0875 13  DT  D C4    
5041 O O4    . DT  D 13  ? 0.7676 0.8088 0.8734 -0.0899 0.0165  -0.0934 13  DT  D O4    
5042 C C5    . DT  D 13  ? 0.7318 0.7852 0.8324 -0.0662 0.0084  -0.0977 13  DT  D C5    
5043 C C7    . DT  D 13  ? 0.6194 0.6887 0.7292 -0.0712 0.0065  -0.1151 13  DT  D C7    
5044 C C6    . DT  D 13  ? 0.6925 0.7446 0.7854 -0.0527 0.0054  -0.0901 13  DT  D C6    
5045 P P     . DG  D 14  ? 0.8402 0.8746 0.8847 0.0001  0.0037  -0.0624 14  DG  D P     
5046 O OP1   . DG  D 14  ? 1.0407 1.0764 1.0759 0.0150  0.0022  -0.0511 14  DG  D OP1   
5047 O OP2   . DG  D 14  ? 0.8689 0.9108 0.9141 -0.0063 0.0015  -0.0828 14  DG  D OP2   
5048 O "O5'" . DG  D 14  ? 0.7227 0.7380 0.7669 -0.0084 0.0128  -0.0538 14  DG  D "O5'" 
5049 C "C5'" . DG  D 14  ? 0.6457 0.6552 0.6932 -0.0094 0.0149  -0.0346 14  DG  D "C5'" 
5050 C "C4'" . DG  D 14  ? 0.6981 0.6943 0.7496 -0.0221 0.0221  -0.0303 14  DG  D "C4'" 
5051 O "O4'" . DG  D 14  ? 0.6912 0.6922 0.7518 -0.0359 0.0204  -0.0417 14  DG  D "O4'" 
5052 C "C3'" . DG  D 14  ? 0.7292 0.7126 0.7750 -0.0224 0.0295  -0.0363 14  DG  D "C3'" 
5053 O "O3'" . DG  D 14  ? 0.7847 0.7552 0.8309 -0.0230 0.0372  -0.0181 14  DG  D "O3'" 
5054 C "C2'" . DG  D 14  ? 0.6634 0.6477 0.7152 -0.0368 0.0293  -0.0544 14  DG  D "C2'" 
5055 C "C1'" . DG  D 14  ? 0.7475 0.7391 0.8096 -0.0461 0.0261  -0.0492 14  DG  D "C1'" 
5056 N N9    . DG  D 14  ? 0.8202 0.8209 0.8900 -0.0572 0.0232  -0.0664 14  DG  D N9    
5057 C C8    . DG  D 14  ? 0.7700 0.7818 0.8400 -0.0561 0.0187  -0.0846 14  DG  D C8    
5058 N N7    . DG  D 14  ? 0.6447 0.6651 0.7240 -0.0674 0.0173  -0.0957 14  DG  D N7    
5059 C C5    . DG  D 14  ? 0.7723 0.7855 0.8565 -0.0768 0.0212  -0.0851 14  DG  D C5    
5060 C C6    . DG  D 14  ? 0.7348 0.7519 0.8280 -0.0910 0.0224  -0.0899 14  DG  D C6    
5061 O O6    . DG  D 14  ? 0.7367 0.7657 0.8371 -0.0974 0.0204  -0.1045 14  DG  D O6    
5062 N N1    . DG  D 14  ? 0.6782 0.6855 0.7719 -0.0985 0.0263  -0.0748 14  DG  D N1    
5063 C C2    . DG  D 14  ? 0.6978 0.6943 0.7853 -0.0928 0.0286  -0.0562 14  DG  D C2    
5064 N N2    . DG  D 14  ? 0.7243 0.7146 0.8134 -0.1031 0.0315  -0.0421 14  DG  D N2    
5065 N N3    . DG  D 14  ? 0.7806 0.7741 0.8610 -0.0786 0.0280  -0.0510 14  DG  D N3    
5066 C C4    . DG  D 14  ? 0.8390 0.8404 0.9174 -0.0713 0.0244  -0.0667 14  DG  D C4    
5067 P P     . DA  D 15  ? 0.9527 0.9066 0.9909 -0.0167 0.0471  -0.0165 15  DA  D P     
5068 O OP1   . DA  D 15  ? 0.9166 0.8692 0.9497 -0.0023 0.0500  0.0031  15  DA  D OP1   
5069 O OP2   . DA  D 15  ? 0.9212 0.8731 0.9517 -0.0172 0.0464  -0.0398 15  DA  D OP2   
