data_5MR4
# 
_entry.id   5MR4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.292 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   5MR4         
WWPDB D_1200002879 
# 
loop_
_pdbx_database_related.content_type 
_pdbx_database_related.db_id 
_pdbx_database_related.db_name 
_pdbx_database_related.details 
unspecified 5MR4 PDB . 
unspecified 5MR5 PDB . 
unspecified 5NMZ PDB . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        5MR4 
_pdbx_database_status.recvd_initial_deposition_date   2016-12-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBE 
_pdbx_database_status.process_site                    PDBE 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Sandmark, J.' 1 ? 
'Oster, L.'    2 ? 
'Aagaard, A.'  3 ? 
'Roth, R.G.'   4 ? 
'Dahl, G.'     5 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'J. Biol. Chem.' 
_citation.journal_id_ASTM           JBCHA3 
_citation.journal_id_CSD            0071 
_citation.journal_id_ISSN           1083-351X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            293 
_citation.language                  ? 
_citation.page_first                5492 
_citation.page_last                 5508 
_citation.title                     
;Structure and biophysical characterization of the human full-length neurturin-GFRa2 complex: A role for heparan sulfate in signaling.
;
_citation.year                      2018 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1074/jbc.RA117.000820 
_citation.pdbx_database_id_PubMed   29414779 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Sandmark, J.'  1  
primary 'Dahl, G.'      2  
primary 'Oster, L.'     3  
primary 'Xu, B.'        4  
primary 'Johansson, P.' 5  
primary 'Akerud, T.'    6  
primary 'Aagaard, A.'   7  
primary 'Davidsson, P.' 8  
primary 'Bigalke, J.M.' 9  
primary 'Winzell, M.S.' 10 
primary 'Rainey, G.J.'  11 
primary 'Roth, R.G.'    12 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   101.93 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     5MR4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     77.810 
_cell.length_a_esd                 ? 
_cell.length_b                     125.811 
_cell.length_b_esd                 ? 
_cell.length_c                     82.722 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         5MR4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Neurturin                      11706.406 2   ? ? ? ? 
2 polymer     man 'GDNF family receptor alpha-2' 50932.676 2   ? ? ? ? 
3 non-polymer syn 'DI(HYDROXYETHYL)ETHER'        106.120   1   ? ? ? ? 
4 non-polymer syn 'FORMIC ACID'                  46.025    3   ? ? ? ? 
5 water       nat water                          18.015    353 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        
;GFR-alpha-2,GDNF receptor beta,GDNFR-beta,Neurturin receptor alpha,NTNR-alpha,RET ligand 2,TGF-beta-related neurotrophic factor receptor 2
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
A,B ? 
2 'polypeptide(L)' no no 
;MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQA
ALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNH
CLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVS
PWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVIT
TCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVL
;
;MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQA
ALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNH
CLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVS
PWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVIT
TCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVL
;
C,D ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   ALA n 
1 2   ARG n 
1 3   LEU n 
1 4   GLY n 
1 5   ALA n 
1 6   ARG n 
1 7   PRO n 
1 8   CYS n 
1 9   GLY n 
1 10  LEU n 
1 11  ARG n 
1 12  GLU n 
1 13  LEU n 
1 14  GLU n 
1 15  VAL n 
1 16  ARG n 
1 17  VAL n 
1 18  SER n 
1 19  GLU n 
1 20  LEU n 
1 21  GLY n 
1 22  LEU n 
1 23  GLY n 
1 24  TYR n 
1 25  ALA n 
1 26  SER n 
1 27  ASP n 
1 28  GLU n 
1 29  THR n 
1 30  VAL n 
1 31  LEU n 
1 32  PHE n 
1 33  ARG n 
1 34  TYR n 
1 35  CYS n 
1 36  ALA n 
1 37  GLY n 
1 38  ALA n 
1 39  CYS n 
1 40  GLU n 
1 41  ALA n 
1 42  ALA n 
1 43  ALA n 
1 44  ARG n 
1 45  VAL n 
1 46  TYR n 
1 47  ASP n 
1 48  LEU n 
1 49  GLY n 
1 50  LEU n 
1 51  ARG n 
1 52  ARG n 
1 53  LEU n 
1 54  ARG n 
1 55  GLN n 
1 56  ARG n 
1 57  ARG n 
1 58  ARG n 
1 59  LEU n 
1 60  ARG n 
1 61  ARG n 
1 62  GLU n 
1 63  ARG n 
1 64  VAL n 
1 65  ARG n 
1 66  ALA n 
1 67  GLN n 
1 68  PRO n 
1 69  CYS n 
1 70  CYS n 
1 71  ARG n 
1 72  PRO n 
1 73  THR n 
1 74  ALA n 
1 75  TYR n 
1 76  GLU n 
1 77  ASP n 
1 78  GLU n 
1 79  VAL n 
1 80  SER n 
1 81  PHE n 
1 82  LEU n 
1 83  ASP n 
1 84  ALA n 
1 85  HIS n 
1 86  SER n 
1 87  ARG n 
1 88  TYR n 
1 89  HIS n 
1 90  THR n 
1 91  VAL n 
1 92  HIS n 
1 93  GLU n 
1 94  LEU n 
1 95  SER n 
1 96  ALA n 
1 97  ARG n 
1 98  GLU n 
1 99  CYS n 
1 100 ALA n 
1 101 CYS n 
1 102 VAL n 
2 1   MET n 
2 2   ILE n 
2 3   LEU n 
2 4   ALA n 
2 5   ASN n 
2 6   VAL n 
2 7   PHE n 
2 8   CYS n 
2 9   LEU n 
2 10  PHE n 
2 11  PHE n 
2 12  PHE n 
2 13  LEU n 
2 14  ASP n 
2 15  GLU n 
2 16  THR n 
2 17  LEU n 
2 18  ARG n 
2 19  SER n 
2 20  LEU n 
2 21  ALA n 
2 22  SER n 
2 23  PRO n 
2 24  SER n 
2 25  SER n 
2 26  LEU n 
2 27  GLN n 
2 28  GLY n 
2 29  PRO n 
2 30  GLU n 
2 31  LEU n 
2 32  HIS n 
2 33  GLY n 
2 34  TRP n 
2 35  ARG n 
2 36  PRO n 
2 37  PRO n 
2 38  VAL n 
2 39  ASP n 
2 40  CYS n 
2 41  VAL n 
2 42  ARG n 
2 43  ALA n 
2 44  ASN n 
2 45  GLU n 
2 46  LEU n 
2 47  CYS n 
2 48  ALA n 
2 49  ALA n 
2 50  GLU n 
2 51  SER n 
2 52  ASN n 
2 53  CYS n 
2 54  SER n 
2 55  SER n 
2 56  ARG n 
2 57  TYR n 
2 58  ARG n 
2 59  THR n 
2 60  LEU n 
2 61  ARG n 
2 62  GLN n 
2 63  CYS n 
2 64  LEU n 
2 65  ALA n 
2 66  GLY n 
2 67  ARG n 
2 68  ASP n 
2 69  ARG n 
2 70  ASN n 
2 71  THR n 
2 72  MET n 
2 73  LEU n 
2 74  ALA n 
2 75  ASN n 
2 76  LYS n 
2 77  GLU n 
2 78  CYS n 
2 79  GLN n 
2 80  ALA n 
2 81  ALA n 
2 82  LEU n 
2 83  GLU n 
2 84  VAL n 
2 85  LEU n 
2 86  GLN n 
2 87  GLU n 
2 88  SER n 
2 89  PRO n 
2 90  LEU n 
2 91  TYR n 
2 92  ASP n 
2 93  CYS n 
2 94  ARG n 
2 95  CYS n 
2 96  LYS n 
2 97  ARG n 
2 98  GLY n 
2 99  MET n 
2 100 LYS n 
2 101 LYS n 
2 102 GLU n 
2 103 LEU n 
2 104 GLN n 
2 105 CYS n 
2 106 LEU n 
2 107 GLN n 
2 108 ILE n 
2 109 TYR n 
2 110 TRP n 
2 111 SER n 
2 112 ILE n 
2 113 HIS n 
2 114 LEU n 
2 115 GLY n 
2 116 LEU n 
2 117 THR n 
2 118 GLU n 
2 119 GLY n 
2 120 GLU n 
2 121 GLU n 
2 122 PHE n 
2 123 TYR n 
2 124 GLU n 
2 125 ALA n 
2 126 SER n 
2 127 PRO n 
2 128 TYR n 
2 129 GLU n 
2 130 PRO n 
2 131 VAL n 
2 132 THR n 
2 133 SER n 
2 134 ARG n 
2 135 LEU n 
2 136 SER n 
2 137 ASP n 
2 138 ILE n 
2 139 PHE n 
2 140 ARG n 
2 141 LEU n 
2 142 ALA n 
2 143 SER n 
2 144 ILE n 
2 145 PHE n 
2 146 SER n 
2 147 GLY n 
2 148 THR n 
2 149 GLY n 
2 150 ALA n 
2 151 ASP n 
2 152 PRO n 
2 153 VAL n 
2 154 VAL n 
2 155 SER n 
2 156 ALA n 
2 157 LYS n 
2 158 SER n 
2 159 ASN n 
2 160 HIS n 
2 161 CYS n 
2 162 LEU n 
2 163 ASP n 
2 164 ALA n 
2 165 ALA n 
2 166 LYS n 
2 167 ALA n 
2 168 CYS n 
2 169 ASN n 
2 170 LEU n 
2 171 ASN n 
2 172 ASP n 
2 173 ASN n 
2 174 CYS n 
2 175 LYS n 
2 176 LYS n 
2 177 LEU n 
2 178 ARG n 
2 179 SER n 
2 180 SER n 
2 181 TYR n 
2 182 ILE n 
2 183 SER n 
2 184 ILE n 
2 185 CYS n 
2 186 ASN n 
2 187 ARG n 
2 188 GLU n 
2 189 ILE n 
2 190 SER n 
2 191 PRO n 
2 192 THR n 
2 193 GLU n 
2 194 ARG n 
2 195 CYS n 
2 196 ASN n 
2 197 ARG n 
2 198 ARG n 
2 199 LYS n 
2 200 CYS n 
2 201 HIS n 
2 202 LYS n 
2 203 ALA n 
2 204 LEU n 
2 205 ARG n 
2 206 GLN n 
2 207 PHE n 
2 208 PHE n 
2 209 ASP n 
2 210 ARG n 
2 211 VAL n 
2 212 PRO n 
2 213 SER n 
2 214 GLU n 
2 215 TYR n 
2 216 THR n 
2 217 TYR n 
2 218 ARG n 
2 219 MET n 
2 220 LEU n 
2 221 PHE n 
2 222 CYS n 
2 223 SER n 
2 224 CYS n 
2 225 GLN n 
2 226 ASP n 
2 227 GLN n 
2 228 ALA n 
2 229 CYS n 
2 230 ALA n 
2 231 GLU n 
2 232 ARG n 
2 233 ARG n 
2 234 ARG n 
2 235 GLN n 
2 236 THR n 
2 237 ILE n 
2 238 LEU n 
2 239 PRO n 
2 240 SER n 
2 241 CYS n 
2 242 SER n 
2 243 TYR n 
2 244 GLU n 
2 245 ASP n 
2 246 LYS n 
2 247 GLU n 
2 248 LYS n 
2 249 PRO n 
2 250 ASN n 
2 251 CYS n 
2 252 LEU n 
2 253 ASP n 
2 254 LEU n 
2 255 ARG n 
2 256 GLY n 
2 257 VAL n 
2 258 CYS n 
2 259 ARG n 
2 260 THR n 
2 261 ASP n 
2 262 HIS n 
2 263 LEU n 
2 264 CYS n 
2 265 ARG n 
2 266 SER n 
2 267 ARG n 
2 268 LEU n 
2 269 ALA n 
2 270 ASP n 
2 271 PHE n 
2 272 HIS n 
2 273 ALA n 
2 274 ASN n 
2 275 CYS n 
2 276 ARG n 
2 277 ALA n 
2 278 SER n 
2 279 TYR n 
2 280 GLN n 
2 281 THR n 
2 282 VAL n 
2 283 THR n 
2 284 SER n 
2 285 CYS n 
2 286 PRO n 
2 287 ALA n 
2 288 ASP n 
2 289 ASN n 
2 290 TYR n 
2 291 GLN n 
2 292 ALA n 
2 293 CYS n 
2 294 LEU n 
2 295 GLY n 
2 296 SER n 
2 297 TYR n 
2 298 ALA n 
2 299 GLY n 
2 300 MET n 
2 301 ILE n 
2 302 GLY n 
2 303 PHE n 
2 304 ASP n 
2 305 MET n 
2 306 THR n 
2 307 PRO n 
2 308 ASN n 
2 309 TYR n 
2 310 VAL n 
2 311 ASP n 
2 312 SER n 
2 313 SER n 
2 314 PRO n 
2 315 THR n 
2 316 GLY n 
2 317 ILE n 
2 318 VAL n 
2 319 VAL n 
2 320 SER n 
2 321 PRO n 
2 322 TRP n 
2 323 CYS n 
2 324 SER n 
2 325 CYS n 
2 326 ARG n 
2 327 GLY n 
2 328 SER n 
2 329 GLY n 
2 330 ASN n 
2 331 MET n 
2 332 GLU n 
2 333 GLU n 
2 334 GLU n 
2 335 CYS n 
2 336 GLU n 
2 337 LYS n 
2 338 PHE n 
2 339 LEU n 
2 340 ARG n 
2 341 ASP n 
2 342 PHE n 
2 343 THR n 
2 344 GLU n 
2 345 ASN n 
2 346 PRO n 
2 347 CYS n 
2 348 LEU n 
2 349 ARG n 
2 350 ASN n 
2 351 ALA n 
2 352 ILE n 
2 353 GLN n 
2 354 ALA n 
2 355 PHE n 
2 356 GLY n 
2 357 ASN n 
2 358 GLY n 
2 359 THR n 
2 360 ASP n 
2 361 VAL n 
2 362 ASN n 
2 363 VAL n 
2 364 SER n 
2 365 PRO n 
2 366 LYS n 
2 367 GLY n 
2 368 PRO n 
2 369 SER n 
2 370 PHE n 
2 371 GLN n 
2 372 ALA n 
2 373 THR n 
2 374 GLN n 
2 375 ALA n 
2 376 PRO n 
2 377 ARG n 
2 378 VAL n 
2 379 GLU n 
2 380 LYS n 
2 381 THR n 
2 382 PRO n 
2 383 SER n 
2 384 LEU n 
2 385 PRO n 
2 386 ASP n 
2 387 ASP n 
2 388 LEU n 
2 389 SER n 
2 390 ASP n 
2 391 SER n 
2 392 THR n 
2 393 SER n 
2 394 LEU n 
2 395 GLY n 
2 396 THR n 
2 397 SER n 
2 398 VAL n 
2 399 ILE n 
2 400 THR n 
2 401 THR n 
2 402 CYS n 
2 403 THR n 
2 404 SER n 
2 405 VAL n 
2 406 GLN n 
2 407 GLU n 
2 408 GLN n 
2 409 GLY n 
2 410 LEU n 
2 411 LYS n 
2 412 ALA n 
2 413 ASN n 
2 414 ASN n 
2 415 SER n 
2 416 LYS n 
2 417 GLU n 
2 418 LEU n 
2 419 SER n 
2 420 MET n 
2 421 CYS n 
2 422 PHE n 
2 423 THR n 
2 424 GLU n 
2 425 LEU n 
2 426 THR n 
2 427 THR n 
2 428 ASN n 
2 429 ILE n 
2 430 ILE n 
2 431 PRO n 
2 432 GLY n 
2 433 SER n 
2 434 ASN n 
2 435 LYS n 
2 436 VAL n 
2 437 ILE n 
2 438 LYS n 
2 439 PRO n 
2 440 ASN n 
2 441 SER n 
2 442 GLY n 
2 443 PRO n 
2 444 SER n 
2 445 ARG n 
2 446 ALA n 
2 447 ARG n 
2 448 PRO n 
2 449 SER n 
2 450 ALA n 
2 451 ALA n 
2 452 LEU n 
2 453 THR n 
2 454 VAL n 
2 455 LEU n 
2 456 SER n 
2 457 VAL n 
2 458 LEU n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 102 Human ? NRTN                          ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
'Escherichia coli'   562   ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 458 Human ? 'GFRA2, GDNFRB, RETL2, TRNR2' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? 
'Chinese Hamster' 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP NRTN_HUMAN  Q99748 ? 1 
;ARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVS
FLDAHSRYHTVHELSARECACV
;
96 
2 UNP GFRA2_HUMAN O00451 ? 2 
;MILANVFCLFFFLDETLRSLASPSSLQGPELHGWRPPVDCVRANELCAAESNCSSRYRTLRQCLAGRDRNTMLANKECQA
ALEVLQESPLYDCRCKRGMKKELQCLQIYWSIHLGLTEGEEFYEASPYEPVTSRLSDIFRLASIFSGTGADPVVSAKSNH
CLDAAKACNLNDNCKKLRSSYISICNREISPTERCNRRKCHKALRQFFDRVPSEYTYRMLFCSCQDQACAERRRQTILPS
CSYEDKEKPNCLDLRGVCRTDHLCRSRLADFHANCRASYQTVTSCPADNYQACLGSYAGMIGFDMTPNYVDSSPTGIVVS
PWCSCRGSGNMEEECEKFLRDFTENPCLRNAIQAFGNGTDVNVSPKGPSFQATQAPRVEKTPSLPDDLSDSTSLGTSVIT
TCTSVQEQGLKANNSKELSMCFTELTTNIIPGSNKVIKPNSGPSRARPSAALTVLSVL
;
1  
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 5MR4 A 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
2 1 5MR4 B 1 ? 102 ? Q99748 96 ? 197 ? 96 197 
3 2 5MR4 C 1 ? 458 ? O00451 1  ? 458 ? 1  458 
4 2 5MR4 D 1 ? 458 ? O00451 1  ? 458 ? 1  458 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                 ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE              ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'         ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                ? 'C3 H7 N O2 S'   121.158 
FMT non-polymer         . 'FORMIC ACID'           ? 'C H2 O2'        46.025  
GLN 'L-peptide linking' y GLUTAMINE               ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'         ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                 ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE               ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                   ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE              ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                 ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                  ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE              ? 'C5 H11 N O2 S'  149.211 
PEG non-polymer         . 'DI(HYDROXYETHYL)ETHER' ? 'C4 H10 O3'      106.120 
PHE 'L-peptide linking' y PHENYLALANINE           ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                 ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                  ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE               ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN              ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                  ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   5MR4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.16 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.10 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '8% Tacsimate, 8% PEG MME 5000 and 0.1 M HEPES pH 7.5.' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2013-09-11 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.985 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ESRF BEAMLINE ID23-1' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.985 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ID23-1 
_diffrn_source.pdbx_synchrotron_site       ESRF 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         5MR4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.4 
_reflns.d_resolution_low                 55.8 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       60705 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.7 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  3.5 
_reflns.pdbx_Rmerge_I_obs                0.098 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            9.4 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.4 
_reflns_shell.d_res_low                   2.53 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        ? 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.75 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             ? 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.03 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            -0.01 
_refine.aniso_B[2][2]                            0.02 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            0.02 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               54.043 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.951 
_refine.correlation_coeff_Fo_to_Fc_free          0.940 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 5MR4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.40 
_refine.ls_d_res_low                             49.67 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     57605 
_refine.ls_number_reflns_R_free                  3073 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.68 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19633 
_refine.ls_R_factor_R_free                       0.22002 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.19503 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      '5MR5, 5MR9' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.215 
_refine.pdbx_overall_ESU_R_Free                  0.180 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             5.537 
_refine.overall_SU_ML                            0.126 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        6079 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         16 
_refine_hist.number_atoms_solvent             353 
_refine_hist.number_atoms_total               6448 
_refine_hist.d_res_high                       2.40 
_refine_hist.d_res_low                        49.67 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  0.019  6229  ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.020  5722  ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.387  1.959  8398  ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.970  3.000  13131 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 5.051  5.000  756   ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 34.245 22.260 323   ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 18.139 15.000 1070  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 19.245 15.000 86    ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.081  0.200  879   ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.006  0.021  7106  ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  1536  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 3.356  5.049  3054  ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 3.357  5.049  3055  ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 5.171  7.544  3800  ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 5.172  7.546  3801  ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 4.672  5.650  3175  ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 4.652  5.652  3169  ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 7.341  8.226  4599  ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 9.430  39.172 7085  ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 9.443  39.109 7041  ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?     ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.400 
_refine_ls_shell.d_res_low                        2.462 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             206 
_refine_ls_shell.number_reflns_R_work             4265 
_refine_ls_shell.percent_reflns_obs               99.60 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.383 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.362 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     5MR4 
_struct.title                        'Ligand-receptor complex.' 
_struct.pdbx_descriptor              'Neurturin, GDNF family receptor alpha-2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        5MR4 
_struct_keywords.text            'Complex, Signalling, Receptor, signaling protein' 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 18  ? GLY A 21  ? SER A 113 GLY A 116 5 ? 4  
HELX_P HELX_P2  AA2 ARG A 44  ? ARG A 56  ? ARG A 139 ARG A 151 1 ? 13 
HELX_P HELX_P3  AA3 SER B 18  ? GLY B 21  ? SER B 113 GLY B 116 5 ? 4  
HELX_P HELX_P4  AA4 ARG B 44  ? ARG B 56  ? ARG B 139 ARG B 151 1 ? 13 
HELX_P HELX_P5  AA5 ASP C 39  ? ALA C 49  ? ASP C 39  ALA C 49  1 ? 11 
HELX_P HELX_P6  AA6 GLU C 50  ? ALA C 65  ? GLU C 50  ALA C 65  1 ? 16 
HELX_P HELX_P7  AA7 LYS C 76  ? GLU C 87  ? LYS C 76  GLU C 87  1 ? 12 
HELX_P HELX_P8  AA8 LYS C 101 ? ILE C 112 ? LYS C 101 ILE C 112 1 ? 12 
HELX_P HELX_P9  AA9 ASN C 159 ? LEU C 170 ? ASN C 159 LEU C 170 1 ? 12 
HELX_P HELX_P10 AB1 ASN C 171 ? ARG C 187 ? ASN C 171 ARG C 187 1 ? 17 
HELX_P HELX_P11 AB2 ASN C 196 ? VAL C 211 ? ASN C 196 VAL C 211 1 ? 16 
HELX_P HELX_P12 AB3 PRO C 212 ? PHE C 221 ? PRO C 212 PHE C 221 1 ? 10 
HELX_P HELX_P13 AB4 ASP C 226 ? GLN C 235 ? ASP C 226 GLN C 235 1 ? 10 
HELX_P HELX_P14 AB5 LEU C 238 ? TYR C 243 ? LEU C 238 TYR C 243 1 ? 6  
HELX_P HELX_P15 AB6 ASN C 250 ? THR C 260 ? ASN C 250 THR C 260 1 ? 11 
HELX_P HELX_P16 AB7 ASP C 261 ? ARG C 276 ? ASP C 261 ARG C 276 1 ? 16 
HELX_P HELX_P17 AB8 CYS C 285 ? ASP C 288 ? CYS C 285 ASP C 288 5 ? 4  
HELX_P HELX_P18 AB9 ASN C 289 ? GLY C 299 ? ASN C 289 GLY C 299 1 ? 11 
HELX_P HELX_P19 AC1 SER C 328 ? ASN C 330 ? SER C 328 ASN C 330 5 ? 3  
HELX_P HELX_P20 AC2 MET C 331 ? GLU C 344 ? MET C 331 GLU C 344 1 ? 14 
HELX_P HELX_P21 AC3 ASN C 345 ? GLY C 358 ? ASN C 345 GLY C 358 1 ? 14 
HELX_P HELX_P22 AC4 ASP D 39  ? GLU D 50  ? ASP D 39  GLU D 50  1 ? 12 
HELX_P HELX_P23 AC5 GLU D 50  ? LEU D 64  ? GLU D 50  LEU D 64  1 ? 15 
HELX_P HELX_P24 AC6 GLU D 77  ? GLU D 87  ? GLU D 77  GLU D 87  1 ? 11 
HELX_P HELX_P25 AC7 SER D 88  ? CYS D 93  ? SER D 88  CYS D 93  5 ? 6  
HELX_P HELX_P26 AC8 LYS D 101 ? HIS D 113 ? LYS D 101 HIS D 113 1 ? 13 
HELX_P HELX_P27 AC9 ASN D 159 ? LEU D 170 ? ASN D 159 LEU D 170 1 ? 12 
HELX_P HELX_P28 AD1 ASN D 171 ? ARG D 187 ? ASN D 171 ARG D 187 1 ? 17 
HELX_P HELX_P29 AD2 ASN D 196 ? VAL D 211 ? ASN D 196 VAL D 211 1 ? 16 
HELX_P HELX_P30 AD3 PRO D 212 ? PHE D 221 ? PRO D 212 PHE D 221 1 ? 10 
HELX_P HELX_P31 AD4 ASP D 226 ? THR D 236 ? ASP D 226 THR D 236 1 ? 11 
HELX_P HELX_P32 AD5 LEU D 238 ? TYR D 243 ? LEU D 238 TYR D 243 1 ? 6  
HELX_P HELX_P33 AD6 ASN D 250 ? ASP D 261 ? ASN D 250 ASP D 261 1 ? 12 
HELX_P HELX_P34 AD7 ASP D 261 ? ARG D 276 ? ASP D 261 ARG D 276 1 ? 16 
HELX_P HELX_P35 AD8 CYS D 285 ? ASP D 288 ? CYS D 285 ASP D 288 5 ? 4  
HELX_P HELX_P36 AD9 ASN D 289 ? GLY D 299 ? ASN D 289 GLY D 299 1 ? 11 
HELX_P HELX_P37 AE1 MET D 331 ? GLU D 344 ? MET D 331 GLU D 344 1 ? 14 
HELX_P HELX_P38 AE2 ASN D 345 ? GLY D 358 ? ASN D 345 GLY D 358 1 ? 14 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1  disulf ? ? A CYS 8   SG ? ? ? 1_555 A CYS 70  SG ? ? A CYS 103 A CYS 165 1_555 ? ? ? ? ? ? ? 2.118 ? 
disulf2  disulf ? ? A CYS 35  SG ? ? ? 1_555 A CYS 99  SG ? ? A CYS 130 A CYS 194 1_555 ? ? ? ? ? ? ? 2.100 ? 
disulf3  disulf ? ? A CYS 39  SG ? ? ? 1_555 A CYS 101 SG ? ? A CYS 134 A CYS 196 1_555 ? ? ? ? ? ? ? 2.108 ? 
disulf4  disulf ? ? A CYS 69  SG ? ? ? 1_555 B CYS 69  SG ? ? A CYS 164 B CYS 164 1_555 ? ? ? ? ? ? ? 2.139 ? 
disulf5  disulf ? ? B CYS 8   SG ? ? ? 1_555 B CYS 70  SG ? ? B CYS 103 B CYS 165 1_555 ? ? ? ? ? ? ? 2.106 ? 
disulf6  disulf ? ? B CYS 35  SG ? ? ? 1_555 B CYS 99  SG ? ? B CYS 130 B CYS 194 1_555 ? ? ? ? ? ? ? 2.074 ? 
disulf7  disulf ? ? B CYS 39  SG ? ? ? 1_555 B CYS 101 SG ? ? B CYS 134 B CYS 196 1_555 ? ? ? ? ? ? ? 2.116 ? 
disulf8  disulf ? ? C CYS 40  SG ? ? ? 1_555 C CYS 93  SG ? ? C CYS 40  C CYS 93  1_555 ? ? ? ? ? ? ? 2.113 ? 
disulf9  disulf ? ? C CYS 47  SG ? ? ? 1_555 C CYS 53  SG ? ? C CYS 47  C CYS 53  1_555 ? ? ? ? ? ? ? 2.718 ? 
disulf10 disulf ? ? C CYS 63  SG ? ? ? 1_555 C CYS 78  SG ? ? C CYS 63  C CYS 78  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf11 disulf ? ? C CYS 95  SG ? ? ? 1_555 C CYS 105 SG ? ? C CYS 95  C CYS 105 1_555 ? ? ? ? ? ? ? 2.193 ? 
disulf12 disulf ? ? C CYS 161 SG ? ? ? 1_555 C CYS 222 SG ? ? C CYS 161 C CYS 222 1_555 ? ? ? ? ? ? ? 2.065 ? 
disulf13 disulf ? ? C CYS 168 SG ? ? ? 1_555 C CYS 174 SG ? ? C CYS 168 C CYS 174 1_555 ? ? ? ? ? ? ? 2.086 ? 
disulf14 disulf ? ? C CYS 185 SG ? ? ? 1_555 C CYS 200 SG ? ? C CYS 185 C CYS 200 1_555 ? ? ? ? ? ? ? 2.103 ? 
disulf15 disulf ? ? C CYS 195 SG ? ? ? 1_555 C CYS 241 SG ? ? C CYS 195 C CYS 241 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf16 disulf ? ? C CYS 224 SG ? ? ? 1_555 C CYS 229 SG ? ? C CYS 224 C CYS 229 1_555 ? ? ? ? ? ? ? 2.197 ? 
disulf17 disulf ? ? C CYS 251 SG ? ? ? 1_555 C CYS 323 SG ? ? C CYS 251 C CYS 323 1_555 ? ? ? ? ? ? ? 2.217 ? 
disulf18 disulf ? ? C CYS 258 SG ? ? ? 1_555 C CYS 264 SG ? ? C CYS 258 C CYS 264 1_555 ? ? ? ? ? ? ? 2.127 ? 
disulf19 disulf ? ? C CYS 275 SG ? ? ? 1_555 C CYS 293 SG ? ? C CYS 275 C CYS 293 1_555 ? ? ? ? ? ? ? 2.105 ? 
disulf20 disulf ? ? C CYS 285 SG ? ? ? 1_555 C CYS 347 SG ? ? C CYS 285 C CYS 347 1_555 ? ? ? ? ? ? ? 2.062 ? 
disulf21 disulf ? ? C CYS 325 SG ? ? ? 1_555 C CYS 335 SG ? ? C CYS 325 C CYS 335 1_555 ? ? ? ? ? ? ? 2.795 ? 
disulf22 disulf ? ? D CYS 40  SG ? ? ? 1_555 D CYS 93  SG ? ? D CYS 40  D CYS 93  1_555 ? ? ? ? ? ? ? 2.054 ? 
disulf23 disulf ? ? D CYS 47  SG ? ? ? 1_555 D CYS 53  SG ? ? D CYS 47  D CYS 53  1_555 ? ? ? ? ? ? ? 2.056 ? 
disulf24 disulf ? ? D CYS 63  SG ? ? ? 1_555 D CYS 78  SG ? ? D CYS 63  D CYS 78  1_555 ? ? ? ? ? ? ? 2.042 ? 
disulf25 disulf ? ? D CYS 95  SG ? ? ? 1_555 D CYS 105 SG ? ? D CYS 95  D CYS 105 1_555 ? ? ? ? ? ? ? 2.073 ? 
disulf26 disulf ? ? D CYS 161 SG ? ? ? 1_555 D CYS 222 SG ? ? D CYS 161 D CYS 222 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf27 disulf ? ? D CYS 168 SG ? ? ? 1_555 D CYS 174 SG ? ? D CYS 168 D CYS 174 1_555 ? ? ? ? ? ? ? 2.040 ? 
disulf28 disulf ? ? D CYS 185 SG ? ? ? 1_555 D CYS 200 SG ? ? D CYS 185 D CYS 200 1_555 ? ? ? ? ? ? ? 2.088 ? 
disulf29 disulf ? ? D CYS 195 SG ? ? ? 1_555 D CYS 241 SG ? ? D CYS 195 D CYS 241 1_555 ? ? ? ? ? ? ? 2.014 ? 
disulf30 disulf ? ? D CYS 224 SG ? ? ? 1_555 D CYS 229 SG ? ? D CYS 224 D CYS 229 1_555 ? ? ? ? ? ? ? 2.188 ? 
disulf31 disulf ? ? D CYS 251 SG ? ? ? 1_555 D CYS 323 SG ? ? D CYS 251 D CYS 323 1_555 ? ? ? ? ? ? ? 2.131 ? 
disulf32 disulf ? ? D CYS 258 SG ? ? ? 1_555 D CYS 264 SG ? ? D CYS 258 D CYS 264 1_555 ? ? ? ? ? ? ? 2.149 ? 
disulf33 disulf ? ? D CYS 275 SG ? ? ? 1_555 D CYS 293 SG ? ? D CYS 275 D CYS 293 1_555 ? ? ? ? ? ? ? 2.112 ? 
disulf34 disulf ? ? D CYS 285 SG ? ? ? 1_555 D CYS 347 SG ? ? D CYS 285 D CYS 347 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf35 disulf ? ? D CYS 325 SG ? ? ? 1_555 D CYS 335 SG ? ? D CYS 325 D CYS 335 1_555 ? ? ? ? ? ? ? 2.083 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 64 D . ? LEU 64 D ALA 65 D ? ALA 65 D 1 -4.28 
2 ALA 65 D . ? ALA 65 D GLY 66 D ? GLY 66 D 1 1.13  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA8 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 GLY A 9   ? ARG A 16  ? GLY A 104 ARG A 111 
AA1 2 THR A 29  ? ALA A 36  ? THR A 124 ALA A 131 
AA2 1 CYS A 70  ? TYR A 75  ? CYS A 165 TYR A 170 
AA2 2 ALA A 96  ? CYS A 101 ? ALA A 191 CYS A 196 
AA3 1 VAL A 79  ? LEU A 82  ? VAL A 174 LEU A 177 
AA3 2 TYR A 88  ? VAL A 91  ? TYR A 183 VAL A 186 
AA4 1 GLY B 9   ? ARG B 16  ? GLY B 104 ARG B 111 
AA4 2 THR B 29  ? ALA B 36  ? THR B 124 ALA B 131 
AA5 1 CYS B 70  ? TYR B 75  ? CYS B 165 TYR B 170 
AA5 2 ALA B 96  ? CYS B 101 ? ALA B 191 CYS B 196 
AA6 1 GLU B 78  ? LEU B 82  ? GLU B 173 LEU B 177 
AA6 2 TYR B 88  ? HIS B 92  ? TYR B 183 HIS B 187 
AA7 1 ASN C 308 ? TYR C 309 ? ASN C 308 TYR C 309 
AA7 2 VAL C 319 ? SER C 320 ? VAL C 319 SER C 320 
AA8 1 PRO D 307 ? TYR D 309 ? PRO D 307 TYR D 309 
AA8 2 VAL D 319 ? PRO D 321 ? VAL D 319 PRO D 321 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 11  ? N ARG A 106 O TYR A 34  ? O TYR A 129 
AA2 1 2 N ALA A 74  ? N ALA A 169 O ARG A 97  ? O ARG A 192 
AA3 1 2 N VAL A 79  ? N VAL A 174 O VAL A 91  ? O VAL A 186 
AA4 1 2 N LEU B 13  ? N LEU B 108 O PHE B 32  ? O PHE B 127 
AA5 1 2 N ALA B 74  ? N ALA B 169 O ARG B 97  ? O ARG B 192 
AA6 1 2 N VAL B 79  ? N VAL B 174 O VAL B 91  ? O VAL B 186 
AA7 1 2 N ASN C 308 ? N ASN C 308 O SER C 320 ? O SER C 320 
AA8 1 2 N ASN D 308 ? N ASN D 308 O SER D 320 ? O SER D 320 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A PEG 201 ? 6 'binding site for residue PEG A 201' 
AC2 Software C FMT 501 ? 7 'binding site for residue FMT C 501' 
AC3 Software D FMT 501 ? 6 'binding site for residue FMT D 501' 
AC4 Software D FMT 502 ? 1 'binding site for residue FMT D 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 CYS A 39  ? CYS A 134 . ? 1_555 ? 
2  AC1 6 GLU A 40  ? GLU A 135 . ? 1_555 ? 
3  AC1 6 ALA A 41  ? ALA A 136 . ? 1_555 ? 
4  AC1 6 CYS A 101 ? CYS A 196 . ? 1_555 ? 
5  AC1 6 HOH I .   ? HOH A 311 . ? 1_555 ? 
6  AC1 6 HOH I .   ? HOH A 312 . ? 1_555 ? 
7  AC2 7 ILE C 317 ? ILE C 317 . ? 1_555 ? 
8  AC2 7 VAL C 318 ? VAL C 318 . ? 1_555 ? 
9  AC2 7 VAL C 319 ? VAL C 319 . ? 1_555 ? 
10 AC2 7 PHE C 342 ? PHE C 342 . ? 1_555 ? 
11 AC2 7 THR C 343 ? THR C 343 . ? 1_555 ? 
12 AC2 7 ASN C 345 ? ASN C 345 . ? 1_555 ? 
13 AC2 7 HOH K .   ? HOH C 621 . ? 1_555 ? 
14 AC3 6 VAL D 318 ? VAL D 318 . ? 1_555 ? 
15 AC3 6 VAL D 319 ? VAL D 319 . ? 1_555 ? 
16 AC3 6 PHE D 342 ? PHE D 342 . ? 1_555 ? 
17 AC3 6 THR D 343 ? THR D 343 . ? 1_555 ? 
18 AC3 6 ASN D 345 ? ASN D 345 . ? 1_555 ? 
19 AC3 6 HOH L .   ? HOH D 663 . ? 1_555 ? 
20 AC4 1 SER D 312 ? SER D 312 . ? 1_555 ? 
# 
_atom_sites.entry_id                    5MR4 
_atom_sites.fract_transf_matrix[1][1]   0.012852 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002715 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.007948 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012356 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ALA A 1 5   ? 84.571  -33.306  -28.214  1.00 82.94  ? 100 ALA A N   1 
ATOM   2    C CA  . ALA A 1 5   ? 83.578  -34.408  -28.490  1.00 83.87  ? 100 ALA A CA  1 
ATOM   3    C C   . ALA A 1 5   ? 83.437  -34.663  -30.002  1.00 80.80  ? 100 ALA A C   1 
ATOM   4    O O   . ALA A 1 5   ? 83.105  -33.743  -30.776  1.00 78.44  ? 100 ALA A O   1 
ATOM   5    C CB  . ALA A 1 5   ? 82.212  -34.094  -27.875  1.00 78.46  ? 100 ALA A CB  1 
ATOM   6    N N   . ARG A 1 6   ? 83.692  -35.908  -30.410  1.00 70.51  ? 101 ARG A N   1 
ATOM   7    C CA  . ARG A 1 6   ? 83.637  -36.288  -31.836  1.00 66.27  ? 101 ARG A CA  1 
ATOM   8    C C   . ARG A 1 6   ? 82.205  -36.324  -32.362  1.00 56.53  ? 101 ARG A C   1 
ATOM   9    O O   . ARG A 1 6   ? 81.311  -36.877  -31.716  1.00 54.02  ? 101 ARG A O   1 
ATOM   10   C CB  . ARG A 1 6   ? 84.298  -37.633  -32.075  1.00 75.12  ? 101 ARG A CB  1 
ATOM   11   C CG  . ARG A 1 6   ? 85.753  -37.542  -32.499  1.00 79.80  ? 101 ARG A CG  1 
ATOM   12   C CD  . ARG A 1 6   ? 86.385  -38.924  -32.476  1.00 80.16  ? 101 ARG A CD  1 
ATOM   13   N NE  . ARG A 1 6   ? 86.362  -39.579  -33.779  1.00 78.57  ? 101 ARG A NE  1 
ATOM   14   C CZ  . ARG A 1 6   ? 86.485  -40.895  -33.981  1.00 77.91  ? 101 ARG A CZ  1 
ATOM   15   N NH1 . ARG A 1 6   ? 86.620  -41.748  -32.960  1.00 74.30  ? 101 ARG A NH1 1 
ATOM   16   N NH2 . ARG A 1 6   ? 86.470  -41.366  -35.228  1.00 73.62  ? 101 ARG A NH2 1 
ATOM   17   N N   . PRO A 1 7   ? 81.969  -35.708  -33.526  1.00 52.05  ? 102 PRO A N   1 
ATOM   18   C CA  . PRO A 1 7   ? 80.596  -35.679  -34.026  1.00 51.92  ? 102 PRO A CA  1 
ATOM   19   C C   . PRO A 1 7   ? 80.116  -37.068  -34.522  1.00 49.29  ? 102 PRO A C   1 
ATOM   20   O O   . PRO A 1 7   ? 80.926  -37.948  -34.783  1.00 47.68  ? 102 PRO A O   1 
ATOM   21   C CB  . PRO A 1 7   ? 80.667  -34.675  -35.191  1.00 48.67  ? 102 PRO A CB  1 
ATOM   22   C CG  . PRO A 1 7   ? 82.084  -34.674  -35.631  1.00 48.27  ? 102 PRO A CG  1 
ATOM   23   C CD  . PRO A 1 7   ? 82.917  -35.058  -34.454  1.00 50.33  ? 102 PRO A CD  1 
ATOM   24   N N   . CYS A 1 8   ? 78.805  -37.219  -34.665  1.00 45.53  ? 103 CYS A N   1 
ATOM   25   C CA  . CYS A 1 8   ? 78.189  -38.437  -35.173  1.00 45.76  ? 103 CYS A CA  1 
ATOM   26   C C   . CYS A 1 8   ? 78.942  -39.014  -36.364  1.00 40.40  ? 103 CYS A C   1 
ATOM   27   O O   . CYS A 1 8   ? 79.263  -38.313  -37.296  1.00 43.73  ? 103 CYS A O   1 
ATOM   28   C CB  . CYS A 1 8   ? 76.740  -38.148  -35.556  1.00 48.02  ? 103 CYS A CB  1 
ATOM   29   S SG  . CYS A 1 8   ? 75.863  -39.505  -36.381  1.00 50.15  ? 103 CYS A SG  1 
ATOM   30   N N   . GLY A 1 9   ? 79.266  -40.293  -36.317  1.00 39.62  ? 104 GLY A N   1 
ATOM   31   C CA  . GLY A 1 9   ? 79.918  -40.944  -37.470  1.00 37.21  ? 104 GLY A CA  1 
ATOM   32   C C   . GLY A 1 9   ? 80.245  -42.401  -37.217  1.00 39.85  ? 104 GLY A C   1 
ATOM   33   O O   . GLY A 1 9   ? 79.895  -42.987  -36.156  1.00 39.65  ? 104 GLY A O   1 
ATOM   34   N N   . LEU A 1 10  ? 80.932  -42.985  -38.188  1.00 39.86  ? 105 LEU A N   1 
ATOM   35   C CA  . LEU A 1 10  ? 81.267  -44.403  -38.179  1.00 42.70  ? 105 LEU A CA  1 
ATOM   36   C C   . LEU A 1 10  ? 82.428  -44.700  -37.297  1.00 43.64  ? 105 LEU A C   1 
ATOM   37   O O   . LEU A 1 10  ? 83.466  -44.088  -37.452  1.00 49.93  ? 105 LEU A O   1 
ATOM   38   C CB  . LEU A 1 10  ? 81.661  -44.881  -39.560  1.00 44.78  ? 105 LEU A CB  1 
ATOM   39   C CG  . LEU A 1 10  ? 80.578  -45.381  -40.473  1.00 49.95  ? 105 LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 10  ? 81.277  -45.810  -41.754  1.00 55.80  ? 105 LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 10  ? 79.796  -46.556  -39.874  1.00 51.80  ? 105 LEU A CD2 1 
ATOM   42   N N   . ARG A 1 11  ? 82.262  -45.663  -36.396  1.00 44.10  ? 106 ARG A N   1 
ATOM   43   C CA  . ARG A 1 11  ? 83.350  -46.164  -35.563  1.00 43.13  ? 106 ARG A CA  1 
ATOM   44   C C   . ARG A 1 11  ? 83.589  -47.637  -35.921  1.00 46.40  ? 106 ARG A C   1 
ATOM   45   O O   . ARG A 1 11  ? 82.700  -48.286  -36.469  1.00 46.18  ? 106 ARG A O   1 
ATOM   46   C CB  . ARG A 1 11  ? 83.004  -46.034  -34.093  1.00 44.77  ? 106 ARG A CB  1 
ATOM   47   C CG  . ARG A 1 11  ? 82.472  -44.671  -33.682  1.00 49.09  ? 106 ARG A CG  1 
ATOM   48   C CD  . ARG A 1 11  ? 83.545  -43.610  -33.582  1.00 45.36  ? 106 ARG A CD  1 
ATOM   49   N NE  . ARG A 1 11  ? 83.011  -42.357  -33.031  1.00 44.36  ? 106 ARG A NE  1 
ATOM   50   C CZ  . ARG A 1 11  ? 82.656  -41.279  -33.744  1.00 44.38  ? 106 ARG A CZ  1 
ATOM   51   N NH1 . ARG A 1 11  ? 82.204  -40.197  -33.113  1.00 42.70  ? 106 ARG A NH1 1 
ATOM   52   N NH2 . ARG A 1 11  ? 82.733  -41.267  -35.077  1.00 45.42  ? 106 ARG A NH2 1 
ATOM   53   N N   . GLU A 1 12  ? 84.785  -48.131  -35.595  1.00 45.03  ? 107 GLU A N   1 
ATOM   54   C CA  . GLU A 1 12  ? 85.255  -49.480  -35.930  1.00 45.51  ? 107 GLU A CA  1 
ATOM   55   C C   . GLU A 1 12  ? 85.761  -50.144  -34.689  1.00 45.89  ? 107 GLU A C   1 
ATOM   56   O O   . GLU A 1 12  ? 86.449  -49.509  -33.910  1.00 46.24  ? 107 GLU A O   1 
ATOM   57   C CB  . GLU A 1 12  ? 86.436  -49.429  -36.887  1.00 45.62  ? 107 GLU A CB  1 
ATOM   58   C CG  . GLU A 1 12  ? 86.005  -49.218  -38.314  1.00 57.29  ? 107 GLU A CG  1 
ATOM   59   C CD  . GLU A 1 12  ? 87.146  -49.227  -39.299  1.00 61.33  ? 107 GLU A CD  1 
ATOM   60   O OE1 . GLU A 1 12  ? 86.884  -48.947  -40.494  1.00 75.44  ? 107 GLU A OE1 1 
ATOM   61   O OE2 . GLU A 1 12  ? 88.283  -49.520  -38.892  1.00 62.46  ? 107 GLU A OE2 1 
ATOM   62   N N   . LEU A 1 13  ? 85.475  -51.432  -34.537  1.00 44.35  ? 108 LEU A N   1 
ATOM   63   C CA  . LEU A 1 13  ? 85.965  -52.209  -33.408  1.00 44.19  ? 108 LEU A CA  1 
ATOM   64   C C   . LEU A 1 13  ? 86.160  -53.646  -33.865  1.00 43.08  ? 108 LEU A C   1 
ATOM   65   O O   . LEU A 1 13  ? 85.280  -54.222  -34.495  1.00 37.17  ? 108 LEU A O   1 
ATOM   66   C CB  . LEU A 1 13  ? 84.950  -52.163  -32.288  1.00 46.81  ? 108 LEU A CB  1 
ATOM   67   C CG  . LEU A 1 13  ? 85.244  -52.976  -31.041  1.00 49.74  ? 108 LEU A CG  1 
ATOM   68   C CD1 . LEU A 1 13  ? 86.373  -52.330  -30.282  1.00 50.69  ? 108 LEU A CD1 1 
ATOM   69   C CD2 . LEU A 1 13  ? 84.017  -53.010  -30.158  1.00 55.28  ? 108 LEU A CD2 1 
ATOM   70   N N   . GLU A 1 14  ? 87.319  -54.217  -33.561  1.00 42.83  ? 109 GLU A N   1 
ATOM   71   C CA  . GLU A 1 14  ? 87.560  -55.623  -33.826  1.00 41.50  ? 109 GLU A CA  1 
ATOM   72   C C   . GLU A 1 14  ? 86.912  -56.443  -32.719  1.00 39.41  ? 109 GLU A C   1 
ATOM   73   O O   . GLU A 1 14  ? 87.236  -56.240  -31.559  1.00 38.64  ? 109 GLU A O   1 
ATOM   74   C CB  . GLU A 1 14  ? 89.051  -55.902  -33.881  1.00 43.38  ? 109 GLU A CB  1 
ATOM   75   C CG  . GLU A 1 14  ? 89.706  -55.362  -35.141  1.00 49.93  ? 109 GLU A CG  1 
ATOM   76   C CD  . GLU A 1 14  ? 91.234  -55.567  -35.174  1.00 53.27  ? 109 GLU A CD  1 
ATOM   77   O OE1 . GLU A 1 14  ? 91.889  -54.738  -35.861  1.00 52.33  ? 109 GLU A OE1 1 
ATOM   78   O OE2 . GLU A 1 14  ? 91.759  -56.532  -34.525  1.00 46.93  ? 109 GLU A OE2 1 
ATOM   79   N N   . VAL A 1 15  ? 86.015  -57.362  -33.083  1.00 35.37  ? 110 VAL A N   1 
ATOM   80   C CA  . VAL A 1 15  ? 85.330  -58.188  -32.110  1.00 35.95  ? 110 VAL A CA  1 
ATOM   81   C C   . VAL A 1 15  ? 85.391  -59.659  -32.455  1.00 36.42  ? 110 VAL A C   1 
ATOM   82   O O   . VAL A 1 15  ? 85.389  -60.052  -33.609  1.00 40.14  ? 110 VAL A O   1 
ATOM   83   C CB  . VAL A 1 15  ? 83.859  -57.775  -31.921  1.00 39.47  ? 110 VAL A CB  1 
ATOM   84   C CG1 . VAL A 1 15  ? 83.758  -56.286  -31.579  1.00 42.52  ? 110 VAL A CG1 1 
ATOM   85   C CG2 . VAL A 1 15  ? 83.014  -58.074  -33.150  1.00 39.63  ? 110 VAL A CG2 1 
ATOM   86   N N   . ARG A 1 16  ? 85.446  -60.467  -31.422  1.00 39.59  ? 111 ARG A N   1 
ATOM   87   C CA  . ARG A 1 16  ? 85.335  -61.898  -31.533  1.00 41.97  ? 111 ARG A CA  1 
ATOM   88   C C   . ARG A 1 16  ? 83.837  -62.150  -31.673  1.00 39.97  ? 111 ARG A C   1 
ATOM   89   O O   . ARG A 1 16  ? 83.063  -61.631  -30.868  1.00 36.64  ? 111 ARG A O   1 
ATOM   90   C CB  . ARG A 1 16  ? 85.933  -62.550  -30.281  1.00 49.99  ? 111 ARG A CB  1 
ATOM   91   C CG  . ARG A 1 16  ? 86.854  -63.713  -30.607  1.00 64.81  ? 111 ARG A CG  1 
ATOM   92   C CD  . ARG A 1 16  ? 87.520  -64.369  -29.393  1.00 72.19  ? 111 ARG A CD  1 
ATOM   93   N NE  . ARG A 1 16  ? 88.553  -65.314  -29.852  1.00 79.19  ? 111 ARG A NE  1 
ATOM   94   C CZ  . ARG A 1 16  ? 89.761  -64.970  -30.313  1.00 80.24  ? 111 ARG A CZ  1 
ATOM   95   N NH1 . ARG A 1 16  ? 90.145  -63.692  -30.366  1.00 80.35  ? 111 ARG A NH1 1 
ATOM   96   N NH2 . ARG A 1 16  ? 90.606  -65.914  -30.720  1.00 79.41  ? 111 ARG A NH2 1 
ATOM   97   N N   . VAL A 1 17  ? 83.404  -62.903  -32.687  1.00 36.73  ? 112 VAL A N   1 
ATOM   98   C CA  . VAL A 1 17  ? 81.965  -63.079  -32.908  1.00 37.71  ? 112 VAL A CA  1 
ATOM   99   C C   . VAL A 1 17  ? 81.245  -63.723  -31.695  1.00 38.71  ? 112 VAL A C   1 
ATOM   100  O O   . VAL A 1 17  ? 80.052  -63.478  -31.503  1.00 36.74  ? 112 VAL A O   1 
ATOM   101  C CB  . VAL A 1 17  ? 81.564  -63.813  -34.235  1.00 41.43  ? 112 VAL A CB  1 
ATOM   102  C CG1 . VAL A 1 17  ? 82.419  -63.407  -35.432  1.00 44.56  ? 112 VAL A CG1 1 
ATOM   103  C CG2 . VAL A 1 17  ? 81.620  -65.298  -34.085  1.00 42.13  ? 112 VAL A CG2 1 
ATOM   104  N N   . SER A 1 18  ? 81.974  -64.497  -30.883  1.00 36.54  ? 113 SER A N   1 
ATOM   105  C CA  . SER A 1 18  ? 81.420  -65.088  -29.661  1.00 39.91  ? 113 SER A CA  1 
ATOM   106  C C   . SER A 1 18  ? 81.107  -64.094  -28.534  1.00 37.23  ? 113 SER A C   1 
ATOM   107  O O   . SER A 1 18  ? 80.341  -64.407  -27.637  1.00 39.75  ? 113 SER A O   1 
ATOM   108  C CB  . SER A 1 18  ? 82.334  -66.197  -29.122  1.00 37.16  ? 113 SER A CB  1 
ATOM   109  O OG  . SER A 1 18  ? 83.569  -65.640  -28.800  1.00 40.96  ? 113 SER A OG  1 
ATOM   110  N N   . GLU A 1 19  ? 81.699  -62.922  -28.586  1.00 37.11  ? 114 GLU A N   1 
ATOM   111  C CA  . GLU A 1 19  ? 81.430  -61.860  -27.618  1.00 41.19  ? 114 GLU A CA  1 
ATOM   112  C C   . GLU A 1 19  ? 80.053  -61.237  -27.830  1.00 40.64  ? 114 GLU A C   1 
ATOM   113  O O   . GLU A 1 19  ? 79.537  -60.618  -26.913  1.00 38.75  ? 114 GLU A O   1 
ATOM   114  C CB  . GLU A 1 19  ? 82.399  -60.678  -27.789  1.00 43.48  ? 114 GLU A CB  1 
ATOM   115  C CG  . GLU A 1 19  ? 83.871  -60.884  -27.550  1.00 56.40  ? 114 GLU A CG  1 
ATOM   116  C CD  . GLU A 1 19  ? 84.684  -59.632  -27.960  1.00 67.21  ? 114 GLU A CD  1 
ATOM   117  O OE1 . GLU A 1 19  ? 84.074  -58.527  -27.979  1.00 70.81  ? 114 GLU A OE1 1 
ATOM   118  O OE2 . GLU A 1 19  ? 85.917  -59.738  -28.259  1.00 63.50  ? 114 GLU A OE2 1 
ATOM   119  N N   . LEU A 1 20  ? 79.494  -61.344  -29.039  1.00 36.83  ? 115 LEU A N   1 
ATOM   120  C CA  . LEU A 1 20  ? 78.328  -60.551  -29.415  1.00 38.78  ? 115 LEU A CA  1 
ATOM   121  C C   . LEU A 1 20  ? 76.991  -60.948  -28.795  1.00 37.63  ? 115 LEU A C   1 
ATOM   122  O O   . LEU A 1 20  ? 76.007  -60.190  -28.877  1.00 41.10  ? 115 LEU A O   1 
ATOM   123  C CB  . LEU A 1 20  ? 78.200  -60.520  -30.945  1.00 39.66  ? 115 LEU A CB  1 
ATOM   124  C CG  . LEU A 1 20  ? 79.336  -59.766  -31.632  1.00 38.80  ? 115 LEU A CG  1 
ATOM   125  C CD1 . LEU A 1 20  ? 79.302  -59.931  -33.125  1.00 39.85  ? 115 LEU A CD1 1 
ATOM   126  C CD2 . LEU A 1 20  ? 79.276  -58.299  -31.308  1.00 42.65  ? 115 LEU A CD2 1 
ATOM   127  N N   . GLY A 1 21  ? 76.948  -62.123  -28.190  1.00 36.62  ? 116 GLY A N   1 
ATOM   128  C CA  . GLY A 1 21  ? 75.718  -62.652  -27.619  1.00 37.75  ? 116 GLY A CA  1 
ATOM   129  C C   . GLY A 1 21  ? 74.669  -63.134  -28.602  1.00 36.27  ? 116 GLY A C   1 
ATOM   130  O O   . GLY A 1 21  ? 73.511  -63.297  -28.233  1.00 40.57  ? 116 GLY A O   1 
ATOM   131  N N   . LEU A 1 22  ? 75.090  -63.412  -29.830  1.00 37.78  ? 117 LEU A N   1 
ATOM   132  C CA  . LEU A 1 22  ? 74.194  -63.790  -30.924  1.00 39.48  ? 117 LEU A CA  1 
ATOM   133  C C   . LEU A 1 22  ? 74.125  -65.288  -31.190  1.00 36.57  ? 117 LEU A C   1 
ATOM   134  O O   . LEU A 1 22  ? 73.441  -65.705  -32.124  1.00 35.62  ? 117 LEU A O   1 
ATOM   135  C CB  . LEU A 1 22  ? 74.547  -63.021  -32.206  1.00 38.93  ? 117 LEU A CB  1 
ATOM   136  C CG  . LEU A 1 22  ? 74.436  -61.498  -32.063  1.00 42.88  ? 117 LEU A CG  1 
ATOM   137  C CD1 . LEU A 1 22  ? 75.004  -60.821  -33.299  1.00 46.62  ? 117 LEU A CD1 1 
ATOM   138  C CD2 . LEU A 1 22  ? 73.014  -61.025  -31.821  1.00 44.75  ? 117 LEU A CD2 1 
ATOM   139  N N   . GLY A 1 23  ? 74.778  -66.079  -30.344  1.00 33.40  ? 118 GLY A N   1 
ATOM   140  C CA  . GLY A 1 23  ? 74.660  -67.514  -30.391  1.00 34.29  ? 118 GLY A CA  1 
ATOM   141  C C   . GLY A 1 23  ? 75.679  -68.213  -31.254  1.00 36.37  ? 118 GLY A C   1 
ATOM   142  O O   . GLY A 1 23  ? 75.584  -69.420  -31.450  1.00 35.82  ? 118 GLY A O   1 
ATOM   143  N N   . TYR A 1 24  ? 76.677  -67.471  -31.716  1.00 38.20  ? 119 TYR A N   1 
ATOM   144  C CA  . TYR A 1 24  ? 77.742  -68.006  -32.549  1.00 39.42  ? 119 TYR A CA  1 
ATOM   145  C C   . TYR A 1 24  ? 78.956  -68.399  -31.733  1.00 38.45  ? 119 TYR A C   1 
ATOM   146  O O   . TYR A 1 24  ? 79.741  -67.558  -31.294  1.00 39.00  ? 119 TYR A O   1 
ATOM   147  C CB  . TYR A 1 24  ? 78.148  -66.973  -33.608  1.00 44.02  ? 119 TYR A CB  1 
ATOM   148  C CG  . TYR A 1 24  ? 76.993  -66.519  -34.470  1.00 46.36  ? 119 TYR A CG  1 
ATOM   149  C CD1 . TYR A 1 24  ? 76.342  -67.422  -35.314  1.00 50.13  ? 119 TYR A CD1 1 
ATOM   150  C CD2 . TYR A 1 24  ? 76.548  -65.192  -34.439  1.00 48.20  ? 119 TYR A CD2 1 
ATOM   151  C CE1 . TYR A 1 24  ? 75.267  -67.027  -36.098  1.00 53.78  ? 119 TYR A CE1 1 
ATOM   152  C CE2 . TYR A 1 24  ? 75.468  -64.793  -35.202  1.00 51.10  ? 119 TYR A CE2 1 
ATOM   153  C CZ  . TYR A 1 24  ? 74.846  -65.711  -36.043  1.00 54.21  ? 119 TYR A CZ  1 
ATOM   154  O OH  . TYR A 1 24  ? 73.793  -65.324  -36.824  1.00 61.06  ? 119 TYR A OH  1 
ATOM   155  N N   . ALA A 1 25  ? 79.114  -69.693  -31.540  1.00 38.36  ? 120 ALA A N   1 
ATOM   156  C CA  . ALA A 1 25  ? 80.287  -70.235  -30.894  1.00 40.68  ? 120 ALA A CA  1 
ATOM   157  C C   . ALA A 1 25  ? 81.492  -70.239  -31.846  1.00 41.54  ? 120 ALA A C   1 
ATOM   158  O O   . ALA A 1 25  ? 81.901  -71.279  -32.315  1.00 40.05  ? 120 ALA A O   1 
ATOM   159  C CB  . ALA A 1 25  ? 79.978  -71.648  -30.417  1.00 42.07  ? 120 ALA A CB  1 
ATOM   160  N N   . SER A 1 26  ? 82.081  -69.075  -32.091  1.00 43.48  ? 121 SER A N   1 
ATOM   161  C CA  . SER A 1 26  ? 83.235  -68.967  -32.991  1.00 41.39  ? 121 SER A CA  1 
ATOM   162  C C   . SER A 1 26  ? 84.316  -68.048  -32.480  1.00 40.55  ? 121 SER A C   1 
ATOM   163  O O   . SER A 1 26  ? 84.026  -66.981  -31.935  1.00 42.99  ? 121 SER A O   1 
ATOM   164  C CB  . SER A 1 26  ? 82.766  -68.454  -34.349  1.00 42.22  ? 121 SER A CB  1 
ATOM   165  O OG  . SER A 1 26  ? 83.864  -68.227  -35.213  1.00 41.04  ? 121 SER A OG  1 
ATOM   166  N N   . ASP A 1 27  ? 85.567  -68.430  -32.711  1.00 40.11  ? 122 ASP A N   1 
ATOM   167  C CA  . ASP A 1 27  ? 86.694  -67.586  -32.373  1.00 40.32  ? 122 ASP A CA  1 
ATOM   168  C C   . ASP A 1 27  ? 87.100  -66.621  -33.514  1.00 36.71  ? 122 ASP A C   1 
ATOM   169  O O   . ASP A 1 27  ? 88.090  -65.911  -33.410  1.00 35.44  ? 122 ASP A O   1 
ATOM   170  C CB  . ASP A 1 27  ? 87.847  -68.465  -31.906  1.00 46.59  ? 122 ASP A CB  1 
ATOM   171  C CG  . ASP A 1 27  ? 87.555  -69.151  -30.548  1.00 59.63  ? 122 ASP A CG  1 
ATOM   172  O OD1 . ASP A 1 27  ? 86.806  -68.576  -29.685  1.00 65.18  ? 122 ASP A OD1 1 
ATOM   173  O OD2 . ASP A 1 27  ? 88.058  -70.286  -30.355  1.00 64.69  ? 122 ASP A OD2 1 
ATOM   174  N N   . GLU A 1 28  ? 86.339  -66.583  -34.598  1.00 32.26  ? 123 GLU A N   1 
ATOM   175  C CA  . GLU A 1 28  ? 86.624  -65.636  -35.653  1.00 34.36  ? 123 GLU A CA  1 
ATOM   176  C C   . GLU A 1 28  ? 86.411  -64.194  -35.193  1.00 36.86  ? 123 GLU A C   1 
ATOM   177  O O   . GLU A 1 28  ? 85.672  -63.936  -34.235  1.00 32.43  ? 123 GLU A O   1 
ATOM   178  C CB  . GLU A 1 28  ? 85.803  -65.932  -36.900  1.00 33.40  ? 123 GLU A CB  1 
ATOM   179  C CG  . GLU A 1 28  ? 86.317  -67.153  -37.669  1.00 34.70  ? 123 GLU A CG  1 
ATOM   180  C CD  . GLU A 1 28  ? 86.145  -67.037  -39.171  1.00 39.07  ? 123 GLU A CD  1 
ATOM   181  O OE1 . GLU A 1 28  ? 86.194  -65.871  -39.700  1.00 39.93  ? 123 GLU A OE1 1 
ATOM   182  O OE2 . GLU A 1 28  ? 85.932  -68.116  -39.816  1.00 32.17  ? 123 GLU A OE2 1 
ATOM   183  N N   . THR A 1 29  ? 87.114  -63.288  -35.866  1.00 36.96  ? 124 THR A N   1 
ATOM   184  C CA  . THR A 1 29  ? 87.023  -61.855  -35.642  1.00 38.56  ? 124 THR A CA  1 
ATOM   185  C C   . THR A 1 29  ? 86.230  -61.211  -36.791  1.00 37.21  ? 124 THR A C   1 
ATOM   186  O O   . THR A 1 29  ? 86.344  -61.637  -37.937  1.00 35.12  ? 124 THR A O   1 
ATOM   187  C CB  . THR A 1 29  ? 88.450  -61.254  -35.566  1.00 39.57  ? 124 THR A CB  1 
ATOM   188  O OG1 . THR A 1 29  ? 89.120  -61.855  -34.472  1.00 40.35  ? 124 THR A OG1 1 
ATOM   189  C CG2 . THR A 1 29  ? 88.476  -59.716  -35.345  1.00 39.73  ? 124 THR A CG2 1 
ATOM   190  N N   . VAL A 1 30  ? 85.427  -60.198  -36.475  1.00 36.96  ? 125 VAL A N   1 
ATOM   191  C CA  . VAL A 1 30  ? 84.856  -59.310  -37.492  1.00 37.60  ? 125 VAL A CA  1 
ATOM   192  C C   . VAL A 1 30  ? 85.192  -57.869  -37.165  1.00 37.59  ? 125 VAL A C   1 
ATOM   193  O O   . VAL A 1 30  ? 85.474  -57.516  -36.008  1.00 39.86  ? 125 VAL A O   1 
ATOM   194  C CB  . VAL A 1 30  ? 83.328  -59.472  -37.665  1.00 40.55  ? 125 VAL A CB  1 
ATOM   195  C CG1 . VAL A 1 30  ? 82.988  -60.861  -38.176  1.00 43.79  ? 125 VAL A CG1 1 
ATOM   196  C CG2 . VAL A 1 30  ? 82.575  -59.216  -36.373  1.00 41.27  ? 125 VAL A CG2 1 
ATOM   197  N N   . LEU A 1 31  ? 85.204  -57.039  -38.195  1.00 38.37  ? 126 LEU A N   1 
ATOM   198  C CA  . LEU A 1 31  ? 85.275  -55.613  -38.008  1.00 37.82  ? 126 LEU A CA  1 
ATOM   199  C C   . LEU A 1 31  ? 83.840  -55.143  -37.848  1.00 37.10  ? 126 LEU A C   1 
ATOM   200  O O   . LEU A 1 31  ? 83.065  -55.082  -38.791  1.00 36.73  ? 126 LEU A O   1 
ATOM   201  C CB  . LEU A 1 31  ? 85.935  -54.918  -39.182  1.00 41.67  ? 126 LEU A CB  1 
ATOM   202  C CG  . LEU A 1 31  ? 86.352  -53.454  -38.963  1.00 45.81  ? 126 LEU A CG  1 
ATOM   203  C CD1 . LEU A 1 31  ? 87.448  -53.302  -37.915  1.00 45.82  ? 126 LEU A CD1 1 
ATOM   204  C CD2 . LEU A 1 31  ? 86.847  -52.881  -40.278  1.00 48.95  ? 126 LEU A CD2 1 
ATOM   205  N N   . PHE A 1 32  ? 83.487  -54.851  -36.624  1.00 34.20  ? 127 PHE A N   1 
ATOM   206  C CA  . PHE A 1 32  ? 82.198  -54.300  -36.302  1.00 36.70  ? 127 PHE A CA  1 
ATOM   207  C C   . PHE A 1 32  ? 82.213  -52.773  -36.441  1.00 37.76  ? 127 PHE A C   1 
ATOM   208  O O   . PHE A 1 32  ? 82.952  -52.086  -35.750  1.00 39.56  ? 127 PHE A O   1 
ATOM   209  C CB  . PHE A 1 32  ? 81.850  -54.700  -34.875  1.00 35.63  ? 127 PHE A CB  1 
ATOM   210  C CG  . PHE A 1 32  ? 80.498  -54.283  -34.455  1.00 36.86  ? 127 PHE A CG  1 
ATOM   211  C CD1 . PHE A 1 32  ? 79.382  -54.925  -34.946  1.00 36.25  ? 127 PHE A CD1 1 
ATOM   212  C CD2 . PHE A 1 32  ? 80.334  -53.238  -33.542  1.00 38.73  ? 127 PHE A CD2 1 
ATOM   213  C CE1 . PHE A 1 32  ? 78.104  -54.539  -34.547  1.00 37.01  ? 127 PHE A CE1 1 
ATOM   214  C CE2 . PHE A 1 32  ? 79.071  -52.857  -33.132  1.00 36.13  ? 127 PHE A CE2 1 
ATOM   215  C CZ  . PHE A 1 32  ? 77.959  -53.498  -33.648  1.00 37.35  ? 127 PHE A CZ  1 
ATOM   216  N N   . ARG A 1 33  ? 81.393  -52.253  -37.341  1.00 38.60  ? 128 ARG A N   1 
ATOM   217  C CA  . ARG A 1 33  ? 81.223  -50.829  -37.484  1.00 38.86  ? 128 ARG A CA  1 
ATOM   218  C C   . ARG A 1 33  ? 79.874  -50.370  -36.935  1.00 38.45  ? 128 ARG A C   1 
ATOM   219  O O   . ARG A 1 33  ? 78.845  -51.002  -37.202  1.00 37.64  ? 128 ARG A O   1 
ATOM   220  C CB  . ARG A 1 33  ? 81.336  -50.414  -38.936  1.00 42.92  ? 128 ARG A CB  1 
ATOM   221  C CG  . ARG A 1 33  ? 82.655  -50.762  -39.578  1.00 45.76  ? 128 ARG A CG  1 
ATOM   222  C CD  . ARG A 1 33  ? 82.992  -49.786  -40.688  1.00 50.81  ? 128 ARG A CD  1 
ATOM   223  N NE  . ARG A 1 33  ? 84.244  -50.196  -41.318  1.00 63.16  ? 128 ARG A NE  1 
ATOM   224  C CZ  . ARG A 1 33  ? 84.353  -51.008  -42.375  1.00 67.60  ? 128 ARG A CZ  1 
ATOM   225  N NH1 . ARG A 1 33  ? 83.273  -51.487  -42.986  1.00 76.66  ? 128 ARG A NH1 1 
ATOM   226  N NH2 . ARG A 1 33  ? 85.555  -51.333  -42.838  1.00 62.85  ? 128 ARG A NH2 1 
ATOM   227  N N   . TYR A 1 34  ? 79.888  -49.250  -36.213  1.00 35.87  ? 129 TYR A N   1 
ATOM   228  C CA  . TYR A 1 34  ? 78.692  -48.698  -35.610  1.00 36.00  ? 129 TYR A CA  1 
ATOM   229  C C   . TYR A 1 34  ? 78.677  -47.171  -35.668  1.00 37.33  ? 129 TYR A C   1 
ATOM   230  O O   . TYR A 1 34  ? 79.670  -46.537  -36.004  1.00 41.79  ? 129 TYR A O   1 
ATOM   231  C CB  . TYR A 1 34  ? 78.523  -49.215  -34.188  1.00 35.73  ? 129 TYR A CB  1 
ATOM   232  C CG  . TYR A 1 34  ? 79.639  -48.814  -33.274  1.00 40.17  ? 129 TYR A CG  1 
ATOM   233  C CD1 . TYR A 1 34  ? 80.876  -49.474  -33.305  1.00 40.38  ? 129 TYR A CD1 1 
ATOM   234  C CD2 . TYR A 1 34  ? 79.487  -47.740  -32.392  1.00 41.41  ? 129 TYR A CD2 1 
ATOM   235  C CE1 . TYR A 1 34  ? 81.909  -49.085  -32.471  1.00 41.56  ? 129 TYR A CE1 1 
ATOM   236  C CE2 . TYR A 1 34  ? 80.512  -47.363  -31.553  1.00 41.65  ? 129 TYR A CE2 1 
ATOM   237  C CZ  . TYR A 1 34  ? 81.717  -48.026  -31.606  1.00 40.62  ? 129 TYR A CZ  1 
ATOM   238  O OH  . TYR A 1 34  ? 82.718  -47.627  -30.779  1.00 48.31  ? 129 TYR A OH  1 
ATOM   239  N N   . CYS A 1 35  ? 77.506  -46.603  -35.423  1.00 37.94  ? 130 CYS A N   1 
ATOM   240  C CA  . CYS A 1 35  ? 77.301  -45.151  -35.431  1.00 38.52  ? 130 CYS A CA  1 
ATOM   241  C C   . CYS A 1 35  ? 77.298  -44.627  -34.005  1.00 35.96  ? 130 CYS A C   1 
ATOM   242  O O   . CYS A 1 35  ? 76.557  -45.131  -33.171  1.00 35.77  ? 130 CYS A O   1 
ATOM   243  C CB  . CYS A 1 35  ? 75.987  -44.807  -36.141  1.00 39.64  ? 130 CYS A CB  1 
ATOM   244  S SG  . CYS A 1 35  ? 76.014  -45.254  -37.902  1.00 44.05  ? 130 CYS A SG  1 
ATOM   245  N N   . ALA A 1 36  ? 78.125  -43.615  -33.745  1.00 34.62  ? 131 ALA A N   1 
ATOM   246  C CA  . ALA A 1 36  ? 78.238  -42.983  -32.420  1.00 33.91  ? 131 ALA A CA  1 
ATOM   247  C C   . ALA A 1 36  ? 78.709  -41.538  -32.561  1.00 35.71  ? 131 ALA A C   1 
ATOM   248  O O   . ALA A 1 36  ? 79.168  -41.117  -33.618  1.00 34.79  ? 131 ALA A O   1 
ATOM   249  C CB  . ALA A 1 36  ? 79.185  -43.756  -31.518  1.00 34.00  ? 131 ALA A CB  1 
ATOM   250  N N   . GLY A 1 37  ? 78.560  -40.776  -31.484  1.00 39.13  ? 132 GLY A N   1 
ATOM   251  C CA  . GLY A 1 37  ? 78.879  -39.369  -31.496  1.00 42.86  ? 132 GLY A CA  1 
ATOM   252  C C   . GLY A 1 37  ? 77.678  -38.438  -31.417  1.00 46.49  ? 132 GLY A C   1 
ATOM   253  O O   . GLY A 1 37  ? 76.521  -38.824  -31.610  1.00 48.62  ? 132 GLY A O   1 
ATOM   254  N N   . ALA A 1 38  ? 77.999  -37.184  -31.142  1.00 47.93  ? 133 ALA A N   1 
ATOM   255  C CA  . ALA A 1 38  ? 77.026  -36.143  -30.922  1.00 46.35  ? 133 ALA A CA  1 
ATOM   256  C C   . ALA A 1 38  ? 76.549  -35.567  -32.244  1.00 42.93  ? 133 ALA A C   1 
ATOM   257  O O   . ALA A 1 38  ? 77.328  -35.431  -33.182  1.00 44.51  ? 133 ALA A O   1 
ATOM   258  C CB  . ALA A 1 38  ? 77.650  -35.059  -30.067  1.00 48.71  ? 133 ALA A CB  1 
ATOM   259  N N   . CYS A 1 39  ? 75.250  -35.293  -32.302  1.00 43.71  ? 134 CYS A N   1 
ATOM   260  C CA  . CYS A 1 39  ? 74.610  -34.566  -33.362  1.00 44.20  ? 134 CYS A CA  1 
ATOM   261  C C   . CYS A 1 39  ? 74.735  -33.088  -32.978  1.00 47.73  ? 134 CYS A C   1 
ATOM   262  O O   . CYS A 1 39  ? 74.129  -32.651  -32.015  1.00 48.80  ? 134 CYS A O   1 
ATOM   263  C CB  . CYS A 1 39  ? 73.140  -34.994  -33.449  1.00 46.61  ? 134 CYS A CB  1 
ATOM   264  S SG  . CYS A 1 39  ? 72.910  -36.685  -34.093  1.00 50.04  ? 134 CYS A SG  1 
ATOM   265  N N   . GLU A 1 40  ? 75.544  -32.348  -33.722  1.00 47.06  ? 135 GLU A N   1 
ATOM   266  C CA  . GLU A 1 40  ? 75.968  -30.997  -33.376  1.00 53.00  ? 135 GLU A CA  1 
ATOM   267  C C   . GLU A 1 40  ? 75.296  -29.845  -34.140  1.00 47.13  ? 135 GLU A C   1 
ATOM   268  O O   . GLU A 1 40  ? 75.520  -28.697  -33.816  1.00 50.97  ? 135 GLU A O   1 
ATOM   269  C CB  . GLU A 1 40  ? 77.484  -30.899  -33.591  1.00 61.32  ? 135 GLU A CB  1 
ATOM   270  C CG  . GLU A 1 40  ? 78.287  -31.718  -32.585  1.00 68.62  ? 135 GLU A CG  1 
ATOM   271  C CD  . GLU A 1 40  ? 79.795  -31.561  -32.754  1.00 75.88  ? 135 GLU A CD  1 
ATOM   272  O OE1 . GLU A 1 40  ? 80.512  -31.946  -31.794  1.00 80.14  ? 135 GLU A OE1 1 
ATOM   273  O OE2 . GLU A 1 40  ? 80.254  -31.077  -33.840  1.00 71.61  ? 135 GLU A OE2 1 
ATOM   274  N N   . ALA A 1 41  ? 74.482  -30.129  -35.136  1.00 39.88  ? 136 ALA A N   1 
ATOM   275  C CA  . ALA A 1 41  ? 73.795  -29.078  -35.871  1.00 38.49  ? 136 ALA A CA  1 
ATOM   276  C C   . ALA A 1 41  ? 72.907  -28.241  -34.974  1.00 35.60  ? 136 ALA A C   1 
ATOM   277  O O   . ALA A 1 41  ? 72.460  -28.678  -33.947  1.00 34.62  ? 136 ALA A O   1 
ATOM   278  C CB  . ALA A 1 41  ? 72.962  -29.629  -37.018  1.00 36.14  ? 136 ALA A CB  1 
ATOM   279  N N   . ALA A 1 42  ? 72.654  -27.023  -35.421  1.00 33.85  ? 137 ALA A N   1 
ATOM   280  C CA  . ALA A 1 42  ? 71.733  -26.144  -34.762  1.00 34.33  ? 137 ALA A CA  1 
ATOM   281  C C   . ALA A 1 42  ? 70.401  -26.838  -34.530  1.00 33.23  ? 137 ALA A C   1 
ATOM   282  O O   . ALA A 1 42  ? 69.922  -27.619  -35.370  1.00 35.53  ? 137 ALA A O   1 
ATOM   283  C CB  . ALA A 1 42  ? 71.538  -24.881  -35.588  1.00 33.23  ? 137 ALA A CB  1 
ATOM   284  N N   . ALA A 1 43  ? 69.819  -26.545  -33.383  1.00 33.43  ? 138 ALA A N   1 
ATOM   285  C CA  . ALA A 1 43  ? 68.518  -27.042  -33.002  1.00 35.83  ? 138 ALA A CA  1 
ATOM   286  C C   . ALA A 1 43  ? 67.475  -26.641  -34.012  1.00 34.10  ? 138 ALA A C   1 
ATOM   287  O O   . ALA A 1 43  ? 67.436  -25.505  -34.420  1.00 35.08  ? 138 ALA A O   1 
ATOM   288  C CB  . ALA A 1 43  ? 68.132  -26.495  -31.635  1.00 38.57  ? 138 ALA A CB  1 
ATOM   289  N N   . ARG A 1 44  ? 66.658  -27.594  -34.422  1.00 33.56  ? 139 ARG A N   1 
ATOM   290  C CA  . ARG A 1 44  ? 65.596  -27.338  -35.369  1.00 33.25  ? 139 ARG A CA  1 
ATOM   291  C C   . ARG A 1 44  ? 64.449  -26.597  -34.714  1.00 33.06  ? 139 ARG A C   1 
ATOM   292  O O   . ARG A 1 44  ? 64.175  -26.732  -33.522  1.00 35.59  ? 139 ARG A O   1 
ATOM   293  C CB  . ARG A 1 44  ? 65.032  -28.653  -35.880  1.00 33.69  ? 139 ARG A CB  1 
ATOM   294  C CG  . ARG A 1 44  ? 65.889  -29.404  -36.868  1.00 33.96  ? 139 ARG A CG  1 
ATOM   295  C CD  . ARG A 1 44  ? 65.096  -30.599  -37.400  1.00 33.76  ? 139 ARG A CD  1 
ATOM   296  N NE  . ARG A 1 44  ? 65.632  -31.077  -38.654  1.00 33.90  ? 139 ARG A NE  1 
ATOM   297  C CZ  . ARG A 1 44  ? 65.366  -30.544  -39.843  1.00 36.24  ? 139 ARG A CZ  1 
ATOM   298  N NH1 . ARG A 1 44  ? 64.502  -29.530  -39.979  1.00 36.41  ? 139 ARG A NH1 1 
ATOM   299  N NH2 . ARG A 1 44  ? 65.909  -31.075  -40.924  1.00 34.57  ? 139 ARG A NH2 1 
ATOM   300  N N   . VAL A 1 45  ? 63.722  -25.873  -35.525  1.00 34.47  ? 140 VAL A N   1 
ATOM   301  C CA  . VAL A 1 45  ? 62.586  -25.123  -35.040  1.00 36.78  ? 140 VAL A CA  1 
ATOM   302  C C   . VAL A 1 45  ? 61.475  -26.118  -34.646  1.00 35.80  ? 140 VAL A C   1 
ATOM   303  O O   . VAL A 1 45  ? 60.820  -25.944  -33.641  1.00 37.35  ? 140 VAL A O   1 
ATOM   304  C CB  . VAL A 1 45  ? 62.211  -24.037  -36.078  1.00 38.41  ? 140 VAL A CB  1 
ATOM   305  C CG1 . VAL A 1 45  ? 61.231  -24.536  -37.106  1.00 43.29  ? 140 VAL A CG1 1 
ATOM   306  C CG2 . VAL A 1 45  ? 61.668  -22.824  -35.402  1.00 44.11  ? 140 VAL A CG2 1 
ATOM   307  N N   . TYR A 1 46  ? 61.319  -27.180  -35.432  1.00 34.91  ? 141 TYR A N   1 
ATOM   308  C CA  . TYR A 1 46  ? 60.520  -28.362  -35.069  1.00 34.65  ? 141 TYR A CA  1 
ATOM   309  C C   . TYR A 1 46  ? 60.826  -28.908  -33.668  1.00 35.61  ? 141 TYR A C   1 
ATOM   310  O O   . TYR A 1 46  ? 59.915  -29.183  -32.896  1.00 35.21  ? 141 TYR A O   1 
ATOM   311  C CB  . TYR A 1 46  ? 60.758  -29.474  -36.081  1.00 32.65  ? 141 TYR A CB  1 
ATOM   312  C CG  . TYR A 1 46  ? 60.181  -30.803  -35.690  1.00 35.16  ? 141 TYR A CG  1 
ATOM   313  C CD1 . TYR A 1 46  ? 58.837  -31.091  -35.923  1.00 37.53  ? 141 TYR A CD1 1 
ATOM   314  C CD2 . TYR A 1 46  ? 60.976  -31.803  -35.131  1.00 35.56  ? 141 TYR A CD2 1 
ATOM   315  C CE1 . TYR A 1 46  ? 58.290  -32.304  -35.576  1.00 35.95  ? 141 TYR A CE1 1 
ATOM   316  C CE2 . TYR A 1 46  ? 60.431  -33.028  -34.783  1.00 37.07  ? 141 TYR A CE2 1 
ATOM   317  C CZ  . TYR A 1 46  ? 59.082  -33.262  -35.010  1.00 36.72  ? 141 TYR A CZ  1 
ATOM   318  O OH  . TYR A 1 46  ? 58.523  -34.455  -34.698  1.00 35.92  ? 141 TYR A OH  1 
ATOM   319  N N   . ASP A 1 47  ? 62.103  -29.087  -33.355  1.00 34.45  ? 142 ASP A N   1 
ATOM   320  C CA  . ASP A 1 47  ? 62.472  -29.635  -32.057  1.00 35.55  ? 142 ASP A CA  1 
ATOM   321  C C   . ASP A 1 47  ? 62.212  -28.640  -30.918  1.00 36.83  ? 142 ASP A C   1 
ATOM   322  O O   . ASP A 1 47  ? 61.719  -29.028  -29.880  1.00 35.28  ? 142 ASP A O   1 
ATOM   323  C CB  . ASP A 1 47  ? 63.919  -30.149  -32.061  1.00 35.70  ? 142 ASP A CB  1 
ATOM   324  C CG  . ASP A 1 47  ? 64.058  -31.525  -32.770  1.00 39.08  ? 142 ASP A CG  1 
ATOM   325  O OD1 . ASP A 1 47  ? 63.142  -32.373  -32.646  1.00 41.54  ? 142 ASP A OD1 1 
ATOM   326  O OD2 . ASP A 1 47  ? 65.063  -31.759  -33.460  1.00 36.22  ? 142 ASP A OD2 1 
ATOM   327  N N   . LEU A 1 48  ? 62.517  -27.362  -31.125  1.00 37.01  ? 143 LEU A N   1 
ATOM   328  C CA  . LEU A 1 48  ? 62.265  -26.351  -30.108  1.00 37.50  ? 143 LEU A CA  1 
ATOM   329  C C   . LEU A 1 48  ? 60.761  -26.242  -29.806  1.00 37.47  ? 143 LEU A C   1 
ATOM   330  O O   . LEU A 1 48  ? 60.346  -26.202  -28.640  1.00 37.59  ? 143 LEU A O   1 
ATOM   331  C CB  . LEU A 1 48  ? 62.822  -25.002  -30.540  1.00 38.66  ? 143 LEU A CB  1 
ATOM   332  C CG  . LEU A 1 48  ? 64.190  -24.500  -30.069  1.00 41.40  ? 143 LEU A CG  1 
ATOM   333  C CD1 . LEU A 1 48  ? 65.091  -25.536  -29.448  1.00 44.21  ? 143 LEU A CD1 1 
ATOM   334  C CD2 . LEU A 1 48  ? 64.911  -23.834  -31.211  1.00 44.67  ? 143 LEU A CD2 1 
ATOM   335  N N   . GLY A 1 49  ? 59.956  -26.233  -30.855  1.00 35.68  ? 144 GLY A N   1 
ATOM   336  C CA  . GLY A 1 49  ? 58.503  -26.249  -30.713  1.00 37.62  ? 144 GLY A CA  1 
ATOM   337  C C   . GLY A 1 49  ? 58.002  -27.465  -29.929  1.00 36.57  ? 144 GLY A C   1 
ATOM   338  O O   . GLY A 1 49  ? 57.189  -27.344  -29.013  1.00 33.86  ? 144 GLY A O   1 
ATOM   339  N N   . LEU A 1 50  ? 58.515  -28.629  -30.303  1.00 35.36  ? 145 LEU A N   1 
ATOM   340  C CA  . LEU A 1 50  ? 58.126  -29.893  -29.712  1.00 36.23  ? 145 LEU A CA  1 
ATOM   341  C C   . LEU A 1 50  ? 58.550  -29.964  -28.253  1.00 37.10  ? 145 LEU A C   1 
ATOM   342  O O   . LEU A 1 50  ? 57.826  -30.489  -27.446  1.00 42.55  ? 145 LEU A O   1 
ATOM   343  C CB  . LEU A 1 50  ? 58.727  -31.050  -30.522  1.00 37.03  ? 145 LEU A CB  1 
ATOM   344  C CG  . LEU A 1 50  ? 58.193  -32.479  -30.420  1.00 37.83  ? 145 LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 50  ? 56.725  -32.556  -30.776  1.00 37.93  ? 145 LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 50  ? 58.978  -33.383  -31.362  1.00 41.10  ? 145 LEU A CD2 1 
ATOM   347  N N   . ARG A 1 51  ? 59.705  -29.408  -27.906  1.00 38.13  ? 146 ARG A N   1 
ATOM   348  C CA  . ARG A 1 51  ? 60.145  -29.408  -26.511  1.00 38.35  ? 146 ARG A CA  1 
ATOM   349  C C   . ARG A 1 51  ? 59.232  -28.531  -25.643  1.00 41.38  ? 146 ARG A C   1 
ATOM   350  O O   . ARG A 1 51  ? 58.979  -28.834  -24.475  1.00 44.01  ? 146 ARG A O   1 
ATOM   351  C CB  . ARG A 1 51  ? 61.637  -29.010  -26.360  1.00 38.31  ? 146 ARG A CB  1 
ATOM   352  C CG  . ARG A 1 51  ? 62.568  -29.790  -27.280  1.00 43.68  ? 146 ARG A CG  1 
ATOM   353  C CD  . ARG A 1 51  ? 64.004  -30.032  -26.867  1.00 42.22  ? 146 ARG A CD  1 
ATOM   354  N NE  . ARG A 1 51  ? 64.979  -29.117  -27.409  1.00 48.11  ? 146 ARG A NE  1 
ATOM   355  C CZ  . ARG A 1 51  ? 65.972  -29.387  -28.261  1.00 49.28  ? 146 ARG A CZ  1 
ATOM   356  N NH1 . ARG A 1 51  ? 66.799  -28.404  -28.594  1.00 61.86  ? 146 ARG A NH1 1 
ATOM   357  N NH2 . ARG A 1 51  ? 66.161  -30.571  -28.802  1.00 44.99  ? 146 ARG A NH2 1 
ATOM   358  N N   . ARG A 1 52  ? 58.777  -27.423  -26.216  1.00 43.94  ? 147 ARG A N   1 
ATOM   359  C CA  . ARG A 1 52  ? 57.891  -26.472  -25.539  1.00 43.03  ? 147 ARG A CA  1 
ATOM   360  C C   . ARG A 1 52  ? 56.483  -27.079  -25.335  1.00 42.99  ? 147 ARG A C   1 
ATOM   361  O O   . ARG A 1 52  ? 55.939  -27.023  -24.256  1.00 38.35  ? 147 ARG A O   1 
ATOM   362  C CB  . ARG A 1 52  ? 57.838  -25.161  -26.345  1.00 40.94  ? 147 ARG A CB  1 
ATOM   363  C CG  . ARG A 1 52  ? 56.688  -24.213  -26.054  1.00 39.45  ? 147 ARG A CG  1 
ATOM   364  C CD  . ARG A 1 52  ? 56.688  -23.679  -24.653  1.00 40.29  ? 147 ARG A CD  1 
ATOM   365  N NE  . ARG A 1 52  ? 57.580  -22.544  -24.423  1.00 42.88  ? 147 ARG A NE  1 
ATOM   366  C CZ  . ARG A 1 52  ? 57.247  -21.255  -24.508  1.00 43.30  ? 147 ARG A CZ  1 
ATOM   367  N NH1 . ARG A 1 52  ? 56.040  -20.859  -24.889  1.00 42.10  ? 147 ARG A NH1 1 
ATOM   368  N NH2 . ARG A 1 52  ? 58.157  -20.332  -24.224  1.00 47.09  ? 147 ARG A NH2 1 
ATOM   369  N N   . LEU A 1 53  ? 55.921  -27.652  -26.392  1.00 40.78  ? 148 LEU A N   1 
ATOM   370  C CA  . LEU A 1 53  ? 54.656  -28.337  -26.306  1.00 42.65  ? 148 LEU A CA  1 
ATOM   371  C C   . LEU A 1 53  ? 54.655  -29.524  -25.326  1.00 44.67  ? 148 LEU A C   1 
ATOM   372  O O   . LEU A 1 53  ? 53.678  -29.736  -24.617  1.00 42.85  ? 148 LEU A O   1 
ATOM   373  C CB  . LEU A 1 53  ? 54.227  -28.819  -27.677  1.00 40.44  ? 148 LEU A CB  1 
ATOM   374  C CG  . LEU A 1 53  ? 53.861  -27.728  -28.671  1.00 41.41  ? 148 LEU A CG  1 
ATOM   375  C CD1 . LEU A 1 53  ? 53.676  -28.338  -30.045  1.00 42.37  ? 148 LEU A CD1 1 
ATOM   376  C CD2 . LEU A 1 53  ? 52.599  -27.004  -28.234  1.00 42.76  ? 148 LEU A CD2 1 
ATOM   377  N N   . ARG A 1 54  ? 55.739  -30.277  -25.287  1.00 45.24  ? 149 ARG A N   1 
ATOM   378  C CA  . ARG A 1 54  ? 55.866  -31.367  -24.329  1.00 49.74  ? 149 ARG A CA  1 
ATOM   379  C C   . ARG A 1 54  ? 55.871  -30.866  -22.893  1.00 50.11  ? 149 ARG A C   1 
ATOM   380  O O   . ARG A 1 54  ? 55.127  -31.377  -22.073  1.00 54.59  ? 149 ARG A O   1 
ATOM   381  C CB  . ARG A 1 54  ? 57.113  -32.166  -24.614  1.00 50.97  ? 149 ARG A CB  1 
ATOM   382  C CG  . ARG A 1 54  ? 57.429  -33.248  -23.590  1.00 52.52  ? 149 ARG A CG  1 
ATOM   383  C CD  . ARG A 1 54  ? 58.934  -33.344  -23.392  1.00 52.85  ? 149 ARG A CD  1 
ATOM   384  N NE  . ARG A 1 54  ? 59.542  -34.241  -24.366  1.00 52.40  ? 149 ARG A NE  1 
ATOM   385  C CZ  . ARG A 1 54  ? 60.795  -34.158  -24.814  1.00 50.27  ? 149 ARG A CZ  1 
ATOM   386  N NH1 . ARG A 1 54  ? 61.593  -33.171  -24.429  1.00 46.88  ? 149 ARG A NH1 1 
ATOM   387  N NH2 . ARG A 1 54  ? 61.245  -35.064  -25.685  1.00 50.59  ? 149 ARG A NH2 1 
ATOM   388  N N   . GLN A 1 55  ? 56.674  -29.856  -22.603  1.00 48.50  ? 150 GLN A N   1 
ATOM   389  C CA  . GLN A 1 55  ? 56.749  -29.311  -21.267  1.00 52.68  ? 150 GLN A CA  1 
ATOM   390  C C   . GLN A 1 55  ? 55.394  -28.801  -20.845  1.00 54.44  ? 150 GLN A C   1 
ATOM   391  O O   . GLN A 1 55  ? 54.959  -29.041  -19.731  1.00 62.50  ? 150 GLN A O   1 
ATOM   392  C CB  . GLN A 1 55  ? 57.769  -28.176  -21.186  1.00 55.12  ? 150 GLN A CB  1 
ATOM   393  C CG  . GLN A 1 55  ? 58.182  -27.814  -19.761  1.00 60.54  ? 150 GLN A CG  1 
ATOM   394  C CD  . GLN A 1 55  ? 57.237  -26.893  -18.970  1.00 67.51  ? 150 GLN A CD  1 
ATOM   395  O OE1 . GLN A 1 55  ? 57.373  -26.815  -17.747  1.00 78.39  ? 150 GLN A OE1 1 
ATOM   396  N NE2 . GLN A 1 55  ? 56.316  -26.176  -19.637  1.00 69.32  ? 150 GLN A NE2 1 
ATOM   397  N N   . ARG A 1 56  ? 54.722  -28.124  -21.760  1.00 53.85  ? 151 ARG A N   1 
ATOM   398  C CA  . ARG A 1 56  ? 53.383  -27.616  -21.528  1.00 53.89  ? 151 ARG A CA  1 
ATOM   399  C C   . ARG A 1 56  ? 52.320  -28.722  -21.483  1.00 50.40  ? 151 ARG A C   1 
ATOM   400  O O   . ARG A 1 56  ? 51.151  -28.440  -21.314  1.00 51.04  ? 151 ARG A O   1 
ATOM   401  C CB  . ARG A 1 56  ? 53.024  -26.605  -22.621  1.00 57.83  ? 151 ARG A CB  1 
ATOM   402  C CG  . ARG A 1 56  ? 52.573  -25.281  -22.060  1.00 67.29  ? 151 ARG A CG  1 
ATOM   403  C CD  . ARG A 1 56  ? 53.747  -24.423  -21.634  1.00 70.68  ? 151 ARG A CD  1 
ATOM   404  N NE  . ARG A 1 56  ? 53.433  -22.995  -21.733  1.00 80.16  ? 151 ARG A NE  1 
ATOM   405  C CZ  . ARG A 1 56  ? 53.187  -22.343  -22.879  1.00 85.02  ? 151 ARG A CZ  1 
ATOM   406  N NH1 . ARG A 1 56  ? 52.941  -21.039  -22.854  1.00 82.91  ? 151 ARG A NH1 1 
ATOM   407  N NH2 . ARG A 1 56  ? 53.168  -22.982  -24.062  1.00 89.18  ? 151 ARG A NH2 1 
ATOM   408  N N   . ARG A 1 57  ? 52.730  -29.970  -21.671  1.00 53.36  ? 152 ARG A N   1 
ATOM   409  C CA  . ARG A 1 57  ? 51.840  -31.129  -21.600  1.00 57.70  ? 152 ARG A CA  1 
ATOM   410  C C   . ARG A 1 57  ? 50.731  -31.042  -22.636  1.00 52.92  ? 152 ARG A C   1 
ATOM   411  O O   . ARG A 1 57  ? 49.595  -31.402  -22.376  1.00 54.00  ? 152 ARG A O   1 
ATOM   412  C CB  . ARG A 1 57  ? 51.232  -31.286  -20.194  1.00 60.88  ? 152 ARG A CB  1 
ATOM   413  C CG  . ARG A 1 57  ? 52.233  -31.198  -19.056  1.00 71.87  ? 152 ARG A CG  1 
ATOM   414  C CD  . ARG A 1 57  ? 52.512  -32.550  -18.435  1.00 84.25  ? 152 ARG A CD  1 
ATOM   415  N NE  . ARG A 1 57  ? 52.312  -32.522  -16.988  1.00 94.74  ? 152 ARG A NE  1 
ATOM   416  C CZ  . ARG A 1 57  ? 52.305  -33.597  -16.200  1.00 96.12  ? 152 ARG A CZ  1 
ATOM   417  N NH1 . ARG A 1 57  ? 52.500  -34.816  -16.700  1.00 89.56  ? 152 ARG A NH1 1 
ATOM   418  N NH2 . ARG A 1 57  ? 52.100  -33.450  -14.892  1.00 100.53 ? 152 ARG A NH2 1 
ATOM   419  N N   . ARG A 1 58  ? 51.068  -30.567  -23.819  1.00 52.55  ? 153 ARG A N   1 
ATOM   420  C CA  . ARG A 1 58  ? 50.101  -30.450  -24.915  1.00 48.82  ? 153 ARG A CA  1 
ATOM   421  C C   . ARG A 1 58  ? 50.053  -31.728  -25.741  1.00 47.73  ? 153 ARG A C   1 
ATOM   422  O O   . ARG A 1 58  ? 49.193  -31.889  -26.593  1.00 52.97  ? 153 ARG A O   1 
ATOM   423  C CB  . ARG A 1 58  ? 50.452  -29.263  -25.820  1.00 47.28  ? 153 ARG A CB  1 
ATOM   424  C CG  . ARG A 1 58  ? 50.181  -27.913  -25.181  1.00 47.87  ? 153 ARG A CG  1 
ATOM   425  C CD  . ARG A 1 58  ? 48.707  -27.512  -25.254  1.00 47.79  ? 153 ARG A CD  1 
ATOM   426  N NE  . ARG A 1 58  ? 48.388  -26.788  -26.501  1.00 48.43  ? 153 ARG A NE  1 
ATOM   427  C CZ  . ARG A 1 58  ? 47.606  -27.242  -27.478  1.00 49.64  ? 153 ARG A CZ  1 
ATOM   428  N NH1 . ARG A 1 58  ? 47.413  -26.503  -28.569  1.00 51.13  ? 153 ARG A NH1 1 
ATOM   429  N NH2 . ARG A 1 58  ? 47.008  -28.426  -27.384  1.00 53.30  ? 153 ARG A NH2 1 
ATOM   430  N N   . LEU A 1 59  ? 50.987  -32.625  -25.510  1.00 48.28  ? 154 LEU A N   1 
ATOM   431  C CA  . LEU A 1 59  ? 51.009  -33.906  -26.200  1.00 57.86  ? 154 LEU A CA  1 
ATOM   432  C C   . LEU A 1 59  ? 50.171  -34.919  -25.454  1.00 65.34  ? 154 LEU A C   1 
ATOM   433  O O   . LEU A 1 59  ? 49.869  -34.745  -24.270  1.00 78.73  ? 154 LEU A O   1 
ATOM   434  C CB  . LEU A 1 59  ? 52.447  -34.420  -26.309  1.00 59.45  ? 154 LEU A CB  1 
ATOM   435  C CG  . LEU A 1 59  ? 53.326  -33.843  -27.434  1.00 56.41  ? 154 LEU A CG  1 
ATOM   436  C CD1 . LEU A 1 59  ? 52.929  -32.467  -27.912  1.00 51.90  ? 154 LEU A CD1 1 
ATOM   437  C CD2 . LEU A 1 59  ? 54.782  -33.828  -27.021  1.00 60.70  ? 154 LEU A CD2 1 
ATOM   438  N N   . ARG A 1 60  ? 49.848  -36.006  -26.130  1.00 73.21  ? 155 ARG A N   1 
ATOM   439  C CA  . ARG A 1 60  ? 48.893  -36.995  -25.592  1.00 87.58  ? 155 ARG A CA  1 
ATOM   440  C C   . ARG A 1 60  ? 49.632  -38.107  -24.848  1.00 89.28  ? 155 ARG A C   1 
ATOM   441  O O   . ARG A 1 60  ? 49.366  -39.280  -25.057  1.00 93.37  ? 155 ARG A O   1 
ATOM   442  C CB  . ARG A 1 60  ? 47.964  -37.559  -26.691  1.00 91.70  ? 155 ARG A CB  1 
ATOM   443  C CG  . ARG A 1 60  ? 48.535  -37.494  -28.093  1.00 99.35  ? 155 ARG A CG  1 
ATOM   444  C CD  . ARG A 1 60  ? 47.542  -37.983  -29.122  1.00 107.75 ? 155 ARG A CD  1 
ATOM   445  N NE  . ARG A 1 60  ? 47.702  -37.276  -30.388  1.00 113.00 ? 155 ARG A NE  1 
ATOM   446  C CZ  . ARG A 1 60  ? 46.999  -37.529  -31.486  1.00 111.46 ? 155 ARG A CZ  1 
ATOM   447  N NH1 . ARG A 1 60  ? 47.227  -36.817  -32.575  1.00 104.23 ? 155 ARG A NH1 1 
ATOM   448  N NH2 . ARG A 1 60  ? 46.065  -38.478  -31.499  1.00 113.46 ? 155 ARG A NH2 1 
ATOM   449  N N   . ARG A 1 61  ? 50.543  -37.741  -23.953  1.00 85.40  ? 156 ARG A N   1 
ATOM   450  C CA  . ARG A 1 61  ? 51.295  -38.721  -23.169  1.00 86.91  ? 156 ARG A CA  1 
ATOM   451  C C   . ARG A 1 61  ? 51.793  -39.886  -24.023  1.00 80.08  ? 156 ARG A C   1 
ATOM   452  O O   . ARG A 1 61  ? 51.267  -40.988  -23.967  1.00 78.67  ? 156 ARG A O   1 
ATOM   453  C CB  . ARG A 1 61  ? 50.442  -39.248  -22.018  1.00 90.73  ? 156 ARG A CB  1 
ATOM   454  C CG  . ARG A 1 61  ? 50.375  -38.306  -20.831  1.00 103.44 ? 156 ARG A CG  1 
ATOM   455  C CD  . ARG A 1 61  ? 49.106  -38.540  -20.017  1.00 112.24 ? 156 ARG A CD  1 
ATOM   456  N NE  . ARG A 1 61  ? 49.276  -38.224  -18.598  1.00 113.70 ? 156 ARG A NE  1 
ATOM   457  C CZ  . ARG A 1 61  ? 48.310  -38.303  -17.684  1.00 110.90 ? 156 ARG A CZ  1 
ATOM   458  N NH1 . ARG A 1 61  ? 47.081  -38.687  -18.024  1.00 109.95 ? 156 ARG A NH1 1 
ATOM   459  N NH2 . ARG A 1 61  ? 48.573  -37.992  -16.419  1.00 111.97 ? 156 ARG A NH2 1 
ATOM   460  N N   . GLU A 1 62  ? 52.804  -39.623  -24.828  1.00 73.43  ? 157 GLU A N   1 
ATOM   461  C CA  . GLU A 1 62  ? 53.344  -40.632  -25.719  1.00 66.24  ? 157 GLU A CA  1 
ATOM   462  C C   . GLU A 1 62  ? 54.846  -40.436  -25.832  1.00 65.07  ? 157 GLU A C   1 
ATOM   463  O O   . GLU A 1 62  ? 55.376  -39.366  -25.495  1.00 59.25  ? 157 GLU A O   1 
ATOM   464  C CB  . GLU A 1 62  ? 52.668  -40.517  -27.086  1.00 66.15  ? 157 GLU A CB  1 
ATOM   465  C CG  . GLU A 1 62  ? 52.750  -41.771  -27.929  1.00 65.09  ? 157 GLU A CG  1 
ATOM   466  C CD  . GLU A 1 62  ? 52.002  -41.624  -29.238  1.00 64.61  ? 157 GLU A CD  1 
ATOM   467  O OE1 . GLU A 1 62  ? 51.845  -42.652  -29.942  1.00 70.34  ? 157 GLU A OE1 1 
ATOM   468  O OE2 . GLU A 1 62  ? 51.565  -40.492  -29.563  1.00 54.23  ? 157 GLU A OE2 1 
ATOM   469  N N   . ARG A 1 63  ? 55.525  -41.488  -26.279  1.00 61.77  ? 158 ARG A N   1 
ATOM   470  C CA  . ARG A 1 63  ? 56.956  -41.432  -26.560  1.00 60.54  ? 158 ARG A CA  1 
ATOM   471  C C   . ARG A 1 63  ? 57.216  -40.463  -27.724  1.00 52.30  ? 158 ARG A C   1 
ATOM   472  O O   . ARG A 1 63  ? 56.768  -40.710  -28.851  1.00 50.18  ? 158 ARG A O   1 
ATOM   473  C CB  . ARG A 1 63  ? 57.489  -42.838  -26.894  1.00 67.96  ? 158 ARG A CB  1 
ATOM   474  C CG  . ARG A 1 63  ? 58.677  -43.271  -26.049  1.00 82.80  ? 158 ARG A CG  1 
ATOM   475  C CD  . ARG A 1 63  ? 59.991  -42.745  -26.594  1.00 91.90  ? 158 ARG A CD  1 
ATOM   476  N NE  . ARG A 1 63  ? 61.107  -43.643  -26.277  1.00 104.60 ? 158 ARG A NE  1 
ATOM   477  C CZ  . ARG A 1 63  ? 62.383  -43.271  -26.153  1.00 102.66 ? 158 ARG A CZ  1 
ATOM   478  N NH1 . ARG A 1 63  ? 63.306  -44.191  -25.872  1.00 98.54  ? 158 ARG A NH1 1 
ATOM   479  N NH2 . ARG A 1 63  ? 62.748  -41.992  -26.294  1.00 98.97  ? 158 ARG A NH2 1 
ATOM   480  N N   . VAL A 1 64  ? 57.914  -39.360  -27.440  1.00 46.73  ? 159 VAL A N   1 
ATOM   481  C CA  . VAL A 1 64  ? 58.306  -38.400  -28.471  1.00 48.40  ? 159 VAL A CA  1 
ATOM   482  C C   . VAL A 1 64  ? 59.797  -38.102  -28.429  1.00 39.87  ? 159 VAL A C   1 
ATOM   483  O O   . VAL A 1 64  ? 60.328  -37.731  -27.413  1.00 41.77  ? 159 VAL A O   1 
ATOM   484  C CB  . VAL A 1 64  ? 57.494  -37.088  -28.371  1.00 53.30  ? 159 VAL A CB  1 
ATOM   485  C CG1 . VAL A 1 64  ? 56.007  -37.394  -28.264  1.00 57.87  ? 159 VAL A CG1 1 
ATOM   486  C CG2 . VAL A 1 64  ? 57.899  -36.298  -27.145  1.00 61.88  ? 159 VAL A CG2 1 
ATOM   487  N N   . ARG A 1 65  ? 60.458  -38.218  -29.559  1.00 41.01  ? 160 ARG A N   1 
ATOM   488  C CA  . ARG A 1 65  ? 61.884  -37.890  -29.658  1.00 42.16  ? 160 ARG A CA  1 
ATOM   489  C C   . ARG A 1 65  ? 62.047  -36.449  -30.176  1.00 39.32  ? 160 ARG A C   1 
ATOM   490  O O   . ARG A 1 65  ? 61.803  -36.172  -31.348  1.00 37.38  ? 160 ARG A O   1 
ATOM   491  C CB  . ARG A 1 65  ? 62.589  -38.914  -30.569  1.00 45.90  ? 160 ARG A CB  1 
ATOM   492  C CG  . ARG A 1 65  ? 63.874  -39.460  -30.007  1.00 54.87  ? 160 ARG A CG  1 
ATOM   493  C CD  . ARG A 1 65  ? 64.847  -38.349  -29.638  1.00 58.51  ? 160 ARG A CD  1 
ATOM   494  N NE  . ARG A 1 65  ? 66.267  -38.695  -29.768  1.00 61.27  ? 160 ARG A NE  1 
ATOM   495  C CZ  . ARG A 1 65  ? 67.120  -38.953  -28.761  1.00 76.09  ? 160 ARG A CZ  1 
ATOM   496  N NH1 . ARG A 1 65  ? 66.727  -38.936  -27.480  1.00 78.90  ? 160 ARG A NH1 1 
ATOM   497  N NH2 . ARG A 1 65  ? 68.403  -39.229  -29.038  1.00 75.11  ? 160 ARG A NH2 1 
ATOM   498  N N   . ALA A 1 66  ? 62.507  -35.547  -29.308  1.00 40.08  ? 161 ALA A N   1 
ATOM   499  C CA  . ALA A 1 66  ? 62.618  -34.112  -29.631  1.00 40.87  ? 161 ALA A CA  1 
ATOM   500  C C   . ALA A 1 66  ? 64.056  -33.670  -29.853  1.00 40.34  ? 161 ALA A C   1 
ATOM   501  O O   . ALA A 1 66  ? 64.412  -32.546  -29.574  1.00 41.49  ? 161 ALA A O   1 
ATOM   502  C CB  . ALA A 1 66  ? 61.992  -33.278  -28.528  1.00 39.05  ? 161 ALA A CB  1 
ATOM   503  N N   . GLN A 1 67  ? 64.860  -34.561  -30.401  1.00 41.12  ? 162 GLN A N   1 
ATOM   504  C CA  . GLN A 1 67  ? 66.285  -34.360  -30.522  1.00 41.59  ? 162 GLN A CA  1 
ATOM   505  C C   . GLN A 1 67  ? 66.747  -35.297  -31.618  1.00 38.90  ? 162 GLN A C   1 
ATOM   506  O O   . GLN A 1 67  ? 66.246  -36.394  -31.691  1.00 36.39  ? 162 GLN A O   1 
ATOM   507  C CB  . GLN A 1 67  ? 66.876  -34.814  -29.239  1.00 49.27  ? 162 GLN A CB  1 
ATOM   508  C CG  . GLN A 1 67  ? 68.315  -34.501  -29.127  1.00 55.70  ? 162 GLN A CG  1 
ATOM   509  C CD  . GLN A 1 67  ? 68.873  -35.088  -27.878  1.00 57.53  ? 162 GLN A CD  1 
ATOM   510  O OE1 . GLN A 1 67  ? 68.131  -35.599  -27.041  1.00 62.97  ? 162 GLN A OE1 1 
ATOM   511  N NE2 . GLN A 1 67  ? 70.180  -35.013  -27.733  1.00 61.48  ? 162 GLN A NE2 1 
ATOM   512  N N   . PRO A 1 68  ? 67.696  -34.890  -32.469  1.00 40.24  ? 163 PRO A N   1 
ATOM   513  C CA  . PRO A 1 68  ? 68.124  -35.855  -33.492  1.00 39.44  ? 163 PRO A CA  1 
ATOM   514  C C   . PRO A 1 68  ? 68.837  -37.083  -32.920  1.00 41.30  ? 163 PRO A C   1 
ATOM   515  O O   . PRO A 1 68  ? 69.282  -37.059  -31.775  1.00 42.45  ? 163 PRO A O   1 
ATOM   516  C CB  . PRO A 1 68  ? 69.070  -35.042  -34.366  1.00 38.33  ? 163 PRO A CB  1 
ATOM   517  C CG  . PRO A 1 68  ? 68.760  -33.617  -34.089  1.00 37.47  ? 163 PRO A CG  1 
ATOM   518  C CD  . PRO A 1 68  ? 68.319  -33.567  -32.666  1.00 38.50  ? 163 PRO A CD  1 
ATOM   519  N N   . CYS A 1 69  ? 68.927  -38.146  -33.716  1.00 41.63  ? 164 CYS A N   1 
ATOM   520  C CA  . CYS A 1 69  ? 69.613  -39.375  -33.313  1.00 41.99  ? 164 CYS A CA  1 
ATOM   521  C C   . CYS A 1 69  ? 70.695  -39.706  -34.311  1.00 37.87  ? 164 CYS A C   1 
ATOM   522  O O   . CYS A 1 69  ? 70.501  -39.571  -35.501  1.00 37.98  ? 164 CYS A O   1 
ATOM   523  C CB  . CYS A 1 69  ? 68.654  -40.579  -33.272  1.00 47.05  ? 164 CYS A CB  1 
ATOM   524  S SG  . CYS A 1 69  ? 67.306  -40.531  -32.073  1.00 55.37  ? 164 CYS A SG  1 
ATOM   525  N N   . CYS A 1 70  ? 71.816  -40.189  -33.810  1.00 35.49  ? 165 CYS A N   1 
ATOM   526  C CA  . CYS A 1 70  ? 72.870  -40.709  -34.632  1.00 36.24  ? 165 CYS A CA  1 
ATOM   527  C C   . CYS A 1 70  ? 72.577  -42.202  -34.859  1.00 36.05  ? 165 CYS A C   1 
ATOM   528  O O   . CYS A 1 70  ? 72.717  -43.021  -33.938  1.00 33.63  ? 165 CYS A O   1 
ATOM   529  C CB  . CYS A 1 70  ? 74.206  -40.526  -33.935  1.00 35.39  ? 165 CYS A CB  1 
ATOM   530  S SG  . CYS A 1 70  ? 75.609  -41.034  -34.938  1.00 40.76  ? 165 CYS A SG  1 
ATOM   531  N N   . ARG A 1 71  ? 72.194  -42.532  -36.089  1.00 33.95  ? 166 ARG A N   1 
ATOM   532  C CA  . ARG A 1 71  ? 71.786  -43.878  -36.454  1.00 33.47  ? 166 ARG A CA  1 
ATOM   533  C C   . ARG A 1 71  ? 72.282  -44.250  -37.836  1.00 34.20  ? 166 ARG A C   1 
ATOM   534  O O   . ARG A 1 71  ? 72.577  -43.380  -38.637  1.00 36.37  ? 166 ARG A O   1 
ATOM   535  C CB  . ARG A 1 71  ? 70.265  -44.020  -36.393  1.00 33.06  ? 166 ARG A CB  1 
ATOM   536  C CG  . ARG A 1 71  ? 69.676  -43.999  -34.984  1.00 32.46  ? 166 ARG A CG  1 
ATOM   537  C CD  . ARG A 1 71  ? 69.943  -45.300  -34.237  1.00 33.34  ? 166 ARG A CD  1 
ATOM   538  N NE  . ARG A 1 71  ? 69.271  -46.467  -34.805  1.00 35.90  ? 166 ARG A NE  1 
ATOM   539  C CZ  . ARG A 1 71  ? 69.473  -47.731  -34.401  1.00 37.03  ? 166 ARG A CZ  1 
ATOM   540  N NH1 . ARG A 1 71  ? 70.348  -48.011  -33.438  1.00 35.83  ? 166 ARG A NH1 1 
ATOM   541  N NH2 . ARG A 1 71  ? 68.798  -48.733  -34.965  1.00 38.88  ? 166 ARG A NH2 1 
ATOM   542  N N   . PRO A 1 72  ? 72.442  -45.562  -38.104  1.00 36.54  ? 167 PRO A N   1 
ATOM   543  C CA  . PRO A 1 72  ? 72.883  -45.951  -39.436  1.00 34.45  ? 167 PRO A CA  1 
ATOM   544  C C   . PRO A 1 72  ? 71.851  -45.642  -40.504  1.00 33.45  ? 167 PRO A C   1 
ATOM   545  O O   . PRO A 1 72  ? 70.671  -45.767  -40.247  1.00 30.95  ? 167 PRO A O   1 
ATOM   546  C CB  . PRO A 1 72  ? 73.086  -47.464  -39.317  1.00 36.65  ? 167 PRO A CB  1 
ATOM   547  C CG  . PRO A 1 72  ? 73.177  -47.737  -37.854  1.00 37.29  ? 167 PRO A CG  1 
ATOM   548  C CD  . PRO A 1 72  ? 72.292  -46.729  -37.212  1.00 35.18  ? 167 PRO A CD  1 
ATOM   549  N N   . THR A 1 73  ? 72.305  -45.210  -41.675  1.00 33.87  ? 168 THR A N   1 
ATOM   550  C CA  . THR A 1 73  ? 71.432  -45.061  -42.851  1.00 38.57  ? 168 THR A CA  1 
ATOM   551  C C   . THR A 1 73  ? 71.575  -46.251  -43.800  1.00 37.78  ? 168 THR A C   1 
ATOM   552  O O   . THR A 1 73  ? 70.794  -46.401  -44.720  1.00 43.98  ? 168 THR A O   1 
ATOM   553  C CB  . THR A 1 73  ? 71.736  -43.770  -43.660  1.00 40.11  ? 168 THR A CB  1 
ATOM   554  O OG1 . THR A 1 73  ? 73.121  -43.727  -44.057  1.00 40.68  ? 168 THR A OG1 1 
ATOM   555  C CG2 . THR A 1 73  ? 71.427  -42.578  -42.841  1.00 42.10  ? 168 THR A CG2 1 
ATOM   556  N N   . ALA A 1 74  ? 72.573  -47.086  -43.570  1.00 35.34  ? 169 ALA A N   1 
ATOM   557  C CA  . ALA A 1 74  ? 72.766  -48.273  -44.364  1.00 36.84  ? 169 ALA A CA  1 
ATOM   558  C C   . ALA A 1 74  ? 73.595  -49.268  -43.578  1.00 37.22  ? 169 ALA A C   1 
ATOM   559  O O   . ALA A 1 74  ? 74.352  -48.899  -42.703  1.00 37.91  ? 169 ALA A O   1 
ATOM   560  C CB  . ALA A 1 74  ? 73.469  -47.923  -45.665  1.00 36.01  ? 169 ALA A CB  1 
ATOM   561  N N   . TYR A 1 75  ? 73.495  -50.526  -43.958  1.00 37.22  ? 170 TYR A N   1 
ATOM   562  C CA  . TYR A 1 75  ? 74.108  -51.611  -43.218  1.00 35.92  ? 170 TYR A CA  1 
ATOM   563  C C   . TYR A 1 75  ? 74.983  -52.448  -44.153  1.00 36.64  ? 170 TYR A C   1 
ATOM   564  O O   . TYR A 1 75  ? 74.765  -52.478  -45.358  1.00 39.39  ? 170 TYR A O   1 
ATOM   565  C CB  . TYR A 1 75  ? 72.999  -52.455  -42.600  1.00 35.55  ? 170 TYR A CB  1 
ATOM   566  C CG  . TYR A 1 75  ? 72.275  -51.754  -41.463  1.00 35.22  ? 170 TYR A CG  1 
ATOM   567  C CD1 . TYR A 1 75  ? 72.727  -51.861  -40.152  1.00 33.31  ? 170 TYR A CD1 1 
ATOM   568  C CD2 . TYR A 1 75  ? 71.143  -50.985  -41.696  1.00 35.15  ? 170 TYR A CD2 1 
ATOM   569  C CE1 . TYR A 1 75  ? 72.092  -51.189  -39.120  1.00 32.93  ? 170 TYR A CE1 1 
ATOM   570  C CE2 . TYR A 1 75  ? 70.483  -50.325  -40.662  1.00 33.55  ? 170 TYR A CE2 1 
ATOM   571  C CZ  . TYR A 1 75  ? 70.961  -50.430  -39.376  1.00 33.69  ? 170 TYR A CZ  1 
ATOM   572  O OH  . TYR A 1 75  ? 70.324  -49.773  -38.348  1.00 33.09  ? 170 TYR A OH  1 
ATOM   573  N N   . GLU A 1 76  ? 75.989  -53.101  -43.584  1.00 37.23  ? 171 GLU A N   1 
ATOM   574  C CA  . GLU A 1 76  ? 76.800  -54.136  -44.253  1.00 39.04  ? 171 GLU A CA  1 
ATOM   575  C C   . GLU A 1 76  ? 75.926  -55.243  -44.833  1.00 38.12  ? 171 GLU A C   1 
ATOM   576  O O   . GLU A 1 76  ? 74.995  -55.662  -44.180  1.00 38.67  ? 171 GLU A O   1 
ATOM   577  C CB  . GLU A 1 76  ? 77.784  -54.723  -43.225  1.00 40.30  ? 171 GLU A CB  1 
ATOM   578  C CG  . GLU A 1 76  ? 78.486  -56.013  -43.609  1.00 42.46  ? 171 GLU A CG  1 
ATOM   579  C CD  . GLU A 1 76  ? 79.451  -56.502  -42.517  1.00 44.09  ? 171 GLU A CD  1 
ATOM   580  O OE1 . GLU A 1 76  ? 80.680  -56.447  -42.716  1.00 47.35  ? 171 GLU A OE1 1 
ATOM   581  O OE2 . GLU A 1 76  ? 78.996  -56.934  -41.457  1.00 36.71  ? 171 GLU A OE2 1 
ATOM   582  N N   . ASP A 1 77  ? 76.217  -55.700  -46.052  1.00 41.22  ? 172 ASP A N   1 
ATOM   583  C CA  . ASP A 1 77  ? 75.452  -56.782  -46.717  1.00 43.84  ? 172 ASP A CA  1 
ATOM   584  C C   . ASP A 1 77  ? 75.525  -58.089  -45.948  1.00 39.46  ? 172 ASP A C   1 
ATOM   585  O O   . ASP A 1 77  ? 74.497  -58.667  -45.576  1.00 35.89  ? 172 ASP A O   1 
ATOM   586  C CB  . ASP A 1 77  ? 75.987  -57.073  -48.132  1.00 54.22  ? 172 ASP A CB  1 
ATOM   587  C CG  . ASP A 1 77  ? 75.574  -56.037  -49.159  1.00 68.47  ? 172 ASP A CG  1 
ATOM   588  O OD1 . ASP A 1 77  ? 74.629  -55.227  -48.923  1.00 82.13  ? 172 ASP A OD1 1 
ATOM   589  O OD2 . ASP A 1 77  ? 76.213  -56.044  -50.233  1.00 82.65  ? 172 ASP A OD2 1 
ATOM   590  N N   . GLU A 1 78  ? 76.749  -58.548  -45.726  1.00 37.72  ? 173 GLU A N   1 
ATOM   591  C CA  . GLU A 1 78  ? 76.971  -59.840  -45.078  1.00 40.28  ? 173 GLU A CA  1 
ATOM   592  C C   . GLU A 1 78  ? 78.396  -60.052  -44.616  1.00 37.30  ? 173 GLU A C   1 
ATOM   593  O O   . GLU A 1 78  ? 79.335  -59.520  -45.196  1.00 39.16  ? 173 GLU A O   1 
ATOM   594  C CB  . GLU A 1 78  ? 76.556  -61.005  -45.999  1.00 40.82  ? 173 GLU A CB  1 
ATOM   595  C CG  . GLU A 1 78  ? 77.115  -60.969  -47.419  1.00 43.57  ? 173 GLU A CG  1 
ATOM   596  C CD  . GLU A 1 78  ? 76.756  -62.246  -48.190  1.00 49.78  ? 173 GLU A CD  1 
ATOM   597  O OE1 . GLU A 1 78  ? 77.587  -63.184  -48.219  1.00 45.96  ? 173 GLU A OE1 1 
ATOM   598  O OE2 . GLU A 1 78  ? 75.612  -62.341  -48.710  1.00 55.18  ? 173 GLU A OE2 1 
ATOM   599  N N   . VAL A 1 79  ? 78.540  -60.845  -43.562  1.00 34.18  ? 174 VAL A N   1 
ATOM   600  C CA  . VAL A 1 79  ? 79.841  -61.322  -43.106  1.00 32.70  ? 174 VAL A CA  1 
ATOM   601  C C   . VAL A 1 79  ? 79.674  -62.805  -42.729  1.00 31.88  ? 174 VAL A C   1 
ATOM   602  O O   . VAL A 1 79  ? 78.614  -63.240  -42.279  1.00 32.02  ? 174 VAL A O   1 
ATOM   603  C CB  . VAL A 1 79  ? 80.390  -60.440  -41.958  1.00 33.53  ? 174 VAL A CB  1 
ATOM   604  C CG1 . VAL A 1 79  ? 79.540  -60.539  -40.704  1.00 33.40  ? 174 VAL A CG1 1 
ATOM   605  C CG2 . VAL A 1 79  ? 81.829  -60.803  -41.633  1.00 36.20  ? 174 VAL A CG2 1 
ATOM   606  N N   . SER A 1 80  ? 80.716  -63.585  -42.926  1.00 31.55  ? 175 SER A N   1 
ATOM   607  C CA  . SER A 1 80  ? 80.649  -65.014  -42.649  1.00 30.36  ? 175 SER A CA  1 
ATOM   608  C C   . SER A 1 80  ? 81.827  -65.458  -41.797  1.00 30.96  ? 175 SER A C   1 
ATOM   609  O O   . SER A 1 80  ? 82.866  -64.788  -41.724  1.00 30.47  ? 175 SER A O   1 
ATOM   610  C CB  . SER A 1 80  ? 80.625  -65.825  -43.952  1.00 30.01  ? 175 SER A CB  1 
ATOM   611  O OG  . SER A 1 80  ? 79.428  -65.641  -44.702  1.00 31.36  ? 175 SER A OG  1 
ATOM   612  N N   . PHE A 1 81  ? 81.676  -66.629  -41.196  1.00 31.53  ? 176 PHE A N   1 
ATOM   613  C CA  . PHE A 1 81  ? 82.711  -67.204  -40.362  1.00 33.02  ? 176 PHE A CA  1 
ATOM   614  C C   . PHE A 1 81  ? 82.412  -68.686  -40.098  1.00 32.99  ? 176 PHE A C   1 
ATOM   615  O O   . PHE A 1 81  ? 81.280  -69.136  -40.243  1.00 32.04  ? 176 PHE A O   1 
ATOM   616  C CB  . PHE A 1 81  ? 82.794  -66.436  -39.020  1.00 34.62  ? 176 PHE A CB  1 
ATOM   617  C CG  . PHE A 1 81  ? 81.453  -66.214  -38.369  1.00 33.69  ? 176 PHE A CG  1 
ATOM   618  C CD1 . PHE A 1 81  ? 80.870  -67.201  -37.595  1.00 34.33  ? 176 PHE A CD1 1 
ATOM   619  C CD2 . PHE A 1 81  ? 80.763  -65.026  -38.553  1.00 35.66  ? 176 PHE A CD2 1 
ATOM   620  C CE1 . PHE A 1 81  ? 79.634  -67.015  -37.011  1.00 32.59  ? 176 PHE A CE1 1 
ATOM   621  C CE2 . PHE A 1 81  ? 79.514  -64.823  -37.952  1.00 35.98  ? 176 PHE A CE2 1 
ATOM   622  C CZ  . PHE A 1 81  ? 78.949  -65.827  -37.193  1.00 33.80  ? 176 PHE A CZ  1 
ATOM   623  N N   . LEU A 1 82  ? 83.442  -69.417  -39.684  1.00 32.19  ? 177 LEU A N   1 
ATOM   624  C CA  . LEU A 1 82  ? 83.324  -70.817  -39.349  1.00 32.67  ? 177 LEU A CA  1 
ATOM   625  C C   . LEU A 1 82  ? 83.340  -70.908  -37.819  1.00 34.62  ? 177 LEU A C   1 