5070 O "O5'" . DA  D 15  ? 0.8765 0.8186 0.9233 -0.0298 0.0543  -0.0094 15  DA  D "O5'" 
5071 C "C5'" . DA  D 15  ? 0.7672 0.7119 0.8228 -0.0360 0.0544  0.0110  15  DA  D "C5'" 
5072 C "C4'" . DA  D 15  ? 0.7805 0.7171 0.8445 -0.0516 0.0595  0.0116  15  DA  D "C4'" 
5073 O "O4'" . DA  D 15  ? 0.7327 0.6771 0.8012 -0.0646 0.0536  -0.0065 15  DA  D "O4'" 
5074 C "C3'" . DA  D 15  ? 0.7612 0.6805 0.8223 -0.0501 0.0691  0.0060  15  DA  D "C3'" 
5075 O "O3'" . DA  D 15  ? 0.8382 0.7494 0.9084 -0.0587 0.0760  0.0217  15  DA  D "O3'" 
5076 C "C2'" . DA  D 15  ? 0.7790 0.6994 0.8382 -0.0588 0.0653  -0.0208 15  DA  D "C2'" 
5077 C "C1'" . DA  D 15  ? 0.7841 0.7195 0.8528 -0.0715 0.0576  -0.0222 15  DA  D "C1'" 
5078 N N9    . DA  D 15  ? 0.7635 0.7097 0.8317 -0.0758 0.0506  -0.0449 15  DA  D N9    
5079 C C8    . DA  D 15  ? 0.7112 0.6605 0.7709 -0.0677 0.0475  -0.0609 15  DA  D C8    
5080 N N7    . DA  D 15  ? 0.6792 0.6415 0.7425 -0.0746 0.0410  -0.0778 15  DA  D N7    
5081 C C5    . DA  D 15  ? 0.7874 0.7543 0.8618 -0.0875 0.0406  -0.0736 15  DA  D C5    
5082 C C6    . DA  D 15  ? 0.7813 0.7614 0.8643 -0.0989 0.0363  -0.0851 15  DA  D C6    
5083 N N6    . DA  D 15  ? 0.7266 0.7201 0.8106 -0.0986 0.0307  -0.1025 15  DA  D N6    
5084 N N1    . DA  D 15  ? 0.7027 0.6830 0.7936 -0.1108 0.0381  -0.0770 15  DA  D N1    
5085 C C2    . DA  D 15  ? 0.6466 0.6158 0.7372 -0.1121 0.0430  -0.0579 15  DA  D C2    
5086 N N3    . DA  D 15  ? 0.7609 0.7189 0.8457 -0.1018 0.0472  -0.0443 15  DA  D N3    
5087 C C4    . DA  D 15  ? 0.8092 0.7659 0.8858 -0.0892 0.0462  -0.0537 15  DA  D C4    
5088 P P     . DC  D 16  ? 0.8919 0.7820 0.9606 -0.0540 0.0888  0.0250  16  DC  D P     
5089 O OP1   . DC  D 16  ? 0.9532 0.8414 1.0266 -0.0454 0.0955  0.0536  16  DC  D OP1   
5090 O OP2   . DC  D 16  ? 0.7290 0.6096 0.7839 -0.0453 0.0905  0.0038  16  DC  D OP2   
5091 O "O5'" . DC  D 16  ? 0.9047 0.7894 0.9830 -0.0729 0.0906  0.0195  16  DC  D "O5'" 
5092 C "C5'" . DC  D 16  ? 0.7743 0.6644 0.8653 -0.0844 0.0911  0.0393  16  DC  D "C5'" 
5093 C "C4'" . DC  D 16  ? 0.6965 0.5904 0.7944 -0.1042 0.0873  0.0264  16  DC  D "C4'" 
5094 O "O4'" . DC  D 16  ? 0.7011 0.6085 0.7948 -0.1072 0.0774  0.0073  16  DC  D "O4'" 
5095 C "C3'" . DC  D 16  ? 0.7107 0.5884 0.8080 -0.1095 0.0934  0.0113  16  DC  D "C3'" 
5096 O "O3'" . DC  D 16  ? 0.8074 0.6749 0.9145 -0.1152 0.1019  0.0292  16  DC  D "O3'" 
5097 C "C2'" . DC  D 16  ? 0.7020 0.5910 0.8020 -0.1254 0.0853  -0.0088 16  DC  D "C2'" 
5098 C "C1'" . DC  D 16  ? 0.6855 0.5929 0.7823 -0.1210 0.0758  -0.0118 16  DC  D "C1'" 
5099 N N1    . DC  D 16  ? 0.7981 0.7106 0.8867 -0.1157 0.0702  -0.0355 16  DC  D N1    
5100 C C2    . DC  D 16  ? 0.7771 0.7056 0.8694 -0.1250 0.0623  -0.0499 16  DC  D C2    
5101 O O2    . DC  D 16  ? 0.7465 0.6827 0.8470 -0.1375 0.0608  -0.0440 16  DC  D O2    
5102 N N3    . DC  D 16  ? 0.7927 0.7285 0.8792 -0.1202 0.0570  -0.0694 16  DC  D N3    
5103 C C4    . DC  D 16  ? 0.6978 0.6247 0.7734 -0.1081 0.0588  -0.0754 16  DC  D C4    
5104 N N4    . DC  D 16  ? 0.7018 0.6383 0.7719 -0.1052 0.0526  -0.0936 16  DC  D N4    
5105 C C5    . DC  D 16  ? 0.7109 0.6193 0.7805 -0.0985 0.0675  -0.0624 16  DC  D C5    
5106 C C6    . DC  D 16  ? 0.8021 0.7043 0.8796 -0.1021 0.0731  -0.0423 16  DC  D C6    
5107 P P     . DA  D 17  ? 0.8998 0.7469 1.0050 -0.1000 0.1150  0.0430  17  DA  D P     
5108 O OP1   . DA  D 17  ? 0.8383 0.6712 0.9524 -0.1102 0.1229  0.0472  17  DA  D OP1   
5109 O OP2   . DA  D 17  ? 0.9699 0.8261 1.0774 -0.0884 0.1157  0.0679  17  DA  D OP2   
5110 O "O5'" . DA  D 17  ? 1.0153 0.8496 1.1033 -0.0874 0.1166  0.0196  17  DA  D "O5'" 
5111 C "C5'" . DA  D 17  ? 1.0776 0.9016 1.1567 -0.0675 0.1243  0.0277  17  DA  D "C5'" 
5112 C "C4'" . DA  D 17  ? 1.0365 0.8385 1.0995 -0.0612 0.1305  0.0058  17  DA  D "C4'" 
5113 O "O4'" . DA  D 17  ? 1.0562 0.8347 1.1225 -0.0653 0.1421  0.0080  17  DA  D "O4'" 
5114 C "C3'" . DA  D 17  ? 1.0380 0.8453 1.0923 -0.0715 0.1205  -0.0236 17  DA  D "C3'" 
5115 O "O3'" . DA  D 17  ? 0.9954 0.8136 1.0379 -0.0607 0.1140  -0.0325 17  DA  D "O3'" 
5116 C "C2'" . DA  D 17  ? 1.1007 0.8803 1.1451 -0.0750 0.1293  -0.0394 17  DA  D "C2'" 
5117 C "C1'" . DA  D 17  ? 1.1982 0.9577 1.2478 -0.0656 0.1446  -0.0174 17  DA  D "C1'" 
5118 N N9    . DA  D 17  ? 1.3333 1.0704 1.3864 -0.0758 0.1529  -0.0207 17  DA  D N9    
5119 C C8    . DA  D 17  ? 1.3805 1.0881 1.4182 -0.0746 0.1617  -0.0374 17  DA  D C8    
5120 N N7    . DA  D 17  ? 1.3272 1.0179 1.3721 -0.0856 0.1680  -0.0362 17  DA  D N7    
5121 C C5    . DA  D 17  ? 1.2684 0.9807 1.3355 -0.0947 0.1629  -0.0171 17  DA  D C5    
5122 C C6    . DA  D 17  ? 1.2816 0.9920 1.3657 -0.1087 0.1652  -0.0059 17  DA  D C6    
5123 N N6    . DA  D 17  ? 1.2709 0.9548 1.3533 -0.1154 0.1738  -0.0126 17  DA  D N6    
5124 N N1    . DA  D 17  ? 1.2759 1.0121 1.3779 -0.1164 0.1584  0.0125  17  DA  D N1    
5125 C C2    . DA  D 17  ? 1.2125 0.9726 1.3148 -0.1103 0.1500  0.0188  17  DA  D C2    
5126 N N3    . DA  D 17  ? 1.1232 0.8873 1.2116 -0.0967 0.1470  0.0101  17  DA  D N3    
5127 C C4    . DA  D 17  ? 1.1983 0.9384 1.2697 -0.0893 0.1537  -0.0077 17  DA  D C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -2  ?   ?   ?   A . n 
A 1 2   PRO 2   -1  ?   ?   ?   A . n 
A 1 3   GLY 3   0   ?   ?   ?   A . n 