ATOM   626  O O   . LEU A 1 82  ? 84.167  -70.257  -37.165  1.00 34.82  ? 177 LEU A O   1 
ATOM   627  C CB  . LEU A 1 82  ? 84.491  -71.596  -39.962  1.00 31.79  ? 177 LEU A CB  1 
ATOM   628  C CG  . LEU A 1 82  ? 84.491  -73.120  -39.743  1.00 31.60  ? 177 LEU A CG  1 
ATOM   629  C CD1 . LEU A 1 82  ? 83.539  -73.822  -40.675  1.00 31.61  ? 177 LEU A CD1 1 
ATOM   630  C CD2 . LEU A 1 82  ? 85.891  -73.645  -39.957  1.00 33.11  ? 177 LEU A CD2 1 
ATOM   631  N N   . ASP A 1 83  ? 82.417  -71.689  -37.257  1.00 35.61  ? 178 ASP A N   1 
ATOM   632  C CA  . ASP A 1 83  ? 82.358  -71.899  -35.802  1.00 38.42  ? 178 ASP A CA  1 
ATOM   633  C C   . ASP A 1 83  ? 83.198  -73.083  -35.303  1.00 39.31  ? 178 ASP A C   1 
ATOM   634  O O   . ASP A 1 83  ? 83.841  -73.779  -36.054  1.00 38.87  ? 178 ASP A O   1 
ATOM   635  C CB  . ASP A 1 83  ? 80.891  -71.955  -35.303  1.00 40.52  ? 178 ASP A CB  1 
ATOM   636  C CG  . ASP A 1 83  ? 80.174  -73.265  -35.609  1.00 41.60  ? 178 ASP A CG  1 
ATOM   637  O OD1 . ASP A 1 83  ? 80.854  -74.270  -35.900  1.00 38.18  ? 178 ASP A OD1 1 
ATOM   638  O OD2 . ASP A 1 83  ? 78.911  -73.271  -35.520  1.00 39.24  ? 178 ASP A OD2 1 
ATOM   639  N N   . ALA A 1 84  ? 83.189  -73.270  -33.997  1.00 44.35  ? 179 ALA A N   1 
ATOM   640  C CA  . ALA A 1 84  ? 83.968  -74.314  -33.317  1.00 44.75  ? 179 ALA A CA  1 
ATOM   641  C C   . ALA A 1 84  ? 83.538  -75.732  -33.672  1.00 41.30  ? 179 ALA A C   1 
ATOM   642  O O   . ALA A 1 84  ? 84.283  -76.642  -33.470  1.00 49.32  ? 179 ALA A O   1 
ATOM   643  C CB  . ALA A 1 84  ? 83.881  -74.113  -31.800  1.00 42.80  ? 179 ALA A CB  1 
ATOM   644  N N   . HIS A 1 85  ? 82.327  -75.901  -34.167  1.00 43.62  ? 180 HIS A N   1 
ATOM   645  C CA  . HIS A 1 85  ? 81.811  -77.195  -34.614  1.00 43.92  ? 180 HIS A CA  1 
ATOM   646  C C   . HIS A 1 85  ? 81.951  -77.397  -36.128  1.00 39.74  ? 180 HIS A C   1 
ATOM   647  O O   . HIS A 1 85  ? 81.307  -78.251  -36.702  1.00 38.98  ? 180 HIS A O   1 
ATOM   648  C CB  . HIS A 1 85  ? 80.340  -77.304  -34.208  1.00 46.68  ? 180 HIS A CB  1 
ATOM   649  C CG  . HIS A 1 85  ? 80.092  -76.918  -32.786  1.00 58.04  ? 180 HIS A CG  1 
ATOM   650  N ND1 . HIS A 1 85  ? 80.749  -77.518  -31.731  1.00 66.83  ? 180 HIS A ND1 1 
ATOM   651  C CD2 . HIS A 1 85  ? 79.298  -75.962  -32.244  1.00 61.13  ? 180 HIS A CD2 1 
ATOM   652  C CE1 . HIS A 1 85  ? 80.358  -76.958  -30.598  1.00 68.31  ? 180 HIS A CE1 1 
ATOM   653  N NE2 . HIS A 1 85  ? 79.477  -76.013  -30.883  1.00 67.58  ? 180 HIS A NE2 1 
ATOM   654  N N   . SER A 1 86  ? 82.772  -76.582  -36.780  1.00 40.27  ? 181 SER A N   1 
ATOM   655  C CA  . SER A 1 86  ? 83.004  -76.704  -38.218  1.00 41.79  ? 181 SER A CA  1 
ATOM   656  C C   . SER A 1 86  ? 81.774  -76.408  -39.092  1.00 38.55  ? 181 SER A C   1 
ATOM   657  O O   . SER A 1 86  ? 81.635  -76.952  -40.175  1.00 38.69  ? 181 SER A O   1 
ATOM   658  C CB  . SER A 1 86  ? 83.573  -78.100  -38.530  1.00 45.85  ? 181 SER A CB  1 
ATOM   659  O OG  . SER A 1 86  ? 84.692  -77.982  -39.355  1.00 51.10  ? 181 SER A OG  1 
ATOM   660  N N   . ARG A 1 87  ? 80.899  -75.544  -38.602  1.00 37.92  ? 182 ARG A N   1 
ATOM   661  C CA  . ARG A 1 87  ? 79.743  -75.061  -39.321  1.00 41.85  ? 182 ARG A CA  1 
ATOM   662  C C   . ARG A 1 87  ? 79.982  -73.580  -39.710  1.00 38.82  ? 182 ARG A C   1 
ATOM   663  O O   . ARG A 1 87  ? 80.402  -72.757  -38.880  1.00 35.51  ? 182 ARG A O   1 
ATOM   664  C CB  . ARG A 1 87  ? 78.487  -75.186  -38.446  1.00 51.03  ? 182 ARG A CB  1 
ATOM   665  C CG  . ARG A 1 87  ? 77.675  -76.475  -38.630  1.00 66.76  ? 182 ARG A CG  1 
ATOM   666  C CD  . ARG A 1 87  ? 76.393  -76.232  -39.439  1.00 83.19  ? 182 ARG A CD  1 
ATOM   667  N NE  . ARG A 1 87  ? 76.192  -77.210  -40.523  1.00 88.78  ? 182 ARG A NE  1 
ATOM   668  C CZ  . ARG A 1 87  ? 75.727  -76.930  -41.749  1.00 92.77  ? 182 ARG A CZ  1 
ATOM   669  N NH1 . ARG A 1 87  ? 75.394  -75.687  -42.115  1.00 88.55  ? 182 ARG A NH1 1 
ATOM   670  N NH2 . ARG A 1 87  ? 75.595  -77.912  -42.637  1.00 103.69 ? 182 ARG A NH2 1 
ATOM   671  N N   . TYR A 1 88  ? 79.684  -73.258  -40.964  1.00 33.33  ? 183 TYR A N   1 
ATOM   672  C CA  . TYR A 1 88  ? 79.786  -71.898  -41.465  1.00 34.68  ? 183 TYR A CA  1 
ATOM   673  C C   . TYR A 1 88  ? 78.501  -71.133  -41.170  1.00 33.57  ? 183 TYR A C   1 
ATOM   674  O O   . TYR A 1 88  ? 77.443  -71.707  -41.195  1.00 30.66  ? 183 TYR A O   1 
ATOM   675  C CB  . TYR A 1 88  ? 80.046  -71.895  -42.979  1.00 33.84  ? 183 TYR A CB  1 
ATOM   676  C CG  . TYR A 1 88  ? 81.496  -71.976  -43.384  1.00 33.02  ? 183 TYR A CG  1 
ATOM   677  C CD1 . TYR A 1 88  ? 82.363  -70.913  -43.164  1.00 31.16  ? 183 TYR A CD1 1 
ATOM   678  C CD2 . TYR A 1 88  ? 82.001  -73.106  -44.032  1.00 33.22  ? 183 TYR A CD2 1 
ATOM   679  C CE1 . TYR A 1 88  ? 83.694  -70.964  -43.557  1.00 31.04  ? 183 TYR A CE1 1 
ATOM   680  C CE2 . TYR A 1 88  ? 83.325  -73.155  -44.435  1.00 33.72  ? 183 TYR A CE2 1 
ATOM   681  C CZ  . TYR A 1 88  ? 84.177  -72.085  -44.196  1.00 34.12  ? 183 TYR A CZ  1 
ATOM   682  O OH  . TYR A 1 88  ? 85.524  -72.154  -44.605  1.00 37.79  ? 183 TYR A OH  1 
ATOM   683  N N   . HIS A 1 89  ? 78.618  -69.831  -40.905  1.00 34.73  ? 184 HIS A N   1 
ATOM   684  C CA  . HIS A 1 89  ? 77.448  -68.944  -40.745  1.00 35.20  ? 184 HIS A CA  1 
ATOM   685  C C   . HIS A 1 89  ? 77.657  -67.655  -41.501  1.00 33.47  ? 184 HIS A C   1 
ATOM   686  O O   . HIS A 1 89  ? 78.782  -67.237  -41.676  1.00 32.07  ? 184 HIS A O   1 
ATOM   687  C CB  . HIS A 1 89  ? 77.212  -68.634  -39.283  1.00 35.71  ? 184 HIS A CB  1 
ATOM   688  C CG  . HIS A 1 89  ? 77.091  -69.854  -38.428  1.00 36.91  ? 184 HIS A CG  1 
ATOM   689  N ND1 . HIS A 1 89  ? 75.888  -70.483  -38.194  1.00 36.81  ? 184 HIS A ND1 1 
ATOM   690  C CD2 . HIS A 1 89  ? 78.022  -70.555  -37.738  1.00 38.52  ? 184 HIS A CD2 1 
ATOM   691  C CE1 . HIS A 1 89  ? 76.084  -71.526  -37.406  1.00 36.49  ? 184 HIS A CE1 1 
ATOM   692  N NE2 . HIS A 1 89  ? 77.369  -71.582  -37.102  1.00 38.01  ? 184 HIS A NE2 1 
ATOM   693  N N   . THR A 1 90  ? 76.563  -67.101  -42.016  1.00 35.69  ? 185 THR A N   1 
ATOM   694  C CA  . THR A 1 90  ? 76.527  -65.796  -42.652  1.00 37.78  ? 185 THR A CA  1 
ATOM   695  C C   . THR A 1 90  ? 75.538  -64.903  -41.910  1.00 38.97  ? 185 THR A C   1 
ATOM   696  O O   . THR A 1 90  ? 74.416  -65.316  -41.708  1.00 37.57  ? 185 THR A O   1 
ATOM   697  C CB  . THR A 1 90  ? 76.084  -65.879  -44.098  1.00 36.50  ? 185 THR A CB  1 
ATOM   698  O OG1 . THR A 1 90  ? 76.953  -66.761  -44.784  1.00 36.59  ? 185 THR A OG1 1 
ATOM   699  C CG2 . THR A 1 90  ? 76.197  -64.503  -44.755  1.00 38.05  ? 185 THR A CG2 1 
ATOM   700  N N   . VAL A 1 91  ? 75.973  -63.701  -41.515  1.00 37.73  ? 186 VAL A N   1 
ATOM   701  C CA  . VAL A 1 91  ? 75.120  -62.730  -40.822  1.00 35.07  ? 186 VAL A CA  1 
ATOM   702  C C   . VAL A 1 91  ? 74.933  -61.517  -41.710  1.00 34.58  ? 186 VAL A C   1 
ATOM   703  O O   . VAL A 1 91  ? 75.889  -60.964  -42.236  1.00 34.38  ? 186 VAL A O   1 
ATOM   704  C CB  . VAL A 1 91  ? 75.701  -62.307  -39.467  1.00 37.54  ? 186 VAL A CB  1 
ATOM   705  C CG1 . VAL A 1 91  ? 74.708  -61.439  -38.708  1.00 38.43  ? 186 VAL A CG1 1 
ATOM   706  C CG2 . VAL A 1 91  ? 75.963  -63.541  -38.627  1.00 41.74  ? 186 VAL A CG2 1 
ATOM   707  N N   . HIS A 1 92  ? 73.685  -61.116  -41.864  1.00 37.62  ? 187 HIS A N   1 
ATOM   708  C CA  . HIS A 1 92  ? 73.306  -59.954  -42.670  1.00 39.24  ? 187 HIS A CA  1 
ATOM   709  C C   . HIS A 1 92  ? 73.105  -58.732  -41.782  1.00 37.00  ? 187 HIS A C   1 
ATOM   710  O O   . HIS A 1 92  ? 72.543  -58.839  -40.692  1.00 33.49  ? 187 HIS A O   1 
ATOM   711  C CB  . HIS A 1 92  ? 72.045  -60.262  -43.481  1.00 38.94  ? 187 HIS A CB  1 
ATOM   712  C CG  . HIS A 1 92  ? 72.197  -61.457  -44.362  1.00 41.31  ? 187 HIS A CG  1 
ATOM   713  N ND1 . HIS A 1 92  ? 72.578  -61.366  -45.685  1.00 43.18  ? 187 HIS A ND1 1 
ATOM   714  C CD2 . HIS A 1 92  ? 72.070  -62.781  -44.093  1.00 43.61  ? 187 HIS A CD2 1 
ATOM   715  C CE1 . HIS A 1 92  ? 72.670  -62.584  -46.195  1.00 46.34  ? 187 HIS A CE1 1 
ATOM   716  N NE2 . HIS A 1 92  ? 72.361  -63.457  -45.252  1.00 46.69  ? 187 HIS A NE2 1 
ATOM   717  N N   . GLU A 1 93  ? 73.624  -57.594  -42.241  1.00 36.99  ? 188 GLU A N   1 
ATOM   718  C CA  . GLU A 1 93  ? 73.388  -56.288  -41.595  1.00 37.69  ? 188 GLU A CA  1 
ATOM   719  C C   . GLU A 1 93  ? 73.837  -56.240  -40.149  1.00 36.70  ? 188 GLU A C   1 
ATOM   720  O O   . GLU A 1 93  ? 73.166  -55.648  -39.280  1.00 38.70  ? 188 GLU A O   1 
ATOM   721  C CB  . GLU A 1 93  ? 71.914  -55.882  -41.730  1.00 39.23  ? 188 GLU A CB  1 
ATOM   722  C CG  . GLU A 1 93  ? 71.433  -55.885  -43.164  1.00 45.41  ? 188 GLU A CG  1 
ATOM   723  C CD  . GLU A 1 93  ? 70.167  -55.081  -43.391  1.00 49.84  ? 188 GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 93  ? 69.214  -55.195  -42.609  1.00 57.19  ? 188 GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 93  ? 70.118  -54.334  -44.380  1.00 64.91  ? 188 GLU A OE2 1 
ATOM   726  N N   . LEU A 1 94  ? 74.972  -56.867  -39.877  1.00 36.53  ? 189 LEU A N   1 
ATOM   727  C CA  . LEU A 1 94  ? 75.525  -56.871  -38.517  1.00 35.68  ? 189 LEU A CA  1 
ATOM   728  C C   . LEU A 1 94  ? 76.148  -55.521  -38.180  1.00 36.21  ? 189 LEU A C   1 
ATOM   729  O O   . LEU A 1 94  ? 76.036  -55.075  -37.045  1.00 32.34  ? 189 LEU A O   1 
ATOM   730  C CB  . LEU A 1 94  ? 76.546  -57.974  -38.337  1.00 36.02  ? 189 LEU A CB  1 
ATOM   731  C CG  . LEU A 1 94  ? 77.278  -58.030  -36.987  1.00 38.89  ? 189 LEU A CG  1 
ATOM   732  C CD1 . LEU A 1 94  ? 76.319  -58.195  -35.825  1.00 41.79  ? 189 LEU A CD1 1 
ATOM   733  C CD2 . LEU A 1 94  ? 78.302  -59.152  -36.992  1.00 40.35  ? 189 LEU A CD2 1 
ATOM   734  N N   . SER A 1 95  ? 76.818  -54.917  -39.172  1.00 35.65  ? 190 SER A N   1 
ATOM   735  C CA  . SER A 1 95  ? 77.542  -53.639  -39.049  1.00 36.73  ? 190 SER A CA  1 
ATOM   736  C C   . SER A 1 95  ? 76.869  -52.524  -39.804  1.00 38.89  ? 190 SER A C   1 
ATOM   737  O O   . SER A 1 95  ? 76.193  -52.774  -40.799  1.00 37.52  ? 190 SER A O   1 
ATOM   738  C CB  . SER A 1 95  ? 78.957  -53.747  -39.609  1.00 36.33  ? 190 SER A CB  1 
ATOM   739  O OG  . SER A 1 95  ? 79.858  -54.265  -38.654  1.00 35.88  ? 190 SER A OG  1 
ATOM   740  N N   . ALA A 1 96  ? 77.064  -51.291  -39.313  1.00 38.31  ? 191 ALA A N   1 
ATOM   741  C CA  . ALA A 1 96  ? 76.663  -50.083  -40.026  1.00 35.41  ? 191 ALA A CA  1 
ATOM   742  C C   . ALA A 1 96  ? 77.635  -49.821  -41.167  1.00 35.76  ? 191 ALA A C   1 
ATOM   743  O O   . ALA A 1 96  ? 78.819  -50.117  -41.055  1.00 38.56  ? 191 ALA A O   1 
ATOM   744  C CB  . ALA A 1 96  ? 76.659  -48.897  -39.090  1.00 36.11  ? 191 ALA A CB  1 
ATOM   745  N N   . ARG A 1 97  ? 77.127  -49.271  -42.259  1.00 36.65  ? 192 ARG A N   1 
ATOM   746  C CA  . ARG A 1 97  ? 77.933  -48.883  -43.408  1.00 40.68  ? 192 ARG A CA  1 
ATOM   747  C C   . ARG A 1 97  ? 78.036  -47.356  -43.550  1.00 42.24  ? 192 ARG A C   1 
ATOM   748  O O   . ARG A 1 97  ? 79.045  -46.858  -44.037  1.00 42.66  ? 192 ARG A O   1 
ATOM   749  C CB  . ARG A 1 97  ? 77.302  -49.449  -44.678  1.00 44.88  ? 192 ARG A CB  1 
ATOM   750  C CG  . ARG A 1 97  ? 78.316  -49.978  -45.645  1.00 53.74  ? 192 ARG A CG  1 
ATOM   751  C CD  . ARG A 1 97  ? 77.825  -50.196  -47.069  1.00 55.51  ? 192 ARG A CD  1 
ATOM   752  N NE  . ARG A 1 97  ? 76.410  -50.536  -47.242  1.00 57.43  ? 192 ARG A NE  1 
ATOM   753  C CZ  . ARG A 1 97  ? 75.561  -49.858  -48.028  1.00 65.51  ? 192 ARG A CZ  1 
ATOM   754  N NH1 . ARG A 1 97  ? 75.955  -48.754  -48.678  1.00 66.04  ? 192 ARG A NH1 1 
ATOM   755  N NH2 . ARG A 1 97  ? 74.294  -50.266  -48.158  1.00 62.33  ? 192 ARG A NH2 1 
ATOM   756  N N   . GLU A 1 98  ? 76.954  -46.660  -43.189  1.00 42.36  ? 193 GLU A N   1 
ATOM   757  C CA  . GLU A 1 98  ? 76.844  -45.200  -43.204  1.00 46.05  ? 193 GLU A CA  1 
ATOM   758  C C   . GLU A 1 98  ? 76.013  -44.711  -42.017  1.00 40.28  ? 193 GLU A C   1 
ATOM   759  O O   . GLU A 1 98  ? 75.146  -45.442  -41.546  1.00 38.57  ? 193 GLU A O   1 
ATOM   760  C CB  . GLU A 1 98  ? 76.173  -44.754  -44.490  1.00 52.40  ? 193 GLU A CB  1 
ATOM   761  C CG  . GLU A 1 98  ? 77.091  -44.732  -45.696  1.00 66.19  ? 193 GLU A CG  1 
ATOM   762  C CD  . GLU A 1 98  ? 76.334  -44.781  -47.030  1.00 82.22  ? 193 GLU A CD  1 
ATOM   763  O OE1 . GLU A 1 98  ? 75.173  -44.290  -47.104  1.00 84.90  ? 193 GLU A OE1 1 
ATOM   764  O OE2 . GLU A 1 98  ? 76.911  -45.318  -48.011  1.00 86.63  ? 193 GLU A OE2 1 
ATOM   765  N N   . CYS A 1 99  ? 76.272  -43.477  -41.572  1.00 41.88  ? 194 CYS A N   1 
ATOM   766  C CA  . CYS A 1 99  ? 75.608  -42.832  -40.421  1.00 45.03  ? 194 CYS A CA  1 
ATOM   767  C C   . CYS A 1 99  ? 75.000  -41.509  -40.813  1.00 43.33  ? 194 CYS A C   1 
ATOM   768  O O   . CYS A 1 99  ? 75.415  -40.909  -41.772  1.00 42.88  ? 194 CYS A O   1 
ATOM   769  C CB  . CYS A 1 99  ? 76.611  -42.515  -39.306  1.00 45.50  ? 194 CYS A CB  1 
ATOM   770  S SG  . CYS A 1 99  ? 77.468  -43.978  -38.720  1.00 56.99  ? 194 CYS A SG  1 
ATOM   771  N N   . ALA A 1 100 ? 74.035  -41.057  -40.030  1.00 40.24  ? 195 ALA A N   1 
ATOM   772  C CA  . ALA A 1 100 ? 73.469  -39.729  -40.177  1.00 41.03  ? 195 ALA A CA  1 
ATOM   773  C C   . ALA A 1 100 ? 72.745  -39.342  -38.905  1.00 42.84  ? 195 ALA A C   1 
ATOM   774  O O   . ALA A 1 100 ? 72.359  -40.201  -38.100  1.00 40.57  ? 195 ALA A O   1 
ATOM   775  C CB  . ALA A 1 100 ? 72.503  -39.691  -41.341  1.00 40.52  ? 195 ALA A CB  1 
ATOM   776  N N   . CYS A 1 101 ? 72.564  -38.043  -38.729  1.00 45.52  ? 196 CYS A N   1 
ATOM   777  C CA  . CYS A 1 101 ? 71.744  -37.527  -37.647  1.00 46.71  ? 196 CYS A CA  1 
ATOM   778  C C   . CYS A 1 101 ? 70.390  -37.214  -38.210  1.00 43.64  ? 196 CYS A C   1 
ATOM   779  O O   . CYS A 1 101 ? 70.287  -36.453  -39.143  1.00 50.96  ? 196 CYS A O   1 
ATOM   780  C CB  . CYS A 1 101 ? 72.359  -36.286  -37.070  1.00 50.00  ? 196 CYS A CB  1 
ATOM   781  S SG  . CYS A 1 101 ? 73.780  -36.554  -36.009  1.00 60.55  ? 196 CYS A SG  1 
ATOM   782  N N   . VAL A 1 102 ? 69.352  -37.794  -37.636  1.00 45.12  ? 197 VAL A N   1 
ATOM   783  C CA  . VAL A 1 102 ? 67.991  -37.620  -38.130  1.00 53.22  ? 197 VAL A CA  1 
ATOM   784  C C   . VAL A 1 102 ? 67.111  -37.210  -36.949  1.00 53.07  ? 197 VAL A C   1 
ATOM   785  O O   . VAL A 1 102 ? 66.366  -36.226  -36.995  1.00 45.92  ? 197 VAL A O   1 
ATOM   786  C CB  . VAL A 1 102 ? 67.443  -38.926  -38.766  1.00 56.88  ? 197 VAL A CB  1 
ATOM   787  C CG1 . VAL A 1 102 ? 66.196  -38.654  -39.593  1.00 59.19  ? 197 VAL A CG1 1 
ATOM   788  C CG2 . VAL A 1 102 ? 68.486  -39.562  -39.656  1.00 62.67  ? 197 VAL A CG2 1 
ATOM   789  O OXT . VAL A 1 102 ? 67.138  -37.886  -35.920  1.00 55.78  ? 197 VAL A OXT 1 
ATOM   790  N N   . ALA B 1 5   ? 49.481  -49.904  -27.769  1.00 75.56  ? 100 ALA B N   1 
ATOM   791  C CA  . ALA B 1 5   ? 50.336  -48.687  -27.969  1.00 78.09  ? 100 ALA B CA  1 
ATOM   792  C C   . ALA B 1 5   ? 50.508  -48.355  -29.457  1.00 75.60  ? 100 ALA B C   1 
ATOM   793  O O   . ALA B 1 5   ? 50.972  -49.186  -30.250  1.00 69.18  ? 100 ALA B O   1 
ATOM   794  C CB  . ALA B 1 5   ? 51.695  -48.864  -27.309  1.00 75.55  ? 100 ALA B CB  1 
ATOM   795  N N   . ARG B 1 6   ? 50.118  -47.137  -29.826  1.00 73.51  ? 101 ARG B N   1 
ATOM   796  C CA  . ARG B 1 6   ? 50.156  -46.700  -31.231  1.00 69.68  ? 101 ARG B CA  1 
ATOM   797  C C   . ARG B 1 6   ? 51.600  -46.678  -31.753  1.00 62.72  ? 101 ARG B C   1 
ATOM   798  O O   . ARG B 1 6   ? 52.537  -46.207  -31.026  1.00 57.70  ? 101 ARG B O   1 
ATOM   799  C CB  . ARG B 1 6   ? 49.561  -45.308  -31.348  1.00 77.99  ? 101 ARG B CB  1 
ATOM   800  C CG  . ARG B 1 6   ? 48.487  -45.189  -32.413  1.00 82.87  ? 101 ARG B CG  1 
ATOM   801  C CD  . ARG B 1 6   ? 47.715  -43.900  -32.201  1.00 85.55  ? 101 ARG B CD  1 
ATOM   802  N NE  . ARG B 1 6   ? 47.544  -43.164  -33.450  1.00 84.61  ? 101 ARG B NE  1 
ATOM   803  C CZ  . ARG B 1 6   ? 47.295  -41.861  -33.523  1.00 82.81  ? 101 ARG B CZ  1 
ATOM   804  N NH1 . ARG B 1 6   ? 47.154  -41.285  -34.718  1.00 81.89  ? 101 ARG B NH1 1 
ATOM   805  N NH2 . ARG B 1 6   ? 47.193  -41.126  -32.410  1.00 79.56  ? 101 ARG B NH2 1 
ATOM   806  N N   . PRO B 1 7   ? 51.801  -47.201  -32.994  1.00 50.49  ? 102 PRO B N   1 
ATOM   807  C CA  . PRO B 1 7   ? 53.193  -47.215  -33.427  1.00 50.41  ? 102 PRO B CA  1 
ATOM   808  C C   . PRO B 1 7   ? 53.651  -45.898  -34.053  1.00 48.19  ? 102 PRO B C   1 
ATOM   809  O O   . PRO B 1 7   ? 52.830  -45.062  -34.376  1.00 45.21  ? 102 PRO B O   1 
ATOM   810  C CB  . PRO B 1 7   ? 53.189  -48.310  -34.494  1.00 52.45  ? 102 PRO B CB  1 
ATOM   811  C CG  . PRO B 1 7   ? 51.837  -48.195  -35.135  1.00 51.92  ? 102 PRO B CG  1 
ATOM   812  C CD  . PRO B 1 7   ? 50.899  -47.554  -34.117  1.00 52.47  ? 102 PRO B CD  1 
ATOM   813  N N   . CYS B 1 8   ? 54.964  -45.766  -34.254  1.00 48.90  ? 103 CYS B N   1 
ATOM   814  C CA  . CYS B 1 8   ? 55.575  -44.579  -34.849  1.00 45.42  ? 103 CYS B CA  1 
ATOM   815  C C   . CYS B 1 8   ? 54.786  -44.013  -36.027  1.00 42.67  ? 103 CYS B C   1 
ATOM   816  O O   . CYS B 1 8   ? 54.479  -44.713  -36.964  1.00 43.85  ? 103 CYS B O   1 
ATOM   817  C CB  . CYS B 1 8   ? 56.996  -44.887  -35.298  1.00 46.01  ? 103 CYS B CB  1 
ATOM   818  S SG  . CYS B 1 8   ? 57.851  -43.529  -36.161  1.00 52.56  ? 103 CYS B SG  1 
ATOM   819  N N   . GLY B 1 9   ? 54.424  -42.744  -35.950  1.00 42.58  ? 104 GLY B N   1 
ATOM   820  C CA  . GLY B 1 9   ? 53.744  -42.066  -37.069  1.00 40.62  ? 104 GLY B CA  1 
ATOM   821  C C   . GLY B 1 9   ? 53.428  -40.592  -36.794  1.00 41.10  ? 104 GLY B C   1 
ATOM   822  O O   . GLY B 1 9   ? 53.778  -40.014  -35.731  1.00 38.49  ? 104 GLY B O   1 
ATOM   823  N N   . LEU B 1 10  ? 52.752  -40.010  -37.771  1.00 41.10  ? 105 LEU B N   1 
ATOM   824  C CA  . LEU B 1 10  ? 52.363  -38.610  -37.775  1.00 43.00  ? 105 LEU B CA  1 
ATOM   825  C C   . LEU B 1 10  ? 51.222  -38.324  -36.847  1.00 44.19  ? 105 LEU B C   1 
ATOM   826  O O   . LEU B 1 10  ? 50.238  -39.027  -36.880  1.00 50.88  ? 105 LEU B O   1 
ATOM   827  C CB  . LEU B 1 10  ? 51.920  -38.193  -39.156  1.00 44.65  ? 105 LEU B CB  1 
ATOM   828  C CG  . LEU B 1 10  ? 53.003  -37.643  -40.063  1.00 50.71  ? 105 LEU B CG  1 
ATOM   829  C CD1 . LEU B 1 10  ? 52.301  -37.257  -41.353  1.00 53.15  ? 105 LEU B CD1 1 
ATOM   830  C CD2 . LEU B 1 10  ? 53.742  -36.431  -39.477  1.00 51.75  ? 105 LEU B CD2 1 
ATOM   831  N N   . ARG B 1 11  ? 51.379  -37.294  -36.024  1.00 43.95  ? 106 ARG B N   1 
ATOM   832  C CA  . ARG B 1 11  ? 50.345  -36.797  -35.117  1.00 44.28  ? 106 ARG B CA  1 
ATOM   833  C C   . ARG B 1 11  ? 50.126  -35.302  -35.423  1.00 46.75  ? 106 ARG B C   1 
ATOM   834  O O   . ARG B 1 11  ? 50.994  -34.652  -36.000  1.00 50.28  ? 106 ARG B O   1 
ATOM   835  C CB  . ARG B 1 11  ? 50.777  -36.941  -33.655  1.00 45.97  ? 106 ARG B CB  1 
ATOM   836  C CG  . ARG B 1 11  ? 51.326  -38.298  -33.261  1.00 47.86  ? 106 ARG B CG  1 
ATOM   837  C CD  . ARG B 1 11  ? 50.249  -39.354  -33.181  1.00 45.37  ? 106 ARG B CD  1 
ATOM   838  N NE  . ARG B 1 11  ? 50.761  -40.608  -32.629  1.00 46.12  ? 106 ARG B NE  1 
ATOM   839  C CZ  . ARG B 1 11  ? 51.095  -41.687  -33.337  1.00 43.89  ? 106 ARG B CZ  1 
ATOM   840  N NH1 . ARG B 1 11  ? 51.522  -42.765  -32.700  1.00 45.87  ? 106 ARG B NH1 1 
ATOM   841  N NH2 . ARG B 1 11  ? 51.008  -41.708  -34.663  1.00 46.17  ? 106 ARG B NH2 1 
ATOM   842  N N   . GLU B 1 12  ? 48.967  -34.783  -35.031  1.00 47.04  ? 107 GLU B N   1 
ATOM   843  C CA  . GLU B 1 12  ? 48.511  -33.439  -35.387  1.00 46.31  ? 107 GLU B CA  1 
ATOM   844  C C   . GLU B 1 12  ? 48.009  -32.740  -34.169  1.00 44.89  ? 107 GLU B C   1 
ATOM   845  O O   . GLU B 1 12  ? 47.414  -33.346  -33.309  1.00 47.45  ? 107 GLU B O   1 
ATOM   846  C CB  . GLU B 1 12  ? 47.352  -33.491  -36.354  1.00 49.77  ? 107 GLU B CB  1 
ATOM   847  C CG  . GLU B 1 12  ? 47.751  -33.685  -37.798  1.00 55.65  ? 107 GLU B CG  1 
ATOM   848  C CD  . GLU B 1 12  ? 46.558  -33.854  -38.697  1.00 57.51  ? 107 GLU B CD  1 
ATOM   849  O OE1 . GLU B 1 12  ? 46.729  -34.424  -39.801  1.00 72.17  ? 107 GLU B OE1 1 
ATOM   850  O OE2 . GLU B 1 12  ? 45.459  -33.427  -38.292  1.00 60.68  ? 107 GLU B OE2 1 
ATOM   851  N N   . LEU B 1 13  ? 48.224  -31.441  -34.122  1.00 44.80  ? 108 LEU B N   1 
ATOM   852  C CA  . LEU B 1 13  ? 47.808  -30.639  -32.997  1.00 45.00  ? 108 LEU B CA  1 
ATOM   853  C C   . LEU B 1 13  ? 47.637  -29.209  -33.501  1.00 45.79  ? 108 LEU B C   1 
ATOM   854  O O   . LEU B 1 13  ? 48.516  -28.680  -34.186  1.00 39.99  ? 108 LEU B O   1 
ATOM   855  C CB  . LEU B 1 13  ? 48.882  -30.698  -31.943  1.00 48.86  ? 108 LEU B CB  1 
ATOM   856  C CG  . LEU B 1 13  ? 48.617  -29.948  -30.660  1.00 53.40  ? 108 LEU B CG  1 
ATOM   857  C CD1 . LEU B 1 13  ? 47.499  -30.658  -29.911  1.00 54.91  ? 108 LEU B CD1 1 
ATOM   858  C CD2 . LEU B 1 13  ? 49.887  -29.927  -29.835  1.00 55.92  ? 108 LEU B CD2 1 
ATOM   859  N N   . GLU B 1 14  ? 46.486  -28.617  -33.212  1.00 42.39  ? 109 GLU B N   1 
ATOM   860  C CA  . GLU B 1 14  ? 46.251  -27.222  -33.498  1.00 41.26  ? 109 GLU B CA  1 
ATOM   861  C C   . GLU B 1 14  ? 46.916  -26.413  -32.391  1.00 41.41  ? 109 GLU B C   1 
ATOM   862  O O   . GLU B 1 14  ? 46.613  -26.615  -31.225  1.00 37.50  ? 109 GLU B O   1 
ATOM   863  C CB  . GLU B 1 14  ? 44.750  -26.912  -33.523  1.00 43.81  ? 109 GLU B CB  1 
ATOM   864  C CG  . GLU B 1 14  ? 44.003  -27.641  -34.625  1.00 50.41  ? 109 GLU B CG  1 
ATOM   865  C CD  . GLU B 1 14  ? 42.517  -27.255  -34.754  1.00 55.02  ? 109 GLU B CD  1 
ATOM   866  O OE1 . GLU B 1 14  ? 41.798  -27.978  -35.494  1.00 58.45  ? 109 GLU B OE1 1 
ATOM   867  O OE2 . GLU B 1 14  ? 42.068  -26.253  -34.145  1.00 50.08  ? 109 GLU B OE2 1 
ATOM   868  N N   . VAL B 1 15  ? 47.822  -25.508  -32.758  1.00 39.45  ? 110 VAL B N   1 
ATOM   869  C CA  . VAL B 1 15  ? 48.483  -24.665  -31.794  1.00 40.18  ? 110 VAL B CA  1 
ATOM   870  C C   . VAL B 1 15  ? 48.407  -23.211  -32.188  1.00 38.97  ? 110 VAL B C   1 
ATOM   871  O O   . VAL B 1 15  ? 48.409  -22.861  -33.364  1.00 40.84  ? 110 VAL B O   1 
ATOM   872  C CB  . VAL B 1 15  ? 49.966  -25.054  -31.609  1.00 44.70  ? 110 VAL B CB  1 
ATOM   873  C CG1 . VAL B 1 15  ? 50.074  -26.510  -31.195  1.00 49.33  ? 110 VAL B CG1 1 
ATOM   874  C CG2 . VAL B 1 15  ? 50.772  -24.831  -32.877  1.00 45.02  ? 110 VAL B CG2 1 
ATOM   875  N N   . ARG B 1 16  ? 48.360  -22.374  -31.181  1.00 41.05  ? 111 ARG B N   1 
ATOM   876  C CA  . ARG B 1 16  ? 48.492  -20.939  -31.353  1.00 48.12  ? 111 ARG B CA  1 
ATOM   877  C C   . ARG B 1 16  ? 49.983  -20.665  -31.513  1.00 46.17  ? 111 ARG B C   1 
ATOM   878  O O   . ARG B 1 16  ? 50.779  -21.177  -30.731  1.00 46.64  ? 111 ARG B O   1 
ATOM   879  C CB  . ARG B 1 16  ? 47.925  -20.213  -30.123  1.00 57.74  ? 111 ARG B CB  1 
ATOM   880  C CG  . ARG B 1 16  ? 47.121  -18.964  -30.462  1.00 71.46  ? 111 ARG B CG  1 
ATOM   881  C CD  . ARG B 1 16  ? 46.550  -18.278  -29.222  1.00 79.10  ? 111 ARG B CD  1 
ATOM   882  N NE  . ARG B 1 16  ? 45.581  -19.135  -28.538  1.00 88.85  ? 111 ARG B NE  1 
ATOM   883  C CZ  . ARG B 1 16  ? 44.329  -19.381  -28.948  1.00 93.23  ? 111 ARG B CZ  1 
ATOM   884  N NH1 . ARG B 1 16  ? 43.841  -18.838  -30.069  1.00 88.38  ? 111 ARG B NH1 1 
ATOM   885  N NH2 . ARG B 1 16  ? 43.553  -20.195  -28.225  1.00 92.26  ? 111 ARG B NH2 1 
ATOM   886  N N   . VAL B 1 17  ? 50.381  -19.852  -32.486  1.00 42.13  ? 112 VAL B N   1 
ATOM   887  C CA  . VAL B 1 17  ? 51.812  -19.708  -32.765  1.00 41.16  ? 112 VAL B CA  1 
ATOM   888  C C   . VAL B 1 17  ? 52.562  -19.097  -31.589  1.00 39.18  ? 112 VAL B C   1 
ATOM   889  O O   . VAL B 1 17  ? 53.725  -19.407  -31.383  1.00 41.19  ? 112 VAL B O   1 
ATOM   890  C CB  . VAL B 1 17  ? 52.184  -19.007  -34.111  1.00 44.16  ? 112 VAL B CB  1 
ATOM   891  C CG1 . VAL B 1 17  ? 51.278  -19.413  -35.255  1.00 46.53  ? 112 VAL B CG1 1 
ATOM   892  C CG2 . VAL B 1 17  ? 52.157  -17.531  -33.995  1.00 47.74  ? 112 VAL B CG2 1 
ATOM   893  N N   . SER B 1 18  ? 51.878  -18.289  -30.792  1.00 39.99  ? 113 SER B N   1 
ATOM   894  C CA  . SER B 1 18  ? 52.470  -17.700  -29.600  1.00 39.83  ? 113 SER B CA  1 
ATOM   895  C C   . SER B 1 18  ? 52.753  -18.712  -28.484  1.00 38.50  ? 113 SER B C   1 
ATOM   896  O O   . SER B 1 18  ? 53.527  -18.418  -27.618  1.00 45.05  ? 113 SER B O   1 
ATOM   897  C CB  . SER B 1 18  ? 51.595  -16.545  -29.071  1.00 39.68  ? 113 SER B CB  1 
ATOM   898  O OG  . SER B 1 18  ? 50.367  -17.059  -28.590  1.00 43.68  ? 113 SER B OG  1 
ATOM   899  N N   . GLU B 1 19  ? 52.133  -19.878  -28.506  1.00 40.72  ? 114 GLU B N   1 
ATOM   900  C CA  . GLU B 1 19  ? 52.413  -20.939  -27.529  1.00 48.66  ? 114 GLU B CA  1 
ATOM   901  C C   . GLU B 1 19  ? 53.756  -21.646  -27.785  1.00 46.79  ? 114 GLU B C   1 
ATOM   902  O O   . GLU B 1 19  ? 54.249  -22.335  -26.900  1.00 48.20  ? 114 GLU B O   1 
ATOM   903  C CB  . GLU B 1 19  ? 51.378  -22.070  -27.602  1.00 52.06  ? 114 GLU B CB  1 
ATOM   904  C CG  . GLU B 1 19  ? 49.928  -21.808  -27.243  1.00 63.46  ? 114 GLU B CG  1 
ATOM   905  C CD  . GLU B 1 19  ? 49.046  -23.000  -27.717  1.00 78.39  ? 114 GLU B CD  1 
ATOM   906  O OE1 . GLU B 1 19  ? 49.573  -24.146  -27.756  1.00 79.44  ? 114 GLU B OE1 1 
ATOM   907  O OE2 . GLU B 1 19  ? 47.846  -22.817  -28.080  1.00 75.40  ? 114 GLU B OE2 1 
ATOM   908  N N   . LEU B 1 20  ? 54.283  -21.542  -29.005  1.00 42.51  ? 115 LEU B N   1 
ATOM   909  C CA  . LEU B 1 20  ? 55.473  -22.296  -29.436  1.00 44.21  ? 115 LEU B CA  1 
ATOM   910  C C   . LEU B 1 20  ? 56.833  -21.840  -28.865  1.00 41.23  ? 115 LEU B C   1 
ATOM   911  O O   . LEU B 1 20  ? 57.808  -22.591  -28.910  1.00 46.29  ? 115 LEU B O   1 
ATOM   912  C CB  . LEU B 1 20  ? 55.544  -22.311  -30.973  1.00 42.88  ? 115 LEU B CB  1 
ATOM   913  C CG  . LEU B 1 20  ? 54.431  -23.077  -31.679  1.00 40.51  ? 115 LEU B CG  1 
ATOM   914  C CD1 . LEU B 1 20  ? 54.496  -22.864  -33.169  1.00 43.29  ? 115 LEU B CD1 1 
ATOM   915  C CD2 . LEU B 1 20  ? 54.539  -24.559  -31.402  1.00 44.05  ? 115 LEU B CD2 1 
ATOM   916  N N   . GLY B 1 21  ? 56.884  -20.631  -28.327  1.00 44.05  ? 116 GLY B N   1 
ATOM   917  C CA  . GLY B 1 21  ? 58.087  -20.112  -27.690  1.00 46.40  ? 116 GLY B CA  1 
ATOM   918  C C   . GLY B 1 21  ? 59.192  -19.692  -28.644  1.00 45.20  ? 116 GLY B C   1 
ATOM   919  O O   . GLY B 1 21  ? 60.360  -19.667  -28.270  1.00 49.63  ? 116 GLY B O   1 
ATOM   920  N N   . LEU B 1 22  ? 58.795  -19.333  -29.856  1.00 43.34  ? 117 LEU B N   1 
ATOM   921  C CA  . LEU B 1 22  ? 59.694  -19.040  -30.950  1.00 44.20  ? 117 LEU B CA  1 
ATOM   922  C C   . LEU B 1 22  ? 59.705  -17.548  -31.229  1.00 41.34  ? 117 LEU B C   1 
ATOM   923  O O   . LEU B 1 22  ? 60.257  -17.120  -32.205  1.00 40.90  ? 117 LEU B O   1 
ATOM   924  C CB  . LEU B 1 22  ? 59.270  -19.829  -32.195  1.00 44.25  ? 117 LEU B CB  1 
ATOM   925  C CG  . LEU B 1 22  ? 59.341  -21.354  -32.063  1.00 52.13  ? 117 LEU B CG  1 
ATOM   926  C CD1 . LEU B 1 22  ? 58.661  -22.002  -33.262  1.00 54.54  ? 117 LEU B CD1 1 
ATOM   927  C CD2 . LEU B 1 22  ? 60.775  -21.854  -31.933  1.00 53.65  ? 117 LEU B CD2 1 
ATOM   928  N N   . GLY B 1 23  ? 59.100  -16.755  -30.357  1.00 45.07  ? 118 GLY B N   1 
ATOM   929  C CA  . GLY B 1 23  ? 59.236  -15.297  -30.425  1.00 48.04  ? 118 GLY B CA  1 
ATOM   930  C C   . GLY B 1 23  ? 58.200  -14.579  -31.267  1.00 49.54  ? 118 GLY B C   1 
ATOM   931  O O   . GLY B 1 23  ? 58.260  -13.375  -31.393  1.00 48.55  ? 118 GLY B O   1 
ATOM   932  N N   . TYR B 1 24  ? 57.231  -15.323  -31.798  1.00 53.83  ? 119 TYR B N   1 
ATOM   933  C CA  . TYR B 1 24  ? 56.154  -14.783  -32.613  1.00 51.48  ? 119 TYR B CA  1 
ATOM   934  C C   . TYR B 1 24  ? 54.947  -14.418  -31.759  1.00 48.90  ? 119 TYR B C   1 
ATOM   935  O O   . TYR B 1 24  ? 54.244  -15.297  -31.262  1.00 47.13  ? 119 TYR B O   1 
ATOM   936  C CB  . TYR B 1 24  ? 55.733  -15.833  -33.638  1.00 55.98  ? 119 TYR B CB  1 
ATOM   937  C CG  . TYR B 1 24  ? 56.864  -16.316  -34.490  1.00 54.03  ? 119 TYR B CG  1 
ATOM   938  C CD1 . TYR B 1 24  ? 57.521  -15.432  -35.328  1.00 53.84  ? 119 TYR B CD1 1 
ATOM   939  C CD2 . TYR B 1 24  ? 57.278  -17.662  -34.462  1.00 54.92  ? 119 TYR B CD2 1 
ATOM   940  C CE1 . TYR B 1 24  ? 58.570  -15.853  -36.130  1.00 59.28  ? 119 TYR B CE1 1 
ATOM   941  C CE2 . TYR B 1 24  ? 58.330  -18.100  -35.255  1.00 56.52  ? 119 TYR B CE2 1 
ATOM   942  C CZ  . TYR B 1 24  ? 58.977  -17.192  -36.097  1.00 59.76  ? 119 TYR B CZ  1 
ATOM   943  O OH  . TYR B 1 24  ? 60.032  -17.568  -36.915  1.00 55.41  ? 119 TYR B OH  1 
ATOM   944  N N   . ALA B 1 25  ? 54.725  -13.120  -31.581  1.00 47.75  ? 120 ALA B N   1 
ATOM   945  C CA  . ALA B 1 25  ? 53.530  -12.601  -30.903  1.00 45.94  ? 120 ALA B CA  1 
ATOM   946  C C   . ALA B 1 25  ? 52.331  -12.572  -31.870  1.00 42.83  ? 120 ALA B C   1 
ATOM   947  O O   . ALA B 1 25  ? 51.994  -11.559  -32.439  1.00 42.53  ? 120 ALA B O   1 
ATOM   948  C CB  . ALA B 1 25  ? 53.820  -11.212  -30.351  1.00 48.55  ? 120 ALA B CB  1 
ATOM   949  N N   . SER B 1 26  ? 51.682  -13.710  -32.028  1.00 44.00  ? 121 SER B N   1 
ATOM   950  C CA  . SER B 1 26  ? 50.579  -13.859  -32.961  1.00 41.56  ? 121 SER B CA  1 
ATOM   951  C C   . SER B 1 26  ? 49.506  -14.783  -32.431  1.00 41.88  ? 121 SER B C   1 
ATOM   952  O O   . SER B 1 26  ? 49.807  -15.848  -31.899  1.00 46.24  ? 121 SER B O   1 
ATOM   953  C CB  . SER B 1 26  ? 51.082  -14.416  -34.289  1.00 39.69  ? 121 SER B CB  1 
ATOM   954  O OG  . SER B 1 26  ? 49.984  -14.693  -35.143  1.00 38.24  ? 121 SER B OG  1 
ATOM   955  N N   . ASP B 1 27  ? 48.253  -14.381  -32.611  1.00 41.57  ? 122 ASP B N   1 
ATOM   956  C CA  . ASP B 1 27  ? 47.120  -15.213  -32.265  1.00 40.58  ? 122 ASP B CA  1 
ATOM   957  C C   . ASP B 1 27  ? 46.690  -16.171  -33.389  1.00 39.19  ? 122 ASP B C   1 
ATOM   958  O O   . ASP B 1 27  ? 45.696  -16.834  -33.234  1.00 39.16  ? 122 ASP B O   1 
ATOM   959  C CB  . ASP B 1 27  ? 45.949  -14.332  -31.841  1.00 47.37  ? 122 ASP B CB  1 
ATOM   960  C CG  . ASP B 1 27  ? 46.205  -13.623  -30.503  1.00 56.62  ? 122 ASP B CG  1 
ATOM   961  O OD1 . ASP B 1 27  ? 46.944  -14.190  -29.653  1.00 64.62  ? 122 ASP B OD1 1 
ATOM   962  O OD2 . ASP B 1 27  ? 45.668  -12.504  -30.300  1.00 62.55  ? 122 ASP B OD2 1 
ATOM   963  N N   . GLU B 1 28  ? 47.428  -16.254  -34.498  1.00 34.31  ? 123 GLU B N   1 
ATOM   964  C CA  . GLU B 1 28  ? 47.129  -17.237  -35.515  1.00 36.52  ? 123 GLU B CA  1 
ATOM   965  C C   . GLU B 1 28  ? 47.313  -18.659  -35.013  1.00 38.48  ? 123 GLU B C   1 
ATOM   966  O O   . GLU B 1 28  ? 48.033  -18.882  -34.035  1.00 39.25  ? 123 GLU B O   1 
ATOM   967  C CB  . GLU B 1 28  ? 47.976  -17.008  -36.759  1.00 35.35  ? 123 GLU B CB  1 
ATOM   968  C CG  . GLU B 1 28  ? 47.537  -15.780  -37.564  1.00 37.32  ? 123 GLU B CG  1 
ATOM   969  C CD  . GLU B 1 28  ? 47.635  -15.944  -39.075  1.00 40.20  ? 123 GLU B CD  1 
ATOM   970  O OE1 . GLU B 1 28  ? 47.511  -17.095  -39.581  1.00 39.24  ? 123 GLU B OE1 1 
ATOM   971  O OE2 . GLU B 1 28  ? 47.818  -14.894  -39.761  1.00 37.06  ? 123 GLU B OE2 1 
ATOM   972  N N   . THR B 1 29  ? 46.641  -19.609  -35.660  1.00 36.77  ? 124 THR B N   1 
ATOM   973  C CA  . THR B 1 29  ? 46.877  -21.010  -35.367  1.00 39.20  ? 124 THR B CA  1 
ATOM   974  C C   . THR B 1 29  ? 47.536  -21.719  -36.534  1.00 37.76  ? 124 THR B C   1 
ATOM   975  O O   . THR B 1 29  ? 47.325  -21.375  -37.703  1.00 36.43  ? 124 THR B O   1 
ATOM   976  C CB  . THR B 1 29  ? 45.626  -21.795  -34.882  1.00 40.92  ? 124 THR B CB  1 
ATOM   977  O OG1 . THR B 1 29  ? 45.001  -22.466  -35.963  1.00 51.82  ? 124 THR B OG1 1 
ATOM   978  C CG2 . THR B 1 29  ? 44.650  -20.941  -34.247  1.00 40.92  ? 124 THR B CG2 1 
ATOM   979  N N   . VAL B 1 30  ? 48.342  -22.722  -36.201  1.00 38.09  ? 125 VAL B N   1 
ATOM   980  C CA  . VAL B 1 30  ? 48.922  -23.598  -37.226  1.00 39.71  ? 125 VAL B CA  1 
ATOM   981  C C   . VAL B 1 30  ? 48.585  -25.032  -36.878  1.00 39.59  ? 125 VAL B C   1 
ATOM   982  O O   . VAL B 1 30  ? 48.332  -25.352  -35.706  1.00 39.97  ? 125 VAL B O   1 
ATOM   983  C CB  . VAL B 1 30  ? 50.452  -23.388  -37.391  1.00 42.50  ? 125 VAL B CB  1 
ATOM   984  C CG1 . VAL B 1 30  ? 50.743  -21.962  -37.844  1.00 42.52  ? 125 VAL B CG1 1 
ATOM   985  C CG2 . VAL B 1 30  ? 51.207  -23.674  -36.110  1.00 42.26  ? 125 VAL B CG2 1 
ATOM   986  N N   . LEU B 1 31  ? 48.541  -25.884  -37.891  1.00 39.23  ? 126 LEU B N   1 
ATOM   987  C CA  . LEU B 1 31  ? 48.459  -27.309  -37.665  0.50 40.48  ? 126 LEU B CA  1 
ATOM   988  C C   . LEU B 1 31  ? 49.879  -27.799  -37.489  1.00 40.99  ? 126 LEU B C   1 
ATOM   989  O O   . LEU B 1 31  ? 50.625  -27.903  -38.437  1.00 41.80  ? 126 LEU B O   1 
ATOM   990  C CB  . LEU B 1 31  ? 47.816  -28.002  -38.846  1.00 45.62  ? 126 LEU B CB  1 
ATOM   991  C CG  . LEU B 1 31  ? 47.350  -29.454  -38.641  1.00 51.14  ? 126 LEU B CG  1 
ATOM   992  C CD1 . LEU B 1 31  ? 46.297  -29.608  -37.548  1.00 53.47  ? 126 LEU B CD1 1 
ATOM   993  C CD2 . LEU B 1 31  ? 46.779  -29.971  -39.941  1.00 50.77  ? 126 LEU B CD2 1 
ATOM   994  N N   . PHE B 1 32  ? 50.264  -28.060  -36.256  1.00 38.77  ? 127 PHE B N   1 
ATOM   995  C CA  . PHE B 1 32  ? 51.557  -28.630  -35.970  1.00 40.75  ? 127 PHE B CA  1 
ATOM   996  C C   . PHE B 1 32  ? 51.526  -30.154  -36.061  1.00 38.07  ? 127 PHE B C   1 
ATOM   997  O O   . PHE B 1 32  ? 50.838  -30.787  -35.290  1.00 43.23  ? 127 PHE B O   1 
ATOM   998  C CB  . PHE B 1 32  ? 51.972  -28.193  -34.579  1.00 40.22  ? 127 PHE B CB  1 
ATOM   999  C CG  . PHE B 1 32  ? 53.335  -28.634  -34.187  1.00 41.37  ? 127 PHE B CG  1 
ATOM   1000 C CD1 . PHE B 1 32  ? 54.451  -28.001  -34.687  1.00 43.96  ? 127 PHE B CD1 1 
ATOM   1001 C CD2 . PHE B 1 32  ? 53.505  -29.666  -33.278  1.00 45.05  ? 127 PHE B CD2 1 
ATOM   1002 C CE1 . PHE B 1 32  ? 55.724  -28.398  -34.302  1.00 42.94  ? 127 PHE B CE1 1 
ATOM   1003 C CE2 . PHE B 1 32  ? 54.773  -30.073  -32.893  1.00 41.69  ? 127 PHE B CE2 1 
ATOM   1004 C CZ  . PHE B 1 32  ? 55.880  -29.437  -33.405  1.00 41.57  ? 127 PHE B CZ  1 
ATOM   1005 N N   . ARG B 1 33  ? 52.285  -30.720  -36.991  1.00 38.62  ? 128 ARG B N   1 
ATOM   1006 C CA  . ARG B 1 33  ? 52.467  -32.176  -37.123  1.00 38.87  ? 128 ARG B CA  1 
ATOM   1007 C C   . ARG B 1 33  ? 53.817  -32.636  -36.595  1.00 40.01  ? 128 ARG B C   1 
ATOM   1008 O O   . ARG B 1 33  ? 54.831  -31.985  -36.827  1.00 38.48  ? 128 ARG B O   1 
ATOM   1009 C CB  . ARG B 1 33  ? 52.392  -32.607  -38.583  1.00 40.31  ? 128 ARG B CB  1 
ATOM   1010 C CG  . ARG B 1 33  ? 51.077  -32.261  -39.249  1.00 44.96  ? 128 ARG B CG  1 
ATOM   1011 C CD  . ARG B 1 33  ? 50.689  -33.237  -40.345  1.00 49.48  ? 128 ARG B CD  1 
ATOM   1012 N NE  . ARG B 1 33  ? 49.447  -32.773  -40.941  1.00 59.86  ? 128 ARG B NE  1 
ATOM   1013 C CZ  . ARG B 1 33  ? 49.349  -32.035  -42.046  1.00 66.91  ? 128 ARG B CZ  1 
ATOM   1014 N NH1 . ARG B 1 33  ? 50.429  -31.703  -42.745  1.00 73.86  ? 128 ARG B NH1 1 
ATOM   1015 N NH2 . ARG B 1 33  ? 48.155  -31.646  -42.474  1.00 68.74  ? 128 ARG B NH2 1 
ATOM   1016 N N   . TYR B 1 34  ? 53.835  -33.792  -35.945  1.00 39.60  ? 129 TYR B N   1 
ATOM   1017 C CA  . TYR B 1 34  ? 55.058  -34.328  -35.389  1.00 37.64  ? 129 TYR B CA  1 
ATOM   1018 C C   . TYR B 1 34  ? 55.056  -35.837  -35.428  1.00 39.57  ? 129 TYR B C   1 
ATOM   1019 O O   . TYR B 1 34  ? 54.036  -36.445  -35.713  1.00 40.09  ? 129 TYR B O   1 
ATOM   1020 C CB  . TYR B 1 34  ? 55.239  -33.832  -33.966  1.00 37.14  ? 129 TYR B CB  1 
ATOM   1021 C CG  . TYR B 1 34  ? 54.130  -34.220  -33.007  1.00 39.08  ? 129 TYR B CG  1 
ATOM   1022 C CD1 . TYR B 1 34  ? 52.931  -33.512  -32.966  1.00 39.77  ? 129 TYR B CD1 1 
ATOM   1023 C CD2 . TYR B 1 34  ? 54.299  -35.265  -32.098  1.00 38.59  ? 129 TYR B CD2 1 
ATOM   1024 C CE1 . TYR B 1 34  ? 51.927  -33.848  -32.065  1.00 38.04  ? 129 TYR B CE1 1 
ATOM   1025 C CE2 . TYR B 1 34  ? 53.304  -35.595  -31.198  1.00 38.14  ? 129 TYR B CE2 1 
ATOM   1026 C CZ  . TYR B 1 34  ? 52.116  -34.888  -31.197  1.00 38.46  ? 129 TYR B CZ  1 
ATOM   1027 O OH  . TYR B 1 34  ? 51.131  -35.228  -30.308  1.00 46.53  ? 129 TYR B OH  1 
ATOM   1028 N N   . CYS B 1 35  ? 56.221  -36.418  -35.156  1.00 39.84  ? 130 CYS B N   1 
ATOM   1029 C CA  . CYS B 1 35  ? 56.406  -37.868  -35.143  1.00 40.30  ? 130 CYS B CA  1 
ATOM   1030 C C   . CYS B 1 35  ? 56.463  -38.374  -33.709  1.00 36.84  ? 130 CYS B C   1 
ATOM   1031 O O   . CYS B 1 35  ? 57.225  -37.879  -32.906  1.00 37.36  ? 130 CYS B O   1 
ATOM   1032 C CB  . CYS B 1 35  ? 57.686  -38.263  -35.881  1.00 40.22  ? 130 CYS B CB  1 
ATOM   1033 S SG  . CYS B 1 35  ? 57.657  -37.808  -37.627  1.00 44.52  ? 130 CYS B SG  1 
ATOM   1034 N N   . ALA B 1 36  ? 55.675  -39.393  -33.427  1.00 35.03  ? 131 ALA B N   1 
ATOM   1035 C CA  . ALA B 1 36  ? 55.605  -39.967  -32.103  1.00 34.90  ? 131 ALA B CA  1 
ATOM   1036 C C   . ALA B 1 36  ? 55.154  -41.411  -32.210  1.00 36.07  ? 131 ALA B C   1 
ATOM   1037 O O   . ALA B 1 36  ? 54.692  -41.858  -33.270  1.00 35.42  ? 131 ALA B O   1 
ATOM   1038 C CB  . ALA B 1 36  ? 54.638  -39.180  -31.252  1.00 36.70  ? 131 ALA B CB  1 
ATOM   1039 N N   . GLY B 1 37  ? 55.307  -42.130  -31.104  1.00 41.59  ? 132 GLY B N   1 
ATOM   1040 C CA  . GLY B 1 37  ? 55.014  -43.550  -31.037  1.00 46.50  ? 132 GLY B CA  1 
ATOM   1041 C C   . GLY B 1 37  ? 56.212  -44.470  -30.997  1.00 47.42  ? 132 GLY B C   1 
ATOM   1042 O O   . GLY B 1 37  ? 57.364  -44.044  -31.108  1.00 56.14  ? 132 GLY B O   1 
ATOM   1043 N N   . ALA B 1 38  ? 55.896  -45.752  -30.851  1.00 50.08  ? 133 ALA B N   1 
ATOM   1044 C CA  . ALA B 1 38  ? 56.869  -46.818  -30.599  1.00 47.94  ? 133 ALA B CA  1 
ATOM   1045 C C   . ALA B 1 38  ? 57.339  -47.448  -31.904  1.00 45.04  ? 133 ALA B C   1 
ATOM   1046 O O   . ALA B 1 38  ? 56.568  -47.606  -32.850  1.00 46.61  ? 133 ALA B O   1 
ATOM   1047 C CB  . ALA B 1 38  ? 56.246  -47.882  -29.713  1.00 47.91  ? 133 ALA B CB  1 
ATOM   1048 N N   . CYS B 1 39  ? 58.622  -47.772  -31.941  1.00 47.70  ? 134 CYS B N   1 
ATOM   1049 C CA  . CYS B 1 39  ? 59.231  -48.509  -33.036  1.00 48.50  ? 134 CYS B CA  1 
ATOM   1050 C C   . CYS B 1 39  ? 59.139  -49.970  -32.619  1.00 47.83  ? 134 CYS B C   1 
ATOM   1051 O O   . CYS B 1 39  ? 59.780  -50.381  -31.681  1.00 47.27  ? 134 CYS B O   1 
ATOM   1052 C CB  . CYS B 1 39  ? 60.681  -48.034  -33.219  1.00 49.68  ? 134 CYS B CB  1 
ATOM   1053 S SG  . CYS B 1 39  ? 60.795  -46.352  -33.935  1.00 50.41  ? 134 CYS B SG  1 
ATOM   1054 N N   . GLU B 1 40  ? 58.302  -50.724  -33.313  1.00 51.47  ? 135 GLU B N   1 
ATOM   1055 C CA  . GLU B 1 40  ? 57.882  -52.047  -32.895  1.00 54.86  ? 135 GLU B CA  1 
ATOM   1056 C C   . GLU B 1 40  ? 58.537  -53.207  -33.636  1.00 50.62  ? 135 GLU B C   1 
ATOM   1057 O O   . GLU B 1 40  ? 58.364  -54.345  -33.226  1.00 52.09  ? 135 GLU B O   1 
ATOM   1058 C CB  . GLU B 1 40  ? 56.370  -52.140  -33.059  1.00 64.07  ? 135 GLU B CB  1 
ATOM   1059 C CG  . GLU B 1 40  ? 55.610  -51.149  -32.184  1.00 73.34  ? 135 GLU B CG  1 
ATOM   1060 C CD  . GLU B 1 40  ? 54.103  -51.352  -32.213  1.00 77.89  ? 135 GLU B CD  1 
ATOM   1061 O OE1 . GLU B 1 40  ? 53.465  -51.129  -31.154  1.00 81.67  ? 135 GLU B OE1 1 
ATOM   1062 O OE2 . GLU B 1 40  ? 53.567  -51.731  -33.289  1.00 76.36  ? 135 GLU B OE2 1 
ATOM   1063 N N   . ALA B 1 41  ? 59.279  -52.937  -34.710  1.00 43.65  ? 136 ALA B N   1 
ATOM   1064 C CA  . ALA B 1 41  ? 59.936  -53.993  -35.459  1.00 39.90  ? 136 ALA B CA  1 
ATOM   1065 C C   . ALA B 1 41  ? 60.873  -54.811  -34.582  1.00 40.28  ? 136 ALA B C   1 
ATOM   1066 O O   . ALA B 1 41  ? 61.396  -54.327  -33.596  1.00 39.85  ? 136 ALA B O   1 
ATOM   1067 C CB  . ALA B 1 41  ? 60.708  -53.432  -36.642  1.00 38.16  ? 136 ALA B CB  1 
ATOM   1068 N N   . ALA B 1 42  ? 61.078  -56.062  -34.965  1.00 38.54  ? 137 ALA B N   1 
ATOM   1069 C CA  . ALA B 1 42  ? 62.068  -56.915  -34.338  1.00 41.38  ? 137 ALA B CA  1 
ATOM   1070 C C   . ALA B 1 42  ? 63.426  -56.209  -34.259  1.00 39.08  ? 137 ALA B C   1 
ATOM   1071 O O   . ALA B 1 42  ? 63.838  -55.515  -35.189  1.00 38.30  ? 137 ALA B O   1 
ATOM   1072 C CB  . ALA B 1 42  ? 62.227  -58.211  -35.132  1.00 42.16  ? 137 ALA B CB  1 
ATOM   1073 N N   . ALA B 1 43  ? 64.108  -56.437  -33.150  1.00 33.77  ? 138 ALA B N   1 
ATOM   1074 C CA  . ALA B 1 43  ? 65.431  -55.930  -32.918  1.00 35.18  ? 138 ALA B CA  1 
ATOM   1075 C C   . ALA B 1 43  ? 66.405  -56.425  -33.983  1.00 35.78  ? 138 ALA B C   1 
ATOM   1076 O O   . ALA B 1 43  ? 66.423  -57.615  -34.341  1.00 37.71  ? 138 ALA B O   1 
ATOM   1077 C CB  . ALA B 1 43  ? 65.920  -56.336  -31.531  1.00 35.84  ? 138 ALA B CB  1 
ATOM   1078 N N   . ARG B 1 44  ? 67.218  -55.486  -34.459  1.00 33.27  ? 139 ARG B N   1 
ATOM   1079 C CA  . ARG B 1 44  ? 68.277  -55.755  -35.401  1.00 32.18  ? 139 ARG B CA  1 
ATOM   1080 C C   . ARG B 1 44  ? 69.413  -56.468  -34.715  1.00 32.76  ? 139 ARG B C   1 
ATOM   1081 O O   . ARG B 1 44  ? 69.675  -56.223  -33.515  1.00 32.79  ? 139 ARG B O   1 
ATOM   1082 C CB  . ARG B 1 44  ? 68.842  -54.434  -35.893  1.00 33.83  ? 139 ARG B CB  1 
ATOM   1083 C CG  . ARG B 1 44  ? 67.950  -53.646  -36.810  1.00 34.34  ? 139 ARG B CG  1 
ATOM   1084 C CD  . ARG B 1 44  ? 68.718  -52.481  -37.397  1.00 34.52  ? 139 ARG B CD  1 
ATOM   1085 N NE  . ARG B 1 44  ? 68.045  -52.005  -38.580  1.00 35.09  ? 139 ARG B NE  1 
ATOM   1086 C CZ  . ARG B 1 44  ? 68.223  -52.464  -39.810  1.00 38.00  ? 139 ARG B CZ  1 
ATOM   1087 N NH1 . ARG B 1 44  ? 69.112  -53.434  -40.080  1.00 39.80  ? 139 ARG B NH1 1 
ATOM   1088 N NH2 . ARG B 1 44  ? 67.513  -51.921  -40.786  1.00 36.73  ? 139 ARG B NH2 1 
ATOM   1089 N N   . VAL B 1 45  ? 70.140  -57.280  -35.486  1.00 33.04  ? 140 VAL B N   1 
ATOM   1090 C CA  . VAL B 1 45  ? 71.346  -57.913  -34.966  1.00 33.48  ? 140 VAL B CA  1 
ATOM   1091 C C   . VAL B 1 45  ? 72.377  -56.870  -34.624  1.00 31.12  ? 140 VAL B C   1 
ATOM   1092 O O   . VAL B 1 45  ? 73.096  -57.038  -33.676  1.00 29.42  ? 140 VAL B O   1 
ATOM   1093 C CB  . VAL B 1 45  ? 71.987  -58.974  -35.900  1.00 35.02  ? 140 VAL B CB  1 
ATOM   1094 C CG1 . VAL B 1 45  ? 71.139  -60.219  -35.935  1.00 37.68  ? 140 VAL B CG1 1 
ATOM   1095 C CG2 . VAL B 1 45  ? 72.206  -58.448  -37.286  1.00 36.97  ? 140 VAL B CG2 1 
ATOM   1096 N N   . TYR B 1 46  ? 72.443  -55.805  -35.420  1.00 32.10  ? 141 TYR B N   1 
ATOM   1097 C CA  . TYR B 1 46  ? 73.301  -54.636  -35.131  1.00 32.07  ? 141 TYR B CA  1 
ATOM   1098 C C   . TYR B 1 46  ? 73.055  -54.079  -33.742  1.00 31.14  ? 141 TYR B C   1 
ATOM   1099 O O   . TYR B 1 46  ? 73.983  -53.871  -32.995  1.00 31.95  ? 141 TYR B O   1 
ATOM   1100 C CB  . TYR B 1 46  ? 73.070  -53.536  -36.174  1.00 31.61  ? 141 TYR B CB  1 
ATOM   1101 C CG  . TYR B 1 46  ? 73.649  -52.214  -35.826  1.00 30.89  ? 141 TYR B CG  1 
ATOM   1102 C CD1 . TYR B 1 46  ? 74.962  -51.934  -36.071  1.00 32.65  ? 141 TYR B CD1 1 
ATOM   1103 C CD2 . TYR B 1 46  ? 72.857  -51.212  -35.276  1.00 32.46  ? 141 TYR B CD2 1 
ATOM   1104 C CE1 . TYR B 1 46  ? 75.502  -50.695  -35.774  1.00 33.45  ? 141 TYR B CE1 1 
ATOM   1105 C CE2 . TYR B 1 46  ? 73.376  -49.971  -34.988  1.00 34.49  ? 141 TYR B CE2 1 
ATOM   1106 C CZ  . TYR B 1 46  ? 74.708  -49.714  -35.233  1.00 35.50  ? 141 TYR B CZ  1 
ATOM   1107 O OH  . TYR B 1 46  ? 75.220  -48.474  -34.925  1.00 35.30  ? 141 TYR B OH  1 
ATOM   1108 N N   . ASP B 1 47  ? 71.799  -53.857  -33.402  1.00 31.90  ? 142 ASP B N   1 
ATOM   1109 C CA  . ASP B 1 47  ? 71.465  -53.293  -32.091  1.00 34.20  ? 142 ASP B CA  1 
ATOM   1110 C C   . ASP B 1 47  ? 71.717  -54.286  -30.952  1.00 36.69  ? 142 ASP B C   1 
ATOM   1111 O O   . ASP B 1 47  ? 72.191  -53.898  -29.887  1.00 36.67  ? 142 ASP B O   1 
ATOM   1112 C CB  . ASP B 1 47  ? 70.025  -52.781  -32.072  1.00 33.48  ? 142 ASP B CB  1 
ATOM   1113 C CG  . ASP B 1 47  ? 69.868  -51.454  -32.823  1.00 37.09  ? 142 ASP B CG  1 
ATOM   1114 O OD1 . ASP B 1 47  ? 70.786  -50.613  -32.709  1.00 37.92  ? 142 ASP B OD1 1 
ATOM   1115 O OD2 . ASP B 1 47  ? 68.842  -51.239  -33.525  1.00 35.58  ? 142 ASP B OD2 1 
ATOM   1116 N N   . LEU B 1 48  ? 71.430  -55.567  -31.185  1.00 37.27  ? 143 LEU B N   1 
ATOM   1117 C CA  . LEU B 1 48  ? 71.683  -56.598  -30.169  1.00 36.67  ? 143 LEU B CA  1 
ATOM   1118 C C   . LEU B 1 48  ? 73.190  -56.715  -29.896  1.00 36.11  ? 143 LEU B C   1 
ATOM   1119 O O   . LEU B 1 48  ? 73.645  -56.775  -28.745  1.00 36.97  ? 143 LEU B O   1 
ATOM   1120 C CB  . LEU B 1 48  ? 71.085  -57.936  -30.600  1.00 36.32  ? 143 LEU B CB  1 
ATOM   1121 C CG  . LEU B 1 48  ? 69.727  -58.410  -30.108  1.00 37.07  ? 143 LEU B CG  1 
ATOM   1122 C CD1 . LEU B 1 48  ? 68.900  -57.414  -29.326  1.00 37.38  ? 143 LEU B CD1 1 
ATOM   1123 C CD2 . LEU B 1 48  ? 68.923  -59.002  -31.241  1.00 38.84  ? 143 LEU B CD2 1 
ATOM   1124 N N   . GLY B 1 49  ? 73.963  -56.688  -30.963  1.00 36.80  ? 144 GLY B N   1 
ATOM   1125 C CA  . GLY B 1 49  ? 75.430  -56.631  -30.859  1.00 37.01  ? 144 GLY B CA  1 
ATOM   1126 C C   . GLY B 1 49  ? 75.928  -55.433  -30.067  1.00 35.51  ? 144 GLY B C   1 
ATOM   1127 O O   . GLY B 1 49  ? 76.767  -55.539  -29.173  1.00 35.24  ? 144 GLY B O   1 
ATOM   1128 N N   . LEU B 1 50  ? 75.402  -54.283  -30.427  1.00 35.58  ? 145 LEU B N   1 
ATOM   1129 C CA  . LEU B 1 50  ? 75.801  -53.021  -29.852  1.00 36.43  ? 145 LEU B CA  1 
ATOM   1130 C C   . LEU B 1 50  ? 75.420  -52.960  -28.363  1.00 35.35  ? 145 LEU B C   1 
ATOM   1131 O O   . LEU B 1 50  ? 76.208  -52.531  -27.552  1.00 35.98  ? 145 LEU B O   1 
ATOM   1132 C CB  . LEU B 1 50  ? 75.145  -51.896  -30.640  1.00 37.88  ? 145 LEU B CB  1 
ATOM   1133 C CG  . LEU B 1 50  ? 75.691  -50.488  -30.612  1.00 38.61  ? 145 LEU B CG  1 
ATOM   1134 C CD1 . LEU B 1 50  ? 77.117  -50.458  -31.109  1.00 38.04  ? 145 LEU B CD1 1 
ATOM   1135 C CD2 . LEU B 1 50  ? 74.812  -49.632  -31.505  1.00 39.86  ? 145 LEU B CD2 1 
ATOM   1136 N N   . ARG B 1 51  ? 74.244  -53.453  -28.011  1.00 34.03  ? 146 ARG B N   1 
ATOM   1137 C CA  . ARG B 1 51  ? 73.836  -53.508  -26.620  1.00 35.77  ? 146 ARG B CA  1 
ATOM   1138 C C   . ARG B 1 51  ? 74.750  -54.345  -25.747  1.00 37.32  ? 146 ARG B C   1 
ATOM   1139 O O   . ARG B 1 51  ? 75.025  -53.980  -24.615  1.00 40.28  ? 146 ARG B O   1 
ATOM   1140 C CB  . ARG B 1 51  ? 72.416  -54.039  -26.503  1.00 37.38  ? 146 ARG B CB  1 
ATOM   1141 C CG  . ARG B 1 51  ? 71.378  -53.029  -26.944  1.00 39.02  ? 146 ARG B CG  1 
ATOM   1142 C CD  . ARG B 1 51  ? 69.977  -53.608  -26.981  1.00 37.45  ? 146 ARG B CD  1 
ATOM   1143 N NE  . ARG B 1 51  ? 69.156  -52.809  -27.873  1.00 41.09  ? 146 ARG B NE  1 
ATOM   1144 C CZ  . ARG B 1 51  ? 67.998  -53.182  -28.398  1.00 43.50  ? 146 ARG B CZ  1 
ATOM   1145 N NH1 . ARG B 1 51  ? 67.491  -54.379  -28.130  1.00 43.92  ? 146 ARG B NH1 1 
ATOM   1146 N NH2 . ARG B 1 51  ? 67.359  -52.352  -29.229  1.00 42.72  ? 146 ARG B NH2 1 
ATOM   1147 N N   . ARG B 1 52  ? 75.191  -55.481  -26.280  1.00 38.67  ? 147 ARG B N   1 
ATOM   1148 C CA  . ARG B 1 52  ? 76.119  -56.376  -25.607  1.00 38.01  ? 147 ARG B CA  1 
ATOM   1149 C C   . ARG B 1 52  ? 77.525  -55.751  -25.454  1.00 38.04  ? 147 ARG B C   1 
ATOM   1150 O O   . ARG B 1 52  ? 78.119  -55.790  -24.386  1.00 36.90  ? 147 ARG B O   1 
ATOM   1151 C CB  . ARG B 1 52  ? 76.192  -57.687  -26.388  1.00 38.34  ? 147 ARG B CB  1 
ATOM   1152 C CG  . ARG B 1 52  ? 77.272  -58.655  -25.976  1.00 37.95  ? 147 ARG B CG  1 
ATOM   1153 C CD  . ARG B 1 52  ? 77.177  -59.132  -24.546  1.00 37.36  ? 147 ARG B CD  1 
ATOM   1154 N NE  . ARG B 1 52  ? 76.272  -60.265  -24.334  1.00 42.25  ? 147 ARG B NE  1 
ATOM   1155 C CZ  . ARG B 1 52  ? 76.589  -61.573  -24.422  1.00 42.36  ? 147 ARG B CZ  1 
ATOM   1156 N NH1 . ARG B 1 52  ? 77.786  -62.002  -24.791  1.00 40.73  ? 147 ARG B NH1 1 
ATOM   1157 N NH2 . ARG B 1 52  ? 75.668  -62.488  -24.155  1.00 42.25  ? 147 ARG B NH2 1 
ATOM   1158 N N   . LEU B 1 53  ? 78.040  -55.178  -26.526  1.00 35.78  ? 148 LEU B N   1 
ATOM   1159 C CA  . LEU B 1 53  ? 79.326  -54.532  -26.480  1.00 35.96  ? 148 LEU B CA  1 
ATOM   1160 C C   . LEU B 1 53  ? 79.311  -53.324  -25.529  1.00 41.10  ? 148 LEU B C   1 
ATOM   1161 O O   . LEU B 1 53  ? 80.325  -53.035  -24.889  1.00 34.81  ? 148 LEU B O   1 
ATOM   1162 C CB  . LEU B 1 53  ? 79.735  -54.086  -27.871  1.00 36.43  ? 148 LEU B CB  1 
ATOM   1163 C CG  . LEU B 1 53  ? 80.133  -55.189  -28.859  1.00 37.02  ? 148 LEU B CG  1 
ATOM   1164 C CD1 . LEU B 1 53  ? 80.400  -54.549  -30.210  1.00 39.28  ? 148 LEU B CD1 1 
ATOM   1165 C CD2 . LEU B 1 53  ? 81.373  -55.936  -28.397  1.00 37.88  ? 148 LEU B CD2 1 
ATOM   1166 N N   . ARG B 1 54  ? 78.177  -52.619  -25.449  1.00 41.07  ? 149 ARG B N   1 
ATOM   1167 C CA  . ARG B 1 54  ? 78.056  -51.512  -24.518  1.00 42.51  ? 149 ARG B CA  1 
ATOM   1168 C C   . ARG B 1 54  ? 78.068  -52.017  -23.091  1.00 41.06  ? 149 ARG B C   1 
ATOM   1169 O O   . ARG B 1 54  ? 78.800  -51.497  -22.269  1.00 41.74  ? 149 ARG B O   1 
ATOM   1170 C CB  . ARG B 1 54  ? 76.803  -50.699  -24.740  1.00 43.53  ? 149 ARG B CB  1 
ATOM   1171 C CG  . ARG B 1 54  ? 76.694  -49.539  -23.754  1.00 41.27  ? 149 ARG B CG  1 
ATOM   1172 C CD  . ARG B 1 54  ? 75.593  -48.591  -24.154  1.00 41.37  ? 149 ARG B CD  1 
ATOM   1173 N NE  . ARG B 1 54  ? 74.293  -49.257  -24.153  1.00 44.46  ? 149 ARG B NE  1 
ATOM   1174 C CZ  . ARG B 1 54  ? 73.211  -48.804  -24.786  1.00 41.91  ? 149 ARG B CZ  1 
ATOM   1175 N NH1 . ARG B 1 54  ? 73.262  -47.679  -25.503  1.00 44.58  ? 149 ARG B NH1 1 
ATOM   1176 N NH2 . ARG B 1 54  ? 72.091  -49.495  -24.714  1.00 36.66  ? 149 ARG B NH2 1 
ATOM   1177 N N   . GLN B 1 55  ? 77.303  -53.060  -22.810  1.00 43.84  ? 150 GLN B N   1 
ATOM   1178 C CA  . GLN B 1 55  ? 77.293  -53.632  -21.470  1.00 45.41  ? 150 GLN B CA  1 
ATOM   1179 C C   . GLN B 1 55  ? 78.669  -54.088  -21.042  1.00 47.11  ? 150 GLN B C   1 
ATOM   1180 O O   . GLN B 1 55  ? 79.048  -53.917  -19.908  1.00 51.14  ? 150 GLN B O   1 
ATOM   1181 C CB  . GLN B 1 55  ? 76.324  -54.784  -21.379  1.00 47.31  ? 150 GLN B CB  1 
ATOM   1182 C CG  . GLN B 1 55  ? 75.976  -55.169  -19.943  1.00 50.39  ? 150 GLN B CG  1 
ATOM   1183 C CD  . GLN B 1 55  ? 76.982  -56.121  -19.296  1.00 54.00  ? 150 GLN B CD  1 
ATOM   1184 O OE1 . GLN B 1 55  ? 77.868  -56.682  -19.960  1.00 52.93  ? 150 GLN B OE1 1 
ATOM   1185 N NE2 . GLN B 1 55  ? 76.847  -56.301  -17.984  1.00 56.17  ? 150 GLN B NE2 1 
ATOM   1186 N N   . ARG B 1 56  ? 79.421  -54.634  -21.980  1.00 52.49  ? 151 ARG B N   1 
ATOM   1187 C CA  . ARG B 1 56  ? 80.749  -55.163  -21.732  1.00 52.69  ? 151 ARG B CA  1 
ATOM   1188 C C   . ARG B 1 56  ? 81.822  -54.058  -21.734  1.00 54.11  ? 151 ARG B C   1 
ATOM   1189 O O   . ARG B 1 56  ? 83.012  -54.335  -21.744  1.00 52.41  ? 151 ARG B O   1 
ATOM   1190 C CB  . ARG B 1 56  ? 81.057  -56.220  -22.804  1.00 54.16  ? 151 ARG B CB  1 
ATOM   1191 C CG  . ARG B 1 56  ? 81.406  -57.572  -22.229  1.00 63.66  ? 151 ARG B CG  1 
ATOM   1192 C CD  . ARG B 1 56  ? 80.181  -58.407  -21.875  1.00 66.66  ? 151 ARG B CD  1 
ATOM   1193 N NE  . ARG B 1 56  ? 80.479  -59.840  -21.779  1.00 72.94  ? 151 ARG B NE  1 
ATOM   1194 C CZ  . ARG B 1 56  ? 80.893  -60.616  -22.793  1.00 82.70  ? 151 ARG B CZ  1 
ATOM   1195 N NH1 . ARG B 1 56  ? 81.110  -60.126  -24.026  1.00 91.04  ? 151 ARG B NH1 1 
ATOM   1196 N NH2 . ARG B 1 56  ? 81.105  -61.910  -22.580  1.00 82.89  ? 151 ARG B NH2 1 
ATOM   1197 N N   . ARG B 1 57  ? 81.397  -52.803  -21.759  1.00 58.05  ? 152 ARG B N   1 
ATOM   1198 C CA  . ARG B 1 57  ? 82.306  -51.658  -21.726  1.00 62.10  ? 152 ARG B CA  1 
ATOM   1199 C C   . ARG B 1 57  ? 83.351  -51.701  -22.841  1.00 56.64  ? 152 ARG B C   1 
ATOM   1200 O O   . ARG B 1 57  ? 84.504  -51.366  -22.621  1.00 59.48  ? 152 ARG B O   1 
ATOM   1201 C CB  . ARG B 1 57  ? 82.977  -51.549  -20.342  1.00 68.16  ? 152 ARG B CB  1 
ATOM   1202 C CG  . ARG B 1 57  ? 82.014  -51.455  -19.159  1.00 74.95  ? 152 ARG B CG  1 
ATOM   1203 C CD  . ARG B 1 57  ? 82.026  -50.071  -18.540  1.00 91.70  ? 152 ARG B CD  1 
ATOM   1204 N NE  . ARG B 1 57  ? 81.204  -49.992  -17.333  1.00 106.24 ? 152 ARG B NE  1 
ATOM   1205 C CZ  . ARG B 1 57  ? 81.021  -48.887  -16.610  1.00 108.17 ? 152 ARG B CZ  1 
ATOM   1206 N NH1 . ARG B 1 57  ? 81.609  -47.741  -16.961  1.00 107.89 ? 152 ARG B NH1 1 
ATOM   1207 N NH2 . ARG B 1 57  ? 80.247  -48.926  -15.525  1.00 107.18 ? 152 ARG B NH2 1 
ATOM   1208 N N   . ARG B 1 58  ? 82.940  -52.087  -24.043  1.00 53.01  ? 153 ARG B N   1 
ATOM   1209 C CA  . ARG B 1 58  ? 83.857  -52.173  -25.181  1.00 48.68  ? 153 ARG B CA  1 
ATOM   1210 C C   . ARG B 1 58  ? 83.789  -50.990  -26.149  1.00 46.29  ? 153 ARG B C   1 
ATOM   1211 O O   . ARG B 1 58  ? 84.568  -50.953  -27.076  1.00 50.69  ? 153 ARG B O   1 
ATOM   1212 C CB  . ARG B 1 58  ? 83.685  -53.521  -25.921  1.00 48.50  ? 153 ARG B CB  1 
ATOM   1213 C CG  . ARG B 1 58  ? 84.119  -54.756  -25.105  1.00 48.42  ? 153 ARG B CG  1 
ATOM   1214 C CD  . ARG B 1 58  ? 84.930  -55.784  -25.904  1.00 50.23  ? 153 ARG B CD  1 
ATOM   1215 N NE  . ARG B 1 58  ? 86.023  -55.101  -26.581  1.00 53.65  ? 153 ARG B NE  1 
ATOM   1216 C CZ  . ARG B 1 58  ? 86.580  -55.441  -27.740  1.00 52.33  ? 153 ARG B CZ  1 
ATOM   1217 N NH1 . ARG B 1 58  ? 86.196  -56.496  -28.429  1.00 46.95  ? 153 ARG B NH1 1 
ATOM   1218 N NH2 . ARG B 1 58  ? 87.551  -54.680  -28.223  1.00 62.83  ? 153 ARG B NH2 1 
ATOM   1219 N N   . LEU B 1 59  ? 82.939  -49.993  -25.916  1.00 48.08  ? 154 LEU B N   1 
ATOM   1220 C CA  . LEU B 1 59  ? 82.731  -48.899  -26.903  1.00 55.22  ? 154 LEU B CA  1 
ATOM   1221 C C   . LEU B 1 59  ? 83.323  -47.497  -26.622  1.00 63.80  ? 154 LEU B C   1 
ATOM   1222 O O   . LEU B 1 59  ? 82.739  -46.463  -27.015  1.00 76.92  ? 154 LEU B O   1 
ATOM   1223 C CB  . LEU B 1 59  ? 81.222  -48.729  -27.167  1.00 54.99  ? 154 LEU B CB  1 
ATOM   1224 C CG  . LEU B 1 59  ? 80.435  -49.936  -27.648  1.00 50.01  ? 154 LEU B CG  1 
ATOM   1225 C CD1 . LEU B 1 59  ? 78.991  -49.507  -27.806  1.00 50.06  ? 154 LEU B CD1 1 
ATOM   1226 C CD2 . LEU B 1 59  ? 80.999  -50.506  -28.942  1.00 50.21  ? 154 LEU B CD2 1 
ATOM   1227 N N   . ARG B 1 60  ? 84.466  -47.435  -25.963  1.00 68.82  ? 155 ARG B N   1 
ATOM   1228 C CA  . ARG B 1 60  ? 85.154  -46.141  -25.764  1.00 82.21  ? 155 ARG B CA  1 
ATOM   1229 C C   . ARG B 1 60  ? 84.334  -45.076  -25.025  1.00 78.98  ? 155 ARG B C   1 
ATOM   1230 O O   . ARG B 1 60  ? 84.569  -43.885  -25.193  1.00 83.11  ? 155 ARG B O   1 
ATOM   1231 C CB  . ARG B 1 60  ? 85.614  -45.554  -27.106  1.00 84.67  ? 155 ARG B CB  1 
ATOM   1232 C CG  . ARG B 1 60  ? 86.580  -46.449  -27.852  1.00 95.80  ? 155 ARG B CG  1 
ATOM   1233 C CD  . ARG B 1 60  ? 87.496  -45.653  -28.778  1.00 102.09 ? 155 ARG B CD  1 
ATOM   1234 N NE  . ARG B 1 60  ? 86.914  -45.457  -30.105  1.00 105.76 ? 155 ARG B NE  1 
ATOM   1235 C CZ  . ARG B 1 60  ? 86.781  -46.414  -31.030  1.00 112.54 ? 155 ARG B CZ  1 
ATOM   1236 N NH1 . ARG B 1 60  ? 86.245  -46.124  -32.213  1.00 107.03 ? 155 ARG B NH1 1 
ATOM   1237 N NH2 . ARG B 1 60  ? 87.171  -47.669  -30.784  1.00 114.79 ? 155 ARG B NH2 1 
ATOM   1238 N N   . ARG B 1 61  ? 83.378  -45.507  -24.212  1.00 85.71  ? 156 ARG B N   1 
ATOM   1239 C CA  . ARG B 1 61  ? 82.587  -44.594  -23.409  1.00 92.17  ? 156 ARG B CA  1 
ATOM   1240 C C   . ARG B 1 61  ? 82.147  -43.364  -24.208  1.00 84.64  ? 156 ARG B C   1 
ATOM   1241 O O   . ARG B 1 61  ? 82.557  -42.245  -23.938  1.00 92.96  ? 156 ARG B O   1 
ATOM   1242 C CB  . ARG B 1 61  ? 83.390  -44.169  -22.178  1.00 99.77  ? 156 ARG B CB  1 
ATOM   1243 C CG  . ARG B 1 61  ? 82.507  -43.713  -21.043  1.00 115.06 ? 156 ARG B CG  1 
ATOM   1244 C CD  . ARG B 1 61  ? 83.043  -42.499  -20.275  1.00 122.82 ? 156 ARG B CD  1 
ATOM   1245 N NE  . ARG B 1 61  ? 81.978  -41.576  -19.860  1.00 125.23 ? 156 ARG B NE  1 
ATOM   1246 C CZ  . ARG B 1 61  ? 80.819  -41.918  -19.280  1.00 124.16 ? 156 ARG B CZ  1 
ATOM   1247 N NH1 . ARG B 1 61  ? 80.525  -43.188  -18.975  1.00 118.78 ? 156 ARG B NH1 1 
ATOM   1248 N NH2 . ARG B 1 61  ? 79.936  -40.969  -18.976  1.00 122.16 ? 156 ARG B NH2 1 
ATOM   1249 N N   . GLU B 1 62  ? 81.332  -43.593  -25.216  1.00 75.14  ? 157 GLU B N   1 
ATOM   1250 C CA  . GLU B 1 62  ? 80.806  -42.517  -26.047  1.00 68.28  ? 157 GLU B CA  1 
ATOM   1251 C C   . GLU B 1 62  ? 79.285  -42.642  -26.109  1.00 63.46  ? 157 GLU B C   1 
ATOM   1252 O O   . GLU B 1 62  ? 78.725  -43.661  -25.739  1.00 57.87  ? 157 GLU B O   1 
ATOM   1253 C CB  . GLU B 1 62  ? 81.417  -42.627  -27.447  1.00 66.78  ? 157 GLU B CB  1 
ATOM   1254 C CG  . GLU B 1 62  ? 81.173  -41.450  -28.365  1.00 61.70  ? 157 GLU B CG  1 
ATOM   1255 C CD  . GLU B 1 62  ? 81.899  -41.569  -29.691  1.00 62.61  ? 157 GLU B CD  1 
ATOM   1256 O OE1 . GLU B 1 62  ? 81.887  -40.591  -30.485  1.00 64.57  ? 157 GLU B OE1 1 
ATOM   1257 O OE2 . GLU B 1 62  ? 82.486  -42.630  -29.963  1.00 58.87  ? 157 GLU B OE2 1 
ATOM   1258 N N   . ARG B 1 63  ? 78.624  -41.593  -26.573  1.00 59.98  ? 158 ARG B N   1 
ATOM   1259 C CA  . ARG B 1 63  ? 77.181  -41.640  -26.798  1.00 60.94  ? 158 ARG B CA  1 
ATOM   1260 C C   . ARG B 1 63  ? 76.829  -42.582  -27.959  1.00 56.30  ? 158 ARG B C   1 
ATOM   1261 O O   . ARG B 1 63  ? 77.284  -42.373  -29.106  1.00 47.18  ? 158 ARG B O   1 
ATOM   1262 C CB  . ARG B 1 63  ? 76.636  -40.248  -27.093  1.00 64.04  ? 158 ARG B CB  1 
ATOM   1263 C CG  . ARG B 1 63  ? 75.125  -40.154  -26.974  1.00 72.97  ? 158 ARG B CG  1 
ATOM   1264 C CD  . ARG B 1 63  ? 74.612  -38.879  -27.622  1.00 83.84  ? 158 ARG B CD  1 
ATOM   1265 N NE  . ARG B 1 63  ? 73.270  -38.539  -27.141  1.00 93.17  ? 158 ARG B NE  1 
ATOM   1266 C CZ  . ARG B 1 63  ? 72.897  -37.367  -26.614  1.00 102.83 ? 158 ARG B CZ  1 
ATOM   1267 N NH1 . ARG B 1 63  ? 73.754  -36.341  -26.487  1.00 104.34 ? 158 ARG B NH1 1 
ATOM   1268 N NH2 . ARG B 1 63  ? 71.637  -37.212  -26.210  1.00 100.31 ? 158 ARG B NH2 1 
ATOM   1269 N N   . VAL B 1 64  ? 76.032  -43.613  -27.644  1.00 48.48  ? 159 VAL B N   1 
ATOM   1270 C CA  . VAL B 1 64  ? 75.579  -44.566  -28.654  1.00 49.33  ? 159 VAL B CA  1 
ATOM   1271 C C   . VAL B 1 64  ? 74.071  -44.826  -28.545  1.00 43.41  ? 159 VAL B C   1 
ATOM   1272 O O   . VAL B 1 64  ? 73.546  -45.086  -27.461  1.00 41.04  ? 159 VAL B O   1 
ATOM   1273 C CB  . VAL B 1 64  ? 76.414  -45.884  -28.619  1.00 50.98  ? 159 VAL B CB  1 
ATOM   1274 C CG1 . VAL B 1 64  ? 75.881  -46.870  -27.605  1.00 56.72  ? 159 VAL B CG1 1 
ATOM   1275 C CG2 . VAL B 1 64  ? 76.382  -46.566  -29.958  1.00 52.19  ? 159 VAL B CG2 1 
ATOM   1276 N N   . ARG B 1 65  ? 73.396  -44.735  -29.679  1.00 40.60  ? 160 ARG B N   1 
ATOM   1277 C CA  . ARG B 1 65  ? 71.993  -45.077  -29.788  1.00 41.46  ? 160 ARG B CA  1 
ATOM   1278 C C   . ARG B 1 65  ? 71.843  -46.515  -30.334  1.00 40.98  ? 160 ARG B C   1 
ATOM   1279 O O   . ARG B 1 65  ? 72.128  -46.780  -31.507  1.00 41.56  ? 160 ARG B O   1 
ATOM   1280 C CB  . ARG B 1 65  ? 71.285  -44.080  -30.689  1.00 43.73  ? 160 ARG B CB  1 
ATOM   1281 C CG  . ARG B 1 65  ? 70.042  -43.516  -30.050  1.00 55.08  ? 160 ARG B CG  1 
ATOM   1282 C CD  . ARG B 1 65  ? 69.070  -44.614  -29.624  1.00 55.61  ? 160 ARG B CD  1 
ATOM   1283 N NE  . ARG B 1 65  ? 67.656  -44.247  -29.742  1.00 58.17  ? 160 ARG B NE  1 
ATOM   1284 C CZ  . ARG B 1 65  ? 66.816  -43.985  -28.729  1.00 69.86  ? 160 ARG B CZ  1 
ATOM   1285 N NH1 . ARG B 1 65  ? 67.214  -44.029  -27.449  1.00 69.88  ? 160 ARG B NH1 1 
ATOM   1286 N NH2 . ARG B 1 65  ? 65.539  -43.687  -29.002  1.00 69.59  ? 160 ARG B NH2 1 
ATOM   1287 N N   . ALA B 1 66  ? 71.384  -47.418  -29.469  1.00 39.31  ? 161 ALA B N   1 
ATOM   1288 C CA  . ALA B 1 66  ? 71.295  -48.843  -29.734  1.00 39.49  ? 161 ALA B CA  1 
ATOM   1289 C C   . ALA B 1 66  ? 69.852  -49.306  -29.837  1.00 41.34  ? 161 ALA B C   1 
ATOM   1290 O O   . ALA B 1 66  ? 69.517  -50.462  -29.528  1.00 41.46  ? 161 ALA B O   1 
ATOM   1291 C CB  . ALA B 1 66  ? 72.022  -49.616  -28.659  1.00 37.48  ? 161 ALA B CB  1 
ATOM   1292 N N   . GLN B 1 67  ? 69.036  -48.415  -30.373  1.00 41.51  ? 162 GLN B N   1 
ATOM   1293 C CA  . GLN B 1 67  ? 67.599  -48.595  -30.500  1.00 43.99  ? 162 GLN B CA  1 
ATOM   1294 C C   . GLN B 1 67  ? 67.126  -47.711  -31.651  1.00 43.25  ? 162 GLN B C   1 
ATOM   1295 O O   . GLN B 1 67  ? 67.661  -46.642  -31.829  1.00 36.76  ? 162 GLN B O   1 
ATOM   1296 C CB  . GLN B 1 67  ? 67.006  -48.060  -29.245  1.00 49.66  ? 162 GLN B CB  1 
ATOM   1297 C CG  . GLN B 1 67  ? 65.597  -48.468  -29.013  1.00 58.05  ? 162 GLN B CG  1 
ATOM   1298 C CD  . GLN B 1 67  ? 65.107  -47.850  -27.736  1.00 59.44  ? 162 GLN B CD  1 
ATOM   1299 O OE1 . GLN B 1 67  ? 65.907  -47.329  -26.956  1.00 64.21  ? 162 GLN B OE1 1 
ATOM   1300 N NE2 . GLN B 1 67  ? 63.800  -47.879  -27.518  1.00 59.89  ? 162 GLN B NE2 1 
ATOM   1301 N N   . PRO B 1 68  ? 66.126  -48.137  -32.434  1.00 44.17  ? 163 PRO B N   1 
ATOM   1302 C CA  . PRO B 1 68  ? 65.648  -47.202  -33.447  1.00 40.87  ? 163 PRO B CA  1 
ATOM   1303 C C   . PRO B 1 68  ? 64.958  -45.961  -32.854  1.00 40.78  ? 163 PRO B C   1 
ATOM   1304 O O   . PRO B 1 68  ? 64.564  -45.970  -31.700  1.00 39.12  ? 163 PRO B O   1 
ATOM   1305 C CB  . PRO B 1 68  ? 64.664  -48.036  -34.259  1.00 42.09  ? 163 PRO B CB  1 
ATOM   1306 C CG  . PRO B 1 68  ? 64.947  -49.454  -33.932  1.00 41.21  ? 163 PRO B CG  1 
ATOM   1307 C CD  . PRO B 1 68  ? 65.479  -49.452  -32.546  1.00 42.36  ? 163 PRO B CD  1 
ATOM   1308 N N   . CYS B 1 69  ? 64.845  -44.903  -33.658  1.00 44.22  ? 164 CYS B N   1 
ATOM   1309 C CA  . CYS B 1 69  ? 64.220  -43.642  -33.256  1.00 43.10  ? 164 CYS B CA  1 
ATOM   1310 C C   . CYS B 1 69  ? 63.128  -43.300  -34.221  1.00 35.82  ? 164 CYS B C   1 
ATOM   1311 O O   . CYS B 1 69  ? 63.318  -43.429  -35.418  1.00 36.66  ? 164 CYS B O   1 
ATOM   1312 C CB  . CYS B 1 69  ? 65.221  -42.482  -33.282  1.00 48.19  ? 164 CYS B CB  1 
ATOM   1313 S SG  . CYS B 1 69  ? 66.531  -42.525  -32.054  1.00 57.56  ? 164 CYS B SG  1 
ATOM   1314 N N   . CYS B 1 70  ? 61.992  -42.858  -33.688  1.00 34.39  ? 165 CYS B N   1 
ATOM   1315 C CA  . CYS B 1 70  ? 60.885  -42.362  -34.478  1.00 36.15  ? 165 CYS B CA  1 
ATOM   1316 C C   . CYS B 1 70  ? 61.153  -40.868  -34.709  1.00 35.18  ? 165 CYS B C   1 
ATOM   1317 O O   . CYS B 1 70  ? 61.084  -40.066  -33.772  1.00 33.27  ? 165 CYS B O   1 
ATOM   1318 C CB  . CYS B 1 70  ? 59.576  -42.559  -33.737  1.00 37.25  ? 165 CYS B CB  1 
ATOM   1319 S SG  . CYS B 1 70  ? 58.128  -42.044  -34.693  1.00 42.05  ? 165 CYS B SG  1 
ATOM   1320 N N   . ARG B 1 71  ? 61.487  -40.524  -35.947  1.00 32.85  ? 166 ARG B N   1 
ATOM   1321 C CA  . ARG B 1 71  ? 61.880  -39.175  -36.303  1.00 33.59  ? 166 ARG B CA  1 
ATOM   1322 C C   . ARG B 1 71  ? 61.378  -38.788  -37.694  1.00 34.86  ? 166 ARG B C   1 
ATOM   1323 O O   . ARG B 1 71  ? 61.070  -39.642  -38.516  1.00 37.80  ? 166 ARG B O   1 
ATOM   1324 C CB  . ARG B 1 71  ? 63.401  -39.026  -36.270  1.00 33.21  ? 166 ARG B CB  1 
ATOM   1325 C CG  . ARG B 1 71  ? 64.063  -39.035  -34.910  1.00 31.03  ? 166 ARG B CG  1 
ATOM   1326 C CD  . ARG B 1 71  ? 63.855  -37.735  -34.163  1.00 32.17  ? 166 ARG B CD  1 
ATOM   1327 N NE  . ARG B 1 71  ? 64.508  -36.560  -34.756  1.00 34.18  ? 166 ARG B NE  1 
ATOM   1328 C CZ  . ARG B 1 71  ? 64.307  -35.290  -34.359  1.00 35.12  ? 166 ARG B CZ  1 
ATOM   1329 N NH1 . ARG B 1 71  ? 63.465  -34.986  -33.353  1.00 33.21  ? 166 ARG B NH1 1 
ATOM   1330 N NH2 . ARG B 1 71  ? 64.969  -34.306  -34.951  1.00 37.92  ? 166 ARG B NH2 1 
ATOM   1331 N N   . PRO B 1 72  ? 61.282  -37.481  -37.971  1.00 37.13  ? 167 PRO B N   1 
ATOM   1332 C CA  . PRO B 1 72  ? 60.809  -37.106  -39.308  1.00 36.19  ? 167 PRO B CA  1 
ATOM   1333 C C   . PRO B 1 72  ? 61.808  -37.428  -40.412  1.00 34.28  ? 167 PRO B C   1 
ATOM   1334 O O   . PRO B 1 72  ? 62.990  -37.258  -40.224  1.00 36.17  ? 167 PRO B O   1 
ATOM   1335 C CB  . PRO B 1 72  ? 60.576  -35.602  -39.191  1.00 35.05  ? 167 PRO B CB  1 
ATOM   1336 C CG  . PRO B 1 72  ? 60.437  -35.332  -37.735  1.00 34.91  ? 167 PRO B CG  1 
ATOM   1337 C CD  . PRO B 1 72  ? 61.304  -36.335  -37.049  1.00 36.46  ? 167 PRO B CD  1 
ATOM   1338 N N   . THR B 1 73  ? 61.326  -37.917  -41.537  1.00 36.51  ? 168 THR B N   1 
ATOM   1339 C CA  . THR B 1 73  ? 62.151  -38.070  -42.754  1.00 41.15  ? 168 THR B CA  1 
ATOM   1340 C C   . THR B 1 73  ? 61.977  -36.865  -43.693  1.00 41.34  ? 168 THR B C   1 
ATOM   1341 O O   . THR B 1 73  ? 62.730  -36.693  -44.638  1.00 44.44  ? 168 THR B O   1 
ATOM   1342 C CB  . THR B 1 73  ? 61.773  -39.364  -43.535  1.00 39.48  ? 168 THR B CB  1 
ATOM   1343 O OG1 . THR B 1 73  ? 60.365  -39.356  -43.808  1.00 40.92  ? 168 THR B OG1 1 
ATOM   1344 C CG2 . THR B 1 73  ? 62.065  -40.571  -42.704  1.00 41.32  ? 168 THR B CG2 1 
ATOM   1345 N N   . ALA B 1 74  ? 60.965  -36.046  -43.441  1.00 40.78  ? 169 ALA B N   1 
ATOM   1346 C CA  . ALA B 1 74  ? 60.745  -34.852  -44.223  1.00 40.30  ? 169 ALA B CA  1 
ATOM   1347 C C   . ALA B 1 74  ? 59.915  -33.845  -43.429  1.00 39.70  ? 169 ALA B C   1 
ATOM   1348 O O   . ALA B 1 74  ? 59.126  -34.211  -42.564  1.00 37.28  ? 169 ALA B O   1 
ATOM   1349 C CB  . ALA B 1 74  ? 60.046  -35.204  -45.529  1.00 38.81  ? 169 ALA B CB  1 
ATOM   1350 N N   . TYR B 1 75  ? 60.076  -32.577  -43.787  1.00 39.02  ? 170 TYR B N   1 
ATOM   1351 C CA  . TYR B 1 75  ? 59.506  -31.461  -43.047  1.00 36.10  ? 170 TYR B CA  1 
ATOM   1352 C C   . TYR B 1 75  ? 58.634  -30.610  -43.955  1.00 35.67  ? 170 TYR B C   1 
ATOM   1353 O O   . TYR B 1 75  ? 58.834  -30.575  -45.146  1.00 43.21  ? 170 TYR B O   1 
ATOM   1354 C CB  . TYR B 1 75  ? 60.643  -30.644  -42.449  1.00 36.65  ? 170 TYR B CB  1 
ATOM   1355 C CG  . TYR B 1 75  ? 61.351  -31.353  -41.306  1.00 34.51  ? 170 TYR B CG  1 
ATOM   1356 C CD1 . TYR B 1 75  ? 60.907  -31.221  -40.017  1.00 35.70  ? 170 TYR B CD1 1 
ATOM   1357 C CD2 . TYR B 1 75  ? 62.456  -32.151  -41.524  1.00 35.14  ? 170 TYR B CD2 1 
ATOM   1358 C CE1 . TYR B 1 75  ? 61.535  -31.872  -38.971  1.00 36.11  ? 170 TYR B CE1 1 
ATOM   1359 C CE2 . TYR B 1 75  ? 63.094  -32.820  -40.481  1.00 34.29  ? 170 TYR B CE2 1 
ATOM   1360 C CZ  . TYR B 1 75  ? 62.631  -32.668  -39.205  1.00 35.28  ? 170 TYR B CZ  1 
ATOM   1361 O OH  . TYR B 1 75  ? 63.236  -33.321  -38.154  1.00 35.47  ? 170 TYR B OH  1 
ATOM   1362 N N   . GLU B 1 76  ? 57.617  -29.988  -43.385  1.00 38.35  ? 171 GLU B N   1 
ATOM   1363 C CA  . GLU B 1 76  ? 56.802  -28.972  -44.055  1.00 38.87  ? 171 GLU B CA  1 
ATOM   1364 C C   . GLU B 1 76  ? 57.695  -27.902  -44.643  1.00 35.97  ? 171 GLU B C   1 
ATOM   1365 O O   . GLU B 1 76  ? 58.686  -27.527  -44.026  1.00 33.86  ? 171 GLU B O   1 
ATOM   1366 C CB  . GLU B 1 76  ? 55.900  -28.340  -43.019  1.00 39.50  ? 171 GLU B CB  1 
ATOM   1367 C CG  . GLU B 1 76  ? 54.986  -27.233  -43.489  1.00 42.84  ? 171 GLU B CG  1 
ATOM   1368 C CD  . GLU B 1 76  ? 54.160  -26.643  -42.329  1.00 43.58  ? 171 GLU B CD  1 
ATOM   1369 O OE1 . GLU B 1 76  ? 52.914  -26.641  -42.444  1.00 45.09  ? 171 GLU B OE1 1 
ATOM   1370 O OE2 . GLU B 1 76  ? 54.751  -26.199  -41.311  1.00 36.98  ? 171 GLU B OE2 1 
ATOM   1371 N N   . ASP B 1 77  ? 57.348  -27.431  -45.833  1.00 37.72  ? 172 ASP B N   1 
ATOM   1372 C CA  . ASP B 1 77  ? 58.143  -26.418  -46.536  1.00 42.58  ? 172 ASP B CA  1 
ATOM   1373 C C   . ASP B 1 77  ? 58.078  -25.094  -45.812  1.00 38.77  ? 172 ASP B C   1 
ATOM   1374 O O   . ASP B 1 77  ? 59.108  -24.549  -45.411  1.00 37.58  ? 172 ASP B O   1 
ATOM   1375 C CB  . ASP B 1 77  ? 57.649  -26.223  -47.977  1.00 53.42  ? 172 ASP B CB  1 
ATOM   1376 C CG  . ASP B 1 77  ? 58.145  -27.302  -48.929  1.00 64.75  ? 172 ASP B CG  1 
ATOM   1377 O OD1 . ASP B 1 77  ? 58.861  -28.253  -48.504  1.00 80.18  ? 172 ASP B OD1 1 
ATOM   1378 O OD2 . ASP B 1 77  ? 57.818  -27.200  -50.132  1.00 81.02  ? 172 ASP B OD2 1 
ATOM   1379 N N   . GLU B 1 78  ? 56.860  -24.591  -45.636  1.00 38.11  ? 173 GLU B N   1 
ATOM   1380 C CA  . GLU B 1 78  ? 56.647  -23.297  -44.962  1.00 38.42  ? 173 GLU B CA  1 
ATOM   1381 C C   . GLU B 1 78  ? 55.232  -23.103  -44.478  1.00 36.54  ? 173 GLU B C   1 
ATOM   1382 O O   . GLU B 1 78  ? 54.293  -23.707  -45.008  1.00 39.42  ? 173 GLU B O   1 
ATOM   1383 C CB  . GLU B 1 78  ? 57.035  -22.120  -45.862  1.00 36.90  ? 173 GLU B CB  1 
ATOM   1384 C CG  . GLU B 1 78  ? 56.379  -22.158  -47.233  1.00 44.39  ? 173 GLU B CG  1 
ATOM   1385 C CD  . GLU B 1 78  ? 56.813  -20.996  -48.114  1.00 49.08  ? 173 GLU B CD  1 
ATOM   1386 O OE1 . GLU B 1 78  ? 56.110  -19.967  -48.139  1.00 51.35  ? 173 GLU B OE1 1 
ATOM   1387 O OE2 . GLU B 1 78  ? 57.885  -21.093  -48.750  1.00 58.81  ? 173 GLU B OE2 1 
ATOM   1388 N N   . VAL B 1 79  ? 55.102  -22.268  -43.456  1.00 32.75  ? 174 VAL B N   1 
ATOM   1389 C CA  . VAL B 1 79  ? 53.815  -21.812  -42.994  1.00 34.74  ? 174 VAL B CA  1 
ATOM   1390 C C   . VAL B 1 79  ? 53.985  -20.338  -42.624  1.00 34.23  ? 174 VAL B C   1 
ATOM   1391 O O   . VAL B 1 79  ? 55.056  -19.941  -42.159  1.00 38.86  ? 174 VAL B O   1 
ATOM   1392 C CB  . VAL B 1 79  ? 53.290  -22.668  -41.814  1.00 35.31  ? 174 VAL B CB  1 
ATOM   1393 C CG1 . VAL B 1 79  ? 54.125  -22.508  -40.543  1.00 33.67  ? 174 VAL B CG1 1 
ATOM   1394 C CG2 . VAL B 1 79  ? 51.844  -22.305  -41.507  1.00 38.01  ? 174 VAL B CG2 1 
ATOM   1395 N N   . SER B 1 80  ? 52.942  -19.545  -42.816  1.00 31.94  ? 175 SER B N   1 
ATOM   1396 C CA  . SER B 1 80  ? 53.022  -18.096  -42.585  1.00 33.55  ? 175 SER B CA  1 
ATOM   1397 C C   . SER B 1 80  ? 51.885  -17.610  -41.718  1.00 34.63  ? 175 SER B C   1 
ATOM   1398 O O   . SER B 1 80  ? 50.879  -18.280  -41.566  1.00 35.12  ? 175 SER B O   1 
ATOM   1399 C CB  . SER B 1 80  ? 52.995  -17.310  -43.897  1.00 34.44  ? 175 SER B CB  1 
ATOM   1400 O OG  . SER B 1 80  ? 54.090  -17.596  -44.765  1.00 34.85  ? 175 SER B OG  1 
ATOM   1401 N N   . PHE B 1 81  ? 52.052  -16.412  -41.173  1.00 35.30  ? 176 PHE B N   1 
ATOM   1402 C CA  . PHE B 1 81  ? 51.050  -15.800  -40.339  1.00 35.06  ? 176 PHE B CA  1 
ATOM   1403 C C   . PHE B 1 81  ? 51.388  -14.323  -40.084  1.00 35.67  ? 176 PHE B C   1 
ATOM   1404 O O   . PHE B 1 81  ? 52.530  -13.909  -40.217  1.00 35.70  ? 176 PHE B O   1 
ATOM   1405 C CB  . PHE B 1 81  ? 50.961  -16.546  -39.002  1.00 35.69  ? 176 PHE B CB  1 
ATOM   1406 C CG  . PHE B 1 81  ? 52.294  -16.778  -38.360  1.00 37.56  ? 176 PHE B CG  1 
ATOM   1407 C CD1 . PHE B 1 81  ? 52.892  -15.783  -37.600  1.00 38.54  ? 176 PHE B CD1 1 
ATOM   1408 C CD2 . PHE B 1 81  ? 52.964  -17.980  -38.527  1.00 40.98  ? 176 PHE B CD2 1 
ATOM   1409 C CE1 . PHE B 1 81  ? 54.119  -15.979  -37.017  1.00 37.18  ? 176 PHE B CE1 1 
ATOM   1410 C CE2 . PHE B 1 81  ? 54.199  -18.187  -37.938  1.00 41.44  ? 176 PHE B CE2 1 
ATOM   1411 C CZ  . PHE B 1 81  ? 54.780  -17.173  -37.189  1.00 39.04  ? 176 PHE B CZ  1 
ATOM   1412 N N   . LEU B 1 82  ? 50.399  -13.566  -39.633  1.00 34.72  ? 177 LEU B N   1 
ATOM   1413 C CA  . LEU B 1 82  ? 50.557  -12.170  -39.355  1.00 36.27  ? 177 LEU B CA  1 
ATOM   1414 C C   . LEU B 1 82  ? 50.502  -12.025  -37.838  1.00 38.82  ? 177 LEU B C   1 
ATOM   1415 O O   . LEU B 1 82  ? 49.639  -12.625  -37.185  1.00 35.96  ? 177 LEU B O   1 
ATOM   1416 C CB  . LEU B 1 82  ? 49.418  -11.387  -40.009  1.00 35.69  ? 177 LEU B CB  1 
ATOM   1417 C CG  . LEU B 1 82  ? 49.378  -9.867   -39.807  1.00 35.04  ? 177 LEU B CG  1 
ATOM   1418 C CD1 . LEU B 1 82  ? 50.259  -9.150   -40.820  1.00 32.12  ? 177 LEU B CD1 1 
ATOM   1419 C CD2 . LEU B 1 82  ? 47.933  -9.395   -39.937  1.00 36.25  ? 177 LEU B CD2 1 
ATOM   1420 N N   . ASP B 1 83  ? 51.400  -11.208  -37.286  1.00 38.36  ? 178 ASP B N   1 
ATOM   1421 C CA  . ASP B 1 83  ? 51.498  -11.049  -35.840  1.00 40.00  ? 178 ASP B CA  1 
ATOM   1422 C C   . ASP B 1 83  ? 50.684  -9.852   -35.363  1.00 42.55  ? 178 ASP B C   1 
ATOM   1423 O O   . ASP B 1 83  ? 50.042  -9.201   -36.159  1.00 39.28  ? 178 ASP B O   1 
ATOM   1424 C CB  . ASP B 1 83  ? 52.965  -11.020  -35.384  1.00 42.59  ? 178 ASP B CB  1 
ATOM   1425 C CG  . ASP B 1 83  ? 53.712  -9.745   -35.744  1.00 47.28  ? 178 ASP B CG  1 
ATOM   1426 O OD1 . ASP B 1 83  ? 53.082  -8.686   -35.980  1.00 47.56  ? 178 ASP B OD1 1 
ATOM   1427 O OD2 . ASP B 1 83  ? 54.974  -9.817   -35.722  1.00 47.63  ? 178 ASP B OD2 1 
ATOM   1428 N N   . ALA B 1 84  ? 50.720  -9.570   -34.063  1.00 45.93  ? 179 ALA B N   1 
ATOM   1429 C CA  . ALA B 1 84  ? 49.915  -8.495   -33.460  1.00 43.96  ? 179 ALA B CA  1 
ATOM   1430 C C   . ALA B 1 84  ? 50.367  -7.086   -33.837  1.00 45.02  ? 179 ALA B C   1 
ATOM   1431 O O   . ALA B 1 84  ? 49.618  -6.135   -33.659  1.00 52.42  ? 179 ALA B O   1 
ATOM   1432 C CB  . ALA B 1 84  ? 49.897  -8.649   -31.946  1.00 43.72  ? 179 ALA B CB  1 
ATOM   1433 N N   . HIS B 1 85  ? 51.579  -6.948   -34.355  1.00 46.30  ? 180 HIS B N   1 
ATOM   1434 C CA  . HIS B 1 85  ? 52.110  -5.657   -34.813  1.00 46.81  ? 180 HIS B CA  1 
ATOM   1435 C C   . HIS B 1 85  ? 51.957  -5.508   -36.332  1.00 46.16  ? 180 HIS B C   1 
ATOM   1436 O O   . HIS B 1 85  ? 52.644  -4.704   -36.974  1.00 44.88  ? 180 HIS B O   1 
ATOM   1437 C CB  . HIS B 1 85  ? 53.592  -5.537   -34.405  1.00 51.91  ? 180 HIS B CB  1 
ATOM   1438 C CG  . HIS B 1 85  ? 53.859  -5.957   -32.990  1.00 57.92  ? 180 HIS B CG  1 
ATOM   1439 N ND1 . HIS B 1 85  ? 53.429  -5.228   -31.899  1.00 63.83  ? 180 HIS B ND1 1 
ATOM   1440 C CD2 . HIS B 1 85  ? 54.462  -7.062   -32.488  1.00 67.12  ? 180 HIS B CD2 1 
ATOM   1441 C CE1 . HIS B 1 85  ? 53.771  -5.856   -30.787  1.00 67.56  ? 180 HIS B CE1 1 
ATOM   1442 N NE2 . HIS B 1 85  ? 54.395  -6.974   -31.116  1.00 72.21  ? 180 HIS B NE2 1 
ATOM   1443 N N   . SER B 1 86  ? 51.081  -6.328   -36.911  1.00 45.79  ? 181 SER B N   1 
ATOM   1444 C CA  . SER B 1 86  ? 50.802  -6.301   -38.328  1.00 45.58  ? 181 SER B CA  1 
ATOM   1445 C C   . SER B 1 86  ? 51.998  -6.624   -39.207  1.00 42.16  ? 181 SER B C   1 
ATOM   1446 O O   . SER B 1 86  ? 52.089  -6.121   -40.316  1.00 39.14  ? 181 SER B O   1 
ATOM   1447 C CB  . SER B 1 86  ? 50.196  -4.941   -38.716  1.00 53.68  ? 181 SER B CB  1 
ATOM   1448 O OG  . SER B 1 86  ? 49.163  -5.125   -39.661  1.00 56.03  ? 181 SER B OG  1 
ATOM   1449 N N   . ARG B 1 87  ? 52.879  -7.497   -38.729  1.00 42.31  ? 182 ARG B N   1 
ATOM   1450 C CA  . ARG B 1 87  ? 53.985  -7.991   -39.519  1.00 45.99  ? 182 ARG B CA  1 
ATOM   1451 C C   . ARG B 1 87  ? 53.766  -9.474   -39.866  1.00 39.50  ? 182 ARG B C   1 
ATOM   1452 O O   . ARG B 1 87  ? 53.328  -10.264  -39.034  1.00 39.28  ? 182 ARG B O   1 
ATOM   1453 C CB  . ARG B 1 87  ? 55.312  -7.817   -38.765  1.00 58.44  ? 182 ARG B CB  1 
ATOM   1454 C CG  . ARG B 1 87  ? 56.067  -6.512   -39.060  1.00 73.98  ? 182 ARG B CG  1 
ATOM   1455 C CD  . ARG B 1 87  ? 57.513  -6.449   -38.522  1.00 88.54  ? 182 ARG B CD  1 
ATOM   1456 N NE  . ARG B 1 87  ? 58.260  -7.730   -38.496  1.00 99.32  ? 182 ARG B NE  1 
ATOM   1457 C CZ  . ARG B 1 87  ? 59.575  -7.865   -38.268  1.00 107.08 ? 182 ARG B CZ  1 
ATOM   1458 N NH1 . ARG B 1 87  ? 60.359  -6.806   -38.050  1.00 107.57 ? 182 ARG B NH1 1 
ATOM   1459 N NH2 . ARG B 1 87  ? 60.123  -9.084   -38.264  1.00 108.77 ? 182 ARG B NH2 1 
ATOM   1460 N N   . TYR B 1 88  ? 54.125  -9.835   -41.090  1.00 34.71  ? 183 TYR B N   1 
ATOM   1461 C CA  . TYR B 1 88  ? 54.019  -11.185  -41.577  1.00 35.75  ? 183 TYR B CA  1 
ATOM   1462 C C   . TYR B 1 88  ? 55.311  -11.928  -41.286  1.00 35.02  ? 183 TYR B C   1 
ATOM   1463 O O   . TYR B 1 88  ? 56.373  -11.353  -41.338  1.00 33.16  ? 183 TYR B O   1 
ATOM   1464 C CB  . TYR B 1 88  ? 53.725  -11.199  -43.082  1.00 37.35  ? 183 TYR B CB  1 
ATOM   1465 C CG  . TYR B 1 88  ? 52.260  -11.141  -43.483  1.00 37.16  ? 183 TYR B CG  1 
ATOM   1466 C CD1 . TYR B 1 88  ? 51.384  -12.184  -43.184  1.00 38.00  ? 183 TYR B CD1 1 
ATOM   1467 C CD2 . TYR B 1 88  ? 51.757  -10.053  -44.202  1.00 39.71  ? 183 TYR B CD2 1 
ATOM   1468 C CE1 . TYR B 1 88  ? 50.044  -12.153  -43.589  1.00 36.32  ? 183 TYR B CE1 1 
ATOM   1469 C CE2 . TYR B 1 88  ? 50.433  -10.015  -44.598  1.00 39.87  ? 183 TYR B CE2 1 
ATOM   1470 C CZ  . TYR B 1 88  ? 49.575  -11.065  -44.286  1.00 39.28  ? 183 TYR B CZ  1 
ATOM   1471 O OH  . TYR B 1 88  ? 48.244  -11.013  -44.675  1.00 41.19  ? 183 TYR B OH  1 
ATOM   1472 N N   . HIS B 1 89  ? 55.198  -13.224  -40.992  1.00 38.20  ? 184 HIS B N   1 
ATOM   1473 C CA  . HIS B 1 89  ? 56.361  -14.101  -40.782  1.00 37.59  ? 184 HIS B CA  1 
ATOM   1474 C C   . HIS B 1 89  ? 56.131  -15.406  -41.495  1.00 37.51  ? 184 HIS B C   1 
ATOM   1475 O O   . HIS B 1 89  ? 54.994  -15.858  -41.602  1.00 39.60  ? 184 HIS B O   1 
ATOM   1476 C CB  . HIS B 1 89  ? 56.532  -14.385  -39.319  1.00 37.60  ? 184 HIS B CB  1 
ATOM   1477 C CG  . HIS B 1 89  ? 56.679  -13.166  -38.489  1.00 39.48  ? 184 HIS B CG  1 
ATOM   1478 N ND1 . HIS B 1 89  ? 57.890  -12.540  -38.302  1.00 41.67  ? 184 HIS B ND1 1 
ATOM   1479 C CD2 . HIS B 1 89  ? 55.767  -12.440  -37.801  1.00 43.40  ? 184 HIS B CD2 1 
ATOM   1480 C CE1 . HIS B 1 89  ? 57.720  -11.481  -37.530  1.00 40.44  ? 184 HIS B CE1 1 
ATOM   1481 N NE2 . HIS B 1 89  ? 56.443  -11.400  -37.207  1.00 42.56  ? 184 HIS B NE2 1 
ATOM   1482 N N   . THR B 1 90  ? 57.192  -15.986  -42.032  1.00 38.14  ? 185 THR B N   1 
ATOM   1483 C CA  . THR B 1 90  ? 57.114  -17.349  -42.535  1.00 41.35  ? 185 THR B CA  1 
ATOM   1484 C C   . THR B 1 90  ? 58.166  -18.231  -41.873  1.00 40.47  ? 185 THR B C   1 
ATOM   1485 O O   . THR B 1 90  ? 59.285  -17.824  -41.698  1.00 41.63  ? 185 THR B O   1 
ATOM   1486 C CB  . THR B 1 90  ? 57.020  -17.449  -44.075  1.00 41.86  ? 185 THR B CB  1 
ATOM   1487 O OG1 . THR B 1 90  ? 58.036  -18.288  -44.613  1.00 45.53  ? 185 THR B OG1 1 
ATOM   1488 C CG2 . THR B 1 90  ? 57.061  -16.203  -44.677  1.00 39.45  ? 185 THR B CG2 1 
ATOM   1489 N N   . VAL B 1 91  ? 57.741  -19.401  -41.411  1.00 41.39  ? 186 VAL B N   1 
ATOM   1490 C CA  . VAL B 1 91  ? 58.614  -20.360  -40.752  1.00 37.23  ? 186 VAL B CA  1 
ATOM   1491 C C   . VAL B 1 91  ? 58.726  -21.587  -41.635  1.00 38.17  ? 186 VAL B C   1 
ATOM   1492 O O   . VAL B 1 91  ? 57.720  -22.094  -42.156  1.00 35.15  ? 186 VAL B O   1 
ATOM   1493 C CB  . VAL B 1 91  ? 58.059  -20.761  -39.413  1.00 38.73  ? 186 VAL B CB  1 
ATOM   1494 C CG1 . VAL B 1 91  ? 58.978  -21.771  -38.749  1.00 42.19  ? 186 VAL B CG1 1 
ATOM   1495 C CG2 . VAL B 1 91  ? 57.961  -19.522  -38.529  1.00 41.67  ? 186 VAL B CG2 1 
ATOM   1496 N N   . HIS B 1 92  ? 59.961  -22.046  -41.784  1.00 38.42  ? 187 HIS B N   1 
ATOM   1497 C CA  . HIS B 1 92  ? 60.297  -23.176  -42.619  1.00 38.19  ? 187 HIS B CA  1 
ATOM   1498 C C   . HIS B 1 92  ? 60.537  -24.396  -41.729  1.00 36.89  ? 187 HIS B C   1 
ATOM   1499 O O   . HIS B 1 92  ? 61.127  -24.282  -40.651  1.00 37.34  ? 187 HIS B O   1 
ATOM   1500 C CB  . HIS B 1 92  ? 61.558  -22.852  -43.414  1.00 40.93  ? 187 HIS B CB  1 
ATOM   1501 C CG  . HIS B 1 92  ? 61.410  -21.659  -44.298  1.00 44.40  ? 187 HIS B CG  1 
ATOM   1502 N ND1 . HIS B 1 92  ? 61.083  -21.755  -45.633  1.00 43.61  ? 187 HIS B ND1 1 
ATOM   1503 C CD2 . HIS B 1 92  ? 61.479  -20.336  -44.019  1.00 45.36  ? 187 HIS B CD2 1 
ATOM   1504 C CE1 . HIS B 1 92  ? 60.962  -20.542  -46.139  1.00 45.75  ? 187 HIS B CE1 1 
ATOM   1505 N NE2 . HIS B 1 92  ? 61.216  -19.665  -45.187  1.00 44.02  ? 187 HIS B NE2 1 
ATOM   1506 N N   . GLU B 1 93  ? 60.066  -25.547  -42.181  1.00 35.08  ? 188 GLU B N   1 
ATOM   1507 C CA  . GLU B 1 93  ? 60.301  -26.824  -41.502  1.00 36.14  ? 188 GLU B CA  1 
ATOM   1508 C C   . GLU B 1 93  ? 59.857  -26.849  -40.053  1.00 34.75  ? 188 GLU B C   1 
ATOM   1509 O O   . GLU B 1 93  ? 60.531  -27.423  -39.187  1.00 36.23  ? 188 GLU B O   1 
ATOM   1510 C CB  . GLU B 1 93  ? 61.768  -27.236  -41.661  1.00 38.47  ? 188 GLU B CB  1 
ATOM   1511 C CG  . GLU B 1 93  ? 62.188  -27.245  -43.119  1.00 42.34  ? 188 GLU B CG  1 
ATOM   1512 C CD  . GLU B 1 93  ? 63.404  -28.097  -43.415  1.00 47.75  ? 188 GLU B CD  1 
ATOM   1513 O OE1 . GLU B 1 93  ? 64.294  -28.220  -42.559  1.00 52.05  ? 188 GLU B OE1 1 
ATOM   1514 O OE2 . GLU B 1 93  ? 63.481  -28.657  -44.531  1.00 58.09  ? 188 GLU B OE2 1 
ATOM   1515 N N   . LEU B 1 94  ? 58.708  -26.240  -39.783  1.00 34.92  ? 189 LEU B N   1 
ATOM   1516 C CA  . LEU B 1 94  ? 58.184  -26.216  -38.414  1.00 36.99  ? 189 LEU B CA  1 
ATOM   1517 C C   . LEU B 1 94  ? 57.533  -27.547  -38.066  1.00 34.67  ? 189 LEU B C   1 
ATOM   1518 O O   . LEU B 1 94  ? 57.665  -27.997  -36.968  1.00 34.13  ? 189 LEU B O   1 
ATOM   1519 C CB  . LEU B 1 94  ? 57.185  -25.084  -38.216  1.00 38.01  ? 189 LEU B CB  1 
ATOM   1520 C CG  . LEU B 1 94  ? 56.474  -25.031  -36.871  1.00 38.94  ? 189 LEU B CG  1 
ATOM   1521 C CD1 . LEU B 1 94  ? 57.470  -24.902  -35.738  1.00 40.82  ? 189 LEU B CD1 1 
ATOM   1522 C CD2 . LEU B 1 94  ? 55.512  -23.868  -36.843  1.00 41.55  ? 189 LEU B CD2 1 
ATOM   1523 N N   . SER B 1 95  ? 56.816  -28.134  -39.013  1.00 34.48  ? 190 SER B N   1 
ATOM   1524 C CA  . SER B 1 95  ? 56.137  -29.433  -38.850  1.00 36.47  ? 190 SER B CA  1 
ATOM   1525 C C   . SER B 1 95  ? 56.837  -30.563  -39.599  1.00 36.92  ? 190 SER B C   1 
ATOM   1526 O O   . SER B 1 95  ? 57.482  -30.354  -40.622  1.00 35.11  ? 190 SER B O   1 
ATOM   1527 C CB  . SER B 1 95  ? 54.681  -29.360  -39.356  1.00 35.76  ? 190 SER B CB  1 
ATOM   1528 O OG  . SER B 1 95  ? 53.838  -28.785  -38.367  1.00 35.70  ? 190 SER B OG  1 
ATOM   1529 N N   . ALA B 1 96  ? 56.689  -31.771  -39.070  1.00 36.99  ? 191 ALA B N   1 
ATOM   1530 C CA  . ALA B 1 96  ? 57.062  -32.972  -39.792  1.00 34.78  ? 191 ALA B CA  1 
ATOM   1531 C C   . ALA B 1 96  ? 56.024  -33.201  -40.887  1.00 35.40  ? 191 ALA B C   1 
ATOM   1532 O O   . ALA B 1 96  ? 54.870  -32.834  -40.736  1.00 37.85  ? 191 ALA B O   1 
ATOM   1533 C CB  . ALA B 1 96  ? 57.077  -34.154  -38.841  1.00 34.81  ? 191 ALA B CB  1 
ATOM   1534 N N   . ARG B 1 97  ? 56.449  -33.809  -41.979  1.00 38.38  ? 192 ARG B N   1 
ATOM   1535 C CA  . ARG B 1 97  ? 55.584  -34.223  -43.077  1.00 40.36  ? 192 ARG B CA  1 
ATOM   1536 C C   . ARG B 1 97  ? 55.513  -35.772  -43.242  1.00 41.38  ? 192 ARG B C   1 
ATOM   1537 O O   . ARG B 1 97  ? 54.519  -36.286  -43.728  1.00 45.48  ? 192 ARG B O   1 
ATOM   1538 C CB  . ARG B 1 97  ? 56.118  -33.594  -44.359  1.00 44.88  ? 192 ARG B CB  1 
ATOM   1539 C CG  . ARG B 1 97  ? 55.101  -33.362  -45.442  1.00 50.59  ? 192 ARG B CG  1 
ATOM   1540 C CD  . ARG B 1 97  ? 55.779  -32.770  -46.664  1.00 59.43  ? 192 ARG B CD  1 
ATOM   1541 N NE  . ARG B 1 97  ? 56.644  -33.737  -47.343  1.00 66.84  ? 192 ARG B NE  1 
ATOM   1542 C CZ  . ARG B 1 97  ? 57.794  -33.450  -47.956  1.00 73.60  ? 192 ARG B CZ  1 
ATOM   1543 N NH1 . ARG B 1 97  ? 58.281  -32.213  -47.974  1.00 81.67  ? 192 ARG B NH1 1 
ATOM   1544 N NH2 . ARG B 1 97  ? 58.485  -34.422  -48.541  1.00 75.51  ? 192 ARG B NH2 1 
ATOM   1545 N N   . GLU B 1 98  ? 56.583  -36.482  -42.885  1.00 41.17  ? 193 GLU B N   1 
ATOM   1546 C CA  . GLU B 1 98  ? 56.667  -37.940  -42.926  1.00 43.65  ? 193 GLU B CA  1 
ATOM   1547 C C   . GLU B 1 98  ? 57.550  -38.431  -41.779  1.00 44.56  ? 193 GLU B C   1 
ATOM   1548 O O   . GLU B 1 98  ? 58.437  -37.704  -41.339  1.00 43.75  ? 193 GLU B O   1 
ATOM   1549 C CB  . GLU B 1 98  ? 57.289  -38.397  -44.232  1.00 51.57  ? 193 GLU B CB  1 
ATOM   1550 C CG  . GLU B 1 98  ? 56.333  -38.540  -45.397  1.00 63.31  ? 193 GLU B CG  1 
ATOM   1551 C CD  . GLU B 1 98  ? 57.051  -38.505  -46.741  1.00 79.68  ? 193 GLU B CD  1 
ATOM   1552 O OE1 . GLU B 1 98  ? 58.183  -39.050  -46.833  1.00 87.55  ? 193 GLU B OE1 1 
ATOM   1553 O OE2 . GLU B 1 98  ? 56.482  -37.921  -47.701  1.00 88.40  ? 193 GLU B OE2 1 
ATOM   1554 N N   . CYS B 1 99  ? 57.310  -39.667  -41.329  1.00 44.71  ? 194 CYS B N   1 
ATOM   1555 C CA  . CYS B 1 99  ? 57.980  -40.277  -40.184  1.00 45.94  ? 194 CYS B CA  1 
ATOM   1556 C C   . CYS B 1 99  ? 58.542  -41.631  -40.554  1.00 43.27  ? 194 CYS B C   1 
ATOM   1557 O O   . CYS B 1 99  ? 58.040  -42.271  -41.432  1.00 45.29  ? 194 CYS B O   1 
ATOM   1558 C CB  . CYS B 1 99  ? 56.997  -40.496  -39.042  1.00 45.38  ? 194 CYS B CB  1 
ATOM   1559 S SG  . CYS B 1 99  ? 56.189  -38.965  -38.525  1.00 59.95  ? 194 CYS B SG  1 
ATOM   1560 N N   . ALA B 1 100 ? 59.585  -42.053  -39.853  1.00 41.02  ? 195 ALA B N   1 
ATOM   1561 C CA  . ALA B 1 100 ? 60.145  -43.397  -40.003  1.00 40.61  ? 195 ALA B CA  1 
ATOM   1562 C C   . ALA B 1 100 ? 60.885  -43.744  -38.722  1.00 40.81  ? 195 ALA B C   1 
ATOM   1563 O O   . ALA B 1 100 ? 61.226  -42.851  -37.922  1.00 38.73  ? 195 ALA B O   1 
ATOM   1564 C CB  . ALA B 1 100 ? 61.086  -43.470  -41.194  1.00 39.54  ? 195 ALA B CB  1 
ATOM   1565 N N   . CYS B 1 101 ? 61.091  -45.041  -38.535  1.00 40.75  ? 196 CYS B N   1 
ATOM   1566 C CA  . CYS B 1 101 ? 61.890  -45.586  -37.461  1.00 43.00  ? 196 CYS B CA  1 
ATOM   1567 C C   . CYS B 1 101 ? 63.211  -45.887  -38.097  1.00 43.84  ? 196 CYS B C   1 
ATOM   1568 O O   . CYS B 1 101 ? 63.258  -46.653  -39.050  1.00 46.41  ? 196 CYS B O   1 