A 1 4   CYS 4   1   ?   ?   ?   A . n 
A 1 5   ASN 5   2   ?   ?   ?   A . n 
A 1 6   THR 6   3   ?   ?   ?   A . n 
A 1 7   LYS 7   4   ?   ?   ?   A . n 
A 1 8   LYS 8   5   ?   ?   ?   A . n 
A 1 9   PRO 9   6   ?   ?   ?   A . n 
A 1 10  ASN 10  7   ?   ?   ?   A . n 
A 1 11  LEU 11  8   ?   ?   ?   A . n 
A 1 12  ASP 12  9   9   ASP ASP A . n 
A 1 13  ALA 13  10  10  ALA ALA A . n 
A 1 14  GLU 14  11  11  GLU GLU A . n 
A 1 15  LEU 15  12  12  LEU LEU A . n 
A 1 16  ASP 16  13  13  ASP ASP A . n 
A 1 17  GLN 17  14  14  GLN GLN A . n 
A 1 18  LEU 18  15  15  LEU LEU A . n 
A 1 19  LEU 19  16  16  LEU LEU A . n 
A 1 20  GLN 20  17  17  GLN GLN A . n 
A 1 21  GLY 21  18  18  GLY GLY A . n 
A 1 22  HIS 22  19  19  HIS HIS A . n 
A 1 23  TYR 23  20  20  TYR TYR A . n 
A 1 24  ILE 24  21  21  ILE ILE A . n 
A 1 25  LYS 25  22  22  LYS LYS A . n 
A 1 26  GLY 26  23  23  GLY GLY A . n 
A 1 27  TYR 27  24  24  TYR TYR A . n 
A 1 28  PRO 28  25  25  PRO PRO A . n 
A 1 29  LYS 29  26  26  LYS LYS A . n 
A 1 30  GLN 30  27  27  GLN GLN A . n 
A 1 31  TYR 31  28  28  TYR TYR A . n 
A 1 32  THR 32  29  29  THR THR A . n 
A 1 33  TYR 33  30  30  TYR TYR A . n 
A 1 34  PHE 34  31  31  PHE PHE A . n 
A 1 35  LEU 35  32  32  LEU LEU A . n 
A 1 36  GLU 36  33  33  GLU GLU A . n 
A 1 37  ASP 37  34  34  ASP ASP A . n 
A 1 38  GLY 38  35  35  GLY GLY A . n 
A 1 39  LYS 39  36  36  LYS LYS A . n 
A 1 40  VAL 40  37  37  VAL VAL A . n 
A 1 41  LYS 41  38  38  LYS LYS A . n 
A 1 42  VAL 42  39  39  VAL VAL A . n 
A 1 43  SER 43  40  40  SER SER A . n 
A 1 44  ARG 44  41  41  ARG ARG A . n 
A 1 45  PRO 45  42  42  PRO PRO A . n 
A 1 46  GLU 46  43  43  GLU GLU A . n 
A 1 47  GLY 47  44  44  GLY GLY A . n 
A 1 48  VAL 48  45  45  VAL VAL A . n 
A 1 49  LYS 49  46  46  LYS LYS A . n 
A 1 50  ILE 50  47  47  ILE ILE A . n 
A 1 51  ILE 51  48  48  ILE ILE A . n 
A 1 52  PRO 52  49  49  PRO PRO A . n 
A 1 53  PRO 53  50  50  PRO PRO A . n 
A 1 54  GLN 54  51  51  GLN GLN A . n 
A 1 55  SER 55  52  52  SER SER A . n 
A 1 56  ASP 56  53  53  ASP ASP A . n 
A 1 57  ARG 57  54  54  ARG ARG A . n 
A 1 58  GLN 58  55  55  GLN GLN A . n 
A 1 59  LYS 59  56  56  LYS LYS A . n 
A 1 60  ILE 60  57  57  ILE ILE A . n 
A 1 61  VAL 61  58  58  VAL VAL A . n 
A 1 62  LEU 62  59  59  LEU LEU A . n 
A 1 63  GLN 63  60  60  GLN GLN A . n 
A 1 64  ALA 64  61  61  ALA ALA A . n 
A 1 65  HIS 65  62  62  HIS HIS A . n 
A 1 66  ASN 66  63  63  ASN ASN A . n 
A 1 67  LEU 67  64  64  LEU LEU A . n 
A 1 68  ALA 68  65  65  ALA ALA A . n 
A 1 69  HIS 69  66  66  HIS HIS A . n 
A 1 70  THR 70  67  67  THR THR A . n 
A 1 71  GLY 71  68  68  GLY GLY A . n 
A 1 72  ARG 72  69  69  ARG ARG A . n 
A 1 73  GLU 73  70  70  GLU GLU A . n 
A 1 74  ALA 74  71  71  ALA ALA A . n 
A 1 75  THR 75  72  72  THR THR A . n 
A 1 76  LEU 76  73  73  LEU LEU A . n 
A 1 77  LEU 77  74  74  LEU LEU A . n 
A 1 78  LYS 78  75  75  LYS LYS A . n 
A 1 79  ILE 79  76  76  ILE ILE A . n 
A 1 80  ALA 80  77  77  ALA ALA A . n 
A 1 81  ASN 81  78  78  ASN ASN A . n 
A 1 82  LEU 82  79  79  LEU LEU A . n 
A 1 83  TYR 83  80  80  TYR TYR A . n 
A 1 84  TRP 84  81  81  TRP TRP A . n 
A 1 85  TRP 85  82  82  TRP TRP A . n 
A 1 86  PRO 86  83  83  PRO PRO A . n 
A 1 87  ASN 87  84  84  ASN ASN A . n 
A 1 88  MET 88  85  85  MET MET A . n 
A 1 89  ARG 89  86  86  ARG ARG A . n 
A 1 90  LYS 90  87  87  LYS LYS A . n 
A 1 91  ASP 91  88  88  ASP ASP A . n 
A 1 92  VAL 92  89  89  VAL VAL A . n 
A 1 93  VAL 93  90  90  VAL VAL A . n 
A 1 94  LYS 94  91  91  LYS LYS A . n 
A 1 95  GLN 95  92  92  GLN GLN A . n 
A 1 96  LEU 96  93  93  LEU LEU A . n 
A 1 97  GLY 97  94  94  GLY GLY A . n 
A 1 98  ARG 98  95  95  ARG ARG A . n 
A 1 99  CYS 99  96  96  CYS CYS A . n 
A 1 100 GLN 100 97  97  GLN GLN A . n 
A 1 101 GLN 101 98  98  GLN GLN A . n 
A 1 102 CYS 102 99  99  CYS CYS A . n 
A 1 103 LEU 103 100 100 LEU LEU A . n 
A 1 104 ILE 104 101 101 ILE ILE A . n 
A 1 105 THR 105 102 102 THR THR A . n 
A 1 106 ASN 106 103 103 ASN ASN A . n 
A 1 107 ALA 107 104 104 ALA ALA A . n 
A 1 108 SER 108 105 105 SER SER A . n 
A 1 109 ASN 109 106 106 ASN ASN A . n 
A 1 110 LYS 110 107 107 LYS LYS A . n 
A 1 111 ALA 111 108 108 ALA ALA A . n 
A 1 112 SER 112 109 109 SER SER A . n 
A 1 113 GLY 113 110 110 GLY GLY A . n 
A 1 114 PRO 114 111 111 PRO PRO A . n 
A 1 115 ILE 115 112 112 ILE ILE A . n 
A 1 116 LEU 116 113 113 LEU LEU A . n 
A 1 117 ARG 117 114 114 ARG ARG A . n 
A 1 118 PRO 118 115 115 PRO PRO A . n 
A 1 119 ASP 119 116 116 ASP ASP A . n 
A 1 120 ARG 120 117 117 ARG ARG A . n 
A 1 121 PRO 121 118 118 PRO PRO A . n 
A 1 122 GLN 122 119 119 GLN GLN A . n 
A 1 123 LYS 123 120 120 LYS LYS A . n 
A 1 124 PRO 124 121 121 PRO PRO A . n 
A 1 125 PHE 125 122 122 PHE PHE A . n 
A 1 126 ASP 126 123 123 ASP ASP A . n 
A 1 127 LYS 127 124 124 LYS LYS A . n 
A 1 128 PHE 128 125 125 PHE PHE A . n 
A 1 129 PHE 129 126 126 PHE PHE A . n 
A 1 130 ILE 130 127 127 ILE ILE A . n 
A 1 131 ASP 131 128 128 ASP ASP A . n 
A 1 132 TYR 132 129 129 TYR TYR A . n 
A 1 133 ILE 133 130 130 ILE ILE A . n 
A 1 134 GLY 134 131 131 GLY GLY A . n 
A 1 135 PRO 135 132 132 PRO PRO A . n 
A 1 136 LEU 136 133 133 LEU LEU A . n 
A 1 137 PRO 137 134 134 PRO PRO A . n 
A 1 138 PRO 138 135 135 PRO PRO A . n 
A 1 139 SER 139 136 136 SER SER A . n 