ATOM   1569 C CB  . CYS B 1 101 ? 61.273  -46.882  -36.925  1.00 50.24  ? 196 CYS B CB  1 
ATOM   1570 S SG  . CYS B 1 101 ? 59.866  -46.591  -35.821  1.00 56.67  ? 196 CYS B SG  1 
ATOM   1571 N N   . VAL B 1 102 ? 64.275  -45.284  -37.577  1.00 43.09  ? 197 VAL B N   1 
ATOM   1572 C CA  . VAL B 1 102 ? 65.619  -45.475  -38.095  1.00 49.28  ? 197 VAL B CA  1 
ATOM   1573 C C   . VAL B 1 102 ? 66.546  -45.853  -36.947  1.00 51.82  ? 197 VAL B C   1 
ATOM   1574 O O   . VAL B 1 102 ? 67.282  -46.841  -37.023  1.00 44.34  ? 197 VAL B O   1 
ATOM   1575 C CB  . VAL B 1 102 ? 66.152  -44.219  -38.843  1.00 53.03  ? 197 VAL B CB  1 
ATOM   1576 C CG1 . VAL B 1 102 ? 65.632  -44.224  -40.271  1.00 59.56  ? 197 VAL B CG1 1 
ATOM   1577 C CG2 . VAL B 1 102 ? 65.740  -42.920  -38.152  1.00 59.34  ? 197 VAL B CG2 1 
ATOM   1578 O OXT . VAL B 1 102 ? 66.587  -45.162  -35.922  1.00 56.23  ? 197 VAL B OXT 1 
ATOM   1579 N N   . PRO C 2 36  ? 104.885 -57.897  -79.298  1.00 132.15 ? 36  PRO C N   1 
ATOM   1580 C CA  . PRO C 2 36  ? 104.263 -58.869  -78.382  1.00 130.44 ? 36  PRO C CA  1 
ATOM   1581 C C   . PRO C 2 36  ? 103.347 -59.830  -79.139  1.00 124.74 ? 36  PRO C C   1 
ATOM   1582 O O   . PRO C 2 36  ? 102.437 -59.343  -79.824  1.00 114.12 ? 36  PRO C O   1 
ATOM   1583 C CB  . PRO C 2 36  ? 103.442 -57.977  -77.421  1.00 126.68 ? 36  PRO C CB  1 
ATOM   1584 C CG  . PRO C 2 36  ? 104.040 -56.610  -77.549  1.00 128.36 ? 36  PRO C CG  1 
ATOM   1585 C CD  . PRO C 2 36  ? 104.522 -56.507  -78.968  1.00 129.36 ? 36  PRO C CD  1 
ATOM   1586 N N   . PRO C 2 37  ? 103.576 -61.176  -79.049  1.00 121.00 ? 37  PRO C N   1 
ATOM   1587 C CA  . PRO C 2 37  ? 102.608 -62.038  -79.747  1.00 111.70 ? 37  PRO C CA  1 
ATOM   1588 C C   . PRO C 2 37  ? 101.174 -61.806  -79.286  1.00 100.74 ? 37  PRO C C   1 
ATOM   1589 O O   . PRO C 2 37  ? 100.925 -61.211  -78.219  1.00 94.47  ? 37  PRO C O   1 
ATOM   1590 C CB  . PRO C 2 37  ? 103.048 -63.454  -79.357  1.00 110.19 ? 37  PRO C CB  1 
ATOM   1591 C CG  . PRO C 2 37  ? 104.507 -63.322  -79.139  1.00 115.11 ? 37  PRO C CG  1 
ATOM   1592 C CD  . PRO C 2 37  ? 104.636 -61.996  -78.419  1.00 117.05 ? 37  PRO C CD  1 
ATOM   1593 N N   . VAL C 2 38  ? 100.243 -62.292  -80.089  1.00 84.47  ? 38  VAL C N   1 
ATOM   1594 C CA  . VAL C 2 38  ? 98.844  -62.009  -79.862  1.00 75.11  ? 38  VAL C CA  1 
ATOM   1595 C C   . VAL C 2 38  ? 98.183  -63.191  -79.167  1.00 64.15  ? 38  VAL C C   1 
ATOM   1596 O O   . VAL C 2 38  ? 98.593  -64.341  -79.363  1.00 59.84  ? 38  VAL C O   1 
ATOM   1597 C CB  . VAL C 2 38  ? 98.121  -61.725  -81.188  1.00 77.85  ? 38  VAL C CB  1 
ATOM   1598 C CG1 . VAL C 2 38  ? 96.869  -60.978  -80.892  1.00 84.65  ? 38  VAL C CG1 1 
ATOM   1599 C CG2 . VAL C 2 38  ? 98.962  -60.858  -82.115  1.00 80.24  ? 38  VAL C CG2 1 
ATOM   1600 N N   . ASP C 2 39  ? 97.160  -62.910  -78.360  1.00 57.78  ? 39  ASP C N   1 
ATOM   1601 C CA  . ASP C 2 39  ? 96.393  -63.971  -77.736  1.00 55.20  ? 39  ASP C CA  1 
ATOM   1602 C C   . ASP C 2 39  ? 95.413  -64.591  -78.742  1.00 54.18  ? 39  ASP C C   1 
ATOM   1603 O O   . ASP C 2 39  ? 95.259  -64.091  -79.849  1.00 49.40  ? 39  ASP C O   1 
ATOM   1604 C CB  . ASP C 2 39  ? 95.719  -63.487  -76.449  1.00 58.29  ? 39  ASP C CB  1 
ATOM   1605 C CG  . ASP C 2 39  ? 94.515  -62.582  -76.682  1.00 63.95  ? 39  ASP C CG  1 
ATOM   1606 O OD1 . ASP C 2 39  ? 93.631  -62.907  -77.504  1.00 71.70  ? 39  ASP C OD1 1 
ATOM   1607 O OD2 . ASP C 2 39  ? 94.414  -61.554  -75.972  1.00 69.09  ? 39  ASP C OD2 1 
ATOM   1608 N N   . CYS C 2 40  ? 94.756  -65.671  -78.335  1.00 50.69  ? 40  CYS C N   1 
ATOM   1609 C CA  . CYS C 2 40  ? 93.908  -66.441  -79.215  1.00 49.47  ? 40  CYS C CA  1 
ATOM   1610 C C   . CYS C 2 40  ? 92.639  -65.700  -79.641  1.00 50.46  ? 40  CYS C C   1 
ATOM   1611 O O   . CYS C 2 40  ? 92.176  -65.916  -80.744  1.00 47.28  ? 40  CYS C O   1 
ATOM   1612 C CB  . CYS C 2 40  ? 93.549  -67.792  -78.577  1.00 48.66  ? 40  CYS C CB  1 
ATOM   1613 S SG  . CYS C 2 40  ? 94.911  -68.990  -78.480  1.00 52.06  ? 40  CYS C SG  1 
ATOM   1614 N N   . VAL C 2 41  ? 92.074  -64.863  -78.774  1.00 48.75  ? 41  VAL C N   1 
ATOM   1615 C CA  . VAL C 2 41  ? 90.846  -64.142  -79.092  1.00 49.97  ? 41  VAL C CA  1 
ATOM   1616 C C   . VAL C 2 41  ? 91.098  -63.142  -80.216  1.00 52.41  ? 41  VAL C C   1 
ATOM   1617 O O   . VAL C 2 41  ? 90.312  -63.039  -81.155  1.00 48.88  ? 41  VAL C O   1 
ATOM   1618 C CB  . VAL C 2 41  ? 90.281  -63.433  -77.844  1.00 52.04  ? 41  VAL C CB  1 
ATOM   1619 C CG1 . VAL C 2 41  ? 89.220  -62.385  -78.201  1.00 49.89  ? 41  VAL C CG1 1 
ATOM   1620 C CG2 . VAL C 2 41  ? 89.694  -64.477  -76.889  1.00 51.53  ? 41  VAL C CG2 1 
ATOM   1621 N N   . ARG C 2 42  ? 92.197  -62.409  -80.100  1.00 52.52  ? 42  ARG C N   1 
ATOM   1622 C CA  . ARG C 2 42  ? 92.597  -61.456  -81.104  1.00 52.87  ? 42  ARG C CA  1 
ATOM   1623 C C   . ARG C 2 42  ? 92.999  -62.149  -82.401  1.00 49.32  ? 42  ARG C C   1 
ATOM   1624 O O   . ARG C 2 42  ? 92.622  -61.693  -83.463  1.00 51.86  ? 42  ARG C O   1 
ATOM   1625 C CB  . ARG C 2 42  ? 93.734  -60.594  -80.576  1.00 55.16  ? 42  ARG C CB  1 
ATOM   1626 C CG  . ARG C 2 42  ? 94.383  -59.633  -81.591  1.00 62.81  ? 42  ARG C CG  1 
ATOM   1627 C CD  . ARG C 2 42  ? 93.872  -58.228  -81.545  1.00 66.41  ? 42  ARG C CD  1 
ATOM   1628 N NE  . ARG C 2 42  ? 92.864  -57.967  -82.553  1.00 71.97  ? 42  ARG C NE  1 
ATOM   1629 C CZ  . ARG C 2 42  ? 93.028  -57.200  -83.640  1.00 80.53  ? 42  ARG C CZ  1 
ATOM   1630 N NH1 . ARG C 2 42  ? 91.997  -57.042  -84.467  1.00 80.10  ? 42  ARG C NH1 1 
ATOM   1631 N NH2 . ARG C 2 42  ? 94.185  -56.583  -83.917  1.00 75.42  ? 42  ARG C NH2 1 
ATOM   1632 N N   . ALA C 2 43  ? 93.759  -63.232  -82.308  1.00 46.75  ? 43  ALA C N   1 
ATOM   1633 C CA  . ALA C 2 43  ? 94.194  -63.989  -83.472  1.00 44.43  ? 43  ALA C CA  1 
ATOM   1634 C C   . ALA C 2 43  ? 93.001  -64.506  -84.287  1.00 44.90  ? 43  ALA C C   1 
ATOM   1635 O O   . ALA C 2 43  ? 93.032  -64.557  -85.505  1.00 42.80  ? 43  ALA C O   1 
ATOM   1636 C CB  . ALA C 2 43  ? 95.080  -65.147  -83.042  1.00 42.82  ? 43  ALA C CB  1 
ATOM   1637 N N   . ASN C 2 44  ? 91.939  -64.844  -83.581  1.00 42.50  ? 44  ASN C N   1 
ATOM   1638 C CA  . ASN C 2 44  ? 90.721  -65.280  -84.194  1.00 44.22  ? 44  ASN C CA  1 
ATOM   1639 C C   . ASN C 2 44  ? 89.955  -64.143  -84.879  1.00 46.70  ? 44  ASN C C   1 
ATOM   1640 O O   . ASN C 2 44  ? 89.293  -64.373  -85.880  1.00 47.87  ? 44  ASN C O   1 
ATOM   1641 C CB  . ASN C 2 44  ? 89.891  -65.941  -83.126  1.00 40.07  ? 44  ASN C CB  1 
ATOM   1642 C CG  . ASN C 2 44  ? 88.557  -66.436  -83.620  1.00 41.61  ? 44  ASN C CG  1 
ATOM   1643 O OD1 . ASN C 2 44  ? 88.471  -67.425  -84.327  1.00 46.64  ? 44  ASN C OD1 1 
ATOM   1644 N ND2 . ASN C 2 44  ? 87.504  -65.788  -83.184  1.00 41.84  ? 44  ASN C ND2 1 
ATOM   1645 N N   . GLU C 2 45  ? 90.006  -62.944  -84.316  1.00 50.72  ? 45  GLU C N   1 
ATOM   1646 C CA  . GLU C 2 45  ? 89.403  -61.775  -84.955  1.00 55.14  ? 45  GLU C CA  1 
ATOM   1647 C C   . GLU C 2 45  ? 90.054  -61.523  -86.317  1.00 48.79  ? 45  GLU C C   1 
ATOM   1648 O O   . GLU C 2 45  ? 89.360  -61.326  -87.296  1.00 45.34  ? 45  GLU C O   1 
ATOM   1649 C CB  . GLU C 2 45  ? 89.546  -60.515  -84.096  1.00 59.81  ? 45  GLU C CB  1 
ATOM   1650 C CG  . GLU C 2 45  ? 88.390  -60.248  -83.163  1.00 72.82  ? 45  GLU C CG  1 
ATOM   1651 C CD  . GLU C 2 45  ? 88.700  -59.121  -82.178  1.00 86.95  ? 45  GLU C CD  1 
ATOM   1652 O OE1 . GLU C 2 45  ? 89.330  -58.104  -82.591  1.00 85.23  ? 45  GLU C OE1 1 
ATOM   1653 O OE2 . GLU C 2 45  ? 88.327  -59.270  -80.988  1.00 85.93  ? 45  GLU C OE2 1 
ATOM   1654 N N   . LEU C 2 46  ? 91.384  -61.493  -86.317  1.00 44.21  ? 46  LEU C N   1 
ATOM   1655 C CA  . LEU C 2 46  ? 92.189  -61.294  -87.502  1.00 48.30  ? 46  LEU C CA  1 
ATOM   1656 C C   . LEU C 2 46  ? 91.936  -62.357  -88.569  1.00 48.39  ? 46  LEU C C   1 
ATOM   1657 O O   . LEU C 2 46  ? 91.828  -62.043  -89.743  1.00 51.05  ? 46  LEU C O   1 
ATOM   1658 C CB  . LEU C 2 46  ? 93.673  -61.255  -87.125  1.00 47.72  ? 46  LEU C CB  1 
ATOM   1659 C CG  . LEU C 2 46  ? 94.069  -59.995  -86.322  1.00 54.90  ? 46  LEU C CG  1 
ATOM   1660 C CD1 . LEU C 2 46  ? 95.460  -60.147  -85.712  1.00 55.73  ? 46  LEU C CD1 1 
ATOM   1661 C CD2 . LEU C 2 46  ? 94.033  -58.720  -87.155  1.00 51.97  ? 46  LEU C CD2 1 
ATOM   1662 N N   . CYS C 2 47  ? 91.812  -63.606  -88.149  1.00 45.93  ? 47  CYS C N   1 
ATOM   1663 C CA  . CYS C 2 47  ? 91.566  -64.683  -89.068  1.00 47.91  ? 47  CYS C CA  1 
ATOM   1664 C C   . CYS C 2 47  ? 90.123  -64.634  -89.630  1.00 47.68  ? 47  CYS C C   1 
ATOM   1665 O O   . CYS C 2 47  ? 89.911  -64.779  -90.846  1.00 44.88  ? 47  CYS C O   1 
ATOM   1666 C CB  . CYS C 2 47  ? 91.865  -66.007  -88.393  1.00 49.46  ? 47  CYS C CB  1 
ATOM   1667 S SG  . CYS C 2 47  ? 91.326  -67.424  -89.375  1.00 52.23  ? 47  CYS C SG  1 
ATOM   1668 N N   . ALA C 2 48  ? 89.148  -64.408  -88.754  1.00 42.99  ? 48  ALA C N   1 
ATOM   1669 C CA  . ALA C 2 48  ? 87.735  -64.286  -89.157  1.00 42.94  ? 48  ALA C CA  1 
ATOM   1670 C C   . ALA C 2 48  ? 87.460  -63.148  -90.151  1.00 43.97  ? 48  ALA C C   1 
ATOM   1671 O O   . ALA C 2 48  ? 86.530  -63.237  -90.948  1.00 48.61  ? 48  ALA C O   1 
ATOM   1672 C CB  . ALA C 2 48  ? 86.844  -64.115  -87.934  1.00 41.93  ? 48  ALA C CB  1 
ATOM   1673 N N   . ALA C 2 49  ? 88.265  -62.094  -90.099  1.00 40.61  ? 49  ALA C N   1 
ATOM   1674 C CA  . ALA C 2 49  ? 88.116  -60.968  -91.005  1.00 43.60  ? 49  ALA C CA  1 
ATOM   1675 C C   . ALA C 2 49  ? 88.614  -61.242  -92.431  1.00 45.38  ? 49  ALA C C   1 
ATOM   1676 O O   . ALA C 2 49  ? 88.359  -60.432  -93.286  1.00 50.86  ? 49  ALA C O   1 
ATOM   1677 C CB  . ALA C 2 49  ? 88.808  -59.729  -90.442  1.00 40.92  ? 49  ALA C CB  1 
ATOM   1678 N N   . GLU C 2 50  ? 89.326  -62.342  -92.687  1.00 46.50  ? 50  GLU C N   1 
ATOM   1679 C CA  . GLU C 2 50  ? 89.786  -62.634  -94.040  1.00 45.94  ? 50  GLU C CA  1 
ATOM   1680 C C   . GLU C 2 50  ? 89.324  -64.038  -94.502  1.00 43.26  ? 50  GLU C C   1 
ATOM   1681 O O   . GLU C 2 50  ? 89.583  -65.050  -93.877  1.00 42.32  ? 50  GLU C O   1 
ATOM   1682 C CB  . GLU C 2 50  ? 91.287  -62.305  -94.201  1.00 47.79  ? 50  GLU C CB  1 
ATOM   1683 C CG  . GLU C 2 50  ? 92.244  -63.434  -94.476  1.00 56.37  ? 50  GLU C CG  1 
ATOM   1684 C CD  . GLU C 2 50  ? 92.231  -64.015  -95.900  1.00 58.14  ? 50  GLU C CD  1 
ATOM   1685 O OE1 . GLU C 2 50  ? 91.568  -63.534  -96.895  1.00 47.28  ? 50  GLU C OE1 1 
ATOM   1686 O OE2 . GLU C 2 50  ? 92.924  -65.046  -95.978  1.00 59.49  ? 50  GLU C OE2 1 
ATOM   1687 N N   . SER C 2 51  ? 88.593  -64.066  -95.609  1.00 39.63  ? 51  SER C N   1 
ATOM   1688 C CA  . SER C 2 51  ? 87.798  -65.223  -95.952  1.00 37.17  ? 51  SER C CA  1 
ATOM   1689 C C   . SER C 2 51  ? 88.620  -66.493  -96.164  1.00 34.72  ? 51  SER C C   1 
ATOM   1690 O O   . SER C 2 51  ? 88.124  -67.568  -95.924  1.00 34.93  ? 51  SER C O   1 
ATOM   1691 C CB  . SER C 2 51  ? 86.926  -64.925  -97.190  1.00 38.99  ? 51  SER C CB  1 
ATOM   1692 O OG  . SER C 2 51  ? 87.715  -64.879  -98.367  1.00 40.28  ? 51  SER C OG  1 
ATOM   1693 N N   . ASN C 2 52  ? 89.848  -66.370  -96.654  1.00 34.41  ? 52  ASN C N   1 
ATOM   1694 C CA  . ASN C 2 52  ? 90.699  -67.539  -96.883  1.00 35.72  ? 52  ASN C CA  1 
ATOM   1695 C C   . ASN C 2 52  ? 91.151  -68.165  -95.545  1.00 37.81  ? 52  ASN C C   1 
ATOM   1696 O O   . ASN C 2 52  ? 90.941  -69.352  -95.334  1.00 37.40  ? 52  ASN C O   1 
ATOM   1697 C CB  . ASN C 2 52  ? 91.891  -67.222  -97.792  1.00 33.00  ? 52  ASN C CB  1 
ATOM   1698 C CG  . ASN C 2 52  ? 92.787  -68.429  -98.023  1.00 37.89  ? 52  ASN C CG  1 
ATOM   1699 O OD1 . ASN C 2 52  ? 92.324  -69.517  -98.431  1.00 36.46  ? 52  ASN C OD1 1 
ATOM   1700 N ND2 . ASN C 2 52  ? 94.079  -68.258  -97.771  1.00 40.45  ? 52  ASN C ND2 1 
ATOM   1701 N N   . CYS C 2 53  ? 91.741  -67.360  -94.664  1.00 39.19  ? 53  CYS C N   1 
ATOM   1702 C CA  . CYS C 2 53  ? 92.134  -67.799  -93.312  1.00 42.37  ? 53  CYS C CA  1 
ATOM   1703 C C   . CYS C 2 53  ? 90.955  -68.455  -92.586  1.00 38.73  ? 53  CYS C C   1 
ATOM   1704 O O   . CYS C 2 53  ? 91.041  -69.570  -92.102  1.00 40.25  ? 53  CYS C O   1 
ATOM   1705 C CB  . CYS C 2 53  ? 92.642  -66.607  -92.485  1.00 47.76  ? 53  CYS C CB  1 
ATOM   1706 S SG  . CYS C 2 53  ? 93.514  -67.045  -90.942  1.00 52.57  ? 53  CYS C SG  1 
ATOM   1707 N N   . SER C 2 54  ? 89.839  -67.765  -92.579  1.00 37.29  ? 54  SER C N   1 
ATOM   1708 C CA  . SER C 2 54  ? 88.613  -68.240  -91.945  1.00 39.51  ? 54  SER C CA  1 
ATOM   1709 C C   . SER C 2 54  ? 88.154  -69.630  -92.425  1.00 40.61  ? 54  SER C C   1 
ATOM   1710 O O   . SER C 2 54  ? 87.753  -70.481  -91.633  1.00 41.51  ? 54  SER C O   1 
ATOM   1711 C CB  . SER C 2 54  ? 87.527  -67.204  -92.184  1.00 36.95  ? 54  SER C CB  1 
ATOM   1712 O OG  . SER C 2 54  ? 86.361  -67.517  -91.475  1.00 37.99  ? 54  SER C OG  1 
ATOM   1713 N N   . SER C 2 55  ? 88.220  -69.841  -93.730  1.00 41.26  ? 55  SER C N   1 
ATOM   1714 C CA  . SER C 2 55  ? 87.896  -71.125  -94.331  1.00 39.24  ? 55  SER C CA  1 
ATOM   1715 C C   . SER C 2 55  ? 88.960  -72.178  -93.966  1.00 38.29  ? 55  SER C C   1 
ATOM   1716 O O   . SER C 2 55  ? 88.625  -73.293  -93.584  1.00 37.12  ? 55  SER C O   1 
ATOM   1717 C CB  . SER C 2 55  ? 87.779  -70.949  -95.847  1.00 40.16  ? 55  SER C CB  1 
ATOM   1718 O OG  . SER C 2 55  ? 87.686  -72.180  -96.525  1.00 40.69  ? 55  SER C OG  1 
ATOM   1719 N N   . ARG C 2 56  ? 90.237  -71.811  -94.042  1.00 37.73  ? 56  ARG C N   1 
ATOM   1720 C CA  . ARG C 2 56  ? 91.305  -72.731  -93.634  1.00 43.02  ? 56  ARG C CA  1 
ATOM   1721 C C   . ARG C 2 56  ? 91.149  -73.158  -92.156  1.00 45.41  ? 56  ARG C C   1 
ATOM   1722 O O   . ARG C 2 56  ? 91.316  -74.337  -91.823  1.00 42.97  ? 56  ARG C O   1 
ATOM   1723 C CB  . ARG C 2 56  ? 92.678  -72.133  -93.848  1.00 42.56  ? 56  ARG C CB  1 
ATOM   1724 C CG  . ARG C 2 56  ? 92.977  -71.702  -95.269  1.00 49.93  ? 56  ARG C CG  1 
ATOM   1725 C CD  . ARG C 2 56  ? 93.058  -72.810  -96.300  1.00 53.71  ? 56  ARG C CD  1 
ATOM   1726 N NE  . ARG C 2 56  ? 93.690  -72.290  -97.524  1.00 57.63  ? 56  ARG C NE  1 
ATOM   1727 C CZ  . ARG C 2 56  ? 94.029  -73.026  -98.584  1.00 61.75  ? 56  ARG C CZ  1 
ATOM   1728 N NH1 . ARG C 2 56  ? 93.798  -74.346  -98.619  1.00 57.95  ? 56  ARG C NH1 1 
ATOM   1729 N NH2 . ARG C 2 56  ? 94.593  -72.432  -99.631  1.00 64.76  ? 56  ARG C NH2 1 
ATOM   1730 N N   . TYR C 2 57  ? 90.770  -72.189  -91.315  1.00 41.74  ? 57  TYR C N   1 
ATOM   1731 C CA  . TYR C 2 57  ? 90.551  -72.404  -89.905  1.00 43.80  ? 57  TYR C CA  1 
ATOM   1732 C C   . TYR C 2 57  ? 89.396  -73.356  -89.654  1.00 44.24  ? 57  TYR C C   1 
ATOM   1733 O O   . TYR C 2 57  ? 89.526  -74.310  -88.887  1.00 43.41  ? 57  TYR C O   1 
ATOM   1734 C CB  . TYR C 2 57  ? 90.345  -71.059  -89.198  1.00 45.02  ? 57  TYR C CB  1 
ATOM   1735 C CG  . TYR C 2 57  ? 89.958  -71.171  -87.752  1.00 51.08  ? 57  TYR C CG  1 
ATOM   1736 C CD1 . TYR C 2 57  ? 90.849  -71.641  -86.799  1.00 55.74  ? 57  TYR C CD1 1 
ATOM   1737 C CD2 . TYR C 2 57  ? 88.691  -70.834  -87.337  1.00 61.89  ? 57  TYR C CD2 1 
ATOM   1738 C CE1 . TYR C 2 57  ? 90.490  -71.737  -85.464  1.00 57.22  ? 57  TYR C CE1 1 
ATOM   1739 C CE2 . TYR C 2 57  ? 88.327  -70.923  -86.009  1.00 68.48  ? 57  TYR C CE2 1 
ATOM   1740 C CZ  . TYR C 2 57  ? 89.235  -71.383  -85.074  1.00 65.52  ? 57  TYR C CZ  1 
ATOM   1741 O OH  . TYR C 2 57  ? 88.854  -71.488  -83.754  1.00 70.96  ? 57  TYR C OH  1 
ATOM   1742 N N   . ARG C 2 58  ? 88.281  -73.112  -90.324  1.00 44.55  ? 58  ARG C N   1 
ATOM   1743 C CA  . ARG C 2 58  ? 87.118  -73.976  -90.218  1.00 46.01  ? 58  ARG C CA  1 
ATOM   1744 C C   . ARG C 2 58  ? 87.441  -75.427  -90.631  1.00 46.57  ? 58  ARG C C   1 
ATOM   1745 O O   . ARG C 2 58  ? 87.028  -76.367  -89.947  1.00 45.13  ? 58  ARG C O   1 
ATOM   1746 C CB  . ARG C 2 58  ? 85.996  -73.401  -91.057  1.00 51.95  ? 58  ARG C CB  1 
ATOM   1747 C CG  . ARG C 2 58  ? 84.621  -73.978  -90.775  1.00 60.99  ? 58  ARG C CG  1 
ATOM   1748 C CD  . ARG C 2 58  ? 83.541  -72.964  -91.163  1.00 68.23  ? 58  ARG C CD  1 
ATOM   1749 N NE  . ARG C 2 58  ? 83.571  -72.730  -92.600  1.00 68.15  ? 58  ARG C NE  1 
ATOM   1750 C CZ  . ARG C 2 58  ? 82.806  -73.346  -93.506  1.00 74.77  ? 58  ARG C CZ  1 
ATOM   1751 N NH1 . ARG C 2 58  ? 81.870  -74.240  -93.157  1.00 71.42  ? 58  ARG C NH1 1 
ATOM   1752 N NH2 . ARG C 2 58  ? 82.968  -73.031  -94.795  1.00 82.01  ? 58  ARG C NH2 1 
ATOM   1753 N N   . THR C 2 59  ? 88.219  -75.585  -91.712  1.00 44.79  ? 59  THR C N   1 
ATOM   1754 C CA  . THR C 2 59  ? 88.669  -76.895  -92.187  1.00 45.55  ? 59  THR C CA  1 
ATOM   1755 C C   . THR C 2 59  ? 89.553  -77.601  -91.132  1.00 46.39  ? 59  THR C C   1 
ATOM   1756 O O   . THR C 2 59  ? 89.309  -78.759  -90.809  1.00 46.70  ? 59  THR C O   1 
ATOM   1757 C CB  . THR C 2 59  ? 89.401  -76.801  -93.555  1.00 42.16  ? 59  THR C CB  1 
ATOM   1758 O OG1 . THR C 2 59  ? 88.468  -76.440  -94.574  1.00 42.56  ? 59  THR C OG1 1 
ATOM   1759 C CG2 . THR C 2 59  ? 89.992  -78.115  -93.965  1.00 40.57  ? 59  THR C CG2 1 
ATOM   1760 N N   . LEU C 2 60  ? 90.565  -76.916  -90.609  1.00 46.98  ? 60  LEU C N   1 
ATOM   1761 C CA  . LEU C 2 60  ? 91.449  -77.511  -89.599  1.00 49.14  ? 60  LEU C CA  1 
ATOM   1762 C C   . LEU C 2 60  ? 90.694  -77.954  -88.340  1.00 51.07  ? 60  LEU C C   1 
ATOM   1763 O O   . LEU C 2 60  ? 90.926  -79.032  -87.820  1.00 51.27  ? 60  LEU C O   1 
ATOM   1764 C CB  . LEU C 2 60  ? 92.539  -76.535  -89.194  1.00 48.69  ? 60  LEU C CB  1 
ATOM   1765 C CG  . LEU C 2 60  ? 93.580  -77.105  -88.217  1.00 52.25  ? 60  LEU C CG  1 
ATOM   1766 C CD1 . LEU C 2 60  ? 94.387  -78.252  -88.832  1.00 53.89  ? 60  LEU C CD1 1 
ATOM   1767 C CD2 . LEU C 2 60  ? 94.507  -76.003  -87.717  1.00 50.16  ? 60  LEU C CD2 1 
ATOM   1768 N N   . ARG C 2 61  ? 89.800  -77.097  -87.873  1.00 51.95  ? 61  ARG C N   1 
ATOM   1769 C CA  . ARG C 2 61  ? 88.909  -77.387  -86.752  1.00 54.08  ? 61  ARG C CA  1 
ATOM   1770 C C   . ARG C 2 61  ? 88.147  -78.710  -86.971  1.00 56.86  ? 61  ARG C C   1 
ATOM   1771 O O   . ARG C 2 61  ? 88.130  -79.588  -86.106  1.00 55.55  ? 61  ARG C O   1 
ATOM   1772 C CB  . ARG C 2 61  ? 87.899  -76.255  -86.579  1.00 53.86  ? 61  ARG C CB  1 
ATOM   1773 C CG  . ARG C 2 61  ? 87.801  -75.694  -85.203  1.00 60.33  ? 61  ARG C CG  1 
ATOM   1774 C CD  . ARG C 2 61  ? 87.090  -74.354  -85.212  1.00 67.40  ? 61  ARG C CD  1 
ATOM   1775 N NE  . ARG C 2 61  ? 85.731  -74.485  -85.747  1.00 78.28  ? 61  ARG C NE  1 
ATOM   1776 C CZ  . ARG C 2 61  ? 85.145  -73.643  -86.614  1.00 80.50  ? 61  ARG C CZ  1 
ATOM   1777 N NH1 . ARG C 2 61  ? 85.783  -72.574  -87.083  1.00 73.05  ? 61  ARG C NH1 1 
ATOM   1778 N NH2 . ARG C 2 61  ? 83.901  -73.885  -87.034  1.00 82.28  ? 61  ARG C NH2 1 
ATOM   1779 N N   . GLN C 2 62  ? 87.517  -78.825  -88.133  1.00 56.26  ? 62  GLN C N   1 
ATOM   1780 C CA  . GLN C 2 62  ? 86.817  -80.044  -88.541  1.00 60.48  ? 62  GLN C CA  1 
ATOM   1781 C C   . GLN C 2 62  ? 87.770  -81.262  -88.602  1.00 58.67  ? 62  GLN C C   1 
ATOM   1782 O O   . GLN C 2 62  ? 87.426  -82.335  -88.127  1.00 61.48  ? 62  GLN C O   1 
ATOM   1783 C CB  . GLN C 2 62  ? 86.107  -79.819  -89.888  1.00 67.04  ? 62  GLN C CB  1 
ATOM   1784 C CG  . GLN C 2 62  ? 85.226  -80.961  -90.399  1.00 74.77  ? 62  GLN C CG  1 
ATOM   1785 C CD  . GLN C 2 62  ? 83.941  -81.172  -89.593  1.00 84.36  ? 62  GLN C CD  1 
ATOM   1786 O OE1 . GLN C 2 62  ? 83.387  -80.234  -89.007  1.00 93.00  ? 62  GLN C OE1 1 
ATOM   1787 N NE2 . GLN C 2 62  ? 83.454  -82.414  -89.573  1.00 87.29  ? 62  GLN C NE2 1 
ATOM   1788 N N   . CYS C 2 63  ? 88.963  -81.092  -89.149  1.00 56.75  ? 63  CYS C N   1 
ATOM   1789 C CA  . CYS C 2 63  ? 89.929  -82.188  -89.210  1.00 64.59  ? 63  CYS C CA  1 
ATOM   1790 C C   . CYS C 2 63  ? 90.296  -82.697  -87.807  1.00 70.31  ? 63  CYS C C   1 
ATOM   1791 O O   . CYS C 2 63  ? 90.287  -83.897  -87.557  1.00 69.83  ? 63  CYS C O   1 
ATOM   1792 C CB  . CYS C 2 63  ? 91.204  -81.751  -89.927  1.00 68.61  ? 63  CYS C CB  1 
ATOM   1793 S SG  . CYS C 2 63  ? 90.987  -81.232  -91.648  1.00 80.13  ? 63  CYS C SG  1 
ATOM   1794 N N   . LEU C 2 64  ? 90.605  -81.764  -86.907  1.00 70.74  ? 64  LEU C N   1 
ATOM   1795 C CA  . LEU C 2 64  ? 91.013  -82.080  -85.533  1.00 71.62  ? 64  LEU C CA  1 
ATOM   1796 C C   . LEU C 2 64  ? 89.915  -82.587  -84.607  1.00 69.74  ? 64  LEU C C   1 
ATOM   1797 O O   . LEU C 2 64  ? 90.221  -83.263  -83.639  1.00 72.44  ? 64  LEU C O   1 
ATOM   1798 C CB  . LEU C 2 64  ? 91.683  -80.869  -84.892  1.00 68.06  ? 64  LEU C CB  1 
ATOM   1799 C CG  . LEU C 2 64  ? 92.982  -80.418  -85.565  1.00 68.48  ? 64  LEU C CG  1 
ATOM   1800 C CD1 . LEU C 2 64  ? 93.408  -79.094  -84.976  1.00 67.11  ? 64  LEU C CD1 1 
ATOM   1801 C CD2 . LEU C 2 64  ? 94.100  -81.444  -85.426  1.00 69.98  ? 64  LEU C CD2 1 
ATOM   1802 N N   . ALA C 2 65  ? 88.653  -82.299  -84.911  1.00 73.50  ? 65  ALA C N   1 
ATOM   1803 C CA  . ALA C 2 65  ? 87.522  -82.880  -84.175  1.00 73.96  ? 65  ALA C CA  1 
ATOM   1804 C C   . ALA C 2 65  ? 87.288  -84.384  -84.485  1.00 86.46  ? 65  ALA C C   1 
ATOM   1805 O O   . ALA C 2 65  ? 86.201  -84.893  -84.209  1.00 90.08  ? 65  ALA C O   1 
ATOM   1806 C CB  . ALA C 2 65  ? 86.251  -82.075  -84.446  1.00 71.03  ? 65  ALA C CB  1 
ATOM   1807 N N   . GLY C 2 66  ? 88.295  -85.081  -85.042  1.00 97.13  ? 66  GLY C N   1 
ATOM   1808 C CA  . GLY C 2 66  ? 88.227  -86.525  -85.366  1.00 99.38  ? 66  GLY C CA  1 
ATOM   1809 C C   . GLY C 2 66  ? 89.288  -87.399  -84.690  1.00 100.57 ? 66  GLY C C   1 
ATOM   1810 O O   . GLY C 2 66  ? 89.472  -87.369  -83.463  1.00 92.37  ? 66  GLY C O   1 
ATOM   1811 N N   . ASN C 2 75  ? 94.625  -85.631  -94.113  1.00 92.08  ? 75  ASN C N   1 
ATOM   1812 C CA  . ASN C 2 75  ? 94.609  -85.925  -95.544  1.00 88.27  ? 75  ASN C CA  1 
ATOM   1813 C C   . ASN C 2 75  ? 95.296  -84.809  -96.383  1.00 90.90  ? 75  ASN C C   1 
ATOM   1814 O O   . ASN C 2 75  ? 96.278  -84.211  -95.939  1.00 92.05  ? 75  ASN C O   1 
ATOM   1815 C CB  . ASN C 2 75  ? 93.154  -86.203  -95.975  1.00 82.31  ? 75  ASN C CB  1 
ATOM   1816 C CG  . ASN C 2 75  ? 92.242  -84.971  -95.863  1.00 80.31  ? 75  ASN C CG  1 
ATOM   1817 O OD1 . ASN C 2 75  ? 92.695  -83.815  -95.881  1.00 71.96  ? 75  ASN C OD1 1 
ATOM   1818 N ND2 . ASN C 2 75  ? 90.939  -85.221  -95.777  1.00 75.38  ? 75  ASN C ND2 1 
ATOM   1819 N N   . LYS C 2 76  ? 94.775  -84.535  -97.580  1.00 92.23  ? 76  LYS C N   1 
ATOM   1820 C CA  . LYS C 2 76  ? 95.326  -83.521  -98.489  1.00 95.37  ? 76  LYS C CA  1 
ATOM   1821 C C   . LYS C 2 76  ? 94.948  -82.095  -98.091  1.00 86.12  ? 76  LYS C C   1 
ATOM   1822 O O   . LYS C 2 76  ? 95.816  -81.217  -97.994  1.00 78.72  ? 76  LYS C O   1 
ATOM   1823 C CB  . LYS C 2 76  ? 94.859  -83.790  -99.936  1.00 100.95 ? 76  LYS C CB  1 
ATOM   1824 C CG  . LYS C 2 76  ? 95.907  -84.464  -100.812 1.00 104.48 ? 76  LYS C CG  1 
ATOM   1825 C CD  . LYS C 2 76  ? 95.280  -85.293  -101.930 1.00 109.41 ? 76  LYS C CD  1 
ATOM   1826 C CE  . LYS C 2 76  ? 95.887  -86.694  -102.009 1.00 112.09 ? 76  LYS C CE  1 
ATOM   1827 N NZ  . LYS C 2 76  ? 94.868  -87.731  -102.336 1.00 109.67 ? 76  LYS C NZ  1 
ATOM   1828 N N   . GLU C 2 77  ? 93.649  -81.872  -97.904  1.00 81.68  ? 77  GLU C N   1 
ATOM   1829 C CA  . GLU C 2 77  ? 93.132  -80.542  -97.571  1.00 85.41  ? 77  GLU C CA  1 
ATOM   1830 C C   . GLU C 2 77  ? 93.543  -80.125  -96.158  1.00 84.61  ? 77  GLU C C   1 
ATOM   1831 O O   . GLU C 2 77  ? 93.950  -78.975  -95.951  1.00 79.74  ? 77  GLU C O   1 
ATOM   1832 C CB  . GLU C 2 77  ? 91.599  -80.446  -97.743  1.00 89.51  ? 77  GLU C CB  1 
ATOM   1833 C CG  . GLU C 2 77  ? 91.168  -79.479  -98.846  1.00 94.36  ? 77  GLU C CG  1 
ATOM   1834 C CD  . GLU C 2 77  ? 89.809  -78.848  -98.601  1.00 100.23 ? 77  GLU C CD  1 
ATOM   1835 O OE1 . GLU C 2 77  ? 88.846  -79.600  -98.343  1.00 95.08  ? 77  GLU C OE1 1 
ATOM   1836 O OE2 . GLU C 2 77  ? 89.703  -77.596  -98.675  1.00 106.52 ? 77  GLU C OE2 1 
ATOM   1837 N N   . CYS C 2 78  ? 93.445  -81.064  -95.209  1.00 80.47  ? 78  CYS C N   1 
ATOM   1838 C CA  . CYS C 2 78  ? 93.836  -80.829  -93.809  1.00 77.41  ? 78  CYS C CA  1 
ATOM   1839 C C   . CYS C 2 78  ? 95.271  -80.318  -93.692  1.00 75.35  ? 78  CYS C C   1 
ATOM   1840 O O   . CYS C 2 78  ? 95.534  -79.344  -92.966  1.00 69.36  ? 78  CYS C O   1 
ATOM   1841 C CB  . CYS C 2 78  ? 93.668  -82.088  -92.955  1.00 72.20  ? 78  CYS C CB  1 
ATOM   1842 S SG  . CYS C 2 78  ? 91.966  -82.666  -92.745  1.00 78.51  ? 78  CYS C SG  1 
ATOM   1843 N N   . GLN C 2 79  ? 96.181  -80.951  -94.428  1.00 72.36  ? 79  GLN C N   1 
ATOM   1844 C CA  . GLN C 2 79  ? 97.591  -80.545  -94.426  1.00 70.70  ? 79  GLN C CA  1 
ATOM   1845 C C   . GLN C 2 79  ? 97.777  -79.140  -94.989  1.00 67.83  ? 79  GLN C C   1 
ATOM   1846 O O   . GLN C 2 79  ? 98.585  -78.363  -94.474  1.00 66.20  ? 79  GLN C O   1 
ATOM   1847 C CB  . GLN C 2 79  ? 98.458  -81.552  -95.206  1.00 73.75  ? 79  GLN C CB  1 
ATOM   1848 C CG  . GLN C 2 79  ? 99.958  -81.225  -95.226  1.00 82.06  ? 79  GLN C CG  1 
ATOM   1849 C CD  . GLN C 2 79  ? 100.579 -81.127  -93.824  1.00 85.60  ? 79  GLN C CD  1 
ATOM   1850 O OE1 . GLN C 2 79  ? 100.282 -81.944  -92.942  1.00 83.91  ? 79  GLN C OE1 1 
ATOM   1851 N NE2 . GLN C 2 79  ? 101.443 -80.128  -93.617  1.00 81.68  ? 79  GLN C NE2 1 
ATOM   1852 N N   . ALA C 2 80  ? 97.036  -78.822  -96.051  1.00 66.75  ? 80  ALA C N   1 
ATOM   1853 C CA  . ALA C 2 80  ? 97.097  -77.483  -96.661  1.00 65.66  ? 80  ALA C CA  1 
ATOM   1854 C C   . ALA C 2 80  ? 96.518  -76.420  -95.717  1.00 61.37  ? 80  ALA C C   1 
ATOM   1855 O O   . ALA C 2 80  ? 97.022  -75.295  -95.653  1.00 63.44  ? 80  ALA C O   1 
ATOM   1856 C CB  . ALA C 2 80  ? 96.363  -77.470  -97.995  1.00 64.11  ? 80  ALA C CB  1 
ATOM   1857 N N   . ALA C 2 81  ? 95.470  -76.788  -94.982  1.00 56.40  ? 81  ALA C N   1 
ATOM   1858 C CA  . ALA C 2 81  ? 94.859  -75.884  -94.016  1.00 57.44  ? 81  ALA C CA  1 
ATOM   1859 C C   . ALA C 2 81  ? 95.843  -75.586  -92.876  1.00 55.96  ? 81  ALA C C   1 
ATOM   1860 O O   . ALA C 2 81  ? 96.091  -74.416  -92.551  1.00 54.41  ? 81  ALA C O   1 
ATOM   1861 C CB  . ALA C 2 81  ? 93.549  -76.457  -93.498  1.00 55.94  ? 81  ALA C CB  1 
ATOM   1862 N N   . LEU C 2 82  ? 96.445  -76.637  -92.322  1.00 59.09  ? 82  LEU C N   1 
ATOM   1863 C CA  . LEU C 2 82  ? 97.491  -76.483  -91.306  1.00 61.43  ? 82  LEU C CA  1 
ATOM   1864 C C   . LEU C 2 82  ? 98.638  -75.562  -91.749  1.00 62.74  ? 82  LEU C C   1 
ATOM   1865 O O   . LEU C 2 82  ? 99.058  -74.673  -91.003  1.00 63.33  ? 82  LEU C O   1 
ATOM   1866 C CB  . LEU C 2 82  ? 98.032  -77.847  -90.888  1.00 66.08  ? 82  LEU C CB  1 
ATOM   1867 C CG  . LEU C 2 82  ? 99.134  -77.801  -89.822  1.00 70.01  ? 82  LEU C CG  1 
ATOM   1868 C CD1 . LEU C 2 82  ? 98.601  -77.294  -88.482  1.00 67.55  ? 82  LEU C CD1 1 
ATOM   1869 C CD2 . LEU C 2 82  ? 99.729  -79.192  -89.687  1.00 72.99  ? 82  LEU C CD2 1 
ATOM   1870 N N   . GLU C 2 83  ? 99.116  -75.758  -92.973  1.00 68.31  ? 83  GLU C N   1 
ATOM   1871 C CA  . GLU C 2 83  ? 100.200 -74.944  -93.518  1.00 70.97  ? 83  GLU C CA  1 
ATOM   1872 C C   . GLU C 2 83  ? 99.874  -73.464  -93.594  1.00 69.34  ? 83  GLU C C   1 
ATOM   1873 O O   . GLU C 2 83  ? 100.745 -72.623  -93.316  1.00 71.68  ? 83  GLU C O   1 
ATOM   1874 C CB  . GLU C 2 83  ? 100.610 -75.444  -94.901  1.00 80.67  ? 83  GLU C CB  1 
ATOM   1875 C CG  . GLU C 2 83  ? 101.470 -76.697  -94.867  1.00 88.75  ? 83  GLU C CG  1 
ATOM   1876 C CD  . GLU C 2 83  ? 101.870 -77.169  -96.256  1.00 98.92  ? 83  GLU C CD  1 
ATOM   1877 O OE1 . GLU C 2 83  ? 102.598 -76.424  -96.950  1.00 100.37 ? 83  GLU C OE1 1 
ATOM   1878 O OE2 . GLU C 2 83  ? 101.460 -78.285  -96.654  1.00 108.00 ? 83  GLU C OE2 1 
ATOM   1879 N N   . VAL C 2 84  ? 98.639  -73.134  -93.973  1.00 66.46  ? 84  VAL C N   1 
ATOM   1880 C CA  . VAL C 2 84  ? 98.221  -71.714  -94.023  1.00 66.01  ? 84  VAL C CA  1 
ATOM   1881 C C   . VAL C 2 84  ? 98.139  -71.122  -92.627  1.00 61.96  ? 84  VAL C C   1 
ATOM   1882 O O   . VAL C 2 84  ? 98.533  -69.966  -92.409  1.00 63.27  ? 84  VAL C O   1 
ATOM   1883 C CB  . VAL C 2 84  ? 96.874  -71.482  -94.773  1.00 66.11  ? 84  VAL C CB  1 
ATOM   1884 C CG1 . VAL C 2 84  ? 96.365  -70.045  -94.607  1.00 60.41  ? 84  VAL C CG1 1 
ATOM   1885 C CG2 . VAL C 2 84  ? 97.037  -71.784  -96.253  1.00 64.38  ? 84  VAL C CG2 1 
ATOM   1886 N N   . LEU C 2 85  ? 97.610  -71.898  -91.691  1.00 62.16  ? 85  LEU C N   1 
ATOM   1887 C CA  . LEU C 2 85  ? 97.445  -71.394  -90.325  1.00 64.57  ? 85  LEU C CA  1 
ATOM   1888 C C   . LEU C 2 85  ? 98.756  -71.280  -89.567  1.00 61.95  ? 85  LEU C C   1 
ATOM   1889 O O   . LEU C 2 85  ? 98.873  -70.423  -88.695  1.00 58.15  ? 85  LEU C O   1 
ATOM   1890 C CB  . LEU C 2 85  ? 96.431  -72.223  -89.560  1.00 60.96  ? 85  LEU C CB  1 
ATOM   1891 C CG  . LEU C 2 85  ? 95.052  -72.095  -90.201  1.00 64.86  ? 85  LEU C CG  1 
ATOM   1892 C CD1 . LEU C 2 85  ? 94.152  -73.201  -89.691  1.00 70.75  ? 85  LEU C CD1 1 
ATOM   1893 C CD2 . LEU C 2 85  ? 94.409  -70.740  -89.965  1.00 70.67  ? 85  LEU C CD2 1 
ATOM   1894 N N   . GLN C 2 86  ? 99.759  -72.070  -89.945  1.00 62.42  ? 86  GLN C N   1 
ATOM   1895 C CA  . GLN C 2 86  ? 101.101 -71.915  -89.364  1.00 67.38  ? 86  GLN C CA  1 
ATOM   1896 C C   . GLN C 2 86  ? 101.725 -70.546  -89.607  1.00 65.17  ? 86  GLN C C   1 
ATOM   1897 O O   . GLN C 2 86  ? 102.530 -70.098  -88.794  1.00 69.83  ? 86  GLN C O   1 
ATOM   1898 C CB  . GLN C 2 86  ? 102.036 -73.035  -89.804  1.00 69.95  ? 86  GLN C CB  1 
ATOM   1899 C CG  . GLN C 2 86  ? 101.748 -74.327  -89.039  1.00 77.16  ? 86  GLN C CG  1 
ATOM   1900 C CD  . GLN C 2 86  ? 102.393 -75.574  -89.635  1.00 81.71  ? 86  GLN C CD  1 
ATOM   1901 O OE1 . GLN C 2 86  ? 102.871 -75.568  -90.778  1.00 81.74  ? 86  GLN C OE1 1 
ATOM   1902 N NE2 . GLN C 2 86  ? 102.397 -76.663  -88.860  1.00 79.08  ? 86  GLN C NE2 1 
ATOM   1903 N N   . GLU C 2 87  ? 101.323 -69.867  -90.679  1.00 60.12  ? 87  GLU C N   1 
ATOM   1904 C CA  . GLU C 2 87  ? 101.793 -68.502  -90.962  1.00 64.20  ? 87  GLU C CA  1 
ATOM   1905 C C   . GLU C 2 87  ? 100.886 -67.436  -90.357  1.00 59.63  ? 87  GLU C C   1 
ATOM   1906 O O   . GLU C 2 87  ? 101.182 -66.253  -90.453  1.00 68.30  ? 87  GLU C O   1 
ATOM   1907 C CB  . GLU C 2 87  ? 101.942 -68.246  -92.482  1.00 69.31  ? 87  GLU C CB  1 
ATOM   1908 C CG  . GLU C 2 87  ? 102.536 -69.400  -93.309  1.00 79.72  ? 87  GLU C CG  1 
ATOM   1909 C CD  . GLU C 2 87  ? 103.870 -69.932  -92.787  1.00 82.15  ? 87  GLU C CD  1 
ATOM   1910 O OE1 . GLU C 2 87  ? 104.129 -71.144  -92.940  1.00 82.54  ? 87  GLU C OE1 1 
ATOM   1911 O OE2 . GLU C 2 87  ? 104.663 -69.148  -92.230  1.00 81.25  ? 87  GLU C OE2 1 
ATOM   1912 N N   . SER C 2 88  ? 99.776  -67.845  -89.757  1.00 59.60  ? 88  SER C N   1 
ATOM   1913 C CA  . SER C 2 88  ? 98.827  -66.917  -89.134  1.00 58.23  ? 88  SER C CA  1 
ATOM   1914 C C   . SER C 2 88  ? 99.152  -66.731  -87.663  1.00 57.37  ? 88  SER C C   1 
ATOM   1915 O O   . SER C 2 88  ? 99.845  -67.565  -87.073  1.00 58.61  ? 88  SER C O   1 
ATOM   1916 C CB  . SER C 2 88  ? 97.401  -67.458  -89.270  1.00 59.12  ? 88  SER C CB  1 
ATOM   1917 O OG  . SER C 2 88  ? 97.132  -68.471  -88.314  1.00 57.06  ? 88  SER C OG  1 
ATOM   1918 N N   . PRO C 2 89  ? 98.615  -65.666  -87.043  1.00 59.56  ? 89  PRO C N   1 
ATOM   1919 C CA  . PRO C 2 89  ? 98.837  -65.532  -85.606  1.00 57.50  ? 89  PRO C CA  1 
ATOM   1920 C C   . PRO C 2 89  ? 98.068  -66.538  -84.717  1.00 58.92  ? 89  PRO C C   1 
ATOM   1921 O O   . PRO C 2 89  ? 98.295  -66.560  -83.514  1.00 57.68  ? 89  PRO C O   1 
ATOM   1922 C CB  . PRO C 2 89  ? 98.371  -64.104  -85.322  1.00 62.92  ? 89  PRO C CB  1 
ATOM   1923 C CG  . PRO C 2 89  ? 97.322  -63.841  -86.338  1.00 63.15  ? 89  PRO C CG  1 
ATOM   1924 C CD  . PRO C 2 89  ? 97.756  -64.583  -87.574  1.00 62.75  ? 89  PRO C CD  1 
ATOM   1925 N N   . LEU C 2 90  ? 97.168  -67.350  -85.278  1.00 57.04  ? 90  LEU C N   1 
ATOM   1926 C CA  . LEU C 2 90  ? 96.548  -68.446  -84.515  1.00 56.39  ? 90  LEU C CA  1 
ATOM   1927 C C   . LEU C 2 90  ? 97.567  -69.494  -84.077  1.00 59.50  ? 90  LEU C C   1 
ATOM   1928 O O   . LEU C 2 90  ? 97.409  -70.120  -83.035  1.00 64.55  ? 90  LEU C O   1 
ATOM   1929 C CB  . LEU C 2 90  ? 95.456  -69.152  -85.326  1.00 51.55  ? 90  LEU C CB  1 
ATOM   1930 C CG  . LEU C 2 90  ? 94.085  -68.516  -85.329  1.00 49.83  ? 90  LEU C CG  1 
ATOM   1931 C CD1 . LEU C 2 90  ? 93.245  -69.052  -86.475  1.00 51.62  ? 90  LEU C CD1 1 
ATOM   1932 C CD2 . LEU C 2 90  ? 93.378  -68.740  -84.011  1.00 51.70  ? 90  LEU C CD2 1 
ATOM   1933 N N   . TYR C 2 91  ? 98.579  -69.723  -84.903  1.00 65.76  ? 91  TYR C N   1 
ATOM   1934 C CA  . TYR C 2 91  ? 99.654  -70.644  -84.562  1.00 73.75  ? 91  TYR C CA  1 
ATOM   1935 C C   . TYR C 2 91  ? 100.466 -70.045  -83.424  1.00 70.65  ? 91  TYR C C   1 
ATOM   1936 O O   . TYR C 2 91  ? 100.947 -68.911  -83.535  1.00 71.13  ? 91  TYR C O   1 
ATOM   1937 C CB  . TYR C 2 91  ? 100.565 -70.869  -85.764  1.00 78.08  ? 91  TYR C CB  1 
ATOM   1938 C CG  . TYR C 2 91  ? 101.550 -72.007  -85.586  1.00 83.63  ? 91  TYR C CG  1 
ATOM   1939 C CD1 . TYR C 2 91  ? 101.107 -73.342  -85.567  1.00 83.50  ? 91  TYR C CD1 1 
ATOM   1940 C CD2 . TYR C 2 91  ? 102.927 -71.757  -85.452  1.00 84.88  ? 91  TYR C CD2 1 
ATOM   1941 C CE1 . TYR C 2 91  ? 101.998 -74.393  -85.408  1.00 88.67  ? 91  TYR C CE1 1 
ATOM   1942 C CE2 . TYR C 2 91  ? 103.830 -72.804  -85.293  1.00 88.36  ? 91  TYR C CE2 1 
ATOM   1943 C CZ  . TYR C 2 91  ? 103.363 -74.119  -85.276  1.00 93.42  ? 91  TYR C CZ  1 
ATOM   1944 O OH  . TYR C 2 91  ? 104.245 -75.169  -85.121  1.00 100.69 ? 91  TYR C OH  1 
ATOM   1945 N N   . ASP C 2 92  ? 100.608 -70.796  -82.339  1.00 60.86  ? 92  ASP C N   1 
ATOM   1946 C CA  . ASP C 2 92  ? 101.332 -70.316  -81.159  1.00 64.79  ? 92  ASP C CA  1 
ATOM   1947 C C   . ASP C 2 92  ? 100.582 -69.279  -80.313  1.00 55.49  ? 92  ASP C C   1 
ATOM   1948 O O   . ASP C 2 92  ? 101.177 -68.695  -79.421  1.00 61.66  ? 92  ASP C O   1 
ATOM   1949 C CB  . ASP C 2 92  ? 102.760 -69.795  -81.530  1.00 73.96  ? 92  ASP C CB  1 
ATOM   1950 C CG  . ASP C 2 92  ? 103.797 -70.925  -81.650  1.00 88.09  ? 92  ASP C CG  1 
ATOM   1951 O OD1 . ASP C 2 92  ? 103.464 -72.114  -81.414  1.00 94.25  ? 92  ASP C OD1 1 
ATOM   1952 O OD2 . ASP C 2 92  ? 104.966 -70.621  -81.983  1.00 101.93 ? 92  ASP C OD2 1 
ATOM   1953 N N   . CYS C 2 93  ? 99.297  -69.050  -80.562  1.00 49.52  ? 93  CYS C N   1 
ATOM   1954 C CA  . CYS C 2 93  ? 98.519  -68.164  -79.701  1.00 48.55  ? 93  CYS C CA  1 
ATOM   1955 C C   . CYS C 2 93  ? 98.358  -68.801  -78.314  1.00 46.15  ? 93  CYS C C   1 
ATOM   1956 O O   . CYS C 2 93  ? 98.294  -70.019  -78.177  1.00 46.26  ? 93  CYS C O   1 
ATOM   1957 C CB  . CYS C 2 93  ? 97.149  -67.803  -80.318  1.00 47.59  ? 93  CYS C CB  1 
ATOM   1958 S SG  . CYS C 2 93  ? 95.865  -69.068  -80.364  1.00 52.15  ? 93  CYS C SG  1 
ATOM   1959 N N   . ARG C 2 94  ? 98.289  -67.951  -77.302  1.00 48.90  ? 94  ARG C N   1 
ATOM   1960 C CA  . ARG C 2 94  ? 98.234  -68.358  -75.902  1.00 47.94  ? 94  ARG C CA  1 
ATOM   1961 C C   . ARG C 2 94  ? 97.241  -67.506  -75.155  1.00 49.34  ? 94  ARG C C   1 
ATOM   1962 O O   . ARG C 2 94  ? 96.807  -66.469  -75.658  1.00 52.19  ? 94  ARG C O   1 
ATOM   1963 C CB  . ARG C 2 94  ? 99.590  -68.180  -75.250  1.00 47.77  ? 94  ARG C CB  1 
ATOM   1964 C CG  . ARG C 2 94  ? 100.687 -69.045  -75.834  1.00 49.31  ? 94  ARG C CG  1 
ATOM   1965 C CD  . ARG C 2 94  ? 100.485 -70.514  -75.544  1.00 54.92  ? 94  ARG C CD  1 
ATOM   1966 N NE  . ARG C 2 94  ? 101.685 -71.256  -75.936  1.00 61.40  ? 94  ARG C NE  1 
ATOM   1967 C CZ  . ARG C 2 94  ? 101.831 -71.957  -77.064  1.00 65.07  ? 94  ARG C CZ  1 
ATOM   1968 N NH1 . ARG C 2 94  ? 100.840 -72.067  -77.952  1.00 68.31  ? 94  ARG C NH1 1 
ATOM   1969 N NH2 . ARG C 2 94  ? 102.985 -72.571  -77.307  1.00 63.78  ? 94  ARG C NH2 1 
ATOM   1970 N N   . CYS C 2 95  ? 96.892  -67.960  -73.950  1.00 49.21  ? 95  CYS C N   1 
ATOM   1971 C CA  . CYS C 2 95  ? 95.953  -67.271  -73.074  1.00 50.27  ? 95  CYS C CA  1 
ATOM   1972 C C   . CYS C 2 95  ? 96.605  -66.867  -71.754  1.00 49.09  ? 95  CYS C C   1 
ATOM   1973 O O   . CYS C 2 95  ? 97.763  -67.181  -71.506  1.00 53.41  ? 95  CYS C O   1 
ATOM   1974 C CB  . CYS C 2 95  ? 94.732  -68.157  -72.865  1.00 54.14  ? 95  CYS C CB  1 
ATOM   1975 S SG  . CYS C 2 95  ? 94.056  -68.709  -74.479  1.00 55.63  ? 95  CYS C SG  1 
ATOM   1976 N N   . LYS C 2 96  ? 95.864  -66.113  -70.948  1.00 53.01  ? 96  LYS C N   1 
ATOM   1977 C CA  . LYS C 2 96  ? 96.332  -65.561  -69.662  1.00 55.74  ? 96  LYS C CA  1 
ATOM   1978 C C   . LYS C 2 96  ? 95.234  -65.715  -68.624  1.00 52.04  ? 96  LYS C C   1 
ATOM   1979 O O   . LYS C 2 96  ? 94.064  -65.504  -68.936  1.00 48.04  ? 96  LYS C O   1 
ATOM   1980 C CB  . LYS C 2 96  ? 96.710  -64.078  -69.796  1.00 61.85  ? 96  LYS C CB  1 
ATOM   1981 C CG  . LYS C 2 96  ? 98.114  -63.851  -70.335  1.00 72.37  ? 96  LYS C CG  1 
ATOM   1982 C CD  . LYS C 2 96  ? 98.393  -62.380  -70.639  1.00 80.89  ? 96  LYS C CD  1 
ATOM   1983 C CE  . LYS C 2 96  ? 99.720  -62.207  -71.378  1.00 84.52  ? 96  LYS C CE  1 
ATOM   1984 N NZ  . LYS C 2 96  ? 99.869  -60.837  -71.935  1.00 85.74  ? 96  LYS C NZ  1 
ATOM   1985 N N   . ARG C 2 97  ? 95.607  -66.097  -67.403  1.00 49.32  ? 97  ARG C N   1 
ATOM   1986 C CA  . ARG C 2 97  ? 94.655  -66.151  -66.286  1.00 50.89  ? 97  ARG C CA  1 
ATOM   1987 C C   . ARG C 2 97  ? 94.124  -64.746  -65.990  1.00 49.95  ? 97  ARG C C   1 
ATOM   1988 O O   . ARG C 2 97  ? 94.874  -63.782  -66.018  1.00 49.64  ? 97  ARG C O   1 
ATOM   1989 C CB  . ARG C 2 97  ? 95.325  -66.711  -65.034  1.00 48.94  ? 97  ARG C CB  1 
ATOM   1990 C CG  . ARG C 2 97  ? 95.567  -68.198  -65.080  1.00 47.59  ? 97  ARG C CG  1 
ATOM   1991 C CD  . ARG C 2 97  ? 94.286  -68.955  -64.812  1.00 53.09  ? 97  ARG C CD  1 
ATOM   1992 N NE  . ARG C 2 97  ? 93.700  -68.537  -63.541  1.00 53.81  ? 97  ARG C NE  1 
ATOM   1993 C CZ  . ARG C 2 97  ? 94.129  -68.917  -62.340  1.00 50.04  ? 97  ARG C CZ  1 
ATOM   1994 N NH1 . ARG C 2 97  ? 93.521  -68.440  -61.266  1.00 54.33  ? 97  ARG C NH1 1 
ATOM   1995 N NH2 . ARG C 2 97  ? 95.141  -69.779  -62.202  1.00 47.54  ? 97  ARG C NH2 1 
ATOM   1996 N N   . GLY C 2 98  ? 92.824  -64.647  -65.742  1.00 54.00  ? 98  GLY C N   1 
ATOM   1997 C CA  . GLY C 2 98  ? 92.183  -63.364  -65.466  1.00 57.27  ? 98  GLY C CA  1 
ATOM   1998 C C   . GLY C 2 98  ? 92.041  -62.421  -66.656  1.00 66.26  ? 98  GLY C C   1 
ATOM   1999 O O   . GLY C 2 98  ? 91.729  -61.245  -66.466  1.00 73.31  ? 98  GLY C O   1 
ATOM   2000 N N   . MET C 2 99  ? 92.252  -62.919  -67.879  1.00 64.53  ? 99  MET C N   1 
ATOM   2001 C CA  . MET C 2 99  ? 92.029  -62.122  -69.082  1.00 59.31  ? 99  MET C CA  1 
ATOM   2002 C C   . MET C 2 99  ? 90.529  -61.981  -69.314  1.00 60.78  ? 99  MET C C   1 
ATOM   2003 O O   . MET C 2 99  ? 89.713  -62.771  -68.794  1.00 53.31  ? 99  MET C O   1 
ATOM   2004 C CB  . MET C 2 99  ? 92.689  -62.751  -70.320  1.00 56.40  ? 99  MET C CB  1 
ATOM   2005 C CG  . MET C 2 99  ? 91.978  -63.983  -70.877  1.00 58.30  ? 99  MET C CG  1 
ATOM   2006 S SD  . MET C 2 99  ? 92.851  -64.750  -72.258  1.00 59.61  ? 99  MET C SD  1 
ATOM   2007 C CE  . MET C 2 99  ? 92.466  -63.599  -73.579  1.00 57.39  ? 99  MET C CE  1 
ATOM   2008 N N   . LYS C 2 100 ? 90.177  -60.971  -70.104  1.00 62.31  ? 100 LYS C N   1 
ATOM   2009 C CA  . LYS C 2 100 ? 88.818  -60.852  -70.629  1.00 65.98  ? 100 LYS C CA  1 
ATOM   2010 C C   . LYS C 2 100 ? 88.611  -61.987  -71.624  1.00 57.01  ? 100 LYS C C   1 
ATOM   2011 O O   . LYS C 2 100 ? 89.494  -62.272  -72.417  1.00 57.64  ? 100 LYS C O   1 
ATOM   2012 C CB  . LYS C 2 100 ? 88.621  -59.499  -71.332  1.00 71.08  ? 100 LYS C CB  1 
ATOM   2013 C CG  . LYS C 2 100 ? 88.745  -58.288  -70.416  1.00 79.31  ? 100 LYS C CG  1 
ATOM   2014 C CD  . LYS C 2 100 ? 87.628  -58.230  -69.375  1.00 85.82  ? 100 LYS C CD  1 
ATOM   2015 C CE  . LYS C 2 100 ? 87.773  -57.008  -68.476  1.00 93.27  ? 100 LYS C CE  1 
ATOM   2016 N NZ  . LYS C 2 100 ? 86.566  -56.805  -67.628  1.00 96.57  ? 100 LYS C NZ  1 
ATOM   2017 N N   . LYS C 2 101 ? 87.461  -62.638  -71.563  1.00 56.36  ? 101 LYS C N   1 
ATOM   2018 C CA  . LYS C 2 101 ? 87.107  -63.691  -72.518  1.00 60.91  ? 101 LYS C CA  1 
ATOM   2019 C C   . LYS C 2 101 ? 88.090  -64.883  -72.468  1.00 57.34  ? 101 LYS C C   1 
ATOM   2020 O O   . LYS C 2 101 ? 88.495  -65.434  -73.498  1.00 53.25  ? 101 LYS C O   1 
ATOM   2021 C CB  . LYS C 2 101 ? 86.983  -63.114  -73.946  1.00 64.85  ? 101 LYS C CB  1 
ATOM   2022 C CG  . LYS C 2 101 ? 85.843  -62.130  -74.136  1.00 68.61  ? 101 LYS C CG  1 
ATOM   2023 C CD  . LYS C 2 101 ? 85.777  -61.604  -75.572  1.00 78.28  ? 101 LYS C CD  1 
ATOM   2024 C CE  . LYS C 2 101 ? 86.306  -60.176  -75.691  1.00 83.18  ? 101 LYS C CE  1 
ATOM   2025 N NZ  . LYS C 2 101 ? 86.348  -59.721  -77.107  1.00 88.18  ? 101 LYS C NZ  1 
ATOM   2026 N N   . GLU C 2 102 ? 88.457  -65.261  -71.246  1.00 54.82  ? 102 GLU C N   1 
ATOM   2027 C CA  . GLU C 2 102 ? 89.354  -66.377  -70.981  1.00 50.36  ? 102 GLU C CA  1 
ATOM   2028 C C   . GLU C 2 102 ? 88.824  -67.646  -71.631  1.00 47.55  ? 102 GLU C C   1 
ATOM   2029 O O   . GLU C 2 102 ? 89.554  -68.329  -72.341  1.00 43.80  ? 102 GLU C O   1 
ATOM   2030 C CB  . GLU C 2 102 ? 89.507  -66.622  -69.480  1.00 47.36  ? 102 GLU C CB  1 
ATOM   2031 C CG  . GLU C 2 102 ? 90.721  -67.476  -69.132  1.00 51.23  ? 102 GLU C CG  1 
ATOM   2032 C CD  . GLU C 2 102 ? 90.922  -67.698  -67.634  1.00 55.68  ? 102 GLU C CD  1 
ATOM   2033 O OE1 . GLU C 2 102 ? 90.466  -66.853  -66.821  1.00 58.53  ? 102 GLU C OE1 1 
ATOM   2034 O OE2 . GLU C 2 102 ? 91.567  -68.716  -67.269  1.00 49.34  ? 102 GLU C OE2 1 
ATOM   2035 N N   . LEU C 2 103 ? 87.552  -67.935  -71.400  1.00 43.99  ? 103 LEU C N   1 
ATOM   2036 C CA  . LEU C 2 103 ? 86.905  -69.121  -71.972  1.00 46.33  ? 103 LEU C CA  1 
ATOM   2037 C C   . LEU C 2 103 ? 86.964  -69.178  -73.497  1.00 51.72  ? 103 LEU C C   1 
ATOM   2038 O O   . LEU C 2 103 ? 87.214  -70.242  -74.059  1.00 52.98  ? 103 LEU C O   1 
ATOM   2039 C CB  . LEU C 2 103 ? 85.443  -69.182  -71.537  1.00 47.00  ? 103 LEU C CB  1 
ATOM   2040 C CG  . LEU C 2 103 ? 84.564  -70.290  -72.143  1.00 52.19  ? 103 LEU C CG  1 
ATOM   2041 C CD1 . LEU C 2 103 ? 85.080  -71.694  -71.852  1.00 51.27  ? 103 LEU C CD1 1 
ATOM   2042 C CD2 . LEU C 2 103 ? 83.146  -70.126  -71.628  1.00 52.83  ? 103 LEU C CD2 1 
ATOM   2043 N N   . GLN C 2 104 ? 86.709  -68.039  -74.150  1.00 53.49  ? 104 GLN C N   1 
ATOM   2044 C CA  . GLN C 2 104 ? 86.715  -67.952  -75.618  1.00 53.05  ? 104 GLN C CA  1 
ATOM   2045 C C   . GLN C 2 104 ? 88.124  -68.240  -76.118  1.00 49.28  ? 104 GLN C C   1 
ATOM   2046 O O   . GLN C 2 104 ? 88.311  -69.002  -77.079  1.00 45.88  ? 104 GLN C O   1 
ATOM   2047 C CB  . GLN C 2 104 ? 86.261  -66.563  -76.110  1.00 57.78  ? 104 GLN C CB  1 
ATOM   2048 C CG  . GLN C 2 104 ? 84.753  -66.298  -76.013  1.00 69.01  ? 104 GLN C CG  1 
ATOM   2049 C CD  . GLN C 2 104 ? 84.169  -66.319  -74.577  1.00 73.79  ? 104 GLN C CD  1 
ATOM   2050 O OE1 . GLN C 2 104 ? 84.714  -65.701  -73.640  1.00 73.27  ? 104 GLN C OE1 1 
ATOM   2051 N NE2 . GLN C 2 104 ? 83.049  -67.029  -74.408  1.00 75.33  ? 104 GLN C NE2 1 
ATOM   2052 N N   . CYS C 2 105 ? 89.105  -67.629  -75.452  1.00 44.21  ? 105 CYS C N   1 
ATOM   2053 C CA  . CYS C 2 105 ? 90.520  -67.821  -75.782  1.00 43.39  ? 105 CYS C CA  1 
ATOM   2054 C C   . CYS C 2 105 ? 90.880  -69.314  -75.776  1.00 44.20  ? 105 CYS C C   1 
ATOM   2055 O O   . CYS C 2 105 ? 91.504  -69.819  -76.709  1.00 41.78  ? 105 CYS C O   1 
ATOM   2056 C CB  . CYS C 2 105 ? 91.387  -67.067  -74.788  1.00 42.70  ? 105 CYS C CB  1 
ATOM   2057 S SG  . CYS C 2 105 ? 93.132  -66.877  -75.253  1.00 48.67  ? 105 CYS C SG  1 
ATOM   2058 N N   . LEU C 2 106 ? 90.427  -70.008  -74.735  1.00 40.29  ? 106 LEU C N   1 
ATOM   2059 C CA  . LEU C 2 106 ? 90.736  -71.388  -74.535  1.00 39.79  ? 106 LEU C CA  1 
ATOM   2060 C C   . LEU C 2 106 ? 90.018  -72.261  -75.545  1.00 40.65  ? 106 LEU C C   1 
ATOM   2061 O O   . LEU C 2 106 ? 90.604  -73.217  -76.053  1.00 41.75  ? 106 LEU C O   1 
ATOM   2062 C CB  . LEU C 2 106 ? 90.397  -71.809  -73.092  1.00 41.85  ? 106 LEU C CB  1 
ATOM   2063 C CG  . LEU C 2 106 ? 91.203  -71.082  -71.990  1.00 39.51  ? 106 LEU C CG  1 
ATOM   2064 C CD1 . LEU C 2 106 ? 90.627  -71.348  -70.618  1.00 41.83  ? 106 LEU C CD1 1 
ATOM   2065 C CD2 . LEU C 2 106 ? 92.665  -71.451  -72.005  1.00 41.52  ? 106 LEU C CD2 1 
ATOM   2066 N N   . GLN C 2 107 ? 88.760  -71.947  -75.839  1.00 42.00  ? 107 GLN C N   1 
ATOM   2067 C CA  . GLN C 2 107 ? 88.039  -72.627  -76.918  1.00 43.75  ? 107 GLN C CA  1 
ATOM   2068 C C   . GLN C 2 107 ? 88.801  -72.548  -78.237  1.00 40.98  ? 107 GLN C C   1 
ATOM   2069 O O   . GLN C 2 107 ? 88.908  -73.540  -78.945  1.00 41.61  ? 107 GLN C O   1 
ATOM   2070 C CB  . GLN C 2 107 ? 86.636  -72.066  -77.107  1.00 49.69  ? 107 GLN C CB  1 
ATOM   2071 C CG  . GLN C 2 107 ? 85.647  -72.507  -76.042  1.00 59.75  ? 107 GLN C CG  1 
ATOM   2072 C CD  . GLN C 2 107 ? 84.316  -71.733  -76.054  1.00 64.48  ? 107 GLN C CD  1 
ATOM   2073 O OE1 . GLN C 2 107 ? 84.249  -70.567  -76.472  1.00 63.24  ? 107 GLN C OE1 1 
ATOM   2074 N NE2 . GLN C 2 107 ? 83.250  -72.389  -75.586  1.00 68.45  ? 107 GLN C NE2 1 
ATOM   2075 N N   . ILE C 2 108 ? 89.346  -71.373  -78.540  1.00 39.25  ? 108 ILE C N   1 
ATOM   2076 C CA  . ILE C 2 108 ? 90.134  -71.183  -79.749  1.00 39.10  ? 108 ILE C CA  1 
ATOM   2077 C C   . ILE C 2 108 ? 91.430  -72.027  -79.702  1.00 40.30  ? 108 ILE C C   1 
ATOM   2078 O O   . ILE C 2 108 ? 91.733  -72.788  -80.630  1.00 40.33  ? 108 ILE C O   1 
ATOM   2079 C CB  . ILE C 2 108 ? 90.384  -69.681  -79.996  1.00 38.48  ? 108 ILE C CB  1 
ATOM   2080 C CG1 . ILE C 2 108 ? 89.056  -68.967  -80.287  1.00 37.51  ? 108 ILE C CG1 1 
ATOM   2081 C CG2 . ILE C 2 108 ? 91.322  -69.451  -81.178  1.00 39.92  ? 108 ILE C CG2 1 
ATOM   2082 C CD1 . ILE C 2 108 ? 89.105  -67.469  -80.130  1.00 39.28  ? 108 ILE C CD1 1 
ATOM   2083 N N   . TYR C 2 109 ? 92.172  -71.913  -78.610  1.00 40.92  ? 109 TYR C N   1 
ATOM   2084 C CA  . TYR C 2 109 ? 93.392  -72.687  -78.420  1.00 40.28  ? 109 TYR C CA  1 
ATOM   2085 C C   . TYR C 2 109 ? 93.181  -74.181  -78.650  1.00 41.07  ? 109 TYR C C   1 
ATOM   2086 O O   . TYR C 2 109 ? 93.909  -74.802  -79.423  1.00 43.42  ? 109 TYR C O   1 
ATOM   2087 C CB  . TYR C 2 109 ? 93.988  -72.431  -77.018  1.00 39.88  ? 109 TYR C CB  1 
ATOM   2088 C CG  . TYR C 2 109 ? 95.220  -73.262  -76.716  1.00 37.62  ? 109 TYR C CG  1 
ATOM   2089 C CD1 . TYR C 2 109 ? 95.099  -74.546  -76.227  1.00 42.33  ? 109 TYR C CD1 1 
ATOM   2090 C CD2 . TYR C 2 109 ? 96.496  -72.765  -76.909  1.00 37.87  ? 109 TYR C CD2 1 
ATOM   2091 C CE1 . TYR C 2 109 ? 96.216  -75.324  -75.959  1.00 45.84  ? 109 TYR C CE1 1 
ATOM   2092 C CE2 . TYR C 2 109 ? 97.621  -73.532  -76.636  1.00 38.81  ? 109 TYR C CE2 1 
ATOM   2093 C CZ  . TYR C 2 109 ? 97.472  -74.812  -76.167  1.00 40.70  ? 109 TYR C CZ  1 
ATOM   2094 O OH  . TYR C 2 109 ? 98.557  -75.595  -75.882  1.00 43.40  ? 109 TYR C OH  1 
ATOM   2095 N N   . TRP C 2 110 ? 92.206  -74.765  -77.971  1.00 41.53  ? 110 TRP C N   1 
ATOM   2096 C CA  . TRP C 2 110 ? 91.985  -76.214  -78.089  1.00 42.63  ? 110 TRP C CA  1 
ATOM   2097 C C   . TRP C 2 110 ? 91.403  -76.659  -79.442  1.00 43.04  ? 110 TRP C C   1 
ATOM   2098 O O   . TRP C 2 110 ? 91.688  -77.761  -79.897  1.00 42.47  ? 110 TRP C O   1 
ATOM   2099 C CB  . TRP C 2 110 ? 91.141  -76.740  -76.934  1.00 40.65  ? 110 TRP C CB  1 
ATOM   2100 C CG  . TRP C 2 110 ? 91.869  -76.661  -75.623  1.00 42.81  ? 110 TRP C CG  1 
ATOM   2101 C CD1 . TRP C 2 110 ? 91.572  -75.852  -74.567  1.00 41.18  ? 110 TRP C CD1 1 
ATOM   2102 C CD2 . TRP C 2 110 ? 93.011  -77.407  -75.239  1.00 45.02  ? 110 TRP C CD2 1 
ATOM   2103 N NE1 . TRP C 2 110 ? 92.451  -76.049  -73.555  1.00 41.63  ? 110 TRP C NE1 1 
ATOM   2104 C CE2 . TRP C 2 110 ? 93.365  -76.985  -73.939  1.00 44.53  ? 110 TRP C CE2 1 
ATOM   2105 C CE3 . TRP C 2 110 ? 93.788  -78.386  -75.868  1.00 49.01  ? 110 TRP C CE3 1 
ATOM   2106 C CZ2 . TRP C 2 110 ? 94.454  -77.512  -73.245  1.00 43.50  ? 110 TRP C CZ2 1 
ATOM   2107 C CZ3 . TRP C 2 110 ? 94.884  -78.917  -75.175  1.00 49.07  ? 110 TRP C CZ3 1 
ATOM   2108 C CH2 . TRP C 2 110 ? 95.194  -78.479  -73.866  1.00 46.01  ? 110 TRP C CH2 1 
ATOM   2109 N N   . SER C 2 111 ? 90.628  -75.798  -80.095  1.00 44.42  ? 111 SER C N   1 
ATOM   2110 C CA  . SER C 2 111 ? 90.030  -76.111  -81.414  1.00 45.84  ? 111 SER C CA  1 
ATOM   2111 C C   . SER C 2 111 ? 91.065  -76.420  -82.501  1.00 46.53  ? 111 SER C C   1 
ATOM   2112 O O   . SER C 2 111 ? 90.782  -77.220  -83.396  1.00 46.21  ? 111 SER C O   1 
ATOM   2113 C CB  . SER C 2 111 ? 89.128  -74.969  -81.889  1.00 44.51  ? 111 SER C CB  1 
ATOM   2114 O OG  . SER C 2 111 ? 89.897  -73.822  -82.181  1.00 45.57  ? 111 SER C OG  1 
ATOM   2115 N N   . ILE C 2 112 ? 92.252  -75.811  -82.378  1.00 45.85  ? 112 ILE C N   1 
ATOM   2116 C CA  . ILE C 2 112 ? 93.372  -75.998  -83.307  1.00 49.94  ? 112 ILE C CA  1 
ATOM   2117 C C   . ILE C 2 112 ? 94.614  -76.697  -82.735  1.00 52.59  ? 112 ILE C C   1 
ATOM   2118 O O   . ILE C 2 112 ? 95.640  -76.775  -83.401  1.00 53.34  ? 112 ILE C O   1 
ATOM   2119 C CB  . ILE C 2 112 ? 93.791  -74.656  -83.959  1.00 51.16  ? 112 ILE C CB  1 
ATOM   2120 C CG1 . ILE C 2 112 ? 94.089  -73.593  -82.922  1.00 54.91  ? 112 ILE C CG1 1 
ATOM   2121 C CG2 . ILE C 2 112 ? 92.678  -74.192  -84.870  1.00 53.71  ? 112 ILE C CG2 1 
ATOM   2122 C CD1 . ILE C 2 112 ? 94.915  -72.440  -83.447  1.00 59.25  ? 112 ILE C CD1 1 
ATOM   2123 N N   . HIS C 2 113 ? 94.510  -77.226  -81.520  1.00 59.07  ? 113 HIS C N   1 
ATOM   2124 C CA  . HIS C 2 113 ? 95.642  -77.898  -80.854  1.00 60.13  ? 113 HIS C CA  1 
ATOM   2125 C C   . HIS C 2 113 ? 95.864  -79.305  -81.419  1.00 59.01  ? 113 HIS C C   1 
ATOM   2126 O O   . HIS C 2 113 ? 94.928  -80.109  -81.495  1.00 54.67  ? 113 HIS C O   1 
ATOM   2127 C CB  . HIS C 2 113 ? 95.395  -77.970  -79.341  1.00 62.96  ? 113 HIS C CB  1 
ATOM   2128 C CG  . HIS C 2 113 ? 96.141  -79.072  -78.650  1.00 65.47  ? 113 HIS C CG  1 
ATOM   2129 N ND1 . HIS C 2 113 ? 97.455  -78.947  -78.240  1.00 62.53  ? 113 HIS C ND1 1 
ATOM   2130 C CD2 . HIS C 2 113 ? 95.750  -80.324  -78.297  1.00 64.79  ? 113 HIS C CD2 1 
ATOM   2131 C CE1 . HIS C 2 113 ? 97.837  -80.074  -77.661  1.00 65.67  ? 113 HIS C CE1 1 
ATOM   2132 N NE2 . HIS C 2 113 ? 96.822  -80.924  -77.680  1.00 64.69  ? 113 HIS C NE2 1 
ATOM   2133 N N   . LEU C 2 114 ? 97.112  -79.582  -81.796  1.00 67.51  ? 114 LEU C N   1 
ATOM   2134 C CA  . LEU C 2 114 ? 97.527  -80.895  -82.324  1.00 75.42  ? 114 LEU C CA  1 
ATOM   2135 C C   . LEU C 2 114 ? 97.954  -81.867  -81.220  1.00 81.36  ? 114 LEU C C   1 
ATOM   2136 O O   . LEU C 2 114 ? 98.992  -81.650  -80.568  1.00 78.89  ? 114 LEU C O   1 
ATOM   2137 C CB  . LEU C 2 114 ? 98.689  -80.748  -83.315  1.00 77.82  ? 114 LEU C CB  1 
ATOM   2138 C CG  . LEU C 2 114 ? 98.283  -80.793  -84.792  1.00 85.90  ? 114 LEU C CG  1 
ATOM   2139 C CD1 . LEU C 2 114 ? 98.237  -79.382  -85.375  1.00 86.13  ? 114 LEU C CD1 1 
ATOM   2140 C CD2 . LEU C 2 114 ? 99.245  -81.688  -85.570  1.00 86.25  ? 114 LEU C CD2 1 
ATOM   2141 N N   . GLY C 2 115 ? 97.173  -82.939  -81.045  1.00 84.40  ? 115 GLY C N   1 
ATOM   2142 C CA  . GLY C 2 115 ? 97.454  -83.987  -80.048  1.00 91.08  ? 115 GLY C CA  1 
ATOM   2143 C C   . GLY C 2 115 ? 97.177  -85.390  -80.566  1.00 97.00  ? 115 GLY C C   1 
ATOM   2144 O O   . GLY C 2 115 ? 98.096  -86.115  -80.963  1.00 101.30 ? 115 GLY C O   1 
ATOM   2145 N N   . GLU C 2 121 ? 99.611  -86.604  -74.443  1.00 75.22  ? 121 GLU C N   1 
ATOM   2146 C CA  . GLU C 2 121 ? 98.297  -87.091  -74.024  1.00 73.15  ? 121 GLU C CA  1 
ATOM   2147 C C   . GLU C 2 121 ? 98.139  -87.298  -72.511  1.00 71.08  ? 121 GLU C C   1 
ATOM   2148 O O   . GLU C 2 121 ? 97.059  -87.037  -71.995  1.00 75.87  ? 121 GLU C O   1 
ATOM   2149 C CB  . GLU C 2 121 ? 97.929  -88.383  -74.754  1.00 81.62  ? 121 GLU C CB  1 
ATOM   2150 C CG  . GLU C 2 121 ? 96.444  -88.738  -74.672  1.00 89.42  ? 121 GLU C CG  1 
ATOM   2151 C CD  . GLU C 2 121 ? 96.007  -89.754  -75.730  1.00 97.21  ? 121 GLU C CD  1 
ATOM   2152 O OE1 . GLU C 2 121 ? 96.131  -90.966  -75.461  1.00 98.48  ? 121 GLU C OE1 1 
ATOM   2153 O OE2 . GLU C 2 121 ? 95.530  -89.355  -76.826  1.00 87.27  ? 121 GLU C OE2 1 
ATOM   2154 N N   . PHE C 2 122 ? 99.162  -87.797  -71.808  1.00 62.84  ? 122 PHE C N   1 
ATOM   2155 C CA  . PHE C 2 122 ? 99.102  -87.870  -70.334  1.00 55.16  ? 122 PHE C CA  1 
ATOM   2156 C C   . PHE C 2 122 ? 99.235  -86.460  -69.735  1.00 51.31  ? 122 PHE C C   1 
ATOM   2157 O O   . PHE C 2 122 ? 98.414  -86.049  -68.914  1.00 55.83  ? 122 PHE C O   1 
ATOM   2158 C CB  . PHE C 2 122 ? 100.170 -88.797  -69.735  1.00 53.15  ? 122 PHE C CB  1 
ATOM   2159 C CG  . PHE C 2 122 ? 99.969  -89.054  -68.264  1.00 53.56  ? 122 PHE C CG  1 
ATOM   2160 C CD1 . PHE C 2 122 ? 100.556 -88.220  -67.301  1.00 56.45  ? 122 PHE C CD1 1 
ATOM   2161 C CD2 . PHE C 2 122 ? 99.133  -90.073  -67.838  1.00 53.04  ? 122 PHE C CD2 1 
ATOM   2162 C CE1 . PHE C 2 122 ? 100.333 -88.428  -65.952  1.00 54.59  ? 122 PHE C CE1 1 
ATOM   2163 C CE2 . PHE C 2 122 ? 98.918  -90.289  -66.490  1.00 55.44  ? 122 PHE C CE2 1 
ATOM   2164 C CZ  . PHE C 2 122 ? 99.513  -89.466  -65.548  1.00 55.08  ? 122 PHE C CZ  1 
ATOM   2165 N N   . TYR C 2 123 ? 100.275 -85.749  -70.148  1.00 47.75  ? 123 TYR C N   1 
ATOM   2166 C CA  . TYR C 2 123 ? 100.449 -84.324  -69.853  1.00 50.80  ? 123 TYR C CA  1 
ATOM   2167 C C   . TYR C 2 123 ? 100.250 -83.482  -71.117  1.00 49.64  ? 123 TYR C C   1 
ATOM   2168 O O   . TYR C 2 123 ? 101.056 -83.564  -72.020  1.00 54.88  ? 123 TYR C O   1 
ATOM   2169 C CB  . TYR C 2 123 ? 101.849 -84.040  -69.284  1.00 48.47  ? 123 TYR C CB  1 
ATOM   2170 C CG  . TYR C 2 123 ? 102.175 -84.781  -67.995  1.00 55.67  ? 123 TYR C CG  1 
ATOM   2171 C CD1 . TYR C 2 123 ? 101.441 -84.551  -66.834  1.00 51.90  ? 123 TYR C CD1 1 
ATOM   2172 C CD2 . TYR C 2 123 ? 103.230 -85.718  -67.931  1.00 57.43  ? 123 TYR C CD2 1 
ATOM   2173 C CE1 . TYR C 2 123 ? 101.725 -85.224  -65.655  1.00 52.10  ? 123 TYR C CE1 1 
ATOM   2174 C CE2 . TYR C 2 123 ? 103.521 -86.391  -66.747  1.00 57.33  ? 123 TYR C CE2 1 
ATOM   2175 C CZ  . TYR C 2 123 ? 102.761 -86.137  -65.607  1.00 55.23  ? 123 TYR C CZ  1 
ATOM   2176 O OH  . TYR C 2 123 ? 103.030 -86.783  -64.415  1.00 51.24  ? 123 TYR C OH  1 
ATOM   2177 N N   . GLU C 2 124 ? 99.192  -82.671  -71.178  1.00 49.29  ? 124 GLU C N   1 
ATOM   2178 C CA  . GLU C 2 124 ? 98.976  -81.747  -72.311  1.00 47.29  ? 124 GLU C CA  1 
ATOM   2179 C C   . GLU C 2 124 ? 99.656  -80.438  -71.987  1.00 46.18  ? 124 GLU C C   1 
ATOM   2180 O O   . GLU C 2 124 ? 99.730  -80.058  -70.830  1.00 49.45  ? 124 GLU C O   1 
ATOM   2181 C CB  . GLU C 2 124 ? 97.490  -81.490  -72.564  1.00 50.36  ? 124 GLU C CB  1 
ATOM   2182 C CG  . GLU C 2 124 ? 96.677  -82.750  -72.787  1.00 49.91  ? 124 GLU C CG  1 
ATOM   2183 C CD  . GLU C 2 124 ? 95.227  -82.467  -73.061  1.00 51.30  ? 124 GLU C CD  1 
ATOM   2184 O OE1 . GLU C 2 124 ? 94.583  -81.712  -72.306  1.00 48.00  ? 124 GLU C OE1 1 
ATOM   2185 O OE2 . GLU C 2 124 ? 94.714  -83.023  -74.045  1.00 58.29  ? 124 GLU C OE2 1 
ATOM   2186 N N   . ALA C 2 125 ? 100.176 -79.757  -73.002  1.00 44.20  ? 125 ALA C N   1 
ATOM   2187 C CA  . ALA C 2 125 ? 100.842 -78.479  -72.795  1.00 42.99  ? 125 ALA C CA  1 
ATOM   2188 C C   . ALA C 2 125 ? 99.809  -77.456  -72.336  1.00 42.28  ? 125 ALA C C   1 
ATOM   2189 O O   . ALA C 2 125 ? 98.632  -77.546  -72.692  1.00 46.97  ? 125 ALA C O   1 
ATOM   2190 C CB  . ALA C 2 125 ? 101.525 -78.015  -74.069  1.00 42.56  ? 125 ALA C CB  1 
ATOM   2191 N N   . SER C 2 126 ? 100.239 -76.503  -71.532  1.00 40.10  ? 126 SER C N   1 
ATOM   2192 C CA  . SER C 2 126 ? 99.307  -75.519  -70.982  1.00 41.36  ? 126 SER C CA  1 
ATOM   2193 C C   . SER C 2 126 ? 99.038  -74.405  -71.965  1.00 39.11  ? 126 SER C C   1 
ATOM   2194 O O   . SER C 2 126 ? 99.969  -73.845  -72.477  1.00 37.45  ? 126 SER C O   1 
ATOM   2195 C CB  . SER C 2 126 ? 99.873  -74.894  -69.719  1.00 40.41  ? 126 SER C CB  1 
ATOM   2196 O OG  . SER C 2 126 ? 99.036  -73.850  -69.272  1.00 39.31  ? 126 SER C OG  1 
ATOM   2197 N N   . PRO C 2 127 ? 97.761  -74.016  -72.154  1.00 43.68  ? 127 PRO C N   1 
ATOM   2198 C CA  . PRO C 2 127 ? 97.463  -72.818  -72.957  1.00 43.85  ? 127 PRO C CA  1 
ATOM   2199 C C   . PRO C 2 127 ? 97.934  -71.512  -72.344  1.00 45.93  ? 127 PRO C C   1 
ATOM   2200 O O   . PRO C 2 127 ? 97.869  -70.491  -73.018  1.00 46.80  ? 127 PRO C O   1 
ATOM   2201 C CB  . PRO C 2 127 ? 95.951  -72.780  -73.019  1.00 41.97  ? 127 PRO C CB  1 
ATOM   2202 C CG  . PRO C 2 127 ? 95.461  -73.991  -72.329  1.00 46.55  ? 127 PRO C CG  1 
ATOM   2203 C CD  . PRO C 2 127 ? 96.558  -74.567  -71.525  1.00 42.76  ? 127 PRO C CD  1 
ATOM   2204 N N   . TYR C 2 128 ? 98.319  -71.532  -71.064  1.00 44.06  ? 128 TYR C N   1 
ATOM   2205 C CA  . TYR C 2 128 ? 98.737  -70.319  -70.354  1.00 46.13  ? 128 TYR C CA  1 
ATOM   2206 C C   . TYR C 2 128 ? 100.242 -70.079  -70.426  1.00 48.22  ? 128 TYR C C   1 
ATOM   2207 O O   . TYR C 2 128 ? 100.703 -68.993  -70.122  1.00 49.52  ? 128 TYR C O   1 
ATOM   2208 C CB  . TYR C 2 128 ? 98.299  -70.361  -68.884  1.00 42.21  ? 128 TYR C CB  1 
ATOM   2209 C CG  . TYR C 2 128 ? 96.828  -70.515  -68.656  1.00 39.00  ? 128 TYR C CG  1 
ATOM   2210 C CD1 . TYR C 2 128 ? 95.960  -69.442  -68.827  1.00 38.95  ? 128 TYR C CD1 1 
ATOM   2211 C CD2 . TYR C 2 128 ? 96.289  -71.738  -68.243  1.00 37.39  ? 128 TYR C CD2 1 
ATOM   2212 C CE1 . TYR C 2 128 ? 94.588  -69.594  -68.620  1.00 36.93  ? 128 TYR C CE1 1 
ATOM   2213 C CE2 . TYR C 2 128 ? 94.929  -71.895  -68.030  1.00 34.16  ? 128 TYR C CE2 1 
ATOM   2214 C CZ  . TYR C 2 128 ? 94.086  -70.821  -68.210  1.00 35.29  ? 128 TYR C CZ  1 
ATOM   2215 O OH  . TYR C 2 128 ? 92.746  -70.950  -67.944  1.00 35.23  ? 128 TYR C OH  1 
ATOM   2216 N N   . GLU C 2 129 ? 100.982 -71.096  -70.844  1.00 57.43  ? 129 GLU C N   1 
ATOM   2217 C CA  . GLU C 2 129 ? 102.444 -71.047  -70.976  1.00 74.99  ? 129 GLU C CA  1 
ATOM   2218 C C   . GLU C 2 129 ? 102.888 -70.125  -72.107  1.00 77.20  ? 129 GLU C C   1 
ATOM   2219 O O   . GLU C 2 129 ? 102.550 -70.400  -73.256  1.00 74.92  ? 129 GLU C O   1 
ATOM   2220 C CB  . GLU C 2 129 ? 103.001 -72.455  -71.286  1.00 78.66  ? 129 GLU C CB  1 
ATOM   2221 C CG  . GLU C 2 129 ? 104.456 -72.668  -70.870  1.00 84.48  ? 129 GLU C CG  1 
ATOM   2222 C CD  . GLU C 2 129 ? 104.571 -73.459  -69.563  1.00 97.13  ? 129 GLU C CD  1 
ATOM   2223 O OE1 . GLU C 2 129 ? 105.320 -74.461  -69.546  1.00 92.09  ? 129 GLU C OE1 1 
ATOM   2224 O OE2 . GLU C 2 129 ? 103.892 -73.102  -68.562  1.00 97.93  ? 129 GLU C OE2 1 
ATOM   2225 N N   . PRO C 2 130 ? 103.671 -69.061  -71.802  1.00 83.68  ? 130 PRO C N   1 
ATOM   2226 C CA  . PRO C 2 130 ? 104.248 -68.278  -72.916  1.00 88.22  ? 130 PRO C CA  1 
ATOM   2227 C C   . PRO C 2 130 ? 105.297 -69.084  -73.702  1.00 92.92  ? 130 PRO C C   1 
ATOM   2228 O O   . PRO C 2 130 ? 105.837 -70.075  -73.188  1.00 87.82  ? 130 PRO C O   1 
ATOM   2229 C CB  . PRO C 2 130 ? 104.871 -67.046  -72.230  1.00 84.71  ? 130 PRO C CB  1 
ATOM   2230 C CG  . PRO C 2 130 ? 104.476 -67.122  -70.782  1.00 86.77  ? 130 PRO C CG  1 
ATOM   2231 C CD  . PRO C 2 130 ? 104.070 -68.532  -70.482  1.00 83.60  ? 130 PRO C CD  1 
ATOM   2232 N N   . VAL C 2 131 ? 105.552 -68.666  -74.943  1.00 101.02 ? 131 VAL C N   1 
ATOM   2233 C CA  . VAL C 2 131 ? 106.482 -69.368  -75.851  1.00 101.55 ? 131 VAL C CA  1 
ATOM   2234 C C   . VAL C 2 131 ? 107.946 -69.282  -75.386  1.00 92.57  ? 131 VAL C C   1 
ATOM   2235 O O   . VAL C 2 131 ? 108.443 -68.206  -75.058  1.00 85.38  ? 131 VAL C O   1 
ATOM   2236 C CB  . VAL C 2 131 ? 106.332 -68.844  -77.304  1.00 102.31 ? 131 VAL C CB  1 
ATOM   2237 C CG1 . VAL C 2 131 ? 107.436 -69.385  -78.214  1.00 107.79 ? 131 VAL C CG1 1 
ATOM   2238 C CG2 . VAL C 2 131 ? 104.960 -69.217  -77.856  1.00 96.49  ? 131 VAL C CG2 1 
ATOM   2239 N N   . SER C 2 158 ? 99.145  -70.689  -31.133  1.00 82.28  ? 158 SER C N   1 
ATOM   2240 C CA  . SER C 2 158 ? 98.991  -69.957  -32.396  1.00 87.93  ? 158 SER C CA  1 
ATOM   2241 C C   . SER C 2 158 ? 98.250  -70.811  -33.425  1.00 81.98  ? 158 SER C C   1 
ATOM   2242 O O   . SER C 2 158 ? 98.689  -71.928  -33.713  1.00 78.43  ? 158 SER C O   1 
ATOM   2243 C CB  . SER C 2 158 ? 100.361 -69.558  -32.959  1.00 90.20  ? 158 SER C CB  1 
ATOM   2244 O OG  . SER C 2 158 ? 100.227 -68.615  -34.009  1.00 90.25  ? 158 SER C OG  1 
ATOM   2245 N N   . ASN C 2 159 ? 97.128  -70.295  -33.944  1.00 71.74  ? 159 ASN C N   1 
ATOM   2246 C CA  . ASN C 2 159 ? 96.367  -70.953  -35.006  1.00 56.00  ? 159 ASN C CA  1 
ATOM   2247 C C   . ASN C 2 159 ? 96.471  -70.096  -36.259  1.00 50.66  ? 159 ASN C C   1 
ATOM   2248 O O   . ASN C 2 159 ? 95.861  -69.033  -36.350  1.00 42.49  ? 159 ASN C O   1 
ATOM   2249 C CB  . ASN C 2 159 ? 94.929  -71.146  -34.584  1.00 54.70  ? 159 ASN C CB  1 
ATOM   2250 C CG  . ASN C 2 159 ? 94.126  -72.022  -35.570  1.00 50.78  ? 159 ASN C CG  1 
ATOM   2251 O OD1 . ASN C 2 159 ? 94.241  -71.911  -36.788  1.00 49.63  ? 159 ASN C OD1 1 
ATOM   2252 N ND2 . ASN C 2 159 ? 93.262  -72.835  -35.034  1.00 47.09  ? 159 ASN C ND2 1 
ATOM   2253 N N   . HIS C 2 160 ? 97.276  -70.562  -37.215  1.00 44.50  ? 160 HIS C N   1 
ATOM   2254 C CA  . HIS C 2 160 ? 97.563  -69.773  -38.397  1.00 44.34  ? 160 HIS C CA  1 
ATOM   2255 C C   . HIS C 2 160 ? 96.378  -69.638  -39.351  1.00 39.42  ? 160 HIS C C   1 
ATOM   2256 O O   . HIS C 2 160 ? 96.289  -68.656  -40.087  1.00 35.06  ? 160 HIS C O   1 
ATOM   2257 C CB  . HIS C 2 160 ? 98.765  -70.332  -39.141  1.00 48.09  ? 160 HIS C CB  1 
ATOM   2258 C CG  . HIS C 2 160 ? 100.061 -70.142  -38.426  1.00 51.39  ? 160 HIS C CG  1 
ATOM   2259 N ND1 . HIS C 2 160 ? 101.213 -70.807  -38.791  1.00 50.88  ? 160 HIS C ND1 1 
ATOM   2260 C CD2 . HIS C 2 160 ? 100.392 -69.364  -37.369  1.00 53.80  ? 160 HIS C CD2 1 
ATOM   2261 C CE1 . HIS C 2 160 ? 102.201 -70.434  -37.999  1.00 51.74  ? 160 HIS C CE1 1 
ATOM   2262 N NE2 . HIS C 2 160 ? 101.727 -69.569  -37.120  1.00 54.20  ? 160 HIS C NE2 1 
ATOM   2263 N N   . CYS C 2 161 ? 95.481  -70.619  -39.332  1.00 36.59  ? 161 CYS C N   1 
ATOM   2264 C CA  . CYS C 2 161 ? 94.316  -70.580  -40.173  1.00 38.55  ? 161 CYS C CA  1 
ATOM   2265 C C   . CYS C 2 161 ? 93.286  -69.596  -39.642  1.00 37.33  ? 161 CYS C C   1 
ATOM   2266 O O   . CYS C 2 161 ? 92.629  -68.911  -40.417  1.00 35.47  ? 161 CYS C O   1 
ATOM   2267 C CB  . CYS C 2 161 ? 93.743  -71.979  -40.369  1.00 42.88  ? 161 CYS C CB  1 
ATOM   2268 S SG  . CYS C 2 161 ? 94.967  -73.158  -41.047  1.00 52.17  ? 161 CYS C SG  1 
ATOM   2269 N N   . LEU C 2 162 ? 93.179  -69.514  -38.320  1.00 38.46  ? 162 LEU C N   1 
ATOM   2270 C CA  . LEU C 2 162 ? 92.394  -68.481  -37.664  1.00 38.02  ? 162 LEU C CA  1 
ATOM   2271 C C   . LEU C 2 162 ? 92.932  -67.066  -37.923  1.00 36.48  ? 162 LEU C C   1 
ATOM   2272 O O   . LEU C 2 162 ? 92.173  -66.154  -38.243  1.00 37.10  ? 162 LEU C O   1 
ATOM   2273 C CB  . LEU C 2 162 ? 92.297  -68.757  -36.166  1.00 37.98  ? 162 LEU C CB  1 
ATOM   2274 C CG  . LEU C 2 162 ? 91.172  -68.040  -35.428  1.00 40.48  ? 162 LEU C CG  1 
ATOM   2275 C CD1 . LEU C 2 162 ? 89.810  -68.478  -35.962  1.00 41.29  ? 162 LEU C CD1 1 
ATOM   2276 C CD2 . LEU C 2 162 ? 91.285  -68.373  -33.945  1.00 42.09  ? 162 LEU C CD2 1 
ATOM   2277 N N   . ASP C 2 163 ? 94.240  -66.900  -37.830  1.00 37.60  ? 163 ASP C N   1 
ATOM   2278 C CA  . ASP C 2 163 ? 94.887  -65.635  -38.194  1.00 38.99  ? 163 ASP C CA  1 
ATOM   2279 C C   . ASP C 2 163 ? 94.575  -65.239  -39.617  1.00 35.80  ? 163 ASP C C   1 
ATOM   2280 O O   . ASP C 2 163 ? 94.396  -64.059  -39.902  1.00 36.67  ? 163 ASP C O   1 
ATOM   2281 C CB  . ASP C 2 163 ? 96.416  -65.739  -38.080  1.00 44.36  ? 163 ASP C CB  1 
ATOM   2282 C CG  . ASP C 2 163 ? 96.904  -65.986  -36.642  1.00 54.27  ? 163 ASP C CG  1 
ATOM   2283 O OD1 . ASP C 2 163 ? 96.115  -65.762  -35.680  1.00 49.92  ? 163 ASP C OD1 1 
ATOM   2284 O OD2 . ASP C 2 163 ? 98.096  -66.397  -36.482  1.00 60.15  ? 163 ASP C OD2 1 
ATOM   2285 N N   . ALA C 2 164 ? 94.551  -66.224  -40.514  1.00 32.97  ? 164 ALA C N   1 
ATOM   2286 C CA  . ALA C 2 164 ? 94.339  -65.962  -41.932  1.00 34.48  ? 164 ALA C CA  1 
ATOM   2287 C C   . ALA C 2 164 ? 92.903  -65.500  -42.193  1.00 34.43  ? 164 ALA C C   1 
ATOM   2288 O O   . ALA C 2 164 ? 92.658  -64.570  -42.987  1.00 32.94  ? 164 ALA C O   1 
ATOM   2289 C CB  . ALA C 2 164 ? 94.667  -67.197  -42.750  1.00 34.89  ? 164 ALA C CB  1 
ATOM   2290 N N   . ALA C 2 165 ? 91.959  -66.141  -41.502  1.00 34.18  ? 165 ALA C N   1 
ATOM   2291 C CA  . ALA C 2 165 ? 90.541  -65.750  -41.583  1.00 33.09  ? 165 ALA C CA  1 
ATOM   2292 C C   . ALA C 2 165 ? 90.307  -64.353  -41.022  1.00 33.89  ? 165 ALA C C   1 
ATOM   2293 O O   . ALA C 2 165 ? 89.469  -63.617  -41.539  1.00 34.67  ? 165 ALA C O   1 
ATOM   2294 C CB  . ALA C 2 165 ? 89.675  -66.742  -40.848  1.00 31.45  ? 165 ALA C CB  1 
ATOM   2295 N N   . LYS C 2 166 ? 91.032  -63.993  -39.967  1.00 33.62  ? 166 LYS C N   1 
ATOM   2296 C CA  . LYS C 2 166 ? 90.936  -62.636  -39.399  1.00 36.94  ? 166 LYS C CA  1 
ATOM   2297 C C   . LYS C 2 166 ? 91.458  -61.569  -40.372  1.00 35.84  ? 166 LYS C C   1 
ATOM   2298 O O   . LYS C 2 166 ? 90.778  -60.612  -40.650  1.00 38.12  ? 166 LYS C O   1 
ATOM   2299 C CB  . LYS C 2 166 ? 91.680  -62.578  -38.077  1.00 39.27  ? 166 LYS C CB  1 
ATOM   2300 C CG  . LYS C 2 166 ? 91.916  -61.193  -37.539  1.00 42.52  ? 166 LYS C CG  1 
ATOM   2301 C CD  . LYS C 2 166 ? 92.583  -61.273  -36.181  1.00 44.47  ? 166 LYS C CD  1 
ATOM   2302 C CE  . LYS C 2 166 ? 92.908  -59.887  -35.664  1.00 48.72  ? 166 LYS C CE  1 
ATOM   2303 N NZ  . LYS C 2 166 ? 93.643  -59.968  -34.369  1.00 56.76  ? 166 LYS C NZ  1 
ATOM   2304 N N   . ALA C 2 167 ? 92.629  -61.780  -40.947  1.00 34.96  ? 167 ALA C N   1 
ATOM   2305 C CA  . ALA C 2 167 ? 93.157  -60.859  -41.945  1.00 36.01  ? 167 ALA C CA  1 
ATOM   2306 C C   . ALA C 2 167 ? 92.196  -60.671  -43.117  1.00 38.50  ? 167 ALA C C   1 
ATOM   2307 O O   . ALA C 2 167 ? 92.025  -59.562  -43.635  1.00 40.32  ? 167 ALA C O   1 
ATOM   2308 C CB  . ALA C 2 167 ? 94.529  -61.313  -42.440  1.00 33.92  ? 167 ALA C CB  1 
ATOM   2309 N N   . CYS C 2 168 ? 91.538  -61.750  -43.506  1.00 36.95  ? 168 CYS C N   1 
ATOM   2310 C CA  . CYS C 2 168 ? 90.570  -61.695  -44.594  1.00 36.50  ? 168 CYS C CA  1 
ATOM   2311 C C   . CYS C 2 168 ? 89.328  -60.890  -44.224  1.00 36.64  ? 168 CYS C C   1 
ATOM   2312 O O   . CYS C 2 168 ? 88.923  -60.001  -44.963  1.00 35.25  ? 168 CYS C O   1 
ATOM   2313 C CB  . CYS C 2 168 ? 90.164  -63.100  -45.003  1.00 36.91  ? 168 CYS C CB  1 
ATOM   2314 S SG  . CYS C 2 168 ? 88.961  -63.112  -46.327  1.00 47.54  ? 168 CYS C SG  1 
ATOM   2315 N N   . ASN C 2 169 ? 88.730  -61.199  -43.076  1.00 35.73  ? 169 ASN C N   1 
ATOM   2316 C CA  . ASN C 2 169 ? 87.556  -60.462  -42.591  1.00 34.52  ? 169 ASN C CA  1 
ATOM   2317 C C   . ASN C 2 169 ? 87.824  -58.994  -42.253  1.00 35.48  ? 169 ASN C C   1 
ATOM   2318 O O   . ASN C 2 169 ? 86.871  -58.208  -42.194  1.00 37.63  ? 169 ASN C O   1 
ATOM   2319 C CB  . ASN C 2 169 ? 86.885  -61.155  -41.377  1.00 33.91  ? 169 ASN C CB  1 
ATOM   2320 C CG  . ASN C 2 169 ? 85.863  -62.226  -41.775  1.00 33.93  ? 169 ASN C CG  1 
ATOM   2321 O OD1 . ASN C 2 169 ? 85.658  -62.549  -42.948  1.00 36.25  ? 169 ASN C OD1 1 
ATOM   2322 N ND2 . ASN C 2 169 ? 85.220  -62.790  -40.775  1.00 35.85  ? 169 ASN C ND2 1 
ATOM   2323 N N   . LEU C 2 170 ? 89.077  -58.628  -41.998  1.00 36.30  ? 170 LEU C N   1 
ATOM   2324 C CA  . LEU C 2 170 ? 89.427  -57.225  -41.730  1.00 41.25  ? 170 LEU C CA  1 
ATOM   2325 C C   . LEU C 2 170 ? 89.784  -56.429  -42.987  1.00 39.72  ? 170 LEU C C   1 
ATOM   2326 O O   . LEU C 2 170 ? 90.079  -55.251  -42.909  1.00 43.85  ? 170 LEU C O   1 
ATOM   2327 C CB  . LEU C 2 170 ? 90.557  -57.136  -40.705  1.00 43.40  ? 170 LEU C CB  1 
ATOM   2328 C CG  . LEU C 2 170 ? 90.299  -57.678  -39.295  1.00 44.59  ? 170 LEU C CG  1 
ATOM   2329 C CD1 . LEU C 2 170 ? 91.473  -57.355  -38.379  1.00 42.98  ? 170 LEU C CD1 1 
ATOM   2330 C CD2 . LEU C 2 170 ? 89.018  -57.147  -38.703  1.00 47.81  ? 170 LEU C CD2 1 
ATOM   2331 N N   . ASN C 2 171 ? 89.747  -57.092  -44.134  1.00 40.57  ? 171 ASN C N   1 
ATOM   2332 C CA  . ASN C 2 171 ? 89.902  -56.483  -45.438  1.00 37.96  ? 171 ASN C CA  1 
ATOM   2333 C C   . ASN C 2 171 ? 88.580  -56.528  -46.190  1.00 41.83  ? 171 ASN C C   1 
ATOM   2334 O O   . ASN C 2 171 ? 88.014  -57.610  -46.414  1.00 45.12  ? 171 ASN C O   1 
ATOM   2335 C CB  . ASN C 2 171 ? 90.930  -57.276  -46.209  1.00 39.17  ? 171 ASN C CB  1 
ATOM   2336 C CG  . ASN C 2 171 ? 91.279  -56.632  -47.528  1.00 40.94  ? 171 ASN C CG  1 
ATOM   2337 O OD1 . ASN C 2 171 ? 92.166  -55.770  -47.592  1.00 44.56  ? 171 ASN C OD1 1 
ATOM   2338 N ND2 . ASN C 2 171 ? 90.612  -57.049  -48.578  1.00 35.83  ? 171 ASN C ND2 1 
ATOM   2339 N N   . ASP C 2 172 ? 88.096  -55.365  -46.612  1.00 43.61  ? 172 ASP C N   1 
ATOM   2340 C CA  . ASP C 2 172 ? 86.755  -55.266  -47.168  1.00 47.78  ? 172 ASP C CA  1 
ATOM   2341 C C   . ASP C 2 172 ? 86.562  -56.168  -48.369  1.00 43.82  ? 172 ASP C C   1 
ATOM   2342 O O   . ASP C 2 172 ? 85.548  -56.845  -48.451  1.00 45.57  ? 172 ASP C O   1 
ATOM   2343 C CB  . ASP C 2 172 ? 86.376  -53.810  -47.524  1.00 55.85  ? 172 ASP C CB  1 
ATOM   2344 C CG  . ASP C 2 172 ? 85.831  -53.017  -46.310  1.00 74.59  ? 172 ASP C CG  1 
ATOM   2345 O OD1 . ASP C 2 172 ? 85.073  -53.572  -45.466  1.00 80.35  ? 172 ASP C OD1 1 
ATOM   2346 O OD2 . ASP C 2 172 ? 86.157  -51.810  -46.209  1.00 90.86  ? 172 ASP C OD2 1 
ATOM   2347 N N   . ASN C 2 173 ? 87.499  -56.152  -49.311  1.00 38.76  ? 173 ASN C N   1 
ATOM   2348 C CA  . ASN C 2 173 ? 87.347  -56.942  -50.520  1.00 40.62  ? 173 ASN C CA  1 
ATOM   2349 C C   . ASN C 2 173 ? 87.344  -58.491  -50.205  1.00 37.88  ? 173 ASN C C   1 
ATOM   2350 O O   . ASN C 2 173 ? 86.486  -59.216  -50.645  1.00 38.56  ? 173 ASN C O   1 
ATOM   2351 C CB  . ASN C 2 173 ? 88.431  -56.558  -51.531  1.00 40.50  ? 173 ASN C CB  1 
ATOM   2352 C CG  . ASN C 2 173 ? 88.326  -57.351  -52.819  1.00 41.72  ? 173 ASN C CG  1 
ATOM   2353 O OD1 . ASN C 2 173 ? 87.284  -57.359  -53.441  1.00 43.13  ? 173 ASN C OD1 1 
ATOM   2354 N ND2 . ASN C 2 173 ? 89.390  -58.061  -53.194  1.00 42.38  ? 173 ASN C ND2 1 
ATOM   2355 N N   . CYS C 2 174 ? 88.265  -58.941  -49.378  1.00 36.42  ? 174 CYS C N   1 
ATOM   2356 C CA  . CYS C 2 174 ? 88.382  -60.352  -48.999  1.00 38.74  ? 174 CYS C CA  1 
ATOM   2357 C C   . CYS C 2 174 ? 87.127  -60.781  -48.245  1.00 36.28  ? 174 CYS C C   1 
ATOM   2358 O O   . CYS C 2 174 ? 86.557  -61.805  -48.565  1.00 32.61  ? 174 CYS C O   1 
ATOM   2359 C CB  . CYS C 2 174 ? 89.632  -60.639  -48.141  1.00 37.57  ? 174 CYS C CB  1 
ATOM   2360 S SG  . CYS C 2 174 ? 90.021  -62.419  -47.984  1.00 42.54  ? 174 CYS C SG  1 
ATOM   2361 N N   . LYS C 2 175 ? 86.691  -59.955  -47.292  1.00 34.28  ? 175 LYS C N   1 
ATOM   2362 C CA  . LYS C 2 175 ? 85.511  -60.238  -46.490  1.00 34.94  ? 175 LYS C CA  1 
ATOM   2363 C C   . LYS C 2 175 ? 84.273  -60.407  -47.321  1.00 35.18  ? 175 LYS C C   1 
ATOM   2364 O O   . LYS C 2 175 ? 83.494  -61.325  -47.072  1.00 36.05  ? 175 LYS C O   1 
ATOM   2365 C CB  . LYS C 2 175 ? 85.280  -59.123  -45.461  1.00 37.39  ? 175 LYS C CB  1 
ATOM   2366 C CG  . LYS C 2 175 ? 84.073  -59.325  -44.552  1.00 39.42  ? 175 LYS C CG  1 
ATOM   2367 C CD  . LYS C 2 175 ? 83.372  -58.013  -44.252  1.00 44.01  ? 175 LYS C CD  1 
ATOM   2368 C CE  . LYS C 2 175 ? 82.504  -57.550  -45.399  1.00 43.10  ? 175 LYS C CE  1 
ATOM   2369 N NZ  . LYS C 2 175 ? 82.144  -56.142  -45.137  1.00 52.36  ? 175 LYS C NZ  1 
ATOM   2370 N N   . LYS C 2 176 ? 84.070  -59.509  -48.275  1.00 35.30  ? 176 LYS C N   1 
ATOM   2371 C CA  . LYS C 2 176 ? 82.932  -59.593  -49.194  1.00 38.73  ? 176 LYS C CA  1 
ATOM   2372 C C   . LYS C 2 176 ? 82.949  -60.883  -50.025  1.00 35.21  ? 176 LYS C C   1 
ATOM   2373 O O   . LYS C 2 176 ? 81.973  -61.597  -50.062  1.00 36.13  ? 176 LYS C O   1 
ATOM   2374 C CB  . LYS C 2 176 ? 82.918  -58.407  -50.180  1.00 46.21  ? 176 LYS C CB  1 
ATOM   2375 C CG  . LYS C 2 176 ? 82.380  -57.101  -49.596  1.00 58.20  ? 176 LYS C CG  1 
ATOM   2376 C CD  . LYS C 2 176 ? 82.584  -55.877  -50.501  1.00 65.38  ? 176 LYS C CD  1 
ATOM   2377 C CE  . LYS C 2 176 ? 82.078  -54.582  -49.854  1.00 74.82  ? 176 LYS C CE  1 
ATOM   2378 N NZ  . LYS C 2 176 ? 82.819  -54.193  -48.611  1.00 82.26  ? 176 LYS C NZ  1 
ATOM   2379 N N   . LEU C 2 177 ? 84.051  -61.135  -50.719  1.00 33.16  ? 177 LEU C N   1 
ATOM   2380 C CA  . LEU C 2 177 ? 84.144  -62.244  -51.657  1.00 36.07  ? 177 LEU C CA  1 
ATOM   2381 C C   . LEU C 2 177 ? 84.219  -63.608  -50.915  1.00 36.80  ? 177 LEU C C   1 
ATOM   2382 O O   . LEU C 2 177 ? 83.718  -64.608  -51.427  1.00 35.15  ? 177 LEU C O   1 
ATOM   2383 C CB  . LEU C 2 177 ? 85.313  -62.036  -52.619  1.00 40.34  ? 177 LEU C CB  1 
ATOM   2384 C CG  . LEU C 2 177 ? 85.030  -61.159  -53.858  1.00 45.61  ? 177 LEU C CG  1 
ATOM   2385 C CD1 . LEU C 2 177 ? 84.534  -59.774  -53.503  1.00 50.77  ? 177 LEU C CD1 1 
ATOM   2386 C CD2 . LEU C 2 177 ? 86.315  -60.989  -54.644  1.00 48.81  ? 177 LEU C CD2 1 
ATOM   2387 N N   . ARG C 2 178 ? 84.781  -63.608  -49.698  1.00 33.12  ? 178 ARG C N   1 
ATOM   2388 C CA  . ARG C 2 178 ? 84.739  -64.759  -48.828  1.00 32.95  ? 178 ARG C CA  1 
ATOM   2389 C C   . ARG C 2 178 ? 83.307  -65.077  -48.418  1.00 34.55  ? 178 ARG C C   1 
ATOM   2390 O O   . ARG C 2 178 ? 82.824  -66.212  -48.587  1.00 33.36  ? 178 ARG C O   1 
ATOM   2391 C CB  . ARG C 2 178 ? 85.580  -64.528  -47.575  1.00 31.05  ? 178 ARG C CB  1 
ATOM   2392 C CG  . ARG C 2 178 ? 85.849  -65.799  -46.798  1.00 31.05  ? 178 ARG C CG  1 
ATOM   2393 C CD  . ARG C 2 178 ? 86.050  -65.517  -45.335  1.00 31.44  ? 178 ARG C CD  1 
ATOM   2394 N NE  . ARG C 2 178 ? 86.208  -66.746  -44.567  1.00 31.69  ? 178 ARG C NE  1 
ATOM   2395 C CZ  . ARG C 2 178 ? 86.205  -66.809  -43.243  1.00 32.32  ? 178 ARG C CZ  1 
ATOM   2396 N NH1 . ARG C 2 178 ? 86.052  -65.715  -42.498  1.00 32.89  ? 178 ARG C NH1 1 
ATOM   2397 N NH2 . ARG C 2 178 ? 86.371  -67.979  -42.650  1.00 36.97  ? 178 ARG C NH2 1 
ATOM   2398 N N   . SER C 2 179 ? 82.630  -64.076  -47.875  1.00 32.96  ? 179 SER C N   1 
ATOM   2399 C CA  . SER C 2 179 ? 81.260  -64.274  -47.443  1.00 35.67  ? 179 SER C CA  1 
ATOM   2400 C C   . SER C 2 179 ? 80.358  -64.669  -48.596  1.00 34.25  ? 179 SER C C   1 
ATOM   2401 O O   . SER C 2 179 ? 79.427  -65.434  -48.429  1.00 38.09  ? 179 SER C O   1 
ATOM   2402 C CB  . SER C 2 179 ? 80.698  -63.011  -46.780  1.00 36.46  ? 179 SER C CB  1 
ATOM   2403 O OG  . SER C 2 179 ? 79.488  -63.316  -46.151  1.00 36.03  ? 179 SER C OG  1 
ATOM   2404 N N   . SER C 2 180 ? 80.624  -64.127  -49.768  1.00 33.66  ? 180 SER C N   1 
ATOM   2405 C CA  . SER C 2 180 ? 79.816  -64.449  -50.917  1.00 34.30  ? 180 SER C CA  1 
ATOM   2406 C C   . SER C 2 180 ? 79.890  -65.955  -51.282  1.00 33.21  ? 180 SER C C   1 
ATOM   2407 O O   . SER C 2 180 ? 78.862  -66.569  -51.515  1.00 34.45  ? 180 SER C O   1 
ATOM   2408 C CB  . SER C 2 180 ? 80.223  -63.551  -52.086  1.00 37.24  ? 180 SER C CB  1 
ATOM   2409 O OG  . SER C 2 180 ? 79.652  -64.046  -53.284  1.00 49.17  ? 180 SER C OG  1 
ATOM   2410 N N   . TYR C 2 181 ? 81.087  -66.550  -51.319  1.00 32.71  ? 181 TYR C N   1 
ATOM   2411 C CA  . TYR C 2 181 ? 81.190  -67.983  -51.655  1.00 31.75  ? 181 TYR C CA  1 
ATOM   2412 C C   . TYR C 2 181 ? 80.720  -68.844  -50.494  1.00 33.88  ? 181 TYR C C   1 
ATOM   2413 O O   . TYR C 2 181 ? 80.149  -69.915  -50.709  1.00 30.82  ? 181 TYR C O   1 
ATOM   2414 C CB  . TYR C 2 181 ? 82.594  -68.380  -52.157  1.00 33.48  ? 181 TYR C CB  1 
ATOM   2415 C CG  . TYR C 2 181 ? 83.662  -68.735  -51.144  1.00 31.97  ? 181 TYR C CG  1 
ATOM   2416 C CD1 . TYR C 2 181 ? 83.626  -69.929  -50.435  1.00 32.38  ? 181 TYR C CD1 1 
ATOM   2417 C CD2 . TYR C 2 181 ? 84.748  -67.903  -50.937  1.00 33.76  ? 181 TYR C CD2 1 
ATOM   2418 C CE1 . TYR C 2 181 ? 84.604  -70.246  -49.505  1.00 30.64  ? 181 TYR C CE1 1 
ATOM   2419 C CE2 . TYR C 2 181 ? 85.733  -68.225  -50.019  1.00 33.34  ? 181 TYR C CE2 1 
ATOM   2420 C CZ  . TYR C 2 181 ? 85.658  -69.411  -49.304  1.00 32.41  ? 181 TYR C CZ  1 
ATOM   2421 O OH  . TYR C 2 181 ? 86.689  -69.740  -48.413  1.00 32.37  ? 181 TYR C OH  1 
ATOM   2422 N N   . ILE C 2 182 ? 80.941  -68.380  -49.260  1.00 33.44  ? 182 ILE C N   1 
ATOM   2423 C CA  . ILE C 2 182 ? 80.467  -69.125  -48.119  1.00 34.57  ? 182 ILE C CA  1 
ATOM   2424 C C   . ILE C 2 182 ? 78.947  -69.230  -48.152  1.00 36.49  ? 182 ILE C C   1 
ATOM   2425 O O   . ILE C 2 182 ? 78.391  -70.334  -48.043  1.00 37.45  ? 182 ILE C O   1 
ATOM   2426 C CB  . ILE C 2 182 ? 80.967  -68.554  -46.778  1.00 35.78  ? 182 ILE C CB  1 
ATOM   2427 C CG1 . ILE C 2 182 ? 82.434  -68.933  -46.593  1.00 36.10  ? 182 ILE C CG1 1 
ATOM   2428 C CG2 . ILE C 2 182 ? 80.191  -69.167  -45.624  1.00 35.90  ? 182 ILE C CG2 1 
ATOM   2429 C CD1 . ILE C 2 182 ? 83.166  -68.075  -45.602  1.00 39.44  ? 182 ILE C CD1 1 
ATOM   2430 N N   . SER C 2 183 ? 78.277  -68.107  -48.362  1.00 35.26  ? 183 SER C N   1 
ATOM   2431 C CA  . SER C 2 183 ? 76.815  -68.101  -48.285  1.00 37.44  ? 183 SER C CA  1 
ATOM   2432 C C   . SER C 2 183 ? 76.186  -68.836  -49.450  1.00 36.83  ? 183 SER C C   1 
ATOM   2433 O O   . SER C 2 183 ? 75.188  -69.492  -49.270  1.00 42.19  ? 183 SER C O   1 
ATOM   2434 C CB  . SER C 2 183 ? 76.256  -66.682  -48.189  1.00 36.10  ? 183 SER C CB  1 
ATOM   2435 O OG  . SER C 2 183 ? 76.655  -65.932  -49.289  1.00 38.55  ? 183 SER C OG  1 
ATOM   2436 N N   . ILE C 2 184 ? 76.755  -68.729  -50.645  1.00 36.69  ? 184 ILE C N   1 
ATOM   2437 C CA  . ILE C 2 184 ? 76.274  -69.515  -51.781  1.00 35.98  ? 184 ILE C CA  1 
ATOM   2438 C C   . ILE C 2 184 ? 76.531  -71.017  -51.581  1.00 34.79  ? 184 ILE C C   1 
ATOM   2439 O O   . ILE C 2 184 ? 75.671  -71.826  -51.850  1.00 36.94  ? 184 ILE C O   1 
ATOM   2440 C CB  . ILE C 2 184 ? 76.911  -69.055  -53.097  1.00 38.70  ? 184 ILE C CB  1 
ATOM   2441 C CG1 . ILE C 2 184 ? 76.383  -67.674  -53.493  1.00 40.96  ? 184 ILE C CG1 1 
ATOM   2442 C CG2 . ILE C 2 184 ? 76.588  -70.034  -54.232  1.00 41.22  ? 184 ILE C CG2 1 
ATOM   2443 C CD1 . ILE C 2 184 ? 77.281  -66.926  -54.464  1.00 43.36  ? 184 ILE C CD1 1 
ATOM   2444 N N   . CYS C 2 185 ? 77.718  -71.375  -51.136  1.00 34.04  ? 185 CYS C N   1 
ATOM   2445 C CA  . CYS C 2 185 ? 78.094  -72.788  -51.020  1.00 36.82  ? 185 CYS C CA  1 
ATOM   2446 C C   . CYS C 2 185 ? 77.393  -73.479  -49.840  1.00 34.93  ? 185 CYS C C   1 
ATOM   2447 O O   . CYS C 2 185 ? 77.225  -74.674  -49.862  1.00 34.36  ? 185 CYS C O   1 
ATOM   2448 C CB  . CYS C 2 185 ? 79.621  -72.940  -50.881  1.00 37.03  ? 185 CYS C CB  1 
ATOM   2449 S SG  . CYS C 2 185 ? 80.635  -72.392  -52.295  1.00 35.85  ? 185 CYS C SG  1 
ATOM   2450 N N   . ASN C 2 186 ? 76.990  -72.712  -48.828  1.00 34.61  ? 186 ASN C N   1 
ATOM   2451 C CA  . ASN C 2 186 ? 76.385  -73.247  -47.595  1.00 36.56  ? 186 ASN C CA  1 
ATOM   2452 C C   . ASN C 2 186 ? 74.856  -73.338  -47.691  1.00 38.27  ? 186 ASN C C   1 
ATOM   2453 O O   . ASN C 2 186 ? 74.224  -73.936  -46.826  1.00 45.61  ? 186 ASN C O   1 
ATOM   2454 C CB  . ASN C 2 186 ? 76.779  -72.348  -46.400  1.00 37.22  ? 186 ASN C CB  1 
ATOM   2455 C CG  . ASN C 2 186 ? 76.791  -73.063  -45.065  1.00 38.88  ? 186 ASN C CG  1 
ATOM   2456 O OD1 . ASN C 2 186 ? 77.042  -74.265  -44.971  1.00 39.10  ? 186 ASN C OD1 1 
ATOM   2457 N ND2 . ASN C 2 186 ? 76.589  -72.291  -43.999  1.00 37.22  ? 186 ASN C ND2 1 
ATOM   2458 N N   . ARG C 2 187 ? 74.268  -72.776  -48.739  1.00 38.74  ? 187 ARG C N   1 
ATOM   2459 C CA  . ARG C 2 187 ? 72.804  -72.741  -48.887  1.00 45.67  ? 187 ARG C CA  1 
ATOM   2460 C C   . ARG C 2 187 ? 72.241  -74.033  -49.483  1.00 46.58  ? 187 ARG C C   1 
ATOM   2461 O O   . ARG C 2 187 ? 72.476  -74.328  -50.639  1.00 45.21  ? 187 ARG C O   1 
ATOM   2462 C CB  . ARG C 2 187 ? 72.363  -71.530  -49.722  1.00 48.32  ? 187 ARG C CB  1 
ATOM   2463 C CG  . ARG C 2 187 ? 70.897  -71.144  -49.554  1.00 51.03  ? 187 ARG C CG  1 
ATOM   2464 C CD  . ARG C 2 187 ? 70.428  -70.039  -50.502  1.00 54.02  ? 187 ARG C CD  1 
ATOM   2465 N NE  . ARG C 2 187 ? 71.516  -69.147  -50.948  1.00 64.22  ? 187 ARG C NE  1 
ATOM   2466 C CZ  . ARG C 2 187 ? 72.010  -68.089  -50.283  1.00 62.92  ? 187 ARG C CZ  1 
ATOM   2467 N NH1 . ARG C 2 187 ? 71.526  -67.732  -49.092  1.00 64.43  ? 187 ARG C NH1 1 
ATOM   2468 N NH2 . ARG C 2 187 ? 73.012  -67.384  -50.818  1.00 56.00  ? 187 ARG C NH2 1 
ATOM   2469 N N   . GLU C 2 188 ? 71.492  -74.783  -48.679  1.00 49.91  ? 188 GLU C N   1 
ATOM   2470 C CA  . GLU C 2 188 ? 70.832  -76.011  -49.123  1.00 56.18  ? 188 GLU C CA  1 
ATOM   2471 C C   . GLU C 2 188 ? 69.710  -75.712  -50.106  1.00 54.82  ? 188 GLU C C   1 
ATOM   2472 O O   . GLU C 2 188 ? 68.929  -74.803  -49.876  1.00 48.87  ? 188 GLU C O   1 
ATOM   2473 C CB  . GLU C 2 188 ? 70.251  -76.776  -47.936  1.00 64.71  ? 188 GLU C CB  1 
ATOM   2474 C CG  . GLU C 2 188 ? 71.249  -77.658  -47.197  1.00 74.36  ? 188 GLU C CG  1 
ATOM   2475 C CD  . GLU C 2 188 ? 70.571  -78.874  -46.588  1.00 83.99  ? 188 GLU C CD  1 
ATOM   2476 O OE1 . GLU C 2 188 ? 69.807  -78.687  -45.622  1.00 86.96  ? 188 GLU C OE1 1 
ATOM   2477 O OE2 . GLU C 2 188 ? 70.783  -80.008  -47.088  1.00 87.80  ? 188 GLU C OE2 1 
ATOM   2478 N N   . ILE C 2 189 ? 69.663  -76.457  -51.212  1.00 53.68  ? 189 ILE C N   1 
ATOM   2479 C CA  . ILE C 2 189 ? 68.592  -76.312  -52.188  1.00 57.56  ? 189 ILE C CA  1 
ATOM   2480 C C   . ILE C 2 189 ? 67.396  -77.213  -51.824  1.00 58.19  ? 189 ILE C C   1 
ATOM   2481 O O   . ILE C 2 189 ? 66.275  -76.778  -51.946  1.00 57.58  ? 189 ILE C O   1 
ATOM   2482 C CB  . ILE C 2 189 ? 69.072  -76.615  -53.619  1.00 59.91  ? 189 ILE C CB  1 
ATOM   2483 C CG1 . ILE C 2 189 ? 70.305  -75.773  -53.973  1.00 57.51  ? 189 ILE C CG1 1 
ATOM   2484 C CG2 . ILE C 2 189 ? 67.953  -76.378  -54.641  1.00 56.06  ? 189 ILE C CG2 1 
ATOM   2485 C CD1 . ILE C 2 189 ? 70.062  -74.283  -54.064  1.00 56.17  ? 189 ILE C CD1 1 
ATOM   2486 N N   . SER C 2 190 ? 67.656  -78.446  -51.386  1.00 59.95  ? 190 SER C N   1 
ATOM   2487 C CA  . SER C 2 190 ? 66.624  -79.416  -50.990  1.00 61.15  ? 190 SER C CA  1 
ATOM   2488 C C   . SER C 2 190 ? 67.318  -80.472  -50.120  1.00 68.34  ? 190 SER C C   1 
ATOM   2489 O O   . SER C 2 190 ? 68.525  -80.346  -49.882  1.00 65.28  ? 190 SER C O   1 
ATOM   2490 C CB  . SER C 2 190 ? 66.010  -80.071  -52.236  1.00 64.75  ? 190 SER C CB  1 
ATOM   2491 O OG  . SER C 2 190 ? 66.842  -81.123  -52.740  1.00 59.12  ? 190 SER C OG  1 
ATOM   2492 N N   . PRO C 2 191 ? 66.588  -81.524  -49.658  1.00 75.38  ? 191 PRO C N   1 
ATOM   2493 C CA  . PRO C 2 191 ? 67.267  -82.616  -48.902  1.00 75.48  ? 191 PRO C CA  1 
ATOM   2494 C C   . PRO C 2 191 ? 68.200  -83.514  -49.725  1.00 74.16  ? 191 PRO C C   1 
ATOM   2495 O O   . PRO C 2 191 ? 69.071  -84.176  -49.154  1.00 69.43  ? 191 PRO C O   1 
ATOM   2496 C CB  . PRO C 2 191 ? 66.102  -83.453  -48.344  1.00 75.33  ? 191 PRO C CB  1 
ATOM   2497 C CG  . PRO C 2 191 ? 64.889  -82.595  -48.482  1.00 76.31  ? 191 PRO C CG  1 
ATOM   2498 C CD  . PRO C 2 191 ? 65.125  -81.710  -49.668  1.00 74.78  ? 191 PRO C CD  1 
ATOM   2499 N N   . THR C 2 192 ? 67.995  -83.547  -51.040  1.00 75.54  ? 192 THR C N   1 
ATOM   2500 C CA  . THR C 2 192 ? 68.839  -84.320  -51.965  1.00 81.51  ? 192 THR C CA  1 
ATOM   2501 C C   . THR C 2 192 ? 69.877  -83.453  -52.702  1.00 76.36  ? 192 THR C C   1 
ATOM   2502 O O   . THR C 2 192 ? 70.637  -83.966  -53.528  1.00 80.21  ? 192 THR C O   1 
ATOM   2503 C CB  . THR C 2 192 ? 67.967  -85.051  -53.017  1.00 84.49  ? 192 THR C CB  1 
ATOM   2504 O OG1 . THR C 2 192 ? 67.113  -84.110  -53.691  1.00 83.11  ? 192 THR C OG1 1 
ATOM   2505 C CG2 . THR C 2 192 ? 67.112  -86.111  -52.349  1.00 86.16  ? 192 THR C CG2 1 
ATOM   2506 N N   . GLU C 2 193 ? 69.878  -82.151  -52.425  1.00 65.79  ? 193 GLU C N   1 
ATOM   2507 C CA  . GLU C 2 193 ? 70.810  -81.213  -53.040  1.00 60.71  ? 193 GLU C CA  1 
ATOM   2508 C C   . GLU C 2 193 ? 71.390  -80.243  -51.975  1.00 54.49  ? 193 GLU C C   1 
ATOM   2509 O O   . GLU C 2 193 ? 70.750  -79.297  -51.547  1.00 53.33  ? 193 GLU C O   1 
ATOM   2510 C CB  . GLU C 2 193 ? 70.129  -80.471  -54.191  1.00 61.49  ? 193 GLU C CB  1 
ATOM   2511 C CG  . GLU C 2 193 ? 71.088  -79.937  -55.250  1.00 61.79  ? 193 GLU C CG  1 
ATOM   2512 C CD  . GLU C 2 193 ? 70.395  -79.063  -56.282  1.00 63.71  ? 193 GLU C CD  1 
ATOM   2513 O OE1 . GLU C 2 193 ? 69.158  -79.168  -56.420  1.00 68.01  ? 193 GLU C OE1 1 
ATOM   2514 O OE2 . GLU C 2 193 ? 71.074  -78.251  -56.946  1.00 63.68  ? 193 GLU C OE2 1 
ATOM   2515 N N   . ARG C 2 194 ? 72.631  -80.515  -51.584  1.00 54.07  ? 194 ARG C N   1 
ATOM   2516 C CA  . ARG C 2 194 ? 73.355  -79.795  -50.543  1.00 52.11  ? 194 ARG C CA  1 
ATOM   2517 C C   . ARG C 2 194 ? 73.536  -78.301  -50.877  1.00 48.47  ? 194 ARG C C   1 
ATOM   2518 O O   . ARG C 2 194 ? 73.607  -77.477  -49.975  1.00 48.33  ? 194 ARG C O   1 
ATOM   2519 C CB  . ARG C 2 194 ? 74.721  -80.479  -50.340  1.00 53.36  ? 194 ARG C CB  1 
ATOM   2520 C CG  . ARG C 2 194 ? 75.734  -79.735  -49.457  1.00 63.42  ? 194 ARG C CG  1 
ATOM   2521 C CD  . ARG C 2 194 ? 75.324  -79.737  -47.993  1.00 63.60  ? 194 ARG C CD  1 
ATOM   2522 N NE  . ARG C 2 194 ? 76.131  -78.889  -47.107  1.00 65.49  ? 194 ARG C NE  1 
ATOM   2523 C CZ  . ARG C 2 194 ? 75.976  -77.564  -46.909  1.00 68.86  ? 194 ARG C CZ  1 
ATOM   2524 N NH1 . ARG C 2 194 ? 75.072  -76.860  -47.598  1.00 64.87  ? 194 ARG C NH1 1 
ATOM   2525 N NH2 . ARG C 2 194 ? 76.760  -76.921  -46.018  1.00 62.48  ? 194 ARG C NH2 1 
ATOM   2526 N N   . CYS C 2 195 ? 73.617  -77.975  -52.168  1.00 43.92  ? 195 CYS C N   1 
ATOM   2527 C CA  . CYS C 2 195 ? 73.898  -76.629  -52.638  1.00 41.88  ? 195 CYS C CA  1 
ATOM   2528 C C   . CYS C 2 195 ? 73.771  -76.554  -54.138  1.00 42.59  ? 195 CYS C C   1 
ATOM   2529 O O   . CYS C 2 195 ? 73.687  -77.569  -54.822  1.00 43.06  ? 195 CYS C O   1 
ATOM   2530 C CB  . CYS C 2 195 ? 75.342  -76.244  -52.301  1.00 47.56  ? 195 CYS C CB  1 
ATOM   2531 S SG  . CYS C 2 195 ? 76.585  -77.332  -53.085  1.00 49.95  ? 195 CYS C SG  1 
ATOM   2532 N N   . ASN C 2 196 ? 73.805  -75.338  -54.648  1.00 42.58  ? 196 ASN C N   1 
ATOM   2533 C CA  . ASN C 2 196 ? 74.020  -75.116  -56.081  1.00 47.84  ? 196 ASN C CA  1 
ATOM   2534 C C   . ASN C 2 196 ? 75.530  -75.159  -56.376  1.00 44.77  ? 196 ASN C C   1 
ATOM   2535 O O   . ASN C 2 196 ? 76.254  -74.152  -56.216  1.00 47.13  ? 196 ASN C O   1 
ATOM   2536 C CB  . ASN C 2 196 ? 73.396  -73.775  -56.479  1.00 49.17  ? 196 ASN C CB  1 
ATOM   2537 C CG  . ASN C 2 196 ? 73.355  -73.554  -57.978  1.00 48.31  ? 196 ASN C CG  1 
ATOM   2538 O OD1 . ASN C 2 196 ? 74.188  -74.058  -58.728  1.00 46.90  ? 196 ASN C OD1 1 
ATOM   2539 N ND2 . ASN C 2 196 ? 72.434  -72.711  -58.406  1.00 49.57  ? 196 ASN C ND2 1 
ATOM   2540 N N   . ARG C 2 197 ? 75.999  -76.330  -56.785  1.00 44.75  ? 197 ARG C N   1 
ATOM   2541 C CA  . ARG C 2 197 ? 77.445  -76.602  -56.961  1.00 44.96  ? 197 ARG C CA  1 
ATOM   2542 C C   . ARG C 2 197 ? 78.093  -75.676  -57.999  1.00 44.72  ? 197 ARG C C   1 
ATOM   2543 O O   . ARG C 2 197 ? 79.159  -75.120  -57.767  1.00 45.86  ? 197 ARG C O   1 
ATOM   2544 C CB  . ARG C 2 197 ? 77.649  -78.056  -57.357  1.00 45.55  ? 197 ARG C CB  1 
ATOM   2545 C CG  . ARG C 2 197 ? 79.062  -78.610  -57.232  1.00 51.73  ? 197 ARG C CG  1 
ATOM   2546 C CD  . ARG C 2 197 ? 79.042  -80.080  -57.614  1.00 58.18  ? 197 ARG C CD  1 
ATOM   2547 N NE  . ARG C 2 197 ? 80.375  -80.670  -57.642  1.00 73.93  ? 197 ARG C NE  1 
ATOM   2548 C CZ  . ARG C 2 197 ? 80.966  -81.332  -56.637  1.00 81.61  ? 197 ARG C CZ  1 
ATOM   2549 N NH1 . ARG C 2 197 ? 80.360  -81.532  -55.455  1.00 74.44  ? 197 ARG C NH1 1 
ATOM   2550 N NH2 . ARG C 2 197 ? 82.202  -81.803  -56.823  1.00 85.10  ? 197 ARG C NH2 1 
ATOM   2551 N N   . ARG C 2 198 ? 77.412  -75.494  -59.124  1.00 45.40  ? 198 ARG C N   1 
ATOM   2552 C CA  . ARG C 2 198 ? 77.856  -74.596  -60.182  1.00 43.42  ? 198 ARG C CA  1 
ATOM   2553 C C   . ARG C 2 198 ? 78.027  -73.188  -59.676  1.00 40.89  ? 198 ARG C C   1 
ATOM   2554 O O   . ARG C 2 198 ? 79.056  -72.553  -59.910  1.00 42.34  ? 198 ARG C O   1 
ATOM   2555 C CB  . ARG C 2 198 ? 76.863  -74.606  -61.360  1.00 48.99  ? 198 ARG C CB  1 
ATOM   2556 C CG  . ARG C 2 198 ? 77.165  -73.534  -62.402  1.00 57.62  ? 198 ARG C CG  1 
ATOM   2557 C CD  . ARG C 2 198 ? 76.424  -73.698  -63.708  1.00 69.53  ? 198 ARG C CD  1 
ATOM   2558 N NE  . ARG C 2 198 ? 77.118  -72.977  -64.791  1.00 79.91  ? 198 ARG C NE  1 
ATOM   2559 C CZ  . ARG C 2 198 ? 78.114  -73.467  -65.546  1.00 85.47  ? 198 ARG C CZ  1 
ATOM   2560 N NH1 . ARG C 2 198 ? 78.577  -74.714  -65.372  1.00 85.55  ? 198 ARG C NH1 1 
ATOM   2561 N NH2 . ARG C 2 198 ? 78.652  -72.702  -66.503  1.00 87.06  ? 198 ARG C NH2 1 
ATOM   2562 N N   . LYS C 2 199 ? 77.020  -72.694  -58.970  1.00 42.15  ? 199 LYS C N   1 
ATOM   2563 C CA  . LYS C 2 199 ? 77.075  -71.329  -58.425  1.00 43.51  ? 199 LYS C CA  1 
ATOM   2564 C C   . LYS C 2 199 ? 78.207  -71.241  -57.381  1.00 39.39  ? 199 LYS C C   1 
ATOM   2565 O O   . LYS C 2 199 ? 78.958  -70.271  -57.337  1.00 38.24  ? 199 LYS C O   1 
ATOM   2566 C CB  . LYS C 2 199 ? 75.715  -70.948  -57.814  1.00 48.67  ? 199 LYS C CB  1 
ATOM   2567 C CG  . LYS C 2 199 ? 75.148  -69.649  -58.314  1.00 54.10  ? 199 LYS C CG  1 
ATOM   2568 C CD  . LYS C 2 199 ? 74.150  -69.052  -57.333  1.00 64.90  ? 199 LYS C CD  1 
ATOM   2569 C CE  . LYS C 2 199 ? 73.883  -67.580  -57.645  1.00 73.24  ? 199 LYS C CE  1 
ATOM   2570 N NZ  . LYS C 2 199 ? 73.747  -66.764  -56.408  1.00 78.72  ? 199 LYS C NZ  1 
ATOM   2571 N N   . CYS C 2 200 ? 78.324  -72.284  -56.556  1.00 37.44  ? 200 CYS C N   1 
ATOM   2572 C CA  . CYS C 2 200 ? 79.383  -72.364  -55.541  1.00 37.66  ? 200 CYS C CA  1 
ATOM   2573 C C   . CYS C 2 200 ? 80.772  -72.292  -56.172  1.00 36.66  ? 200 CYS C C   1 
ATOM   2574 O O   . CYS C 2 200 ? 81.630  -71.498  -55.736  1.00 34.05  ? 200 CYS C O   1 
ATOM   2575 C CB  . CYS C 2 200 ? 79.243  -73.652  -54.720  1.00 39.11  ? 200 CYS C CB  1 
ATOM   2576 S SG  . CYS C 2 200 ? 80.620  -74.032  -53.611  1.00 40.19  ? 200 CYS C SG  1 
ATOM   2577 N N   . HIS C 2 201 ? 80.970  -73.098  -57.213  1.00 34.33  ? 201 HIS C N   1 
ATOM   2578 C CA  . HIS C 2 201 ? 82.245  -73.143  -57.895  1.00 36.82  ? 201 HIS C CA  1 
ATOM   2579 C C   . HIS C 2 201 ? 82.602  -71.799  -58.489  1.00 37.91  ? 201 HIS C C   1 
ATOM   2580 O O   . HIS C 2 201 ? 83.728  -71.315  -58.337  1.00 39.86  ? 201 HIS C O   1 
ATOM   2581 C CB  . HIS C 2 201 ? 82.240  -74.227  -58.968  1.00 36.82  ? 201 HIS C CB  1 
ATOM   2582 C CG  . HIS C 2 201 ? 82.469  -75.592  -58.427  1.00 37.18  ? 201 HIS C CG  1 
ATOM   2583 N ND1 . HIS C 2 201 ? 82.508  -76.709  -59.228  1.00 42.44  ? 201 HIS C ND1 1 
ATOM   2584 C CD2 . HIS C 2 201 ? 82.714  -76.021  -57.170  1.00 37.40  ? 201 HIS C CD2 1 
ATOM   2585 C CE1 . HIS C 2 201 ? 82.731  -77.777  -58.485  1.00 40.70  ? 201 HIS C CE1 1 
ATOM   2586 N NE2 . HIS C 2 201 ? 82.884  -77.383  -57.235  1.00 41.53  ? 201 HIS C NE2 1 
ATOM   2587 N N   . LYS C 2 202 ? 81.626  -71.187  -59.135  1.00 39.75  ? 202 LYS C N   1 
ATOM   2588 C CA  . LYS C 2 202 ? 81.797  -69.864  -59.722  1.00 42.84  ? 202 LYS C CA  1 
ATOM   2589 C C   . LYS C 2 202 ? 82.244  -68.847  -58.677  1.00 39.36  ? 202 LYS C C   1 
ATOM   2590 O O   . LYS C 2 202 ? 83.146  -68.036  -58.935  1.00 38.94  ? 202 LYS C O   1 
ATOM   2591 C CB  . LYS C 2 202 ? 80.490  -69.441  -60.392  1.00 52.67  ? 202 LYS C CB  1 
ATOM   2592 C CG  . LYS C 2 202 ? 80.532  -68.123  -61.141  1.00 67.82  ? 202 LYS C CG  1 
ATOM   2593 C CD  . LYS C 2 202 ? 79.200  -67.884  -61.846  1.00 81.57  ? 202 LYS C CD  1 
ATOM   2594 C CE  . LYS C 2 202 ? 79.047  -66.428  -62.279  1.00 87.64  ? 202 LYS C CE  1 
ATOM   2595 N NZ  . LYS C 2 202 ? 77.773  -66.218  -63.024  1.00 89.89  ? 202 LYS C NZ  1 
ATOM   2596 N N   . ALA C 2 203 ? 81.650  -68.906  -57.484  1.00 36.72  ? 203 ALA C N   1 
ATOM   2597 C CA  . ALA C 2 203 ? 81.993  -67.929  -56.456  1.00 36.32  ? 203 ALA C CA  1 
ATOM   2598 C C   . ALA C 2 203 ? 83.373  -68.212  -55.856  1.00 36.08  ? 203 ALA C C   1 
ATOM   2599 O O   . ALA C 2 203 ? 84.066  -67.280  -55.443  1.00 37.31  ? 203 ALA C O   1 
ATOM   2600 C CB  . ALA C 2 203 ? 80.930  -67.881  -55.390  1.00 36.22  ? 203 ALA C CB  1 
ATOM   2601 N N   . LEU C 2 204 ? 83.772  -69.480  -55.837  1.00 33.44  ? 204 LEU C N   1 
ATOM   2602 C CA  . LEU C 2 204 ? 85.107  -69.859  -55.409  1.00 33.63  ? 204 LEU C CA  1 
ATOM   2603 C C   . LEU C 2 204 ? 86.139  -69.336  -56.399  1.00 33.75  ? 204 LEU C C   1 
ATOM   2604 O O   . LEU C 2 204 ? 87.156  -68.778  -56.006  1.00 32.59  ? 204 LEU C O   1 
ATOM   2605 C CB  . LEU C 2 204 ? 85.237  -71.400  -55.255  1.00 33.39  ? 204 LEU C CB  1 
ATOM   2606 C CG  . LEU C 2 204 ? 84.707  -72.030  -53.967  1.00 33.96  ? 204 LEU C CG  1 
ATOM   2607 C CD1 . LEU C 2 204 ? 84.539  -73.551  -54.070  1.00 33.88  ? 204 LEU C CD1 1 
ATOM   2608 C CD2 . LEU C 2 204 ? 85.618  -71.679  -52.809  1.00 35.41  ? 204 LEU C CD2 1 
ATOM   2609 N N   . ARG C 2 205 ? 85.872  -69.521  -57.688  1.00 35.26  ? 205 ARG C N   1 
ATOM   2610 C CA  . ARG C 2 205 ? 86.738  -68.920  -58.747  1.00 38.28  ? 205 ARG C CA  1 
ATOM   2611 C C   . ARG C 2 205 ? 86.895  -67.409  -58.605  1.00 35.35  ? 205 ARG C C   1 
ATOM   2612 O O   . ARG C 2 205 ? 88.001  -66.892  -58.681  1.00 37.98  ? 205 ARG C O   1 
ATOM   2613 C CB  . ARG C 2 205 ? 86.230  -69.247  -60.132  1.00 39.54  ? 205 ARG C CB  1 
ATOM   2614 C CG  . ARG C 2 205 ? 86.181  -70.731  -60.381  1.00 45.08  ? 205 ARG C CG  1 
ATOM   2615 C CD  . ARG C 2 205 ? 86.333  -71.091  -61.817  1.00 54.65  ? 205 ARG C CD  1 
ATOM   2616 N NE  . ARG C 2 205 ? 85.221  -70.700  -62.677  1.00 63.59  ? 205 ARG C NE  1 
ATOM   2617 C CZ  . ARG C 2 205 ? 84.146  -71.450  -62.936  1.00 69.77  ? 205 ARG C CZ  1 
ATOM   2618 N NH1 . ARG C 2 205 ? 83.219  -70.974  -63.753  1.00 73.18  ? 205 ARG C NH1 1 
ATOM   2619 N NH2 . ARG C 2 205 ? 83.971  -72.661  -62.384  1.00 71.99  ? 205 ARG C NH2 1 
ATOM   2620 N N   . GLN C 2 206 ? 85.801  -66.724  -58.324  1.00 36.78  ? 206 GLN C N   1 
ATOM   2621 C CA  . GLN C 2 206 ? 85.833  -65.276  -58.072  1.00 39.36  ? 206 GLN C CA  1 
ATOM   2622 C C   . GLN C 2 206 ? 86.699  -64.892  -56.887  1.00 40.41  ? 206 GLN C C   1 
ATOM   2623 O O   . GLN C 2 206 ? 87.418  -63.903  -56.955  1.00 39.06  ? 206 GLN C O   1 
ATOM   2624 C CB  . GLN C 2 206 ? 84.426  -64.739  -57.848  1.00 45.14  ? 206 GLN C CB  1 
ATOM   2625 C CG  . GLN C 2 206 ? 83.615  -64.562  -59.118  1.00 53.22  ? 206 GLN C CG  1 
ATOM   2626 C CD  . GLN C 2 206 ? 84.067  -63.328  -59.881  1.00 61.60  ? 206 GLN C CD  1 
ATOM   2627 O OE1 . GLN C 2 206 ? 83.712  -62.204  -59.520  1.00 67.85  ? 206 GLN C OE1 1 
ATOM   2628 N NE2 . GLN C 2 206 ? 84.891  -63.527  -60.908  1.00 63.03  ? 206 GLN C NE2 1 
ATOM   2629 N N   . PHE C 2 207 ? 86.634  -65.673  -55.798  1.00 39.23  ? 207 PHE C N   1 
ATOM   2630 C CA  . PHE C 2 207 ? 87.465  -65.427  -54.595  1.00 33.05  ? 207 PHE C CA  1 
ATOM   2631 C C   . PHE C 2 207 ? 88.950  -65.582  -54.930  1.00 34.39  ? 207 PHE C C   1 
ATOM   2632 O O   . PHE C 2 207 ? 89.762  -64.719  -54.617  1.00 37.55  ? 207 PHE C O   1 
ATOM   2633 C CB  . PHE C 2 207 ? 87.041  -66.386  -53.472  1.00 31.98  ? 207 PHE C CB  1 
ATOM   2634 C CG  . PHE C 2 207 ? 87.846  -66.272  -52.218  1.00 32.62  ? 207 PHE C CG  1 
ATOM   2635 C CD1 . PHE C 2 207 ? 87.680  -65.200  -51.361  1.00 33.11  ? 207 PHE C CD1 1 
ATOM   2636 C CD2 . PHE C 2 207 ? 88.754  -67.268  -51.867  1.00 34.96  ? 207 PHE C CD2 1 
ATOM   2637 C CE1 . PHE C 2 207 ? 88.395  -65.114  -50.195  1.00 31.77  ? 207 PHE C CE1 1 
ATOM   2638 C CE2 . PHE C 2 207 ? 89.468  -67.180  -50.694  1.00 32.92  ? 207 PHE C CE2 1 
ATOM   2639 C CZ  . PHE C 2 207 ? 89.295  -66.099  -49.870  1.00 32.81  ? 207 PHE C CZ  1 
ATOM   2640 N N   . PHE C 2 208 ? 89.307  -66.678  -55.576  1.00 33.04  ? 208 PHE C N   1 
ATOM   2641 C CA  . PHE C 2 208 ? 90.707  -66.912  -55.930  1.00 35.24  ? 208 PHE C CA  1 
ATOM   2642 C C   . PHE C 2 208 ? 91.243  -65.993  -57.040  1.00 37.57  ? 208 PHE C C   1 
ATOM   2643 O O   . PHE C 2 208 ? 92.418  -65.699  -57.043  1.00 40.08  ? 208 PHE C O   1 
ATOM   2644 C CB  . PHE C 2 208 ? 90.955  -68.407  -56.230  1.00 34.71  ? 208 PHE C CB  1 
ATOM   2645 C CG  . PHE C 2 208 ? 90.950  -69.247  -54.997  1.00 35.20  ? 208 PHE C CG  1 
ATOM   2646 C CD1 . PHE C 2 208 ? 92.026  -69.193  -54.096  1.00 37.25  ? 208 PHE C CD1 1 
ATOM   2647 C CD2 . PHE C 2 208 ? 89.867  -70.048  -54.691  1.00 35.05  ? 208 PHE C CD2 1 
ATOM   2648 C CE1 . PHE C 2 208 ? 92.007  -69.939  -52.920  1.00 36.72  ? 208 PHE C CE1 1 
ATOM   2649 C CE2 . PHE C 2 208 ? 89.840  -70.788  -53.525  1.00 36.92  ? 208 PHE C CE2 1 
ATOM   2650 C CZ  . PHE C 2 208 ? 90.912  -70.731  -52.634  1.00 39.42  ? 208 PHE C CZ  1 
ATOM   2651 N N   . ASP C 2 209 ? 90.379  -65.505  -57.936  1.00 42.39  ? 209 ASP C N   1 
ATOM   2652 C CA  . ASP C 2 209 ? 90.783  -64.587  -59.020  1.00 42.41  ? 209 ASP C CA  1 
ATOM   2653 C C   . ASP C 2 209 ? 90.808  -63.104  -58.603  1.00 44.11  ? 209 ASP C C   1 
ATOM   2654 O O   . ASP C 2 209 ? 91.584  -62.333  -59.146  1.00 49.33  ? 209 ASP C O   1 
ATOM   2655 C CB  . ASP C 2 209 ? 89.826  -64.711  -60.216  1.00 43.51  ? 209 ASP C CB  1 
ATOM   2656 C CG  . ASP C 2 209 ? 89.982  -66.018  -60.997  1.00 47.97  ? 209 ASP C CG  1 
ATOM   2657 O OD1 . ASP C 2 209 ? 90.984  -66.763  -60.849  1.00 48.11  ? 209 ASP C OD1 1 
ATOM   2658 O OD2 . ASP C 2 209 ? 89.066  -66.288  -61.812  1.00 56.76  ? 209 ASP C OD2 1 
ATOM   2659 N N   . ARG C 2 210 ? 89.962  -62.704  -57.659  1.00 43.12  ? 210 ARG C N   1 
ATOM   2660 C CA  . ARG C 2 210 ? 89.781  -61.279  -57.352  1.00 44.86  ? 210 ARG C CA  1 
ATOM   2661 C C   . ARG C 2 210 ? 90.240  -60.875  -55.965  1.00 42.45  ? 210 ARG C C   1 
ATOM   2662 O O   . ARG C 2 210 ? 90.100  -59.713  -55.587  1.00 43.77  ? 210 ARG C O   1 
ATOM   2663 C CB  . ARG C 2 210 ? 88.315  -60.866  -57.561  1.00 47.53  ? 210 ARG C CB  1 
ATOM   2664 C CG  . ARG C 2 210 ? 87.844  -60.956  -59.017  1.00 54.63  ? 210 ARG C CG  1 
ATOM   2665 C CD  . ARG C 2 210 ? 86.412  -60.479  -59.216  1.00 64.81  ? 210 ARG C CD  1 
ATOM   2666 N NE  . ARG C 2 210 ? 86.166  -59.216  -58.494  1.00 82.88  ? 210 ARG C NE  1 
ATOM   2667 C CZ  . ARG C 2 210 ? 85.029  -58.858  -57.871  1.00 82.98  ? 210 ARG C CZ  1 
ATOM   2668 N NH1 . ARG C 2 210 ? 83.951  -59.641  -57.867  1.00 78.71  ? 210 ARG C NH1 1 
ATOM   2669 N NH2 . ARG C 2 210 ? 84.972  -57.691  -57.229  1.00 88.26  ? 210 ARG C NH2 1 
ATOM   2670 N N   . VAL C 2 211 ? 90.772  -61.812  -55.188  1.00 40.19  ? 211 VAL C N   1 
ATOM   2671 C CA  . VAL C 2 211 ? 91.349  -61.457  -53.886  1.00 38.40  ? 211 VAL C CA  1 
ATOM   2672 C C   . VAL C 2 211 ? 92.831  -61.791  -53.985  1.00 37.99  ? 211 VAL C C   1 
ATOM   2673 O O   . VAL C 2 211 ? 93.186  -62.862  -54.476  1.00 37.24  ? 211 VAL C O   1 
ATOM   2674 C CB  . VAL C 2 211 ? 90.677  -62.197  -52.719  1.00 37.74  ? 211 VAL C CB  1 
ATOM   2675 C CG1 . VAL C 2 211 ? 91.347  -61.872  -51.396  1.00 37.52  ? 211 VAL C CG1 1 
ATOM   2676 C CG2 . VAL C 2 211 ? 89.223  -61.834  -52.636  1.00 38.09  ? 211 VAL C CG2 1 
ATOM   2677 N N   . PRO C 2 212 ? 93.708  -60.879  -53.563  1.00 36.35  ? 212 PRO C N   1 
ATOM   2678 C CA  . PRO C 2 212 ? 95.142  -61.193  -53.689  1.00 37.81  ? 212 PRO C CA  1 
ATOM   2679 C C   . PRO C 2 212 ? 95.557  -62.471  -52.952  1.00 37.68  ? 212 PRO C C   1 
ATOM   2680 O O   . PRO C 2 212 ? 94.976  -62.827  -51.929  1.00 37.39  ? 212 PRO C O   1 
ATOM   2681 C CB  . PRO C 2 212 ? 95.839  -59.976  -53.048  1.00 36.27  ? 212 PRO C CB  1 
ATOM   2682 C CG  . PRO C 2 212 ? 94.840  -58.884  -53.166  1.00 36.99  ? 212 PRO C CG  1 
ATOM   2683 C CD  . PRO C 2 212 ? 93.489  -59.534  -53.023  1.00 38.31  ? 212 PRO C CD  1 
ATOM   2684 N N   . SER C 2 213 ? 96.595  -63.108  -53.463  1.00 38.08  ? 213 SER C N   1 
ATOM   2685 C CA  . SER C 2 213 ? 97.103  -64.347  -52.916  1.00 39.84  ? 213 SER C CA  1 
ATOM   2686 C C   . SER C 2 213 ? 97.659  -64.166  -51.508  1.00 38.52  ? 213 SER C C   1 
ATOM   2687 O O   . SER C 2 213 ? 97.707  -65.115  -50.739  1.00 37.66  ? 213 SER C O   1 
ATOM   2688 C CB  . SER C 2 213 ? 98.189  -64.895  -53.825  1.00 40.52  ? 213 SER C CB  1 
ATOM   2689 O OG  . SER C 2 213 ? 99.258  -63.968  -53.890  1.00 41.32  ? 213 SER C OG  1 
ATOM   2690 N N   . GLU C 2 214 ? 98.082  -62.960  -51.161  1.00 38.31  ? 214 GLU C N   1 
ATOM   2691 C CA  . GLU C 2 214 ? 98.502  -62.719  -49.786  1.00 43.13  ? 214 GLU C CA  1 
ATOM   2692 C C   . GLU C 2 214 ? 97.381  -63.091  -48.785  1.00 39.53  ? 214 GLU C C   1 
ATOM   2693 O O   . GLU C 2 214 ? 97.687  -63.546  -47.715  1.00 37.50  ? 214 GLU C O   1 
ATOM   2694 C CB  . GLU C 2 214 ? 99.035  -61.289  -49.571  1.00 49.61  ? 214 GLU C CB  1 
ATOM   2695 C CG  . GLU C 2 214 ? 97.985  -60.197  -49.458  1.00 62.43  ? 214 GLU C CG  1 
ATOM   2696 C CD  . GLU C 2 214 ? 98.523  -58.766  -49.694  1.00 74.38  ? 214 GLU C CD  1 
ATOM   2697 O OE1 . GLU C 2 214 ? 98.762  -58.370  -50.881  1.00 71.26  ? 214 GLU C OE1 1 
ATOM   2698 O OE2 . GLU C 2 214 ? 98.662  -58.024  -48.683  1.00 73.34  ? 214 GLU C OE2 1 
ATOM   2699 N N   . TYR C 2 215 ? 96.107  -62.903  -49.155  1.00 37.05  ? 215 TYR C N   1 
ATOM   2700 C CA  . TYR C 2 215 ? 94.978  -63.348  -48.349  1.00 36.14  ? 215 TYR C CA  1 
ATOM   2701 C C   . TYR C 2 215 ? 94.602  -64.790  -48.615  1.00 36.86  ? 215 TYR C C   1 
ATOM   2702 O O   . TYR C 2 215 ? 94.502  -65.561  -47.670  1.00 36.14  ? 215 TYR C O   1 
ATOM   2703 C CB  . TYR C 2 215 ? 93.759  -62.458  -48.555  1.00 39.84  ? 215 TYR C CB  1 
ATOM   2704 C CG  . TYR C 2 215 ? 94.025  -61.038  -48.120  1.00 43.43  ? 215 TYR C CG  1 
ATOM   2705 C CD1 . TYR C 2 215 ? 94.131  -60.720  -46.782  1.00 45.09  ? 215 TYR C CD1 1 
ATOM   2706 C CD2 . TYR C 2 215 ? 94.211  -60.014  -49.061  1.00 47.77  ? 215 TYR C CD2 1 
ATOM   2707 C CE1 . TYR C 2 215 ? 94.404  -59.421  -46.377  1.00 49.18  ? 215 TYR C CE1 1 
ATOM   2708 C CE2 . TYR C 2 215 ? 94.481  -58.709  -48.667  1.00 48.67  ? 215 TYR C CE2 1 
ATOM   2709 C CZ  . TYR C 2 215 ? 94.577  -58.424  -47.322  1.00 48.61  ? 215 TYR C CZ  1 
ATOM   2710 O OH  . TYR C 2 215 ? 94.849  -57.159  -46.907  1.00 50.00  ? 215 TYR C OH  1 
ATOM   2711 N N   . THR C 2 216 ? 94.451  -65.173  -49.894  1.00 35.80  ? 216 THR C N   1 
ATOM   2712 C CA  . THR C 2 216 ? 93.849  -66.467  -50.229  1.00 36.73  ? 216 THR C CA  1 
ATOM   2713 C C   . THR C 2 216 ? 94.752  -67.660  -49.948  1.00 36.88  ? 216 THR C C   1 
ATOM   2714 O O   . THR C 2 216 ? 94.269  -68.671  -49.476  1.00 38.03  ? 216 THR C O   1 
ATOM   2715 C CB  . THR C 2 216 ? 93.347  -66.552  -51.686  1.00 36.24  ? 216 THR C CB  1 
ATOM   2716 O OG1 . THR C 2 216 ? 94.452  -66.503  -52.586  1.00 36.73  ? 216 THR C OG1 1 
ATOM   2717 C CG2 . THR C 2 216 ? 92.402  -65.415  -51.994  1.00 38.35  ? 216 THR C CG2 1 
ATOM   2718 N N   . TYR C 2 217 ? 96.040  -67.542  -50.255  1.00 36.62  ? 217 TYR C N   1 
ATOM   2719 C CA  . TYR C 2 217 ? 96.998  -68.630  -50.022  1.00 38.53  ? 217 TYR C CA  1 
ATOM   2720 C C   . TYR C 2 217 ? 97.272  -68.865  -48.524  1.00 38.11  ? 217 TYR C C   1 
ATOM   2721 O O   . TYR C 2 217 ? 97.551  -69.976  -48.089  1.00 36.89  ? 217 TYR C O   1 
ATOM   2722 C CB  . TYR C 2 217 ? 98.323  -68.331  -50.710  1.00 39.08  ? 217 TYR C CB  1 
ATOM   2723 C CG  . TYR C 2 217 ? 98.337  -68.388  -52.227  1.00 39.16  ? 217 TYR C CG  1 
ATOM   2724 C CD1 . TYR C 2 217 ? 97.167  -68.442  -52.984  1.00 39.47  ? 217 TYR C CD1 1 
ATOM   2725 C CD2 . TYR C 2 217 ? 99.551  -68.307  -52.904  1.00 40.46  ? 217 TYR C CD2 1 
ATOM   2726 C CE1 . TYR C 2 217 ? 97.220  -68.448  -54.373  1.00 42.40  ? 217 TYR C CE1 1 
ATOM   2727 C CE2 . TYR C 2 217 ? 99.609  -68.310  -54.279  1.00 38.80  ? 217 TYR C CE2 1 
ATOM   2728 C CZ  . TYR C 2 217 ? 98.458  -68.385  -55.000  1.00 40.51  ? 217 TYR C CZ  1 
ATOM   2729 O OH  . TYR C 2 217 ? 98.557  -68.379  -56.350  1.00 50.97  ? 217 TYR C OH  1 
ATOM   2730 N N   . ARG C 2 218 ? 97.206  -67.796  -47.754  1.00 37.56  ? 218 ARG C N   1 
ATOM   2731 C CA  . ARG C 2 218 ? 97.392  -67.845  -46.322  1.00 36.62  ? 218 ARG C CA  1 
ATOM   2732 C C   . ARG C 2 218 ? 96.248  -68.659  -45.687  1.00 38.15  ? 218 ARG C C   1 
ATOM   2733 O O   . ARG C 2 218 ? 96.455  -69.390  -44.721  1.00 37.98  ? 218 ARG C O   1 
ATOM   2734 C CB  . ARG C 2 218 ? 97.422  -66.436  -45.808  1.00 40.96  ? 218 ARG C CB  1 
ATOM   2735 C CG  . ARG C 2 218 ? 98.029  -66.302  -44.462  1.00 49.29  ? 218 ARG C CG  1 
ATOM   2736 C CD  . ARG C 2 218 ? 97.833  -64.898  -43.938  1.00 57.11  ? 218 ARG C CD  1 
ATOM   2737 N NE  . ARG C 2 218 ? 98.058  -64.849  -42.493  1.00 59.09  ? 218 ARG C NE  1 
ATOM   2738 C CZ  . ARG C 2 218 ? 98.003  -63.747  -41.768  1.00 60.24  ? 218 ARG C CZ  1 
ATOM   2739 N NH1 . ARG C 2 218 ? 97.750  -62.571  -42.353  1.00 65.86  ? 218 ARG C NH1 1 
ATOM   2740 N NH2 . ARG C 2 218 ? 98.220  -63.821  -40.461  1.00 60.10  ? 218 ARG C NH2 1 
ATOM   2741 N N   . MET C 2 219 ? 95.060  -68.579  -46.275  1.00 35.01  ? 219 MET C N   1 
ATOM   2742 C CA  . MET C 2 219 ? 93.929  -69.409  -45.858  1.00 37.20  ? 219 MET C CA  1 
ATOM   2743 C C   . MET C 2 219 ? 94.015  -70.866  -46.358  1.00 40.33  ? 219 MET C C   1 
ATOM   2744 O O   . MET C 2 219 ? 93.734  -71.800  -45.601  1.00 41.88  ? 219 MET C O   1 
ATOM   2745 C CB  . MET C 2 219 ? 92.623  -68.800  -46.336  1.00 36.44  ? 219 MET C CB  1 
ATOM   2746 C CG  . MET C 2 219 ? 92.366  -67.425  -45.744  1.00 39.90  ? 219 MET C CG  1 
ATOM   2747 S SD  . MET C 2 219 ? 90.867  -66.621  -46.313  1.00 44.54  ? 219 MET C SD  1 
ATOM   2748 C CE  . MET C 2 219 ? 89.640  -67.757  -45.694  1.00 47.80  ? 219 MET C CE  1 
ATOM   2749 N N   . LEU C 2 220 ? 94.382  -71.054  -47.626  1.00 35.73  ? 220 LEU C N   1 
ATOM   2750 C CA  . LEU C 2 220 ? 94.452  -72.394  -48.231  1.00 34.85  ? 220 LEU C CA  1 
ATOM   2751 C C   . LEU C 2 220 ? 95.666  -73.237  -47.795  1.00 34.33  ? 220 LEU C C   1 
ATOM   2752 O O   . LEU C 2 220 ? 95.563  -74.429  -47.584  1.00 32.77  ? 220 LEU C O   1 
ATOM   2753 C CB  . LEU C 2 220 ? 94.458  -72.233  -49.725  1.00 35.70  ? 220 LEU C CB  1 
ATOM   2754 C CG  . LEU C 2 220 ? 94.090  -73.396  -50.614  1.00 38.95  ? 220 LEU C CG  1 
ATOM   2755 C CD1 . LEU C 2 220 ? 92.717  -73.931  -50.318  1.00 38.64  ? 220 LEU C CD1 1 
ATOM   2756 C CD2 . LEU C 2 220 ? 94.162  -72.930  -52.067  1.00 40.06  ? 220 LEU C CD2 1 
ATOM   2757 N N   . PHE C 2 221 ? 96.811  -72.597  -47.649  1.00 35.22  ? 221 PHE C N   1 
ATOM   2758 C CA  . PHE C 2 221 ? 98.057  -73.283  -47.372  1.00 35.07  ? 221 PHE C CA  1 
ATOM   2759 C C   . PHE C 2 221 ? 98.636  -73.033  -45.947  1.00 36.51  ? 221 PHE C C   1 
ATOM   2760 O O   . PHE C 2 221 ? 99.789  -73.358  -45.696  1.00 40.45  ? 221 PHE C O   1 
ATOM   2761 C CB  . PHE C 2 221 ? 99.078  -72.886  -48.451  1.00 32.43  ? 221 PHE C CB  1 
ATOM   2762 C CG  . PHE C 2 221 ? 98.566  -73.046  -49.865  1.00 32.66  ? 221 PHE C CG  1 
ATOM   2763 C CD1 . PHE C 2 221 ? 98.069  -74.258  -50.315  1.00 31.72  ? 221 PHE C CD1 1 
ATOM   2764 C CD2 . PHE C 2 221 ? 98.581  -71.978  -50.736  1.00 33.48  ? 221 PHE C CD2 1 
ATOM   2765 C CE1 . PHE C 2 221 ? 97.593  -74.413  -51.600  1.00 32.81  ? 221 PHE C CE1 1 
ATOM   2766 C CE2 . PHE C 2 221 ? 98.108  -72.123  -52.023  1.00 36.59  ? 221 PHE C CE2 1 
ATOM   2767 C CZ  . PHE C 2 221 ? 97.616  -73.348  -52.459  1.00 34.33  ? 221 PHE C CZ  1 
ATOM   2768 N N   . CYS C 2 222 ? 97.864  -72.477  -45.023  1.00 36.98  ? 222 CYS C N   1 
ATOM   2769 C CA  . CYS C 2 222 ? 98.348  -72.248  -43.636  1.00 40.78  ? 222 CYS C CA  1 
ATOM   2770 C C   . CYS C 2 222 ? 98.882  -73.534  -43.000  1.00 42.95  ? 222 CYS C C   1 
ATOM   2771 O O   . CYS C 2 222 ? 98.376  -74.619  -43.258  1.00 41.85  ? 222 CYS C O   1 
ATOM   2772 C CB  . CYS C 2 222 ? 97.249  -71.689  -42.708  1.00 41.55  ? 222 CYS C CB  1 
ATOM   2773 S SG  . CYS C 2 222 ? 95.607  -72.435  -42.872  1.00 48.33  ? 222 CYS C SG  1 
ATOM   2774 N N   . SER C 2 223 ? 99.883  -73.411  -42.146  1.00 40.71  ? 223 SER C N   1 
ATOM   2775 C CA  . SER C 2 223 ? 100.372 -74.589  -41.419  1.00 44.35  ? 223 SER C CA  1 
ATOM   2776 C C   . SER C 2 223 ? 99.640  -74.815  -40.098  1.00 44.58  ? 223 SER C C   1 
ATOM   2777 O O   . SER C 2 223 ? 99.188  -73.867  -39.436  1.00 42.06  ? 223 SER C O   1 
ATOM   2778 C CB  . SER C 2 223 ? 101.872 -74.499  -41.159  1.00 42.67  ? 223 SER C CB  1 
ATOM   2779 O OG  . SER C 2 223 ? 102.121 -73.442  -40.282  1.00 47.19  ? 223 SER C OG  1 
ATOM   2780 N N   . CYS C 2 224 ? 99.567  -76.084  -39.717  1.00 43.46  ? 224 CYS C N   1 
ATOM   2781 C CA  . CYS C 2 224 ? 98.799  -76.516  -38.564  1.00 43.26  ? 224 CYS C CA  1 
ATOM   2782 C C   . CYS C 2 224 ? 99.575  -77.524  -37.717  1.00 46.82  ? 224 CYS C C   1 
ATOM   2783 O O   . CYS C 2 224 ? 100.365 -78.316  -38.222  1.00 45.23  ? 224 CYS C O   1 
ATOM   2784 C CB  . CYS C 2 224 ? 97.500  -77.153  -39.011  1.00 41.99  ? 224 CYS C CB  1 
ATOM   2785 S SG  . CYS C 2 224 ? 96.270  -76.065  -39.759  1.00 45.83  ? 224 CYS C SG  1 
ATOM   2786 N N   . GLN C 2 225 ? 99.315  -77.470  -36.416  1.00 54.84  ? 225 GLN C N   1 
ATOM   2787 C CA  . GLN C 2 225 ? 99.853  -78.397  -35.430  1.00 57.85  ? 225 GLN C CA  1 
ATOM   2788 C C   . GLN C 2 225 ? 98.779  -79.178  -34.696  1.00 54.15  ? 225 GLN C C   1 
ATOM   2789 O O   . GLN C 2 225 ? 99.106  -80.156  -34.039  1.00 62.62  ? 225 GLN C O   1 
ATOM   2790 C CB  . GLN C 2 225 ? 100.688 -77.627  -34.418  1.00 65.61  ? 225 GLN C CB  1 
ATOM   2791 C CG  . GLN C 2 225 ? 101.890 -76.942  -35.044  1.00 75.48  ? 225 GLN C CG  1 
ATOM   2792 C CD  . GLN C 2 225 ? 102.507 -75.906  -34.123  1.00 89.40  ? 225 GLN C CD  1 
ATOM   2793 O OE1 . GLN C 2 225 ? 101.793 -75.134  -33.473  1.00 95.82  ? 225 GLN C OE1 1 
ATOM   2794 N NE2 . GLN C 2 225 ? 103.840 -75.877  -34.061  1.00 93.37  ? 225 GLN C NE2 1 
ATOM   2795 N N   . ASP C 2 226 ? 97.515  -78.770  -34.795  1.00 52.01  ? 226 ASP C N   1 
ATOM   2796 C CA  . ASP C 2 226 ? 96.390  -79.511  -34.169  1.00 51.39  ? 226 ASP C CA  1 
ATOM   2797 C C   . ASP C 2 226 ? 95.233  -79.719  -35.132  1.00 45.13  ? 226 ASP C C   1 
ATOM   2798 O O   . ASP C 2 226 ? 95.165  -79.126  -36.196  1.00 46.08  ? 226 ASP C O   1 
ATOM   2799 C CB  . ASP C 2 226 ? 95.889  -78.781  -32.915  1.00 54.85  ? 226 ASP C CB  1 
ATOM   2800 C CG  . ASP C 2 226 ? 95.148  -77.496  -33.241  1.00 62.19  ? 226 ASP C CG  1 
ATOM   2801 O OD1 . ASP C 2 226 ? 95.660  -76.684  -34.015  1.00 69.10  ? 226 ASP C OD1 1 
ATOM   2802 O OD2 . ASP C 2 226 ? 94.038  -77.286  -32.729  1.00 80.72  ? 226 ASP C OD2 1 
ATOM   2803 N N   . GLN C 2 227 ? 94.304  -80.551  -34.725  1.00 43.57  ? 227 GLN C N   1 
ATOM   2804 C CA  . GLN C 2 227 ? 93.206  -80.941  -35.579  1.00 47.95  ? 227 GLN C CA  1 
ATOM   2805 C C   . GLN C 2 227 ? 92.206  -79.787  -35.845  1.00 46.01  ? 227 GLN C C   1 
ATOM   2806 O O   . GLN C 2 227 ? 91.654  -79.701  -36.925  1.00 49.03  ? 227 GLN C O   1 
ATOM   2807 C CB  . GLN C 2 227 ? 92.562  -82.227  -35.035  1.00 47.91  ? 227 GLN C CB  1 
ATOM   2808 C CG  . GLN C 2 227 ? 91.075  -82.149  -34.749  1.00 62.18  ? 227 GLN C CG  1 
ATOM   2809 C CD  . GLN C 2 227 ? 90.235  -82.668  -35.878  1.00 69.05  ? 227 GLN C CD  1 
ATOM   2810 O OE1 . GLN C 2 227 ? 90.636  -83.610  -36.573  1.00 86.71  ? 227 GLN C OE1 1 
ATOM   2811 N NE2 . GLN C 2 227 ? 89.057  -82.084  -36.062  1.00 70.69  ? 227 GLN C NE2 1 
ATOM   2812 N N   . ALA C 2 228 ? 91.976  -78.905  -34.883  1.00 43.39  ? 228 ALA C N   1 
ATOM   2813 C CA  . ALA C 2 228 ? 91.012  -77.829  -35.087  1.00 41.87  ? 228 ALA C CA  1 
ATOM   2814 C C   . ALA C 2 228 ? 91.489  -76.860  -36.196  1.00 39.06  ? 228 ALA C C   1 
ATOM   2815 O O   . ALA C 2 228 ? 90.681  -76.318  -36.921  1.00 41.12  ? 228 ALA C O   1 
ATOM   2816 C CB  . ALA C 2 228 ? 90.749  -77.069  -33.795  1.00 39.51  ? 228 ALA C CB  1 
ATOM   2817 N N   . CYS C 2 229 ? 92.797  -76.658  -36.289  1.00 38.91  ? 229 CYS C N   1 
ATOM   2818 C CA  . CYS C 2 229 ? 93.425  -75.809  -37.306  1.00 39.54  ? 229 CYS C CA  1 
ATOM   2819 C C   . CYS C 2 229 ? 93.303  -76.509  -38.640  1.00 38.13  ? 229 CYS C C   1 
ATOM   2820 O O   . CYS C 2 229 ? 92.859  -75.918  -39.597  1.00 37.11  ? 229 CYS C O   1 
ATOM   2821 C CB  . CYS C 2 229 ? 94.889  -75.509  -36.964  1.00 37.76  ? 229 CYS C CB  1 
ATOM   2822 S SG  . CYS C 2 229 ? 95.822  -74.562  -38.221  1.00 43.37  ? 229 CYS C SG  1 
ATOM   2823 N N   . ALA C 2 230 ? 93.643  -77.790  -38.675  1.00 35.58  ? 230 ALA C N   1 
ATOM   2824 C CA  . ALA C 2 230 ? 93.586  -78.545  -39.910  1.00 35.45  ? 230 ALA C CA  1 
ATOM   2825 C C   . ALA C 2 230 ? 92.190  -78.709  -40.464  1.00 34.33  ? 230 ALA C C   1 
ATOM   2826 O O   . ALA C 2 230 ? 92.018  -78.810  -41.660  1.00 39.36  ? 230 ALA C O   1 
ATOM   2827 C CB  . ALA C 2 230 ? 94.245  -79.897  -39.727  1.00 34.73  ? 230 ALA C CB  1 
ATOM   2828 N N   . GLU C 2 231 ? 91.204  -78.792  -39.595  1.00 34.12  ? 231 GLU C N   1 
ATOM   2829 C CA  . GLU C 2 231 ? 89.803  -78.873  -40.017  1.00 34.79  ? 231 GLU C CA  1 
ATOM   2830 C C   . GLU C 2 231 ? 89.318  -77.531  -40.571  1.00 34.84  ? 231 GLU C C   1 
ATOM   2831 O O   . GLU C 2 231 ? 88.505  -77.500  -41.492  1.00 34.86  ? 231 GLU C O   1 
ATOM   2832 C CB  . GLU C 2 231 ? 88.921  -79.264  -38.836  1.00 35.73  ? 231 GLU C CB  1 
ATOM   2833 C CG  . GLU C 2 231 ? 87.424  -79.273  -39.108  1.00 37.53  ? 231 GLU C CG  1 
ATOM   2834 C CD  . GLU C 2 231 ? 86.972  -80.270  -40.148  1.00 40.95  ? 231 GLU C CD  1 
ATOM   2835 O OE1 . GLU C 2 231 ? 87.763  -81.127  -40.606  1.00 47.61  ? 231 GLU C OE1 1 
ATOM   2836 O OE2 . GLU C 2 231 ? 85.787  -80.206  -40.502  1.00 46.51  ? 231 GLU C OE2 1 
ATOM   2837 N N   . ARG C 2 232 ? 89.779  -76.428  -39.966  1.00 32.97  ? 232 ARG C N   1 
ATOM   2838 C CA  . ARG C 2 232 ? 89.494  -75.120  -40.503  1.00 30.69  ? 232 ARG C CA  1 
ATOM   2839 C C   . ARG C 2 232 ? 90.085  -75.002  -41.931  1.00 30.31  ? 232 ARG C C   1 
ATOM   2840 O O   . ARG C 2 232 ? 89.385  -74.620  -42.852  1.00 31.26  ? 232 ARG C O   1 
ATOM   2841 C CB  . ARG C 2 232 ? 89.996  -74.042  -39.570  1.00 29.28  ? 232 ARG C CB  1 
ATOM   2842 C CG  . ARG C 2 232 ? 89.852  -72.646  -40.123  1.00 29.44  ? 232 ARG C CG  1 
ATOM   2843 C CD  . ARG C 2 232 ? 90.222  -71.634  -39.056  1.00 29.70  ? 232 ARG C CD  1 
ATOM   2844 N NE  . ARG C 2 232 ? 89.164  -71.474  -38.071  1.00 29.18  ? 232 ARG C NE  1 
ATOM   2845 C CZ  . ARG C 2 232 ? 88.102  -70.684  -38.236  1.00 31.99  ? 232 ARG C CZ  1 
ATOM   2846 N NH1 . ARG C 2 232 ? 87.926  -69.994  -39.363  1.00 34.36  ? 232 ARG C NH1 1 
ATOM   2847 N NH2 . ARG C 2 232 ? 87.187  -70.596  -37.285  1.00 35.46  ? 232 ARG C NH2 1 
ATOM   2848 N N   . ARG C 2 233 ? 91.339  -75.399  -42.106  1.00 30.33  ? 233 ARG C N   1 
ATOM   2849 C CA  . ARG C 2 233 ? 91.977  -75.436  -43.413  1.00 31.10  ? 233 ARG C CA  1 
ATOM   2850 C C   . ARG C 2 233 ? 91.202  -76.287  -44.439  1.00 32.76  ? 233 ARG C C   1 
ATOM   2851 O O   . ARG C 2 233 ? 90.929  -75.821  -45.554  1.00 31.10  ? 233 ARG C O   1 
ATOM   2852 C CB  . ARG C 2 233 ? 93.401  -75.952  -43.255  1.00 32.52  ? 233 ARG C CB  1 
ATOM   2853 C CG  . ARG C 2 233 ? 94.249  -75.822  -44.518  1.00 33.66  ? 233 ARG C CG  1 
ATOM   2854 C CD  . ARG C 2 233 ? 95.652  -76.296  -44.279  1.00 35.26  ? 233 ARG C CD  1 
ATOM   2855 N NE  . ARG C 2 233 ? 95.699  -77.668  -43.802  1.00 37.04  ? 233 ARG C NE  1 
ATOM   2856 C CZ  . ARG C 2 233 ? 96.724  -78.209  -43.156  1.00 38.15  ? 233 ARG C CZ  1 
ATOM   2857 N NH1 . ARG C 2 233 ? 97.816  -77.496  -42.892  1.00 36.48  ? 233 ARG C NH1 1 
ATOM   2858 N NH2 . ARG C 2 233 ? 96.650  -79.481  -42.760  1.00 38.74  ? 233 ARG C NH2 1 
ATOM   2859 N N   . ARG C 2 234 ? 90.818  -77.504  -44.030  1.00 31.07  ? 234 ARG C N   1 
ATOM   2860 C CA  . ARG C 2 234 ? 90.061  -78.429  -44.874  1.00 32.66  ? 234 ARG C CA  1 
ATOM   2861 C C   . ARG C 2 234 ? 88.742  -77.807  -45.309  1.00 34.91  ? 234 ARG C C   1 
ATOM   2862 O O   . ARG C 2 234 ? 88.282  -78.039  -46.420  1.00 38.02  ? 234 ARG C O   1 
ATOM   2863 C CB  . ARG C 2 234 ? 89.804  -79.745  -44.123  1.00 33.13  ? 234 ARG C CB  1 
ATOM   2864 C CG  . ARG C 2 234 ? 89.353  -80.915  -44.976  1.00 35.65  ? 234 ARG C CG  1 
ATOM   2865 C CD  . ARG C 2 234 ? 88.878  -82.113  -44.148  1.00 36.20  ? 234 ARG C CD  1 
ATOM   2866 N NE  . ARG C 2 234 ? 87.620  -81.828  -43.474  1.00 41.34  ? 234 ARG C NE  1 
ATOM   2867 C CZ  . ARG C 2 234 ? 86.411  -81.856  -44.038  1.00 44.55  ? 234 ARG C CZ  1 
ATOM   2868 N NH1 . ARG C 2 234 ? 86.247  -82.187  -45.319  1.00 45.47  ? 234 ARG C NH1 1 
ATOM   2869 N NH2 . ARG C 2 234 ? 85.346  -81.537  -43.307  1.00 47.05  ? 234 ARG C NH2 1 
ATOM   2870 N N   . GLN C 2 235 ? 88.136  -77.008  -44.427  1.00 34.96  ? 235 GLN C N   1 
ATOM   2871 C CA  . GLN C 2 235 ? 86.860  -76.350  -44.720  1.00 34.53  ? 235 GLN C CA  1 
ATOM   2872 C C   . GLN C 2 235 ? 86.921  -75.068  -45.574  1.00 33.05  ? 235 GLN C C   1 
ATOM   2873 O O   . GLN C 2 235 ? 85.870  -74.541  -45.908  1.00 32.85  ? 235 GLN C O   1 
ATOM   2874 C CB  . GLN C 2 235 ? 86.163  -75.993  -43.411  1.00 36.86  ? 235 GLN C CB  1 
ATOM   2875 C CG  . GLN C 2 235 ? 85.608  -77.174  -42.651  1.00 39.34  ? 235 GLN C CG  1 
ATOM   2876 C CD  . GLN C 2 235 ? 84.268  -77.614  -43.177  1.00 42.56  ? 235 GLN C CD  1 
ATOM   2877 O OE1 . GLN C 2 235 ? 84.029  -77.626  -44.376  1.00 43.16  ? 235 GLN C OE1 1 
ATOM   2878 N NE2 . GLN C 2 235 ? 83.371  -77.944  -42.275  1.00 51.99  ? 235 GLN C NE2 1 
ATOM   2879 N N   . THR C 2 236 ? 88.111  -74.548  -45.889  1.00 31.30  ? 236 THR C N   1 
ATOM   2880 C CA  . THR C 2 236 ? 88.248  -73.313  -46.664  1.00 32.33  ? 236 THR C CA  1 
ATOM   2881 C C   . THR C 2 236 ? 87.316  -73.269  -47.877  1.00 32.16  ? 236 THR C C   1 
ATOM   2882 O O   . THR C 2 236 ? 86.543  -72.319  -48.024  1.00 32.97  ? 236 THR C O   1 
ATOM   2883 C CB  . THR C 2 236 ? 89.698  -73.100  -47.110  1.00 35.45  ? 236 THR C CB  1 
ATOM   2884 O OG1 . THR C 2 236 ? 90.541  -73.107  -45.953  1.00 38.49  ? 236 THR C OG1 1 
ATOM   2885 C CG2 . THR C 2 236 ? 89.880  -71.768  -47.856  1.00 37.60  ? 236 THR C CG2 1 
ATOM   2886 N N   . ILE C 2 237 ? 87.327  -74.326  -48.692  1.00 32.13  ? 237 ILE C N   1 
ATOM   2887 C CA  . ILE C 2 237 ? 86.521  -74.365  -49.942  1.00 31.32  ? 237 ILE C CA  1 
ATOM   2888 C C   . ILE C 2 237 ? 85.060  -74.821  -49.735  1.00 33.22  ? 237 ILE C C   1 
ATOM   2889 O O   . ILE C 2 237 ? 84.274  -74.933  -50.696  1.00 28.39  ? 237 ILE C O   1 
ATOM   2890 C CB  . ILE C 2 237 ? 87.218  -75.175  -51.062  1.00 31.11  ? 237 ILE C CB  1 
ATOM   2891 C CG1 . ILE C 2 237 ? 87.312  -76.664  -50.723  1.00 32.25  ? 237 ILE C CG1 1 
ATOM   2892 C CG2 . ILE C 2 237 ? 88.612  -74.633  -51.303  1.00 32.85  ? 237 ILE C CG2 1 
ATOM   2893 C CD1 . ILE C 2 237 ? 87.656  -77.541  -51.920  1.00 33.91  ? 237 ILE C CD1 1 
ATOM   2894 N N   . LEU C 2 238 ? 84.708  -75.076  -48.472  1.00 34.67  ? 238 LEU C N   1 
ATOM   2895 C CA  . LEU C 2 238 ? 83.434  -75.633  -48.086  1.00 35.38  ? 238 LEU C CA  1 
ATOM   2896 C C   . LEU C 2 238 ? 83.206  -76.924  -48.868  1.00 35.86  ? 238 LEU C C   1 
ATOM   2897 O O   . LEU C 2 238 ? 82.239  -77.033  -49.622  1.00 39.35  ? 238 LEU C O   1 
ATOM   2898 C CB  . LEU C 2 238 ? 82.335  -74.589  -48.274  1.00 38.47  ? 238 LEU C CB  1 
ATOM   2899 C CG  . LEU C 2 238 ? 81.267  -74.599  -47.182  1.00 42.77  ? 238 LEU C CG  1 
ATOM   2900 C CD1 . LEU C 2 238 ? 80.548  -73.278  -46.999  1.00 38.48  ? 238 LEU C CD1 1 
ATOM   2901 C CD2 . LEU C 2 238 ? 80.257  -75.705  -47.441  1.00 49.25  ? 238 LEU C CD2 1 
ATOM   2902 N N   . PRO C 2 239 ? 84.112  -77.925  -48.697  1.00 36.31  ? 239 PRO C N   1 
ATOM   2903 C CA  . PRO C 2 239 ? 84.126  -79.200  -49.468  1.00 38.22  ? 239 PRO C CA  1 
ATOM   2904 C C   . PRO C 2 239 ? 82.809  -80.027  -49.507  1.00 40.35  ? 239 PRO C C   1 
ATOM   2905 O O   . PRO C 2 239 ? 82.565  -80.803  -50.444  1.00 38.31  ? 239 PRO C O   1 
ATOM   2906 C CB  . PRO C 2 239 ? 85.233  -80.006  -48.779  1.00 37.13  ? 239 PRO C CB  1 
ATOM   2907 C CG  . PRO C 2 239 ? 85.353  -79.398  -47.425  1.00 36.43  ? 239 PRO C CG  1 
ATOM   2908 C CD  . PRO C 2 239 ? 85.167  -77.946  -47.681  1.00 36.18  ? 239 PRO C CD  1 
ATOM   2909 N N   . SER C 2 240 ? 81.966  -79.836  -48.512  1.00 40.34  ? 240 SER C N   1 
ATOM   2910 C CA  . SER C 2 240 ? 80.687  -80.514  -48.462  1.00 44.62  ? 240 SER C CA  1 
ATOM   2911 C C   . SER C 2 240 ? 79.813  -80.216  -49.682  1.00 43.05  ? 240 SER C C   1 
ATOM   2912 O O   . SER C 2 240 ? 79.006  -81.038  -50.087  1.00 43.04  ? 240 SER C O   1 
ATOM   2913 C CB  . SER C 2 240 ? 79.947  -80.111  -47.201  1.00 46.17  ? 240 SER C CB  1 
ATOM   2914 O OG  . SER C 2 240 ? 79.147  -81.185  -46.834  1.00 60.05  ? 240 SER C OG  1 
ATOM   2915 N N   . CYS C 2 241 ? 80.012  -79.029  -50.248  1.00 40.93  ? 241 CYS C N   1 
ATOM   2916 C CA  . CYS C 2 241 ? 79.371  -78.595  -51.459  1.00 39.23  ? 241 CYS C CA  1 
ATOM   2917 C C   . CYS C 2 241 ? 80.262  -78.692  -52.684  1.00 37.70  ? 241 CYS C C   1 
ATOM   2918 O O   . CYS C 2 241 ? 79.848  -79.207  -53.715  1.00 39.48  ? 241 CYS C O   1 
ATOM   2919 C CB  . CYS C 2 241 ? 78.988  -77.133  -51.295  1.00 42.17  ? 241 CYS C CB  1 
ATOM   2920 S SG  . CYS C 2 241 ? 78.322  -76.356  -52.790  1.00 50.50  ? 241 CYS C SG  1 
ATOM   2921 N N   . SER C 2 242 ? 81.463  -78.128  -52.578  1.00 38.17  ? 242 SER C N   1 
ATOM   2922 C CA  . SER C 2 242 ? 82.349  -77.952  -53.720  1.00 35.08  ? 242 SER C CA  1 
ATOM   2923 C C   . SER C 2 242 ? 83.216  -79.160  -54.099  1.00 36.17  ? 242 SER C C   1 
ATOM   2924 O O   . SER C 2 242 ? 83.707  -79.220  -55.210  1.00 37.87  ? 242 SER C O   1 
ATOM   2925 C CB  . SER C 2 242 ? 83.270  -76.778  -53.453  1.00 36.32  ? 242 SER C CB  1 
ATOM   2926 O OG  . SER C 2 242 ? 84.224  -77.107  -52.460  1.00 37.48  ? 242 SER C OG  1 
ATOM   2927 N N   . TYR C 2 243 ? 83.381  -80.118  -53.200  1.00 35.19  ? 243 TYR C N   1 
ATOM   2928 C CA  . TYR C 2 243 ? 84.375  -81.175  -53.379  1.00 35.16  ? 243 TYR C CA  1 
ATOM   2929 C C   . TYR C 2 243 ? 83.791  -82.587  -53.308  1.00 36.66  ? 243 TYR C C   1 
ATOM   2930 O O   . TYR C 2 243 ? 84.002  -83.370  -54.200  1.00 37.53  ? 243 TYR C O   1 
ATOM   2931 C CB  . TYR C 2 243 ? 85.447  -81.001  -52.304  1.00 33.59  ? 243 TYR C CB  1 
ATOM   2932 C CG  . TYR C 2 243 ? 86.528  -82.030  -52.292  1.00 33.74  ? 243 TYR C CG  1 
ATOM   2933 C CD1 . TYR C 2 243 ? 87.427  -82.135  -53.349  1.00 34.57  ? 243 TYR C CD1 1 
ATOM   2934 C CD2 . TYR C 2 243 ? 86.687  -82.877  -51.205  1.00 33.05  ? 243 TYR C CD2 1 
ATOM   2935 C CE1 . TYR C 2 243 ? 88.444  -83.066  -53.331  1.00 37.14  ? 243 TYR C CE1 1 
ATOM   2936 C CE2 . TYR C 2 243 ? 87.699  -83.810  -51.175  1.00 34.60  ? 243 TYR C CE2 1 
ATOM   2937 C CZ  . TYR C 2 243 ? 88.577  -83.906  -52.239  1.00 36.46  ? 243 TYR C CZ  1 
ATOM   2938 O OH  . TYR C 2 243 ? 89.582  -84.824  -52.220  1.00 36.08  ? 243 TYR C OH  1 
ATOM   2939 N N   . GLU C 2 244 ? 83.094  -82.896  -52.226  1.00 39.33  ? 244 GLU C N   1 
ATOM   2940 C CA  . GLU C 2 244 ? 82.523  -84.209  -52.004  1.00 44.99  ? 244 GLU C CA  1 
ATOM   2941 C C   . GLU C 2 244 ? 81.289  -84.425  -52.881  1.00 49.53  ? 244 GLU C C   1 
ATOM   2942 O O   . GLU C 2 244 ? 80.640  -83.487  -53.291  1.00 52.74  ? 244 GLU C O   1 
ATOM   2943 C CB  . GLU C 2 244 ? 82.139  -84.367  -50.543  1.00 45.43  ? 244 GLU C CB  1 
ATOM   2944 C CG  . GLU C 2 244 ? 83.289  -84.527  -49.569  1.00 50.38  ? 244 GLU C CG  1 
ATOM   2945 C CD  . GLU C 2 244 ? 82.841  -84.423  -48.121  1.00 56.78  ? 244 GLU C CD  1 
ATOM   2946 O OE1 . GLU C 2 244 ? 81.656  -84.749  -47.860  1.00 61.19  ? 244 GLU C OE1 1 
ATOM   2947 O OE2 . GLU C 2 244 ? 83.648  -83.979  -47.260  1.00 56.32  ? 244 GLU C OE2 1 
ATOM   2948 N N   . ASP C 2 245 ? 80.982  -85.680  -53.156  1.00 56.30  ? 245 ASP C N   1 
ATOM   2949 C CA  . ASP C 2 245 ? 79.808  -86.046  -53.946  1.00 61.49  ? 245 ASP C CA  1 
ATOM   2950 C C   . ASP C 2 245 ? 79.351  -87.437  -53.513  1.00 61.20  ? 245 ASP C C   1 
ATOM   2951 O O   . ASP C 2 245 ? 80.116  -88.191  -52.916  1.00 57.25  ? 245 ASP C O   1 
ATOM   2952 C CB  . ASP C 2 245 ? 80.131  -86.000  -55.448  1.00 65.64  ? 245 ASP C CB  1 
ATOM   2953 C CG  . ASP C 2 245 ? 78.867  -85.961  -56.342  1.00 76.21  ? 245 ASP C CG  1 
ATOM   2954 O OD1 . ASP C 2 245 ? 78.201  -87.013  -56.528  1.00 81.53  ? 245 ASP C OD1 1 
ATOM   2955 O OD2 . ASP C 2 245 ? 78.553  -84.877  -56.880  1.00 82.97  ? 245 ASP C OD2 1 
ATOM   2956 N N   . LYS C 2 246 ? 78.090  -87.744  -53.793  1.00 71.45  ? 246 LYS C N   1 
ATOM   2957 C CA  . LYS C 2 246 ? 77.515  -89.090  -53.592  1.00 73.54  ? 246 LYS C CA  1 
ATOM   2958 C C   . LYS C 2 246 ? 78.379  -90.187  -54.246  1.00 68.71  ? 246 LYS C C   1 
ATOM   2959 O O   . LYS C 2 246 ? 78.609  -91.226  -53.658  1.00 67.52  ? 246 LYS C O   1 
ATOM   2960 C CB  . LYS C 2 246 ? 76.085  -89.166  -54.159  1.00 83.62  ? 246 LYS C CB  1 
ATOM   2961 C CG  . LYS C 2 246 ? 75.136  -88.050  -53.706  1.00 99.53  ? 246 LYS C CG  1 
ATOM   2962 C CD  . LYS C 2 246 ? 73.677  -88.295  -54.113  1.00 108.08 ? 246 LYS C CD  1 
ATOM   2963 C CE  . LYS C 2 246 ? 72.925  -87.004  -54.468  1.00 108.52 ? 246 LYS C CE  1 
ATOM   2964 N NZ  . LYS C 2 246 ? 72.833  -86.020  -53.352  1.00 111.28 ? 246 LYS C NZ  1 
ATOM   2965 N N   . GLU C 2 247 ? 78.857  -89.940  -55.459  1.00 67.23  ? 247 GLU C N   1 
ATOM   2966 C CA  . GLU C 2 247 ? 79.756  -90.872  -56.137  1.00 69.17  ? 247 GLU C CA  1 
ATOM   2967 C C   . GLU C 2 247 ? 81.184  -90.375  -56.126  1.00 61.96  ? 247 GLU C C   1 
ATOM   2968 O O   . GLU C 2 247 ? 81.447  -89.179  -56.292  1.00 62.82  ? 247 GLU C O   1 
ATOM   2969 C CB  . GLU C 2 247 ? 79.328  -91.098  -57.590  1.00 80.31  ? 247 GLU C CB  1 
ATOM   2970 C CG  . GLU C 2 247 ? 77.899  -91.629  -57.736  1.00 94.32  ? 247 GLU C CG  1 
ATOM   2971 C CD  . GLU C 2 247 ? 77.811  -92.912  -58.557  1.00 108.37 ? 247 GLU C CD  1 
ATOM   2972 O OE1 . GLU C 2 247 ? 78.344  -92.965  -59.692  1.00 110.53 ? 247 GLU C OE1 1 
ATOM   2973 O OE2 . GLU C 2 247 ? 77.204  -93.881  -58.054  1.00 116.37 ? 247 GLU C OE2 1 
ATOM   2974 N N   . LYS C 2 248 ? 82.103  -91.309  -55.933  1.00 53.03  ? 248 LYS C N   1 
ATOM   2975 C CA  . LYS C 2 248 ? 83.517  -91.053  -56.072  1.00 51.52  ? 248 LYS C CA  1 
ATOM   2976 C C   . LYS C 2 248 ? 83.997  -91.745  -57.337  1.00 46.63  ? 248 LYS C C   1 
ATOM   2977 O O   . LYS C 2 248 ? 84.257  -92.932  -57.325  1.00 51.93  ? 248 LYS C O   1 
ATOM   2978 C CB  . LYS C 2 248 ? 84.243  -91.578  -54.850  1.00 50.86  ? 248 LYS C CB  1 
ATOM   2979 C CG  . LYS C 2 248 ? 85.632  -91.001  -54.644  1.00 50.84  ? 248 LYS C CG  1 
ATOM   2980 C CD  . LYS C 2 248 ? 86.075  -91.246  -53.209  1.00 48.87  ? 248 LYS C CD  1 
ATOM   2981 C CE  . LYS C 2 248 ? 87.218  -90.352  -52.822  1.00 53.77  ? 248 LYS C CE  1 
ATOM   2982 N NZ  . LYS C 2 248 ? 87.626  -90.649  -51.431  1.00 57.41  ? 248 LYS C NZ  1 
ATOM   2983 N N   . PRO C 2 249 ? 84.124  -91.008  -58.439  1.00 46.20  ? 249 PRO C N   1 
ATOM   2984 C CA  . PRO C 2 249 ? 84.500  -91.696  -59.683  1.00 44.42  ? 249 PRO C CA  1 
ATOM   2985 C C   . PRO C 2 249 ? 85.928  -92.189  -59.691  1.00 45.64  ? 249 PRO C C   1 
ATOM   2986 O O   . PRO C 2 249 ? 86.717  -91.860  -58.801  1.00 47.51  ? 249 PRO C O   1 
ATOM   2987 C CB  . PRO C 2 249 ? 84.337  -90.617  -60.745  1.00 43.71  ? 249 PRO C CB  1 
ATOM   2988 C CG  . PRO C 2 249 ? 84.593  -89.341  -60.007  1.00 46.21  ? 249 PRO C CG  1 
ATOM   2989 C CD  . PRO C 2 249 ? 84.139  -89.542  -58.586  1.00 44.10  ? 249 PRO C CD  1 
ATOM   2990 N N   . ASN C 2 250 ? 86.234  -92.983  -60.706  1.00 47.66  ? 250 ASN C N   1 
ATOM   2991 C CA  . ASN C 2 250 ? 87.588  -93.377  -61.029  1.00 46.06  ? 250 ASN C CA  1 
ATOM   2992 C C   . ASN C 2 250 ? 88.317  -92.147  -61.558  1.00 43.39  ? 250 ASN C C   1 
ATOM   2993 O O   . ASN C 2 250 ? 87.734  -91.338  -62.271  1.00 43.51  ? 250 ASN C O   1 
ATOM   2994 C CB  . ASN C 2 250 ? 87.554  -94.490  -62.089  1.00 50.28  ? 250 ASN C CB  1 
ATOM   2995 C CG  . ASN C 2 250 ? 88.938  -94.956  -62.517  1.00 51.12  ? 250 ASN C CG  1 
ATOM   2996 O OD1 . ASN C 2 250 ? 89.452  -94.512  -63.533  1.00 48.39  ? 250 ASN C OD1 1 
ATOM   2997 N ND2 . ASN C 2 250 ? 89.543  -95.849  -61.739  1.00 55.41  ? 250 ASN C ND2 1 
ATOM   2998 N N   . CYS C 2 251 ? 89.592  -92.024  -61.215  1.00 44.69  ? 251 CYS C N   1 
ATOM   2999 C CA  . CYS C 2 251 ? 90.378  -90.837  -61.545  1.00 46.02  ? 251 CYS C CA  1 
ATOM   3000 C C   . CYS C 2 251 ? 90.527  -90.562  -63.038  1.00 46.65  ? 251 CYS C C   1 
ATOM   3001 O O   . CYS C 2 251 ? 90.479  -89.403  -63.451  1.00 47.79  ? 251 CYS C O   1 
ATOM   3002 C CB  . CYS C 2 251 ? 91.751  -90.924  -60.910  1.00 47.81  ? 251 CYS C CB  1 
ATOM   3003 S SG  . CYS C 2 251 ? 91.738  -90.755  -59.107  1.00 53.99  ? 251 CYS C SG  1 
ATOM   3004 N N   . LEU C 2 252 ? 90.730  -91.612  -63.836  1.00 47.04  ? 252 LEU C N   1 
ATOM   3005 C CA  . LEU C 2 252 ? 90.808  -91.467  -65.301  1.00 44.68  ? 252 LEU C CA  1 
ATOM   3006 C C   . LEU C 2 252 ? 89.472  -91.096  -65.939  1.00 43.14  ? 252 LEU C C   1 
ATOM   3007 O O   . LEU C 2 252 ? 89.439  -90.369  -66.926  1.00 47.37  ? 252 LEU C O   1 
ATOM   3008 C CB  . LEU C 2 252 ? 91.415  -92.721  -65.939  1.00 45.10  ? 252 LEU C CB  1 
ATOM   3009 C CG  . LEU C 2 252 ? 92.866  -93.017  -65.497  1.00 48.20  ? 252 LEU C CG  1 
ATOM   3010 C CD1 . LEU C 2 252 ? 93.441  -94.180  -66.281  1.00 50.82  ? 252 LEU C CD1 1 
ATOM   3011 C CD2 . LEU C 2 252 ? 93.824  -91.827  -65.608  1.00 46.99  ? 252 LEU C CD2 1 
ATOM   3012 N N   . ASP C 2 253 ? 88.362  -91.555  -65.371  1.00 46.91  ? 253 ASP C N   1 
ATOM   3013 C CA  . ASP C 2 253 ? 87.042  -91.093  -65.841  1.00 50.68  ? 253 ASP C CA  1 
ATOM   3014 C C   . ASP C 2 253 ? 86.852  -89.601  -65.546  1.00 50.50  ? 253 ASP C C   1 
ATOM   3015 O O   . ASP C 2 253 ? 86.368  -88.864  -66.396  1.00 55.36  ? 253 ASP C O   1 
ATOM   3016 C CB  . ASP C 2 253 ? 85.890  -91.911  -65.213  1.00 53.62  ? 253 ASP C CB  1 
ATOM   3017 C CG  . ASP C 2 253 ? 85.915  -93.402  -65.618  1.00 59.07  ? 253 ASP C CG  1 
ATOM   3018 O OD1 . ASP C 2 253 ? 86.518  -93.747  -66.642  1.00 60.36  ? 253 ASP C OD1 1 
ATOM   3019 O OD2 . ASP C 2 253 ? 85.335  -94.247  -64.895  1.00 65.82  ? 253 ASP C OD2 1 
ATOM   3020 N N   . LEU C 2 254 ? 87.238  -89.177  -64.335  1.00 47.63  ? 254 LEU C N   1 
ATOM   3021 C CA  . LEU C 2 254 ? 87.185  -87.781  -63.936  1.00 44.70  ? 254 LEU C CA  1 
ATOM   3022 C C   . LEU C 2 254 ? 88.045  -86.919  -64.830  1.00 43.76  ? 254 LEU C C   1 
ATOM   3023 O O   . LEU C 2 254 ? 87.607  -85.851  -65.287  1.00 43.61  ? 254 LEU C O   1 
ATOM   3024 C CB  . LEU C 2 254 ? 87.626  -87.596  -62.479  1.00 45.45  ? 254 LEU C CB  1 
ATOM   3025 C CG  . LEU C 2 254 ? 87.439  -86.180  -61.899  1.00 46.51  ? 254 LEU C CG  1 
ATOM   3026 C CD1 . LEU C 2 254 ? 86.013  -85.679  -62.110  1.00 48.53  ? 254 LEU C CD1 1 
ATOM   3027 C CD2 . LEU C 2 254 ? 87.799  -86.085  -60.425  1.00 45.68  ? 254 LEU C CD2 1 
ATOM   3028 N N   . ARG C 2 255 ? 89.266  -87.381  -65.078  1.00 41.19  ? 255 ARG C N   1 
ATOM   3029 C CA  . ARG C 2 255 ? 90.129  -86.729  -66.056  1.00 42.32  ? 255 ARG C CA  1 
ATOM   3030 C C   . ARG C 2 255 ? 89.442  -86.559  -67.388  1.00 43.50  ? 255 ARG C C   1 
ATOM   3031 O O   . ARG C 2 255 ? 89.512  -85.489  -67.998  1.00 47.30  ? 255 ARG C O   1 
ATOM   3032 C CB  . ARG C 2 255 ? 91.437  -87.482  -66.245  1.00 42.08  ? 255 ARG C CB  1 
ATOM   3033 C CG  . ARG C 2 255 ? 92.488  -86.660  -66.989  1.00 43.45  ? 255 ARG C CG  1 
ATOM   3034 C CD  . ARG C 2 255 ? 93.787  -87.408  -67.209  1.00 43.79  ? 255 ARG C CD  1 
ATOM   3035 N NE  . ARG C 2 255 ? 93.603  -88.517  -68.139  1.00 50.53  ? 255 ARG C NE  1 
ATOM   3036 C CZ  . ARG C 2 255 ? 94.528  -89.413  -68.463  1.00 52.92  ? 255 ARG C CZ  1 
ATOM   3037 N NH1 . ARG C 2 255 ? 95.753  -89.369  -67.933  1.00 56.83  ? 255 ARG C NH1 1 
ATOM   3038 N NH2 . ARG C 2 255 ? 94.211  -90.384  -69.305  1.00 54.81  ? 255 ARG C NH2 1 
ATOM   3039 N N   . GLY C 2 256 ? 88.776  -87.619  -67.831  1.00 45.93  ? 256 GLY C N   1 
ATOM   3040 C CA  . GLY C 2 256 ? 88.029  -87.606  -69.093  1.00 46.66  ? 256 GLY C CA  1 
ATOM   3041 C C   . GLY C 2 256 ? 86.995  -86.499  -69.094  1.00 46.89  ? 256 GLY C C   1 
ATOM   3042 O O   . GLY C 2 256 ? 86.945  -85.694  -70.015  1.00 44.47  ? 256 GLY C O   1 
ATOM   3043 N N   . VAL C 2 257 ? 86.200  -86.440  -68.029  1.00 46.35  ? 257 VAL C N   1 
ATOM   3044 C CA  . VAL C 2 257 ? 85.181  -85.382  -67.882  1.00 50.99  ? 257 VAL C CA  1 
ATOM   3045 C C   . VAL C 2 257 ? 85.829  -84.005  -67.848  1.00 49.26  ? 257 VAL C C   1 
ATOM   3046 O O   . VAL C 2 257 ? 85.347  -83.074  -68.486  1.00 53.25  ? 257 VAL C O   1 
ATOM   3047 C CB  . VAL C 2 257 ? 84.295  -85.583  -66.623  1.00 51.25  ? 257 VAL C CB  1 
ATOM   3048 C CG1 . VAL C 2 257 ? 83.380  -84.396  -66.389  1.00 50.43  ? 257 VAL C CG1 1 
ATOM   3049 C CG2 . VAL C 2 257 ? 83.463  -86.854  -66.740  1.00 51.07  ? 257 VAL C CG2 1 
ATOM   3050 N N   . CYS C 2 258 ? 86.926  -83.882  -67.115  1.00 48.26  ? 258 CYS C N   1 
ATOM   3051 C CA  . CYS C 2 258 ? 87.622  -82.596  -67.030  1.00 50.05  ? 258 CYS C CA  1 
ATOM   3052 C C   . CYS C 2 258 ? 88.134  -82.150  -68.398  1.00 46.83  ? 258 CYS C C   1 
ATOM   3053 O O   . CYS C 2 258 ? 88.033  -80.976  -68.737  1.00 44.52  ? 258 CYS C O   1 
ATOM   3054 C CB  . CYS C 2 258 ? 88.774  -82.664  -66.014  1.00 50.67  ? 258 CYS C CB  1 
ATOM   3055 S SG  . CYS C 2 258 ? 89.840  -81.204  -65.902  1.00 54.00  ? 258 CYS C SG  1 
ATOM   3056 N N   . ARG C 2 259 ? 88.666  -83.076  -69.187  1.00 45.77  ? 259 ARG C N   1 
ATOM   3057 C CA  . ARG C 2 259 ? 89.209  -82.689  -70.500  1.00 51.40  ? 259 ARG C CA  1 
ATOM   3058 C C   . ARG C 2 259 ? 88.149  -82.304  -71.550  1.00 49.84  ? 259 ARG C C   1 
ATOM   3059 O O   . ARG C 2 259 ? 88.493  -81.641  -72.517  1.00 54.81  ? 259 ARG C O   1 
ATOM   3060 C CB  . ARG C 2 259 ? 90.250  -83.689  -71.020  1.00 50.45  ? 259 ARG C CB  1 
ATOM   3061 C CG  . ARG C 2 259 ? 91.352  -83.900  -69.996  1.00 55.13  ? 259 ARG C CG  1 
ATOM   3062 C CD  . ARG C 2 259 ? 92.777  -83.783  -70.490  1.00 56.62  ? 259 ARG C CD  1 
ATOM   3063 N NE  . ARG C 2 259 ? 93.402  -85.089  -70.550  1.00 62.17  ? 259 ARG C NE  1 
ATOM   3064 C CZ  . ARG C 2 259 ? 94.665  -85.390  -70.230  1.00 65.85  ? 259 ARG C CZ  1 
ATOM   3065 N NH1 . ARG C 2 259 ? 95.538  -84.483  -69.783  1.00 60.23  ? 259 ARG C NH1 1 
ATOM   3066 N NH2 . ARG C 2 259 ? 95.055  -86.659  -70.355  1.00 71.37  ? 259 ARG C NH2 1 
ATOM   3067 N N   . THR C 2 260 ? 86.877  -82.656  -71.329  1.00 47.42  ? 260 THR C N   1 
ATOM   3068 C CA  . THR C 2 260 ? 85.786  -82.161  -72.181  1.00 49.51  ? 260 THR C CA  1 
ATOM   3069 C C   . THR C 2 260 ? 85.345  -80.713  -71.869  1.00 50.16  ? 260 THR C C   1 
ATOM   3070 O O   . THR C 2 260 ? 84.558  -80.148  -72.613  1.00 52.01  ? 260 THR C O   1 
ATOM   3071 C CB  . THR C 2 260 ? 84.508  -83.046  -72.147  1.00 53.08  ? 260 THR C CB  1 
ATOM   3072 O OG1 . THR C 2 260 ? 83.728  -82.749  -70.978  1.00 60.14  ? 260 THR C OG1 1 
ATOM   3073 C CG2 . THR C 2 260 ? 84.838  -84.541  -72.216  1.00 51.96  ? 260 THR C CG2 1 
ATOM   3074 N N   . ASP C 2 261 ? 85.793  -80.141  -70.759  1.00 48.36  ? 261 ASP C N   1 
ATOM   3075 C CA  . ASP C 2 261 ? 85.485  -78.745  -70.420  1.00 46.97  ? 261 ASP C CA  1 
ATOM   3076 C C   . ASP C 2 261 ? 86.733  -77.896  -70.672  1.00 45.01  ? 261 ASP C C   1 
ATOM   3077 O O   . ASP C 2 261 ? 87.781  -78.193  -70.127  1.00 43.87  ? 261 ASP C O   1 
ATOM   3078 C CB  . ASP C 2 261 ? 85.078  -78.651  -68.951  1.00 47.72  ? 261 ASP C CB  1 
ATOM   3079 C CG  . ASP C 2 261 ? 84.700  -77.252  -68.541  1.00 53.16  ? 261 ASP C CG  1 
ATOM   3080 O OD1 . ASP C 2 261 ? 83.498  -76.944  -68.670  1.00 65.61  ? 261 ASP C OD1 1 
ATOM   3081 O OD2 . ASP C 2 261 ? 85.570  -76.464  -68.083  1.00 53.32  ? 261 ASP C OD2 1 
ATOM   3082 N N   . HIS C 2 262 ? 86.613  -76.838  -71.474  1.00 43.40  ? 262 HIS C N   1 
ATOM   3083 C CA  . HIS C 2 262 ? 87.772  -76.042  -71.902  1.00 43.09  ? 262 HIS C CA  1 
ATOM   3084 C C   . HIS C 2 262 ? 88.593  -75.421  -70.759  1.00 42.91  ? 262 HIS C C   1 
ATOM   3085 O O   . HIS C 2 262 ? 89.816  -75.372  -70.816  1.00 43.41  ? 262 HIS C O   1 
ATOM   3086 C CB  . HIS C 2 262 ? 87.316  -74.953  -72.861  1.00 47.26  ? 262 HIS C CB  1 
ATOM   3087 C CG  . HIS C 2 262 ? 86.806  -75.489  -74.156  1.00 51.75  ? 262 HIS C CG  1 
ATOM   3088 N ND1 . HIS C 2 262 ? 87.624  -76.106  -75.075  1.00 51.69  ? 262 HIS C ND1 1 
ATOM   3089 C CD2 . HIS C 2 262 ? 85.560  -75.534  -74.672  1.00 52.91  ? 262 HIS C CD2 1 
ATOM   3090 C CE1 . HIS C 2 262 ? 86.901  -76.515  -76.098  1.00 51.38  ? 262 HIS C CE1 1 
ATOM   3091 N NE2 . HIS C 2 262 ? 85.648  -76.171  -75.882  1.00 51.10  ? 262 HIS C NE2 1 
ATOM   3092 N N   . LEU C 2 263 ? 87.899  -74.965  -69.727  1.00 43.88  ? 263 LEU C N   1 
ATOM   3093 C CA  . LEU C 2 263 ? 88.526  -74.345  -68.561  1.00 44.59  ? 263 LEU C CA  1 
ATOM   3094 C C   . LEU C 2 263 ? 89.241  -75.366  -67.685  1.00 41.13  ? 263 LEU C C   1 
ATOM   3095 O O   . LEU C 2 263 ? 90.430  -75.223  -67.393  1.00 41.42  ? 263 LEU C O   1 
ATOM   3096 C CB  . LEU C 2 263 ? 87.498  -73.558  -67.732  1.00 43.24  ? 263 LEU C CB  1 
ATOM   3097 C CG  . LEU C 2 263 ? 87.489  -72.070  -68.061  1.00 46.25  ? 263 LEU C CG  1 
ATOM   3098 C CD1 . LEU C 2 263 ? 86.189  -71.431  -67.613  1.00 50.97  ? 263 LEU C CD1 1 
ATOM   3099 C CD2 . LEU C 2 263 ? 88.700  -71.379  -67.455  1.00 44.33  ? 263 LEU C CD2 1 
ATOM   3100 N N   . CYS C 2 264 ? 88.511  -76.388  -67.268  1.00 40.03  ? 264 CYS C N   1 
ATOM   3101 C CA  . CYS C 2 264 ? 89.078  -77.461  -66.450  1.00 40.21  ? 264 CYS C CA  1 
ATOM   3102 C C   . CYS C 2 264 ? 90.292  -78.099  -67.099  1.00 39.18  ? 264 CYS C C   1 
ATOM   3103 O O   . CYS C 2 264 ? 91.307  -78.290  -66.464  1.00 40.83  ? 264 CYS C O   1 
ATOM   3104 C CB  . CYS C 2 264 ? 88.055  -78.552  -66.185  1.00 43.32  ? 264 CYS C CB  1 
ATOM   3105 S SG  . CYS C 2 264 ? 88.630  -79.744  -64.938  1.00 50.18  ? 264 CYS C SG  1 
ATOM   3106 N N   . ARG C 2 265 ? 90.167  -78.418  -68.377  1.00 40.30  ? 265 ARG C N   1 
ATOM   3107 C CA  . ARG C 2 265 ? 91.249  -78.999  -69.165  1.00 37.37  ? 265 ARG C CA  1 
ATOM   3108 C C   . ARG C 2 265 ? 92.520  -78.155  -69.142  1.00 36.56  ? 265 ARG C C   1 
ATOM   3109 O O   . ARG C 2 265 ? 93.651  -78.668  -69.028  1.00 35.06  ? 265 ARG C O   1 
ATOM   3110 C CB  . ARG C 2 265 ? 90.781  -79.131  -70.596  1.00 39.21  ? 265 ARG C CB  1 
ATOM   3111 C CG  . ARG C 2 265 ? 91.698  -79.954  -71.461  1.00 42.98  ? 265 ARG C CG  1 
ATOM   3112 C CD  . ARG C 2 265 ? 91.260  -79.855  -72.893  1.00 41.41  ? 265 ARG C CD  1 
ATOM   3113 N NE  . ARG C 2 265 ? 92.129  -80.669  -73.713  1.00 45.75  ? 265 ARG C NE  1 
ATOM   3114 C CZ  . ARG C 2 265 ? 91.946  -80.915  -75.008  1.00 43.35  ? 265 ARG C CZ  1 
ATOM   3115 N NH1 . ARG C 2 265 ? 90.919  -80.391  -75.650  1.00 41.28  ? 265 ARG C NH1 1 
ATOM   3116 N NH2 . ARG C 2 265 ? 92.824  -81.663  -75.658  1.00 40.25  ? 265 ARG C NH2 1 
ATOM   3117 N N   . SER C 2 266 ? 92.314  -76.857  -69.274  1.00 33.55  ? 266 SER C N   1 
ATOM   3118 C CA  . SER C 2 266 ? 93.400  -75.922  -69.314  1.00 35.10  ? 266 SER C CA  1 
ATOM   3119 C C   . SER C 2 266 ? 94.038  -75.743  -67.943  1.00 33.93  ? 266 SER C C   1 
ATOM   3120 O O   . SER C 2 266 ? 95.267  -75.600  -67.840  1.00 33.67  ? 266 SER C O   1 
ATOM   3121 C CB  . SER C 2 266 ? 92.891  -74.560  -69.797  1.00 36.43  ? 266 SER C CB  1 
ATOM   3122 O OG  . SER C 2 266 ? 92.229  -74.682  -71.009  1.00 34.16  ? 266 SER C OG  1 
ATOM   3123 N N   . ARG C 2 267 ? 93.196  -75.662  -66.914  1.00 33.20  ? 267 ARG C N   1 
ATOM   3124 C CA  . ARG C 2 267 ? 93.685  -75.549  -65.521  1.00 34.34  ? 267 ARG C CA  1 
ATOM   3125 C C   . ARG C 2 267 ? 94.445  -76.787  -65.104  1.00 31.46  ? 267 ARG C C   1 
ATOM   3126 O O   . ARG C 2 267 ? 95.453  -76.674  -64.420  1.00 35.59  ? 267 ARG C O   1 
ATOM   3127 C CB  . ARG C 2 267 ? 92.549  -75.288  -64.535  1.00 33.91  ? 267 ARG C CB  1 
ATOM   3128 C CG  . ARG C 2 267 ? 91.835  -73.965  -64.753  1.00 36.34  ? 267 ARG C CG  1 
ATOM   3129 C CD  . ARG C 2 267 ? 92.777  -72.781  -64.615  1.00 35.65  ? 267 ARG C CD  1 
ATOM   3130 N NE  . ARG C 2 267 ? 92.105  -71.560  -65.003  1.00 39.04  ? 267 ARG C NE  1 
ATOM   3131 C CZ  . ARG C 2 267 ? 91.325  -70.812  -64.218  1.00 41.86  ? 267 ARG C CZ  1 
ATOM   3132 N NH1 . ARG C 2 267 ? 91.062  -71.143  -62.954  1.00 43.73  ? 267 ARG C NH1 1 
ATOM   3133 N NH2 . ARG C 2 267 ? 90.793  -69.712  -64.716  1.00 39.88  ? 267 ARG C NH2 1 
ATOM   3134 N N   . LEU C 2 268 ? 93.990  -77.948  -65.566  1.00 31.87  ? 268 LEU C N   1 
ATOM   3135 C CA  . LEU C 2 268 ? 94.684  -79.212  -65.308  1.00 34.81  ? 268 LEU C CA  1 
ATOM   3136 C C   . LEU C 2 268 ? 96.038  -79.225  -65.981  1.00 35.60  ? 268 LEU C C   1 
ATOM   3137 O O   . LEU C 2 268 ? 97.030  -79.618  -65.382  1.00 36.77  ? 268 LEU C O   1 
ATOM   3138 C CB  . LEU C 2 268 ? 93.867  -80.398  -65.793  1.00 35.01  ? 268 LEU C CB  1 
ATOM   3139 C CG  . LEU C 2 268 ? 94.543  -81.756  -65.598  1.00 38.58  ? 268 LEU C CG  1 
ATOM   3140 C CD1 . LEU C 2 268 ? 94.702  -82.089  -64.113  1.00 38.88  ? 268 LEU C CD1 1 
ATOM   3141 C CD2 . LEU C 2 268 ? 93.761  -82.843  -66.321  1.00 35.49  ? 268 LEU C CD2 1 
ATOM   3142 N N   . ALA C 2 269 ? 96.072  -78.776  -67.227  1.00 36.00  ? 269 ALA C N   1 
ATOM   3143 C CA  . ALA C 2 269 ? 97.308  -78.745  -67.972  1.00 35.63  ? 269 ALA C CA  1 
ATOM   3144 C C   . ALA C 2 269 ? 98.278  -77.742  -67.352  1.00 36.27  ? 269 ALA C C   1 
ATOM   3145 O O   . ALA C 2 269 ? 99.484  -77.991  -67.310  1.00 37.98  ? 269 ALA C O   1 
ATOM   3146 C CB  . ALA C 2 269 ? 97.026  -78.414  -69.426  1.00 38.36  ? 269 ALA C CB  1 
ATOM   3147 N N   . ASP C 2 270 ? 97.759  -76.623  -66.847  1.00 34.74  ? 270 ASP C N   1 
ATOM   3148 C CA  . ASP C 2 270 ? 98.608  -75.644  -66.165  1.00 32.46  ? 270 ASP C CA  1 
ATOM   3149 C C   . ASP C 2 270 ? 99.187  -76.167  -64.834  1.00 32.78  ? 270 ASP C C   1 
ATOM   3150 O O   . ASP C 2 270 ? 100.323 -75.846  -64.484  1.00 35.18  ? 270 ASP C O   1 
ATOM   3151 C CB  . ASP C 2 270 ? 97.839  -74.378  -65.924  1.00 35.01  ? 270 ASP C CB  1 
ATOM   3152 C CG  . ASP C 2 270 ? 98.733  -73.171  -65.782  1.00 37.61  ? 270 ASP C CG  1 
ATOM   3153 O OD1 . ASP C 2 270 ? 99.669  -73.023  -66.587  1.00 40.30  ? 270 ASP C OD1 1 
ATOM   3154 O OD2 . ASP C 2 270 ? 98.478  -72.354  -64.870  1.00 40.08  ? 270 ASP C OD2 1 
ATOM   3155 N N   . PHE C 2 271 ? 98.404  -76.959  -64.104  1.00 32.85  ? 271 PHE C N   1 
ATOM   3156 C CA  . PHE C 2 271 ? 98.862  -77.677  -62.889  1.00 31.98  ? 271 PHE C CA  1 
ATOM   3157 C C   . PHE C 2 271 ? 99.930  -78.711  -63.230  1.00 32.14  ? 271 PHE C C   1 
ATOM   3158 O O   . PHE C 2 271 ? 100.975 -78.774  -62.591  1.00 30.06  ? 271 PHE C O   1 
ATOM   3159 C CB  . PHE C 2 271 ? 97.668  -78.349  -62.167  1.00 32.50  ? 271 PHE C CB  1 
ATOM   3160 C CG  . PHE C 2 271 ? 98.068  -79.320  -61.101  1.00 31.86  ? 271 PHE C CG  1 
ATOM   3161 C CD1 . PHE C 2 271 ? 98.482  -78.872  -59.873  1.00 35.06  ? 271 PHE C CD1 1 
ATOM   3162 C CD2 . PHE C 2 271 ? 98.059  -80.678  -61.344  1.00 34.69  ? 271 PHE C CD2 1 
ATOM   3163 C CE1 . PHE C 2 271 ? 98.883  -79.755  -58.882  1.00 36.50  ? 271 PHE C CE1 1 
ATOM   3164 C CE2 . PHE C 2 271 ? 98.447  -81.578  -60.358  1.00 37.41  ? 271 PHE C CE2 1 
ATOM   3165 C CZ  . PHE C 2 271 ? 98.873  -81.115  -59.128  1.00 35.75  ? 271 PHE C CZ  1 
ATOM   3166 N N   . HIS C 2 272 ? 99.679  -79.507  -64.259  1.00 33.29  ? 272 HIS C N   1 
ATOM   3167 C CA  . HIS C 2 272 ? 100.700 -80.422  -64.746  1.00 33.27  ? 272 HIS C CA  1 
ATOM   3168 C C   . HIS C 2 272 ? 102.000 -79.727  -65.135  1.00 34.31  ? 272 HIS C C   1 
ATOM   3169 O O   . HIS C 2 272 ? 103.051 -80.260  -64.890  1.00 39.37  ? 272 HIS C O   1 
ATOM   3170 C CB  . HIS C 2 272 ? 100.171 -81.241  -65.906  1.00 32.92  ? 272 HIS C CB  1 
ATOM   3171 C CG  . HIS C 2 272 ? 99.266  -82.362  -65.507  1.00 31.23  ? 272 HIS C CG  1 
ATOM   3172 N ND1 . HIS C 2 272 ? 98.298  -82.864  -66.353  1.00 35.55  ? 272 HIS C ND1 1 
ATOM   3173 C CD2 . HIS C 2 272 ? 99.213  -83.120  -64.388  1.00 32.41  ? 272 HIS C CD2 1 
ATOM   3174 C CE1 . HIS C 2 272 ? 97.658  -83.854  -65.754  1.00 35.21  ? 272 HIS C CE1 1 
ATOM   3175 N NE2 . HIS C 2 272 ? 98.201  -84.034  -64.563  1.00 35.17  ? 272 HIS C NE2 1 
ATOM   3176 N N   . ALA C 2 273 ? 101.937 -78.530  -65.695  1.00 35.26  ? 273 ALA C N   1 
ATOM   3177 C CA  . ALA C 2 273 ? 103.160 -77.843  -66.126  1.00 35.33  ? 273 ALA C CA  1 
ATOM   3178 C C   . ALA C 2 273 ? 103.928 -77.268  -64.951  1.00 36.13  ? 273 ALA C C   1 
ATOM   3179 O O   . ALA C 2 273 ? 105.134 -77.320  -64.940  1.00 41.55  ? 273 ALA C O   1 
ATOM   3180 C CB  . ALA C 2 273 ? 102.834 -76.744  -67.125  1.00 34.24  ? 273 ALA C CB  1 
ATOM   3181 N N   . ASN C 2 274 ? 103.236 -76.695  -63.976  1.00 36.60  ? 274 ASN C N   1 
ATOM   3182 C CA  . ASN C 2 274 ? 103.906 -75.984  -62.897  1.00 36.94  ? 274 ASN C CA  1 
ATOM   3183 C C   . ASN C 2 274 ? 104.144 -76.761  -61.618  1.00 39.19  ? 274 ASN C C   1 
ATOM   3184 O O   . ASN C 2 274 ? 104.963 -76.337  -60.808  1.00 41.69  ? 274 ASN C O   1 
ATOM   3185 C CB  . ASN C 2 274 ? 103.174 -74.694  -62.591  1.00 38.67  ? 274 ASN C CB  1 
ATOM   3186 C CG  . ASN C 2 274 ? 103.244 -73.699  -63.745  1.00 41.27  ? 274 ASN C CG  1 
ATOM   3187 O OD1 . ASN C 2 274 ? 102.247 -73.122  -64.114  1.00 42.59  ? 274 ASN C OD1 1 
ATOM   3188 N ND2 . ASN C 2 274 ? 104.427 -73.479  -64.291  1.00 42.25  ? 274 ASN C ND2 1 
ATOM   3189 N N   . CYS C 2 275 ? 103.460 -77.891  -61.445  1.00 37.45  ? 275 CYS C N   1 
ATOM   3190 C CA  . CYS C 2 275 ? 103.644 -78.743  -60.267  1.00 38.99  ? 275 CYS C CA  1 
ATOM   3191 C C   . CYS C 2 275 ? 104.232 -80.120  -60.588  1.00 39.97  ? 275 CYS C C   1 
ATOM   3192 O O   . CYS C 2 275 ? 104.410 -80.936  -59.693  1.00 40.68  ? 275 CYS C O   1 
ATOM   3193 C CB  . CYS C 2 275 ? 102.325 -78.905  -59.511  1.00 39.13  ? 275 CYS C CB  1 
ATOM   3194 S SG  . CYS C 2 275 ? 101.576 -77.381  -58.898  1.00 40.10  ? 275 CYS C SG  1 
ATOM   3195 N N   . ARG C 2 276 ? 104.600 -80.360  -61.840  1.00 45.36  ? 276 ARG C N   1 
ATOM   3196 C CA  . ARG C 2 276 ? 105.281 -81.597  -62.223  1.00 49.93  ? 276 ARG C CA  1 
ATOM   3197 C C   . ARG C 2 276 ? 106.594 -81.728  -61.479  1.00 46.05  ? 276 ARG C C   1 
ATOM   3198 O O   . ARG C 2 276 ? 107.419 -80.829  -61.545  1.00 41.31  ? 276 ARG C O   1 
ATOM   3199 C CB  . ARG C 2 276 ? 105.581 -81.591  -63.711  1.00 61.97  ? 276 ARG C CB  1 
ATOM   3200 C CG  . ARG C 2 276 ? 105.830 -82.975  -64.274  1.00 68.99  ? 276 ARG C CG  1 
ATOM   3201 C CD  . ARG C 2 276 ? 104.883 -83.302  -65.414  1.00 79.49  ? 276 ARG C CD  1 
ATOM   3202 N NE  . ARG C 2 276 ? 105.598 -83.515  -66.677  1.00 89.81  ? 276 ARG C NE  1 
ATOM   3203 C CZ  . ARG C 2 276 ? 105.419 -82.832  -67.812  1.00 89.10  ? 276 ARG C CZ  1 
ATOM   3204 N NH1 . ARG C 2 276 ? 104.520 -81.843  -67.915  1.00 85.93  ? 276 ARG C NH1 1 
ATOM   3205 N NH2 . ARG C 2 276 ? 106.150 -83.161  -68.876  1.00 88.34  ? 276 ARG C NH2 1 
ATOM   3206 N N   . ALA C 2 277 ? 106.766 -82.829  -60.756  1.00 42.43  ? 277 ALA C N   1 
ATOM   3207 C CA  . ALA C 2 277 ? 107.946 -83.028  -59.932  1.00 40.34  ? 277 ALA C CA  1 
ATOM   3208 C C   . ALA C 2 277 ? 109.180 -83.239  -60.796  1.00 40.99  ? 277 ALA C C   1 
ATOM   3209 O O   . ALA C 2 277 ? 109.122 -83.922  -61.799  1.00 43.52  ? 277 ALA C O   1 
ATOM   3210 C CB  . ALA C 2 277 ? 107.754 -84.228  -59.028  1.00 37.93  ? 277 ALA C CB  1 
ATOM   3211 N N   . SER C 2 278 ? 110.280 -82.639  -60.388  1.00 40.76  ? 278 SER C N   1 
ATOM   3212 C CA  . SER C 2 278 ? 111.556 -82.788  -61.025  1.00 41.75  ? 278 SER C CA  1 
ATOM   3213 C C   . SER C 2 278 ? 112.498 -83.499  -60.067  1.00 42.78  ? 278 SER C C   1 
ATOM   3214 O O   . SER C 2 278 ? 112.587 -83.128  -58.892  1.00 40.06  ? 278 SER C O   1 
ATOM   3215 C CB  . SER C 2 278 ? 112.137 -81.412  -61.300  1.00 43.14  ? 278 SER C CB  1 
ATOM   3216 O OG  . SER C 2 278 ? 113.514 -81.529  -61.610  1.00 46.91  ? 278 SER C OG  1 
ATOM   3217 N N   . TYR C 2 279 ? 113.245 -84.469  -60.580  1.00 42.99  ? 279 TYR C N   1 
ATOM   3218 C CA  . TYR C 2 279 ? 114.321 -85.106  -59.818  1.00 45.42  ? 279 TYR C CA  1 
ATOM   3219 C C   . TYR C 2 279 ? 115.652 -84.325  -59.845  1.00 42.87  ? 279 TYR C C   1 
ATOM   3220 O O   . TYR C 2 279 ? 116.632 -84.800  -59.300  1.00 40.28  ? 279 TYR C O   1 
ATOM   3221 C CB  . TYR C 2 279 ? 114.545 -86.509  -60.354  1.00 48.59  ? 279 TYR C CB  1 
ATOM   3222 C CG  . TYR C 2 279 ? 113.393 -87.441  -60.119  1.00 54.59  ? 279 TYR C CG  1 
ATOM   3223 C CD1 . TYR C 2 279 ? 113.186 -88.019  -58.865  1.00 59.59  ? 279 TYR C CD1 1 
ATOM   3224 C CD2 . TYR C 2 279 ? 112.498 -87.765  -61.150  1.00 60.89  ? 279 TYR C CD2 1 
ATOM   3225 C CE1 . TYR C 2 279 ? 112.132 -88.900  -58.644  1.00 61.93  ? 279 TYR C CE1 1 
ATOM   3226 C CE2 . TYR C 2 279 ? 111.433 -88.648  -60.935  1.00 61.60  ? 279 TYR C CE2 1 
ATOM   3227 C CZ  . TYR C 2 279 ? 111.256 -89.215  -59.685  1.00 63.36  ? 279 TYR C CZ  1 
ATOM   3228 O OH  . TYR C 2 279 ? 110.196 -90.080  -59.470  1.00 70.02  ? 279 TYR C OH  1 
ATOM   3229 N N   . GLN C 2 280 ? 115.661 -83.123  -60.438  1.00 45.04  ? 280 GLN C N   1 
ATOM   3230 C CA  . GLN C 2 280 ? 116.878 -82.325  -60.667  1.00 48.73  ? 280 GLN C CA  1 
ATOM   3231 C C   . GLN C 2 280 ? 117.052 -81.109  -59.761  1.00 47.82  ? 280 GLN C C   1 
ATOM   3232 O O   . GLN C 2 280 ? 118.168 -80.669  -59.573  1.00 57.53  ? 280 GLN C O   1 
ATOM   3233 C CB  . GLN C 2 280 ? 116.942 -81.834  -62.132  1.00 53.58  ? 280 GLN C CB  1 
ATOM   3234 C CG  . GLN C 2 280 ? 116.842 -82.918  -63.202  1.00 59.27  ? 280 GLN C CG  1 
ATOM   3235 C CD  . GLN C 2 280 ? 117.877 -84.020  -63.031  1.00 68.36  ? 280 GLN C CD  1 
ATOM   3236 O OE1 . GLN C 2 280 ? 117.526 -85.179  -62.772  1.00 81.34  ? 280 GLN C OE1 1 
ATOM   3237 N NE2 . GLN C 2 280 ? 119.158 -83.667  -63.163  1.00 72.81  ? 280 GLN C NE2 1 
ATOM   3238 N N   . THR C 2 281 ? 115.979 -80.558  -59.219  1.00 43.26  ? 281 THR C N   1 
ATOM   3239 C CA  . THR C 2 281 ? 116.042 -79.303  -58.477  1.00 39.95  ? 281 THR C CA  1 
ATOM   3240 C C   . THR C 2 281 ? 115.989 -79.546  -56.983  1.00 41.83  ? 281 THR C C   1 
ATOM   3241 O O   . THR C 2 281 ? 115.494 -80.588  -56.529  1.00 44.91  ? 281 THR C O   1 
ATOM   3242 C CB  . THR C 2 281 ? 114.867 -78.380  -58.877  1.00 42.70  ? 281 THR C CB  1 
ATOM   3243 O OG1 . THR C 2 281 ? 113.599 -79.013  -58.583  1.00 41.14  ? 281 THR C OG1 1 
ATOM   3244 C CG2 . THR C 2 281 ? 114.956 -78.016  -60.375  1.00 40.05  ? 281 THR C CG2 1 
ATOM   3245 N N   . VAL C 2 282 ? 116.472 -78.584  -56.208  1.00 42.51  ? 282 VAL C N   1 
ATOM   3246 C CA  . VAL C 2 282 ? 116.494 -78.740  -54.760  1.00 44.47  ? 282 VAL C CA  1 
ATOM   3247 C C   . VAL C 2 282 ? 115.077 -78.885  -54.192  1.00 41.60  ? 282 VAL C C   1 
ATOM   3248 O O   . VAL C 2 282 ? 114.865 -79.675  -53.262  1.00 41.02  ? 282 VAL C O   1 
ATOM   3249 C CB  . VAL C 2 282 ? 117.281 -77.632  -54.008  1.00 48.26  ? 282 VAL C CB  1 
ATOM   3250 C CG1 . VAL C 2 282 ? 118.715 -77.607  -54.494  1.00 54.86  ? 282 VAL C CG1 1 
ATOM   3251 C CG2 . VAL C 2 282 ? 116.658 -76.252  -54.166  1.00 52.33  ? 282 VAL C CG2 1 
ATOM   3252 N N   . THR C 2 283 ? 114.129 -78.150  -54.774  1.00 39.04  ? 283 THR C N   1 
ATOM   3253 C CA  . THR C 2 283 ? 112.731 -78.129  -54.314  1.00 38.12  ? 283 THR C CA  1 
ATOM   3254 C C   . THR C 2 283 ? 111.837 -79.186  -54.923  1.00 37.18  ? 283 THR C C   1 
ATOM   3255 O O   . THR C 2 283 ? 110.711 -79.347  -54.494  1.00 38.58  ? 283 THR C O   1 
ATOM   3256 C CB  . THR C 2 283 ? 112.072 -76.822  -54.689  1.00 39.68  ? 283 THR C CB  1 
ATOM   3257 O OG1 . THR C 2 283 ? 112.053 -76.730  -56.116  1.00 40.43  ? 283 THR C OG1 1 
ATOM   3258 C CG2 . THR C 2 283 ? 112.812 -75.622  -54.070  1.00 38.20  ? 283 THR C CG2 1 
ATOM   3259 N N   . SER C 2 284 ? 112.333 -79.884  -55.934  1.00 36.05  ? 284 SER C N   1 
ATOM   3260 C CA  . SER C 2 284 ? 111.538 -80.791  -56.769  1.00 36.74  ? 284 SER C CA  1 
ATOM   3261 C C   . SER C 2 284 ? 110.515 -80.065  -57.655  1.00 36.41  ? 284 SER C C   1 
ATOM   3262 O O   . SER C 2 284 ? 109.789 -80.706  -58.382  1.00 35.45  ? 284 SER C O   1 
ATOM   3263 C CB  . SER C 2 284 ? 110.891 -81.945  -55.967  1.00 37.81  ? 284 SER C CB  1 
ATOM   3264 O OG  . SER C 2 284 ? 111.859 -82.816  -55.384  1.00 40.86  ? 284 SER C OG  1 
ATOM   3265 N N   . CYS C 2 285 ? 110.496 -78.739  -57.638  1.00 38.82  ? 285 CYS C N   1 
ATOM   3266 C CA  . CYS C 2 285 ? 109.619 -77.986  -58.507  1.00 42.75  ? 285 CYS C CA  1 
ATOM   3267 C C   . CYS C 2 285 ? 110.364 -77.503  -59.745  1.00 41.39  ? 285 CYS C C   1 
ATOM   3268 O O   . CYS C 2 285 ? 111.555 -77.263  -59.678  1.00 40.67  ? 285 CYS C O   1 
ATOM   3269 C CB  . CYS C 2 285 ? 109.008 -76.797  -57.761  1.00 42.97  ? 285 CYS C CB  1 
ATOM   3270 S SG  . CYS C 2 285 ? 107.738 -77.275  -56.564  1.00 45.18  ? 285 CYS C SG  1 
ATOM   3271 N N   . PRO C 2 286 ? 109.658 -77.332  -60.875  1.00 42.90  ? 286 PRO C N   1 
ATOM   3272 C CA  . PRO C 2 286 ? 110.307 -76.767  -62.067  1.00 43.95  ? 286 PRO C CA  1 
ATOM   3273 C C   . PRO C 2 286 ? 110.841 -75.372  -61.780  1.00 42.45  ? 286 PRO C C   1 
ATOM   3274 O O   . PRO C 2 286 ? 110.100 -74.518  -61.313  1.00 46.94  ? 286 PRO C O   1 
ATOM   3275 C CB  . PRO C 2 286 ? 109.193 -76.720  -63.107  1.00 40.96  ? 286 PRO C CB  1 
ATOM   3276 C CG  . PRO C 2 286 ? 108.166 -77.673  -62.606  1.00 44.85  ? 286 PRO C CG  1 
ATOM   3277 C CD  . PRO C 2 286 ? 108.234 -77.581  -61.113  1.00 46.28  ? 286 PRO C CD  1 
ATOM   3278 N N   . ALA C 2 287 ? 112.140 -75.192  -61.982  1.00 43.79  ? 287 ALA C N   1 
ATOM   3279 C CA  . ALA C 2 287 ? 112.819 -73.901  -61.784  1.00 44.68  ? 287 ALA C CA  1 
ATOM   3280 C C   . ALA C 2 287 ? 112.730 -73.416  -60.335  1.00 46.86  ? 287 ALA C C   1 
ATOM   3281 O O   . ALA C 2 287 ? 112.824 -72.207  -60.064  1.00 43.17  ? 287 ALA C O   1 
ATOM   3282 C CB  . ALA C 2 287 ? 112.263 -72.842  -62.746  1.00 42.06  ? 287 ALA C CB  1 
ATOM   3283 N N   . ASP C 2 288 ? 112.537 -74.357  -59.410  1.00 44.97  ? 288 ASP C N   1 
ATOM   3284 C CA  . ASP C 2 288 ? 112.311 -74.041  -58.004  1.00 45.47  ? 288 ASP C CA  1 
ATOM   3285 C C   . ASP C 2 288 ? 111.223 -72.982  -57.792  1.00 42.03  ? 288 ASP C C   1 
ATOM   3286 O O   . ASP C 2 288 ? 111.317 -72.168  -56.902  1.00 44.66  ? 288 ASP C O   1 
ATOM   3287 C CB  . ASP C 2 288 ? 113.628 -73.574  -57.360  1.00 46.38  ? 288 ASP C CB  1 
ATOM   3288 C CG  . ASP C 2 288 ? 114.683 -74.652  -57.321  1.00 49.94  ? 288 ASP C CG  1 
ATOM   3289 O OD1 . ASP C 2 288 ? 114.349 -75.819  -57.037  1.00 52.57  ? 288 ASP C OD1 1 
ATOM   3290 O OD2 . ASP C 2 288 ? 115.865 -74.319  -57.538  1.00 54.35  ? 288 ASP C OD2 1 
ATOM   3291 N N   . ASN C 2 289 ? 110.200 -72.988  -58.625  1.00 40.78  ? 289 ASN C N   1 
ATOM   3292 C CA  . ASN C 2 289 ? 109.190 -71.954  -58.584  1.00 40.54  ? 289 ASN C CA  1 
ATOM   3293 C C   . ASN C 2 289 ? 107.943 -72.433  -57.847  1.00 39.30  ? 289 ASN C C   1 
ATOM   3294 O O   . ASN C 2 289 ? 106.998 -72.934  -58.449  1.00 40.60  ? 289 ASN C O   1 
ATOM   3295 C CB  . ASN C 2 289 ? 108.845 -71.494  -60.004  1.00 42.59  ? 289 ASN C CB  1 
ATOM   3296 C CG  . ASN C 2 289 ? 108.038 -70.215  -60.014  1.00 42.36  ? 289 ASN C CG  1 
ATOM   3297 O OD1 . ASN C 2 289 ? 107.447 -69.828  -59.013  1.00 43.48  ? 289 ASN C OD1 1 
ATOM   3298 N ND2 . ASN C 2 289 ? 107.989 -69.566  -61.154  1.00 46.19  ? 289 ASN C ND2 1 
ATOM   3299 N N   . TYR C 2 290 ? 107.944 -72.221  -56.541  1.00 38.62  ? 290 TYR C N   1 
ATOM   3300 C CA  . TYR C 2 290 ? 106.840 -72.603  -55.686  1.00 39.10  ? 290 TYR C CA  1 
ATOM   3301 C C   . TYR C 2 290 ? 105.531 -71.867  -56.028  1.00 42.84  ? 290 TYR C C   1 
ATOM   3302 O O   . TYR C 2 290 ? 104.435 -72.486  -56.060  1.00 39.99  ? 290 TYR C O   1 
ATOM   3303 C CB  . TYR C 2 290 ? 107.211 -72.336  -54.216  1.00 39.09  ? 290 TYR C CB  1 
ATOM   3304 C CG  . TYR C 2 290 ? 108.143 -73.346  -53.540  1.00 36.52  ? 290 TYR C CG  1 
ATOM   3305 C CD1 . TYR C 2 290 ? 108.149 -74.700  -53.906  1.00 35.63  ? 290 TYR C CD1 1 
ATOM   3306 C CD2 . TYR C 2 290 ? 108.974 -72.954  -52.485  1.00 34.53  ? 290 TYR C CD2 1 
ATOM   3307 C CE1 . TYR C 2 290 ? 108.969 -75.618  -53.267  1.00 33.54  ? 290 TYR C CE1 1 
ATOM   3308 C CE2 . TYR C 2 290 ? 109.808 -73.866  -51.858  1.00 34.56  ? 290 TYR C CE2 1 
ATOM   3309 C CZ  . TYR C 2 290 ? 109.794 -75.200  -52.251  1.00 34.99  ? 290 TYR C CZ  1 
ATOM   3310 O OH  . TYR C 2 290 ? 110.591 -76.119  -51.600  1.00 37.42  ? 290 TYR C OH  1 
ATOM   3311 N N   . GLN C 2 291 ? 105.659 -70.568  -56.305  1.00 43.57  ? 291 GLN C N   1 
ATOM   3312 C CA  . GLN C 2 291 ? 104.504 -69.680  -56.506  1.00 44.11  ? 291 GLN C CA  1 
ATOM   3313 C C   . GLN C 2 291 ? 103.687 -70.106  -57.707  1.00 40.39  ? 291 GLN C C   1 
ATOM   3314 O O   . GLN C 2 291 ? 102.471 -70.175  -57.647  1.00 39.86  ? 291 GLN C O   1 
ATOM   3315 C CB  . GLN C 2 291 ? 104.951 -68.216  -56.673  1.00 50.49  ? 291 GLN C CB  1 
ATOM   3316 C CG  . GLN C 2 291 ? 105.042 -67.436  -55.371  1.00 63.04  ? 291 GLN C CG  1 
ATOM   3317 C CD  . GLN C 2 291 ? 103.663 -67.128  -54.761  1.00 77.15  ? 291 GLN C CD  1 
ATOM   3318 O OE1 . GLN C 2 291 ? 102.749 -66.678  -55.470  1.00 90.03  ? 291 GLN C OE1 1 
ATOM   3319 N NE2 . GLN C 2 291 ? 103.505 -67.370  -53.443  1.00 79.61  ? 291 GLN C NE2 1 
ATOM   3320 N N   . ALA C 2 292 ? 104.360 -70.403  -58.807  1.00 39.02  ? 292 ALA C N   1 
ATOM   3321 C CA  . ALA C 2 292 ? 103.655 -70.808  -59.995  1.00 36.98  ? 292 ALA C CA  1 
ATOM   3322 C C   . ALA C 2 292 ? 102.886 -72.103  -59.721  1.00 36.71  ? 292 ALA C C   1 
ATOM   3323 O O   . ALA C 2 292 ? 101.742 -72.259  -60.178  1.00 39.89  ? 292 ALA C O   1 
ATOM   3324 C CB  . ALA C 2 292 ? 104.622 -70.983  -61.133  1.00 38.28  ? 292 ALA C CB  1 
ATOM   3325 N N   . CYS C 2 293 ? 103.474 -73.019  -58.952  1.00 35.13  ? 293 CYS C N   1 
ATOM   3326 C CA  . CYS C 2 293 ? 102.762 -74.291  -58.621  1.00 34.62  ? 293 CYS C CA  1 
ATOM   3327 C C   . CYS C 2 293 ? 101.540 -74.046  -57.745  1.00 33.66  ? 293 CYS C C   1 
ATOM   3328 O O   . CYS C 2 293 ? 100.474 -74.582  -58.000  1.00 33.99  ? 293 CYS C O   1 
ATOM   3329 C CB  . CYS C 2 293 ? 103.667 -75.295  -57.914  1.00 38.01  ? 293 CYS C CB  1 
ATOM   3330 S SG  . CYS C 2 293 ? 102.789 -76.760  -57.293  1.00 37.42  ? 293 CYS C SG  1 
ATOM   3331 N N   . LEU C 2 294 ? 101.701 -73.228  -56.718  1.00 32.95  ? 294 LEU C N   1 
ATOM   3332 C CA  . LEU C 2 294 ? 100.594 -72.914  -55.837  1.00 34.28  ? 294 LEU C CA  1 
ATOM   3333 C C   . LEU C 2 294 ? 99.462  -72.246  -56.573  1.00 33.52  ? 294 LEU C C   1 
ATOM   3334 O O   . LEU C 2 294 ? 98.291  -72.578  -56.360  1.00 33.79  ? 294 LEU C O   1 
ATOM   3335 C CB  . LEU C 2 294 ? 101.059 -72.036  -54.668  1.00 35.38  ? 294 LEU C CB  1 
ATOM   3336 C CG  . LEU C 2 294 ? 101.995 -72.737  -53.667  1.00 34.46  ? 294 LEU C CG  1 
ATOM   3337 C CD1 . LEU C 2 294 ? 102.435 -71.765  -52.580  1.00 35.23  ? 294 LEU C CD1 1 
ATOM   3338 C CD2 . LEU C 2 294 ? 101.335 -73.950  -53.047  1.00 34.89  ? 294 LEU C CD2 1 
ATOM   3339 N N   . GLY C 2 295 ? 99.810  -71.332  -57.480  1.00 36.39  ? 295 GLY C N   1 
ATOM   3340 C CA  . GLY C 2 295 ? 98.801  -70.662  -58.314  1.00 32.50  ? 295 GLY C CA  1 
ATOM   3341 C C   . GLY C 2 295 ? 98.044  -71.618  -59.200  1.00 32.11  ? 295 GLY C C   1 
ATOM   3342 O O   . GLY C 2 295 ? 96.826  -71.522  -59.315  1.00 34.36  ? 295 GLY C O   1 
ATOM   3343 N N   . SER C 2 296 ? 98.765  -72.541  -59.831  1.00 31.53  ? 296 SER C N   1 
ATOM   3344 C CA  . SER C 2 296 ? 98.129  -73.526  -60.705  1.00 33.21  ? 296 SER C CA  1 
ATOM   3345 C C   . SER C 2 296 ? 97.285  -74.512  -59.912  1.00 31.10  ? 296 SER C C   1 
ATOM   3346 O O   . SER C 2 296 ? 96.234  -74.953  -60.373  1.00 33.25  ? 296 SER C O   1 
ATOM   3347 C CB  . SER C 2 296 ? 99.178  -74.269  -61.524  1.00 35.55  ? 296 SER C CB  1 
ATOM   3348 O OG  . SER C 2 296 ? 99.815  -73.399  -62.437  1.00 38.42  ? 296 SER C OG  1 
ATOM   3349 N N   . TYR C 2 297 ? 97.727  -74.837  -58.703  1.00 30.97  ? 297 TYR C N   1 
ATOM   3350 C CA  . TYR C 2 297 ? 96.949  -75.715  -57.820  1.00 29.37  ? 297 TYR C CA  1 
ATOM   3351 C C   . TYR C 2 297 ? 95.653  -75.010  -57.450  1.00 29.44  ? 297 TYR C C   1 
ATOM   3352 O O   . TYR C 2 297 ? 94.564  -75.541  -57.639  1.00 31.35  ? 297 TYR C O   1 
ATOM   3353 C CB  . TYR C 2 297 ? 97.767  -76.091  -56.573  1.00 31.04  ? 297 TYR C CB  1 
ATOM   3354 C CG  . TYR C 2 297 ? 96.988  -76.919  -55.585  1.00 31.68  ? 297 TYR C CG  1 
ATOM   3355 C CD1 . TYR C 2 297 ? 96.940  -78.310  -55.690  1.00 32.47  ? 297 TYR C CD1 1 
ATOM   3356 C CD2 . TYR C 2 297 ? 96.275  -76.303  -54.568  1.00 27.75  ? 297 TYR C CD2 1 
ATOM   3357 C CE1 . TYR C 2 297 ? 96.200  -79.058  -54.794  1.00 33.60  ? 297 TYR C CE1 1 
ATOM   3358 C CE2 . TYR C 2 297 ? 95.550  -77.025  -53.684  1.00 30.38  ? 297 TYR C CE2 1 
ATOM   3359 C CZ  . TYR C 2 297 ? 95.511  -78.401  -53.781  1.00 33.62  ? 297 TYR C CZ  1 
ATOM   3360 O OH  . TYR C 2 297 ? 94.725  -79.073  -52.887  1.00 35.62  ? 297 TYR C OH  1 
ATOM   3361 N N   . ALA C 2 298 ? 95.765  -73.793  -56.943  1.00 31.22  ? 298 ALA C N   1 
ATOM   3362 C CA  . ALA C 2 298 ? 94.578  -73.014  -56.601  1.00 33.49  ? 298 ALA C CA  1 
ATOM   3363 C C   . ALA C 2 298 ? 93.638  -72.760  -57.811  1.00 34.92  ? 298 ALA C C   1 
ATOM   3364 O O   . ALA C 2 298 ? 92.394  -72.648  -57.666  1.00 36.11  ? 298 ALA C O   1 
ATOM   3365 C CB  . ALA C 2 298 ? 94.989  -71.697  -55.970  1.00 34.81  ? 298 ALA C CB  1 
ATOM   3366 N N   . GLY C 2 299 ? 94.233  -72.713  -59.001  1.00 33.88  ? 299 GLY C N   1 
ATOM   3367 C CA  . GLY C 2 299 ? 93.492  -72.507  -60.240  1.00 32.97  ? 299 GLY C CA  1 
ATOM   3368 C C   . GLY C 2 299 ? 92.591  -73.637  -60.610  1.00 33.32  ? 299 GLY C C   1 
ATOM   3369 O O   . GLY C 2 299 ? 91.782  -73.503  -61.507  1.00 36.91  ? 299 GLY C O   1 
ATOM   3370 N N   . MET C 2 300 ? 92.749  -74.787  -59.971  1.00 36.44  ? 300 MET C N   1 
ATOM   3371 C CA  . MET C 2 300 ? 91.831  -75.906  -60.198  1.00 37.89  ? 300 MET C CA  1 
ATOM   3372 C C   . MET C 2 300 ? 90.621  -75.933  -59.265  1.00 38.06  ? 300 MET C C   1 
ATOM   3373 O O   . MET C 2 300 ? 89.687  -76.713  -59.463  1.00 40.96  ? 300 MET C O   1 
ATOM   3374 C CB  . MET C 2 300 ? 92.573  -77.206  -60.101  1.00 43.18  ? 300 MET C CB  1 
ATOM   3375 C CG  . MET C 2 300 ? 93.329  -77.496  -61.375  1.00 48.32  ? 300 MET C CG  1 
ATOM   3376 S SD  . MET C 2 300 ? 94.307  -78.953  -61.138  1.00 53.09  ? 300 MET C SD  1 
ATOM   3377 C CE  . MET C 2 300 ? 93.079  -80.175  -61.413  1.00 56.59  ? 300 MET C CE  1 
ATOM   3378 N N   . ILE C 2 301 ? 90.613  -75.071  -58.265  1.00 37.59  ? 301 ILE C N   1 
ATOM   3379 C CA  . ILE C 2 301 ? 89.472  -75.012  -57.360  1.00 39.78  ? 301 ILE C CA  1 
ATOM   3380 C C   . ILE C 2 301 ? 88.301  -74.368  -58.097  1.00 39.12  ? 301 ILE C C   1 
ATOM   3381 O O   . ILE C 2 301 ? 88.449  -73.297  -58.672  1.00 39.38  ? 301 ILE C O   1 
ATOM   3382 C CB  . ILE C 2 301 ? 89.831  -74.243  -56.079  1.00 36.93  ? 301 ILE C CB  1 
ATOM   3383 C CG1 . ILE C 2 301 ? 90.902  -75.013  -55.317  1.00 34.86  ? 301 ILE C CG1 1 
ATOM   3384 C CG2 . ILE C 2 301 ? 88.614  -74.062  -55.201  1.00 38.06  ? 301 ILE C CG2 1 
ATOM   3385 C CD1 . ILE C 2 301 ? 91.649  -74.174  -54.326  1.00 34.84  ? 301 ILE C CD1 1 
ATOM   3386 N N   . GLY C 2 302 ? 87.150  -75.030  -58.083  1.00 38.47  ? 302 GLY C N   1 
ATOM   3387 C CA  . GLY C 2 302 ? 85.990  -74.544  -58.838  1.00 40.21  ? 302 GLY C CA  1 
ATOM   3388 C C   . GLY C 2 302 ? 85.664  -75.275  -60.126  1.00 40.23  ? 302 GLY C C   1 
ATOM   3389 O O   . GLY C 2 302 ? 84.806  -74.820  -60.871  1.00 41.38  ? 302 GLY C O   1 
ATOM   3390 N N   . PHE C 2 303 ? 86.322  -76.406  -60.386  1.00 39.74  ? 303 PHE C N   1 
ATOM   3391 C CA  . PHE C 2 303 ? 86.084  -77.209  -61.592  1.00 39.91  ? 303 PHE C CA  1 
ATOM   3392 C C   . PHE C 2 303 ? 85.838  -78.669  -61.207  1.00 44.61  ? 303 PHE C C   1 
ATOM   3393 O O   . PHE C 2 303 ? 85.800  -79.006  -60.019  1.00 48.24  ? 303 PHE C O   1 
ATOM   3394 C CB  . PHE C 2 303 ? 87.269  -77.050  -62.557  1.00 40.82  ? 303 PHE C CB  1 
ATOM   3395 C CG  . PHE C 2 303 ? 87.568  -75.621  -62.898  1.00 38.93  ? 303 PHE C CG  1 
ATOM   3396 C CD1 . PHE C 2 303 ? 86.807  -74.959  -63.856  1.00 39.15  ? 303 PHE C CD1 1 
ATOM   3397 C CD2 . PHE C 2 303 ? 88.539  -74.896  -62.204  1.00 38.86  ? 303 PHE C CD2 1 
ATOM   3398 C CE1 . PHE C 2 303 ? 87.022  -73.616  -64.158  1.00 37.76  ? 303 PHE C CE1 1 
ATOM   3399 C CE2 . PHE C 2 303 ? 88.770  -73.555  -62.519  1.00 38.85  ? 303 PHE C CE2 1 
ATOM   3400 C CZ  . PHE C 2 303 ? 88.008  -72.921  -63.511  1.00 36.77  ? 303 PHE C CZ  1 
ATOM   3401 N N   . ASP C 2 304 ? 85.653  -79.534  -62.203  1.00 46.84  ? 304 ASP C N   1 
ATOM   3402 C CA  . ASP C 2 304 ? 85.444  -80.971  -61.968  1.00 49.65  ? 304 ASP C CA  1 
ATOM   3403 C C   . ASP C 2 304 ? 86.538  -81.643  -61.156  1.00 47.54  ? 304 ASP C C   1 
ATOM   3404 O O   . ASP C 2 304 ? 86.265  -82.581  -60.411  1.00 52.12  ? 304 ASP C O   1 
ATOM   3405 C CB  . ASP C 2 304 ? 85.302  -81.722  -63.300  1.00 57.46  ? 304 ASP C CB  1 
ATOM   3406 C CG  . ASP C 2 304 ? 83.957  -81.465  -63.982  1.00 64.75  ? 304 ASP C CG  1 
ATOM   3407 O OD1 . ASP C 2 304 ? 82.918  -81.686  -63.302  1.00 59.38  ? 304 ASP C OD1 1 
ATOM   3408 O OD2 . ASP C 2 304 ? 83.949  -81.068  -65.190  1.00 66.21  ? 304 ASP C OD2 1 
ATOM   3409 N N   . MET C 2 305 ? 87.768  -81.173  -61.325  1.00 46.32  ? 305 MET C N   1 
ATOM   3410 C CA  . MET C 2 305 ? 88.940  -81.762  -60.699  1.00 44.21  ? 305 MET C CA  1 
ATOM   3411 C C   . MET C 2 305 ? 89.367  -80.992  -59.432  1.00 41.00  ? 305 MET C C   1 
ATOM   3412 O O   . MET C 2 305 ? 90.525  -81.046  -59.036  1.00 38.02  ? 305 MET C O   1 
ATOM   3413 C CB  . MET C 2 305 ? 90.075  -81.748  -61.713  1.00 49.81  ? 305 MET C CB  1 
ATOM   3414 C CG  . MET C 2 305 ? 91.220  -82.730  -61.420  1.00 56.54  ? 305 MET C CG  1 
ATOM   3415 S SD  . MET C 2 305 ? 90.958  -84.381  -62.031  1.00 60.98  ? 305 MET C SD  1 
ATOM   3416 C CE  . MET C 2 305 ? 91.014  -84.026  -63.758  1.00 59.67  ? 305 MET C CE  1 
ATOM   3417 N N   . THR C 2 306 ? 88.440  -80.280  -58.798  1.00 36.24  ? 306 THR C N   1 
ATOM   3418 C CA  . THR C 2 306 ? 88.743  -79.496  -57.622  1.00 35.92  ? 306 THR C CA  1 
ATOM   3419 C C   . THR C 2 306 ? 89.462  -80.353  -56.599  1.00 33.37  ? 306 THR C C   1 
ATOM   3420 O O   . THR C 2 306 ? 88.938  -81.383  -56.205  1.00 35.30  ? 306 THR C O   1 
ATOM   3421 C CB  . THR C 2 306 ? 87.445  -78.962  -57.003  1.00 39.72  ? 306 THR C CB  1 
ATOM   3422 O OG1 . THR C 2 306 ? 86.926  -77.907  -57.827  1.00 40.00  ? 306 THR C OG1 1 
ATOM   3423 C CG2 . THR C 2 306 ? 87.676  -78.437  -55.582  1.00 39.62  ? 306 THR C CG2 1 
ATOM   3424 N N   . PRO C 2 307 ? 90.671  -79.950  -56.191  1.00 32.65  ? 307 PRO C N   1 
ATOM   3425 C CA  . PRO C 2 307 ? 91.394  -80.684  -55.175  1.00 33.32  ? 307 PRO C CA  1 
ATOM   3426 C C   . PRO C 2 307 ? 91.171  -80.128  -53.758  1.00 32.91  ? 307 PRO C C   1 
ATOM   3427 O O   . PRO C 2 307 ? 90.918  -78.935  -53.592  1.00 31.95  ? 307 PRO C O   1 
ATOM   3428 C CB  . PRO C 2 307 ? 92.837  -80.456  -55.580  1.00 33.16  ? 307 PRO C CB  1 
ATOM   3429 C CG  . PRO C 2 307 ? 92.838  -79.062  -56.131  1.00 33.56  ? 307 PRO C CG  1 
ATOM   3430 C CD  . PRO C 2 307 ? 91.480  -78.825  -56.705  1.00 32.99  ? 307 PRO C CD  1 
ATOM   3431 N N   . ASN C 2 308 ? 91.313  -80.983  -52.752  1.00 31.35  ? 308 ASN C N   1 
ATOM   3432 C CA  . ASN C 2 308 ? 91.282  -80.544  -51.362  1.00 31.13  ? 308 ASN C CA  1 
ATOM   3433 C C   . ASN C 2 308 ? 92.041  -81.495  -50.450  1.00 33.65  ? 308 ASN C C   1 
ATOM   3434 O O   . ASN C 2 308 ? 92.364  -82.648  -50.820  1.00 33.25  ? 308 ASN C O   1 
ATOM   3435 C CB  . ASN C 2 308 ? 89.849  -80.465  -50.861  1.00 32.98  ? 308 ASN C CB  1 
ATOM   3436 C CG  . ASN C 2 308 ? 89.687  -79.498  -49.686  1.00 34.19  ? 308 ASN C CG  1 
ATOM   3437 O OD1 . ASN C 2 308 ? 90.347  -78.456  -49.645  1.00 32.32  ? 308 ASN C OD1 1 
ATOM   3438 N ND2 . ASN C 2 308 ? 88.809  -79.834  -48.740  1.00 30.21  ? 308 ASN C ND2 1 
ATOM   3439 N N   . TYR C 2 309 ? 92.324  -80.987  -49.256  1.00 32.21  ? 309 TYR C N   1 
ATOM   3440 C CA  . TYR C 2 309 ? 92.818  -81.784  -48.152  1.00 31.77  ? 309 TYR C CA  1 
ATOM   3441 C C   . TYR C 2 309 ? 91.776  -82.887  -47.920  1.00 33.61  ? 309 TYR C C   1 
ATOM   3442 O O   . TYR C 2 309 ? 90.583  -82.600  -47.771  1.00 32.39  ? 309 TYR C O   1 
ATOM   3443 C CB  . TYR C 2 309 ? 93.013  -80.910  -46.900  1.00 31.96  ? 309 TYR C CB  1 
ATOM   3444 C CG  . TYR C 2 309 ? 93.985  -79.774  -47.119  1.00 30.77  ? 309 TYR C CG  1 
ATOM   3445 C CD1 . TYR C 2 309 ? 95.345  -79.969  -46.994  1.00 32.76  ? 309 TYR C CD1 1 
ATOM   3446 C CD2 . TYR C 2 309 ? 93.553  -78.521  -47.475  1.00 29.88  ? 309 TYR C CD2 1 
ATOM   3447 C CE1 . TYR C 2 309 ? 96.239  -78.947  -47.249  1.00 33.27  ? 309 TYR C CE1 1 
ATOM   3448 C CE2 . TYR C 2 309 ? 94.445  -77.487  -47.695  1.00 30.73  ? 309 TYR C CE2 1 
ATOM   3449 C CZ  . TYR C 2 309 ? 95.779  -77.706  -47.586  1.00 31.41  ? 309 TYR C CZ  1 
ATOM   3450 O OH  . TYR C 2 309 ? 96.676  -76.695  -47.825  1.00 34.40  ? 309 TYR C OH  1 
ATOM   3451 N N   . VAL C 2 310 ? 92.234  -84.141  -47.981  1.00 34.61  ? 310 VAL C N   1 
ATOM   3452 C CA  . VAL C 2 310 ? 91.374  -85.306  -47.826  1.00 35.13  ? 310 VAL C CA  1 
ATOM   3453 C C   . VAL C 2 310 ? 90.897  -85.494  -46.381  1.00 34.98  ? 310 VAL C C   1 
ATOM   3454 O O   . VAL C 2 310 ? 89.886  -86.111  -46.169  1.00 35.96  ? 310 VAL C O   1 