A 1 140 GLN 140 137 137 GLN GLN A . n 
A 1 141 GLY 141 138 138 GLY GLY A . n 
A 1 142 TYR 142 139 139 TYR TYR A . n 
A 1 143 LEU 143 140 140 LEU LEU A . n 
A 1 144 TYR 144 141 141 TYR TYR A . n 
A 1 145 VAL 145 142 142 VAL VAL A . n 
A 1 146 LEU 146 143 143 LEU LEU A . n 
A 1 147 VAL 147 144 144 VAL VAL A . n 
A 1 148 VAL 148 145 145 VAL VAL A . n 
A 1 149 VAL 149 146 146 VAL VAL A . n 
A 1 150 ASP 150 147 147 ASP ASP A . n 
A 1 151 GLY 151 148 148 GLY GLY A . n 
A 1 152 MET 152 149 149 MET MET A . n 
A 1 153 THR 153 150 150 THR THR A . n 
A 1 154 GLY 154 151 151 GLY GLY A . n 
A 1 155 PHE 155 152 152 PHE PHE A . n 
A 1 156 THR 156 153 153 THR THR A . n 
A 1 157 TRP 157 154 154 TRP TRP A . n 
A 1 158 LEU 158 155 155 LEU LEU A . n 
A 1 159 TYR 159 156 156 TYR TYR A . n 
A 1 160 PRO 160 157 157 PRO PRO A . n 
A 1 161 THR 161 158 158 THR THR A . n 
A 1 162 LYS 162 159 159 LYS LYS A . n 
A 1 163 ALA 163 160 160 ALA ALA A . n 
A 1 164 PRO 164 161 161 PRO PRO A . n 
A 1 165 SER 165 162 162 SER SER A . n 
A 1 166 THR 166 163 163 THR THR A . n 
A 1 167 SER 167 164 164 SER SER A . n 
A 1 168 ALA 168 165 165 ALA ALA A . n 
A 1 169 THR 169 166 166 THR THR A . n 
A 1 170 VAL 170 167 167 VAL VAL A . n 
A 1 171 LYS 171 168 168 LYS LYS A . n 
A 1 172 SER 172 169 169 SER SER A . n 
A 1 173 LEU 173 170 170 LEU LEU A . n 
A 1 174 ASN 174 171 171 ASN ASN A . n 
A 1 175 VAL 175 172 172 VAL VAL A . n 
A 1 176 LEU 176 173 173 LEU LEU A . n 
A 1 177 THR 177 174 174 THR THR A . n 
A 1 178 SER 178 175 175 SER SER A . n 
A 1 179 ILE 179 176 176 ILE ILE A . n 
A 1 180 ALA 180 177 177 ALA ALA A . n 
A 1 181 ILE 181 178 178 ILE ILE A . n 
A 1 182 PRO 182 179 179 PRO PRO A . n 
A 1 183 LYS 183 180 180 LYS LYS A . n 
A 1 184 VAL 184 181 181 VAL VAL A . n 
A 1 185 ILE 185 182 182 ILE ILE A . n 
A 1 186 HIS 186 183 183 HIS HIS A . n 
A 1 187 SER 187 184 184 SER SER A . n 
A 1 188 ASP 188 185 185 ASP ASP A . n 
A 1 189 GLN 189 186 186 GLN GLN A . n 
A 1 190 GLY 190 187 187 GLY GLY A . n 
A 1 191 ALA 191 188 188 ALA ALA A . n 
A 1 192 ALA 192 189 189 ALA ALA A . n 
A 1 193 PHE 193 190 190 PHE PHE A . n 
A 1 194 THR 194 191 191 THR THR A . n 
A 1 195 SER 195 192 192 SER SER A . n 
A 1 196 SER 196 193 193 SER SER A . n 
A 1 197 THR 197 194 194 THR THR A . n 
A 1 198 PHE 198 195 195 PHE PHE A . n 
A 1 199 ALA 199 196 196 ALA ALA A . n 
A 1 200 GLU 200 197 197 GLU GLU A . n 
A 1 201 TRP 201 198 198 TRP TRP A . n 
A 1 202 ALA 202 199 199 ALA ALA A . n 
A 1 203 LYS 203 200 200 LYS LYS A . n 
A 1 204 GLU 204 201 201 GLU GLU A . n 
A 1 205 ARG 205 202 202 ARG ARG A . n 
A 1 206 GLY 206 203 203 GLY GLY A . n 
A 1 207 ILE 207 204 204 ILE ILE A . n 