ATOM   3455 C CB  . VAL C 2 310 ? 92.030  -86.629  -48.336  1.00 38.56  ? 310 VAL C CB  1 
ATOM   3456 C CG1 . VAL C 2 310 ? 92.506  -86.496  -49.784  1.00 39.23  ? 310 VAL C CG1 1 
ATOM   3457 C CG2 . VAL C 2 310 ? 93.165  -87.085  -47.451  1.00 38.78  ? 310 VAL C CG2 1 
ATOM   3458 N N   . ASP C 2 311 ? 91.626  -84.956  -45.400  1.00 37.78  ? 311 ASP C N   1 
ATOM   3459 C CA  . ASP C 2 311 ? 91.227  -85.048  -43.989  1.00 37.74  ? 311 ASP C CA  1 
ATOM   3460 C C   . ASP C 2 311 ? 91.862  -83.922  -43.141  1.00 38.35  ? 311 ASP C C   1 
ATOM   3461 O O   . ASP C 2 311 ? 92.531  -82.998  -43.668  1.00 40.25  ? 311 ASP C O   1 
ATOM   3462 C CB  . ASP C 2 311 ? 91.557  -86.454  -43.423  1.00 37.49  ? 311 ASP C CB  1 
ATOM   3463 C CG  . ASP C 2 311 ? 93.043  -86.702  -43.304  1.00 44.13  ? 311 ASP C CG  1 
ATOM   3464 O OD1 . ASP C 2 311 ? 93.838  -85.747  -43.422  1.00 45.08  ? 311 ASP C OD1 1 
ATOM   3465 O OD2 . ASP C 2 311 ? 93.441  -87.869  -43.098  1.00 52.91  ? 311 ASP C OD2 1 
ATOM   3466 N N   . SER C 2 312 ? 91.654  -84.014  -41.831  1.00 37.41  ? 312 SER C N   1 
ATOM   3467 C CA  . SER C 2 312 ? 92.067  -83.002  -40.881  1.00 39.26  ? 312 SER C CA  1 
ATOM   3468 C C   . SER C 2 312 ? 93.286  -83.385  -40.070  1.00 41.27  ? 312 SER C C   1 
ATOM   3469 O O   . SER C 2 312 ? 93.448  -82.936  -38.938  1.00 45.53  ? 312 SER C O   1 
ATOM   3470 C CB  . SER C 2 312 ? 90.895  -82.641  -39.968  1.00 44.11  ? 312 SER C CB  1 
ATOM   3471 O OG  . SER C 2 312 ? 90.331  -83.770  -39.338  1.00 47.14  ? 312 SER C OG  1 
ATOM   3472 N N   . SER C 2 313 ? 94.175  -84.169  -40.673  1.00 42.96  ? 313 SER C N   1 
ATOM   3473 C CA  . SER C 2 313 ? 95.504  -84.411  -40.129  1.00 48.01  ? 313 SER C CA  1 
ATOM   3474 C C   . SER C 2 313 ? 96.354  -83.129  -40.122  1.00 47.95  ? 313 SER C C   1 
ATOM   3475 O O   . SER C 2 313 ? 96.470  -82.480  -41.147  1.00 53.65  ? 313 SER C O   1 
ATOM   3476 C CB  . SER C 2 313 ? 96.221  -85.460  -40.979  1.00 48.17  ? 313 SER C CB  1 
ATOM   3477 O OG  . SER C 2 313 ? 97.605  -85.489  -40.663  1.00 49.82  ? 313 SER C OG  1 
ATOM   3478 N N   . PRO C 2 314 ? 97.003  -82.796  -38.993  1.00 53.54  ? 314 PRO C N   1 
ATOM   3479 C CA  . PRO C 2 314 ? 97.767  -81.534  -38.945  1.00 54.64  ? 314 PRO C CA  1 
ATOM   3480 C C   . PRO C 2 314 ? 98.963  -81.382  -39.920  1.00 60.03  ? 314 PRO C C   1 
ATOM   3481 O O   . PRO C 2 314 ? 99.005  -80.420  -40.711  1.00 57.10  ? 314 PRO C O   1 
ATOM   3482 C CB  . PRO C 2 314 ? 98.233  -81.465  -37.488  1.00 52.41  ? 314 PRO C CB  1 
ATOM   3483 C CG  . PRO C 2 314 ? 97.269  -82.319  -36.738  1.00 51.83  ? 314 PRO C CG  1 
ATOM   3484 C CD  . PRO C 2 314 ? 96.899  -83.424  -37.664  1.00 53.10  ? 314 PRO C CD  1 
ATOM   3485 N N   . THR C 2 315 ? 99.927  -82.297  -39.825  1.00 61.59  ? 315 THR C N   1 
ATOM   3486 C CA  . THR C 2 315 ? 101.159 -82.269  -40.649  1.00 61.81  ? 315 THR C CA  1 
ATOM   3487 C C   . THR C 2 315 ? 101.201 -83.328  -41.762  1.00 60.33  ? 315 THR C C   1 
ATOM   3488 O O   . THR C 2 315 ? 101.923 -83.146  -42.744  1.00 56.75  ? 315 THR C O   1 
ATOM   3489 C CB  . THR C 2 315 ? 102.406 -82.500  -39.790  1.00 66.27  ? 315 THR C CB  1 
ATOM   3490 O OG1 . THR C 2 315 ? 102.309 -83.793  -39.169  1.00 65.19  ? 315 THR C OG1 1 
ATOM   3491 C CG2 . THR C 2 315 ? 102.555 -81.375  -38.724  1.00 68.13  ? 315 THR C CG2 1 
ATOM   3492 N N   . GLY C 2 316 ? 100.459 -84.426  -41.607  1.00 55.06  ? 316 GLY C N   1 
ATOM   3493 C CA  . GLY C 2 316 ? 100.349 -85.442  -42.661  1.00 61.62  ? 316 GLY C CA  1 
ATOM   3494 C C   . GLY C 2 316 ? 99.413  -85.037  -43.800  1.00 62.29  ? 316 GLY C C   1 
ATOM   3495 O O   . GLY C 2 316 ? 98.346  -85.669  -44.008  1.00 68.34  ? 316 GLY C O   1 
ATOM   3496 N N   . ILE C 2 317 ? 99.833  -84.012  -44.548  1.00 57.32  ? 317 ILE C N   1 
ATOM   3497 C CA  . ILE C 2 317 ? 99.011  -83.375  -45.576  1.00 52.00  ? 317 ILE C CA  1 
ATOM   3498 C C   . ILE C 2 317 ? 98.919  -84.282  -46.798  1.00 49.74  ? 317 ILE C C   1 
ATOM   3499 O O   . ILE C 2 317 ? 99.940  -84.701  -47.344  1.00 54.37  ? 317 ILE C O   1 
ATOM   3500 C CB  . ILE C 2 317 ? 99.592  -82.001  -46.000  1.00 52.20  ? 317 ILE C CB  1 
ATOM   3501 C CG1 . ILE C 2 317 ? 99.272  -80.962  -44.915  1.00 53.94  ? 317 ILE C CG1 1 
ATOM   3502 C CG2 . ILE C 2 317 ? 99.048  -81.568  -47.361  1.00 49.19  ? 317 ILE C CG2 1 
ATOM   3503 C CD1 . ILE C 2 317 ? 100.053 -79.668  -45.029  1.00 54.38  ? 317 ILE C CD1 1 
ATOM   3504 N N   . VAL C 2 318 ? 97.687  -84.572  -47.203  1.00 41.68  ? 318 VAL C N   1 
ATOM   3505 C CA  . VAL C 2 318 ? 97.387  -85.222  -48.450  1.00 36.98  ? 318 VAL C CA  1 
ATOM   3506 C C   . VAL C 2 318 ? 96.262  -84.427  -49.125  1.00 33.08  ? 318 VAL C C   1 
ATOM   3507 O O   . VAL C 2 318 ? 95.209  -84.231  -48.544  1.00 32.82  ? 318 VAL C O   1 
ATOM   3508 C CB  . VAL C 2 318 ? 96.949  -86.690  -48.247  1.00 36.85  ? 318 VAL C CB  1 
ATOM   3509 C CG1 . VAL C 2 318 ? 96.667  -87.355  -49.582  1.00 37.65  ? 318 VAL C CG1 1 
ATOM   3510 C CG2 . VAL C 2 318 ? 98.034  -87.480  -47.538  1.00 36.84  ? 318 VAL C CG2 1 
ATOM   3511 N N   . VAL C 2 319 ? 96.495  -83.989  -50.349  1.00 27.93  ? 319 VAL C N   1 
ATOM   3512 C CA  . VAL C 2 319 ? 95.471  -83.355  -51.152  1.00 29.52  ? 319 VAL C CA  1 
ATOM   3513 C C   . VAL C 2 319 ? 95.188  -84.237  -52.365  1.00 30.90  ? 319 VAL C C   1 
ATOM   3514 O O   . VAL C 2 319 ? 96.058  -84.957  -52.826  1.00 33.54  ? 319 VAL C O   1 
ATOM   3515 C CB  . VAL C 2 319 ? 95.846  -81.917  -51.570  1.00 28.27  ? 319 VAL C CB  1 
ATOM   3516 C CG1 . VAL C 2 319 ? 96.153  -81.086  -50.341  1.00 28.83  ? 319 VAL C CG1 1 
ATOM   3517 C CG2 . VAL C 2 319 ? 97.043  -81.896  -52.503  1.00 31.82  ? 319 VAL C CG2 1 
ATOM   3518 N N   . SER C 2 320 ? 93.966  -84.175  -52.867  1.00 31.45  ? 320 SER C N   1 
ATOM   3519 C CA  . SER C 2 320 ? 93.567  -84.985  -53.976  1.00 34.04  ? 320 SER C CA  1 
ATOM   3520 C C   . SER C 2 320 ? 92.277  -84.473  -54.583  1.00 33.78  ? 320 SER C C   1 
ATOM   3521 O O   . SER C 2 320 ? 91.464  -83.870  -53.889  1.00 33.12  ? 320 SER C O   1 
ATOM   3522 C CB  . SER C 2 320 ? 93.365  -86.430  -53.490  1.00 38.54  ? 320 SER C CB  1 
ATOM   3523 O OG  . SER C 2 320 ? 92.443  -87.140  -54.312  1.00 38.47  ? 320 SER C OG  1 
ATOM   3524 N N   . PRO C 2 321 ? 92.047  -84.770  -55.868  1.00 35.07  ? 321 PRO C N   1 
ATOM   3525 C CA  . PRO C 2 321 ? 90.690  -84.568  -56.376  1.00 35.72  ? 321 PRO C CA  1 
ATOM   3526 C C   . PRO C 2 321 ? 89.732  -85.600  -55.779  1.00 35.67  ? 321 PRO C C   1 
ATOM   3527 O O   . PRO C 2 321 ? 90.154  -86.478  -55.029  1.00 32.80  ? 321 PRO C O   1 
ATOM   3528 C CB  . PRO C 2 321 ? 90.830  -84.766  -57.891  1.00 35.76  ? 321 PRO C CB  1 
ATOM   3529 C CG  . PRO C 2 321 ? 92.248  -85.140  -58.141  1.00 36.91  ? 321 PRO C CG  1 
ATOM   3530 C CD  . PRO C 2 321 ? 92.894  -85.469  -56.837  1.00 36.62  ? 321 PRO C CD  1 
ATOM   3531 N N   . TRP C 2 322 ? 88.447  -85.477  -56.086  1.00 38.54  ? 322 TRP C N   1 
ATOM   3532 C CA  . TRP C 2 322 ? 87.446  -86.389  -55.513  1.00 39.20  ? 322 TRP C CA  1 
ATOM   3533 C C   . TRP C 2 322 ? 87.342  -87.593  -56.442  1.00 38.87  ? 322 TRP C C   1 
ATOM   3534 O O   . TRP C 2 322 ? 86.523  -87.621  -57.348  1.00 37.80  ? 322 TRP C O   1 
ATOM   3535 C CB  . TRP C 2 322 ? 86.103  -85.690  -55.279  1.00 38.81  ? 322 TRP C CB  1 
ATOM   3536 C CG  . TRP C 2 322 ? 85.085  -86.551  -54.618  1.00 40.29  ? 322 TRP C CG  1 
ATOM   3537 C CD1 . TRP C 2 322 ? 84.008  -87.140  -55.217  1.00 40.90  ? 322 TRP C CD1 1 
ATOM   3538 C CD2 . TRP C 2 322 ? 85.046  -86.949  -53.248  1.00 40.81  ? 322 TRP C CD2 1 
ATOM   3539 N NE1 . TRP C 2 322 ? 83.305  -87.879  -54.305  1.00 39.80  ? 322 TRP C NE1 1 
ATOM   3540 C CE2 . TRP C 2 322 ? 83.918  -87.780  -53.088  1.00 41.24  ? 322 TRP C CE2 1 
ATOM   3541 C CE3 . TRP C 2 322 ? 85.857  -86.696  -52.139  1.00 44.70  ? 322 TRP C CE3 1 
ATOM   3542 C CZ2 . TRP C 2 322 ? 83.566  -88.345  -51.859  1.00 43.02  ? 322 TRP C CZ2 1 
ATOM   3543 C CZ3 . TRP C 2 322 ? 85.513  -87.266  -50.910  1.00 47.31  ? 322 TRP C CZ3 1 
ATOM   3544 C CH2 . TRP C 2 322 ? 84.368  -88.081  -50.782  1.00 42.36  ? 322 TRP C CH2 1 
ATOM   3545 N N   . CYS C 2 323 ? 88.243  -88.551  -56.246  1.00 40.35  ? 323 CYS C N   1 
ATOM   3546 C CA  . CYS C 2 323 ? 88.317  -89.725  -57.104  1.00 42.87  ? 323 CYS C CA  1 
ATOM   3547 C C   . CYS C 2 323 ? 89.169  -90.772  -56.460  1.00 47.10  ? 323 CYS C C   1 
ATOM   3548 O O   . CYS C 2 323 ? 89.846  -90.469  -55.493  1.00 46.18  ? 323 CYS C O   1 
ATOM   3549 C CB  . CYS C 2 323 ? 88.850  -89.409  -58.514  1.00 45.59  ? 323 CYS C CB  1 
ATOM   3550 S SG  . CYS C 2 323 ? 90.594  -88.908  -58.663  1.00 46.25  ? 323 CYS C SG  1 
ATOM   3551 N N   . SER C 2 324 ? 89.096  -92.003  -56.986  1.00 46.44  ? 324 SER C N   1 
ATOM   3552 C CA  . SER C 2 324 ? 89.972  -93.114  -56.565  1.00 50.59  ? 324 SER C CA  1 
ATOM   3553 C C   . SER C 2 324 ? 90.402  -93.973  -57.762  1.00 51.28  ? 324 SER C C   1 
ATOM   3554 O O   . SER C 2 324 ? 89.857  -93.849  -58.850  1.00 48.38  ? 324 SER C O   1 
ATOM   3555 C CB  . SER C 2 324 ? 89.293  -94.016  -55.511  1.00 48.68  ? 324 SER C CB  1 
ATOM   3556 O OG  . SER C 2 324 ? 88.472  -94.994  -56.119  1.00 52.27  ? 324 SER C OG  1 
ATOM   3557 N N   . CYS C 2 325 ? 91.354  -94.875  -57.536  1.00 57.88  ? 325 CYS C N   1 
ATOM   3558 C CA  . CYS C 2 325 ? 91.809  -95.811  -58.592  1.00 64.93  ? 325 CYS C CA  1 
ATOM   3559 C C   . CYS C 2 325 ? 91.055  -97.169  -58.615  1.00 69.58  ? 325 CYS C C   1 
ATOM   3560 O O   . CYS C 2 325 ? 91.488  -98.113  -59.265  1.00 77.67  ? 325 CYS C O   1 
ATOM   3561 C CB  . CYS C 2 325 ? 93.324  -96.001  -58.498  1.00 62.80  ? 325 CYS C CB  1 
ATOM   3562 S SG  . CYS C 2 325 ? 94.231  -94.522  -59.007  1.00 65.48  ? 325 CYS C SG  1 
ATOM   3563 N N   . ARG C 2 326 ? 89.922  -97.242  -57.918  1.00 72.21  ? 326 ARG C N   1 
ATOM   3564 C CA  . ARG C 2 326 ? 89.010  -98.377  -57.975  1.00 70.80  ? 326 ARG C CA  1 
ATOM   3565 C C   . ARG C 2 326 ? 88.286  -98.392  -59.338  1.00 70.86  ? 326 ARG C C   1 
ATOM   3566 O O   . ARG C 2 326 ? 87.762  -97.371  -59.799  1.00 63.12  ? 326 ARG C O   1 
ATOM   3567 C CB  . ARG C 2 326 ? 88.010  -98.301  -56.798  1.00 76.99  ? 326 ARG C CB  1 
ATOM   3568 C CG  . ARG C 2 326 ? 87.002  -99.455  -56.711  1.00 88.85  ? 326 ARG C CG  1 
ATOM   3569 C CD  . ARG C 2 326 ? 86.643  -99.875  -55.278  1.00 94.90  ? 326 ARG C CD  1 
ATOM   3570 N NE  . ARG C 2 326 ? 85.604  -99.050  -54.641  1.00 101.78 ? 326 ARG C NE  1 
ATOM   3571 C CZ  . ARG C 2 326 ? 85.111  -99.244  -53.410  1.00 104.53 ? 326 ARG C CZ  1 
ATOM   3572 N NH1 . ARG C 2 326 ? 85.545  -100.242 -52.637  1.00 108.72 ? 326 ARG C NH1 1 
ATOM   3573 N NH2 . ARG C 2 326 ? 84.167  -98.433  -52.941  1.00 106.42 ? 326 ARG C NH2 1 
ATOM   3574 N N   . GLY C 2 327 ? 88.281  -99.559  -59.981  1.00 72.54  ? 327 GLY C N   1 
ATOM   3575 C CA  . GLY C 2 327 ? 87.643  -99.747  -61.285  1.00 66.96  ? 327 GLY C CA  1 
ATOM   3576 C C   . GLY C 2 327 ? 88.529  -99.318  -62.439  1.00 71.23  ? 327 GLY C C   1 
ATOM   3577 O O   . GLY C 2 327 ? 88.034  -98.885  -63.482  1.00 78.36  ? 327 GLY C O   1 
ATOM   3578 N N   . SER C 2 328 ? 89.840  -99.435  -62.262  1.00 71.69  ? 328 SER C N   1 
ATOM   3579 C CA  . SER C 2 328 ? 90.786  -99.015  -63.287  1.00 76.37  ? 328 SER C CA  1 
ATOM   3580 C C   . SER C 2 328 ? 91.010  -100.094 -64.343  1.00 80.48  ? 328 SER C C   1 
ATOM   3581 O O   . SER C 2 328 ? 91.157  -99.775  -65.525  1.00 80.62  ? 328 SER C O   1 
ATOM   3582 C CB  . SER C 2 328 ? 92.102  -98.623  -62.649  1.00 75.25  ? 328 SER C CB  1 
ATOM   3583 O OG  . SER C 2 328 ? 91.916  -97.467  -61.870  1.00 77.16  ? 328 SER C OG  1 
ATOM   3584 N N   . GLY C 2 329 ? 91.043  -101.357 -63.909  1.00 81.25  ? 329 GLY C N   1 
ATOM   3585 C CA  . GLY C 2 329 ? 91.191  -102.493 -64.814  1.00 79.20  ? 329 GLY C CA  1 
ATOM   3586 C C   . GLY C 2 329 ? 92.596  -102.587 -65.364  1.00 77.61  ? 329 GLY C C   1 
ATOM   3587 O O   . GLY C 2 329 ? 93.552  -102.764 -64.602  1.00 81.69  ? 329 GLY C O   1 
ATOM   3588 N N   . ASN C 2 330 ? 92.719  -102.444 -66.683  1.00 78.85  ? 330 ASN C N   1 
ATOM   3589 C CA  . ASN C 2 330 ? 94.028  -102.471 -67.365  1.00 89.54  ? 330 ASN C CA  1 
ATOM   3590 C C   . ASN C 2 330 ? 94.883  -101.212 -67.142  1.00 86.34  ? 330 ASN C C   1 
ATOM   3591 O O   . ASN C 2 330 ? 96.107  -101.254 -67.301  1.00 88.19  ? 330 ASN C O   1 
ATOM   3592 C CB  . ASN C 2 330 ? 93.850  -102.677 -68.877  1.00 94.93  ? 330 ASN C CB  1 
ATOM   3593 C CG  . ASN C 2 330 ? 93.110  -103.962 -69.221  1.00 102.03 ? 330 ASN C CG  1 
ATOM   3594 O OD1 . ASN C 2 330 ? 92.882  -104.831 -68.371  1.00 103.36 ? 330 ASN C OD1 1 
ATOM   3595 N ND2 . ASN C 2 330 ? 92.724  -104.085 -70.480  1.00 107.68 ? 330 ASN C ND2 1 
ATOM   3596 N N   . MET C 2 331 ? 94.244  -100.102 -66.773  1.00 82.77  ? 331 MET C N   1 
ATOM   3597 C CA  . MET C 2 331 ? 94.937  -98.825  -66.615  1.00 83.92  ? 331 MET C CA  1 
ATOM   3598 C C   . MET C 2 331 ? 95.131  -98.405  -65.154  1.00 77.67  ? 331 MET C C   1 
ATOM   3599 O O   . MET C 2 331 ? 95.243  -97.215  -64.865  1.00 74.93  ? 331 MET C O   1 
ATOM   3600 C CB  . MET C 2 331 ? 94.192  -97.752  -67.391  1.00 87.04  ? 331 MET C CB  1 
ATOM   3601 C CG  . MET C 2 331 ? 94.264  -97.951  -68.894  1.00 87.10  ? 331 MET C CG  1 
ATOM   3602 S SD  . MET C 2 331 ? 92.618  -97.743  -69.567  1.00 100.01 ? 331 MET C SD  1 
ATOM   3603 C CE  . MET C 2 331 ? 91.809  -99.277  -69.087  1.00 104.05 ? 331 MET C CE  1 
ATOM   3604 N N   . GLU C 2 332 ? 95.222  -99.380  -64.248  1.00 67.48  ? 332 GLU C N   1 
ATOM   3605 C CA  . GLU C 2 332 ? 95.539  -99.097  -62.857  1.00 70.12  ? 332 GLU C CA  1 
ATOM   3606 C C   . GLU C 2 332 ? 96.840  -98.314  -62.717  1.00 65.86  ? 332 GLU C C   1 
ATOM   3607 O O   . GLU C 2 332 ? 96.936  -97.399  -61.903  1.00 69.28  ? 332 GLU C O   1 
ATOM   3608 C CB  . GLU C 2 332 ? 95.609  -100.380 -62.024  1.00 77.97  ? 332 GLU C CB  1 
ATOM   3609 C CG  . GLU C 2 332 ? 95.374  -100.136 -60.537  1.00 86.94  ? 332 GLU C CG  1 
ATOM   3610 C CD  . GLU C 2 332 ? 95.497  -101.387 -59.684  1.00 96.38  ? 332 GLU C CD  1 
ATOM   3611 O OE1 . GLU C 2 332 ? 95.002  -102.458 -60.096  1.00 102.81 ? 332 GLU C OE1 1 
ATOM   3612 O OE2 . GLU C 2 332 ? 96.074  -101.290 -58.580  1.00 104.97 ? 332 GLU C OE2 1 
ATOM   3613 N N   . GLU C 2 333 ? 97.834  -98.675  -63.511  1.00 65.21  ? 333 GLU C N   1 
ATOM   3614 C CA  . GLU C 2 333 ? 99.153  -98.044  -63.440  1.00 64.09  ? 333 GLU C CA  1 
ATOM   3615 C C   . GLU C 2 333 ? 99.061  -96.549  -63.776  1.00 56.39  ? 333 GLU C C   1 
ATOM   3616 O O   . GLU C 2 333 ? 99.597  -95.720  -63.057  1.00 50.40  ? 333 GLU C O   1 
ATOM   3617 C CB  . GLU C 2 333 ? 100.112 -98.742  -64.404  1.00 70.23  ? 333 GLU C CB  1 
ATOM   3618 C CG  . GLU C 2 333 ? 101.545 -98.815  -63.925  1.00 82.41  ? 333 GLU C CG  1 
ATOM   3619 C CD  . GLU C 2 333 ? 102.450 -99.513  -64.935  1.00 93.52  ? 333 GLU C CD  1 
ATOM   3620 O OE1 . GLU C 2 333 ? 103.324 -98.832  -65.525  1.00 95.28  ? 333 GLU C OE1 1 
ATOM   3621 O OE2 . GLU C 2 333 ? 102.279 -100.741 -65.142  1.00 96.70  ? 333 GLU C OE2 1 
ATOM   3622 N N   . GLU C 2 334 ? 98.365  -96.253  -64.873  1.00 51.44  ? 334 GLU C N   1 
ATOM   3623 C CA  . GLU C 2 334 ? 98.149  -94.907  -65.370  1.00 54.93  ? 334 GLU C CA  1 
ATOM   3624 C C   . GLU C 2 334 ? 97.272  -94.078  -64.388  1.00 54.35  ? 334 GLU C C   1 
ATOM   3625 O O   . GLU C 2 334 ? 97.553  -92.900  -64.128  1.00 50.93  ? 334 GLU C O   1 
ATOM   3626 C CB  . GLU C 2 334 ? 97.516  -94.941  -66.772  1.00 54.16  ? 334 GLU C CB  1 
ATOM   3627 C CG  . GLU C 2 334 ? 97.785  -93.682  -67.595  1.00 62.04  ? 334 GLU C CG  1 
ATOM   3628 C CD  . GLU C 2 334 ? 96.739  -93.404  -68.674  1.00 72.49  ? 334 GLU C CD  1 
ATOM   3629 O OE1 . GLU C 2 334 ? 96.127  -94.376  -69.178  1.00 76.28  ? 334 GLU C OE1 1 
ATOM   3630 O OE2 . GLU C 2 334 ? 96.522  -92.209  -69.020  1.00 67.85  ? 334 GLU C OE2 1 
ATOM   3631 N N   . CYS C 2 335 ? 96.222  -94.700  -63.861  1.00 50.19  ? 335 CYS C N   1 
ATOM   3632 C CA  . CYS C 2 335 ? 95.371  -94.069  -62.871  1.00 53.87  ? 335 CYS C CA  1 
ATOM   3633 C C   . CYS C 2 335 ? 96.196  -93.650  -61.645  1.00 52.53  ? 335 CYS C C   1 
ATOM   3634 O O   . CYS C 2 335 ? 96.154  -92.494  -61.238  1.00 49.61  ? 335 CYS C O   1 
ATOM   3635 C CB  . CYS C 2 335 ? 94.230  -94.996  -62.466  1.00 53.34  ? 335 CYS C CB  1 
ATOM   3636 S SG  . CYS C 2 335 ? 92.945  -94.215  -61.469  1.00 54.44  ? 335 CYS C SG  1 
ATOM   3637 N N   . GLU C 2 336 ? 96.975  -94.578  -61.104  1.00 49.86  ? 336 GLU C N   1 
ATOM   3638 C CA  . GLU C 2 336 ? 97.794  -94.304  -59.931  1.00 52.49  ? 336 GLU C CA  1 
ATOM   3639 C C   . GLU C 2 336 ? 98.834  -93.230  -60.176  1.00 49.57  ? 336 GLU C C   1 
ATOM   3640 O O   . GLU C 2 336 ? 99.116  -92.445  -59.274  1.00 45.26  ? 336 GLU C O   1 
ATOM   3641 C CB  . GLU C 2 336 ? 98.464  -95.573  -59.397  1.00 60.57  ? 336 GLU C CB  1 
ATOM   3642 C CG  . GLU C 2 336 ? 97.556  -96.393  -58.483  1.00 71.54  ? 336 GLU C CG  1 
ATOM   3643 C CD  . GLU C 2 336 ? 98.034  -97.826  -58.269  1.00 85.62  ? 336 GLU C CD  1 
ATOM   3644 O OE1 . GLU C 2 336 ? 99.235  -98.113  -58.516  1.00 91.44  ? 336 GLU C OE1 1 
ATOM   3645 O OE2 . GLU C 2 336 ? 97.205  -98.670  -57.847  1.00 92.51  ? 336 GLU C OE2 1 
ATOM   3646 N N   . LYS C 2 337 ? 99.397  -93.209  -61.382  1.00 46.18  ? 337 LYS C N   1 
ATOM   3647 C CA  . LYS C 2 337 ? 100.394 -92.225  -61.771  1.00 46.76  ? 337 LYS C CA  1 
ATOM   3648 C C   . LYS C 2 337 ? 99.744  -90.842  -61.780  1.00 44.42  ? 337 LYS C C   1 
ATOM   3649 O O   . LYS C 2 337 ? 100.343 -89.855  -61.336  1.00 45.20  ? 337 LYS C O   1 
ATOM   3650 C CB  . LYS C 2 337 ? 100.963 -92.543  -63.160  1.00 51.59  ? 337 LYS C CB  1 
ATOM   3651 C CG  . LYS C 2 337 ? 102.208 -91.737  -63.528  1.00 57.81  ? 337 LYS C CG  1 
ATOM   3652 C CD  . LYS C 2 337 ? 102.443 -91.648  -65.044  1.00 64.11  ? 337 LYS C CD  1 
ATOM   3653 C CE  . LYS C 2 337 ? 103.756 -90.951  -65.417  1.00 68.79  ? 337 LYS C CE  1 
ATOM   3654 N NZ  . LYS C 2 337 ? 104.056 -89.688  -64.664  1.00 72.59  ? 337 LYS C NZ  1 
ATOM   3655 N N   . PHE C 2 338 ? 98.523  -90.793  -62.303  1.00 40.16  ? 338 PHE C N   1 
ATOM   3656 C CA  . PHE C 2 338 ? 97.751  -89.573  -62.356  1.00 41.81  ? 338 PHE C CA  1 
ATOM   3657 C C   . PHE C 2 338 ? 97.479  -89.043  -60.956  1.00 42.49  ? 338 PHE C C   1 
ATOM   3658 O O   . PHE C 2 338 ? 97.697  -87.854  -60.685  1.00 39.44  ? 338 PHE C O   1 
ATOM   3659 C CB  . PHE C 2 338 ? 96.443  -89.805  -63.097  1.00 41.20  ? 338 PHE C CB  1 
ATOM   3660 C CG  . PHE C 2 338 ? 95.532  -88.628  -63.082  1.00 41.49  ? 338 PHE C CG  1 
ATOM   3661 C CD1 . PHE C 2 338 ? 95.734  -87.584  -63.952  1.00 41.68  ? 338 PHE C CD1 1 
ATOM   3662 C CD2 . PHE C 2 338 ? 94.488  -88.553  -62.174  1.00 43.40  ? 338 PHE C CD2 1 
ATOM   3663 C CE1 . PHE C 2 338 ? 94.917  -86.468  -63.933  1.00 40.82  ? 338 PHE C CE1 1 
ATOM   3664 C CE2 . PHE C 2 338 ? 93.675  -87.435  -62.144  1.00 45.38  ? 338 PHE C CE2 1 
ATOM   3665 C CZ  . PHE C 2 338 ? 93.890  -86.398  -63.041  1.00 41.13  ? 338 PHE C CZ  1 
ATOM   3666 N N   . LEU C 2 339 ? 97.036  -89.935  -60.072  1.00 39.63  ? 339 LEU C N   1 
ATOM   3667 C CA  . LEU C 2 339 ? 96.658  -89.529  -58.754  1.00 40.54  ? 339 LEU C CA  1 
ATOM   3668 C C   . LEU C 2 339 ? 97.866  -89.072  -57.964  1.00 41.07  ? 339 LEU C C   1 
ATOM   3669 O O   . LEU C 2 339 ? 97.756  -88.135  -57.168  1.00 42.88  ? 339 LEU C O   1 
ATOM   3670 C CB  . LEU C 2 339 ? 95.889  -90.627  -58.034  1.00 40.97  ? 339 LEU C CB  1 
ATOM   3671 C CG  . LEU C 2 339 ? 95.327  -90.257  -56.649  1.00 42.56  ? 339 LEU C CG  1 
ATOM   3672 C CD1 . LEU C 2 339 ? 94.402  -89.052  -56.708  1.00 43.13  ? 339 LEU C CD1 1 
ATOM   3673 C CD2 . LEU C 2 339 ? 94.579  -91.441  -56.059  1.00 43.59  ? 339 LEU C CD2 1 
ATOM   3674 N N   . ARG C 2 340 ? 99.023  -89.672  -58.227  1.00 42.39  ? 340 ARG C N   1 
ATOM   3675 C CA  . ARG C 2 340 ? 100.232 -89.356  -57.463  1.00 43.05  ? 340 ARG C CA  1 
ATOM   3676 C C   . ARG C 2 340 ? 100.738 -87.932  -57.673  1.00 40.56  ? 340 ARG C C   1 
ATOM   3677 O O   . ARG C 2 340 ? 101.392 -87.375  -56.788  1.00 43.41  ? 340 ARG C O   1 
ATOM   3678 C CB  . ARG C 2 340 ? 101.339 -90.374  -57.752  1.00 47.67  ? 340 ARG C CB  1 
ATOM   3679 C CG  . ARG C 2 340 ? 101.263 -91.640  -56.882  1.00 51.78  ? 340 ARG C CG  1 
ATOM   3680 C CD  . ARG C 2 340 ? 102.603 -92.387  -56.823  1.00 54.67  ? 340 ARG C CD  1 
ATOM   3681 N NE  . ARG C 2 340 ? 103.163 -92.639  -58.160  1.00 52.66  ? 340 ARG C NE  1 
ATOM   3682 C CZ  . ARG C 2 340 ? 102.834 -93.657  -58.959  1.00 52.73  ? 340 ARG C CZ  1 
ATOM   3683 N NH1 . ARG C 2 340 ? 101.929 -94.565  -58.590  1.00 54.88  ? 340 ARG C NH1 1 
ATOM   3684 N NH2 . ARG C 2 340 ? 103.421 -93.769  -60.147  1.00 52.32  ? 340 ARG C NH2 1 
ATOM   3685 N N   . ASP C 2 341 ? 100.422 -87.331  -58.824  1.00 37.64  ? 341 ASP C N   1 
ATOM   3686 C CA  . ASP C 2 341 ? 100.732 -85.928  -59.059  1.00 37.06  ? 341 ASP C CA  1 
ATOM   3687 C C   . ASP C 2 341 ? 100.044 -85.000  -58.083  1.00 35.63  ? 341 ASP C C   1 
ATOM   3688 O O   . ASP C 2 341 ? 100.454 -83.874  -57.931  1.00 37.27  ? 341 ASP C O   1 
ATOM   3689 C CB  . ASP C 2 341 ? 100.393 -85.524  -60.491  1.00 39.87  ? 341 ASP C CB  1 
ATOM   3690 C CG  . ASP C 2 341 ? 101.340 -86.145  -61.509  1.00 41.82  ? 341 ASP C CG  1 
ATOM   3691 O OD1 . ASP C 2 341 ? 102.494 -86.404  -61.139  1.00 41.86  ? 341 ASP C OD1 1 
ATOM   3692 O OD2 . ASP C 2 341 ? 100.932 -86.386  -62.665  1.00 45.71  ? 341 ASP C OD2 1 
ATOM   3693 N N   . PHE C 2 342 ? 99.003  -85.478  -57.419  1.00 36.76  ? 342 PHE C N   1 
ATOM   3694 C CA  . PHE C 2 342 ? 98.356  -84.754  -56.328  1.00 37.12  ? 342 PHE C CA  1 
ATOM   3695 C C   . PHE C 2 342 ? 98.785  -85.253  -54.966  1.00 37.39  ? 342 PHE C C   1 
ATOM   3696 O O   . PHE C 2 342 ? 99.213  -84.465  -54.088  1.00 39.62  ? 342 PHE C O   1 
ATOM   3697 C CB  . PHE C 2 342 ? 96.850  -84.918  -56.450  1.00 36.91  ? 342 PHE C CB  1 
ATOM   3698 C CG  . PHE C 2 342 ? 96.284  -84.282  -57.662  1.00 36.31  ? 342 PHE C CG  1 
ATOM   3699 C CD1 . PHE C 2 342 ? 96.240  -84.959  -58.867  1.00 39.91  ? 342 PHE C CD1 1 
ATOM   3700 C CD2 . PHE C 2 342 ? 95.772  -82.995  -57.602  1.00 41.65  ? 342 PHE C CD2 1 
ATOM   3701 C CE1 . PHE C 2 342 ? 95.694  -84.362  -60.005  1.00 39.80  ? 342 PHE C CE1 1 
ATOM   3702 C CE2 . PHE C 2 342 ? 95.225  -82.391  -58.729  1.00 42.45  ? 342 PHE C CE2 1 
ATOM   3703 C CZ  . PHE C 2 342 ? 95.188  -83.075  -59.931  1.00 40.08  ? 342 PHE C CZ  1 
ATOM   3704 N N   . THR C 2 343 ? 98.644  -86.563  -54.771  1.00 38.24  ? 343 THR C N   1 
ATOM   3705 C CA  . THR C 2 343 ? 98.828  -87.147  -53.438  1.00 39.13  ? 343 THR C CA  1 
ATOM   3706 C C   . THR C 2 343 ? 100.271 -87.282  -53.010  1.00 41.34  ? 343 THR C C   1 
ATOM   3707 O O   . THR C 2 343 ? 100.563 -87.071  -51.858  1.00 44.59  ? 343 THR C O   1 
ATOM   3708 C CB  . THR C 2 343 ? 98.151  -88.506  -53.313  1.00 41.10  ? 343 THR C CB  1 
ATOM   3709 O OG1 . THR C 2 343 ? 98.701  -89.411  -54.278  1.00 43.40  ? 343 THR C OG1 1 
ATOM   3710 C CG2 . THR C 2 343 ? 96.652  -88.368  -53.532  1.00 39.14  ? 343 THR C CG2 1 
ATOM   3711 N N   . GLU C 2 344 ? 101.172 -87.616  -53.934  1.00 45.65  ? 344 GLU C N   1 
ATOM   3712 C CA  . GLU C 2 344 ? 102.559 -87.964  -53.596  1.00 46.54  ? 344 GLU C CA  1 
ATOM   3713 C C   . GLU C 2 344 ? 103.573 -87.164  -54.392  1.00 45.37  ? 344 GLU C C   1 
ATOM   3714 O O   . GLU C 2 344 ? 104.568 -87.697  -54.892  1.00 48.69  ? 344 GLU C O   1 
ATOM   3715 C CB  . GLU C 2 344 ? 102.747 -89.463  -53.808  1.00 49.66  ? 344 GLU C CB  1 
ATOM   3716 C CG  . GLU C 2 344 ? 102.176 -90.287  -52.671  1.00 57.31  ? 344 GLU C CG  1 
ATOM   3717 C CD  . GLU C 2 344 ? 102.243 -91.775  -52.933  1.00 65.58  ? 344 GLU C CD  1 
ATOM   3718 O OE1 . GLU C 2 344 ? 103.366 -92.270  -53.195  1.00 76.86  ? 344 GLU C OE1 1 
ATOM   3719 O OE2 . GLU C 2 344 ? 101.177 -92.439  -52.887  1.00 67.03  ? 344 GLU C OE2 1 
ATOM   3720 N N   . ASN C 2 345 ? 103.323 -85.871  -54.497  1.00 43.63  ? 345 ASN C N   1 
ATOM   3721 C CA  . ASN C 2 345 ? 104.123 -84.998  -55.334  1.00 39.10  ? 345 ASN C CA  1 
ATOM   3722 C C   . ASN C 2 345 ? 105.066 -84.166  -54.453  1.00 38.20  ? 345 ASN C C   1 
ATOM   3723 O O   . ASN C 2 345 ? 104.624 -83.272  -53.734  1.00 36.10  ? 345 ASN C O   1 
ATOM   3724 C CB  . ASN C 2 345 ? 103.175 -84.121  -56.128  1.00 40.33  ? 345 ASN C CB  1 
ATOM   3725 C CG  . ASN C 2 345 ? 103.878 -83.212  -57.113  1.00 36.78  ? 345 ASN C CG  1 
ATOM   3726 O OD1 . ASN C 2 345 ? 105.061 -82.897  -56.980  1.00 38.88  ? 345 ASN C OD1 1 
ATOM   3727 N ND2 . ASN C 2 345 ? 103.137 -82.763  -58.095  1.00 33.58  ? 345 ASN C ND2 1 
ATOM   3728 N N   . PRO C 2 346 ? 106.375 -84.442  -54.520  1.00 35.76  ? 346 PRO C N   1 
ATOM   3729 C CA  . PRO C 2 346 ? 107.300 -83.654  -53.719  1.00 33.34  ? 346 PRO C CA  1 
ATOM   3730 C C   . PRO C 2 346 ? 107.317 -82.161  -54.051  1.00 34.58  ? 346 PRO C C   1 
ATOM   3731 O O   . PRO C 2 346 ? 107.570 -81.348  -53.158  1.00 32.31  ? 346 PRO C O   1 
ATOM   3732 C CB  . PRO C 2 346 ? 108.658 -84.286  -54.012  1.00 33.53  ? 346 PRO C CB  1 
ATOM   3733 C CG  . PRO C 2 346 ? 108.497 -84.965  -55.316  1.00 35.70  ? 346 PRO C CG  1 
ATOM   3734 C CD  . PRO C 2 346 ? 107.075 -85.420  -55.373  1.00 36.19  ? 346 PRO C CD  1 
ATOM   3735 N N   . CYS C 2 347 ? 107.044 -81.788  -55.303  1.00 35.85  ? 347 CYS C N   1 
ATOM   3736 C CA  . CYS C 2 347 ? 106.926 -80.364  -55.627  1.00 35.83  ? 347 CYS C CA  1 
ATOM   3737 C C   . CYS C 2 347 ? 105.762 -79.688  -54.877  1.00 33.86  ? 347 CYS C C   1 
ATOM   3738 O O   . CYS C 2 347 ? 105.954 -78.725  -54.162  1.00 30.44  ? 347 CYS C O   1 
ATOM   3739 C CB  . CYS C 2 347 ? 106.738 -80.154  -57.118  1.00 38.86  ? 347 CYS C CB  1 
ATOM   3740 S SG  . CYS C 2 347 ? 106.353 -78.449  -57.541  1.00 39.89  ? 347 CYS C SG  1 
ATOM   3741 N N   . LEU C 2 348 ? 104.560 -80.213  -55.064  1.00 33.68  ? 348 LEU C N   1 
ATOM   3742 C CA  . LEU C 2 348 ? 103.392 -79.689  -54.403  1.00 34.04  ? 348 LEU C CA  1 
ATOM   3743 C C   . LEU C 2 348 ? 103.525 -79.734  -52.861  1.00 36.37  ? 348 LEU C C   1 
ATOM   3744 O O   . LEU C 2 348 ? 103.303 -78.739  -52.164  1.00 35.86  ? 348 LEU C O   1 
ATOM   3745 C CB  . LEU C 2 348 ? 102.180 -80.477  -54.871  1.00 36.21  ? 348 LEU C CB  1 
ATOM   3746 C CG  . LEU C 2 348 ? 100.809 -80.014  -54.420  1.00 33.28  ? 348 LEU C CG  1 
ATOM   3747 C CD1 . LEU C 2 348 ? 100.574 -78.614  -54.937  1.00 35.52  ? 348 LEU C CD1 1 
ATOM   3748 C CD2 . LEU C 2 348 ? 99.786  -80.965  -54.956  1.00 33.53  ? 348 LEU C CD2 1 
ATOM   3749 N N   . ARG C 2 349 ? 103.958 -80.875  -52.344  1.00 37.77  ? 349 ARG C N   1 
ATOM   3750 C CA  . ARG C 2 349 ? 104.226 -81.014  -50.910  1.00 38.28  ? 349 ARG C CA  1 
ATOM   3751 C C   . ARG C 2 349 ? 105.136 -79.920  -50.382  1.00 36.37  ? 349 ARG C C   1 
ATOM   3752 O O   . ARG C 2 349 ? 104.846 -79.286  -49.370  1.00 41.08  ? 349 ARG C O   1 
ATOM   3753 C CB  . ARG C 2 349 ? 104.889 -82.363  -50.644  1.00 42.54  ? 349 ARG C CB  1 
ATOM   3754 C CG  . ARG C 2 349 ? 105.249 -82.610  -49.176  1.00 48.42  ? 349 ARG C CG  1 
ATOM   3755 C CD  . ARG C 2 349 ? 106.310 -83.677  -49.033  1.00 54.64  ? 349 ARG C CD  1 
ATOM   3756 N NE  . ARG C 2 349 ? 106.689 -83.840  -47.637  1.00 54.35  ? 349 ARG C NE  1 
ATOM   3757 C CZ  . ARG C 2 349 ? 107.747 -83.277  -47.039  1.00 61.60  ? 349 ARG C CZ  1 
ATOM   3758 N NH1 . ARG C 2 349 ? 108.618 -82.502  -47.700  1.00 62.07  ? 349 ARG C NH1 1 
ATOM   3759 N NH2 . ARG C 2 349 ? 107.945 -83.505  -45.738  1.00 63.05  ? 349 ARG C NH2 1 
ATOM   3760 N N   . ASN C 2 350 ? 106.273 -79.742  -51.044  1.00 34.52  ? 350 ASN C N   1 
ATOM   3761 C CA  . ASN C 2 350 ? 107.249 -78.763  -50.613  1.00 34.35  ? 350 ASN C CA  1 
ATOM   3762 C C   . ASN C 2 350 ? 106.772 -77.328  -50.753  1.00 34.93  ? 350 ASN C C   1 
ATOM   3763 O O   . ASN C 2 350 ? 107.079 -76.490  -49.906  1.00 37.74  ? 350 ASN C O   1 
ATOM   3764 C CB  . ASN C 2 350 ? 108.523 -78.911  -51.409  1.00 35.84  ? 350 ASN C CB  1 
ATOM   3765 C CG  . ASN C 2 350 ? 109.301 -80.163  -51.064  1.00 36.17  ? 350 ASN C CG  1 
ATOM   3766 O OD1 . ASN C 2 350 ? 109.066 -80.845  -50.063  1.00 36.65  ? 350 ASN C OD1 1 
ATOM   3767 N ND2 . ASN C 2 350 ? 110.252 -80.468  -51.908  1.00 36.12  ? 350 ASN C ND2 1 
ATOM   3768 N N   . ALA C 2 351 ? 106.031 -77.041  -51.814  1.00 33.38  ? 351 ALA C N   1 
ATOM   3769 C CA  . ALA C 2 351 ? 105.494 -75.702  -52.009  1.00 36.23  ? 351 ALA C CA  1 
ATOM   3770 C C   . ALA C 2 351 ? 104.480 -75.352  -50.913  1.00 35.36  ? 351 ALA C C   1 
ATOM   3771 O O   . ALA C 2 351 ? 104.551 -74.281  -50.352  1.00 33.99  ? 351 ALA C O   1 
ATOM   3772 C CB  . ALA C 2 351 ? 104.854 -75.580  -53.394  1.00 37.49  ? 351 ALA C CB  1 
ATOM   3773 N N   . ILE C 2 352 ? 103.551 -76.273  -50.616  1.00 38.20  ? 352 ILE C N   1 
ATOM   3774 C CA  . ILE C 2 352 ? 102.566 -76.063  -49.556  1.00 40.73  ? 352 ILE C CA  1 
ATOM   3775 C C   . ILE C 2 352 ? 103.230 -75.841  -48.188  1.00 43.22  ? 352 ILE C C   1 
ATOM   3776 O O   . ILE C 2 352 ? 102.911 -74.893  -47.459  1.00 45.63  ? 352 ILE C O   1 
ATOM   3777 C CB  . ILE C 2 352 ? 101.526 -77.194  -49.502  1.00 39.43  ? 352 ILE C CB  1 
ATOM   3778 C CG1 . ILE C 2 352 ? 100.576 -77.086  -50.693  1.00 36.09  ? 352 ILE C CG1 1 
ATOM   3779 C CG2 . ILE C 2 352 ? 100.694 -77.103  -48.226  1.00 39.79  ? 352 ILE C CG2 1 
ATOM   3780 C CD1 . ILE C 2 352 ? 99.718  -78.311  -50.922  1.00 37.61  ? 352 ILE C CD1 1 
ATOM   3781 N N   . GLN C 2 353 ? 104.185 -76.691  -47.874  1.00 47.57  ? 353 GLN C N   1 
ATOM   3782 C CA  . GLN C 2 353 ? 104.911 -76.601  -46.607  1.00 45.78  ? 353 GLN C CA  1 
ATOM   3783 C C   . GLN C 2 353 ? 105.756 -75.342  -46.482  1.00 42.31  ? 353 GLN C C   1 
ATOM   3784 O O   . GLN C 2 353 ? 105.803 -74.750  -45.422  1.00 41.95  ? 353 GLN C O   1 
ATOM   3785 C CB  . GLN C 2 353 ? 105.758 -77.839  -46.452  1.00 49.96  ? 353 GLN C CB  1 
ATOM   3786 C CG  . GLN C 2 353 ? 106.304 -78.064  -45.064  1.00 59.94  ? 353 GLN C CG  1 
ATOM   3787 C CD  . GLN C 2 353 ? 106.945 -79.436  -44.942  1.00 68.60  ? 353 GLN C CD  1 
ATOM   3788 O OE1 . GLN C 2 353 ? 106.450 -80.422  -45.500  1.00 68.01  ? 353 GLN C OE1 1 
ATOM   3789 N NE2 . GLN C 2 353 ? 108.058 -79.510  -44.228  1.00 76.01  ? 353 GLN C NE2 1 
ATOM   3790 N N   . ALA C 2 354 ? 106.406 -74.919  -47.560  1.00 42.17  ? 354 ALA C N   1 
ATOM   3791 C CA  . ALA C 2 354 ? 107.199 -73.683  -47.540  1.00 40.85  ? 354 ALA C CA  1 
ATOM   3792 C C   . ALA C 2 354 ? 106.331 -72.468  -47.389  1.00 44.53  ? 354 ALA C C   1 
ATOM   3793 O O   . ALA C 2 354 ? 106.752 -71.469  -46.795  1.00 47.60  ? 354 ALA C O   1 
ATOM   3794 C CB  . ALA C 2 354 ? 107.994 -73.538  -48.824  1.00 43.54  ? 354 ALA C CB  1 
ATOM   3795 N N   . PHE C 2 355 ? 105.126 -72.511  -47.951  1.00 46.52  ? 355 PHE C N   1 
ATOM   3796 C CA  . PHE C 2 355 ? 104.254 -71.363  -47.789  1.00 50.39  ? 355 PHE C CA  1 
ATOM   3797 C C   . PHE C 2 355 ? 103.879 -71.164  -46.316  1.00 53.93  ? 355 PHE C C   1 
ATOM   3798 O O   . PHE C 2 355 ? 103.987 -70.067  -45.796  1.00 49.82  ? 355 PHE C O   1 
ATOM   3799 C CB  . PHE C 2 355 ? 102.990 -71.452  -48.617  1.00 47.55  ? 355 PHE C CB  1 
ATOM   3800 C CG  . PHE C 2 355 ? 102.275 -70.153  -48.666  1.00 46.24  ? 355 PHE C CG  1 
ATOM   3801 C CD1 . PHE C 2 355 ? 102.597 -69.216  -49.637  1.00 47.99  ? 355 PHE C CD1 1 
ATOM   3802 C CD2 . PHE C 2 355 ? 101.388 -69.806  -47.664  1.00 45.20  ? 355 PHE C CD2 1 
ATOM   3803 C CE1 . PHE C 2 355 ? 101.980 -67.984  -49.652  1.00 47.96  ? 355 PHE C CE1 1 
ATOM   3804 C CE2 . PHE C 2 355 ? 100.778 -68.577  -47.666  1.00 42.99  ? 355 PHE C CE2 1 
ATOM   3805 C CZ  . PHE C 2 355 ? 101.068 -67.670  -48.659  1.00 45.31  ? 355 PHE C CZ  1 
ATOM   3806 N N   . GLY C 2 356 ? 103.431 -72.239  -45.675  1.00 61.11  ? 356 GLY C N   1 
ATOM   3807 C CA  . GLY C 2 356 ? 102.981 -72.191  -44.287  1.00 68.48  ? 356 GLY C CA  1 
ATOM   3808 C C   . GLY C 2 356 ? 104.056 -71.817  -43.286  1.00 69.22  ? 356 GLY C C   1 
ATOM   3809 O O   . GLY C 2 356 ? 103.763 -71.175  -42.278  1.00 73.90  ? 356 GLY C O   1 
ATOM   3810 N N   . ASN C 2 357 ? 105.289 -72.220  -43.575  1.00 69.14  ? 357 ASN C N   1 
ATOM   3811 C CA  . ASN C 2 357 ? 106.433 -71.965  -42.705  1.00 75.80  ? 357 ASN C CA  1 
ATOM   3812 C C   . ASN C 2 357 ? 106.976 -70.543  -42.774  1.00 76.83  ? 357 ASN C C   1 
ATOM   3813 O O   . ASN C 2 357 ? 107.651 -70.112  -41.853  1.00 79.63  ? 357 ASN C O   1 
ATOM   3814 C CB  . ASN C 2 357 ? 107.556 -72.971  -43.012  1.00 78.41  ? 357 ASN C CB  1 
ATOM   3815 C CG  . ASN C 2 357 ? 107.227 -74.381  -42.533  1.00 90.70  ? 357 ASN C CG  1 
ATOM   3816 O OD1 . ASN C 2 357 ? 106.226 -74.599  -41.829  1.00 96.44  ? 357 ASN C OD1 1 
ATOM   3817 N ND2 . ASN C 2 357 ? 108.074 -75.346  -42.899  1.00 90.83  ? 357 ASN C ND2 1 
ATOM   3818 N N   . GLY C 2 358 ? 106.698 -69.817  -43.850  1.00 86.26  ? 358 GLY C N   1 
ATOM   3819 C CA  . GLY C 2 358 ? 107.275 -68.476  -44.054  1.00 96.40  ? 358 GLY C CA  1 
ATOM   3820 C C   . GLY C 2 358 ? 108.646 -68.506  -44.723  1.00 107.58 ? 358 GLY C C   1 
ATOM   3821 O O   . GLY C 2 358 ? 109.624 -67.983  -44.178  1.00 108.60 ? 358 GLY C O   1 
ATOM   3822 N N   . THR C 2 359 ? 108.699 -69.119  -45.910  1.00 116.08 ? 359 THR C N   1 
ATOM   3823 C CA  . THR C 2 359 ? 109.913 -69.214  -46.749  1.00 116.16 ? 359 THR C CA  1 
ATOM   3824 C C   . THR C 2 359 ? 109.775 -68.246  -47.933  1.00 117.88 ? 359 THR C C   1 
ATOM   3825 O O   . THR C 2 359 ? 110.766 -67.843  -48.560  1.00 109.43 ? 359 THR C O   1 
ATOM   3826 C CB  . THR C 2 359 ? 110.113 -70.667  -47.262  1.00 113.85 ? 359 THR C CB  1 
ATOM   3827 O OG1 . THR C 2 359 ? 110.260 -71.556  -46.144  1.00 104.54 ? 359 THR C OG1 1 
ATOM   3828 C CG2 . THR C 2 359 ? 111.337 -70.815  -48.206  1.00 109.38 ? 359 THR C CG2 1 
ATOM   3829 N N   . PRO D 2 37  ? 29.528  -23.425  -75.278  1.00 123.05 ? 37  PRO D N   1 
ATOM   3830 C CA  . PRO D 2 37  ? 30.101  -22.961  -76.544  1.00 120.88 ? 37  PRO D CA  1 
ATOM   3831 C C   . PRO D 2 37  ? 31.639  -22.962  -76.577  1.00 115.78 ? 37  PRO D C   1 
ATOM   3832 O O   . PRO D 2 37  ? 32.296  -23.104  -75.544  1.00 122.09 ? 37  PRO D O   1 
ATOM   3833 C CB  . PRO D 2 37  ? 29.528  -21.535  -76.697  1.00 122.26 ? 37  PRO D CB  1 
ATOM   3834 C CG  . PRO D 2 37  ? 28.917  -21.173  -75.366  1.00 123.60 ? 37  PRO D CG  1 
ATOM   3835 C CD  . PRO D 2 37  ? 29.146  -22.304  -74.402  1.00 122.65 ? 37  PRO D CD  1 
ATOM   3836 N N   . VAL D 2 38  ? 32.182  -22.786  -77.773  1.00 109.38 ? 38  VAL D N   1 
ATOM   3837 C CA  . VAL D 2 38  ? 33.628  -22.908  -78.037  1.00 106.32 ? 38  VAL D CA  1 
ATOM   3838 C C   . VAL D 2 38  ? 34.431  -21.661  -77.587  1.00 100.63 ? 38  VAL D C   1 
ATOM   3839 O O   . VAL D 2 38  ? 34.108  -20.531  -77.982  1.00 100.84 ? 38  VAL D O   1 
ATOM   3840 C CB  . VAL D 2 38  ? 33.854  -23.229  -79.549  1.00 107.15 ? 38  VAL D CB  1 
ATOM   3841 C CG1 . VAL D 2 38  ? 35.257  -22.873  -80.033  1.00 106.00 ? 38  VAL D CG1 1 
ATOM   3842 C CG2 . VAL D 2 38  ? 33.543  -24.699  -79.834  1.00 104.85 ? 38  VAL D CG2 1 
ATOM   3843 N N   . ASP D 2 39  ? 35.490  -21.882  -76.797  1.00 91.08  ? 39  ASP D N   1 
ATOM   3844 C CA  . ASP D 2 39  ? 36.397  -20.796  -76.363  1.00 89.32  ? 39  ASP D CA  1 
ATOM   3845 C C   . ASP D 2 39  ? 37.320  -20.309  -77.495  1.00 85.32  ? 39  ASP D C   1 
ATOM   3846 O O   . ASP D 2 39  ? 37.366  -20.924  -78.550  1.00 85.70  ? 39  ASP D O   1 
ATOM   3847 C CB  . ASP D 2 39  ? 37.203  -21.195  -75.106  1.00 87.47  ? 39  ASP D CB  1 
ATOM   3848 C CG  . ASP D 2 39  ? 38.235  -22.289  -75.363  1.00 88.66  ? 39  ASP D CG  1 
ATOM   3849 O OD1 . ASP D 2 39  ? 39.177  -22.090  -76.160  1.00 87.04  ? 39  ASP D OD1 1 
ATOM   3850 O OD2 . ASP D 2 39  ? 38.119  -23.353  -74.729  1.00 93.83  ? 39  ASP D OD2 1 
ATOM   3851 N N   . CYS D 2 40  ? 38.057  -19.218  -77.261  1.00 79.98  ? 40  CYS D N   1 
ATOM   3852 C CA  . CYS D 2 40  ? 38.896  -18.597  -78.303  1.00 80.54  ? 40  CYS D CA  1 
ATOM   3853 C C   . CYS D 2 40  ? 40.123  -19.403  -78.734  1.00 83.63  ? 40  CYS D C   1 
ATOM   3854 O O   . CYS D 2 40  ? 40.534  -19.306  -79.891  1.00 85.06  ? 40  CYS D O   1 
ATOM   3855 C CB  . CYS D 2 40  ? 39.347  -17.193  -77.889  1.00 79.96  ? 40  CYS D CB  1 
ATOM   3856 S SG  . CYS D 2 40  ? 38.038  -15.951  -77.887  1.00 85.98  ? 40  CYS D SG  1 
ATOM   3857 N N   . VAL D 2 41  ? 40.709  -20.167  -77.814  1.00 83.56  ? 41  VAL D N   1 
ATOM   3858 C CA  . VAL D 2 41  ? 41.846  -21.048  -78.133  1.00 91.49  ? 41  VAL D CA  1 
ATOM   3859 C C   . VAL D 2 41  ? 41.431  -22.178  -79.087  1.00 92.16  ? 41  VAL D C   1 
ATOM   3860 O O   . VAL D 2 41  ? 42.187  -22.526  -79.992  1.00 94.57  ? 41  VAL D O   1 
ATOM   3861 C CB  . VAL D 2 41  ? 42.494  -21.644  -76.851  1.00 94.02  ? 41  VAL D CB  1 
ATOM   3862 C CG1 . VAL D 2 41  ? 43.502  -22.744  -77.177  1.00 90.73  ? 41  VAL D CG1 1 
ATOM   3863 C CG2 . VAL D 2 41  ? 43.178  -20.544  -76.046  1.00 95.20  ? 41  VAL D CG2 1 
ATOM   3864 N N   . ARG D 2 42  ? 40.254  -22.756  -78.850  1.00 91.08  ? 42  ARG D N   1 
ATOM   3865 C CA  . ARG D 2 42  ? 39.675  -23.791  -79.715  1.00 93.51  ? 42  ARG D CA  1 
ATOM   3866 C C   . ARG D 2 42  ? 39.154  -23.206  -81.035  1.00 89.70  ? 42  ARG D C   1 
ATOM   3867 O O   . ARG D 2 42  ? 39.286  -23.833  -82.082  1.00 89.33  ? 42  ARG D O   1 
ATOM   3868 C CB  . ARG D 2 42  ? 38.544  -24.526  -78.977  1.00 96.75  ? 42  ARG D CB  1 
ATOM   3869 C CG  . ARG D 2 42  ? 37.830  -25.619  -79.782  1.00 106.60 ? 42  ARG D CG  1 
ATOM   3870 C CD  . ARG D 2 42  ? 38.612  -26.925  -79.796  1.00 108.03 ? 42  ARG D CD  1 
ATOM   3871 N NE  . ARG D 2 42  ? 38.087  -27.868  -80.792  1.00 113.22 ? 42  ARG D NE  1 
ATOM   3872 C CZ  . ARG D 2 42  ? 38.689  -28.238  -81.931  1.00 116.17 ? 42  ARG D CZ  1 
ATOM   3873 N NH1 . ARG D 2 42  ? 39.888  -27.766  -82.284  1.00 116.25 ? 42  ARG D NH1 1 
ATOM   3874 N NH2 . ARG D 2 42  ? 38.081  -29.109  -82.735  1.00 113.79 ? 42  ARG D NH2 1 
ATOM   3875 N N   . ALA D 2 43  ? 38.536  -22.028  -80.966  1.00 88.83  ? 43  ALA D N   1 
ATOM   3876 C CA  . ALA D 2 43  ? 38.043  -21.318  -82.144  1.00 84.98  ? 43  ALA D CA  1 
ATOM   3877 C C   . ALA D 2 43  ? 39.178  -20.970  -83.098  1.00 86.81  ? 43  ALA D C   1 
ATOM   3878 O O   . ALA D 2 43  ? 38.983  -20.994  -84.304  1.00 84.42  ? 43  ALA D O   1 
ATOM   3879 C CB  . ALA D 2 43  ? 37.313  -20.054  -81.727  1.00 83.22  ? 43  ALA D CB  1 
ATOM   3880 N N   . ASN D 2 44  ? 40.345  -20.648  -82.538  1.00 86.60  ? 44  ASN D N   1 
ATOM   3881 C CA  . ASN D 2 44  ? 41.556  -20.360  -83.304  1.00 93.11  ? 44  ASN D CA  1 
ATOM   3882 C C   . ASN D 2 44  ? 42.197  -21.609  -83.931  1.00 96.38  ? 44  ASN D C   1 
ATOM   3883 O O   . ASN D 2 44  ? 42.801  -21.509  -84.999  1.00 103.55 ? 44  ASN D O   1 
ATOM   3884 C CB  . ASN D 2 44  ? 42.577  -19.650  -82.412  1.00 95.13  ? 44  ASN D CB  1 
ATOM   3885 C CG  . ASN D 2 44  ? 43.853  -19.281  -83.154  1.00 91.84  ? 44  ASN D CG  1 
ATOM   3886 O OD1 . ASN D 2 44  ? 43.835  -18.423  -84.039  1.00 92.58  ? 44  ASN D OD1 1 
ATOM   3887 N ND2 . ASN D 2 44  ? 44.965  -19.927  -82.794  1.00 89.94  ? 44  ASN D ND2 1 
ATOM   3888 N N   . GLU D 2 45  ? 42.091  -22.762  -83.267  1.00 94.58  ? 45  GLU D N   1 
ATOM   3889 C CA  . GLU D 2 45  ? 42.556  -24.041  -83.833  1.00 98.70  ? 45  GLU D CA  1 
ATOM   3890 C C   . GLU D 2 45  ? 41.738  -24.412  -85.072  1.00 101.23 ? 45  GLU D C   1 
ATOM   3891 O O   . GLU D 2 45  ? 42.297  -24.817  -86.097  1.00 105.49 ? 45  GLU D O   1 
ATOM   3892 C CB  . GLU D 2 45  ? 42.457  -25.174  -82.808  1.00 96.75  ? 45  GLU D CB  1 
ATOM   3893 C CG  . GLU D 2 45  ? 43.534  -25.159  -81.729  1.00 103.06 ? 45  GLU D CG  1 
ATOM   3894 C CD  . GLU D 2 45  ? 43.195  -26.054  -80.537  1.00 107.39 ? 45  GLU D CD  1 
ATOM   3895 O OE1 . GLU D 2 45  ? 42.397  -27.008  -80.686  1.00 105.36 ? 45  GLU D OE1 1 
ATOM   3896 O OE2 . GLU D 2 45  ? 43.730  -25.804  -79.438  1.00 102.30 ? 45  GLU D OE2 1 
ATOM   3897 N N   . LEU D 2 46  ? 40.417  -24.278  -84.952  1.00 98.35  ? 46  LEU D N   1 
ATOM   3898 C CA  . LEU D 2 46  ? 39.474  -24.485  -86.064  1.00 96.76  ? 46  LEU D CA  1 
ATOM   3899 C C   . LEU D 2 46  ? 39.661  -23.506  -87.229  1.00 98.17  ? 46  LEU D C   1 
ATOM   3900 O O   . LEU D 2 46  ? 39.416  -23.859  -88.383  1.00 97.44  ? 46  LEU D O   1 
ATOM   3901 C CB  . LEU D 2 46  ? 38.037  -24.374  -85.565  1.00 92.07  ? 46  LEU D CB  1 
ATOM   3902 C CG  . LEU D 2 46  ? 37.602  -25.472  -84.599  1.00 99.23  ? 46  LEU D CG  1 
ATOM   3903 C CD1 . LEU D 2 46  ? 36.334  -25.053  -83.869  1.00 101.31 ? 46  LEU D CD1 1 
ATOM   3904 C CD2 . LEU D 2 46  ? 37.400  -26.801  -85.318  1.00 96.66  ? 46  LEU D CD2 1 
ATOM   3905 N N   . CYS D 2 47  ? 40.065  -22.280  -86.911  1.00 93.30  ? 47  CYS D N   1 
ATOM   3906 C CA  . CYS D 2 47  ? 40.417  -21.276  -87.907  1.00 94.03  ? 47  CYS D CA  1 
ATOM   3907 C C   . CYS D 2 47  ? 41.764  -21.570  -88.576  1.00 100.49 ? 47  CYS D C   1 
ATOM   3908 O O   . CYS D 2 47  ? 41.894  -21.429  -89.790  1.00 105.99 ? 47  CYS D O   1 
ATOM   3909 C CB  . CYS D 2 47  ? 40.485  -19.903  -87.253  1.00 94.93  ? 47  CYS D CB  1 
ATOM   3910 S SG  . CYS D 2 47  ? 40.976  -18.567  -88.365  1.00 98.18  ? 47  CYS D SG  1 
ATOM   3911 N N   . ALA D 2 48  ? 42.762  -21.954  -87.781  1.00 103.55 ? 48  ALA D N   1 
ATOM   3912 C CA  . ALA D 2 48  ? 44.118  -22.234  -88.283  1.00 106.19 ? 48  ALA D CA  1 
ATOM   3913 C C   . ALA D 2 48  ? 44.159  -23.432  -89.239  1.00 109.43 ? 48  ALA D C   1 
ATOM   3914 O O   . ALA D 2 48  ? 45.033  -23.499  -90.109  1.00 100.48 ? 48  ALA D O   1 
ATOM   3915 C CB  . ALA D 2 48  ? 45.088  -22.445  -87.126  1.00 105.62 ? 48  ALA D CB  1 
ATOM   3916 N N   . ALA D 2 49  ? 43.214  -24.359  -89.067  1.00 110.70 ? 49  ALA D N   1 
ATOM   3917 C CA  . ALA D 2 49  ? 43.061  -25.525  -89.941  1.00 116.48 ? 49  ALA D CA  1 
ATOM   3918 C C   . ALA D 2 49  ? 42.393  -25.212  -91.296  1.00 122.16 ? 49  ALA D C   1 
ATOM   3919 O O   . ALA D 2 49  ? 42.778  -25.799  -92.313  1.00 131.20 ? 49  ALA D O   1 
ATOM   3920 C CB  . ALA D 2 49  ? 42.298  -26.627  -89.213  1.00 114.01 ? 49  ALA D CB  1 
ATOM   3921 N N   . GLU D 2 50  ? 41.413  -24.301  -91.315  1.00 121.21 ? 50  GLU D N   1 
ATOM   3922 C CA  . GLU D 2 50  ? 40.681  -23.936  -92.558  1.00 119.52 ? 50  GLU D CA  1 
ATOM   3923 C C   . GLU D 2 50  ? 41.393  -22.886  -93.432  1.00 115.78 ? 50  GLU D C   1 
ATOM   3924 O O   . GLU D 2 50  ? 41.974  -21.928  -92.923  1.00 114.76 ? 50  GLU D O   1 
ATOM   3925 C CB  . GLU D 2 50  ? 39.248  -23.466  -92.244  1.00 118.65 ? 50  GLU D CB  1 
ATOM   3926 C CG  . GLU D 2 50  ? 38.319  -24.565  -91.734  1.00 122.59 ? 50  GLU D CG  1 
ATOM   3927 C CD  . GLU D 2 50  ? 38.246  -25.775  -92.654  1.00 127.91 ? 50  GLU D CD  1 
ATOM   3928 O OE1 . GLU D 2 50  ? 38.098  -25.585  -93.880  1.00 141.51 ? 50  GLU D OE1 1 
ATOM   3929 O OE2 . GLU D 2 50  ? 38.342  -26.915  -92.154  1.00 124.57 ? 50  GLU D OE2 1 
ATOM   3930 N N   . SER D 2 51  ? 41.299  -23.073  -94.750  1.00 113.41 ? 51  SER D N   1 
ATOM   3931 C CA  . SER D 2 51  ? 42.084  -22.320  -95.741  1.00 110.54 ? 51  SER D CA  1 
ATOM   3932 C C   . SER D 2 51  ? 41.880  -20.799  -95.700  1.00 107.90 ? 51  SER D C   1 
ATOM   3933 O O   . SER D 2 51  ? 42.850  -20.038  -95.574  1.00 104.13 ? 51  SER D O   1 
ATOM   3934 C CB  . SER D 2 51  ? 41.777  -22.838  -97.156  1.00 112.00 ? 51  SER D CB  1 
ATOM   3935 O OG  . SER D 2 51  ? 42.287  -24.151  -97.355  1.00 113.64 ? 51  SER D OG  1 
ATOM   3936 N N   . ASN D 2 52  ? 40.626  -20.368  -95.819  1.00 103.81 ? 52  ASN D N   1 
ATOM   3937 C CA  . ASN D 2 52  ? 40.303  -18.931  -95.880  1.00 103.77 ? 52  ASN D CA  1 
ATOM   3938 C C   . ASN D 2 52  ? 40.542  -18.222  -94.542  1.00 105.54 ? 52  ASN D C   1 
ATOM   3939 O O   . ASN D 2 52  ? 41.113  -17.135  -94.519  1.00 96.57  ? 52  ASN D O   1 
ATOM   3940 C CB  . ASN D 2 52  ? 38.857  -18.687  -96.359  1.00 95.82  ? 52  ASN D CB  1 
ATOM   3941 C CG  . ASN D 2 52  ? 38.512  -17.194  -96.475  1.00 88.92  ? 52  ASN D CG  1 
ATOM   3942 O OD1 . ASN D 2 52  ? 39.263  -16.406  -97.050  1.00 80.59  ? 52  ASN D OD1 1 
ATOM   3943 N ND2 . ASN D 2 52  ? 37.376  -16.808  -95.924  1.00 91.01  ? 52  ASN D ND2 1 
ATOM   3944 N N   . CYS D 2 53  ? 40.109  -18.840  -93.440  1.00 107.98 ? 53  CYS D N   1 
ATOM   3945 C CA  . CYS D 2 53  ? 40.229  -18.229  -92.107  1.00 105.27 ? 53  CYS D CA  1 
ATOM   3946 C C   . CYS D 2 53  ? 41.686  -18.002  -91.700  1.00 101.28 ? 53  CYS D C   1 
ATOM   3947 O O   . CYS D 2 53  ? 42.078  -16.864  -91.429  1.00 98.20  ? 53  CYS D O   1 
ATOM   3948 C CB  . CYS D 2 53  ? 39.516  -19.072  -91.043  1.00 108.86 ? 53  CYS D CB  1 
ATOM   3949 S SG  . CYS D 2 53  ? 39.270  -18.218  -89.458  1.00 116.82 ? 53  CYS D SG  1 
ATOM   3950 N N   . SER D 2 54  ? 42.471  -19.081  -91.674  1.00 98.99  ? 54  SER D N   1 
ATOM   3951 C CA  . SER D 2 54  ? 43.905  -19.032  -91.323  1.00 94.74  ? 54  SER D CA  1 
ATOM   3952 C C   . SER D 2 54  ? 44.676  -17.972  -92.115  1.00 95.34  ? 54  SER D C   1 
ATOM   3953 O O   . SER D 2 54  ? 45.557  -17.298  -91.568  1.00 94.72  ? 54  SER D O   1 
ATOM   3954 C CB  . SER D 2 54  ? 44.550  -20.396  -91.553  1.00 93.34  ? 54  SER D CB  1 
ATOM   3955 O OG  . SER D 2 54  ? 44.349  -20.813  -92.888  1.00 94.13  ? 54  SER D OG  1 
ATOM   3956 N N   . SER D 2 55  ? 44.332  -17.839  -93.399  1.00 98.82  ? 55  SER D N   1 
ATOM   3957 C CA  . SER D 2 55  ? 44.893  -16.804  -94.282  1.00 96.54  ? 55  SER D CA  1 
ATOM   3958 C C   . SER D 2 55  ? 44.527  -15.385  -93.820  1.00 90.53  ? 55  SER D C   1 
ATOM   3959 O O   . SER D 2 55  ? 45.387  -14.509  -93.765  1.00 83.31  ? 55  SER D O   1 
ATOM   3960 C CB  . SER D 2 55  ? 44.426  -17.033  -95.729  1.00 94.84  ? 55  SER D CB  1 
ATOM   3961 O OG  . SER D 2 55  ? 44.935  -16.033  -96.598  1.00 95.18  ? 55  SER D OG  1 
ATOM   3962 N N   . ARG D 2 56  ? 43.253  -15.179  -93.485  1.00 89.67  ? 56  ARG D N   1 
ATOM   3963 C CA  . ARG D 2 56  ? 42.770  -13.888  -92.980  1.00 89.31  ? 56  ARG D CA  1 
ATOM   3964 C C   . ARG D 2 56  ? 43.401  -13.565  -91.615  1.00 91.21  ? 56  ARG D C   1 
ATOM   3965 O O   . ARG D 2 56  ? 43.775  -12.422  -91.361  1.00 83.60  ? 56  ARG D O   1 
ATOM   3966 C CB  . ARG D 2 56  ? 41.234  -13.866  -92.870  1.00 88.11  ? 56  ARG D CB  1 
ATOM   3967 C CG  . ARG D 2 56  ? 40.469  -14.162  -94.161  1.00 90.80  ? 56  ARG D CG  1 
ATOM   3968 C CD  . ARG D 2 56  ? 40.619  -13.087  -95.221  1.00 87.89  ? 56  ARG D CD  1 
ATOM   3969 N NE  . ARG D 2 56  ? 39.712  -13.311  -96.345  1.00 89.10  ? 56  ARG D NE  1 
ATOM   3970 C CZ  . ARG D 2 56  ? 39.490  -12.446  -97.339  1.00 86.01  ? 56  ARG D CZ  1 
ATOM   3971 N NH1 . ARG D 2 56  ? 40.114  -11.267  -97.371  1.00 80.27  ? 56  ARG D NH1 1 
ATOM   3972 N NH2 . ARG D 2 56  ? 38.625  -12.758  -98.305  1.00 80.88  ? 56  ARG D NH2 1 
ATOM   3973 N N   . TYR D 2 57  ? 43.531  -14.577  -90.754  1.00 97.35  ? 57  TYR D N   1 
ATOM   3974 C CA  . TYR D 2 57  ? 44.113  -14.392  -89.411  1.00 107.44 ? 57  TYR D CA  1 
ATOM   3975 C C   . TYR D 2 57  ? 45.633  -14.141  -89.449  1.00 110.40 ? 57  TYR D C   1 
ATOM   3976 O O   . TYR D 2 57  ? 46.144  -13.330  -88.662  1.00 108.62 ? 57  TYR D O   1 
ATOM   3977 C CB  . TYR D 2 57  ? 43.744  -15.555  -88.451  1.00 106.53 ? 57  TYR D CB  1 
ATOM   3978 C CG  . TYR D 2 57  ? 43.841  -15.178  -86.973  1.00 107.16 ? 57  TYR D CG  1 
ATOM   3979 C CD1 . TYR D 2 57  ? 43.166  -14.060  -86.472  1.00 106.29 ? 57  TYR D CD1 1 
ATOM   3980 C CD2 . TYR D 2 57  ? 44.607  -15.927  -86.078  1.00 108.38 ? 57  TYR D CD2 1 
ATOM   3981 C CE1 . TYR D 2 57  ? 43.253  -13.695  -85.141  1.00 104.28 ? 57  TYR D CE1 1 
ATOM   3982 C CE2 . TYR D 2 57  ? 44.700  -15.564  -84.740  1.00 104.46 ? 57  TYR D CE2 1 
ATOM   3983 C CZ  . TYR D 2 57  ? 44.018  -14.448  -84.280  1.00 104.88 ? 57  TYR D CZ  1 
ATOM   3984 O OH  . TYR D 2 57  ? 44.096  -14.072  -82.964  1.00 104.77 ? 57  TYR D OH  1 
ATOM   3985 N N   . ARG D 2 58  ? 46.340  -14.808  -90.364  1.00 108.46 ? 58  ARG D N   1 
ATOM   3986 C CA  . ARG D 2 58  ? 47.764  -14.510  -90.602  1.00 108.05 ? 58  ARG D CA  1 
ATOM   3987 C C   . ARG D 2 58  ? 47.949  -13.084  -91.132  1.00 102.07 ? 58  ARG D C   1 
ATOM   3988 O O   . ARG D 2 58  ? 48.939  -12.432  -90.817  1.00 109.96 ? 58  ARG D O   1 
ATOM   3989 C CB  . ARG D 2 58  ? 48.416  -15.525  -91.558  1.00 111.88 ? 58  ARG D CB  1 
ATOM   3990 C CG  . ARG D 2 58  ? 48.900  -16.816  -90.892  1.00 113.64 ? 58  ARG D CG  1 
ATOM   3991 C CD  . ARG D 2 58  ? 49.883  -17.589  -91.770  1.00 114.66 ? 58  ARG D CD  1 
ATOM   3992 N NE  . ARG D 2 58  ? 49.377  -17.766  -93.134  1.00 117.51 ? 58  ARG D NE  1 
ATOM   3993 C CZ  . ARG D 2 58  ? 48.444  -18.648  -93.504  1.00 122.56 ? 58  ARG D CZ  1 
ATOM   3994 N NH1 . ARG D 2 58  ? 47.881  -19.471  -92.619  1.00 132.09 ? 58  ARG D NH1 1 
ATOM   3995 N NH2 . ARG D 2 58  ? 48.057  -18.710  -94.777  1.00 116.60 ? 58  ARG D NH2 1 
ATOM   3996 N N   . THR D 2 59  ? 46.994  -12.612  -91.932  1.00 101.92 ? 59  THR D N   1 
ATOM   3997 C CA  . THR D 2 59  ? 47.002  -11.232  -92.456  1.00 97.62  ? 59  THR D CA  1 
ATOM   3998 C C   . THR D 2 59  ? 46.809  -10.231  -91.332  1.00 93.80  ? 59  THR D C   1 
ATOM   3999 O O   . THR D 2 59  ? 47.541  -9.257   -91.248  1.00 89.28  ? 59  THR D O   1 
ATOM   4000 C CB  . THR D 2 59  ? 45.891  -11.002  -93.520  1.00 93.45  ? 59  THR D CB  1 
ATOM   4001 O OG1 . THR D 2 59  ? 46.113  -11.861  -94.641  1.00 90.52  ? 59  THR D OG1 1 
ATOM   4002 C CG2 . THR D 2 59  ? 45.832  -9.534   -94.008  1.00 85.76  ? 59  THR D CG2 1 
ATOM   4003 N N   . LEU D 2 60  ? 45.804  -10.479  -90.494  1.00 98.75  ? 60  LEU D N   1 
ATOM   4004 C CA  . LEU D 2 60  ? 45.490  -9.619   -89.347  1.00 100.92 ? 60  LEU D CA  1 
ATOM   4005 C C   . LEU D 2 60  ? 46.640  -9.570   -88.341  1.00 100.53 ? 60  LEU D C   1 
ATOM   4006 O O   . LEU D 2 60  ? 46.980  -8.495   -87.852  1.00 93.88  ? 60  LEU D O   1 
ATOM   4007 C CB  . LEU D 2 60  ? 44.215  -10.101  -88.645  1.00 100.35 ? 60  LEU D CB  1 
ATOM   4008 C CG  . LEU D 2 60  ? 43.720  -9.260   -87.455  1.00 100.20 ? 60  LEU D CG  1 
ATOM   4009 C CD1 . LEU D 2 60  ? 42.974  -8.017   -87.929  1.00 98.48  ? 60  LEU D CD1 1 
ATOM   4010 C CD2 . LEU D 2 60  ? 42.854  -10.103  -86.529  1.00 97.41  ? 60  LEU D CD2 1 
ATOM   4011 N N   . ARG D 2 61  ? 47.218  -10.730  -88.031  1.00 104.81 ? 61  ARG D N   1 
ATOM   4012 C CA  . ARG D 2 61  ? 48.381  -10.802  -87.135  1.00 113.01 ? 61  ARG D CA  1 
ATOM   4013 C C   . ARG D 2 61  ? 49.600  -10.017  -87.640  1.00 119.66 ? 61  ARG D C   1 
ATOM   4014 O O   . ARG D 2 61  ? 50.282  -9.377   -86.844  1.00 119.03 ? 61  ARG D O   1 
ATOM   4015 C CB  . ARG D 2 61  ? 48.773  -12.257  -86.834  1.00 116.58 ? 61  ARG D CB  1 
ATOM   4016 C CG  . ARG D 2 61  ? 48.020  -12.838  -85.648  1.00 123.63 ? 61  ARG D CG  1 
ATOM   4017 C CD  . ARG D 2 61  ? 48.670  -14.088  -85.085  1.00 127.34 ? 61  ARG D CD  1 
ATOM   4018 N NE  . ARG D 2 61  ? 48.274  -15.285  -85.830  1.00 133.26 ? 61  ARG D NE  1 
ATOM   4019 C CZ  . ARG D 2 61  ? 48.164  -16.515  -85.320  1.00 137.34 ? 61  ARG D CZ  1 
ATOM   4020 N NH1 . ARG D 2 61  ? 48.415  -16.762  -84.031  1.00 136.35 ? 61  ARG D NH1 1 
ATOM   4021 N NH2 . ARG D 2 61  ? 47.785  -17.518  -86.110  1.00 138.36 ? 61  ARG D NH2 1 
ATOM   4022 N N   . GLN D 2 62  ? 49.859  -10.060  -88.949  1.00 126.09 ? 62  GLN D N   1 
ATOM   4023 C CA  . GLN D 2 62  ? 50.941  -9.266   -89.565  1.00 123.09 ? 62  GLN D CA  1 
ATOM   4024 C C   . GLN D 2 62  ? 50.637  -7.760   -89.597  1.00 121.06 ? 62  GLN D C   1 
ATOM   4025 O O   . GLN D 2 62  ? 51.554  -6.944   -89.504  1.00 126.83 ? 62  GLN D O   1 
ATOM   4026 C CB  . GLN D 2 62  ? 51.249  -9.764   -90.980  1.00 125.36 ? 62  GLN D CB  1 
ATOM   4027 C CG  . GLN D 2 62  ? 51.999  -11.087  -91.021  1.00 126.07 ? 62  GLN D CG  1 
ATOM   4028 C CD  . GLN D 2 62  ? 52.264  -11.555  -92.443  1.00 126.81 ? 62  GLN D CD  1 
ATOM   4029 O OE1 . GLN D 2 62  ? 52.984  -10.895  -93.191  1.00 129.37 ? 62  GLN D OE1 1 
ATOM   4030 N NE2 . GLN D 2 62  ? 51.684  -12.696  -92.826  1.00 123.87 ? 62  GLN D NE2 1 
ATOM   4031 N N   . CYS D 2 63  ? 49.360  -7.406   -89.746  1.00 117.54 ? 63  CYS D N   1 
ATOM   4032 C CA  . CYS D 2 63  ? 48.910  -6.003   -89.687  1.00 122.43 ? 63  CYS D CA  1 
ATOM   4033 C C   . CYS D 2 63  ? 49.047  -5.374   -88.299  1.00 125.03 ? 63  CYS D C   1 
ATOM   4034 O O   . CYS D 2 63  ? 49.251  -4.164   -88.190  1.00 119.22 ? 63  CYS D O   1 
ATOM   4035 C CB  . CYS D 2 63  ? 47.438  -5.876   -90.099  1.00 124.45 ? 63  CYS D CB  1 
ATOM   4036 S SG  . CYS D 2 63  ? 47.010  -6.438   -91.764  1.00 130.60 ? 63  CYS D SG  1 
ATOM   4037 N N   . LEU D 2 64  ? 48.874  -6.200   -87.262  1.00 129.95 ? 64  LEU D N   1 
ATOM   4038 C CA  . LEU D 2 64  ? 48.923  -5.785   -85.852  1.00 130.04 ? 64  LEU D CA  1 
ATOM   4039 C C   . LEU D 2 64  ? 50.297  -6.118   -85.247  1.00 128.27 ? 64  LEU D C   1 
ATOM   4040 O O   . LEU D 2 64  ? 50.597  -7.292   -85.040  1.00 122.77 ? 64  LEU D O   1 
ATOM   4041 C CB  . LEU D 2 64  ? 47.827  -6.507   -85.050  1.00 129.09 ? 64  LEU D CB  1 
ATOM   4042 C CG  . LEU D 2 64  ? 46.405  -5.923   -85.004  1.00 128.23 ? 64  LEU D CG  1 
ATOM   4043 C CD1 . LEU D 2 64  ? 45.948  -5.362   -86.345  1.00 129.13 ? 64  LEU D CD1 1 
ATOM   4044 C CD2 . LEU D 2 64  ? 45.427  -6.982   -84.501  1.00 127.47 ? 64  LEU D CD2 1 
ATOM   4045 N N   . ALA D 2 65  ? 51.145  -5.130   -84.956  1.00 131.81 ? 65  ALA D N   1 
ATOM   4046 C CA  . ALA D 2 65  ? 50.927  -3.705   -85.244  1.00 130.57 ? 65  ALA D CA  1 
ATOM   4047 C C   . ALA D 2 65  ? 52.264  -3.002   -85.513  1.00 129.62 ? 65  ALA D C   1 
ATOM   4048 O O   . ALA D 2 65  ? 52.648  -2.103   -84.761  1.00 135.16 ? 65  ALA D O   1 
ATOM   4049 C CB  . ALA D 2 65  ? 50.184  -3.039   -84.088  1.00 124.44 ? 65  ALA D CB  1 
ATOM   4050 N N   . GLY D 2 66  ? 52.984  -3.382   -86.574  1.00 123.23 ? 66  GLY D N   1 
ATOM   4051 C CA  . GLY D 2 66  ? 52.584  -4.418   -87.533  1.00 117.90 ? 66  GLY D CA  1 
ATOM   4052 C C   . GLY D 2 66  ? 53.489  -4.450   -88.751  1.00 119.56 ? 66  GLY D C   1 
ATOM   4053 O O   . GLY D 2 66  ? 54.675  -4.773   -88.652  1.00 114.84 ? 66  GLY D O   1 
ATOM   4054 N N   . LYS D 2 76  ? 43.222  -1.736   -96.106  1.00 96.72  ? 76  LYS D N   1 
ATOM   4055 C CA  . LYS D 2 76  ? 42.376  -2.354   -97.145  1.00 100.98 ? 76  LYS D CA  1 
ATOM   4056 C C   . LYS D 2 76  ? 42.475  -3.886   -97.215  1.00 98.00  ? 76  LYS D C   1 
ATOM   4057 O O   . LYS D 2 76  ? 41.457  -4.580   -97.229  1.00 90.81  ? 76  LYS D O   1 
ATOM   4058 C CB  . LYS D 2 76  ? 42.670  -1.740   -98.528  1.00 97.86  ? 76  LYS D CB  1 
ATOM   4059 C CG  . LYS D 2 76  ? 41.555  -0.835   -99.067  1.00 95.75  ? 76  LYS D CG  1 
ATOM   4060 C CD  . LYS D 2 76  ? 40.636  -1.581   -100.038 1.00 91.31  ? 76  LYS D CD  1 
ATOM   4061 C CE  . LYS D 2 76  ? 39.460  -0.717   -100.493 1.00 90.30  ? 76  LYS D CE  1 
ATOM   4062 N NZ  . LYS D 2 76  ? 38.841  -1.264   -101.747 1.00 88.93  ? 76  LYS D NZ  1 
ATOM   4063 N N   . GLU D 2 77  ? 43.691  -4.407   -97.279  1.00 97.75  ? 77  GLU D N   1 
ATOM   4064 C CA  . GLU D 2 77  ? 43.885  -5.853   -97.178  1.00 102.72 ? 77  GLU D CA  1 
ATOM   4065 C C   . GLU D 2 77  ? 43.706  -6.292   -95.718  1.00 103.81 ? 77  GLU D C   1 
ATOM   4066 O O   . GLU D 2 77  ? 43.316  -7.435   -95.453  1.00 98.89  ? 77  GLU D O   1 
ATOM   4067 C CB  . GLU D 2 77  ? 45.258  -6.276   -97.714  1.00 105.41 ? 77  GLU D CB  1 
ATOM   4068 C CG  . GLU D 2 77  ? 45.167  -7.364   -98.773  1.00 104.93 ? 77  GLU D CG  1 
ATOM   4069 C CD  . GLU D 2 77  ? 46.465  -8.121   -98.948  1.00 104.53 ? 77  GLU D CD  1 
ATOM   4070 O OE1 . GLU D 2 77  ? 47.430  -7.550   -99.500  1.00 101.77 ? 77  GLU D OE1 1 
ATOM   4071 O OE2 . GLU D 2 77  ? 46.514  -9.293   -98.534  1.00 105.59 ? 77  GLU D OE2 1 
ATOM   4072 N N   . CYS D 2 78  ? 44.006  -5.374   -94.792  1.00 109.48 ? 78  CYS D N   1 
ATOM   4073 C CA  . CYS D 2 78  ? 43.799  -5.581   -93.352  1.00 113.59 ? 78  CYS D CA  1 
ATOM   4074 C C   . CYS D 2 78  ? 42.330  -5.431   -92.953  1.00 103.27 ? 78  CYS D C   1 
ATOM   4075 O O   . CYS D 2 78  ? 41.805  -6.273   -92.227  1.00 97.81  ? 78  CYS D O   1 
ATOM   4076 C CB  . CYS D 2 78  ? 44.654  -4.609   -92.525  1.00 118.59 ? 78  CYS D CB  1 
ATOM   4077 S SG  . CYS D 2 78  ? 46.452  -4.739   -92.750  1.00 124.80 ? 78  CYS D SG  1 
ATOM   4078 N N   . GLN D 2 79  ? 41.684  -4.364   -93.424  1.00 95.43  ? 79  GLN D N   1 
ATOM   4079 C CA  . GLN D 2 79  ? 40.254  -4.141   -93.171  1.00 100.43 ? 79  GLN D CA  1 
ATOM   4080 C C   . GLN D 2 79  ? 39.399  -5.334   -93.646  1.00 95.12  ? 79  GLN D C   1 
ATOM   4081 O O   . GLN D 2 79  ? 38.456  -5.728   -92.965  1.00 89.31  ? 79  GLN D O   1 
ATOM   4082 C CB  . GLN D 2 79  ? 39.791  -2.816   -93.818  1.00 105.24 ? 79  GLN D CB  1 
ATOM   4083 C CG  . GLN D 2 79  ? 38.356  -2.378   -93.500  1.00 110.44 ? 79  GLN D CG  1 
ATOM   4084 C CD  . GLN D 2 79  ? 38.077  -2.180   -92.005  1.00 114.74 ? 79  GLN D CD  1 
ATOM   4085 O OE1 . GLN D 2 79  ? 38.890  -1.602   -91.282  1.00 113.04 ? 79  GLN D OE1 1 
ATOM   4086 N NE2 . GLN D 2 79  ? 36.914  -2.649   -91.542  1.00 113.69 ? 79  GLN D NE2 1 
ATOM   4087 N N   . ALA D 2 80  ? 39.761  -5.907   -94.795  1.00 97.40  ? 80  ALA D N   1 
ATOM   4088 C CA  . ALA D 2 80  ? 39.089  -7.088   -95.358  1.00 98.84  ? 80  ALA D CA  1 
ATOM   4089 C C   . ALA D 2 80  ? 39.271  -8.328   -94.484  1.00 93.94  ? 80  ALA D C   1 
ATOM   4090 O O   . ALA D 2 80  ? 38.333  -9.107   -94.321  1.00 84.83  ? 80  ALA D O   1 
ATOM   4091 C CB  . ALA D 2 80  ? 39.599  -7.371   -96.769  1.00 99.94  ? 80  ALA D CB  1 
ATOM   4092 N N   . ALA D 2 81  ? 40.480  -8.502   -93.945  1.00 86.75  ? 81  ALA D N   1 
ATOM   4093 C CA  . ALA D 2 81  ? 40.803  -9.619   -93.048  1.00 85.12  ? 81  ALA D CA  1 
ATOM   4094 C C   . ALA D 2 81  ? 40.044  -9.522   -91.719  1.00 86.34  ? 81  ALA D C   1 
ATOM   4095 O O   . ALA D 2 81  ? 39.520  -10.529  -91.212  1.00 74.83  ? 81  ALA D O   1 
ATOM   4096 C CB  . ALA D 2 81  ? 42.301  -9.674   -92.794  1.00 85.55  ? 81  ALA D CB  1 
ATOM   4097 N N   . LEU D 2 82  ? 39.991  -8.306   -91.171  1.00 83.73  ? 82  LEU D N   1 
ATOM   4098 C CA  . LEU D 2 82  ? 39.247  -8.025   -89.940  1.00 86.89  ? 82  LEU D CA  1 
ATOM   4099 C C   . LEU D 2 82  ? 37.751  -8.294   -90.112  1.00 84.03  ? 82  LEU D C   1 
ATOM   4100 O O   . LEU D 2 82  ? 37.152  -8.978   -89.283  1.00 84.28  ? 82  LEU D O   1 
ATOM   4101 C CB  . LEU D 2 82  ? 39.476  -6.578   -89.473  1.00 89.49  ? 82  LEU D CB  1 
ATOM   4102 C CG  . LEU D 2 82  ? 38.780  -6.149   -88.167  1.00 91.19  ? 82  LEU D CG  1 
ATOM   4103 C CD1 . LEU D 2 82  ? 39.297  -6.948   -86.973  1.00 88.03  ? 82  LEU D CD1 1 
ATOM   4104 C CD2 . LEU D 2 82  ? 38.928  -4.651   -87.928  1.00 90.36  ? 82  LEU D CD2 1 
ATOM   4105 N N   . GLU D 2 83  ? 37.169  -7.769   -91.190  1.00 80.19  ? 83  GLU D N   1 
ATOM   4106 C CA  . GLU D 2 83  ? 35.751  -7.972   -91.487  1.00 78.38  ? 83  GLU D CA  1 
ATOM   4107 C C   . GLU D 2 83  ? 35.358  -9.439   -91.581  1.00 75.82  ? 83  GLU D C   1 
ATOM   4108 O O   . GLU D 2 83  ? 34.342  -9.834   -91.020  1.00 78.13  ? 83  GLU D O   1 
ATOM   4109 C CB  . GLU D 2 83  ? 35.366  -7.282   -92.783  1.00 83.92  ? 83  GLU D CB  1 
ATOM   4110 C CG  . GLU D 2 83  ? 35.120  -5.801   -92.637  1.00 89.08  ? 83  GLU D CG  1 
ATOM   4111 C CD  . GLU D 2 83  ? 34.780  -5.178   -93.970  1.00 97.66  ? 83  GLU D CD  1 
ATOM   4112 O OE1 . GLU D 2 83  ? 33.776  -5.611   -94.573  1.00 97.62  ? 83  GLU D OE1 1 
ATOM   4113 O OE2 . GLU D 2 83  ? 35.520  -4.275   -94.421  1.00 105.41 ? 83  GLU D OE2 1 
ATOM   4114 N N   . VAL D 2 84  ? 36.148  -10.235  -92.297  1.00 75.77  ? 84  VAL D N   1 
ATOM   4115 C CA  . VAL D 2 84  ? 35.845  -11.667  -92.470  1.00 77.60  ? 84  VAL D CA  1 
ATOM   4116 C C   . VAL D 2 84  ? 35.855  -12.359  -91.120  1.00 77.53  ? 84  VAL D C   1 
ATOM   4117 O O   . VAL D 2 84  ? 34.975  -13.174  -90.828  1.00 76.25  ? 84  VAL D O   1 
ATOM   4118 C CB  . VAL D 2 84  ? 36.843  -12.395  -93.405  1.00 77.03  ? 84  VAL D CB  1 
ATOM   4119 C CG1 . VAL D 2 84  ? 36.585  -13.903  -93.441  1.00 77.59  ? 84  VAL D CG1 1 
ATOM   4120 C CG2 . VAL D 2 84  ? 36.741  -11.851  -94.820  1.00 81.22  ? 84  VAL D CG2 1 
ATOM   4121 N N   . LEU D 2 85  ? 36.856  -12.031  -90.308  1.00 75.30  ? 85  LEU D N   1 
ATOM   4122 C CA  . LEU D 2 85  ? 37.007  -12.649  -88.993  1.00 74.18  ? 85  LEU D CA  1 
ATOM   4123 C C   . LEU D 2 85  ? 35.929  -12.166  -88.019  1.00 72.39  ? 85  LEU D C   1 
ATOM   4124 O O   . LEU D 2 85  ? 35.427  -12.963  -87.214  1.00 67.36  ? 85  LEU D O   1 
ATOM   4125 C CB  . LEU D 2 85  ? 38.415  -12.416  -88.435  1.00 71.67  ? 85  LEU D CB  1 
ATOM   4126 C CG  . LEU D 2 85  ? 39.537  -13.094  -89.238  1.00 70.33  ? 85  LEU D CG  1 
ATOM   4127 C CD1 . LEU D 2 85  ? 40.867  -12.460  -88.884  1.00 68.76  ? 85  LEU D CD1 1 
ATOM   4128 C CD2 . LEU D 2 85  ? 39.587  -14.607  -89.055  1.00 66.90  ? 85  LEU D CD2 1 
ATOM   4129 N N   . GLN D 2 86  ? 35.541  -10.891  -88.130  1.00 72.84  ? 86  GLN D N   1 
ATOM   4130 C CA  . GLN D 2 86  ? 34.419  -10.339  -87.334  1.00 79.28  ? 86  GLN D CA  1 
ATOM   4131 C C   . GLN D 2 86  ? 33.037  -10.873  -87.759  1.00 82.43  ? 86  GLN D C   1 
ATOM   4132 O O   . GLN D 2 86  ? 32.045  -10.653  -87.054  1.00 87.84  ? 86  GLN D O   1 
ATOM   4133 C CB  . GLN D 2 86  ? 34.428  -8.802   -87.352  1.00 78.30  ? 86  GLN D CB  1 
ATOM   4134 C CG  . GLN D 2 86  ? 35.518  -8.188   -86.486  1.00 75.73  ? 86  GLN D CG  1 
ATOM   4135 C CD  . GLN D 2 86  ? 35.471  -6.673   -86.445  1.00 79.27  ? 86  GLN D CD  1 
ATOM   4136 O OE1 . GLN D 2 86  ? 34.866  -6.034   -87.306  1.00 78.41  ? 86  GLN D OE1 1 
ATOM   4137 N NE2 . GLN D 2 86  ? 36.121  -6.086   -85.440  1.00 82.41  ? 86  GLN D NE2 1 
ATOM   4138 N N   . GLU D 2 87  ? 32.988  -11.551  -88.907  1.00 86.61  ? 87  GLU D N   1 
ATOM   4139 C CA  . GLU D 2 87  ? 31.800  -12.254  -89.394  1.00 88.46  ? 87  GLU D CA  1 
ATOM   4140 C C   . GLU D 2 87  ? 31.927  -13.780  -89.289  1.00 84.77  ? 87  GLU D C   1 
ATOM   4141 O O   . GLU D 2 87  ? 30.997  -14.499  -89.629  1.00 89.34  ? 87  GLU D O   1 
ATOM   4142 C CB  . GLU D 2 87  ? 31.528  -11.824  -90.840  1.00 93.30  ? 87  GLU D CB  1 
ATOM   4143 C CG  . GLU D 2 87  ? 30.987  -10.401  -90.932  1.00 99.07  ? 87  GLU D CG  1 
ATOM   4144 C CD  . GLU D 2 87  ? 31.210  -9.729   -92.279  1.00 106.61 ? 87  GLU D CD  1 
ATOM   4145 O OE1 . GLU D 2 87  ? 31.249  -10.433  -93.315  1.00 110.28 ? 87  GLU D OE1 1 
ATOM   4146 O OE2 . GLU D 2 87  ? 31.332  -8.479   -92.294  1.00 107.44 ? 87  GLU D OE2 1 
ATOM   4147 N N   . SER D 2 88  ? 33.072  -14.265  -88.819  1.00 87.04  ? 88  SER D N   1 
ATOM   4148 C CA  . SER D 2 88  ? 33.281  -15.689  -88.554  1.00 91.18  ? 88  SER D CA  1 
ATOM   4149 C C   . SER D 2 88  ? 32.815  -15.960  -87.115  1.00 99.32  ? 88  SER D C   1 
ATOM   4150 O O   . SER D 2 88  ? 32.490  -15.011  -86.382  1.00 91.22  ? 88  SER D O   1 
ATOM   4151 C CB  . SER D 2 88  ? 34.760  -16.046  -88.753  1.00 88.00  ? 88  SER D CB  1 
ATOM   4152 O OG  . SER D 2 88  ? 35.572  -15.488  -87.742  1.00 85.20  ? 88  SER D OG  1 
ATOM   4153 N N   . PRO D 2 89  ? 32.762  -17.245  -86.702  1.00 111.24 ? 89  PRO D N   1 
ATOM   4154 C CA  . PRO D 2 89  ? 32.408  -17.529  -85.293  1.00 113.06 ? 89  PRO D CA  1 
ATOM   4155 C C   . PRO D 2 89  ? 33.506  -17.202  -84.240  1.00 110.46 ? 89  PRO D C   1 
ATOM   4156 O O   . PRO D 2 89  ? 33.210  -17.197  -83.034  1.00 105.60 ? 89  PRO D O   1 
ATOM   4157 C CB  . PRO D 2 89  ? 32.063  -19.027  -85.308  1.00 112.42 ? 89  PRO D CB  1 
ATOM   4158 C CG  . PRO D 2 89  ? 32.773  -19.584  -86.491  1.00 116.46 ? 89  PRO D CG  1 
ATOM   4159 C CD  . PRO D 2 89  ? 32.893  -18.481  -87.502  1.00 113.62 ? 89  PRO D CD  1 
ATOM   4160 N N   . LEU D 2 90  ? 34.740  -16.938  -84.689  1.00 104.60 ? 90  LEU D N   1 
ATOM   4161 C CA  . LEU D 2 90  ? 35.811  -16.374  -83.834  1.00 96.23  ? 90  LEU D CA  1 
ATOM   4162 C C   . LEU D 2 90  ? 35.367  -15.123  -83.059  1.00 88.57  ? 90  LEU D C   1 
ATOM   4163 O O   . LEU D 2 90  ? 35.763  -14.922  -81.912  1.00 89.34  ? 90  LEU D O   1 
ATOM   4164 C CB  . LEU D 2 90  ? 37.068  -16.033  -84.657  1.00 96.70  ? 90  LEU D CB  1 
ATOM   4165 C CG  . LEU D 2 90  ? 38.274  -16.974  -84.575  1.00 100.22 ? 90  LEU D CG  1 
ATOM   4166 C CD1 . LEU D 2 90  ? 39.212  -16.731  -85.745  1.00 101.70 ? 90  LEU D CD1 1 
ATOM   4167 C CD2 . LEU D 2 90  ? 39.041  -16.791  -83.276  1.00 99.72  ? 90  LEU D CD2 1 
ATOM   4168 N N   . TYR D 2 91  ? 34.547  -14.287  -83.687  1.00 79.46  ? 91  TYR D N   1 
ATOM   4169 C CA  . TYR D 2 91  ? 34.034  -13.087  -83.038  1.00 75.92  ? 91  TYR D CA  1 
ATOM   4170 C C   . TYR D 2 91  ? 33.098  -13.347  -81.832  1.00 75.78  ? 91  TYR D C   1 
ATOM   4171 O O   . TYR D 2 91  ? 32.961  -12.496  -80.955  1.00 73.49  ? 91  TYR D O   1 
ATOM   4172 C CB  . TYR D 2 91  ? 33.317  -12.208  -84.064  1.00 76.38  ? 91  TYR D CB  1 
ATOM   4173 C CG  . TYR D 2 91  ? 33.206  -10.764  -83.616  1.00 73.77  ? 91  TYR D CG  1 
ATOM   4174 C CD1 . TYR D 2 91  ? 34.356  -9.993   -83.424  1.00 74.44  ? 91  TYR D CD1 1 
ATOM   4175 C CD2 . TYR D 2 91  ? 31.965  -10.175  -83.357  1.00 67.52  ? 91  TYR D CD2 1 
ATOM   4176 C CE1 . TYR D 2 91  ? 34.277  -8.676   -83.003  1.00 75.51  ? 91  TYR D CE1 1 
ATOM   4177 C CE2 . TYR D 2 91  ? 31.875  -8.850   -82.939  1.00 73.09  ? 91  TYR D CE2 1 
ATOM   4178 C CZ  . TYR D 2 91  ? 33.035  -8.107   -82.766  1.00 77.85  ? 91  TYR D CZ  1 
ATOM   4179 O OH  . TYR D 2 91  ? 32.976  -6.803   -82.343  1.00 83.06  ? 91  TYR D OH  1 
ATOM   4180 N N   . ASP D 2 92  ? 32.452  -14.506  -81.809  1.00 76.51  ? 92  ASP D N   1 
ATOM   4181 C CA  . ASP D 2 92  ? 31.597  -14.910  -80.698  1.00 80.05  ? 92  ASP D CA  1 
ATOM   4182 C C   . ASP D 2 92  ? 32.329  -15.692  -79.585  1.00 81.82  ? 92  ASP D C   1 
ATOM   4183 O O   . ASP D 2 92  ? 31.735  -15.943  -78.526  1.00 75.52  ? 92  ASP D O   1 
ATOM   4184 C CB  . ASP D 2 92  ? 30.423  -15.751  -81.227  1.00 85.97  ? 92  ASP D CB  1 
ATOM   4185 C CG  . ASP D 2 92  ? 29.599  -15.024  -82.297  1.00 91.72  ? 92  ASP D CG  1 
ATOM   4186 O OD1 . ASP D 2 92  ? 29.575  -13.765  -82.311  1.00 87.69  ? 92  ASP D OD1 1 
ATOM   4187 O OD2 . ASP D 2 92  ? 28.964  -15.725  -83.124  1.00 96.18  ? 92  ASP D OD2 1 
ATOM   4188 N N   . CYS D 2 93  ? 33.589  -16.087  -79.812  1.00 74.79  ? 93  CYS D N   1 
ATOM   4189 C CA  . CYS D 2 93  ? 34.348  -16.828  -78.793  1.00 74.40  ? 93  CYS D CA  1 
ATOM   4190 C C   . CYS D 2 93  ? 34.611  -15.953  -77.556  1.00 72.31  ? 93  CYS D C   1 
ATOM   4191 O O   . CYS D 2 93  ? 34.699  -14.721  -77.640  1.00 70.25  ? 93  CYS D O   1 
ATOM   4192 C CB  . CYS D 2 93  ? 35.679  -17.395  -79.336  1.00 76.86  ? 93  CYS D CB  1 
ATOM   4193 S SG  . CYS D 2 93  ? 37.042  -16.218  -79.663  1.00 77.84  ? 93  CYS D SG  1 
ATOM   4194 N N   . ARG D 2 94  ? 34.714  -16.618  -76.414  1.00 69.14  ? 94  ARG D N   1 
ATOM   4195 C CA  . ARG D 2 94  ? 34.879  -15.974  -75.115  1.00 65.02  ? 94  ARG D CA  1 
ATOM   4196 C C   . ARG D 2 94  ? 35.797  -16.860  -74.287  1.00 64.21  ? 94  ARG D C   1 
ATOM   4197 O O   . ARG D 2 94  ? 36.109  -17.989  -74.686  1.00 62.02  ? 94  ARG D O   1 
ATOM   4198 C CB  . ARG D 2 94  ? 33.530  -15.860  -74.412  1.00 63.50  ? 94  ARG D CB  1 
ATOM   4199 C CG  . ARG D 2 94  ? 32.483  -15.015  -75.110  1.00 62.98  ? 94  ARG D CG  1 
ATOM   4200 C CD  . ARG D 2 94  ? 32.751  -13.533  -74.938  1.00 67.51  ? 94  ARG D CD  1 
ATOM   4201 N NE  . ARG D 2 94  ? 31.714  -12.716  -75.579  1.00 71.53  ? 94  ARG D NE  1 
ATOM   4202 C CZ  . ARG D 2 94  ? 31.735  -12.275  -76.841  1.00 75.06  ? 94  ARG D CZ  1 
ATOM   4203 N NH1 . ARG D 2 94  ? 32.750  -12.547  -77.668  1.00 72.28  ? 94  ARG D NH1 1 
ATOM   4204 N NH2 . ARG D 2 94  ? 30.716  -11.541  -77.286  1.00 81.36  ? 94  ARG D NH2 1 
ATOM   4205 N N   . CYS D 2 95  ? 36.210  -16.353  -73.131  1.00 65.71  ? 95  CYS D N   1 
ATOM   4206 C CA  . CYS D 2 95  ? 37.167  -17.043  -72.260  1.00 66.89  ? 95  CYS D CA  1 
ATOM   4207 C C   . CYS D 2 95  ? 36.574  -17.335  -70.872  1.00 69.36  ? 95  CYS D C   1 
ATOM   4208 O O   . CYS D 2 95  ? 35.487  -16.858  -70.536  1.00 67.86  ? 95  CYS D O   1 
ATOM   4209 C CB  . CYS D 2 95  ? 38.437  -16.198  -72.138  1.00 72.13  ? 95  CYS D CB  1 
ATOM   4210 S SG  . CYS D 2 95  ? 39.272  -15.867  -73.724  1.00 80.41  ? 95  CYS D SG  1 
ATOM   4211 N N   . LYS D 2 96  ? 37.300  -18.128  -70.089  1.00 67.09  ? 96  LYS D N   1 
ATOM   4212 C CA  . LYS D 2 96  ? 36.897  -18.507  -68.735  1.00 72.30  ? 96  LYS D CA  1 
ATOM   4213 C C   . LYS D 2 96  ? 38.034  -18.307  -67.749  1.00 68.01  ? 96  LYS D C   1 
ATOM   4214 O O   . LYS D 2 96  ? 39.175  -18.575  -68.056  1.00 68.33  ? 96  LYS D O   1 
ATOM   4215 C CB  . LYS D 2 96  ? 36.415  -19.963  -68.692  1.00 75.89  ? 96  LYS D CB  1 
ATOM   4216 C CG  . LYS D 2 96  ? 34.942  -20.089  -69.037  1.00 84.42  ? 96  LYS D CG  1 
ATOM   4217 C CD  . LYS D 2 96  ? 34.459  -21.525  -69.128  1.00 93.34  ? 96  LYS D CD  1 
ATOM   4218 C CE  . LYS D 2 96  ? 32.934  -21.570  -69.093  1.00 99.76  ? 96  LYS D CE  1 
ATOM   4219 N NZ  . LYS D 2 96  ? 32.382  -22.833  -69.649  1.00 102.16 ? 96  LYS D NZ  1 
ATOM   4220 N N   . ARG D 2 97  ? 37.703  -17.819  -66.563  1.00 65.17  ? 97  ARG D N   1 
ATOM   4221 C CA  . ARG D 2 97  ? 38.667  -17.686  -65.475  1.00 66.92  ? 97  ARG D CA  1 
ATOM   4222 C C   . ARG D 2 97  ? 39.197  -19.052  -65.053  1.00 65.35  ? 97  ARG D C   1 
ATOM   4223 O O   . ARG D 2 97  ? 38.455  -20.028  -65.038  1.00 61.02  ? 97  ARG D O   1 
ATOM   4224 C CB  . ARG D 2 97  ? 38.000  -17.006  -64.275  1.00 68.11  ? 97  ARG D CB  1 
ATOM   4225 C CG  . ARG D 2 97  ? 37.770  -15.516  -64.463  1.00 66.31  ? 97  ARG D CG  1 
ATOM   4226 C CD  . ARG D 2 97  ? 39.073  -14.745  -64.312  1.00 66.39  ? 97  ARG D CD  1 
ATOM   4227 N NE  . ARG D 2 97  ? 39.736  -15.031  -63.035  1.00 66.19  ? 97  ARG D NE  1 
ATOM   4228 C CZ  . ARG D 2 97  ? 39.326  -14.606  -61.836  1.00 63.36  ? 97  ARG D CZ  1 
ATOM   4229 N NH1 . ARG D 2 97  ? 38.235  -13.852  -61.701  1.00 57.33  ? 97  ARG D NH1 1 
ATOM   4230 N NH2 . ARG D 2 97  ? 40.027  -14.939  -60.749  1.00 67.51  ? 97  ARG D NH2 1 
ATOM   4231 N N   . GLY D 2 98  ? 40.489  -19.110  -64.742  1.00 68.77  ? 98  GLY D N   1 
ATOM   4232 C CA  . GLY D 2 98  ? 41.175  -20.377  -64.435  1.00 74.45  ? 98  GLY D CA  1 
ATOM   4233 C C   . GLY D 2 98  ? 41.184  -21.451  -65.531  1.00 78.20  ? 98  GLY D C   1 
ATOM   4234 O O   . GLY D 2 98  ? 41.348  -22.642  -65.238  1.00 75.39  ? 98  GLY D O   1 
ATOM   4235 N N   . MET D 2 99  ? 41.004  -21.050  -66.790  1.00 75.25  ? 99  MET D N   1 
ATOM   4236 C CA  . MET D 2 99  ? 41.108  -21.981  -67.906  1.00 76.17  ? 99  MET D CA  1 
ATOM   4237 C C   . MET D 2 99  ? 42.587  -22.253  -68.185  1.00 76.76  ? 99  MET D C   1 
ATOM   4238 O O   . MET D 2 99  ? 43.464  -21.498  -67.750  1.00 71.63  ? 99  MET D O   1 
ATOM   4239 C CB  . MET D 2 99  ? 40.416  -21.422  -69.157  1.00 74.71  ? 99  MET D CB  1 
ATOM   4240 C CG  . MET D 2 99  ? 41.152  -20.272  -69.845  1.00 73.11  ? 99  MET D CG  1 
ATOM   4241 S SD  . MET D 2 99  ? 40.231  -19.668  -71.266  1.00 75.04  ? 99  MET D SD  1 
ATOM   4242 C CE  . MET D 2 99  ? 40.591  -20.963  -72.452  1.00 81.05  ? 99  MET D CE  1 
ATOM   4243 N N   . LYS D 2 100 ? 42.852  -23.328  -68.920  1.00 85.32  ? 100 LYS D N   1 
ATOM   4244 C CA  . LYS D 2 100 ? 44.197  -23.599  -69.447  1.00 89.20  ? 100 LYS D CA  1 
ATOM   4245 C C   . LYS D 2 100 ? 44.432  -22.636  -70.616  1.00 85.54  ? 100 LYS D C   1 
ATOM   4246 O O   . LYS D 2 100 ? 43.548  -22.476  -71.467  1.00 85.43  ? 100 LYS D O   1 
ATOM   4247 C CB  . LYS D 2 100 ? 44.316  -25.053  -69.927  1.00 94.47  ? 100 LYS D CB  1 
ATOM   4248 C CG  . LYS D 2 100 ? 45.641  -25.733  -69.596  1.00 97.29  ? 100 LYS D CG  1 
ATOM   4249 C CD  . LYS D 2 100 ? 45.616  -26.388  -68.217  1.00 99.56  ? 100 LYS D CD  1 
ATOM   4250 C CE  . LYS D 2 100 ? 46.643  -27.506  -68.089  1.00 101.17 ? 100 LYS D CE  1 
ATOM   4251 N NZ  . LYS D 2 100 ? 48.011  -26.980  -67.840  1.00 99.44  ? 100 LYS D NZ  1 
ATOM   4252 N N   . LYS D 2 101 ? 45.599  -21.990  -70.635  1.00 84.01  ? 101 LYS D N   1 
ATOM   4253 C CA  . LYS D 2 101 ? 45.996  -21.023  -71.693  1.00 86.21  ? 101 LYS D CA  1 
ATOM   4254 C C   . LYS D 2 101 ? 45.059  -19.796  -71.756  1.00 80.31  ? 101 LYS D C   1 
ATOM   4255 O O   . LYS D 2 101 ? 44.578  -19.395  -72.831  1.00 74.75  ? 101 LYS D O   1 
ATOM   4256 C CB  . LYS D 2 101 ? 46.133  -21.713  -73.067  1.00 90.56  ? 101 LYS D CB  1 
ATOM   4257 C CG  . LYS D 2 101 ? 47.208  -22.796  -73.125  1.00 95.29  ? 101 LYS D CG  1 
ATOM   4258 C CD  . LYS D 2 101 ? 47.187  -23.562  -74.442  1.00 99.88  ? 101 LYS D CD  1 
ATOM   4259 C CE  . LYS D 2 101 ? 46.106  -24.637  -74.444  1.00 101.24 ? 101 LYS D CE  1 
ATOM   4260 N NZ  . LYS D 2 101 ? 45.968  -25.263  -75.784  1.00 103.01 ? 101 LYS D NZ  1 
ATOM   4261 N N   . GLU D 2 102 ? 44.820  -19.204  -70.583  1.00 75.72  ? 102 GLU D N   1 
ATOM   4262 C CA  . GLU D 2 102 ? 43.931  -18.046  -70.446  1.00 70.51  ? 102 GLU D CA  1 
ATOM   4263 C C   . GLU D 2 102 ? 44.440  -16.837  -71.237  1.00 66.90  ? 102 GLU D C   1 
ATOM   4264 O O   . GLU D 2 102 ? 43.657  -16.197  -71.943  1.00 58.31  ? 102 GLU D O   1 
ATOM   4265 C CB  . GLU D 2 102 ? 43.755  -17.662  -68.971  1.00 68.08  ? 102 GLU D CB  1 
ATOM   4266 C CG  . GLU D 2 102 ? 42.644  -16.643  -68.726  1.00 66.54  ? 102 GLU D CG  1 
ATOM   4267 C CD  . GLU D 2 102 ? 42.434  -16.300  -67.255  1.00 68.87  ? 102 GLU D CD  1 
ATOM   4268 O OE1 . GLU D 2 102 ? 42.697  -17.149  -66.372  1.00 69.64  ? 102 GLU D OE1 1 
ATOM   4269 O OE2 . GLU D 2 102 ? 41.980  -15.168  -66.982  1.00 64.24  ? 102 GLU D OE2 1 
ATOM   4270 N N   . LEU D 2 103 ? 45.738  -16.535  -71.095  1.00 62.98  ? 103 LEU D N   1 
ATOM   4271 C CA  . LEU D 2 103 ? 46.384  -15.406  -71.787  1.00 64.60  ? 103 LEU D CA  1 
ATOM   4272 C C   . LEU D 2 103 ? 46.304  -15.522  -73.310  1.00 65.72  ? 103 LEU D C   1 
ATOM   4273 O O   . LEU D 2 103 ? 46.101  -14.538  -73.994  1.00 64.32  ? 103 LEU D O   1 
ATOM   4274 C CB  . LEU D 2 103 ? 47.851  -15.296  -71.363  1.00 68.45  ? 103 LEU D CB  1 
ATOM   4275 C CG  . LEU D 2 103 ? 48.736  -14.244  -72.055  1.00 72.61  ? 103 LEU D CG  1 
ATOM   4276 C CD1 . LEU D 2 103 ? 48.219  -12.827  -71.849  1.00 75.80  ? 103 LEU D CD1 1 
ATOM   4277 C CD2 . LEU D 2 103 ? 50.171  -14.369  -71.561  1.00 73.23  ? 103 LEU D CD2 1 
ATOM   4278 N N   . GLN D 2 104 ? 46.465  -16.732  -73.825  1.00 72.18  ? 104 GLN D N   1 
ATOM   4279 C CA  . GLN D 2 104 ? 46.405  -16.978  -75.268  1.00 82.56  ? 104 GLN D CA  1 
ATOM   4280 C C   . GLN D 2 104 ? 44.985  -16.662  -75.729  1.00 76.64  ? 104 GLN D C   1 
ATOM   4281 O O   . GLN D 2 104 ? 44.783  -15.887  -76.674  1.00 68.24  ? 104 GLN D O   1 
ATOM   4282 C CB  . GLN D 2 104 ? 46.789  -18.433  -75.600  1.00 90.99  ? 104 GLN D CB  1 
ATOM   4283 C CG  . GLN D 2 104 ? 48.291  -18.738  -75.554  1.00 103.34 ? 104 GLN D CG  1 
ATOM   4284 C CD  . GLN D 2 104 ? 48.919  -18.586  -74.162  1.00 115.82 ? 104 GLN D CD  1 
ATOM   4285 O OE1 . GLN D 2 104 ? 48.431  -19.164  -73.181  1.00 121.87 ? 104 GLN D OE1 1 
ATOM   4286 N NE2 . GLN D 2 104 ? 50.005  -17.808  -74.073  1.00 119.94 ? 104 GLN D NE2 1 
ATOM   4287 N N   . CYS D 2 105 ? 44.016  -17.241  -75.016  1.00 69.51  ? 105 CYS D N   1 
ATOM   4288 C CA  . CYS D 2 105 ? 42.579  -16.967  -75.227  1.00 67.15  ? 105 CYS D CA  1 
ATOM   4289 C C   . CYS D 2 105 ? 42.273  -15.468  -75.317  1.00 61.58  ? 105 CYS D C   1 
ATOM   4290 O O   . CYS D 2 105 ? 41.581  -15.018  -76.226  1.00 61.24  ? 105 CYS D O   1 
ATOM   4291 C CB  . CYS D 2 105 ? 41.763  -17.597  -74.090  1.00 67.32  ? 105 CYS D CB  1 
ATOM   4292 S SG  . CYS D 2 105 ? 39.984  -17.715  -74.337  1.00 67.58  ? 105 CYS D SG  1 
ATOM   4293 N N   . LEU D 2 106 ? 42.801  -14.702  -74.368  1.00 61.89  ? 106 LEU D N   1 
ATOM   4294 C CA  . LEU D 2 106 ? 42.542  -13.263  -74.307  1.00 59.74  ? 106 LEU D CA  1 
ATOM   4295 C C   . LEU D 2 106 ? 43.252  -12.492  -75.422  1.00 60.80  ? 106 LEU D C   1 
ATOM   4296 O O   . LEU D 2 106 ? 42.717  -11.503  -75.923  1.00 58.80  ? 106 LEU D O   1 
ATOM   4297 C CB  . LEU D 2 106 ? 42.953  -12.722  -72.936  1.00 59.94  ? 106 LEU D CB  1 
ATOM   4298 C CG  . LEU D 2 106 ? 42.177  -13.268  -71.731  1.00 59.66  ? 106 LEU D CG  1 
ATOM   4299 C CD1 . LEU D 2 106 ? 42.834  -12.848  -70.425  1.00 60.04  ? 106 LEU D CD1 1 
ATOM   4300 C CD2 . LEU D 2 106 ? 40.731  -12.814  -71.765  1.00 61.94  ? 106 LEU D CD2 1 
ATOM   4301 N N   . GLN D 2 107 ? 44.462  -12.930  -75.789  1.00 63.78  ? 107 GLN D N   1 
ATOM   4302 C CA  . GLN D 2 107 ? 45.199  -12.353  -76.934  1.00 70.76  ? 107 GLN D CA  1 
ATOM   4303 C C   . GLN D 2 107 ? 44.429  -12.528  -78.242  1.00 64.16  ? 107 GLN D C   1 
ATOM   4304 O O   . GLN D 2 107 ? 44.350  -11.610  -79.049  1.00 61.68  ? 107 GLN D O   1 
ATOM   4305 C CB  . GLN D 2 107 ? 46.583  -12.984  -77.074  1.00 77.49  ? 107 GLN D CB  1 
ATOM   4306 C CG  . GLN D 2 107 ? 47.570  -12.510  -76.019  1.00 84.60  ? 107 GLN D CG  1 
ATOM   4307 C CD  . GLN D 2 107 ? 48.871  -13.309  -75.993  1.00 91.20  ? 107 GLN D CD  1 
ATOM   4308 O OE1 . GLN D 2 107 ? 48.935  -14.462  -76.449  1.00 88.03  ? 107 GLN D OE1 1 
ATOM   4309 N NE2 . GLN D 2 107 ? 49.924  -12.693  -75.447  1.00 92.82  ? 107 GLN D NE2 1 
ATOM   4310 N N   . ILE D 2 108 ? 43.831  -13.700  -78.406  1.00 61.87  ? 108 ILE D N   1 
ATOM   4311 C CA  . ILE D 2 108 ? 42.965  -13.982  -79.542  1.00 66.53  ? 108 ILE D CA  1 
ATOM   4312 C C   . ILE D 2 108 ? 41.729  -13.072  -79.521  1.00 66.70  ? 108 ILE D C   1 
ATOM   4313 O O   . ILE D 2 108 ? 41.494  -12.339  -80.494  1.00 65.66  ? 108 ILE D O   1 
ATOM   4314 C CB  . ILE D 2 108 ? 42.582  -15.480  -79.580  1.00 68.97  ? 108 ILE D CB  1 
ATOM   4315 C CG1 . ILE D 2 108 ? 43.841  -16.329  -79.832  1.00 69.63  ? 108 ILE D CG1 1 
ATOM   4316 C CG2 . ILE D 2 108 ? 41.540  -15.766  -80.661  1.00 71.18  ? 108 ILE D CG2 1 
ATOM   4317 C CD1 . ILE D 2 108 ? 43.702  -17.781  -79.418  1.00 71.01  ? 108 ILE D CD1 1 
ATOM   4318 N N   . TYR D 2 109 ? 40.964  -13.108  -78.421  1.00 60.26  ? 109 TYR D N   1 
ATOM   4319 C CA  . TYR D 2 109 ? 39.773  -12.243  -78.269  1.00 56.49  ? 109 TYR D CA  1 
ATOM   4320 C C   . TYR D 2 109 ? 40.054  -10.763  -78.619  1.00 57.09  ? 109 TYR D C   1 
ATOM   4321 O O   . TYR D 2 109 ? 39.310  -10.156  -79.393  1.00 57.88  ? 109 TYR D O   1 
ATOM   4322 C CB  . TYR D 2 109 ? 39.152  -12.353  -76.845  1.00 56.73  ? 109 TYR D CB  1 
ATOM   4323 C CG  . TYR D 2 109 ? 37.986  -11.379  -76.598  1.00 52.60  ? 109 TYR D CG  1 
ATOM   4324 C CD1 . TYR D 2 109 ? 38.220  -10.043  -76.274  1.00 51.48  ? 109 TYR D CD1 1 
ATOM   4325 C CD2 . TYR D 2 109 ? 36.650  -11.794  -76.715  1.00 48.87  ? 109 TYR D CD2 1 
ATOM   4326 C CE1 . TYR D 2 109 ? 37.167  -9.152   -76.070  1.00 55.50  ? 109 TYR D CE1 1 
ATOM   4327 C CE2 . TYR D 2 109 ? 35.595  -10.908  -76.512  1.00 49.17  ? 109 TYR D CE2 1 
ATOM   4328 C CZ  . TYR D 2 109 ? 35.852  -9.586   -76.191  1.00 52.32  ? 109 TYR D CZ  1 
ATOM   4329 O OH  . TYR D 2 109 ? 34.828  -8.680   -75.973  1.00 50.22  ? 109 TYR D OH  1 
ATOM   4330 N N   . TRP D 2 110 ? 41.108  -10.186  -78.038  1.00 60.09  ? 110 TRP D N   1 
ATOM   4331 C CA  . TRP D 2 110 ? 41.393  -8.747   -78.215  1.00 63.51  ? 110 TRP D CA  1 
ATOM   4332 C C   . TRP D 2 110 ? 42.039  -8.424   -79.573  1.00 61.93  ? 110 TRP D C   1 
ATOM   4333 O O   . TRP D 2 110 ? 42.024  -7.265   -80.006  1.00 58.53  ? 110 TRP D O   1 
ATOM   4334 C CB  . TRP D 2 110 ? 42.251  -8.192   -77.068  1.00 60.15  ? 110 TRP D CB  1 
ATOM   4335 C CG  . TRP D 2 110 ? 41.535  -8.088   -75.753  1.00 60.22  ? 110 TRP D CG  1 
ATOM   4336 C CD1 . TRP D 2 110 ? 41.787  -8.826   -74.625  1.00 60.89  ? 110 TRP D CD1 1 
ATOM   4337 C CD2 . TRP D 2 110 ? 40.452  -7.213   -75.420  1.00 59.87  ? 110 TRP D CD2 1 
ATOM   4338 N NE1 . TRP D 2 110 ? 40.942  -8.460   -73.621  1.00 59.88  ? 110 TRP D NE1 1 
ATOM   4339 C CE2 . TRP D 2 110 ? 40.110  -7.471   -74.076  1.00 60.60  ? 110 TRP D CE2 1 
ATOM   4340 C CE3 . TRP D 2 110 ? 39.733  -6.232   -76.124  1.00 65.67  ? 110 TRP D CE3 1 
ATOM   4341 C CZ2 . TRP D 2 110 ? 39.082  -6.785   -73.417  1.00 61.44  ? 110 TRP D CZ2 1 
ATOM   4342 C CZ3 . TRP D 2 110 ? 38.701  -5.544   -75.464  1.00 60.94  ? 110 TRP D CZ3 1 
ATOM   4343 C CH2 . TRP D 2 110 ? 38.393  -5.826   -74.126  1.00 63.40  ? 110 TRP D CH2 1 
ATOM   4344 N N   . SER D 2 111 ? 42.598  -9.432   -80.239  1.00 61.59  ? 111 SER D N   1 
ATOM   4345 C CA  . SER D 2 111 ? 43.092  -9.228   -81.612  1.00 70.52  ? 111 SER D CA  1 
ATOM   4346 C C   . SER D 2 111 ? 41.957  -8.943   -82.638  1.00 71.22  ? 111 SER D C   1 
ATOM   4347 O O   . SER D 2 111 ? 42.180  -8.209   -83.600  1.00 72.65  ? 111 SER D O   1 
ATOM   4348 C CB  . SER D 2 111 ? 44.033  -10.367  -82.065  1.00 69.11  ? 111 SER D CB  1 
ATOM   4349 O OG  . SER D 2 111 ? 43.359  -11.586  -82.329  1.00 70.24  ? 111 SER D OG  1 
ATOM   4350 N N   . ILE D 2 112 ? 40.754  -9.477   -82.394  1.00 70.04  ? 112 ILE D N   1 
ATOM   4351 C CA  . ILE D 2 112 ? 39.575  -9.240   -83.272  1.00 72.09  ? 112 ILE D CA  1 
ATOM   4352 C C   . ILE D 2 112 ? 38.526  -8.269   -82.705  1.00 73.76  ? 112 ILE D C   1 
ATOM   4353 O O   . ILE D 2 112 ? 37.672  -7.806   -83.456  1.00 73.94  ? 112 ILE D O   1 
ATOM   4354 C CB  . ILE D 2 112 ? 38.880  -10.555  -83.743  1.00 75.26  ? 112 ILE D CB  1 
ATOM   4355 C CG1 . ILE D 2 112 ? 38.582  -11.491  -82.565  1.00 78.78  ? 112 ILE D CG1 1 
ATOM   4356 C CG2 . ILE D 2 112 ? 39.746  -11.261  -84.787  1.00 80.58  ? 112 ILE D CG2 1 
ATOM   4357 C CD1 . ILE D 2 112 ? 38.023  -12.851  -82.924  1.00 79.31  ? 112 ILE D CD1 1 
ATOM   4358 N N   . HIS D 2 113 ? 38.581  -7.957   -81.408  1.00 73.11  ? 113 HIS D N   1 
ATOM   4359 C CA  . HIS D 2 113 ? 37.641  -7.004   -80.797  1.00 73.18  ? 113 HIS D CA  1 
ATOM   4360 C C   . HIS D 2 113 ? 38.377  -5.680   -80.644  1.00 75.40  ? 113 HIS D C   1 
ATOM   4361 O O   . HIS D 2 113 ? 38.835  -5.307   -79.567  1.00 77.85  ? 113 HIS D O   1 
ATOM   4362 C CB  . HIS D 2 113 ? 37.084  -7.524   -79.461  1.00 73.92  ? 113 HIS D CB  1 
ATOM   4363 C CG  . HIS D 2 113 ? 36.085  -8.633   -79.613  1.00 75.91  ? 113 HIS D CG  1 
ATOM   4364 N ND1 . HIS D 2 113 ? 36.452  -9.948   -79.832  1.00 70.85  ? 113 HIS D ND1 1 
ATOM   4365 C CD2 . HIS D 2 113 ? 34.728  -8.621   -79.583  1.00 76.28  ? 113 HIS D CD2 1 
ATOM   4366 C CE1 . HIS D 2 113 ? 35.367  -10.697  -79.933  1.00 72.88  ? 113 HIS D CE1 1 
ATOM   4367 N NE2 . HIS D 2 113 ? 34.307  -9.918   -79.783  1.00 75.62  ? 113 HIS D NE2 1 
ATOM   4368 N N   . LEU D 2 114 ? 38.495  -4.995   -81.769  1.00 85.48  ? 114 LEU D N   1 
ATOM   4369 C CA  . LEU D 2 114 ? 39.207  -3.723   -81.890  1.00 86.06  ? 114 LEU D CA  1 
ATOM   4370 C C   . LEU D 2 114 ? 38.224  -2.578   -81.683  1.00 87.86  ? 114 LEU D C   1 
ATOM   4371 O O   . LEU D 2 114 ? 38.616  -1.417   -81.617  1.00 92.57  ? 114 LEU D O   1 
ATOM   4372 C CB  . LEU D 2 114 ? 39.864  -3.633   -83.281  1.00 86.19  ? 114 LEU D CB  1 
ATOM   4373 C CG  . LEU D 2 114 ? 41.207  -4.356   -83.544  1.00 87.59  ? 114 LEU D CG  1 
ATOM   4374 C CD1 . LEU D 2 114 ? 41.750  -5.179   -82.384  1.00 88.80  ? 114 LEU D CD1 1 
ATOM   4375 C CD2 . LEU D 2 114 ? 41.124  -5.240   -84.771  1.00 88.50  ? 114 LEU D CD2 1 
ATOM   4376 N N   . GLU D 2 118 ? 33.922  4.645    -81.774  1.00 106.99 ? 118 GLU D N   1 
ATOM   4377 C CA  . GLU D 2 118 ? 34.217  3.232    -82.022  1.00 116.44 ? 118 GLU D CA  1 
ATOM   4378 C C   . GLU D 2 118 ? 35.327  2.654    -81.119  1.00 122.41 ? 118 GLU D C   1 
ATOM   4379 O O   . GLU D 2 118 ? 35.184  1.541    -80.599  1.00 116.87 ? 118 GLU D O   1 
ATOM   4380 C CB  . GLU D 2 118 ? 34.581  3.026    -83.493  1.00 117.59 ? 118 GLU D CB  1 
ATOM   4381 C CG  . GLU D 2 118 ? 33.445  3.341    -84.455  1.00 119.42 ? 118 GLU D CG  1 
ATOM   4382 C CD  . GLU D 2 118 ? 33.882  3.336    -85.905  1.00 121.46 ? 118 GLU D CD  1 
ATOM   4383 O OE1 . GLU D 2 118 ? 35.023  2.910    -86.196  1.00 118.87 ? 118 GLU D OE1 1 
ATOM   4384 O OE2 . GLU D 2 118 ? 33.078  3.767    -86.758  1.00 122.14 ? 118 GLU D OE2 1 
ATOM   4385 N N   . GLY D 2 119 ? 36.424  3.400    -80.958  1.00 122.52 ? 119 GLY D N   1 
ATOM   4386 C CA  . GLY D 2 119 ? 37.551  3.006    -80.091  1.00 117.80 ? 119 GLY D CA  1 
ATOM   4387 C C   . GLY D 2 119 ? 37.615  3.780    -78.780  1.00 117.40 ? 119 GLY D C   1 
ATOM   4388 O O   . GLY D 2 119 ? 37.094  4.895    -78.682  1.00 116.34 ? 119 GLY D O   1 
ATOM   4389 N N   . GLU D 2 120 ? 38.267  3.179    -77.778  1.00 114.98 ? 120 GLU D N   1 
ATOM   4390 C CA  . GLU D 2 120 ? 38.442  3.765    -76.425  1.00 108.17 ? 120 GLU D CA  1 
ATOM   4391 C C   . GLU D 2 120 ? 37.107  4.014    -75.683  1.00 97.73  ? 120 GLU D C   1 
ATOM   4392 O O   . GLU D 2 120 ? 36.712  5.156    -75.411  1.00 87.56  ? 120 GLU D O   1 
ATOM   4393 C CB  . GLU D 2 120 ? 39.327  5.036    -76.490  1.00 111.82 ? 120 GLU D CB  1 
ATOM   4394 C CG  . GLU D 2 120 ? 39.650  5.736    -75.166  1.00 110.40 ? 120 GLU D CG  1 
ATOM   4395 C CD  . GLU D 2 120 ? 40.463  4.897    -74.187  1.00 112.74 ? 120 GLU D CD  1 
ATOM   4396 O OE1 . GLU D 2 120 ? 40.674  5.380    -73.059  1.00 113.52 ? 120 GLU D OE1 1 
ATOM   4397 O OE2 . GLU D 2 120 ? 40.906  3.773    -74.519  1.00 112.98 ? 120 GLU D OE2 1 
ATOM   4398 N N   . GLU D 2 121 ? 36.419  2.921    -75.363  1.00 89.16  ? 121 GLU D N   1 
ATOM   4399 C CA  . GLU D 2 121 ? 35.181  2.973    -74.573  1.00 87.40  ? 121 GLU D CA  1 
ATOM   4400 C C   . GLU D 2 121 ? 35.512  3.173    -73.095  1.00 78.40  ? 121 GLU D C   1 
ATOM   4401 O O   . GLU D 2 121 ? 36.541  2.694    -72.616  1.00 78.17  ? 121 GLU D O   1 
ATOM   4402 C CB  . GLU D 2 121 ? 34.389  1.677    -74.734  1.00 93.22  ? 121 GLU D CB  1 
ATOM   4403 C CG  . GLU D 2 121 ? 33.986  1.361    -76.164  1.00 101.08 ? 121 GLU D CG  1 
ATOM   4404 C CD  . GLU D 2 121 ? 33.053  0.168    -76.260  1.00 106.69 ? 121 GLU D CD  1 
ATOM   4405 O OE1 . GLU D 2 121 ? 31.821  0.390    -76.260  1.00 110.70 ? 121 GLU D OE1 1 
ATOM   4406 O OE2 . GLU D 2 121 ? 33.547  -0.981   -76.325  1.00 104.22 ? 121 GLU D OE2 1 
ATOM   4407 N N   . PHE D 2 122 ? 34.653  3.876    -72.372  1.00 67.63  ? 122 PHE D N   1 
ATOM   4408 C CA  . PHE D 2 122 ? 34.805  3.985    -70.918  1.00 65.17  ? 122 PHE D CA  1 
ATOM   4409 C C   . PHE D 2 122 ? 34.653  2.610    -70.232  1.00 62.06  ? 122 PHE D C   1 
ATOM   4410 O O   . PHE D 2 122 ? 35.438  2.254    -69.340  1.00 63.45  ? 122 PHE D O   1 
ATOM   4411 C CB  . PHE D 2 122 ? 33.800  4.974    -70.352  1.00 60.26  ? 122 PHE D CB  1 
ATOM   4412 C CG  . PHE D 2 122 ? 34.023  5.289    -68.910  1.00 64.98  ? 122 PHE D CG  1 
ATOM   4413 C CD1 . PHE D 2 122 ? 33.478  4.466    -67.907  1.00 64.44  ? 122 PHE D CD1 1 
ATOM   4414 C CD2 . PHE D 2 122 ? 34.781  6.399    -68.539  1.00 62.86  ? 122 PHE D CD2 1 
ATOM   4415 C CE1 . PHE D 2 122 ? 33.689  4.743    -66.576  1.00 61.11  ? 122 PHE D CE1 1 
ATOM   4416 C CE2 . PHE D 2 122 ? 34.984  6.688    -67.200  1.00 66.17  ? 122 PHE D CE2 1 
ATOM   4417 C CZ  . PHE D 2 122 ? 34.443  5.855    -66.219  1.00 68.29  ? 122 PHE D CZ  1 
ATOM   4418 N N   . TYR D 2 123 ? 33.633  1.871    -70.663  1.00 59.79  ? 123 TYR D N   1 
ATOM   4419 C CA  . TYR D 2 123 ? 33.384  0.481    -70.260  1.00 59.66  ? 123 TYR D CA  1 
ATOM   4420 C C   . TYR D 2 123 ? 33.522  -0.422   -71.473  1.00 59.15  ? 123 TYR D C   1 
ATOM   4421 O O   . TYR D 2 123 ? 32.719  -0.334   -72.382  1.00 64.31  ? 123 TYR D O   1 
ATOM   4422 C CB  . TYR D 2 123 ? 31.961  0.311    -69.695  1.00 54.53  ? 123 TYR D CB  1 
ATOM   4423 C CG  . TYR D 2 123 ? 31.666  1.113    -68.439  1.00 55.02  ? 123 TYR D CG  1 
ATOM   4424 C CD1 . TYR D 2 123 ? 32.410  0.928    -67.282  1.00 56.50  ? 123 TYR D CD1 1 
ATOM   4425 C CD2 . TYR D 2 123 ? 30.622  2.032    -68.394  1.00 57.00  ? 123 TYR D CD2 1 
ATOM   4426 C CE1 . TYR D 2 123 ? 32.150  1.652    -66.130  1.00 53.70  ? 123 TYR D CE1 1 
ATOM   4427 C CE2 . TYR D 2 123 ? 30.349  2.763    -67.244  1.00 55.80  ? 123 TYR D CE2 1 
ATOM   4428 C CZ  . TYR D 2 123 ? 31.116  2.563    -66.109  1.00 53.76  ? 123 TYR D CZ  1 
ATOM   4429 O OH  . TYR D 2 123 ? 30.855  3.276    -64.961  1.00 49.73  ? 123 TYR D OH  1 
ATOM   4430 N N   . GLU D 2 124 ? 34.532  -1.284   -71.486  1.00 61.25  ? 124 GLU D N   1 
ATOM   4431 C CA  . GLU D 2 124 ? 34.708  -2.276   -72.546  1.00 59.55  ? 124 GLU D CA  1 
ATOM   4432 C C   . GLU D 2 124 ? 33.949  -3.534   -72.159  1.00 58.67  ? 124 GLU D C   1 
ATOM   4433 O O   . GLU D 2 124 ? 33.803  -3.827   -70.978  1.00 66.02  ? 124 GLU D O   1 
ATOM   4434 C CB  . GLU D 2 124 ? 36.198  -2.610   -72.752  1.00 61.38  ? 124 GLU D CB  1 
ATOM   4435 C CG  . GLU D 2 124 ? 37.056  -1.394   -73.080  1.00 64.79  ? 124 GLU D CG  1 
ATOM   4436 C CD  . GLU D 2 124 ? 38.482  -1.753   -73.458  1.00 68.68  ? 124 GLU D CD  1 
ATOM   4437 O OE1 . GLU D 2 124 ? 39.153  -2.512   -72.726  1.00 65.82  ? 124 GLU D OE1 1 
ATOM   4438 O OE2 . GLU D 2 124 ? 38.950  -1.266   -74.504  1.00 73.30  ? 124 GLU D OE2 1 
ATOM   4439 N N   . ALA D 2 125 ? 33.477  -4.270   -73.155  1.00 54.30  ? 125 ALA D N   1 
ATOM   4440 C CA  . ALA D 2 125 ? 32.775  -5.518   -72.940  1.00 52.41  ? 125 ALA D CA  1 
ATOM   4441 C C   . ALA D 2 125 ? 33.740  -6.521   -72.355  1.00 52.16  ? 125 ALA D C   1 
ATOM   4442 O O   . ALA D 2 125 ? 34.923  -6.514   -72.696  1.00 55.10  ? 125 ALA D O   1 
ATOM   4443 C CB  . ALA D 2 125 ? 32.182  -6.047   -74.256  1.00 49.41  ? 125 ALA D CB  1 
ATOM   4444 N N   . SER D 2 126 ? 33.233  -7.387   -71.483  1.00 53.76  ? 126 SER D N   1 
ATOM   4445 C CA  . SER D 2 126 ? 34.053  -8.422   -70.885  1.00 56.22  ? 126 SER D CA  1 
ATOM   4446 C C   . SER D 2 126 ? 34.279  -9.553   -71.882  1.00 55.04  ? 126 SER D C   1 
ATOM   4447 O O   . SER D 2 126 ? 33.327  -10.067  -72.426  1.00 59.66  ? 126 SER D O   1 
ATOM   4448 C CB  . SER D 2 126 ? 33.401  -9.001   -69.622  1.00 53.85  ? 126 SER D CB  1 
ATOM   4449 O OG  . SER D 2 126 ? 34.145  -10.120  -69.139  1.00 52.45  ? 126 SER D OG  1 
ATOM   4450 N N   . PRO D 2 127 ? 35.531  -9.992   -72.056  1.00 57.17  ? 127 PRO D N   1 
ATOM   4451 C CA  . PRO D 2 127 ? 35.796  -11.219  -72.815  1.00 62.42  ? 127 PRO D CA  1 
ATOM   4452 C C   . PRO D 2 127 ? 35.414  -12.521  -72.109  1.00 60.33  ? 127 PRO D C   1 
ATOM   4453 O O   . PRO D 2 127 ? 35.547  -13.587  -72.700  1.00 61.95  ? 127 PRO D O   1 
ATOM   4454 C CB  . PRO D 2 127 ? 37.319  -11.191  -73.001  1.00 61.33  ? 127 PRO D CB  1 
ATOM   4455 C CG  . PRO D 2 127 ? 37.819  -10.376  -71.869  1.00 62.22  ? 127 PRO D CG  1 
ATOM   4456 C CD  . PRO D 2 127 ? 36.779  -9.325   -71.653  1.00 61.17  ? 127 PRO D CD  1 
ATOM   4457 N N   . TYR D 2 128 ? 35.004  -12.446  -70.848  1.00 59.68  ? 128 TYR D N   1 
ATOM   4458 C CA  . TYR D 2 128 ? 34.769  -13.646  -70.055  1.00 60.43  ? 128 TYR D CA  1 
ATOM   4459 C C   . TYR D 2 128 ? 33.319  -14.073  -70.204  1.00 60.19  ? 128 TYR D C   1 
ATOM   4460 O O   . TYR D 2 128 ? 32.422  -13.225  -70.290  1.00 63.39  ? 128 TYR D O   1 
ATOM   4461 C CB  . TYR D 2 128 ? 35.126  -13.425  -68.573  1.00 57.53  ? 128 TYR D CB  1 
ATOM   4462 C CG  . TYR D 2 128 ? 36.605  -13.312  -68.329  1.00 54.93  ? 128 TYR D CG  1 
ATOM   4463 C CD1 . TYR D 2 128 ? 37.409  -14.439  -68.337  1.00 56.91  ? 128 TYR D CD1 1 
ATOM   4464 C CD2 . TYR D 2 128 ? 37.207  -12.076  -68.098  1.00 56.10  ? 128 TYR D CD2 1 
ATOM   4465 C CE1 . TYR D 2 128 ? 38.776  -14.346  -68.141  1.00 56.42  ? 128 TYR D CE1 1 
ATOM   4466 C CE2 . TYR D 2 128 ? 38.573  -11.970  -67.889  1.00 53.47  ? 128 TYR D CE2 1 
ATOM   4467 C CZ  . TYR D 2 128 ? 39.349  -13.108  -67.913  1.00 54.33  ? 128 TYR D CZ  1 
ATOM   4468 O OH  . TYR D 2 128 ? 40.696  -13.028  -67.701  1.00 49.01  ? 128 TYR D OH  1 
ATOM   4469 N N   . GLU D 2 129 ? 33.111  -15.388  -70.243  1.00 65.38  ? 129 GLU D N   1 
ATOM   4470 C CA  . GLU D 2 129 ? 31.767  -15.982  -70.302  1.00 71.81  ? 129 GLU D CA  1 
ATOM   4471 C C   . GLU D 2 129 ? 31.047  -15.707  -68.993  1.00 71.29  ? 129 GLU D C   1 
ATOM   4472 O O   . GLU D 2 129 ? 31.598  -15.995  -67.933  1.00 74.14  ? 129 GLU D O   1 
ATOM   4473 C CB  . GLU D 2 129 ? 31.830  -17.508  -70.515  1.00 75.60  ? 129 GLU D CB  1 
ATOM   4474 C CG  . GLU D 2 129 ? 31.936  -17.929  -71.970  1.00 83.43  ? 129 GLU D CG  1 
ATOM   4475 C CD  . GLU D 2 129 ? 32.359  -19.382  -72.159  1.00 91.99  ? 129 GLU D CD  1 
ATOM   4476 O OE1 . GLU D 2 129 ? 33.525  -19.626  -72.568  1.00 98.14  ? 129 GLU D OE1 1 
ATOM   4477 O OE2 . GLU D 2 129 ? 31.529  -20.283  -71.908  1.00 93.67  ? 129 GLU D OE2 1 
ATOM   4478 N N   . PRO D 2 130 ? 29.811  -15.176  -69.049  1.00 74.52  ? 130 PRO D N   1 
ATOM   4479 C CA  . PRO D 2 130 ? 29.083  -15.100  -67.777  1.00 76.89  ? 130 PRO D CA  1 
ATOM   4480 C C   . PRO D 2 130 ? 28.819  -16.506  -67.175  1.00 80.93  ? 130 PRO D C   1 
ATOM   4481 O O   . PRO D 2 130 ? 28.954  -17.524  -67.868  1.00 80.17  ? 130 PRO D O   1 
ATOM   4482 C CB  . PRO D 2 130 ? 27.767  -14.420  -68.175  1.00 72.63  ? 130 PRO D CB  1 
ATOM   4483 C CG  . PRO D 2 130 ? 27.552  -14.880  -69.587  1.00 73.64  ? 130 PRO D CG  1 
ATOM   4484 C CD  . PRO D 2 130 ? 28.932  -14.851  -70.195  1.00 73.52  ? 130 PRO D CD  1 
ATOM   4485 N N   . VAL D 2 131 ? 28.453  -16.531  -65.896  1.00 89.26  ? 131 VAL D N   1 
ATOM   4486 C CA  . VAL D 2 131 ? 28.246  -17.775  -65.125  1.00 93.29  ? 131 VAL D CA  1 
ATOM   4487 C C   . VAL D 2 131 ? 26.754  -18.086  -64.963  1.00 85.51  ? 131 VAL D C   1 
ATOM   4488 O O   . VAL D 2 131 ? 26.230  -19.029  -65.544  1.00 80.73  ? 131 VAL D O   1 
ATOM   4489 C CB  . VAL D 2 131 ? 28.900  -17.693  -63.713  1.00 101.08 ? 131 VAL D CB  1 
ATOM   4490 C CG1 . VAL D 2 131 ? 30.380  -17.318  -63.817  1.00 96.05  ? 131 VAL D CG1 1 
ATOM   4491 C CG2 . VAL D 2 131 ? 28.152  -16.713  -62.789  1.00 103.48 ? 131 VAL D CG2 1 
ATOM   4492 N N   . SER D 2 158 ? 39.152  -14.643  -32.327  1.00 84.52  ? 158 SER D N   1 
ATOM   4493 C CA  . SER D 2 158 ? 38.147  -13.694  -31.850  1.00 86.35  ? 158 SER D CA  1 
ATOM   4494 C C   . SER D 2 158 ? 37.432  -13.058  -33.056  1.00 82.51  ? 158 SER D C   1 
ATOM   4495 O O   . SER D 2 158 ? 36.267  -13.378  -33.346  1.00 88.81  ? 158 SER D O   1 
ATOM   4496 C CB  . SER D 2 158 ? 38.755  -12.600  -30.933  1.00 86.78  ? 158 SER D CB  1 
ATOM   4497 O OG  . SER D 2 158 ? 40.136  -12.789  -30.685  1.00 86.55  ? 158 SER D OG  1 
ATOM   4498 N N   . ASN D 2 159 ? 38.134  -12.181  -33.768  1.00 63.44  ? 159 ASN D N   1 
ATOM   4499 C CA  . ASN D 2 159 ? 37.553  -11.529  -34.919  1.00 54.57  ? 159 ASN D CA  1 
ATOM   4500 C C   . ASN D 2 159 ? 37.409  -12.495  -36.114  1.00 50.27  ? 159 ASN D C   1 
ATOM   4501 O O   . ASN D 2 159 ? 38.085  -13.538  -36.196  1.00 43.83  ? 159 ASN D O   1 
ATOM   4502 C CB  . ASN D 2 159 ? 38.347  -10.270  -35.295  1.00 55.43  ? 159 ASN D CB  1 
ATOM   4503 C CG  . ASN D 2 159 ? 39.694  -10.573  -35.883  1.00 45.22  ? 159 ASN D CG  1 
ATOM   4504 O OD1 . ASN D 2 159 ? 39.787  -11.190  -36.929  1.00 47.59  ? 159 ASN D OD1 1 
ATOM   4505 N ND2 . ASN D 2 159 ? 40.730  -10.126  -35.237  1.00 44.58  ? 159 ASN D ND2 1 
ATOM   4506 N N   . HIS D 2 160 ? 36.549  -12.110  -37.056  1.00 46.32  ? 160 HIS D N   1 
ATOM   4507 C CA  . HIS D 2 160 ? 36.230  -12.961  -38.208  1.00 45.41  ? 160 HIS D CA  1 
ATOM   4508 C C   . HIS D 2 160 ? 37.387  -13.140  -39.190  1.00 41.91  ? 160 HIS D C   1 
ATOM   4509 O O   . HIS D 2 160 ? 37.471  -14.162  -39.883  1.00 38.11  ? 160 HIS D O   1 
ATOM   4510 C CB  . HIS D 2 160 ? 35.009  -12.436  -38.949  1.00 46.45  ? 160 HIS D CB  1 
ATOM   4511 C CG  . HIS D 2 160 ? 33.720  -12.619  -38.204  1.00 53.52  ? 160 HIS D CG  1 
ATOM   4512 N ND1 . HIS D 2 160 ? 32.545  -12.011  -38.592  1.00 57.41  ? 160 HIS D ND1 1 
ATOM   4513 C CD2 . HIS D 2 160 ? 33.427  -13.328  -37.091  1.00 52.66  ? 160 HIS D CD2 1 
ATOM   4514 C CE1 . HIS D 2 160 ? 31.580  -12.352  -37.762  1.00 54.70  ? 160 HIS D CE1 1 
ATOM   4515 N NE2 . HIS D 2 160 ? 32.090  -13.149  -36.842  1.00 54.82  ? 160 HIS D NE2 1 
ATOM   4516 N N   . CYS D 2 161 ? 38.284  -12.158  -39.238  1.00 39.49  ? 161 CYS D N   1 
ATOM   4517 C CA  . CYS D 2 161 ? 39.455  -12.234  -40.105  1.00 37.56  ? 161 CYS D CA  1 
ATOM   4518 C C   . CYS D 2 161 ? 40.490  -13.218  -39.568  1.00 36.38  ? 161 CYS D C   1 
ATOM   4519 O O   . CYS D 2 161 ? 41.168  -13.905  -40.329  1.00 35.72  ? 161 CYS D O   1 
ATOM   4520 C CB  . CYS D 2 161 ? 40.073  -10.870  -40.322  1.00 38.45  ? 161 CYS D CB  1 
ATOM   4521 S SG  . CYS D 2 161 ? 39.022  -9.712   -41.286  1.00 58.13  ? 161 CYS D SG  1 
ATOM   4522 N N   . LEU D 2 162 ? 40.609  -13.290  -38.253  1.00 35.77  ? 162 LEU D N   1 
ATOM   4523 C CA  . LEU D 2 162 ? 41.468  -14.266  -37.614  1.00 36.80  ? 162 LEU D CA  1 
ATOM   4524 C C   . LEU D 2 162 ? 40.916  -15.671  -37.822  1.00 34.10  ? 162 LEU D C   1 
ATOM   4525 O O   . LEU D 2 162 ? 41.636  -16.560  -38.193  1.00 35.56  ? 162 LEU D O   1 
ATOM   4526 C CB  . LEU D 2 162 ? 41.588  -13.951  -36.121  1.00 40.27  ? 162 LEU D CB  1 
ATOM   4527 C CG  . LEU D 2 162 ? 42.734  -14.637  -35.362  1.00 42.87  ? 162 LEU D CG  1 
ATOM   4528 C CD1 . LEU D 2 162 ? 44.101  -14.294  -35.952  1.00 41.54  ? 162 LEU D CD1 1 
ATOM   4529 C CD2 . LEU D 2 162 ? 42.677  -14.249  -33.889  1.00 44.93  ? 162 LEU D CD2 1 
ATOM   4530 N N   . ASP D 2 163 ? 39.603  -15.818  -37.641  1.00 38.10  ? 163 ASP D N   1 
ATOM   4531 C CA  . ASP D 2 163 ? 38.881  -17.048  -37.963  1.00 38.28  ? 163 ASP D CA  1 
ATOM   4532 C C   . ASP D 2 163 ? 39.139  -17.555  -39.373  1.00 36.03  ? 163 ASP D C   1 
ATOM   4533 O O   . ASP D 2 163 ? 39.289  -18.748  -39.587  1.00 41.53  ? 163 ASP D O   1 
ATOM   4534 C CB  . ASP D 2 163 ? 37.377  -16.851  -37.803  1.00 44.02  ? 163 ASP D CB  1 
ATOM   4535 C CG  . ASP D 2 163 ? 36.937  -16.559  -36.354  1.00 51.53  ? 163 ASP D CG  1 
ATOM   4536 O OD1 . ASP D 2 163 ? 37.688  -16.855  -35.380  1.00 50.96  ? 163 ASP D OD1 1 
ATOM   4537 O OD2 . ASP D 2 163 ? 35.790  -16.051  -36.202  1.00 55.92  ? 163 ASP D OD2 1 
ATOM   4538 N N   . ALA D 2 164 ? 39.156  -16.647  -40.340  1.00 34.42  ? 164 ALA D N   1 
ATOM   4539 C CA  . ALA D 2 164 ? 39.391  -17.002  -41.736  1.00 32.99  ? 164 ALA D CA  1 
ATOM   4540 C C   . ALA D 2 164 ? 40.836  -17.472  -41.993  1.00 33.72  ? 164 ALA D C   1 
ATOM   4541 O O   . ALA D 2 164 ? 41.061  -18.420  -42.742  1.00 34.04  ? 164 ALA D O   1 
ATOM   4542 C CB  . ALA D 2 164 ? 39.060  -15.820  -42.612  1.00 37.37  ? 164 ALA D CB  1 
ATOM   4543 N N   . ALA D 2 165 ? 41.800  -16.804  -41.358  1.00 31.24  ? 165 ALA D N   1 
ATOM   4544 C CA  . ALA D 2 165 ? 43.188  -17.216  -41.385  1.00 33.68  ? 165 ALA D CA  1 
ATOM   4545 C C   . ALA D 2 165 ? 43.394  -18.622  -40.773  1.00 35.14  ? 165 ALA D C   1 
ATOM   4546 O O   . ALA D 2 165 ? 44.204  -19.409  -41.266  1.00 36.43  ? 165 ALA D O   1 
ATOM   4547 C CB  . ALA D 2 165 ? 44.060  -16.184  -40.659  1.00 31.83  ? 165 ALA D CB  1 
ATOM   4548 N N   . LYS D 2 166 ? 42.683  -18.917  -39.697  1.00 35.48  ? 166 LYS D N   1 
ATOM   4549 C CA  . LYS D 2 166 ? 42.732  -20.250  -39.095  1.00 39.19  ? 166 LYS D CA  1 
ATOM   4550 C C   . LYS D 2 166 ? 42.193  -21.311  -40.059  1.00 39.22  ? 166 LYS D C   1 
ATOM   4551 O O   . LYS D 2 166 ? 42.831  -22.323  -40.307  1.00 38.46  ? 166 LYS D O   1 
ATOM   4552 C CB  . LYS D 2 166 ? 41.930  -20.258  -37.805  1.00 43.01  ? 166 LYS D CB  1 
ATOM   4553 C CG  . LYS D 2 166 ? 41.815  -21.612  -37.134  1.00 49.10  ? 166 LYS D CG  1 
ATOM   4554 C CD  . LYS D 2 166 ? 41.053  -21.489  -35.821  1.00 52.45  ? 166 LYS D CD  1 
ATOM   4555 C CE  . LYS D 2 166 ? 40.964  -22.826  -35.122  1.00 58.45  ? 166 LYS D CE  1 
ATOM   4556 N NZ  . LYS D 2 166 ? 40.319  -22.693  -33.796  1.00 64.67  ? 166 LYS D NZ  1 
ATOM   4557 N N   . ALA D 2 167 ? 41.025  -21.079  -40.629  1.00 38.26  ? 167 ALA D N   1 
ATOM   4558 C CA  . ALA D 2 167 ? 40.479  -22.070  -41.549  1.00 39.27  ? 167 ALA D CA  1 
ATOM   4559 C C   . ALA D 2 167 ? 41.460  -22.340  -42.672  1.00 39.67  ? 167 ALA D C   1 
ATOM   4560 O O   . ALA D 2 167 ? 41.634  -23.489  -43.092  1.00 42.40  ? 167 ALA D O   1 
ATOM   4561 C CB  . ALA D 2 167 ? 39.145  -21.622  -42.116  1.00 38.35  ? 167 ALA D CB  1 
ATOM   4562 N N   . CYS D 2 168 ? 42.081  -21.273  -43.167  1.00 37.84  ? 168 CYS D N   1 
ATOM   4563 C CA  . CYS D 2 168 ? 43.010  -21.374  -44.276  1.00 39.66  ? 168 CYS D CA  1 
ATOM   4564 C C   . CYS D 2 168 ? 44.299  -22.127  -43.871  1.00 38.75  ? 168 CYS D C   1 
ATOM   4565 O O   . CYS D 2 168 ? 44.752  -22.983  -44.602  1.00 37.73  ? 168 CYS D O   1 
ATOM   4566 C CB  . CYS D 2 168 ? 43.340  -19.986  -44.836  1.00 42.88  ? 168 CYS D CB  1 
ATOM   4567 S SG  . CYS D 2 168 ? 44.626  -20.028  -46.115  1.00 50.25  ? 168 CYS D SG  1 
ATOM   4568 N N   . ASN D 2 169 ? 44.875  -21.808  -42.714  1.00 37.30  ? 169 ASN D N   1 
ATOM   4569 C CA  . ASN D 2 169 ? 46.047  -22.540  -42.216  1.00 37.69  ? 169 ASN D CA  1 
ATOM   4570 C C   . ASN D 2 169 ? 45.804  -24.016  -41.841  1.00 37.69  ? 169 ASN D C   1 
ATOM   4571 O O   . ASN D 2 169 ? 46.765  -24.784  -41.776  1.00 40.45  ? 169 ASN D O   1 
ATOM   4572 C CB  . ASN D 2 169 ? 46.720  -21.795  -41.045  1.00 36.35  ? 169 ASN D CB  1 
ATOM   4573 C CG  . ASN D 2 169 ? 47.802  -20.792  -41.496  1.00 37.72  ? 169 ASN D CG  1 
ATOM   4574 O OD1 . ASN D 2 169 ? 48.029  -20.530  -42.697  1.00 35.51  ? 169 ASN D OD1 1 
ATOM   4575 N ND2 . ASN D 2 169 ? 48.485  -20.223  -40.506  1.00 37.91  ? 169 ASN D ND2 1 
ATOM   4576 N N   . LEU D 2 170 ? 44.555  -24.393  -41.579  1.00 40.42  ? 170 LEU D N   1 
ATOM   4577 C CA  . LEU D 2 170 ? 44.166  -25.799  -41.287  1.00 39.80  ? 170 LEU D CA  1 
ATOM   4578 C C   . LEU D 2 170 ? 43.779  -26.602  -42.530  1.00 39.94  ? 170 LEU D C   1 
ATOM   4579 O O   . LEU D 2 170 ? 43.554  -27.786  -42.443  1.00 46.63  ? 170 LEU D O   1 
ATOM   4580 C CB  . LEU D 2 170 ? 43.017  -25.825  -40.293  1.00 39.62  ? 170 LEU D CB  1 
ATOM   4581 C CG  . LEU D 2 170 ? 43.326  -25.317  -38.892  1.00 43.30  ? 170 LEU D CG  1 
ATOM   4582 C CD1 . LEU D 2 170 ? 42.158  -25.598  -37.979  1.00 44.77  ? 170 LEU D CD1 1 
ATOM   4583 C CD2 . LEU D 2 170 ? 44.580  -25.924  -38.307  1.00 45.18  ? 170 LEU D CD2 1 
ATOM   4584 N N   . ASN D 2 171 ? 43.720  -25.942  -43.679  1.00 42.82  ? 171 ASN D N   1 
ATOM   4585 C CA  . ASN D 2 171 ? 43.569  -26.574  -44.980  1.00 41.67  ? 171 ASN D CA  1 
ATOM   4586 C C   . ASN D 2 171 ? 44.908  -26.592  -45.716  1.00 46.53  ? 171 ASN D C   1 
ATOM   4587 O O   . ASN D 2 171 ? 45.499  -25.536  -45.965  1.00 42.05  ? 171 ASN D O   1 
ATOM   4588 C CB  . ASN D 2 171 ? 42.585  -25.768  -45.798  1.00 42.25  ? 171 ASN D CB  1 
ATOM   4589 C CG  . ASN D 2 171 ? 42.220  -26.445  -47.101  1.00 43.91  ? 171 ASN D CG  1 
ATOM   4590 O OD1 . ASN D 2 171 ? 41.355  -27.316  -47.128  1.00 50.06  ? 171 ASN D OD1 1 
ATOM   4591 N ND2 . ASN D 2 171 ? 42.853  -26.042  -48.180  1.00 39.24  ? 171 ASN D ND2 1 
ATOM   4592 N N   . ASP D 2 172 ? 45.379  -27.783  -46.095  1.00 48.02  ? 172 ASP D N   1 
ATOM   4593 C CA  . ASP D 2 172 ? 46.724  -27.922  -46.659  1.00 48.02  ? 172 ASP D CA  1 
ATOM   4594 C C   . ASP D 2 172 ? 46.958  -27.043  -47.891  1.00 41.36  ? 172 ASP D C   1 
ATOM   4595 O O   . ASP D 2 172 ? 47.969  -26.399  -47.987  1.00 40.51  ? 172 ASP D O   1 
ATOM   4596 C CB  . ASP D 2 172 ? 47.065  -29.394  -46.959  1.00 55.10  ? 172 ASP D CB  1 
ATOM   4597 C CG  . ASP D 2 172 ? 47.462  -30.187  -45.692  1.00 72.96  ? 172 ASP D CG  1 
ATOM   4598 O OD1 . ASP D 2 172 ? 47.935  -29.594  -44.694  1.00 87.40  ? 172 ASP D OD1 1 
ATOM   4599 O OD2 . ASP D 2 172 ? 47.307  -31.429  -45.681  1.00 86.42  ? 172 ASP D OD2 1 
ATOM   4600 N N   . ASN D 2 173 ? 46.035  -27.050  -48.829  1.00 39.96  ? 173 ASN D N   1 
ATOM   4601 C CA  . ASN D 2 173 ? 46.180  -26.313  -50.079  1.00 43.20  ? 173 ASN D CA  1 
ATOM   4602 C C   . ASN D 2 173 ? 46.177  -24.763  -49.857  1.00 41.06  ? 173 ASN D C   1 
ATOM   4603 O O   . ASN D 2 173 ? 46.949  -24.052  -50.470  1.00 39.91  ? 173 ASN D O   1 
ATOM   4604 C CB  . ASN D 2 173 ? 45.064  -26.738  -51.045  1.00 41.69  ? 173 ASN D CB  1 
ATOM   4605 C CG  . ASN D 2 173 ? 45.132  -26.011  -52.368  1.00 44.38  ? 173 ASN D CG  1 
ATOM   4606 O OD1 . ASN D 2 173 ? 46.152  -26.060  -53.047  1.00 48.01  ? 173 ASN D OD1 1 
ATOM   4607 N ND2 . ASN D 2 173 ? 44.043  -25.317  -52.742  1.00 43.42  ? 173 ASN D ND2 1 
ATOM   4608 N N   . CYS D 2 174 ? 45.352  -24.284  -48.940  1.00 38.63  ? 174 CYS D N   1 
ATOM   4609 C CA  . CYS D 2 174 ? 45.198  -22.853  -48.673  1.00 39.86  ? 174 CYS D CA  1 
ATOM   4610 C C   . CYS D 2 174 ? 46.444  -22.391  -47.946  1.00 40.34  ? 174 CYS D C   1 
ATOM   4611 O O   . CYS D 2 174 ? 47.037  -21.363  -48.319  1.00 37.84  ? 174 CYS D O   1 
ATOM   4612 C CB  . CYS D 2 174 ? 43.947  -22.517  -47.837  1.00 38.73  ? 174 CYS D CB  1 
ATOM   4613 S SG  . CYS D 2 174 ? 43.601  -20.707  -47.743  1.00 44.08  ? 174 CYS D SG  1 
ATOM   4614 N N   . LYS D 2 175 ? 46.843  -23.172  -46.935  1.00 37.43  ? 175 LYS D N   1 
ATOM   4615 C CA  . LYS D 2 175 ? 48.044  -22.895  -46.157  1.00 40.14  ? 175 LYS D CA  1 
ATOM   4616 C C   . LYS D 2 175 ? 49.271  -22.751  -47.039  1.00 39.76  ? 175 LYS D C   1 
ATOM   4617 O O   . LYS D 2 175 ? 50.074  -21.844  -46.815  1.00 39.60  ? 175 LYS D O   1 
ATOM   4618 C CB  . LYS D 2 175 ? 48.304  -23.991  -45.126  1.00 41.43  ? 175 LYS D CB  1 
ATOM   4619 C CG  . LYS D 2 175 ? 49.522  -23.754  -44.229  1.00 45.21  ? 175 LYS D CG  1 
ATOM   4620 C CD  . LYS D 2 175 ? 50.243  -25.026  -43.841  1.00 48.97  ? 175 LYS D CD  1 
ATOM   4621 C CE  . LYS D 2 175 ? 51.051  -25.606  -44.991  1.00 50.44  ? 175 LYS D CE  1 
ATOM   4622 N NZ  . LYS D 2 175 ? 51.285  -27.046  -44.691  1.00 57.66  ? 175 LYS D NZ  1 
ATOM   4623 N N   . LYS D 2 176 ? 49.425  -23.668  -47.991  1.00 36.95  ? 176 LYS D N   1 
ATOM   4624 C CA  . LYS D 2 176 ? 50.573  -23.676  -48.878  1.00 41.75  ? 176 LYS D CA  1 
ATOM   4625 C C   . LYS D 2 176 ? 50.579  -22.425  -49.749  1.00 39.61  ? 176 LYS D C   1 
ATOM   4626 O O   . LYS D 2 176 ? 51.589  -21.742  -49.851  1.00 36.85  ? 176 LYS D O   1 
ATOM   4627 C CB  . LYS D 2 176 ? 50.572  -24.898  -49.826  1.00 48.15  ? 176 LYS D CB  1 
ATOM   4628 C CG  . LYS D 2 176 ? 51.175  -26.178  -49.274  1.00 61.29  ? 176 LYS D CG  1 
ATOM   4629 C CD  . LYS D 2 176 ? 50.842  -27.410  -50.142  1.00 68.05  ? 176 LYS D CD  1 
ATOM   4630 C CE  . LYS D 2 176 ? 51.317  -28.728  -49.518  1.00 73.68  ? 176 LYS D CE  1 
ATOM   4631 N NZ  . LYS D 2 176 ? 50.597  -29.069  -48.257  1.00 82.94  ? 176 LYS D NZ  1 
ATOM   4632 N N   . LEU D 2 177 ? 49.462  -22.193  -50.436  1.00 38.14  ? 177 LEU D N   1 
ATOM   4633 C CA  . LEU D 2 177 ? 49.361  -21.110  -51.416  1.00 38.22  ? 177 LEU D CA  1 
ATOM   4634 C C   . LEU D 2 177 ? 49.329  -19.722  -50.734  1.00 36.55  ? 177 LEU D C   1 
ATOM   4635 O O   . LEU D 2 177 ? 49.846  -18.754  -51.287  1.00 35.92  ? 177 LEU D O   1 
ATOM   4636 C CB  . LEU D 2 177 ? 48.178  -21.340  -52.345  1.00 40.34  ? 177 LEU D CB  1 
ATOM   4637 C CG  . LEU D 2 177 ? 48.520  -22.226  -53.567  1.00 44.29  ? 177 LEU D CG  1 
ATOM   4638 C CD1 . LEU D 2 177 ? 48.931  -23.632  -53.195  1.00 50.18  ? 177 LEU D CD1 1 
ATOM   4639 C CD2 . LEU D 2 177 ? 47.331  -22.353  -54.489  1.00 45.63  ? 177 LEU D CD2 1 
ATOM   4640 N N   . ARG D 2 178 ? 48.804  -19.662  -49.508  1.00 33.35  ? 178 ARG D N   1 
ATOM   4641 C CA  . ARG D 2 178 ? 48.888  -18.466  -48.700  1.00 33.28  ? 178 ARG D CA  1 
ATOM   4642 C C   . ARG D 2 178 ? 50.331  -18.137  -48.317  1.00 36.56  ? 178 ARG D C   1 
ATOM   4643 O O   . ARG D 2 178 ? 50.795  -16.993  -48.464  1.00 38.14  ? 178 ARG D O   1 
ATOM   4644 C CB  . ARG D 2 178 ? 48.063  -18.626  -47.426  1.00 30.95  ? 178 ARG D CB  1 
ATOM   4645 C CG  . ARG D 2 178 ? 47.875  -17.352  -46.659  1.00 31.97  ? 178 ARG D CG  1 
ATOM   4646 C CD  . ARG D 2 178 ? 47.678  -17.610  -45.193  1.00 32.87  ? 178 ARG D CD  1 
ATOM   4647 N NE  . ARG D 2 178 ? 47.469  -16.368  -44.455  1.00 33.38  ? 178 ARG D NE  1 
ATOM   4648 C CZ  . ARG D 2 178 ? 47.496  -16.283  -43.136  1.00 37.43  ? 178 ARG D CZ  1 
ATOM   4649 N NH1 . ARG D 2 178 ? 47.691  -17.378  -42.402  1.00 38.81  ? 178 ARG D NH1 1 
ATOM   4650 N NH2 . ARG D 2 178 ? 47.309  -15.109  -42.540  1.00 39.26  ? 178 ARG D NH2 1 
ATOM   4651 N N   . SER D 2 179 ? 51.013  -19.123  -47.758  1.00 36.70  ? 179 SER D N   1 
ATOM   4652 C CA  . SER D 2 179 ? 52.376  -18.933  -47.323  1.00 40.02  ? 179 SER D CA  1 
ATOM   4653 C C   . SER D 2 179 ? 53.270  -18.547  -48.494  1.00 38.34  ? 179 SER D C   1 
ATOM   4654 O O   . SER D 2 179 ? 54.186  -17.745  -48.371  1.00 41.75  ? 179 SER D O   1 
ATOM   4655 C CB  . SER D 2 179 ? 52.926  -20.213  -46.690  1.00 40.19  ? 179 SER D CB  1 
ATOM   4656 O OG  . SER D 2 179 ? 54.135  -19.923  -46.021  1.00 39.05  ? 179 SER D OG  1 
ATOM   4657 N N   . SER D 2 180 ? 53.002  -19.167  -49.623  1.00 36.03  ? 180 SER D N   1 
ATOM   4658 C CA  . SER D 2 180 ? 53.749  -18.926  -50.813  1.00 36.96  ? 180 SER D CA  1 
ATOM   4659 C C   . SER D 2 180 ? 53.706  -17.425  -51.237  1.00 38.03  ? 180 SER D C   1 
ATOM   4660 O O   . SER D 2 180 ? 54.762  -16.851  -51.506  1.00 41.93  ? 180 SER D O   1 
ATOM   4661 C CB  . SER D 2 180 ? 53.236  -19.878  -51.891  1.00 38.35  ? 180 SER D CB  1 
ATOM   4662 O OG  . SER D 2 180 ? 53.799  -19.560  -53.129  1.00 50.61  ? 180 SER D OG  1 
ATOM   4663 N N   . TYR D 2 181 ? 52.527  -16.787  -51.250  1.00 37.41  ? 181 TYR D N   1 
ATOM   4664 C CA  . TYR D 2 181 ? 52.453  -15.333  -51.552  1.00 34.61  ? 181 TYR D CA  1 
ATOM   4665 C C   . TYR D 2 181 ? 52.987  -14.485  -50.435  1.00 35.84  ? 181 TYR D C   1 
ATOM   4666 O O   . TYR D 2 181 ? 53.665  -13.498  -50.691  1.00 36.20  ? 181 TYR D O   1 
ATOM   4667 C CB  . TYR D 2 181 ? 51.084  -14.841  -52.058  1.00 34.54  ? 181 TYR D CB  1 
ATOM   4668 C CG  . TYR D 2 181 ? 50.008  -14.504  -51.070  1.00 34.33  ? 181 TYR D CG  1 
ATOM   4669 C CD1 . TYR D 2 181 ? 50.032  -13.311  -50.342  1.00 34.32  ? 181 TYR D CD1 1 
ATOM   4670 C CD2 . TYR D 2 181 ? 48.926  -15.343  -50.892  1.00 34.83  ? 181 TYR D CD2 1 
ATOM   4671 C CE1 . TYR D 2 181 ? 49.041  -13.003  -49.428  1.00 31.59  ? 181 TYR D CE1 1 
ATOM   4672 C CE2 . TYR D 2 181 ? 47.923  -15.025  -49.986  1.00 33.78  ? 181 TYR D CE2 1 
ATOM   4673 C CZ  . TYR D 2 181 ? 47.987  -13.851  -49.268  1.00 32.42  ? 181 TYR D CZ  1 
ATOM   4674 O OH  . TYR D 2 181 ? 46.966  -13.542  -48.392  1.00 37.19  ? 181 TYR D OH  1 
ATOM   4675 N N   . ILE D 2 182 ? 52.733  -14.870  -49.198  1.00 35.43  ? 182 ILE D N   1 
ATOM   4676 C CA  . ILE D 2 182 ? 53.246  -14.091  -48.076  1.00 35.20  ? 182 ILE D CA  1 
ATOM   4677 C C   . ILE D 2 182 ? 54.764  -14.037  -48.135  1.00 37.82  ? 182 ILE D C   1 
ATOM   4678 O O   . ILE D 2 182 ? 55.349  -12.962  -48.029  1.00 38.13  ? 182 ILE D O   1 
ATOM   4679 C CB  . ILE D 2 182 ? 52.749  -14.654  -46.731  1.00 34.52  ? 182 ILE D CB  1 
ATOM   4680 C CG1 . ILE D 2 182 ? 51.268  -14.289  -46.569  1.00 36.59  ? 182 ILE D CG1 1 
ATOM   4681 C CG2 . ILE D 2 182 ? 53.524  -14.091  -45.564  1.00 32.33  ? 182 ILE D CG2 1 
ATOM   4682 C CD1 . ILE D 2 182 ? 50.545  -15.062  -45.482  1.00 38.97  ? 182 ILE D CD1 1 
ATOM   4683 N N   . SER D 2 183 ? 55.401  -15.189  -48.331  1.00 37.53  ? 183 SER D N   1 
ATOM   4684 C CA  . SER D 2 183 ? 56.859  -15.249  -48.256  1.00 37.20  ? 183 SER D CA  1 
ATOM   4685 C C   . SER D 2 183 ? 57.496  -14.519  -49.445  1.00 35.56  ? 183 SER D C   1 
ATOM   4686 O O   . SER D 2 183 ? 58.501  -13.875  -49.282  1.00 37.46  ? 183 SER D O   1 
ATOM   4687 C CB  . SER D 2 183 ? 57.371  -16.698  -48.159  1.00 34.53  ? 183 SER D CB  1 
ATOM   4688 O OG  . SER D 2 183 ? 57.027  -17.441  -49.298  1.00 36.53  ? 183 SER D OG  1 
ATOM   4689 N N   . ILE D 2 184 ? 56.938  -14.669  -50.630  1.00 35.54  ? 184 ILE D N   1 
ATOM   4690 C CA  . ILE D 2 184 ? 57.379  -13.894  -51.793  1.00 40.52  ? 184 ILE D CA  1 
ATOM   4691 C C   . ILE D 2 184 ? 57.144  -12.388  -51.629  1.00 39.27  ? 184 ILE D C   1 
ATOM   4692 O O   . ILE D 2 184 ? 58.031  -11.597  -51.922  1.00 41.77  ? 184 ILE D O   1 
ATOM   4693 C CB  . ILE D 2 184 ? 56.711  -14.376  -53.091  1.00 44.09  ? 184 ILE D CB  1 
ATOM   4694 C CG1 . ILE D 2 184 ? 57.255  -15.740  -53.486  1.00 49.20  ? 184 ILE D CG1 1 
ATOM   4695 C CG2 . ILE D 2 184 ? 57.015  -13.431  -54.235  1.00 49.37  ? 184 ILE D CG2 1 
ATOM   4696 C CD1 . ILE D 2 184 ? 56.369  -16.503  -54.451  1.00 54.70  ? 184 ILE D CD1 1 
ATOM   4697 N N   . CYS D 2 185 ? 55.957  -12.005  -51.180  1.00 41.26  ? 185 CYS D N   1 
ATOM   4698 C CA  . CYS D 2 185 ? 55.567  -10.589  -51.090  1.00 40.86  ? 185 CYS D CA  1 
ATOM   4699 C C   . CYS D 2 185 ? 56.289  -9.874   -49.969  1.00 41.02  ? 185 CYS D C   1 
ATOM   4700 O O   . CYS D 2 185 ? 56.490  -8.671   -50.039  1.00 43.90  ? 185 CYS D O   1 
ATOM   4701 C CB  . CYS D 2 185 ? 54.055  -10.426  -50.902  1.00 40.31  ? 185 CYS D CB  1 
ATOM   4702 S SG  . CYS D 2 185 ? 53.035  -10.897  -52.323  1.00 43.01  ? 185 CYS D SG  1 
ATOM   4703 N N   . ASN D 2 186 ? 56.684  -10.614  -48.940  1.00 41.67  ? 186 ASN D N   1 
ATOM   4704 C CA  . ASN D 2 186 ? 57.365  -10.045  -47.760  1.00 41.42  ? 186 ASN D CA  1 
ATOM   4705 C C   . ASN D 2 186 ? 58.916  -9.970   -47.864  1.00 42.61  ? 186 ASN D C   1 
ATOM   4706 O O   . ASN D 2 186 ? 59.560  -9.366   -47.003  1.00 43.27  ? 186 ASN D O   1 
ATOM   4707 C CB  . ASN D 2 186 ? 57.004  -10.913  -46.551  1.00 40.46  ? 186 ASN D CB  1 
ATOM   4708 C CG  . ASN D 2 186 ? 56.993  -10.165  -45.242  1.00 39.70  ? 186 ASN D CG  1 
ATOM   4709 O OD1 . ASN D 2 186 ? 56.685  -8.969   -45.165  1.00 43.59  ? 186 ASN D OD1 1 
ATOM   4710 N ND2 . ASN D 2 186 ? 57.250  -10.894  -44.179  1.00 39.47  ? 186 ASN D ND2 1 
ATOM   4711 N N   . ARG D 2 187 ? 59.498  -10.599  -48.880  1.00 42.96  ? 187 ARG D N   1 
ATOM   4712 C CA  . ARG D 2 187 ? 60.951  -10.698  -49.012  1.00 50.83  ? 187 ARG D CA  1 
ATOM   4713 C C   . ARG D 2 187 ? 61.532  -9.439   -49.647  1.00 52.26  ? 187 ARG D C   1 
ATOM   4714 O O   . ARG D 2 187 ? 61.358  -9.194   -50.841  1.00 50.15  ? 187 ARG D O   1 
ATOM   4715 C CB  . ARG D 2 187 ? 61.346  -11.922  -49.864  1.00 54.95  ? 187 ARG D CB  1 
ATOM   4716 C CG  . ARG D 2 187 ? 62.703  -12.519  -49.490  1.00 59.21  ? 187 ARG D CG  1 
ATOM   4717 C CD  . ARG D 2 187 ? 63.260  -13.537  -50.494  1.00 62.33  ? 187 ARG D CD  1 
ATOM   4718 N NE  . ARG D 2 187 ? 62.243  -14.451  -51.058  1.00 75.08  ? 187 ARG D NE  1 
ATOM   4719 C CZ  . ARG D 2 187 ? 61.669  -15.488  -50.428  1.00 71.75  ? 187 ARG D CZ  1 
ATOM   4720 N NH1 . ARG D 2 187 ? 61.986  -15.800  -49.173  1.00 70.84  ? 187 ARG D NH1 1 
ATOM   4721 N NH2 . ARG D 2 187 ? 60.756  -16.218  -51.062  1.00 69.88  ? 187 ARG D NH2 1 
ATOM   4722 N N   . GLU D 2 188 ? 62.222  -8.644   -48.843  1.00 57.46  ? 188 GLU D N   1 
ATOM   4723 C CA  . GLU D 2 188 ? 62.943  -7.472   -49.355  1.00 64.11  ? 188 GLU D CA  1 
ATOM   4724 C C   . GLU D 2 188 ? 64.034  -7.869   -50.334  1.00 59.79  ? 188 GLU D C   1 
ATOM   4725 O O   . GLU D 2 188 ? 64.722  -8.858   -50.133  1.00 59.39  ? 188 GLU D O   1 
ATOM   4726 C CB  . GLU D 2 188 ? 63.548  -6.647   -48.220  1.00 70.85  ? 188 GLU D CB  1 
ATOM   4727 C CG  . GLU D 2 188 ? 62.745  -5.408   -47.866  1.00 79.22  ? 188 GLU D CG  1 
ATOM   4728 C CD  . GLU D 2 188 ? 63.458  -4.511   -46.863  1.00 94.12  ? 188 GLU D CD  1 
ATOM   4729 O OE1 . GLU D 2 188 ? 63.999  -5.029   -45.854  1.00 96.69  ? 188 GLU D OE1 1 
ATOM   4730 O OE2 . GLU D 2 188 ? 63.474  -3.276   -47.082  1.00 99.19  ? 188 GLU D OE2 1 
ATOM   4731 N N   . ILE D 2 189 ? 64.150  -7.110   -51.413  1.00 63.54  ? 189 ILE D N   1 
ATOM   4732 C CA  . ILE D 2 189 ? 65.208  -7.309   -52.401  1.00 67.36  ? 189 ILE D CA  1 
ATOM   4733 C C   . ILE D 2 189 ? 66.416  -6.429   -52.054  1.00 66.42  ? 189 ILE D C   1 
ATOM   4734 O O   . ILE D 2 189 ? 67.541  -6.877   -52.142  1.00 68.18  ? 189 ILE D O   1 
ATOM   4735 C CB  . ILE D 2 189 ? 64.713  -6.944   -53.809  1.00 68.55  ? 189 ILE D CB  1 
ATOM   4736 C CG1 . ILE D 2 189 ? 63.473  -7.773   -54.189  1.00 65.72  ? 189 ILE D CG1 1 
ATOM   4737 C CG2 . ILE D 2 189 ? 65.836  -7.078   -54.852  1.00 67.17  ? 189 ILE D CG2 1 
ATOM   4738 C CD1 . ILE D 2 189 ? 63.763  -9.193   -54.637  1.00 62.70  ? 189 ILE D CD1 1 
ATOM   4739 N N   . SER D 2 190 ? 66.163  -5.178   -51.690  1.00 67.98  ? 190 SER D N   1 
ATOM   4740 C CA  . SER D 2 190 ? 67.217  -4.209   -51.359  1.00 72.94  ? 190 SER D CA  1 
ATOM   4741 C C   . SER D 2 190 ? 66.566  -3.029   -50.625  1.00 74.94  ? 190 SER D C   1 
ATOM   4742 O O   . SER D 2 190 ? 65.344  -3.009   -50.470  1.00 77.09  ? 190 SER D O   1 
ATOM   4743 C CB  . SER D 2 190 ? 67.953  -3.759   -52.638  1.00 72.38  ? 190 SER D CB  1 
ATOM   4744 O OG  . SER D 2 190 ? 67.135  -2.975   -53.491  1.00 62.76  ? 190 SER D OG  1 
ATOM   4745 N N   . PRO D 2 191 ? 67.358  -2.045   -50.155  1.00 83.56  ? 191 PRO D N   1 
ATOM   4746 C CA  . PRO D 2 191 ? 66.704  -0.890   -49.489  1.00 83.99  ? 191 PRO D CA  1 
ATOM   4747 C C   . PRO D 2 191 ? 65.772  -0.047   -50.386  1.00 82.66  ? 191 PRO D C   1 
ATOM   4748 O O   . PRO D 2 191 ? 64.889  0.654    -49.873  1.00 74.37  ? 191 PRO D O   1 
ATOM   4749 C CB  . PRO D 2 191 ? 67.890  -0.051   -49.008  1.00 82.71  ? 191 PRO D CB  1 
ATOM   4750 C CG  . PRO D 2 191 ? 69.017  -1.023   -48.898  1.00 81.39  ? 191 PRO D CG  1 
ATOM   4751 C CD  . PRO D 2 191 ? 68.825  -1.957   -50.055  1.00 82.28  ? 191 PRO D CD  1 
ATOM   4752 N N   . THR D 2 192 ? 65.975  -0.129   -51.701  1.00 86.07  ? 192 THR D N   1 
ATOM   4753 C CA  . THR D 2 192 ? 65.112  0.537    -52.688  1.00 89.01  ? 192 THR D CA  1 
ATOM   4754 C C   . THR D 2 192 ? 64.006  -0.360   -53.276  1.00 83.17  ? 192 THR D C   1 
ATOM   4755 O O   . THR D 2 192 ? 63.052  0.163    -53.847  1.00 85.24  ? 192 THR D O   1 
ATOM   4756 C CB  . THR D 2 192 ? 65.952  1.148    -53.846  1.00 90.52  ? 192 THR D CB  1 
ATOM   4757 O OG1 . THR D 2 192 ? 66.905  0.186    -54.339  1.00 80.81  ? 192 THR D OG1 1 
ATOM   4758 C CG2 . THR D 2 192 ? 66.681  2.397    -53.363  1.00 88.07  ? 192 THR D CG2 1 
ATOM   4759 N N   . GLU D 2 193 ? 64.141  -1.682   -53.149  1.00 80.23  ? 193 GLU D N   1 
ATOM   4760 C CA  . GLU D 2 193 ? 63.124  -2.631   -53.614  1.00 70.86  ? 193 GLU D CA  1 
ATOM   4761 C C   . GLU D 2 193 ? 62.513  -3.462   -52.445  1.00 68.34  ? 193 GLU D C   1 
ATOM   4762 O O   . GLU D 2 193 ? 63.124  -4.406   -51.932  1.00 67.11  ? 193 GLU D O   1 
ATOM   4763 C CB  . GLU D 2 193 ? 63.722  -3.516   -54.693  1.00 68.34  ? 193 GLU D CB  1 
ATOM   4764 C CG  . GLU D 2 193 ? 62.790  -3.770   -55.860  1.00 70.20  ? 193 GLU D CG  1 
ATOM   4765 C CD  . GLU D 2 193 ? 63.373  -4.727   -56.877  1.00 73.68  ? 193 GLU D CD  1 
ATOM   4766 O OE1 . GLU D 2 193 ? 64.627  -4.754   -57.038  1.00 72.39  ? 193 GLU D OE1 1 
ATOM   4767 O OE2 . GLU D 2 193 ? 62.569  -5.453   -57.509  1.00 70.81  ? 193 GLU D OE2 1 
ATOM   4768 N N   . ARG D 2 194 ? 61.299  -3.072   -52.053  1.00 58.32  ? 194 ARG D N   1 
ATOM   4769 C CA  . ARG D 2 194 ? 60.521  -3.700   -50.990  1.00 57.36  ? 194 ARG D CA  1 
ATOM   4770 C C   . ARG D 2 194 ? 60.276  -5.179   -51.267  1.00 53.02  ? 194 ARG D C   1 
ATOM   4771 O O   . ARG D 2 194 ? 60.247  -6.002   -50.339  1.00 48.72  ? 194 ARG D O   1 
ATOM   4772 C CB  . ARG D 2 194 ? 59.168  -2.957   -50.827  1.00 60.57  ? 194 ARG D CB  1 
ATOM   4773 C CG  . ARG D 2 194 ? 58.119  -3.636   -49.930  1.00 70.34  ? 194 ARG D CG  1 
ATOM   4774 C CD  . ARG D 2 194 ? 58.503  -3.604   -48.450  1.00 72.23  ? 194 ARG D CD  1 
ATOM   4775 N NE  . ARG D 2 194 ? 57.617  -4.389   -47.569  1.00 76.26  ? 194 ARG D NE  1 
ATOM   4776 C CZ  . ARG D 2 194 ? 57.766  -5.686   -47.241  1.00 78.20  ? 194 ARG D CZ  1 
ATOM   4777 N NH1 . ARG D 2 194 ? 58.760  -6.432   -47.742  1.00 78.64  ? 194 ARG D NH1 1 
ATOM   4778 N NH2 . ARG D 2 194 ? 56.893  -6.260   -46.406  1.00 73.71  ? 194 ARG D NH2 1 
ATOM   4779 N N   . CYS D 2 195 ? 60.069  -5.508   -52.535  1.00 49.05  ? 195 CYS D N   1 
ATOM   4780 C CA  . CYS D 2 195 ? 59.796  -6.867   -52.902  1.00 47.31  ? 195 CYS D CA  1 
ATOM   4781 C C   . CYS D 2 195 ? 59.899  -7.010   -54.387  1.00 45.34  ? 195 CYS D C   1 
ATOM   4782 O O   . CYS D 2 195 ? 59.933  -6.026   -55.109  1.00 47.42  ? 195 CYS D O   1 
ATOM   4783 C CB  . CYS D 2 195 ? 58.371  -7.235   -52.470  1.00 51.36  ? 195 CYS D CB  1 
ATOM   4784 S SG  . CYS D 2 195 ? 57.096  -6.225   -53.293  1.00 53.96  ? 195 CYS D SG  1 
ATOM   4785 N N   . ASN D 2 196 ? 59.901  -8.250   -54.842  1.00 44.39  ? 196 ASN D N   1 
ATOM   4786 C CA  . ASN D 2 196 ? 59.671  -8.531   -56.251  1.00 50.55  ? 196 ASN D CA  1 
ATOM   4787 C C   . ASN D 2 196 ? 58.143  -8.475   -56.543  1.00 52.71  ? 196 ASN D C   1 
ATOM   4788 O O   . ASN D 2 196 ? 57.416  -9.458   -56.366  1.00 49.32  ? 196 ASN D O   1 
ATOM   4789 C CB  . ASN D 2 196 ? 60.279  -9.890   -56.593  1.00 49.96  ? 196 ASN D CB  1 
ATOM   4790 C CG  . ASN D 2 196 ? 60.343  -10.146  -58.071  1.00 51.97  ? 196 ASN D CG  1 
ATOM   4791 O OD1 . ASN D 2 196 ? 59.537  -9.621   -58.856  1.00 50.59  ? 196 ASN D OD1 1 
ATOM   4792 N ND2 . ASN D 2 196 ? 61.282  -10.991  -58.464  1.00 56.31  ? 196 ASN D ND2 1 
ATOM   4793 N N   . ARG D 2 197 ? 57.677  -7.306   -56.975  1.00 55.19  ? 197 ARG D N   1 
ATOM   4794 C CA  . ARG D 2 197 ? 56.251  -7.044   -57.212  1.00 51.81  ? 197 ARG D CA  1 
ATOM   4795 C C   . ARG D 2 197 ? 55.644  -7.997   -58.260  1.00 53.69  ? 197 ARG D C   1 
ATOM   4796 O O   . ARG D 2 197 ? 54.555  -8.528   -58.076  1.00 54.09  ? 197 ARG D O   1 
ATOM   4797 C CB  . ARG D 2 197 ? 56.074  -5.595   -57.650  1.00 50.93  ? 197 ARG D CB  1 
ATOM   4798 C CG  . ARG D 2 197 ? 54.646  -5.054   -57.595  1.00 54.47  ? 197 ARG D CG  1 
ATOM   4799 C CD  . ARG D 2 197 ? 54.649  -3.584   -57.982  1.00 56.87  ? 197 ARG D CD  1 
ATOM   4800 N NE  . ARG D 2 197 ? 53.317  -2.980   -58.009  1.00 69.84  ? 197 ARG D NE  1 
ATOM   4801 C CZ  . ARG D 2 197 ? 52.740  -2.292   -57.008  1.00 84.08  ? 197 ARG D CZ  1 
ATOM   4802 N NH1 . ARG D 2 197 ? 53.351  -2.089   -55.829  1.00 81.22  ? 197 ARG D NH1 1 
ATOM   4803 N NH2 . ARG D 2 197 ? 51.514  -1.786   -57.186  1.00 89.58  ? 197 ARG D NH2 1 
ATOM   4804 N N   . ARG D 2 198 ? 56.364  -8.209   -59.350  1.00 51.93  ? 198 ARG D N   1 
ATOM   4805 C CA  . ARG D 2 198 ? 55.945  -9.125   -60.381  1.00 55.20  ? 198 ARG D CA  1 
ATOM   4806 C C   . ARG D 2 198 ? 55.671  -10.520  -59.807  1.00 51.16  ? 198 ARG D C   1 
ATOM   4807 O O   . ARG D 2 198 ? 54.602  -11.080  -60.007  1.00 50.63  ? 198 ARG D O   1 
ATOM   4808 C CB  . ARG D 2 198 ? 57.014  -9.186   -61.485  1.00 60.17  ? 198 ARG D CB  1 
ATOM   4809 C CG  . ARG D 2 198 ? 56.639  -10.066  -62.677  1.00 73.92  ? 198 ARG D CG  1 
ATOM   4810 C CD  . ARG D 2 198 ? 57.511  -9.830   -63.912  1.00 87.09  ? 198 ARG D CD  1 
ATOM   4811 N NE  . ARG D 2 198 ? 57.488  -8.426   -64.375  1.00 99.56  ? 198 ARG D NE  1 
ATOM   4812 C CZ  . ARG D 2 198 ? 56.557  -7.863   -65.161  1.00 106.43 ? 198 ARG D CZ  1 
ATOM   4813 N NH1 . ARG D 2 198 ? 55.512  -8.555   -65.625  1.00 111.02 ? 198 ARG D NH1 1 
ATOM   4814 N NH2 . ARG D 2 198 ? 56.672  -6.580   -65.497  1.00 105.55 ? 198 ARG D NH2 1 
ATOM   4815 N N   . LYS D 2 199 ? 56.652  -11.062  -59.102  1.00 51.22  ? 199 LYS D N   1 
ATOM   4816 C CA  . LYS D 2 199 ? 56.544  -12.386  -58.477  1.00 55.26  ? 199 LYS D CA  1 
ATOM   4817 C C   . LYS D 2 199 ? 55.411  -12.421  -57.421  1.00 49.61  ? 199 LYS D C   1 
ATOM   4818 O O   . LYS D 2 199 ? 54.640  -13.369  -57.380  1.00 51.80  ? 199 LYS D O   1 
ATOM   4819 C CB  . LYS D 2 199 ? 57.883  -12.797  -57.835  1.00 60.69  ? 199 LYS D CB  1 
ATOM   4820 C CG  . LYS D 2 199 ? 58.654  -13.920  -58.516  1.00 66.83  ? 199 LYS D CG  1 
ATOM   4821 C CD  . LYS D 2 199 ? 59.655  -14.581  -57.550  1.00 76.46  ? 199 LYS D CD  1 
ATOM   4822 C CE  . LYS D 2 199 ? 59.830  -16.084  -57.786  1.00 85.61  ? 199 LYS D CE  1 
ATOM   4823 N NZ  . LYS D 2 199 ? 59.828  -16.886  -56.521  1.00 90.56  ? 199 LYS D NZ  1 
ATOM   4824 N N   . CYS D 2 200 ? 55.336  -11.384  -56.586  1.00 42.57  ? 200 CYS D N   1 
ATOM   4825 C CA  . CYS D 2 200 ? 54.254  -11.195  -55.601  1.00 42.22  ? 200 CYS D CA  1 
ATOM   4826 C C   . CYS D 2 200 ? 52.872  -11.234  -56.241  1.00 40.55  ? 200 CYS D C   1 
ATOM   4827 O O   . CYS D 2 200 ? 52.019  -12.030  -55.854  1.00 38.32  ? 200 CYS D O   1 
ATOM   4828 C CB  . CYS D 2 200 ? 54.441  -9.869   -54.863  1.00 44.71  ? 200 CYS D CB  1 
ATOM   4829 S SG  . CYS D 2 200 ? 53.134  -9.348   -53.719  1.00 45.92  ? 200 CYS D SG  1 
ATOM   4830 N N   . HIS D 2 201 ? 52.668  -10.402  -57.245  1.00 36.66  ? 201 HIS D N   1 
ATOM   4831 C CA  . HIS D 2 201 ? 51.422  -10.432  -57.976  1.00 39.91  ? 201 HIS D CA  1 
ATOM   4832 C C   . HIS D 2 201 ? 51.069  -11.822  -58.512  1.00 39.85  ? 201 HIS D C   1 
ATOM   4833 O O   . HIS D 2 201 ? 49.941  -12.287  -58.368  1.00 41.36  ? 201 HIS D O   1 
ATOM   4834 C CB  . HIS D 2 201 ? 51.465  -9.412   -59.089  1.00 42.00  ? 201 HIS D CB  1 
ATOM   4835 C CG  . HIS D 2 201 ? 51.212  -8.025   -58.617  1.00 41.98  ? 201 HIS D CG  1 
ATOM   4836 N ND1 . HIS D 2 201 ? 51.063  -6.965   -59.479  1.00 44.58  ? 201 HIS D ND1 1 
ATOM   4837 C CD2 . HIS D 2 201 ? 51.033  -7.525   -57.369  1.00 43.91  ? 201 HIS D CD2 1 
ATOM   4838 C CE1 . HIS D 2 201 ? 50.836  -5.865   -58.783  1.00 42.37  ? 201 HIS D CE1 1 
ATOM   4839 N NE2 . HIS D 2 201 ? 50.796  -6.179   -57.501  1.00 39.62  ? 201 HIS D NE2 1 
ATOM   4840 N N   . LYS D 2 202 ? 52.052  -12.499  -59.068  1.00 41.51  ? 202 LYS D N   1 
ATOM   4841 C CA  . LYS D 2 202 ? 51.831  -13.803  -59.666  1.00 44.23  ? 202 LYS D CA  1 
ATOM   4842 C C   . LYS D 2 202 ? 51.366  -14.807  -58.603  1.00 41.15  ? 202 LYS D C   1 
ATOM   4843 O O   . LYS D 2 202 ? 50.440  -15.560  -58.829  1.00 42.75  ? 202 LYS D O   1 
ATOM   4844 C CB  . LYS D 2 202 ? 53.119  -14.242  -60.363  1.00 52.17  ? 202 LYS D CB  1 
ATOM   4845 C CG  . LYS D 2 202 ? 53.075  -15.572  -61.094  1.00 63.67  ? 202 LYS D CG  1 
ATOM   4846 C CD  . LYS D 2 202 ? 54.405  -15.830  -61.813  1.00 73.01  ? 202 LYS D CD  1 
ATOM   4847 C CE  . LYS D 2 202 ? 54.727  -17.324  -61.926  1.00 79.43  ? 202 LYS D CE  1 
ATOM   4848 N NZ  . LYS D 2 202 ? 56.197  -17.576  -61.979  1.00 82.06  ? 202 LYS D NZ  1 
ATOM   4849 N N   . ALA D 2 203 ? 51.989  -14.780  -57.434  1.00 37.33  ? 203 ALA D N   1 
ATOM   4850 C CA  . ALA D 2 203 ? 51.619  -15.651  -56.362  1.00 38.40  ? 203 ALA D CA  1 
ATOM   4851 C C   . ALA D 2 203 ? 50.229  -15.317  -55.801  1.00 41.25  ? 203 ALA D C   1 
ATOM   4852 O O   . ALA D 2 203 ? 49.502  -16.228  -55.406  1.00 39.80  ? 203 ALA D O   1 
ATOM   4853 C CB  . ALA D 2 203 ? 52.656  -15.591  -55.261  1.00 40.10  ? 203 ALA D CB  1 
ATOM   4854 N N   . LEU D 2 204 ? 49.868  -14.027  -55.778  1.00 38.79  ? 204 LEU D N   1 
ATOM   4855 C CA  . LEU D 2 204 ? 48.517  -13.605  -55.391  1.00 39.08  ? 204 LEU D CA  1 
ATOM   4856 C C   . LEU D 2 204 ? 47.458  -14.145  -56.343  1.00 37.81  ? 204 LEU D C   1 
ATOM   4857 O O   . LEU D 2 204 ? 46.416  -14.626  -55.918  1.00 35.76  ? 204 LEU D O   1 
ATOM   4858 C CB  . LEU D 2 204 ? 48.417  -12.070  -55.277  1.00 39.25  ? 204 LEU D CB  1 
ATOM   4859 C CG  . LEU D 2 204 ? 48.968  -11.489  -53.969  1.00 36.60  ? 204 LEU D CG  1 
ATOM   4860 C CD1 . LEU D 2 204 ? 49.257  -10.005  -54.069  1.00 38.69  ? 204 LEU D CD1 1 
ATOM   4861 C CD2 . LEU D 2 204 ? 48.002  -11.730  -52.824  1.00 36.09  ? 204 LEU D CD2 1 
ATOM   4862 N N   . ARG D 2 205 ? 47.739  -14.104  -57.633  1.00 39.30  ? 205 ARG D N   1 
ATOM   4863 C CA  . ARG D 2 205 ? 46.819  -14.706  -58.597  1.00 42.28  ? 205 ARG D CA  1 
ATOM   4864 C C   . ARG D 2 205 ? 46.638  -16.185  -58.411  1.00 41.88  ? 205 ARG D C   1 
ATOM   4865 O O   . ARG D 2 205 ? 45.525  -16.697  -58.552  1.00 42.45  ? 205 ARG D O   1 
ATOM   4866 C CB  . ARG D 2 205 ? 47.302  -14.489  -59.988  1.00 44.03  ? 205 ARG D CB  1 
ATOM   4867 C CG  . ARG D 2 205 ? 47.197  -13.052  -60.387  1.00 47.66  ? 205 ARG D CG  1 
ATOM   4868 C CD  . ARG D 2 205 ? 47.553  -12.974  -61.834  1.00 50.26  ? 205 ARG D CD  1 
ATOM   4869 N NE  . ARG D 2 205 ? 48.604  -12.003  -61.983  1.00 61.64  ? 205 ARG D NE  1 
ATOM   4870 C CZ  . ARG D 2 205 ? 49.607  -12.101  -62.842  1.00 65.04  ? 205 ARG D CZ  1 
ATOM   4871 N NH1 . ARG D 2 205 ? 49.705  -13.153  -63.666  1.00 64.03  ? 205 ARG D NH1 1 
ATOM   4872 N NH2 . ARG D 2 205 ? 50.517  -11.128  -62.871  1.00 62.69  ? 205 ARG D NH2 1 
ATOM   4873 N N   . GLN D 2 206 ? 47.736  -16.862  -58.104  1.00 41.59  ? 206 GLN D N   1 
ATOM   4874 C CA  . GLN D 2 206 ? 47.698  -18.300  -57.869  1.00 44.01  ? 206 GLN D CA  1 
ATOM   4875 C C   . GLN D 2 206 ? 46.793  -18.606  -56.690  1.00 41.70  ? 206 GLN D C   1 
ATOM   4876 O O   . GLN D 2 206 ? 45.958  -19.510  -56.766  1.00 43.07  ? 206 GLN D O   1 
ATOM   4877 C CB  . GLN D 2 206 ? 49.110  -18.854  -57.643  1.00 48.62  ? 206 GLN D CB  1 
ATOM   4878 C CG  . GLN D 2 206 ? 49.855  -19.128  -58.938  1.00 58.38  ? 206 GLN D CG  1 
ATOM   4879 C CD  . GLN D 2 206 ? 49.431  -20.461  -59.550  1.00 70.45  ? 206 GLN D CD  1 
ATOM   4880 O OE1 . GLN D 2 206 ? 48.672  -20.501  -60.519  1.00 75.06  ? 206 GLN D OE1 1 
ATOM   4881 N NE2 . GLN D 2 206 ? 49.896  -21.567  -58.953  1.00 73.71  ? 206 GLN D NE2 1 
ATOM   4882 N N   . PHE D 2 207 ? 46.938  -17.834  -55.612  1.00 36.84  ? 207 PHE D N   1 
ATOM   4883 C CA  . PHE D 2 207 ? 46.074  -17.963  -54.445  1.00 35.29  ? 207 PHE D CA  1 
ATOM   4884 C C   . PHE D 2 207 ? 44.599  -17.786  -54.812  1.00 39.65  ? 207 PHE D C   1 
ATOM   4885 O O   . PHE D 2 207 ? 43.777  -18.650  -54.514  1.00 40.76  ? 207 PHE D O   1 
ATOM   4886 C CB  . PHE D 2 207 ? 46.490  -16.958  -53.385  1.00 34.05  ? 207 PHE D CB  1 
ATOM   4887 C CG  . PHE D 2 207 ? 45.719  -17.042  -52.107  1.00 35.16  ? 207 PHE D CG  1 
ATOM   4888 C CD1 . PHE D 2 207 ? 45.921  -18.089  -51.217  1.00 36.02  ? 207 PHE D CD1 1 
ATOM   4889 C CD2 . PHE D 2 207 ? 44.826  -16.031  -51.757  1.00 35.62  ? 207 PHE D CD2 1 
ATOM   4890 C CE1 . PHE D 2 207 ? 45.224  -18.134  -50.011  1.00 35.17  ? 207 PHE D CE1 1 
ATOM   4891 C CE2 . PHE D 2 207 ? 44.136  -16.070  -50.558  1.00 34.51  ? 207 PHE D CE2 1 
ATOM   4892 C CZ  . PHE D 2 207 ? 44.333  -17.126  -49.691  1.00 36.35  ? 207 PHE D CZ  1 
ATOM   4893 N N   . PHE D 2 208 ? 44.255  -16.686  -55.469  1.00 40.27  ? 208 PHE D N   1 
ATOM   4894 C CA  . PHE D 2 208 ? 42.841  -16.445  -55.774  1.00 40.38  ? 208 PHE D CA  1 
ATOM   4895 C C   . PHE D 2 208 ? 42.290  -17.441  -56.823  1.00 44.06  ? 208 PHE D C   1 
ATOM   4896 O O   . PHE D 2 208 ? 41.121  -17.797  -56.755  1.00 44.00  ? 208 PHE D O   1 
ATOM   4897 C CB  . PHE D 2 208 ? 42.590  -14.966  -56.107  1.00 36.63  ? 208 PHE D CB  1 
ATOM   4898 C CG  . PHE D 2 208 ? 42.653  -14.087  -54.892  1.00 36.72  ? 208 PHE D CG  1 
ATOM   4899 C CD1 . PHE D 2 208 ? 41.618  -14.090  -53.973  1.00 37.61  ? 208 PHE D CD1 1 
ATOM   4900 C CD2 . PHE D 2 208 ? 43.772  -13.312  -54.621  1.00 36.22  ? 208 PHE D CD2 1 
ATOM   4901 C CE1 . PHE D 2 208 ? 41.690  -13.316  -52.822  1.00 39.04  ? 208 PHE D CE1 1 
ATOM   4902 C CE2 . PHE D 2 208 ? 43.868  -12.557  -53.471  1.00 36.44  ? 208 PHE D CE2 1 
ATOM   4903 C CZ  . PHE D 2 208 ? 42.818  -12.548  -52.566  1.00 39.35  ? 208 PHE D CZ  1 
ATOM   4904 N N   . ASP D 2 209 ? 43.138  -17.931  -57.734  1.00 46.73  ? 209 ASP D N   1 
ATOM   4905 C CA  . ASP D 2 209 ? 42.740  -18.933  -58.768  1.00 48.28  ? 209 ASP D CA  1 
ATOM   4906 C C   . ASP D 2 209 ? 42.710  -20.419  -58.338  1.00 47.45  ? 209 ASP D C   1 
ATOM   4907 O O   . ASP D 2 209 ? 41.950  -21.193  -58.892  1.00 50.02  ? 209 ASP D O   1 
ATOM   4908 C CB  . ASP D 2 209 ? 43.653  -18.828  -60.005  1.00 48.69  ? 209 ASP D CB  1 
ATOM   4909 C CG  . ASP D 2 209 ? 43.375  -17.585  -60.865  1.00 56.10  ? 209 ASP D CG  1 
ATOM   4910 O OD1 . ASP D 2 209 ? 42.359  -16.876  -60.662  1.00 59.20  ? 209 ASP D OD1 1 
ATOM   4911 O OD2 . ASP D 2 209 ? 44.193  -17.316  -61.770  1.00 65.62  ? 209 ASP D OD2 1 
ATOM   4912 N N   . ARG D 2 210 ? 43.538  -20.814  -57.380  1.00 45.80  ? 210 ARG D N   1 
ATOM   4913 C CA  . ARG D 2 210 ? 43.698  -22.217  -57.028  1.00 46.38  ? 210 ARG D CA  1 
ATOM   4914 C C   . ARG D 2 210 ? 43.243  -22.585  -55.612  1.00 47.02  ? 210 ARG D C   1 
ATOM   4915 O O   . ARG D 2 210 ? 43.333  -23.757  -55.225  1.00 48.45  ? 210 ARG D O   1 
ATOM   4916 C CB  . ARG D 2 210 ? 45.156  -22.623  -57.246  1.00 53.35  ? 210 ARG D CB  1 
ATOM   4917 C CG  . ARG D 2 210 ? 45.643  -22.457  -58.688  1.00 58.62  ? 210 ARG D CG  1 
ATOM   4918 C CD  . ARG D 2 210 ? 47.056  -23.002  -58.852  1.00 74.21  ? 210 ARG D CD  1 
ATOM   4919 N NE  . ARG D 2 210 ? 47.178  -24.388  -58.361  1.00 89.35  ? 210 ARG D NE  1 
ATOM   4920 C CZ  . ARG D 2 210 ? 46.994  -25.502  -59.086  1.00 101.84 ? 210 ARG D CZ  1 
ATOM   4921 N NH1 . ARG D 2 210 ? 46.705  -25.450  -60.390  1.00 97.31  ? 210 ARG D NH1 1 
ATOM   4922 N NH2 . ARG D 2 210 ? 47.113  -26.696  -58.495  1.00 107.35 ? 210 ARG D NH2 1 
ATOM   4923 N N   . VAL D 2 211 ? 42.755  -21.597  -54.853  1.00 42.70  ? 211 VAL D N   1 
ATOM   4924 C CA  . VAL D 2 211 ? 42.161  -21.832  -53.544  1.00 41.96  ? 211 VAL D CA  1 
ATOM   4925 C C   . VAL D 2 211 ? 40.674  -21.525  -53.698  1.00 43.57  ? 211 VAL D C   1 
ATOM   4926 O O   . VAL D 2 211 ? 40.305  -20.536  -54.334  1.00 45.49  ? 211 VAL D O   1 
ATOM   4927 C CB  . VAL D 2 211 ? 42.808  -20.967  -52.436  1.00 41.83  ? 211 VAL D CB  1 
ATOM   4928 C CG1 . VAL D 2 211 ? 42.173  -21.231  -51.086  1.00 42.52  ? 211 VAL D CG1 1 
ATOM   4929 C CG2 . VAL D 2 211 ? 44.291  -21.263  -52.327  1.00 43.66  ? 211 VAL D CG2 1 
ATOM   4930 N N   . PRO D 2 212 ? 39.801  -22.392  -53.175  1.00 40.42  ? 212 PRO D N   1 
ATOM   4931 C CA  . PRO D 2 212 ? 38.372  -22.075  -53.288  1.00 42.98  ? 212 PRO D CA  1 
ATOM   4932 C C   . PRO D 2 212 ? 37.961  -20.755  -52.615  1.00 40.38  ? 212 PRO D C   1 
ATOM   4933 O O   . PRO D 2 212 ? 38.463  -20.403  -51.559  1.00 39.02  ? 212 PRO D O   1 
ATOM   4934 C CB  . PRO D 2 212 ? 37.691  -23.250  -52.567  1.00 43.38  ? 212 PRO D CB  1 
ATOM   4935 C CG  . PRO D 2 212 ? 38.669  -24.369  -52.647  1.00 43.88  ? 212 PRO D CG  1 
ATOM   4936 C CD  . PRO D 2 212 ? 40.028  -23.738  -52.635  1.00 41.67  ? 212 PRO D CD  1 
ATOM   4937 N N   . SER D 2 213 ? 36.987  -20.093  -53.211  1.00 42.51  ? 213 SER D N   1 
ATOM   4938 C CA  . SER D 2 213 ? 36.454  -18.846  -52.691  1.00 42.86  ? 213 SER D CA  1 
ATOM   4939 C C   . SER D 2 213 ? 35.925  -18.970  -51.281  1.00 39.31  ? 213 SER D C   1 
ATOM   4940 O O   . SER D 2 213 ? 35.932  -17.994  -50.544  1.00 41.91  ? 213 SER D O   1 
ATOM   4941 C CB  . SER D 2 213 ? 35.395  -18.265  -53.638  1.00 42.32  ? 213 SER D CB  1 
ATOM   4942 O OG  . SER D 2 213 ? 34.237  -19.068  -53.655  1.00 46.49  ? 213 SER D OG  1 
ATOM   4943 N N   . GLU D 2 214 ? 35.494  -20.160  -50.876  1.00 41.24  ? 214 GLU D N   1 
ATOM   4944 C CA  . GLU D 2 214 ? 35.071  -20.363  -49.471  1.00 42.61  ? 214 GLU D CA  1 
ATOM   4945 C C   . GLU D 2 214 ? 36.184  -19.970  -48.477  1.00 38.68  ? 214 GLU D C   1 
ATOM   4946 O O   . GLU D 2 214 ? 35.887  -19.528  -47.400  1.00 41.81  ? 214 GLU D O   1 
ATOM   4947 C CB  . GLU D 2 214 ? 34.557  -21.803  -49.204  1.00 48.74  ? 214 GLU D CB  1 
ATOM   4948 C CG  . GLU D 2 214 ? 35.645  -22.866  -49.049  1.00 62.58  ? 214 GLU D CG  1 
ATOM   4949 C CD  . GLU D 2 214 ? 35.141  -24.326  -49.006  1.00 76.36  ? 214 GLU D CD  1 
ATOM   4950 O OE1 . GLU D 2 214 ? 34.440  -24.690  -48.023  1.00 78.42  ? 214 GLU D OE1 1 
ATOM   4951 O OE2 . GLU D 2 214 ? 35.496  -25.126  -49.931  1.00 76.32  ? 214 GLU D OE2 1 
ATOM   4952 N N   . TYR D 2 215 ? 37.452  -20.164  -48.849  1.00 38.10  ? 215 TYR D N   1 
ATOM   4953 C CA  . TYR D 2 215 ? 38.573  -19.716  -48.057  1.00 37.31  ? 215 TYR D CA  1 
ATOM   4954 C C   . TYR D 2 215 ? 38.971  -18.270  -48.337  1.00 36.68  ? 215 TYR D C   1 
ATOM   4955 O O   . TYR D 2 215 ? 39.104  -17.494  -47.397  1.00 33.53  ? 215 TYR D O   1 
ATOM   4956 C CB  . TYR D 2 215 ? 39.779  -20.619  -48.251  1.00 41.62  ? 215 TYR D CB  1 
ATOM   4957 C CG  . TYR D 2 215 ? 39.541  -22.015  -47.757  1.00 43.23  ? 215 TYR D CG  1 
ATOM   4958 C CD1 . TYR D 2 215 ? 39.457  -22.281  -46.401  1.00 44.53  ? 215 TYR D CD1 1 
ATOM   4959 C CD2 . TYR D 2 215 ? 39.342  -23.065  -48.651  1.00 45.21  ? 215 TYR D CD2 1 
ATOM   4960 C CE1 . TYR D 2 215 ? 39.204  -23.568  -45.944  1.00 47.01  ? 215 TYR D CE1 1 
ATOM   4961 C CE2 . TYR D 2 215 ? 39.097  -24.355  -48.200  1.00 46.72  ? 215 TYR D CE2 1 
ATOM   4962 C CZ  . TYR D 2 215 ? 39.027  -24.593  -46.849  1.00 45.47  ? 215 TYR D CZ  1 
ATOM   4963 O OH  . TYR D 2 215 ? 38.779  -25.842  -46.400  1.00 47.94  ? 215 TYR D OH  1 
ATOM   4964 N N   . THR D 2 216 ? 39.157  -17.924  -49.613  1.00 33.53  ? 216 THR D N   1 
ATOM   4965 C CA  . THR D 2 216 ? 39.805  -16.677  -49.976  1.00 34.78  ? 216 THR D CA  1 
ATOM   4966 C C   . THR D 2 216 ? 38.918  -15.462  -49.728  1.00 35.87  ? 216 THR D C   1 
ATOM   4967 O O   . THR D 2 216 ? 39.411  -14.450  -49.250  1.00 36.22  ? 216 THR D O   1 
ATOM   4968 C CB  . THR D 2 216 ? 40.278  -16.639  -51.449  1.00 35.11  ? 216 THR D CB  1 
ATOM   4969 O OG1 . THR D 2 216 ? 39.151  -16.714  -52.309  1.00 36.26  ? 216 THR D OG1 1 
ATOM   4970 C CG2 . THR D 2 216 ? 41.201  -17.781  -51.774  1.00 38.70  ? 216 THR D CG2 1 
ATOM   4971 N N   . TYR D 2 217 ? 37.628  -15.559  -50.062  1.00 35.93  ? 217 TYR D N   1 
ATOM   4972 C CA  . TYR D 2 217 ? 36.697  -14.458  -49.849  1.00 36.82  ? 217 TYR D CA  1 
ATOM   4973 C C   . TYR D 2 217 ? 36.445  -14.194  -48.372  1.00 38.39  ? 217 TYR D C   1 
ATOM   4974 O O   . TYR D 2 217 ? 36.151  -13.063  -47.958  1.00 36.26  ? 217 TYR D O   1 
ATOM   4975 C CB  . TYR D 2 217 ? 35.358  -14.721  -50.507  1.00 36.99  ? 217 TYR D CB  1 
ATOM   4976 C CG  . TYR D 2 217 ? 35.320  -14.730  -52.007  1.00 38.46  ? 217 TYR D CG  1 
ATOM   4977 C CD1 . TYR D 2 217 ? 36.471  -14.732  -52.792  1.00 38.66  ? 217 TYR D CD1 1 
ATOM   4978 C CD2 . TYR D 2 217 ? 34.100  -14.825  -52.654  1.00 39.42  ? 217 TYR D CD2 1 
ATOM   4979 C CE1 . TYR D 2 217 ? 36.385  -14.789  -54.183  1.00 37.53  ? 217 TYR D CE1 1 
ATOM   4980 C CE2 . TYR D 2 217 ? 34.022  -14.890  -54.026  1.00 39.13  ? 217 TYR D CE2 1 
ATOM   4981 C CZ  . TYR D 2 217 ? 35.162  -14.875  -54.775  1.00 38.98  ? 217 TYR D CZ  1 
ATOM   4982 O OH  . TYR D 2 217 ? 35.027  -14.961  -56.138  1.00 49.85  ? 217 TYR D OH  1 
ATOM   4983 N N   . ARG D 2 218 ? 36.535  -15.246  -47.577  1.00 39.66  ? 218 ARG D N   1 
ATOM   4984 C CA  . ARG D 2 218 ? 36.301  -15.129  -46.146  1.00 40.90  ? 218 ARG D CA  1 
ATOM   4985 C C   . ARG D 2 218 ? 37.467  -14.335  -45.520  1.00 41.21  ? 218 ARG D C   1 
ATOM   4986 O O   . ARG D 2 218 ? 37.296  -13.596  -44.565  1.00 41.02  ? 218 ARG D O   1 
ATOM   4987 C CB  . ARG D 2 218 ? 36.138  -16.506  -45.567  1.00 42.33  ? 218 ARG D CB  1 
ATOM   4988 C CG  . ARG D 2 218 ? 35.593  -16.537  -44.180  1.00 50.59  ? 218 ARG D CG  1 
ATOM   4989 C CD  . ARG D 2 218 ? 35.838  -17.905  -43.554  1.00 59.21  ? 218 ARG D CD  1 
ATOM   4990 N NE  . ARG D 2 218 ? 35.619  -17.912  -42.098  1.00 58.31  ? 218 ARG D NE  1 
ATOM   4991 C CZ  . ARG D 2 218 ? 35.697  -18.995  -41.333  1.00 58.35  ? 218 ARG D CZ  1 
ATOM   4992 N NH1 . ARG D 2 218 ? 35.998  -20.188  -41.866  1.00 64.65  ? 218 ARG D NH1 1 
ATOM   4993 N NH2 . ARG D 2 218 ? 35.468  -18.892  -40.033  1.00 58.21  ? 218 ARG D NH2 1 
ATOM   4994 N N   . MET D 2 219 ? 38.644  -14.450  -46.117  1.00 39.54  ? 219 MET D N   1 
ATOM   4995 C CA  . MET D 2 219 ? 39.785  -13.643  -45.714  1.00 40.41  ? 219 MET D CA  1 
ATOM   4996 C C   . MET D 2 219 ? 39.681  -12.213  -46.230  1.00 36.41  ? 219 MET D C   1 
ATOM   4997 O O   . MET D 2 219 ? 39.928  -11.304  -45.520  1.00 41.72  ? 219 MET D O   1 
ATOM   4998 C CB  . MET D 2 219 ? 41.074  -14.294  -46.218  1.00 43.60  ? 219 MET D CB  1 
ATOM   4999 C CG  . MET D 2 219 ? 41.354  -15.650  -45.566  1.00 47.80  ? 219 MET D CG  1 
ATOM   5000 S SD  . MET D 2 219 ? 42.795  -16.525  -46.219  1.00 47.56  ? 219 MET D SD  1 
ATOM   5001 C CE  . MET D 2 219 ? 44.047  -15.432  -45.564  1.00 54.21  ? 219 MET D CE  1 
ATOM   5002 N N   . LEU D 2 220 ? 39.300  -12.043  -47.486  1.00 35.84  ? 220 LEU D N   1 
ATOM   5003 C CA  . LEU D 2 220 ? 39.309  -10.766  -48.155  1.00 34.82  ? 220 LEU D CA  1 
ATOM   5004 C C   . LEU D 2 220 ? 38.117  -9.860   -47.777  1.00 34.68  ? 220 LEU D C   1 
ATOM   5005 O O   . LEU D 2 220 ? 38.271  -8.684   -47.655  1.00 34.37  ? 220 LEU D O   1 
ATOM   5006 C CB  . LEU D 2 220 ? 39.371  -11.014  -49.649  1.00 35.42  ? 220 LEU D CB  1 
ATOM   5007 C CG  . LEU D 2 220 ? 39.668  -9.845   -50.578  1.00 39.40  ? 220 LEU D CG  1 
ATOM   5008 C CD1 . LEU D 2 220 ? 41.022  -9.236   -50.293  1.00 40.15  ? 220 LEU D CD1 1 
ATOM   5009 C CD2 . LEU D 2 220 ? 39.558  -10.304  -52.039  1.00 39.69  ? 220 LEU D CD2 1 
ATOM   5010 N N   . PHE D 2 221 ? 36.958  -10.445  -47.544  1.00 36.31  ? 221 PHE D N   1 
ATOM   5011 C CA  . PHE D 2 221 ? 35.721  -9.722   -47.302  1.00 33.99  ? 221 PHE D CA  1 
ATOM   5012 C C   . PHE D 2 221 ? 35.158  -9.948   -45.899  1.00 36.62  ? 221 PHE D C   1 
ATOM   5013 O O   . PHE D 2 221 ? 33.990  -9.649   -45.672  1.00 40.09  ? 221 PHE D O   1 
ATOM   5014 C CB  . PHE D 2 221 ? 34.677  -10.133  -48.354  1.00 32.67  ? 221 PHE D CB  1 
ATOM   5015 C CG  . PHE D 2 221 ? 35.174  -10.012  -49.780  1.00 31.56  ? 221 PHE D CG  1 
ATOM   5016 C CD1 . PHE D 2 221 ? 35.641  -8.795   -50.265  1.00 30.77  ? 221 PHE D CD1 1 
ATOM   5017 C CD2 . PHE D 2 221 ? 35.175  -11.098  -50.615  1.00 30.82  ? 221 PHE D CD2 1 
ATOM   5018 C CE1 . PHE D 2 221 ? 36.110  -8.667   -51.561  1.00 29.95  ? 221 PHE D CE1 1 
ATOM   5019 C CE2 . PHE D 2 221 ? 35.633  -10.981  -51.912  1.00 32.67  ? 221 PHE D CE2 1 
ATOM   5020 C CZ  . PHE D 2 221 ? 36.108  -9.747   -52.383  1.00 30.96  ? 221 PHE D CZ  1 
ATOM   5021 N N   . CYS D 2 222 ? 35.964  -10.442  -44.956  1.00 37.10  ? 222 CYS D N   1 
ATOM   5022 C CA  . CYS D 2 222 ? 35.497  -10.635  -43.568  1.00 40.33  ? 222 CYS D CA  1 
ATOM   5023 C C   . CYS D 2 222 ? 34.981  -9.310   -42.992  1.00 43.47  ? 222 CYS D C   1 
ATOM   5024 O O   . CYS D 2 222 ? 35.472  -8.232   -43.361  1.00 42.99  ? 222 CYS D O   1 
ATOM   5025 C CB  . CYS D 2 222 ? 36.600  -11.192  -42.645  1.00 41.75  ? 222 CYS D CB  1 
ATOM   5026 S SG  . CYS D 2 222 ? 38.235  -10.521  -42.980  1.00 50.92  ? 222 CYS D SG  1 
ATOM   5027 N N   . SER D 2 223 ? 34.010  -9.387   -42.085  1.00 43.17  ? 223 SER D N   1 
ATOM   5028 C CA  . SER D 2 223 ? 33.514  -8.161   -41.415  1.00 45.51  ? 223 SER D CA  1 
ATOM   5029 C C   . SER D 2 223 ? 34.266  -7.900   -40.113  1.00 46.09  ? 223 SER D C   1 
ATOM   5030 O O   . SER D 2 223 ? 34.697  -8.827   -39.440  1.00 46.64  ? 223 SER D O   1 
ATOM   5031 C CB  . SER D 2 223 ? 31.999  -8.228   -41.159  1.00 42.51  ? 223 SER D CB  1 
ATOM   5032 O OG  . SER D 2 223 ? 31.702  -9.312   -40.327  1.00 44.91  ? 223 SER D OG  1 
ATOM   5033 N N   . CYS D 2 224 ? 34.398  -6.628   -39.766  1.00 47.43  ? 224 CYS D N   1 
ATOM   5034 C CA  . CYS D 2 224 ? 35.157  -6.204   -38.593  1.00 46.78  ? 224 CYS D CA  1 
ATOM   5035 C C   . CYS D 2 224 ? 34.411  -5.208   -37.729  1.00 47.44  ? 224 CYS D C   1 
ATOM   5036 O O   . CYS D 2 224 ? 33.625  -4.400   -38.220  1.00 43.83  ? 224 CYS D O   1 
ATOM   5037 C CB  . CYS D 2 224 ? 36.447  -5.547   -39.055  1.00 48.46  ? 224 CYS D CB  1 
ATOM   5038 S SG  . CYS D 2 224 ? 37.600  -6.685   -39.845  1.00 49.46  ? 224 CYS D SG  1 
ATOM   5039 N N   . GLN D 2 225 ? 34.702  -5.260   -36.433  1.00 53.87  ? 225 GLN D N   1 
ATOM   5040 C CA  . GLN D 2 225 ? 34.177  -4.296   -35.458  1.00 56.10  ? 225 GLN D CA  1 
ATOM   5041 C C   . GLN D 2 225 ? 35.234  -3.432   -34.802  1.00 55.47  ? 225 GLN D C   1 
ATOM   5042 O O   . GLN D 2 225 ? 34.882  -2.421   -34.215  1.00 58.77  ? 225 GLN D O   1 
ATOM   5043 C CB  . GLN D 2 225 ? 33.388  -5.028   -34.401  1.00 61.13  ? 225 GLN D CB  1 
ATOM   5044 C CG  . GLN D 2 225 ? 32.056  -5.513   -34.938  1.00 74.18  ? 225 GLN D CG  1 
ATOM   5045 C CD  . GLN D 2 225 ? 31.436  -6.600   -34.076  1.00 89.64  ? 225 GLN D CD  1 
ATOM   5046 O OE1 . GLN D 2 225 ? 32.142  -7.426   -33.483  1.00 95.85  ? 225 GLN D OE1 1 
ATOM   5047 N NE2 . GLN D 2 225 ? 30.105  -6.618   -34.012  1.00 93.69  ? 225 GLN D NE2 1 
ATOM   5048 N N   . ASP D 2 226 ? 36.508  -3.823   -34.909  1.00 55.27  ? 226 ASP D N   1 
ATOM   5049 C CA  . ASP D 2 226 ? 37.632  -3.066   -34.352  1.00 55.74  ? 226 ASP D CA  1 
ATOM   5050 C C   . ASP D 2 226 ? 38.788  -2.963   -35.348  1.00 53.81  ? 226 ASP D C   1 
ATOM   5051 O O   . ASP D 2 226 ? 38.821  -3.646   -36.387  1.00 49.98  ? 226 ASP D O   1 
ATOM   5052 C CB  . ASP D 2 226 ? 38.116  -3.720   -33.057  1.00 59.96  ? 226 ASP D CB  1 
ATOM   5053 C CG  . ASP D 2 226 ? 38.785  -5.066   -33.291  1.00 69.83  ? 226 ASP D CG  1 
ATOM   5054 O OD1 . ASP D 2 226 ? 38.240  -5.898   -34.048  1.00 79.67  ? 226 ASP D OD1 1 
ATOM   5055 O OD2 . ASP D 2 226 ? 39.869  -5.291   -32.719  1.00 83.44  ? 226 ASP D OD2 1 
ATOM   5056 N N   . GLN D 2 227 ? 39.741  -2.112   -34.995  1.00 53.05  ? 227 GLN D N   1 
ATOM   5057 C CA  . GLN D 2 227 ? 40.853  -1.759   -35.867  1.00 53.77  ? 227 GLN D CA  1 
ATOM   5058 C C   . GLN D 2 227 ? 41.837  -2.915   -36.108  1.00 48.23  ? 227 GLN D C   1 
ATOM   5059 O O   . GLN D 2 227 ? 42.412  -3.020   -37.183  1.00 46.78  ? 227 GLN D O   1 
ATOM   5060 C CB  . GLN D 2 227 ? 41.529  -0.467   -35.362  1.00 59.12  ? 227 GLN D CB  1 
ATOM   5061 C CG  . GLN D 2 227 ? 43.046  -0.497   -35.168  1.00 71.49  ? 227 GLN D CG  1 
ATOM   5062 C CD  . GLN D 2 227 ? 43.816  -0.029   -36.379  1.00 75.42  ? 227 GLN D CD  1 
ATOM   5063 O OE1 . GLN D 2 227 ? 43.291  0.731    -37.195  1.00 88.12  ? 227 GLN D OE1 1 
ATOM   5064 N NE2 . GLN D 2 227 ? 45.073  -0.468   -36.500  1.00 70.16  ? 227 GLN D NE2 1 
ATOM   5065 N N   . ALA D 2 228 ? 42.037  -3.777   -35.121  1.00 45.57  ? 228 ALA D N   1 
ATOM   5066 C CA  . ALA D 2 228 ? 42.925  -4.941   -35.300  1.00 45.60  ? 228 ALA D CA  1 
ATOM   5067 C C   . ALA D 2 228 ? 42.412  -5.917   -36.382  1.00 44.38  ? 228 ALA D C   1 
ATOM   5068 O O   . ALA D 2 228 ? 43.192  -6.507   -37.126  1.00 44.64  ? 228 ALA D O   1 
ATOM   5069 C CB  . ALA D 2 228 ? 43.098  -5.699   -33.993  1.00 44.28  ? 228 ALA D CB  1 
ATOM   5070 N N   . CYS D 2 229 ? 41.101  -6.107   -36.408  1.00 42.80  ? 229 CYS D N   1 
ATOM   5071 C CA  . CYS D 2 229 ? 40.459  -6.928   -37.419  1.00 44.24  ? 229 CYS D CA  1 
ATOM   5072 C C   . CYS D 2 229 ? 40.586  -6.253   -38.789  1.00 41.36  ? 229 CYS D C   1 
ATOM   5073 O O   . CYS D 2 229 ? 41.021  -6.874   -39.737  1.00 41.59  ? 229 CYS D O   1 
ATOM   5074 C CB  . CYS D 2 229 ? 39.006  -7.167   -37.062  1.00 42.49  ? 229 CYS D CB  1 
ATOM   5075 S SG  . CYS D 2 229 ? 38.098  -8.124   -38.274  1.00 47.44  ? 229 CYS D SG  1 
ATOM   5076 N N   . ALA D 2 230 ? 40.257  -4.973   -38.857  1.00 37.59  ? 230 ALA D N   1 
ATOM   5077 C CA  . ALA D 2 230 ? 40.339  -4.228   -40.102  1.00 37.45  ? 230 ALA D CA  1 
ATOM   5078 C C   . ALA D 2 230 ? 41.752  -4.131   -40.664  1.00 37.37  ? 230 ALA D C   1 
ATOM   5079 O O   . ALA D 2 230 ? 41.933  -4.217   -41.858  1.00 39.42  ? 230 ALA D O   1 
ATOM   5080 C CB  . ALA D 2 230 ? 39.760  -2.846   -39.926  1.00 34.91  ? 230 ALA D CB  1 
ATOM   5081 N N   . GLU D 2 231 ? 42.740  -3.941   -39.801  1.00 37.51  ? 231 GLU D N   1 
ATOM   5082 C CA  . GLU D 2 231 ? 44.141  -3.975   -40.209  1.00 37.78  ? 231 GLU D CA  1 
ATOM   5083 C C   . GLU D 2 231 ? 44.597  -5.341   -40.785  1.00 37.67  ? 231 GLU D C   1 
ATOM   5084 O O   . GLU D 2 231 ? 45.362  -5.392   -41.757  1.00 37.14  ? 231 GLU D O   1 
ATOM   5085 C CB  . GLU D 2 231 ? 45.021  -3.630   -39.022  1.00 37.45  ? 231 GLU D CB  1 
ATOM   5086 C CG  . GLU D 2 231 ? 46.513  -3.547   -39.313  1.00 39.79  ? 231 GLU D CG  1 
ATOM   5087 C CD  . GLU D 2 231 ? 46.929  -2.615   -40.466  1.00 43.80  ? 231 GLU D CD  1 
ATOM   5088 O OE1 . GLU D 2 231 ? 46.187  -1.706   -40.917  1.00 47.89  ? 231 GLU D OE1 1 
ATOM   5089 O OE2 . GLU D 2 231 ? 48.067  -2.779   -40.940  1.00 47.90  ? 231 GLU D OE2 1 
ATOM   5090 N N   . ARG D 2 232 ? 44.121  -6.428   -40.190  1.00 34.03  ? 232 ARG D N   1 
ATOM   5091 C CA  . ARG D 2 232 ? 44.410  -7.745   -40.695  1.00 34.22  ? 232 ARG D CA  1 
ATOM   5092 C C   . ARG D 2 232 ? 43.779  -7.914   -42.073  1.00 33.19  ? 232 ARG D C   1 
ATOM   5093 O O   . ARG D 2 232 ? 44.438  -8.398   -42.985  1.00 32.91  ? 232 ARG D O   1 
ATOM   5094 C CB  . ARG D 2 232 ? 43.933  -8.815   -39.732  1.00 33.40  ? 232 ARG D CB  1 
ATOM   5095 C CG  . ARG D 2 232 ? 44.011  -10.228  -40.241  1.00 34.88  ? 232 ARG D CG  1 
ATOM   5096 C CD  . ARG D 2 232 ? 43.623  -11.209  -39.133  1.00 37.59  ? 232 ARG D CD  1 
ATOM   5097 N NE  . ARG D 2 232 ? 44.662  -11.383  -38.125  1.00 35.25  ? 232 ARG D NE  1 
ATOM   5098 C CZ  . ARG D 2 232 ? 45.706  -12.188  -38.255  1.00 36.49  ? 232 ARG D CZ  1 
ATOM   5099 N NH1 . ARG D 2 232 ? 46.587  -12.293  -37.264  1.00 38.19  ? 232 ARG D NH1 1 
ATOM   5100 N NH2 . ARG D 2 232 ? 45.884  -12.883  -39.376  1.00 37.53  ? 232 ARG D NH2 1 
ATOM   5101 N N   . ARG D 2 233 ? 42.540  -7.467   -42.233  1.00 32.69  ? 233 ARG D N   1 
ATOM   5102 C CA  . ARG D 2 233 ? 41.854  -7.538   -43.522  1.00 33.24  ? 233 ARG D CA  1 
ATOM   5103 C C   . ARG D 2 233 ? 42.593  -6.732   -44.586  1.00 33.35  ? 233 ARG D C   1 
ATOM   5104 O O   . ARG D 2 233 ? 42.824  -7.202   -45.693  1.00 36.01  ? 233 ARG D O   1 
ATOM   5105 C CB  . ARG D 2 233 ? 40.423  -7.050   -43.364  1.00 34.88  ? 233 ARG D CB  1 
ATOM   5106 C CG  . ARG D 2 233 ? 39.562  -7.147   -44.615  1.00 35.62  ? 233 ARG D CG  1 
ATOM   5107 C CD  . ARG D 2 233 ? 38.171  -6.647   -44.329  1.00 37.91  ? 233 ARG D CD  1 
ATOM   5108 N NE  . ARG D 2 233 ? 38.156  -5.236   -43.953  1.00 40.70  ? 233 ARG D NE  1 
ATOM   5109 C CZ  . ARG D 2 233 ? 37.165  -4.615   -43.305  1.00 40.06  ? 233 ARG D CZ  1 
ATOM   5110 N NH1 . ARG D 2 233 ? 36.051  -5.253   -42.957  1.00 39.19  ? 233 ARG D NH1 1 
ATOM   5111 N NH2 . ARG D 2 233 ? 37.285  -3.322   -43.012  1.00 39.67  ? 233 ARG D NH2 1 
ATOM   5112 N N   . ARG D 2 234 ? 43.014  -5.532   -44.213  1.00 34.93  ? 234 ARG D N   1 
ATOM   5113 C CA  . ARG D 2 234 ? 43.778  -4.652   -45.101  1.00 37.81  ? 234 ARG D CA  1 
ATOM   5114 C C   . ARG D 2 234 ? 45.078  -5.309   -45.558  1.00 38.75  ? 234 ARG D C   1 
ATOM   5115 O O   . ARG D 2 234 ? 45.529  -5.099   -46.688  1.00 40.11  ? 234 ARG D O   1 
ATOM   5116 C CB  . ARG D 2 234 ? 44.078  -3.340   -44.367  1.00 39.60  ? 234 ARG D CB  1 
ATOM   5117 C CG  . ARG D 2 234 ? 44.366  -2.126   -45.235  1.00 41.95  ? 234 ARG D CG  1 
ATOM   5118 C CD  . ARG D 2 234 ? 45.127  -1.030   -44.457  1.00 45.00  ? 234 ARG D CD  1 
ATOM   5119 N NE  . ARG D 2 234 ? 46.453  -0.940   -45.057  1.00 53.07  ? 234 ARG D NE  1 
ATOM   5120 C CZ  . ARG D 2 234 ? 47.615  -1.161   -44.471  1.00 53.95  ? 234 ARG D CZ  1 
ATOM   5121 N NH1 . ARG D 2 234 ? 47.705  -1.410   -43.186  1.00 59.88  ? 234 ARG D NH1 1 
ATOM   5122 N NH2 . ARG D 2 234 ? 48.708  -1.085   -45.201  1.00 66.17  ? 234 ARG D NH2 1 
ATOM   5123 N N   . GLN D 2 235 ? 45.676  -6.105   -44.665  1.00 38.67  ? 235 GLN D N   1 
ATOM   5124 C CA  . GLN D 2 235 ? 46.959  -6.781   -44.921  1.00 37.10  ? 235 GLN D CA  1 
ATOM   5125 C C   . GLN D 2 235 ? 46.885  -8.057   -45.723  1.00 33.99  ? 235 GLN D C   1 
ATOM   5126 O O   . GLN D 2 235 ? 47.907  -8.561   -46.123  1.00 39.28  ? 235 GLN D O   1 
ATOM   5127 C CB  . GLN D 2 235 ? 47.652  -7.096   -43.600  1.00 39.68  ? 235 GLN D CB  1 
ATOM   5128 C CG  . GLN D 2 235 ? 48.198  -5.873   -42.889  1.00 43.79  ? 235 GLN D CG  1 
ATOM   5129 C CD  . GLN D 2 235 ? 49.576  -5.468   -43.383  1.00 46.42  ? 235 GLN D CD  1 
ATOM   5130 O OE1 . GLN D 2 235 ? 49.851  -5.474   -44.566  1.00 39.83  ? 235 GLN D OE1 1 
ATOM   5131 N NE2 . GLN D 2 235 ? 50.462  -5.151   -42.446  1.00 55.20  ? 235 GLN D NE2 1 
ATOM   5132 N N   . THR D 2 236 ? 45.697  -8.584   -45.979  1.00 33.89  ? 236 THR D N   1 
ATOM   5133 C CA  . THR D 2 236 ? 45.563  -9.846   -46.703  1.00 34.98  ? 236 THR D CA  1 
ATOM   5134 C C   . THR D 2 236 ? 46.464  -9.932   -47.939  1.00 35.83  ? 236 THR D C   1 
ATOM   5135 O O   . THR D 2 236 ? 47.175  -10.923  -48.120  1.00 37.04  ? 236 THR D O   1 
ATOM   5136 C CB  . THR D 2 236 ? 44.116  -10.067  -47.144  1.00 35.76  ? 236 THR D CB  1 
ATOM   5137 O OG1 . THR D 2 236 ? 43.262  -9.973   -45.998  1.00 38.22  ? 236 THR D OG1 1 
ATOM   5138 C CG2 . THR D 2 236 ? 43.973  -11.432  -47.766  1.00 36.81  ? 236 THR D CG2 1 
ATOM   5139 N N   . ILE D 2 237 ? 46.447  -8.892   -48.772  1.00 35.24  ? 237 ILE D N   1 
ATOM   5140 C CA  . ILE D 2 237 ? 47.217  -8.905   -50.026  1.00 36.22  ? 237 ILE D CA  1 
ATOM   5141 C C   . ILE D 2 237 ? 48.649  -8.423   -49.851  1.00 34.79  ? 237 ILE D C   1 
ATOM   5142 O O   . ILE D 2 237 ? 49.383  -8.292   -50.824  1.00 34.54  ? 237 ILE D O   1 
ATOM   5143 C CB  . ILE D 2 237 ? 46.516  -8.126   -51.168  1.00 37.19  ? 237 ILE D CB  1 
ATOM   5144 C CG1 . ILE D 2 237 ? 46.398  -6.629   -50.855  1.00 37.60  ? 237 ILE D CG1 1 
ATOM   5145 C CG2 . ILE D 2 237 ? 45.156  -8.737   -51.427  1.00 37.33  ? 237 ILE D CG2 1 
ATOM   5146 C CD1 . ILE D 2 237 ? 46.052  -5.814   -52.069  1.00 38.71  ? 237 ILE D CD1 1 
ATOM   5147 N N   . LEU D 2 238 ? 49.036  -8.162   -48.601  1.00 37.55  ? 238 LEU D N   1 
ATOM   5148 C CA  . LEU D 2 238 ? 50.332  -7.613   -48.275  1.00 38.97  ? 238 LEU D CA  1 
ATOM   5149 C C   . LEU D 2 238 ? 50.569  -6.330   -49.129  1.00 41.21  ? 238 LEU D C   1 
ATOM   5150 O O   . LEU D 2 238 ? 51.481  -6.254   -49.966  1.00 38.94  ? 238 LEU D O   1 
ATOM   5151 C CB  . LEU D 2 238 ? 51.379  -8.712   -48.456  1.00 42.93  ? 238 LEU D CB  1 
ATOM   5152 C CG  . LEU D 2 238 ? 52.504  -8.638   -47.426  1.00 47.81  ? 238 LEU D CG  1 
ATOM   5153 C CD1 . LEU D 2 238 ? 53.214  -9.967   -47.259  1.00 49.95  ? 238 LEU D CD1 1 
ATOM   5154 C CD2 . LEU D 2 238 ? 53.491  -7.557   -47.820  1.00 53.63  ? 238 LEU D CD2 1 
ATOM   5155 N N   . PRO D 2 239 ? 49.701  -5.313   -48.936  1.00 39.15  ? 239 PRO D N   1 
ATOM   5156 C CA  . PRO D 2 239 ? 49.666  -4.101   -49.769  1.00 40.79  ? 239 PRO D CA  1 
ATOM   5157 C C   . PRO D 2 239 ? 50.970  -3.311   -49.863  1.00 41.36  ? 239 PRO D C   1 
ATOM   5158 O O   . PRO D 2 239 ? 51.214  -2.641   -50.858  1.00 38.42  ? 239 PRO D O   1 
ATOM   5159 C CB  . PRO D 2 239 ? 48.612  -3.236   -49.071  1.00 39.21  ? 239 PRO D CB  1 
ATOM   5160 C CG  . PRO D 2 239 ? 48.566  -3.747   -47.670  1.00 40.28  ? 239 PRO D CG  1 
ATOM   5161 C CD  . PRO D 2 239 ? 48.708  -5.226   -47.858  1.00 38.82  ? 239 PRO D CD  1 
ATOM   5162 N N   . SER D 2 240 ? 51.784  -3.391   -48.828  1.00 44.27  ? 240 SER D N   1 
ATOM   5163 C CA  . SER D 2 240 ? 53.080  -2.749   -48.823  1.00 49.49  ? 240 SER D CA  1 
ATOM   5164 C C   . SER D 2 240 ? 53.904  -3.126   -50.049  1.00 47.28  ? 240 SER D C   1 
ATOM   5165 O O   . SER D 2 240 ? 54.700  -2.332   -50.527  1.00 49.82  ? 240 SER D O   1 
ATOM   5166 C CB  . SER D 2 240 ? 53.845  -3.134   -47.564  1.00 50.79  ? 240 SER D CB  1 
ATOM   5167 O OG  . SER D 2 240 ? 54.882  -2.228   -47.397  1.00 64.96  ? 240 SER D OG  1 
ATOM   5168 N N   . CYS D 2 241 ? 53.689  -4.342   -50.540  1.00 46.74  ? 241 CYS D N   1 
ATOM   5169 C CA  . CYS D 2 241 ? 54.356  -4.857   -51.718  1.00 47.20  ? 241 CYS D CA  1 
ATOM   5170 C C   . CYS D 2 241 ? 53.501  -4.800   -52.969  1.00 42.85  ? 241 CYS D C   1 
ATOM   5171 O O   . CYS D 2 241 ? 53.978  -4.425   -54.044  1.00 48.22  ? 241 CYS D O   1 
ATOM   5172 C CB  . CYS D 2 241 ? 54.736  -6.314   -51.456  1.00 50.48  ? 241 CYS D CB  1 
ATOM   5173 S SG  . CYS D 2 241 ? 55.368  -7.189   -52.916  1.00 59.97  ? 241 CYS D SG  1 
ATOM   5174 N N   . SER D 2 242 ? 52.254  -5.226   -52.844  1.00 40.58  ? 242 SER D N   1 
ATOM   5175 C CA  . SER D 2 242 ? 51.399  -5.483   -54.006  1.00 39.46  ? 242 SER D CA  1 
ATOM   5176 C C   . SER D 2 242 ? 50.555  -4.295   -54.457  1.00 37.00  ? 242 SER D C   1 
ATOM   5177 O O   . SER D 2 242 ? 50.055  -4.277   -55.579  1.00 35.34  ? 242 SER D O   1 
ATOM   5178 C CB  . SER D 2 242 ? 50.459  -6.658   -53.695  1.00 41.03  ? 242 SER D CB  1 
ATOM   5179 O OG  . SER D 2 242 ? 49.554  -6.321   -52.646  1.00 45.24  ? 242 SER D OG  1 
ATOM   5180 N N   . TYR D 2 243 ? 50.378  -3.317   -53.581  1.00 38.46  ? 243 TYR D N   1 
ATOM   5181 C CA  . TYR D 2 243 ? 49.407  -2.237   -53.799  1.00 37.49  ? 243 TYR D CA  1 
ATOM   5182 C C   . TYR D 2 243 ? 50.071  -0.861   -53.766  1.00 38.93  ? 243 TYR D C   1 
ATOM   5183 O O   . TYR D 2 243 ? 49.967  -0.125   -54.707  1.00 39.76  ? 243 TYR D O   1 
ATOM   5184 C CB  . TYR D 2 243 ? 48.369  -2.337   -52.709  1.00 36.02  ? 243 TYR D CB  1 
ATOM   5185 C CG  . TYR D 2 243 ? 47.283  -1.314   -52.703  1.00 35.95  ? 243 TYR D CG  1 
ATOM   5186 C CD1 . TYR D 2 243 ? 46.397  -1.208   -53.771  1.00 38.22  ? 243 TYR D CD1 1 
ATOM   5187 C CD2 . TYR D 2 243 ? 47.097  -0.492   -51.608  1.00 34.34  ? 243 TYR D CD2 1 
ATOM   5188 C CE1 . TYR D 2 243 ? 45.372  -0.288   -53.751  1.00 39.10  ? 243 TYR D CE1 1 
ATOM   5189 C CE2 . TYR D 2 243 ? 46.072  0.429    -51.573  1.00 36.03  ? 243 TYR D CE2 1 
ATOM   5190 C CZ  . TYR D 2 243 ? 45.207  0.532    -52.642  1.00 38.13  ? 243 TYR D CZ  1 
ATOM   5191 O OH  . TYR D 2 243 ? 44.146  1.432    -52.592  1.00 41.81  ? 243 TYR D OH  1 
ATOM   5192 N N   . GLU D 2 244 ? 50.727  -0.539   -52.656  1.00 41.11  ? 244 GLU D N   1 
ATOM   5193 C CA  . GLU D 2 244 ? 51.378  0.752    -52.450  1.00 45.58  ? 244 GLU D CA  1 
ATOM   5194 C C   . GLU D 2 244 ? 52.593  0.918    -53.337  1.00 48.20  ? 244 GLU D C   1 
ATOM   5195 O O   . GLU D 2 244 ? 53.217  -0.055   -53.726  1.00 55.42  ? 244 GLU D O   1 
ATOM   5196 C CB  . GLU D 2 244 ? 51.803  0.898    -51.000  1.00 44.24  ? 244 GLU D CB  1 
ATOM   5197 C CG  . GLU D 2 244 ? 50.647  1.149    -50.078  1.00 50.38  ? 244 GLU D CG  1 
ATOM   5198 C CD  . GLU D 2 244 ? 51.035  1.227    -48.622  1.00 56.88  ? 244 GLU D CD  1 
ATOM   5199 O OE1 . GLU D 2 244 ? 52.241  1.392    -48.324  1.00 68.45  ? 244 GLU D OE1 1 
ATOM   5200 O OE2 . GLU D 2 244 ? 50.130  1.115    -47.771  1.00 59.08  ? 244 GLU D OE2 1 
ATOM   5201 N N   . ASP D 2 245 ? 52.914  2.157    -53.664  1.00 55.96  ? 245 ASP D N   1 
ATOM   5202 C CA  . ASP D 2 245 ? 54.068  2.457    -54.519  1.00 64.63  ? 245 ASP D CA  1 
ATOM   5203 C C   . ASP D 2 245 ? 54.522  3.872    -54.234  1.00 63.92  ? 245 ASP D C   1 
ATOM   5204 O O   . ASP D 2 245 ? 53.750  4.663    -53.727  1.00 57.73  ? 245 ASP D O   1 
ATOM   5205 C CB  . ASP D 2 245 ? 53.721  2.280    -55.999  1.00 70.25  ? 245 ASP D CB  1 
ATOM   5206 C CG  . ASP D 2 245 ? 54.955  2.131    -56.878  1.00 78.60  ? 245 ASP D CG  1 
ATOM   5207 O OD1 . ASP D 2 245 ? 55.843  3.008    -56.811  1.00 85.16  ? 245 ASP D OD1 1 
ATOM   5208 O OD2 . ASP D 2 245 ? 55.037  1.138    -57.636  1.00 84.27  ? 245 ASP D OD2 1 
ATOM   5209 N N   . LYS D 2 246 ? 55.783  4.166    -54.554  1.00 78.59  ? 246 LYS D N   1 
ATOM   5210 C CA  . LYS D 2 246 ? 56.393  5.500    -54.327  1.00 84.71  ? 246 LYS D CA  1 
ATOM   5211 C C   . LYS D 2 246 ? 55.546  6.596    -54.973  1.00 78.19  ? 246 LYS D C   1 
ATOM   5212 O O   . LYS D 2 246 ? 55.270  7.621    -54.347  1.00 68.86  ? 246 LYS D O   1 
ATOM   5213 C CB  . LYS D 2 246 ? 57.840  5.555    -54.861  1.00 93.72  ? 246 LYS D CB  1 
ATOM   5214 C CG  . LYS D 2 246 ? 58.761  4.478    -54.277  1.00 107.50 ? 246 LYS D CG  1 
ATOM   5215 C CD  . LYS D 2 246 ? 60.242  4.720    -54.559  1.00 112.58 ? 246 LYS D CD  1 
ATOM   5216 C CE  . LYS D 2 246 ? 61.131  3.688    -53.864  1.00 110.79 ? 246 LYS D CE  1 
ATOM   5217 N NZ  . LYS D 2 246 ? 61.171  2.379    -54.577  1.00 110.21 ? 246 LYS D NZ  1 
ATOM   5218 N N   . GLU D 2 247 ? 55.094  6.324    -56.199  1.00 72.16  ? 247 GLU D N   1 
ATOM   5219 C CA  . GLU D 2 247 ? 54.219  7.223    -56.946  1.00 75.55  ? 247 GLU D CA  1 
ATOM   5220 C C   . GLU D 2 247 ? 52.767  6.725    -56.952  1.00 65.35  ? 247 GLU D C   1 
ATOM   5221 O O   . GLU D 2 247 ? 52.494  5.544    -57.161  1.00 64.07  ? 247 GLU D O   1 
ATOM   5222 C CB  . GLU D 2 247 ? 54.705  7.376    -58.395  1.00 89.48  ? 247 GLU D CB  1 
ATOM   5223 C CG  . GLU D 2 247 ? 56.214  7.185    -58.588  1.00 100.55 ? 247 GLU D CG  1 
ATOM   5224 C CD  . GLU D 2 247 ? 56.807  7.942    -59.769  1.00 105.91 ? 247 GLU D CD  1 
ATOM   5225 O OE1 . GLU D 2 247 ? 56.062  8.505    -60.607  1.00 106.82 ? 247 GLU D OE1 1 
ATOM   5226 O OE2 . GLU D 2 247 ? 58.053  7.974    -59.849  1.00 106.89 ? 247 GLU D OE2 1 
ATOM   5227 N N   . LYS D 2 248 ? 51.848  7.649    -56.723  1.00 58.12  ? 248 LYS D N   1 
ATOM   5228 C CA  . LYS D 2 248 ? 50.426  7.432    -56.924  1.00 57.13  ? 248 LYS D CA  1 
ATOM   5229 C C   . LYS D 2 248 ? 49.983  8.054    -58.254  1.00 56.96  ? 248 LYS D C   1 
ATOM   5230 O O   . LYS D 2 248 ? 49.840  9.268    -58.344  1.00 58.06  ? 248 LYS D O   1 
ATOM   5231 C CB  . LYS D 2 248 ? 49.659  8.044    -55.759  1.00 55.64  ? 248 LYS D CB  1 
ATOM   5232 C CG  . LYS D 2 248 ? 48.249  7.502    -55.571  1.00 52.27  ? 248 LYS D CG  1 
ATOM   5233 C CD  . LYS D 2 248 ? 47.802  7.751    -54.141  1.00 54.31  ? 248 LYS D CD  1 
ATOM   5234 C CE  . LYS D 2 248 ? 46.596  6.918    -53.780  1.00 58.51  ? 248 LYS D CE  1 
ATOM   5235 N NZ  . LYS D 2 248 ? 46.228  7.163    -52.372  1.00 60.40  ? 248 LYS D NZ  1 
ATOM   5236 N N   . PRO D 2 249 ? 49.768  7.234    -59.299  1.00 56.71  ? 249 PRO D N   1 
ATOM   5237 C CA  . PRO D 2 249 ? 49.424  7.833    -60.578  1.00 54.47  ? 249 PRO D CA  1 
ATOM   5238 C C   . PRO D 2 249 ? 48.005  8.399    -60.628  1.00 59.17  ? 249 PRO D C   1 
ATOM   5239 O O   . PRO D 2 249 ? 47.213  8.277    -59.673  1.00 61.39  ? 249 PRO D O   1 
ATOM   5240 C CB  . PRO D 2 249 ? 49.586  6.674    -61.558  1.00 57.48  ? 249 PRO D CB  1 
ATOM   5241 C CG  . PRO D 2 249 ? 49.326  5.452    -60.741  1.00 59.12  ? 249 PRO D CG  1 
ATOM   5242 C CD  . PRO D 2 249 ? 49.801  5.765    -59.361  1.00 58.99  ? 249 PRO D CD  1 
ATOM   5243 N N   . ASN D 2 250 ? 47.704  9.048    -61.740  1.00 60.50  ? 250 ASN D N   1 
ATOM   5244 C CA  . ASN D 2 250 ? 46.353  9.522    -62.014  1.00 60.13  ? 250 ASN D CA  1 
ATOM   5245 C C   . ASN D 2 250 ? 45.574  8.308    -62.507  1.00 56.13  ? 250 ASN D C   1 
ATOM   5246 O O   . ASN D 2 250 ? 46.109  7.500    -63.278  1.00 56.89  ? 250 ASN D O   1 
ATOM   5247 C CB  . ASN D 2 250 ? 46.394  10.643   -63.063  1.00 62.55  ? 250 ASN D CB  1 
ATOM   5248 C CG  . ASN D 2 250 ? 45.012  11.051   -63.567  1.00 60.28  ? 250 ASN D CG  1 
ATOM   5249 O OD1 . ASN D 2 250 ? 44.533  10.515   -64.566  1.00 57.84  ? 250 ASN D OD1 1 
ATOM   5250 N ND2 . ASN D 2 250 ? 44.377  12.007   -62.889  1.00 60.66  ? 250 ASN D ND2 1 
ATOM   5251 N N   . CYS D 2 251 ? 44.326  8.175    -62.073  1.00 51.34  ? 251 CYS D N   1 
ATOM   5252 C CA  . CYS D 2 251 ? 43.534  6.963    -62.390  1.00 54.43  ? 251 CYS D CA  1 
ATOM   5253 C C   . CYS D 2 251 ? 43.397  6.642    -63.874  1.00 50.30  ? 251 CYS D C   1 
ATOM   5254 O O   . CYS D 2 251 ? 43.468  5.473    -64.251  1.00 52.42  ? 251 CYS D O   1 
ATOM   5255 C CB  . CYS D 2 251 ? 42.159  7.003    -61.728  1.00 53.64  ? 251 CYS D CB  1 
ATOM   5256 S SG  . CYS D 2 251 ? 42.257  7.072    -59.925  1.00 65.33  ? 251 CYS D SG  1 
ATOM   5257 N N   . LEU D 2 252 ? 43.237  7.657    -64.716  1.00 52.63  ? 252 LEU D N   1 
ATOM   5258 C CA  . LEU D 2 252 ? 43.176  7.438    -66.173  1.00 53.27  ? 252 LEU D CA  1 
ATOM   5259 C C   . LEU D 2 252 ? 44.487  6.978    -66.783  1.00 53.91  ? 252 LEU D C   1 
ATOM   5260 O O   . LEU D 2 252 ? 44.490  6.154    -67.694  1.00 56.16  ? 252 LEU D O   1 
ATOM   5261 C CB  . LEU D 2 252 ? 42.644  8.670    -66.873  1.00 59.31  ? 252 LEU D CB  1 
ATOM   5262 C CG  . LEU D 2 252 ? 41.220  9.056    -66.454  1.00 62.65  ? 252 LEU D CG  1 
ATOM   5263 C CD1 . LEU D 2 252 ? 40.707  10.088   -67.427  1.00 65.72  ? 252 LEU D CD1 1 
ATOM   5264 C CD2 . LEU D 2 252 ? 40.253  7.882    -66.421  1.00 62.67  ? 252 LEU D CD2 1 
ATOM   5265 N N   . ASP D 2 253 ? 45.604  7.460    -66.250  1.00 58.08  ? 253 ASP D N   1 
ATOM   5266 C CA  . ASP D 2 253 ? 46.914  6.971    -66.679  1.00 60.00  ? 253 ASP D CA  1 
ATOM   5267 C C   . ASP D 2 253 ? 47.050  5.514    -66.312  1.00 59.42  ? 253 ASP D C   1 
ATOM   5268 O O   . ASP D 2 253 ? 47.450  4.700    -67.159  1.00 59.35  ? 253 ASP D O   1 
ATOM   5269 C CB  . ASP D 2 253 ? 48.069  7.784    -66.062  1.00 68.18  ? 253 ASP D CB  1 
ATOM   5270 C CG  . ASP D 2 253 ? 48.114  9.245    -66.560  1.00 71.47  ? 253 ASP D CG  1 
ATOM   5271 O OD1 . ASP D 2 253 ? 47.735  9.529    -67.720  1.00 69.11  ? 253 ASP D OD1 1 
ATOM   5272 O OD2 . ASP D 2 253 ? 48.540  10.116   -65.778  1.00 78.52  ? 253 ASP D OD2 1 
ATOM   5273 N N   . LEU D 2 254 ? 46.692  5.184    -65.062  1.00 56.25  ? 254 LEU D N   1 
ATOM   5274 C CA  . LEU D 2 254 ? 46.724  3.797    -64.604  1.00 52.53  ? 254 LEU D CA  1 
ATOM   5275 C C   . LEU D 2 254 ? 45.823  2.891    -65.451  1.00 48.92  ? 254 LEU D C   1 
ATOM   5276 O O   . LEU D 2 254 ? 46.216  1.788    -65.822  1.00 45.91  ? 254 LEU D O   1 
ATOM   5277 C CB  . LEU D 2 254 ? 46.331  3.691    -63.128  1.00 56.01  ? 254 LEU D CB  1 
ATOM   5278 C CG  . LEU D 2 254 ? 46.474  2.274    -62.513  1.00 53.66  ? 254 LEU D CG  1 
ATOM   5279 C CD1 . LEU D 2 254 ? 47.860  1.670    -62.740  1.00 51.27  ? 254 LEU D CD1 1 
ATOM   5280 C CD2 . LEU D 2 254 ? 46.185  2.315    -61.030  1.00 52.11  ? 254 LEU D CD2 1 
ATOM   5281 N N   . ARG D 2 255 ? 44.635  3.386    -65.785  1.00 47.99  ? 255 ARG D N   1 
ATOM   5282 C CA  . ARG D 2 255 ? 43.742  2.676    -66.688  1.00 49.33  ? 255 ARG D CA  1 
ATOM   5283 C C   . ARG D 2 255 ? 44.409  2.419    -68.015  1.00 55.59  ? 255 ARG D C   1 
ATOM   5284 O O   . ARG D 2 255 ? 44.306  1.309    -68.549  1.00 51.30  ? 255 ARG D O   1 
ATOM   5285 C CB  . ARG D 2 255 ? 42.438  3.435    -66.905  1.00 49.83  ? 255 ARG D CB  1 
ATOM   5286 C CG  . ARG D 2 255 ? 41.415  2.628    -67.696  1.00 52.27  ? 255 ARG D CG  1 
ATOM   5287 C CD  . ARG D 2 255 ? 40.140  3.412    -67.955  1.00 55.80  ? 255 ARG D CD  1 
ATOM   5288 N NE  . ARG D 2 255 ? 40.354  4.480    -68.930  1.00 63.09  ? 255 ARG D NE  1 
ATOM   5289 C CZ  . ARG D 2 255 ? 39.481  5.442    -69.236  1.00 67.33  ? 255 ARG D CZ  1 
ATOM   5290 N NH1 . ARG D 2 255 ? 38.275  5.500    -68.668  1.00 71.96  ? 255 ARG D NH1 1 
ATOM   5291 N NH2 . ARG D 2 255 ? 39.824  6.364    -70.128  1.00 70.11  ? 255 ARG D NH2 1 
ATOM   5292 N N   . GLY D 2 256 ? 45.082  3.451    -68.545  1.00 60.31  ? 256 GLY D N   1 
ATOM   5293 C CA  . GLY D 2 256 ? 45.807  3.337    -69.815  1.00 56.76  ? 256 GLY D CA  1 
ATOM   5294 C C   . GLY D 2 256 ? 46.806  2.200    -69.779  1.00 55.87  ? 256 GLY D C   1 
ATOM   5295 O O   . GLY D 2 256 ? 46.817  1.358    -70.663  1.00 58.37  ? 256 GLY D O   1 
ATOM   5296 N N   . VAL D 2 257 ? 47.608  2.156    -68.717  1.00 54.54  ? 257 VAL D N   1 
ATOM   5297 C CA  . VAL D 2 257 ? 48.620  1.115    -68.558  1.00 55.97  ? 257 VAL D CA  1 
ATOM   5298 C C   . VAL D 2 257 ? 47.950  -0.254   -68.445  1.00 57.02  ? 257 VAL D C   1 
ATOM   5299 O O   . VAL D 2 257 ? 48.385  -1.222   -69.080  1.00 54.41  ? 257 VAL D O   1 
ATOM   5300 C CB  . VAL D 2 257 ? 49.526  1.372    -67.321  1.00 59.18  ? 257 VAL D CB  1 
ATOM   5301 C CG1 . VAL D 2 257 ? 50.462  0.192    -67.062  1.00 58.70  ? 257 VAL D CG1 1 
ATOM   5302 C CG2 . VAL D 2 257 ? 50.331  2.663    -67.483  1.00 57.06  ? 257 VAL D CG2 1 
ATOM   5303 N N   . CYS D 2 258 ? 46.896  -0.323   -67.629  1.00 57.39  ? 258 CYS D N   1 
ATOM   5304 C CA  . CYS D 2 258 ? 46.148  -1.574   -67.444  1.00 58.47  ? 258 CYS D CA  1 
ATOM   5305 C C   . CYS D 2 258 ? 45.629  -2.104   -68.780  1.00 51.74  ? 258 CYS D C   1 
ATOM   5306 O O   . CYS D 2 258 ? 45.749  -3.299   -69.054  1.00 55.01  ? 258 CYS D O   1 
ATOM   5307 C CB  . CYS D 2 258 ? 44.968  -1.391   -66.453  1.00 57.99  ? 258 CYS D CB  1 
ATOM   5308 S SG  . CYS D 2 258 ? 43.886  -2.846   -66.258  1.00 59.43  ? 258 CYS D SG  1 
ATOM   5309 N N   . ARG D 2 259 ? 45.070  -1.221   -69.605  1.00 50.05  ? 259 ARG D N   1 
ATOM   5310 C CA  . ARG D 2 259 ? 44.510  -1.645   -70.910  1.00 58.78  ? 259 ARG D CA  1 
ATOM   5311 C C   . ARG D 2 259 ? 45.551  -2.115   -71.971  1.00 59.33  ? 259 ARG D C   1 
ATOM   5312 O O   . ARG D 2 259 ? 45.174  -2.758   -72.939  1.00 63.83  ? 259 ARG D O   1 
ATOM   5313 C CB  . ARG D 2 259 ? 43.516  -0.611   -71.469  1.00 59.21  ? 259 ARG D CB  1 
ATOM   5314 C CG  . ARG D 2 259 ? 42.410  -0.247   -70.465  1.00 62.91  ? 259 ARG D CG  1 
ATOM   5315 C CD  . ARG D 2 259 ? 40.978  -0.307   -70.972  1.00 62.37  ? 259 ARG D CD  1 
ATOM   5316 N NE  . ARG D 2 259 ? 40.413  1.024    -71.149  1.00 67.95  ? 259 ARG D NE  1 
ATOM   5317 C CZ  . ARG D 2 259 ? 39.154  1.396    -70.891  1.00 70.33  ? 259 ARG D CZ  1 
ATOM   5318 N NH1 . ARG D 2 259 ? 38.238  0.557    -70.403  1.00 66.09  ? 259 ARG D NH1 1 
ATOM   5319 N NH2 . ARG D 2 259 ? 38.811  2.660    -71.116  1.00 76.16  ? 259 ARG D NH2 1 
ATOM   5320 N N   . THR D 2 260 ? 46.843  -1.844   -71.760  1.00 59.61  ? 260 THR D N   1 
ATOM   5321 C CA  . THR D 2 260 ? 47.911  -2.395   -72.626  1.00 61.45  ? 260 THR D CA  1 
ATOM   5322 C C   . THR D 2 260 ? 48.233  -3.859   -72.294  1.00 61.05  ? 260 THR D C   1 
ATOM   5323 O O   . THR D 2 260 ? 48.819  -4.566   -73.110  1.00 60.46  ? 260 THR D O   1 
ATOM   5324 C CB  . THR D 2 260 ? 49.229  -1.568   -72.588  1.00 60.69  ? 260 THR D CB  1 
ATOM   5325 O OG1 . THR D 2 260 ? 49.912  -1.787   -71.346  1.00 67.29  ? 260 THR D OG1 1 
ATOM   5326 C CG2 . THR D 2 260 ? 48.964  -0.050   -72.783  1.00 61.08  ? 260 THR D CG2 1 
ATOM   5327 N N   . ASP D 2 261 ? 47.875  -4.308   -71.097  1.00 57.47  ? 261 ASP D N   1 
ATOM   5328 C CA  . ASP D 2 261 ? 48.070  -5.716   -70.717  1.00 56.18  ? 261 ASP D CA  1 
ATOM   5329 C C   . ASP D 2 261 ? 46.790  -6.515   -70.957  1.00 54.54  ? 261 ASP D C   1 
ATOM   5330 O O   . ASP D 2 261 ? 45.728  -6.086   -70.549  1.00 61.73  ? 261 ASP D O   1 
ATOM   5331 C CB  . ASP D 2 261 ? 48.470  -5.799   -69.254  1.00 57.92  ? 261 ASP D CB  1 
ATOM   5332 C CG  . ASP D 2 261 ? 48.723  -7.207   -68.813  1.00 61.82  ? 261 ASP D CG  1 
ATOM   5333 O OD1 . ASP D 2 261 ? 49.834  -7.701   -69.063  1.00 70.86  ? 261 ASP D OD1 1 
ATOM   5334 O OD2 . ASP D 2 261 ? 47.816  -7.834   -68.231  1.00 65.93  ? 261 ASP D OD2 1 
ATOM   5335 N N   . HIS D 2 262 ? 46.890  -7.673   -71.601  1.00 53.64  ? 262 HIS D N   1 
ATOM   5336 C CA  . HIS D 2 262 ? 45.713  -8.442   -71.990  1.00 56.66  ? 262 HIS D CA  1 
ATOM   5337 C C   . HIS D 2 262 ? 44.889  -8.907   -70.796  1.00 56.35  ? 262 HIS D C   1 
ATOM   5338 O O   . HIS D 2 262 ? 43.665  -8.873   -70.826  1.00 53.23  ? 262 HIS D O   1 
ATOM   5339 C CB  . HIS D 2 262 ? 46.104  -9.642   -72.854  1.00 59.99  ? 262 HIS D CB  1 
ATOM   5340 C CG  . HIS D 2 262 ? 46.553  -9.258   -74.235  1.00 70.06  ? 262 HIS D CG  1 