A 1 208 HIS 208 205 205 HIS HIS A . n 
A 1 209 LEU 209 206 206 LEU LEU A . n 
A 1 210 GLU 210 207 207 GLU GLU A . n 
A 1 211 PHE 211 208 208 PHE PHE A . n 
A 1 212 SER 212 209 209 SER SER A . n 
A 1 213 THR 213 210 210 THR THR A . n 
A 1 214 PRO 214 211 211 PRO PRO A . n 
A 1 215 TYR 215 212 212 TYR TYR A . n 
A 1 216 HIS 216 213 213 HIS HIS A . n 
A 1 217 PRO 217 214 214 PRO PRO A . n 
A 1 218 GLN 218 215 215 GLN GLN A . n 
A 1 219 SER 219 216 216 SER SER A . n 
A 1 220 SER 220 217 217 SER SER A . n 
A 1 221 GLY 221 218 218 GLY GLY A . n 
A 1 222 LYS 222 219 219 LYS LYS A . n 
A 1 223 VAL 223 220 220 VAL VAL A . n 
A 1 224 GLU 224 221 221 GLU GLU A . n 
A 1 225 ARG 225 222 222 ARG ARG A . n 
A 1 226 LYS 226 223 223 LYS LYS A . n 
A 1 227 ASN 227 224 224 ASN ASN A . n 
A 1 228 SER 228 225 225 SER SER A . n 
A 1 229 ASP 229 226 226 ASP ASP A . n 
A 1 230 ILE 230 227 227 ILE ILE A . n 
A 1 231 LYS 231 228 228 LYS LYS A . n 
A 1 232 ARG 232 229 229 ARG ARG A . n 
A 1 233 LEU 233 230 230 LEU LEU A . n 
A 1 234 LEU 234 231 231 LEU LEU A . n 
A 1 235 THR 235 232 232 THR THR A . n 
A 1 236 LYS 236 233 233 LYS LYS A . n 
A 1 237 LEU 237 234 234 LEU LEU A . n 
A 1 238 LEU 238 235 235 LEU LEU A . n 
A 1 239 VAL 239 236 236 VAL VAL A . n 
A 1 240 GLY 240 237 237 GLY GLY A . n 
A 1 241 ARG 241 238 238 ARG ARG A . n 
A 1 242 PRO 242 239 239 PRO PRO A . n 
A 1 243 THR 243 240 240 THR THR A . n 
A 1 244 LYS 244 241 241 LYS LYS A . n 
A 1 245 TRP 245 242 242 TRP TRP A . n 
A 1 246 TYR 246 243 243 TYR TYR A . n 
A 1 247 ASP 247 244 244 ASP ASP A . n 
A 1 248 LEU 248 245 245 LEU LEU A . n 
A 1 249 LEU 249 246 246 LEU LEU A . n 
A 1 250 PRO 250 247 247 PRO PRO A . n 
A 1 251 VAL 251 248 248 VAL VAL A . n 
A 1 252 VAL 252 249 249 VAL VAL A . n 
A 1 253 GLN 253 250 250 GLN GLN A . n 
A 1 254 LEU 254 251 251 LEU LEU A . n 
A 1 255 ALA 255 252 252 ALA ALA A . n 
A 1 256 LEU 256 253 253 LEU LEU A . n 
A 1 257 ASN 257 254 254 ASN ASN A . n 
A 1 258 ASN 258 255 255 ASN ASN A . n 
A 1 259 THR 259 256 256 THR THR A . n 
A 1 260 TYR 260 257 257 TYR TYR A . n 
A 1 261 SER 261 258 258 SER SER A . n 
A 1 262 PRO 262 259 259 PRO PRO A . n 
A 1 263 VAL 263 260 260 VAL VAL A . n 
A 1 264 LEU 264 261 261 LEU LEU A . n 
A 1 265 LYS 265 262 262 LYS LYS A . n 
A 1 266 TYR 266 263 263 TYR TYR A . n 
A 1 267 THR 267 264 264 THR THR A . n 
A 1 268 PRO 268 265 265 PRO PRO A . n 
A 1 269 HIS 269 266 266 HIS HIS A . n 
A 1 270 GLN 270 267 267 GLN GLN A . n 
A 1 271 LEU 271 268 268 LEU LEU A . n 
A 1 272 LEU 272 269 269 LEU LEU A . n 
A 1 273 PHE 273 270 270 PHE PHE A . n 
A 1 274 GLY 274 271 271 GLY GLY A . n 