ATOM   5341 N ND1 . HIS D 2 262 ? 45.709  -8.686   -75.165  1.00 71.34  ? 262 HIS D ND1 1 
ATOM   5342 C CD2 . HIS D 2 262 ? 47.765  -9.342   -74.830  1.00 70.35  ? 262 HIS D CD2 1 
ATOM   5343 C CE1 . HIS D 2 262 ? 46.381  -8.442   -76.275  1.00 72.40  ? 262 HIS D CE1 1 
ATOM   5344 N NE2 . HIS D 2 262 ? 47.629  -8.833   -76.098  1.00 72.47  ? 262 HIS D NE2 1 
ATOM   5345 N N   . LEU D 2 263 ? 45.577  -9.327   -69.745  1.00 57.11  ? 263 LEU D N   1 
ATOM   5346 C CA  . LEU D 2 263 ? 44.923  -9.876   -68.571  1.00 53.63  ? 263 LEU D CA  1 
ATOM   5347 C C   . LEU D 2 263 ? 44.237  -8.769   -67.788  1.00 50.30  ? 263 LEU D C   1 
ATOM   5348 O O   . LEU D 2 263 ? 43.031  -8.822   -67.549  1.00 47.10  ? 263 LEU D O   1 
ATOM   5349 C CB  . LEU D 2 263 ? 45.915  -10.630  -67.698  1.00 55.62  ? 263 LEU D CB  1 
ATOM   5350 C CG  . LEU D 2 263 ? 45.916  -12.129  -67.947  1.00 60.18  ? 263 LEU D CG  1 
ATOM   5351 C CD1 . LEU D 2 263 ? 47.223  -12.726  -67.459  1.00 67.77  ? 263 LEU D CD1 1 
ATOM   5352 C CD2 . LEU D 2 263 ? 44.716  -12.787  -67.271  1.00 59.65  ? 263 LEU D CD2 1 
ATOM   5353 N N   . CYS D 2 264 ? 45.003  -7.751   -67.437  1.00 47.88  ? 264 CYS D N   1 
ATOM   5354 C CA  . CYS D 2 264 ? 44.486  -6.626   -66.659  1.00 49.73  ? 264 CYS D CA  1 
ATOM   5355 C C   . CYS D 2 264 ? 43.273  -5.999   -67.326  1.00 50.87  ? 264 CYS D C   1 
ATOM   5356 O O   . CYS D 2 264 ? 42.249  -5.775   -66.698  1.00 53.36  ? 264 CYS D O   1 
ATOM   5357 C CB  . CYS D 2 264 ? 45.566  -5.563   -66.447  1.00 49.80  ? 264 CYS D CB  1 
ATOM   5358 S SG  . CYS D 2 264 ? 45.160  -4.249   -65.245  1.00 55.78  ? 264 CYS D SG  1 
ATOM   5359 N N   . ARG D 2 265 ? 43.411  -5.721   -68.612  1.00 56.07  ? 265 ARG D N   1 
ATOM   5360 C CA  . ARG D 2 265 ? 42.341  -5.150   -69.421  1.00 54.04  ? 265 ARG D CA  1 
ATOM   5361 C C   . ARG D 2 265 ? 41.032  -5.942   -69.329  1.00 49.84  ? 265 ARG D C   1 
ATOM   5362 O O   . ARG D 2 265 ? 39.962  -5.376   -69.130  1.00 47.11  ? 265 ARG D O   1 
ATOM   5363 C CB  . ARG D 2 265 ? 42.788  -5.129   -70.868  1.00 57.76  ? 265 ARG D CB  1 
ATOM   5364 C CG  . ARG D 2 265 ? 41.885  -4.329   -71.765  1.00 60.50  ? 265 ARG D CG  1 
ATOM   5365 C CD  . ARG D 2 265 ? 42.314  -4.516   -73.183  1.00 59.15  ? 265 ARG D CD  1 
ATOM   5366 N NE  . ARG D 2 265 ? 41.549  -3.640   -74.040  1.00 64.97  ? 265 ARG D NE  1 
ATOM   5367 C CZ  . ARG D 2 265 ? 41.632  -3.633   -75.363  1.00 62.42  ? 265 ARG D CZ  1 
ATOM   5368 N NH1 . ARG D 2 265 ? 42.463  -4.461   -75.998  1.00 54.53  ? 265 ARG D NH1 1 
ATOM   5369 N NH2 . ARG D 2 265 ? 40.862  -2.800   -76.044  1.00 57.97  ? 265 ARG D NH2 1 
ATOM   5370 N N   . SER D 2 266 ? 41.162  -7.250   -69.489  1.00 45.51  ? 266 SER D N   1 
ATOM   5371 C CA  . SER D 2 266 ? 40.061  -8.186   -69.384  1.00 46.46  ? 266 SER D CA  1 
ATOM   5372 C C   . SER D 2 266 ? 39.447  -8.230   -67.969  1.00 44.68  ? 266 SER D C   1 
ATOM   5373 O O   . SER D 2 266 ? 38.239  -8.260   -67.830  1.00 44.33  ? 266 SER D O   1 
ATOM   5374 C CB  . SER D 2 266 ? 40.561  -9.585   -69.743  1.00 49.84  ? 266 SER D CB  1 
ATOM   5375 O OG  . SER D 2 266 ? 41.267  -9.596   -70.966  1.00 51.10  ? 266 SER D OG  1 
ATOM   5376 N N   . ARG D 2 267 ? 40.288  -8.282   -66.935  1.00 41.72  ? 267 ARG D N   1 
ATOM   5377 C CA  . ARG D 2 267 ? 39.821  -8.283   -65.542  1.00 40.80  ? 267 ARG D CA  1 
ATOM   5378 C C   . ARG D 2 267 ? 39.092  -6.984   -65.176  1.00 40.41  ? 267 ARG D C   1 
ATOM   5379 O O   . ARG D 2 267 ? 38.095  -7.007   -64.454  1.00 41.53  ? 267 ARG D O   1 
ATOM   5380 C CB  . ARG D 2 267 ? 40.991  -8.538   -64.572  1.00 41.68  ? 267 ARG D CB  1 
ATOM   5381 C CG  . ARG D 2 267 ? 41.667  -9.901   -64.733  1.00 40.30  ? 267 ARG D CG  1 
ATOM   5382 C CD  . ARG D 2 267 ? 40.720  -11.055  -64.515  1.00 40.31  ? 267 ARG D CD  1 
ATOM   5383 N NE  . ARG D 2 267 ? 41.361  -12.323  -64.844  1.00 41.00  ? 267 ARG D NE  1 
ATOM   5384 C CZ  . ARG D 2 267 ? 42.073  -13.073  -64.005  1.00 43.89  ? 267 ARG D CZ  1 
ATOM   5385 N NH1 . ARG D 2 267 ? 42.271  -12.730  -62.725  1.00 43.08  ? 267 ARG D NH1 1 
ATOM   5386 N NH2 . ARG D 2 267 ? 42.597  -14.193  -64.453  1.00 44.75  ? 267 ARG D NH2 1 
ATOM   5387 N N   . LEU D 2 268 ? 39.570  -5.858   -65.701  1.00 40.82  ? 268 LEU D N   1 
ATOM   5388 C CA  . LEU D 2 268 ? 38.898  -4.592   -65.508  1.00 40.48  ? 268 LEU D CA  1 
ATOM   5389 C C   . LEU D 2 268 ? 37.547  -4.575   -66.212  1.00 40.87  ? 268 LEU D C   1 
ATOM   5390 O O   . LEU D 2 268 ? 36.555  -4.087   -65.662  1.00 42.69  ? 268 LEU D O   1 
ATOM   5391 C CB  . LEU D 2 268 ? 39.752  -3.453   -66.037  1.00 41.93  ? 268 LEU D CB  1 
ATOM   5392 C CG  . LEU D 2 268 ? 39.115  -2.072   -65.948  1.00 42.36  ? 268 LEU D CG  1 
ATOM   5393 C CD1 . LEU D 2 268 ? 38.849  -1.715   -64.485  1.00 42.06  ? 268 LEU D CD1 1 
ATOM   5394 C CD2 . LEU D 2 268 ? 40.023  -1.058   -66.628  1.00 42.48  ? 268 LEU D CD2 1 
ATOM   5395 N N   . ALA D 2 269 ? 37.501  -5.089   -67.430  1.00 37.22  ? 269 ALA D N   1 
ATOM   5396 C CA  . ALA D 2 269 ? 36.222  -5.131   -68.149  1.00 40.14  ? 269 ALA D CA  1 
ATOM   5397 C C   . ALA D 2 269 ? 35.204  -6.056   -67.439  1.00 40.56  ? 269 ALA D C   1 
ATOM   5398 O O   . ALA D 2 269 ? 34.002  -5.753   -67.382  1.00 46.02  ? 269 ALA D O   1 
ATOM   5399 C CB  . ALA D 2 269 ? 36.430  -5.583   -69.586  1.00 40.29  ? 269 ALA D CB  1 
ATOM   5400 N N   . ASP D 2 270 ? 35.699  -7.170   -66.905  1.00 37.59  ? 270 ASP D N   1 
ATOM   5401 C CA  . ASP D 2 270 ? 34.883  -8.097   -66.130  1.00 40.13  ? 270 ASP D CA  1 
ATOM   5402 C C   . ASP D 2 270 ? 34.346  -7.460   -64.813  1.00 38.74  ? 270 ASP D C   1 
ATOM   5403 O O   . ASP D 2 270 ? 33.171  -7.609   -64.480  1.00 37.48  ? 270 ASP D O   1 
ATOM   5404 C CB  . ASP D 2 270 ? 35.682  -9.363   -65.839  1.00 40.95  ? 270 ASP D CB  1 
ATOM   5405 C CG  . ASP D 2 270 ? 34.794  -10.576  -65.628  1.00 42.71  ? 270 ASP D CG  1 
ATOM   5406 O OD1 . ASP D 2 270 ? 33.857  -10.789  -66.418  1.00 43.58  ? 270 ASP D OD1 1 
ATOM   5407 O OD2 . ASP D 2 270 ? 35.054  -11.331  -64.667  1.00 47.93  ? 270 ASP D OD2 1 
ATOM   5408 N N   . PHE D 2 271 ? 35.193  -6.721   -64.111  1.00 36.48  ? 271 PHE D N   1 
ATOM   5409 C CA  . PHE D 2 271 ? 34.754  -5.898   -62.963  1.00 37.64  ? 271 PHE D CA  1 
ATOM   5410 C C   . PHE D 2 271 ? 33.680  -4.876   -63.355  1.00 39.72  ? 271 PHE D C   1 
ATOM   5411 O O   . PHE D 2 271 ? 32.673  -4.744   -62.677  1.00 41.91  ? 271 PHE D O   1 
ATOM   5412 C CB  . PHE D 2 271 ? 35.955  -5.209   -62.294  1.00 35.05  ? 271 PHE D CB  1 
ATOM   5413 C CG  . PHE D 2 271 ? 35.580  -4.169   -61.295  1.00 34.53  ? 271 PHE D CG  1 
ATOM   5414 C CD1 . PHE D 2 271 ? 35.218  -4.527   -60.017  1.00 36.62  ? 271 PHE D CD1 1 
ATOM   5415 C CD2 . PHE D 2 271 ? 35.611  -2.829   -61.625  1.00 36.66  ? 271 PHE D CD2 1 
ATOM   5416 C CE1 . PHE D 2 271 ? 34.881  -3.578   -59.081  1.00 34.91  ? 271 PHE D CE1 1 
ATOM   5417 C CE2 . PHE D 2 271 ? 35.270  -1.868   -60.702  1.00 37.39  ? 271 PHE D CE2 1 
ATOM   5418 C CZ  . PHE D 2 271 ? 34.900  -2.248   -59.424  1.00 36.29  ? 271 PHE D CZ  1 
ATOM   5419 N N   . HIS D 2 272 ? 33.874  -4.188   -64.470  1.00 40.85  ? 272 HIS D N   1 
ATOM   5420 C CA  . HIS D 2 272 ? 32.888  -3.214   -64.938  1.00 41.16  ? 272 HIS D CA  1 
ATOM   5421 C C   . HIS D 2 272 ? 31.550  -3.884   -65.260  1.00 40.96  ? 272 HIS D C   1 
ATOM   5422 O O   . HIS D 2 272 ? 30.486  -3.374   -64.907  1.00 45.32  ? 272 HIS D O   1 
ATOM   5423 C CB  . HIS D 2 272 ? 33.427  -2.440   -66.168  1.00 42.53  ? 272 HIS D CB  1 
ATOM   5424 C CG  . HIS D 2 272 ? 34.419  -1.360   -65.826  1.00 42.61  ? 272 HIS D CG  1 
ATOM   5425 N ND1 . HIS D 2 272 ? 35.413  -0.955   -66.692  1.00 44.70  ? 272 HIS D ND1 1 
ATOM   5426 C CD2 . HIS D 2 272 ? 34.542  -0.580   -64.725  1.00 42.91  ? 272 HIS D CD2 1 
ATOM   5427 C CE1 . HIS D 2 272 ? 36.116  0.015    -66.130  1.00 46.86  ? 272 HIS D CE1 1 
ATOM   5428 N NE2 . HIS D 2 272 ? 35.604  0.266    -64.938  1.00 45.66  ? 272 HIS D NE2 1 
ATOM   5429 N N   . ALA D 2 273 ? 31.595  -5.042   -65.904  1.00 39.17  ? 273 ALA D N   1 
ATOM   5430 C CA  . ALA D 2 273 ? 30.370  -5.740   -66.276  1.00 36.81  ? 273 ALA D CA  1 
ATOM   5431 C C   . ALA D 2 273 ? 29.597  -6.260   -65.038  1.00 40.67  ? 273 ALA D C   1 
ATOM   5432 O O   . ALA D 2 273 ? 28.369  -6.207   -65.008  1.00 42.15  ? 273 ALA D O   1 
ATOM   5433 C CB  . ALA D 2 273 ? 30.685  -6.897   -67.215  1.00 34.89  ? 273 ALA D CB  1 
ATOM   5434 N N   . ASN D 2 274 ? 30.302  -6.760   -64.025  1.00 36.91  ? 274 ASN D N   1 
ATOM   5435 C CA  . ASN D 2 274 ? 29.621  -7.335   -62.880  1.00 36.39  ? 274 ASN D CA  1 
ATOM   5436 C C   . ASN D 2 274 ? 29.388  -6.450   -61.668  1.00 37.10  ? 274 ASN D C   1 
ATOM   5437 O O   . ASN D 2 274 ? 28.518  -6.758   -60.872  1.00 37.60  ? 274 ASN D O   1 
ATOM   5438 C CB  . ASN D 2 274 ? 30.345  -8.602   -62.449  1.00 36.88  ? 274 ASN D CB  1 
ATOM   5439 C CG  . ASN D 2 274 ? 30.265  -9.685   -63.509  1.00 37.06  ? 274 ASN D CG  1 
ATOM   5440 O OD1 . ASN D 2 274 ? 29.194  -9.970   -64.038  1.00 39.65  ? 274 ASN D OD1 1 
ATOM   5441 N ND2 . ASN D 2 274 ? 31.383  -10.279  -63.824  1.00 37.82  ? 274 ASN D ND2 1 
ATOM   5442 N N   . CYS D 2 275 ? 30.153  -5.377   -61.515  1.00 36.86  ? 275 CYS D N   1 
ATOM   5443 C CA  . CYS D 2 275 ? 30.056  -4.529   -60.312  1.00 39.21  ? 275 CYS D CA  1 
ATOM   5444 C C   . CYS D 2 275 ? 29.479  -3.128   -60.546  1.00 39.89  ? 275 CYS D C   1 
ATOM   5445 O O   . CYS D 2 275 ? 29.176  -2.432   -59.593  1.00 41.75  ? 275 CYS D O   1 
ATOM   5446 C CB  . CYS D 2 275 ? 31.416  -4.395   -59.645  1.00 41.05  ? 275 CYS D CB  1 
ATOM   5447 S SG  . CYS D 2 275 ? 32.090  -5.937   -58.981  1.00 40.27  ? 275 CYS D SG  1 
ATOM   5448 N N   . ARG D 2 276 ? 29.299  -2.735   -61.794  1.00 40.33  ? 276 ARG D N   1 
ATOM   5449 C CA  . ARG D 2 276 ? 28.750  -1.426   -62.145  1.00 42.81  ? 276 ARG D CA  1 
ATOM   5450 C C   . ARG D 2 276 ? 27.372  -1.254   -61.526  1.00 39.18  ? 276 ARG D C   1 
ATOM   5451 O O   . ARG D 2 276 ? 26.487  -2.088   -61.719  1.00 36.02  ? 276 ARG D O   1 
ATOM   5452 C CB  . ARG D 2 276 ? 28.676  -1.362   -63.652  1.00 52.23  ? 276 ARG D CB  1 
ATOM   5453 C CG  . ARG D 2 276 ? 28.563  -0.015   -64.294  1.00 62.30  ? 276 ARG D CG  1 
ATOM   5454 C CD  . ARG D 2 276 ? 28.882  -0.169   -65.789  1.00 67.23  ? 276 ARG D CD  1 
ATOM   5455 N NE  . ARG D 2 276 ? 27.956  0.620    -66.608  1.00 72.28  ? 276 ARG D NE  1 
ATOM   5456 C CZ  . ARG D 2 276 ? 27.106  0.126    -67.509  1.00 74.41  ? 276 ARG D CZ  1 
ATOM   5457 N NH1 . ARG D 2 276 ? 27.049  -1.180   -67.789  1.00 73.09  ? 276 ARG D NH1 1 
ATOM   5458 N NH2 . ARG D 2 276 ? 26.315  0.961    -68.169  1.00 78.55  ? 276 ARG D NH2 1 
ATOM   5459 N N   . ALA D 2 277 ? 27.190  -0.197   -60.746  1.00 37.40  ? 277 ALA D N   1 
ATOM   5460 C CA  . ALA D 2 277 ? 25.925  -0.019   -60.007  1.00 37.04  ? 277 ALA D CA  1 
ATOM   5461 C C   . ALA D 2 277 ? 24.727  0.246    -60.909  1.00 36.90  ? 277 ALA D C   1 
ATOM   5462 O O   . ALA D 2 277 ? 24.855  0.954    -61.892  1.00 37.87  ? 277 ALA D O   1 
ATOM   5463 C CB  . ALA D 2 277 ? 26.036  1.106    -58.985  1.00 35.99  ? 277 ALA D CB  1 
ATOM   5464 N N   . SER D 2 278 ? 23.573  -0.298   -60.516  1.00 34.61  ? 278 SER D N   1 
ATOM   5465 C CA  . SER D 2 278 ? 22.318  -0.147   -61.190  1.00 35.95  ? 278 SER D CA  1 
ATOM   5466 C C   . SER D 2 278 ? 21.347  0.547    -60.250  1.00 36.81  ? 278 SER D C   1 
ATOM   5467 O O   . SER D 2 278 ? 21.305  0.242    -59.073  1.00 32.67  ? 278 SER D O   1 
ATOM   5468 C CB  . SER D 2 278 ? 21.724  -1.535   -61.534  1.00 40.56  ? 278 SER D CB  1 
ATOM   5469 O OG  . SER D 2 278 ? 20.436  -1.421   -62.152  1.00 41.63  ? 278 SER D OG  1 
ATOM   5470 N N   . TYR D 2 279 ? 20.512  1.412    -60.810  1.00 36.51  ? 279 TYR D N   1 
ATOM   5471 C CA  . TYR D 2 279 ? 19.464  2.092    -60.065  1.00 39.83  ? 279 TYR D CA  1 
ATOM   5472 C C   . TYR D 2 279 ? 18.145  1.310    -60.086  1.00 40.53  ? 279 TYR D C   1 
ATOM   5473 O O   . TYR D 2 279 ? 17.162  1.764    -59.502  1.00 40.99  ? 279 TYR D O   1 
ATOM   5474 C CB  . TYR D 2 279 ? 19.229  3.467    -60.674  1.00 40.58  ? 279 TYR D CB  1 
ATOM   5475 C CG  . TYR D 2 279 ? 20.350  4.444    -60.425  1.00 41.88  ? 279 TYR D CG  1 
ATOM   5476 C CD1 . TYR D 2 279 ? 20.569  4.975    -59.142  1.00 40.62  ? 279 TYR D CD1 1 
ATOM   5477 C CD2 . TYR D 2 279 ? 21.179  4.865    -61.460  1.00 42.67  ? 279 TYR D CD2 1 
ATOM   5478 C CE1 . TYR D 2 279 ? 21.582  5.882    -58.913  1.00 40.37  ? 279 TYR D CE1 1 
ATOM   5479 C CE2 . TYR D 2 279 ? 22.206  5.775    -61.235  1.00 41.65  ? 279 TYR D CE2 1 
ATOM   5480 C CZ  . TYR D 2 279 ? 22.393  6.284    -59.966  1.00 42.51  ? 279 TYR D CZ  1 
ATOM   5481 O OH  . TYR D 2 279 ? 23.402  7.176    -59.723  1.00 48.17  ? 279 TYR D OH  1 
ATOM   5482 N N   . GLN D 2 280 ? 18.158  0.143    -60.745  1.00 37.98  ? 280 GLN D N   1 
ATOM   5483 C CA  . GLN D 2 280 ? 16.986  -0.694   -60.992  1.00 40.08  ? 280 GLN D CA  1 
ATOM   5484 C C   . GLN D 2 280 ? 16.826  -1.916   -60.080  1.00 39.01  ? 280 GLN D C   1 
ATOM   5485 O O   . GLN D 2 280 ? 15.778  -2.547   -60.121  1.00 45.45  ? 280 GLN D O   1 
ATOM   5486 C CB  . GLN D 2 280 ? 17.020  -1.216   -62.463  1.00 40.88  ? 280 GLN D CB  1 
ATOM   5487 C CG  . GLN D 2 280 ? 17.044  -0.125   -63.516  1.00 43.32  ? 280 GLN D CG  1 
ATOM   5488 C CD  . GLN D 2 280 ? 15.886  0.853    -63.321  1.00 49.36  ? 280 GLN D CD  1 
ATOM   5489 O OE1 . GLN D 2 280 ? 14.727  0.442    -63.249  1.00 55.08  ? 280 GLN D OE1 1 
ATOM   5490 N NE2 . GLN D 2 280 ? 16.195  2.133    -63.181  1.00 53.25  ? 280 GLN D NE2 1 
ATOM   5491 N N   . THR D 2 281 ? 17.845  -2.287   -59.312  1.00 37.03  ? 281 THR D N   1 
ATOM   5492 C CA  . THR D 2 281 ? 17.808  -3.535   -58.518  1.00 35.64  ? 281 THR D CA  1 
ATOM   5493 C C   . THR D 2 281 ? 17.865  -3.276   -57.028  1.00 34.65  ? 281 THR D C   1 
ATOM   5494 O O   . THR D 2 281 ? 18.358  -2.252   -56.601  1.00 34.47  ? 281 THR D O   1 
ATOM   5495 C CB  . THR D 2 281 ? 18.944  -4.476   -58.903  1.00 35.95  ? 281 THR D CB  1 
ATOM   5496 O OG1 . THR D 2 281 ? 20.202  -3.836   -58.674  1.00 35.70  ? 281 THR D OG1 1 
ATOM   5497 C CG2 . THR D 2 281 ? 18.851  -4.899   -60.374  1.00 36.55  ? 281 THR D CG2 1 
ATOM   5498 N N   . VAL D 2 282 ? 17.350  -4.205   -56.230  1.00 35.71  ? 282 VAL D N   1 
ATOM   5499 C CA  . VAL D 2 282 ? 17.305  -3.982   -54.786  1.00 35.66  ? 282 VAL D CA  1 
ATOM   5500 C C   . VAL D 2 282 ? 18.687  -3.871   -54.151  1.00 33.21  ? 282 VAL D C   1 
ATOM   5501 O O   . VAL D 2 282 ? 18.864  -3.098   -53.207  1.00 33.30  ? 282 VAL D O   1 
ATOM   5502 C CB  . VAL D 2 282 ? 16.415  -4.982   -54.007  1.00 39.12  ? 282 VAL D CB  1 
ATOM   5503 C CG1 . VAL D 2 282 ? 15.026  -4.975   -54.603  1.00 40.78  ? 282 VAL D CG1 1 
ATOM   5504 C CG2 . VAL D 2 282 ? 16.974  -6.382   -54.011  1.00 46.51  ? 282 VAL D CG2 1 
ATOM   5505 N N   . THR D 2 283 ? 19.659  -4.601   -54.697  1.00 33.41  ? 283 THR D N   1 
ATOM   5506 C CA  . THR D 2 283 ? 21.045  -4.576   -54.204  1.00 32.26  ? 283 THR D CA  1 
ATOM   5507 C C   . THR D 2 283 ? 21.926  -3.520   -54.851  1.00 33.48  ? 283 THR D C   1 
ATOM   5508 O O   . THR D 2 283 ? 23.072  -3.339   -54.442  1.00 34.21  ? 283 THR D O   1 
ATOM   5509 C CB  . THR D 2 283 ? 21.712  -5.912   -54.512  1.00 35.16  ? 283 THR D CB  1 
ATOM   5510 O OG1 . THR D 2 283 ? 21.777  -6.070   -55.935  1.00 34.62  ? 283 THR D OG1 1 
ATOM   5511 C CG2 . THR D 2 283 ? 20.910  -7.087   -53.881  1.00 33.97  ? 283 THR D CG2 1 
ATOM   5512 N N   . SER D 2 284 ? 21.406  -2.878   -55.901  1.00 33.87  ? 284 SER D N   1 
ATOM   5513 C CA  . SER D 2 284 ? 22.161  -2.024   -56.831  1.00 35.00  ? 284 SER D CA  1 
ATOM   5514 C C   . SER D 2 284 ? 23.198  -2.771   -57.672  1.00 33.60  ? 284 SER D C   1 
ATOM   5515 O O   . SER D 2 284 ? 23.938  -2.145   -58.420  1.00 35.09  ? 284 SER D O   1 
ATOM   5516 C CB  . SER D 2 284 ? 22.799  -0.813   -56.109  1.00 38.66  ? 284 SER D CB  1 
ATOM   5517 O OG  . SER D 2 284 ? 21.815  0.021    -55.499  1.00 39.70  ? 284 SER D OG  1 
ATOM   5518 N N   . CYS D 2 285 ? 23.285  -4.089   -57.539  1.00 33.97  ? 285 CYS D N   1 
ATOM   5519 C CA  . CYS D 2 285 ? 24.152  -4.888   -58.403  1.00 36.88  ? 285 CYS D CA  1 
ATOM   5520 C C   . CYS D 2 285 ? 23.386  -5.378   -59.632  1.00 36.08  ? 285 CYS D C   1 
ATOM   5521 O O   . CYS D 2 285 ? 22.166  -5.585   -59.556  1.00 35.10  ? 285 CYS D O   1 
ATOM   5522 C CB  . CYS D 2 285 ? 24.733  -6.079   -57.657  1.00 37.55  ? 285 CYS D CB  1 
ATOM   5523 S SG  . CYS D 2 285 ? 26.006  -5.627   -56.450  1.00 41.69  ? 285 CYS D SG  1 
ATOM   5524 N N   . PRO D 2 286 ? 24.089  -5.575   -60.763  1.00 37.21  ? 286 PRO D N   1 
ATOM   5525 C CA  . PRO D 2 286 ? 23.421  -6.127   -61.941  1.00 35.45  ? 286 PRO D CA  1 
ATOM   5526 C C   . PRO D 2 286 ? 22.905  -7.499   -61.622  1.00 35.85  ? 286 PRO D C   1 
ATOM   5527 O O   . PRO D 2 286 ? 23.644  -8.302   -61.062  1.00 37.82  ? 286 PRO D O   1 
ATOM   5528 C CB  . PRO D 2 286 ? 24.542  -6.224   -62.970  1.00 36.83  ? 286 PRO D CB  1 
ATOM   5529 C CG  . PRO D 2 286 ? 25.537  -5.215   -62.542  1.00 36.74  ? 286 PRO D CG  1 
ATOM   5530 C CD  . PRO D 2 286 ? 25.504  -5.269   -61.039  1.00 37.40  ? 286 PRO D CD  1 
ATOM   5531 N N   . ALA D 2 287 ? 21.625  -7.740   -61.917  1.00 37.05  ? 287 ALA D N   1 
ATOM   5532 C CA  . ALA D 2 287 ? 20.972  -9.038   -61.662  1.00 36.00  ? 287 ALA D CA  1 
ATOM   5533 C C   . ALA D 2 287 ? 21.039  -9.493   -60.193  1.00 37.44  ? 287 ALA D C   1 
ATOM   5534 O O   . ALA D 2 287 ? 20.880  -10.684  -59.887  1.00 38.45  ? 287 ALA D O   1 
ATOM   5535 C CB  . ALA D 2 287 ? 21.564  -10.105  -62.590  1.00 34.85  ? 287 ALA D CB  1 
ATOM   5536 N N   . ASP D 2 288 ? 21.255  -8.537   -59.288  1.00 39.63  ? 288 ASP D N   1 
ATOM   5537 C CA  . ASP D 2 288 ? 21.435  -8.802   -57.861  1.00 38.76  ? 288 ASP D CA  1 
ATOM   5538 C C   . ASP D 2 288 ? 22.479  -9.869   -57.600  1.00 37.69  ? 288 ASP D C   1 
ATOM   5539 O O   . ASP D 2 288 ? 22.361  -10.635  -56.666  1.00 37.35  ? 288 ASP D O   1 
ATOM   5540 C CB  . ASP D 2 288 ? 20.109  -9.213   -57.218  1.00 36.19  ? 288 ASP D CB  1 
ATOM   5541 C CG  . ASP D 2 288 ? 19.105  -8.109   -57.213  1.00 39.96  ? 288 ASP D CG  1 
ATOM   5542 O OD1 . ASP D 2 288 ? 19.452  -6.940   -56.917  1.00 43.67  ? 288 ASP D OD1 1 
ATOM   5543 O OD2 . ASP D 2 288 ? 17.931  -8.413   -57.457  1.00 46.40  ? 288 ASP D OD2 1 
ATOM   5544 N N   . ASN D 2 289 ? 23.506  -9.905   -58.432  1.00 37.41  ? 289 ASN D N   1 
ATOM   5545 C CA  . ASN D 2 289 ? 24.473  -10.969  -58.382  1.00 36.91  ? 289 ASN D CA  1 
ATOM   5546 C C   . ASN D 2 289 ? 25.768  -10.567  -57.665  1.00 38.90  ? 289 ASN D C   1 
ATOM   5547 O O   . ASN D 2 289 ? 26.759  -10.213  -58.299  1.00 41.70  ? 289 ASN D O   1 
ATOM   5548 C CB  . ASN D 2 289 ? 24.764  -11.477  -59.798  1.00 38.04  ? 289 ASN D CB  1 
ATOM   5549 C CG  . ASN D 2 289 ? 25.491  -12.808  -59.798  1.00 37.48  ? 289 ASN D CG  1 
ATOM   5550 O OD1 . ASN D 2 289 ? 26.069  -13.247  -58.774  1.00 37.16  ? 289 ASN D OD1 1 
ATOM   5551 N ND2 . ASN D 2 289 ? 25.476  -13.458  -60.934  1.00 37.64  ? 289 ASN D ND2 1 
ATOM   5552 N N   . TYR D 2 290 ? 25.756  -10.697  -56.341  1.00 36.88  ? 290 TYR D N   1 
ATOM   5553 C CA  . TYR D 2 290 ? 26.885  -10.369  -55.485  1.00 34.43  ? 290 TYR D CA  1 
ATOM   5554 C C   . TYR D 2 290 ? 28.133  -11.224  -55.766  1.00 39.41  ? 290 TYR D C   1 
ATOM   5555 O O   . TYR D 2 290 ? 29.269  -10.711  -55.796  1.00 37.74  ? 290 TYR D O   1 
ATOM   5556 C CB  . TYR D 2 290 ? 26.484  -10.569  -54.019  1.00 34.04  ? 290 TYR D CB  1 
ATOM   5557 C CG  . TYR D 2 290 ? 25.558  -9.518   -53.372  1.00 34.09  ? 290 TYR D CG  1 
ATOM   5558 C CD1 . TYR D 2 290 ? 25.552  -8.181   -53.801  1.00 31.65  ? 290 TYR D CD1 1 
ATOM   5559 C CD2 . TYR D 2 290 ? 24.732  -9.863   -52.292  1.00 31.54  ? 290 TYR D CD2 1 
ATOM   5560 C CE1 . TYR D 2 290 ? 24.781  -7.237   -53.188  1.00 29.51  ? 290 TYR D CE1 1 
ATOM   5561 C CE2 . TYR D 2 290 ? 23.922  -8.911   -51.682  1.00 32.57  ? 290 TYR D CE2 1 
ATOM   5562 C CZ  . TYR D 2 290 ? 23.959  -7.599   -52.126  1.00 33.76  ? 290 TYR D CZ  1 
ATOM   5563 O OH  . TYR D 2 290 ? 23.178  -6.634   -51.522  1.00 32.61  ? 290 TYR D OH  1 
ATOM   5564 N N   . GLN D 2 291 ? 27.927  -12.526  -55.949  1.00 40.41  ? 291 GLN D N   1 
ATOM   5565 C CA  . GLN D 2 291 ? 29.029  -13.447  -56.222  1.00 40.87  ? 291 GLN D CA  1 
ATOM   5566 C C   . GLN D 2 291 ? 29.806  -13.076  -57.476  1.00 37.35  ? 291 GLN D C   1 
ATOM   5567 O O   . GLN D 2 291 ? 31.016  -13.112  -57.470  1.00 37.71  ? 291 GLN D O   1 
ATOM   5568 C CB  . GLN D 2 291 ? 28.534  -14.908  -56.333  1.00 48.10  ? 291 GLN D CB  1 
ATOM   5569 C CG  . GLN D 2 291 ? 28.469  -15.660  -55.005  1.00 59.15  ? 291 GLN D CG  1 
ATOM   5570 C CD  . GLN D 2 291 ? 29.862  -16.048  -54.454  1.00 73.68  ? 291 GLN D CD  1 
ATOM   5571 O OE1 . GLN D 2 291 ? 30.675  -16.669  -55.160  1.00 76.86  ? 291 GLN D OE1 1 
ATOM   5572 N NE2 . GLN D 2 291 ? 30.133  -15.697  -53.182  1.00 75.64  ? 291 GLN D NE2 1 
ATOM   5573 N N   . ALA D 2 292 ? 29.113  -12.736  -58.555  1.00 34.89  ? 292 ALA D N   1 
ATOM   5574 C CA  . ALA D 2 292 ? 29.799  -12.388  -59.794  1.00 33.72  ? 292 ALA D CA  1 
ATOM   5575 C C   . ALA D 2 292 ? 30.604  -11.105  -59.618  1.00 33.95  ? 292 ALA D C   1 
ATOM   5576 O O   . ALA D 2 292 ? 31.733  -10.985  -60.131  1.00 35.96  ? 292 ALA D O   1 
ATOM   5577 C CB  . ALA D 2 292 ? 28.797  -12.274  -60.943  1.00 34.83  ? 292 ALA D CB  1 
ATOM   5578 N N   . CYS D 2 293 ? 30.074  -10.168  -58.832  1.00 32.95  ? 293 CYS D N   1 
ATOM   5579 C CA  . CYS D 2 293 ? 30.814  -8.922   -58.570  1.00 33.09  ? 293 CYS D CA  1 
ATOM   5580 C C   . CYS D 2 293 ? 32.045  -9.164   -57.722  1.00 32.73  ? 293 CYS D C   1 
ATOM   5581 O O   . CYS D 2 293 ? 33.135  -8.721   -58.083  1.00 32.65  ? 293 CYS D O   1 
ATOM   5582 C CB  . CYS D 2 293 ? 29.928  -7.868   -57.920  1.00 36.04  ? 293 CYS D CB  1 
ATOM   5583 S SG  . CYS D 2 293 ? 30.877  -6.452   -57.331  1.00 40.81  ? 293 CYS D SG  1 
ATOM   5584 N N   . LEU D 2 294 ? 31.881  -9.886   -56.611  1.00 32.32  ? 294 LEU D N   1 
ATOM   5585 C CA  . LEU D 2 294 ? 33.010  -10.243  -55.767  1.00 33.42  ? 294 LEU D CA  1 
ATOM   5586 C C   . LEU D 2 294 ? 34.127  -10.991  -56.507  1.00 35.71  ? 294 LEU D C   1 
ATOM   5587 O O   . LEU D 2 294 ? 35.308  -10.702  -56.291  1.00 38.92  ? 294 LEU D O   1 
ATOM   5588 C CB  . LEU D 2 294 ? 32.546  -11.073  -54.559  1.00 33.69  ? 294 LEU D CB  1 
ATOM   5589 C CG  . LEU D 2 294 ? 31.687  -10.307  -53.527  1.00 34.13  ? 294 LEU D CG  1 
ATOM   5590 C CD1 . LEU D 2 294 ? 31.277  -11.214  -52.360  1.00 34.71  ? 294 LEU D CD1 1 
ATOM   5591 C CD2 . LEU D 2 294 ? 32.411  -9.074   -53.011  1.00 31.70  ? 294 LEU D CD2 1 
ATOM   5592 N N   . GLY D 2 295 ? 33.762  -11.946  -57.359  1.00 36.10  ? 295 GLY D N   1 
ATOM   5593 C CA  . GLY D 2 295 ? 34.752  -12.702  -58.161  1.00 35.22  ? 295 GLY D CA  1 
ATOM   5594 C C   . GLY D 2 295 ? 35.535  -11.803  -59.089  1.00 35.06  ? 295 GLY D C   1 
ATOM   5595 O O   . GLY D 2 295 ? 36.742  -11.906  -59.180  1.00 36.52  ? 295 GLY D O   1 
ATOM   5596 N N   . SER D 2 296 ? 34.841  -10.879  -59.733  1.00 34.23  ? 296 SER D N   1 
ATOM   5597 C CA  . SER D 2 296 ? 35.481  -9.939   -60.631  1.00 35.71  ? 296 SER D CA  1 
ATOM   5598 C C   . SER D 2 296 ? 36.326  -8.913   -59.894  1.00 36.77  ? 296 SER D C   1 
ATOM   5599 O O   . SER D 2 296 ? 37.367  -8.475   -60.406  1.00 38.29  ? 296 SER D O   1 
ATOM   5600 C CB  . SER D 2 296 ? 34.427  -9.244   -61.499  1.00 37.38  ? 296 SER D CB  1 
ATOM   5601 O OG  . SER D 2 296 ? 33.767  -10.187  -62.343  1.00 37.80  ? 296 SER D OG  1 
ATOM   5602 N N   . TYR D 2 297 ? 35.894  -8.534   -58.689  1.00 36.37  ? 297 TYR D N   1 
ATOM   5603 C CA  . TYR D 2 297 ? 36.685  -7.637   -57.851  1.00 32.42  ? 297 TYR D CA  1 
ATOM   5604 C C   . TYR D 2 297 ? 37.985  -8.321   -57.481  1.00 33.04  ? 297 TYR D C   1 
ATOM   5605 O O   . TYR D 2 297 ? 39.081  -7.744   -57.659  1.00 34.27  ? 297 TYR D O   1 
ATOM   5606 C CB  . TYR D 2 297 ? 35.910  -7.209   -56.592  1.00 32.86  ? 297 TYR D CB  1 
ATOM   5607 C CG  . TYR D 2 297 ? 36.710  -6.350   -55.640  1.00 32.61  ? 297 TYR D CG  1 
ATOM   5608 C CD1 . TYR D 2 297 ? 36.803  -4.974   -55.822  1.00 36.33  ? 297 TYR D CD1 1 
ATOM   5609 C CD2 . TYR D 2 297 ? 37.448  -6.920   -54.612  1.00 32.10  ? 297 TYR D CD2 1 
ATOM   5610 C CE1 . TYR D 2 297 ? 37.571  -4.180   -54.967  1.00 36.27  ? 297 TYR D CE1 1 
ATOM   5611 C CE2 . TYR D 2 297 ? 38.204  -6.145   -53.750  1.00 34.23  ? 297 TYR D CE2 1 
ATOM   5612 C CZ  . TYR D 2 297 ? 38.257  -4.770   -53.942  1.00 35.84  ? 297 TYR D CZ  1 
ATOM   5613 O OH  . TYR D 2 297 ? 39.006  -3.997   -53.134  1.00 35.67  ? 297 TYR D OH  1 
ATOM   5614 N N   . ALA D 2 298 ? 37.874  -9.532   -56.938  1.00 33.68  ? 298 ALA D N   1 
ATOM   5615 C CA  . ALA D 2 298 ? 39.057  -10.292  -56.512  1.00 34.92  ? 298 ALA D CA  1 
ATOM   5616 C C   . ALA D 2 298 ? 39.980  -10.661  -57.696  1.00 36.69  ? 298 ALA D C   1 
ATOM   5617 O O   . ALA D 2 298 ? 41.208  -10.857  -57.537  1.00 34.83  ? 298 ALA D O   1 
ATOM   5618 C CB  . ALA D 2 298 ? 38.631  -11.560  -55.794  1.00 36.58  ? 298 ALA D CB  1 
ATOM   5619 N N   . GLY D 2 299 ? 39.379  -10.769  -58.874  1.00 34.55  ? 299 GLY D N   1 
ATOM   5620 C CA  . GLY D 2 299 ? 40.104  -11.075  -60.075  1.00 37.82  ? 299 GLY D CA  1 
ATOM   5621 C C   . GLY D 2 299 ? 41.009  -9.967   -60.582  1.00 40.06  ? 299 GLY D C   1 
ATOM   5622 O O   . GLY D 2 299 ? 41.753  -10.181  -61.529  1.00 40.09  ? 299 GLY D O   1 
ATOM   5623 N N   . MET D 2 300 ? 40.930  -8.782   -59.982  1.00 40.57  ? 300 MET D N   1 
ATOM   5624 C CA  . MET D 2 300 ? 41.851  -7.694   -60.311  1.00 41.45  ? 300 MET D CA  1 
ATOM   5625 C C   . MET D 2 300 ? 43.069  -7.616   -59.380  1.00 42.52  ? 300 MET D C   1 
ATOM   5626 O O   . MET D 2 300 ? 43.974  -6.828   -59.603  1.00 44.11  ? 300 MET D O   1 
ATOM   5627 C CB  . MET D 2 300 ? 41.102  -6.382   -60.289  1.00 44.78  ? 300 MET D CB  1 
ATOM   5628 C CG  . MET D 2 300 ? 40.254  -6.199   -61.529  1.00 47.40  ? 300 MET D CG  1 
ATOM   5629 S SD  . MET D 2 300 ? 39.310  -4.702   -61.344  1.00 55.99  ? 300 MET D SD  1 
ATOM   5630 C CE  . MET D 2 300 ? 40.574  -3.510   -61.660  1.00 60.79  ? 300 MET D CE  1 
ATOM   5631 N N   . ILE D 2 301 ? 43.084  -8.422   -58.331  1.00 38.75  ? 301 ILE D N   1 
ATOM   5632 C CA  . ILE D 2 301 ? 44.211  -8.458   -57.429  1.00 39.03  ? 301 ILE D CA  1 
ATOM   5633 C C   . ILE D 2 301 ? 45.359  -9.178   -58.139  1.00 41.80  ? 301 ILE D C   1 
ATOM   5634 O O   . ILE D 2 301 ? 45.169  -10.275  -58.689  1.00 39.87  ? 301 ILE D O   1 
ATOM   5635 C CB  . ILE D 2 301 ? 43.826  -9.175   -56.134  1.00 39.36  ? 301 ILE D CB  1 
ATOM   5636 C CG1 . ILE D 2 301 ? 42.719  -8.381   -55.409  1.00 41.21  ? 301 ILE D CG1 1 
ATOM   5637 C CG2 . ILE D 2 301 ? 45.027  -9.320   -55.232  1.00 38.48  ? 301 ILE D CG2 1 
ATOM   5638 C CD1 . ILE D 2 301 ? 41.997  -9.161   -54.335  1.00 41.19  ? 301 ILE D CD1 1 
ATOM   5639 N N   . GLY D 2 302 ? 46.546  -8.571   -58.097  1.00 39.58  ? 302 GLY D N   1 
ATOM   5640 C CA  . GLY D 2 302 ? 47.704  -9.098   -58.798  1.00 41.73  ? 302 GLY D CA  1 
ATOM   5641 C C   . GLY D 2 302 ? 47.975  -8.495   -60.153  1.00 43.60  ? 302 GLY D C   1 
ATOM   5642 O O   . GLY D 2 302 ? 48.817  -9.022   -60.896  1.00 46.12  ? 302 GLY D O   1 
ATOM   5643 N N   . PHE D 2 303 ? 47.291  -7.390   -60.470  1.00 44.24  ? 303 PHE D N   1 
ATOM   5644 C CA  . PHE D 2 303 ? 47.530  -6.642   -61.719  1.00 44.61  ? 303 PHE D CA  1 
ATOM   5645 C C   . PHE D 2 303 ? 47.791  -5.166   -61.426  1.00 49.35  ? 303 PHE D C   1 
ATOM   5646 O O   . PHE D 2 303 ? 47.797  -4.763   -60.251  1.00 48.87  ? 303 PHE D O   1 
ATOM   5647 C CB  . PHE D 2 303 ? 46.354  -6.833   -62.664  1.00 45.98  ? 303 PHE D CB  1 
ATOM   5648 C CG  . PHE D 2 303 ? 46.066  -8.264   -62.977  1.00 45.90  ? 303 PHE D CG  1 
ATOM   5649 C CD1 . PHE D 2 303 ? 46.785  -8.928   -63.962  1.00 44.26  ? 303 PHE D CD1 1 
ATOM   5650 C CD2 . PHE D 2 303 ? 45.086  -8.963   -62.272  1.00 47.00  ? 303 PHE D CD2 1 
ATOM   5651 C CE1 . PHE D 2 303 ? 46.526  -10.258  -64.257  1.00 43.56  ? 303 PHE D CE1 1 
ATOM   5652 C CE2 . PHE D 2 303 ? 44.826  -10.302  -62.557  1.00 46.38  ? 303 PHE D CE2 1 
ATOM   5653 C CZ  . PHE D 2 303 ? 45.543  -10.946  -63.560  1.00 46.65  ? 303 PHE D CZ  1 
ATOM   5654 N N   . ASP D 2 304 ? 48.038  -4.359   -62.470  1.00 52.42  ? 304 ASP D N   1 
ATOM   5655 C CA  . ASP D 2 304 ? 48.331  -2.915   -62.276  1.00 56.12  ? 304 ASP D CA  1 
ATOM   5656 C C   . ASP D 2 304 ? 47.238  -2.183   -61.453  1.00 52.34  ? 304 ASP D C   1 
ATOM   5657 O O   . ASP D 2 304 ? 47.520  -1.283   -60.655  1.00 50.11  ? 304 ASP D O   1 
ATOM   5658 C CB  . ASP D 2 304 ? 48.527  -2.202   -63.629  1.00 64.83  ? 304 ASP D CB  1 
ATOM   5659 C CG  . ASP D 2 304 ? 49.757  -2.710   -64.409  1.00 75.17  ? 304 ASP D CG  1 
ATOM   5660 O OD1 . ASP D 2 304 ? 50.876  -2.685   -63.853  1.00 72.59  ? 304 ASP D OD1 1 
ATOM   5661 O OD2 . ASP D 2 304 ? 49.601  -3.120   -65.589  1.00 81.29  ? 304 ASP D OD2 1 
ATOM   5662 N N   . MET D 2 305 ? 45.992  -2.607   -61.648  1.00 53.59  ? 305 MET D N   1 
ATOM   5663 C CA  . MET D 2 305 ? 44.814  -1.976   -61.067  1.00 51.24  ? 305 MET D CA  1 
ATOM   5664 C C   . MET D 2 305 ? 44.402  -2.681   -59.758  1.00 44.98  ? 305 MET D C   1 
ATOM   5665 O O   . MET D 2 305 ? 43.273  -2.573   -59.340  1.00 42.81  ? 305 MET D O   1 
ATOM   5666 C CB  . MET D 2 305 ? 43.685  -2.061   -62.104  1.00 55.98  ? 305 MET D CB  1 
ATOM   5667 C CG  . MET D 2 305 ? 42.524  -1.108   -61.878  1.00 62.01  ? 305 MET D CG  1 
ATOM   5668 S SD  . MET D 2 305 ? 42.829  0.551    -62.413  1.00 64.66  ? 305 MET D SD  1 
ATOM   5669 C CE  . MET D 2 305 ? 42.727  0.263    -64.160  1.00 60.42  ? 305 MET D CE  1 
ATOM   5670 N N   . THR D 2 306 ? 45.321  -3.391   -59.120  1.00 38.75  ? 306 THR D N   1 
ATOM   5671 C CA  . THR D 2 306 ? 45.045  -4.106   -57.887  1.00 40.55  ? 306 THR D CA  1 
ATOM   5672 C C   . THR D 2 306 ? 44.340  -3.177   -56.899  1.00 36.95  ? 306 THR D C   1 
ATOM   5673 O O   . THR D 2 306 ? 44.879  -2.144   -56.577  1.00 41.01  ? 306 THR D O   1 
ATOM   5674 C CB  . THR D 2 306 ? 46.354  -4.662   -57.296  1.00 41.20  ? 306 THR D CB  1 
ATOM   5675 O OG1 . THR D 2 306 ? 46.809  -5.761   -58.103  1.00 41.45  ? 306 THR D OG1 1 
ATOM   5676 C CG2 . THR D 2 306 ? 46.173  -5.159   -55.889  1.00 41.75  ? 306 THR D CG2 1 
ATOM   5677 N N   . PRO D 2 307 ? 43.118  -3.534   -56.450  1.00 36.75  ? 307 PRO D N   1 
ATOM   5678 C CA  . PRO D 2 307 ? 42.401  -2.710   -55.478  1.00 34.70  ? 307 PRO D CA  1 
ATOM   5679 C C   . PRO D 2 307 ? 42.610  -3.202   -54.059  1.00 35.17  ? 307 PRO D C   1 
ATOM   5680 O O   . PRO D 2 307 ? 42.952  -4.361   -53.861  1.00 34.83  ? 307 PRO D O   1 
ATOM   5681 C CB  . PRO D 2 307 ? 40.949  -2.916   -55.874  1.00 35.81  ? 307 PRO D CB  1 
ATOM   5682 C CG  . PRO D 2 307 ? 40.910  -4.325   -56.402  1.00 35.58  ? 307 PRO D CG  1 
ATOM   5683 C CD  . PRO D 2 307 ? 42.271  -4.659   -56.919  1.00 33.90  ? 307 PRO D CD  1 
ATOM   5684 N N   . ASN D 2 308 ? 42.390  -2.329   -53.079  1.00 35.15  ? 308 ASN D N   1 
ATOM   5685 C CA  . ASN D 2 308 ? 42.463  -2.708   -51.675  1.00 31.33  ? 308 ASN D CA  1 
ATOM   5686 C C   . ASN D 2 308 ? 41.762  -1.704   -50.818  1.00 32.36  ? 308 ASN D C   1 
ATOM   5687 O O   . ASN D 2 308 ? 41.454  -0.613   -51.262  1.00 32.35  ? 308 ASN D O   1 
ATOM   5688 C CB  . ASN D 2 308 ? 43.907  -2.799   -51.190  1.00 34.40  ? 308 ASN D CB  1 
ATOM   5689 C CG  . ASN D 2 308 ? 44.059  -3.717   -49.964  1.00 33.64  ? 308 ASN D CG  1 
ATOM   5690 O OD1 . ASN D 2 308 ? 43.386  -4.725   -49.882  1.00 35.94  ? 308 ASN D OD1 1 
ATOM   5691 N ND2 . ASN D 2 308 ? 44.931  -3.368   -49.032  1.00 29.00  ? 308 ASN D ND2 1 
ATOM   5692 N N   . TYR D 2 309 ? 41.475  -2.139   -49.597  1.00 33.89  ? 309 TYR D N   1 
ATOM   5693 C CA  . TYR D 2 309 ? 41.046  -1.316   -48.502  1.00 33.74  ? 309 TYR D CA  1 
ATOM   5694 C C   . TYR D 2 309 ? 42.093  -0.214   -48.336  1.00 36.26  ? 309 TYR D C   1 
ATOM   5695 O O   . TYR D 2 309 ? 43.290  -0.498   -48.199  1.00 36.70  ? 309 TYR D O   1 
ATOM   5696 C CB  . TYR D 2 309 ? 40.927  -2.154   -47.213  1.00 35.21  ? 309 TYR D CB  1 
ATOM   5697 C CG  . TYR D 2 309 ? 39.912  -3.288   -47.367  1.00 35.47  ? 309 TYR D CG  1 
ATOM   5698 C CD1 . TYR D 2 309 ? 38.552  -3.053   -47.210  1.00 34.50  ? 309 TYR D CD1 1 
ATOM   5699 C CD2 . TYR D 2 309 ? 40.321  -4.581   -47.728  1.00 36.20  ? 309 TYR D CD2 1 
ATOM   5700 C CE1 . TYR D 2 309 ? 37.630  -4.072   -47.382  1.00 37.41  ? 309 TYR D CE1 1 
ATOM   5701 C CE2 . TYR D 2 309 ? 39.404  -5.613   -47.902  1.00 34.52  ? 309 TYR D CE2 1 
ATOM   5702 C CZ  . TYR D 2 309 ? 38.071  -5.366   -47.731  1.00 36.10  ? 309 TYR D CZ  1 
ATOM   5703 O OH  . TYR D 2 309 ? 37.149  -6.366   -47.934  1.00 35.70  ? 309 TYR D OH  1 
ATOM   5704 N N   . VAL D 2 310 ? 41.642  1.039    -48.415  1.00 36.01  ? 310 VAL D N   1 
ATOM   5705 C CA  . VAL D 2 310 ? 42.544  2.170    -48.343  1.00 37.21  ? 310 VAL D CA  1 
ATOM   5706 C C   . VAL D 2 310 ? 43.066  2.413    -46.934  1.00 38.98  ? 310 VAL D C   1 
ATOM   5707 O O   . VAL D 2 310 ? 44.030  3.133    -46.791  1.00 43.93  ? 310 VAL D O   1 
ATOM   5708 C CB  . VAL D 2 310 ? 41.926  3.475    -48.928  1.00 38.97  ? 310 VAL D CB  1 
ATOM   5709 C CG1 . VAL D 2 310 ? 41.498  3.240    -50.363  1.00 37.26  ? 310 VAL D CG1 1 
ATOM   5710 C CG2 . VAL D 2 310 ? 40.777  4.029    -48.070  1.00 38.11  ? 310 VAL D CG2 1 
ATOM   5711 N N   . ASP D 2 311 ? 42.426  1.836    -45.911  1.00 40.68  ? 311 ASP D N   1 
ATOM   5712 C CA  . ASP D 2 311 ? 42.818  2.036    -44.513  1.00 43.05  ? 311 ASP D CA  1 
ATOM   5713 C C   . ASP D 2 311 ? 42.177  0.966    -43.629  1.00 42.40  ? 311 ASP D C   1 
ATOM   5714 O O   . ASP D 2 311 ? 41.488  0.082    -44.134  1.00 46.42  ? 311 ASP D O   1 
ATOM   5715 C CB  . ASP D 2 311 ? 42.454  3.464    -44.009  1.00 46.22  ? 311 ASP D CB  1 
ATOM   5716 C CG  . ASP D 2 311 ? 40.951  3.708    -43.920  1.00 51.30  ? 311 ASP D CG  1 
ATOM   5717 O OD1 . ASP D 2 311 ? 40.154  2.749    -43.965  1.00 53.88  ? 311 ASP D OD1 1 
ATOM   5718 O OD2 . ASP D 2 311 ? 40.554  4.882    -43.804  1.00 64.12  ? 311 ASP D OD2 1 
ATOM   5719 N N   . SER D 2 312 ? 42.383  1.082    -42.315  1.00 43.55  ? 312 SER D N   1 
ATOM   5720 C CA  . SER D 2 312 ? 41.940  0.108    -41.328  1.00 48.72  ? 312 SER D CA  1 
ATOM   5721 C C   . SER D 2 312 ? 40.699  0.542    -40.515  1.00 52.46  ? 312 SER D C   1 
ATOM   5722 O O   . SER D 2 312 ? 40.551  0.184    -39.331  1.00 49.54  ? 312 SER D O   1 
ATOM   5723 C CB  . SER D 2 312 ? 43.109  -0.206   -40.387  1.00 53.32  ? 312 SER D CB  1 
ATOM   5724 O OG  . SER D 2 312 ? 43.507  0.963    -39.686  1.00 63.45  ? 312 SER D OG  1 
ATOM   5725 N N   . SER D 2 313 ? 39.794  1.276    -41.160  1.00 51.72  ? 313 SER D N   1 
ATOM   5726 C CA  . SER D 2 313 ? 38.491  1.604    -40.569  1.00 53.21  ? 313 SER D CA  1 
ATOM   5727 C C   . SER D 2 313 ? 37.616  0.352    -40.469  1.00 53.18  ? 313 SER D C   1 
ATOM   5728 O O   . SER D 2 313 ? 37.425  -0.343   -41.485  1.00 48.91  ? 313 SER D O   1 
ATOM   5729 C CB  . SER D 2 313 ? 37.779  2.644    -41.436  1.00 53.05  ? 313 SER D CB  1 
ATOM   5730 O OG  . SER D 2 313 ? 36.424  2.798    -41.033  1.00 59.07  ? 313 SER D OG  1 
ATOM   5731 N N   . PRO D 2 314 ? 37.053  0.062    -39.267  1.00 57.87  ? 314 PRO D N   1 
ATOM   5732 C CA  . PRO D 2 314 ? 36.320  -1.219   -39.201  1.00 60.36  ? 314 PRO D CA  1 
ATOM   5733 C C   . PRO D 2 314 ? 35.113  -1.363   -40.154  1.00 67.26  ? 314 PRO D C   1 
ATOM   5734 O O   . PRO D 2 314 ? 35.049  -2.330   -40.933  1.00 60.55  ? 314 PRO D O   1 
ATOM   5735 C CB  . PRO D 2 314 ? 35.857  -1.280   -37.742  1.00 59.26  ? 314 PRO D CB  1 
ATOM   5736 C CG  . PRO D 2 314 ? 36.829  -0.427   -37.012  1.00 58.82  ? 314 PRO D CG  1 
ATOM   5737 C CD  . PRO D 2 314 ? 37.075  0.719    -37.939  1.00 58.95  ? 314 PRO D CD  1 
ATOM   5738 N N   . THR D 2 315 ? 34.170  -0.417   -40.073  1.00 72.91  ? 315 THR D N   1 
ATOM   5739 C CA  . THR D 2 315 ? 32.941  -0.443   -40.901  1.00 72.18  ? 315 THR D CA  1 
ATOM   5740 C C   . THR D 2 315 ? 33.007  0.454    -42.118  1.00 68.90  ? 315 THR D C   1 
ATOM   5741 O O   . THR D 2 315 ? 32.619  0.023    -43.223  1.00 73.37  ? 315 THR D O   1 
ATOM   5742 C CB  . THR D 2 315 ? 31.678  -0.022   -40.130  1.00 73.53  ? 315 THR D CB  1 
ATOM   5743 O OG1 . THR D 2 315 ? 31.944  1.120    -39.298  1.00 75.17  ? 315 THR D OG1 1 
ATOM   5744 C CG2 . THR D 2 315 ? 31.193  -1.169   -39.280  1.00 72.97  ? 315 THR D CG2 1 
ATOM   5745 N N   . GLY D 2 316 ? 33.452  1.704    -41.927  1.00 61.03  ? 316 GLY D N   1 
ATOM   5746 C CA  . GLY D 2 316 ? 33.634  2.626    -43.059  1.00 60.57  ? 316 GLY D CA  1 
ATOM   5747 C C   . GLY D 2 316 ? 34.538  2.071    -44.166  1.00 57.89  ? 316 GLY D C   1 
ATOM   5748 O O   . GLY D 2 316 ? 35.663  2.551    -44.354  1.00 71.14  ? 316 GLY D O   1 
ATOM   5749 N N   . ILE D 2 317 ? 34.039  1.075    -44.902  1.00 47.66  ? 317 ILE D N   1 
ATOM   5750 C CA  . ILE D 2 317 ? 34.829  0.356    -45.881  1.00 47.30  ? 317 ILE D CA  1 
ATOM   5751 C C   . ILE D 2 317 ? 34.959  1.217    -47.144  1.00 43.73  ? 317 ILE D C   1 
ATOM   5752 O O   . ILE D 2 317 ? 33.990  1.698    -47.690  1.00 48.92  ? 317 ILE D O   1 
ATOM   5753 C CB  . ILE D 2 317 ? 34.230  -1.007   -46.240  1.00 50.14  ? 317 ILE D CB  1 
ATOM   5754 C CG1 . ILE D 2 317 ? 34.301  -1.954   -45.025  1.00 54.15  ? 317 ILE D CG1 1 
ATOM   5755 C CG2 . ILE D 2 317 ? 34.969  -1.598   -47.430  1.00 51.08  ? 317 ILE D CG2 1 
ATOM   5756 C CD1 . ILE D 2 317 ? 33.872  -3.382   -45.286  1.00 53.07  ? 317 ILE D CD1 1 
ATOM   5757 N N   . VAL D 2 318 ? 36.184  1.417    -47.585  1.00 37.54  ? 318 VAL D N   1 
ATOM   5758 C CA  . VAL D 2 318 ? 36.464  2.091    -48.801  1.00 35.08  ? 318 VAL D CA  1 
ATOM   5759 C C   . VAL D 2 318 ? 37.600  1.331    -49.503  1.00 35.22  ? 318 VAL D C   1 
ATOM   5760 O O   . VAL D 2 318 ? 38.689  1.176    -48.927  1.00 37.41  ? 318 VAL D O   1 
ATOM   5761 C CB  . VAL D 2 318 ? 36.852  3.573    -48.554  1.00 36.45  ? 318 VAL D CB  1 
ATOM   5762 C CG1 . VAL D 2 318 ? 37.217  4.252    -49.849  1.00 33.76  ? 318 VAL D CG1 1 
ATOM   5763 C CG2 . VAL D 2 318 ? 35.709  4.345    -47.919  1.00 38.12  ? 318 VAL D CG2 1 
ATOM   5764 N N   . VAL D 2 319 ? 37.357  0.898    -50.739  1.00 31.96  ? 319 VAL D N   1 
ATOM   5765 C CA  . VAL D 2 319 ? 38.380  0.234    -51.535  1.00 32.74  ? 319 VAL D CA  1 
ATOM   5766 C C   . VAL D 2 319 ? 38.683  1.069    -52.763  1.00 33.68  ? 319 VAL D C   1 
ATOM   5767 O O   . VAL D 2 319 ? 37.808  1.762    -53.263  1.00 33.72  ? 319 VAL D O   1 
ATOM   5768 C CB  . VAL D 2 319 ? 37.975  -1.202   -51.925  1.00 31.42  ? 319 VAL D CB  1 
ATOM   5769 C CG1 . VAL D 2 319 ? 37.655  -2.017   -50.686  1.00 32.01  ? 319 VAL D CG1 1 
ATOM   5770 C CG2 . VAL D 2 319 ? 36.774  -1.241   -52.858  1.00 32.40  ? 319 VAL D CG2 1 
ATOM   5771 N N   . SER D 2 320 ? 39.914  0.995    -53.252  1.00 34.88  ? 320 SER D N   1 
ATOM   5772 C CA  . SER D 2 320 ? 40.303  1.728    -54.439  1.00 36.43  ? 320 SER D CA  1 
ATOM   5773 C C   . SER D 2 320 ? 41.548  1.105    -55.048  1.00 36.39  ? 320 SER D C   1 
ATOM   5774 O O   . SER D 2 320 ? 42.343  0.530    -54.315  1.00 36.31  ? 320 SER D O   1 
ATOM   5775 C CB  . SER D 2 320 ? 40.576  3.200    -54.029  1.00 41.27  ? 320 SER D CB  1 
ATOM   5776 O OG  . SER D 2 320 ? 41.414  3.915    -54.960  1.00 42.86  ? 320 SER D OG  1 
ATOM   5777 N N   . PRO D 2 321 ? 41.769  1.269    -56.367  1.00 39.48  ? 321 PRO D N   1 
ATOM   5778 C CA  . PRO D 2 321 ? 43.133  1.001    -56.868  1.00 43.80  ? 321 PRO D CA  1 
ATOM   5779 C C   . PRO D 2 321 ? 44.116  2.066    -56.355  1.00 42.84  ? 321 PRO D C   1 
ATOM   5780 O O   . PRO D 2 321 ? 43.691  3.039    -55.719  1.00 38.33  ? 321 PRO D O   1 
ATOM   5781 C CB  . PRO D 2 321 ? 42.993  1.116    -58.401  1.00 43.50  ? 321 PRO D CB  1 
ATOM   5782 C CG  . PRO D 2 321 ? 41.578  1.518    -58.673  1.00 41.73  ? 321 PRO D CG  1 
ATOM   5783 C CD  . PRO D 2 321 ? 40.971  1.976    -57.377  1.00 41.40  ? 321 PRO D CD  1 
ATOM   5784 N N   . TRP D 2 322 ? 45.406  1.891    -56.632  1.00 44.51  ? 322 TRP D N   1 
ATOM   5785 C CA  . TRP D 2 322 ? 46.418  2.841    -56.148  1.00 44.77  ? 322 TRP D CA  1 
ATOM   5786 C C   . TRP D 2 322 ? 46.554  3.975    -57.179  1.00 46.66  ? 322 TRP D C   1 
ATOM   5787 O O   . TRP D 2 322 ? 47.328  3.894    -58.131  1.00 45.79  ? 322 TRP D O   1 
ATOM   5788 C CB  . TRP D 2 322 ? 47.733  2.134    -55.855  1.00 45.16  ? 322 TRP D CB  1 
ATOM   5789 C CG  . TRP D 2 322 ? 48.768  3.020    -55.227  1.00 45.16  ? 322 TRP D CG  1 
ATOM   5790 C CD1 . TRP D 2 322 ? 49.848  3.551    -55.848  1.00 47.37  ? 322 TRP D CD1 1 
ATOM   5791 C CD2 . TRP D 2 322 ? 48.816  3.478    -53.880  1.00 44.59  ? 322 TRP D CD2 1 
ATOM   5792 N NE1 . TRP D 2 322 ? 50.566  4.317    -54.978  1.00 47.57  ? 322 TRP D NE1 1 
ATOM   5793 C CE2 . TRP D 2 322 ? 49.960  4.293    -53.760  1.00 43.73  ? 322 TRP D CE2 1 
ATOM   5794 C CE3 . TRP D 2 322 ? 47.998  3.289    -52.757  1.00 47.62  ? 322 TRP D CE3 1 
ATOM   5795 C CZ2 . TRP D 2 322 ? 50.338  4.900    -52.558  1.00 46.17  ? 322 TRP D CZ2 1 
ATOM   5796 C CZ3 . TRP D 2 322 ? 48.357  3.907    -51.556  1.00 48.54  ? 322 TRP D CZ3 1 
ATOM   5797 C CH2 . TRP D 2 322 ? 49.531  4.703    -51.468  1.00 48.27  ? 322 TRP D CH2 1 
ATOM   5798 N N   . CYS D 2 323 ? 45.733  5.001    -56.994  1.00 49.32  ? 323 CYS D N   1 
ATOM   5799 C CA  . CYS D 2 323 ? 45.618  6.104    -57.951  1.00 54.40  ? 323 CYS D CA  1 
ATOM   5800 C C   . CYS D 2 323 ? 44.780  7.210    -57.337  1.00 52.14  ? 323 CYS D C   1 
ATOM   5801 O O   . CYS D 2 323 ? 44.133  6.993    -56.318  1.00 47.82  ? 323 CYS D O   1 
ATOM   5802 C CB  . CYS D 2 323 ? 45.009  5.664    -59.302  1.00 56.95  ? 323 CYS D CB  1 
ATOM   5803 S SG  . CYS D 2 323 ? 43.229  5.273    -59.324  1.00 56.85  ? 323 CYS D SG  1 
ATOM   5804 N N   . SER D 2 324 ? 44.848  8.396    -57.942  1.00 52.44  ? 324 SER D N   1 
ATOM   5805 C CA  . SER D 2 324 ? 44.005  9.548    -57.565  1.00 52.96  ? 324 SER D CA  1 
ATOM   5806 C C   . SER D 2 324 ? 43.576  10.323   -58.811  1.00 58.11  ? 324 SER D C   1 
ATOM   5807 O O   . SER D 2 324 ? 44.022  10.055   -59.944  1.00 52.46  ? 324 SER D O   1 
ATOM   5808 C CB  . SER D 2 324 ? 44.744  10.508   -56.618  1.00 54.54  ? 324 SER D CB  1 
ATOM   5809 O OG  . SER D 2 324 ? 45.685  11.301   -57.345  1.00 56.27  ? 324 SER D OG  1 
ATOM   5810 N N   . CYS D 2 325 ? 42.712  11.303   -58.588  1.00 68.61  ? 325 CYS D N   1 
ATOM   5811 C CA  . CYS D 2 325 ? 42.260  12.178   -59.671  1.00 77.77  ? 325 CYS D CA  1 
ATOM   5812 C C   . CYS D 2 325 ? 42.994  13.526   -59.773  1.00 80.31  ? 325 CYS D C   1 
ATOM   5813 O O   . CYS D 2 325 ? 42.565  14.413   -60.496  1.00 88.38  ? 325 CYS D O   1 
ATOM   5814 C CB  . CYS D 2 325 ? 40.742  12.344   -59.581  1.00 77.97  ? 325 CYS D CB  1 
ATOM   5815 S SG  . CYS D 2 325 ? 39.879  10.955   -60.356  1.00 82.29  ? 325 CYS D SG  1 
ATOM   5816 N N   . ARG D 2 326 ? 44.115  13.661   -59.075  1.00 81.80  ? 326 ARG D N   1 
ATOM   5817 C CA  . ARG D 2 326 ? 44.976  14.827   -59.218  1.00 81.68  ? 326 ARG D CA  1 
ATOM   5818 C C   . ARG D 2 326 ? 45.648  14.804   -60.576  1.00 79.45  ? 326 ARG D C   1 
ATOM   5819 O O   . ARG D 2 326 ? 46.095  13.743   -61.027  1.00 72.84  ? 326 ARG D O   1 
ATOM   5820 C CB  . ARG D 2 326 ? 46.059  14.840   -58.146  1.00 89.97  ? 326 ARG D CB  1 
ATOM   5821 C CG  . ARG D 2 326 ? 45.605  15.402   -56.814  1.00 95.11  ? 326 ARG D CG  1 
ATOM   5822 C CD  . ARG D 2 326 ? 46.539  14.977   -55.689  1.00 104.33 ? 326 ARG D CD  1 
ATOM   5823 N NE  . ARG D 2 326 ? 47.953  15.285   -55.947  1.00 109.18 ? 326 ARG D NE  1 
ATOM   5824 C CZ  . ARG D 2 326 ? 48.981  14.434   -55.841  1.00 112.96 ? 326 ARG D CZ  1 
ATOM   5825 N NH1 . ARG D 2 326 ? 48.821  13.162   -55.452  1.00 109.09 ? 326 ARG D NH1 1 
ATOM   5826 N NH2 . ARG D 2 326 ? 50.207  14.871   -56.118  1.00 117.91 ? 326 ARG D NH2 1 
ATOM   5827 N N   . GLY D 2 327 ? 45.727  15.979   -61.205  1.00 71.72  ? 327 GLY D N   1 
ATOM   5828 C CA  . GLY D 2 327 ? 46.379  16.128   -62.499  1.00 74.94  ? 327 GLY D CA  1 
ATOM   5829 C C   . GLY D 2 327 ? 45.552  15.559   -63.635  1.00 75.14  ? 327 GLY D C   1 
ATOM   5830 O O   . GLY D 2 327 ? 46.090  14.982   -64.589  1.00 75.81  ? 327 GLY D O   1 
ATOM   5831 N N   . SER D 2 328 ? 44.238  15.710   -63.528  1.00 77.18  ? 328 SER D N   1 
ATOM   5832 C CA  . SER D 2 328 ? 43.329  15.229   -64.568  1.00 85.67  ? 328 SER D CA  1 
ATOM   5833 C C   . SER D 2 328 ? 43.201  16.268   -65.677  1.00 86.91  ? 328 SER D C   1 
ATOM   5834 O O   . SER D 2 328 ? 43.240  15.927   -66.871  1.00 82.60  ? 328 SER D O   1 
ATOM   5835 C CB  . SER D 2 328 ? 41.965  14.901   -63.966  1.00 86.43  ? 328 SER D CB  1 
ATOM   5836 O OG  . SER D 2 328 ? 42.110  13.975   -62.902  1.00 83.33  ? 328 SER D OG  1 
ATOM   5837 N N   . GLY D 2 329 ? 43.067  17.532   -65.260  1.00 94.23  ? 329 GLY D N   1 
ATOM   5838 C CA  . GLY D 2 329 ? 42.896  18.663   -66.165  1.00 93.41  ? 329 GLY D CA  1 
ATOM   5839 C C   . GLY D 2 329 ? 41.456  18.711   -66.634  1.00 91.92  ? 329 GLY D C   1 
ATOM   5840 O O   . GLY D 2 329 ? 40.543  18.973   -65.842  1.00 85.85  ? 329 GLY D O   1 
ATOM   5841 N N   . ASN D 2 330 ? 41.253  18.409   -67.914  1.00 88.15  ? 330 ASN D N   1 
ATOM   5842 C CA  . ASN D 2 330 ? 39.905  18.371   -68.506  1.00 95.35  ? 330 ASN D CA  1 
ATOM   5843 C C   . ASN D 2 330 ? 39.248  16.985   -68.443  1.00 91.27  ? 330 ASN D C   1 
ATOM   5844 O O   . ASN D 2 330 ? 38.208  16.764   -69.067  1.00 89.01  ? 330 ASN D O   1 
ATOM   5845 C CB  . ASN D 2 330 ? 39.944  18.877   -69.958  1.00 100.82 ? 330 ASN D CB  1 
ATOM   5846 C CG  . ASN D 2 330 ? 40.841  18.034   -70.859  1.00 103.83 ? 330 ASN D CG  1 
ATOM   5847 O OD1 . ASN D 2 330 ? 41.758  17.350   -70.394  1.00 106.66 ? 330 ASN D OD1 1 
ATOM   5848 N ND2 . ASN D 2 330 ? 40.589  18.097   -72.159  1.00 105.22 ? 330 ASN D ND2 1 
ATOM   5849 N N   . MET D 2 331 ? 39.866  16.065   -67.703  1.00 86.14  ? 331 MET D N   1 
ATOM   5850 C CA  . MET D 2 331 ? 39.331  14.734   -67.479  1.00 85.17  ? 331 MET D CA  1 
ATOM   5851 C C   . MET D 2 331 ? 38.837  14.532   -66.064  1.00 81.49  ? 331 MET D C   1 
ATOM   5852 O O   . MET D 2 331 ? 38.266  13.487   -65.772  1.00 85.37  ? 331 MET D O   1 
ATOM   5853 C CB  . MET D 2 331 ? 40.391  13.684   -67.792  1.00 90.67  ? 331 MET D CB  1 
ATOM   5854 C CG  . MET D 2 331 ? 40.217  13.014   -69.143  1.00 93.83  ? 331 MET D CG  1 
ATOM   5855 S SD  . MET D 2 331 ? 40.833  14.034   -70.477  1.00 101.32 ? 331 MET D SD  1 
ATOM   5856 C CE  . MET D 2 331 ? 41.880  12.842   -71.324  1.00 95.87  ? 331 MET D CE  1 
ATOM   5857 N N   . GLU D 2 332 ? 39.011  15.524   -65.195  1.00 77.89  ? 332 GLU D N   1 
ATOM   5858 C CA  . GLU D 2 332 ? 38.546  15.427   -63.814  1.00 79.65  ? 332 GLU D CA  1 
ATOM   5859 C C   . GLU D 2 332 ? 37.142  14.784   -63.694  1.00 82.34  ? 332 GLU D C   1 
ATOM   5860 O O   . GLU D 2 332 ? 36.842  14.112   -62.707  1.00 88.45  ? 332 GLU D O   1 
ATOM   5861 C CB  . GLU D 2 332 ? 38.574  16.807   -63.162  1.00 79.45  ? 332 GLU D CB  1 
ATOM   5862 C CG  . GLU D 2 332 ? 37.840  16.896   -61.832  1.00 85.63  ? 332 GLU D CG  1 
ATOM   5863 C CD  . GLU D 2 332 ? 38.053  18.212   -61.114  1.00 99.36  ? 332 GLU D CD  1 
ATOM   5864 O OE1 . GLU D 2 332 ? 38.750  19.102   -61.658  1.00 107.30 ? 332 GLU D OE1 1 
ATOM   5865 O OE2 . GLU D 2 332 ? 37.506  18.359   -59.997  1.00 103.71 ? 332 GLU D OE2 1 
ATOM   5866 N N   . GLU D 2 333 ? 36.294  14.997   -64.695  1.00 79.45  ? 333 GLU D N   1 
ATOM   5867 C CA  . GLU D 2 333 ? 34.952  14.413   -64.721  1.00 76.08  ? 333 GLU D CA  1 
ATOM   5868 C C   . GLU D 2 333 ? 35.018  12.901   -65.008  1.00 69.96  ? 333 GLU D C   1 
ATOM   5869 O O   . GLU D 2 333 ? 34.399  12.080   -64.317  1.00 58.32  ? 333 GLU D O   1 
ATOM   5870 C CB  . GLU D 2 333 ? 34.102  15.110   -65.788  1.00 81.42  ? 333 GLU D CB  1 
ATOM   5871 C CG  . GLU D 2 333 ? 32.719  15.502   -65.301  1.00 88.42  ? 333 GLU D CG  1 
ATOM   5872 C CD  . GLU D 2 333 ? 31.872  16.110   -66.410  1.00 98.06  ? 333 GLU D CD  1 
ATOM   5873 O OE1 . GLU D 2 333 ? 30.998  15.396   -66.954  1.00 98.26  ? 333 GLU D OE1 1 
ATOM   5874 O OE2 . GLU D 2 333 ? 32.088  17.298   -66.748  1.00 93.24  ? 333 GLU D OE2 1 
ATOM   5875 N N   . GLU D 2 334 ? 35.772  12.559   -66.041  1.00 63.27  ? 334 GLU D N   1 
ATOM   5876 C CA  . GLU D 2 334 ? 35.964  11.181   -66.442  1.00 65.67  ? 334 GLU D CA  1 
ATOM   5877 C C   . GLU D 2 334 ? 36.768  10.382   -65.386  1.00 70.52  ? 334 GLU D C   1 
ATOM   5878 O O   . GLU D 2 334 ? 36.417  9.237    -65.082  1.00 66.28  ? 334 GLU D O   1 
ATOM   5879 C CB  . GLU D 2 334 ? 36.658  11.123   -67.800  1.00 64.69  ? 334 GLU D CB  1 
ATOM   5880 C CG  . GLU D 2 334 ? 36.272  9.927    -68.635  1.00 69.56  ? 334 GLU D CG  1 
ATOM   5881 C CD  . GLU D 2 334 ? 37.316  9.585    -69.676  1.00 75.92  ? 334 GLU D CD  1 
ATOM   5882 O OE1 . GLU D 2 334 ? 37.816  10.523   -70.337  1.00 83.40  ? 334 GLU D OE1 1 
ATOM   5883 O OE2 . GLU D 2 334 ? 37.633  8.385    -69.837  1.00 71.98  ? 334 GLU D OE2 1 
ATOM   5884 N N   . CYS D 2 335 ? 37.821  10.992   -64.827  1.00 66.44  ? 335 CYS D N   1 
ATOM   5885 C CA  . CYS D 2 335 ? 38.663  10.319   -63.831  1.00 68.74  ? 335 CYS D CA  1 
ATOM   5886 C C   . CYS D 2 335 ? 37.864  9.989    -62.577  1.00 64.07  ? 335 CYS D C   1 
ATOM   5887 O O   . CYS D 2 335 ? 38.033  8.921    -62.014  1.00 61.43  ? 335 CYS D O   1 
ATOM   5888 C CB  . CYS D 2 335 ? 39.905  11.153   -63.460  1.00 68.19  ? 335 CYS D CB  1 
ATOM   5889 S SG  . CYS D 2 335 ? 40.922  10.487   -62.097  1.00 70.64  ? 335 CYS D SG  1 
ATOM   5890 N N   . GLU D 2 336 ? 37.033  10.927   -62.137  1.00 60.69  ? 336 GLU D N   1 
ATOM   5891 C CA  . GLU D 2 336 ? 36.264  10.770   -60.913  1.00 63.52  ? 336 GLU D CA  1 
ATOM   5892 C C   . GLU D 2 336 ? 35.175  9.715    -61.076  1.00 65.10  ? 336 GLU D C   1 
ATOM   5893 O O   . GLU D 2 336 ? 34.822  9.038    -60.112  1.00 62.90  ? 336 GLU D O   1 
ATOM   5894 C CB  . GLU D 2 336 ? 35.640  12.104   -60.480  1.00 66.40  ? 336 GLU D CB  1 
ATOM   5895 C CG  . GLU D 2 336 ? 36.594  13.014   -59.718  1.00 75.18  ? 336 GLU D CG  1 
ATOM   5896 C CD  . GLU D 2 336 ? 36.108  14.461   -59.568  1.00 88.18  ? 336 GLU D CD  1 
ATOM   5897 O OE1 . GLU D 2 336 ? 35.062  14.837   -60.151  1.00 91.66  ? 336 GLU D OE1 1 
ATOM   5898 O OE2 . GLU D 2 336 ? 36.788  15.241   -58.855  1.00 95.25  ? 336 GLU D OE2 1 
ATOM   5899 N N   . LYS D 2 337 ? 34.643  9.596    -62.292  1.00 63.56  ? 337 LYS D N   1 
ATOM   5900 C CA  . LYS D 2 337 ? 33.587  8.649    -62.598  1.00 61.49  ? 337 LYS D CA  1 
ATOM   5901 C C   . LYS D 2 337 ? 34.179  7.250    -62.551  1.00 60.09  ? 337 LYS D C   1 
ATOM   5902 O O   . LYS D 2 337 ? 33.539  6.296    -62.092  1.00 58.87  ? 337 LYS D O   1 
ATOM   5903 C CB  . LYS D 2 337 ? 33.027  8.913    -63.997  1.00 66.31  ? 337 LYS D CB  1 
ATOM   5904 C CG  . LYS D 2 337 ? 31.761  8.125    -64.330  1.00 69.23  ? 337 LYS D CG  1 
ATOM   5905 C CD  . LYS D 2 337 ? 31.581  7.906    -65.833  1.00 70.10  ? 337 LYS D CD  1 
ATOM   5906 C CE  . LYS D 2 337 ? 30.208  7.338    -66.171  1.00 77.11  ? 337 LYS D CE  1 
ATOM   5907 N NZ  . LYS D 2 337 ? 29.820  6.152    -65.345  1.00 81.92  ? 337 LYS D NZ  1 
ATOM   5908 N N   . PHE D 2 338 ? 35.398  7.142    -63.066  1.00 54.17  ? 338 PHE D N   1 
ATOM   5909 C CA  . PHE D 2 338 ? 36.121  5.893    -63.069  1.00 52.32  ? 338 PHE D CA  1 
ATOM   5910 C C   . PHE D 2 338 ? 36.435  5.433    -61.662  1.00 52.79  ? 338 PHE D C   1 
ATOM   5911 O O   . PHE D 2 338 ? 36.310  4.249    -61.357  1.00 50.76  ? 338 PHE D O   1 
ATOM   5912 C CB  . PHE D 2 338 ? 37.412  6.026    -63.835  1.00 51.33  ? 338 PHE D CB  1 
ATOM   5913 C CG  . PHE D 2 338 ? 38.277  4.824    -63.740  1.00 51.71  ? 338 PHE D CG  1 
ATOM   5914 C CD1 . PHE D 2 338 ? 38.150  3.804    -64.661  1.00 52.78  ? 338 PHE D CD1 1 
ATOM   5915 C CD2 . PHE D 2 338 ? 39.206  4.700    -62.710  1.00 54.84  ? 338 PHE D CD2 1 
ATOM   5916 C CE1 . PHE D 2 338 ? 38.956  2.679    -64.585  1.00 55.20  ? 338 PHE D CE1 1 
ATOM   5917 C CE2 . PHE D 2 338 ? 40.010  3.574    -62.623  1.00 54.87  ? 338 PHE D CE2 1 
ATOM   5918 C CZ  . PHE D 2 338 ? 39.889  2.569    -63.568  1.00 52.09  ? 338 PHE D CZ  1 
ATOM   5919 N N   . LEU D 2 339 ? 36.852  6.372    -60.820  1.00 49.10  ? 339 LEU D N   1 
ATOM   5920 C CA  . LEU D 2 339 ? 37.226  6.052    -59.477  1.00 48.45  ? 339 LEU D CA  1 
ATOM   5921 C C   . LEU D 2 339 ? 36.030  5.691    -58.609  1.00 51.90  ? 339 LEU D C   1 
ATOM   5922 O O   . LEU D 2 339 ? 36.148  4.845    -57.730  1.00 56.47  ? 339 LEU D O   1 
ATOM   5923 C CB  . LEU D 2 339 ? 38.006  7.203    -58.857  1.00 47.55  ? 339 LEU D CB  1 
ATOM   5924 C CG  . LEU D 2 339 ? 38.630  6.918    -57.478  1.00 48.22  ? 339 LEU D CG  1 
ATOM   5925 C CD1 . LEU D 2 339 ? 39.578  5.707    -57.536  1.00 46.85  ? 339 LEU D CD1 1 
ATOM   5926 C CD2 . LEU D 2 339 ? 39.353  8.145    -56.943  1.00 46.54  ? 339 LEU D CD2 1 
ATOM   5927 N N   . ARG D 2 340 ? 34.884  6.315    -58.868  1.00 52.26  ? 340 ARG D N   1 
ATOM   5928 C CA  . ARG D 2 340 ? 33.651  6.051    -58.111  1.00 51.10  ? 340 ARG D CA  1 
ATOM   5929 C C   . ARG D 2 340 ? 33.087  4.631    -58.266  1.00 44.47  ? 340 ARG D C   1 
ATOM   5930 O O   . ARG D 2 340 ? 32.396  4.126    -57.371  1.00 47.95  ? 340 ARG D O   1 
ATOM   5931 C CB  . ARG D 2 340 ? 32.558  7.088    -58.462  1.00 56.85  ? 340 ARG D CB  1 
ATOM   5932 C CG  . ARG D 2 340 ? 32.642  8.405    -57.668  1.00 58.37  ? 340 ARG D CG  1 
ATOM   5933 C CD  . ARG D 2 340 ? 31.331  9.194    -57.706  1.00 58.20  ? 340 ARG D CD  1 
ATOM   5934 N NE  . ARG D 2 340 ? 30.851  9.370    -59.082  1.00 64.18  ? 340 ARG D NE  1 
ATOM   5935 C CZ  . ARG D 2 340 ? 31.197  10.359   -59.917  1.00 63.62  ? 340 ARG D CZ  1 
ATOM   5936 N NH1 . ARG D 2 340 ? 30.696  10.378   -61.150  1.00 62.39  ? 340 ARG D NH1 1 
ATOM   5937 N NH2 . ARG D 2 340 ? 32.040  11.326   -59.547  1.00 64.81  ? 340 ARG D NH2 1 
ATOM   5938 N N   . ASP D 2 341 ? 33.365  3.989    -59.386  1.00 42.52  ? 341 ASP D N   1 
ATOM   5939 C CA  . ASP D 2 341 ? 33.064  2.561    -59.545  1.00 44.58  ? 341 ASP D CA  1 
ATOM   5940 C C   . ASP D 2 341 ? 33.698  1.633    -58.475  1.00 43.84  ? 341 ASP D C   1 
ATOM   5941 O O   . ASP D 2 341 ? 33.221  0.523    -58.261  1.00 39.71  ? 341 ASP D O   1 
ATOM   5942 C CB  . ASP D 2 341 ? 33.458  2.107    -60.935  1.00 45.12  ? 341 ASP D CB  1 
ATOM   5943 C CG  . ASP D 2 341 ? 32.473  2.578    -62.000  1.00 51.26  ? 341 ASP D CG  1 
ATOM   5944 O OD1 . ASP D 2 341 ? 31.315  2.892    -61.652  1.00 49.44  ? 341 ASP D OD1 1 
ATOM   5945 O OD2 . ASP D 2 341 ? 32.849  2.636    -63.189  1.00 56.54  ? 341 ASP D OD2 1 
ATOM   5946 N N   . PHE D 2 342 ? 34.759  2.118    -57.829  1.00 43.04  ? 342 PHE D N   1 
ATOM   5947 C CA  . PHE D 2 342 ? 35.413  1.477    -56.685  1.00 40.06  ? 342 PHE D CA  1 
ATOM   5948 C C   . PHE D 2 342 ? 34.993  2.113    -55.376  1.00 41.85  ? 342 PHE D C   1 
ATOM   5949 O O   . PHE D 2 342 ? 34.537  1.426    -54.445  1.00 45.37  ? 342 PHE D O   1 
ATOM   5950 C CB  . PHE D 2 342 ? 36.923  1.617    -56.828  1.00 38.30  ? 342 PHE D CB  1 
ATOM   5951 C CG  . PHE D 2 342 ? 37.488  0.895    -58.004  1.00 36.16  ? 342 PHE D CG  1 
ATOM   5952 C CD1 . PHE D 2 342 ? 37.923  -0.414   -57.881  1.00 41.22  ? 342 PHE D CD1 1 
ATOM   5953 C CD2 . PHE D 2 342 ? 37.604  1.512    -59.213  1.00 38.70  ? 342 PHE D CD2 1 
ATOM   5954 C CE1 . PHE D 2 342 ? 38.450  -1.101   -58.972  1.00 41.35  ? 342 PHE D CE1 1 
ATOM   5955 C CE2 . PHE D 2 342 ? 38.132  0.842    -60.306  1.00 40.97  ? 342 PHE D CE2 1 
ATOM   5956 C CZ  . PHE D 2 342 ? 38.549  -0.469   -60.184  1.00 40.32  ? 342 PHE D CZ  1 
ATOM   5957 N N   . THR D 2 343 ? 35.131  3.436    -55.295  1.00 46.04  ? 343 THR D N   1 
ATOM   5958 C CA  . THR D 2 343 ? 35.079  4.124    -54.001  1.00 47.27  ? 343 THR D CA  1 
ATOM   5959 C C   . THR D 2 343 ? 33.692  4.431    -53.549  1.00 50.13  ? 343 THR D C   1 
ATOM   5960 O O   . THR D 2 343 ? 33.442  4.459    -52.344  1.00 54.92  ? 343 THR D O   1 
ATOM   5961 C CB  . THR D 2 343 ? 35.895  5.423    -54.009  1.00 47.54  ? 343 THR D CB  1 
ATOM   5962 O OG1 . THR D 2 343 ? 35.413  6.287    -55.039  1.00 54.48  ? 343 THR D OG1 1 
ATOM   5963 C CG2 . THR D 2 343 ? 37.336  5.133    -54.273  1.00 45.13  ? 343 THR D CG2 1 
ATOM   5964 N N   . GLU D 2 344 ? 32.783  4.642    -54.497  1.00 52.74  ? 344 GLU D N   1 
ATOM   5965 C CA  . GLU D 2 344 ? 31.441  5.092    -54.173  1.00 57.90  ? 344 GLU D CA  1 
ATOM   5966 C C   . GLU D 2 344 ? 30.353  4.244    -54.853  1.00 57.46  ? 344 GLU D C   1 
ATOM   5967 O O   . GLU D 2 344 ? 29.335  4.754    -55.343  1.00 61.73  ? 344 GLU D O   1 
ATOM   5968 C CB  . GLU D 2 344 ? 31.329  6.555    -54.581  1.00 65.47  ? 344 GLU D CB  1 
ATOM   5969 C CG  . GLU D 2 344 ? 30.534  7.405    -53.604  1.00 77.62  ? 344 GLU D CG  1 
ATOM   5970 C CD  . GLU D 2 344 ? 31.346  8.536    -53.014  1.00 85.43  ? 344 GLU D CD  1 
ATOM   5971 O OE1 . GLU D 2 344 ? 31.204  8.747    -51.790  1.00 88.44  ? 344 GLU D OE1 1 
ATOM   5972 O OE2 . GLU D 2 344 ? 32.102  9.210    -53.771  1.00 83.65  ? 344 GLU D OE2 1 
ATOM   5973 N N   . ASN D 2 345 ? 30.556  2.939    -54.843  1.00 47.20  ? 345 ASN D N   1 
ATOM   5974 C CA  . ASN D 2 345 ? 29.731  2.043    -55.623  1.00 39.46  ? 345 ASN D CA  1 
ATOM   5975 C C   . ASN D 2 345 ? 28.822  1.245    -54.677  1.00 38.02  ? 345 ASN D C   1 
ATOM   5976 O O   . ASN D 2 345 ? 29.289  0.363    -53.966  1.00 36.54  ? 345 ASN D O   1 
ATOM   5977 C CB  . ASN D 2 345 ? 30.654  1.134    -56.430  1.00 39.67  ? 345 ASN D CB  1 
ATOM   5978 C CG  . ASN D 2 345 ? 29.896  0.125    -57.263  1.00 35.35  ? 345 ASN D CG  1 
ATOM   5979 O OD1 . ASN D 2 345 ? 28.701  -0.085   -57.050  1.00 33.49  ? 345 ASN D OD1 1 
ATOM   5980 N ND2 . ASN D 2 345 ? 30.589  -0.525   -58.184  1.00 28.57  ? 345 ASN D ND2 1 
ATOM   5981 N N   . PRO D 2 346 ? 27.520  1.558    -54.652  1.00 35.33  ? 346 PRO D N   1 
ATOM   5982 C CA  . PRO D 2 346 ? 26.648  0.819    -53.749  1.00 35.46  ? 346 PRO D CA  1 
ATOM   5983 C C   . PRO D 2 346 ? 26.598  -0.682   -54.029  1.00 37.39  ? 346 PRO D C   1 
ATOM   5984 O O   . PRO D 2 346 ? 26.330  -1.454   -53.105  1.00 35.84  ? 346 PRO D O   1 
ATOM   5985 C CB  . PRO D 2 346 ? 25.262  1.465    -53.943  1.00 34.04  ? 346 PRO D CB  1 
ATOM   5986 C CG  . PRO D 2 346 ? 25.361  2.300    -55.149  1.00 34.80  ? 346 PRO D CG  1 
ATOM   5987 C CD  . PRO D 2 346 ? 26.790  2.532    -55.482  1.00 35.56  ? 346 PRO D CD  1 
ATOM   5988 N N   . CYS D 2 347 ? 26.856  -1.103   -55.274  1.00 36.77  ? 347 CYS D N   1 
ATOM   5989 C CA  . CYS D 2 347 ? 26.900  -2.543   -55.563  1.00 36.56  ? 347 CYS D CA  1 
ATOM   5990 C C   . CYS D 2 347 ? 28.050  -3.236   -54.812  1.00 34.35  ? 347 CYS D C   1 
ATOM   5991 O O   . CYS D 2 347 ? 27.835  -4.201   -54.081  1.00 33.20  ? 347 CYS D O   1 
ATOM   5992 C CB  . CYS D 2 347 ? 26.981  -2.819   -57.084  1.00 36.14  ? 347 CYS D CB  1 
ATOM   5993 S SG  . CYS D 2 347 ? 27.387  -4.523   -57.460  1.00 37.10  ? 347 CYS D SG  1 
ATOM   5994 N N   . LEU D 2 348 ? 29.267  -2.760   -55.046  1.00 34.19  ? 348 LEU D N   1 
ATOM   5995 C CA  . LEU D 2 348 ? 30.458  -3.313   -54.408  1.00 32.36  ? 348 LEU D CA  1 
ATOM   5996 C C   . LEU D 2 348 ? 30.350  -3.214   -52.903  1.00 31.85  ? 348 LEU D C   1 
ATOM   5997 O O   . LEU D 2 348 ? 30.639  -4.153   -52.179  1.00 31.96  ? 348 LEU D O   1 
ATOM   5998 C CB  . LEU D 2 348 ? 31.666  -2.550   -54.867  1.00 36.14  ? 348 LEU D CB  1 
ATOM   5999 C CG  . LEU D 2 348 ? 33.047  -3.081   -54.506  1.00 38.85  ? 348 LEU D CG  1 
ATOM   6000 C CD1 . LEU D 2 348 ? 33.284  -4.482   -55.021  1.00 37.44  ? 348 LEU D CD1 1 
ATOM   6001 C CD2 . LEU D 2 348 ? 34.044  -2.119   -55.135  1.00 40.06  ? 348 LEU D CD2 1 
ATOM   6002 N N   . ARG D 2 349 ? 29.869  -2.077   -52.423  1.00 33.12  ? 349 ARG D N   1 
ATOM   6003 C CA  . ARG D 2 349 ? 29.674  -1.882   -50.997  1.00 32.58  ? 349 ARG D CA  1 
ATOM   6004 C C   . ARG D 2 349 ? 28.765  -2.957   -50.419  1.00 34.91  ? 349 ARG D C   1 
ATOM   6005 O O   . ARG D 2 349 ? 29.115  -3.601   -49.437  1.00 39.82  ? 349 ARG D O   1 
ATOM   6006 C CB  . ARG D 2 349 ? 29.045  -0.523   -50.752  1.00 33.48  ? 349 ARG D CB  1 
ATOM   6007 C CG  . ARG D 2 349 ? 28.680  -0.254   -49.302  1.00 34.02  ? 349 ARG D CG  1 
ATOM   6008 C CD  . ARG D 2 349 ? 27.614  0.810    -49.187  1.00 40.97  ? 349 ARG D CD  1 
ATOM   6009 N NE  . ARG D 2 349 ? 27.295  1.104    -47.796  1.00 41.91  ? 349 ARG D NE  1 
ATOM   6010 C CZ  . ARG D 2 349 ? 26.296  0.557    -47.099  1.00 47.48  ? 349 ARG D CZ  1 
ATOM   6011 N NH1 . ARG D 2 349 ? 25.472  -0.312   -47.647  1.00 47.52  ? 349 ARG D NH1 1 
ATOM   6012 N NH2 . ARG D 2 349 ? 26.114  0.887    -45.825  1.00 52.10  ? 349 ARG D NH2 1 
ATOM   6013 N N   . ASN D 2 350 ? 27.583  -3.115   -51.030  1.00 34.46  ? 350 ASN D N   1 
ATOM   6014 C CA  . ASN D 2 350 ? 26.596  -4.074   -50.582  1.00 34.14  ? 350 ASN D CA  1 
ATOM   6015 C C   . ASN D 2 350 ? 27.086  -5.509   -50.691  1.00 35.87  ? 350 ASN D C   1 
ATOM   6016 O O   . ASN D 2 350 ? 26.784  -6.334   -49.815  1.00 35.22  ? 350 ASN D O   1 
ATOM   6017 C CB  . ASN D 2 350 ? 25.289  -3.946   -51.351  1.00 34.60  ? 350 ASN D CB  1 
ATOM   6018 C CG  . ASN D 2 350 ? 24.534  -2.638   -51.103  1.00 36.94  ? 350 ASN D CG  1 
ATOM   6019 O OD1 . ASN D 2 350 ? 23.642  -2.269   -51.891  1.00 36.50  ? 350 ASN D OD1 1 
ATOM   6020 N ND2 . ASN D 2 350 ? 24.853  -1.938   -50.049  1.00 35.01  ? 350 ASN D ND2 1 
ATOM   6021 N N   . ALA D 2 351 ? 27.834  -5.808   -51.750  1.00 35.41  ? 351 ALA D N   1 
ATOM   6022 C CA  . ALA D 2 351 ? 28.330  -7.177   -51.955  1.00 36.62  ? 351 ALA D CA  1 
ATOM   6023 C C   . ALA D 2 351 ? 29.349  -7.565   -50.880  1.00 34.94  ? 351 ALA D C   1 
ATOM   6024 O O   . ALA D 2 351 ? 29.257  -8.630   -50.318  1.00 33.11  ? 351 ALA D O   1 
ATOM   6025 C CB  . ALA D 2 351 ? 28.937  -7.321   -53.344  1.00 36.33  ? 351 ALA D CB  1 
ATOM   6026 N N   . ILE D 2 352 ? 30.300  -6.671   -50.591  1.00 39.20  ? 352 ILE D N   1 
ATOM   6027 C CA  . ILE D 2 352 ? 31.298  -6.892   -49.542  1.00 39.54  ? 352 ILE D CA  1 
ATOM   6028 C C   . ILE D 2 352 ? 30.636  -6.996   -48.159  1.00 42.33  ? 352 ILE D C   1 
ATOM   6029 O O   . ILE D 2 352 ? 30.931  -7.891   -47.380  1.00 45.58  ? 352 ILE D O   1 
ATOM   6030 C CB  . ILE D 2 352 ? 32.388  -5.809   -49.570  1.00 38.50  ? 352 ILE D CB  1 
ATOM   6031 C CG1 . ILE D 2 352 ? 33.259  -5.985   -50.814  1.00 38.15  ? 352 ILE D CG1 1 
ATOM   6032 C CG2 . ILE D 2 352 ? 33.287  -5.899   -48.335  1.00 39.94  ? 352 ILE D CG2 1 
ATOM   6033 C CD1 . ILE D 2 352 ? 34.188  -4.811   -51.116  1.00 37.04  ? 352 ILE D CD1 1 
ATOM   6034 N N   . GLN D 2 353 ? 29.710  -6.103   -47.871  1.00 45.36  ? 353 GLN D N   1 
ATOM   6035 C CA  . GLN D 2 353 ? 28.988  -6.155   -46.591  1.00 45.31  ? 353 GLN D CA  1 
ATOM   6036 C C   . GLN D 2 353 ? 28.109  -7.405   -46.440  1.00 44.37  ? 353 GLN D C   1 
ATOM   6037 O O   . GLN D 2 353 ? 28.049  -7.983   -45.352  1.00 44.31  ? 353 GLN D O   1 
ATOM   6038 C CB  . GLN D 2 353 ? 28.178  -4.893   -46.444  1.00 49.00  ? 353 GLN D CB  1 
ATOM   6039 C CG  . GLN D 2 353 ? 27.599  -4.622   -45.082  1.00 60.24  ? 353 GLN D CG  1 
ATOM   6040 C CD  . GLN D 2 353 ? 26.955  -3.236   -45.012  1.00 69.35  ? 353 GLN D CD  1 
ATOM   6041 O OE1 . GLN D 2 353 ? 27.414  -2.282   -45.661  1.00 80.39  ? 353 GLN D OE1 1 
ATOM   6042 N NE2 . GLN D 2 353 ? 25.902  -3.114   -44.221  1.00 70.15  ? 353 GLN D NE2 1 
ATOM   6043 N N   . ALA D 2 354 ? 27.450  -7.851   -47.519  1.00 44.32  ? 354 ALA D N   1 
ATOM   6044 C CA  . ALA D 2 354 ? 26.577  -9.049   -47.429  1.00 44.33  ? 354 ALA D CA  1 
ATOM   6045 C C   . ALA D 2 354 ? 27.383  -10.320  -47.255  1.00 45.61  ? 354 ALA D C   1 
ATOM   6046 O O   . ALA D 2 354 ? 26.921  -11.271  -46.629  1.00 45.54  ? 354 ALA D O   1 
ATOM   6047 C CB  . ALA D 2 354 ? 25.663  -9.182   -48.636  1.00 44.09  ? 354 ALA D CB  1 
ATOM   6048 N N   . PHE D 2 355 ? 28.583  -10.342  -47.808  1.00 45.17  ? 355 PHE D N   1 
ATOM   6049 C CA  . PHE D 2 355 ? 29.410  -11.504  -47.640  1.00 49.50  ? 355 PHE D CA  1 
ATOM   6050 C C   . PHE D 2 355 ? 29.809  -11.694  -46.181  1.00 57.18  ? 355 PHE D C   1 
ATOM   6051 O O   . PHE D 2 355 ? 29.674  -12.793  -45.635  1.00 56.36  ? 355 PHE D O   1 
ATOM   6052 C CB  . PHE D 2 355 ? 30.670  -11.445  -48.487  1.00 46.89  ? 355 PHE D CB  1 
ATOM   6053 C CG  . PHE D 2 355 ? 31.379  -12.743  -48.503  1.00 46.91  ? 355 PHE D CG  1 
ATOM   6054 C CD1 . PHE D 2 355 ? 31.018  -13.717  -49.422  1.00 46.31  ? 355 PHE D CD1 1 
ATOM   6055 C CD2 . PHE D 2 355 ? 32.312  -13.048  -47.512  1.00 46.77  ? 355 PHE D CD2 1 
ATOM   6056 C CE1 . PHE D 2 355 ? 31.633  -14.952  -49.409  1.00 48.78  ? 355 PHE D CE1 1 
ATOM   6057 C CE2 . PHE D 2 355 ? 32.925  -14.278  -47.491  1.00 44.84  ? 355 PHE D CE2 1 
ATOM   6058 C CZ  . PHE D 2 355 ? 32.590  -15.229  -48.431  1.00 47.02  ? 355 PHE D CZ  1 
ATOM   6059 N N   . GLY D 2 356 ? 30.334  -10.621  -45.592  1.00 64.29  ? 356 GLY D N   1 
ATOM   6060 C CA  . GLY D 2 356 ? 30.755  -10.601  -44.192  1.00 69.77  ? 356 GLY D CA  1 
ATOM   6061 C C   . GLY D 2 356 ? 29.666  -10.887  -43.172  1.00 67.94  ? 356 GLY D C   1 
ATOM   6062 O O   . GLY D 2 356 ? 29.947  -11.446  -42.100  1.00 71.52  ? 356 GLY D O   1 
ATOM   6063 N N   . ASN D 2 357 ? 28.434  -10.492  -43.495  1.00 71.95  ? 357 ASN D N   1 
ATOM   6064 C CA  . ASN D 2 357 ? 27.267  -10.753  -42.625  1.00 74.95  ? 357 ASN D CA  1 
ATOM   6065 C C   . ASN D 2 357 ? 26.800  -12.219  -42.624  1.00 75.20  ? 357 ASN D C   1 
ATOM   6066 O O   . ASN D 2 357 ? 26.128  -12.640  -41.693  1.00 71.88  ? 357 ASN D O   1 
ATOM   6067 C CB  . ASN D 2 357 ? 26.106  -9.815   -42.993  1.00 72.91  ? 357 ASN D CB  1 
ATOM   6068 C CG  . ASN D 2 357 ? 26.371  -8.369   -42.584  1.00 78.43  ? 357 ASN D CG  1 
ATOM   6069 O OD1 . ASN D 2 357 ? 27.196  -8.099   -41.709  1.00 78.85  ? 357 ASN D OD1 1 
ATOM   6070 N ND2 . ASN D 2 357 ? 25.674  -7.428   -43.221  1.00 78.81  ? 357 ASN D ND2 1 
ATOM   6071 N N   . GLY D 2 358 ? 27.165  -12.985  -43.652  1.00 81.64  ? 358 GLY D N   1 
ATOM   6072 C CA  . GLY D 2 358 ? 26.768  -14.393  -43.770  1.00 88.58  ? 358 GLY D CA  1 
ATOM   6073 C C   . GLY D 2 358 ? 25.360  -14.617  -44.320  1.00 97.36  ? 358 GLY D C   1 
ATOM   6074 O O   . GLY D 2 358 ? 24.853  -15.745  -44.274  1.00 98.02  ? 358 GLY D O   1 
ATOM   6075 N N   . THR D 2 359 ? 24.738  -13.557  -44.850  1.00 104.40 ? 359 THR D N   1 
ATOM   6076 C CA  . THR D 2 359 ? 23.396  -13.625  -45.443  1.00 108.36 ? 359 THR D CA  1 
ATOM   6077 C C   . THR D 2 359 ? 23.150  -12.389  -46.311  1.00 98.36  ? 359 THR D C   1 
ATOM   6078 O O   . THR D 2 359 ? 22.920  -12.506  -47.515  1.00 86.59  ? 359 THR D O   1 
ATOM   6079 C CB  . THR D 2 359 ? 22.324  -13.745  -44.357  1.00 110.14 ? 359 THR D CB  1 
HETATM 6080 C C1  . PEG E 3 .   ? 70.175  -32.563  -38.249  1.00 83.11  ? 201 PEG A C1  1 
HETATM 6081 O O1  . PEG E 3 .   ? 69.228  -31.799  -37.490  1.00 77.14  ? 201 PEG A O1  1 
HETATM 6082 C C2  . PEG E 3 .   ? 71.094  -33.346  -37.324  1.00 83.63  ? 201 PEG A C2  1 
HETATM 6083 O O2  . PEG E 3 .   ? 72.114  -32.532  -36.738  1.00 84.79  ? 201 PEG A O2  1 
HETATM 6084 C C3  . PEG E 3 .   ? 73.364  -33.144  -36.400  1.00 79.35  ? 201 PEG A C3  1 
HETATM 6085 C C4  . PEG E 3 .   ? 74.497  -32.914  -37.427  1.00 78.82  ? 201 PEG A C4  1 
HETATM 6086 O O4  . PEG E 3 .   ? 75.811  -32.978  -36.831  1.00 78.82  ? 201 PEG A O4  1 
HETATM 6087 C C   . FMT F 4 .   ? 100.710 -83.809  -51.268  1.00 48.07  ? 501 FMT C C   1 
HETATM 6088 O O1  . FMT F 4 .   ? 101.239 -83.772  -52.455  1.00 43.94  ? 501 FMT C O1  1 
HETATM 6089 O O2  . FMT F 4 .   ? 99.581  -84.557  -51.011  1.00 32.95  ? 501 FMT C O2  1 
HETATM 6090 C C   . FMT G 4 .   ? 33.433  0.948    -51.498  1.00 51.00  ? 501 FMT D C   1 
HETATM 6091 O O1  . FMT G 4 .   ? 34.523  1.572    -51.579  1.00 37.71  ? 501 FMT D O1  1 
HETATM 6092 O O2  . FMT G 4 .   ? 32.571  0.949    -52.579  1.00 47.26  ? 501 FMT D O2  1 
HETATM 6093 C C   . FMT H 4 .   ? 41.959  4.361    -39.790  1.00 66.58  ? 502 FMT D C   1 
HETATM 6094 O O1  . FMT H 4 .   ? 43.000  3.830    -40.276  1.00 52.47  ? 502 FMT D O1  1 
HETATM 6095 O O2  . FMT H 4 .   ? 41.368  3.799    -38.682  1.00 58.03  ? 502 FMT D O2  1 
HETATM 6096 O O   . HOH I 5 .   ? 46.848  -37.167  -34.570  1.00 55.43  ? 301 HOH A O   1 
HETATM 6097 O O   . HOH I 5 .   ? 70.316  -40.754  -29.169  1.00 68.90  ? 302 HOH A O   1 
HETATM 6098 O O   . HOH I 5 .   ? 70.066  -59.365  -40.064  1.00 32.50  ? 303 HOH A O   1 
HETATM 6099 O O   . HOH I 5 .   ? 80.083  -56.963  -39.077  1.00 36.62  ? 304 HOH A O   1 
HETATM 6100 O O   . HOH I 5 .   ? 76.762  -58.229  -41.951  1.00 36.59  ? 305 HOH A O   1 
HETATM 6101 O O   . HOH I 5 .   ? 82.324  -57.027  -40.740  1.00 43.71  ? 306 HOH A O   1 
HETATM 6102 O O   . HOH I 5 .   ? 77.324  -26.813  -34.228  1.00 48.27  ? 307 HOH A O   1 
HETATM 6103 O O   . HOH I 5 .   ? 67.232  -30.250  -33.340  1.00 34.64  ? 308 HOH A O   1 
HETATM 6104 O O   . HOH I 5 .   ? 77.109  -75.182  -35.195  1.00 46.82  ? 309 HOH A O   1 
HETATM 6105 O O   . HOH I 5 .   ? 89.938  -64.377  -34.542  1.00 36.66  ? 310 HOH A O   1 
HETATM 6106 O O   . HOH I 5 .   ? 69.209  -30.370  -35.229  1.00 40.85  ? 311 HOH A O   1 
HETATM 6107 O O   . HOH I 5 .   ? 67.223  -33.567  -37.680  1.00 49.80  ? 312 HOH A O   1 
HETATM 6108 O O   . HOH I 5 .   ? 70.731  -55.252  -38.218  1.00 28.20  ? 313 HOH A O   1 
HETATM 6109 O O   . HOH I 5 .   ? 64.685  -35.462  -38.946  1.00 37.40  ? 314 HOH A O   1 
HETATM 6110 O O   . HOH I 5 .   ? 74.567  -43.586  -32.056  1.00 32.04  ? 315 HOH A O   1 
HETATM 6111 O O   . HOH I 5 .   ? 68.942  -47.555  -39.118  1.00 37.36  ? 316 HOH A O   1 
HETATM 6112 O O   . HOH I 5 .   ? 59.906  -36.478  -33.473  1.00 34.05  ? 317 HOH A O   1 
HETATM 6113 O O   . HOH I 5 .   ? 61.641  -24.745  -26.702  1.00 47.87  ? 318 HOH A O   1 
HETATM 6114 O O   . HOH I 5 .   ? 60.293  -22.612  -24.882  1.00 41.93  ? 319 HOH A O   1 
HETATM 6115 O O   . HOH I 5 .   ? 71.957  -58.016  -46.417  1.00 41.40  ? 320 HOH A O   1 
HETATM 6116 O O   . HOH I 5 .   ? 87.938  -64.018  -38.646  1.00 32.03  ? 321 HOH A O   1 
HETATM 6117 O O   . HOH I 5 .   ? 73.520  -69.443  -39.176  1.00 50.48  ? 322 HOH A O   1 
HETATM 6118 O O   . HOH I 5 .   ? 87.884  -72.280  -43.139  1.00 36.42  ? 323 HOH A O   1 
HETATM 6119 O O   . HOH I 5 .   ? 79.681  -64.258  -24.938  1.00 38.04  ? 324 HOH A O   1 
HETATM 6120 O O   . HOH I 5 .   ? 72.257  -39.636  -31.116  1.00 41.36  ? 325 HOH A O   1 
HETATM 6121 O O   . HOH I 5 .   ? 77.618  -64.615  -30.730  1.00 42.17  ? 326 HOH A O   1 
HETATM 6122 O O   . HOH I 5 .   ? 75.840  -69.327  -44.687  1.00 28.44  ? 327 HOH A O   1 
HETATM 6123 O O   . HOH I 5 .   ? 71.628  -31.354  -33.839  1.00 45.84  ? 328 HOH A O   1 
HETATM 6124 O O   . HOH I 5 .   ? 73.849  -36.241  -40.483  1.00 48.62  ? 329 HOH A O   1 
HETATM 6125 O O   . HOH I 5 .   ? 60.631  -30.601  -22.979  1.00 59.66  ? 330 HOH A O   1 
HETATM 6126 O O   . HOH I 5 .   ? 70.813  -34.889  -30.507  1.00 45.64  ? 331 HOH A O   1 
HETATM 6127 O O   . HOH I 5 .   ? 69.576  -27.637  -38.208  1.00 45.11  ? 332 HOH A O   1 
HETATM 6128 O O   . HOH I 5 .   ? 77.858  -71.464  -33.521  1.00 50.28  ? 333 HOH A O   1 
HETATM 6129 O O   . HOH I 5 .   ? 73.921  -60.064  -49.378  1.00 60.63  ? 334 HOH A O   1 
HETATM 6130 O O   . HOH I 5 .   ? 86.148  -71.109  -33.713  1.00 43.45  ? 335 HOH A O   1 
HETATM 6131 O O   . HOH I 5 .   ? 75.280  -28.182  -30.940  1.00 57.17  ? 336 HOH A O   1 
HETATM 6132 O O   . HOH I 5 .   ? 80.387  -52.064  -42.754  1.00 48.20  ? 337 HOH A O   1 
HETATM 6133 O O   . HOH I 5 .   ? 71.333  -51.081  -45.891  1.00 52.42  ? 338 HOH A O   1 
HETATM 6134 O O   . HOH I 5 .   ? 74.181  -25.975  -37.760  1.00 57.78  ? 339 HOH A O   1 
HETATM 6135 O O   . HOH I 5 .   ? 68.321  -22.875  -33.311  1.00 59.13  ? 340 HOH A O   1 
HETATM 6136 O O   . HOH I 5 .   ? 56.261  -31.202  -18.106  1.00 63.48  ? 341 HOH A O   1 
HETATM 6137 O O   . HOH I 5 .   ? 81.774  -47.955  -44.677  1.00 52.84  ? 342 HOH A O   1 
HETATM 6138 O O   . HOH I 5 .   ? 52.719  -33.803  -23.348  1.00 53.46  ? 343 HOH A O   1 
HETATM 6139 O O   . HOH I 5 .   ? 89.624  -52.509  -32.588  1.00 46.02  ? 344 HOH A O   1 
HETATM 6140 O O   . HOH I 5 .   ? 78.685  -42.048  -42.719  1.00 51.24  ? 345 HOH A O   1 
HETATM 6141 O O   . HOH I 5 .   ? 74.188  -68.968  -42.270  1.00 37.68  ? 346 HOH A O   1 
HETATM 6142 O O   . HOH I 5 .   ? 64.639  -25.726  -38.432  1.00 30.47  ? 347 HOH A O   1 
HETATM 6143 O O   . HOH I 5 .   ? 63.884  -36.340  -26.587  1.00 34.78  ? 348 HOH A O   1 
HETATM 6144 O O   . HOH I 5 .   ? 71.478  -62.791  -40.492  1.00 45.66  ? 349 HOH A O   1 
HETATM 6145 O O   . HOH I 5 .   ? 74.695  -41.183  -30.555  1.00 42.80  ? 350 HOH A O   1 
HETATM 6146 O O   . HOH I 5 .   ? 72.362  -54.465  -46.709  1.00 58.42  ? 351 HOH A O   1 
HETATM 6147 O O   . HOH I 5 .   ? 68.609  -30.287  -30.942  1.00 44.16  ? 352 HOH A O   1 
HETATM 6148 O O   . HOH I 5 .   ? 84.060  -70.446  -29.494  1.00 65.32  ? 353 HOH A O   1 
HETATM 6149 O O   . HOH I 5 .   ? 86.033  -45.023  -39.364  1.00 64.19  ? 354 HOH A O   1 
HETATM 6150 O O   . HOH I 5 .   ? 89.514  -50.595  -41.839  1.00 61.53  ? 355 HOH A O   1 
HETATM 6151 O O   . HOH I 5 .   ? 63.177  -30.426  -23.114  1.00 59.84  ? 356 HOH A O   1 
HETATM 6152 O O   . HOH I 5 .   ? 92.476  -64.521  -33.405  1.00 45.60  ? 357 HOH A O   1 
HETATM 6153 O O   . HOH I 5 .   ? 67.990  -47.440  -42.134  1.00 59.66  ? 358 HOH A O   1 
HETATM 6154 O O   . HOH I 5 .   ? 68.586  -49.358  -44.189  1.00 59.48  ? 359 HOH A O   1 
HETATM 6155 O O   . HOH I 5 .   ? 89.289  -59.408  -31.197  1.00 60.06  ? 360 HOH A O   1 
HETATM 6156 O O   . HOH I 5 .   ? 67.725  -44.533  -43.332  1.00 56.20  ? 361 HOH A O   1 
HETATM 6157 O O   . HOH I 5 .   ? 89.905  -51.220  -35.534  1.00 67.52  ? 362 HOH A O   1 
HETATM 6158 O O   . HOH I 5 .   ? 76.009  -35.982  -39.551  1.00 59.46  ? 363 HOH A O   1 
HETATM 6159 O O   . HOH I 5 .   ? 67.233  -26.571  -39.159  1.00 41.63  ? 364 HOH A O   1 
HETATM 6160 O O   . HOH I 5 .   ? 72.019  -25.873  -39.406  1.00 63.08  ? 365 HOH A O   1 
HETATM 6161 O O   . HOH J 5 .   ? 63.907  -42.115  -29.000  1.00 62.11  ? 201 HOH B O   1 
HETATM 6162 O O   . HOH J 5 .   ? 62.890  -27.821  -38.266  1.00 31.62  ? 202 HOH B O   1 
HETATM 6163 O O   . HOH J 5 .   ? 66.740  -52.741  -33.388  1.00 37.32  ? 203 HOH B O   1 
HETATM 6164 O O   . HOH J 5 .   ? 64.004  -55.574  -37.803  1.00 57.38  ? 204 HOH B O   1 
HETATM 6165 O O   . HOH J 5 .   ? 61.509  -25.177  -46.312  1.00 48.95  ? 205 HOH B O   1 
HETATM 6166 O O   . HOH J 5 .   ? 73.906  -46.504  -33.756  1.00 32.69  ? 206 HOH B O   1 
HETATM 6167 O O   . HOH J 5 .   ? 53.518  -26.099  -38.953  1.00 44.46  ? 207 HOH B O   1 
HETATM 6168 O O   . HOH J 5 .   ? 43.904  -18.375  -34.504  1.00 40.79  ? 208 HOH B O   1 
HETATM 6169 O O   . HOH J 5 .   ? 86.930  -45.573  -34.751  1.00 49.64  ? 209 HOH B O   1 
HETATM 6170 O O   . HOH J 5 .   ? 66.560  -49.386  -40.818  1.00 59.84  ? 210 HOH B O   1 
HETATM 6171 O O   . HOH J 5 .   ? 59.368  -39.409  -31.773  1.00 33.11  ? 211 HOH B O   1 
HETATM 6172 O O   . HOH J 5 .   ? 54.053  -24.870  -47.459  1.00 50.51  ? 212 HOH B O   1 
HETATM 6173 O O   . HOH J 5 .   ? 59.471  -23.248  -49.262  1.00 61.83  ? 213 HOH B O   1 
HETATM 6174 O O   . HOH J 5 .   ? 56.180  -18.346  -30.851  1.00 42.24  ? 214 HOH B O   1 
HETATM 6175 O O   . HOH J 5 .   ? 45.819  -18.938  -38.482  1.00 35.34  ? 215 HOH B O   1 
HETATM 6176 O O   . HOH J 5 .   ? 62.297  -51.740  -33.647  1.00 49.95  ? 216 HOH B O   1 
HETATM 6177 O O   . HOH J 5 .   ? 63.716  -23.635  -39.985  1.00 35.63  ? 217 HOH B O   1 
HETATM 6178 O O   . HOH J 5 .   ? 65.547  -59.986  -33.254  1.00 48.75  ? 218 HOH B O   1 
HETATM 6179 O O   . HOH J 5 .   ? 57.163  -24.949  -41.772  1.00 40.57  ? 219 HOH B O   1 
HETATM 6180 O O   . HOH J 5 .   ? 58.594  -55.216  -30.607  1.00 59.13  ? 220 HOH B O   1 
HETATM 6181 O O   . HOH J 5 .   ? 56.877  -7.824   -35.385  1.00 57.66  ? 221 HOH B O   1 
HETATM 6182 O O   . HOH J 5 .   ? 60.152  -13.711  -39.453  1.00 48.04  ? 222 HOH B O   1 
HETATM 6183 O O   . HOH J 5 .   ? 73.387  -52.227  -23.152  1.00 48.74  ? 223 HOH B O   1 
HETATM 6184 O O   . HOH J 5 .   ? 83.551  -58.800  -24.467  1.00 49.19  ? 224 HOH B O   1 
HETATM 6185 O O   . HOH J 5 .   ? 66.897  -59.704  -36.183  1.00 53.52  ? 225 HOH B O   1 
HETATM 6186 O O   . HOH J 5 .   ? 53.962  -18.598  -24.817  1.00 44.06  ? 226 HOH B O   1 
HETATM 6187 O O   . HOH J 5 .   ? 64.567  -52.780  -34.905  1.00 41.48  ? 227 HOH B O   1 
HETATM 6188 O O   . HOH J 5 .   ? 87.041  -52.078  -26.215  1.00 63.25  ? 228 HOH B O   1 
HETATM 6189 O O   . HOH J 5 .   ? 67.878  -56.338  -26.094  1.00 43.59  ? 229 HOH B O   1 
HETATM 6190 O O   . HOH J 5 .   ? 50.388  -24.351  -24.973  1.00 66.96  ? 230 HOH B O   1 
HETATM 6191 O O   . HOH J 5 .   ? 59.721  -50.406  -28.762  1.00 58.94  ? 231 HOH B O   1 
HETATM 6192 O O   . HOH J 5 .   ? 59.110  -41.796  -30.383  1.00 39.01  ? 232 HOH B O   1 
HETATM 6193 O O   . HOH J 5 .   ? 62.159  -32.099  -45.823  1.00 39.67  ? 233 HOH B O   1 
HETATM 6194 O O   . HOH J 5 .   ? 56.236  -11.510  -33.568  1.00 47.65  ? 234 HOH B O   1 
HETATM 6195 O O   . HOH J 5 .   ? 59.562  -14.220  -42.338  1.00 33.53  ? 235 HOH B O   1 
HETATM 6196 O O   . HOH J 5 .   ? 56.679  -49.602  -35.567  1.00 55.91  ? 236 HOH B O   1 
HETATM 6197 O O   . HOH J 5 .   ? 75.087  -45.417  -24.770  1.00 53.49  ? 237 HOH B O   1 
HETATM 6198 O O   . HOH J 5 .   ? 54.843  -41.109  -42.272  1.00 50.91  ? 238 HOH B O   1 
HETATM 6199 O O   . HOH J 5 .   ? 65.444  -30.980  -44.059  1.00 55.79  ? 239 HOH B O   1 
HETATM 6200 O O   . HOH J 5 .   ? 47.728  -11.607  -33.837  1.00 50.62  ? 240 HOH B O   1 
HETATM 6201 O O   . HOH J 5 .   ? 81.477  -48.369  -23.746  1.00 51.73  ? 241 HOH B O   1 
HETATM 6202 O O   . HOH J 5 .   ? 44.174  -30.277  -32.030  1.00 52.96  ? 242 HOH B O   1 
HETATM 6203 O O   . HOH J 5 .   ? 72.404  -58.174  -26.287  1.00 50.39  ? 243 HOH B O   1 
HETATM 6204 O O   . HOH J 5 .   ? 61.510  -43.536  -30.700  1.00 50.61  ? 244 HOH B O   1 
HETATM 6205 O O   . HOH J 5 .   ? 68.930  -57.394  -38.409  1.00 36.90  ? 245 HOH B O   1 
HETATM 6206 O O   . HOH J 5 .   ? 54.902  -29.060  -47.018  1.00 49.88  ? 246 HOH B O   1 
HETATM 6207 O O   . HOH J 5 .   ? 62.274  -20.221  -40.561  1.00 51.26  ? 247 HOH B O   1 
HETATM 6208 O O   . HOH J 5 .   ? 87.323  -48.709  -24.609  1.00 61.92  ? 248 HOH B O   1 
HETATM 6209 O O   . HOH J 5 .   ? 61.015  -50.082  -35.605  1.00 55.17  ? 249 HOH B O   1 
HETATM 6210 O O   . HOH J 5 .   ? 60.926  -46.045  -29.843  1.00 64.91  ? 250 HOH B O   1 
HETATM 6211 O O   . HOH J 5 .   ? 74.352  -51.599  -20.713  1.00 48.55  ? 251 HOH B O   1 
HETATM 6212 O O   . HOH J 5 .   ? 63.133  -50.265  -37.407  1.00 66.99  ? 252 HOH B O   1 
HETATM 6213 O O   . HOH J 5 .   ? 41.487  -18.548  -33.294  1.00 47.68  ? 253 HOH B O   1 
HETATM 6214 O O   . HOH J 5 .   ? 66.370  -56.561  -38.903  1.00 42.53  ? 254 HOH B O   1 
HETATM 6215 O O   . HOH K 5 .   ? 87.986  -63.625  -81.296  1.00 43.72  ? 601 HOH C O   1 
HETATM 6216 O O   . HOH K 5 .   ? 93.795  -77.726  -51.023  1.00 43.84  ? 602 HOH C O   1 
HETATM 6217 O O   . HOH K 5 .   ? 104.421 -76.015  -42.864  1.00 63.52  ? 603 HOH C O   1 
HETATM 6218 O O   . HOH K 5 .   ? 98.181  -76.672  -79.064  1.00 54.92  ? 604 HOH C O   1 
HETATM 6219 O O   . HOH K 5 .   ? 96.247  -71.878  -63.777  1.00 34.25  ? 605 HOH C O   1 
HETATM 6220 O O   . HOH K 5 .   ? 100.015 -84.543  -38.375  1.00 56.64  ? 606 HOH C O   1 
HETATM 6221 O O   . HOH K 5 .   ? 82.189  -78.298  -46.011  1.00 38.75  ? 607 HOH C O   1 
HETATM 6222 O O   . HOH K 5 .   ? 88.639  -78.605  -83.512  1.00 53.05  ? 608 HOH C O   1 
HETATM 6223 O O   . HOH K 5 .   ? 87.537  -83.668  -40.241  1.00 58.67  ? 609 HOH C O   1 
HETATM 6224 O O   . HOH K 5 .   ? 94.081  -65.494  -54.931  1.00 37.38  ? 610 HOH C O   1 
HETATM 6225 O O   . HOH K 5 .   ? 111.696 -75.289  -49.414  1.00 58.65  ? 611 HOH C O   1 
HETATM 6226 O O   . HOH K 5 .   ? 112.083 -69.789  -60.632  1.00 53.03  ? 612 HOH C O   1 
HETATM 6227 O O   . HOH K 5 .   ? 101.297 -79.728  -68.780  1.00 48.79  ? 613 HOH C O   1 
HETATM 6228 O O   . HOH K 5 .   ? 87.577  -83.203  -57.498  1.00 37.47  ? 614 HOH C O   1 
HETATM 6229 O O   . HOH K 5 .   ? 92.645  -79.180  -31.584  1.00 46.42  ? 615 HOH C O   1 
HETATM 6230 O O   . HOH K 5 .   ? 91.536  -91.441  -53.742  1.00 67.32  ? 616 HOH C O   1 
HETATM 6231 O O   . HOH K 5 .   ? 93.724  -57.614  -43.177  1.00 44.84  ? 617 HOH C O   1 
HETATM 6232 O O   . HOH K 5 .   ? 102.860 -89.004  -61.143  1.00 56.97  ? 618 HOH C O   1 
HETATM 6233 O O   . HOH K 5 .   ? 100.250 -66.635  -69.050  1.00 62.36  ? 619 HOH C O   1 
HETATM 6234 O O   . HOH K 5 .   ? 97.861  -91.915  -54.190  1.00 52.50  ? 620 HOH C O   1 
HETATM 6235 O O   . HOH K 5 .   ? 102.089 -85.059  -48.848  1.00 78.11  ? 621 HOH C O   1 
HETATM 6236 O O   . HOH K 5 .   ? 101.760 -71.461  -67.045  1.00 54.69  ? 622 HOH C O   1 
HETATM 6237 O O   . HOH K 5 .   ? 104.677 -84.930  -60.839  1.00 51.18  ? 623 HOH C O   1 
HETATM 6238 O O   . HOH K 5 .   ? 98.225  -67.248  -41.231  1.00 45.43  ? 624 HOH C O   1 
HETATM 6239 O O   . HOH K 5 .   ? 98.296  -86.208  -63.006  1.00 47.02  ? 625 HOH C O   1 
HETATM 6240 O O   . HOH K 5 .   ? 101.606 -75.205  -45.067  1.00 42.76  ? 626 HOH C O   1 
HETATM 6241 O O   . HOH K 5 .   ? 87.917  -82.465  -47.748  1.00 29.46  ? 627 HOH C O   1 
HETATM 6242 O O   . HOH K 5 .   ? 73.558  -73.251  -52.832  1.00 38.57  ? 628 HOH C O   1 
HETATM 6243 O O   . HOH K 5 .   ? 74.671  -80.024  -54.428  1.00 44.29  ? 629 HOH C O   1 
HETATM 6244 O O   . HOH K 5 .   ? 88.083  -86.588  -48.095  1.00 40.99  ? 630 HOH C O   1 
HETATM 6245 O O   . HOH K 5 .   ? 95.497  -61.939  -38.678  1.00 48.56  ? 631 HOH C O   1 
HETATM 6246 O O   . HOH K 5 .   ? 74.184  -69.579  -46.781  1.00 39.75  ? 632 HOH C O   1 
HETATM 6247 O O   . HOH K 5 .   ? 94.704  -81.203  -69.669  1.00 36.54  ? 633 HOH C O   1 
HETATM 6248 O O   . HOH K 5 .   ? 83.297  -64.893  -54.068  1.00 34.29  ? 634 HOH C O   1 
HETATM 6249 O O   . HOH K 5 .   ? 91.500  -57.872  -50.986  1.00 44.39  ? 635 HOH C O   1 
HETATM 6250 O O   . HOH K 5 .   ? 106.664 -89.397  -54.782  1.00 45.53  ? 636 HOH C O   1 
HETATM 6251 O O   . HOH K 5 .   ? 84.817  -82.517  -56.808  1.00 53.06  ? 637 HOH C O   1 
HETATM 6252 O O   . HOH K 5 .   ? 91.491  -77.089  -51.690  1.00 34.33  ? 638 HOH C O   1 
HETATM 6253 O O   . HOH K 5 .   ? 85.657  -72.507  -98.297  1.00 44.77  ? 639 HOH C O   1 
HETATM 6254 O O   . HOH K 5 .   ? 95.529  -74.312  -62.916  1.00 33.04  ? 640 HOH C O   1 
HETATM 6255 O O   . HOH K 5 .   ? 84.934  -78.544  -64.992  1.00 52.87  ? 641 HOH C O   1 
HETATM 6256 O O   . HOH K 5 .   ? 90.098  -71.134  -58.575  1.00 32.19  ? 642 HOH C O   1 
HETATM 6257 O O   . HOH K 5 .   ? 92.706  -59.682  -90.776  1.00 51.85  ? 643 HOH C O   1 
HETATM 6258 O O   . HOH K 5 .   ? 89.155  -87.143  -50.858  1.00 47.06  ? 644 HOH C O   1 
HETATM 6259 O O   . HOH K 5 .   ? 117.733 -76.304  -57.590  1.00 47.90  ? 645 HOH C O   1 
HETATM 6260 O O   . HOH K 5 .   ? 96.596  -74.736  -79.938  1.00 53.66  ? 646 HOH C O   1 
HETATM 6261 O O   . HOH K 5 .   ? 84.559  -58.357  -40.729  1.00 39.63  ? 647 HOH C O   1 
HETATM 6262 O O   . HOH K 5 .   ? 106.597 -74.033  -60.932  1.00 39.59  ? 648 HOH C O   1 
HETATM 6263 O O   . HOH K 5 .   ? 98.247  -66.775  -67.075  1.00 56.36  ? 649 HOH C O   1 
HETATM 6264 O O   . HOH K 5 .   ? 91.939  -71.929  -43.515  1.00 42.54  ? 650 HOH C O   1 
HETATM 6265 O O   . HOH K 5 .   ? 78.745  -75.242  -43.038  1.00 35.65  ? 651 HOH C O   1 
HETATM 6266 O O   . HOH K 5 .   ? 91.227  -69.459  -42.733  1.00 42.66  ? 652 HOH C O   1 
HETATM 6267 O O   . HOH K 5 .   ? 89.903  -76.083  -48.281  1.00 29.00  ? 653 HOH C O   1 
HETATM 6268 O O   . HOH K 5 .   ? 97.109  -82.335  -68.952  1.00 40.71  ? 654 HOH C O   1 
HETATM 6269 O O   . HOH K 5 .   ? 94.300  -64.123  -45.206  1.00 38.95  ? 655 HOH C O   1 
HETATM 6270 O O   . HOH K 5 .   ? 93.627  -79.720  -43.761  1.00 38.25  ? 656 HOH C O   1 
HETATM 6271 O O   . HOH K 5 .   ? 91.222  -61.067  -98.182  1.00 37.51  ? 657 HOH C O   1 
HETATM 6272 O O   . HOH K 5 .   ? 90.969  -53.448  -40.955  1.00 62.86  ? 658 HOH C O   1 
HETATM 6273 O O   . HOH K 5 .   ? 83.353  -62.984  -44.496  1.00 36.17  ? 659 HOH C O   1 
HETATM 6274 O O   . HOH K 5 .   ? 86.287  -84.487  -48.099  1.00 42.45  ? 660 HOH C O   1 
HETATM 6275 O O   . HOH K 5 .   ? 100.284 -78.022  -41.630  1.00 34.30  ? 661 HOH C O   1 
HETATM 6276 O O   . HOH K 5 .   ? 86.124  -68.465  -64.151  1.00 67.77  ? 662 HOH C O   1 
HETATM 6277 O O   . HOH K 5 .   ? 85.261  -89.763  -68.839  1.00 50.71  ? 663 HOH C O   1 
HETATM 6278 O O   . HOH K 5 .   ? 92.773  -54.437  -45.171  1.00 60.21  ? 664 HOH C O   1 
HETATM 6279 O O   . HOH K 5 .   ? 99.940  -69.928  -64.914  1.00 57.02  ? 665 HOH C O   1 
HETATM 6280 O O   . HOH K 5 .   ? 100.834 -70.744  -42.043  1.00 50.07  ? 666 HOH C O   1 
HETATM 6281 O O   . HOH K 5 .   ? 94.966  -69.394  -59.023  1.00 54.23  ? 667 HOH C O   1 
HETATM 6282 O O   . HOH K 5 .   ? 107.182 -73.362  -63.624  1.00 55.34  ? 668 HOH C O   1 
HETATM 6283 O O   . HOH K 5 .   ? 78.276  -67.650  -58.183  1.00 46.22  ? 669 HOH C O   1 
HETATM 6284 O O   . HOH K 5 .   ? 98.829  -72.922  -36.779  1.00 42.76  ? 670 HOH C O   1 
HETATM 6285 O O   . HOH K 5 .   ? 86.239  -55.693  -43.369  1.00 45.94  ? 671 HOH C O   1 
HETATM 6286 O O   . HOH K 5 .   ? 99.636  -66.202  -38.874  1.00 46.63  ? 672 HOH C O   1 
HETATM 6287 O O   . HOH K 5 .   ? 89.345  -74.509  -96.487  1.00 41.12  ? 673 HOH C O   1 
HETATM 6288 O O   . HOH K 5 .   ? 100.605 -70.184  -61.778  1.00 45.10  ? 674 HOH C O   1 
HETATM 6289 O O   . HOH K 5 .   ? 100.628 -66.730  -71.869  1.00 60.84  ? 675 HOH C O   1 
HETATM 6290 O O   . HOH K 5 .   ? 88.498  -79.049  -74.929  1.00 48.60  ? 676 HOH C O   1 
HETATM 6291 O O   . HOH K 5 .   ? 106.881 -79.218  -66.182  1.00 59.00  ? 677 HOH C O   1 
HETATM 6292 O O   . HOH K 5 .   ? 88.623  -69.989  -42.147  1.00 44.23  ? 678 HOH C O   1 
HETATM 6293 O O   . HOH K 5 .   ? 84.419  -86.132  -58.610  1.00 42.83  ? 679 HOH C O   1 
HETATM 6294 O O   . HOH K 5 .   ? 89.720  -65.217  -37.081  1.00 40.77  ? 680 HOH C O   1 
HETATM 6295 O O   . HOH K 5 .   ? 77.346  -80.588  -54.066  1.00 51.18  ? 681 HOH C O   1 
HETATM 6296 O O   . HOH K 5 .   ? 86.813  -69.411  -45.554  1.00 39.91  ? 682 HOH C O   1 
HETATM 6297 O O   . HOH K 5 .   ? 96.864  -62.272  -45.091  1.00 56.50  ? 683 HOH C O   1 
HETATM 6298 O O   . HOH K 5 .   ? 92.205  -76.176  -97.036  1.00 60.28  ? 684 HOH C O   1 
HETATM 6299 O O   . HOH K 5 .   ? 83.601  -67.158  -61.660  1.00 57.11  ? 685 HOH C O   1 
HETATM 6300 O O   . HOH K 5 .   ? 101.265 -64.482  -51.847  1.00 60.36  ? 686 HOH C O   1 
HETATM 6301 O O   . HOH K 5 .   ? 81.577  -76.717  -61.986  1.00 61.37  ? 687 HOH C O   1 
HETATM 6302 O O   . HOH K 5 .   ? 90.441  -73.180  -36.057  1.00 47.27  ? 688 HOH C O   1 
HETATM 6303 O O   . HOH K 5 .   ? 113.589 -77.060  -63.734  1.00 54.00  ? 689 HOH C O   1 
HETATM 6304 O O   . HOH K 5 .   ? 90.040  -69.553  -60.482  1.00 39.11  ? 690 HOH C O   1 
HETATM 6305 O O   . HOH K 5 .   ? 95.887  -88.093  -44.777  1.00 55.71  ? 691 HOH C O   1 
HETATM 6306 O O   . HOH K 5 .   ? 70.662  -71.209  -56.511  1.00 48.67  ? 692 HOH C O   1 
HETATM 6307 O O   . HOH K 5 .   ? 70.713  -73.712  -45.985  1.00 48.12  ? 693 HOH C O   1 
HETATM 6308 O O   . HOH K 5 .   ? 101.398 -89.309  -73.139  1.00 61.96  ? 694 HOH C O   1 
HETATM 6309 O O   . HOH K 5 .   ? 95.036  -83.953  -45.521  1.00 45.20  ? 695 HOH C O   1 
HETATM 6310 O O   . HOH K 5 .   ? 102.058 -74.543  -37.465  1.00 64.54  ? 696 HOH C O   1 
HETATM 6311 O O   . HOH K 5 .   ? 99.303  -60.797  -52.897  1.00 48.84  ? 697 HOH C O   1 
HETATM 6312 O O   . HOH K 5 .   ? 113.263 -84.853  -63.598  1.00 40.04  ? 698 HOH C O   1 
HETATM 6313 O O   . HOH K 5 .   ? 74.869  -76.950  -59.944  1.00 55.56  ? 699 HOH C O   1 
HETATM 6314 O O   . HOH K 5 .   ? 87.156  -73.123  -35.555  1.00 62.40  ? 700 HOH C O   1 
HETATM 6315 O O   . HOH K 5 .   ? 98.320  -98.289  -67.169  1.00 49.75  ? 701 HOH C O   1 
HETATM 6316 O O   . HOH K 5 .   ? 78.595  -83.938  -49.155  1.00 54.26  ? 702 HOH C O   1 
HETATM 6317 O O   . HOH K 5 .   ? 89.347  -53.710  -49.638  1.00 52.38  ? 703 HOH C O   1 
HETATM 6318 O O   . HOH K 5 .   ? 103.025 -84.299  -45.387  1.00 62.24  ? 704 HOH C O   1 
HETATM 6319 O O   . HOH K 5 .   ? 97.358  -62.061  -56.278  1.00 50.83  ? 705 HOH C O   1 
HETATM 6320 O O   . HOH K 5 .   ? 87.962  -86.252  -72.905  1.00 62.20  ? 706 HOH C O   1 
HETATM 6321 O O   . HOH K 5 .   ? 90.939  -89.061  -69.740  1.00 63.23  ? 707 HOH C O   1 
HETATM 6322 O O   . HOH K 5 .   ? 98.104  -93.588  -56.507  1.00 54.86  ? 708 HOH C O   1 
HETATM 6323 O O   . HOH K 5 .   ? 90.369  -60.740  -75.099  1.00 60.70  ? 709 HOH C O   1 
HETATM 6324 O O   . HOH K 5 .   ? 109.588 -76.871  -47.937  1.00 56.74  ? 710 HOH C O   1 
HETATM 6325 O O   . HOH K 5 .   ? 89.919  -52.791  -45.779  1.00 66.63  ? 711 HOH C O   1 
HETATM 6326 O O   . HOH K 5 .   ? 83.627  -74.747  -66.079  1.00 61.03  ? 712 HOH C O   1 
HETATM 6327 O O   . HOH K 5 .   ? 108.584 -69.194  -55.288  1.00 49.75  ? 713 HOH C O   1 
HETATM 6328 O O   . HOH K 5 .   ? 87.290  -75.886  -36.439  1.00 63.72  ? 714 HOH C O   1 
HETATM 6329 O O   . HOH K 5 .   ? 94.696  -61.993  -57.673  1.00 63.21  ? 715 HOH C O   1 
HETATM 6330 O O   . HOH K 5 .   ? 105.465 -70.228  -65.056  1.00 55.13  ? 716 HOH C O   1 
HETATM 6331 O O   . HOH K 5 .   ? 105.065 -87.510  -58.357  1.00 52.48  ? 717 HOH C O   1 
HETATM 6332 O O   . HOH K 5 .   ? 80.127  -65.759  -57.917  1.00 52.82  ? 718 HOH C O   1 
HETATM 6333 O O   . HOH K 5 .   ? 93.045  -73.907  -31.663  1.00 71.49  ? 719 HOH C O   1 
HETATM 6334 O O   . HOH K 5 .   ? 72.109  -71.228  -45.780  1.00 60.90  ? 720 HOH C O   1 
HETATM 6335 O O   . HOH K 5 .   ? 79.604  -77.932  -44.007  1.00 54.46  ? 721 HOH C O   1 
HETATM 6336 O O   . HOH K 5 .   ? 93.524  -59.540  -57.128  1.00 63.48  ? 722 HOH C O   1 
HETATM 6337 O O   . HOH K 5 .   ? 86.457  -104.049 -52.377  1.00 71.01  ? 723 HOH C O   1 
HETATM 6338 O O   . HOH K 5 .   ? 80.235  -52.681  -45.272  1.00 52.51  ? 724 HOH C O   1 
HETATM 6339 O O   . HOH K 5 .   ? 109.176 -88.804  -55.727  1.00 45.42  ? 725 HOH C O   1 
HETATM 6340 O O   . HOH K 5 .   ? 93.214  -55.782  -51.623  1.00 57.53  ? 726 HOH C O   1 
HETATM 6341 O O   . HOH K 5 .   ? 89.022  -59.221  -97.289  1.00 47.97  ? 727 HOH C O   1 
HETATM 6342 O O   . HOH K 5 .   ? 95.566  -63.808  -90.923  1.00 66.78  ? 728 HOH C O   1 
HETATM 6343 O O   . HOH K 5 .   ? 107.660 -68.616  -52.648  1.00 60.59  ? 729 HOH C O   1 
HETATM 6344 O O   . HOH K 5 .   ? 102.235 -77.381  -43.463  1.00 49.26  ? 730 HOH C O   1 
HETATM 6345 O O   . HOH K 5 .   ? 91.410  -57.548  -89.674  1.00 61.04  ? 731 HOH C O   1 
HETATM 6346 O O   . HOH K 5 .   ? 120.326 -75.248  -56.527  1.00 65.98  ? 732 HOH C O   1 
HETATM 6347 O O   . HOH L 5 .   ? 34.199  1.770    -38.695  1.00 73.53  ? 601 HOH D O   1 
HETATM 6348 O O   . HOH L 5 .   ? 39.559  -17.781  -54.473  1.00 42.09  ? 602 HOH D O   1 
HETATM 6349 O O   . HOH L 5 .   ? 59.372  -13.785  -46.959  1.00 42.77  ? 603 HOH D O   1 
HETATM 6350 O O   . HOH L 5 .   ? 53.185  -10.334  -61.950  1.00 52.92  ? 604 HOH D O   1 
HETATM 6351 O O   . HOH L 5 .   ? 39.874  -5.228   -51.069  1.00 43.80  ? 605 HOH D O   1 
HETATM 6352 O O   . HOH L 5 .   ? 21.984  -7.562   -49.458  1.00 51.43  ? 606 HOH D O   1 
HETATM 6353 O O   . HOH L 5 .   ? 51.725  -4.899   -46.237  1.00 38.99  ? 607 HOH D O   1 
HETATM 6354 O O   . HOH L 5 .   ? 16.219  -6.476   -57.666  1.00 40.30  ? 608 HOH D O   1 
HETATM 6355 O O   . HOH L 5 .   ? 47.090  -13.817  -45.815  1.00 41.92  ? 609 HOH D O   1 
HETATM 6356 O O   . HOH L 5 .   ? 52.416  -19.229  -55.310  1.00 46.23  ? 610 HOH D O   1 
HETATM 6357 O O   . HOH L 5 .   ? 26.458  -4.977   -66.293  1.00 41.60  ? 611 HOH D O   1 
HETATM 6358 O O   . HOH L 5 .   ? 24.191  8.493    -57.606  1.00 52.29  ? 612 HOH D O   1 
HETATM 6359 O O   . HOH L 5 .   ? 32.136  -15.427  -56.989  1.00 55.55  ? 613 HOH D O   1 
HETATM 6360 O O   . HOH L 5 .   ? 41.685  -11.056  -43.593  1.00 40.95  ? 614 HOH D O   1 
HETATM 6361 O O   . HOH L 5 .   ? 47.633  1.357    -48.637  1.00 40.73  ? 615 HOH D O   1 
HETATM 6362 O O   . HOH L 5 .   ? 60.200  -10.416  -52.902  1.00 43.19  ? 616 HOH D O   1 
HETATM 6363 O O   . HOH L 5 .   ? 35.346  -15.510  -40.981  1.00 42.88  ? 617 HOH D O   1 
HETATM 6364 O O   . HOH L 5 .   ? 35.506  2.599    -63.466  1.00 47.59  ? 618 HOH D O   1 
HETATM 6365 O O   . HOH L 5 .   ? 45.775  3.429    -48.797  1.00 44.39  ? 619 HOH D O   1 
HETATM 6366 O O   . HOH L 5 .   ? 29.048  2.254    -60.375  1.00 38.67  ? 620 HOH D O   1 
HETATM 6367 O O   . HOH L 5 .   ? 43.400  -12.284  -58.518  1.00 37.46  ? 621 HOH D O   1 
HETATM 6368 O O   . HOH L 5 .   ? 46.148  -26.054  -55.735  1.00 55.51  ? 622 HOH D O   1 
HETATM 6369 O O   . HOH L 5 .   ? 40.009  -25.592  -42.670  1.00 40.31  ? 623 HOH D O   1 
HETATM 6370 O O   . HOH L 5 .   ? 23.366  -1.845   -46.942  1.00 56.35  ? 624 HOH D O   1 
HETATM 6371 O O   . HOH L 5 .   ? 45.979  -0.708   -48.082  1.00 37.62  ? 625 HOH D O   1 
HETATM 6372 O O   . HOH L 5 .   ? 32.050  -4.324   -68.984  1.00 56.65  ? 626 HOH D O   1 
HETATM 6373 O O   . HOH L 5 .   ? 49.123  -24.766  -40.451  1.00 38.64  ? 627 HOH D O   1 
HETATM 6374 O O   . HOH L 5 .   ? 42.528  -13.594  -42.654  1.00 41.14  ? 628 HOH D O   1 
HETATM 6375 O O   . HOH L 5 .   ? 46.322  -0.333   -57.990  1.00 39.66  ? 629 HOH D O   1 
HETATM 6376 O O   . HOH L 5 .   ? 29.791  10.207   -49.979  1.00 45.05  ? 630 HOH D O   1 
HETATM 6377 O O   . HOH L 5 .   ? 26.903  2.716    -62.244  1.00 44.56  ? 631 HOH D O   1 
HETATM 6378 O O   . HOH L 5 .   ? 38.072  -9.311   -62.988  1.00 34.49  ? 632 HOH D O   1 
HETATM 6379 O O   . HOH L 5 .   ? 37.481  -11.915  -63.554  1.00 36.92  ? 633 HOH D O   1 
HETATM 6380 O O   . HOH L 5 .   ? 38.735  -0.735   -43.853  1.00 43.84  ? 634 HOH D O   1 
HETATM 6381 O O   . HOH L 5 .   ? 59.884  -5.243   -58.008  1.00 50.83  ? 635 HOH D O   1 
HETATM 6382 O O   . HOH L 5 .   ? 44.761  -12.976  -41.876  1.00 42.62  ? 636 HOH D O   1 
HETATM 6383 O O   . HOH L 5 .   ? 42.088  -6.218   -52.031  1.00 39.41  ? 637 HOH D O   1 
HETATM 6384 O O   . HOH L 5 .   ? 26.936  -9.001   -61.012  1.00 35.85  ? 638 HOH D O   1 
HETATM 6385 O O   . HOH L 5 .   ? 21.564  2.629    -56.384  1.00 41.11  ? 639 HOH D O   1 
HETATM 6386 O O   . HOH L 5 .   ? 32.847  -13.147  -61.473  1.00 43.66  ? 640 HOH D O   1 
HETATM 6387 O O   . HOH L 5 .   ? 39.299  -18.836  -44.853  1.00 41.33  ? 641 HOH D O   1 
HETATM 6388 O O   . HOH L 5 .   ? 36.596  -1.653   -69.116  1.00 49.04  ? 642 HOH D O   1 
HETATM 6389 O O   . HOH L 5 .   ? 43.935  -7.015   -48.386  1.00 32.21  ? 643 HOH D O   1 
HETATM 6390 O O   . HOH L 5 .   ? 50.192  -18.611  -54.054  1.00 38.08  ? 644 HOH D O   1 
HETATM 6391 O O   . HOH L 5 .   ? 40.173  -3.232   -43.793  1.00 36.49  ? 645 HOH D O   1 
HETATM 6392 O O   . HOH L 5 .   ? 41.881  -25.311  -50.698  1.00 46.87  ? 646 HOH D O   1 
HETATM 6393 O O   . HOH L 5 .   ? 45.811  -10.835  -43.087  1.00 44.10  ? 647 HOH D O   1 
HETATM 6394 O O   . HOH L 5 .   ? 39.022  -2.861   -69.935  1.00 49.82  ? 648 HOH D O   1 
HETATM 6395 O O   . HOH L 5 .   ? 54.924  -7.842   -43.292  1.00 41.25  ? 649 HOH D O   1 
HETATM 6396 O O   . HOH L 5 .   ? 50.347  -20.359  -44.285  1.00 35.56  ? 650 HOH D O   1 
HETATM 6397 O O   . HOH L 5 .   ? 32.504  -7.344   -45.036  1.00 41.53  ? 651 HOH D O   1 
HETATM 6398 O O   . HOH L 5 .   ? 33.488  -4.745   -41.656  1.00 34.42  ? 652 HOH D O   1 
HETATM 6399 O O   . HOH L 5 .   ? 36.147  -7.373   -35.238  1.00 44.71  ? 653 HOH D O   1 
HETATM 6400 O O   . HOH L 5 .   ? 47.463  -27.409  -42.966  1.00 57.61  ? 654 HOH D O   1 
HETATM 6401 O O   . HOH L 5 .   ? 33.040  -12.030  -41.814  1.00 48.17  ? 655 HOH D O   1 
HETATM 6402 O O   . HOH L 5 .   ? 30.805  5.752    -61.605  1.00 60.85  ? 656 HOH D O   1 
HETATM 6403 O O   . HOH L 5 .   ? 18.601  3.099    -64.341  1.00 45.85  ? 657 HOH D O   1 
HETATM 6404 O O   . HOH L 5 .   ? 63.096  -12.222  -56.646  1.00 49.01  ? 658 HOH D O   1 
HETATM 6405 O O   . HOH L 5 .   ? 35.257  -9.478   -36.719  1.00 43.07  ? 659 HOH D O   1 
HETATM 6406 O O   . HOH L 5 .   ? 38.546  -14.252  -58.384  1.00 54.78  ? 660 HOH D O   1 
HETATM 6407 O O   . HOH L 5 .   ? 41.562  -20.936  -31.881  1.00 58.34  ? 661 HOH D O   1 
HETATM 6408 O O   . HOH L 5 .   ? 36.707  -20.734  -44.613  1.00 59.57  ? 662 HOH D O   1 
HETATM 6409 O O   . HOH L 5 .   ? 31.047  2.176    -50.450  1.00 70.22  ? 663 HOH D O   1 
HETATM 6410 O O   . HOH L 5 .   ? 43.423  -9.383   -36.067  1.00 45.82  ? 664 HOH D O   1 
HETATM 6411 O O   . HOH L 5 .   ? 34.225  -22.324  -52.364  1.00 52.57  ? 665 HOH D O   1 
HETATM 6412 O O   . HOH L 5 .   ? 35.912  -21.304  -55.639  1.00 46.40  ? 666 HOH D O   1 
HETATM 6413 O O   . HOH L 5 .   ? 38.003  -20.861  -38.031  1.00 44.39  ? 667 HOH D O   1 
HETATM 6414 O O   . HOH L 5 .   ? 38.895  0.882    -45.828  1.00 38.71  ? 668 HOH D O   1 
HETATM 6415 O O   . HOH L 5 .   ? 21.680  -13.416  -60.567  1.00 63.12  ? 669 HOH D O   1 
HETATM 6416 O O   . HOH L 5 .   ? 23.900  1.351    -64.636  1.00 40.28  ? 670 HOH D O   1 
HETATM 6417 O O   . HOH L 5 .   ? 43.360  -14.097  -60.359  1.00 45.47  ? 671 HOH D O   1 
HETATM 6418 O O   . HOH L 5 .   ? 41.483  -2.952   -31.888  1.00 56.52  ? 672 HOH D O   1 
HETATM 6419 O O   . HOH L 5 .   ? 51.448  -7.053   -62.423  1.00 63.57  ? 673 HOH D O   1 
HETATM 6420 O O   . HOH L 5 .   ? 38.979  -0.350   -32.682  1.00 58.82  ? 674 HOH D O   1 
HETATM 6421 O O   . HOH L 5 .   ? 62.833  -9.545   -46.037  1.00 48.35  ? 675 HOH D O   1 
HETATM 6422 O O   . HOH L 5 .   ? 57.981  -13.802  -44.589  1.00 32.45  ? 676 HOH D O   1 
HETATM 6423 O O   . HOH L 5 .   ? 63.999  -14.584  -47.263  1.00 65.06  ? 677 HOH D O   1 
HETATM 6424 O O   . HOH L 5 .   ? 55.419  0.440    -49.514  1.00 55.46  ? 678 HOH D O   1 
HETATM 6425 O O   . HOH L 5 .   ? 32.119  -18.217  -51.603  1.00 68.06  ? 679 HOH D O   1 
HETATM 6426 O O   . HOH L 5 .   ? 45.249  -5.670   -74.754  1.00 63.26  ? 680 HOH D O   1 
HETATM 6427 O O   . HOH L 5 .   ? 58.973  -6.617   -59.864  1.00 50.48  ? 681 HOH D O   1 
HETATM 6428 O O   . HOH L 5 .   ? 25.013  -13.638  -55.526  1.00 50.55  ? 682 HOH D O   1 
HETATM 6429 O O   . HOH L 5 .   ? 31.481  -2.413   -47.729  1.00 48.08  ? 683 HOH D O   1 
HETATM 6430 O O   . HOH L 5 .   ? 28.527  4.223    -58.345  1.00 49.57  ? 684 HOH D O   1 
HETATM 6431 O O   . HOH L 5 .   ? 43.731  -30.397  -45.458  1.00 51.06  ? 685 HOH D O   1 
HETATM 6432 O O   . HOH L 5 .   ? 31.571  -12.995  -65.475  1.00 63.75  ? 686 HOH D O   1 
HETATM 6433 O O   . HOH L 5 .   ? 39.042  -9.781   -100.132 1.00 47.63  ? 687 HOH D O   1 
HETATM 6434 O O   . HOH L 5 .   ? 30.396  -14.551  -40.959  1.00 72.00  ? 688 HOH D O   1 
HETATM 6435 O O   . HOH L 5 .   ? 46.452  -6.892   -36.510  1.00 59.35  ? 689 HOH D O   1 
HETATM 6436 O O   . HOH L 5 .   ? 40.271  -28.225  -44.095  1.00 60.59  ? 690 HOH D O   1 
HETATM 6437 O O   . HOH L 5 .   ? 56.933  -20.084  -52.040  1.00 61.23  ? 691 HOH D O   1 
HETATM 6438 O O   . HOH L 5 .   ? 35.671  -23.513  -45.044  1.00 70.36  ? 692 HOH D O   1 
HETATM 6439 O O   . HOH L 5 .   ? 37.854  -20.596  -35.026  1.00 58.99  ? 693 HOH D O   1 
HETATM 6440 O O   . HOH L 5 .   ? 53.501  -17.912  -57.891  1.00 47.18  ? 694 HOH D O   1 
HETATM 6441 O O   . HOH L 5 .   ? 39.726  -23.315  -56.966  1.00 58.60  ? 695 HOH D O   1 
HETATM 6442 O O   . HOH L 5 .   ? 54.221  -5.051   -44.269  1.00 53.78  ? 696 HOH D O   1 
HETATM 6443 O O   . HOH L 5 .   ? 25.609  4.658    -58.253  1.00 47.21  ? 697 HOH D O   1 
HETATM 6444 O O   . HOH L 5 .   ? 38.953  -23.297  -38.459  1.00 56.86  ? 698 HOH D O   1 
HETATM 6445 O O   . HOH L 5 .   ? 53.275  -30.453  -45.308  1.00 52.16  ? 699 HOH D O   1 
HETATM 6446 O O   . HOH L 5 .   ? 24.531  6.068    -55.889  1.00 42.19  ? 700 HOH D O   1 
HETATM 6447 O O   . HOH L 5 .   ? 37.063  -24.114  -56.374  1.00 64.33  ? 701 HOH D O   1 
HETATM 6448 O O   . HOH L 5 .   ? 39.990  -27.302  -51.515  1.00 53.62  ? 702 HOH D O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   ALA 1   96  ?   ?   ?   A . n 
A 1 2   ARG 2   97  ?   ?   ?   A . n 
A 1 3   LEU 3   98  ?   ?   ?   A . n 
A 1 4   GLY 4   99  ?   ?   ?   A . n 
A 1 5   ALA 5   100 100 ALA ALA A . n 
A 1 6   ARG 6   101 101 ARG ARG A . n 
A 1 7   PRO 7   102 102 PRO PRO A . n 
A 1 8   CYS 8   103 103 CYS CYS A . n 
A 1 9   GLY 9   104 104 GLY GLY A . n 
A 1 10  LEU 10  105 105 LEU LEU A . n 
A 1 11  ARG 11  106 106 ARG ARG A . n 
A 1 12  GLU 12  107 107 GLU GLU A . n 
A 1 13  LEU 13  108 108 LEU LEU A . n 
A 1 14  GLU 14  109 109 GLU GLU A . n 
A 1 15  VAL 15  110 110 VAL VAL A . n 
A 1 16  ARG 16  111 111 ARG ARG A . n 
A 1 17  VAL 17  112 112 VAL VAL A . n 
A 1 18  SER 18  113 113 SER SER A . n 
A 1 19  GLU 19  114 114 GLU GLU A . n 
A 1 20  LEU 20  115 115 LEU LEU A . n 
A 1 21  GLY 21  116 116 GLY GLY A . n 
A 1 22  LEU 22  117 117 LEU LEU A . n 
A 1 23  GLY 23  118 118 GLY GLY A . n 
A 1 24  TYR 24  119 119 TYR TYR A . n 
A 1 25  ALA 25  120 120 ALA ALA A . n 
A 1 26  SER 26  121 121 SER SER A . n 
A 1 27  ASP 27  122 122 ASP ASP A . n 
A 1 28  GLU 28  123 123 GLU GLU A . n 
A 1 29  THR 29  124 124 THR THR A . n 
A 1 30  VAL 30  125 125 VAL VAL A . n 
A 1 31  LEU 31  126 126 LEU LEU A . n 
A 1 32  PHE 32  127 127 PHE PHE A . n 
A 1 33  ARG 33  128 128 ARG ARG A . n 
A 1 34  TYR 34  129 129 TYR TYR A . n 
A 1 35  CYS 35  130 130 CYS CYS A . n 
A 1 36  ALA 36  131 131 ALA ALA A . n 
A 1 37  GLY 37  132 132 GLY GLY A . n 
A 1 38  ALA 38  133 133 ALA ALA A . n 
A 1 39  CYS 39  134 134 CYS CYS A . n 
A 1 40  GLU 40  135 135 GLU GLU A . n 
A 1 41  ALA 41  136 136 ALA ALA A . n 
A 1 42  ALA 42  137 137 ALA ALA A . n 
A 1 43  ALA 43  138 138 ALA ALA A . n 
A 1 44  ARG 44  139 139 ARG ARG A . n 
A 1 45  VAL 45  140 140 VAL VAL A . n 
A 1 46  TYR 46  141 141 TYR TYR A . n 
A 1 47  ASP 47  142 142 ASP ASP A . n 
A 1 48  LEU 48  143 143 LEU LEU A . n 
A 1 49  GLY 49  144 144 GLY GLY A . n 
A 1 50  LEU 50  145 145 LEU LEU A . n 
A 1 51  ARG 51  146 146 ARG ARG A . n 
A 1 52  ARG 52  147 147 ARG ARG A . n 
A 1 53  LEU 53  148 148 LEU LEU A . n 
A 1 54  ARG 54  149 149 ARG ARG A . n 
A 1 55  GLN 55  150 150 GLN GLN A . n 
A 1 56  ARG 56  151 151 ARG ARG A . n 
A 1 57  ARG 57  152 152 ARG ARG A . n 
A 1 58  ARG 58  153 153 ARG ARG A . n 
A 1 59  LEU 59  154 154 LEU LEU A . n 
A 1 60  ARG 60  155 155 ARG ARG A . n 
A 1 61  ARG 61  156 156 ARG ARG A . n 
A 1 62  GLU 62  157 157 GLU GLU A . n 
A 1 63  ARG 63  158 158 ARG ARG A . n 
A 1 64  VAL 64  159 159 VAL VAL A . n 
A 1 65  ARG 65  160 160 ARG ARG A . n 
A 1 66  ALA 66  161 161 ALA ALA A . n 
A 1 67  GLN 67  162 162 GLN GLN A . n 
A 1 68  PRO 68  163 163 PRO PRO A . n 
A 1 69  CYS 69  164 164 CYS CYS A . n 
A 1 70  CYS 70  165 165 CYS CYS A . n 
A 1 71  ARG 71  166 166 ARG ARG A . n 
A 1 72  PRO 72  167 167 PRO PRO A . n 
A 1 73  THR 73  168 168 THR THR A . n 
A 1 74  ALA 74  169 169 ALA ALA A . n 
A 1 75  TYR 75  170 170 TYR TYR A . n 
A 1 76  GLU 76  171 171 GLU GLU A . n 
A 1 77  ASP 77  172 172 ASP ASP A . n 
A 1 78  GLU 78  173 173 GLU GLU A . n 
A 1 79  VAL 79  174 174 VAL VAL A . n 
A 1 80  SER 80  175 175 SER SER A . n 
A 1 81  PHE 81  176 176 PHE PHE A . n 
A 1 82  LEU 82  177 177 LEU LEU A . n 
A 1 83  ASP 83  178 178 ASP ASP A . n 
A 1 84  ALA 84  179 179 ALA ALA A . n 
A 1 85  HIS 85  180 180 HIS HIS A . n 
A 1 86  SER 86  181 181 SER SER A . n 
A 1 87  ARG 87  182 182 ARG ARG A . n 
A 1 88  TYR 88  183 183 TYR TYR A . n 
A 1 89  HIS 89  184 184 HIS HIS A . n 
A 1 90  THR 90  185 185 THR THR A . n 
A 1 91  VAL 91  186 186 VAL VAL A . n 
A 1 92  HIS 92  187 187 HIS HIS A . n 
A 1 93  GLU 93  188 188 GLU GLU A . n 
A 1 94  LEU 94  189 189 LEU LEU A . n 
A 1 95  SER 95  190 190 SER SER A . n 
A 1 96  ALA 96  191 191 ALA ALA A . n 
A 1 97  ARG 97  192 192 ARG ARG A . n 
A 1 98  GLU 98  193 193 GLU GLU A . n 
A 1 99  CYS 99  194 194 CYS CYS A . n 
A 1 100 ALA 100 195 195 ALA ALA A . n 
A 1 101 CYS 101 196 196 CYS CYS A . n 
A 1 102 VAL 102 197 197 VAL VAL A . n 
B 1 1   ALA 1   96  ?   ?   ?   B . n 
B 1 2   ARG 2   97  ?   ?   ?   B . n 
B 1 3   LEU 3   98  ?   ?   ?   B . n 
B 1 4   GLY 4   99  ?   ?   ?   B . n 
B 1 5   ALA 5   100 100 ALA ALA B . n 
B 1 6   ARG 6   101 101 ARG ARG B . n 
B 1 7   PRO 7   102 102 PRO PRO B . n 
B 1 8   CYS 8   103 103 CYS CYS B . n 
B 1 9   GLY 9   104 104 GLY GLY B . n 
B 1 10  LEU 10  105 105 LEU LEU B . n 
B 1 11  ARG 11  106 106 ARG ARG B . n 
B 1 12  GLU 12  107 107 GLU GLU B . n 
B 1 13  LEU 13  108 108 LEU LEU B . n 
B 1 14  GLU 14  109 109 GLU GLU B . n 
B 1 15  VAL 15  110 110 VAL VAL B . n 
B 1 16  ARG 16  111 111 ARG ARG B . n 
B 1 17  VAL 17  112 112 VAL VAL B . n 
B 1 18  SER 18  113 113 SER SER B . n 
B 1 19  GLU 19  114 114 GLU GLU B . n 
B 1 20  LEU 20  115 115 LEU LEU B . n 
B 1 21  GLY 21  116 116 GLY GLY B . n 
B 1 22  LEU 22  117 117 LEU LEU B . n 
B 1 23  GLY 23  118 118 GLY GLY B . n 
B 1 24  TYR 24  119 119 TYR TYR B . n 
B 1 25  ALA 25  120 120 ALA ALA B . n 
B 1 26  SER 26  121 121 SER SER B . n 
B 1 27  ASP 27  122 122 ASP ASP B . n 
B 1 28  GLU 28  123 123 GLU GLU B . n 
B 1 29  THR 29  124 124 THR THR B . n 
B 1 30  VAL 30  125 125 VAL VAL B . n 
B 1 31  LEU 31  126 126 LEU LEU B . n 
B 1 32  PHE 32  127 127 PHE PHE B . n 
B 1 33  ARG 33  128 128 ARG ARG B . n 
B 1 34  TYR 34  129 129 TYR TYR B . n 
B 1 35  CYS 35  130 130 CYS CYS B . n 
B 1 36  ALA 36  131 131 ALA ALA B . n 
B 1 37  GLY 37  132 132 GLY GLY B . n 
B 1 38  ALA 38  133 133 ALA ALA B . n 
B 1 39  CYS 39  134 134 CYS CYS B . n 
B 1 40  GLU 40  135 135 GLU GLU B . n 
B 1 41  ALA 41  136 136 ALA ALA B . n 
B 1 42  ALA 42  137 137 ALA ALA B . n 
B 1 43  ALA 43  138 138 ALA ALA B . n 
B 1 44  ARG 44  139 139 ARG ARG B . n 
B 1 45  VAL 45  140 140 VAL VAL B . n 
B 1 46  TYR 46  141 141 TYR TYR B . n 
B 1 47  ASP 47  142 142 ASP ASP B . n 
B 1 48  LEU 48  143 143 LEU LEU B . n 
B 1 49  GLY 49  144 144 GLY GLY B . n 
B 1 50  LEU 50  145 145 LEU LEU B . n 
B 1 51  ARG 51  146 146 ARG ARG B . n 
B 1 52  ARG 52  147 147 ARG ARG B . n 
B 1 53  LEU 53  148 148 LEU LEU B . n 
B 1 54  ARG 54  149 149 ARG ARG B . n 
B 1 55  GLN 55  150 150 GLN GLN B . n 
B 1 56  ARG 56  151 151 ARG ARG B . n 
B 1 57  ARG 57  152 152 ARG ARG B . n 
B 1 58  ARG 58  153 153 ARG ARG B . n 
B 1 59  LEU 59  154 154 LEU LEU B . n 
B 1 60  ARG 60  155 155 ARG ARG B . n 
B 1 61  ARG 61  156 156 ARG ARG B . n 
B 1 62  GLU 62  157 157 GLU GLU B . n 
B 1 63  ARG 63  158 158 ARG ARG B . n 
B 1 64  VAL 64  159 159 VAL VAL B . n 
B 1 65  ARG 65  160 160 ARG ARG B . n 
B 1 66  ALA 66  161 161 ALA ALA B . n 
B 1 67  GLN 67  162 162 GLN GLN B . n 
B 1 68  PRO 68  163 163 PRO PRO B . n 
B 1 69  CYS 69  164 164 CYS CYS B . n 
B 1 70  CYS 70  165 165 CYS CYS B . n 
B 1 71  ARG 71  166 166 ARG ARG B . n 
B 1 72  PRO 72  167 167 PRO PRO B . n 
B 1 73  THR 73  168 168 THR THR B . n 
B 1 74  ALA 74  169 169 ALA ALA B . n 
B 1 75  TYR 75  170 170 TYR TYR B . n 
B 1 76  GLU 76  171 171 GLU GLU B . n 
B 1 77  ASP 77  172 172 ASP ASP B . n 
B 1 78  GLU 78  173 173 GLU GLU B . n 
B 1 79  VAL 79  174 174 VAL VAL B . n 
B 1 80  SER 80  175 175 SER SER B . n 
B 1 81  PHE 81  176 176 PHE PHE B . n 
B 1 82  LEU 82  177 177 LEU LEU B . n 
B 1 83  ASP 83  178 178 ASP ASP B . n 
B 1 84  ALA 84  179 179 ALA ALA B . n 
B 1 85  HIS 85  180 180 HIS HIS B . n 
B 1 86  SER 86  181 181 SER SER B . n 
B 1 87  ARG 87  182 182 ARG ARG B . n 
B 1 88  TYR 88  183 183 TYR TYR B . n 
B 1 89  HIS 89  184 184 HIS HIS B . n 
B 1 90  THR 90  185 185 THR THR B . n 
B 1 91  VAL 91  186 186 VAL VAL B . n 
B 1 92  HIS 92  187 187 HIS HIS B . n 
B 1 93  GLU 93  188 188 GLU GLU B . n 
B 1 94  LEU 94  189 189 LEU LEU B . n 
B 1 95  SER 95  190 190 SER SER B . n 
B 1 96  ALA 96  191 191 ALA ALA B . n 
B 1 97  ARG 97  192 192 ARG ARG B . n 
B 1 98  GLU 98  193 193 GLU GLU B . n 
B 1 99  CYS 99  194 194 CYS CYS B . n 
B 1 100 ALA 100 195 195 ALA ALA B . n 
B 1 101 CYS 101 196 196 CYS CYS B . n 
B 1 102 VAL 102 197 197 VAL VAL B . n 
C 2 1   MET 1   1   ?   ?   ?   C . n 
C 2 2   ILE 2   2   ?   ?   ?   C . n 
C 2 3   LEU 3   3   ?   ?   ?   C . n 
C 2 4   ALA 4   4   ?   ?   ?   C . n 
C 2 5   ASN 5   5   ?   ?   ?   C . n 
C 2 6   VAL 6   6   ?   ?   ?   C . n 
C 2 7   PHE 7   7   ?   ?   ?   C . n 
C 2 8   CYS 8   8   ?   ?   ?   C . n 
C 2 9   LEU 9   9   ?   ?   ?   C . n 
C 2 10  PHE 10  10  ?   ?   ?   C . n 
C 2 11  PHE 11  11  ?   ?   ?   C . n 
C 2 12  PHE 12  12  ?   ?   ?   C . n 
C 2 13  LEU 13  13  ?   ?   ?   C . n 
C 2 14  ASP 14  14  ?   ?   ?   C . n 
C 2 15  GLU 15  15  ?   ?   ?   C . n 
C 2 16  THR 16  16  ?   ?   ?   C . n 
C 2 17  LEU 17  17  ?   ?   ?   C . n 
C 2 18  ARG 18  18  ?   ?   ?   C . n 
C 2 19  SER 19  19  ?   ?   ?   C . n 
C 2 20  LEU 20  20  ?   ?   ?   C . n 
C 2 21  ALA 21  21  ?   ?   ?   C . n 
C 2 22  SER 22  22  ?   ?   ?   C . n 
C 2 23  PRO 23  23  ?   ?   ?   C . n 
C 2 24  SER 24  24  ?   ?   ?   C . n 
C 2 25  SER 25  25  ?   ?   ?   C . n 
C 2 26  LEU 26  26  ?   ?   ?   C . n 
C 2 27  GLN 27  27  ?   ?   ?   C . n 
C 2 28  GLY 28  28  ?   ?   ?   C . n 
C 2 29  PRO 29  29  ?   ?   ?   C . n 
C 2 30  GLU 30  30  ?   ?   ?   C . n 
C 2 31  LEU 31  31  ?   ?   ?   C . n 
C 2 32  HIS 32  32  ?   ?   ?   C . n 
C 2 33  GLY 33  33  ?   ?   ?   C . n 
C 2 34  TRP 34  34  ?   ?   ?   C . n 
C 2 35  ARG 35  35  ?   ?   ?   C . n 
C 2 36  PRO 36  36  36  PRO PRO C . n 
C 2 37  PRO 37  37  37  PRO PRO C . n 
C 2 38  VAL 38  38  38  VAL VAL C . n 
C 2 39  ASP 39  39  39  ASP ASP C . n 
C 2 40  CYS 40  40  40  CYS CYS C . n 
C 2 41  VAL 41  41  41  VAL VAL C . n 
C 2 42  ARG 42  42  42  ARG ARG C . n 
C 2 43  ALA 43  43  43  ALA ALA C . n 
C 2 44  ASN 44  44  44  ASN ASN C . n 
C 2 45  GLU 45  45  45  GLU GLU C . n 
C 2 46  LEU 46  46  46  LEU LEU C . n 
C 2 47  CYS 47  47  47  CYS CYS C . n 
C 2 48  ALA 48  48  48  ALA ALA C . n 
C 2 49  ALA 49  49  49  ALA ALA C . n 
C 2 50  GLU 50  50  50  GLU GLU C . n 
C 2 51  SER 51  51  51  SER SER C . n 
C 2 52  ASN 52  52  52  ASN ASN C . n 
C 2 53  CYS 53  53  53  CYS CYS C . n 
C 2 54  SER 54  54  54  SER SER C . n 
C 2 55  SER 55  55  55  SER SER C . n 
C 2 56  ARG 56  56  56  ARG ARG C . n 
C 2 57  TYR 57  57  57  TYR TYR C . n 
C 2 58  ARG 58  58  58  ARG ARG C . n 
C 2 59  THR 59  59  59  THR THR C . n 
C 2 60  LEU 60  60  60  LEU LEU C . n 
C 2 61  ARG 61  61  61  ARG ARG C . n 
C 2 62  GLN 62  62  62  GLN GLN C . n 
C 2 63  CYS 63  63  63  CYS CYS C . n 
C 2 64  LEU 64  64  64  LEU LEU C . n 
C 2 65  ALA 65  65  65  ALA ALA C . n 
C 2 66  GLY 66  66  66  GLY GLY C . n 
C 2 67  ARG 67  67  ?   ?   ?   C . n 
C 2 68  ASP 68  68  ?   ?   ?   C . n 
C 2 69  ARG 69  69  ?   ?   ?   C . n 
C 2 70  ASN 70  70  ?   ?   ?   C . n 
C 2 71  THR 71  71  ?   ?   ?   C . n 
C 2 72  MET 72  72  ?   ?   ?   C . n 
C 2 73  LEU 73  73  ?   ?   ?   C . n 
C 2 74  ALA 74  74  ?   ?   ?   C . n 
C 2 75  ASN 75  75  75  ASN ASN C . n 
C 2 76  LYS 76  76  76  LYS LYS C . n 
C 2 77  GLU 77  77  77  GLU GLU C . n 
C 2 78  CYS 78  78  78  CYS CYS C . n 
C 2 79  GLN 79  79  79  GLN GLN C . n 
C 2 80  ALA 80  80  80  ALA ALA C . n 
C 2 81  ALA 81  81  81  ALA ALA C . n 
C 2 82  LEU 82  82  82  LEU LEU C . n 
C 2 83  GLU 83  83  83  GLU GLU C . n 
C 2 84  VAL 84  84  84  VAL VAL C . n 
C 2 85  LEU 85  85  85  LEU LEU C . n 
C 2 86  GLN 86  86  86  GLN GLN C . n 
C 2 87  GLU 87  87  87  GLU GLU C . n 
C 2 88  SER 88  88  88  SER SER C . n 
C 2 89  PRO 89  89  89  PRO PRO C . n 
C 2 90  LEU 90  90  90  LEU LEU C . n 
C 2 91  TYR 91  91  91  TYR TYR C . n 
C 2 92  ASP 92  92  92  ASP ASP C . n 
C 2 93  CYS 93  93  93  CYS CYS C . n 
C 2 94  ARG 94  94  94  ARG ARG C . n 
C 2 95  CYS 95  95  95  CYS CYS C . n 
C 2 96  LYS 96  96  96  LYS LYS C . n 
C 2 97  ARG 97  97  97  ARG ARG C . n 
C 2 98  GLY 98  98  98  GLY GLY C . n 
C 2 99  MET 99  99  99  MET MET C . n 
C 2 100 LYS 100 100 100 LYS LYS C . n 
C 2 101 LYS 101 101 101 LYS LYS C . n 
C 2 102 GLU 102 102 102 GLU GLU C . n 
C 2 103 LEU 103 103 103 LEU LEU C . n 
C 2 104 GLN 104 104 104 GLN GLN C . n 
C 2 105 CYS 105 105 105 CYS CYS C . n 
C 2 106 LEU 106 106 106 LEU LEU C . n 
C 2 107 GLN 107 107 107 GLN GLN C . n 
C 2 108 ILE 108 108 108 ILE ILE C . n 
C 2 109 TYR 109 109 109 TYR TYR C . n 
C 2 110 TRP 110 110 110 TRP TRP C . n 
C 2 111 SER 111 111 111 SER SER C . n 
C 2 112 ILE 112 112 112 ILE ILE C . n 
C 2 113 HIS 113 113 113 HIS HIS C . n 
C 2 114 LEU 114 114 114 LEU LEU C . n 
C 2 115 GLY 115 115 115 GLY GLY C . n 
C 2 116 LEU 116 116 ?   ?   ?   C . n 
C 2 117 THR 117 117 ?   ?   ?   C . n 
C 2 118 GLU 118 118 ?   ?   ?   C . n 
C 2 119 GLY 119 119 ?   ?   ?   C . n 
C 2 120 GLU 120 120 ?   ?   ?   C . n 
C 2 121 GLU 121 121 121 GLU GLU C . n 
C 2 122 PHE 122 122 122 PHE PHE C . n 
C 2 123 TYR 123 123 123 TYR TYR C . n 
C 2 124 GLU 124 124 124 GLU GLU C . n 
C 2 125 ALA 125 125 125 ALA ALA C . n 
C 2 126 SER 126 126 126 SER SER C . n 
C 2 127 PRO 127 127 127 PRO PRO C . n 
C 2 128 TYR 128 128 128 TYR TYR C . n 
C 2 129 GLU 129 129 129 GLU GLU C . n 
C 2 130 PRO 130 130 130 PRO PRO C . n 
C 2 131 VAL 131 131 131 VAL VAL C . n 
C 2 132 THR 132 132 ?   ?   ?   C . n 
C 2 133 SER 133 133 ?   ?   ?   C . n 
C 2 134 ARG 134 134 ?   ?   ?   C . n 
C 2 135 LEU 135 135 ?   ?   ?   C . n 
C 2 136 SER 136 136 ?   ?   ?   C . n 
C 2 137 ASP 137 137 ?   ?   ?   C . n 
C 2 138 ILE 138 138 ?   ?   ?   C . n 
C 2 139 PHE 139 139 ?   ?   ?   C . n 
C 2 140 ARG 140 140 ?   ?   ?   C . n 
C 2 141 LEU 141 141 ?   ?   ?   C . n 
C 2 142 ALA 142 142 ?   ?   ?   C . n 
C 2 143 SER 143 143 ?   ?   ?   C . n 
C 2 144 ILE 144 144 ?   ?   ?   C . n 
C 2 145 PHE 145 145 ?   ?   ?   C . n 
C 2 146 SER 146 146 ?   ?   ?   C . n 
C 2 147 GLY 147 147 ?   ?   ?   C . n 
C 2 148 THR 148 148 ?   ?   ?   C . n 
C 2 149 GLY 149 149 ?   ?   ?   C . n 
C 2 150 ALA 150 150 ?   ?   ?   C . n 
C 2 151 ASP 151 151 ?   ?   ?   C . n 
C 2 152 PRO 152 152 ?   ?   ?   C . n 
C 2 153 VAL 153 153 ?   ?   ?   C . n 
C 2 154 VAL 154 154 ?   ?   ?   C . n 
C 2 155 SER 155 155 ?   ?   ?   C . n 
C 2 156 ALA 156 156 ?   ?   ?   C . n 
C 2 157 LYS 157 157 ?   ?   ?   C . n 
C 2 158 SER 158 158 158 SER SER C . n 
C 2 159 ASN 159 159 159 ASN ASN C . n 
C 2 160 HIS 160 160 160 HIS HIS C . n 
C 2 161 CYS 161 161 161 CYS CYS C . n 
C 2 162 LEU 162 162 162 LEU LEU C . n 
C 2 163 ASP 163 163 163 ASP ASP C . n 
C 2 164 ALA 164 164 164 ALA ALA C . n 
C 2 165 ALA 165 165 165 ALA ALA C . n 
C 2 166 LYS 166 166 166 LYS LYS C . n 
C 2 167 ALA 167 167 167 ALA ALA C . n 
C 2 168 CYS 168 168 168 CYS CYS C . n 
C 2 169 ASN 169 169 169 ASN ASN C . n 
C 2 170 LEU 170 170 170 LEU LEU C . n 
C 2 171 ASN 171 171 171 ASN ASN C . n 
C 2 172 ASP 172 172 172 ASP ASP C . n 
C 2 173 ASN 173 173 173 ASN ASN C . n 
C 2 174 CYS 174 174 174 CYS CYS C . n 
C 2 175 LYS 175 175 175 LYS LYS C . n 
C 2 176 LYS 176 176 176 LYS LYS C . n 
C 2 177 LEU 177 177 177 LEU LEU C . n 
C 2 178 ARG 178 178 178 ARG ARG C . n 
C 2 179 SER 179 179 179 SER SER C . n 
C 2 180 SER 180 180 180 SER SER C . n 
C 2 181 TYR 181 181 181 TYR TYR C . n 
C 2 182 ILE 182 182 182 ILE ILE C . n 
C 2 183 SER 183 183 183 SER SER C . n 
C 2 184 ILE 184 184 184 ILE ILE C . n 
C 2 185 CYS 185 185 185 CYS CYS C . n 
C 2 186 ASN 186 186 186 ASN ASN C . n 
C 2 187 ARG 187 187 187 ARG ARG C . n 
C 2 188 GLU 188 188 188 GLU GLU C . n 
C 2 189 ILE 189 189 189 ILE ILE C . n 
C 2 190 SER 190 190 190 SER SER C . n 
C 2 191 PRO 191 191 191 PRO PRO C . n 
C 2 192 THR 192 192 192 THR THR C . n 
C 2 193 GLU 193 193 193 GLU GLU C . n 
C 2 194 ARG 194 194 194 ARG ARG C . n 
C 2 195 CYS 195 195 195 CYS CYS C . n 
C 2 196 ASN 196 196 196 ASN ASN C . n 
C 2 197 ARG 197 197 197 ARG ARG C . n 
C 2 198 ARG 198 198 198 ARG ARG C . n 
C 2 199 LYS 199 199 199 LYS LYS C . n 
C 2 200 CYS 200 200 200 CYS CYS C . n 
C 2 201 HIS 201 201 201 HIS HIS C . n 
C 2 202 LYS 202 202 202 LYS LYS C . n 
C 2 203 ALA 203 203 203 ALA ALA C . n 
C 2 204 LEU 204 204 204 LEU LEU C . n 
C 2 205 ARG 205 205 205 ARG ARG C . n 
C 2 206 GLN 206 206 206 GLN GLN C . n 
C 2 207 PHE 207 207 207 PHE PHE C . n 
C 2 208 PHE 208 208 208 PHE PHE C . n 
C 2 209 ASP 209 209 209 ASP ASP C . n 
C 2 210 ARG 210 210 210 ARG ARG C . n 
C 2 211 VAL 211 211 211 VAL VAL C . n 
C 2 212 PRO 212 212 212 PRO PRO C . n 
C 2 213 SER 213 213 213 SER SER C . n 
C 2 214 GLU 214 214 214 GLU GLU C . n 
C 2 215 TYR 215 215 215 TYR TYR C . n 
C 2 216 THR 216 216 216 THR THR C . n 
C 2 217 TYR 217 217 217 TYR TYR C . n 
C 2 218 ARG 218 218 218 ARG ARG C . n 
C 2 219 MET 219 219 219 MET MET C . n 
C 2 220 LEU 220 220 220 LEU LEU C . n 
C 2 221 PHE 221 221 221 PHE PHE C . n 
C 2 222 CYS 222 222 222 CYS CYS C . n 
C 2 223 SER 223 223 223 SER SER C . n 
C 2 224 CYS 224 224 224 CYS CYS C . n 
C 2 225 GLN 225 225 225 GLN GLN C . n 
C 2 226 ASP 226 226 226 ASP ASP C . n 
C 2 227 GLN 227 227 227 GLN GLN C . n 
C 2 228 ALA 228 228 228 ALA ALA C . n 
C 2 229 CYS 229 229 229 CYS CYS C . n 
C 2 230 ALA 230 230 230 ALA ALA C . n 
C 2 231 GLU 231 231 231 GLU GLU C . n 
C 2 232 ARG 232 232 232 ARG ARG C . n 
C 2 233 ARG 233 233 233 ARG ARG C . n 
C 2 234 ARG 234 234 234 ARG ARG C . n 
C 2 235 GLN 235 235 235 GLN GLN C . n 
C 2 236 THR 236 236 236 THR THR C . n 
C 2 237 ILE 237 237 237 ILE ILE C . n 
C 2 238 LEU 238 238 238 LEU LEU C . n 
C 2 239 PRO 239 239 239 PRO PRO C . n 
C 2 240 SER 240 240 240 SER SER C . n 
C 2 241 CYS 241 241 241 CYS CYS C . n 
C 2 242 SER 242 242 242 SER SER C . n 
C 2 243 TYR 243 243 243 TYR TYR C . n 
C 2 244 GLU 244 244 244 GLU GLU C . n 
C 2 245 ASP 245 245 245 ASP ASP C . n 
C 2 246 LYS 246 246 246 LYS LYS C . n 
C 2 247 GLU 247 247 247 GLU GLU C . n 
C 2 248 LYS 248 248 248 LYS LYS C . n 
C 2 249 PRO 249 249 249 PRO PRO C . n 
C 2 250 ASN 250 250 250 ASN ASN C . n 
C 2 251 CYS 251 251 251 CYS CYS C . n 
C 2 252 LEU 252 252 252 LEU LEU C . n 
C 2 253 ASP 253 253 253 ASP ASP C . n 
C 2 254 LEU 254 254 254 LEU LEU C . n 
C 2 255 ARG 255 255 255 ARG ARG C . n 
C 2 256 GLY 256 256 256 GLY GLY C . n 
C 2 257 VAL 257 257 257 VAL VAL C . n 
C 2 258 CYS 258 258 258 CYS CYS C . n 
C 2 259 ARG 259 259 259 ARG ARG C . n 
C 2 260 THR 260 260 260 THR THR C . n 
C 2 261 ASP 261 261 261 ASP ASP C . n 
C 2 262 HIS 262 262 262 HIS HIS C . n 
C 2 263 LEU 263 263 263 LEU LEU C . n 
C 2 264 CYS 264 264 264 CYS CYS C . n 
C 2 265 ARG 265 265 265 ARG ARG C . n 
C 2 266 SER 266 266 266 SER SER C . n 
C 2 267 ARG 267 267 267 ARG ARG C . n 
C 2 268 LEU 268 268 268 LEU LEU C . n 
C 2 269 ALA 269 269 269 ALA ALA C . n 
C 2 270 ASP 270 270 270 ASP ASP C . n 
C 2 271 PHE 271 271 271 PHE PHE C . n 
C 2 272 HIS 272 272 272 HIS HIS C . n 
C 2 273 ALA 273 273 273 ALA ALA C . n 
C 2 274 ASN 274 274 274 ASN ASN C . n 
C 2 275 CYS 275 275 275 CYS CYS C . n 
C 2 276 ARG 276 276 276 ARG ARG C . n 
C 2 277 ALA 277 277 277 ALA ALA C . n 
C 2 278 SER 278 278 278 SER SER C . n 
C 2 279 TYR 279 279 279 TYR TYR C . n 
C 2 280 GLN 280 280 280 GLN GLN C . n 
C 2 281 THR 281 281 281 THR THR C . n 
C 2 282 VAL 282 282 282 VAL VAL C . n 
C 2 283 THR 283 283 283 THR THR C . n 
C 2 284 SER 284 284 284 SER SER C . n 
C 2 285 CYS 285 285 285 CYS CYS C . n 
C 2 286 PRO 286 286 286 PRO PRO C . n 
C 2 287 ALA 287 287 287 ALA ALA C . n 
C 2 288 ASP 288 288 288 ASP ASP C . n 
C 2 289 ASN 289 289 289 ASN ASN C . n 
C 2 290 TYR 290 290 290 TYR TYR C . n 
C 2 291 GLN 291 291 291 GLN GLN C . n 
C 2 292 ALA 292 292 292 ALA ALA C . n 
C 2 293 CYS 293 293 293 CYS CYS C . n 
C 2 294 LEU 294 294 294 LEU LEU C . n 
C 2 295 GLY 295 295 295 GLY GLY C . n 
C 2 296 SER 296 296 296 SER SER C . n 
C 2 297 TYR 297 297 297 TYR TYR C . n 
C 2 298 ALA 298 298 298 ALA ALA C . n 
C 2 299 GLY 299 299 299 GLY GLY C . n 
C 2 300 MET 300 300 300 MET MET C . n 
C 2 301 ILE 301 301 301 ILE ILE C . n 
C 2 302 GLY 302 302 302 GLY GLY C . n 
C 2 303 PHE 303 303 303 PHE PHE C . n 
C 2 304 ASP 304 304 304 ASP ASP C . n 
C 2 305 MET 305 305 305 MET MET C . n 
C 2 306 THR 306 306 306 THR THR C . n 
C 2 307 PRO 307 307 307 PRO PRO C . n 
C 2 308 ASN 308 308 308 ASN ASN C . n 
C 2 309 TYR 309 309 309 TYR TYR C . n 
C 2 310 VAL 310 310 310 VAL VAL C . n 
C 2 311 ASP 311 311 311 ASP ASP C . n 
C 2 312 SER 312 312 312 SER SER C . n 
C 2 313 SER 313 313 313 SER SER C . n 
C 2 314 PRO 314 314 314 PRO PRO C . n 
C 2 315 THR 315 315 315 THR THR C . n 
C 2 316 GLY 316 316 316 GLY GLY C . n 
C 2 317 ILE 317 317 317 ILE ILE C . n 
C 2 318 VAL 318 318 318 VAL VAL C . n 
C 2 319 VAL 319 319 319 VAL VAL C . n 
C 2 320 SER 320 320 320 SER SER C . n 
C 2 321 PRO 321 321 321 PRO PRO C . n 
C 2 322 TRP 322 322 322 TRP TRP C . n 
C 2 323 CYS 323 323 323 CYS CYS C . n 
C 2 324 SER 324 324 324 SER SER C . n 
C 2 325 CYS 325 325 325 CYS CYS C . n 
C 2 326 ARG 326 326 326 ARG ARG C . n 
C 2 327 GLY 327 327 327 GLY GLY C . n 
C 2 328 SER 328 328 328 SER SER C . n 
C 2 329 GLY 329 329 329 GLY GLY C . n 
C 2 330 ASN 330 330 330 ASN ASN C . n 
C 2 331 MET 331 331 331 MET MET C . n 
C 2 332 GLU 332 332 332 GLU GLU C . n 
C 2 333 GLU 333 333 333 GLU GLU C . n 
C 2 334 GLU 334 334 334 GLU GLU C . n 
C 2 335 CYS 335 335 335 CYS CYS C . n 
C 2 336 GLU 336 336 336 GLU GLU C . n 
C 2 337 LYS 337 337 337 LYS LYS C . n 
C 2 338 PHE 338 338 338 PHE PHE C . n 
C 2 339 LEU 339 339 339 LEU LEU C . n 
C 2 340 ARG 340 340 340 ARG ARG C . n 
C 2 341 ASP 341 341 341 ASP ASP C . n 
C 2 342 PHE 342 342 342 PHE PHE C . n 
C 2 343 THR 343 343 343 THR THR C . n 
C 2 344 GLU 344 344 344 GLU GLU C . n 
C 2 345 ASN 345 345 345 ASN ASN C . n 
C 2 346 PRO 346 346 346 PRO PRO C . n 
C 2 347 CYS 347 347 347 CYS CYS C . n 
C 2 348 LEU 348 348 348 LEU LEU C . n 
C 2 349 ARG 349 349 349 ARG ARG C . n 
C 2 350 ASN 350 350 350 ASN ASN C . n 
C 2 351 ALA 351 351 351 ALA ALA C . n 
C 2 352 ILE 352 352 352 ILE ILE C . n 
C 2 353 GLN 353 353 353 GLN GLN C . n 
C 2 354 ALA 354 354 354 ALA ALA C . n 
C 2 355 PHE 355 355 355 PHE PHE C . n 
C 2 356 GLY 356 356 356 GLY GLY C . n 
C 2 357 ASN 357 357 357 ASN ASN C . n 
C 2 358 GLY 358 358 358 GLY GLY C . n 
C 2 359 THR 359 359 359 THR THR C . n 
C 2 360 ASP 360 360 ?   ?   ?   C . n 
C 2 361 VAL 361 361 ?   ?   ?   C . n 
C 2 362 ASN 362 362 ?   ?   ?   C . n 
C 2 363 VAL 363 363 ?   ?   ?   C . n 
C 2 364 SER 364 364 ?   ?   ?   C . n 
C 2 365 PRO 365 365 ?   ?   ?   C . n 
C 2 366 LYS 366 366 ?   ?   ?   C . n 
C 2 367 GLY 367 367 ?   ?   ?   C . n 
C 2 368 PRO 368 368 ?   ?   ?   C . n 
C 2 369 SER 369 369 ?   ?   ?   C . n 
C 2 370 PHE 370 370 ?   ?   ?   C . n 
C 2 371 GLN 371 371 ?   ?   ?   C . n 
C 2 372 ALA 372 372 ?   ?   ?   C . n 
C 2 373 THR 373 373 ?   ?   ?   C . n 
C 2 374 GLN 374 374 ?   ?   ?   C . n 
C 2 375 ALA 375 375 ?   ?   ?   C . n 
C 2 376 PRO 376 376 ?   ?   ?   C . n 
C 2 377 ARG 377 377 ?   ?   ?   C . n 
C 2 378 VAL 378 378 ?   ?   ?   C . n 
C 2 379 GLU 379 379 ?   ?   ?   C . n 
C 2 380 LYS 380 380 ?   ?   ?   C . n 
C 2 381 THR 381 381 ?   ?   ?   C . n 
C 2 382 PRO 382 382 ?   ?   ?   C . n 
C 2 383 SER 383 383 ?   ?   ?   C . n 
C 2 384 LEU 384 384 ?   ?   ?   C . n 
C 2 385 PRO 385 385 ?   ?   ?   C . n 
C 2 386 ASP 386 386 ?   ?   ?   C . n 
C 2 387 ASP 387 387 ?   ?   ?   C . n 
C 2 388 LEU 388 388 ?   ?   ?   C . n 
C 2 389 SER 389 389 ?   ?   ?   C . n 
C 2 390 ASP 390 390 ?   ?   ?   C . n 
C 2 391 SER 391 391 ?   ?   ?   C . n 
C 2 392 THR 392 392 ?   ?   ?   C . n 
C 2 393 SER 393 393 ?   ?   ?   C . n 
C 2 394 LEU 394 394 ?   ?   ?   C . n 
C 2 395 GLY 395 395 ?   ?   ?   C . n 
C 2 396 THR 396 396 ?   ?   ?   C . n 
C 2 397 SER 397 397 ?   ?   ?   C . n 
C 2 398 VAL 398 398 ?   ?   ?   C . n 
C 2 399 ILE 399 399 ?   ?   ?   C . n 
C 2 400 THR 400 400 ?   ?   ?   C . n 
C 2 401 THR 401 401 ?   ?   ?   C . n 
C 2 402 CYS 402 402 ?   ?   ?   C . n 
C 2 403 THR 403 403 ?   ?   ?   C . n 
C 2 404 SER 404 404 ?   ?   ?   C . n 
C 2 405 VAL 405 405 ?   ?   ?   C . n 
C 2 406 GLN 406 406 ?   ?   ?   C . n 
C 2 407 GLU 407 407 ?   ?   ?   C . n 
C 2 408 GLN 408 408 ?   ?   ?   C . n 
C 2 409 GLY 409 409 ?   ?   ?   C . n 
C 2 410 LEU 410 410 ?   ?   ?   C . n 
C 2 411 LYS 411 411 ?   ?   ?   C . n 
C 2 412 ALA 412 412 ?   ?   ?   C . n 
C 2 413 ASN 413 413 ?   ?   ?   C . n 
C 2 414 ASN 414 414 ?   ?   ?   C . n 
C 2 415 SER 415 415 ?   ?   ?   C . n 
C 2 416 LYS 416 416 ?   ?   ?   C . n 
C 2 417 GLU 417 417 ?   ?   ?   C . n 
C 2 418 LEU 418 418 ?   ?   ?   C . n 
C 2 419 SER 419 419 ?   ?   ?   C . n 
C 2 420 MET 420 420 ?   ?   ?   C . n 
C 2 421 CYS 421 421 ?   ?   ?   C . n 
C 2 422 PHE 422 422 ?   ?   ?   C . n 
C 2 423 THR 423 423 ?   ?   ?   C . n 
C 2 424 GLU 424 424 ?   ?   ?   C . n 
C 2 425 LEU 425 425 ?   ?   ?   C . n 
C 2 426 THR 426 426 ?   ?   ?   C . n 
C 2 427 THR 427 427 ?   ?   ?   C . n 
C 2 428 ASN 428 428 ?   ?   ?   C . n 
C 2 429 ILE 429 429 ?   ?   ?   C . n 
C 2 430 ILE 430 430 ?   ?   ?   C . n 
C 2 431 PRO 431 431 ?   ?   ?   C . n 
C 2 432 GLY 432 432 ?   ?   ?   C . n 
C 2 433 SER 433 433 ?   ?   ?   C . n 
C 2 434 ASN 434 434 ?   ?   ?   C . n 
C 2 435 LYS 435 435 ?   ?   ?   C . n 
C 2 436 VAL 436 436 ?   ?   ?   C . n 
C 2 437 ILE 437 437 ?   ?   ?   C . n 
C 2 438 LYS 438 438 ?   ?   ?   C . n 
C 2 439 PRO 439 439 ?   ?   ?   C . n 
C 2 440 ASN 440 440 ?   ?   ?   C . n 
C 2 441 SER 441 441 ?   ?   ?   C . n 
C 2 442 GLY 442 442 ?   ?   ?   C . n 
C 2 443 PRO 443 443 ?   ?   ?   C . n 
C 2 444 SER 444 444 ?   ?   ?   C . n 
C 2 445 ARG 445 445 ?   ?   ?   C . n 
C 2 446 ALA 446 446 ?   ?   ?   C . n 
C 2 447 ARG 447 447 ?   ?   ?   C . n 
C 2 448 PRO 448 448 ?   ?   ?   C . n 
C 2 449 SER 449 449 ?   ?   ?   C . n 
C 2 450 ALA 450 450 ?   ?   ?   C . n 
C 2 451 ALA 451 451 ?   ?   ?   C . n 
C 2 452 LEU 452 452 ?   ?   ?   C . n 
C 2 453 THR 453 453 ?   ?   ?   C . n 
C 2 454 VAL 454 454 ?   ?   ?   C . n 
C 2 455 LEU 455 455 ?   ?   ?   C . n 
C 2 456 SER 456 456 ?   ?   ?   C . n 
C 2 457 VAL 457 457 ?   ?   ?   C . n 
C 2 458 LEU 458 458 ?   ?   ?   C . n 
D 2 1   MET 1   1   ?   ?   ?   D . n 
D 2 2   ILE 2   2   ?   ?   ?   D . n 
D 2 3   LEU 3   3   ?   ?   ?   D . n 
D 2 4   ALA 4   4   ?   ?   ?   D . n 
D 2 5   ASN 5   5   ?   ?   ?   D . n 
D 2 6   VAL 6   6   ?   ?   ?   D . n 
D 2 7   PHE 7   7   ?   ?   ?   D . n 
D 2 8   CYS 8   8   ?   ?   ?   D . n 
D 2 9   LEU 9   9   ?   ?   ?   D . n 
D 2 10  PHE 10  10  ?   ?   ?   D . n 
D 2 11  PHE 11  11  ?   ?   ?   D . n 
D 2 12  PHE 12  12  ?   ?   ?   D . n 
D 2 13  LEU 13  13  ?   ?   ?   D . n 
D 2 14  ASP 14  14  ?   ?   ?   D . n 
D 2 15  GLU 15  15  ?   ?   ?   D . n 
D 2 16  THR 16  16  ?   ?   ?   D . n 
D 2 17  LEU 17  17  ?   ?   ?   D . n 
D 2 18  ARG 18  18  ?   ?   ?   D . n 
D 2 19  SER 19  19  ?   ?   ?   D . n 
D 2 20  LEU 20  20  ?   ?   ?   D . n 
D 2 21  ALA 21  21  ?   ?   ?   D . n 
D 2 22  SER 22  22  ?   ?   ?   D . n 
D 2 23  PRO 23  23  ?   ?   ?   D . n 
D 2 24  SER 24  24  ?   ?   ?   D . n 
D 2 25  SER 25  25  ?   ?   ?   D . n 
D 2 26  LEU 26  26  ?   ?   ?   D . n 
D 2 27  GLN 27  27  ?   ?   ?   D . n 
D 2 28  GLY 28  28  ?   ?   ?   D . n 
D 2 29  PRO 29  29  ?   ?   ?   D . n 
D 2 30  GLU 30  30  ?   ?   ?   D . n 
D 2 31  LEU 31  31  ?   ?   ?   D . n 
D 2 32  HIS 32  32  ?   ?   ?   D . n 
D 2 33  GLY 33  33  ?   ?   ?   D . n 
D 2 34  TRP 34  34  ?   ?   ?   D . n 
D 2 35  ARG 35  35  ?   ?   ?   D . n 
D 2 36  PRO 36  36  ?   ?   ?   D . n 
D 2 37  PRO 37  37  37  PRO PRO D . n 
D 2 38  VAL 38  38  38  VAL VAL D . n 
D 2 39  ASP 39  39  39  ASP ASP D . n 
D 2 40  CYS 40  40  40  CYS CYS D . n 
D 2 41  VAL 41  41  41  VAL VAL D . n 
D 2 42  ARG 42  42  42  ARG ARG D . n 
D 2 43  ALA 43  43  43  ALA ALA D . n 
D 2 44  ASN 44  44  44  ASN ASN D . n 
D 2 45  GLU 45  45  45  GLU GLU D . n 
D 2 46  LEU 46  46  46  LEU LEU D . n 
D 2 47  CYS 47  47  47  CYS CYS D . n 
D 2 48  ALA 48  48  48  ALA ALA D . n 
D 2 49  ALA 49  49  49  ALA ALA D . n 
D 2 50  GLU 50  50  50  GLU GLU D . n 
D 2 51  SER 51  51  51  SER SER D . n 
D 2 52  ASN 52  52  52  ASN ASN D . n 
D 2 53  CYS 53  53  53  CYS CYS D . n 
D 2 54  SER 54  54  54  SER SER D . n 
D 2 55  SER 55  55  55  SER SER D . n 
D 2 56  ARG 56  56  56  ARG ARG D . n 
D 2 57  TYR 57  57  57  TYR TYR D . n 
D 2 58  ARG 58  58  58  ARG ARG D . n 
D 2 59  THR 59  59  59  THR THR D . n 
D 2 60  LEU 60  60  60  LEU LEU D . n 
D 2 61  ARG 61  61  61  ARG ARG D . n 
D 2 62  GLN 62  62  62  GLN GLN D . n 
D 2 63  CYS 63  63  63  CYS CYS D . n 
D 2 64  LEU 64  64  64  LEU LEU D . n 
D 2 65  ALA 65  65  65  ALA ALA D . n 
D 2 66  GLY 66  66  66  GLY GLY D . n 
D 2 67  ARG 67  67  ?   ?   ?   D . n 
D 2 68  ASP 68  68  ?   ?   ?   D . n 
D 2 69  ARG 69  69  ?   ?   ?   D . n 
D 2 70  ASN 70  70  ?   ?   ?   D . n 
D 2 71  THR 71  71  ?   ?   ?   D . n 
D 2 72  MET 72  72  ?   ?   ?   D . n 
D 2 73  LEU 73  73  ?   ?   ?   D . n 
D 2 74  ALA 74  74  ?   ?   ?   D . n 
D 2 75  ASN 75  75  ?   ?   ?   D . n 
D 2 76  LYS 76  76  76  LYS LYS D . n 
D 2 77  GLU 77  77  77  GLU GLU D . n 
D 2 78  CYS 78  78  78  CYS CYS D . n 
D 2 79  GLN 79  79  79  GLN GLN D . n 
D 2 80  ALA 80  80  80  ALA ALA D . n 
D 2 81  ALA 81  81  81  ALA ALA D . n 
D 2 82  LEU 82  82  82  LEU LEU D . n 
D 2 83  GLU 83  83  83  GLU GLU D . n 
D 2 84  VAL 84  84  84  VAL VAL D . n 
D 2 85  LEU 85  85  85  LEU LEU D . n 
D 2 86  GLN 86  86  86  GLN GLN D . n 
D 2 87  GLU 87  87  87  GLU GLU D . n 
D 2 88  SER 88  88  88  SER SER D . n 
D 2 89  PRO 89  89  89  PRO PRO D . n 
D 2 90  LEU 90  90  90  LEU LEU D . n 
D 2 91  TYR 91  91  91  TYR TYR D . n 
D 2 92  ASP 92  92  92  ASP ASP D . n 
D 2 93  CYS 93  93  93  CYS CYS D . n 
D 2 94  ARG 94  94  94  ARG ARG D . n 
D 2 95  CYS 95  95  95  CYS CYS D . n 
D 2 96  LYS 96  96  96  LYS LYS D . n 
D 2 97  ARG 97  97  97  ARG ARG D . n 
D 2 98  GLY 98  98  98  GLY GLY D . n 
D 2 99  MET 99  99  99  MET MET D . n 
D 2 100 LYS 100 100 100 LYS LYS D . n 
D 2 101 LYS 101 101 101 LYS LYS D . n 
D 2 102 GLU 102 102 102 GLU GLU D . n 
D 2 103 LEU 103 103 103 LEU LEU D . n 
D 2 104 GLN 104 104 104 GLN GLN D . n 
D 2 105 CYS 105 105 105 CYS CYS D . n 
D 2 106 LEU 106 106 106 LEU LEU D . n 
D 2 107 GLN 107 107 107 GLN GLN D . n 
D 2 108 ILE 108 108 108 ILE ILE D . n 
D 2 109 TYR 109 109 109 TYR TYR D . n 
D 2 110 TRP 110 110 110 TRP TRP D . n 
D 2 111 SER 111 111 111 SER SER D . n 
D 2 112 ILE 112 112 112 ILE ILE D . n 
D 2 113 HIS 113 113 113 HIS HIS D . n 
D 2 114 LEU 114 114 114 LEU LEU D . n 
D 2 115 GLY 115 115 ?   ?   ?   D . n 
D 2 116 LEU 116 116 ?   ?   ?   D . n 
D 2 117 THR 117 117 ?   ?   ?   D . n 
D 2 118 GLU 118 118 118 GLU GLU D . n 
D 2 119 GLY 119 119 119 GLY GLY D . n 
D 2 120 GLU 120 120 120 GLU GLU D . n 
D 2 121 GLU 121 121 121 GLU GLU D . n 
D 2 122 PHE 122 122 122 PHE PHE D . n 
D 2 123 TYR 123 123 123 TYR TYR D . n 
D 2 124 GLU 124 124 124 GLU GLU D . n 
D 2 125 ALA 125 125 125 ALA ALA D . n 
D 2 126 SER 126 126 126 SER SER D . n 
D 2 127 PRO 127 127 127 PRO PRO D . n 
D 2 128 TYR 128 128 128 TYR TYR D . n 
D 2 129 GLU 129 129 129 GLU GLU D . n 
D 2 130 PRO 130 130 130 PRO PRO D . n 
D 2 131 VAL 131 131 131 VAL VAL D . n 
D 2 132 THR 132 132 ?   ?   ?   D . n 
D 2 133 SER 133 133 ?   ?   ?   D . n 
D 2 134 ARG 134 134 ?   ?   ?   D . n 
D 2 135 LEU 135 135 ?   ?   ?   D . n 
D 2 136 SER 136 136 ?   ?   ?   D . n 
D 2 137 ASP 137 137 ?   ?   ?   D . n 
D 2 138 ILE 138 138 ?   ?   ?   D . n 
D 2 139 PHE 139 139 ?   ?   ?   D . n 
D 2 140 ARG 140 140 ?   ?   ?   D . n 
D 2 141 LEU 141 141 ?   ?   ?   D . n 
D 2 142 ALA 142 142 ?   ?   ?   D . n 
D 2 143 SER 143 143 ?   ?   ?   D . n 
D 2 144 ILE 144 144 ?   ?   ?   D . n 
D 2 145 PHE 145 145 ?   ?   ?   D . n 
D 2 146 SER 146 146 ?   ?   ?   D . n 
D 2 147 GLY 147 147 ?   ?   ?   D . n 
D 2 148 THR 148 148 ?   ?   ?   D . n 
D 2 149 GLY 149 149 ?   ?   ?   D . n 
D 2 150 ALA 150 150 ?   ?   ?   D . n 
D 2 151 ASP 151 151 ?   ?   ?   D . n 
D 2 152 PRO 152 152 ?   ?   ?   D . n 
D 2 153 VAL 153 153 ?   ?   ?   D . n 
D 2 154 VAL 154 154 ?   ?   ?   D . n 
D 2 155 SER 155 155 ?   ?   ?   D . n 
D 2 156 ALA 156 156 ?   ?   ?   D . n 
D 2 157 LYS 157 157 ?   ?   ?   D . n 
D 2 158 SER 158 158 158 SER SER D . n 
D 2 159 ASN 159 159 159 ASN ASN D . n 
D 2 160 HIS 160 160 160 HIS HIS D . n 
D 2 161 CYS 161 161 161 CYS CYS D . n 
D 2 162 LEU 162 162 162 LEU LEU D . n 
D 2 163 ASP 163 163 163 ASP ASP D . n 
D 2 164 ALA 164 164 164 ALA ALA D . n 
D 2 165 ALA 165 165 165 ALA ALA D . n 
D 2 166 LYS 166 166 166 LYS LYS D . n 
D 2 167 ALA 167 167 167 ALA ALA D . n 
D 2 168 CYS 168 168 168 CYS CYS D . n 
D 2 169 ASN 169 169 169 ASN ASN D . n 
D 2 170 LEU 170 170 170 LEU LEU D . n 
D 2 171 ASN 171 171 171 ASN ASN D . n 
D 2 172 ASP 172 172 172 ASP ASP D . n 
D 2 173 ASN 173 173 173 ASN ASN D . n 
D 2 174 CYS 174 174 174 CYS CYS D . n 
D 2 175 LYS 175 175 175 LYS LYS D . n 
D 2 176 LYS 176 176 176 LYS LYS D . n 
D 2 177 LEU 177 177 177 LEU LEU D . n 
D 2 178 ARG 178 178 178 ARG ARG D . n 
D 2 179 SER 179 179 179 SER SER D . n 
D 2 180 SER 180 180 180 SER SER D . n 
D 2 181 TYR 181 181 181 TYR TYR D . n 
D 2 182 ILE 182 182 182 ILE ILE D . n 
D 2 183 SER 183 183 183 SER SER D . n 
D 2 184 ILE 184 184 184 ILE ILE D . n 
D 2 185 CYS 185 185 185 CYS CYS D . n 
D 2 186 ASN 186 186 186 ASN ASN D . n 
D 2 187 ARG 187 187 187 ARG ARG D . n 
D 2 188 GLU 188 188 188 GLU GLU D . n 
D 2 189 ILE 189 189 189 ILE ILE D . n 
D 2 190 SER 190 190 190 SER SER D . n 
D 2 191 PRO 191 191 191 PRO PRO D . n 
D 2 192 THR 192 192 192 THR THR D . n 
D 2 193 GLU 193 193 193 GLU GLU D . n 
D 2 194 ARG 194 194 194 ARG ARG D . n 
D 2 195 CYS 195 195 195 CYS CYS D . n 
D 2 196 ASN 196 196 196 ASN ASN D . n 
D 2 197 ARG 197 197 197 ARG ARG D . n 
D 2 198 ARG 198 198 198 ARG ARG D . n 
D 2 199 LYS 199 199 199 LYS LYS D . n 
D 2 200 CYS 200 200 200 CYS CYS D . n 
D 2 201 HIS 201 201 201 HIS HIS D . n 
D 2 202 LYS 202 202 202 LYS LYS D . n 
D 2 203 ALA 203 203 203 ALA ALA D . n 
D 2 204 LEU 204 204 204 LEU LEU D . n 
D 2 205 ARG 205 205 205 ARG ARG D . n 
D 2 206 GLN 206 206 206 GLN GLN D . n 
D 2 207 PHE 207 207 207 PHE PHE D . n 
D 2 208 PHE 208 208 208 PHE PHE D . n 
D 2 209 ASP 209 209 209 ASP ASP D . n 
D 2 210 ARG 210 210 210 ARG ARG D . n 
D 2 211 VAL 211 211 211 VAL VAL D . n 
D 2 212 PRO 212 212 212 PRO PRO D . n 
D 2 213 SER 213 213 213 SER SER D . n 
D 2 214 GLU 214 214 214 GLU GLU D . n 
D 2 215 TYR 215 215 215 TYR TYR D . n 
D 2 216 THR 216 216 216 THR THR D . n 
D 2 217 TYR 217 217 217 TYR TYR D . n 
D 2 218 ARG 218 218 218 ARG ARG D . n 
D 2 219 MET 219 219 219 MET MET D . n 
D 2 220 LEU 220 220 220 LEU LEU D . n 
D 2 221 PHE 221 221 221 PHE PHE D . n 
D 2 222 CYS 222 222 222 CYS CYS D . n 
D 2 223 SER 223 223 223 SER SER D . n 
D 2 224 CYS 224 224 224 CYS CYS D . n 
D 2 225 GLN 225 225 225 GLN GLN D . n 
D 2 226 ASP 226 226 226 ASP ASP D . n 
D 2 227 GLN 227 227 227 GLN GLN D . n 
D 2 228 ALA 228 228 228 ALA ALA D . n 
D 2 229 CYS 229 229 229 CYS CYS D . n 
D 2 230 ALA 230 230 230 ALA ALA D . n 
D 2 231 GLU 231 231 231 GLU GLU D . n 
D 2 232 ARG 232 232 232 ARG ARG D . n 
D 2 233 ARG 233 233 233 ARG ARG D . n 
D 2 234 ARG 234 234 234 ARG ARG D . n 
D 2 235 GLN 235 235 235 GLN GLN D . n 
D 2 236 THR 236 236 236 THR THR D . n 
D 2 237 ILE 237 237 237 ILE ILE D . n 
D 2 238 LEU 238 238 238 LEU LEU D . n 
D 2 239 PRO 239 239 239 PRO PRO D . n 
D 2 240 SER 240 240 240 SER SER D . n 
D 2 241 CYS 241 241 241 CYS CYS D . n 
D 2 242 SER 242 242 242 SER SER D . n 
D 2 243 TYR 243 243 243 TYR TYR D . n 
D 2 244 GLU 244 244 244 GLU GLU D . n 
D 2 245 ASP 245 245 245 ASP ASP D . n 
D 2 246 LYS 246 246 246 LYS LYS D . n 
D 2 247 GLU 247 247 247 GLU GLU D . n 
D 2 248 LYS 248 248 248 LYS LYS D . n 
D 2 249 PRO 249 249 249 PRO PRO D . n 
D 2 250 ASN 250 250 250 ASN ASN D . n 
D 2 251 CYS 251 251 251 CYS CYS D . n 
D 2 252 LEU 252 252 252 LEU LEU D . n 
D 2 253 ASP 253 253 253 ASP ASP D . n 
D 2 254 LEU 254 254 254 LEU LEU D . n 
D 2 255 ARG 255 255 255 ARG ARG D . n 
D 2 256 GLY 256 256 256 GLY GLY D . n 
D 2 257 VAL 257 257 257 VAL VAL D . n 
D 2 258 CYS 258 258 258 CYS CYS D . n 
D 2 259 ARG 259 259 259 ARG ARG D . n 
D 2 260 THR 260 260 260 THR THR D . n 
D 2 261 ASP 261 261 261 ASP ASP D . n 
D 2 262 HIS 262 262 262 HIS HIS D . n 
D 2 263 LEU 263 263 263 LEU LEU D . n 
D 2 264 CYS 264 264 264 CYS CYS D . n 
D 2 265 ARG 265 265 265 ARG ARG D . n 
D 2 266 SER 266 266 266 SER SER D . n 
D 2 267 ARG 267 267 267 ARG ARG D . n 
D 2 268 LEU 268 268 268 LEU LEU D . n 
D 2 269 ALA 269 269 269 ALA ALA D . n 
D 2 270 ASP 270 270 270 ASP ASP D . n 
D 2 271 PHE 271 271 271 PHE PHE D . n 
D 2 272 HIS 272 272 272 HIS HIS D . n 
D 2 273 ALA 273 273 273 ALA ALA D . n 
D 2 274 ASN 274 274 274 ASN ASN D . n 
D 2 275 CYS 275 275 275 CYS CYS D . n 
D 2 276 ARG 276 276 276 ARG ARG D . n 
D 2 277 ALA 277 277 277 ALA ALA D . n 
D 2 278 SER 278 278 278 SER SER D . n 
D 2 279 TYR 279 279 279 TYR TYR D . n 
D 2 280 GLN 280 280 280 GLN GLN D . n 
D 2 281 THR 281 281 281 THR THR D . n 
D 2 282 VAL 282 282 282 VAL VAL D . n 
D 2 283 THR 283 283 283 THR THR D . n 
D 2 284 SER 284 284 284 SER SER D . n 
D 2 285 CYS 285 285 285 CYS CYS D . n 
D 2 286 PRO 286 286 286 PRO PRO D . n 
D 2 287 ALA 287 287 287 ALA ALA D . n 
D 2 288 ASP 288 288 288 ASP ASP D . n 
D 2 289 ASN 289 289 289 ASN ASN D . n 
D 2 290 TYR 290 290 290 TYR TYR D . n 
D 2 291 GLN 291 291 291 GLN GLN D . n 
D 2 292 ALA 292 292 292 ALA ALA D . n 
D 2 293 CYS 293 293 293 CYS CYS D . n 
D 2 294 LEU 294 294 294 LEU LEU D . n 
D 2 295 GLY 295 295 295 GLY GLY D . n 
D 2 296 SER 296 296 296 SER SER D . n 
D 2 297 TYR 297 297 297 TYR TYR D . n 
D 2 298 ALA 298 298 298 ALA ALA D . n 
D 2 299 GLY 299 299 299 GLY GLY D . n 
D 2 300 MET 300 300 300 MET MET D . n 
D 2 301 ILE 301 301 301 ILE ILE D . n 
D 2 302 GLY 302 302 302 GLY GLY D . n 
D 2 303 PHE 303 303 303 PHE PHE D . n 
D 2 304 ASP 304 304 304 ASP ASP D . n 
D 2 305 MET 305 305 305 MET MET D . n 
D 2 306 THR 306 306 306 THR THR D . n 
D 2 307 PRO 307 307 307 PRO PRO D . n 
D 2 308 ASN 308 308 308 ASN ASN D . n 
D 2 309 TYR 309 309 309 TYR TYR D . n 
D 2 310 VAL 310 310 310 VAL VAL D . n 
D 2 311 ASP 311 311 311 ASP ASP D . n 
D 2 312 SER 312 312 312 SER SER D . n 
D 2 313 SER 313 313 313 SER SER D . n 
D 2 314 PRO 314 314 314 PRO PRO D . n 
D 2 315 THR 315 315 315 THR THR D . n 
D 2 316 GLY 316 316 316 GLY GLY D . n 
D 2 317 ILE 317 317 317 ILE ILE D . n 
D 2 318 VAL 318 318 318 VAL VAL D . n 
D 2 319 VAL 319 319 319 VAL VAL D . n 
D 2 320 SER 320 320 320 SER SER D . n 
D 2 321 PRO 321 321 321 PRO PRO D . n 
D 2 322 TRP 322 322 322 TRP TRP D . n 
D 2 323 CYS 323 323 323 CYS CYS D . n 
D 2 324 SER 324 324 324 SER SER D . n 
D 2 325 CYS 325 325 325 CYS CYS D . n 
D 2 326 ARG 326 326 326 ARG ARG D . n 
D 2 327 GLY 327 327 327 GLY GLY D . n 
D 2 328 SER 328 328 328 SER SER D . n 
D 2 329 GLY 329 329 329 GLY GLY D . n 
D 2 330 ASN 330 330 330 ASN ASN D . n 
D 2 331 MET 331 331 331 MET MET D . n 
D 2 332 GLU 332 332 332 GLU GLU D . n 
D 2 333 GLU 333 333 333 GLU GLU D . n 
D 2 334 GLU 334 334 334 GLU GLU D . n 
D 2 335 CYS 335 335 335 CYS CYS D . n 
D 2 336 GLU 336 336 336 GLU GLU D . n 
D 2 337 LYS 337 337 337 LYS LYS D . n 
D 2 338 PHE 338 338 338 PHE PHE D . n 
D 2 339 LEU 339 339 339 LEU LEU D . n 
D 2 340 ARG 340 340 340 ARG ARG D . n 
D 2 341 ASP 341 341 341 ASP ASP D . n 
D 2 342 PHE 342 342 342 PHE PHE D . n 
D 2 343 THR 343 343 343 THR THR D . n 
D 2 344 GLU 344 344 344 GLU GLU D . n 
D 2 345 ASN 345 345 345 ASN ASN D . n 
D 2 346 PRO 346 346 346 PRO PRO D . n 
D 2 347 CYS 347 347 347 CYS CYS D . n 
D 2 348 LEU 348 348 348 LEU LEU D . n 
D 2 349 ARG 349 349 349 ARG ARG D . n 
D 2 350 ASN 350 350 350 ASN ASN D . n 
D 2 351 ALA 351 351 351 ALA ALA D . n 
D 2 352 ILE 352 352 352 ILE ILE D . n 
D 2 353 GLN 353 353 353 GLN GLN D . n 
D 2 354 ALA 354 354 354 ALA ALA D . n 
D 2 355 PHE 355 355 355 PHE PHE D . n 
D 2 356 GLY 356 356 356 GLY GLY D . n 
D 2 357 ASN 357 357 357 ASN ASN D . n 
D 2 358 GLY 358 358 358 GLY GLY D . n 
D 2 359 THR 359 359 359 THR ALA D . n 
D 2 360 ASP 360 360 ?   ?   ?   D . n 
D 2 361 VAL 361 361 ?   ?   ?   D . n 
D 2 362 ASN 362 362 ?   ?   ?   D . n 
D 2 363 VAL 363 363 ?   ?   ?   D . n 
D 2 364 SER 364 364 ?   ?   ?   D . n 
D 2 365 PRO 365 365 ?   ?   ?   D . n 
D 2 366 LYS 366 366 ?   ?   ?   D . n 
D 2 367 GLY 367 367 ?   ?   ?   D . n 
D 2 368 PRO 368 368 ?   ?   ?   D . n 
D 2 369 SER 369 369 ?   ?   ?   D . n 
D 2 370 PHE 370 370 ?   ?   ?   D . n 
D 2 371 GLN 371 371 ?   ?   ?   D . n 
D 2 372 ALA 372 372 ?   ?   ?   D . n 
D 2 373 THR 373 373 ?   ?   ?   D . n 
D 2 374 GLN 374 374 ?   ?   ?   D . n 
D 2 375 ALA 375 375 ?   ?   ?   D . n 
D 2 376 PRO 376 376 ?   ?   ?   D . n 
D 2 377 ARG 377 377 ?   ?   ?   D . n 
D 2 378 VAL 378 378 ?   ?   ?   D . n 
D 2 379 GLU 379 379 ?   ?   ?   D . n 
D 2 380 LYS 380 380 ?   ?   ?   D . n 
D 2 381 THR 381 381 ?   ?   ?   D . n 
D 2 382 PRO 382 382 ?   ?   ?   D . n 
D 2 383 SER 383 383 ?   ?   ?   D . n 
D 2 384 LEU 384 384 ?   ?   ?   D . n 
D 2 385 PRO 385 385 ?   ?   ?   D . n 
D 2 386 ASP 386 386 ?   ?   ?   D . n 
D 2 387 ASP 387 387 ?   ?   ?   D . n 
D 2 388 LEU 388 388 ?   ?   ?   D . n 
D 2 389 SER 389 389 ?   ?   ?   D . n 
D 2 390 ASP 390 390 ?   ?   ?   D . n 
D 2 391 SER 391 391 ?   ?   ?   D . n 
D 2 392 THR 392 392 ?   ?   ?   D . n 
D 2 393 SER 393 393 ?   ?   ?   D . n 
D 2 394 LEU 394 394 ?   ?   ?   D . n 
D 2 395 GLY 395 395 ?   ?   ?   D . n 
D 2 396 THR 396 396 ?   ?   ?   D . n 
D 2 397 SER 397 397 ?   ?   ?   D . n 
D 2 398 VAL 398 398 ?   ?   ?   D . n 
D 2 399 ILE 399 399 ?   ?   ?   D . n 
D 2 400 THR 400 400 ?   ?   ?   D . n 
D 2 401 THR 401 401 ?   ?   ?   D . n 
D 2 402 CYS 402 402 ?   ?   ?   D . n 
D 2 403 THR 403 403 ?   ?   ?   D . n 
D 2 404 SER 404 404 ?   ?   ?   D . n 
D 2 405 VAL 405 405 ?   ?   ?   D . n 
D 2 406 GLN 406 406 ?   ?   ?   D . n 
D 2 407 GLU 407 407 ?   ?   ?   D . n 
D 2 408 GLN 408 408 ?   ?   ?   D . n 
D 2 409 GLY 409 409 ?   ?   ?   D . n 
D 2 410 LEU 410 410 ?   ?   ?   D . n 
D 2 411 LYS 411 411 ?   ?   ?   D . n 
D 2 412 ALA 412 412 ?   ?   ?   D . n 
D 2 413 ASN 413 413 ?   ?   ?   D . n 
D 2 414 ASN 414 414 ?   ?   ?   D . n 
D 2 415 SER 415 415 ?   ?   ?   D . n 
D 2 416 LYS 416 416 ?   ?   ?   D . n 
D 2 417 GLU 417 417 ?   ?   ?   D . n 
D 2 418 LEU 418 418 ?   ?   ?   D . n 
D 2 419 SER 419 419 ?   ?   ?   D . n 
D 2 420 MET 420 420 ?   ?   ?   D . n 
D 2 421 CYS 421 421 ?   ?   ?   D . n 
D 2 422 PHE 422 422 ?   ?   ?   D . n 
D 2 423 THR 423 423 ?   ?   ?   D . n 
D 2 424 GLU 424 424 ?   ?   ?   D . n 
D 2 425 LEU 425 425 ?   ?   ?   D . n 
D 2 426 THR 426 426 ?   ?   ?   D . n 
D 2 427 THR 427 427 ?   ?   ?   D . n 
D 2 428 ASN 428 428 ?   ?   ?   D . n 
D 2 429 ILE 429 429 ?   ?   ?   D . n 
D 2 430 ILE 430 430 ?   ?   ?   D . n 
D 2 431 PRO 431 431 ?   ?   ?   D . n 
D 2 432 GLY 432 432 ?   ?   ?   D . n 
D 2 433 SER 433 433 ?   ?   ?   D . n 
D 2 434 ASN 434 434 ?   ?   ?   D . n 
D 2 435 LYS 435 435 ?   ?   ?   D . n 
D 2 436 VAL 436 436 ?   ?   ?   D . n 
D 2 437 ILE 437 437 ?   ?   ?   D . n 
D 2 438 LYS 438 438 ?   ?   ?   D . n 
D 2 439 PRO 439 439 ?   ?   ?   D . n 
D 2 440 ASN 440 440 ?   ?   ?   D . n 
D 2 441 SER 441 441 ?   ?   ?   D . n 
D 2 442 GLY 442 442 ?   ?   ?   D . n 
D 2 443 PRO 443 443 ?   ?   ?   D . n 
D 2 444 SER 444 444 ?   ?   ?   D . n 
D 2 445 ARG 445 445 ?   ?   ?   D . n 
D 2 446 ALA 446 446 ?   ?   ?   D . n 
D 2 447 ARG 447 447 ?   ?   ?   D . n 
D 2 448 PRO 448 448 ?   ?   ?   D . n 
D 2 449 SER 449 449 ?   ?   ?   D . n 
D 2 450 ALA 450 450 ?   ?   ?   D . n 
D 2 451 ALA 451 451 ?   ?   ?   D . n 
D 2 452 LEU 452 452 ?   ?   ?   D . n 
D 2 453 THR 453 453 ?   ?   ?   D . n 
D 2 454 VAL 454 454 ?   ?   ?   D . n 
D 2 455 LEU 455 455 ?   ?   ?   D . n 
D 2 456 SER 456 456 ?   ?   ?   D . n 
D 2 457 VAL 457 457 ?   ?   ?   D . n 
D 2 458 LEU 458 458 ?   ?   ?   D . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 PEG 1   201 1   PEG PEG A . 
F 4 FMT 1   501 2   FMT FMT C . 
G 4 FMT 1   501 1   FMT FMT D . 
H 4 FMT 1   502 3   FMT FMT D . 
I 5 HOH 1   301 24  HOH HOH A . 
I 5 HOH 2   302 341 HOH HOH A . 
I 5 HOH 3   303 200 HOH HOH A . 
I 5 HOH 4   304 113 HOH HOH A . 
I 5 HOH 5   305 59  HOH HOH A . 
I 5 HOH 6   306 180 HOH HOH A . 
I 5 HOH 7   307 73  HOH HOH A . 
I 5 HOH 8   308 53  HOH HOH A . 
I 5 HOH 9   309 93  HOH HOH A . 
I 5 HOH 10  310 52  HOH HOH A . 
I 5 HOH 11  311 129 HOH HOH A . 
I 5 HOH 12  312 243 HOH HOH A . 
I 5 HOH 13  313 58  HOH HOH A . 
I 5 HOH 14  314 21  HOH HOH A . 
I 5 HOH 15  315 15  HOH HOH A . 
I 5 HOH 16  316 18  HOH HOH A . 
I 5 HOH 17  317 75  HOH HOH A . 
I 5 HOH 18  318 78  HOH HOH A . 
I 5 HOH 19  319 141 HOH HOH A . 
I 5 HOH 20  320 20  HOH HOH A . 
I 5 HOH 21  321 154 HOH HOH A . 
I 5 HOH 22  322 323 HOH HOH A . 
I 5 HOH 23  323 89  HOH HOH A . 
I 5 HOH 24  324 12  HOH HOH A . 
I 5 HOH 25  325 55  HOH HOH A . 
I 5 HOH 26  326 13  HOH HOH A . 
I 5 HOH 27  327 79  HOH HOH A . 
I 5 HOH 28  328 102 HOH HOH A . 
I 5 HOH 29  329 72  HOH HOH A . 
I 5 HOH 30  330 241 HOH HOH A . 
I 5 HOH 31  331 54  HOH HOH A . 
I 5 HOH 32  332 259 HOH HOH A . 
I 5 HOH 33  333 142 HOH HOH A . 
I 5 HOH 34  334 206 HOH HOH A . 
I 5 HOH 35  335 71  HOH HOH A . 
I 5 HOH 36  336 183 HOH HOH A . 
I 5 HOH 37  337 153 HOH HOH A . 
I 5 HOH 38  338 125 HOH HOH A . 
I 5 HOH 39  339 301 HOH HOH A . 
I 5 HOH 40  340 315 HOH HOH A . 
I 5 HOH 41  341 321 HOH HOH A . 
I 5 HOH 42  342 343 HOH HOH A . 
I 5 HOH 43  343 77  HOH HOH A . 
I 5 HOH 44  344 318 HOH HOH A . 
I 5 HOH 45  345 324 HOH HOH A . 
I 5 HOH 46  346 86  HOH HOH A . 
I 5 HOH 47  347 260 HOH HOH A . 
I 5 HOH 48  348 347 HOH HOH A . 
I 5 HOH 49  349 19  HOH HOH A . 
I 5 HOH 50  350 139 HOH HOH A . 
I 5 HOH 51  351 248 HOH HOH A . 
I 5 HOH 52  352 237 HOH HOH A . 
I 5 HOH 53  353 138 HOH HOH A . 
I 5 HOH 54  354 235 HOH HOH A . 
I 5 HOH 55  355 215 HOH HOH A . 
I 5 HOH 56  356 306 HOH HOH A . 
I 5 HOH 57  357 220 HOH HOH A . 
I 5 HOH 58  358 336 HOH HOH A . 
I 5 HOH 59  359 17  HOH HOH A . 
I 5 HOH 60  360 320 HOH HOH A . 
I 5 HOH 61  361 56  HOH HOH A . 
I 5 HOH 62  362 319 HOH HOH A . 
I 5 HOH 63  363 325 HOH HOH A . 
I 5 HOH 64  364 258 HOH HOH A . 
I 5 HOH 65  365 300 HOH HOH A . 
J 5 HOH 1   201 344 HOH HOH B . 
J 5 HOH 2   202 74  HOH HOH B . 
J 5 HOH 3   203 26  HOH HOH B . 
J 5 HOH 4   204 337 HOH HOH B . 
J 5 HOH 5   205 185 HOH HOH B . 
J 5 HOH 6   206 16  HOH HOH B . 
J 5 HOH 7   207 104 HOH HOH B . 
J 5 HOH 8   208 80  HOH HOH B . 
J 5 HOH 9   209 214 HOH HOH B . 
J 5 HOH 10  210 163 HOH HOH B . 
J 5 HOH 11  211 76  HOH HOH B . 
J 5 HOH 12  212 244 HOH HOH B . 
J 5 HOH 13  213 256 HOH HOH B . 
J 5 HOH 14  214 132 HOH HOH B . 
J 5 HOH 15  215 81  HOH HOH B . 
J 5 HOH 16  216 339 HOH HOH B . 
J 5 HOH 17  217 245 HOH HOH B . 
J 5 HOH 18  218 334 HOH HOH B . 
J 5 HOH 19  219 23  HOH HOH B . 
J 5 HOH 20  220 181 HOH HOH B . 
J 5 HOH 21  221 212 HOH HOH B . 
J 5 HOH 22  222 107 HOH HOH B . 
J 5 HOH 23  223 118 HOH HOH B . 
J 5 HOH 24  224 51  HOH HOH B . 
J 5 HOH 25  225 263 HOH HOH B . 
J 5 HOH 26  226 170 HOH HOH B . 
J 5 HOH 27  227 109 HOH HOH B . 
J 5 HOH 28  228 234 HOH HOH B . 
J 5 HOH 29  229 264 HOH HOH B . 
J 5 HOH 30  230 322 HOH HOH B . 
J 5 HOH 31  231 171 HOH HOH B . 
J 5 HOH 32  232 194 HOH HOH B . 
J 5 HOH 33  233 22  HOH HOH B . 
J 5 HOH 34  234 103 HOH HOH B . 
J 5 HOH 35  235 34  HOH HOH B . 
J 5 HOH 36  236 159 HOH HOH B . 
J 5 HOH 37  237 346 HOH HOH B . 
J 5 HOH 38  238 266 HOH HOH B . 
J 5 HOH 39  239 236 HOH HOH B . 
J 5 HOH 40  240 174 HOH HOH B . 
J 5 HOH 41  241 27  HOH HOH B . 
J 5 HOH 42  242 281 HOH HOH B . 
J 5 HOH 43  243 333 HOH HOH B . 
J 5 HOH 44  244 92  HOH HOH B . 
J 5 HOH 45  245 262 HOH HOH B . 
J 5 HOH 46  246 250 HOH HOH B . 
J 5 HOH 47  247 327 HOH HOH B . 
J 5 HOH 48  248 233 HOH HOH B . 
J 5 HOH 49  249 57  HOH HOH B . 
J 5 HOH 50  250 340 HOH HOH B . 
J 5 HOH 51  251 345 HOH HOH B . 
J 5 HOH 52  252 338 HOH HOH B . 
J 5 HOH 53  253 279 HOH HOH B . 
J 5 HOH 54  254 261 HOH HOH B . 
K 5 HOH 1   601 187 HOH HOH C . 
K 5 HOH 2   602 179 HOH HOH C . 
K 5 HOH 3   603 221 HOH HOH C . 
K 5 HOH 4   604 257 HOH HOH C . 
K 5 HOH 5   605 8   HOH HOH C . 
K 5 HOH 6   606 328 HOH HOH C . 
K 5 HOH 7   607 61  HOH HOH C . 
K 5 HOH 8   608 122 HOH HOH C . 
K 5 HOH 9   609 307 HOH HOH C . 
K 5 HOH 10  610 226 HOH HOH C . 
K 5 HOH 11  611 316 HOH HOH C . 
K 5 HOH 12  612 351 HOH HOH C . 
K 5 HOH 13  613 224 HOH HOH C . 
K 5 HOH 14  614 65  HOH HOH C . 
K 5 HOH 15  615 186 HOH HOH C . 
K 5 HOH 16  616 310 HOH HOH C . 
K 5 HOH 17  617 218 HOH HOH C . 
K 5 HOH 18  618 309 HOH HOH C . 
K 5 HOH 19  619 287 HOH HOH C . 
K 5 HOH 20  620 311 HOH HOH C . 
K 5 HOH 21  621 123 HOH HOH C . 
K 5 HOH 22  622 175 HOH HOH C . 
K 5 HOH 23  623 156 HOH HOH C . 
K 5 HOH 24  624 157 HOH HOH C . 
K 5 HOH 25  625 222 HOH HOH C . 
K 5 HOH 26  626 6   HOH HOH C . 
K 5 HOH 27  627 62  HOH HOH C . 
K 5 HOH 28  628 4   HOH HOH C . 
K 5 HOH 29  629 85  HOH HOH C . 
K 5 HOH 30  630 130 HOH HOH C . 
K 5 HOH 31  631 219 HOH HOH C . 
K 5 HOH 32  632 121 HOH HOH C . 
K 5 HOH 33  633 105 HOH HOH C . 
K 5 HOH 34  634 2   HOH HOH C . 
K 5 HOH 35  635 217 HOH HOH C . 
K 5 HOH 36  636 313 HOH HOH C . 
K 5 HOH 37  637 189 HOH HOH C . 
K 5 HOH 38  638 64  HOH HOH C . 
K 5 HOH 39  639 110 HOH HOH C . 
K 5 HOH 40  640 149 HOH HOH C . 
K 5 HOH 41  641 204 HOH HOH C . 
K 5 HOH 42  642 90  HOH HOH C . 
K 5 HOH 43  643 283 HOH HOH C . 
K 5 HOH 44  644 67  HOH HOH C . 
K 5 HOH 45  645 158 HOH HOH C . 
K 5 HOH 46  646 255 HOH HOH C . 
K 5 HOH 47  647 101 HOH HOH C . 
K 5 HOH 48  648 127 HOH HOH C . 
K 5 HOH 49  649 182 HOH HOH C . 
K 5 HOH 50  650 98  HOH HOH C . 
K 5 HOH 51  651 60  HOH HOH C . 
K 5 HOH 52  652 201 HOH HOH C . 
K 5 HOH 53  653 63  HOH HOH C . 
K 5 HOH 54  654 223 HOH HOH C . 
K 5 HOH 55  655 99  HOH HOH C . 
K 5 HOH 56  656 7   HOH HOH C . 
K 5 HOH 57  657 128 HOH HOH C . 
K 5 HOH 58  658 1   HOH HOH C . 
K 5 HOH 59  659 119 HOH HOH C . 
K 5 HOH 60  660 299 HOH HOH C . 
K 5 HOH 61  661 126 HOH HOH C . 
K 5 HOH 62  662 288 HOH HOH C . 
K 5 HOH 63  663 135 HOH HOH C . 
K 5 HOH 64  664 290 HOH HOH C . 
K 5 HOH 65  665 203 HOH HOH C . 
K 5 HOH 66  666 87  HOH HOH C . 
K 5 HOH 67  667 165 HOH HOH C . 
K 5 HOH 68  668 120 HOH HOH C . 
K 5 HOH 69  669 131 HOH HOH C . 
K 5 HOH 70  670 88  HOH HOH C . 
K 5 HOH 71  671 108 HOH HOH C . 
K 5 HOH 72  672 155 HOH HOH C . 
K 5 HOH 73  673 48  HOH HOH C . 
K 5 HOH 74  674 253 HOH HOH C . 
K 5 HOH 75  675 286 HOH HOH C . 
K 5 HOH 76  676 242 HOH HOH C . 
K 5 HOH 77  677 164 HOH HOH C . 
K 5 HOH 78  678 247 HOH HOH C . 
K 5 HOH 79  679 66  HOH HOH C . 
K 5 HOH 80  680 14  HOH HOH C . 
K 5 HOH 81  681 83  HOH HOH C . 
K 5 HOH 82  682 3   HOH HOH C . 
K 5 HOH 83  683 216 HOH HOH C . 
K 5 HOH 84  684 238 HOH HOH C . 
K 5 HOH 85  685 5   HOH HOH C . 
K 5 HOH 86  686 251 HOH HOH C . 
K 5 HOH 87  687 193 HOH HOH C . 
K 5 HOH 88  688 196 HOH HOH C . 
K 5 HOH 89  689 146 HOH HOH C . 
K 5 HOH 90  690 198 HOH HOH C . 
K 5 HOH 91  691 302 HOH HOH C . 
K 5 HOH 92  692 352 HOH HOH C . 
K 5 HOH 93  693 152 HOH HOH C . 
K 5 HOH 94  694 249 HOH HOH C . 
K 5 HOH 95  695 114 HOH HOH C . 
K 5 HOH 96  696 298 HOH HOH C . 
K 5 HOH 97  697 297 HOH HOH C . 
K 5 HOH 98  698 173 HOH HOH C . 
K 5 HOH 99  699 84  HOH HOH C . 
K 5 HOH 100 700 70  HOH HOH C . 
K 5 HOH 101 701 308 HOH HOH C . 
K 5 HOH 102 702 169 HOH HOH C . 
K 5 HOH 103 703 292 HOH HOH C . 
K 5 HOH 104 704 192 HOH HOH C . 
K 5 HOH 105 705 227 HOH HOH C . 
K 5 HOH 106 706 303 HOH HOH C . 
K 5 HOH 107 707 246 HOH HOH C . 
K 5 HOH 108 708 312 HOH HOH C . 
K 5 HOH 109 709 282 HOH HOH C . 
K 5 HOH 110 710 326 HOH HOH C . 
K 5 HOH 111 711 291 HOH HOH C . 
K 5 HOH 112 712 304 HOH HOH C . 
K 5 HOH 113 713 225 HOH HOH C . 
K 5 HOH 114 714 69  HOH HOH C . 
K 5 HOH 115 715 295 HOH HOH C . 
K 5 HOH 116 716 350 HOH HOH C . 
K 5 HOH 117 717 305 HOH HOH C . 
K 5 HOH 118 718 293 HOH HOH C . 
K 5 HOH 119 719 202 HOH HOH C . 
K 5 HOH 120 720 143 HOH HOH C . 
K 5 HOH 121 721 68  HOH HOH C . 
K 5 HOH 122 722 296 HOH HOH C . 
K 5 HOH 123 723 317 HOH HOH C . 
K 5 HOH 124 724 168 HOH HOH C . 
K 5 HOH 125 725 314 HOH HOH C . 
K 5 HOH 126 726 289 HOH HOH C . 
K 5 HOH 127 727 349 HOH HOH C . 
K 5 HOH 128 728 285 HOH HOH C . 
K 5 HOH 129 729 353 HOH HOH C . 
K 5 HOH 130 730 145 HOH HOH C . 
K 5 HOH 131 731 284 HOH HOH C . 
K 5 HOH 132 732 167 HOH HOH C . 
L 5 HOH 1   601 335 HOH HOH D . 
L 5 HOH 2   602 330 HOH HOH D . 
L 5 HOH 3   603 32  HOH HOH D . 
L 5 HOH 4   604 229 HOH HOH D . 
L 5 HOH 5   605 230 HOH HOH D . 
L 5 HOH 6   606 162 HOH HOH D . 
L 5 HOH 7   607 40  HOH HOH D . 
L 5 HOH 8   608 49  HOH HOH D . 
L 5 HOH 9   609 117 HOH HOH D . 
L 5 HOH 10  610 271 HOH HOH D . 
L 5 HOH 11  611 197 HOH HOH D . 
L 5 HOH 12  612 277 HOH HOH D . 
L 5 HOH 13  613 184 HOH HOH D . 
L 5 HOH 14  614 38  HOH HOH D . 
L 5 HOH 15  615 275 HOH HOH D . 
L 5 HOH 16  616 29  HOH HOH D . 
L 5 HOH 17  617 190 HOH HOH D . 
L 5 HOH 18  618 209 HOH HOH D . 
L 5 HOH 19  619 140 HOH HOH D . 
L 5 HOH 20  620 91  HOH HOH D . 
L 5 HOH 21  621 172 HOH HOH D . 
L 5 HOH 22  622 211 HOH HOH D . 
L 5 HOH 23  623 9   HOH HOH D . 
L 5 HOH 24  624 278 HOH HOH D . 
L 5 HOH 25  625 11  HOH HOH D . 
L 5 HOH 26  626 239 HOH HOH D . 
L 5 HOH 27  627 25  HOH HOH D . 
L 5 HOH 28  628 147 HOH HOH D . 
L 5 HOH 29  629 136 HOH HOH D . 
L 5 HOH 30  630 265 HOH HOH D . 
L 5 HOH 31  631 137 HOH HOH D . 
L 5 HOH 32  632 46  HOH HOH D . 
L 5 HOH 33  633 45  HOH HOH D . 
L 5 HOH 34  634 232 HOH HOH D . 
L 5 HOH 35  635 31  HOH HOH D . 
L 5 HOH 36  636 39  HOH HOH D . 
L 5 HOH 37  637 100 HOH HOH D . 
L 5 HOH 38  638 50  HOH HOH D . 
L 5 HOH 39  639 178 HOH HOH D . 
L 5 HOH 40  640 195 HOH HOH D . 
L 5 HOH 41  641 82  HOH HOH D . 
L 5 HOH 42  642 208 HOH HOH D . 
L 5 HOH 43  643 37  HOH HOH D . 
L 5 HOH 44  644 10  HOH HOH D . 
L 5 HOH 45  645 148 HOH HOH D . 
L 5 HOH 46  646 210 HOH HOH D . 
L 5 HOH 47  647 95  HOH HOH D . 
L 5 HOH 48  648 106 HOH HOH D . 
L 5 HOH 49  649 36  HOH HOH D . 
L 5 HOH 50  650 151 HOH HOH D . 
L 5 HOH 51  651 115 HOH HOH D . 
L 5 HOH 52  652 150 HOH HOH D . 
L 5 HOH 53  653 43  HOH HOH D . 
L 5 HOH 54  654 112 HOH HOH D . 
L 5 HOH 55  655 42  HOH HOH D . 
L 5 HOH 56  656 96  HOH HOH D . 
L 5 HOH 57  657 252 HOH HOH D . 
L 5 HOH 58  658 176 HOH HOH D . 
L 5 HOH 59  659 44  HOH HOH D . 
L 5 HOH 60  660 160 HOH HOH D . 
L 5 HOH 61  661 342 HOH HOH D . 
L 5 HOH 62  662 94  HOH HOH D . 
L 5 HOH 63  663 254 HOH HOH D . 
L 5 HOH 64  664 213 HOH HOH D . 
L 5 HOH 65  665 205 HOH HOH D . 
L 5 HOH 66  666 111 HOH HOH D . 
L 5 HOH 67  667 188 HOH HOH D . 
L 5 HOH 68  668 144 HOH HOH D . 
L 5 HOH 69  669 47  HOH HOH D . 
L 5 HOH 70  670 97  HOH HOH D . 
L 5 HOH 71  671 329 HOH HOH D . 
L 5 HOH 72  672 199 HOH HOH D . 
L 5 HOH 73  673 134 HOH HOH D . 
L 5 HOH 74  674 240 HOH HOH D . 
L 5 HOH 75  675 273 HOH HOH D . 
L 5 HOH 76  676 33  HOH HOH D . 
L 5 HOH 77  677 28  HOH HOH D . 
L 5 HOH 78  678 41  HOH HOH D . 
L 5 HOH 79  679 177 HOH HOH D . 
L 5 HOH 80  680 116 HOH HOH D . 
L 5 HOH 81  681 30  HOH HOH D . 
L 5 HOH 82  682 228 HOH HOH D . 
L 5 HOH 83  683 191 HOH HOH D . 
L 5 HOH 84  684 331 HOH HOH D . 
L 5 HOH 85  685 269 HOH HOH D . 
L 5 HOH 86  686 276 HOH HOH D . 
L 5 HOH 87  687 294 HOH HOH D . 
L 5 HOH 88  688 133 HOH HOH D . 
L 5 HOH 89  689 231 HOH HOH D . 
L 5 HOH 90  690 270 HOH HOH D . 
L 5 HOH 91  691 272 HOH HOH D . 
L 5 HOH 92  692 161 HOH HOH D . 
L 5 HOH 93  693 280 HOH HOH D . 
L 5 HOH 94  694 274 HOH HOH D . 
L 5 HOH 95  695 166 HOH HOH D . 
L 5 HOH 96  696 35  HOH HOH D . 
L 5 HOH 97  697 207 HOH HOH D . 
L 5 HOH 98  698 267 HOH HOH D . 
L 5 HOH 99  699 348 HOH HOH D . 
L 5 HOH 100 700 332 HOH HOH D . 
L 5 HOH 101 701 124 HOH HOH D . 
L 5 HOH 102 702 268 HOH HOH D . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 8270  ? 
1 MORE         -2    ? 
1 'SSA (A^2)'  38870 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2018-01-17 
2 'Structure model' 1 1 2018-02-14 
3 'Structure model' 1 2 2018-02-21 
4 'Structure model' 1 3 2018-04-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references' 
2 3 'Structure model' 'Database references' 
3 4 'Structure model' 'Data collection'     
4 4 'Structure model' 'Database references' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation        
2 2 'Structure model' citation_author 
3 3 'Structure model' citation        
4 4 'Structure model' citation        
5 4 'Structure model' citation_author 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                 
2  2 'Structure model' '_citation.journal_abbrev'          
3  2 'Structure model' '_citation.journal_id_ASTM'         
4  2 'Structure model' '_citation.journal_id_CSD'          
5  2 'Structure model' '_citation.journal_id_ISSN'         
6  2 'Structure model' '_citation.pdbx_database_id_DOI'    
7  2 'Structure model' '_citation.title'                   
8  2 'Structure model' '_citation.year'                    
9  3 'Structure model' '_citation.journal_abbrev'          
10 3 'Structure model' '_citation.pdbx_database_id_PubMed' 
11 3 'Structure model' '_citation.title'                   
12 4 'Structure model' '_citation.journal_volume'          
13 4 'Structure model' '_citation.page_first'              
14 4 'Structure model' '_citation.page_last'               
15 4 'Structure model' '_citation.title'                   
16 4 'Structure model' '_citation_author.name'             
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC  ? ? ? 5.8.0135 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS     ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER  ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    155 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    301 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.06 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             NE 
_pdbx_validate_rmsd_angle.auth_asym_id_1             A 
_pdbx_validate_rmsd_angle.auth_comp_id_1             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_1              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             CZ 
_pdbx_validate_rmsd_angle.auth_asym_id_2             A 
_pdbx_validate_rmsd_angle.auth_comp_id_2             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_2              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             NH2 
_pdbx_validate_rmsd_angle.auth_asym_id_3             A 
_pdbx_validate_rmsd_angle.auth_comp_id_3             ARG 
_pdbx_validate_rmsd_angle.auth_seq_id_3              146 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                123.44 
_pdbx_validate_rmsd_angle.angle_target_value         120.30 
_pdbx_validate_rmsd_angle.angle_deviation            3.14 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.50 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 ARG A 155 ? ? -93.40  49.12  
2 1 ARG A 156 ? ? 44.16   73.74  
3 1 TYR C 243 ? ? -124.44 -54.63 
4 1 HIS D 113 ? ? -101.69 77.04  
5 1 GLU D 120 ? ? 61.83   65.98  
6 1 TYR D 243 ? ? -122.57 -57.96 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 Y 1 D THR 359 ? OG1 ? D THR 359 OG1 
2 1 Y 1 D THR 359 ? CG2 ? D THR 359 CG2 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A ALA 96  ? A ALA 1   
2   1 Y 1 A ARG 97  ? A ARG 2   
3   1 Y 1 A LEU 98  ? A LEU 3   
4   1 Y 1 A GLY 99  ? A GLY 4   
5   1 Y 1 B ALA 96  ? B ALA 1   
6   1 Y 1 B ARG 97  ? B ARG 2   
7   1 Y 1 B LEU 98  ? B LEU 3   
8   1 Y 1 B GLY 99  ? B GLY 4   
9   1 Y 1 C MET 1   ? C MET 1   
10  1 Y 1 C ILE 2   ? C ILE 2   
11  1 Y 1 C LEU 3   ? C LEU 3   
12  1 Y 1 C ALA 4   ? C ALA 4   
13  1 Y 1 C ASN 5   ? C ASN 5   
14  1 Y 1 C VAL 6   ? C VAL 6   
15  1 Y 1 C PHE 7   ? C PHE 7   
16  1 Y 1 C CYS 8   ? C CYS 8   
17  1 Y 1 C LEU 9   ? C LEU 9   
18  1 Y 1 C PHE 10  ? C PHE 10  
19  1 Y 1 C PHE 11  ? C PHE 11  
20  1 Y 1 C PHE 12  ? C PHE 12  
21  1 Y 1 C LEU 13  ? C LEU 13  
22  1 Y 1 C ASP 14  ? C ASP 14  
23  1 Y 1 C GLU 15  ? C GLU 15  
24  1 Y 1 C THR 16  ? C THR 16  
25  1 Y 1 C LEU 17  ? C LEU 17  
26  1 Y 1 C ARG 18  ? C ARG 18  
27  1 Y 1 C SER 19  ? C SER 19  
28  1 Y 1 C LEU 20  ? C LEU 20  
29  1 Y 1 C ALA 21  ? C ALA 21  
30  1 Y 1 C SER 22  ? C SER 22  
31  1 Y 1 C PRO 23  ? C PRO 23  
32  1 Y 1 C SER 24  ? C SER 24  
33  1 Y 1 C SER 25  ? C SER 25  
34  1 Y 1 C LEU 26  ? C LEU 26  
35  1 Y 1 C GLN 27  ? C GLN 27  
36  1 Y 1 C GLY 28  ? C GLY 28  
37  1 Y 1 C PRO 29  ? C PRO 29  
38  1 Y 1 C GLU 30  ? C GLU 30  
39  1 Y 1 C LEU 31  ? C LEU 31  
40  1 Y 1 C HIS 32  ? C HIS 32  
41  1 Y 1 C GLY 33  ? C GLY 33  
42  1 Y 1 C TRP 34  ? C TRP 34  
43  1 Y 1 C ARG 35  ? C ARG 35  
44  1 Y 1 C ARG 67  ? C ARG 67  
45  1 Y 1 C ASP 68  ? C ASP 68  
46  1 Y 1 C ARG 69  ? C ARG 69  
47  1 Y 1 C ASN 70  ? C ASN 70  
48  1 Y 1 C THR 71  ? C THR 71  
49  1 Y 1 C MET 72  ? C MET 72  
50  1 Y 1 C LEU 73  ? C LEU 73  
51  1 Y 1 C ALA 74  ? C ALA 74  
52  1 Y 1 C LEU 116 ? C LEU 116 
53  1 Y 1 C THR 117 ? C THR 117 
54  1 Y 1 C GLU 118 ? C GLU 118 
55  1 Y 1 C GLY 119 ? C GLY 119 
56  1 Y 1 C GLU 120 ? C GLU 120 
57  1 Y 1 C THR 132 ? C THR 132 
58  1 Y 1 C SER 133 ? C SER 133 
59  1 Y 1 C ARG 134 ? C ARG 134 
60  1 Y 1 C LEU 135 ? C LEU 135 
61  1 Y 1 C SER 136 ? C SER 136 
62  1 Y 1 C ASP 137 ? C ASP 137 
63  1 Y 1 C ILE 138 ? C ILE 138 
64  1 Y 1 C PHE 139 ? C PHE 139 
65  1 Y 1 C ARG 140 ? C ARG 140 
66  1 Y 1 C LEU 141 ? C LEU 141 
67  1 Y 1 C ALA 142 ? C ALA 142 
68  1 Y 1 C SER 143 ? C SER 143 
69  1 Y 1 C ILE 144 ? C ILE 144 
70  1 Y 1 C PHE 145 ? C PHE 145 
71  1 Y 1 C SER 146 ? C SER 146 
72  1 Y 1 C GLY 147 ? C GLY 147 
73  1 Y 1 C THR 148 ? C THR 148 
74  1 Y 1 C GLY 149 ? C GLY 149 
75  1 Y 1 C ALA 150 ? C ALA 150 
76  1 Y 1 C ASP 151 ? C ASP 151 
77  1 Y 1 C PRO 152 ? C PRO 152 
78  1 Y 1 C VAL 153 ? C VAL 153 
79  1 Y 1 C VAL 154 ? C VAL 154 
80  1 Y 1 C SER 155 ? C SER 155 
81  1 Y 1 C ALA 156 ? C ALA 156 
82  1 Y 1 C LYS 157 ? C LYS 157 
83  1 Y 1 C ASP 360 ? C ASP 360 
84  1 Y 1 C VAL 361 ? C VAL 361 
85  1 Y 1 C ASN 362 ? C ASN 362 
86  1 Y 1 C VAL 363 ? C VAL 363 
87  1 Y 1 C SER 364 ? C SER 364 
88  1 Y 1 C PRO 365 ? C PRO 365 
89  1 Y 1 C LYS 366 ? C LYS 366 
90  1 Y 1 C GLY 367 ? C GLY 367 
91  1 Y 1 C PRO 368 ? C PRO 368 
92  1 Y 1 C SER 369 ? C SER 369 
93  1 Y 1 C PHE 370 ? C PHE 370 
94  1 Y 1 C GLN 371 ? C GLN 371 
95  1 Y 1 C ALA 372 ? C ALA 372 
96  1 Y 1 C THR 373 ? C THR 373 
97  1 Y 1 C GLN 374 ? C GLN 374 
98  1 Y 1 C ALA 375 ? C ALA 375 
99  1 Y 1 C PRO 376 ? C PRO 376 
100 1 Y 1 C ARG 377 ? C ARG 377 
101 1 Y 1 C VAL 378 ? C VAL 378 
102 1 Y 1 C GLU 379 ? C GLU 379 
103 1 Y 1 C LYS 380 ? C LYS 380 
104 1 Y 1 C THR 381 ? C THR 381 
105 1 Y 1 C PRO 382 ? C PRO 382 
106 1 Y 1 C SER 383 ? C SER 383 
107 1 Y 1 C LEU 384 ? C LEU 384 
108 1 Y 1 C PRO 385 ? C PRO 385 
109 1 Y 1 C ASP 386 ? C ASP 386 
110 1 Y 1 C ASP 387 ? C ASP 387 
111 1 Y 1 C LEU 388 ? C LEU 388 
112 1 Y 1 C SER 389 ? C SER 389 
113 1 Y 1 C ASP 390 ? C ASP 390 
114 1 Y 1 C SER 391 ? C SER 391 
115 1 Y 1 C THR 392 ? C THR 392 
116 1 Y 1 C SER 393 ? C SER 393 
117 1 Y 1 C LEU 394 ? C LEU 394 
118 1 Y 1 C GLY 395 ? C GLY 395 
119 1 Y 1 C THR 396 ? C THR 396 
120 1 Y 1 C SER 397 ? C SER 397 
121 1 Y 1 C VAL 398 ? C VAL 398 
122 1 Y 1 C ILE 399 ? C ILE 399 
123 1 Y 1 C THR 400 ? C THR 400 
124 1 Y 1 C THR 401 ? C THR 401 
125 1 Y 1 C CYS 402 ? C CYS 402 
126 1 Y 1 C THR 403 ? C THR 403 
127 1 Y 1 C SER 404 ? C SER 404 
128 1 Y 1 C VAL 405 ? C VAL 405 
129 1 Y 1 C GLN 406 ? C GLN 406 
130 1 Y 1 C GLU 407 ? C GLU 407 
131 1 Y 1 C GLN 408 ? C GLN 408 
132 1 Y 1 C GLY 409 ? C GLY 409 
133 1 Y 1 C LEU 410 ? C LEU 410 
134 1 Y 1 C LYS 411 ? C LYS 411 
135 1 Y 1 C ALA 412 ? C ALA 412 
136 1 Y 1 C ASN 413 ? C ASN 413 
137 1 Y 1 C ASN 414 ? C ASN 414 
138 1 Y 1 C SER 415 ? C SER 415 
139 1 Y 1 C LYS 416 ? C LYS 416 
140 1 Y 1 C GLU 417 ? C GLU 417 
141 1 Y 1 C LEU 418 ? C LEU 418 
142 1 Y 1 C SER 419 ? C SER 419 
143 1 Y 1 C MET 420 ? C MET 420 
144 1 Y 1 C CYS 421 ? C CYS 421 
145 1 Y 1 C PHE 422 ? C PHE 422 
146 1 Y 1 C THR 423 ? C THR 423 
147 1 Y 1 C GLU 424 ? C GLU 424 
148 1 Y 1 C LEU 425 ? C LEU 425 
149 1 Y 1 C THR 426 ? C THR 426 
150 1 Y 1 C THR 427 ? C THR 427 
151 1 Y 1 C ASN 428 ? C ASN 428 
152 1 Y 1 C ILE 429 ? C ILE 429 
153 1 Y 1 C ILE 430 ? C ILE 430 
154 1 Y 1 C PRO 431 ? C PRO 431 
155 1 Y 1 C GLY 432 ? C GLY 432 
156 1 Y 1 C SER 433 ? C SER 433 
157 1 Y 1 C ASN 434 ? C ASN 434 
158 1 Y 1 C LYS 435 ? C LYS 435 
159 1 Y 1 C VAL 436 ? C VAL 436 
160 1 Y 1 C ILE 437 ? C ILE 437 
161 1 Y 1 C LYS 438 ? C LYS 438 
162 1 Y 1 C PRO 439 ? C PRO 439 
163 1 Y 1 C ASN 440 ? C ASN 440 
164 1 Y 1 C SER 441 ? C SER 441 
165 1 Y 1 C GLY 442 ? C GLY 442 
166 1 Y 1 C PRO 443 ? C PRO 443 
167 1 Y 1 C SER 444 ? C SER 444 
168 1 Y 1 C ARG 445 ? C ARG 445 
169 1 Y 1 C ALA 446 ? C ALA 446 
170 1 Y 1 C ARG 447 ? C ARG 447 
171 1 Y 1 C PRO 448 ? C PRO 448 
172 1 Y 1 C SER 449 ? C SER 449 
173 1 Y 1 C ALA 450 ? C ALA 450 
174 1 Y 1 C ALA 451 ? C ALA 451 
175 1 Y 1 C LEU 452 ? C LEU 452 
176 1 Y 1 C THR 453 ? C THR 453 
177 1 Y 1 C VAL 454 ? C VAL 454 
178 1 Y 1 C LEU 455 ? C LEU 455 
179 1 Y 1 C SER 456 ? C SER 456 
180 1 Y 1 C VAL 457 ? C VAL 457 
181 1 Y 1 C LEU 458 ? C LEU 458 
182 1 Y 1 D MET 1   ? D MET 1   
183 1 Y 1 D ILE 2   ? D ILE 2   
184 1 Y 1 D LEU 3   ? D LEU 3   
185 1 Y 1 D ALA 4   ? D ALA 4   
186 1 Y 1 D ASN 5   ? D ASN 5   
187 1 Y 1 D VAL 6   ? D VAL 6   
188 1 Y 1 D PHE 7   ? D PHE 7   
189 1 Y 1 D CYS 8   ? D CYS 8   
190 1 Y 1 D LEU 9   ? D LEU 9   
191 1 Y 1 D PHE 10  ? D PHE 10  
192 1 Y 1 D PHE 11  ? D PHE 11  
193 1 Y 1 D PHE 12  ? D PHE 12  
194 1 Y 1 D LEU 13  ? D LEU 13  
195 1 Y 1 D ASP 14  ? D ASP 14  
196 1 Y 1 D GLU 15  ? D GLU 15  
197 1 Y 1 D THR 16  ? D THR 16  
198 1 Y 1 D LEU 17  ? D LEU 17  
199 1 Y 1 D ARG 18  ? D ARG 18  
200 1 Y 1 D SER 19  ? D SER 19  
201 1 Y 1 D LEU 20  ? D LEU 20  
202 1 Y 1 D ALA 21  ? D ALA 21  
203 1 Y 1 D SER 22  ? D SER 22  
204 1 Y 1 D PRO 23  ? D PRO 23  
205 1 Y 1 D SER 24  ? D SER 24  
206 1 Y 1 D SER 25  ? D SER 25  
207 1 Y 1 D LEU 26  ? D LEU 26  
208 1 Y 1 D GLN 27  ? D GLN 27  
209 1 Y 1 D GLY 28  ? D GLY 28  
210 1 Y 1 D PRO 29  ? D PRO 29  
211 1 Y 1 D GLU 30  ? D GLU 30  
212 1 Y 1 D LEU 31  ? D LEU 31  
213 1 Y 1 D HIS 32  ? D HIS 32  
214 1 Y 1 D GLY 33  ? D GLY 33  
215 1 Y 1 D TRP 34  ? D TRP 34  
216 1 Y 1 D ARG 35  ? D ARG 35  
217 1 Y 1 D PRO 36  ? D PRO 36  
218 1 Y 1 D ARG 67  ? D ARG 67  
219 1 Y 1 D ASP 68  ? D ASP 68  
220 1 Y 1 D ARG 69  ? D ARG 69  
221 1 Y 1 D ASN 70  ? D ASN 70  
222 1 Y 1 D THR 71  ? D THR 71  
223 1 Y 1 D MET 72  ? D MET 72  
224 1 Y 1 D LEU 73  ? D LEU 73  
225 1 Y 1 D ALA 74  ? D ALA 74  
226 1 Y 1 D ASN 75  ? D ASN 75  
227 1 Y 1 D GLY 115 ? D GLY 115 
228 1 Y 1 D LEU 116 ? D LEU 116 
229 1 Y 1 D THR 117 ? D THR 117 
230 1 Y 1 D THR 132 ? D THR 132 
231 1 Y 1 D SER 133 ? D SER 133 
232 1 Y 1 D ARG 134 ? D ARG 134 
233 1 Y 1 D LEU 135 ? D LEU 135 
234 1 Y 1 D SER 136 ? D SER 136 
235 1 Y 1 D ASP 137 ? D ASP 137 
236 1 Y 1 D ILE 138 ? D ILE 138 
237 1 Y 1 D PHE 139 ? D PHE 139 
238 1 Y 1 D ARG 140 ? D ARG 140 
239 1 Y 1 D LEU 141 ? D LEU 141 
240 1 Y 1 D ALA 142 ? D ALA 142 
241 1 Y 1 D SER 143 ? D SER 143 
242 1 Y 1 D ILE 144 ? D ILE 144 
243 1 Y 1 D PHE 145 ? D PHE 145 
244 1 Y 1 D SER 146 ? D SER 146 
245 1 Y 1 D GLY 147 ? D GLY 147 
246 1 Y 1 D THR 148 ? D THR 148 
247 1 Y 1 D GLY 149 ? D GLY 149 
248 1 Y 1 D ALA 150 ? D ALA 150 
249 1 Y 1 D ASP 151 ? D ASP 151 
250 1 Y 1 D PRO 152 ? D PRO 152 
251 1 Y 1 D VAL 153 ? D VAL 153 
252 1 Y 1 D VAL 154 ? D VAL 154 
253 1 Y 1 D SER 155 ? D SER 155 
254 1 Y 1 D ALA 156 ? D ALA 156 
255 1 Y 1 D LYS 157 ? D LYS 157 
256 1 Y 1 D ASP 360 ? D ASP 360 
257 1 Y 1 D VAL 361 ? D VAL 361 
258 1 Y 1 D ASN 362 ? D ASN 362 
259 1 Y 1 D VAL 363 ? D VAL 363 
260 1 Y 1 D SER 364 ? D SER 364 
261 1 Y 1 D PRO 365 ? D PRO 365 
262 1 Y 1 D LYS 366 ? D LYS 366 
263 1 Y 1 D GLY 367 ? D GLY 367 
264 1 Y 1 D PRO 368 ? D PRO 368 
265 1 Y 1 D SER 369 ? D SER 369 
266 1 Y 1 D PHE 370 ? D PHE 370 
267 1 Y 1 D GLN 371 ? D GLN 371 
268 1 Y 1 D ALA 372 ? D ALA 372 
269 1 Y 1 D THR 373 ? D THR 373 
270 1 Y 1 D GLN 374 ? D GLN 374 
271 1 Y 1 D ALA 375 ? D ALA 375 
272 1 Y 1 D PRO 376 ? D PRO 376 
273 1 Y 1 D ARG 377 ? D ARG 377 
274 1 Y 1 D VAL 378 ? D VAL 378 
275 1 Y 1 D GLU 379 ? D GLU 379 
276 1 Y 1 D LYS 380 ? D LYS 380 
277 1 Y 1 D THR 381 ? D THR 381 
278 1 Y 1 D PRO 382 ? D PRO 382 
279 1 Y 1 D SER 383 ? D SER 383 
280 1 Y 1 D LEU 384 ? D LEU 384 
281 1 Y 1 D PRO 385 ? D PRO 385 
282 1 Y 1 D ASP 386 ? D ASP 386 
283 1 Y 1 D ASP 387 ? D ASP 387 
284 1 Y 1 D LEU 388 ? D LEU 388 
285 1 Y 1 D SER 389 ? D SER 389 
286 1 Y 1 D ASP 390 ? D ASP 390 
287 1 Y 1 D SER 391 ? D SER 391 
288 1 Y 1 D THR 392 ? D THR 392 
289 1 Y 1 D SER 393 ? D SER 393 
290 1 Y 1 D LEU 394 ? D LEU 394 
291 1 Y 1 D GLY 395 ? D GLY 395 
292 1 Y 1 D THR 396 ? D THR 396 
293 1 Y 1 D SER 397 ? D SER 397 
294 1 Y 1 D VAL 398 ? D VAL 398 
295 1 Y 1 D ILE 399 ? D ILE 399 
296 1 Y 1 D THR 400 ? D THR 400 
297 1 Y 1 D THR 401 ? D THR 401 
298 1 Y 1 D CYS 402 ? D CYS 402 
299 1 Y 1 D THR 403 ? D THR 403 
300 1 Y 1 D SER 404 ? D SER 404 
301 1 Y 1 D VAL 405 ? D VAL 405 
302 1 Y 1 D GLN 406 ? D GLN 406 
303 1 Y 1 D GLU 407 ? D GLU 407 
304 1 Y 1 D GLN 408 ? D GLN 408 
305 1 Y 1 D GLY 409 ? D GLY 409 
306 1 Y 1 D LEU 410 ? D LEU 410 
307 1 Y 1 D LYS 411 ? D LYS 411 
308 1 Y 1 D ALA 412 ? D ALA 412 
309 1 Y 1 D ASN 413 ? D ASN 413 
310 1 Y 1 D ASN 414 ? D ASN 414 
311 1 Y 1 D SER 415 ? D SER 415 
312 1 Y 1 D LYS 416 ? D LYS 416 
313 1 Y 1 D GLU 417 ? D GLU 417 
314 1 Y 1 D LEU 418 ? D LEU 418 
315 1 Y 1 D SER 419 ? D SER 419 
316 1 Y 1 D MET 420 ? D MET 420 
317 1 Y 1 D CYS 421 ? D CYS 421 
318 1 Y 1 D PHE 422 ? D PHE 422 
319 1 Y 1 D THR 423 ? D THR 423 
320 1 Y 1 D GLU 424 ? D GLU 424 
321 1 Y 1 D LEU 425 ? D LEU 425 
322 1 Y 1 D THR 426 ? D THR 426 
323 1 Y 1 D THR 427 ? D THR 427 
324 1 Y 1 D ASN 428 ? D ASN 428 
325 1 Y 1 D ILE 429 ? D ILE 429 
326 1 Y 1 D ILE 430 ? D ILE 430 
327 1 Y 1 D PRO 431 ? D PRO 431 
328 1 Y 1 D GLY 432 ? D GLY 432 
329 1 Y 1 D SER 433 ? D SER 433 
330 1 Y 1 D ASN 434 ? D ASN 434 
331 1 Y 1 D LYS 435 ? D LYS 435 
332 1 Y 1 D VAL 436 ? D VAL 436 
333 1 Y 1 D ILE 437 ? D ILE 437 
334 1 Y 1 D LYS 438 ? D LYS 438 
335 1 Y 1 D PRO 439 ? D PRO 439 
336 1 Y 1 D ASN 440 ? D ASN 440 
337 1 Y 1 D SER 441 ? D SER 441 
338 1 Y 1 D GLY 442 ? D GLY 442 
339 1 Y 1 D PRO 443 ? D PRO 443 
340 1 Y 1 D SER 444 ? D SER 444 
341 1 Y 1 D ARG 445 ? D ARG 445 
342 1 Y 1 D ALA 446 ? D ALA 446 
343 1 Y 1 D ARG 447 ? D ARG 447 
344 1 Y 1 D PRO 448 ? D PRO 448 
345 1 Y 1 D SER 449 ? D SER 449 
346 1 Y 1 D ALA 450 ? D ALA 450 
347 1 Y 1 D ALA 451 ? D ALA 451 
348 1 Y 1 D LEU 452 ? D LEU 452 
349 1 Y 1 D THR 453 ? D THR 453 
350 1 Y 1 D VAL 454 ? D VAL 454 
351 1 Y 1 D LEU 455 ? D LEU 455 
352 1 Y 1 D SER 456 ? D SER 456 
353 1 Y 1 D VAL 457 ? D VAL 457 
354 1 Y 1 D LEU 458 ? D LEU 458 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'DI(HYDROXYETHYL)ETHER' PEG 
4 'FORMIC ACID'           FMT 
5 water                   HOH 
#