A 1 275 ILE 275 272 272 ILE ILE A . n 
A 1 276 ASP 276 273 273 ASP ASP A . n 
A 1 277 SER 277 274 274 SER SER A . n 
A 1 278 ASN 278 275 275 ASN ASN A . n 
A 1 279 THR 279 276 276 THR THR A . n 
A 1 280 PRO 280 277 277 PRO PRO A . n 
A 1 281 PHE 281 278 278 PHE PHE A . n 
A 1 282 ALA 282 279 279 ALA ALA A . n 
A 1 283 ASN 283 280 280 ASN ASN A . n 
A 1 284 GLN 284 281 281 GLN GLN A . n 
A 1 285 ASP 285 282 282 ASP ASP A . n 
A 1 286 THR 286 283 283 THR THR A . n 
A 1 287 LEU 287 284 284 LEU LEU A . n 
A 1 288 ASP 288 285 285 ASP ASP A . n 
A 1 289 LEU 289 286 286 LEU LEU A . n 
A 1 290 THR 290 287 287 THR THR A . n 
A 1 291 ARG 291 288 288 ARG ARG A . n 
A 1 292 GLU 292 289 289 GLU GLU A . n 
A 1 293 GLU 293 290 290 GLU GLU A . n 
A 1 294 GLU 294 291 291 GLU GLU A . n 
A 1 295 LEU 295 292 292 LEU LEU A . n 
A 1 296 SER 296 293 293 SER SER A . n 
A 1 297 LEU 297 294 294 LEU LEU A . n 
A 1 298 LEU 298 295 295 LEU LEU A . n 
A 1 299 GLN 299 296 296 GLN GLN A . n 
A 1 300 GLU 300 297 297 GLU GLU A . n 
A 1 301 ILE 301 298 298 ILE ILE A . n 
A 1 302 ARG 302 299 299 ARG ARG A . n 
A 1 303 THR 303 300 300 THR THR A . n 
A 1 304 SER 304 301 301 SER SER A . n 
A 1 305 LEU 305 302 302 LEU LEU A . n 
A 1 306 TYR 306 303 303 TYR TYR A . n 
A 1 307 HIS 307 304 304 HIS HIS A . n 
A 1 308 PRO 308 305 305 PRO PRO A . n 
A 1 309 SER 309 306 306 SER SER A . n 
A 1 310 THR 310 307 307 THR THR A . n 
A 1 311 PRO 311 308 308 PRO PRO A . n 
A 1 312 PRO 312 309 309 PRO PRO A . n 
A 1 313 ALA 313 310 310 ALA ALA A . n 
A 1 314 SER 314 311 311 SER SER A . n 
A 1 315 SER 315 312 312 SER SER A . n 
A 1 316 ARG 316 313 313 ARG ARG A . n 
A 1 317 SER 317 314 314 SER SER A . n 
A 1 318 TRP 318 315 315 TRP TRP A . n 
A 1 319 SER 319 316 316 SER SER A . n 
A 1 320 PRO 320 317 317 PRO PRO A . n 
A 1 321 VAL 321 318 318 VAL VAL A . n 
A 1 322 VAL 322 319 319 VAL VAL A . n 
A 1 323 GLY 323 320 320 GLY GLY A . n 
A 1 324 GLN 324 321 321 GLN GLN A . n 
A 1 325 LEU 325 322 322 LEU LEU A . n 
A 1 326 VAL 326 323 323 VAL VAL A . n 
A 1 327 GLN 327 324 324 GLN GLN A . n 
A 1 328 GLU 328 325 325 GLU GLU A . n 
A 1 329 ARG 329 326 326 ARG ARG A . n 
A 1 330 VAL 330 327 327 VAL VAL A . n 
A 1 331 ALA 331 328 328 ALA ALA A . n 
A 1 332 ARG 332 329 329 ARG ARG A . n 
A 1 333 PRO 333 330 330 PRO PRO A . n 
A 1 334 ALA 334 331 331 ALA ALA A . n 
A 1 335 SER 335 332 332 SER SER A . n 
A 1 336 LEU 336 333 333 LEU LEU A . n 
A 1 337 ARG 337 334 334 ARG ARG A . n 
A 1 338 PRO 338 335 335 PRO PRO A . n 
A 1 339 ARG 339 336 336 ARG ARG A . n 
A 1 340 TRP 340 337 337 TRP TRP A . n 
A 1 341 HIS 341 338 338 HIS HIS A . n 
A 1 342 LYS 342 339 339 LYS LYS A . n 
A 1